data_4XYN
# 
_entry.id   4XYN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4XYN         
WWPDB D_1000206525 
# 
_pdbx_database_PDB_obs_spr.date             2015-05-13 
_pdbx_database_PDB_obs_spr.details          ? 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.pdb_id           4XYN 
_pdbx_database_PDB_obs_spr.replace_pdb_id   4N6I 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4XYN 
_pdbx_database_status.recvd_initial_deposition_date   2015-02-02 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Jensen, J.L.'     1 
'Indurthi, V.S.K.' 2 
'Neau, D.'         3 
'Vetter, S.W.'     4 
'Colbert, C.L.'    5 
# 
_citation.id                        primary 
_citation.title                     
;Structural insights into the binding of the human receptor for advanced glycation end products (RAGE) by S100B, as revealed by an S100B-RAGE-derived peptide complex.
;
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            71 
_citation.page_first                1176 
_citation.page_last                 1183 
_citation.year                      2015 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   US 
_citation.journal_id_ISSN           1399-0047 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25945582 
_citation.pdbx_database_id_DOI      10.1107/S1399004715004216 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Jensen, J.L.'   1 
primary 'Indurthi, V.S.' 2 
primary 'Neau, D.B.'     3 
primary 'Vetter, S.W.'   4 
primary 'Colbert, C.L.'  5 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4XYN 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     68.785 
_cell.length_a_esd                 ? 
_cell.length_b                     86.684 
_cell.length_b_esd                 ? 
_cell.length_c                     66.534 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4XYN 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn 'Receptor for advanced glycation endproducts-derived peptide (W61)' 1645.814  1  ? ? ? ? 
2 polymer     man 'Protein S100-B'                                                    10727.037 4  ? ? ? ? 
3 non-polymer syn 'CALCIUM ION'                                                       40.078    8  ? ? ? ? 
4 water       nat water                                                               18.015    35 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        'S-100 protein beta chain,S-100 protein subunit beta,S100 calcium-binding protein B' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no NTGRTEAWKVLSPQG                                                                                 
NTGRTEAWKVLSPQG                                                                                 P       ? 
2 'polypeptide(L)' no no 
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM
VTTACHEFFEHE
;
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM
VTTACHEFFEHE
;
A,B,C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ASN n 
1 2  THR n 
1 3  GLY n 
1 4  ARG n 
1 5  THR n 
1 6  GLU n 
1 7  ALA n 
1 8  TRP n 
1 9  LYS n 
1 10 VAL n 
1 11 LEU n 
1 12 SER n 
1 13 PRO n 
1 14 GLN n 
1 15 GLY n 
2 1  MET n 
2 2  SER n 
2 3  GLU n 
2 4  LEU n 
2 5  GLU n 
2 6  LYS n 
2 7  ALA n 
2 8  MET n 
2 9  VAL n 
2 10 ALA n 
2 11 LEU n 
2 12 ILE n 
2 13 ASP n 
2 14 VAL n 
2 15 PHE n 
2 16 HIS n 
2 17 GLN n 
2 18 TYR n 
2 19 SER n 
2 20 GLY n 
2 21 ARG n 
2 22 GLU n 
2 23 GLY n 
2 24 ASP n 
2 25 LYS n 
2 26 HIS n 
2 27 LYS n 
2 28 LEU n 
2 29 LYS n 
2 30 LYS n 
2 31 SER n 
2 32 GLU n 
2 33 LEU n 
2 34 LYS n 
2 35 GLU n 
2 36 LEU n 
2 37 ILE n 
2 38 ASN n 
2 39 ASN n 
2 40 GLU n 
2 41 LEU n 
2 42 SER n 
2 43 HIS n 
2 44 PHE n 
2 45 LEU n 
2 46 GLU n 
2 47 GLU n 
2 48 ILE n 
2 49 LYS n 
2 50 GLU n 
2 51 GLN n 
2 52 GLU n 
2 53 VAL n 
2 54 VAL n 
2 55 ASP n 
2 56 LYS n 
2 57 VAL n 
2 58 MET n 
2 59 GLU n 
2 60 THR n 
2 61 LEU n 
2 62 ASP n 
2 63 ASN n 
2 64 ASP n 
2 65 GLY n 
2 66 ASP n 
2 67 GLY n 
2 68 GLU n 
2 69 CYS n 
2 70 ASP n 
2 71 PHE n 
2 72 GLN n 
2 73 GLU n 
2 74 PHE n 
2 75 MET n 
2 76 ALA n 
2 77 PHE n 
2 78 VAL n 
2 79 ALA n 
2 80 MET n 
2 81 VAL n 
2 82 THR n 
2 83 THR n 
2 84 ALA n 
2 85 CYS n 
2 86 HIS n 
2 87 GLU n 
2 88 PHE n 
2 89 PHE n 
2 90 GLU n 
2 91 HIS n 
2 92 GLU n 
# 
_entity_src_gen.entity_id                          2 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   92 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 S100B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              1 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       15 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 4XYN        4XYN   ? 1 ?                                                                                               1 
2 UNP S100B_HUMAN P04271 ? 2 
;MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAM
VTTACHEFFEHE
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4XYN P 1 ? 15 ? 4XYN   54 ? 68 ? 54 68 
2 2 4XYN A 1 ? 92 ? P04271 1  ? 92 ? 1  92 
3 2 4XYN B 1 ? 92 ? P04271 1  ? 92 ? 1  92 
4 2 4XYN C 1 ? 92 ? P04271 1  ? 92 ? 1  92 
5 2 4XYN D 1 ? 92 ? P04271 1  ? 92 ? 1  92 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4XYN 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.4 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.7 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M Na cacodylate, pH 6.8, 25% w/v PEG 3350, 9mM CaCl2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-11-05 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9792 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9792 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4XYN 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.55 
_reflns.d_resolution_low                 53.882 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       35655 
_reflns.number_obs                       12927 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  2.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.55 
_reflns_shell.d_res_low                   2.64 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4XYN 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.55 
_refine.ls_d_res_low                             53.882 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     12927 
_refine.ls_number_reflns_R_free                  639 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.64 
_refine.ls_percent_reflns_R_free                 4.94 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2053 
_refine.ls_R_factor_R_free                       0.2537 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2026 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.87 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.41 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2992 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             35 
_refine_hist.number_atoms_total               3035 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        53.882 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.015  ? 3051 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.500  ? 4081 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.132 ? 1148 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.066  ? 442  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.008  ? 534  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.55   2.7458  . . 124 2492 98.00 . . . 0.3651 . 0.2779 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7458 3.0221  . . 130 2428 97.00 . . . 0.3282 . 0.2495 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0221 3.4594  . . 126 2468 97.00 . . . 0.2897 . 0.2351 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4594 4.3582  . . 137 2456 96.00 . . . 0.2197 . 0.1742 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3582 53.8941 . . 122 2444 90.00 . . . 0.2244 . 0.1796 . . . . . . . . . . 
# 
_struct.entry_id                     4XYN 
_struct.title                        'X-ray structure of Ca(2+)-S100B with human RAGE-derived W61 peptide' 
_struct.pdbx_descriptor              'Receptor for advanced glycation endproducts-derived peptide (W61), S100B' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4XYN 
_struct_keywords.text            'Membrane protein, metal binding protein' 
_struct_keywords.pdbx_keywords   'Membrane protein, metal binding protein' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
Q N N 4 ? 
R N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 6  ? VAL A 10 ? GLU P 59 VAL P 63 5 ? 5  
HELX_P HELX_P2  AA2 SER B 2  ? GLY B 20 ? SER A 2  GLY A 20 1 ? 19 
HELX_P HELX_P3  AA3 LYS B 29 ? LEU B 41 ? LYS A 29 LEU A 41 1 ? 13 
HELX_P HELX_P4  AA4 GLU B 50 ? ASP B 62 ? GLU A 50 ASP A 62 1 ? 13 
HELX_P HELX_P5  AA5 ASP B 70 ? GLU B 87 ? ASP A 70 GLU A 87 1 ? 18 
HELX_P HELX_P6  AA6 PHE B 88 ? GLU B 90 ? PHE A 88 GLU A 90 5 ? 3  
HELX_P HELX_P7  AA7 SER C 2  ? GLY C 20 ? SER B 2  GLY B 20 1 ? 19 
HELX_P HELX_P8  AA8 LYS C 29 ? LEU C 41 ? LYS B 29 LEU B 41 1 ? 13 
HELX_P HELX_P9  AA9 GLU C 50 ? ASP C 62 ? GLU B 50 ASP B 62 1 ? 13 
HELX_P HELX_P10 AB1 PHE C 71 ? PHE C 88 ? PHE B 71 PHE B 88 1 ? 18 
HELX_P HELX_P11 AB2 SER D 2  ? GLY D 20 ? SER C 2  GLY C 20 1 ? 19 
HELX_P HELX_P12 AB3 LYS D 29 ? LEU D 41 ? LYS C 29 LEU C 41 1 ? 13 
HELX_P HELX_P13 AB4 GLU D 50 ? ASP D 62 ? GLU C 50 ASP C 62 1 ? 13 
HELX_P HELX_P14 AB5 ASP D 70 ? PHE D 88 ? ASP C 70 PHE C 88 1 ? 19 
HELX_P HELX_P15 AB6 SER E 2  ? GLY E 20 ? SER D 2  GLY D 20 1 ? 19 
HELX_P HELX_P16 AB7 LYS E 29 ? LEU E 41 ? LYS D 29 LEU D 41 1 ? 13 
HELX_P HELX_P17 AB8 GLU E 50 ? ASP E 62 ? GLU D 50 ASP D 62 1 ? 13 
HELX_P HELX_P18 AB9 ASP E 70 ? HIS E 86 ? ASP D 70 HIS D 86 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B SER 19 O   ? ? ? 1_555 G CA  . CA ? ? A SER 19  A CA  502 1_555 ? ? ? ? ? ? ? 2.220 ? 
metalc2  metalc ? ? B GLU 22 O   ? ? ? 1_555 G CA  . CA ? ? A GLU 22  A CA  502 1_555 ? ? ? ? ? ? ? 2.650 ? 
metalc3  metalc ? ? B ASP 24 O   ? ? ? 1_555 G CA  . CA ? ? A ASP 24  A CA  502 1_555 ? ? ? ? ? ? ? 2.454 ? 
metalc4  metalc ? ? B LYS 27 O   ? ? ? 1_555 G CA  . CA ? ? A LYS 27  A CA  502 1_555 ? ? ? ? ? ? ? 2.636 ? 
metalc5  metalc ? ? B GLU 32 OE1 ? ? ? 1_555 G CA  . CA ? ? A GLU 32  A CA  502 1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc6  metalc ? ? B GLU 32 OE2 ? ? ? 1_555 G CA  . CA ? ? A GLU 32  A CA  502 1_555 ? ? ? ? ? ? ? 2.528 ? 
metalc7  metalc ? ? B ASP 62 OD1 ? ? ? 1_555 F CA  . CA ? ? A ASP 62  A CA  501 1_555 ? ? ? ? ? ? ? 2.536 ? 
metalc8  metalc ? ? B ASP 64 OD1 ? ? ? 1_555 F CA  . CA ? ? A ASP 64  A CA  501 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc9  metalc ? ? B ASP 66 OD1 ? ? ? 1_555 F CA  . CA ? ? A ASP 66  A CA  501 1_555 ? ? ? ? ? ? ? 2.488 ? 
metalc10 metalc ? ? B GLU 68 O   ? ? ? 1_555 F CA  . CA ? ? A GLU 68  A CA  501 1_555 ? ? ? ? ? ? ? 2.366 ? 
metalc11 metalc ? ? B GLU 73 OE1 ? ? ? 1_555 F CA  . CA ? ? A GLU 73  A CA  501 1_555 ? ? ? ? ? ? ? 2.448 ? 
metalc12 metalc ? ? B GLU 73 OE2 ? ? ? 1_555 F CA  . CA ? ? A GLU 73  A CA  501 1_555 ? ? ? ? ? ? ? 2.559 ? 
metalc13 metalc ? ? C SER 19 O   ? ? ? 1_555 I CA  . CA ? ? B SER 19  B CA  502 1_555 ? ? ? ? ? ? ? 2.286 ? 
metalc14 metalc ? ? C GLU 22 O   ? ? ? 1_555 I CA  . CA ? ? B GLU 22  B CA  502 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc15 metalc ? ? C ASP 24 O   ? ? ? 1_555 I CA  . CA ? ? B ASP 24  B CA  502 1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc16 metalc ? ? C LYS 27 O   ? ? ? 1_555 I CA  . CA ? ? B LYS 27  B CA  502 1_555 ? ? ? ? ? ? ? 2.485 ? 
metalc17 metalc ? ? C GLU 32 OE1 ? ? ? 1_555 I CA  . CA ? ? B GLU 32  B CA  502 1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc18 metalc ? ? C GLU 32 OE2 ? ? ? 1_555 I CA  . CA ? ? B GLU 32  B CA  502 1_555 ? ? ? ? ? ? ? 2.696 ? 
metalc19 metalc ? ? C ASP 62 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 62  B CA  501 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc20 metalc ? ? C ASP 64 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 64  B CA  501 1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc21 metalc ? ? C ASP 66 OD1 ? ? ? 1_555 H CA  . CA ? ? B ASP 66  B CA  501 1_555 ? ? ? ? ? ? ? 2.526 ? 
metalc22 metalc ? ? C GLU 68 O   ? ? ? 1_555 H CA  . CA ? ? B GLU 68  B CA  501 1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc23 metalc ? ? C GLU 73 OE1 ? ? ? 1_555 H CA  . CA ? ? B GLU 73  B CA  501 1_555 ? ? ? ? ? ? ? 2.757 ? 
metalc24 metalc ? ? C GLU 73 OE2 ? ? ? 1_555 H CA  . CA ? ? B GLU 73  B CA  501 1_555 ? ? ? ? ? ? ? 2.726 ? 
metalc25 metalc ? ? D SER 19 O   ? ? ? 1_555 J CA  . CA ? ? C SER 19  C CA  501 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc26 metalc ? ? D GLU 22 O   ? ? ? 1_555 J CA  . CA ? ? C GLU 22  C CA  501 1_555 ? ? ? ? ? ? ? 2.709 ? 
metalc27 metalc ? ? D ASP 24 O   ? ? ? 1_555 J CA  . CA ? ? C ASP 24  C CA  501 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc28 metalc ? ? D LYS 27 O   ? ? ? 1_555 J CA  . CA ? ? C LYS 27  C CA  501 1_555 ? ? ? ? ? ? ? 2.359 ? 
metalc29 metalc ? ? D GLU 32 OE1 ? ? ? 1_555 J CA  . CA ? ? C GLU 32  C CA  501 1_555 ? ? ? ? ? ? ? 2.459 ? 
metalc30 metalc ? ? D GLU 32 OE2 ? ? ? 1_555 J CA  . CA ? ? C GLU 32  C CA  501 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc31 metalc ? ? D ASP 62 OD1 ? ? ? 1_555 K CA  . CA ? ? C ASP 62  C CA  502 1_555 ? ? ? ? ? ? ? 2.753 ? 
metalc32 metalc ? ? D ASP 64 OD1 ? ? ? 1_555 K CA  . CA ? ? C ASP 64  C CA  502 1_555 ? ? ? ? ? ? ? 2.731 ? 
metalc33 metalc ? ? D ASP 64 OD2 ? ? ? 1_555 K CA  . CA ? ? C ASP 64  C CA  502 1_555 ? ? ? ? ? ? ? 2.795 ? 
metalc34 metalc ? ? D ASP 66 OD1 ? ? ? 1_555 K CA  . CA ? ? C ASP 66  C CA  502 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc35 metalc ? ? D GLU 68 O   ? ? ? 1_555 K CA  . CA ? ? C GLU 68  C CA  502 1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc36 metalc ? ? D GLU 73 OE1 ? ? ? 1_555 K CA  . CA ? ? C GLU 73  C CA  502 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc37 metalc ? ? D GLU 73 OE2 ? ? ? 1_555 K CA  . CA ? ? C GLU 73  C CA  502 1_555 ? ? ? ? ? ? ? 2.444 ? 
metalc38 metalc ? ? E SER 19 O   ? ? ? 1_555 L CA  . CA ? ? D SER 19  D CA  501 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc39 metalc ? ? E GLU 22 O   ? ? ? 1_555 L CA  . CA ? ? D GLU 22  D CA  501 1_555 ? ? ? ? ? ? ? 2.600 ? 
metalc40 metalc ? ? E ASP 24 O   ? ? ? 1_555 L CA  . CA ? ? D ASP 24  D CA  501 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc41 metalc ? ? E LYS 27 O   ? ? ? 1_555 L CA  . CA ? ? D LYS 27  D CA  501 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc42 metalc ? ? E GLU 32 OE1 ? ? ? 1_555 L CA  . CA ? ? D GLU 32  D CA  501 1_555 ? ? ? ? ? ? ? 2.292 ? 
metalc43 metalc ? ? E GLU 32 OE2 ? ? ? 1_555 L CA  . CA ? ? D GLU 32  D CA  501 1_555 ? ? ? ? ? ? ? 2.518 ? 
metalc44 metalc ? ? E ASP 62 OD1 ? ? ? 1_555 M CA  . CA ? ? D ASP 62  D CA  502 1_555 ? ? ? ? ? ? ? 2.593 ? 
metalc45 metalc ? ? E ASP 64 OD1 ? ? ? 1_555 M CA  . CA ? ? D ASP 64  D CA  502 1_555 ? ? ? ? ? ? ? 2.778 ? 
metalc46 metalc ? ? E ASP 66 OD1 ? ? ? 1_555 M CA  . CA ? ? D ASP 66  D CA  502 1_555 ? ? ? ? ? ? ? 2.395 ? 
metalc47 metalc ? ? E GLU 68 O   ? ? ? 1_555 M CA  . CA ? ? D GLU 68  D CA  502 1_555 ? ? ? ? ? ? ? 2.320 ? 
metalc48 metalc ? ? E GLU 73 OE1 ? ? ? 1_555 M CA  . CA ? ? D GLU 73  D CA  502 1_555 ? ? ? ? ? ? ? 3.027 ? 
metalc49 metalc ? ? E GLU 73 OE2 ? ? ? 1_555 M CA  . CA ? ? D GLU 73  D CA  502 1_555 ? ? ? ? ? ? ? 2.787 ? 
metalc50 metalc ? ? F CA  .  CA  ? ? ? 1_555 O HOH . O  ? ? A CA  501 A HOH 605 1_555 ? ? ? ? ? ? ? 2.497 ? 
metalc51 metalc ? ? G CA  .  CA  ? ? ? 1_555 O HOH . O  ? ? A CA  502 A HOH 606 1_555 ? ? ? ? ? ? ? 2.130 ? 
metalc52 metalc ? ? H CA  .  CA  ? ? ? 1_555 P HOH . O  ? ? B CA  501 B HOH 604 1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc53 metalc ? ? I CA  .  CA  ? ? ? 1_555 P HOH . O  ? ? B CA  502 B HOH 603 1_555 ? ? ? ? ? ? ? 2.339 ? 
metalc54 metalc ? ? J CA  .  CA  ? ? ? 1_555 Q HOH . O  ? ? C CA  501 C HOH 601 1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc55 metalc ? ? K CA  .  CA  ? ? ? 1_555 Q HOH . O  ? ? C CA  502 C HOH 602 1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc56 metalc ? ? L CA  .  CA  ? ? ? 1_555 R HOH . O  ? ? D CA  501 D HOH 602 1_555 ? ? ? ? ? ? ? 2.317 ? 
metalc57 metalc ? ? M CA  .  CA  ? ? ? 1_555 R HOH . O  ? ? D CA  502 D HOH 603 1_555 ? ? ? ? ? ? ? 2.422 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA1 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS C 27 ? LEU C 28 ? LYS B 27 LEU B 28 
AA1 2 CYS C 69 ? ASP C 70 ? CYS B 69 ASP B 70 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA1 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LEU 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   C 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    28 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LEU 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    B 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     28 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   CYS 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   C 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    69 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    CYS 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    B 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     69 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CA 501 ? 6 'binding site for residue CA A 501' 
AC2 Software A CA 502 ? 6 'binding site for residue CA A 502' 
AC3 Software B CA 501 ? 6 'binding site for residue CA B 501' 
AC4 Software B CA 502 ? 6 'binding site for residue CA B 502' 
AC5 Software C CA 501 ? 6 'binding site for residue CA C 501' 
AC6 Software C CA 502 ? 5 'binding site for residue CA C 502' 
AC7 Software D CA 501 ? 6 'binding site for residue CA D 501' 
AC8 Software D CA 502 ? 6 'binding site for residue CA D 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP B 62 ? ASP A 62  . ? 1_555 ? 
2  AC1 6 ASP B 64 ? ASP A 64  . ? 1_555 ? 
3  AC1 6 ASP B 66 ? ASP A 66  . ? 1_555 ? 
4  AC1 6 GLU B 68 ? GLU A 68  . ? 1_555 ? 
5  AC1 6 GLU B 73 ? GLU A 73  . ? 1_555 ? 
6  AC1 6 HOH O .  ? HOH A 605 . ? 1_555 ? 
7  AC2 6 SER B 19 ? SER A 19  . ? 1_555 ? 
8  AC2 6 GLU B 22 ? GLU A 22  . ? 1_555 ? 
9  AC2 6 ASP B 24 ? ASP A 24  . ? 1_555 ? 
10 AC2 6 LYS B 27 ? LYS A 27  . ? 1_555 ? 
11 AC2 6 GLU B 32 ? GLU A 32  . ? 1_555 ? 
12 AC2 6 HOH O .  ? HOH A 606 . ? 1_555 ? 
13 AC3 6 ASP C 62 ? ASP B 62  . ? 1_555 ? 
14 AC3 6 ASP C 64 ? ASP B 64  . ? 1_555 ? 
15 AC3 6 ASP C 66 ? ASP B 66  . ? 1_555 ? 
16 AC3 6 GLU C 68 ? GLU B 68  . ? 1_555 ? 
17 AC3 6 GLU C 73 ? GLU B 73  . ? 1_555 ? 
18 AC3 6 HOH P .  ? HOH B 604 . ? 1_555 ? 
19 AC4 6 SER C 19 ? SER B 19  . ? 1_555 ? 
20 AC4 6 GLU C 22 ? GLU B 22  . ? 1_555 ? 
21 AC4 6 ASP C 24 ? ASP B 24  . ? 1_555 ? 
22 AC4 6 LYS C 27 ? LYS B 27  . ? 1_555 ? 
23 AC4 6 GLU C 32 ? GLU B 32  . ? 1_555 ? 
24 AC4 6 HOH P .  ? HOH B 603 . ? 1_555 ? 
25 AC5 6 SER D 19 ? SER C 19  . ? 1_555 ? 
26 AC5 6 GLU D 22 ? GLU C 22  . ? 1_555 ? 
27 AC5 6 ASP D 24 ? ASP C 24  . ? 1_555 ? 
28 AC5 6 LYS D 27 ? LYS C 27  . ? 1_555 ? 
29 AC5 6 GLU D 32 ? GLU C 32  . ? 1_555 ? 
30 AC5 6 HOH Q .  ? HOH C 601 . ? 1_555 ? 
31 AC6 5 ASP D 62 ? ASP C 62  . ? 1_555 ? 
32 AC6 5 ASP D 64 ? ASP C 64  . ? 1_555 ? 
33 AC6 5 GLU D 68 ? GLU C 68  . ? 1_555 ? 
34 AC6 5 GLU D 73 ? GLU C 73  . ? 1_555 ? 
35 AC6 5 HOH Q .  ? HOH C 602 . ? 1_555 ? 
36 AC7 6 SER E 19 ? SER D 19  . ? 1_555 ? 
37 AC7 6 GLU E 22 ? GLU D 22  . ? 1_555 ? 
38 AC7 6 ASP E 24 ? ASP D 24  . ? 1_555 ? 
39 AC7 6 LYS E 27 ? LYS D 27  . ? 1_555 ? 
40 AC7 6 GLU E 32 ? GLU D 32  . ? 1_555 ? 
41 AC7 6 HOH R .  ? HOH D 602 . ? 1_555 ? 
42 AC8 6 ASP E 62 ? ASP D 62  . ? 1_555 ? 
43 AC8 6 ASP E 64 ? ASP D 64  . ? 1_555 ? 
44 AC8 6 ASP E 66 ? ASP D 66  . ? 1_555 ? 
45 AC8 6 GLU E 68 ? GLU D 68  . ? 1_555 ? 
46 AC8 6 GLU E 73 ? GLU D 73  . ? 1_555 ? 
47 AC8 6 HOH R .  ? HOH D 603 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4XYN 
_atom_sites.fract_transf_matrix[1][1]   0.014538 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011536 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.015030 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    . ARG A 1 4  ? -22.565 36.113 -24.052 1.00 71.93  ? 57  ARG P N    1 
ATOM   2    C  CA   . ARG A 1 4  ? -23.141 37.401 -23.710 1.00 63.82  ? 57  ARG P CA   1 
ATOM   3    C  C    . ARG A 1 4  ? -24.529 37.252 -23.081 1.00 68.62  ? 57  ARG P C    1 
ATOM   4    O  O    . ARG A 1 4  ? -25.406 36.583 -23.651 1.00 73.34  ? 57  ARG P O    1 
ATOM   5    C  CB   . ARG A 1 4  ? -23.225 38.290 -24.967 1.00 60.74  ? 57  ARG P CB   1 
ATOM   6    C  CG   . ARG A 1 4  ? -22.852 39.745 -24.697 1.00 59.86  ? 57  ARG P CG   1 
ATOM   7    C  CD   . ARG A 1 4  ? -22.768 40.601 -25.949 1.00 60.68  ? 57  ARG P CD   1 
ATOM   8    N  NE   . ARG A 1 4  ? -21.517 40.445 -26.712 1.00 65.72  ? 57  ARG P NE   1 
ATOM   9    C  CZ   . ARG A 1 4  ? -21.272 41.086 -27.868 1.00 67.73  ? 57  ARG P CZ   1 
ATOM   10   N  NH1  . ARG A 1 4  ? -20.112 40.934 -28.528 1.00 61.78  ? 57  ARG P NH1  1 
ATOM   11   N  NH2  . ARG A 1 4  ? -22.203 41.902 -28.364 1.00 66.05  ? 57  ARG P NH2  1 
ATOM   12   H  HA   . ARG A 1 4  ? -22.565 37.843 -23.066 1.00 76.58  ? 57  ARG P HA   1 
ATOM   13   H  HB2  . ARG A 1 4  ? -22.616 37.944 -25.638 1.00 72.89  ? 57  ARG P HB2  1 
ATOM   14   H  HB3  . ARG A 1 4  ? -24.134 38.272 -25.304 1.00 72.89  ? 57  ARG P HB3  1 
ATOM   15   H  HG2  . ARG A 1 4  ? -23.521 40.136 -24.115 1.00 71.83  ? 57  ARG P HG2  1 
ATOM   16   H  HG3  . ARG A 1 4  ? -21.984 39.769 -24.264 1.00 71.83  ? 57  ARG P HG3  1 
ATOM   17   H  HD2  . ARG A 1 4  ? -23.502 40.364 -26.537 1.00 72.82  ? 57  ARG P HD2  1 
ATOM   18   H  HD3  . ARG A 1 4  ? -22.842 41.533 -25.693 1.00 72.82  ? 57  ARG P HD3  1 
ATOM   19   H  HE   . ARG A 1 4  ? -20.863 40.034 -26.334 1.00 78.87  ? 57  ARG P HE   1 
ATOM   20   H  HH11 . ARG A 1 4  ? -19.507 40.408 -28.218 1.00 74.13  ? 57  ARG P HH11 1 
ATOM   21   H  HH12 . ARG A 1 4  ? -19.981 41.351 -29.269 1.00 74.13  ? 57  ARG P HH12 1 
ATOM   22   H  HH21 . ARG A 1 4  ? -22.947 42.011 -27.946 1.00 79.27  ? 57  ARG P HH21 1 
ATOM   23   H  HH22 . ARG A 1 4  ? -22.061 42.319 -29.103 1.00 79.27  ? 57  ARG P HH22 1 
ATOM   24   N  N    . THR A 1 5  ? -24.732 37.876 -21.915 1.00 65.97  ? 58  THR P N    1 
ATOM   25   C  CA   . THR A 1 5  ? -26.077 38.049 -21.350 1.00 62.30  ? 58  THR P CA   1 
ATOM   26   C  C    . THR A 1 5  ? -26.391 39.466 -20.803 1.00 59.63  ? 58  THR P C    1 
ATOM   27   O  O    . THR A 1 5  ? -25.487 40.254 -20.542 1.00 56.14  ? 58  THR P O    1 
ATOM   28   C  CB   . THR A 1 5  ? -26.305 37.047 -20.234 1.00 64.31  ? 58  THR P CB   1 
ATOM   29   O  OG1  . THR A 1 5  ? -25.613 37.441 -19.060 1.00 61.15  ? 58  THR P OG1  1 
ATOM   30   C  CG2  . THR A 1 5  ? -25.793 35.695 -20.642 1.00 74.66  ? 58  THR P CG2  1 
ATOM   31   H  H    . THR A 1 5  ? -24.105 38.211 -21.431 1.00 79.17  ? 58  THR P H    1 
ATOM   32   H  HA   . THR A 1 5  ? -26.725 37.859 -22.047 1.00 74.76  ? 58  THR P HA   1 
ATOM   33   H  HB   . THR A 1 5  ? -27.254 36.976 -20.046 1.00 77.17  ? 58  THR P HB   1 
ATOM   34   H  HG1  . THR A 1 5  ? -24.789 37.488 -19.214 1.00 73.38  ? 58  THR P HG1  1 
ATOM   35   H  HG21 . THR A 1 5  ? -25.940 35.055 -19.927 1.00 89.60  ? 58  THR P HG21 1 
ATOM   36   H  HG22 . THR A 1 5  ? -26.258 35.390 -21.437 1.00 89.60  ? 58  THR P HG22 1 
ATOM   37   H  HG23 . THR A 1 5  ? -24.843 35.743 -20.831 1.00 89.60  ? 58  THR P HG23 1 
ATOM   38   N  N    . GLU A 1 6  ? -27.685 39.776 -20.648 1.00 59.87  ? 59  GLU P N    1 
ATOM   39   C  CA   . GLU A 1 6  ? -28.123 41.067 -20.108 1.00 59.14  ? 59  GLU P CA   1 
ATOM   40   C  C    . GLU A 1 6  ? -27.672 41.110 -18.663 1.00 56.08  ? 59  GLU P C    1 
ATOM   41   O  O    . GLU A 1 6  ? -27.750 40.115 -17.967 1.00 55.96  ? 59  GLU P O    1 
ATOM   42   C  CB   . GLU A 1 6  ? -29.653 41.273 -20.216 1.00 61.18  ? 59  GLU P CB   1 
ATOM   43   C  CG   . GLU A 1 6  ? -30.250 41.354 -21.658 1.00 62.93  ? 59  GLU P CG   1 
ATOM   44   C  CD   . GLU A 1 6  ? -31.811 41.378 -21.703 1.00 70.99  ? 59  GLU P CD   1 
ATOM   45   O  OE1  . GLU A 1 6  ? -32.449 40.664 -20.885 1.00 68.85  ? 59  GLU P OE1  1 
ATOM   46   O  OE2  . GLU A 1 6  ? -32.407 42.103 -22.559 1.00 72.79  ? 59  GLU P OE2  1 
ATOM   47   H  H    . GLU A 1 6  ? -28.333 39.249 -20.851 1.00 71.85  ? 59  GLU P H    1 
ATOM   48   H  HA   . GLU A 1 6  ? -27.682 41.785 -20.589 1.00 70.97  ? 59  GLU P HA   1 
ATOM   49   H  HB2  . GLU A 1 6  ? -30.090 40.534 -19.766 1.00 73.42  ? 59  GLU P HB2  1 
ATOM   50   H  HB3  . GLU A 1 6  ? -29.879 42.102 -19.765 1.00 73.42  ? 59  GLU P HB3  1 
ATOM   51   H  HG2  . GLU A 1 6  ? -29.930 42.166 -22.082 1.00 75.51  ? 59  GLU P HG2  1 
ATOM   52   H  HG3  . GLU A 1 6  ? -29.951 40.581 -22.162 1.00 75.51  ? 59  GLU P HG3  1 
ATOM   53   N  N    . ALA A 1 7  ? -27.158 42.249 -18.225 1.00 54.33  ? 60  ALA P N    1 
ATOM   54   C  CA   . ALA A 1 7  ? -26.522 42.329 -16.927 1.00 52.71  ? 60  ALA P CA   1 
ATOM   55   C  C    . ALA A 1 7  ? -27.513 42.234 -15.789 1.00 55.15  ? 60  ALA P C    1 
ATOM   56   O  O    . ALA A 1 7  ? -27.172 41.762 -14.705 1.00 54.83  ? 60  ALA P O    1 
ATOM   57   C  CB   . ALA A 1 7  ? -25.757 43.598 -16.809 1.00 53.12  ? 60  ALA P CB   1 
ATOM   58   H  H    . ALA A 1 7  ? -27.166 42.989 -18.663 1.00 65.19  ? 60  ALA P H    1 
ATOM   59   H  HA   . ALA A 1 7  ? -25.895 41.594 -16.839 1.00 63.25  ? 60  ALA P HA   1 
ATOM   60   H  HB1  . ALA A 1 7  ? -25.338 43.633 -15.935 1.00 63.75  ? 60  ALA P HB1  1 
ATOM   61   H  HB2  . ALA A 1 7  ? -25.079 43.623 -17.502 1.00 63.75  ? 60  ALA P HB2  1 
ATOM   62   H  HB3  . ALA A 1 7  ? -26.367 44.344 -16.915 1.00 63.75  ? 60  ALA P HB3  1 
ATOM   63   N  N    . TRP A 1 8  ? -28.741 42.687 -16.009 1.00 54.82  ? 61  TRP P N    1 
ATOM   64   C  CA   . TRP A 1 8  ? -29.711 42.707 -14.911 1.00 54.28  ? 61  TRP P CA   1 
ATOM   65   C  C    . TRP A 1 8  ? -30.214 41.290 -14.573 1.00 55.43  ? 61  TRP P C    1 
ATOM   66   O  O    . TRP A 1 8  ? -30.723 41.055 -13.488 1.00 55.65  ? 61  TRP P O    1 
ATOM   67   C  CB   . TRP A 1 8  ? -30.885 43.643 -15.240 1.00 52.88  ? 61  TRP P CB   1 
ATOM   68   C  CG   . TRP A 1 8  ? -31.561 43.247 -16.458 1.00 54.02  ? 61  TRP P CG   1 
ATOM   69   C  CD1  . TRP A 1 8  ? -31.300 43.671 -17.719 1.00 55.31  ? 61  TRP P CD1  1 
ATOM   70   C  CD2  . TRP A 1 8  ? -32.607 42.303 -16.551 1.00 54.96  ? 61  TRP P CD2  1 
ATOM   71   N  NE1  . TRP A 1 8  ? -32.142 43.051 -18.610 1.00 57.01  ? 61  TRP P NE1  1 
ATOM   72   C  CE2  . TRP A 1 8  ? -32.954 42.199 -17.911 1.00 56.32  ? 61  TRP P CE2  1 
ATOM   73   C  CE3  . TRP A 1 8  ? -33.298 41.530 -15.608 1.00 55.37  ? 61  TRP P CE3  1 
ATOM   74   C  CZ2  . TRP A 1 8  ? -33.959 41.356 -18.357 1.00 57.78  ? 61  TRP P CZ2  1 
ATOM   75   C  CZ3  . TRP A 1 8  ? -34.290 40.688 -16.050 1.00 56.01  ? 61  TRP P CZ3  1 
ATOM   76   C  CH2  . TRP A 1 8  ? -34.620 40.612 -17.413 1.00 56.66  ? 61  TRP P CH2  1 
ATOM   77   H  H    . TRP A 1 8  ? -29.035 42.981 -16.761 1.00 65.79  ? 61  TRP P H    1 
ATOM   78   H  HA   . TRP A 1 8  ? -29.272 43.057 -14.120 1.00 65.14  ? 61  TRP P HA   1 
ATOM   79   H  HB2  . TRP A 1 8  ? -31.528 43.616 -14.514 1.00 63.46  ? 61  TRP P HB2  1 
ATOM   80   H  HB3  . TRP A 1 8  ? -30.551 44.546 -15.359 1.00 63.46  ? 61  TRP P HB3  1 
ATOM   81   H  HD1  . TRP A 1 8  ? -30.650 44.295 -17.947 1.00 66.37  ? 61  TRP P HD1  1 
ATOM   82   H  HE1  . TRP A 1 8  ? -32.153 43.173 -19.462 1.00 68.41  ? 61  TRP P HE1  1 
ATOM   83   H  HE3  . TRP A 1 8  ? -33.082 41.578 -14.705 1.00 66.44  ? 61  TRP P HE3  1 
ATOM   84   H  HZ2  . TRP A 1 8  ? -34.180 41.301 -19.258 1.00 69.34  ? 61  TRP P HZ2  1 
ATOM   85   H  HZ3  . TRP A 1 8  ? -34.759 40.171 -15.435 1.00 67.21  ? 61  TRP P HZ3  1 
ATOM   86   H  HH2  . TRP A 1 8  ? -35.299 40.037 -17.684 1.00 67.99  ? 61  TRP P HH2  1 
ATOM   87   N  N    . LYS A 1 9  ? -30.040 40.328 -15.467 1.00 54.77  ? 62  LYS P N    1 
ATOM   88   C  CA   . LYS A 1 9  ? -30.463 38.973 -15.151 1.00 55.91  ? 62  LYS P CA   1 
ATOM   89   C  C    . LYS A 1 9  ? -29.547 38.268 -14.129 1.00 59.57  ? 62  LYS P C    1 
ATOM   90   O  O    . LYS A 1 9  ? -29.909 37.203 -13.606 1.00 58.86  ? 62  LYS P O    1 
ATOM   91   C  CB   . LYS A 1 9  ? -30.545 38.143 -16.422 1.00 53.79  ? 62  LYS P CB   1 
ATOM   92   C  CG   . LYS A 1 9  ? -31.541 38.643 -17.445 1.00 55.69  ? 62  LYS P CG   1 
ATOM   93   C  CD   . LYS A 1 9  ? -31.180 38.101 -18.818 1.00 58.60  ? 62  LYS P CD   1 
ATOM   94   C  CE   . LYS A 1 9  ? -32.378 37.757 -19.643 1.00 59.75  ? 62  LYS P CE   1 
ATOM   95   N  NZ   . LYS A 1 9  ? -32.464 36.268 -19.769 1.00 60.08  ? 62  LYS P NZ   1 
ATOM   96   H  H    . LYS A 1 9  ? -29.689 40.429 -16.245 1.00 65.72  ? 62  LYS P H    1 
ATOM   97   H  HA   . LYS A 1 9  ? -31.354 39.010 -14.768 1.00 67.09  ? 62  LYS P HA   1 
ATOM   98   H  HB2  . LYS A 1 9  ? -29.671 38.136 -16.843 1.00 64.54  ? 62  LYS P HB2  1 
ATOM   99   H  HB3  . LYS A 1 9  ? -30.799 37.238 -16.184 1.00 64.54  ? 62  LYS P HB3  1 
ATOM   100  H  HG2  . LYS A 1 9  ? -32.430 38.331 -17.213 1.00 66.83  ? 62  LYS P HG2  1 
ATOM   101  H  HG3  . LYS A 1 9  ? -31.516 39.612 -17.478 1.00 66.83  ? 62  LYS P HG3  1 
ATOM   102  H  HD2  . LYS A 1 9  ? -30.670 38.772 -19.298 1.00 70.32  ? 62  LYS P HD2  1 
ATOM   103  H  HD3  . LYS A 1 9  ? -30.650 37.296 -18.710 1.00 70.32  ? 62  LYS P HD3  1 
ATOM   104  H  HE2  . LYS A 1 9  ? -33.181 38.081 -19.207 1.00 71.70  ? 62  LYS P HE2  1 
ATOM   105  H  HE3  . LYS A 1 9  ? -32.288 38.141 -20.529 1.00 71.70  ? 62  LYS P HE3  1 
ATOM   106  H  HZ1  . LYS A 1 9  ? -33.173 36.045 -20.258 1.00 72.10  ? 62  LYS P HZ1  1 
ATOM   107  H  HZ2  . LYS A 1 9  ? -31.730 35.953 -20.162 1.00 72.10  ? 62  LYS P HZ2  1 
ATOM   108  H  HZ3  . LYS A 1 9  ? -32.540 35.899 -18.963 1.00 72.10  ? 62  LYS P HZ3  1 
ATOM   109  N  N    . VAL A 1 10 ? -28.371 38.842 -13.845 1.00 58.92  ? 63  VAL P N    1 
ATOM   110  C  CA   . VAL A 1 10 ? -27.418 38.185 -12.945 1.00 60.72  ? 63  VAL P CA   1 
ATOM   111  C  C    . VAL A 1 10 ? -28.003 38.135 -11.561 1.00 60.79  ? 63  VAL P C    1 
ATOM   112  O  O    . VAL A 1 10 ? -28.505 39.153 -11.059 1.00 60.29  ? 63  VAL P O    1 
ATOM   113  C  CB   . VAL A 1 10 ? -26.021 38.901 -12.846 1.00 62.89  ? 63  VAL P CB   1 
ATOM   114  C  CG1  . VAL A 1 10 ? -25.226 38.819 -14.173 1.00 59.00  ? 63  VAL P CG1  1 
ATOM   115  C  CG2  . VAL A 1 10 ? -26.171 40.334 -12.313 1.00 62.71  ? 63  VAL P CG2  1 
ATOM   116  H  H    . VAL A 1 10 ? -28.105 39.599 -14.156 1.00 70.70  ? 63  VAL P H    1 
ATOM   117  H  HA   . VAL A 1 10 ? -27.271 37.275 -13.246 1.00 72.86  ? 63  VAL P HA   1 
ATOM   118  H  HB   . VAL A 1 10 ? -25.497 38.420 -12.187 1.00 75.47  ? 63  VAL P HB   1 
ATOM   119  H  HG11 . VAL A 1 10 ? -24.377 39.273 -14.060 1.00 70.80  ? 63  VAL P HG11 1 
ATOM   120  H  HG12 . VAL A 1 10 ? -25.077 37.886 -14.393 1.00 70.80  ? 63  VAL P HG12 1 
ATOM   121  H  HG13 . VAL A 1 10 ? -25.740 39.247 -14.875 1.00 70.80  ? 63  VAL P HG13 1 
ATOM   122  H  HG21 . VAL A 1 10 ? -25.295 40.746 -12.265 1.00 75.25  ? 63  VAL P HG21 1 
ATOM   123  H  HG22 . VAL A 1 10 ? -26.741 40.836 -12.916 1.00 75.25  ? 63  VAL P HG22 1 
ATOM   124  H  HG23 . VAL A 1 10 ? -26.571 40.301 -11.430 1.00 75.25  ? 63  VAL P HG23 1 
ATOM   125  N  N    . LEU A 1 11 ? -27.937 36.974 -10.914 1.00 61.10  ? 64  LEU P N    1 
ATOM   126  C  CA   . LEU A 1 11 ? -28.570 36.897 -9.606  1.00 63.69  ? 64  LEU P CA   1 
ATOM   127  C  C    . LEU A 1 11 ? -27.594 36.486 -8.520  1.00 64.03  ? 64  LEU P C    1 
ATOM   128  O  O    . LEU A 1 11 ? -27.255 37.312 -7.658  1.00 59.85  ? 64  LEU P O    1 
ATOM   129  C  CB   . LEU A 1 11 ? -29.781 35.951 -9.658  0.00 61.53  ? 64  LEU P CB   1 
ATOM   130  C  CG   . LEU A 1 11 ? -30.968 36.268 -8.730  0.00 59.46  ? 64  LEU P CG   1 
ATOM   131  C  CD1  . LEU A 1 11 ? -31.379 37.747 -8.736  0.00 59.07  ? 64  LEU P CD1  1 
ATOM   132  C  CD2  . LEU A 1 11 ? -32.168 35.420 -9.120  0.00 55.54  ? 64  LEU P CD2  1 
ATOM   133  H  H    . LEU A 1 11 ? -27.555 36.256 -11.192 1.00 73.32  ? 64  LEU P H    1 
ATOM   134  H  HA   . LEU A 1 11 ? -28.903 37.779 -9.376  1.00 76.42  ? 64  LEU P HA   1 
ATOM   135  H  HB2  . LEU A 1 11 ? -30.122 35.950 -10.566 0.00 73.84  ? 64  LEU P HB2  1 
ATOM   136  H  HB3  . LEU A 1 11 ? -29.474 35.059 -9.433  0.00 73.84  ? 64  LEU P HB3  1 
ATOM   137  H  HG   . LEU A 1 11 ? -30.723 36.034 -7.821  0.00 71.35  ? 64  LEU P HG   1 
ATOM   138  H  HD11 . LEU A 1 11 ? -32.128 37.868 -8.132  0.00 70.89  ? 64  LEU P HD11 1 
ATOM   139  H  HD12 . LEU A 1 11 ? -30.626 38.284 -8.443  0.00 70.89  ? 64  LEU P HD12 1 
ATOM   140  H  HD13 . LEU A 1 11 ? -31.636 37.999 -9.637  0.00 70.89  ? 64  LEU P HD13 1 
ATOM   141  H  HD21 . LEU A 1 11 ? -32.411 35.619 -10.038 0.00 66.64  ? 64  LEU P HD21 1 
ATOM   142  H  HD22 . LEU A 1 11 ? -31.932 34.483 -9.036  0.00 66.64  ? 64  LEU P HD22 1 
ATOM   143  H  HD23 . LEU A 1 11 ? -32.907 35.629 -8.528  0.00 66.64  ? 64  LEU P HD23 1 
ATOM   144  N  N    . SER A 1 12 ? -27.138 35.234 -8.591  1.00 66.38  ? 65  SER P N    1 
ATOM   145  C  CA   . SER A 1 12 ? -26.518 34.519 -7.460  1.00 67.90  ? 65  SER P CA   1 
ATOM   146  C  C    . SER A 1 12 ? -27.205 33.142 -7.329  1.00 65.75  ? 65  SER P C    1 
ATOM   147  O  O    . SER A 1 12 ? -27.170 32.495 -6.273  1.00 68.25  ? 65  SER P O    1 
ATOM   148  C  CB   . SER A 1 12 ? -26.613 35.312 -6.126  1.00 66.47  ? 65  SER P CB   1 
ATOM   149  O  OG   . SER A 1 12 ? -26.138 34.549 -5.022  1.00 77.67  ? 65  SER P OG   1 
ATOM   150  H  H    . SER A 1 12 ? -27.176 34.758 -9.307  1.00 79.66  ? 65  SER P H    1 
ATOM   151  H  HA   . SER A 1 12 ? -25.579 34.370 -7.655  1.00 81.48  ? 65  SER P HA   1 
ATOM   152  H  HB2  . SER A 1 12 ? -26.078 36.118 -6.202  1.00 79.76  ? 65  SER P HB2  1 
ATOM   153  H  HB3  . SER A 1 12 ? -27.541 35.547 -5.967  1.00 79.76  ? 65  SER P HB3  1 
ATOM   154  H  HG   . SER A 1 12 ? -26.593 33.847 -4.940  1.00 93.20  ? 65  SER P HG   1 
ATOM   155  N  N    . MET B 2 1  ? 4.843   35.810 -9.736  1.00 41.35  ? 1   MET A N    1 
ATOM   156  C  CA   . MET B 2 1  ? 3.350   35.820 -9.571  1.00 40.96  ? 1   MET A CA   1 
ATOM   157  C  C    . MET B 2 1  ? 2.771   34.748 -10.496 1.00 39.50  ? 1   MET A C    1 
ATOM   158  O  O    . MET B 2 1  ? 3.126   34.709 -11.670 1.00 39.98  ? 1   MET A O    1 
ATOM   159  C  CB   . MET B 2 1  ? 2.731   37.155 -9.982  1.00 41.97  ? 1   MET A CB   1 
ATOM   160  C  CG   . MET B 2 1  ? 3.227   38.431 -9.304  1.00 49.03  ? 1   MET A CG   1 
ATOM   161  S  SD   . MET B 2 1  ? 2.575   38.755 -7.707  1.00 66.53  ? 1   MET A SD   1 
ATOM   162  C  CE   . MET B 2 1  ? 1.067   39.519 -8.318  1.00 50.66  ? 1   MET A CE   1 
ATOM   163  H  H1   . MET B 2 1  ? 5.228   35.690 -8.942  1.00 49.63  ? 1   MET A H1   1 
ATOM   164  H  H2   . MET B 2 1  ? 5.077   35.147 -10.282 1.00 49.63  ? 1   MET A H2   1 
ATOM   165  H  H3   . MET B 2 1  ? 5.109   36.586 -10.081 1.00 49.63  ? 1   MET A H3   1 
ATOM   166  H  HA   . MET B 2 1  ? 3.114   35.630 -8.650  1.00 49.15  ? 1   MET A HA   1 
ATOM   167  H  HB2  . MET B 2 1  ? 2.878   37.269 -10.934 1.00 50.36  ? 1   MET A HB2  1 
ATOM   168  H  HB3  . MET B 2 1  ? 1.777   37.102 -9.816  1.00 50.36  ? 1   MET A HB3  1 
ATOM   169  H  HG2  . MET B 2 1  ? 4.192   38.375 -9.216  1.00 58.84  ? 1   MET A HG2  1 
ATOM   170  H  HG3  . MET B 2 1  ? 2.998   39.186 -9.868  1.00 58.84  ? 1   MET A HG3  1 
ATOM   171  H  HE1  . MET B 2 1  ? 0.523   39.791 -7.563  1.00 60.79  ? 1   MET A HE1  1 
ATOM   172  H  HE2  . MET B 2 1  ? 1.301   40.293 -8.854  1.00 60.79  ? 1   MET A HE2  1 
ATOM   173  H  HE3  . MET B 2 1  ? 0.584   38.875 -8.859  1.00 60.79  ? 1   MET A HE3  1 
ATOM   174  N  N    . SER B 2 2  ? 1.874   33.899 -10.014 1.00 37.36  ? 2   SER A N    1 
ATOM   175  C  CA   . SER B 2 2  ? 1.117   33.036 -10.947 1.00 37.03  ? 2   SER A CA   1 
ATOM   176  C  C    . SER B 2 2  ? 0.086   33.841 -11.797 1.00 37.74  ? 2   SER A C    1 
ATOM   177  O  O    . SER B 2 2  ? -0.210  35.001 -11.552 1.00 35.39  ? 2   SER A O    1 
ATOM   178  C  CB   . SER B 2 2  ? 0.370   31.939 -10.199 1.00 36.85  ? 2   SER A CB   1 
ATOM   179  O  OG   . SER B 2 2  ? -0.623  32.526 -9.405  1.00 36.09  ? 2   SER A OG   1 
ATOM   180  H  H    . SER B 2 2  ? 1.681   33.795 -9.183  1.00 44.83  ? 2   SER A H    1 
ATOM   181  H  HA   . SER B 2 2  ? 1.740   32.611 -11.557 1.00 44.44  ? 2   SER A HA   1 
ATOM   182  H  HB2  . SER B 2 2  ? -0.043  31.338 -10.838 1.00 44.21  ? 2   SER A HB2  1 
ATOM   183  H  HB3  . SER B 2 2  ? 0.991   31.455 -9.632  1.00 44.21  ? 2   SER A HB3  1 
ATOM   184  H  HG   . SER B 2 2  ? -1.044  31.932 -8.986  1.00 43.31  ? 2   SER A HG   1 
ATOM   185  N  N    . GLU B 2 3  ? -0.457  33.185 -12.807 1.00 38.17  ? 3   GLU A N    1 
ATOM   186  C  CA   . GLU B 2 3  ? -1.507  33.772 -13.584 1.00 39.02  ? 3   GLU A CA   1 
ATOM   187  C  C    . GLU B 2 3  ? -2.690  34.127 -12.690 1.00 35.98  ? 3   GLU A C    1 
ATOM   188  O  O    . GLU B 2 3  ? -3.317  35.200 -12.812 1.00 34.01  ? 3   GLU A O    1 
ATOM   189  C  CB   . GLU B 2 3  ? -1.885  32.821 -14.703 1.00 38.47  ? 3   GLU A CB   1 
ATOM   190  C  CG   . GLU B 2 3  ? -0.722  32.648 -15.680 1.00 47.13  ? 3   GLU A CG   1 
ATOM   191  C  CD   . GLU B 2 3  ? -0.277  33.971 -16.403 1.00 53.79  ? 3   GLU A CD   1 
ATOM   192  O  OE1  . GLU B 2 3  ? -1.106  34.635 -17.062 1.00 54.65  ? 3   GLU A OE1  1 
ATOM   193  O  OE2  . GLU B 2 3  ? 0.907   34.377 -16.245 1.00 52.25  ? 3   GLU A OE2  1 
ATOM   194  H  H    . GLU B 2 3  ? -0.229  32.394 -13.057 1.00 45.81  ? 3   GLU A H    1 
ATOM   195  H  HA   . GLU B 2 3  ? -1.180  34.592 -13.987 1.00 46.83  ? 3   GLU A HA   1 
ATOM   196  H  HB2  . GLU B 2 3  ? -2.103  31.953 -14.328 1.00 46.16  ? 3   GLU A HB2  1 
ATOM   197  H  HB3  . GLU B 2 3  ? -2.643  33.181 -15.189 1.00 46.16  ? 3   GLU A HB3  1 
ATOM   198  H  HG2  . GLU B 2 3  ? 0.044   32.306 -15.194 1.00 56.56  ? 3   GLU A HG2  1 
ATOM   199  H  HG3  . GLU B 2 3  ? -0.985  32.012 -16.365 1.00 56.56  ? 3   GLU A HG3  1 
ATOM   200  N  N    . LEU B 2 4  ? -2.914  33.244 -11.733 1.00 36.44  ? 4   LEU A N    1 
ATOM   201  C  CA   . LEU B 2 4  ? -3.980  33.407 -10.785 1.00 35.85  ? 4   LEU A CA   1 
ATOM   202  C  C    . LEU B 2 4  ? -3.712  34.604 -9.914  1.00 35.35  ? 4   LEU A C    1 
ATOM   203  O  O    . LEU B 2 4  ? -4.598  35.430 -9.712  1.00 33.95  ? 4   LEU A O    1 
ATOM   204  C  CB   . LEU B 2 4  ? -4.136  32.161 -9.926  1.00 35.71  ? 4   LEU A CB   1 
ATOM   205  C  CG   . LEU B 2 4  ? -5.101  32.249 -8.757  1.00 35.88  ? 4   LEU A CG   1 
ATOM   206  C  CD1  . LEU B 2 4  ? -6.445  32.777 -9.182  1.00 34.37  ? 4   LEU A CD1  1 
ATOM   207  C  CD2  . LEU B 2 4  ? -5.226  30.854 -8.178  1.00 36.58  ? 4   LEU A CD2  1 
ATOM   208  H  H    . LEU B 2 4  ? -2.449  32.530 -11.616 1.00 43.73  ? 4   LEU A H    1 
ATOM   209  H  HA   . LEU B 2 4  ? -4.813  33.555 -11.260 1.00 43.02  ? 4   LEU A HA   1 
ATOM   210  H  HB2  . LEU B 2 4  ? -4.442  31.438 -10.495 1.00 42.85  ? 4   LEU A HB2  1 
ATOM   211  H  HB3  . LEU B 2 4  ? -3.266  31.934 -9.561  1.00 42.85  ? 4   LEU A HB3  1 
ATOM   212  H  HG   . LEU B 2 4  ? -4.737  32.837 -8.077  1.00 43.06  ? 4   LEU A HG   1 
ATOM   213  H  HD11 . LEU B 2 4  ? -7.027  32.817 -8.408  1.00 41.25  ? 4   LEU A HD11 1 
ATOM   214  H  HD12 . LEU B 2 4  ? -6.331  33.664 -9.557  1.00 41.25  ? 4   LEU A HD12 1 
ATOM   215  H  HD13 . LEU B 2 4  ? -6.821  32.181 -9.849  1.00 41.25  ? 4   LEU A HD13 1 
ATOM   216  H  HD21 . LEU B 2 4  ? -5.839  30.879 -7.426  1.00 43.89  ? 4   LEU A HD21 1 
ATOM   217  H  HD22 . LEU B 2 4  ? -5.566  30.258 -8.863  1.00 43.89  ? 4   LEU A HD22 1 
ATOM   218  H  HD23 . LEU B 2 4  ? -4.352  30.556 -7.883  1.00 43.89  ? 4   LEU A HD23 1 
ATOM   219  N  N    . GLU B 2 5  ? -2.502  34.710 -9.389  1.00 35.96  ? 5   GLU A N    1 
ATOM   220  C  CA   . GLU B 2 5  ? -2.213  35.834 -8.504  1.00 37.22  ? 5   GLU A CA   1 
ATOM   221  C  C    . GLU B 2 5  ? -2.352  37.185 -9.264  1.00 35.60  ? 5   GLU A C    1 
ATOM   222  O  O    . GLU B 2 5  ? -2.882  38.143 -8.727  1.00 35.67  ? 5   GLU A O    1 
ATOM   223  C  CB   . GLU B 2 5  ? -0.829  35.656 -7.872  1.00 39.79  ? 5   GLU A CB   1 
ATOM   224  C  CG   . GLU B 2 5  ? -0.831  34.561 -6.806  1.00 39.39  ? 5   GLU A CG   1 
ATOM   225  C  CD   . GLU B 2 5  ? 0.560   34.096 -6.368  1.00 39.18  ? 5   GLU A CD   1 
ATOM   226  O  OE1  . GLU B 2 5  ? 1.536   34.081 -7.178  1.00 35.38  ? 5   GLU A OE1  1 
ATOM   227  O  OE2  . GLU B 2 5  ? 0.641   33.765 -5.170  1.00 40.48  ? 5   GLU A OE2  1 
ATOM   228  H  H    . GLU B 2 5  ? -1.849  34.166 -9.521  1.00 43.15  ? 5   GLU A H    1 
ATOM   229  H  HA   . GLU B 2 5  ? -2.864  35.835 -7.784  1.00 44.66  ? 5   GLU A HA   1 
ATOM   230  H  HB2  . GLU B 2 5  ? -0.193  35.407 -8.561  1.00 47.75  ? 5   GLU A HB2  1 
ATOM   231  H  HB3  . GLU B 2 5  ? -0.560  36.488 -7.452  1.00 47.75  ? 5   GLU A HB3  1 
ATOM   232  H  HG2  . GLU B 2 5  ? -1.290  34.895 -6.019  1.00 47.27  ? 5   GLU A HG2  1 
ATOM   233  H  HG3  . GLU B 2 5  ? -1.302  33.788 -7.156  1.00 47.27  ? 5   GLU A HG3  1 
ATOM   234  N  N    . LYS B 2 6  ? -1.886  37.221 -10.507 1.00 36.35  ? 6   LYS A N    1 
ATOM   235  C  CA   . LYS B 2 6  ? -2.003  38.368 -11.396 1.00 35.18  ? 6   LYS A CA   1 
ATOM   236  C  C    . LYS B 2 6  ? -3.450  38.660 -11.710 1.00 33.25  ? 6   LYS A C    1 
ATOM   237  O  O    . LYS B 2 6  ? -3.844  39.797 -11.892 1.00 33.94  ? 6   LYS A O    1 
ATOM   238  C  CB   . LYS B 2 6  ? -1.279  38.105 -12.691 1.00 35.53  ? 6   LYS A CB   1 
ATOM   239  C  CG   . LYS B 2 6  ? 0.157   38.118 -12.554 1.00 38.80  ? 6   LYS A CG   1 
ATOM   240  C  CD   . LYS B 2 6  ? 0.708   37.463 -13.797 1.00 44.42  ? 6   LYS A CD   1 
ATOM   241  C  CE   . LYS B 2 6  ? 2.219   37.502 -13.835 1.00 47.74  ? 6   LYS A CE   1 
ATOM   242  N  NZ   . LYS B 2 6  ? 2.597   36.674 -14.982 1.00 61.04  ? 6   LYS A NZ   1 
ATOM   243  H  H    . LYS B 2 6  ? -1.478  36.559 -10.874 1.00 43.62  ? 6   LYS A H    1 
ATOM   244  H  HA   . LYS B 2 6  ? -1.613  39.149 -10.974 1.00 42.22  ? 6   LYS A HA   1 
ATOM   245  H  HB2  . LYS B 2 6  ? -1.539  37.233 -13.026 1.00 42.64  ? 6   LYS A HB2  1 
ATOM   246  H  HB3  . LYS B 2 6  ? -1.523  38.791 -13.333 1.00 42.64  ? 6   LYS A HB3  1 
ATOM   247  H  HG2  . LYS B 2 6  ? 0.482   39.030 -12.501 1.00 46.56  ? 6   LYS A HG2  1 
ATOM   248  H  HG3  . LYS B 2 6  ? 0.424   37.603 -11.776 1.00 46.56  ? 6   LYS A HG3  1 
ATOM   249  H  HD2  . LYS B 2 6  ? 0.429   36.535 -13.820 1.00 53.31  ? 6   LYS A HD2  1 
ATOM   250  H  HD3  . LYS B 2 6  ? 0.374   37.932 -14.578 1.00 53.31  ? 6   LYS A HD3  1 
ATOM   251  H  HE2  . LYS B 2 6  ? 2.532   38.409 -13.974 1.00 57.29  ? 6   LYS A HE2  1 
ATOM   252  H  HE3  . LYS B 2 6  ? 2.588   37.118 -13.024 1.00 57.29  ? 6   LYS A HE3  1 
ATOM   253  H  HZ1  . LYS B 2 6  ? 2.247   37.010 -15.728 1.00 73.25  ? 6   LYS A HZ1  1 
ATOM   254  H  HZ2  . LYS B 2 6  ? 3.483   36.653 -15.062 1.00 73.25  ? 6   LYS A HZ2  1 
ATOM   255  H  HZ3  . LYS B 2 6  ? 2.298   35.844 -14.870 1.00 73.25  ? 6   LYS A HZ3  1 
ATOM   256  N  N    . ALA B 2 7  ? -4.203  37.589 -11.901 1.00 34.06  ? 7   ALA A N    1 
ATOM   257  C  CA   . ALA B 2 7  ? -5.590  37.722 -12.198 1.00 32.59  ? 7   ALA A CA   1 
ATOM   258  C  C    . ALA B 2 7  ? -6.265  38.424 -11.003 1.00 32.24  ? 7   ALA A C    1 
ATOM   259  O  O    . ALA B 2 7  ? -7.105  39.323 -11.184 1.00 31.02  ? 7   ALA A O    1 
ATOM   260  C  CB   . ALA B 2 7  ? -6.196  36.344 -12.503 1.00 33.55  ? 7   ALA A CB   1 
ATOM   261  H  H    . ALA B 2 7  ? -3.922  36.777 -11.861 1.00 40.87  ? 7   ALA A H    1 
ATOM   262  H  HA   . ALA B 2 7  ? -5.699  38.283 -12.982 1.00 39.11  ? 7   ALA A HA   1 
ATOM   263  H  HB1  . ALA B 2 7  ? -7.139  36.451 -12.703 1.00 40.26  ? 7   ALA A HB1  1 
ATOM   264  H  HB2  . ALA B 2 7  ? -5.737  35.960 -13.267 1.00 40.26  ? 7   ALA A HB2  1 
ATOM   265  H  HB3  . ALA B 2 7  ? -6.085  35.772 -11.728 1.00 40.26  ? 7   ALA A HB3  1 
ATOM   266  N  N    . MET B 2 8  ? -5.863  38.076 -9.778  1.00 33.42  ? 8   MET A N    1 
ATOM   267  C  CA   . MET B 2 8  ? -6.424  38.733 -8.606  1.00 33.45  ? 8   MET A CA   1 
ATOM   268  C  C    . MET B 2 8  ? -6.047  40.236 -8.519  1.00 35.71  ? 8   MET A C    1 
ATOM   269  O  O    . MET B 2 8  ? -6.862  41.083 -8.079  1.00 33.97  ? 8   MET A O    1 
ATOM   270  C  CB   . MET B 2 8  ? -5.984  38.036 -7.353  1.00 34.85  ? 8   MET A CB   1 
ATOM   271  C  CG   . MET B 2 8  ? -6.672  36.708 -7.165  1.00 36.81  ? 8   MET A CG   1 
ATOM   272  S  SD   . MET B 2 8  ? -5.865  35.749 -5.909  1.00 34.28  ? 8   MET A SD   1 
ATOM   273  C  CE   . MET B 2 8  ? -6.971  34.344 -5.848  1.00 45.81  ? 8   MET A CE   1 
ATOM   274  H  H    . MET B 2 8  ? -5.276  37.471 -9.604  1.00 40.10  ? 8   MET A H    1 
ATOM   275  H  HA   . MET B 2 8  ? -7.390  38.663 -8.652  1.00 40.14  ? 8   MET A HA   1 
ATOM   276  H  HB2  . MET B 2 8  ? -5.028  37.877 -7.397  1.00 41.81  ? 8   MET A HB2  1 
ATOM   277  H  HB3  . MET B 2 8  ? -6.194  38.596 -6.589  1.00 41.81  ? 8   MET A HB3  1 
ATOM   278  H  HG2  . MET B 2 8  ? -7.591  36.858 -6.893  1.00 44.17  ? 8   MET A HG2  1 
ATOM   279  H  HG3  . MET B 2 8  ? -6.642  36.210 -7.996  1.00 44.17  ? 8   MET A HG3  1 
ATOM   280  H  HE1  . MET B 2 8  ? -6.992  33.921 -6.721  1.00 54.97  ? 8   MET A HE1  1 
ATOM   281  H  HE2  . MET B 2 8  ? -6.646  33.716 -5.184  1.00 54.97  ? 8   MET A HE2  1 
ATOM   282  H  HE3  . MET B 2 8  ? -7.859  34.651 -5.607  1.00 54.97  ? 8   MET A HE3  1 
ATOM   283  N  N    . VAL B 2 9  ? -4.821  40.560 -8.934  1.00 33.71  ? 9   VAL A N    1 
ATOM   284  C  CA   . VAL B 2 9  ? -4.382  41.929 -8.879  1.00 39.08  ? 9   VAL A CA   1 
ATOM   285  C  C    . VAL B 2 9  ? -5.095  42.776 -9.934  1.00 34.89  ? 9   VAL A C    1 
ATOM   286  O  O    . VAL B 2 9  ? -5.417  43.945 -9.685  1.00 34.63  ? 9   VAL A O    1 
ATOM   287  C  CB   . VAL B 2 9  ? -2.864  41.988 -9.040  1.00 35.49  ? 9   VAL A CB   1 
ATOM   288  C  CG1  . VAL B 2 9  ? -2.373  43.441 -9.228  1.00 34.09  ? 9   VAL A CG1  1 
ATOM   289  C  CG2  . VAL B 2 9  ? -2.230  41.337 -7.800  1.00 35.79  ? 9   VAL A CG2  1 
ATOM   290  H  H    . VAL B 2 9  ? -4.241  40.006 -9.246  1.00 40.45  ? 9   VAL A H    1 
ATOM   291  H  HA   . VAL B 2 9  ? -4.603  42.293 -8.007  1.00 46.90  ? 9   VAL A HA   1 
ATOM   292  H  HB   . VAL B 2 9  ? -2.604  41.475 -9.820  1.00 42.59  ? 9   VAL A HB   1 
ATOM   293  H  HG11 . VAL B 2 9  ? -1.408  43.437 -9.326  1.00 40.91  ? 9   VAL A HG11 1 
ATOM   294  H  HG12 . VAL B 2 9  ? -2.785  43.813 -10.023 1.00 40.91  ? 9   VAL A HG12 1 
ATOM   295  H  HG13 . VAL B 2 9  ? -2.624  43.962 -8.449  1.00 40.91  ? 9   VAL A HG13 1 
ATOM   296  H  HG21 . VAL B 2 9  ? -2.936  41.040 -7.204  1.00 42.94  ? 9   VAL A HG21 1 
ATOM   297  H  HG22 . VAL B 2 9  ? -1.694  40.580 -8.081  1.00 42.94  ? 9   VAL A HG22 1 
ATOM   298  H  HG23 . VAL B 2 9  ? -1.671  41.991 -7.352  1.00 42.94  ? 9   VAL A HG23 1 
ATOM   299  N  N    . ALA B 2 10 ? -5.380  42.147 -11.075 1.00 33.94  ? 10  ALA A N    1 
ATOM   300  C  CA   . ALA B 2 10 ? -6.101  42.754 -12.170 1.00 32.34  ? 10  ALA A CA   1 
ATOM   301  C  C    . ALA B 2 10 ? -7.551  43.153 -11.737 1.00 33.07  ? 10  ALA A C    1 
ATOM   302  O  O    . ALA B 2 10 ? -8.087  44.184 -12.137 1.00 32.74  ? 10  ALA A O    1 
ATOM   303  C  CB   . ALA B 2 10 ? -6.113  41.772 -13.368 1.00 27.54  ? 10  ALA A CB   1 
ATOM   304  H  H    . ALA B 2 10 ? -5.152  41.333 -11.235 1.00 40.72  ? 10  ALA A H    1 
ATOM   305  H  HA   . ALA B 2 10 ? -5.638  43.560 -12.446 1.00 38.80  ? 10  ALA A HA   1 
ATOM   306  H  HB1  . ALA B 2 10 ? -5.199  41.588 -13.635 1.00 33.05  ? 10  ALA A HB1  1 
ATOM   307  H  HB2  . ALA B 2 10 ? -6.551  40.949 -13.098 1.00 33.05  ? 10  ALA A HB2  1 
ATOM   308  H  HB3  . ALA B 2 10 ? -6.597  42.178 -14.104 1.00 33.05  ? 10  ALA A HB3  1 
ATOM   309  N  N    . LEU B 2 11 ? -8.189  42.290 -10.952 1.00 32.15  ? 11  LEU A N    1 
ATOM   310  C  CA   . LEU B 2 11 ? -9.507  42.541 -10.430 1.00 33.16  ? 11  LEU A CA   1 
ATOM   311  C  C    . LEU B 2 11 ? -9.477  43.724 -9.436  1.00 31.92  ? 11  LEU A C    1 
ATOM   312  O  O    . LEU B 2 11 ? -10.352 44.576 -9.451  1.00 33.21  ? 11  LEU A O    1 
ATOM   313  C  CB   . LEU B 2 11 ? -10.039 41.273 -9.777  1.00 32.79  ? 11  LEU A CB   1 
ATOM   314  C  CG   . LEU B 2 11 ? -10.199 39.995 -10.601 1.00 32.19  ? 11  LEU A CG   1 
ATOM   315  C  CD1  . LEU B 2 11 ? -10.481 38.780 -9.697  1.00 32.93  ? 11  LEU A CD1  1 
ATOM   316  C  CD2  . LEU B 2 11 ? -11.341 40.107 -11.505 1.00 31.53  ? 11  LEU A CD2  1 
ATOM   317  H  H    . LEU B 2 11 ? -7.862  41.533 -10.707 1.00 38.58  ? 11  LEU A H    1 
ATOM   318  H  HA   . LEU B 2 11 ? -10.099 42.775 -11.161 1.00 39.79  ? 11  LEU A HA   1 
ATOM   319  H  HB2  . LEU B 2 11 ? -9.445  41.053 -9.043  1.00 39.35  ? 11  LEU A HB2  1 
ATOM   320  H  HB3  . LEU B 2 11 ? -10.915 41.478 -9.417  1.00 39.35  ? 11  LEU A HB3  1 
ATOM   321  H  HG   . LEU B 2 11 ? -9.397  39.827 -11.120 1.00 38.62  ? 11  LEU A HG   1 
ATOM   322  H  HD11 . LEU B 2 11 ? -10.576 37.990 -10.251 1.00 39.52  ? 11  LEU A HD11 1 
ATOM   323  H  HD12 . LEU B 2 11 ? -9.740  38.666 -9.082  1.00 39.52  ? 11  LEU A HD12 1 
ATOM   324  H  HD13 . LEU B 2 11 ? -11.300 38.939 -9.202  1.00 39.52  ? 11  LEU A HD13 1 
ATOM   325  H  HD21 . LEU B 2 11 ? -11.422 39.286 -12.015 1.00 37.84  ? 11  LEU A HD21 1 
ATOM   326  H  HD22 . LEU B 2 11 ? -12.145 40.252 -10.981 1.00 37.84  ? 11  LEU A HD22 1 
ATOM   327  H  HD23 . LEU B 2 11 ? -11.197 40.857 -12.104 1.00 37.84  ? 11  LEU A HD23 1 
ATOM   328  N  N    . ILE B 2 12 ? -8.458  43.777 -8.577  1.00 34.21  ? 12  ILE A N    1 
ATOM   329  C  CA   . ILE B 2 12 ? -8.324  44.887 -7.673  1.00 34.34  ? 12  ILE A CA   1 
ATOM   330  C  C    . ILE B 2 12 ? -8.118  46.186 -8.469  1.00 34.84  ? 12  ILE A C    1 
ATOM   331  O  O    . ILE B 2 12 ? -8.714  47.226 -8.161  1.00 33.25  ? 12  ILE A O    1 
ATOM   332  C  CB   . ILE B 2 12 ? -7.156  44.665 -6.715  1.00 36.38  ? 12  ILE A CB   1 
ATOM   333  C  CG1  . ILE B 2 12 ? -7.500  43.514 -5.754  1.00 38.03  ? 12  ILE A CG1  1 
ATOM   334  C  CG2  . ILE B 2 12 ? -6.835  45.937 -5.922  1.00 38.70  ? 12  ILE A CG2  1 
ATOM   335  C  CD1  . ILE B 2 12 ? -6.363  43.020 -4.971  1.00 39.66  ? 12  ILE A CD1  1 
ATOM   336  H  H    . ILE B 2 12 ? -7.842  43.182 -8.507  1.00 41.05  ? 12  ILE A H    1 
ATOM   337  H  HA   . ILE B 2 12 ? -9.135  44.975 -7.149  1.00 41.21  ? 12  ILE A HA   1 
ATOM   338  H  HB   . ILE B 2 12 ? -6.374  44.415 -7.232  1.00 43.65  ? 12  ILE A HB   1 
ATOM   339  H  HG12 . ILE B 2 12 ? -8.175  43.822 -5.129  1.00 45.64  ? 12  ILE A HG12 1 
ATOM   340  H  HG13 . ILE B 2 12 ? -7.847  42.770 -6.270  1.00 45.64  ? 12  ILE A HG13 1 
ATOM   341  H  HG21 . ILE B 2 12 ? -6.600  46.644 -6.543  1.00 46.44  ? 12  ILE A HG21 1 
ATOM   342  H  HG22 . ILE B 2 12 ? -7.616  46.194 -5.408  1.00 46.44  ? 12  ILE A HG22 1 
ATOM   343  H  HG23 . ILE B 2 12 ? -6.091  45.758 -5.327  1.00 46.44  ? 12  ILE A HG23 1 
ATOM   344  H  HD11 . ILE B 2 12 ? -6.665  42.300 -4.395  1.00 47.60  ? 12  ILE A HD11 1 
ATOM   345  H  HD12 . ILE B 2 12 ? -5.680  42.693 -5.578  1.00 47.60  ? 12  ILE A HD12 1 
ATOM   346  H  HD13 . ILE B 2 12 ? -6.009  43.747 -4.435  1.00 47.60  ? 12  ILE A HD13 1 
ATOM   347  N  N    . ASP B 2 13 ? -7.298  46.087 -9.516  1.00 33.73  ? 13  ASP A N    1 
ATOM   348  C  CA   . ASP B 2 13 ? -6.929  47.199 -10.379 1.00 35.62  ? 13  ASP A CA   1 
ATOM   349  C  C    . ASP B 2 13 ? -8.120  47.784 -11.156 1.00 32.84  ? 13  ASP A C    1 
ATOM   350  O  O    . ASP B 2 13 ? -8.350  48.998 -11.130 1.00 35.18  ? 13  ASP A O    1 
ATOM   351  C  CB   . ASP B 2 13 ? -5.893  46.743 -11.366 1.00 36.16  ? 13  ASP A CB   1 
ATOM   352  C  CG   . ASP B 2 13 ? -5.502  47.840 -12.319 1.00 39.07  ? 13  ASP A CG   1 
ATOM   353  O  OD1  . ASP B 2 13 ? -5.188  48.884 -11.788 1.00 40.34  ? 13  ASP A OD1  1 
ATOM   354  O  OD2  . ASP B 2 13 ? -5.529  47.687 -13.571 1.00 39.78  ? 13  ASP A OD2  1 
ATOM   355  H  H    . ASP B 2 13 ? -6.927  45.347 -9.752  1.00 40.47  ? 13  ASP A H    1 
ATOM   356  H  HA   . ASP B 2 13 ? -6.543  47.906 -9.839  1.00 42.74  ? 13  ASP A HA   1 
ATOM   357  H  HB2  . ASP B 2 13 ? -5.098  46.462 -10.887 1.00 43.39  ? 13  ASP A HB2  1 
ATOM   358  H  HB3  . ASP B 2 13 ? -6.250  46.005 -11.885 1.00 43.39  ? 13  ASP A HB3  1 
ATOM   359  N  N    . VAL B 2 14 ? -8.884  46.910 -11.826 1.00 34.60  ? 14  VAL A N    1 
ATOM   360  C  CA   . VAL B 2 14 ? -10.011 47.370 -12.626 1.00 33.05  ? 14  VAL A CA   1 
ATOM   361  C  C    . VAL B 2 14 ? -10.995 48.084 -11.698 1.00 31.87  ? 14  VAL A C    1 
ATOM   362  O  O    . VAL B 2 14 ? -11.540 49.093 -12.036 1.00 31.77  ? 14  VAL A O    1 
ATOM   363  C  CB   . VAL B 2 14 ? -10.727 46.142 -13.396 1.00 32.64  ? 14  VAL A CB   1 
ATOM   364  C  CG1  . VAL B 2 14 ? -11.524 45.329 -12.492 1.00 34.33  ? 14  VAL A CG1  1 
ATOM   365  C  CG2  . VAL B 2 14 ? -11.645 46.608 -14.474 1.00 33.72  ? 14  VAL A CG2  1 
ATOM   366  H  H    . VAL B 2 14 ? -8.767  46.058 -11.829 1.00 41.52  ? 14  VAL A H    1 
ATOM   367  H  HA   . VAL B 2 14 ? -9.698  48.005 -13.289 1.00 39.66  ? 14  VAL A HA   1 
ATOM   368  H  HB   . VAL B 2 14 ? -10.049 45.576 -13.797 1.00 39.17  ? 14  VAL A HB   1 
ATOM   369  H  HG11 . VAL B 2 14 ? -11.934 44.608 -12.995 1.00 41.20  ? 14  VAL A HG11 1 
ATOM   370  H  HG12 . VAL B 2 14 ? -10.947 44.966 -11.802 1.00 41.20  ? 14  VAL A HG12 1 
ATOM   371  H  HG13 . VAL B 2 14 ? -12.211 45.884 -12.091 1.00 41.20  ? 14  VAL A HG13 1 
ATOM   372  H  HG21 . VAL B 2 14 ? -12.046 45.836 -14.902 1.00 40.47  ? 14  VAL A HG21 1 
ATOM   373  H  HG22 . VAL B 2 14 ? -12.334 47.166 -14.081 1.00 40.47  ? 14  VAL A HG22 1 
ATOM   374  H  HG23 . VAL B 2 14 ? -11.135 47.119 -15.122 1.00 40.47  ? 14  VAL A HG23 1 
ATOM   375  N  N    . PHE B 2 15 ? -11.128 47.609 -10.477 1.00 32.95  ? 15  PHE A N    1 
ATOM   376  C  CA   . PHE B 2 15 ? -12.008 48.211 -9.509  1.00 33.17  ? 15  PHE A CA   1 
ATOM   377  C  C    . PHE B 2 15 ? -11.538 49.617 -9.087  1.00 34.36  ? 15  PHE A C    1 
ATOM   378  O  O    . PHE B 2 15 ? -12.343 50.548 -8.967  1.00 33.56  ? 15  PHE A O    1 
ATOM   379  C  CB   . PHE B 2 15 ? -12.159 47.291 -8.302  1.00 32.70  ? 15  PHE A CB   1 
ATOM   380  C  CG   . PHE B 2 15 ? -13.036 47.857 -7.226  1.00 33.61  ? 15  PHE A CG   1 
ATOM   381  C  CD1  . PHE B 2 15 ? -14.425 47.654 -7.265  1.00 33.35  ? 15  PHE A CD1  1 
ATOM   382  C  CD2  . PHE B 2 15 ? -12.492 48.591 -6.186  1.00 35.34  ? 15  PHE A CD2  1 
ATOM   383  C  CE1  . PHE B 2 15 ? -15.258 48.154 -6.257  1.00 35.14  ? 15  PHE A CE1  1 
ATOM   384  C  CE2  . PHE B 2 15 ? -13.304 49.102 -5.185  1.00 35.03  ? 15  PHE A CE2  1 
ATOM   385  C  CZ   . PHE B 2 15 ? -14.706 48.906 -5.232  1.00 35.80  ? 15  PHE A CZ   1 
ATOM   386  H  H    . PHE B 2 15 ? -10.707 46.921 -10.180 1.00 39.54  ? 15  PHE A H    1 
ATOM   387  H  HA   . PHE B 2 15 ? -12.885 48.308 -9.912  1.00 39.80  ? 15  PHE A HA   1 
ATOM   388  H  HB2  . PHE B 2 15 ? -12.549 46.452 -8.594  1.00 39.23  ? 15  PHE A HB2  1 
ATOM   389  H  HB3  . PHE B 2 15 ? -11.282 47.131 -7.919  1.00 39.23  ? 15  PHE A HB3  1 
ATOM   390  H  HD1  . PHE B 2 15 ? -14.795 47.157 -7.958  1.00 40.02  ? 15  PHE A HD1  1 
ATOM   391  H  HD2  . PHE B 2 15 ? -11.573 48.732 -6.152  1.00 42.41  ? 15  PHE A HD2  1 
ATOM   392  H  HE1  . PHE B 2 15 ? -16.178 48.019 -6.298  1.00 42.17  ? 15  PHE A HE1  1 
ATOM   393  H  HE2  . PHE B 2 15 ? -12.930 49.598 -4.493  1.00 42.04  ? 15  PHE A HE2  1 
ATOM   394  H  HZ   . PHE B 2 15 ? -15.248 49.245 -4.557  1.00 42.96  ? 15  PHE A HZ   1 
ATOM   395  N  N    . HIS B 2 16 ? -10.228 49.736 -8.879  1.00 34.29  ? 16  HIS A N    1 
ATOM   396  C  CA   . HIS B 2 16 ? -9.630  51.010 -8.572  1.00 36.12  ? 16  HIS A CA   1 
ATOM   397  C  C    . HIS B 2 16 ? -9.801  51.978 -9.716  1.00 33.58  ? 16  HIS A C    1 
ATOM   398  O  O    . HIS B 2 16 ? -10.003 53.159 -9.458  1.00 34.33  ? 16  HIS A O    1 
ATOM   399  C  CB   . HIS B 2 16 ? -8.128  50.903 -8.311  1.00 36.14  ? 16  HIS A CB   1 
ATOM   400  C  CG   . HIS B 2 16 ? -7.784  50.202 -7.040  1.00 39.25  ? 16  HIS A CG   1 
ATOM   401  N  ND1  . HIS B 2 16 ? -8.623  50.205 -5.937  1.00 41.28  ? 16  HIS A ND1  1 
ATOM   402  C  CD2  . HIS B 2 16 ? -6.678  49.493 -6.687  1.00 41.28  ? 16  HIS A CD2  1 
ATOM   403  C  CE1  . HIS B 2 16 ? -8.062  49.492 -4.978  1.00 51.95  ? 16  HIS A CE1  1 
ATOM   404  N  NE2  . HIS B 2 16 ? -6.875  49.063 -5.401  1.00 45.55  ? 16  HIS A NE2  1 
ATOM   405  H  H    . HIS B 2 16 ? -9.669  49.083 -8.913  1.00 41.14  ? 16  HIS A H    1 
ATOM   406  H  HA   . HIS B 2 16 ? -10.055 51.385 -7.785  1.00 43.35  ? 16  HIS A HA   1 
ATOM   407  H  HB2  . HIS B 2 16 ? -7.718  50.412 -9.040  1.00 43.37  ? 16  HIS A HB2  1 
ATOM   408  H  HB3  . HIS B 2 16 ? -7.755  51.797 -8.266  1.00 43.37  ? 16  HIS A HB3  1 
ATOM   409  H  HD2  . HIS B 2 16 ? -5.936  49.321 -7.221  1.00 49.54  ? 16  HIS A HD2  1 
ATOM   410  H  HE1  . HIS B 2 16 ? -8.422  49.343 -4.134  1.00 62.34  ? 16  HIS A HE1  1 
ATOM   411  N  N    . GLN B 2 17 ? -9.665  51.499 -10.959 1.00 31.47  ? 17  GLN A N    1 
ATOM   412  C  CA   . GLN B 2 17 ? -9.775  52.380 -12.105 1.00 33.74  ? 17  GLN A CA   1 
ATOM   413  C  C    . GLN B 2 17 ? -11.136 53.110 -12.207 1.00 37.20  ? 17  GLN A C    1 
ATOM   414  O  O    . GLN B 2 17 ? -11.192 54.281 -12.561 1.00 36.63  ? 17  GLN A O    1 
ATOM   415  C  CB   . GLN B 2 17 ? -9.522  51.621 -13.385 1.00 33.97  ? 17  GLN A CB   1 
ATOM   416  C  CG   . GLN B 2 17 ? -8.063  51.242 -13.592 0.00 36.41  ? 17  GLN A CG   1 
ATOM   417  C  CD   . GLN B 2 17 ? -7.832  50.442 -14.858 0.00 40.16  ? 17  GLN A CD   1 
ATOM   418  O  OE1  . GLN B 2 17 ? -8.752  49.826 -15.398 0.00 38.55  ? 17  GLN A OE1  1 
ATOM   419  N  NE2  . GLN B 2 17 ? -6.593  50.443 -15.336 0.00 48.10  ? 17  GLN A NE2  1 
ATOM   420  H  H    . GLN B 2 17 ? -9.511  50.675 -11.155 1.00 37.77  ? 17  GLN A H    1 
ATOM   421  H  HA   . GLN B 2 17 ? -9.088  53.061 -12.032 1.00 40.49  ? 17  GLN A HA   1 
ATOM   422  H  HB2  . GLN B 2 17 ? -10.042 50.802 -13.372 1.00 40.76  ? 17  GLN A HB2  1 
ATOM   423  H  HB3  . GLN B 2 17 ? -9.794  52.172 -14.135 1.00 40.76  ? 17  GLN A HB3  1 
ATOM   424  H  HG2  . GLN B 2 17 ? -7.532  52.052 -13.648 0.00 43.70  ? 17  GLN A HG2  1 
ATOM   425  H  HG3  . GLN B 2 17 ? -7.767  50.704 -12.840 0.00 43.70  ? 17  GLN A HG3  1 
ATOM   426  H  HE21 . GLN B 2 17 ? -6.409  50.005 -16.053 0.00 57.71  ? 17  GLN A HE21 1 
ATOM   427  H  HE22 . GLN B 2 17 ? -5.976  50.882 -14.930 0.00 57.71  ? 17  GLN A HE22 1 
ATOM   428  N  N    . TYR B 2 18 ? -12.217 52.434 -11.838 1.00 34.29  ? 18  TYR A N    1 
ATOM   429  C  CA   . TYR B 2 18 ? -13.534 52.982 -12.042 1.00 34.85  ? 18  TYR A CA   1 
ATOM   430  C  C    . TYR B 2 18 ? -14.135 53.607 -10.782 1.00 34.60  ? 18  TYR A C    1 
ATOM   431  O  O    . TYR B 2 18 ? -14.907 54.553 -10.899 1.00 36.50  ? 18  TYR A O    1 
ATOM   432  C  CB   . TYR B 2 18 ? -14.484 51.896 -12.595 1.00 35.06  ? 18  TYR A CB   1 
ATOM   433  C  CG   . TYR B 2 18 ? -14.258 51.652 -14.047 1.00 37.13  ? 18  TYR A CG   1 
ATOM   434  C  CD1  . TYR B 2 18 ? -14.905 52.402 -14.988 1.00 37.10  ? 18  TYR A CD1  1 
ATOM   435  C  CD2  . TYR B 2 18 ? -13.341 50.700 -14.475 1.00 35.17  ? 18  TYR A CD2  1 
ATOM   436  C  CE1  . TYR B 2 18 ? -14.694 52.215 -16.302 1.00 39.17  ? 18  TYR A CE1  1 
ATOM   437  C  CE2  . TYR B 2 18 ? -13.127 50.497 -15.794 1.00 38.11  ? 18  TYR A CE2  1 
ATOM   438  C  CZ   . TYR B 2 18 ? -13.802 51.270 -16.724 1.00 39.91  ? 18  TYR A CZ   1 
ATOM   439  O  OH   . TYR B 2 18 ? -13.607 51.089 -18.085 1.00 47.65  ? 18  TYR A OH   1 
ATOM   440  H  H    . TYR B 2 18 ? -12.207 51.658 -11.467 1.00 41.14  ? 18  TYR A H    1 
ATOM   441  H  HA   . TYR B 2 18 ? -13.473 53.682 -12.710 1.00 41.83  ? 18  TYR A HA   1 
ATOM   442  H  HB2  . TYR B 2 18 ? -14.329 51.065 -12.121 1.00 42.07  ? 18  TYR A HB2  1 
ATOM   443  H  HB3  . TYR B 2 18 ? -15.402 52.184 -12.475 1.00 42.07  ? 18  TYR A HB3  1 
ATOM   444  H  HD1  . TYR B 2 18 ? -15.512 53.051 -14.713 1.00 44.52  ? 18  TYR A HD1  1 
ATOM   445  H  HD2  . TYR B 2 18 ? -12.885 50.184 -13.849 1.00 42.20  ? 18  TYR A HD2  1 
ATOM   446  H  HE1  . TYR B 2 18 ? -15.154 52.730 -16.924 1.00 47.01  ? 18  TYR A HE1  1 
ATOM   447  H  HE2  . TYR B 2 18 ? -12.518 49.853 -16.076 1.00 45.74  ? 18  TYR A HE2  1 
ATOM   448  H  HH   . TYR B 2 18 ? -13.039 50.484 -18.216 1.00 57.17  ? 18  TYR A HH   1 
ATOM   449  N  N    . SER B 2 19 ? -13.772 53.081 -9.612  1.00 36.09  ? 19  SER A N    1 
ATOM   450  C  CA   . SER B 2 19 ? -14.349 53.504 -8.324  1.00 34.91  ? 19  SER A CA   1 
ATOM   451  C  C    . SER B 2 19 ? -13.815 54.879 -7.880  1.00 37.33  ? 19  SER A C    1 
ATOM   452  O  O    . SER B 2 19 ? -14.421 55.541 -7.040  1.00 38.09  ? 19  SER A O    1 
ATOM   453  C  CB   . SER B 2 19 ? -14.057 52.464 -7.214  1.00 35.83  ? 19  SER A CB   1 
ATOM   454  O  OG   . SER B 2 19 ? -12.663 52.361 -6.980  1.00 34.02  ? 19  SER A OG   1 
ATOM   455  H  H    . SER B 2 19 ? -13.179 52.463 -9.533  1.00 43.31  ? 19  SER A H    1 
ATOM   456  H  HA   . SER B 2 19 ? -15.312 53.575 -8.421  1.00 41.89  ? 19  SER A HA   1 
ATOM   457  H  HB2  . SER B 2 19 ? -14.496 52.744 -6.396  1.00 43.00  ? 19  SER A HB2  1 
ATOM   458  H  HB3  . SER B 2 19 ? -14.396 51.599 -7.494  1.00 43.00  ? 19  SER A HB3  1 
ATOM   459  H  HG   . SER B 2 19 ? -12.514 51.795 -6.377  1.00 40.82  ? 19  SER A HG   1 
ATOM   460  N  N    . GLY B 2 20 ? -12.641 55.248 -8.401  1.00 39.01  ? 20  GLY A N    1 
ATOM   461  C  CA   . GLY B 2 20 ? -12.009 56.509 -8.092  1.00 39.43  ? 20  GLY A CA   1 
ATOM   462  C  C    . GLY B 2 20 ? -12.435 57.653 -9.013  1.00 41.47  ? 20  GLY A C    1 
ATOM   463  O  O    . GLY B 2 20 ? -11.937 58.772 -8.884  1.00 42.56  ? 20  GLY A O    1 
ATOM   464  H  H    . GLY B 2 20 ? -12.188 54.764 -8.949  1.00 46.81  ? 20  GLY A H    1 
ATOM   465  H  HA2  . GLY B 2 20 ? -12.224 56.758 -7.180  1.00 47.32  ? 20  GLY A HA2  1 
ATOM   466  H  HA3  . GLY B 2 20 ? -11.047 56.408 -8.160  1.00 47.32  ? 20  GLY A HA3  1 
ATOM   467  N  N    . ARG B 2 21 ? -13.304 57.390 -9.982  1.00 40.31  ? 21  ARG A N    1 
ATOM   468  C  CA   . ARG B 2 21 ? -13.649 58.421 -10.960 1.00 41.50  ? 21  ARG A CA   1 
ATOM   469  C  C    . ARG B 2 21 ? -14.416 59.597 -10.354 1.00 44.27  ? 21  ARG A C    1 
ATOM   470  O  O    . ARG B 2 21 ? -14.025 60.754 -10.513 1.00 45.15  ? 21  ARG A O    1 
ATOM   471  C  CB   . ARG B 2 21 ? -14.463 57.828 -12.091 1.00 40.51  ? 21  ARG A CB   1 
ATOM   472  C  CG   . ARG B 2 21 ? -13.604 57.017 -12.981 1.00 41.07  ? 21  ARG A CG   1 
ATOM   473  C  CD   . ARG B 2 21 ? -14.331 56.426 -14.136 1.00 43.26  ? 21  ARG A CD   1 
ATOM   474  N  NE   . ARG B 2 21 ? -13.323 55.780 -14.952 1.00 43.77  ? 21  ARG A NE   1 
ATOM   475  C  CZ   . ARG B 2 21 ? -13.451 55.458 -16.230 1.00 45.89  ? 21  ARG A CZ   1 
ATOM   476  N  NH1  . ARG B 2 21 ? -14.593 55.683 -16.897 1.00 46.71  ? 21  ARG A NH1  1 
ATOM   477  N  NH2  . ARG B 2 21 ? -12.406 54.891 -16.830 1.00 50.89  ? 21  ARG A NH2  1 
ATOM   478  H  H    . ARG B 2 21 ? -13.703 56.637 -10.097 1.00 48.37  ? 21  ARG A H    1 
ATOM   479  H  HA   . ARG B 2 21 ? -12.829 58.772 -11.341 1.00 49.80  ? 21  ARG A HA   1 
ATOM   480  H  HB2  . ARG B 2 21 ? -15.154 57.254 -11.725 1.00 48.61  ? 21  ARG A HB2  1 
ATOM   481  H  HB3  . ARG B 2 21 ? -14.859 58.543 -12.614 1.00 48.61  ? 21  ARG A HB3  1 
ATOM   482  H  HG2  . ARG B 2 21 ? -12.897 57.581 -13.333 1.00 49.29  ? 21  ARG A HG2  1 
ATOM   483  H  HG3  . ARG B 2 21 ? -13.219 56.289 -12.468 1.00 49.29  ? 21  ARG A HG3  1 
ATOM   484  H  HD2  . ARG B 2 21 ? -14.968 55.762 -13.829 1.00 51.92  ? 21  ARG A HD2  1 
ATOM   485  H  HD3  . ARG B 2 21 ? -14.765 57.122 -14.653 1.00 51.92  ? 21  ARG A HD3  1 
ATOM   486  H  HE   . ARG B 2 21 ? -12.575 55.589 -14.573 1.00 52.53  ? 21  ARG A HE   1 
ATOM   487  H  HH11 . ARG B 2 21 ? -15.258 56.055 -16.499 1.00 56.06  ? 21  ARG A HH11 1 
ATOM   488  H  HH12 . ARG B 2 21 ? -14.657 55.461 -17.726 1.00 56.06  ? 21  ARG A HH12 1 
ATOM   489  H  HH21 . ARG B 2 21 ? -11.682 54.746 -16.388 1.00 61.07  ? 21  ARG A HH21 1 
ATOM   490  H  HH22 . ARG B 2 21 ? -12.459 54.657 -17.656 1.00 61.07  ? 21  ARG A HH22 1 
ATOM   491  N  N    . GLU B 2 22 ? -15.512 59.271 -9.687  1.00 44.21  ? 22  GLU A N    1 
ATOM   492  C  CA   . GLU B 2 22 ? -16.433 60.231 -9.108  1.00 46.04  ? 22  GLU A CA   1 
ATOM   493  C  C    . GLU B 2 22 ? -16.716 59.837 -7.647  1.00 43.71  ? 22  GLU A C    1 
ATOM   494  O  O    . GLU B 2 22 ? -16.336 58.770 -7.219  1.00 42.28  ? 22  GLU A O    1 
ATOM   495  C  CB   . GLU B 2 22 ? -17.718 60.327 -9.951  1.00 46.26  ? 22  GLU A CB   1 
ATOM   496  C  CG   . GLU B 2 22 ? -17.468 60.464 -11.436 0.00 47.33  ? 22  GLU A CG   1 
ATOM   497  C  CD   . GLU B 2 22 ? -18.729 60.288 -12.252 0.00 49.76  ? 22  GLU A CD   1 
ATOM   498  O  OE1  . GLU B 2 22 ? -19.821 60.594 -11.728 0.00 51.48  ? 22  GLU A OE1  1 
ATOM   499  O  OE2  . GLU B 2 22 ? -18.628 59.857 -13.419 0.00 50.04  ? 22  GLU A OE2  1 
ATOM   500  H  H    . GLU B 2 22 ? -15.753 58.456 -9.551  1.00 53.05  ? 22  GLU A H    1 
ATOM   501  H  HA   . GLU B 2 22 ? -16.014 61.106 -9.105  1.00 55.25  ? 22  GLU A HA   1 
ATOM   502  H  HB2  . GLU B 2 22 ? -18.243 59.524 -9.812  1.00 55.52  ? 22  GLU A HB2  1 
ATOM   503  H  HB3  . GLU B 2 22 ? -18.223 61.103 -9.663  1.00 55.52  ? 22  GLU A HB3  1 
ATOM   504  H  HG2  . GLU B 2 22 ? -17.112 61.348 -11.618 0.00 56.79  ? 22  GLU A HG2  1 
ATOM   505  H  HG3  . GLU B 2 22 ? -16.833 59.786 -11.715 0.00 56.79  ? 22  GLU A HG3  1 
ATOM   506  N  N    . GLY B 2 23 ? -17.261 60.760 -6.865  1.00 44.40  ? 23  GLY A N    1 
ATOM   507  C  CA   . GLY B 2 23 ? -17.814 60.456 -5.561  1.00 41.01  ? 23  GLY A CA   1 
ATOM   508  C  C    . GLY B 2 23 ? -16.882 59.802 -4.587  1.00 41.08  ? 23  GLY A C    1 
ATOM   509  O  O    . GLY B 2 23 ? -15.731 60.192 -4.487  1.00 43.67  ? 23  GLY A O    1 
ATOM   510  H  H    . GLY B 2 23 ? -17.322 61.592 -7.078  1.00 53.28  ? 23  GLY A H    1 
ATOM   511  H  HA2  . GLY B 2 23 ? -18.130 61.280 -5.158  1.00 49.21  ? 23  GLY A HA2  1 
ATOM   512  H  HA3  . GLY B 2 23 ? -18.578 59.871 -5.677  1.00 49.21  ? 23  GLY A HA3  1 
ATOM   513  N  N    . ASP B 2 24 ? -17.414 58.848 -3.820  1.00 42.18  ? 24  ASP A N    1 
ATOM   514  C  CA   . ASP B 2 24 ? -16.613 57.967 -2.948  1.00 42.79  ? 24  ASP A CA   1 
ATOM   515  C  C    . ASP B 2 24 ? -15.536 57.275 -3.855  1.00 41.69  ? 24  ASP A C    1 
ATOM   516  O  O    . ASP B 2 24 ? -15.845 56.681 -4.925  1.00 41.75  ? 24  ASP A O    1 
ATOM   517  C  CB   . ASP B 2 24 ? -17.523 56.933 -2.234  1.00 43.93  ? 24  ASP A CB   1 
ATOM   518  C  CG   . ASP B 2 24 ? -16.868 56.214 -1.043  1.00 45.05  ? 24  ASP A CG   1 
ATOM   519  O  OD1  . ASP B 2 24 ? -15.626 56.110 -0.919  1.00 52.44  ? 24  ASP A OD1  1 
ATOM   520  O  OD2  . ASP B 2 24 ? -17.644 55.733 -0.193  1.00 42.98  ? 24  ASP A OD2  1 
ATOM   521  H  H    . ASP B 2 24 ? -18.258 58.685 -3.783  1.00 50.62  ? 24  ASP A H    1 
ATOM   522  H  HA   . ASP B 2 24 ? -16.159 58.499 -2.276  1.00 51.35  ? 24  ASP A HA   1 
ATOM   523  H  HB2  . ASP B 2 24 ? -18.311 57.392 -1.902  1.00 52.72  ? 24  ASP A HB2  1 
ATOM   524  H  HB3  . ASP B 2 24 ? -17.787 56.257 -2.876  1.00 52.72  ? 24  ASP A HB3  1 
ATOM   525  N  N    . LYS B 2 25 ? -14.274 57.408 -3.466  1.00 43.75  ? 25  LYS A N    1 
ATOM   526  C  CA   . LYS B 2 25 ? -13.178 56.896 -4.278  1.00 44.17  ? 25  LYS A CA   1 
ATOM   527  C  C    . LYS B 2 25 ? -12.940 55.387 -4.083  1.00 43.19  ? 25  LYS A C    1 
ATOM   528  O  O    . LYS B 2 25 ? -12.245 54.766 -4.881  1.00 41.46  ? 25  LYS A O    1 
ATOM   529  C  CB   . LYS B 2 25 ? -11.903 57.700 -3.963  1.00 44.83  ? 25  LYS A CB   1 
ATOM   530  C  CG   . LYS B 2 25 ? -11.961 59.179 -4.492  1.00 46.39  ? 25  LYS A CG   1 
ATOM   531  C  CD   . LYS B 2 25 ? -10.704 59.958 -4.172  0.00 53.95  ? 25  LYS A CD   1 
ATOM   532  C  CE   . LYS B 2 25 ? -10.776 61.346 -4.778  0.00 59.64  ? 25  LYS A CE   1 
ATOM   533  N  NZ   . LYS B 2 25 ? -9.579  62.164 -4.460  0.00 63.68  ? 25  LYS A NZ   1 
ATOM   534  H  H    . LYS B 2 25 ? -14.026 57.789 -2.737  1.00 52.51  ? 25  LYS A H    1 
ATOM   535  H  HA   . LYS B 2 25 ? -13.392 57.040 -5.213  1.00 53.01  ? 25  LYS A HA   1 
ATOM   536  H  HB2  . LYS B 2 25 ? -11.780 57.732 -3.001  1.00 53.79  ? 25  LYS A HB2  1 
ATOM   537  H  HB3  . LYS B 2 25 ? -11.144 57.263 -4.379  1.00 53.79  ? 25  LYS A HB3  1 
ATOM   538  H  HG2  . LYS B 2 25 ? -12.070 59.166 -5.456  1.00 55.67  ? 25  LYS A HG2  1 
ATOM   539  H  HG3  . LYS B 2 25 ? -12.710 59.635 -4.079  1.00 55.67  ? 25  LYS A HG3  1 
ATOM   540  H  HD2  . LYS B 2 25 ? -10.613 60.046 -3.211  0.00 64.74  ? 25  LYS A HD2  1 
ATOM   541  H  HD3  . LYS B 2 25 ? -9.935  59.499 -4.545  0.00 64.74  ? 25  LYS A HD3  1 
ATOM   542  H  HE2  . LYS B 2 25 ? -10.840 61.268 -5.743  0.00 71.57  ? 25  LYS A HE2  1 
ATOM   543  H  HE3  . LYS B 2 25 ? -11.556 61.804 -4.428  0.00 71.57  ? 25  LYS A HE3  1 
ATOM   544  H  HZ1  . LYS B 2 25 ? -9.654  62.970 -4.830  0.00 76.41  ? 25  LYS A HZ1  1 
ATOM   545  H  HZ2  . LYS B 2 25 ? -9.499  62.257 -3.578  0.00 76.41  ? 25  LYS A HZ2  1 
ATOM   546  H  HZ3  . LYS B 2 25 ? -8.847  61.768 -4.776  0.00 76.41  ? 25  LYS A HZ3  1 
ATOM   547  N  N    . HIS B 2 26 ? -13.632 54.785 -3.121  1.00 45.13  ? 26  HIS A N    1 
ATOM   548  C  CA   . HIS B 2 26 ? -13.432 53.384 -2.774  1.00 45.32  ? 26  HIS A CA   1 
ATOM   549  C  C    . HIS B 2 26 ? -14.659 52.522 -3.130  1.00 41.44  ? 26  HIS A C    1 
ATOM   550  O  O    . HIS B 2 26 ? -14.698 51.328 -2.859  1.00 40.14  ? 26  HIS A O    1 
ATOM   551  C  CB   . HIS B 2 26 ? -13.171 53.303 -1.267  1.00 55.35  ? 26  HIS A CB   1 
ATOM   552  C  CG   . HIS B 2 26 ? -11.907 53.978 -0.809  1.00 57.55  ? 26  HIS A CG   1 
ATOM   553  N  ND1  . HIS B 2 26 ? -10.662 53.374 -0.881  1.00 62.56  ? 26  HIS A ND1  1 
ATOM   554  C  CD2  . HIS B 2 26 ? -11.701 55.202 -0.265  1.00 57.40  ? 26  HIS A CD2  1 
ATOM   555  C  CE1  . HIS B 2 26 ? -9.749  54.199 -0.398  1.00 67.19  ? 26  HIS A CE1  1 
ATOM   556  N  NE2  . HIS B 2 26 ? -10.352 55.313 -0.013  1.00 63.90  ? 26  HIS A NE2  1 
ATOM   557  H  H    . HIS B 2 26 ? -14.235 55.175 -2.648  1.00 54.15  ? 26  HIS A H    1 
ATOM   558  H  HA   . HIS B 2 26 ? -12.659 53.036 -3.244  1.00 54.38  ? 26  HIS A HA   1 
ATOM   559  H  HB2  . HIS B 2 26 ? -13.912 53.721 -0.801  1.00 66.42  ? 26  HIS A HB2  1 
ATOM   560  H  HB3  . HIS B 2 26 ? -13.113 52.369 -1.013  1.00 66.42  ? 26  HIS A HB3  1 
ATOM   561  H  HD2  . HIS B 2 26 ? -12.350 55.843 -0.086  1.00 68.88  ? 26  HIS A HD2  1 
ATOM   562  H  HE1  . HIS B 2 26 ? -8.837  54.026 -0.339  1.00 80.62  ? 26  HIS A HE1  1 
ATOM   563  N  N    . LYS B 2 27 ? -15.681 53.156 -3.690  1.00 41.05  ? 27  LYS A N    1 
ATOM   564  C  CA   . LYS B 2 27 ? -16.890 52.452 -4.117  1.00 39.56  ? 27  LYS A CA   1 
ATOM   565  C  C    . LYS B 2 27 ? -17.249 52.856 -5.560  1.00 37.54  ? 27  LYS A C    1 
ATOM   566  O  O    . LYS B 2 27 ? -16.626 53.702 -6.182  1.00 37.57  ? 27  LYS A O    1 
ATOM   567  C  CB   . LYS B 2 27 ? -18.084 52.700 -3.133  1.00 41.86  ? 27  LYS A CB   1 
ATOM   568  C  CG   . LYS B 2 27 ? -17.835 52.277 -1.627  1.00 43.00  ? 27  LYS A CG   1 
ATOM   569  C  CD   . LYS B 2 27 ? -18.976 52.640 -0.606  1.00 44.01  ? 27  LYS A CD   1 
ATOM   570  C  CE   . LYS B 2 27 ? -18.621 52.206 0.805   0.00 51.08  ? 27  LYS A CE   1 
ATOM   571  N  NZ   . LYS B 2 27 ? -17.385 52.871 1.296   0.00 55.82  ? 27  LYS A NZ   1 
ATOM   572  H  H    . LYS B 2 27 ? -15.702 54.003 -3.837  1.00 49.26  ? 27  LYS A H    1 
ATOM   573  H  HA   . LYS B 2 27 ? -16.708 51.500 -4.118  1.00 47.47  ? 27  LYS A HA   1 
ATOM   574  H  HB2  . LYS B 2 27 ? -18.292 53.647 -3.137  1.00 50.24  ? 27  LYS A HB2  1 
ATOM   575  H  HB3  . LYS B 2 27 ? -18.852 52.199 -3.451  1.00 50.24  ? 27  LYS A HB3  1 
ATOM   576  H  HG2  . LYS B 2 27 ? -17.717 51.315 -1.597  1.00 51.60  ? 27  LYS A HG2  1 
ATOM   577  H  HG3  . LYS B 2 27 ? -17.024 52.710 -1.319  1.00 51.60  ? 27  LYS A HG3  1 
ATOM   578  H  HD2  . LYS B 2 27 ? -19.109 53.601 -0.603  1.00 52.82  ? 27  LYS A HD2  1 
ATOM   579  H  HD3  . LYS B 2 27 ? -19.794 52.189 -0.866  1.00 52.82  ? 27  LYS A HD3  1 
ATOM   580  H  HE2  . LYS B 2 27 ? -19.348 52.439 1.403   0.00 61.30  ? 27  LYS A HE2  1 
ATOM   581  H  HE3  . LYS B 2 27 ? -18.473 51.247 0.816   0.00 61.30  ? 27  LYS A HE3  1 
ATOM   582  H  HZ1  . LYS B 2 27 ? -17.201 52.598 2.123   0.00 66.99  ? 27  LYS A HZ1  1 
ATOM   583  H  HZ2  . LYS B 2 27 ? -16.700 52.668 0.765   0.00 66.99  ? 27  LYS A HZ2  1 
ATOM   584  H  HZ3  . LYS B 2 27 ? -17.496 53.754 1.300   0.00 66.99  ? 27  LYS A HZ3  1 
ATOM   585  N  N    . LEU B 2 28 ? -18.180 52.121 -6.124  1.00 38.73  ? 28  LEU A N    1 
ATOM   586  C  CA   . LEU B 2 28 ? -18.720 52.399 -7.446  1.00 38.85  ? 28  LEU A CA   1 
ATOM   587  C  C    . LEU B 2 28 ? -20.156 52.986 -7.337  1.00 40.97  ? 28  LEU A C    1 
ATOM   588  O  O    . LEU B 2 28 ? -21.046 52.352 -6.765  1.00 41.18  ? 28  LEU A O    1 
ATOM   589  C  CB   . LEU B 2 28 ? -18.753 51.108 -8.270  1.00 37.68  ? 28  LEU A CB   1 
ATOM   590  C  CG   . LEU B 2 28 ? -17.462 50.321 -8.497  1.00 35.60  ? 28  LEU A CG   1 
ATOM   591  C  CD1  . LEU B 2 28 ? -17.758 48.771 -8.835  1.00 35.03  ? 28  LEU A CD1  1 
ATOM   592  C  CD2  . LEU B 2 28 ? -16.649 51.006 -9.617  1.00 33.43  ? 28  LEU A CD2  1 
ATOM   593  H  H    . LEU B 2 28 ? -18.530 51.429 -5.753  1.00 46.48  ? 28  LEU A H    1 
ATOM   594  H  HA   . LEU B 2 28 ? -18.155 53.044 -7.901  1.00 46.62  ? 28  LEU A HA   1 
ATOM   595  H  HB2  . LEU B 2 28 ? -19.373 50.501 -7.836  1.00 45.22  ? 28  LEU A HB2  1 
ATOM   596  H  HB3  . LEU B 2 28 ? -19.098 51.331 -9.148  1.00 45.22  ? 28  LEU A HB3  1 
ATOM   597  H  HG   . LEU B 2 28 ? -16.931 50.351 -7.686  1.00 42.71  ? 28  LEU A HG   1 
ATOM   598  H  HD11 . LEU B 2 28 ? -16.915 48.311 -8.971  1.00 42.04  ? 28  LEU A HD11 1 
ATOM   599  H  HD12 . LEU B 2 28 ? -18.236 48.372 -8.091  1.00 42.04  ? 28  LEU A HD12 1 
ATOM   600  H  HD13 . LEU B 2 28 ? -18.297 48.721 -9.640  1.00 42.04  ? 28  LEU A HD13 1 
ATOM   601  H  HD21 . LEU B 2 28 ? -15.829 50.507 -9.762  1.00 40.11  ? 28  LEU A HD21 1 
ATOM   602  H  HD22 . LEU B 2 28 ? -17.178 51.016 -10.430 1.00 40.11  ? 28  LEU A HD22 1 
ATOM   603  H  HD23 . LEU B 2 28 ? -16.441 51.913 -9.346  1.00 40.11  ? 28  LEU A HD23 1 
ATOM   604  N  N    . LYS B 2 29 ? -20.354 54.195 -7.845  1.00 41.97  ? 29  LYS A N    1 
ATOM   605  C  CA   . LYS B 2 29 ? -21.686 54.692 -8.050  1.00 45.70  ? 29  LYS A CA   1 
ATOM   606  C  C    . LYS B 2 29 ? -22.166 54.050 -9.394  1.00 42.95  ? 29  LYS A C    1 
ATOM   607  O  O    . LYS B 2 29 ? -21.396 53.348 -10.084 1.00 42.48  ? 29  LYS A O    1 
ATOM   608  C  CB   . LYS B 2 29 ? -21.735 56.231 -8.026  1.00 44.21  ? 29  LYS A CB   1 
ATOM   609  C  CG   . LYS B 2 29 ? -20.874 56.996 -9.021  1.00 43.92  ? 29  LYS A CG   1 
ATOM   610  C  CD   . LYS B 2 29 ? -20.993 58.549 -8.765  1.00 45.97  ? 29  LYS A CD   1 
ATOM   611  C  CE   . LYS B 2 29 ? -22.416 59.106 -8.748  0.00 52.79  ? 29  LYS A CE   1 
ATOM   612  N  NZ   . LYS B 2 29 ? -22.951 59.375 -10.107 0.00 53.94  ? 29  LYS A NZ   1 
ATOM   613  H  H    . LYS B 2 29 ? -19.730 54.740 -8.075  1.00 50.37  ? 29  LYS A H    1 
ATOM   614  H  HA   . LYS B 2 29 ? -22.259 54.363 -7.340  1.00 54.84  ? 29  LYS A HA   1 
ATOM   615  H  HB2  . LYS B 2 29 ? -22.653 56.502 -8.182  1.00 53.06  ? 29  LYS A HB2  1 
ATOM   616  H  HB3  . LYS B 2 29 ? -21.467 56.523 -7.140  1.00 53.06  ? 29  LYS A HB3  1 
ATOM   617  H  HG2  . LYS B 2 29 ? -19.946 56.736 -8.913  1.00 52.71  ? 29  LYS A HG2  1 
ATOM   618  H  HG3  . LYS B 2 29 ? -21.177 56.809 -9.923  1.00 52.71  ? 29  LYS A HG3  1 
ATOM   619  H  HD2  . LYS B 2 29 ? -20.591 58.749 -7.905  1.00 55.16  ? 29  LYS A HD2  1 
ATOM   620  H  HD3  . LYS B 2 29 ? -20.507 59.013 -9.465  1.00 55.16  ? 29  LYS A HD3  1 
ATOM   621  H  HE2  . LYS B 2 29 ? -23.002 58.463 -8.318  0.00 63.35  ? 29  LYS A HE2  1 
ATOM   622  H  HE3  . LYS B 2 29 ? -22.422 59.941 -8.254  0.00 63.35  ? 29  LYS A HE3  1 
ATOM   623  H  HZ1  . LYS B 2 29 ? -22.437 59.970 -10.524 0.00 64.73  ? 29  LYS A HZ1  1 
ATOM   624  H  HZ2  . LYS B 2 29 ? -22.965 58.623 -10.582 0.00 64.73  ? 29  LYS A HZ2  1 
ATOM   625  H  HZ3  . LYS B 2 29 ? -23.778 59.697 -10.050 0.00 64.73  ? 29  LYS A HZ3  1 
ATOM   626  N  N    . LYS B 2 30 ? -23.460 54.177 -9.666  1.00 42.11  ? 30  LYS A N    1 
ATOM   627  C  CA   . LYS B 2 30 ? -24.106 53.587 -10.823 1.00 43.28  ? 30  LYS A CA   1 
ATOM   628  C  C    . LYS B 2 30 ? -23.430 53.902 -12.139 1.00 45.37  ? 30  LYS A C    1 
ATOM   629  O  O    . LYS B 2 30 ? -23.293 53.024 -13.023 1.00 45.20  ? 30  LYS A O    1 
ATOM   630  C  CB   . LYS B 2 30 ? -25.577 54.021 -10.863 1.00 48.63  ? 30  LYS A CB   1 
ATOM   631  C  CG   . LYS B 2 30 ? -26.480 53.312 -9.867  0.00 49.97  ? 30  LYS A CG   1 
ATOM   632  C  CD   . LYS B 2 30 ? -27.891 53.878 -9.918  0.00 52.72  ? 30  LYS A CD   1 
ATOM   633  C  CE   . LYS B 2 30 ? -28.750 53.355 -8.781  0.00 53.36  ? 30  LYS A CE   1 
ATOM   634  N  NZ   . LYS B 2 30 ? -30.181 53.727 -8.961  0.00 55.25  ? 30  LYS A NZ   1 
ATOM   635  H  H    . LYS B 2 30 ? -24.004 54.620 -9.169  1.00 50.53  ? 30  LYS A H    1 
ATOM   636  H  HA   . LYS B 2 30 ? -24.093 52.623 -10.718 1.00 51.93  ? 30  LYS A HA   1 
ATOM   637  H  HB2  . LYS B 2 30 ? -25.624 54.972 -10.676 1.00 58.35  ? 30  LYS A HB2  1 
ATOM   638  H  HB3  . LYS B 2 30 ? -25.927 53.847 -11.751 1.00 58.35  ? 30  LYS A HB3  1 
ATOM   639  H  HG2  . LYS B 2 30 ? -26.521 52.368 -10.085 0.00 59.96  ? 30  LYS A HG2  1 
ATOM   640  H  HG3  . LYS B 2 30 ? -26.132 53.438 -8.970  0.00 59.96  ? 30  LYS A HG3  1 
ATOM   641  H  HD2  . LYS B 2 30 ? -27.850 54.845 -9.847  0.00 63.27  ? 30  LYS A HD2  1 
ATOM   642  H  HD3  . LYS B 2 30 ? -28.307 53.621 -10.756 0.00 63.27  ? 30  LYS A HD3  1 
ATOM   643  H  HE2  . LYS B 2 30 ? -28.689 52.388 -8.753  0.00 64.03  ? 30  LYS A HE2  1 
ATOM   644  H  HE3  . LYS B 2 30 ? -28.441 53.736 -7.945  0.00 64.03  ? 30  LYS A HE3  1 
ATOM   645  H  HZ1  . LYS B 2 30 ? -30.665 53.410 -8.285  0.00 66.30  ? 30  LYS A HZ1  1 
ATOM   646  H  HZ2  . LYS B 2 30 ? -30.265 54.613 -8.987  0.00 66.30  ? 30  LYS A HZ2  1 
ATOM   647  H  HZ3  . LYS B 2 30 ? -30.491 53.385 -9.723  0.00 66.30  ? 30  LYS A HZ3  1 
ATOM   648  N  N    . SER B 2 31 ? -22.991 55.147 -12.272 1.00 45.07  ? 31  SER A N    1 
ATOM   649  C  CA   . SER B 2 31 ? -22.377 55.607 -13.499 1.00 43.35  ? 31  SER A CA   1 
ATOM   650  C  C    . SER B 2 31 ? -21.070 54.880 -13.730 1.00 42.74  ? 31  SER A C    1 
ATOM   651  O  O    . SER B 2 31 ? -20.778 54.536 -14.859 1.00 42.88  ? 31  SER A O    1 
ATOM   652  C  CB   . SER B 2 31 ? -22.149 57.111 -13.421 1.00 44.12  ? 31  SER A CB   1 
ATOM   653  O  OG   . SER B 2 31 ? -21.152 57.354 -12.451 1.00 47.02  ? 31  SER A OG   1 
ATOM   654  H  H    . SER B 2 31 ? -23.039 55.746 -11.658 1.00 54.08  ? 31  SER A H    1 
ATOM   655  H  HA   . SER B 2 31 ? -22.969 55.424 -14.246 1.00 52.02  ? 31  SER A HA   1 
ATOM   656  H  HB2  . SER B 2 31 ? -21.850 57.439 -14.284 1.00 52.95  ? 31  SER A HB2  1 
ATOM   657  H  HB3  . SER B 2 31 ? -22.973 57.551 -13.157 1.00 52.95  ? 31  SER A HB3  1 
ATOM   658  H  HG   . SER B 2 31 ? -20.439 56.967 -12.670 1.00 56.42  ? 31  SER A HG   1 
ATOM   659  N  N    . GLU B 2 32 ? -20.325 54.639 -12.648 1.00 39.10  ? 32  GLU A N    1 
ATOM   660  C  CA   . GLU B 2 32 ? -19.023 53.979 -12.709 1.00 41.34  ? 32  GLU A CA   1 
ATOM   661  C  C    . GLU B 2 32 ? -19.162 52.470 -12.982 1.00 40.16  ? 32  GLU A C    1 
ATOM   662  O  O    . GLU B 2 32 ? -18.465 51.928 -13.821 1.00 36.70  ? 32  GLU A O    1 
ATOM   663  C  CB   . GLU B 2 32 ? -18.251 54.215 -11.407 1.00 39.10  ? 32  GLU A CB   1 
ATOM   664  C  CG   . GLU B 2 32 ? -17.884 55.697 -11.171 1.00 40.28  ? 32  GLU A CG   1 
ATOM   665  C  CD   . GLU B 2 32 ? -17.333 55.958 -9.789  1.00 38.98  ? 32  GLU A CD   1 
ATOM   666  O  OE1  . GLU B 2 32 ? -17.817 55.329 -8.824  1.00 39.39  ? 32  GLU A OE1  1 
ATOM   667  O  OE2  . GLU B 2 32 ? -16.388 56.761 -9.650  1.00 39.50  ? 32  GLU A OE2  1 
ATOM   668  H  H    . GLU B 2 32 ? -20.561 54.854 -11.850 1.00 46.92  ? 32  GLU A H    1 
ATOM   669  H  HA   . GLU B 2 32 ? -18.509 54.367 -13.434 1.00 49.61  ? 32  GLU A HA   1 
ATOM   670  H  HB2  . GLU B 2 32 ? -18.797 53.921 -10.661 1.00 46.92  ? 32  GLU A HB2  1 
ATOM   671  H  HB3  . GLU B 2 32 ? -17.427 53.705 -11.434 1.00 46.92  ? 32  GLU A HB3  1 
ATOM   672  H  HG2  . GLU B 2 32 ? -17.209 55.961 -11.816 1.00 48.34  ? 32  GLU A HG2  1 
ATOM   673  H  HG3  . GLU B 2 32 ? -18.680 56.241 -11.283 1.00 48.34  ? 32  GLU A HG3  1 
ATOM   674  N  N    . LEU B 2 33 ? -20.104 51.820 -12.302 1.00 41.87  ? 33  LEU A N    1 
ATOM   675  C  CA   . LEU B 2 33 ? -20.419 50.386 -12.560 1.00 43.62  ? 33  LEU A CA   1 
ATOM   676  C  C    . LEU B 2 33 ? -20.940 50.206 -14.002 1.00 42.33  ? 33  LEU A C    1 
ATOM   677  O  O    . LEU B 2 33 ? -20.538 49.275 -14.730 1.00 39.82  ? 33  LEU A O    1 
ATOM   678  C  CB   . LEU B 2 33 ? -21.428 49.867 -11.553 1.00 44.26  ? 33  LEU A CB   1 
ATOM   679  C  CG   . LEU B 2 33 ? -21.943 48.445 -11.693 1.00 46.33  ? 33  LEU A CG   1 
ATOM   680  C  CD1  . LEU B 2 33 ? -20.800 47.406 -11.588 1.00 48.19  ? 33  LEU A CD1  1 
ATOM   681  C  CD2  . LEU B 2 33 ? -23.007 48.201 -10.627 1.00 44.62  ? 33  LEU A CD2  1 
ATOM   682  H  H    . LEU B 2 33 ? -20.582 52.174 -11.681 1.00 50.24  ? 33  LEU A H    1 
ATOM   683  H  HA   . LEU B 2 33 ? -19.608 49.863 -12.468 1.00 52.34  ? 33  LEU A HA   1 
ATOM   684  H  HB2  . LEU B 2 33 ? -21.025 49.932 -10.673 1.00 53.11  ? 33  LEU A HB2  1 
ATOM   685  H  HB3  . LEU B 2 33 ? -22.203 50.449 -11.586 1.00 53.11  ? 33  LEU A HB3  1 
ATOM   686  H  HG   . LEU B 2 33 ? -22.361 48.344 -12.563 1.00 55.59  ? 33  LEU A HG   1 
ATOM   687  H  HD11 . LEU B 2 33 ? -21.173 46.516 -11.683 1.00 57.83  ? 33  LEU A HD11 1 
ATOM   688  H  HD12 . LEU B 2 33 ? -20.156 47.573 -12.294 1.00 57.83  ? 33  LEU A HD12 1 
ATOM   689  H  HD13 . LEU B 2 33 ? -20.372 47.495 -10.722 1.00 57.83  ? 33  LEU A HD13 1 
ATOM   690  H  HD21 . LEU B 2 33 ? -22.610 48.326 -9.750  1.00 53.54  ? 33  LEU A HD21 1 
ATOM   691  H  HD22 . LEU B 2 33 ? -23.733 48.832 -10.755 1.00 53.54  ? 33  LEU A HD22 1 
ATOM   692  H  HD23 . LEU B 2 33 ? -23.339 47.294 -10.713 1.00 53.54  ? 33  LEU A HD23 1 
ATOM   693  N  N    . LYS B 2 34 ? -21.750 51.171 -14.448 1.00 43.45  ? 34  LYS A N    1 
ATOM   694  C  CA   . LYS B 2 34 ? -22.186 51.188 -15.838 1.00 44.19  ? 34  LYS A CA   1 
ATOM   695  C  C    . LYS B 2 34 ? -20.959 51.301 -16.795 1.00 43.79  ? 34  LYS A C    1 
ATOM   696  O  O    . LYS B 2 34 ? -20.811 50.453 -17.698 1.00 42.54  ? 34  LYS A O    1 
ATOM   697  C  CB   . LYS B 2 34 ? -23.182 52.350 -16.074 1.00 46.62  ? 34  LYS A CB   1 
ATOM   698  C  CG   . LYS B 2 34 ? -23.786 52.423 -17.501 1.00 48.96  ? 34  LYS A CG   1 
ATOM   699  C  CD   . LYS B 2 34 ? -24.452 53.737 -17.829 1.00 52.98  ? 34  LYS A CD   1 
ATOM   700  C  CE   . LYS B 2 34 ? -24.890 53.770 -19.284 0.00 53.58  ? 34  LYS A CE   1 
ATOM   701  N  NZ   . LYS B 2 34 ? -25.378 55.113 -19.695 0.00 58.42  ? 34  LYS A NZ   1 
ATOM   702  H  H    . LYS B 2 34 ? -22.054 51.818 -13.969 1.00 52.15  ? 34  LYS A H    1 
ATOM   703  H  HA   . LYS B 2 34 ? -22.645 50.356 -16.036 1.00 53.02  ? 34  LYS A HA   1 
ATOM   704  H  HB2  . LYS B 2 34 ? -23.918 52.256 -15.450 1.00 55.94  ? 34  LYS A HB2  1 
ATOM   705  H  HB3  . LYS B 2 34 ? -22.721 53.188 -15.909 1.00 55.94  ? 34  LYS A HB3  1 
ATOM   706  H  HG2  . LYS B 2 34 ? -23.075 52.283 -18.146 1.00 58.76  ? 34  LYS A HG2  1 
ATOM   707  H  HG3  . LYS B 2 34 ? -24.452 51.724 -17.592 1.00 58.76  ? 34  LYS A HG3  1 
ATOM   708  H  HD2  . LYS B 2 34 ? -25.237 53.849 -17.271 1.00 63.58  ? 34  LYS A HD2  1 
ATOM   709  H  HD3  . LYS B 2 34 ? -23.826 54.463 -17.682 1.00 63.58  ? 34  LYS A HD3  1 
ATOM   710  H  HE2  . LYS B 2 34 ? -24.136 53.537 -19.848 0.00 64.29  ? 34  LYS A HE2  1 
ATOM   711  H  HE3  . LYS B 2 34 ? -25.611 53.134 -19.413 0.00 64.29  ? 34  LYS A HE3  1 
ATOM   712  H  HZ1  . LYS B 2 34 ? -24.731 55.716 -19.592 0.00 70.11  ? 34  LYS A HZ1  1 
ATOM   713  H  HZ2  . LYS B 2 34 ? -25.626 55.098 -20.550 0.00 70.11  ? 34  LYS A HZ2  1 
ATOM   714  H  HZ3  . LYS B 2 34 ? -26.076 55.349 -19.196 0.00 70.11  ? 34  LYS A HZ3  1 
ATOM   715  N  N    . GLU B 2 35 ? -20.084 52.310 -16.580 1.00 45.60  ? 35  GLU A N    1 
ATOM   716  C  CA   A GLU B 2 35 ? -18.903 52.517 -17.424 0.54 54.15  ? 35  GLU A CA   1 
ATOM   717  C  CA   B GLU B 2 35 ? -18.914 52.499 -17.442 0.46 53.63  ? 35  GLU A CA   1 
ATOM   718  C  C    . GLU B 2 35 ? -18.001 51.283 -17.374 1.00 44.80  ? 35  GLU A C    1 
ATOM   719  O  O    . GLU B 2 35 ? -17.453 50.845 -18.378 1.00 42.11  ? 35  GLU A O    1 
ATOM   720  C  CB   A GLU B 2 35 ? -18.111 53.778 -16.982 0.54 46.21  ? 35  GLU A CB   1 
ATOM   721  C  CB   B GLU B 2 35 ? -18.137 53.764 -17.072 0.46 50.53  ? 35  GLU A CB   1 
ATOM   722  C  CG   A GLU B 2 35 ? -18.789 55.155 -17.288 0.54 51.03  ? 35  GLU A CG   1 
ATOM   723  C  CG   B GLU B 2 35 ? -18.889 55.076 -17.344 0.46 50.99  ? 35  GLU A CG   1 
ATOM   724  C  CD   A GLU B 2 35 ? -18.144 56.371 -16.563 0.54 51.24  ? 35  GLU A CD   1 
ATOM   725  C  CD   B GLU B 2 35 ? -19.005 55.476 -18.817 0.46 52.02  ? 35  GLU A CD   1 
ATOM   726  O  OE1  A GLU B 2 35 ? -16.981 56.263 -16.119 0.54 48.46  ? 35  GLU A OE1  1 
ATOM   727  O  OE1  B GLU B 2 35 ? -18.467 54.775 -19.716 0.46 49.55  ? 35  GLU A OE1  1 
ATOM   728  O  OE2  A GLU B 2 35 ? -18.817 57.434 -16.437 0.54 52.16  ? 35  GLU A OE2  1 
ATOM   729  O  OE2  B GLU B 2 35 ? -19.649 56.528 -19.055 0.46 55.16  ? 35  GLU A OE2  1 
ATOM   730  H  H    . GLU B 2 35 ? -20.156 52.886 -15.946 1.00 54.72  ? 35  GLU A H    1 
ATOM   731  H  HA   . GLU B 2 35 ? -19.201 52.620 -18.351 0.54 64.35  ? 35  GLU A HA   1 
ATOM   732  H  HB2  A GLU B 2 35 ? -17.972 53.730 -16.023 0.54 55.46  ? 35  GLU A HB2  1 
ATOM   733  H  HB2  B GLU B 2 35 ? -17.929 53.734 -16.125 0.46 60.64  ? 35  GLU A HB2  1 
ATOM   734  H  HB3  A GLU B 2 35 ? -17.251 53.772 -17.432 0.54 55.46  ? 35  GLU A HB3  1 
ATOM   735  H  HB3  B GLU B 2 35 ? -17.314 53.784 -17.586 0.46 60.64  ? 35  GLU A HB3  1 
ATOM   736  H  HG2  A GLU B 2 35 ? -18.736 55.320 -18.242 0.54 61.23  ? 35  GLU A HG2  1 
ATOM   737  H  HG2  B GLU B 2 35 ? -19.790 54.992 -16.994 0.46 61.19  ? 35  GLU A HG2  1 
ATOM   738  H  HG3  A GLU B 2 35 ? -19.719 55.110 -17.015 0.54 61.23  ? 35  GLU A HG3  1 
ATOM   739  H  HG3  B GLU B 2 35 ? -18.429 55.795 -16.882 0.46 61.19  ? 35  GLU A HG3  1 
ATOM   740  N  N    . LEU B 2 36 ? -17.864 50.705 -16.190 1.00 42.08  ? 36  LEU A N    1 
ATOM   741  C  CA   . LEU B 2 36 ? -17.074 49.478 -16.043 1.00 39.56  ? 36  LEU A CA   1 
ATOM   742  C  C    . LEU B 2 36 ? -17.672 48.271 -16.860 1.00 40.26  ? 36  LEU A C    1 
ATOM   743  O  O    . LEU B 2 36 ? -16.947 47.588 -17.624 1.00 40.32  ? 36  LEU A O    1 
ATOM   744  C  CB   . LEU B 2 36 ? -16.955 49.162 -14.560 1.00 38.16  ? 36  LEU A CB   1 
ATOM   745  C  CG   . LEU B 2 36 ? -15.982 48.077 -14.191 1.00 37.06  ? 36  LEU A CG   1 
ATOM   746  C  CD1  . LEU B 2 36 ? -15.569 48.290 -12.788 1.00 35.00  ? 36  LEU A CD1  1 
ATOM   747  C  CD2  . LEU B 2 36 ? -16.626 46.716 -14.370 1.00 36.83  ? 36  LEU A CD2  1 
ATOM   748  H  H    . LEU B 2 36 ? -18.211 50.995 -15.459 1.00 50.49  ? 36  LEU A H    1 
ATOM   749  H  HA   . LEU B 2 36 ? -16.179 49.644 -16.380 1.00 47.48  ? 36  LEU A HA   1 
ATOM   750  H  HB2  . LEU B 2 36 ? -16.678 49.968 -14.098 1.00 45.79  ? 36  LEU A HB2  1 
ATOM   751  H  HB3  . LEU B 2 36 ? -17.828 48.889 -14.236 1.00 45.79  ? 36  LEU A HB3  1 
ATOM   752  H  HG   . LEU B 2 36 ? -15.198 48.130 -14.760 1.00 44.48  ? 36  LEU A HG   1 
ATOM   753  H  HD11 . LEU B 2 36 ? -15.150 49.161 -12.711 1.00 41.99  ? 36  LEU A HD11 1 
ATOM   754  H  HD12 . LEU B 2 36 ? -16.354 48.248 -12.219 1.00 41.99  ? 36  LEU A HD12 1 
ATOM   755  H  HD13 . LEU B 2 36 ? -14.940 47.596 -12.535 1.00 41.99  ? 36  LEU A HD13 1 
ATOM   756  H  HD21 . LEU B 2 36 ? -15.985 46.030 -14.128 1.00 44.20  ? 36  LEU A HD21 1 
ATOM   757  H  HD22 . LEU B 2 36 ? -17.406 46.659 -13.797 1.00 44.20  ? 36  LEU A HD22 1 
ATOM   758  H  HD23 . LEU B 2 36 ? -16.889 46.612 -15.298 1.00 44.20  ? 36  LEU A HD23 1 
ATOM   759  N  N    . ILE B 2 37 ? -18.968 47.996 -16.696 1.00 41.11  ? 37  ILE A N    1 
ATOM   760  C  CA   . ILE B 2 37 ? -19.614 46.929 -17.484 1.00 40.52  ? 37  ILE A CA   1 
ATOM   761  C  C    . ILE B 2 37 ? -19.476 47.172 -18.989 1.00 41.64  ? 37  ILE A C    1 
ATOM   762  O  O    . ILE B 2 37 ? -19.106 46.273 -19.759 1.00 40.91  ? 37  ILE A O    1 
ATOM   763  C  CB   . ILE B 2 37 ? -21.109 46.785 -17.105 1.00 40.63  ? 37  ILE A CB   1 
ATOM   764  C  CG1  . ILE B 2 37 ? -21.207 46.077 -15.762 1.00 39.25  ? 37  ILE A CG1  1 
ATOM   765  C  CG2  . ILE B 2 37 ? -21.879 45.981 -18.137 1.00 40.68  ? 37  ILE A CG2  1 
ATOM   766  C  CD1  . ILE B 2 37 ? -22.446 46.212 -15.129 1.00 38.97  ? 37  ILE A CD1  1 
ATOM   767  H  H    . ILE B 2 37 ? -19.491 48.402 -16.146 1.00 49.33  ? 37  ILE A H    1 
ATOM   768  H  HA   . ILE B 2 37 ? -19.177 46.088 -17.281 1.00 48.63  ? 37  ILE A HA   1 
ATOM   769  H  HB   . ILE B 2 37 ? -21.505 47.667 -17.030 1.00 48.75  ? 37  ILE A HB   1 
ATOM   770  H  HG12 . ILE B 2 37 ? -21.047 45.130 -15.897 1.00 47.10  ? 37  ILE A HG12 1 
ATOM   771  H  HG13 . ILE B 2 37 ? -20.532 46.442 -15.169 1.00 47.10  ? 37  ILE A HG13 1 
ATOM   772  H  HG21 . ILE B 2 37 ? -22.806 45.917 -17.859 1.00 48.81  ? 37  ILE A HG21 1 
ATOM   773  H  HG22 . ILE B 2 37 ? -21.821 46.431 -18.994 1.00 48.81  ? 37  ILE A HG22 1 
ATOM   774  H  HG23 . ILE B 2 37 ? -21.490 45.095 -18.200 1.00 48.81  ? 37  ILE A HG23 1 
ATOM   775  H  HD11 . ILE B 2 37 ? -22.423 45.734 -14.285 1.00 46.76  ? 37  ILE A HD11 1 
ATOM   776  H  HD12 . ILE B 2 37 ? -22.620 47.153 -14.972 1.00 46.76  ? 37  ILE A HD12 1 
ATOM   777  H  HD13 . ILE B 2 37 ? -23.135 45.839 -15.702 1.00 46.76  ? 37  ILE A HD13 1 
ATOM   778  N  N    . ASN B 2 38 ? -19.733 48.400 -19.412 1.00 42.39  ? 38  ASN A N    1 
ATOM   779  C  CA   . ASN B 2 38 ? -19.684 48.725 -20.829 1.00 43.15  ? 38  ASN A CA   1 
ATOM   780  C  C    . ASN B 2 38 ? -18.306 48.757 -21.422 1.00 42.32  ? 38  ASN A C    1 
ATOM   781  O  O    . ASN B 2 38 ? -18.154 48.473 -22.606 1.00 42.52  ? 38  ASN A O    1 
ATOM   782  C  CB   . ASN B 2 38 ? -20.363 50.064 -21.107 1.00 46.25  ? 38  ASN A CB   1 
ATOM   783  C  CG   . ASN B 2 38 ? -21.855 49.945 -21.098 1.00 47.96  ? 38  ASN A CG   1 
ATOM   784  O  OD1  . ASN B 2 38 ? -22.384 48.880 -20.856 1.00 48.71  ? 38  ASN A OD1  1 
ATOM   785  N  ND2  . ASN B 2 38 ? -22.537 51.015 -21.368 1.00 50.89  ? 38  ASN A ND2  1 
ATOM   786  H  H    . ASN B 2 38 ? -19.937 49.062 -18.902 1.00 50.87  ? 38  ASN A H    1 
ATOM   787  H  HA   . ASN B 2 38 ? -20.184 48.046 -21.309 1.00 51.78  ? 38  ASN A HA   1 
ATOM   788  H  HB2  . ASN B 2 38 ? -20.105 50.700 -20.421 1.00 55.50  ? 38  ASN A HB2  1 
ATOM   789  H  HB3  . ASN B 2 38 ? -20.089 50.385 -21.980 1.00 55.50  ? 38  ASN A HB3  1 
ATOM   790  H  HD21 . ASN B 2 38 ? -22.129 51.752 -21.543 1.00 61.07  ? 38  ASN A HD21 1 
ATOM   791  H  HD22 . ASN B 2 38 ? -23.396 50.988 -21.373 1.00 61.07  ? 38  ASN A HD22 1 
ATOM   792  N  N    . ASN B 2 39 ? -17.290 49.092 -20.642 1.00 42.32  ? 39  ASN A N    1 
ATOM   793  C  CA   . ASN B 2 39 ? -15.965 49.186 -21.238 1.00 42.51  ? 39  ASN A CA   1 
ATOM   794  C  C    . ASN B 2 39 ? -15.107 47.952 -21.041 1.00 41.05  ? 39  ASN A C    1 
ATOM   795  O  O    . ASN B 2 39 ? -14.164 47.764 -21.816 1.00 40.43  ? 39  ASN A O    1 
ATOM   796  C  CB   . ASN B 2 39 ? -15.244 50.385 -20.675 1.00 41.37  ? 39  ASN A CB   1 
ATOM   797  C  CG   . ASN B 2 39 ? -15.857 51.662 -21.125 1.00 46.64  ? 39  ASN A CG   1 
ATOM   798  O  OD1  . ASN B 2 39 ? -16.655 51.698 -22.065 1.00 48.37  ? 39  ASN A OD1  1 
ATOM   799  N  ND2  . ASN B 2 39 ? -15.536 52.737 -20.422 1.00 55.61  ? 39  ASN A ND2  1 
ATOM   800  H  H    . ASN B 2 39 ? -17.334 49.263 -19.800 1.00 50.78  ? 39  ASN A H    1 
ATOM   801  H  HA   . ASN B 2 39 ? -16.064 49.324 -22.193 1.00 51.01  ? 39  ASN A HA   1 
ATOM   802  H  HB2  . ASN B 2 39 ? -15.284 50.355 -19.707 1.00 49.65  ? 39  ASN A HB2  1 
ATOM   803  H  HB3  . ASN B 2 39 ? -14.321 50.371 -20.973 1.00 49.65  ? 39  ASN A HB3  1 
ATOM   804  H  HD21 . ASN B 2 39 ? -15.860 53.504 -20.636 1.00 66.73  ? 39  ASN A HD21 1 
ATOM   805  H  HD22 . ASN B 2 39 ? -15.002 52.668 -19.751 1.00 66.73  ? 39  ASN A HD22 1 
ATOM   806  N  N    . GLU B 2 40 ? -15.424 47.145 -20.021 1.00 40.39  ? 40  GLU A N    1 
ATOM   807  C  CA   . GLU B 2 40 ? -14.553 46.027 -19.620 1.00 43.60  ? 40  GLU A CA   1 
ATOM   808  C  C    . GLU B 2 40 ? -15.255 44.640 -19.635 1.00 39.49  ? 40  GLU A C    1 
ATOM   809  O  O    . GLU B 2 40 ? -14.654 43.640 -19.360 1.00 38.48  ? 40  GLU A O    1 
ATOM   810  C  CB   . GLU B 2 40 ? -13.994 46.282 -18.203 1.00 38.88  ? 40  GLU A CB   1 
ATOM   811  C  CG   . GLU B 2 40 ? -13.420 47.677 -17.933 1.00 40.34  ? 40  GLU A CG   1 
ATOM   812  C  CD   . GLU B 2 40 ? -12.204 48.027 -18.766 1.00 40.28  ? 40  GLU A CD   1 
ATOM   813  O  OE1  . GLU B 2 40 ? -11.689 47.147 -19.496 1.00 40.95  ? 40  GLU A OE1  1 
ATOM   814  O  OE2  . GLU B 2 40 ? -11.745 49.178 -18.665 1.00 39.65  ? 40  GLU A OE2  1 
ATOM   815  H  H    . GLU B 2 40 ? -16.137 47.223 -19.545 1.00 48.47  ? 40  GLU A H    1 
ATOM   816  H  HA   . GLU B 2 40 ? -13.802 45.984 -20.231 1.00 52.32  ? 40  GLU A HA   1 
ATOM   817  H  HB2  . GLU B 2 40 ? -14.710 46.137 -17.565 1.00 46.66  ? 40  GLU A HB2  1 
ATOM   818  H  HB3  . GLU B 2 40 ? -13.284 45.642 -18.039 1.00 46.66  ? 40  GLU A HB3  1 
ATOM   819  H  HG2  . GLU B 2 40 ? -14.106 48.336 -18.123 1.00 48.41  ? 40  GLU A HG2  1 
ATOM   820  H  HG3  . GLU B 2 40 ? -13.163 47.731 -17.000 1.00 48.41  ? 40  GLU A HG3  1 
ATOM   821  N  N    . LEU B 2 41 ? -16.547 44.596 -19.883 1.00 39.86  ? 41  LEU A N    1 
ATOM   822  C  CA   . LEU B 2 41 ? -17.260 43.344 -19.880 1.00 39.76  ? 41  LEU A CA   1 
ATOM   823  C  C    . LEU B 2 41 ? -18.156 43.209 -21.110 1.00 43.07  ? 41  LEU A C    1 
ATOM   824  O  O    . LEU B 2 41 ? -19.170 42.505 -21.083 1.00 44.73  ? 41  LEU A O    1 
ATOM   825  C  CB   . LEU B 2 41 ? -18.077 43.220 -18.602 1.00 39.10  ? 41  LEU A CB   1 
ATOM   826  C  CG   . LEU B 2 41 ? -17.316 42.970 -17.301 1.00 38.27  ? 41  LEU A CG   1 
ATOM   827  C  CD1  . LEU B 2 41 ? -18.291 43.006 -16.179 1.00 38.81  ? 41  LEU A CD1  1 
ATOM   828  C  CD2  . LEU B 2 41 ? -16.584 41.637 -17.287 1.00 37.80  ? 41  LEU A CD2  1 
ATOM   829  H  H    . LEU B 2 41 ? -17.036 45.282 -20.056 1.00 47.83  ? 41  LEU A H    1 
ATOM   830  H  HA   . LEU B 2 41 ? -16.619 42.616 -19.896 1.00 47.71  ? 41  LEU A HA   1 
ATOM   831  H  HB2  . LEU B 2 41 ? -18.577 44.043 -18.485 1.00 46.92  ? 41  LEU A HB2  1 
ATOM   832  H  HB3  . LEU B 2 41 ? -18.699 42.484 -18.713 1.00 46.92  ? 41  LEU A HB3  1 
ATOM   833  H  HG   . LEU B 2 41 ? -16.666 43.678 -17.166 1.00 45.92  ? 41  LEU A HG   1 
ATOM   834  H  HD11 . LEU B 2 41 ? -17.820 42.849 -15.346 1.00 46.57  ? 41  LEU A HD11 1 
ATOM   835  H  HD12 . LEU B 2 41 ? -18.717 43.878 -16.159 1.00 46.57  ? 41  LEU A HD12 1 
ATOM   836  H  HD13 . LEU B 2 41 ? -18.958 42.316 -16.318 1.00 46.57  ? 41  LEU A HD13 1 
ATOM   837  H  HD21 . LEU B 2 41 ? -15.944 41.620 -18.015 1.00 45.36  ? 41  LEU A HD21 1 
ATOM   838  H  HD22 . LEU B 2 41 ? -16.123 41.539 -16.439 1.00 45.36  ? 41  LEU A HD22 1 
ATOM   839  H  HD23 . LEU B 2 41 ? -17.230 40.922 -17.397 1.00 45.36  ? 41  LEU A HD23 1 
ATOM   840  N  N    . SER B 2 42 ? -17.791 43.928 -22.166 1.00 43.42  ? 42  SER A N    1 
ATOM   841  C  CA   . SER B 2 42 ? -18.530 43.981 -23.419 1.00 44.88  ? 42  SER A CA   1 
ATOM   842  C  C    . SER B 2 42 ? -18.746 42.581 -24.012 1.00 48.22  ? 42  SER A C    1 
ATOM   843  O  O    . SER B 2 42 ? -19.760 42.315 -24.651 1.00 51.72  ? 42  SER A O    1 
ATOM   844  C  CB   . SER B 2 42 ? -17.787 44.856 -24.429 1.00 42.05  ? 42  SER A CB   1 
ATOM   845  O  OG   . SER B 2 42 ? -16.585 44.212 -24.783 1.00 45.92  ? 42  SER A OG   1 
ATOM   846  H  H    . SER B 2 42 ? -17.083 44.416 -22.177 1.00 52.10  ? 42  SER A H    1 
ATOM   847  H  HA   . SER B 2 42 ? -19.400 44.378 -23.258 1.00 53.86  ? 42  SER A HA   1 
ATOM   848  H  HB2  . SER B 2 42 ? -18.336 44.973 -25.220 1.00 50.46  ? 42  SER A HB2  1 
ATOM   849  H  HB3  . SER B 2 42 ? -17.587 45.716 -24.026 1.00 50.46  ? 42  SER A HB3  1 
ATOM   850  H  HG   . SER B 2 42 ? -16.162 44.679 -25.339 1.00 55.11  ? 42  SER A HG   1 
ATOM   851  N  N    . HIS B 2 43 ? -17.814 41.676 -23.785 1.00 47.07  ? 43  HIS A N    1 
ATOM   852  C  CA   . HIS B 2 43 ? -17.944 40.336 -24.368 1.00 49.99  ? 43  HIS A CA   1 
ATOM   853  C  C    . HIS B 2 43 ? -18.793 39.391 -23.524 1.00 49.53  ? 43  HIS A C    1 
ATOM   854  O  O    . HIS B 2 43 ? -19.227 38.372 -24.005 1.00 51.91  ? 43  HIS A O    1 
ATOM   855  C  CB   . HIS B 2 43 ? -16.557 39.726 -24.602 1.00 47.76  ? 43  HIS A CB   1 
ATOM   856  C  CG   . HIS B 2 43 ? -15.680 40.568 -25.482 1.00 46.60  ? 43  HIS A CG   1 
ATOM   857  N  ND1  . HIS B 2 43 ? -14.684 41.383 -24.990 1.00 46.88  ? 43  HIS A ND1  1 
ATOM   858  C  CD2  . HIS B 2 43 ? -15.714 40.790 -26.810 1.00 46.19  ? 43  HIS A CD2  1 
ATOM   859  C  CE1  . HIS B 2 43 ? -14.097 42.016 -25.984 1.00 46.25  ? 43  HIS A CE1  1 
ATOM   860  N  NE2  . HIS B 2 43 ? -14.713 41.685 -27.098 1.00 46.07  ? 43  HIS A NE2  1 
ATOM   861  H  H    . HIS B 2 43 ? -17.108 41.799 -23.310 1.00 56.49  ? 43  HIS A H    1 
ATOM   862  H  HA   . HIS B 2 43 ? -18.375 40.419 -25.233 1.00 59.99  ? 43  HIS A HA   1 
ATOM   863  H  HB2  . HIS B 2 43 ? -16.111 39.623 -23.747 1.00 57.31  ? 43  HIS A HB2  1 
ATOM   864  H  HB3  . HIS B 2 43 ? -16.662 38.860 -25.026 1.00 57.31  ? 43  HIS A HB3  1 
ATOM   865  H  HD2  . HIS B 2 43 ? -16.289 40.390 -27.421 1.00 55.42  ? 43  HIS A HD2  1 
ATOM   866  H  HE1  . HIS B 2 43 ? -13.389 42.615 -25.909 1.00 55.49  ? 43  HIS A HE1  1 
ATOM   867  N  N    . PHE B 2 44 ? -19.070 39.764 -22.285 1.00 48.83  ? 44  PHE A N    1 
ATOM   868  C  CA   . PHE B 2 44 ? -19.802 38.910 -21.346 1.00 51.53  ? 44  PHE A CA   1 
ATOM   869  C  C    . PHE B 2 44 ? -21.175 39.439 -21.011 1.00 52.16  ? 44  PHE A C    1 
ATOM   870  O  O    . PHE B 2 44 ? -22.020 38.673 -20.567 1.00 57.65  ? 44  PHE A O    1 
ATOM   871  C  CB   . PHE B 2 44 ? -19.007 38.765 -20.049 1.00 51.57  ? 44  PHE A CB   1 
ATOM   872  C  CG   . PHE B 2 44 ? -17.750 37.970 -20.200 1.00 50.56  ? 44  PHE A CG   1 
ATOM   873  C  CD1  . PHE B 2 44 ? -17.450 37.334 -21.379 1.00 53.32  ? 44  PHE A CD1  1 
ATOM   874  C  CD2  . PHE B 2 44 ? -16.822 37.952 -19.191 1.00 48.46  ? 44  PHE A CD2  1 
ATOM   875  C  CE1  . PHE B 2 44 ? -16.275 36.640 -21.509 1.00 56.09  ? 44  PHE A CE1  1 
ATOM   876  C  CE2  . PHE B 2 44 ? -15.655 37.272 -19.319 1.00 45.92  ? 44  PHE A CE2  1 
ATOM   877  C  CZ   . PHE B 2 44 ? -15.371 36.625 -20.471 1.00 49.84  ? 44  PHE A CZ   1 
ATOM   878  H  H    . PHE B 2 44 ? -18.841 40.523 -21.952 1.00 58.59  ? 44  PHE A H    1 
ATOM   879  H  HA   . PHE B 2 44 ? -19.906 38.028 -21.736 1.00 61.83  ? 44  PHE A HA   1 
ATOM   880  H  HB2  . PHE B 2 44 ? -18.763 39.648 -19.731 1.00 61.88  ? 44  PHE A HB2  1 
ATOM   881  H  HB3  . PHE B 2 44 ? -19.562 38.320 -19.390 1.00 61.88  ? 44  PHE A HB3  1 
ATOM   882  H  HD1  . PHE B 2 44 ? -18.061 37.346 -22.081 1.00 63.99  ? 44  PHE A HD1  1 
ATOM   883  H  HD2  . PHE B 2 44 ? -17.006 38.396 -18.395 1.00 58.15  ? 44  PHE A HD2  1 
ATOM   884  H  HE1  . PHE B 2 44 ? -16.081 36.195 -22.303 1.00 67.31  ? 44  PHE A HE1  1 
ATOM   885  H  HE2  . PHE B 2 44 ? -15.047 37.257 -18.615 1.00 55.10  ? 44  PHE A HE2  1 
ATOM   886  H  HZ   . PHE B 2 44 ? -14.574 36.153 -20.555 1.00 59.81  ? 44  PHE A HZ   1 
ATOM   887  N  N    . LEU B 2 45 ? -21.380 40.741 -21.158 1.00 50.04  ? 45  LEU A N    1 
ATOM   888  C  CA   . LEU B 2 45 ? -22.644 41.343 -20.803 1.00 51.30  ? 45  LEU A CA   1 
ATOM   889  C  C    . LEU B 2 45 ? -23.141 42.222 -21.909 1.00 52.72  ? 45  LEU A C    1 
ATOM   890  O  O    . LEU B 2 45 ? -22.355 42.837 -22.616 1.00 50.39  ? 45  LEU A O    1 
ATOM   891  C  CB   . LEU B 2 45 ? -22.526 42.118 -19.504 1.00 48.57  ? 45  LEU A CB   1 
ATOM   892  C  CG   . LEU B 2 45 ? -22.137 41.249 -18.298 1.00 46.72  ? 45  LEU A CG   1 
ATOM   893  C  CD1  . LEU B 2 45 ? -21.942 42.126 -17.064 1.00 45.22  ? 45  LEU A CD1  1 
ATOM   894  C  CD2  . LEU B 2 45 ? -23.177 40.148 -18.008 1.00 48.94  ? 45  LEU A CD2  1 
ATOM   895  H  H    . LEU B 2 45 ? -20.798 41.296 -21.463 1.00 60.05  ? 45  LEU A H    1 
ATOM   896  H  HA   . LEU B 2 45 ? -23.298 40.639 -20.669 1.00 61.56  ? 45  LEU A HA   1 
ATOM   897  H  HB2  . LEU B 2 45 ? -21.846 42.802 -19.608 1.00 58.29  ? 45  LEU A HB2  1 
ATOM   898  H  HB3  . LEU B 2 45 ? -23.381 42.532 -19.308 1.00 58.29  ? 45  LEU A HB3  1 
ATOM   899  H  HG   . LEU B 2 45 ? -21.291 40.814 -18.488 1.00 56.06  ? 45  LEU A HG   1 
ATOM   900  H  HD11 . LEU B 2 45 ? -21.697 41.564 -16.313 1.00 54.26  ? 45  LEU A HD11 1 
ATOM   901  H  HD12 . LEU B 2 45 ? -21.237 42.768 -17.241 1.00 54.26  ? 45  LEU A HD12 1 
ATOM   902  H  HD13 . LEU B 2 45 ? -22.772 42.591 -16.873 1.00 54.26  ? 45  LEU A HD13 1 
ATOM   903  H  HD21 . LEU B 2 45 ? -22.884 39.632 -17.241 1.00 58.73  ? 45  LEU A HD21 1 
ATOM   904  H  HD22 . LEU B 2 45 ? -24.033 40.564 -17.819 1.00 58.73  ? 45  LEU A HD22 1 
ATOM   905  H  HD23 . LEU B 2 45 ? -23.253 39.573 -18.785 1.00 58.73  ? 45  LEU A HD23 1 
ATOM   906  N  N    . GLU B 2 46 ? -24.460 42.218 -22.109 1.00 63.09  ? 46  GLU A N    1 
ATOM   907  C  CA   . GLU B 2 46 ? -25.056 43.151 -23.056 1.00 56.97  ? 46  GLU A CA   1 
ATOM   908  C  C    . GLU B 2 46 ? -24.760 44.547 -22.568 1.00 51.80  ? 46  GLU A C    1 
ATOM   909  O  O    . GLU B 2 46 ? -24.864 44.833 -21.360 1.00 50.62  ? 46  GLU A O    1 
ATOM   910  C  CB   . GLU B 2 46 ? -26.554 42.927 -23.256 0.00 56.34  ? 46  GLU A CB   1 
ATOM   911  C  CG   . GLU B 2 46 ? -26.877 41.575 -23.876 0.00 57.74  ? 46  GLU A CG   1 
ATOM   912  C  CD   . GLU B 2 46 ? -28.322 41.459 -24.323 0.00 58.60  ? 46  GLU A CD   1 
ATOM   913  O  OE1  . GLU B 2 46 ? -29.063 42.459 -24.214 0.00 59.11  ? 46  GLU A OE1  1 
ATOM   914  O  OE2  . GLU B 2 46 ? -28.717 40.368 -24.786 0.00 58.40  ? 46  GLU A OE2  1 
ATOM   915  H  H    . GLU B 2 46 ? -25.019 41.696 -21.717 1.00 75.71  ? 46  GLU A H    1 
ATOM   916  H  HA   . GLU B 2 46 ? -24.623 43.041 -23.917 1.00 68.36  ? 46  GLU A HA   1 
ATOM   917  H  HB2  . GLU B 2 46 ? -26.998 42.975 -22.395 0.00 67.60  ? 46  GLU A HB2  1 
ATOM   918  H  HB3  . GLU B 2 46 ? -26.900 43.616 -23.845 0.00 67.60  ? 46  GLU A HB3  1 
ATOM   919  H  HG2  . GLU B 2 46 ? -26.312 41.440 -24.653 0.00 69.28  ? 46  GLU A HG2  1 
ATOM   920  H  HG3  . GLU B 2 46 ? -26.710 40.879 -23.221 0.00 69.28  ? 46  GLU A HG3  1 
ATOM   921  N  N    . GLU B 2 47 ? -24.362 45.388 -23.522 1.00 50.51  ? 47  GLU A N    1 
ATOM   922  C  CA   . GLU B 2 47 ? -24.129 46.807 -23.297 1.00 52.14  ? 47  GLU A CA   1 
ATOM   923  C  C    . GLU B 2 47 ? -25.341 47.391 -22.607 1.00 54.24  ? 47  GLU A C    1 
ATOM   924  O  O    . GLU B 2 47 ? -26.495 47.076 -22.946 1.00 53.74  ? 47  GLU A O    1 
ATOM   925  C  CB   . GLU B 2 47 ? -23.854 47.530 -24.624 1.00 57.97  ? 47  GLU A CB   1 
ATOM   926  C  CG   . GLU B 2 47 ? -23.602 49.063 -24.523 1.00 61.73  ? 47  GLU A CG   1 
ATOM   927  C  CD   . GLU B 2 47 ? -23.195 49.700 -25.859 1.00 65.21  ? 47  GLU A CD   1 
ATOM   928  O  OE1  . GLU B 2 47 ? -23.435 49.066 -26.904 1.00 67.30  ? 47  GLU A OE1  1 
ATOM   929  O  OE2  . GLU B 2 47 ? -22.657 50.838 -25.871 1.00 65.34  ? 47  GLU A OE2  1 
ATOM   930  H  H    . GLU B 2 47 ? -24.216 45.147 -24.334 1.00 60.61  ? 47  GLU A H    1 
ATOM   931  H  HA   . GLU B 2 47 ? -23.359 46.922 -22.718 1.00 62.57  ? 47  GLU A HA   1 
ATOM   932  H  HB2  . GLU B 2 47 ? -23.068 47.133 -25.031 1.00 69.57  ? 47  GLU A HB2  1 
ATOM   933  H  HB3  . GLU B 2 47 ? -24.619 47.400 -25.207 1.00 69.57  ? 47  GLU A HB3  1 
ATOM   934  H  HG2  . GLU B 2 47 ? -24.416 49.496 -24.222 1.00 74.08  ? 47  GLU A HG2  1 
ATOM   935  H  HG3  . GLU B 2 47 ? -22.888 49.223 -23.887 1.00 74.08  ? 47  GLU A HG3  1 
ATOM   936  N  N    . ILE B 2 48 ? -25.080 48.208 -21.602 1.00 54.49  ? 48  ILE A N    1 
ATOM   937  C  CA   . ILE B 2 48 ? -26.152 48.846 -20.869 1.00 55.72  ? 48  ILE A CA   1 
ATOM   938  C  C    . ILE B 2 48 ? -26.425 50.224 -21.411 1.00 59.82  ? 48  ILE A C    1 
ATOM   939  O  O    . ILE B 2 48 ? -25.574 51.088 -21.322 1.00 60.36  ? 48  ILE A O    1 
ATOM   940  C  CB   . ILE B 2 48 ? -25.845 48.923 -19.389 1.00 53.19  ? 48  ILE A CB   1 
ATOM   941  C  CG1  . ILE B 2 48 ? -25.675 47.510 -18.839 1.00 48.45  ? 48  ILE A CG1  1 
ATOM   942  C  CG2  . ILE B 2 48 ? -26.952 49.660 -18.670 1.00 57.21  ? 48  ILE A CG2  1 
ATOM   943  C  CD1  . ILE B 2 48 ? -25.440 47.433 -17.362 1.00 46.95  ? 48  ILE A CD1  1 
ATOM   944  H  H    . ILE B 2 48 ? -24.291 48.408 -21.325 1.00 65.39  ? 48  ILE A H    1 
ATOM   945  H  HA   . ILE B 2 48 ? -26.960 48.320 -20.977 1.00 66.86  ? 48  ILE A HA   1 
ATOM   946  H  HB   . ILE B 2 48 ? -25.014 49.409 -19.267 1.00 63.82  ? 48  ILE A HB   1 
ATOM   947  H  HG12 . ILE B 2 48 ? -26.478 47.004 -19.034 1.00 58.13  ? 48  ILE A HG12 1 
ATOM   948  H  HG13 . ILE B 2 48 ? -24.915 47.097 -19.278 1.00 58.13  ? 48  ILE A HG13 1 
ATOM   949  H  HG21 . ILE B 2 48 ? -26.741 49.701 -17.724 1.00 68.66  ? 48  ILE A HG21 1 
ATOM   950  H  HG22 . ILE B 2 48 ? -27.022 50.557 -19.033 1.00 68.66  ? 48  ILE A HG22 1 
ATOM   951  H  HG23 . ILE B 2 48 ? -27.786 49.183 -18.803 1.00 68.66  ? 48  ILE A HG23 1 
ATOM   952  H  HD11 . ILE B 2 48 ? -25.344 46.502 -17.106 1.00 56.34  ? 48  ILE A HD11 1 
ATOM   953  H  HD12 . ILE B 2 48 ? -24.630 47.921 -17.145 1.00 56.34  ? 48  ILE A HD12 1 
ATOM   954  H  HD13 . ILE B 2 48 ? -26.197 47.827 -16.901 1.00 56.34  ? 48  ILE A HD13 1 
ATOM   955  N  N    . LYS B 2 49 ? -27.662 50.418 -21.879 1.00 65.47  ? 49  LYS A N    1 
ATOM   956  C  CA   . LYS B 2 49 ? -28.118 51.641 -22.533 1.00 66.26  ? 49  LYS A CA   1 
ATOM   957  C  C    . LYS B 2 49 ? -29.276 52.278 -21.751 1.00 66.96  ? 49  LYS A C    1 
ATOM   958  O  O    . LYS B 2 49 ? -29.493 53.504 -21.827 1.00 67.76  ? 49  LYS A O    1 
ATOM   959  C  CB   . LYS B 2 49 ? -28.567 51.358 -23.964 0.00 72.47  ? 49  LYS A CB   1 
ATOM   960  C  CG   . LYS B 2 49 ? -27.480 50.812 -24.859 0.00 74.01  ? 49  LYS A CG   1 
ATOM   961  C  CD   . LYS B 2 49 ? -28.021 50.531 -26.245 0.00 78.39  ? 49  LYS A CD   1 
ATOM   962  C  CE   . LYS B 2 49 ? -26.921 50.105 -27.196 0.00 80.94  ? 49  LYS A CE   1 
ATOM   963  N  NZ   . LYS B 2 49 ? -27.459 49.736 -28.533 0.00 87.91  ? 49  LYS A NZ   1 
ATOM   964  H  H    . LYS B 2 49 ? -28.280 49.823 -21.824 1.00 78.56  ? 49  LYS A H    1 
ATOM   965  H  HA   . LYS B 2 49 ? -27.387 52.278 -22.565 1.00 79.52  ? 49  LYS A HA   1 
ATOM   966  H  HB2  . LYS B 2 49 ? -29.285 50.706 -23.941 0.00 86.96  ? 49  LYS A HB2  1 
ATOM   967  H  HB3  . LYS B 2 49 ? -28.887 52.184 -24.359 0.00 86.96  ? 49  LYS A HB3  1 
ATOM   968  H  HG2  . LYS B 2 49 ? -26.766 51.464 -24.935 0.00 88.81  ? 49  LYS A HG2  1 
ATOM   969  H  HG3  . LYS B 2 49 ? -27.142 49.982 -24.487 0.00 88.81  ? 49  LYS A HG3  1 
ATOM   970  H  HD2  . LYS B 2 49 ? -28.674 49.814 -26.194 0.00 94.06  ? 49  LYS A HD2  1 
ATOM   971  H  HD3  . LYS B 2 49 ? -28.433 51.335 -26.597 0.00 94.06  ? 49  LYS A HD3  1 
ATOM   972  H  HE2  . LYS B 2 49 ? -26.297 50.839 -27.312 0.00 97.13  ? 49  LYS A HE2  1 
ATOM   973  H  HE3  . LYS B 2 49 ? -26.463 49.332 -26.829 0.00 97.13  ? 49  LYS A HE3  1 
ATOM   974  H  HZ1  . LYS B 2 49 ? -26.794 49.490 -29.071 0.00 105.49 ? 49  LYS A HZ1  1 
ATOM   975  H  HZ2  . LYS B 2 49 ? -28.032 49.060 -28.453 0.00 105.49 ? 49  LYS A HZ2  1 
ATOM   976  H  HZ3  . LYS B 2 49 ? -27.881 50.432 -28.893 0.00 105.49 ? 49  LYS A HZ3  1 
ATOM   977  N  N    . GLU B 2 50 ? -30.060 51.428 -21.080 1.00 62.87  ? 50  GLU A N    1 
ATOM   978  C  CA   . GLU B 2 50 ? -31.183 51.855 -20.258 1.00 59.16  ? 50  GLU A CA   1 
ATOM   979  C  C    . GLU B 2 50 ? -30.770 52.000 -18.794 1.00 59.26  ? 50  GLU A C    1 
ATOM   980  O  O    . GLU B 2 50 ? -30.136 51.098 -18.248 1.00 58.24  ? 50  GLU A O    1 
ATOM   981  C  CB   . GLU B 2 50 ? -32.338 50.866 -20.408 0.00 59.67  ? 50  GLU A CB   1 
ATOM   982  C  CG   . GLU B 2 50 ? -32.911 50.830 -21.823 0.00 60.20  ? 50  GLU A CG   1 
ATOM   983  C  CD   . GLU B 2 50 ? -33.862 49.675 -22.047 0.00 59.78  ? 50  GLU A CD   1 
ATOM   984  O  OE1  . GLU B 2 50 ? -33.964 48.806 -21.158 0.00 60.40  ? 50  GLU A OE1  1 
ATOM   985  O  OE2  . GLU B 2 50 ? -34.512 49.634 -23.114 0.00 57.88  ? 50  GLU A OE2  1 
ATOM   986  H  H    . GLU B 2 50 ? -29.953 50.575 -21.090 1.00 75.45  ? 50  GLU A H    1 
ATOM   987  H  HA   . GLU B 2 50 ? -31.489 52.721 -20.569 1.00 70.99  ? 50  GLU A HA   1 
ATOM   988  H  HB2  . GLU B 2 50 ? -32.021 49.976 -20.191 0.00 71.61  ? 50  GLU A HB2  1 
ATOM   989  H  HB3  . GLU B 2 50 ? -33.051 51.121 -19.803 0.00 71.61  ? 50  GLU A HB3  1 
ATOM   990  H  HG2  . GLU B 2 50 ? -33.396 51.654 -21.987 0.00 72.24  ? 50  GLU A HG2  1 
ATOM   991  H  HG3  . GLU B 2 50 ? -32.181 50.744 -22.456 0.00 72.24  ? 50  GLU A HG3  1 
ATOM   992  N  N    . GLN B 2 51 ? -31.132 53.114 -18.157 1.00 57.39  ? 51  GLN A N    1 
ATOM   993  C  CA   . GLN B 2 51 ? -30.865 53.291 -16.721 1.00 62.33  ? 51  GLN A CA   1 
ATOM   994  C  C    . GLN B 2 51 ? -31.415 52.126 -15.859 1.00 59.71  ? 51  GLN A C    1 
ATOM   995  O  O    . GLN B 2 51 ? -30.765 51.657 -14.899 1.00 56.86  ? 51  GLN A O    1 
ATOM   996  C  CB   . GLN B 2 51 ? -31.464 54.618 -16.206 1.00 61.93  ? 51  GLN A CB   1 
ATOM   997  C  CG   . GLN B 2 51 ? -31.072 54.985 -14.785 0.00 65.62  ? 51  GLN A CG   1 
ATOM   998  C  CD   . GLN B 2 51 ? -29.570 55.093 -14.607 0.00 65.43  ? 51  GLN A CD   1 
ATOM   999  O  OE1  . GLN B 2 51 ? -28.876 55.685 -15.433 0.00 67.34  ? 51  GLN A OE1  1 
ATOM   1000 N  NE2  . GLN B 2 51 ? -29.061 54.517 -13.525 0.00 61.53  ? 51  GLN A NE2  1 
ATOM   1001 H  H    . GLN B 2 51 ? -31.530 53.781 -18.528 1.00 68.87  ? 51  GLN A H    1 
ATOM   1002 H  HA   . GLN B 2 51 ? -29.905 53.329 -16.587 1.00 74.80  ? 51  GLN A HA   1 
ATOM   1003 H  HB2  . GLN B 2 51 ? -31.169 55.336 -16.787 1.00 74.32  ? 51  GLN A HB2  1 
ATOM   1004 H  HB3  . GLN B 2 51 ? -32.432 54.552 -16.235 1.00 74.32  ? 51  GLN A HB3  1 
ATOM   1005 H  HG2  . GLN B 2 51 ? -31.464 55.844 -14.560 0.00 78.75  ? 51  GLN A HG2  1 
ATOM   1006 H  HG3  . GLN B 2 51 ? -31.398 54.302 -14.179 0.00 78.75  ? 51  GLN A HG3  1 
ATOM   1007 H  HE21 . GLN B 2 51 ? -29.577 54.111 -12.970 0.00 73.84  ? 51  GLN A HE21 1 
ATOM   1008 H  HE22 . GLN B 2 51 ? -28.214 54.551 -13.378 0.00 73.84  ? 51  GLN A HE22 1 
ATOM   1009 N  N    . GLU B 2 52 ? -32.606 51.661 -16.226 1.00 59.53  ? 52  GLU A N    1 
ATOM   1010 C  CA   . GLU B 2 52 ? -33.316 50.667 -15.447 1.00 57.54  ? 52  GLU A CA   1 
ATOM   1011 C  C    . GLU B 2 52 ? -32.484 49.394 -15.328 1.00 56.13  ? 52  GLU A C    1 
ATOM   1012 O  O    . GLU B 2 52 ? -32.594 48.695 -14.330 1.00 55.22  ? 52  GLU A O    1 
ATOM   1013 C  CB   . GLU B 2 52 ? -34.689 50.360 -16.066 1.00 59.31  ? 52  GLU A CB   1 
ATOM   1014 C  CG   . GLU B 2 52 ? -35.737 51.516 -16.066 1.00 60.91  ? 52  GLU A CG   1 
ATOM   1015 C  CD   . GLU B 2 52 ? -35.624 52.524 -17.246 1.00 62.56  ? 52  GLU A CD   1 
ATOM   1016 O  OE1  . GLU B 2 52 ? -34.728 52.416 -18.099 1.00 64.13  ? 52  GLU A OE1  1 
ATOM   1017 O  OE2  . GLU B 2 52 ? -36.450 53.446 -17.318 1.00 63.67  ? 52  GLU A OE2  1 
ATOM   1018 H  H    . GLU B 2 52 ? -33.025 51.913 -16.933 1.00 71.43  ? 52  GLU A H    1 
ATOM   1019 H  HA   . GLU B 2 52 ? -33.462 51.013 -14.553 1.00 69.04  ? 52  GLU A HA   1 
ATOM   1020 H  HB2  . GLU B 2 52 ? -34.552 50.098 -16.990 1.00 71.17  ? 52  GLU A HB2  1 
ATOM   1021 H  HB3  . GLU B 2 52 ? -35.081 49.619 -15.578 1.00 71.17  ? 52  GLU A HB3  1 
ATOM   1022 H  HG2  . GLU B 2 52 ? -36.624 51.125 -16.101 1.00 73.09  ? 52  GLU A HG2  1 
ATOM   1023 H  HG3  . GLU B 2 52 ? -35.637 52.020 -15.243 1.00 73.09  ? 52  GLU A HG3  1 
ATOM   1024 N  N    . VAL B 2 53 ? -31.600 49.126 -16.293 1.00 56.49  ? 53  VAL A N    1 
ATOM   1025 C  CA   . VAL B 2 53 ? -30.728 47.949 -16.201 1.00 52.86  ? 53  VAL A CA   1 
ATOM   1026 C  C    . VAL B 2 53 ? -29.732 48.132 -15.062 1.00 51.46  ? 53  VAL A C    1 
ATOM   1027 O  O    . VAL B 2 53 ? -29.722 47.311 -14.126 1.00 48.35  ? 53  VAL A O    1 
ATOM   1028 C  CB   . VAL B 2 53 ? -29.966 47.699 -17.551 1.00 52.11  ? 53  VAL A CB   1 
ATOM   1029 C  CG1  . VAL B 2 53 ? -28.908 46.623 -17.435 1.00 51.35  ? 53  VAL A CG1  1 
ATOM   1030 C  CG2  . VAL B 2 53 ? -30.937 47.335 -18.657 1.00 54.15  ? 53  VAL A CG2  1 
ATOM   1031 H  H    . VAL B 2 53 ? -31.486 49.601 -17.001 1.00 67.79  ? 53  VAL A H    1 
ATOM   1032 H  HA   . VAL B 2 53 ? -31.268 47.167 -16.009 1.00 63.43  ? 53  VAL A HA   1 
ATOM   1033 H  HB   . VAL B 2 53 ? -29.521 48.521 -17.811 1.00 62.54  ? 53  VAL A HB   1 
ATOM   1034 H  HG11 . VAL B 2 53 ? -28.474 46.514 -18.295 1.00 61.62  ? 53  VAL A HG11 1 
ATOM   1035 H  HG12 . VAL B 2 53 ? -28.258 46.891 -16.767 1.00 61.62  ? 53  VAL A HG12 1 
ATOM   1036 H  HG13 . VAL B 2 53 ? -29.332 45.792 -17.170 1.00 61.62  ? 53  VAL A HG13 1 
ATOM   1037 H  HG21 . VAL B 2 53 ? -30.439 47.187 -19.476 1.00 64.98  ? 53  VAL A HG21 1 
ATOM   1038 H  HG22 . VAL B 2 53 ? -31.411 46.527 -18.407 1.00 64.98  ? 53  VAL A HG22 1 
ATOM   1039 H  HG23 . VAL B 2 53 ? -31.565 48.064 -18.778 1.00 64.98  ? 53  VAL A HG23 1 
ATOM   1040 N  N    . VAL B 2 54 ? -28.988 49.251 -15.105 1.00 53.41  ? 54  VAL A N    1 
ATOM   1041 C  CA   . VAL B 2 54 ? -28.046 49.719 -14.037 1.00 54.60  ? 54  VAL A CA   1 
ATOM   1042 C  C    . VAL B 2 54 ? -28.649 49.705 -12.623 1.00 50.26  ? 54  VAL A C    1 
ATOM   1043 O  O    . VAL B 2 54 ? -28.024 49.294 -11.654 1.00 47.00  ? 54  VAL A O    1 
ATOM   1044 C  CB   . VAL B 2 54 ? -27.560 51.168 -14.317 0.00 55.22  ? 54  VAL A CB   1 
ATOM   1045 C  CG1  . VAL B 2 54 ? -26.602 51.646 -13.231 0.00 54.12  ? 54  VAL A CG1  1 
ATOM   1046 C  CG2  . VAL B 2 54 ? -26.897 51.279 -15.675 0.00 55.51  ? 54  VAL A CG2  1 
ATOM   1047 H  H    . VAL B 2 54 ? -29.007 49.789 -15.775 1.00 64.09  ? 54  VAL A H    1 
ATOM   1048 H  HA   . VAL B 2 54 ? -27.267 49.140 -14.033 1.00 65.51  ? 54  VAL A HA   1 
ATOM   1049 H  HB   . VAL B 2 54 ? -28.329 51.760 -14.314 0.00 66.26  ? 54  VAL A HB   1 
ATOM   1050 H  HG11 . VAL B 2 54 ? -26.319 52.551 -13.436 0.00 64.94  ? 54  VAL A HG11 1 
ATOM   1051 H  HG12 . VAL B 2 54 ? -27.059 51.628 -12.376 0.00 64.94  ? 54  VAL A HG12 1 
ATOM   1052 H  HG13 . VAL B 2 54 ? -25.832 51.056 -13.208 0.00 64.94  ? 54  VAL A HG13 1 
ATOM   1053 H  HG21 . VAL B 2 54 ? -26.609 52.195 -15.812 0.00 66.61  ? 54  VAL A HG21 1 
ATOM   1054 H  HG22 . VAL B 2 54 ? -26.132 50.683 -15.702 0.00 66.61  ? 54  VAL A HG22 1 
ATOM   1055 H  HG23 . VAL B 2 54 ? -27.536 51.027 -16.360 0.00 66.61  ? 54  VAL A HG23 1 
ATOM   1056 N  N    . ASP B 2 55 ? -29.846 50.246 -12.514 1.00 51.13  ? 55  ASP A N    1 
ATOM   1057 C  CA   . ASP B 2 55 ? -30.572 50.228 -11.264 1.00 51.24  ? 55  ASP A CA   1 
ATOM   1058 C  C    . ASP B 2 55 ? -30.749 48.796 -10.804 1.00 50.53  ? 55  ASP A C    1 
ATOM   1059 O  O    . ASP B 2 55 ? -30.386 48.436 -9.699  1.00 49.09  ? 55  ASP A O    1 
ATOM   1060 C  CB   . ASP B 2 55 ? -31.948 50.848 -11.478 1.00 54.31  ? 55  ASP A CB   1 
ATOM   1061 C  CG   . ASP B 2 55 ? -31.872 52.274 -11.999 1.00 57.86  ? 55  ASP A CG   1 
ATOM   1062 O  OD1  . ASP B 2 55 ? -31.178 53.144 -11.414 1.00 58.65  ? 55  ASP A OD1  1 
ATOM   1063 O  OD2  . ASP B 2 55 ? -32.419 52.475 -13.094 1.00 59.76  ? 55  ASP A OD2  1 
ATOM   1064 H  H    . ASP B 2 55 ? -30.264 50.634 -13.158 1.00 61.35  ? 55  ASP A H    1 
ATOM   1065 H  HA   . ASP B 2 55 ? -30.093 50.729 -10.586 1.00 61.48  ? 55  ASP A HA   1 
ATOM   1066 H  HB2  . ASP B 2 55 ? -32.437 50.317 -12.126 1.00 65.17  ? 55  ASP A HB2  1 
ATOM   1067 H  HB3  . ASP B 2 55 ? -32.424 50.862 -10.633 1.00 65.17  ? 55  ASP A HB3  1 
ATOM   1068 N  N    . LYS B 2 56 ? -31.272 47.944 -11.680 1.00 50.71  ? 56  LYS A N    1 
ATOM   1069 C  CA   . LYS B 2 56 ? -31.538 46.580 -11.286 1.00 49.30  ? 56  LYS A CA   1 
ATOM   1070 C  C    . LYS B 2 56 ? -30.212 45.882 -10.952 1.00 47.62  ? 56  LYS A C    1 
ATOM   1071 O  O    . LYS B 2 56 ? -30.091 45.231 -9.922  1.00 46.18  ? 56  LYS A O    1 
ATOM   1072 C  CB   . LYS B 2 56 ? -32.334 45.864 -12.376 1.00 49.71  ? 56  LYS A CB   1 
ATOM   1073 C  CG   . LYS B 2 56 ? -33.774 46.336 -12.459 0.00 53.27  ? 56  LYS A CG   1 
ATOM   1074 C  CD   . LYS B 2 56 ? -34.555 45.926 -11.211 0.00 55.74  ? 56  LYS A CD   1 
ATOM   1075 C  CE   . LYS B 2 56 ? -35.937 46.529 -11.190 0.00 57.79  ? 56  LYS A CE   1 
ATOM   1076 N  NZ   . LYS B 2 56 ? -36.706 46.111 -9.986  0.00 58.77  ? 56  LYS A NZ   1 
ATOM   1077 H  H    . LYS B 2 56 ? -31.476 48.133 -12.494 1.00 60.85  ? 56  LYS A H    1 
ATOM   1078 H  HA   . LYS B 2 56 ? -32.080 46.587 -10.481 1.00 59.16  ? 56  LYS A HA   1 
ATOM   1079 H  HB2  . LYS B 2 56 ? -31.914 46.030 -13.234 1.00 59.65  ? 56  LYS A HB2  1 
ATOM   1080 H  HB3  . LYS B 2 56 ? -32.341 44.912 -12.188 1.00 59.65  ? 56  LYS A HB3  1 
ATOM   1081 H  HG2  . LYS B 2 56 ? -33.793 47.304 -12.527 0.00 63.92  ? 56  LYS A HG2  1 
ATOM   1082 H  HG3  . LYS B 2 56 ? -34.201 45.935 -13.232 0.00 63.92  ? 56  LYS A HG3  1 
ATOM   1083 H  HD2  . LYS B 2 56 ? -34.645 44.961 -11.194 0.00 66.89  ? 56  LYS A HD2  1 
ATOM   1084 H  HD3  . LYS B 2 56 ? -34.079 46.232 -10.423 0.00 66.89  ? 56  LYS A HD3  1 
ATOM   1085 H  HE2  . LYS B 2 56 ? -35.864 47.496 -11.181 0.00 69.35  ? 56  LYS A HE2  1 
ATOM   1086 H  HE3  . LYS B 2 56 ? -36.424 46.237 -11.976 0.00 69.35  ? 56  LYS A HE3  1 
ATOM   1087 H  HZ1  . LYS B 2 56 ? -36.792 45.225 -9.972  0.00 70.53  ? 56  LYS A HZ1  1 
ATOM   1088 H  HZ2  . LYS B 2 56 ? -36.281 46.372 -9.248  0.00 70.53  ? 56  LYS A HZ2  1 
ATOM   1089 H  HZ3  . LYS B 2 56 ? -37.516 46.480 -9.999  0.00 70.53  ? 56  LYS A HZ3  1 
ATOM   1090 N  N    . VAL B 2 57 ? -29.180 46.096 -11.748 1.00 46.86  ? 57  VAL A N    1 
ATOM   1091 C  CA   . VAL B 2 57 ? -27.903 45.474 -11.421 1.00 46.65  ? 57  VAL A CA   1 
ATOM   1092 C  C    . VAL B 2 57 ? -27.403 45.962 -10.063 1.00 44.82  ? 57  VAL A C    1 
ATOM   1093 O  O    . VAL B 2 57 ? -26.979 45.120 -9.234  1.00 44.30  ? 57  VAL A O    1 
ATOM   1094 C  CB   . VAL B 2 57 ? -26.831 45.741 -12.468 1.00 48.18  ? 57  VAL A CB   1 
ATOM   1095 C  CG1  . VAL B 2 57 ? -25.550 45.037 -12.077 1.00 52.90  ? 57  VAL A CG1  1 
ATOM   1096 C  CG2  . VAL B 2 57 ? -27.281 45.257 -13.809 1.00 50.73  ? 57  VAL A CG2  1 
ATOM   1097 H  H    . VAL B 2 57 ? -29.186 46.579 -12.459 1.00 56.23  ? 57  VAL A H    1 
ATOM   1098 H  HA   . VAL B 2 57 ? -28.029 44.514 -11.364 1.00 55.98  ? 57  VAL A HA   1 
ATOM   1099 H  HB   . VAL B 2 57 ? -26.657 46.694 -12.523 1.00 57.82  ? 57  VAL A HB   1 
ATOM   1100 H  HG11 . VAL B 2 57 ? -24.875 45.213 -12.750 1.00 63.49  ? 57  VAL A HG11 1 
ATOM   1101 H  HG12 . VAL B 2 57 ? -25.256 45.372 -11.216 1.00 63.49  ? 57  VAL A HG12 1 
ATOM   1102 H  HG13 . VAL B 2 57 ? -25.720 44.083 -12.020 1.00 63.49  ? 57  VAL A HG13 1 
ATOM   1103 H  HG21 . VAL B 2 57 ? -26.584 45.437 -14.459 1.00 60.87  ? 57  VAL A HG21 1 
ATOM   1104 H  HG22 . VAL B 2 57 ? -27.449 44.303 -13.759 1.00 60.87  ? 57  VAL A HG22 1 
ATOM   1105 H  HG23 . VAL B 2 57 ? -28.093 45.725 -14.056 1.00 60.87  ? 57  VAL A HG23 1 
ATOM   1106 N  N    . MET B 2 58 ? -27.424 47.284 -9.823  1.00 43.67  ? 58  MET A N    1 
ATOM   1107 C  CA   . MET B 2 58 ? -26.993 47.815 -8.520  1.00 42.73  ? 58  MET A CA   1 
ATOM   1108 C  C    . MET B 2 58 ? -27.824 47.290 -7.334  1.00 44.53  ? 58  MET A C    1 
ATOM   1109 O  O    . MET B 2 58 ? -27.259 46.873 -6.279  1.00 40.88  ? 58  MET A O    1 
ATOM   1110 C  CB   . MET B 2 58 ? -27.032 49.344 -8.506  1.00 42.00  ? 58  MET A CB   1 
ATOM   1111 C  CG   . MET B 2 58 ? -26.510 49.967 -7.218  1.00 39.79  ? 58  MET A CG   1 
ATOM   1112 S  SD   . MET B 2 58 ? -24.758 49.567 -6.979  1.00 37.75  ? 58  MET A SD   1 
ATOM   1113 C  CE   . MET B 2 58 ? -23.945 50.908 -7.901  1.00 39.97  ? 58  MET A CE   1 
ATOM   1114 H  H    . MET B 2 58 ? -27.678 47.882 -10.387 1.00 52.40  ? 58  MET A H    1 
ATOM   1115 H  HA   . MET B 2 58 ? -26.069 47.552 -8.380  1.00 51.28  ? 58  MET A HA   1 
ATOM   1116 H  HB2  . MET B 2 58 ? -26.488 49.676 -9.237  1.00 50.40  ? 58  MET A HB2  1 
ATOM   1117 H  HB3  . MET B 2 58 ? -27.950 49.633 -8.623  1.00 50.40  ? 58  MET A HB3  1 
ATOM   1118 H  HG2  . MET B 2 58 ? -26.600 50.932 -7.266  1.00 47.75  ? 58  MET A HG2  1 
ATOM   1119 H  HG3  . MET B 2 58 ? -27.010 49.617 -6.464  1.00 47.75  ? 58  MET A HG3  1 
ATOM   1120 H  HE1  . MET B 2 58 ? -22.983 50.793 -7.841  1.00 47.96  ? 58  MET A HE1  1 
ATOM   1121 H  HE2  . MET B 2 58 ? -24.226 50.868 -8.829  1.00 47.96  ? 58  MET A HE2  1 
ATOM   1122 H  HE3  . MET B 2 58 ? -24.202 51.758 -7.513  1.00 47.96  ? 58  MET A HE3  1 
ATOM   1123 N  N    . GLU B 2 59 ? -29.151 47.238 -7.531  1.00 48.69  ? 59  GLU A N    1 
ATOM   1124 C  CA   . GLU B 2 59 ? -30.051 46.695 -6.518  1.00 48.25  ? 59  GLU A CA   1 
ATOM   1125 C  C    . GLU B 2 59 ? -29.604 45.251 -6.142  1.00 44.66  ? 59  GLU A C    1 
ATOM   1126 O  O    . GLU B 2 59 ? -29.542 44.918 -4.948  1.00 43.34  ? 59  GLU A O    1 
ATOM   1127 C  CB   . GLU B 2 59 ? -31.504 46.709 -7.023  1.00 50.64  ? 59  GLU A CB   1 
ATOM   1128 C  CG   . GLU B 2 59 ? -32.167 48.074 -6.936  0.00 52.63  ? 59  GLU A CG   1 
ATOM   1129 C  CD   . GLU B 2 59 ? -33.577 48.069 -7.486  0.00 56.19  ? 59  GLU A CD   1 
ATOM   1130 O  OE1  . GLU B 2 59 ? -34.259 47.029 -7.367  0.00 57.81  ? 59  GLU A OE1  1 
ATOM   1131 O  OE2  . GLU B 2 59 ? -34.003 49.103 -8.042  0.00 56.50  ? 59  GLU A OE2  1 
ATOM   1132 H  H    . GLU B 2 59 ? -29.548 47.512 -8.243  1.00 58.43  ? 59  GLU A H    1 
ATOM   1133 H  HA   . GLU B 2 59 ? -30.002 47.245 -5.720  1.00 57.90  ? 59  GLU A HA   1 
ATOM   1134 H  HB2  . GLU B 2 59 ? -31.515 46.433 -7.953  1.00 60.77  ? 59  GLU A HB2  1 
ATOM   1135 H  HB3  . GLU B 2 59 ? -32.027 46.090 -6.490  1.00 60.77  ? 59  GLU A HB3  1 
ATOM   1136 H  HG2  . GLU B 2 59 ? -32.208 48.347 -6.006  0.00 63.15  ? 59  GLU A HG2  1 
ATOM   1137 H  HG3  . GLU B 2 59 ? -31.646 48.712 -7.447  0.00 63.15  ? 59  GLU A HG3  1 
ATOM   1138 N  N    . THR B 2 60 ? -29.190 44.451 -7.128  1.00 42.69  ? 60  THR A N    1 
ATOM   1139 C  CA   . THR B 2 60 ? -28.751 43.080 -6.847  1.00 42.96  ? 60  THR A CA   1 
ATOM   1140 C  C    . THR B 2 60 ? -27.497 43.090 -6.013  1.00 42.68  ? 60  THR A C    1 
ATOM   1141 O  O    . THR B 2 60 ? -27.349 42.323 -5.075  1.00 44.61  ? 60  THR A O    1 
ATOM   1142 C  CB   . THR B 2 60 ? -28.469 42.275 -8.147  1.00 46.50  ? 60  THR A CB   1 
ATOM   1143 O  OG1  . THR B 2 60 ? -29.599 42.315 -9.041  1.00 47.97  ? 60  THR A OG1  1 
ATOM   1144 C  CG2  . THR B 2 60 ? -28.088 40.848 -7.840  1.00 46.47  ? 60  THR A CG2  1 
ATOM   1145 H  H    . THR B 2 60 ? -29.153 44.674 -7.958  1.00 51.23  ? 60  THR A H    1 
ATOM   1146 H  HA   . THR B 2 60 ? -29.443 42.619 -6.349  1.00 51.55  ? 60  THR A HA   1 
ATOM   1147 H  HB   . THR B 2 60 ? -27.712 42.683 -8.597  1.00 55.79  ? 60  THR A HB   1 
ATOM   1148 H  HG1  . THR B 2 60 ? -29.769 43.109 -9.255  1.00 57.57  ? 60  THR A HG1  1 
ATOM   1149 H  HG21 . THR B 2 60 ? -27.288 40.829 -7.292  1.00 55.76  ? 60  THR A HG21 1 
ATOM   1150 H  HG22 . THR B 2 60 ? -28.808 40.408 -7.362  1.00 55.76  ? 60  THR A HG22 1 
ATOM   1151 H  HG23 . THR B 2 60 ? -27.917 40.366 -8.665  1.00 55.76  ? 60  THR A HG23 1 
ATOM   1152 N  N    . LEU B 2 61 ? -26.572 43.959 -6.377  1.00 42.86  ? 61  LEU A N    1 
ATOM   1153 C  CA   . LEU B 2 61 ? -25.249 43.971 -5.778  1.00 40.95  ? 61  LEU A CA   1 
ATOM   1154 C  C    . LEU B 2 61 ? -25.203 44.695 -4.436  1.00 44.75  ? 61  LEU A C    1 
ATOM   1155 O  O    . LEU B 2 61 ? -24.423 44.337 -3.569  1.00 45.09  ? 61  LEU A O    1 
ATOM   1156 C  CB   . LEU B 2 61 ? -24.279 44.605 -6.785  1.00 43.35  ? 61  LEU A CB   1 
ATOM   1157 C  CG   . LEU B 2 61 ? -24.169 43.836 -8.112  1.00 42.74  ? 61  LEU A CG   1 
ATOM   1158 C  CD1  . LEU B 2 61 ? -23.304 44.449 -9.216  1.00 40.21  ? 61  LEU A CD1  1 
ATOM   1159 C  CD2  . LEU B 2 61 ? -23.642 42.501 -7.795  1.00 40.88  ? 61  LEU A CD2  1 
ATOM   1160 H  H    . LEU B 2 61 ? -26.686 44.562 -6.980  1.00 51.44  ? 61  LEU A H    1 
ATOM   1161 H  HA   . LEU B 2 61 ? -24.965 43.056 -5.629  1.00 49.14  ? 61  LEU A HA   1 
ATOM   1162 H  HB2  . LEU B 2 61 ? -24.582 45.503 -6.988  1.00 52.02  ? 61  LEU A HB2  1 
ATOM   1163 H  HB3  . LEU B 2 61 ? -23.395 44.638 -6.388  1.00 52.02  ? 61  LEU A HB3  1 
ATOM   1164 H  HG   . LEU B 2 61 ? -25.062 43.718 -8.473  1.00 51.29  ? 61  LEU A HG   1 
ATOM   1165 H  HD11 . LEU B 2 61 ? -23.322 43.866 -9.991  1.00 48.26  ? 61  LEU A HD11 1 
ATOM   1166 H  HD12 . LEU B 2 61 ? -23.660 45.320 -9.449  1.00 48.26  ? 61  LEU A HD12 1 
ATOM   1167 H  HD13 . LEU B 2 61 ? -22.394 44.539 -8.891  1.00 48.26  ? 61  LEU A HD13 1 
ATOM   1168 H  HD21 . LEU B 2 61 ? -23.562 41.990 -8.615  1.00 49.06  ? 61  LEU A HD21 1 
ATOM   1169 H  HD22 . LEU B 2 61 ? -22.772 42.597 -7.377  1.00 49.06  ? 61  LEU A HD22 1 
ATOM   1170 H  HD23 . LEU B 2 61 ? -24.254 42.057 -7.187  1.00 49.06  ? 61  LEU A HD23 1 
ATOM   1171 N  N    . ASP B 2 62 ? -25.995 45.758 -4.269  1.00 45.94  ? 62  ASP A N    1 
ATOM   1172 C  CA   . ASP B 2 62 ? -25.921 46.563 -3.050  1.00 47.81  ? 62  ASP A CA   1 
ATOM   1173 C  C    . ASP B 2 62 ? -26.566 45.794 -1.908  1.00 51.87  ? 62  ASP A C    1 
ATOM   1174 O  O    . ASP B 2 62 ? -27.761 45.910 -1.671  1.00 55.73  ? 62  ASP A O    1 
ATOM   1175 C  CB   . ASP B 2 62 ? -26.572 47.935 -3.337  1.00 48.17  ? 62  ASP A CB   1 
ATOM   1176 C  CG   . ASP B 2 62 ? -26.626 48.882 -2.133  1.00 48.72  ? 62  ASP A CG   1 
ATOM   1177 O  OD1  . ASP B 2 62 ? -25.737 48.903 -1.272  1.00 48.68  ? 62  ASP A OD1  1 
ATOM   1178 O  OD2  . ASP B 2 62 ? -27.640 49.596 -2.046  1.00 50.26  ? 62  ASP A OD2  1 
ATOM   1179 H  H    . ASP B 2 62 ? -26.577 46.030 -4.841  1.00 55.13  ? 62  ASP A H    1 
ATOM   1180 H  HA   . ASP B 2 62 ? -24.989 46.713 -2.824  1.00 57.38  ? 62  ASP A HA   1 
ATOM   1181 H  HB2  . ASP B 2 62 ? -26.065 48.378 -4.036  1.00 57.80  ? 62  ASP A HB2  1 
ATOM   1182 H  HB3  . ASP B 2 62 ? -27.483 47.789 -3.637  1.00 57.80  ? 62  ASP A HB3  1 
ATOM   1183 N  N    . ASN B 2 63 ? -25.754 45.076 -1.139  1.00 53.15  ? 63  ASN A N    1 
ATOM   1184 C  CA   . ASN B 2 63 ? -26.271 44.253 -0.053  1.00 55.13  ? 63  ASN A CA   1 
ATOM   1185 C  C    . ASN B 2 63 ? -26.208 44.980 1.279   1.00 58.36  ? 63  ASN A C    1 
ATOM   1186 O  O    . ASN B 2 63 ? -26.805 44.512 2.255   1.00 67.78  ? 63  ASN A O    1 
ATOM   1187 C  CB   . ASN B 2 63 ? -25.553 42.902 0.003   1.00 58.19  ? 63  ASN A CB   1 
ATOM   1188 C  CG   . ASN B 2 63 ? -26.000 41.979 -1.137  1.00 63.73  ? 63  ASN A CG   1 
ATOM   1189 O  OD1  . ASN B 2 63 ? -27.104 42.141 -1.677  1.00 59.15  ? 63  ASN A OD1  1 
ATOM   1190 N  ND2  . ASN B 2 63 ? -25.146 41.024 -1.521  1.00 68.74  ? 63  ASN A ND2  1 
ATOM   1191 H  H    . ASN B 2 63 ? -24.899 45.048 -1.226  1.00 63.78  ? 63  ASN A H    1 
ATOM   1192 H  HA   . ASN B 2 63 ? -27.206 44.071 -0.234  1.00 66.15  ? 63  ASN A HA   1 
ATOM   1193 H  HB2  . ASN B 2 63 ? -24.597 43.044 -0.078  1.00 69.82  ? 63  ASN A HB2  1 
ATOM   1194 H  HB3  . ASN B 2 63 ? -25.758 42.466 0.845   1.00 69.82  ? 63  ASN A HB3  1 
ATOM   1195 H  HD21 . ASN B 2 63 ? -25.359 40.486 -2.157  1.00 82.49  ? 63  ASN A HD21 1 
ATOM   1196 H  HD22 . ASN B 2 63 ? -24.383 40.949 -1.131  1.00 82.49  ? 63  ASN A HD22 1 
ATOM   1197 N  N    . ASP B 2 64 ? -25.477 46.093 1.344   1.00 57.02  ? 64  ASP A N    1 
ATOM   1198 C  CA   . ASP B 2 64 ? -25.535 46.946 2.527   1.00 55.16  ? 64  ASP A CA   1 
ATOM   1199 C  C    . ASP B 2 64 ? -26.402 48.170 2.243   1.00 54.05  ? 64  ASP A C    1 
ATOM   1200 O  O    . ASP B 2 64 ? -26.509 49.040 3.072   1.00 57.91  ? 64  ASP A O    1 
ATOM   1201 C  CB   . ASP B 2 64 ? -24.118 47.328 3.040   1.00 52.07  ? 64  ASP A CB   1 
ATOM   1202 C  CG   . ASP B 2 64 ? -23.233 48.012 1.988   1.00 50.84  ? 64  ASP A CG   1 
ATOM   1203 O  OD1  . ASP B 2 64 ? -23.696 48.889 1.255   1.00 48.49  ? 64  ASP A OD1  1 
ATOM   1204 O  OD2  . ASP B 2 64 ? -22.018 47.666 1.911   1.00 56.11  ? 64  ASP A OD2  1 
ATOM   1205 H  H    . ASP B 2 64 ? -24.948 46.371 0.726   1.00 68.42  ? 64  ASP A H    1 
ATOM   1206 H  HA   . ASP B 2 64 ? -25.969 46.448 3.237   1.00 66.20  ? 64  ASP A HA   1 
ATOM   1207 H  HB2  . ASP B 2 64 ? -24.212 47.938 3.788   1.00 62.48  ? 64  ASP A HB2  1 
ATOM   1208 H  HB3  . ASP B 2 64 ? -23.664 46.522 3.329   1.00 62.48  ? 64  ASP A HB3  1 
ATOM   1209 N  N    . GLY B 2 65 ? -27.122 48.192 1.127   1.00 52.45  ? 65  GLY A N    1 
ATOM   1210 C  CA   . GLY B 2 65 ? -28.084 49.262 0.907   1.00 52.07  ? 65  GLY A CA   1 
ATOM   1211 C  C    . GLY B 2 65 ? -27.577 50.698 0.674   1.00 52.22  ? 65  GLY A C    1 
ATOM   1212 O  O    . GLY B 2 65 ? -28.370 51.623 0.606   1.00 53.18  ? 65  GLY A O    1 
ATOM   1213 H  H    . GLY B 2 65 ? -27.074 47.612 0.495   1.00 62.94  ? 65  GLY A H    1 
ATOM   1214 H  HA2  . GLY B 2 65 ? -28.623 49.025 0.137   1.00 62.48  ? 65  GLY A HA2  1 
ATOM   1215 H  HA3  . GLY B 2 65 ? -28.676 49.293 1.674   1.00 62.48  ? 65  GLY A HA3  1 
ATOM   1216 N  N    . ASP B 2 66 ? -26.281 50.932 0.579   1.00 49.93  ? 66  ASP A N    1 
ATOM   1217 C  CA   . ASP B 2 66 ? -25.817 52.322 0.415   1.00 49.30  ? 66  ASP A CA   1 
ATOM   1218 C  C    . ASP B 2 66 ? -25.881 52.921 -1.023  1.00 46.85  ? 66  ASP A C    1 
ATOM   1219 O  O    . ASP B 2 66 ? -25.509 54.081 -1.266  1.00 46.40  ? 66  ASP A O    1 
ATOM   1220 C  CB   . ASP B 2 66 ? -24.403 52.414 0.990   1.00 48.41  ? 66  ASP A CB   1 
ATOM   1221 C  CG   . ASP B 2 66 ? -23.364 51.765 0.140   1.00 46.78  ? 66  ASP A CG   1 
ATOM   1222 O  OD1  . ASP B 2 66 ? -23.679 51.137 -0.887  1.00 45.18  ? 66  ASP A OD1  1 
ATOM   1223 O  OD2  . ASP B 2 66 ? -22.202 51.854 0.582   1.00 56.40  ? 66  ASP A OD2  1 
ATOM   1224 H  H    . ASP B 2 66 ? -25.661 50.337 0.605   1.00 59.92  ? 66  ASP A H    1 
ATOM   1225 H  HA   . ASP B 2 66 ? -26.379 52.884 0.971   1.00 59.16  ? 66  ASP A HA   1 
ATOM   1226 H  HB2  . ASP B 2 66 ? -24.165 53.350 1.086   1.00 58.10  ? 66  ASP A HB2  1 
ATOM   1227 H  HB3  . ASP B 2 66 ? -24.389 51.981 1.857   1.00 58.10  ? 66  ASP A HB3  1 
ATOM   1228 N  N    . GLY B 2 67 ? -26.384 52.128 -1.952  1.00 45.80  ? 67  GLY A N    1 
ATOM   1229 C  CA   . GLY B 2 67 ? -26.624 52.537 -3.321  1.00 43.30  ? 67  GLY A CA   1 
ATOM   1230 C  C    . GLY B 2 67 ? -25.406 52.361 -4.178  1.00 43.63  ? 67  GLY A C    1 
ATOM   1231 O  O    . GLY B 2 67 ? -25.459 52.581 -5.388  1.00 42.93  ? 67  GLY A O    1 
ATOM   1232 H  H    . GLY B 2 67 ? -26.603 51.310 -1.805  1.00 54.96  ? 67  GLY A H    1 
ATOM   1233 H  HA2  . GLY B 2 67 ? -27.346 52.008 -3.696  1.00 51.96  ? 67  GLY A HA2  1 
ATOM   1234 H  HA3  . GLY B 2 67 ? -26.883 53.472 -3.340  1.00 51.96  ? 67  GLY A HA3  1 
ATOM   1235 N  N    . GLU B 2 68 ? -24.317 51.899 -3.564  1.00 44.59  ? 68  GLU A N    1 
ATOM   1236 C  CA   . GLU B 2 68 ? -23.084 51.703 -4.295  1.00 44.23  ? 68  GLU A CA   1 
ATOM   1237 C  C    . GLU B 2 68 ? -22.497 50.282 -4.138  1.00 41.96  ? 68  GLU A C    1 
ATOM   1238 O  O    . GLU B 2 68 ? -22.863 49.498 -3.240  1.00 43.06  ? 68  GLU A O    1 
ATOM   1239 C  CB   . GLU B 2 68 ? -22.068 52.767 -3.827  1.00 45.62  ? 68  GLU A CB   1 
ATOM   1240 C  CG   . GLU B 2 68 ? -22.563 54.200 -4.083  1.00 48.39  ? 68  GLU A CG   1 
ATOM   1241 C  CD   . GLU B 2 68 ? -21.455 55.246 -4.210  1.00 54.99  ? 68  GLU A CD   1 
ATOM   1242 O  OE1  . GLU B 2 68 ? -20.358 54.953 -4.771  1.00 47.23  ? 68  GLU A OE1  1 
ATOM   1243 O  OE2  . GLU B 2 68 ? -21.709 56.376 -3.719  1.00 55.51  ? 68  GLU A OE2  1 
ATOM   1244 H  H    . GLU B 2 68 ? -24.273 51.695 -2.729  1.00 53.51  ? 68  GLU A H    1 
ATOM   1245 H  HA   . GLU B 2 68 ? -23.255 51.850 -5.239  1.00 53.07  ? 68  GLU A HA   1 
ATOM   1246 H  HB2  . GLU B 2 68 ? -21.918 52.665 -2.874  1.00 54.74  ? 68  GLU A HB2  1 
ATOM   1247 H  HB3  . GLU B 2 68 ? -21.235 52.644 -4.310  1.00 54.74  ? 68  GLU A HB3  1 
ATOM   1248 H  HG2  . GLU B 2 68 ? -23.071 54.209 -4.910  1.00 58.07  ? 68  GLU A HG2  1 
ATOM   1249 H  HG3  . GLU B 2 68 ? -23.134 54.467 -3.347  1.00 58.07  ? 68  GLU A HG3  1 
ATOM   1250 N  N    . CYS B 2 69 ? -21.525 50.003 -4.996  1.00 41.16  ? 69  CYS A N    1 
ATOM   1251 C  CA   . CYS B 2 69 ? -20.822 48.756 -4.966  1.00 39.80  ? 69  CYS A CA   1 
ATOM   1252 C  C    . CYS B 2 69 ? -19.382 48.958 -4.452  1.00 39.34  ? 69  CYS A C    1 
ATOM   1253 O  O    . CYS B 2 69 ? -18.496 49.469 -5.152  1.00 37.47  ? 69  CYS A O    1 
ATOM   1254 C  CB   . CYS B 2 69 ? -20.829 48.118 -6.379  1.00 39.74  ? 69  CYS A CB   1 
ATOM   1255 S  SG   . CYS B 2 69 ? -20.081 46.513 -6.381  1.00 43.33  ? 69  CYS A SG   1 
ATOM   1256 H  H    . CYS B 2 69 ? -21.256 50.538 -5.613  1.00 49.39  ? 69  CYS A H    1 
ATOM   1257 H  HA   . CYS B 2 69 ? -21.276 48.150 -4.360  1.00 47.75  ? 69  CYS A HA   1 
ATOM   1258 H  HB2  . CYS B 2 69 ? -21.746 48.026 -6.683  1.00 47.69  ? 69  CYS A HB2  1 
ATOM   1259 H  HB3  . CYS B 2 69 ? -20.331 48.686 -6.988  1.00 47.69  ? 69  CYS A HB3  1 
ATOM   1260 H  HG   . CYS B 2 69 ? -20.114 46.068 -7.495  1.00 52.00  ? 69  CYS A HG   1 
ATOM   1261 N  N    . ASP B 2 70 ? -19.163 48.498 -3.236  1.00 40.36  ? 70  ASP A N    1 
ATOM   1262 C  CA   . ASP B 2 70 ? -17.846 48.474 -2.639  1.00 40.64  ? 70  ASP A CA   1 
ATOM   1263 C  C    . ASP B 2 70 ? -17.104 47.260 -3.231  1.00 37.84  ? 70  ASP A C    1 
ATOM   1264 O  O    . ASP B 2 70 ? -17.639 46.518 -4.072  1.00 37.59  ? 70  ASP A O    1 
ATOM   1265 C  CB   . ASP B 2 70 ? -17.954 48.405 -1.107  1.00 42.30  ? 70  ASP A CB   1 
ATOM   1266 C  CG   . ASP B 2 70 ? -18.728 47.176 -0.629  1.00 43.73  ? 70  ASP A CG   1 
ATOM   1267 O  OD1  . ASP B 2 70 ? -18.648 46.107 -1.274  1.00 42.07  ? 70  ASP A OD1  1 
ATOM   1268 O  OD2  . ASP B 2 70 ? -19.461 47.299 0.372   1.00 49.13  ? 70  ASP A OD2  1 
ATOM   1269 H  H    . ASP B 2 70 ? -19.779 48.186 -2.723  1.00 48.43  ? 70  ASP A H    1 
ATOM   1270 H  HA   . ASP B 2 70 ? -17.364 49.281 -2.880  1.00 48.77  ? 70  ASP A HA   1 
ATOM   1271 H  HB2  . ASP B 2 70 ? -17.062 48.364 -0.728  1.00 50.76  ? 70  ASP A HB2  1 
ATOM   1272 H  HB3  . ASP B 2 70 ? -18.417 49.195 -0.786  1.00 50.76  ? 70  ASP A HB3  1 
ATOM   1273 N  N    . PHE B 2 71 ? -15.878 47.075 -2.797  1.00 37.72  ? 71  PHE A N    1 
ATOM   1274 C  CA   . PHE B 2 71 ? -15.084 46.048 -3.390  1.00 37.96  ? 71  PHE A CA   1 
ATOM   1275 C  C    . PHE B 2 71 ? -15.596 44.617 -3.179  1.00 37.45  ? 71  PHE A C    1 
ATOM   1276 O  O    . PHE B 2 71 ? -15.638 43.845 -4.127  1.00 35.80  ? 71  PHE A O    1 
ATOM   1277 C  CB   . PHE B 2 71 ? -13.628 46.137 -2.882  1.00 36.72  ? 71  PHE A CB   1 
ATOM   1278 C  CG   . PHE B 2 71 ? -12.746 45.184 -3.575  1.00 37.87  ? 71  PHE A CG   1 
ATOM   1279 C  CD1  . PHE B 2 71 ? -12.323 45.442 -4.887  1.00 38.09  ? 71  PHE A CD1  1 
ATOM   1280 C  CD2  . PHE B 2 71 ? -12.434 43.957 -2.966  1.00 39.38  ? 71  PHE A CD2  1 
ATOM   1281 C  CE1  . PHE B 2 71 ? -11.550 44.499 -5.553  1.00 38.10  ? 71  PHE A CE1  1 
ATOM   1282 C  CE2  . PHE B 2 71 ? -11.707 43.035 -3.604  1.00 41.10  ? 71  PHE A CE2  1 
ATOM   1283 C  CZ   . PHE B 2 71 ? -11.238 43.287 -4.907  1.00 40.79  ? 71  PHE A CZ   1 
ATOM   1284 H  H    . PHE B 2 71 ? -15.494 47.524 -2.172  1.00 45.26  ? 71  PHE A H    1 
ATOM   1285 H  HA   . PHE B 2 71 ? -15.062 46.202 -4.347  1.00 45.55  ? 71  PHE A HA   1 
ATOM   1286 H  HB2  . PHE B 2 71 ? -13.290 47.033 -3.040  1.00 44.07  ? 71  PHE A HB2  1 
ATOM   1287 H  HB3  . PHE B 2 71 ? -13.608 45.934 -1.934  1.00 44.07  ? 71  PHE A HB3  1 
ATOM   1288 H  HD1  . PHE B 2 71 ? -12.542 46.245 -5.302  1.00 45.71  ? 71  PHE A HD1  1 
ATOM   1289 H  HD2  . PHE B 2 71 ? -12.746 43.780 -2.108  1.00 47.26  ? 71  PHE A HD2  1 
ATOM   1290 H  HE1  . PHE B 2 71 ? -11.243 44.666 -6.415  1.00 45.72  ? 71  PHE A HE1  1 
ATOM   1291 H  HE2  . PHE B 2 71 ? -11.487 42.238 -3.176  1.00 49.32  ? 71  PHE A HE2  1 
ATOM   1292 H  HZ   . PHE B 2 71 ? -10.713 42.654 -5.340  1.00 48.95  ? 71  PHE A HZ   1 
ATOM   1293 N  N    . GLN B 2 72 ? -16.005 44.264 -1.976  1.00 38.19  ? 72  GLN A N    1 
ATOM   1294 C  CA   . GLN B 2 72 ? -16.441 42.885 -1.717  1.00 40.28  ? 72  GLN A CA   1 
ATOM   1295 C  C    . GLN B 2 72 ? -17.713 42.666 -2.519  1.00 38.21  ? 72  GLN A C    1 
ATOM   1296 O  O    . GLN B 2 72 ? -17.917 41.613 -3.128  1.00 36.86  ? 72  GLN A O    1 
ATOM   1297 C  CB   . GLN B 2 72 ? -16.634 42.625 -0.227  1.00 44.39  ? 72  GLN A CB   1 
ATOM   1298 C  CG   . GLN B 2 72 ? -15.938 41.340 0.280   1.00 54.24  ? 72  GLN A CG   1 
ATOM   1299 C  CD   . GLN B 2 72 ? -16.258 41.069 1.743   1.00 62.41  ? 72  GLN A CD   1 
ATOM   1300 O  OE1  . GLN B 2 72 ? -17.188 41.678 2.289   1.00 66.66  ? 72  GLN A OE1  1 
ATOM   1301 N  NE2  . GLN B 2 72 ? -15.471 40.193 2.398   1.00 56.89  ? 72  GLN A NE2  1 
ATOM   1302 H  H    . GLN B 2 72 ? -16.044 44.787 -1.295  1.00 45.83  ? 72  GLN A H    1 
ATOM   1303 H  HA   . GLN B 2 72 ? -15.766 42.271 -2.045  1.00 48.34  ? 72  GLN A HA   1 
ATOM   1304 H  HB2  . GLN B 2 72 ? -16.272 43.375 0.270   1.00 53.27  ? 72  GLN A HB2  1 
ATOM   1305 H  HB3  . GLN B 2 72 ? -17.583 42.539 -0.046  1.00 53.27  ? 72  GLN A HB3  1 
ATOM   1306 H  HG2  . GLN B 2 72 ? -16.244 40.583 -0.244  1.00 65.08  ? 72  GLN A HG2  1 
ATOM   1307 H  HG3  . GLN B 2 72 ? -14.977 41.441 0.193   1.00 65.08  ? 72  GLN A HG3  1 
ATOM   1308 H  HE21 . GLN B 2 72 ? -15.622 40.014 3.226   1.00 68.27  ? 72  GLN A HE21 1 
ATOM   1309 H  HE22 . GLN B 2 72 ? -14.818 39.811 1.988   1.00 68.27  ? 72  GLN A HE22 1 
ATOM   1310 N  N    . GLU B 2 73 ? -18.536 43.706 -2.599  1.00 39.30  ? 73  GLU A N    1 
ATOM   1311 C  CA   . GLU B 2 73 ? -19.732 43.588 -3.372  1.00 38.48  ? 73  GLU A CA   1 
ATOM   1312 C  C    . GLU B 2 73 ? -19.293 43.370 -4.820  1.00 36.65  ? 73  GLU A C    1 
ATOM   1313 O  O    . GLU B 2 73 ? -19.928 42.626 -5.544  1.00 40.51  ? 73  GLU A O    1 
ATOM   1314 C  CB   . GLU B 2 73 ? -20.642 44.825 -3.232  1.00 41.99  ? 73  GLU A CB   1 
ATOM   1315 C  CG   . GLU B 2 73 ? -21.426 44.840 -1.913  1.00 45.29  ? 73  GLU A CG   1 
ATOM   1316 C  CD   . GLU B 2 73 ? -21.986 46.204 -1.500  1.00 45.62  ? 73  GLU A CD   1 
ATOM   1317 O  OE1  . GLU B 2 73 ? -21.547 47.233 -2.068  1.00 42.74  ? 73  GLU A OE1  1 
ATOM   1318 O  OE2  . GLU B 2 73 ? -22.821 46.216 -0.558  1.00 47.85  ? 73  GLU A OE2  1 
ATOM   1319 H  H    . GLU B 2 73 ? -18.417 44.469 -2.219  1.00 47.16  ? 73  GLU A H    1 
ATOM   1320 H  HA   . GLU B 2 73 ? -20.228 42.807 -3.081  1.00 46.17  ? 73  GLU A HA   1 
ATOM   1321 H  HB2  . GLU B 2 73 ? -20.094 45.625 -3.264  1.00 50.39  ? 73  GLU A HB2  1 
ATOM   1322 H  HB3  . GLU B 2 73 ? -21.281 44.831 -3.961  1.00 50.39  ? 73  GLU A HB3  1 
ATOM   1323 H  HG2  . GLU B 2 73 ? -22.176 44.230 -1.994  1.00 54.35  ? 73  GLU A HG2  1 
ATOM   1324 H  HG3  . GLU B 2 73 ? -20.839 44.539 -1.202  1.00 54.35  ? 73  GLU A HG3  1 
ATOM   1325 N  N    . PHE B 2 74 ? -18.189 43.979 -5.231  1.00 34.82  ? 74  PHE A N    1 
ATOM   1326 C  CA   . PHE B 2 74 ? -17.723 43.843 -6.596  1.00 34.27  ? 74  PHE A CA   1 
ATOM   1327 C  C    . PHE B 2 74 ? -17.203 42.417 -6.897  1.00 34.70  ? 74  PHE A C    1 
ATOM   1328 O  O    . PHE B 2 74 ? -17.382 41.942 -7.990  1.00 32.47  ? 74  PHE A O    1 
ATOM   1329 C  CB   . PHE B 2 74 ? -16.644 44.919 -6.896  1.00 32.94  ? 74  PHE A CB   1 
ATOM   1330 C  CG   . PHE B 2 74 ? -15.967 44.750 -8.240  1.00 31.47  ? 74  PHE A CG   1 
ATOM   1331 C  CD1  . PHE B 2 74 ? -16.641 45.022 -9.419  1.00 31.06  ? 74  PHE A CD1  1 
ATOM   1332 C  CD2  . PHE B 2 74 ? -14.673 44.258 -8.315  1.00 31.74  ? 74  PHE A CD2  1 
ATOM   1333 C  CE1  . PHE B 2 74 ? -16.030 44.834 -10.657 1.00 31.57  ? 74  PHE A CE1  1 
ATOM   1334 C  CE2  . PHE B 2 74 ? -14.042 44.092 -9.537  1.00 31.14  ? 74  PHE A CE2  1 
ATOM   1335 C  CZ   . PHE B 2 74 ? -14.713 44.382 -10.705 1.00 31.45  ? 74  PHE A CZ   1 
ATOM   1336 H  H    . PHE B 2 74 ? -17.692 44.477 -4.736  1.00 41.78  ? 74  PHE A H    1 
ATOM   1337 H  HA   . PHE B 2 74 ? -18.471 44.009 -7.192  1.00 41.12  ? 74  PHE A HA   1 
ATOM   1338 H  HB2  . PHE B 2 74 ? -17.063 45.794 -6.883  1.00 39.53  ? 74  PHE A HB2  1 
ATOM   1339 H  HB3  . PHE B 2 74 ? -15.959 44.873 -6.211  1.00 39.53  ? 74  PHE A HB3  1 
ATOM   1340 H  HD1  . PHE B 2 74 ? -17.516 45.335 -9.384  1.00 37.27  ? 74  PHE A HD1  1 
ATOM   1341 H  HD2  . PHE B 2 74 ? -14.208 44.072 -7.532  1.00 38.09  ? 74  PHE A HD2  1 
ATOM   1342 H  HE1  . PHE B 2 74 ? -16.485 45.038 -11.441 1.00 37.89  ? 74  PHE A HE1  1 
ATOM   1343 H  HE2  . PHE B 2 74 ? -13.169 43.774 -9.570  1.00 37.36  ? 74  PHE A HE2  1 
ATOM   1344 H  HZ   . PHE B 2 74 ? -14.295 44.254 -11.525 1.00 37.74  ? 74  PHE A HZ   1 
ATOM   1345 N  N    . MET B 2 75 ? -16.547 41.776 -5.923  1.00 34.01  ? 75  MET A N    1 
ATOM   1346 C  CA   . MET B 2 75 ? -16.114 40.401 -6.052  1.00 35.52  ? 75  MET A CA   1 
ATOM   1347 C  C    . MET B 2 75 ? -17.306 39.490 -6.264  1.00 35.65  ? 75  MET A C    1 
ATOM   1348 O  O    . MET B 2 75 ? -17.251 38.635 -7.136  1.00 35.33  ? 75  MET A O    1 
ATOM   1349 C  CB   . MET B 2 75 ? -15.371 39.906 -4.804  1.00 38.78  ? 75  MET A CB   1 
ATOM   1350 C  CG   . MET B 2 75 ? -14.011 40.546 -4.600  1.00 50.55  ? 75  MET A CG   1 
ATOM   1351 S  SD   . MET B 2 75 ? -12.995 40.670 -6.088  1.00 60.77  ? 75  MET A SD   1 
ATOM   1352 C  CE   . MET B 2 75 ? -12.976 38.988 -6.643  1.00 39.93  ? 75  MET A CE   1 
ATOM   1353 H  H    . MET B 2 75 ? -16.343 42.132 -5.167  1.00 40.81  ? 75  MET A H    1 
ATOM   1354 H  HA   . MET B 2 75 ? -15.515 40.325 -6.811  1.00 42.63  ? 75  MET A HA   1 
ATOM   1355 H  HB2  . MET B 2 75 ? -15.911 40.103 -4.022  1.00 46.54  ? 75  MET A HB2  1 
ATOM   1356 H  HB3  . MET B 2 75 ? -15.239 38.948 -4.878  1.00 46.54  ? 75  MET A HB3  1 
ATOM   1357 H  HG2  . MET B 2 75 ? -14.141 41.445 -4.259  1.00 60.66  ? 75  MET A HG2  1 
ATOM   1358 H  HG3  . MET B 2 75 ? -13.516 40.021 -3.952  1.00 60.66  ? 75  MET A HG3  1 
ATOM   1359 H  HE1  . MET B 2 75 ? -12.448 38.930 -7.455  1.00 47.92  ? 75  MET A HE1  1 
ATOM   1360 H  HE2  . MET B 2 75 ? -12.583 38.433 -5.952  1.00 47.92  ? 75  MET A HE2  1 
ATOM   1361 H  HE3  . MET B 2 75 ? -13.887 38.704 -6.819  1.00 47.92  ? 75  MET A HE3  1 
ATOM   1362 N  N    . ALA B 2 76 ? -18.406 39.737 -5.552  1.00 34.88  ? 76  ALA A N    1 
ATOM   1363 C  CA   . ALA B 2 76 ? -19.631 38.940 -5.724  1.00 35.04  ? 76  ALA A CA   1 
ATOM   1364 C  C    . ALA B 2 76 ? -20.133 39.082 -7.112  1.00 35.70  ? 76  ALA A C    1 
ATOM   1365 O  O    . ALA B 2 76 ? -20.590 38.104 -7.709  1.00 37.25  ? 76  ALA A O    1 
ATOM   1366 C  CB   . ALA B 2 76 ? -20.683 39.357 -4.799  1.00 34.71  ? 76  ALA A CB   1 
ATOM   1367 H  H    . ALA B 2 76 ? -18.472 40.359 -4.962  1.00 41.85  ? 76  ALA A H    1 
ATOM   1368 H  HA   . ALA B 2 76 ? -19.434 38.004 -5.562  1.00 42.05  ? 76  ALA A HA   1 
ATOM   1369 H  HB1  . ALA B 2 76 ? -21.469 38.808 -4.946  1.00 41.65  ? 76  ALA A HB1  1 
ATOM   1370 H  HB2  . ALA B 2 76 ? -20.366 39.244 -3.889  1.00 41.65  ? 76  ALA A HB2  1 
ATOM   1371 H  HB3  . ALA B 2 76 ? -20.895 40.290 -4.962  1.00 41.65  ? 76  ALA A HB3  1 
ATOM   1372 N  N    . PHE B 2 77 ? -20.080 40.305 -7.622  1.00 34.84  ? 77  PHE A N    1 
ATOM   1373 C  CA   . PHE B 2 77 ? -20.413 40.549 -9.015  1.00 36.02  ? 77  PHE A CA   1 
ATOM   1374 C  C    . PHE B 2 77 ? -19.480 39.734 -9.955  1.00 36.84  ? 77  PHE A C    1 
ATOM   1375 O  O    . PHE B 2 77 ? -19.945 39.147 -10.927 1.00 36.94  ? 77  PHE A O    1 
ATOM   1376 C  CB   . PHE B 2 77 ? -20.329 42.052 -9.332  1.00 35.88  ? 77  PHE A CB   1 
ATOM   1377 C  CG   . PHE B 2 77 ? -20.639 42.412 -10.758 1.00 36.69  ? 77  PHE A CG   1 
ATOM   1378 C  CD1  . PHE B 2 77 ? -21.858 42.112 -11.331 1.00 42.10  ? 77  PHE A CD1  1 
ATOM   1379 C  CD2  . PHE B 2 77 ? -19.697 43.046 -11.533 1.00 38.16  ? 77  PHE A CD2  1 
ATOM   1380 C  CE1  . PHE B 2 77 ? -22.143 42.473 -12.659 1.00 45.93  ? 77  PHE A CE1  1 
ATOM   1381 C  CE2  . PHE B 2 77 ? -19.965 43.399 -12.846 1.00 39.81  ? 77  PHE A CE2  1 
ATOM   1382 C  CZ   . PHE B 2 77 ? -21.179 43.111 -13.415 1.00 43.45  ? 77  PHE A CZ   1 
ATOM   1383 H  H    . PHE B 2 77 ? -19.854 41.009 -7.182  1.00 41.81  ? 77  PHE A H    1 
ATOM   1384 H  HA   . PHE B 2 77 ? -21.325 40.260 -9.175  1.00 43.22  ? 77  PHE A HA   1 
ATOM   1385 H  HB2  . PHE B 2 77 ? -20.961 42.523 -8.766  1.00 43.05  ? 77  PHE A HB2  1 
ATOM   1386 H  HB3  . PHE B 2 77 ? -19.429 42.359 -9.141  1.00 43.05  ? 77  PHE A HB3  1 
ATOM   1387 H  HD1  . PHE B 2 77 ? -22.510 41.688 -10.822 1.00 50.53  ? 77  PHE A HD1  1 
ATOM   1388 H  HD2  . PHE B 2 77 ? -18.870 43.256 -11.164 1.00 45.80  ? 77  PHE A HD2  1 
ATOM   1389 H  HE1  . PHE B 2 77 ? -22.969 42.266 -13.033 1.00 55.12  ? 77  PHE A HE1  1 
ATOM   1390 H  HE2  . PHE B 2 77 ? -19.312 43.830 -13.349 1.00 47.78  ? 77  PHE A HE2  1 
ATOM   1391 H  HZ   . PHE B 2 77 ? -21.352 43.345 -14.299 1.00 52.14  ? 77  PHE A HZ   1 
ATOM   1392 N  N    . VAL B 2 78 ? -18.171 39.772 -9.707  1.00 35.67  ? 78  VAL A N    1 
ATOM   1393 C  CA   . VAL B 2 78 ? -17.219 39.094 -10.566 1.00 34.88  ? 78  VAL A CA   1 
ATOM   1394 C  C    . VAL B 2 78 ? -17.475 37.583 -10.509 1.00 35.95  ? 78  VAL A C    1 
ATOM   1395 O  O    . VAL B 2 78 ? -17.393 36.931 -11.536 1.00 35.28  ? 78  VAL A O    1 
ATOM   1396 C  CB   . VAL B 2 78 ? -15.734 39.375 -10.199 1.00 34.00  ? 78  VAL A CB   1 
ATOM   1397 C  CG1  . VAL B 2 78 ? -14.788 38.538 -11.108 1.00 34.02  ? 78  VAL A CG1  1 
ATOM   1398 C  CG2  . VAL B 2 78 ? -15.395 40.814 -10.400 1.00 31.88  ? 78  VAL A CG2  1 
ATOM   1399 H  H    . VAL B 2 78 ? -17.813 40.186 -9.044  1.00 42.81  ? 78  VAL A H    1 
ATOM   1400 H  HA   . VAL B 2 78 ? -17.360 39.386 -11.480 1.00 41.85  ? 78  VAL A HA   1 
ATOM   1401 H  HB   . VAL B 2 78 ? -15.571 39.140 -9.273  1.00 40.80  ? 78  VAL A HB   1 
ATOM   1402 H  HG11 . VAL B 2 78 ? -13.869 38.727 -10.865 1.00 40.83  ? 78  VAL A HG11 1 
ATOM   1403 H  HG12 . VAL B 2 78 ? -14.979 37.596 -10.978 1.00 40.83  ? 78  VAL A HG12 1 
ATOM   1404 H  HG13 . VAL B 2 78 ? -14.943 38.783 -12.034 1.00 40.83  ? 78  VAL A HG13 1 
ATOM   1405 H  HG21 . VAL B 2 78 ? -14.465 40.954 -10.163 1.00 38.26  ? 78  VAL A HG21 1 
ATOM   1406 H  HG22 . VAL B 2 78 ? -15.538 41.044 -11.331 1.00 38.26  ? 78  VAL A HG22 1 
ATOM   1407 H  HG23 . VAL B 2 78 ? -15.966 41.355 -9.833  1.00 38.26  ? 78  VAL A HG23 1 
ATOM   1408 N  N    . ALA B 2 79 ? -17.830 37.045 -9.347  1.00 34.68  ? 79  ALA A N    1 
ATOM   1409 C  CA   . ALA B 2 79 ? -18.115 35.592 -9.248  1.00 41.46  ? 79  ALA A CA   1 
ATOM   1410 C  C    . ALA B 2 79 ? -19.363 35.196 -10.043 1.00 39.10  ? 79  ALA A C    1 
ATOM   1411 O  O    . ALA B 2 79 ? -19.351 34.138 -10.651 1.00 41.04  ? 79  ALA A O    1 
ATOM   1412 C  CB   . ALA B 2 79 ? -18.255 35.158 -7.848  1.00 36.01  ? 79  ALA A CB   1 
ATOM   1413 H  H    . ALA B 2 79 ? -17.914 37.478 -8.609  1.00 41.61  ? 79  ALA A H    1 
ATOM   1414 H  HA   . ALA B 2 79 ? -17.365 35.108 -9.627  1.00 49.75  ? 79  ALA A HA   1 
ATOM   1415 H  HB1  . ALA B 2 79 ? -18.440 34.206 -7.830  1.00 43.21  ? 79  ALA A HB1  1 
ATOM   1416 H  HB2  . ALA B 2 79 ? -17.428 35.344 -7.376  1.00 43.21  ? 79  ALA A HB2  1 
ATOM   1417 H  HB3  . ALA B 2 79 ? -18.986 35.646 -7.438  1.00 43.21  ? 79  ALA A HB3  1 
ATOM   1418 N  N    . MET B 2 80 ? -20.413 36.026 -10.017 1.00 38.86  ? 80  MET A N    1 
ATOM   1419 C  CA   . MET B 2 80 ? -21.594 35.800 -10.822 1.00 39.05  ? 80  MET A CA   1 
ATOM   1420 C  C    . MET B 2 80 ? -21.186 35.736 -12.259 1.00 40.63  ? 80  MET A C    1 
ATOM   1421 O  O    . MET B 2 80 ? -21.369 34.717 -12.906 1.00 43.35  ? 80  MET A O    1 
ATOM   1422 C  CB   . MET B 2 80 ? -22.677 36.898 -10.635 1.00 39.75  ? 80  MET A CB   1 
ATOM   1423 C  CG   . MET B 2 80 ? -23.670 36.789 -9.426  1.00 43.61  ? 80  MET A CG   1 
ATOM   1424 S  SD   . MET B 2 80 ? -24.663 38.365 -9.049  1.00 52.73  ? 80  MET A SD   1 
ATOM   1425 C  CE   . MET B 2 80 ? -23.627 39.138 -7.844  1.00 39.04  ? 80  MET A CE   1 
ATOM   1426 H  H    . MET B 2 80 ? -20.455 36.734 -9.531  1.00 46.63  ? 80  MET A H    1 
ATOM   1427 H  HA   . MET B 2 80 ? -21.987 34.950 -10.569 1.00 46.86  ? 80  MET A HA   1 
ATOM   1428 H  HB2  . MET B 2 80 ? -22.221 37.749 -10.545 1.00 47.70  ? 80  MET A HB2  1 
ATOM   1429 H  HB3  . MET B 2 80 ? -23.220 36.916 -11.439 1.00 47.70  ? 80  MET A HB3  1 
ATOM   1430 H  HG2  . MET B 2 80 ? -24.306 36.081 -9.612  1.00 52.34  ? 80  MET A HG2  1 
ATOM   1431 H  HG3  . MET B 2 80 ? -23.161 36.567 -8.630  1.00 52.34  ? 80  MET A HG3  1 
ATOM   1432 H  HE1  . MET B 2 80 ? -24.035 39.972 -7.565  1.00 46.85  ? 80  MET A HE1  1 
ATOM   1433 H  HE2  . MET B 2 80 ? -23.532 38.545 -7.082  1.00 46.85  ? 80  MET A HE2  1 
ATOM   1434 H  HE3  . MET B 2 80 ? -22.758 39.310 -8.239  1.00 46.85  ? 80  MET A HE3  1 
ATOM   1435 N  N    . VAL B 2 81 ? -20.605 36.804 -12.766 1.00 38.86  ? 81  VAL A N    1 
ATOM   1436 C  CA   . VAL B 2 81 ? -20.327 36.846 -14.182 1.00 39.57  ? 81  VAL A CA   1 
ATOM   1437 C  C    . VAL B 2 81 ? -19.455 35.666 -14.539 1.00 41.20  ? 81  VAL A C    1 
ATOM   1438 O  O    . VAL B 2 81 ? -19.726 34.963 -15.471 1.00 42.32  ? 81  VAL A O    1 
ATOM   1439 C  CB   . VAL B 2 81 ? -19.620 38.127 -14.610 1.00 36.86  ? 81  VAL A CB   1 
ATOM   1440 C  CG1  . VAL B 2 81 ? -19.444 38.123 -16.081 1.00 39.73  ? 81  VAL A CG1  1 
ATOM   1441 C  CG2  . VAL B 2 81 ? -20.420 39.333 -14.233 1.00 39.80  ? 81  VAL A CG2  1 
ATOM   1442 H  H    . VAL B 2 81 ? -20.367 37.502 -12.324 1.00 46.63  ? 81  VAL A H    1 
ATOM   1443 H  HA   . VAL B 2 81 ? -21.158 36.774 -14.676 1.00 47.48  ? 81  VAL A HA   1 
ATOM   1444 H  HB   . VAL B 2 81 ? -18.749 38.182 -14.188 1.00 44.24  ? 81  VAL A HB   1 
ATOM   1445 H  HG11 . VAL B 2 81 ? -18.994 38.941 -16.347 1.00 47.68  ? 81  VAL A HG11 1 
ATOM   1446 H  HG12 . VAL B 2 81 ? -18.909 37.354 -16.333 1.00 47.68  ? 81  VAL A HG12 1 
ATOM   1447 H  HG13 . VAL B 2 81 ? -20.316 38.073 -16.503 1.00 47.68  ? 81  VAL A HG13 1 
ATOM   1448 H  HG21 . VAL B 2 81 ? -19.944 40.129 -14.518 1.00 47.76  ? 81  VAL A HG21 1 
ATOM   1449 H  HG22 . VAL B 2 81 ? -21.284 39.288 -14.671 1.00 47.76  ? 81  VAL A HG22 1 
ATOM   1450 H  HG23 . VAL B 2 81 ? -20.538 39.345 -13.270 1.00 47.76  ? 81  VAL A HG23 1 
ATOM   1451 N  N    . THR B 2 82 ? -18.423 35.413 -13.757 1.00 41.27  ? 82  THR A N    1 
ATOM   1452 C  CA   . THR B 2 82 ? -17.476 34.382 -14.138 1.00 42.51  ? 82  THR A CA   1 
ATOM   1453 C  C    . THR B 2 82 ? -18.180 33.025 -14.164 1.00 45.83  ? 82  THR A C    1 
ATOM   1454 O  O    . THR B 2 82 ? -17.973 32.226 -15.077 1.00 44.90  ? 82  THR A O    1 
ATOM   1455 C  CB   . THR B 2 82 ? -16.271 34.347 -13.191 1.00 40.25  ? 82  THR A CB   1 
ATOM   1456 O  OG1  . THR B 2 82 ? -15.682 35.642 -13.150 1.00 38.46  ? 82  THR A OG1  1 
ATOM   1457 C  CG2  . THR B 2 82 ? -15.215 33.375 -13.669 1.00 38.35  ? 82  THR A CG2  1 
ATOM   1458 H  H    . THR B 2 82 ? -18.249 35.813 -13.016 1.00 49.52  ? 82  THR A H    1 
ATOM   1459 H  HA   . THR B 2 82 ? -17.149 34.568 -15.033 1.00 51.01  ? 82  THR A HA   1 
ATOM   1460 H  HB   . THR B 2 82 ? -16.558 34.087 -12.301 1.00 48.30  ? 82  THR A HB   1 
ATOM   1461 H  HG1  . THR B 2 82 ? -15.019 35.640 -12.635 1.00 46.15  ? 82  THR A HG1  1 
ATOM   1462 H  HG21 . THR B 2 82 ? -14.465 33.372 -13.053 1.00 46.02  ? 82  THR A HG21 1 
ATOM   1463 H  HG22 . THR B 2 82 ? -15.586 32.480 -13.718 1.00 46.02  ? 82  THR A HG22 1 
ATOM   1464 H  HG23 . THR B 2 82 ? -14.900 33.635 -14.548 1.00 46.02  ? 82  THR A HG23 1 
ATOM   1465 N  N    . THR B 2 83 ? -19.042 32.818 -13.174 1.00 46.19  ? 83  THR A N    1 
ATOM   1466 C  CA   . THR B 2 83 ? -19.837 31.589 -13.035 1.00 48.78  ? 83  THR A CA   1 
ATOM   1467 C  C    . THR B 2 83 ? -20.827 31.361 -14.181 1.00 52.52  ? 83  THR A C    1 
ATOM   1468 O  O    . THR B 2 83 ? -21.102 30.214 -14.541 1.00 56.01  ? 83  THR A O    1 
ATOM   1469 C  CB   . THR B 2 83 ? -20.574 31.587 -11.693 1.00 48.50  ? 83  THR A CB   1 
ATOM   1470 O  OG1  . THR B 2 83 ? -19.649 31.209 -10.652 1.00 45.76  ? 83  THR A OG1  1 
ATOM   1471 C  CG2  . THR B 2 83 ? -21.714 30.594 -11.702 1.00 63.11  ? 83  THR A CG2  1 
ATOM   1472 H  H    . THR B 2 83 ? -19.192 33.390 -12.549 1.00 55.43  ? 83  THR A H    1 
ATOM   1473 H  HA   . THR B 2 83 ? -19.227 30.835 -13.029 1.00 58.54  ? 83  THR A HA   1 
ATOM   1474 H  HB   . THR B 2 83 ? -20.930 32.470 -11.511 1.00 58.20  ? 83  THR A HB   1 
ATOM   1475 H  HG1  . THR B 2 83 ? -20.040 31.203 -9.908  1.00 54.92  ? 83  THR A HG1  1 
ATOM   1476 H  HG21 . THR B 2 83 ? -22.170 30.605 -10.846 1.00 75.73  ? 83  THR A HG21 1 
ATOM   1477 H  HG22 . THR B 2 83 ? -22.348 30.825 -12.400 1.00 75.73  ? 83  THR A HG22 1 
ATOM   1478 H  HG23 . THR B 2 83 ? -21.375 29.701 -11.868 1.00 75.73  ? 83  THR A HG23 1 
ATOM   1479 N  N    . ALA B 2 84 ? -21.355 32.455 -14.731 1.00 50.52  ? 84  ALA A N    1 
ATOM   1480 C  CA   . ALA B 2 84 ? -22.148 32.427 -15.954 1.00 52.65  ? 84  ALA A CA   1 
ATOM   1481 C  C    . ALA B 2 84 ? -21.277 31.950 -17.137 1.00 55.73  ? 84  ALA A C    1 
ATOM   1482 O  O    . ALA B 2 84 ? -21.643 30.997 -17.806 1.00 59.03  ? 84  ALA A O    1 
ATOM   1483 C  CB   . ALA B 2 84 ? -22.737 33.799 -16.243 0.00 52.47  ? 84  ALA A CB   1 
ATOM   1484 H  H    . ALA B 2 84 ? -21.264 33.244 -14.403 1.00 60.63  ? 84  ALA A H    1 
ATOM   1485 H  HA   . ALA B 2 84 ? -22.880 31.800 -15.845 1.00 63.18  ? 84  ALA A HA   1 
ATOM   1486 H  HB1  . ALA B 2 84 ? -22.014 34.437 -16.347 0.00 62.97  ? 84  ALA A HB1  1 
ATOM   1487 H  HB2  . ALA B 2 84 ? -23.258 33.753 -17.060 0.00 62.97  ? 84  ALA A HB2  1 
ATOM   1488 H  HB3  . ALA B 2 84 ? -23.305 34.061 -15.502 0.00 62.97  ? 84  ALA A HB3  1 
ATOM   1489 N  N    . CYS B 2 85 ? -20.178 32.655 -17.437 1.00 53.02  ? 85  CYS A N    1 
ATOM   1490 C  CA   . CYS B 2 85 ? -19.267 32.227 -18.486 1.00 53.45  ? 85  CYS A CA   1 
ATOM   1491 C  C    . CYS B 2 85 ? -18.812 30.770 -18.382 1.00 58.13  ? 85  CYS A C    1 
ATOM   1492 O  O    . CYS B 2 85 ? -18.675 30.117 -19.406 1.00 63.27  ? 85  CYS A O    1 
ATOM   1493 C  CB   . CYS B 2 85 ? -18.007 33.102 -18.489 1.00 48.67  ? 85  CYS A CB   1 
ATOM   1494 S  SG   . CYS B 2 85 ? -18.324 34.819 -18.789 0.52 51.70  ? 85  CYS A SG   1 
ATOM   1495 H  H    . CYS B 2 85 ? -19.945 33.383 -17.043 1.00 63.62  ? 85  CYS A H    1 
ATOM   1496 H  HA   . CYS B 2 85 ? -19.707 32.339 -19.343 1.00 64.14  ? 85  CYS A HA   1 
ATOM   1497 H  HB2  . CYS B 2 85 ? -17.573 33.027 -17.624 1.00 58.41  ? 85  CYS A HB2  1 
ATOM   1498 H  HB3  . CYS B 2 85 ? -17.409 32.785 -19.184 1.00 58.41  ? 85  CYS A HB3  1 
ATOM   1499 H  HG   . CYS B 2 85 ? -19.051 35.238 -17.931 0.52 62.04  ? 85  CYS A HG   1 
ATOM   1500 N  N    . HIS B 2 86 ? -18.611 30.254 -17.167 1.00 56.85  ? 86  HIS A N    1 
ATOM   1501 C  CA   . HIS B 2 86 ? -17.957 28.939 -16.985 1.00 63.75  ? 86  HIS A CA   1 
ATOM   1502 C  C    . HIS B 2 86 ? -18.819 27.777 -17.464 1.00 72.83  ? 86  HIS A C    1 
ATOM   1503 O  O    . HIS B 2 86 ? -18.288 26.684 -17.771 1.00 72.04  ? 86  HIS A O    1 
ATOM   1504 C  CB   . HIS B 2 86 ? -17.552 28.675 -15.529 1.00 58.36  ? 86  HIS A CB   1 
ATOM   1505 C  CG   . HIS B 2 86 ? -17.151 27.252 -15.269 1.00 60.95  ? 86  HIS A CG   1 
ATOM   1506 N  ND1  . HIS B 2 86 ? -17.946 26.369 -14.561 1.00 64.01  ? 86  HIS A ND1  1 
ATOM   1507 C  CD2  . HIS B 2 86 ? -16.057 26.550 -15.651 1.00 60.57  ? 86  HIS A CD2  1 
ATOM   1508 C  CE1  . HIS B 2 86 ? -17.341 25.195 -14.492 1.00 66.00  ? 86  HIS A CE1  1 
ATOM   1509 N  NE2  . HIS B 2 86 ? -16.198 25.275 -15.152 1.00 63.11  ? 86  HIS A NE2  1 
ATOM   1510 H  H    . HIS B 2 86 ? -18.840 30.637 -16.432 1.00 68.22  ? 86  HIS A H    1 
ATOM   1511 H  HA   . HIS B 2 86 ? -17.144 28.931 -17.514 1.00 76.50  ? 86  HIS A HA   1 
ATOM   1512 H  HB2  . HIS B 2 86 ? -16.798 29.242 -15.305 1.00 70.03  ? 86  HIS A HB2  1 
ATOM   1513 H  HB3  . HIS B 2 86 ? -18.303 28.883 -14.951 1.00 70.03  ? 86  HIS A HB3  1 
ATOM   1514 H  HD2  . HIS B 2 86 ? -15.339 26.873 -16.146 1.00 72.69  ? 86  HIS A HD2  1 
ATOM   1515 H  HE1  . HIS B 2 86 ? -17.671 24.436 -14.067 1.00 79.20  ? 86  HIS A HE1  1 
ATOM   1516 N  N    . GLU B 2 87 ? -20.141 27.998 -17.459 1.00 69.16  ? 87  GLU A N    1 
ATOM   1517 C  CA   . GLU B 2 87 ? -21.116 27.011 -17.915 1.00 70.50  ? 87  GLU A CA   1 
ATOM   1518 C  C    . GLU B 2 87 ? -20.761 26.560 -19.370 1.00 72.78  ? 87  GLU A C    1 
ATOM   1519 O  O    . GLU B 2 87 ? -21.059 25.421 -19.774 1.00 71.04  ? 87  GLU A O    1 
ATOM   1520 C  CB   . GLU B 2 87 ? -22.521 27.594 -17.821 1.00 69.71  ? 87  GLU A CB   1 
ATOM   1521 C  CG   . GLU B 2 87 ? -23.026 27.831 -16.392 1.00 63.23  ? 87  GLU A CG   1 
ATOM   1522 C  CD   . GLU B 2 87 ? -24.423 28.421 -16.371 0.00 60.60  ? 87  GLU A CD   1 
ATOM   1523 O  OE1  . GLU B 2 87 ? -24.658 29.422 -17.079 0.00 59.90  ? 87  GLU A OE1  1 
ATOM   1524 O  OE2  . GLU B 2 87 ? -25.289 27.878 -15.652 0.00 60.37  ? 87  GLU A OE2  1 
ATOM   1525 H  H    . GLU B 2 87 ? -20.500 28.732 -17.190 1.00 82.99  ? 87  GLU A H    1 
ATOM   1526 H  HA   . GLU B 2 87 ? -21.074 26.232 -17.338 1.00 84.61  ? 87  GLU A HA   1 
ATOM   1527 H  HB2  . GLU B 2 87 ? -22.533 28.448 -18.281 1.00 83.65  ? 87  GLU A HB2  1 
ATOM   1528 H  HB3  . GLU B 2 87 ? -23.138 26.983 -18.252 1.00 83.65  ? 87  GLU A HB3  1 
ATOM   1529 H  HG2  . GLU B 2 87 ? -23.048 26.985 -15.918 1.00 75.87  ? 87  GLU A HG2  1 
ATOM   1530 H  HG3  . GLU B 2 87 ? -22.430 28.450 -15.943 1.00 75.87  ? 87  GLU A HG3  1 
ATOM   1531 N  N    . PHE B 2 88 ? -20.110 27.471 -20.113 1.00 70.86  ? 88  PHE A N    1 
ATOM   1532 C  CA   . PHE B 2 88 ? -19.409 27.199 -21.384 1.00 68.94  ? 88  PHE A CA   1 
ATOM   1533 C  C    . PHE B 2 88 ? -18.479 25.981 -21.287 1.00 71.27  ? 88  PHE A C    1 
ATOM   1534 O  O    . PHE B 2 88 ? -18.240 25.287 -22.284 1.00 75.11  ? 88  PHE A O    1 
ATOM   1535 C  CB   . PHE B 2 88 ? -18.574 28.460 -21.720 1.00 68.45  ? 88  PHE A CB   1 
ATOM   1536 C  CG   . PHE B 2 88 ? -17.836 28.443 -23.040 1.00 69.55  ? 88  PHE A CG   1 
ATOM   1537 C  CD1  . PHE B 2 88 ? -16.814 27.559 -23.299 1.00 71.90  ? 88  PHE A CD1  1 
ATOM   1538 C  CD2  . PHE B 2 88 ? -18.112 29.397 -23.985 1.00 70.48  ? 88  PHE A CD2  1 
ATOM   1539 C  CE1  . PHE B 2 88 ? -16.141 27.596 -24.512 1.00 74.02  ? 88  PHE A CE1  1 
ATOM   1540 C  CE2  . PHE B 2 88 ? -17.444 29.449 -25.197 1.00 72.80  ? 88  PHE A CE2  1 
ATOM   1541 C  CZ   . PHE B 2 88 ? -16.464 28.551 -25.459 1.00 73.22  ? 88  PHE A CZ   1 
ATOM   1542 H  H    . PHE B 2 88 ? -20.059 28.299 -19.887 1.00 85.03  ? 88  PHE A H    1 
ATOM   1543 H  HA   . PHE B 2 88 ? -20.054 27.049 -22.093 1.00 82.73  ? 88  PHE A HA   1 
ATOM   1544 H  HB2  . PHE B 2 88 ? -19.171 29.225 -21.733 1.00 82.13  ? 88  PHE A HB2  1 
ATOM   1545 H  HB3  . PHE B 2 88 ? -17.912 28.581 -21.021 1.00 82.13  ? 88  PHE A HB3  1 
ATOM   1546 H  HD1  . PHE B 2 88 ? -16.597 26.908 -22.671 1.00 86.27  ? 88  PHE A HD1  1 
ATOM   1547 H  HD2  . PHE B 2 88 ? -18.789 30.013 -23.818 1.00 84.58  ? 88  PHE A HD2  1 
ATOM   1548 H  HE1  . PHE B 2 88 ? -15.466 26.980 -24.686 1.00 88.82  ? 88  PHE A HE1  1 
ATOM   1549 H  HE2  . PHE B 2 88 ? -17.669 30.094 -25.828 1.00 87.36  ? 88  PHE A HE2  1 
ATOM   1550 H  HZ   . PHE B 2 88 ? -16.009 28.578 -26.270 1.00 87.87  ? 88  PHE A HZ   1 
ATOM   1551 N  N    . PHE B 2 89 ? -17.992 25.697 -20.080 1.00 72.34  ? 89  PHE A N    1 
ATOM   1552 C  CA   . PHE B 2 89 ? -17.119 24.542 -19.823 1.00 74.52  ? 89  PHE A CA   1 
ATOM   1553 C  C    . PHE B 2 89 ? -17.688 23.581 -18.734 1.00 73.46  ? 89  PHE A C    1 
ATOM   1554 O  O    . PHE B 2 89 ? -16.969 22.680 -18.255 1.00 72.09  ? 89  PHE A O    1 
ATOM   1555 C  CB   . PHE B 2 89 ? -15.726 25.059 -19.403 1.00 72.42  ? 89  PHE A CB   1 
ATOM   1556 C  CG   . PHE B 2 89 ? -15.157 26.113 -20.334 1.00 72.39  ? 89  PHE A CG   1 
ATOM   1557 C  CD1  . PHE B 2 89 ? -15.477 27.473 -20.150 1.00 72.13  ? 89  PHE A CD1  1 
ATOM   1558 C  CD2  . PHE B 2 89 ? -14.307 25.763 -21.365 1.00 71.26  ? 89  PHE A CD2  1 
ATOM   1559 C  CE1  . PHE B 2 89 ? -14.942 28.459 -20.987 1.00 70.24  ? 89  PHE A CE1  1 
ATOM   1560 C  CE2  . PHE B 2 89 ? -13.777 26.730 -22.196 1.00 71.53  ? 89  PHE A CE2  1 
ATOM   1561 C  CZ   . PHE B 2 89 ? -14.092 28.088 -22.003 1.00 72.35  ? 89  PHE A CZ   1 
ATOM   1562 H  H    . PHE B 2 89 ? -18.154 26.166 -19.377 1.00 86.81  ? 89  PHE A H    1 
ATOM   1563 H  HA   . PHE B 2 89 ? -17.016 24.036 -20.644 1.00 89.42  ? 89  PHE A HA   1 
ATOM   1564 H  HB2  . PHE B 2 89 ? -15.792 25.449 -18.518 1.00 86.90  ? 89  PHE A HB2  1 
ATOM   1565 H  HB3  . PHE B 2 89 ? -15.108 24.312 -19.388 1.00 86.90  ? 89  PHE A HB3  1 
ATOM   1566 H  HD1  . PHE B 2 89 ? -16.043 27.720 -19.455 1.00 86.55  ? 89  PHE A HD1  1 
ATOM   1567 H  HD2  . PHE B 2 89 ? -14.083 24.870 -21.496 1.00 85.51  ? 89  PHE A HD2  1 
ATOM   1568 H  HE1  . PHE B 2 89 ? -15.159 29.355 -20.858 1.00 84.29  ? 89  PHE A HE1  1 
ATOM   1569 H  HE2  . PHE B 2 89 ? -13.206 26.482 -22.887 1.00 85.84  ? 89  PHE A HE2  1 
ATOM   1570 H  HZ   . PHE B 2 89 ? -13.739 28.733 -22.573 1.00 86.82  ? 89  PHE A HZ   1 
ATOM   1571 N  N    . GLU B 2 90 ? -18.957 23.799 -18.351 1.00 73.39  ? 90  GLU A N    1 
ATOM   1572 C  CA   . GLU B 2 90 ? -19.722 22.916 -17.455 1.00 72.03  ? 90  GLU A CA   1 
ATOM   1573 C  C    . GLU B 2 90 ? -19.428 21.451 -17.713 1.00 70.30  ? 90  GLU A C    1 
ATOM   1574 O  O    . GLU B 2 90 ? -20.288 20.604 -17.483 1.00 75.63  ? 90  GLU A O    1 
ATOM   1575 C  CB   . GLU B 2 90 ? -21.245 23.152 -17.614 1.00 79.91  ? 90  GLU A CB   1 
ATOM   1576 C  CG   . GLU B 2 90 ? -21.867 22.590 -18.955 1.00 78.81  ? 90  GLU A CG   1 
ATOM   1577 C  CD   . GLU B 2 90 ? -23.370 22.896 -19.149 1.00 74.98  ? 90  GLU A CD   1 
ATOM   1578 O  OE1  . GLU B 2 90 ? -24.204 22.234 -18.478 1.00 74.09  ? 90  GLU A OE1  1 
ATOM   1579 O  OE2  . GLU B 2 90 ? -23.716 23.765 -19.997 1.00 68.86  ? 90  GLU A OE2  1 
ATOM   1580 H  H    . GLU B 2 90 ? -19.412 24.482 -18.609 1.00 88.06  ? 90  GLU A H    1 
ATOM   1581 H  HA   . GLU B 2 90 ? -19.481 23.112 -16.537 1.00 86.44  ? 90  GLU A HA   1 
ATOM   1582 H  HB2  . GLU B 2 90 ? -21.703 22.722 -16.875 1.00 95.90  ? 90  GLU A HB2  1 
ATOM   1583 H  HB3  . GLU B 2 90 ? -21.414 24.107 -17.590 1.00 95.90  ? 90  GLU A HB3  1 
ATOM   1584 H  HG2  . GLU B 2 90 ? -21.390 22.979 -19.704 1.00 94.58  ? 90  GLU A HG2  1 
ATOM   1585 H  HG3  . GLU B 2 90 ? -21.760 21.626 -18.965 1.00 94.58  ? 90  GLU A HG3  1 
ATOM   1586 N  N    . MET C 2 1  ? -10.815 41.946 -25.772 1.00 49.11  ? 1   MET B N    1 
ATOM   1587 C  CA   . MET C 2 1  ? -10.856 41.486 -24.349 1.00 45.67  ? 1   MET B CA   1 
ATOM   1588 C  C    . MET C 2 1  ? -10.150 42.459 -23.402 1.00 44.00  ? 1   MET B C    1 
ATOM   1589 O  O    . MET C 2 1  ? -8.929  42.713 -23.487 1.00 45.09  ? 1   MET B O    1 
ATOM   1590 C  CB   . MET C 2 1  ? -10.200 40.098 -24.165 1.00 46.71  ? 1   MET B CB   1 
ATOM   1591 C  CG   . MET C 2 1  ? -10.804 38.999 -24.979 1.00 56.25  ? 1   MET B CG   1 
ATOM   1592 S  SD   . MET C 2 1  ? -12.426 38.491 -24.381 1.00 71.44  ? 1   MET B SD   1 
ATOM   1593 C  CE   . MET C 2 1  ? -11.898 37.365 -23.093 1.00 58.63  ? 1   MET B CE   1 
ATOM   1594 H  H1   . MET C 2 1  ? -11.378 41.457 -26.258 1.00 58.93  ? 1   MET B H1   1 
ATOM   1595 H  H2   . MET C 2 1  ? -11.053 42.802 -25.814 1.00 58.93  ? 1   MET B H2   1 
ATOM   1596 H  H3   . MET C 2 1  ? -9.990  41.852 -26.091 1.00 58.93  ? 1   MET B H3   1 
ATOM   1597 H  HA   . MET C 2 1  ? -11.784 41.410 -24.077 1.00 54.80  ? 1   MET B HA   1 
ATOM   1598 H  HB2  . MET C 2 1  ? -9.264  40.164 -24.412 1.00 56.05  ? 1   MET B HB2  1 
ATOM   1599 H  HB3  . MET C 2 1  ? -10.272 39.844 -23.232 1.00 56.05  ? 1   MET B HB3  1 
ATOM   1600 H  HG2  . MET C 2 1  ? -10.905 39.303 -25.895 1.00 67.50  ? 1   MET B HG2  1 
ATOM   1601 H  HG3  . MET C 2 1  ? -10.219 38.226 -24.950 1.00 67.50  ? 1   MET B HG3  1 
ATOM   1602 H  HE1  . MET C 2 1  ? -12.682 36.994 -22.659 1.00 70.36  ? 1   MET B HE1  1 
ATOM   1603 H  HE2  . MET C 2 1  ? -11.372 36.655 -23.492 1.00 70.36  ? 1   MET B HE2  1 
ATOM   1604 H  HE3  . MET C 2 1  ? -11.362 37.853 -22.448 1.00 70.36  ? 1   MET B HE3  1 
ATOM   1605 N  N    . SER C 2 2  ? -10.914 42.884 -22.411 1.00 39.50  ? 2   SER B N    1 
ATOM   1606 C  CA   . SER C 2 2  ? -10.398 43.723 -21.368 1.00 39.70  ? 2   SER B CA   1 
ATOM   1607 C  C    . SER C 2 2  ? -9.454  42.932 -20.467 1.00 38.89  ? 2   SER B C    1 
ATOM   1608 O  O    . SER C 2 2  ? -9.364  41.707 -20.533 1.00 40.31  ? 2   SER B O    1 
ATOM   1609 C  CB   . SER C 2 2  ? -11.548 44.271 -20.564 1.00 38.04  ? 2   SER B CB   1 
ATOM   1610 O  OG   . SER C 2 2  ? -12.160 43.175 -19.947 1.00 37.85  ? 2   SER B OG   1 
ATOM   1611 H  H    . SER C 2 2  ? -11.748 42.692 -22.325 1.00 47.40  ? 2   SER B H    1 
ATOM   1612 H  HA   . SER C 2 2  ? -9.909  44.465 -21.757 1.00 47.64  ? 2   SER B HA   1 
ATOM   1613 H  HB2  . SER C 2 2  ? -11.216 44.885 -19.890 1.00 45.65  ? 2   SER B HB2  1 
ATOM   1614 H  HB3  . SER C 2 2  ? -12.181 44.713 -21.152 1.00 45.65  ? 2   SER B HB3  1 
ATOM   1615 H  HG   . SER C 2 2  ? -12.811 43.432 -19.484 1.00 45.42  ? 2   SER B HG   1 
ATOM   1616 N  N    . GLU C 2 3  ? -8.724  43.639 -19.633 1.00 38.90  ? 3   GLU B N    1 
ATOM   1617 C  CA   . GLU C 2 3  ? -7.954  42.974 -18.624 1.00 38.60  ? 3   GLU B CA   1 
ATOM   1618 C  C    . GLU C 2 3  ? -8.847  42.150 -17.714 1.00 36.81  ? 3   GLU B C    1 
ATOM   1619 O  O    . GLU C 2 3  ? -8.471  41.054 -17.296 1.00 36.55  ? 3   GLU B O    1 
ATOM   1620 C  CB   . GLU C 2 3  ? -7.167  43.988 -17.807 1.00 38.64  ? 3   GLU B CB   1 
ATOM   1621 C  CG   . GLU C 2 3  ? -6.184  44.702 -18.668 1.00 40.93  ? 3   GLU B CG   1 
ATOM   1622 C  CD   . GLU C 2 3  ? -5.200  43.760 -19.274 1.00 50.00  ? 3   GLU B CD   1 
ATOM   1623 O  OE1  . GLU C 2 3  ? -4.531  43.029 -18.504 1.00 55.83  ? 3   GLU B OE1  1 
ATOM   1624 O  OE2  . GLU C 2 3  ? -5.160  43.688 -20.524 1.00 52.68  ? 3   GLU B OE2  1 
ATOM   1625 H  H    . GLU C 2 3  ? -8.661  44.497 -19.632 1.00 46.68  ? 3   GLU B H    1 
ATOM   1626 H  HA   . GLU C 2 3  ? -7.322  42.374 -19.051 1.00 46.32  ? 3   GLU B HA   1 
ATOM   1627 H  HB2  . GLU C 2 3  ? -7.777  44.641 -17.429 1.00 46.36  ? 3   GLU B HB2  1 
ATOM   1628 H  HB3  . GLU C 2 3  ? -6.683  43.529 -17.102 1.00 46.36  ? 3   GLU B HB3  1 
ATOM   1629 H  HG2  . GLU C 2 3  ? -6.655  45.152 -19.386 1.00 49.11  ? 3   GLU B HG2  1 
ATOM   1630 H  HG3  . GLU C 2 3  ? -5.696  45.346 -18.130 1.00 49.11  ? 3   GLU B HG3  1 
ATOM   1631 N  N    . LEU C 2 4  ? -10.030 42.689 -17.444 1.00 35.53  ? 4   LEU B N    1 
ATOM   1632 C  CA   . LEU C 2 4  ? -10.986 42.100 -16.537 1.00 35.14  ? 4   LEU B CA   1 
ATOM   1633 C  C    . LEU C 2 4  ? -11.454 40.836 -17.146 1.00 36.07  ? 4   LEU B C    1 
ATOM   1634 O  O    . LEU C 2 4  ? -11.479 39.794 -16.491 1.00 35.54  ? 4   LEU B O    1 
ATOM   1635 C  CB   . LEU C 2 4  ? -12.176 43.045 -16.263 1.00 34.07  ? 4   LEU B CB   1 
ATOM   1636 C  CG   . LEU C 2 4  ? -13.359 42.547 -15.390 1.00 33.29  ? 4   LEU B CG   1 
ATOM   1637 C  CD1  . LEU C 2 4  ? -12.909 41.956 -14.043 1.00 31.81  ? 4   LEU B CD1  1 
ATOM   1638 C  CD2  . LEU C 2 4  ? -14.374 43.636 -15.116 1.00 34.22  ? 4   LEU B CD2  1 
ATOM   1639 H  H    . LEU C 2 4  ? -10.305 43.425 -17.793 1.00 42.63  ? 4   LEU B H    1 
ATOM   1640 H  HA   . LEU C 2 4  ? -10.553 41.896 -15.694 1.00 42.17  ? 4   LEU B HA   1 
ATOM   1641 H  HB2  . LEU C 2 4  ? -11.825 43.838 -15.828 1.00 40.88  ? 4   LEU B HB2  1 
ATOM   1642 H  HB3  . LEU C 2 4  ? -12.552 43.299 -17.120 1.00 40.88  ? 4   LEU B HB3  1 
ATOM   1643 H  HG   . LEU C 2 4  ? -13.817 41.843 -15.874 1.00 39.94  ? 4   LEU B HG   1 
ATOM   1644 H  HD11 . LEU C 2 4  ? -13.692 41.665 -13.549 1.00 38.17  ? 4   LEU B HD11 1 
ATOM   1645 H  HD12 . LEU C 2 4  ? -12.324 41.200 -14.210 1.00 38.17  ? 4   LEU B HD12 1 
ATOM   1646 H  HD13 . LEU C 2 4  ? -12.435 42.637 -13.542 1.00 38.17  ? 4   LEU B HD13 1 
ATOM   1647 H  HD21 . LEU C 2 4  ? -15.088 43.272 -14.570 1.00 41.06  ? 4   LEU B HD21 1 
ATOM   1648 H  HD22 . LEU C 2 4  ? -13.937 44.365 -14.648 1.00 41.06  ? 4   LEU B HD22 1 
ATOM   1649 H  HD23 . LEU C 2 4  ? -14.732 43.953 -15.960 1.00 41.06  ? 4   LEU B HD23 1 
ATOM   1650 N  N    . GLU C 2 5  ? -11.792 40.909 -18.417 1.00 35.78  ? 5   GLU B N    1 
ATOM   1651 C  CA   . GLU C 2 5  ? -12.257 39.708 -19.073 1.00 37.52  ? 5   GLU B CA   1 
ATOM   1652 C  C    . GLU C 2 5  ? -11.180 38.638 -19.061 1.00 38.03  ? 5   GLU B C    1 
ATOM   1653 O  O    . GLU C 2 5  ? -11.458 37.477 -18.789 1.00 36.84  ? 5   GLU B O    1 
ATOM   1654 C  CB   . GLU C 2 5  ? -12.698 40.004 -20.484 1.00 41.65  ? 5   GLU B CB   1 
ATOM   1655 C  CG   . GLU C 2 5  ? -14.020 40.760 -20.429 1.00 45.34  ? 5   GLU B CG   1 
ATOM   1656 C  CD   . GLU C 2 5  ? -14.440 41.367 -21.744 1.00 42.80  ? 5   GLU B CD   1 
ATOM   1657 O  OE1  . GLU C 2 5  ? -13.549 41.742 -22.551 1.00 42.68  ? 5   GLU B OE1  1 
ATOM   1658 O  OE2  . GLU C 2 5  ? -15.673 41.433 -21.957 1.00 43.41  ? 5   GLU B OE2  1 
ATOM   1659 H  H    . GLU C 2 5  ? -11.764 41.615 -18.907 1.00 42.93  ? 5   GLU B H    1 
ATOM   1660 H  HA   . GLU C 2 5  ? -13.024 39.364 -18.589 1.00 45.03  ? 5   GLU B HA   1 
ATOM   1661 H  HB2  . GLU C 2 5  ? -12.037 40.560 -20.926 1.00 49.99  ? 5   GLU B HB2  1 
ATOM   1662 H  HB3  . GLU C 2 5  ? -12.831 39.174 -20.968 1.00 49.99  ? 5   GLU B HB3  1 
ATOM   1663 H  HG2  . GLU C 2 5  ? -14.718 40.147 -20.150 1.00 54.40  ? 5   GLU B HG2  1 
ATOM   1664 H  HG3  . GLU C 2 5  ? -13.940 41.480 -19.784 1.00 54.40  ? 5   GLU B HG3  1 
ATOM   1665 N  N    . LYS C 2 6  ? -9.950  39.047 -19.310 1.00 40.00  ? 6   LYS B N    1 
ATOM   1666 C  CA   . LYS C 2 6  ? -8.819  38.137 -19.325 1.00 37.11  ? 6   LYS B CA   1 
ATOM   1667 C  C    . LYS C 2 6  ? -8.565  37.497 -17.966 1.00 36.88  ? 6   LYS B C    1 
ATOM   1668 O  O    . LYS C 2 6  ? -8.250  36.314 -17.855 1.00 35.06  ? 6   LYS B O    1 
ATOM   1669 C  CB   . LYS C 2 6  ? -7.599  38.896 -19.749 1.00 37.23  ? 6   LYS B CB   1 
ATOM   1670 C  CG   . LYS C 2 6  ? -7.532  39.272 -21.208 1.00 39.79  ? 6   LYS B CG   1 
ATOM   1671 C  CD   . LYS C 2 6  ? -6.365  40.340 -21.319 1.00 45.28  ? 6   LYS B CD   1 
ATOM   1672 C  CE   . LYS C 2 6  ? -6.058  40.763 -22.732 1.00 52.95  ? 6   LYS B CE   1 
ATOM   1673 N  NZ   . LYS C 2 6  ? -5.109  41.880 -22.717 1.00 56.19  ? 6   LYS B NZ   1 
ATOM   1674 H  H    . LYS C 2 6  ? -9.739  39.864 -19.476 1.00 48.00  ? 6   LYS B H    1 
ATOM   1675 H  HA   . LYS C 2 6  ? -8.982  37.432 -19.970 1.00 44.53  ? 6   LYS B HA   1 
ATOM   1676 H  HB2  . LYS C 2 6  ? -7.556  39.717 -19.236 1.00 44.67  ? 6   LYS B HB2  1 
ATOM   1677 H  HB3  . LYS C 2 6  ? -6.819  38.353 -19.554 1.00 44.67  ? 6   LYS B HB3  1 
ATOM   1678 H  HG2  . LYS C 2 6  ? -7.311  38.497 -21.748 1.00 47.75  ? 6   LYS B HG2  1 
ATOM   1679 H  HG3  . LYS C 2 6  ? -8.367  39.677 -21.492 1.00 47.75  ? 6   LYS B HG3  1 
ATOM   1680 H  HD2  . LYS C 2 6  ? -6.619  41.133 -20.821 1.00 54.34  ? 6   LYS B HD2  1 
ATOM   1681 H  HD3  . LYS C 2 6  ? -5.557  39.960 -20.941 1.00 54.34  ? 6   LYS B HD3  1 
ATOM   1682 H  HE2  . LYS C 2 6  ? -5.658  40.022 -23.214 1.00 63.54  ? 6   LYS B HE2  1 
ATOM   1683 H  HE3  . LYS C 2 6  ? -6.873  41.055 -23.169 1.00 63.54  ? 6   LYS B HE3  1 
ATOM   1684 H  HZ1  . LYS C 2 6  ? -4.924  42.133 -23.550 1.00 67.43  ? 6   LYS B HZ1  1 
ATOM   1685 H  HZ2  . LYS C 2 6  ? -5.457  42.569 -22.275 1.00 67.43  ? 6   LYS B HZ2  1 
ATOM   1686 H  HZ3  . LYS C 2 6  ? -4.354  41.631 -22.316 1.00 67.43  ? 6   LYS B HZ3  1 
ATOM   1687 N  N    . ALA C 2 7  ? -8.704  38.294 -16.919 1.00 38.01  ? 7   ALA B N    1 
ATOM   1688 C  CA   . ALA C 2 7  ? -8.514  37.804 -15.567 1.00 34.23  ? 7   ALA B CA   1 
ATOM   1689 C  C    . ALA C 2 7  ? -9.567  36.715 -15.284 1.00 34.40  ? 7   ALA B C    1 
ATOM   1690 O  O    . ALA C 2 7  ? -9.243  35.660 -14.773 1.00 33.79  ? 7   ALA B O    1 
ATOM   1691 C  CB   . ALA C 2 7  ? -8.592  38.939 -14.581 1.00 30.14  ? 7   ALA B CB   1 
ATOM   1692 H  H    . ALA C 2 7  ? -8.909  39.127 -16.966 1.00 45.61  ? 7   ALA B H    1 
ATOM   1693 H  HA   . ALA C 2 7  ? -7.635  37.401 -15.494 1.00 41.07  ? 7   ALA B HA   1 
ATOM   1694 H  HB1  . ALA C 2 7  ? -7.899  39.585 -14.787 1.00 36.17  ? 7   ALA B HB1  1 
ATOM   1695 H  HB2  . ALA C 2 7  ? -9.465  39.357 -14.650 1.00 36.17  ? 7   ALA B HB2  1 
ATOM   1696 H  HB3  . ALA C 2 7  ? -8.463  38.588 -13.685 1.00 36.17  ? 7   ALA B HB3  1 
ATOM   1697 N  N    . MET C 2 8  ? -10.795 36.926 -15.728 1.00 33.92  ? 8   MET B N    1 
ATOM   1698 C  CA   . MET C 2 8  ? -11.837 35.923 -15.520 1.00 34.28  ? 8   MET B CA   1 
ATOM   1699 C  C    . MET C 2 8  ? -11.558 34.564 -16.253 1.00 34.97  ? 8   MET B C    1 
ATOM   1700 O  O    . MET C 2 8  ? -11.849 33.477 -15.747 1.00 35.34  ? 8   MET B O    1 
ATOM   1701 C  CB   . MET C 2 8  ? -13.153 36.502 -16.027 1.00 35.75  ? 8   MET B CB   1 
ATOM   1702 C  CG   . MET C 2 8  ? -13.807 37.571 -15.162 1.00 35.40  ? 8   MET B CG   1 
ATOM   1703 S  SD   . MET C 2 8  ? -15.130 38.422 -16.005 1.00 33.68  ? 8   MET B SD   1 
ATOM   1704 C  CE   . MET C 2 8  ? -15.729 39.352 -14.610 1.00 49.46  ? 8   MET B CE   1 
ATOM   1705 H  H    . MET C 2 8  ? -11.053 37.631 -16.148 1.00 40.70  ? 8   MET B H    1 
ATOM   1706 H  HA   . MET C 2 8  ? -11.928 35.756 -14.569 1.00 41.13  ? 8   MET B HA   1 
ATOM   1707 H  HB2  . MET C 2 8  ? -12.994 36.897 -16.899 1.00 42.90  ? 8   MET B HB2  1 
ATOM   1708 H  HB3  . MET C 2 8  ? -13.789 35.776 -16.115 1.00 42.90  ? 8   MET B HB3  1 
ATOM   1709 H  HG2  . MET C 2 8  ? -14.176 37.153 -14.369 1.00 42.48  ? 8   MET B HG2  1 
ATOM   1710 H  HG3  . MET C 2 8  ? -13.138 38.227 -14.912 1.00 42.48  ? 8   MET B HG3  1 
ATOM   1711 H  HE1  . MET C 2 8  ? -15.016 39.920 -14.279 1.00 59.36  ? 8   MET B HE1  1 
ATOM   1712 H  HE2  . MET C 2 8  ? -16.481 39.896 -14.893 1.00 59.36  ? 8   MET B HE2  1 
ATOM   1713 H  HE3  . MET C 2 8  ? -16.010 38.735 -13.916 1.00 59.36  ? 8   MET B HE3  1 
ATOM   1714 N  N    . VAL C 2 9  ? -11.023 34.646 -17.463 1.00 35.67  ? 9   VAL B N    1 
ATOM   1715 C  CA   . VAL C 2 9  ? -10.729 33.479 -18.232 1.00 36.95  ? 9   VAL B CA   1 
ATOM   1716 C  C    . VAL C 2 9  ? -9.542  32.821 -17.564 1.00 37.25  ? 9   VAL B C    1 
ATOM   1717 O  O    . VAL C 2 9  ? -9.421  31.622 -17.612 1.00 38.91  ? 9   VAL B O    1 
ATOM   1718 C  CB   . VAL C 2 9  ? -10.450 33.825 -19.704 1.00 39.60  ? 9   VAL B CB   1 
ATOM   1719 C  CG1  . VAL C 2 9  ? -9.905  32.619 -20.489 1.00 38.92  ? 9   VAL B CG1  1 
ATOM   1720 C  CG2  . VAL C 2 9  ? -11.731 34.367 -20.300 1.00 38.90  ? 9   VAL B CG2  1 
ATOM   1721 H  H    . VAL C 2 9  ? -10.823 35.384 -17.857 1.00 42.81  ? 9   VAL B H    1 
ATOM   1722 H  HA   . VAL C 2 9  ? -11.482 32.868 -18.196 1.00 44.34  ? 9   VAL B HA   1 
ATOM   1723 H  HB   . VAL C 2 9  ? -9.784  34.529 -19.740 1.00 47.52  ? 9   VAL B HB   1 
ATOM   1724 H  HG11 . VAL C 2 9  ? -9.746  32.887 -21.407 1.00 46.70  ? 9   VAL B HG11 1 
ATOM   1725 H  HG12 . VAL C 2 9  ? -9.076  32.326 -20.080 1.00 46.70  ? 9   VAL B HG12 1 
ATOM   1726 H  HG13 . VAL C 2 9  ? -10.559 31.904 -20.461 1.00 46.70  ? 9   VAL B HG13 1 
ATOM   1727 H  HG21 . VAL C 2 9  ? -12.421 34.368 -19.618 1.00 46.68  ? 9   VAL B HG21 1 
ATOM   1728 H  HG22 . VAL C 2 9  ? -11.575 35.271 -20.615 1.00 46.68  ? 9   VAL B HG22 1 
ATOM   1729 H  HG23 . VAL C 2 9  ? -11.999 33.800 -21.040 1.00 46.68  ? 9   VAL B HG23 1 
ATOM   1730 N  N    . ALA C 2 10 ? -8.679  33.621 -16.934 1.00 36.34  ? 10  ALA B N    1 
ATOM   1731 C  CA   . ALA C 2 10 ? -7.577  33.055 -16.200 1.00 36.20  ? 10  ALA B CA   1 
ATOM   1732 C  C    . ALA C 2 10 ? -8.055  32.188 -14.998 1.00 35.05  ? 10  ALA B C    1 
ATOM   1733 O  O    . ALA C 2 10 ? -7.568  31.056 -14.767 1.00 37.01  ? 10  ALA B O    1 
ATOM   1734 C  CB   . ALA C 2 10 ? -6.662  34.178 -15.722 1.00 33.30  ? 10  ALA B CB   1 
ATOM   1735 H  H    . ALA C 2 10 ? -8.718  34.480 -16.922 1.00 43.61  ? 10  ALA B H    1 
ATOM   1736 H  HA   . ALA C 2 10 ? -7.065  32.485 -16.794 1.00 43.44  ? 10  ALA B HA   1 
ATOM   1737 H  HB1  . ALA C 2 10 ? -7.167  34.774 -15.148 1.00 39.96  ? 10  ALA B HB1  1 
ATOM   1738 H  HB2  . ALA C 2 10 ? -5.921  33.792 -15.228 1.00 39.96  ? 10  ALA B HB2  1 
ATOM   1739 H  HB3  . ALA C 2 10 ? -6.329  34.663 -16.493 1.00 39.96  ? 10  ALA B HB3  1 
ATOM   1740 N  N    . LEU C 2 11 ? -9.038  32.691 -14.271 1.00 32.83  ? 11  LEU B N    1 
ATOM   1741 C  CA   . LEU C 2 11 ? -9.558  31.960 -13.160 1.00 35.33  ? 11  LEU B CA   1 
ATOM   1742 C  C    . LEU C 2 11 ? -10.175 30.646 -13.635 1.00 36.91  ? 11  LEU B C    1 
ATOM   1743 O  O    . LEU C 2 11 ? -9.993  29.653 -13.008 1.00 35.76  ? 11  LEU B O    1 
ATOM   1744 C  CB   . LEU C 2 11 ? -10.630 32.766 -12.414 1.00 37.70  ? 11  LEU B CB   1 
ATOM   1745 C  CG   . LEU C 2 11 ? -10.242 34.127 -11.891 1.00 32.45  ? 11  LEU B CG   1 
ATOM   1746 C  CD1  . LEU C 2 11 ? -11.484 34.914 -11.398 1.00 33.24  ? 11  LEU B CD1  1 
ATOM   1747 C  CD2  . LEU C 2 11 ? -9.219  34.036 -10.845 1.00 31.34  ? 11  LEU B CD2  1 
ATOM   1748 H  H    . LEU C 2 11 ? -9.414  33.452 -14.409 1.00 39.40  ? 11  LEU B H    1 
ATOM   1749 H  HA   . LEU C 2 11 ? -8.839  31.756 -12.541 1.00 42.39  ? 11  LEU B HA   1 
ATOM   1750 H  HB2  . LEU C 2 11 ? -11.379 32.896 -13.017 1.00 45.24  ? 11  LEU B HB2  1 
ATOM   1751 H  HB3  . LEU C 2 11 ? -10.923 32.242 -11.652 1.00 45.24  ? 11  LEU B HB3  1 
ATOM   1752 H  HG   . LEU C 2 11 ? -9.857  34.632 -12.624 1.00 38.94  ? 11  LEU B HG   1 
ATOM   1753 H  HD11 . LEU C 2 11 ? -11.197 35.780 -11.069 1.00 39.89  ? 11  LEU B HD11 1 
ATOM   1754 H  HD12 . LEU C 2 11 ? -12.100 35.027 -12.138 1.00 39.89  ? 11  LEU B HD12 1 
ATOM   1755 H  HD13 . LEU C 2 11 ? -11.911 34.414 -10.685 1.00 39.89  ? 11  LEU B HD13 1 
ATOM   1756 H  HD21 . LEU C 2 11 ? -9.567  33.509 -10.108 1.00 37.61  ? 11  LEU B HD21 1 
ATOM   1757 H  HD22 . LEU C 2 11 ? -8.429  33.610 -11.212 1.00 37.61  ? 11  LEU B HD22 1 
ATOM   1758 H  HD23 . LEU C 2 11 ? -9.001  34.930 -10.539 1.00 37.61  ? 11  LEU B HD23 1 
ATOM   1759 N  N    . ILE C 2 12 ? -10.892 30.653 -14.758 1.00 36.82  ? 12  ILE B N    1 
ATOM   1760 C  CA   . ILE C 2 12 ? -11.507 29.437 -15.249 1.00 38.25  ? 12  ILE B CA   1 
ATOM   1761 C  C    . ILE C 2 12 ? -10.393 28.476 -15.573 1.00 38.83  ? 12  ILE B C    1 
ATOM   1762 O  O    . ILE C 2 12 ? -10.493 27.267 -15.327 1.00 38.87  ? 12  ILE B O    1 
ATOM   1763 C  CB   . ILE C 2 12 ? -12.406 29.670 -16.480 1.00 38.86  ? 12  ILE B CB   1 
ATOM   1764 C  CG1  . ILE C 2 12 ? -13.660 30.465 -16.056 1.00 40.94  ? 12  ILE B CG1  1 
ATOM   1765 C  CG2  . ILE C 2 12 ? -12.880 28.359 -17.048 1.00 42.43  ? 12  ILE B CG2  1 
ATOM   1766 C  CD1  . ILE C 2 12 ? -14.467 31.096 -17.203 1.00 40.53  ? 12  ILE B CD1  1 
ATOM   1767 H  H    . ILE C 2 12 ? -11.033 31.346 -15.247 1.00 44.18  ? 12  ILE B H    1 
ATOM   1768 H  HA   . ILE C 2 12 ? -12.050 29.048 -14.547 1.00 45.90  ? 12  ILE B HA   1 
ATOM   1769 H  HB   . ILE C 2 12 ? -11.916 30.164 -17.156 1.00 46.64  ? 12  ILE B HB   1 
ATOM   1770 H  HG12 . ILE C 2 12 ? -14.255 29.867 -15.578 1.00 49.13  ? 12  ILE B HG12 1 
ATOM   1771 H  HG13 . ILE C 2 12 ? -13.383 31.184 -15.467 1.00 49.13  ? 12  ILE B HG13 1 
ATOM   1772 H  HG21 . ILE C 2 12 ? -13.387 27.886 -16.370 1.00 50.91  ? 12  ILE B HG21 1 
ATOM   1773 H  HG22 . ILE C 2 12 ? -13.442 28.535 -17.819 1.00 50.91  ? 12  ILE B HG22 1 
ATOM   1774 H  HG23 . ILE C 2 12 ? -12.110 27.833 -17.313 1.00 50.91  ? 12  ILE B HG23 1 
ATOM   1775 H  HD11 . ILE C 2 12 ? -15.228 31.568 -16.831 1.00 48.64  ? 12  ILE B HD11 1 
ATOM   1776 H  HD12 . ILE C 2 12 ? -13.897 31.714 -17.686 1.00 48.64  ? 12  ILE B HD12 1 
ATOM   1777 H  HD13 . ILE C 2 12 ? -14.772 30.392 -17.798 1.00 48.64  ? 12  ILE B HD13 1 
ATOM   1778 N  N    . ASP C 2 13 ? -9.323  29.028 -16.112 1.00 39.36  ? 13  ASP B N    1 
ATOM   1779 C  CA   . ASP C 2 13 ? -8.230  28.214 -16.551 1.00 40.11  ? 13  ASP B CA   1 
ATOM   1780 C  C    . ASP C 2 13 ? -7.520  27.457 -15.422 1.00 38.82  ? 13  ASP B C    1 
ATOM   1781 O  O    . ASP C 2 13 ? -7.412  26.249 -15.456 1.00 38.64  ? 13  ASP B O    1 
ATOM   1782 C  CB   . ASP C 2 13 ? -7.213  29.083 -17.265 1.00 42.91  ? 13  ASP B CB   1 
ATOM   1783 C  CG   . ASP C 2 13 ? -7.281  28.940 -18.730 1.00 48.84  ? 13  ASP B CG   1 
ATOM   1784 O  OD1  . ASP C 2 13 ? -8.382  29.155 -19.279 1.00 51.68  ? 13  ASP B OD1  1 
ATOM   1785 O  OD2  . ASP C 2 13 ? -6.255  28.528 -19.318 1.00 57.88  ? 13  ASP B OD2  1 
ATOM   1786 H  H    . ASP C 2 13 ? -9.212  29.873 -16.232 1.00 47.23  ? 13  ASP B H    1 
ATOM   1787 H  HA   . ASP C 2 13 ? -8.562  27.560 -17.185 1.00 48.13  ? 13  ASP B HA   1 
ATOM   1788 H  HB2  . ASP C 2 13 ? -7.380  30.013 -17.046 1.00 51.49  ? 13  ASP B HB2  1 
ATOM   1789 H  HB3  . ASP C 2 13 ? -6.322  28.828 -16.979 1.00 51.49  ? 13  ASP B HB3  1 
ATOM   1790 N  N    . VAL C 2 14 ? -7.054  28.169 -14.419 1.00 37.23  ? 14  VAL B N    1 
ATOM   1791 C  CA   . VAL C 2 14 ? -6.305  27.522 -13.401 1.00 37.15  ? 14  VAL B CA   1 
ATOM   1792 C  C    . VAL C 2 14 ? -7.193  26.559 -12.614 1.00 35.92  ? 14  VAL B C    1 
ATOM   1793 O  O    . VAL C 2 14 ? -6.691  25.594 -12.068 1.00 35.20  ? 14  VAL B O    1 
ATOM   1794 C  CB   . VAL C 2 14 ? -5.615  28.562 -12.444 1.00 37.96  ? 14  VAL B CB   1 
ATOM   1795 C  CG1  . VAL C 2 14 ? -6.649  29.393 -11.629 1.00 35.19  ? 14  VAL B CG1  1 
ATOM   1796 C  CG2  . VAL C 2 14 ? -4.569  27.819 -11.525 1.00 39.19  ? 14  VAL B CG2  1 
ATOM   1797 H  H    . VAL C 2 14 ? -7.161  29.016 -14.314 1.00 44.67  ? 14  VAL B H    1 
ATOM   1798 H  HA   . VAL C 2 14 ? -5.604  26.998 -13.819 1.00 44.58  ? 14  VAL B HA   1 
ATOM   1799 H  HB   . VAL C 2 14 ? -5.117  29.188 -12.992 1.00 45.55  ? 14  VAL B HB   1 
ATOM   1800 H  HG11 . VAL C 2 14 ? -6.173  30.016 -11.057 1.00 42.23  ? 14  VAL B HG11 1 
ATOM   1801 H  HG12 . VAL C 2 14 ? -7.219  29.879 -12.245 1.00 42.23  ? 14  VAL B HG12 1 
ATOM   1802 H  HG13 . VAL C 2 14 ? -7.183  28.790 -11.088 1.00 42.23  ? 14  VAL B HG13 1 
ATOM   1803 H  HG21 . VAL C 2 14 ? -4.148  28.467 -10.939 1.00 47.02  ? 14  VAL B HG21 1 
ATOM   1804 H  HG22 . VAL C 2 14 ? -5.031  27.148 -11.000 1.00 47.02  ? 14  VAL B HG22 1 
ATOM   1805 H  HG23 . VAL C 2 14 ? -3.900  27.397 -12.087 1.00 47.02  ? 14  VAL B HG23 1 
ATOM   1806 N  N    . PHE C 2 15 ? -8.494  26.850 -12.512 1.00 36.16  ? 15  PHE B N    1 
ATOM   1807 C  CA   . PHE C 2 15 ? -9.396  25.949 -11.815 1.00 35.28  ? 15  PHE B CA   1 
ATOM   1808 C  C    . PHE C 2 15 ? -9.419  24.590 -12.488 1.00 35.17  ? 15  PHE B C    1 
ATOM   1809 O  O    . PHE C 2 15 ? -9.228  23.577 -11.822 1.00 35.21  ? 15  PHE B O    1 
ATOM   1810 C  CB   . PHE C 2 15 ? -10.786 26.481 -11.764 1.00 35.26  ? 15  PHE B CB   1 
ATOM   1811 C  CG   . PHE C 2 15 ? -11.776 25.481 -11.233 1.00 36.46  ? 15  PHE B CG   1 
ATOM   1812 C  CD1  . PHE C 2 15 ? -12.006 25.364 -9.871  1.00 35.50  ? 15  PHE B CD1  1 
ATOM   1813 C  CD2  . PHE C 2 15 ? -12.480 24.649 -12.101 1.00 37.26  ? 15  PHE B CD2  1 
ATOM   1814 C  CE1  . PHE C 2 15 ? -12.930 24.404 -9.373  1.00 37.16  ? 15  PHE B CE1  1 
ATOM   1815 C  CE2  . PHE C 2 15 ? -13.410 23.685 -11.624 1.00 37.83  ? 15  PHE B CE2  1 
ATOM   1816 C  CZ   . PHE C 2 15 ? -13.637 23.563 -10.274 1.00 36.28  ? 15  PHE B CZ   1 
ATOM   1817 H  H    . PHE C 2 15 ? -8.868  27.553 -12.835 1.00 43.39  ? 15  PHE B H    1 
ATOM   1818 H  HA   . PHE C 2 15 ? -9.085  25.830 -10.904 1.00 42.34  ? 15  PHE B HA   1 
ATOM   1819 H  HB2  . PHE C 2 15 ? -10.805 27.258 -11.185 1.00 42.31  ? 15  PHE B HB2  1 
ATOM   1820 H  HB3  . PHE C 2 15 ? -11.062 26.728 -12.661 1.00 42.31  ? 15  PHE B HB3  1 
ATOM   1821 H  HD1  . PHE C 2 15 ? -11.541 25.908 -9.277  1.00 42.60  ? 15  PHE B HD1  1 
ATOM   1822 H  HD2  . PHE C 2 15 ? -12.330 24.719 -13.016 1.00 44.71  ? 15  PHE B HD2  1 
ATOM   1823 H  HE1  . PHE C 2 15 ? -13.078 24.333 -8.457  1.00 44.59  ? 15  PHE B HE1  1 
ATOM   1824 H  HE2  . PHE C 2 15 ? -13.867 23.142 -12.225 1.00 45.39  ? 15  PHE B HE2  1 
ATOM   1825 H  HZ   . PHE C 2 15 ? -14.248 22.939 -9.955  1.00 43.53  ? 15  PHE B HZ   1 
ATOM   1826 N  N    . HIS C 2 16 ? -9.582  24.619 -13.805 1.00 36.78  ? 16  HIS B N    1 
ATOM   1827 C  CA   . HIS C 2 16 ? -9.514  23.449 -14.666 1.00 37.78  ? 16  HIS B CA   1 
ATOM   1828 C  C    . HIS C 2 16 ? -8.122  22.856 -14.746 1.00 36.98  ? 16  HIS B C    1 
ATOM   1829 O  O    . HIS C 2 16 ? -8.001  21.660 -14.899 1.00 37.44  ? 16  HIS B O    1 
ATOM   1830 C  CB   . HIS C 2 16 ? -10.046 23.772 -16.057 1.00 34.53  ? 16  HIS B CB   1 
ATOM   1831 C  CG   . HIS C 2 16 ? -11.538 23.748 -16.136 1.00 42.16  ? 16  HIS B CG   1 
ATOM   1832 N  ND1  . HIS C 2 16 ? -12.303 22.812 -15.471 1.00 45.67  ? 16  HIS B ND1  1 
ATOM   1833 C  CD2  . HIS C 2 16 ? -12.417 24.589 -16.736 1.00 49.04  ? 16  HIS B CD2  1 
ATOM   1834 C  CE1  . HIS C 2 16 ? -13.582 23.042 -15.707 1.00 50.82  ? 16  HIS B CE1  1 
ATOM   1835 N  NE2  . HIS C 2 16 ? -13.678 24.121 -16.463 1.00 54.25  ? 16  HIS B NE2  1 
ATOM   1836 H  H    . HIS C 2 16 ? -9.740  25.343 -14.242 1.00 44.13  ? 16  HIS B H    1 
ATOM   1837 H  HA   . HIS C 2 16 ? -10.093 22.767 -14.292 1.00 45.33  ? 16  HIS B HA   1 
ATOM   1838 H  HB2  . HIS C 2 16 ? -9.747  24.660 -16.310 1.00 41.43  ? 16  HIS B HB2  1 
ATOM   1839 H  HB3  . HIS C 2 16 ? -9.703  23.117 -16.685 1.00 41.43  ? 16  HIS B HB3  1 
ATOM   1840 H  HD2  . HIS C 2 16 ? -12.204 25.329 -17.258 1.00 58.84  ? 16  HIS B HD2  1 
ATOM   1841 H  HE1  . HIS C 2 16 ? -14.294 22.543 -15.377 1.00 60.98  ? 16  HIS B HE1  1 
ATOM   1842 N  N    . GLN C 2 17 ? -7.078  23.670 -14.710 1.00 38.12  ? 17  GLN B N    1 
ATOM   1843 C  CA   . GLN C 2 17 ? -5.731  23.141 -14.785 1.00 39.16  ? 17  GLN B CA   1 
ATOM   1844 C  C    . GLN C 2 17 ? -5.562  22.114 -13.699 1.00 39.95  ? 17  GLN B C    1 
ATOM   1845 O  O    . GLN C 2 17 ? -4.896  21.082 -13.861 1.00 41.18  ? 17  GLN B O    1 
ATOM   1846 C  CB   . GLN C 2 17 ? -4.755  24.245 -14.638 1.00 39.91  ? 17  GLN B CB   1 
ATOM   1847 C  CG   . GLN C 2 17 ? -3.289  23.951 -14.697 1.00 44.53  ? 17  GLN B CG   1 
ATOM   1848 C  CD   . GLN C 2 17 ? -2.548  25.292 -14.450 1.00 55.98  ? 17  GLN B CD   1 
ATOM   1849 O  OE1  . GLN C 2 17 ? -3.179  26.367 -14.555 1.00 47.14  ? 17  GLN B OE1  1 
ATOM   1850 N  NE2  . GLN C 2 17 ? -1.262  25.239 -14.066 1.00 48.91  ? 17  GLN B NE2  1 
ATOM   1851 H  H    . GLN C 2 17 ? -7.124  24.526 -14.643 1.00 45.74  ? 17  GLN B H    1 
ATOM   1852 H  HA   . GLN C 2 17 ? -5.593  22.713 -15.645 1.00 46.99  ? 17  GLN B HA   1 
ATOM   1853 H  HB2  . GLN C 2 17 ? -4.936  24.890 -15.341 1.00 47.89  ? 17  GLN B HB2  1 
ATOM   1854 H  HB3  . GLN C 2 17 ? -4.918  24.666 -13.780 1.00 47.89  ? 17  GLN B HB3  1 
ATOM   1855 H  HG2  . GLN C 2 17 ? -3.046  23.321 -14.001 1.00 53.43  ? 17  GLN B HG2  1 
ATOM   1856 H  HG3  . GLN C 2 17 ? -3.051  23.614 -15.575 1.00 53.43  ? 17  GLN B HG3  1 
ATOM   1857 H  HE21 . GLN C 2 17 ? -0.874  24.478 -13.965 1.00 58.69  ? 17  GLN B HE21 1 
ATOM   1858 H  HE22 . GLN C 2 17 ? -0.826  25.967 -13.922 1.00 58.69  ? 17  GLN B HE22 1 
ATOM   1859 N  N    . TYR C 2 18 ? -6.233  22.375 -12.593 1.00 37.65  ? 18  TYR B N    1 
ATOM   1860 C  CA   . TYR C 2 18 ? -6.137  21.481 -11.461 1.00 41.95  ? 18  TYR B CA   1 
ATOM   1861 C  C    . TYR C 2 18 ? -7.321  20.518 -11.250 1.00 38.73  ? 18  TYR B C    1 
ATOM   1862 O  O    . TYR C 2 18 ? -7.117  19.454 -10.755 1.00 36.86  ? 18  TYR B O    1 
ATOM   1863 C  CB   . TYR C 2 18 ? -5.915  22.308 -10.230 1.00 36.29  ? 18  TYR B CB   1 
ATOM   1864 C  CG   . TYR C 2 18 ? -4.520  22.739 -10.194 1.00 38.38  ? 18  TYR B CG   1 
ATOM   1865 C  CD1  . TYR C 2 18 ? -3.529  21.922 -9.683  1.00 38.44  ? 18  TYR B CD1  1 
ATOM   1866 C  CD2  . TYR C 2 18 ? -4.173  23.979 -10.698 1.00 39.72  ? 18  TYR B CD2  1 
ATOM   1867 C  CE1  . TYR C 2 18 ? -2.246  22.349 -9.657  1.00 38.92  ? 18  TYR B CE1  1 
ATOM   1868 C  CE2  . TYR C 2 18 ? -2.916  24.401 -10.696 1.00 39.43  ? 18  TYR B CE2  1 
ATOM   1869 C  CZ   . TYR C 2 18 ? -1.944  23.609 -10.184 1.00 40.06  ? 18  TYR B CZ   1 
ATOM   1870 O  OH   . TYR C 2 18 ? -0.668  24.123 -10.181 1.00 39.10  ? 18  TYR B OH   1 
ATOM   1871 H  H    . TYR C 2 18 ? -6.745  23.055 -12.473 1.00 45.18  ? 18  TYR B H    1 
ATOM   1872 H  HA   . TYR C 2 18 ? -5.346  20.932 -11.581 1.00 50.34  ? 18  TYR B HA   1 
ATOM   1873 H  HB2  . TYR C 2 18 ? -6.484  23.094 -10.255 1.00 43.55  ? 18  TYR B HB2  1 
ATOM   1874 H  HB3  . TYR C 2 18 ? -6.097  21.777 -9.439  1.00 43.55  ? 18  TYR B HB3  1 
ATOM   1875 H  HD1  . TYR C 2 18 ? -3.748  21.087 -9.337  1.00 46.13  ? 18  TYR B HD1  1 
ATOM   1876 H  HD2  . TYR C 2 18 ? -4.836  24.528 -11.052 1.00 47.66  ? 18  TYR B HD2  1 
ATOM   1877 H  HE1  . TYR C 2 18 ? -1.575  21.809 -9.308  1.00 46.70  ? 18  TYR B HE1  1 
ATOM   1878 H  HE2  . TYR C 2 18 ? -2.705  25.244 -11.029 1.00 47.32  ? 18  TYR B HE2  1 
ATOM   1879 H  HH   . TYR C 2 18 ? -0.664  24.885 -10.534 1.00 46.91  ? 18  TYR B HH   1 
ATOM   1880 N  N    . SER C 2 19 ? -8.534  20.899 -11.619 1.00 35.79  ? 19  SER B N    1 
ATOM   1881 C  CA   . SER C 2 19 ? -9.689  20.080 -11.330 1.00 36.07  ? 19  SER B CA   1 
ATOM   1882 C  C    . SER C 2 19 ? -9.686  18.846 -12.256 1.00 37.75  ? 19  SER B C    1 
ATOM   1883 O  O    . SER C 2 19 ? -10.279 17.834 -11.939 1.00 37.72  ? 19  SER B O    1 
ATOM   1884 C  CB   . SER C 2 19 ? -10.981 20.880 -11.473 1.00 35.73  ? 19  SER B CB   1 
ATOM   1885 O  OG   . SER C 2 19 ? -11.186 21.262 -12.817 1.00 36.29  ? 19  SER B OG   1 
ATOM   1886 H  H    . SER C 2 19 ? -8.712  21.628 -12.038 1.00 42.95  ? 19  SER B H    1 
ATOM   1887 H  HA   . SER C 2 19 ? -9.631  19.767 -10.414 1.00 43.29  ? 19  SER B HA   1 
ATOM   1888 H  HB2  . SER C 2 19 ? -11.726 20.331 -11.183 1.00 42.87  ? 19  SER B HB2  1 
ATOM   1889 H  HB3  . SER C 2 19 ? -10.922 21.677 -10.924 1.00 42.87  ? 19  SER B HB3  1 
ATOM   1890 H  HG   . SER C 2 19 ? -11.899 21.701 -12.885 1.00 43.55  ? 19  SER B HG   1 
ATOM   1891 N  N    . GLY C 2 20 ? -8.982  18.913 -13.380 1.00 38.85  ? 20  GLY B N    1 
ATOM   1892 C  CA   . GLY C 2 20 ? -8.978  17.815 -14.321 1.00 39.23  ? 20  GLY B CA   1 
ATOM   1893 C  C    . GLY C 2 20 ? -7.946  16.724 -13.993 1.00 41.47  ? 20  GLY B C    1 
ATOM   1894 O  O    . GLY C 2 20 ? -7.785  15.771 -14.754 1.00 42.03  ? 20  GLY B O    1 
ATOM   1895 H  H    . GLY C 2 20 ? -8.499  19.584 -13.616 1.00 46.62  ? 20  GLY B H    1 
ATOM   1896 H  HA2  . GLY C 2 20 ? -9.857  17.405 -14.337 1.00 47.08  ? 20  GLY B HA2  1 
ATOM   1897 H  HA3  . GLY C 2 20 ? -8.786  18.156 -15.209 1.00 47.08  ? 20  GLY B HA3  1 
ATOM   1898 N  N    . ARG C 2 21 ? -7.189  16.884 -12.913 1.00 41.18  ? 21  ARG B N    1 
ATOM   1899 C  CA   . ARG C 2 21 ? -6.113  15.953 -12.638 1.00 42.51  ? 21  ARG B CA   1 
ATOM   1900 C  C    . ARG C 2 21 ? -6.684  14.585 -12.235 1.00 42.51  ? 21  ARG B C    1 
ATOM   1901 O  O    . ARG C 2 21 ? -6.370  13.588 -12.834 1.00 40.89  ? 21  ARG B O    1 
ATOM   1902 C  CB   . ARG C 2 21 ? -5.198  16.529 -11.574 1.00 42.99  ? 21  ARG B CB   1 
ATOM   1903 C  CG   . ARG C 2 21 ? -4.417  17.696 -12.137 1.00 44.68  ? 21  ARG B CG   1 
ATOM   1904 C  CD   . ARG C 2 21 ? -3.432  18.324 -11.168 1.00 46.29  ? 21  ARG B CD   1 
ATOM   1905 N  NE   . ARG C 2 21 ? -2.659  19.352 -11.865 1.00 47.72  ? 21  ARG B NE   1 
ATOM   1906 C  CZ   . ARG C 2 21 ? -1.487  19.822 -11.445 1.00 48.46  ? 21  ARG B CZ   1 
ATOM   1907 N  NH1  . ARG C 2 21 ? -0.948  19.368 -10.308 1.00 45.64  ? 21  ARG B NH1  1 
ATOM   1908 N  NH2  . ARG C 2 21 ? -0.879  20.765 -12.161 1.00 49.83  ? 21  ARG B NH2  1 
ATOM   1909 H  H    . ARG C 2 21 ? -7.279  17.514 -12.335 1.00 49.42  ? 21  ARG B H    1 
ATOM   1910 H  HA   . ARG C 2 21 ? -5.590  15.830 -13.446 1.00 51.01  ? 21  ARG B HA   1 
ATOM   1911 H  HB2  . ARG C 2 21 ? -5.729  16.845 -10.826 1.00 51.59  ? 21  ARG B HB2  1 
ATOM   1912 H  HB3  . ARG C 2 21 ? -4.570  15.850 -11.283 1.00 51.59  ? 21  ARG B HB3  1 
ATOM   1913 H  HG2  . ARG C 2 21 ? -3.916  17.390 -12.909 1.00 53.61  ? 21  ARG B HG2  1 
ATOM   1914 H  HG3  . ARG C 2 21 ? -5.043  18.386 -12.407 1.00 53.61  ? 21  ARG B HG3  1 
ATOM   1915 H  HD2  . ARG C 2 21 ? -3.912  18.740 -10.436 1.00 55.54  ? 21  ARG B HD2  1 
ATOM   1916 H  HD3  . ARG C 2 21 ? -2.821  17.647 -10.838 1.00 55.54  ? 21  ARG B HD3  1 
ATOM   1917 H  HE   . ARG C 2 21 ? -2.984  19.673 -12.594 1.00 57.26  ? 21  ARG B HE   1 
ATOM   1918 H  HH11 . ARG C 2 21 ? -1.352  18.761 -9.853  1.00 54.76  ? 21  ARG B HH11 1 
ATOM   1919 H  HH12 . ARG C 2 21 ? -0.192  19.676 -10.038 1.00 54.76  ? 21  ARG B HH12 1 
ATOM   1920 H  HH21 . ARG C 2 21 ? -1.237  21.051 -12.889 1.00 59.80  ? 21  ARG B HH21 1 
ATOM   1921 H  HH22 . ARG C 2 21 ? -0.122  21.081 -11.901 1.00 59.80  ? 21  ARG B HH22 1 
ATOM   1922 N  N    . GLU C 2 22 ? -7.544  14.568 -11.232 1.00 43.43  ? 22  GLU B N    1 
ATOM   1923 C  CA   . GLU C 2 22 ? -8.101  13.336 -10.734 1.00 44.83  ? 22  GLU B CA   1 
ATOM   1924 C  C    . GLU C 2 22 ? -9.594  13.411 -10.635 1.00 43.45  ? 22  GLU B C    1 
ATOM   1925 O  O    . GLU C 2 22 ? -10.167 14.497 -10.562 1.00 41.90  ? 22  GLU B O    1 
ATOM   1926 C  CB   . GLU C 2 22 ? -7.560  13.007 -9.365  1.00 47.99  ? 22  GLU B CB   1 
ATOM   1927 C  CG   . GLU C 2 22 ? -6.088  13.214 -9.239  1.00 52.34  ? 22  GLU B CG   1 
ATOM   1928 C  CD   . GLU C 2 22 ? -5.599  13.159 -7.795  1.00 59.60  ? 22  GLU B CD   1 
ATOM   1929 O  OE1  . GLU C 2 22 ? -6.192  12.443 -6.933  1.00 66.58  ? 22  GLU B OE1  1 
ATOM   1930 O  OE2  . GLU C 2 22 ? -4.597  13.850 -7.532  1.00 63.99  ? 22  GLU B OE2  1 
ATOM   1931 H  H    . GLU C 2 22 ? -7.822  15.270 -10.820 1.00 52.12  ? 22  GLU B H    1 
ATOM   1932 H  HA   . GLU C 2 22 ? -7.870  12.612 -11.337 1.00 53.80  ? 22  GLU B HA   1 
ATOM   1933 H  HB2  . GLU C 2 22 ? -7.998  13.574 -8.711  1.00 57.59  ? 22  GLU B HB2  1 
ATOM   1934 H  HB3  . GLU C 2 22 ? -7.747  12.075 -9.170  1.00 57.59  ? 22  GLU B HB3  1 
ATOM   1935 H  HG2  . GLU C 2 22 ? -5.628  12.521 -9.737  1.00 62.81  ? 22  GLU B HG2  1 
ATOM   1936 H  HG3  . GLU C 2 22 ? -5.861  14.086 -9.598  1.00 62.81  ? 22  GLU B HG3  1 
ATOM   1937 N  N    . GLY C 2 23 ? -10.209 12.230 -10.625 1.00 44.04  ? 23  GLY B N    1 
ATOM   1938 C  CA   . GLY C 2 23 ? -11.601 12.108 -10.301 1.00 46.44  ? 23  GLY B CA   1 
ATOM   1939 C  C    . GLY C 2 23 ? -12.428 12.978 -11.211 1.00 44.83  ? 23  GLY B C    1 
ATOM   1940 O  O    . GLY C 2 23 ? -12.122 13.115 -12.404 1.00 44.52  ? 23  GLY B O    1 
ATOM   1941 H  H    . GLY C 2 23 ? -9.825  11.483 -10.806 1.00 52.84  ? 23  GLY B H    1 
ATOM   1942 H  HA2  . GLY C 2 23 ? -11.884 11.186 -10.405 1.00 55.72  ? 23  GLY B HA2  1 
ATOM   1943 H  HA3  . GLY C 2 23 ? -11.752 12.381 -9.383  1.00 55.72  ? 23  GLY B HA3  1 
ATOM   1944 N  N    . ASP C 2 24 ? -13.475 13.559 -10.628 1.00 44.68  ? 24  ASP B N    1 
ATOM   1945 C  CA   . ASP C 2 24 ? -14.343 14.514 -11.330 1.00 47.24  ? 24  ASP B CA   1 
ATOM   1946 C  C    . ASP C 2 24 ? -13.501 15.654 -11.871 1.00 42.84  ? 24  ASP B C    1 
ATOM   1947 O  O    . ASP C 2 24 ? -12.736 16.248 -11.121 1.00 40.98  ? 24  ASP B O    1 
ATOM   1948 C  CB   . ASP C 2 24 ? -15.444 15.035 -10.410 1.00 44.12  ? 24  ASP B CB   1 
ATOM   1949 C  CG   . ASP C 2 24 ? -16.466 15.856 -11.137 1.00 46.07  ? 24  ASP B CG   1 
ATOM   1950 O  OD1  . ASP C 2 24 ? -16.135 16.452 -12.201 1.00 45.10  ? 24  ASP B OD1  1 
ATOM   1951 O  OD2  . ASP C 2 24 ? -17.635 15.866 -10.674 1.00 48.64  ? 24  ASP B OD2  1 
ATOM   1952 H  H    . ASP C 2 24 ? -13.710 13.416 -9.813  1.00 53.62  ? 24  ASP B H    1 
ATOM   1953 H  HA   . ASP C 2 24 ? -14.764 14.068 -12.082 1.00 56.69  ? 24  ASP B HA   1 
ATOM   1954 H  HB2  . ASP C 2 24 ? -15.899 14.281 -10.003 1.00 52.95  ? 24  ASP B HB2  1 
ATOM   1955 H  HB3  . ASP C 2 24 ? -15.045 15.592 -9.723  1.00 52.95  ? 24  ASP B HB3  1 
ATOM   1956 N  N    . LYS C 2 25 ? -13.650 15.922 -13.168 1.00 43.63  ? 25  LYS B N    1 
ATOM   1957 C  CA   . LYS C 2 25 ? -12.811 16.874 -13.891 1.00 43.99  ? 25  LYS B CA   1 
ATOM   1958 C  C    . LYS C 2 25 ? -13.220 18.294 -13.682 1.00 42.22  ? 25  LYS B C    1 
ATOM   1959 O  O    . LYS C 2 25 ? -12.504 19.190 -14.089 1.00 41.53  ? 25  LYS B O    1 
ATOM   1960 C  CB   . LYS C 2 25 ? -12.839 16.562 -15.396 1.00 47.74  ? 25  LYS B CB   1 
ATOM   1961 C  CG   . LYS C 2 25 ? -12.121 15.255 -15.710 0.00 52.63  ? 25  LYS B CG   1 
ATOM   1962 C  CD   . LYS C 2 25 ? -12.095 14.904 -17.188 0.00 65.42  ? 25  LYS B CD   1 
ATOM   1963 C  CE   . LYS C 2 25 ? -11.272 13.638 -17.417 0.00 70.09  ? 25  LYS B CE   1 
ATOM   1964 N  NZ   . LYS C 2 25 ? -11.231 13.214 -18.843 0.00 73.57  ? 25  LYS B NZ   1 
ATOM   1965 H  H    . LYS C 2 25 ? -14.249 15.554 -13.663 1.00 52.35  ? 25  LYS B H    1 
ATOM   1966 H  HA   . LYS C 2 25 ? -11.895 16.779 -13.585 1.00 52.79  ? 25  LYS B HA   1 
ATOM   1967 H  HB2  . LYS C 2 25 ? -13.760 16.481 -15.689 1.00 57.29  ? 25  LYS B HB2  1 
ATOM   1968 H  HB3  . LYS C 2 25 ? -12.395 17.277 -15.879 1.00 57.29  ? 25  LYS B HB3  1 
ATOM   1969 H  HG2  . LYS C 2 25 ? -11.202 15.322 -15.406 0.00 63.16  ? 25  LYS B HG2  1 
ATOM   1970 H  HG3  . LYS C 2 25 ? -12.569 14.533 -15.242 0.00 63.16  ? 25  LYS B HG3  1 
ATOM   1971 H  HD2  . LYS C 2 25 ? -13.000 14.744 -17.499 0.00 78.50  ? 25  LYS B HD2  1 
ATOM   1972 H  HD3  . LYS C 2 25 ? -11.689 15.630 -17.686 0.00 78.50  ? 25  LYS B HD3  1 
ATOM   1973 H  HE2  . LYS C 2 25 ? -10.361 13.799 -17.127 0.00 84.10  ? 25  LYS B HE2  1 
ATOM   1974 H  HE3  . LYS C 2 25 ? -11.660 12.914 -16.902 0.00 84.10  ? 25  LYS B HE3  1 
ATOM   1975 H  HZ1  . LYS C 2 25 ? -10.742 12.475 -18.927 0.00 88.28  ? 25  LYS B HZ1  1 
ATOM   1976 H  HZ2  . LYS C 2 25 ? -12.056 13.050 -19.136 0.00 88.28  ? 25  LYS B HZ2  1 
ATOM   1977 H  HZ3  . LYS C 2 25 ? -10.871 13.857 -19.342 0.00 88.28  ? 25  LYS B HZ3  1 
ATOM   1978 N  N    . HIS C 2 26 ? -14.344 18.479 -12.998 1.00 41.99  ? 26  HIS B N    1 
ATOM   1979 C  CA   . HIS C 2 26 ? -14.959 19.785 -12.789 1.00 41.21  ? 26  HIS B CA   1 
ATOM   1980 C  C    . HIS C 2 26 ? -15.018 20.184 -11.365 1.00 38.27  ? 26  HIS B C    1 
ATOM   1981 O  O    . HIS C 2 26 ? -15.614 21.248 -11.011 1.00 35.98  ? 26  HIS B O    1 
ATOM   1982 C  CB   . HIS C 2 26 ? -16.364 19.804 -13.354 1.00 41.92  ? 26  HIS B CB   1 
ATOM   1983 C  CG   . HIS C 2 26 ? -16.411 19.760 -14.848 1.00 49.81  ? 26  HIS B CG   1 
ATOM   1984 N  ND1  . HIS C 2 26 ? -15.621 20.555 -15.649 1.00 52.01  ? 26  HIS B ND1  1 
ATOM   1985 C  CD2  . HIS C 2 26 ? -17.142 18.992 -15.687 1.00 53.33  ? 26  HIS B CD2  1 
ATOM   1986 C  CE1  . HIS C 2 26 ? -15.858 20.269 -16.916 1.00 55.57  ? 26  HIS B CE1  1 
ATOM   1987 N  NE2  . HIS C 2 26 ? -16.779 19.328 -16.967 1.00 53.52  ? 26  HIS B NE2  1 
ATOM   1988 H  H    . HIS C 2 26 ? -14.785 17.838 -12.632 1.00 50.39  ? 26  HIS B H    1 
ATOM   1989 H  HA   . HIS C 2 26 ? -14.440 20.454 -13.262 1.00 49.45  ? 26  HIS B HA   1 
ATOM   1990 H  HB2  . HIS C 2 26 ? -16.847 19.032 -13.019 1.00 50.31  ? 26  HIS B HB2  1 
ATOM   1991 H  HB3  . HIS C 2 26 ? -16.806 20.618 -13.067 1.00 50.31  ? 26  HIS B HB3  1 
ATOM   1992 H  HD2  . HIS C 2 26 ? -17.768 18.349 -15.442 1.00 64.00  ? 26  HIS B HD2  1 
ATOM   1993 H  HE1  . HIS C 2 26 ? -15.456 20.677 -17.650 1.00 66.69  ? 26  HIS B HE1  1 
ATOM   1994 N  N    . LYS C 2 27 ? -14.448 19.312 -10.532 1.00 39.78  ? 27  LYS B N    1 
ATOM   1995 C  CA   . LYS C 2 27 ? -14.343 19.593 -9.098  1.00 37.65  ? 27  LYS B CA   1 
ATOM   1996 C  C    . LYS C 2 27 ? -12.883 19.377 -8.616  1.00 36.27  ? 27  LYS B C    1 
ATOM   1997 O  O    . LYS C 2 27 ? -12.107 18.666 -9.250  1.00 36.03  ? 27  LYS B O    1 
ATOM   1998 C  CB   . LYS C 2 27 ? -15.361 18.733 -8.336  1.00 39.17  ? 27  LYS B CB   1 
ATOM   1999 C  CG   . LYS C 2 27 ? -16.804 18.911 -8.885  1.00 40.14  ? 27  LYS B CG   1 
ATOM   2000 C  CD   . LYS C 2 27 ? -17.818 17.987 -8.211  1.00 41.91  ? 27  LYS B CD   1 
ATOM   2001 C  CE   . LYS C 2 27 ? -19.221 18.164 -8.771  0.00 51.58  ? 27  LYS B CE   1 
ATOM   2002 N  NZ   . LYS C 2 27 ? -19.303 17.850 -10.222 0.00 56.20  ? 27  LYS B NZ   1 
ATOM   2003 H  H    . LYS C 2 27 ? -14.115 18.555 -10.770 1.00 47.74  ? 27  LYS B H    1 
ATOM   2004 H  HA   . LYS C 2 27 ? -14.569 20.523 -8.945  1.00 45.18  ? 27  LYS B HA   1 
ATOM   2005 H  HB2  . LYS C 2 27 ? -15.117 17.798 -8.424  1.00 47.00  ? 27  LYS B HB2  1 
ATOM   2006 H  HB3  . LYS C 2 27 ? -15.360 18.992 -7.401  1.00 47.00  ? 27  LYS B HB3  1 
ATOM   2007 H  HG2  . LYS C 2 27 ? -17.087 19.826 -8.736  1.00 48.17  ? 27  LYS B HG2  1 
ATOM   2008 H  HG3  . LYS C 2 27 ? -16.806 18.714 -9.835  1.00 48.17  ? 27  LYS B HG3  1 
ATOM   2009 H  HD2  . LYS C 2 27 ? -17.551 17.066 -8.352  1.00 50.30  ? 27  LYS B HD2  1 
ATOM   2010 H  HD3  . LYS C 2 27 ? -17.846 18.185 -7.262  1.00 50.30  ? 27  LYS B HD3  1 
ATOM   2011 H  HE2  . LYS C 2 27 ? -19.827 17.569 -8.301  0.00 61.90  ? 27  LYS B HE2  1 
ATOM   2012 H  HE3  . LYS C 2 27 ? -19.498 19.085 -8.647  0.00 61.90  ? 27  LYS B HE3  1 
ATOM   2013 H  HZ1  . LYS C 2 27 ? -20.137 17.965 -10.511 0.00 67.44  ? 27  LYS B HZ1  1 
ATOM   2014 H  HZ2  . LYS C 2 27 ? -18.761 18.388 -10.680 0.00 67.44  ? 27  LYS B HZ2  1 
ATOM   2015 H  HZ3  . LYS C 2 27 ? -19.061 17.006 -10.364 0.00 67.44  ? 27  LYS B HZ3  1 
ATOM   2016 N  N    . LEU C 2 28 ? -12.518 20.039 -7.518  1.00 36.55  ? 28  LEU B N    1 
ATOM   2017 C  CA   . LEU C 2 28 ? -11.216 19.883 -6.914  1.00 35.63  ? 28  LEU B CA   1 
ATOM   2018 C  C    . LEU C 2 28 ? -11.394 19.001 -5.665  1.00 36.99  ? 28  LEU B C    1 
ATOM   2019 O  O    . LEU C 2 28 ? -12.233 19.266 -4.786  1.00 37.64  ? 28  LEU B O    1 
ATOM   2020 C  CB   . LEU C 2 28 ? -10.593 21.230 -6.515  1.00 35.92  ? 28  LEU B CB   1 
ATOM   2021 C  CG   . LEU C 2 28 ? -10.399 22.353 -7.535  1.00 34.21  ? 28  LEU B CG   1 
ATOM   2022 C  CD1  . LEU C 2 28 ? -10.371 23.694 -6.790  1.00 33.85  ? 28  LEU B CD1  1 
ATOM   2023 C  CD2  . LEU C 2 28 ? -9.136  22.178 -8.412  1.00 33.83  ? 28  LEU B CD2  1 
ATOM   2024 H  H    . LEU C 2 28 ? -13.025 20.595 -7.103  1.00 43.86  ? 28  LEU B H    1 
ATOM   2025 H  HA   . LEU C 2 28 ? -10.619 19.433 -7.532  1.00 42.76  ? 28  LEU B HA   1 
ATOM   2026 H  HB2  . LEU C 2 28 ? -11.143 21.600 -5.808  1.00 43.11  ? 28  LEU B HB2  1 
ATOM   2027 H  HB3  . LEU C 2 28 ? -9.713  21.041 -6.152  1.00 43.11  ? 28  LEU B HB3  1 
ATOM   2028 H  HG   . LEU C 2 28 ? -11.166 22.366 -8.128  1.00 41.05  ? 28  LEU B HG   1 
ATOM   2029 H  HD11 . LEU C 2 28 ? -10.248 24.410 -7.433  1.00 40.62  ? 28  LEU B HD11 1 
ATOM   2030 H  HD12 . LEU C 2 28 ? -11.211 23.812 -6.320  1.00 40.62  ? 28  LEU B HD12 1 
ATOM   2031 H  HD13 . LEU C 2 28 ? -9.636  23.688 -6.157  1.00 40.62  ? 28  LEU B HD13 1 
ATOM   2032 H  HD21 . LEU C 2 28 ? -9.076  22.922 -9.032  1.00 40.60  ? 28  LEU B HD21 1 
ATOM   2033 H  HD22 . LEU C 2 28 ? -8.353  22.161 -7.839  1.00 40.60  ? 28  LEU B HD22 1 
ATOM   2034 H  HD23 . LEU C 2 28 ? -9.205  21.343 -8.902  1.00 40.60  ? 28  LEU B HD23 1 
ATOM   2035 N  N    . LYS C 2 29 ? -10.660 17.904 -5.632  1.00 38.30  ? 29  LYS B N    1 
ATOM   2036 C  CA   . LYS C 2 29 ? -10.524 17.153 -4.420  1.00 39.43  ? 29  LYS B CA   1 
ATOM   2037 C  C    . LYS C 2 29 ? -9.418  17.750 -3.519  1.00 39.09  ? 29  LYS B C    1 
ATOM   2038 O  O    . LYS C 2 29 ? -8.621  18.536 -3.990  1.00 37.92  ? 29  LYS B O    1 
ATOM   2039 C  CB   . LYS C 2 29 ? -10.239 15.703 -4.766  1.00 41.57  ? 29  LYS B CB   1 
ATOM   2040 C  CG   . LYS C 2 29 ? -9.060  15.488 -5.724  1.00 42.47  ? 29  LYS B CG   1 
ATOM   2041 C  CD   . LYS C 2 29 ? -8.860  13.991 -5.900  1.00 47.45  ? 29  LYS B CD   1 
ATOM   2042 C  CE   . LYS C 2 29 ? -10.130 13.256 -6.386  1.00 50.01  ? 29  LYS B CE   1 
ATOM   2043 N  NZ   . LYS C 2 29 ? -9.872  11.817 -6.622  1.00 49.69  ? 29  LYS B NZ   1 
ATOM   2044 H  H    . LYS C 2 29 ? -10.232 17.579 -6.304  1.00 45.96  ? 29  LYS B H    1 
ATOM   2045 H  HA   . LYS C 2 29 ? -11.361 17.186 -3.930  1.00 47.32  ? 29  LYS B HA   1 
ATOM   2046 H  HB2  . LYS C 2 29 ? -10.042 15.223 -3.947  1.00 49.88  ? 29  LYS B HB2  1 
ATOM   2047 H  HB3  . LYS C 2 29 ? -11.029 15.324 -5.183  1.00 49.88  ? 29  LYS B HB3  1 
ATOM   2048 H  HG2  . LYS C 2 29 ? -9.260  15.882 -6.588  1.00 50.96  ? 29  LYS B HG2  1 
ATOM   2049 H  HG3  . LYS C 2 29 ? -8.253  15.870 -5.347  1.00 50.96  ? 29  LYS B HG3  1 
ATOM   2050 H  HD2  . LYS C 2 29 ? -8.161  13.843 -6.556  1.00 56.94  ? 29  LYS B HD2  1 
ATOM   2051 H  HD3  . LYS C 2 29 ? -8.601  13.607 -5.048  1.00 56.94  ? 29  LYS B HD3  1 
ATOM   2052 H  HE2  . LYS C 2 29 ? -10.822 13.334 -5.711  1.00 60.01  ? 29  LYS B HE2  1 
ATOM   2053 H  HE3  . LYS C 2 29 ? -10.428 13.652 -7.220  1.00 60.01  ? 29  LYS B HE3  1 
ATOM   2054 H  HZ1  . LYS C 2 29 ? -10.616 11.416 -6.901  1.00 59.63  ? 29  LYS B HZ1  1 
ATOM   2055 H  HZ2  . LYS C 2 29 ? -9.241  11.718 -7.243  1.00 59.63  ? 29  LYS B HZ2  1 
ATOM   2056 H  HZ3  . LYS C 2 29 ? -9.600  11.429 -5.869  1.00 59.63  ? 29  LYS B HZ3  1 
ATOM   2057 N  N    . LYS C 2 30 ? -9.370  17.355 -2.242  1.00 39.80  ? 30  LYS B N    1 
ATOM   2058 C  CA   . LYS C 2 30 ? -8.373  17.879 -1.319  1.00 40.80  ? 30  LYS B CA   1 
ATOM   2059 C  C    . LYS C 2 30 ? -6.990  17.880 -1.912  1.00 39.44  ? 30  LYS B C    1 
ATOM   2060 O  O    . LYS C 2 30 ? -6.277  18.830 -1.723  1.00 38.35  ? 30  LYS B O    1 
ATOM   2061 C  CB   . LYS C 2 30 ? -8.346  17.121 0.030   1.00 42.50  ? 30  LYS B CB   1 
ATOM   2062 C  CG   . LYS C 2 30 ? -9.513  17.520 0.973   1.00 46.60  ? 30  LYS B CG   1 
ATOM   2063 C  CD   . LYS C 2 30 ? -9.545  16.795 2.321   1.00 51.29  ? 30  LYS B CD   1 
ATOM   2064 C  CE   . LYS C 2 30 ? -10.898 17.014 2.980   0.00 53.11  ? 30  LYS B CE   1 
ATOM   2065 N  NZ   . LYS C 2 30 ? -10.951 16.532 4.374   0.00 57.11  ? 30  LYS B NZ   1 
ATOM   2066 H  H    . LYS C 2 30 ? -9.907  16.783 -1.890  1.00 47.76  ? 30  LYS B H    1 
ATOM   2067 H  HA   . LYS C 2 30 ? -8.600  18.801 -1.123  1.00 48.95  ? 30  LYS B HA   1 
ATOM   2068 H  HB2  . LYS C 2 30 ? -8.413  16.169 -0.142  1.00 51.01  ? 30  LYS B HB2  1 
ATOM   2069 H  HB3  . LYS C 2 30 ? -7.513  17.318 0.486   1.00 51.01  ? 30  LYS B HB3  1 
ATOM   2070 H  HG2  . LYS C 2 30 ? -9.450  18.471 1.155   1.00 55.92  ? 30  LYS B HG2  1 
ATOM   2071 H  HG3  . LYS C 2 30 ? -10.351 17.332 0.521   1.00 55.92  ? 30  LYS B HG3  1 
ATOM   2072 H  HD2  . LYS C 2 30 ? -9.416  15.844 2.183   1.00 61.55  ? 30  LYS B HD2  1 
ATOM   2073 H  HD3  . LYS C 2 30 ? -8.855  17.154 2.901   1.00 61.55  ? 30  LYS B HD3  1 
ATOM   2074 H  HE2  . LYS C 2 30 ? -11.095 17.963 2.984   0.00 63.73  ? 30  LYS B HE2  1 
ATOM   2075 H  HE3  . LYS C 2 30 ? -11.574 16.537 2.474   0.00 63.73  ? 30  LYS B HE3  1 
ATOM   2076 H  HZ1  . LYS C 2 30 ? -11.759 16.681 4.716   0.00 68.53  ? 30  LYS B HZ1  1 
ATOM   2077 H  HZ2  . LYS C 2 30 ? -10.781 15.659 4.401   0.00 68.53  ? 30  LYS B HZ2  1 
ATOM   2078 H  HZ3  . LYS C 2 30 ? -10.345 16.960 4.866   0.00 68.53  ? 30  LYS B HZ3  1 
ATOM   2079 N  N    . SER C 2 31 ? -6.609  16.860 -2.658  1.00 39.69  ? 31  SER B N    1 
ATOM   2080 C  CA   . SER C 2 31 ? -5.234  16.821 -3.153  1.00 39.33  ? 31  SER B CA   1 
ATOM   2081 C  C    . SER C 2 31 ? -5.012  17.873 -4.208  1.00 37.99  ? 31  SER B C    1 
ATOM   2082 O  O    . SER C 2 31 ? -3.925  18.343 -4.351  1.00 37.05  ? 31  SER B O    1 
ATOM   2083 C  CB   . SER C 2 31 ? -4.879  15.493 -3.778  1.00 39.46  ? 31  SER B CB   1 
ATOM   2084 O  OG   . SER C 2 31 ? -5.419  15.453 -5.079  1.00 41.93  ? 31  SER B OG   1 
ATOM   2085 H  H    . SER C 2 31 ? -7.103  16.195 -2.889  1.00 47.63  ? 31  SER B H    1 
ATOM   2086 H  HA   . SER C 2 31 ? -4.622  16.988 -2.419  1.00 47.20  ? 31  SER B HA   1 
ATOM   2087 H  HB2  . SER C 2 31 ? -3.914  15.406 -3.826  1.00 47.35  ? 31  SER B HB2  1 
ATOM   2088 H  HB3  . SER C 2 31 ? -5.258  14.775 -3.248  1.00 47.35  ? 31  SER B HB3  1 
ATOM   2089 H  HG   . SER C 2 31 ? -6.254  15.536 -5.046  1.00 50.32  ? 31  SER B HG   1 
ATOM   2090 N  N    . GLU C 2 32 ? -6.025  18.118 -5.040  1.00 37.76  ? 32  GLU B N    1 
ATOM   2091 C  CA   . GLU C 2 32 ? -5.903  19.069 -6.144  1.00 37.35  ? 32  GLU B CA   1 
ATOM   2092 C  C    . GLU C 2 32 ? -5.905  20.525 -5.630  1.00 35.60  ? 32  GLU B C    1 
ATOM   2093 O  O    . GLU C 2 32 ? -5.171  21.362 -6.110  1.00 34.43  ? 32  GLU B O    1 
ATOM   2094 C  CB   . GLU C 2 32 ? -7.033  18.867 -7.169  1.00 36.21  ? 32  GLU B CB   1 
ATOM   2095 C  CG   . GLU C 2 32 ? -6.988  17.503 -7.931  1.00 40.04  ? 32  GLU B CG   1 
ATOM   2096 C  CD   . GLU C 2 32 ? -8.241  17.260 -8.785  1.00 38.55  ? 32  GLU B CD   1 
ATOM   2097 O  OE1  . GLU C 2 32 ? -9.339  17.640 -8.333  1.00 36.08  ? 32  GLU B OE1  1 
ATOM   2098 O  OE2  . GLU C 2 32 ? -8.119  16.728 -9.908  1.00 37.48  ? 32  GLU B OE2  1 
ATOM   2099 H  H    . GLU C 2 32 ? -6.798  17.745 -4.985  1.00 45.32  ? 32  GLU B H    1 
ATOM   2100 H  HA   . GLU C 2 32 ? -5.059  18.916 -6.597  1.00 44.82  ? 32  GLU B HA   1 
ATOM   2101 H  HB2  . GLU C 2 32 ? -7.883  18.917 -6.706  1.00 43.45  ? 32  GLU B HB2  1 
ATOM   2102 H  HB3  . GLU C 2 32 ? -6.980  19.575 -7.831  1.00 43.45  ? 32  GLU B HB3  1 
ATOM   2103 H  HG2  . GLU C 2 32 ? -6.217  17.495 -8.520  1.00 48.04  ? 32  GLU B HG2  1 
ATOM   2104 H  HG3  . GLU C 2 32 ? -6.920  16.783 -7.285  1.00 48.04  ? 32  GLU B HG3  1 
ATOM   2105 N  N    . LEU C 2 33 ? -6.756  20.798 -4.657  1.00 35.62  ? 33  LEU B N    1 
ATOM   2106 C  CA   . LEU C 2 33 ? -6.844  22.092 -4.053  1.00 34.35  ? 33  LEU B CA   1 
ATOM   2107 C  C    . LEU C 2 33 ? -5.529  22.447 -3.350  1.00 34.82  ? 33  LEU B C    1 
ATOM   2108 O  O    . LEU C 2 33 ? -5.020  23.573 -3.477  1.00 35.50  ? 33  LEU B O    1 
ATOM   2109 C  CB   . LEU C 2 33 ? -8.025  22.116 -3.090  1.00 33.48  ? 33  LEU B CB   1 
ATOM   2110 C  CG   . LEU C 2 33 ? -8.133  23.377 -2.231  1.00 35.11  ? 33  LEU B CG   1 
ATOM   2111 C  CD1  . LEU C 2 33 ? -8.265  24.630 -3.092  1.00 34.83  ? 33  LEU B CD1  1 
ATOM   2112 C  CD2  . LEU C 2 33 ? -9.240  23.279 -1.175  1.00 36.43  ? 33  LEU B CD2  1 
ATOM   2113 H  H    . LEU C 2 33 ? -7.305  20.225 -4.326  1.00 42.75  ? 33  LEU B H    1 
ATOM   2114 H  HA   . LEU C 2 33 ? -7.004  22.754 -4.744  1.00 41.22  ? 33  LEU B HA   1 
ATOM   2115 H  HB2  . LEU C 2 33 ? -8.844  22.042 -3.605  1.00 40.17  ? 33  LEU B HB2  1 
ATOM   2116 H  HB3  . LEU C 2 33 ? -7.949  21.358 -2.489  1.00 40.17  ? 33  LEU B HB3  1 
ATOM   2117 H  HG   . LEU C 2 33 ? -7.299  23.466 -1.744  1.00 42.14  ? 33  LEU B HG   1 
ATOM   2118 H  HD11 . LEU C 2 33 ? -8.330  25.405 -2.513  1.00 41.79  ? 33  LEU B HD11 1 
ATOM   2119 H  HD12 . LEU C 2 33 ? -7.482  24.706 -3.660  1.00 41.79  ? 33  LEU B HD12 1 
ATOM   2120 H  HD13 . LEU C 2 33 ? -9.063  24.555 -3.638  1.00 41.79  ? 33  LEU B HD13 1 
ATOM   2121 H  HD21 . LEU C 2 33 ? -9.261  24.102 -0.663  1.00 43.72  ? 33  LEU B HD21 1 
ATOM   2122 H  HD22 . LEU C 2 33 ? -10.090 23.144 -1.621  1.00 43.72  ? 33  LEU B HD22 1 
ATOM   2123 H  HD23 . LEU C 2 33 ? -9.051  22.529 -0.589  1.00 43.72  ? 33  LEU B HD23 1 
ATOM   2124 N  N    . LYS C 2 34 ? -4.959  21.466 -2.662  1.00 36.75  ? 34  LYS B N    1 
ATOM   2125 C  CA   . LYS C 2 34 ? -3.680  21.639 -2.012  1.00 37.74  ? 34  LYS B CA   1 
ATOM   2126 C  C    . LYS C 2 34 ? -2.619  22.022 -3.059  1.00 37.39  ? 34  LYS B C    1 
ATOM   2127 O  O    . LYS C 2 34 ? -1.855  22.980 -2.873  1.00 38.08  ? 34  LYS B O    1 
ATOM   2128 C  CB   . LYS C 2 34 ? -3.262  20.349 -1.270  1.00 39.33  ? 34  LYS B CB   1 
ATOM   2129 C  CG   . LYS C 2 34 ? -1.938  20.451 -0.528  1.00 42.81  ? 34  LYS B CG   1 
ATOM   2130 C  CD   . LYS C 2 34 ? -1.412  19.131 -0.145  1.00 46.59  ? 34  LYS B CD   1 
ATOM   2131 C  CE   . LYS C 2 34 ? 0.020   19.225 0.415   1.00 48.82  ? 34  LYS B CE   1 
ATOM   2132 N  NZ   . LYS C 2 34 ? 0.623   17.876 0.606   0.00 51.94  ? 34  LYS B NZ   1 
ATOM   2133 H  H    . LYS C 2 34 ? -5.302  20.684 -2.559  1.00 44.10  ? 34  LYS B H    1 
ATOM   2134 H  HA   . LYS C 2 34 ? -3.743  22.358 -1.363  1.00 45.29  ? 34  LYS B HA   1 
ATOM   2135 H  HB2  . LYS C 2 34 ? -3.948  20.129 -0.620  1.00 47.20  ? 34  LYS B HB2  1 
ATOM   2136 H  HB3  . LYS C 2 34 ? -3.183  19.631 -1.917  1.00 47.20  ? 34  LYS B HB3  1 
ATOM   2137 H  HG2  . LYS C 2 34 ? -1.285  20.881 -1.102  1.00 51.37  ? 34  LYS B HG2  1 
ATOM   2138 H  HG3  . LYS C 2 34 ? -2.066  20.971 0.280   1.00 51.37  ? 34  LYS B HG3  1 
ATOM   2139 H  HD2  . LYS C 2 34 ? -1.981  18.748 0.540   1.00 55.90  ? 34  LYS B HD2  1 
ATOM   2140 H  HD3  . LYS C 2 34 ? -1.395  18.556 -0.926  1.00 55.90  ? 34  LYS B HD3  1 
ATOM   2141 H  HE2  . LYS C 2 34 ? 0.575   19.720 -0.208  1.00 58.59  ? 34  LYS B HE2  1 
ATOM   2142 H  HE3  . LYS C 2 34 ? -0.001  19.673 1.275   1.00 58.59  ? 34  LYS B HE3  1 
ATOM   2143 H  HZ1  . LYS C 2 34 ? 1.449   17.955 0.929   0.00 62.32  ? 34  LYS B HZ1  1 
ATOM   2144 H  HZ2  . LYS C 2 34 ? 0.133   17.402 1.178   0.00 62.32  ? 34  LYS B HZ2  1 
ATOM   2145 H  HZ3  . LYS C 2 34 ? 0.657   17.445 -0.172  0.00 62.32  ? 34  LYS B HZ3  1 
ATOM   2146 N  N    . GLU C 2 35 ? -2.564  21.241 -4.127  1.00 35.46  ? 35  GLU B N    1 
ATOM   2147 C  CA   . GLU C 2 35 ? -1.602  21.460 -5.149  1.00 38.71  ? 35  GLU B CA   1 
ATOM   2148 C  C    . GLU C 2 35 ? -1.809  22.885 -5.748  1.00 45.34  ? 35  GLU B C    1 
ATOM   2149 O  O    . GLU C 2 35 ? -0.837  23.625 -5.937  1.00 38.16  ? 35  GLU B O    1 
ATOM   2150 C  CB   . GLU C 2 35 ? -1.678  20.333 -6.188  1.00 39.65  ? 35  GLU B CB   1 
ATOM   2151 C  CG   . GLU C 2 35 ? -1.118  19.008 -5.682  0.00 44.05  ? 35  GLU B CG   1 
ATOM   2152 C  CD   . GLU C 2 35 ? -1.369  17.854 -6.633  0.00 49.13  ? 35  GLU B CD   1 
ATOM   2153 O  OE1  . GLU C 2 35 ? -2.104  18.043 -7.624  0.00 47.09  ? 35  GLU B OE1  1 
ATOM   2154 O  OE2  . GLU C 2 35 ? -0.830  16.754 -6.386  0.00 54.12  ? 35  GLU B OE2  1 
ATOM   2155 H  H    . GLU C 2 35 ? -3.087  20.574 -4.271  1.00 42.55  ? 35  GLU B H    1 
ATOM   2156 H  HA   . GLU C 2 35 ? -0.717  21.434 -4.753  1.00 46.46  ? 35  GLU B HA   1 
ATOM   2157 H  HB2  . GLU C 2 35 ? -2.607  20.190 -6.430  1.00 47.57  ? 35  GLU B HB2  1 
ATOM   2158 H  HB3  . GLU C 2 35 ? -1.169  20.592 -6.972  1.00 47.57  ? 35  GLU B HB3  1 
ATOM   2159 H  HG2  . GLU C 2 35 ? -0.159  19.096 -5.565  0.00 52.86  ? 35  GLU B HG2  1 
ATOM   2160 H  HG3  . GLU C 2 35 ? -1.535  18.794 -4.833  0.00 52.86  ? 35  GLU B HG3  1 
ATOM   2161 N  N    . LEU C 2 36 ? -3.070  23.294 -5.958  1.00 37.69  ? 36  LEU B N    1 
ATOM   2162 C  CA   . LEU C 2 36 ? -3.361  24.594 -6.486  1.00 37.22  ? 36  LEU B CA   1 
ATOM   2163 C  C    . LEU C 2 36 ? -2.858  25.766 -5.547  1.00 37.22  ? 36  LEU B C    1 
ATOM   2164 O  O    . LEU C 2 36 ? -2.160  26.709 -5.989  1.00 37.74  ? 36  LEU B O    1 
ATOM   2165 C  CB   . LEU C 2 36 ? -4.882  24.710 -6.765  1.00 35.10  ? 36  LEU B CB   1 
ATOM   2166 C  CG   . LEU C 2 36 ? -5.406  26.025 -7.465  1.00 34.50  ? 36  LEU B CG   1 
ATOM   2167 C  CD1  . LEU C 2 36 ? -6.714  25.844 -8.190  1.00 35.43  ? 36  LEU B CD1  1 
ATOM   2168 C  CD2  . LEU C 2 36 ? -5.600  27.132 -6.468  1.00 31.29  ? 36  LEU B CD2  1 
ATOM   2169 H  H    . LEU C 2 36 ? -3.768  22.819 -5.794  1.00 45.23  ? 36  LEU B H    1 
ATOM   2170 H  HA   . LEU C 2 36 ? -2.902  24.688 -7.336  1.00 44.66  ? 36  LEU B HA   1 
ATOM   2171 H  HB2  . LEU C 2 36 ? -5.139  23.966 -7.332  1.00 42.12  ? 36  LEU B HB2  1 
ATOM   2172 H  HB3  . LEU C 2 36 ? -5.347  24.636 -5.917  1.00 42.12  ? 36  LEU B HB3  1 
ATOM   2173 H  HG   . LEU C 2 36 ? -4.746  26.320 -8.112  1.00 41.40  ? 36  LEU B HG   1 
ATOM   2174 H  HD11 . LEU C 2 36 ? -6.972  26.688 -8.592  1.00 42.52  ? 36  LEU B HD11 1 
ATOM   2175 H  HD12 . LEU C 2 36 ? -6.602  25.170 -8.878  1.00 42.52  ? 36  LEU B HD12 1 
ATOM   2176 H  HD13 . LEU C 2 36 ? -7.390  25.560 -7.555  1.00 42.52  ? 36  LEU B HD13 1 
ATOM   2177 H  HD21 . LEU C 2 36 ? -5.921  27.922 -6.931  1.00 37.55  ? 36  LEU B HD21 1 
ATOM   2178 H  HD22 . LEU C 2 36 ? -6.249  26.850 -5.805  1.00 37.55  ? 36  LEU B HD22 1 
ATOM   2179 H  HD23 . LEU C 2 36 ? -4.751  27.323 -6.039  1.00 37.55  ? 36  LEU B HD23 1 
ATOM   2180 N  N    . ILE C 2 37 ? -3.241  25.714 -4.278  1.00 37.87  ? 37  ILE B N    1 
ATOM   2181 C  CA   . ILE C 2 37 ? -2.846  26.717 -3.314  1.00 43.44  ? 37  ILE B CA   1 
ATOM   2182 C  C    . ILE C 2 37 ? -1.325  26.851 -3.269  1.00 42.27  ? 37  ILE B C    1 
ATOM   2183 O  O    . ILE C 2 37 ? -0.775  27.966 -3.208  1.00 39.00  ? 37  ILE B O    1 
ATOM   2184 C  CB   . ILE C 2 37 ? -3.414  26.387 -1.912  1.00 39.02  ? 37  ILE B CB   1 
ATOM   2185 C  CG1  . ILE C 2 37 ? -4.893  26.729 -1.865  1.00 37.03  ? 37  ILE B CG1  1 
ATOM   2186 C  CG2  . ILE C 2 37 ? -2.742  27.193 -0.831  1.00 40.28  ? 37  ILE B CG2  1 
ATOM   2187 C  CD1  . ILE C 2 37 ? -5.648  26.083 -0.702  1.00 35.87  ? 37  ILE B CD1  1 
ATOM   2188 H  H    . ILE C 2 37 ? -3.739  25.094 -3.950  1.00 45.45  ? 37  ILE B H    1 
ATOM   2189 H  HA   . ILE C 2 37 ? -3.211  27.574 -3.587  1.00 52.12  ? 37  ILE B HA   1 
ATOM   2190 H  HB   . ILE C 2 37 ? -3.296  25.441 -1.731  1.00 46.83  ? 37  ILE B HB   1 
ATOM   2191 H  HG12 . ILE C 2 37 ? -4.988  27.691 -1.781  1.00 44.43  ? 37  ILE B HG12 1 
ATOM   2192 H  HG13 . ILE C 2 37 ? -5.308  26.430 -2.689  1.00 44.43  ? 37  ILE B HG13 1 
ATOM   2193 H  HG21 . ILE C 2 37 ? -3.128  26.953 0.027   1.00 48.34  ? 37  ILE B HG21 1 
ATOM   2194 H  HG22 . ILE C 2 37 ? -1.793  26.994 -0.833  1.00 48.34  ? 37  ILE B HG22 1 
ATOM   2195 H  HG23 . ILE C 2 37 ? -2.884  28.136 -1.006  1.00 48.34  ? 37  ILE B HG23 1 
ATOM   2196 H  HD11 . ILE C 2 37 ? -6.579  26.350 -0.744  1.00 43.04  ? 37  ILE B HD11 1 
ATOM   2197 H  HD12 . ILE C 2 37 ? -5.576  25.119 -0.777  1.00 43.04  ? 37  ILE B HD12 1 
ATOM   2198 H  HD13 . ILE C 2 37 ? -5.255  26.381 0.133   1.00 43.04  ? 37  ILE B HD13 1 
ATOM   2199 N  N    . ASN C 2 38 ? -0.670  25.701 -3.269  1.00 39.30  ? 38  ASN B N    1 
ATOM   2200 C  CA   . ASN C 2 38 ? 0.777   25.617 -3.158  1.00 38.21  ? 38  ASN B CA   1 
ATOM   2201 C  C    . ASN C 2 38 ? 1.546   25.998 -4.399  1.00 37.82  ? 38  ASN B C    1 
ATOM   2202 O  O    . ASN C 2 38 ? 2.693   26.405 -4.296  1.00 37.53  ? 38  ASN B O    1 
ATOM   2203 C  CB   . ASN C 2 38 ? 1.172   24.215 -2.728  1.00 38.08  ? 38  ASN B CB   1 
ATOM   2204 C  CG   . ASN C 2 38 ? 0.962   24.017 -1.274  1.00 41.09  ? 38  ASN B CG   1 
ATOM   2205 O  OD1  . ASN C 2 38 ? 0.563   24.969 -0.586  1.00 41.41  ? 38  ASN B OD1  1 
ATOM   2206 N  ND2  . ASN C 2 38 ? 1.099   22.770 -0.795  1.00 42.07  ? 38  ASN B ND2  1 
ATOM   2207 H  H    . ASN C 2 38 ? -1.052  24.934 -3.334  1.00 47.16  ? 38  ASN B H    1 
ATOM   2208 H  HA   . ASN C 2 38 ? 1.058   26.222 -2.453  1.00 45.85  ? 38  ASN B HA   1 
ATOM   2209 H  HB2  . ASN C 2 38 ? 0.628   23.569 -3.205  1.00 45.69  ? 38  ASN B HB2  1 
ATOM   2210 H  HB3  . ASN C 2 38 ? 2.112   24.073 -2.923  1.00 45.69  ? 38  ASN B HB3  1 
ATOM   2211 H  HD21 . ASN C 2 38 ? 0.984   22.617 0.044   1.00 50.48  ? 38  ASN B HD21 1 
ATOM   2212 H  HD22 . ASN C 2 38 ? 1.300   22.125 -1.326  1.00 50.48  ? 38  ASN B HD22 1 
ATOM   2213 N  N    . ASN C 2 39 ? 0.965   25.795 -5.572  1.00 37.36  ? 39  ASN B N    1 
ATOM   2214 C  CA   . ASN C 2 39 ? 1.638   26.176 -6.792  1.00 37.97  ? 39  ASN B CA   1 
ATOM   2215 C  C    . ASN C 2 39 ? 1.226   27.521 -7.425  1.00 39.63  ? 39  ASN B C    1 
ATOM   2216 O  O    . ASN C 2 39 ? 1.990   28.092 -8.198  1.00 44.85  ? 39  ASN B O    1 
ATOM   2217 C  CB   . ASN C 2 39 ? 1.470   25.080 -7.796  1.00 38.38  ? 39  ASN B CB   1 
ATOM   2218 C  CG   . ASN C 2 39 ? 2.364   23.900 -7.470  1.00 39.70  ? 39  ASN B CG   1 
ATOM   2219 O  OD1  . ASN C 2 39 ? 3.572   23.895 -7.765  1.00 39.87  ? 39  ASN B OD1  1 
ATOM   2220 N  ND2  . ASN C 2 39 ? 1.800   22.936 -6.798  1.00 40.53  ? 39  ASN B ND2  1 
ATOM   2221 H  H    . ASN C 2 39 ? 0.189   25.442 -5.684  1.00 44.83  ? 39  ASN B H    1 
ATOM   2222 H  HA   . ASN C 2 39 ? 2.587   26.239 -6.598  1.00 45.57  ? 39  ASN B HA   1 
ATOM   2223 H  HB2  . ASN C 2 39 ? 0.549   24.776 -7.788  1.00 46.06  ? 39  ASN B HB2  1 
ATOM   2224 H  HB3  . ASN C 2 39 ? 1.709   25.410 -8.676  1.00 46.06  ? 39  ASN B HB3  1 
ATOM   2225 H  HD21 . ASN C 2 39 ? 2.255   22.238 -6.582  1.00 48.64  ? 39  ASN B HD21 1 
ATOM   2226 H  HD22 . ASN C 2 39 ? 0.973   22.997 -6.570  1.00 48.64  ? 39  ASN B HD22 1 
ATOM   2227 N  N    . GLU C 2 40 ? 0.036   28.019 -7.096  1.00 39.26  ? 40  GLU B N    1 
ATOM   2228 C  CA   . GLU C 2 40 ? -0.539  29.167 -7.778  1.00 38.46  ? 40  GLU B CA   1 
ATOM   2229 C  C    . GLU C 2 40 ? -0.892  30.271 -6.808  1.00 38.48  ? 40  GLU B C    1 
ATOM   2230 O  O    . GLU C 2 40 ? -1.258  31.347 -7.218  1.00 37.23  ? 40  GLU B O    1 
ATOM   2231 C  CB   . GLU C 2 40 ? -1.793  28.748 -8.563  1.00 38.39  ? 40  GLU B CB   1 
ATOM   2232 C  CG   . GLU C 2 40 ? -1.635  27.530 -9.460  1.00 38.94  ? 40  GLU B CG   1 
ATOM   2233 C  CD   . GLU C 2 40 ? -0.643  27.721 -10.584 1.00 41.91  ? 40  GLU B CD   1 
ATOM   2234 O  OE1  . GLU C 2 40 ? -0.193  28.869 -10.762 1.00 43.05  ? 40  GLU B OE1  1 
ATOM   2235 O  OE2  . GLU C 2 40 ? -0.283  26.723 -11.276 1.00 46.64  ? 40  GLU B OE2  1 
ATOM   2236 H  H    . GLU C 2 40 ? -0.462  27.702 -6.470  1.00 47.12  ? 40  GLU B H    1 
ATOM   2237 H  HA   . GLU C 2 40 ? 0.108   29.517 -8.410  1.00 46.16  ? 40  GLU B HA   1 
ATOM   2238 H  HB2  . GLU C 2 40 ? -2.500  28.551 -7.928  1.00 46.07  ? 40  GLU B HB2  1 
ATOM   2239 H  HB3  . GLU C 2 40 ? -2.064  29.490 -9.127  1.00 46.07  ? 40  GLU B HB3  1 
ATOM   2240 H  HG2  . GLU C 2 40 ? -1.332  26.783 -8.922  1.00 46.72  ? 40  GLU B HG2  1 
ATOM   2241 H  HG3  . GLU C 2 40 ? -2.495  27.321 -9.857  1.00 46.72  ? 40  GLU B HG3  1 
ATOM   2242 N  N    . LEU C 2 41 ? -0.788  29.999 -5.512  1.00 38.67  ? 41  LEU B N    1 
ATOM   2243 C  CA   . LEU C 2 41 ? -1.092  31.015 -4.512  1.00 38.83  ? 41  LEU B CA   1 
ATOM   2244 C  C    . LEU C 2 41 ? 0.071   31.115 -3.491  1.00 39.69  ? 41  LEU B C    1 
ATOM   2245 O  O    . LEU C 2 41 ? -0.085  31.633 -2.373  1.00 39.32  ? 41  LEU B O    1 
ATOM   2246 C  CB   . LEU C 2 41 ? -2.439  30.687 -3.840  1.00 40.24  ? 41  LEU B CB   1 
ATOM   2247 C  CG   . LEU C 2 41 ? -3.726  30.902 -4.655  1.00 40.94  ? 41  LEU B CG   1 
ATOM   2248 C  CD1  . LEU C 2 41 ? -4.937  30.410 -3.870  1.00 42.51  ? 41  LEU B CD1  1 
ATOM   2249 C  CD2  . LEU C 2 41 ? -3.935  32.398 -5.057  1.00 42.39  ? 41  LEU B CD2  1 
ATOM   2250 H  H    . LEU C 2 41 ? -0.546  29.240 -5.188  1.00 46.41  ? 41  LEU B H    1 
ATOM   2251 H  HA   . LEU C 2 41 ? -1.179  31.875 -4.951  1.00 46.59  ? 41  LEU B HA   1 
ATOM   2252 H  HB2  . LEU C 2 41 ? -2.422  29.752 -3.581  1.00 48.29  ? 41  LEU B HB2  1 
ATOM   2253 H  HB3  . LEU C 2 41 ? -2.515  31.234 -3.043  1.00 48.29  ? 41  LEU B HB3  1 
ATOM   2254 H  HG   . LEU C 2 41 ? -3.671  30.381 -5.471  1.00 49.13  ? 41  LEU B HG   1 
ATOM   2255 H  HD11 . LEU C 2 41 ? -5.736  30.555 -4.400  1.00 51.01  ? 41  LEU B HD11 1 
ATOM   2256 H  HD12 . LEU C 2 41 ? -4.829  29.465 -3.684  1.00 51.01  ? 41  LEU B HD12 1 
ATOM   2257 H  HD13 . LEU C 2 41 ? -4.996  30.907 -3.039  1.00 51.01  ? 41  LEU B HD13 1 
ATOM   2258 H  HD21 . LEU C 2 41 ? -4.757  32.476 -5.566  1.00 50.86  ? 41  LEU B HD21 1 
ATOM   2259 H  HD22 . LEU C 2 41 ? -3.992  32.936 -4.251  1.00 50.86  ? 41  LEU B HD22 1 
ATOM   2260 H  HD23 . LEU C 2 41 ? -3.183  32.688 -5.596  1.00 50.86  ? 41  LEU B HD23 1 
ATOM   2261 N  N    . SER C 2 42 ? 1.244   30.634 -3.928  1.00 40.46  ? 42  SER B N    1 
ATOM   2262 C  CA   . SER C 2 42 ? 2.448   30.556 -3.106  1.00 42.59  ? 42  SER B CA   1 
ATOM   2263 C  C    . SER C 2 42 ? 2.817   31.904 -2.513  1.00 45.52  ? 42  SER B C    1 
ATOM   2264 O  O    . SER C 2 42 ? 3.360   31.962 -1.426  1.00 59.21  ? 42  SER B O    1 
ATOM   2265 C  CB   . SER C 2 42 ? 3.618   30.068 -3.913  1.00 42.76  ? 42  SER B CB   1 
ATOM   2266 O  OG   . SER C 2 42 ? 4.019   31.069 -4.796  1.00 48.32  ? 42  SER B OG   1 
ATOM   2267 H  H    . SER C 2 42 ? 1.364   30.338 -4.727  1.00 48.55  ? 42  SER B H    1 
ATOM   2268 H  HA   . SER C 2 42 ? 2.299   29.933 -2.378  1.00 51.11  ? 42  SER B HA   1 
ATOM   2269 H  HB2  . SER C 2 42 ? 4.352   29.854 -3.316  1.00 51.32  ? 42  SER B HB2  1 
ATOM   2270 H  HB3  . SER C 2 42 ? 3.354   29.283 -4.417  1.00 51.32  ? 42  SER B HB3  1 
ATOM   2271 H  HG   . SER C 2 42 ? 4.673   30.805 -5.252  1.00 57.98  ? 42  SER B HG   1 
ATOM   2272 N  N    . HIS C 2 43 ? 2.535   32.982 -3.238  1.00 43.97  ? 43  HIS B N    1 
ATOM   2273 C  CA   . HIS C 2 43 ? 2.835   34.285 -2.747  1.00 45.43  ? 43  HIS B CA   1 
ATOM   2274 C  C    . HIS C 2 43 ? 1.736   34.879 -1.943  1.00 47.60  ? 43  HIS B C    1 
ATOM   2275 O  O    . HIS C 2 43 ? 1.967   35.913 -1.285  1.00 53.75  ? 43  HIS B O    1 
ATOM   2276 C  CB   . HIS C 2 43 ? 3.190   35.247 -3.894  1.00 44.54  ? 43  HIS B CB   1 
ATOM   2277 C  CG   . HIS C 2 43 ? 4.356   34.798 -4.683  1.00 40.98  ? 43  HIS B CG   1 
ATOM   2278 N  ND1  . HIS C 2 43 ? 4.234   34.260 -5.940  1.00 39.64  ? 43  HIS B ND1  1 
ATOM   2279 C  CD2  . HIS C 2 43 ? 5.662   34.686 -4.340  1.00 42.12  ? 43  HIS B CD2  1 
ATOM   2280 C  CE1  . HIS C 2 43 ? 5.427   33.893 -6.371  1.00 41.52  ? 43  HIS B CE1  1 
ATOM   2281 N  NE2  . HIS C 2 43 ? 6.313   34.133 -5.414  1.00 42.59  ? 43  HIS B NE2  1 
ATOM   2282 H  H    . HIS C 2 43 ? 2.170   32.969 -4.017  1.00 52.76  ? 43  HIS B H    1 
ATOM   2283 H  HA   . HIS C 2 43 ? 3.613   34.221 -2.171  1.00 54.52  ? 43  HIS B HA   1 
ATOM   2284 H  HB2  . HIS C 2 43 ? 2.431   35.316 -4.494  1.00 53.45  ? 43  HIS B HB2  1 
ATOM   2285 H  HB3  . HIS C 2 43 ? 3.398   36.118 -3.521  1.00 53.45  ? 43  HIS B HB3  1 
ATOM   2286 H  HD2  . HIS C 2 43 ? 6.049   34.956 -3.539  1.00 50.54  ? 43  HIS B HD2  1 
ATOM   2287 H  HE1  . HIS C 2 43 ? 5.614   33.520 -7.202  1.00 49.83  ? 43  HIS B HE1  1 
ATOM   2288 N  N    . PHE C 2 44 ? 0.537   34.298 -2.000  1.00 45.32  ? 44  PHE B N    1 
ATOM   2289 C  CA   . PHE C 2 44 ? -0.573  34.912 -1.276  1.00 45.59  ? 44  PHE B CA   1 
ATOM   2290 C  C    . PHE C 2 44 ? -0.953  34.148 -0.008  1.00 45.52  ? 44  PHE B C    1 
ATOM   2291 O  O    . PHE C 2 44 ? -1.541  34.706 0.914   1.00 44.82  ? 44  PHE B O    1 
ATOM   2292 C  CB   . PHE C 2 44 ? -1.810  35.064 -2.172  1.00 46.34  ? 44  PHE B CB   1 
ATOM   2293 C  CG   . PHE C 2 44 ? -1.685  36.132 -3.225  1.00 47.25  ? 44  PHE B CG   1 
ATOM   2294 C  CD1  . PHE C 2 44 ? -0.482  36.808 -3.443  1.00 50.28  ? 44  PHE B CD1  1 
ATOM   2295 C  CD2  . PHE C 2 44 ? -2.817  36.549 -3.923  1.00 46.18  ? 44  PHE B CD2  1 
ATOM   2296 C  CE1  . PHE C 2 44 ? -0.387  37.809 -4.407  1.00 49.62  ? 44  PHE B CE1  1 
ATOM   2297 C  CE2  . PHE C 2 44 ? -2.748  37.564 -4.878  1.00 45.56  ? 44  PHE B CE2  1 
ATOM   2298 C  CZ   . PHE C 2 44 ? -1.534  38.207 -5.108  1.00 49.36  ? 44  PHE B CZ   1 
ATOM   2299 H  H    . PHE C 2 44 ? 0.346   33.579 -2.431  1.00 54.38  ? 44  PHE B H    1 
ATOM   2300 H  HA   . PHE C 2 44 ? -0.302  35.803 -1.005  1.00 54.70  ? 44  PHE B HA   1 
ATOM   2301 H  HB2  . PHE C 2 44 ? -1.971  34.222 -2.625  1.00 55.61  ? 44  PHE B HB2  1 
ATOM   2302 H  HB3  . PHE C 2 44 ? -2.572  35.288 -1.615  1.00 55.61  ? 44  PHE B HB3  1 
ATOM   2303 H  HD1  . PHE C 2 44 ? 0.280   36.547 -2.979  1.00 60.34  ? 44  PHE B HD1  1 
ATOM   2304 H  HD2  . PHE C 2 44 ? -3.629  36.123 -3.769  1.00 55.41  ? 44  PHE B HD2  1 
ATOM   2305 H  HE1  . PHE C 2 44 ? 0.424   38.240 -4.555  1.00 59.54  ? 44  PHE B HE1  1 
ATOM   2306 H  HE2  . PHE C 2 44 ? -3.508  37.817 -5.350  1.00 54.67  ? 44  PHE B HE2  1 
ATOM   2307 H  HZ   . PHE C 2 44 ? -1.477  38.878 -5.749  1.00 59.23  ? 44  PHE B HZ   1 
ATOM   2308 N  N    . LEU C 2 45 ? -0.624  32.871 0.055   1.00 50.40  ? 45  LEU B N    1 
ATOM   2309 C  CA   . LEU C 2 45 ? -1.056  32.065 1.195   1.00 50.91  ? 45  LEU B CA   1 
ATOM   2310 C  C    . LEU C 2 45 ? 0.136   31.296 1.721   1.00 47.78  ? 45  LEU B C    1 
ATOM   2311 O  O    . LEU C 2 45 ? 1.042   30.943 0.962   1.00 46.32  ? 45  LEU B O    1 
ATOM   2312 C  CB   . LEU C 2 45 ? -2.189  31.110 0.793   1.00 46.42  ? 45  LEU B CB   1 
ATOM   2313 C  CG   . LEU C 2 45 ? -3.466  31.658 0.169   1.00 44.37  ? 45  LEU B CG   1 
ATOM   2314 C  CD1  . LEU C 2 45 ? -4.337  30.471 -0.173  1.00 47.37  ? 45  LEU B CD1  1 
ATOM   2315 C  CD2  . LEU C 2 45 ? -4.179  32.602 1.052   1.00 43.81  ? 45  LEU B CD2  1 
ATOM   2316 H  H    . LEU C 2 45 ? -0.160  32.448 -0.533  1.00 60.48  ? 45  LEU B H    1 
ATOM   2317 H  HA   . LEU C 2 45 ? -1.381  32.648 1.899   1.00 61.09  ? 45  LEU B HA   1 
ATOM   2318 H  HB2  . LEU C 2 45 ? -1.822  30.477 0.156   1.00 55.70  ? 45  LEU B HB2  1 
ATOM   2319 H  HB3  . LEU C 2 45 ? -2.458  30.627 1.590   1.00 55.70  ? 45  LEU B HB3  1 
ATOM   2320 H  HG   . LEU C 2 45 ? -3.246  32.121 -0.655  1.00 53.24  ? 45  LEU B HG   1 
ATOM   2321 H  HD11 . LEU C 2 45 ? -5.161  30.790 -0.573  1.00 56.84  ? 45  LEU B HD11 1 
ATOM   2322 H  HD12 . LEU C 2 45 ? -3.863  29.902 -0.799  1.00 56.84  ? 45  LEU B HD12 1 
ATOM   2323 H  HD13 . LEU C 2 45 ? -4.533  29.979 0.640   1.00 56.84  ? 45  LEU B HD13 1 
ATOM   2324 H  HD21 . LEU C 2 45 ? -4.978  32.914 0.600   1.00 52.57  ? 45  LEU B HD21 1 
ATOM   2325 H  HD22 . LEU C 2 45 ? -4.419  32.145 1.873   1.00 52.57  ? 45  LEU B HD22 1 
ATOM   2326 H  HD23 . LEU C 2 45 ? -3.595  33.352 1.248   1.00 52.57  ? 45  LEU B HD23 1 
ATOM   2327 N  N    . GLU C 2 46 ? 0.143   31.069 3.027   1.00 48.92  ? 46  GLU B N    1 
ATOM   2328 C  CA   . GLU C 2 46 ? 1.108   30.154 3.603   1.00 49.64  ? 46  GLU B CA   1 
ATOM   2329 C  C    . GLU C 2 46 ? 0.927   28.796 2.900   1.00 46.88  ? 46  GLU B C    1 
ATOM   2330 O  O    . GLU C 2 46 ? -0.193  28.368 2.585   1.00 45.60  ? 46  GLU B O    1 
ATOM   2331 C  CB   . GLU C 2 46 ? 0.915   30.046 5.128   1.00 48.24  ? 46  GLU B CB   1 
ATOM   2332 C  CG   . GLU C 2 46 ? 1.165   31.350 5.868   0.00 49.53  ? 46  GLU B CG   1 
ATOM   2333 C  CD   . GLU C 2 46 ? 1.140   31.179 7.375   0.00 46.18  ? 46  GLU B CD   1 
ATOM   2334 O  OE1  . GLU C 2 46 ? 0.964   30.034 7.842   0.00 45.71  ? 46  GLU B OE1  1 
ATOM   2335 O  OE2  . GLU C 2 46 ? 1.294   32.190 8.093   0.00 45.53  ? 46  GLU B OE2  1 
ATOM   2336 H  H    . GLU C 2 46 ? -0.395  31.429 3.593   1.00 58.71  ? 46  GLU B H    1 
ATOM   2337 H  HA   . GLU C 2 46 ? 2.006   30.475 3.428   1.00 59.57  ? 46  GLU B HA   1 
ATOM   2338 H  HB2  . GLU C 2 46 ? 0.003   29.771 5.309   1.00 57.88  ? 46  GLU B HB2  1 
ATOM   2339 H  HB3  . GLU C 2 46 ? 1.534   29.384 5.475   1.00 57.88  ? 46  GLU B HB3  1 
ATOM   2340 H  HG2  . GLU C 2 46 ? 2.037   31.693 5.620   0.00 59.44  ? 46  GLU B HG2  1 
ATOM   2341 H  HG3  . GLU C 2 46 ? 0.475   31.988 5.627   0.00 59.44  ? 46  GLU B HG3  1 
ATOM   2342 N  N    . GLU C 2 47 ? 2.037   28.168 2.541   1.00 49.50  ? 47  GLU B N    1 
ATOM   2343 C  CA   . GLU C 2 47 ? 2.007   26.798 2.044   1.00 46.17  ? 47  GLU B CA   1 
ATOM   2344 C  C    . GLU C 2 47 ? 1.274   25.801 2.947   1.00 47.17  ? 47  GLU B C    1 
ATOM   2345 O  O    . GLU C 2 47 ? 1.340   25.901 4.169   1.00 46.61  ? 47  GLU B O    1 
ATOM   2346 C  CB   . GLU C 2 47 ? 3.392   26.260 1.847   1.00 45.51  ? 47  GLU B CB   1 
ATOM   2347 C  CG   . GLU C 2 47 ? 3.306   24.832 1.354   1.00 47.02  ? 47  GLU B CG   1 
ATOM   2348 C  CD   . GLU C 2 47 ? 4.602   24.255 0.914   1.00 50.97  ? 47  GLU B CD   1 
ATOM   2349 O  OE1  . GLU C 2 47 ? 5.649   24.789 1.308   1.00 48.79  ? 47  GLU B OE1  1 
ATOM   2350 O  OE2  . GLU C 2 47 ? 4.571   23.238 0.176   1.00 68.40  ? 47  GLU B OE2  1 
ATOM   2351 H  H    . GLU C 2 47 ? 2.824   28.513 2.576   1.00 59.40  ? 47  GLU B H    1 
ATOM   2352 H  HA   . GLU C 2 47 ? 1.564   26.793 1.181   1.00 55.40  ? 47  GLU B HA   1 
ATOM   2353 H  HB2  . GLU C 2 47 ? 3.858   26.791 1.182   1.00 54.62  ? 47  GLU B HB2  1 
ATOM   2354 H  HB3  . GLU C 2 47 ? 3.870   26.269 2.691   1.00 54.62  ? 47  GLU B HB3  1 
ATOM   2355 H  HG2  . GLU C 2 47 ? 2.964   24.276 2.071   1.00 56.43  ? 47  GLU B HG2  1 
ATOM   2356 H  HG3  . GLU C 2 47 ? 2.698   24.801 0.598   1.00 56.43  ? 47  GLU B HG3  1 
ATOM   2357 N  N    . ILE C 2 48 ? 0.539   24.869 2.339   1.00 49.70  ? 48  ILE B N    1 
ATOM   2358 C  CA   . ILE C 2 48 ? -0.114  23.795 3.088   1.00 49.79  ? 48  ILE B CA   1 
ATOM   2359 C  C    . ILE C 2 48 ? 0.829   22.591 3.112   1.00 50.73  ? 48  ILE B C    1 
ATOM   2360 O  O    . ILE C 2 48 ? 1.247   22.087 2.066   1.00 50.05  ? 48  ILE B O    1 
ATOM   2361 C  CB   . ILE C 2 48 ? -1.448  23.399 2.461   1.00 49.50  ? 48  ILE B CB   1 
ATOM   2362 C  CG1  . ILE C 2 48 ? -2.345  24.619 2.361   1.00 46.67  ? 48  ILE B CG1  1 
ATOM   2363 C  CG2  . ILE C 2 48 ? -2.111  22.312 3.264   1.00 51.64  ? 48  ILE B CG2  1 
ATOM   2364 C  CD1  . ILE C 2 48 ? -3.620  24.337 1.686   1.00 46.32  ? 48  ILE B CD1  1 
ATOM   2365 H  H    . ILE C 2 48 ? 0.403   24.837 1.490   1.00 59.64  ? 48  ILE B H    1 
ATOM   2366 H  HA   . ILE C 2 48 ? -0.273  24.083 4.001   1.00 59.75  ? 48  ILE B HA   1 
ATOM   2367 H  HB   . ILE C 2 48 ? -1.282  23.064 1.566   1.00 59.40  ? 48  ILE B HB   1 
ATOM   2368 H  HG12 . ILE C 2 48 ? -2.544  24.938 3.255   1.00 56.00  ? 48  ILE B HG12 1 
ATOM   2369 H  HG13 . ILE C 2 48 ? -1.885  25.308 1.858   1.00 56.00  ? 48  ILE B HG13 1 
ATOM   2370 H  HG21 . ILE C 2 48 ? -2.954  22.079 2.845   1.00 61.97  ? 48  ILE B HG21 1 
ATOM   2371 H  HG22 . ILE C 2 48 ? -1.528  21.537 3.287   1.00 61.97  ? 48  ILE B HG22 1 
ATOM   2372 H  HG23 . ILE C 2 48 ? -2.267  22.636 4.165   1.00 61.97  ? 48  ILE B HG23 1 
ATOM   2373 H  HD11 . ILE C 2 48 ? -4.146  25.151 1.653   1.00 55.58  ? 48  ILE B HD11 1 
ATOM   2374 H  HD12 . ILE C 2 48 ? -3.437  24.024 0.786   1.00 55.58  ? 48  ILE B HD12 1 
ATOM   2375 H  HD13 . ILE C 2 48 ? -4.096  23.654 2.183   1.00 55.58  ? 48  ILE B HD13 1 
ATOM   2376 N  N    . LYS C 2 49 ? 1.196   22.158 4.302   1.00 52.80  ? 49  LYS B N    1 
ATOM   2377 C  CA   . LYS C 2 49 ? 2.114   21.038 4.435   1.00 55.88  ? 49  LYS B CA   1 
ATOM   2378 C  C    . LYS C 2 49 ? 1.447   19.936 5.289   1.00 61.57  ? 49  LYS B C    1 
ATOM   2379 O  O    . LYS C 2 49 ? 1.719   18.756 5.117   1.00 70.24  ? 49  LYS B O    1 
ATOM   2380 C  CB   . LYS C 2 49 ? 3.442   21.502 5.034   1.00 52.81  ? 49  LYS B CB   1 
ATOM   2381 C  CG   . LYS C 2 49 ? 4.198   22.513 4.207   0.00 52.48  ? 49  LYS B CG   1 
ATOM   2382 C  CD   . LYS C 2 49 ? 5.464   22.927 4.932   0.00 50.79  ? 49  LYS B CD   1 
ATOM   2383 C  CE   . LYS C 2 49 ? 6.318   23.844 4.084   0.00 48.78  ? 49  LYS B CE   1 
ATOM   2384 N  NZ   . LYS C 2 49 ? 7.513   24.329 4.824   0.00 46.70  ? 49  LYS B NZ   1 
ATOM   2385 H  H    . LYS C 2 49 ? 0.932   22.492 5.049   1.00 63.36  ? 49  LYS B H    1 
ATOM   2386 H  HA   . LYS C 2 49 ? 2.294   20.670 3.556   1.00 67.05  ? 49  LYS B HA   1 
ATOM   2387 H  HB2  . LYS C 2 49 ? 3.266   21.904 5.899   1.00 63.37  ? 49  LYS B HB2  1 
ATOM   2388 H  HB3  . LYS C 2 49 ? 4.017   20.728 5.146   1.00 63.37  ? 49  LYS B HB3  1 
ATOM   2389 H  HG2  . LYS C 2 49 ? 4.444   22.119 3.356   0.00 62.98  ? 49  LYS B HG2  1 
ATOM   2390 H  HG3  . LYS C 2 49 ? 3.647   23.300 4.073   0.00 62.98  ? 49  LYS B HG3  1 
ATOM   2391 H  HD2  . LYS C 2 49 ? 5.227   23.399 5.745   0.00 60.95  ? 49  LYS B HD2  1 
ATOM   2392 H  HD3  . LYS C 2 49 ? 5.984   22.137 5.142   0.00 60.95  ? 49  LYS B HD3  1 
ATOM   2393 H  HE2  . LYS C 2 49 ? 6.622   23.362 3.300   0.00 58.54  ? 49  LYS B HE2  1 
ATOM   2394 H  HE3  . LYS C 2 49 ? 5.792   24.616 3.820   0.00 58.54  ? 49  LYS B HE3  1 
ATOM   2395 H  HZ1  . LYS C 2 49 ? 7.997   24.865 4.303   0.00 56.04  ? 49  LYS B HZ1  1 
ATOM   2396 H  HZ2  . LYS C 2 49 ? 7.261   24.780 5.548   0.00 56.04  ? 49  LYS B HZ2  1 
ATOM   2397 H  HZ3  . LYS C 2 49 ? 8.016   23.638 5.074   0.00 56.04  ? 49  LYS B HZ3  1 
ATOM   2398 N  N    . GLU C 2 50 ? 0.601   20.345 6.228   1.00 60.83  ? 50  GLU B N    1 
ATOM   2399 C  CA   . GLU C 2 50 ? -0.149  19.450 7.107   1.00 60.81  ? 50  GLU B CA   1 
ATOM   2400 C  C    . GLU C 2 50 ? -1.541  19.113 6.569   1.00 62.95  ? 50  GLU B C    1 
ATOM   2401 O  O    . GLU C 2 50 ? -2.296  19.986 6.111   1.00 62.11  ? 50  GLU B O    1 
ATOM   2402 C  CB   . GLU C 2 50 ? -0.294  20.071 8.504   1.00 59.23  ? 50  GLU B CB   1 
ATOM   2403 C  CG   . GLU C 2 50 ? 1.005   20.273 9.276   0.00 60.27  ? 50  GLU B CG   1 
ATOM   2404 C  CD   . GLU C 2 50 ? 1.830   19.005 9.416   0.00 59.67  ? 50  GLU B CD   1 
ATOM   2405 O  OE1  . GLU C 2 50 ? 1.272   17.899 9.254   0.00 59.92  ? 50  GLU B OE1  1 
ATOM   2406 O  OE2  . GLU C 2 50 ? 3.043   19.114 9.696   0.00 58.41  ? 50  GLU B OE2  1 
ATOM   2407 H  H    . GLU C 2 50 ? 0.437   21.175 6.381   1.00 72.99  ? 50  GLU B H    1 
ATOM   2408 H  HA   . GLU C 2 50 ? 0.343   18.618 7.201   1.00 72.97  ? 50  GLU B HA   1 
ATOM   2409 H  HB2  . GLU C 2 50 ? -0.714  20.941 8.410   1.00 71.08  ? 50  GLU B HB2  1 
ATOM   2410 H  HB3  . GLU C 2 50 ? -0.862  19.495 9.039   1.00 71.08  ? 50  GLU B HB3  1 
ATOM   2411 H  HG2  . GLU C 2 50 ? 1.547   20.930 8.811   0.00 72.32  ? 50  GLU B HG2  1 
ATOM   2412 H  HG3  . GLU C 2 50 ? 0.794   20.591 10.168  0.00 72.32  ? 50  GLU B HG3  1 
ATOM   2413 N  N    . GLN C 2 51 ? -1.890  17.841 6.637   1.00 64.65  ? 51  GLN B N    1 
ATOM   2414 C  CA   . GLN C 2 51 ? -3.230  17.394 6.266   1.00 64.49  ? 51  GLN B CA   1 
ATOM   2415 C  C    . GLN C 2 51 ? -4.347  18.148 6.992   1.00 61.71  ? 51  GLN B C    1 
ATOM   2416 O  O    . GLN C 2 51 ? -5.385  18.458 6.429   1.00 59.39  ? 51  GLN B O    1 
ATOM   2417 C  CB   . GLN C 2 51 ? -3.352  15.893 6.551   1.00 67.28  ? 51  GLN B CB   1 
ATOM   2418 C  CG   . GLN C 2 51 ? -4.647  15.268 6.088   1.00 65.14  ? 51  GLN B CG   1 
ATOM   2419 C  CD   . GLN C 2 51 ? -4.851  15.464 4.625   1.00 66.12  ? 51  GLN B CD   1 
ATOM   2420 O  OE1  . GLN C 2 51 ? -3.910  15.276 3.827   1.00 63.60  ? 51  GLN B OE1  1 
ATOM   2421 N  NE2  . GLN C 2 51 ? -6.075  15.871 4.241   1.00 63.17  ? 51  GLN B NE2  1 
ATOM   2422 H  H    . GLN C 2 51 ? -1.368  17.208 6.896   1.00 77.59  ? 51  GLN B H    1 
ATOM   2423 H  HA   . GLN C 2 51 ? -3.352  17.528 5.313   1.00 77.39  ? 51  GLN B HA   1 
ATOM   2424 H  HB2  . GLN C 2 51 ? -2.626  15.433 6.101   1.00 80.74  ? 51  GLN B HB2  1 
ATOM   2425 H  HB3  . GLN C 2 51 ? -3.283  15.753 7.508   1.00 80.74  ? 51  GLN B HB3  1 
ATOM   2426 H  HG2  . GLN C 2 51 ? -4.626  14.315 6.268   1.00 78.16  ? 51  GLN B HG2  1 
ATOM   2427 H  HG3  . GLN C 2 51 ? -5.389  15.682 6.557   1.00 78.16  ? 51  GLN B HG3  1 
ATOM   2428 H  HE21 . GLN C 2 51 ? -6.688  16.003 4.829   1.00 75.80  ? 51  GLN B HE21 1 
ATOM   2429 H  HE22 . GLN C 2 51 ? -6.244  15.998 3.407   1.00 75.80  ? 51  GLN B HE22 1 
ATOM   2430 N  N    . GLU C 2 52 ? -4.143  18.409 8.266   1.00 67.24  ? 52  GLU B N    1 
ATOM   2431 C  CA   . GLU C 2 52 ? -5.163  19.071 9.055   1.00 65.82  ? 52  GLU B CA   1 
ATOM   2432 C  C    . GLU C 2 52 ? -5.424  20.466 8.511   1.00 60.10  ? 52  GLU B C    1 
ATOM   2433 O  O    . GLU C 2 52 ? -6.516  20.997 8.680   1.00 58.05  ? 52  GLU B O    1 
ATOM   2434 C  CB   . GLU C 2 52 ? -4.760  19.116 10.526  0.00 69.28  ? 52  GLU B CB   1 
ATOM   2435 C  CG   . GLU C 2 52 ? -4.704  17.735 11.164  0.00 73.04  ? 52  GLU B CG   1 
ATOM   2436 C  CD   . GLU C 2 52 ? -3.422  16.979 10.864  0.00 70.33  ? 52  GLU B CD   1 
ATOM   2437 O  OE1  . GLU C 2 52 ? -2.571  17.505 10.116  0.00 67.68  ? 52  GLU B OE1  1 
ATOM   2438 O  OE2  . GLU C 2 52 ? -3.268  15.850 11.376  0.00 72.05  ? 52  GLU B OE2  1 
ATOM   2439 H  H    . GLU C 2 52 ? -3.426  18.214 8.700   1.00 80.69  ? 52  GLU B H    1 
ATOM   2440 H  HA   . GLU C 2 52 ? -5.988  18.566 8.989   1.00 78.98  ? 52  GLU B HA   1 
ATOM   2441 H  HB2  . GLU C 2 52 ? -3.880  19.517 10.600  0.00 83.13  ? 52  GLU B HB2  1 
ATOM   2442 H  HB3  . GLU C 2 52 ? -5.408  19.647 11.015  0.00 83.13  ? 52  GLU B HB3  1 
ATOM   2443 H  HG2  . GLU C 2 52 ? -4.774  17.832 12.127  0.00 87.64  ? 52  GLU B HG2  1 
ATOM   2444 H  HG3  . GLU C 2 52 ? -5.446  17.207 10.832  0.00 87.64  ? 52  GLU B HG3  1 
ATOM   2445 N  N    . VAL C 2 53 ? -4.429  21.065 7.863   1.00 58.93  ? 53  VAL B N    1 
ATOM   2446 C  CA   . VAL C 2 53 ? -4.636  22.377 7.252   1.00 58.98  ? 53  VAL B CA   1 
ATOM   2447 C  C    . VAL C 2 53 ? -5.552  22.275 5.984   1.00 55.89  ? 53  VAL B C    1 
ATOM   2448 O  O    . VAL C 2 53 ? -6.501  23.061 5.829   1.00 49.71  ? 53  VAL B O    1 
ATOM   2449 C  CB   . VAL C 2 53 ? -3.316  23.019 6.887   1.00 55.18  ? 53  VAL B CB   1 
ATOM   2450 C  CG1  . VAL C 2 53 ? -3.592  24.367 6.293   1.00 51.33  ? 53  VAL B CG1  1 
ATOM   2451 C  CG2  . VAL C 2 53 ? -2.496  23.198 8.114   1.00 56.97  ? 53  VAL B CG2  1 
ATOM   2452 H  H    . VAL C 2 53 ? -3.638  20.742 7.764   1.00 70.72  ? 53  VAL B H    1 
ATOM   2453 H  HA   . VAL C 2 53 ? -5.080  22.954 7.893   1.00 70.77  ? 53  VAL B HA   1 
ATOM   2454 H  HB   . VAL C 2 53 ? -2.833  22.472 6.248   1.00 66.22  ? 53  VAL B HB   1 
ATOM   2455 H  HG11 . VAL C 2 53 ? -2.750  24.786 6.056   1.00 61.60  ? 53  VAL B HG11 1 
ATOM   2456 H  HG12 . VAL C 2 53 ? -4.141  24.256 5.501   1.00 61.60  ? 53  VAL B HG12 1 
ATOM   2457 H  HG13 . VAL C 2 53 ? -4.060  24.910 6.946   1.00 61.60  ? 53  VAL B HG13 1 
ATOM   2458 H  HG21 . VAL C 2 53 ? -1.652  23.610 7.872   1.00 68.37  ? 53  VAL B HG21 1 
ATOM   2459 H  HG22 . VAL C 2 53 ? -2.977  23.768 8.734   1.00 68.37  ? 53  VAL B HG22 1 
ATOM   2460 H  HG23 . VAL C 2 53 ? -2.338  22.330 8.517   1.00 68.37  ? 53  VAL B HG23 1 
ATOM   2461 N  N    . VAL C 2 54 ? -5.243  21.302 5.111   1.00 54.29  ? 54  VAL B N    1 
ATOM   2462 C  CA   . VAL C 2 54 ? -6.081  20.930 3.962   1.00 53.14  ? 54  VAL B CA   1 
ATOM   2463 C  C    . VAL C 2 54 ? -7.582  20.781 4.274   1.00 52.20  ? 54  VAL B C    1 
ATOM   2464 O  O    . VAL C 2 54 ? -8.441  21.299 3.543   1.00 50.24  ? 54  VAL B O    1 
ATOM   2465 C  CB   . VAL C 2 54 ? -5.651  19.573 3.378   1.00 53.67  ? 54  VAL B CB   1 
ATOM   2466 C  CG1  . VAL C 2 54 ? -6.476  19.249 2.170   1.00 52.10  ? 54  VAL B CG1  1 
ATOM   2467 C  CG2  . VAL C 2 54 ? -4.218  19.584 2.996   1.00 56.35  ? 54  VAL B CG2  1 
ATOM   2468 H  H    . VAL C 2 54 ? -4.527  20.829 5.169   1.00 65.14  ? 54  VAL B H    1 
ATOM   2469 H  HA   . VAL C 2 54 ? -5.983  21.601 3.269   1.00 63.77  ? 54  VAL B HA   1 
ATOM   2470 H  HB   . VAL C 2 54 ? -5.788  18.877 4.040   1.00 64.41  ? 54  VAL B HB   1 
ATOM   2471 H  HG11 . VAL C 2 54 ? -6.193  18.392 1.815   1.00 62.52  ? 54  VAL B HG11 1 
ATOM   2472 H  HG12 . VAL C 2 54 ? -7.410  19.208 2.428   1.00 62.52  ? 54  VAL B HG12 1 
ATOM   2473 H  HG13 . VAL C 2 54 ? -6.347  19.943 1.505   1.00 62.52  ? 54  VAL B HG13 1 
ATOM   2474 H  HG21 . VAL C 2 54 ? -3.982  18.716 2.633   1.00 67.62  ? 54  VAL B HG21 1 
ATOM   2475 H  HG22 . VAL C 2 54 ? -4.075  20.273 2.328   1.00 67.62  ? 54  VAL B HG22 1 
ATOM   2476 H  HG23 . VAL C 2 54 ? -3.683  19.770 3.784   1.00 67.62  ? 54  VAL B HG23 1 
ATOM   2477 N  N    . ASP C 2 55 ? -7.880  20.023 5.329   1.00 53.20  ? 55  ASP B N    1 
ATOM   2478 C  CA   . ASP C 2 55 ? -9.246  19.779 5.773   1.00 52.66  ? 55  ASP B CA   1 
ATOM   2479 C  C    . ASP C 2 55 ? -9.998  21.017 6.085   1.00 50.93  ? 55  ASP B C    1 
ATOM   2480 O  O    . ASP C 2 55 ? -11.155 21.153 5.659   1.00 47.69  ? 55  ASP B O    1 
ATOM   2481 C  CB   . ASP C 2 55 ? -9.268  18.899 7.023   1.00 58.15  ? 55  ASP B CB   1 
ATOM   2482 C  CG   . ASP C 2 55 ? -8.749  17.538 6.766   1.00 59.23  ? 55  ASP B CG   1 
ATOM   2483 O  OD1  . ASP C 2 55 ? -9.169  16.986 5.744   1.00 61.11  ? 55  ASP B OD1  1 
ATOM   2484 O  OD2  . ASP C 2 55 ? -7.929  17.030 7.552   1.00 62.90  ? 55  ASP B OD2  1 
ATOM   2485 H  H    . ASP C 2 55 ? -7.289  19.631 5.815   1.00 63.84  ? 55  ASP B H    1 
ATOM   2486 H  HA   . ASP C 2 55 ? -9.724  19.310 5.070   1.00 63.19  ? 55  ASP B HA   1 
ATOM   2487 H  HB2  . ASP C 2 55 ? -8.715  19.308 7.707   1.00 69.77  ? 55  ASP B HB2  1 
ATOM   2488 H  HB3  . ASP C 2 55 ? -10.182 18.819 7.338   1.00 69.77  ? 55  ASP B HB3  1 
ATOM   2489 N  N    . LYS C 2 56 ? -9.346  21.918 6.832   1.00 51.73  ? 56  LYS B N    1 
ATOM   2490 C  CA   . LYS C 2 56 ? -10.009 23.149 7.241   1.00 54.44  ? 56  LYS B CA   1 
ATOM   2491 C  C    . LYS C 2 56 ? -10.383 23.964 6.021   1.00 46.19  ? 56  LYS B C    1 
ATOM   2492 O  O    . LYS C 2 56 ? -11.500 24.416 5.923   1.00 45.32  ? 56  LYS B O    1 
ATOM   2493 C  CB   . LYS C 2 56 ? -9.129  23.987 8.184   1.00 54.15  ? 56  LYS B CB   1 
ATOM   2494 C  CG   . LYS C 2 56 ? -8.978  23.420 9.574   1.00 54.78  ? 56  LYS B CG   1 
ATOM   2495 C  CD   . LYS C 2 56 ? -8.201  24.322 10.508  0.00 60.21  ? 56  LYS B CD   1 
ATOM   2496 C  CE   . LYS C 2 56 ? -8.129  23.703 11.895  0.00 63.69  ? 56  LYS B CE   1 
ATOM   2497 N  NZ   . LYS C 2 56 ? -7.308  24.507 12.837  0.00 67.82  ? 56  LYS B NZ   1 
ATOM   2498 H  H    . LYS C 2 56 ? -8.536  21.836 7.108   1.00 62.07  ? 56  LYS B H    1 
ATOM   2499 H  HA   . LYS C 2 56 ? -10.826 22.925 7.714   1.00 65.33  ? 56  LYS B HA   1 
ATOM   2500 H  HB2  . LYS C 2 56 ? -8.242  24.057 7.799   1.00 64.98  ? 56  LYS B HB2  1 
ATOM   2501 H  HB3  . LYS C 2 56 ? -9.519  24.871 8.268   1.00 64.98  ? 56  LYS B HB3  1 
ATOM   2502 H  HG2  . LYS C 2 56 ? -9.860  23.286 9.956   1.00 65.74  ? 56  LYS B HG2  1 
ATOM   2503 H  HG3  . LYS C 2 56 ? -8.510  22.573 9.519   1.00 65.74  ? 56  LYS B HG3  1 
ATOM   2504 H  HD2  . LYS C 2 56 ? -7.297  24.434 10.174  0.00 72.25  ? 56  LYS B HD2  1 
ATOM   2505 H  HD3  . LYS C 2 56 ? -8.647  25.180 10.577  0.00 72.25  ? 56  LYS B HD3  1 
ATOM   2506 H  HE2  . LYS C 2 56 ? -9.025  23.636 12.259  0.00 76.43  ? 56  LYS B HE2  1 
ATOM   2507 H  HE3  . LYS C 2 56 ? -7.731  22.820 11.828  0.00 76.43  ? 56  LYS B HE3  1 
ATOM   2508 H  HZ1  . LYS C 2 56 ? -7.289  24.114 13.635  0.00 81.38  ? 56  LYS B HZ1  1 
ATOM   2509 H  HZ2  . LYS C 2 56 ? -6.476  24.578 12.530  0.00 81.38  ? 56  LYS B HZ2  1 
ATOM   2510 H  HZ3  . LYS C 2 56 ? -7.655  25.322 12.923  0.00 81.38  ? 56  LYS B HZ3  1 
ATOM   2511 N  N    . VAL C 2 57 ? -9.489  24.077 5.053   1.00 45.37  ? 57  VAL B N    1 
ATOM   2512 C  CA   . VAL C 2 57 ? -9.805  24.878 3.886   1.00 44.77  ? 57  VAL B CA   1 
ATOM   2513 C  C    . VAL C 2 57 ? -10.923 24.240 3.132   1.00 43.54  ? 57  VAL B C    1 
ATOM   2514 O  O    . VAL C 2 57 ? -11.898 24.922 2.778   1.00 42.69  ? 57  VAL B O    1 
ATOM   2515 C  CB   . VAL C 2 57 ? -8.650  25.044 2.916   1.00 42.41  ? 57  VAL B CB   1 
ATOM   2516 C  CG1  . VAL C 2 57 ? -9.066  25.979 1.783   1.00 40.61  ? 57  VAL B CG1  1 
ATOM   2517 C  CG2  . VAL C 2 57 ? -7.458  25.593 3.599   1.00 44.86  ? 57  VAL B CG2  1 
ATOM   2518 H  H    . VAL C 2 57 ? -8.712  23.709 5.045   1.00 54.45  ? 57  VAL B H    1 
ATOM   2519 H  HA   . VAL C 2 57 ? -10.092 25.759 4.172   1.00 53.73  ? 57  VAL B HA   1 
ATOM   2520 H  HB   . VAL C 2 57 ? -8.419  24.182 2.536   1.00 50.89  ? 57  VAL B HB   1 
ATOM   2521 H  HG11 . VAL C 2 57 ? -8.323  26.079 1.168   1.00 48.73  ? 57  VAL B HG11 1 
ATOM   2522 H  HG12 . VAL C 2 57 ? -9.828  25.595 1.321   1.00 48.73  ? 57  VAL B HG12 1 
ATOM   2523 H  HG13 . VAL C 2 57 ? -9.305  26.841 2.157   1.00 48.73  ? 57  VAL B HG13 1 
ATOM   2524 H  HG21 . VAL C 2 57 ? -7.668  25.733 4.535   1.00 53.84  ? 57  VAL B HG21 1 
ATOM   2525 H  HG22 . VAL C 2 57 ? -6.728  24.961 3.514   1.00 53.84  ? 57  VAL B HG22 1 
ATOM   2526 H  HG23 . VAL C 2 57 ? -7.217  26.436 3.183   1.00 53.84  ? 57  VAL B HG23 1 
ATOM   2527 N  N    . MET C 2 58 ? -10.793 22.936 2.852   1.00 43.99  ? 58  MET B N    1 
ATOM   2528 C  CA   . MET C 2 58 ? -11.856 22.317 2.081   1.00 43.04  ? 58  MET B CA   1 
ATOM   2529 C  C    . MET C 2 58 ? -13.183 22.378 2.836   1.00 43.07  ? 58  MET B C    1 
ATOM   2530 O  O    . MET C 2 58 ? -14.242 22.598 2.242   1.00 41.80  ? 58  MET B O    1 
ATOM   2531 C  CB   . MET C 2 58 ? -11.532 20.894 1.708   1.00 43.80  ? 58  MET B CB   1 
ATOM   2532 C  CG   . MET C 2 58 ? -12.599 20.300 0.799   1.00 41.09  ? 58  MET B CG   1 
ATOM   2533 S  SD   . MET C 2 58 ? -12.781 21.095 -0.814  1.00 37.37  ? 58  MET B SD   1 
ATOM   2534 C  CE   . MET C 2 58 ? -11.504 20.089 -1.583  1.00 41.73  ? 58  MET B CE   1 
ATOM   2535 H  H    . MET C 2 58 ? -10.141 22.424 3.082   1.00 52.79  ? 58  MET B H    1 
ATOM   2536 H  HA   . MET C 2 58 ? -11.956 22.813 1.253   1.00 51.65  ? 58  MET B HA   1 
ATOM   2537 H  HB2  . MET C 2 58 ? -10.684 20.871 1.238   1.00 52.56  ? 58  MET B HB2  1 
ATOM   2538 H  HB3  . MET C 2 58 ? -11.485 20.355 2.513   1.00 52.56  ? 58  MET B HB3  1 
ATOM   2539 H  HG2  . MET C 2 58 ? -12.382 19.368 0.640   1.00 49.31  ? 58  MET B HG2  1 
ATOM   2540 H  HG3  . MET C 2 58 ? -13.455 20.361 1.250   1.00 49.31  ? 58  MET B HG3  1 
ATOM   2541 H  HE1  . MET C 2 58 ? -11.760 19.155 -1.524  1.00 50.08  ? 58  MET B HE1  1 
ATOM   2542 H  HE2  . MET C 2 58 ? -11.415 20.349 -2.513  1.00 50.08  ? 58  MET B HE2  1 
ATOM   2543 H  HE3  . MET C 2 58 ? -10.666 20.233 -1.117  1.00 50.08  ? 58  MET B HE3  1 
ATOM   2544 N  N    . GLU C 2 59 ? -13.112 22.171 4.148   1.00 44.60  ? 59  GLU B N    1 
ATOM   2545 C  CA   . GLU C 2 59 ? -14.279 22.258 5.006   1.00 44.94  ? 59  GLU B CA   1 
ATOM   2546 C  C    . GLU C 2 59 ? -14.839 23.662 4.917   1.00 45.52  ? 59  GLU B C    1 
ATOM   2547 O  O    . GLU C 2 59 ? -16.063 23.835 4.942   1.00 44.15  ? 59  GLU B O    1 
ATOM   2548 C  CB   . GLU C 2 59 ? -13.935 21.821 6.431   1.00 48.88  ? 59  GLU B CB   1 
ATOM   2549 C  CG   . GLU C 2 59 ? -13.898 20.263 6.523   1.00 52.41  ? 59  GLU B CG   1 
ATOM   2550 C  CD   . GLU C 2 59 ? -13.510 19.693 7.892   1.00 56.42  ? 59  GLU B CD   1 
ATOM   2551 O  OE1  . GLU C 2 59 ? -12.968 20.413 8.756   1.00 56.71  ? 59  GLU B OE1  1 
ATOM   2552 O  OE2  . GLU C 2 59 ? -13.746 18.485 8.095   1.00 65.13  ? 59  GLU B OE2  1 
ATOM   2553 H  H    . GLU C 2 59 ? -12.387 21.975 4.567   1.00 53.52  ? 59  GLU B H    1 
ATOM   2554 H  HA   . GLU C 2 59 ? -14.957 21.651 4.670   1.00 53.93  ? 59  GLU B HA   1 
ATOM   2555 H  HB2  . GLU C 2 59 ? -13.061 22.165 6.673   1.00 58.66  ? 59  GLU B HB2  1 
ATOM   2556 H  HB3  . GLU C 2 59 ? -14.612 22.150 7.043   1.00 58.66  ? 59  GLU B HB3  1 
ATOM   2557 H  HG2  . GLU C 2 59 ? -14.780 19.922 6.305   1.00 62.90  ? 59  GLU B HG2  1 
ATOM   2558 H  HG3  . GLU C 2 59 ? -13.255 19.933 5.877   1.00 62.90  ? 59  GLU B HG3  1 
ATOM   2559 N  N    . THR C 2 60 ? -13.956 24.671 4.805   1.00 46.15  ? 60  THR B N    1 
ATOM   2560 C  CA   . THR C 2 60 ? -14.434 26.032 4.577   1.00 45.41  ? 60  THR B CA   1 
ATOM   2561 C  C    . THR C 2 60 ? -15.098 26.181 3.200   1.00 44.91  ? 60  THR B C    1 
ATOM   2562 O  O    . THR C 2 60 ? -16.145 26.846 3.092   1.00 44.85  ? 60  THR B O    1 
ATOM   2563 C  CB   . THR C 2 60 ? -13.334 27.132 4.666   1.00 46.50  ? 60  THR B CB   1 
ATOM   2564 O  OG1  . THR C 2 60 ? -12.764 27.205 5.976   1.00 45.03  ? 60  THR B OG1  1 
ATOM   2565 C  CG2  . THR C 2 60 ? -13.973 28.496 4.415   1.00 48.02  ? 60  THR B CG2  1 
ATOM   2566 H  H    . THR C 2 60 ? -13.101 24.590 4.857   1.00 55.38  ? 60  THR B H    1 
ATOM   2567 H  HA   . THR C 2 60 ? -15.104 26.236 5.248   1.00 54.49  ? 60  THR B HA   1 
ATOM   2568 H  HB   . THR C 2 60 ? -12.643 26.974 4.004   1.00 55.80  ? 60  THR B HB   1 
ATOM   2569 H  HG1  . THR C 2 60 ? -12.413 26.469 6.178   1.00 54.04  ? 60  THR B HG1  1 
ATOM   2570 H  HG21 . THR C 2 60 ? -13.299 29.192 4.467   1.00 57.62  ? 60  THR B HG21 1 
ATOM   2571 H  HG22 . THR C 2 60 ? -14.378 28.515 3.534   1.00 57.62  ? 60  THR B HG22 1 
ATOM   2572 H  HG23 . THR C 2 60 ? -14.657 28.669 5.081   1.00 57.62  ? 60  THR B HG23 1 
ATOM   2573 N  N    . LEU C 2 61 ? -14.497 25.624 2.144   1.00 44.18  ? 61  LEU B N    1 
ATOM   2574 C  CA   . LEU C 2 61 ? -15.005 25.909 0.787   1.00 44.49  ? 61  LEU B CA   1 
ATOM   2575 C  C    . LEU C 2 61 ? -16.193 25.018 0.407   1.00 47.18  ? 61  LEU B C    1 
ATOM   2576 O  O    . LEU C 2 61 ? -17.155 25.459 -0.239  1.00 46.46  ? 61  LEU B O    1 
ATOM   2577 C  CB   . LEU C 2 61 ? -13.874 25.775 -0.253  1.00 42.30  ? 61  LEU B CB   1 
ATOM   2578 C  CG   . LEU C 2 61 ? -12.703 26.736 0.004   1.00 40.03  ? 61  LEU B CG   1 
ATOM   2579 C  CD1  . LEU C 2 61 ? -11.652 26.612 -1.056  1.00 37.81  ? 61  LEU B CD1  1 
ATOM   2580 C  CD2  . LEU C 2 61 ? -13.139 28.169 0.159   1.00 40.79  ? 61  LEU B CD2  1 
ATOM   2581 H  H    . LEU C 2 61 ? -13.818 25.097 2.177   1.00 53.01  ? 61  LEU B H    1 
ATOM   2582 H  HA   . LEU C 2 61 ? -15.314 26.829 0.763   1.00 53.39  ? 61  LEU B HA   1 
ATOM   2583 H  HB2  . LEU C 2 61 ? -13.528 24.869 -0.228  1.00 50.76  ? 61  LEU B HB2  1 
ATOM   2584 H  HB3  . LEU C 2 61 ? -14.231 25.969 -1.134  1.00 50.76  ? 61  LEU B HB3  1 
ATOM   2585 H  HG   . LEU C 2 61 ? -12.288 26.478 0.842   1.00 48.03  ? 61  LEU B HG   1 
ATOM   2586 H  HD11 . LEU C 2 61 ? -11.314 25.703 -1.060  1.00 45.37  ? 61  LEU B HD11 1 
ATOM   2587 H  HD12 . LEU C 2 61 ? -12.045 26.824 -1.917  1.00 45.37  ? 61  LEU B HD12 1 
ATOM   2588 H  HD13 . LEU C 2 61 ? -10.932 27.232 -0.859  1.00 45.37  ? 61  LEU B HD13 1 
ATOM   2589 H  HD21 . LEU C 2 61 ? -12.358 28.721 0.318   1.00 48.95  ? 61  LEU B HD21 1 
ATOM   2590 H  HD22 . LEU C 2 61 ? -13.585 28.452 -0.655  1.00 48.95  ? 61  LEU B HD22 1 
ATOM   2591 H  HD23 . LEU C 2 61 ? -13.749 28.233 0.910   1.00 48.95  ? 61  LEU B HD23 1 
ATOM   2592 N  N    . ASP C 2 62 ? -16.131 23.762 0.833   1.00 46.14  ? 62  ASP B N    1 
ATOM   2593 C  CA   . ASP C 2 62 ? -17.147 22.820 0.470   1.00 46.37  ? 62  ASP B CA   1 
ATOM   2594 C  C    . ASP C 2 62 ? -18.446 23.118 1.180   1.00 48.48  ? 62  ASP B C    1 
ATOM   2595 O  O    . ASP C 2 62 ? -18.500 23.098 2.404   1.00 48.39  ? 62  ASP B O    1 
ATOM   2596 C  CB   . ASP C 2 62 ? -16.697 21.407 0.762   1.00 44.91  ? 62  ASP B CB   1 
ATOM   2597 C  CG   . ASP C 2 62 ? -17.768 20.408 0.456   1.00 45.10  ? 62  ASP B CG   1 
ATOM   2598 O  OD1  . ASP C 2 62 ? -18.550 20.684 -0.491  1.00 45.53  ? 62  ASP B OD1  1 
ATOM   2599 O  OD2  . ASP C 2 62 ? -17.843 19.375 1.173   1.00 44.14  ? 62  ASP B OD2  1 
ATOM   2600 H  H    . ASP C 2 62 ? -15.508 23.442 1.333   1.00 55.36  ? 62  ASP B H    1 
ATOM   2601 H  HA   . ASP C 2 62 ? -17.309 22.888 -0.484  1.00 55.64  ? 62  ASP B HA   1 
ATOM   2602 H  HB2  . ASP C 2 62 ? -15.923 21.199 0.215   1.00 53.89  ? 62  ASP B HB2  1 
ATOM   2603 H  HB3  . ASP C 2 62 ? -16.472 21.332 1.703   1.00 53.89  ? 62  ASP B HB3  1 
ATOM   2604 N  N    . ASN C 2 63 ? -19.452 23.549 0.429   1.00 50.30  ? 63  ASN B N    1 
ATOM   2605 C  CA   . ASN C 2 63 ? -20.746 23.782 1.052   1.00 54.22  ? 63  ASN B CA   1 
ATOM   2606 C  C    . ASN C 2 63 ? -21.779 22.691 0.798   1.00 57.00  ? 63  ASN B C    1 
ATOM   2607 O  O    . ASN C 2 63 ? -22.567 22.426 1.680   1.00 68.24  ? 63  ASN B O    1 
ATOM   2608 C  CB   . ASN C 2 63 ? -21.335 25.103 0.577   1.00 57.27  ? 63  ASN B CB   1 
ATOM   2609 C  CG   . ASN C 2 63 ? -20.572 26.272 1.107   1.00 62.17  ? 63  ASN B CG   1 
ATOM   2610 O  OD1  . ASN C 2 63 ? -19.872 26.162 2.126   1.00 66.54  ? 63  ASN B OD1  1 
ATOM   2611 N  ND2  . ASN C 2 63 ? -20.683 27.397 0.432   1.00 59.46  ? 63  ASN B ND2  1 
ATOM   2612 H  H    . ASN C 2 63 ? -19.415 23.709 -0.415  1.00 60.36  ? 63  ASN B H    1 
ATOM   2613 H  HA   . ASN C 2 63 ? -20.619 23.846 2.012   1.00 65.06  ? 63  ASN B HA   1 
ATOM   2614 H  HB2  . ASN C 2 63 ? -21.305 25.136 -0.392  1.00 68.73  ? 63  ASN B HB2  1 
ATOM   2615 H  HB3  . ASN C 2 63 ? -22.251 25.174 0.887   1.00 68.73  ? 63  ASN B HB3  1 
ATOM   2616 H  HD21 . ASN C 2 63 ? -20.263 28.100 0.695   1.00 71.35  ? 63  ASN B HD21 1 
ATOM   2617 H  HD22 . ASN C 2 63 ? -21.175 27.429 -0.273  1.00 71.35  ? 63  ASN B HD22 1 
ATOM   2618 N  N    . ASP C 2 64 ? -21.675 21.937 -0.294  1.00 53.01  ? 64  ASP B N    1 
ATOM   2619 C  CA   . ASP C 2 64 ? -22.700 20.924 -0.624  1.00 52.76  ? 64  ASP B CA   1 
ATOM   2620 C  C    . ASP C 2 64 ? -22.319 19.483 -0.140  1.00 50.08  ? 64  ASP B C    1 
ATOM   2621 O  O    . ASP C 2 64 ? -22.732 18.475 -0.708  1.00 49.59  ? 64  ASP B O    1 
ATOM   2622 C  CB   . ASP C 2 64 ? -23.015 20.975 -2.143  1.00 49.78  ? 64  ASP B CB   1 
ATOM   2623 C  CG   . ASP C 2 64 ? -21.822 20.628 -3.028  1.00 49.99  ? 64  ASP B CG   1 
ATOM   2624 O  OD1  . ASP C 2 64 ? -20.657 20.610 -2.560  1.00 48.54  ? 64  ASP B OD1  1 
ATOM   2625 O  OD2  . ASP C 2 64 ? -22.059 20.389 -4.222  1.00 52.40  ? 64  ASP B OD2  1 
ATOM   2626 H  H    . ASP C 2 64 ? -21.029 21.985 -0.860  1.00 63.61  ? 64  ASP B H    1 
ATOM   2627 H  HA   . ASP C 2 64 ? -23.516 21.167 -0.161  1.00 63.32  ? 64  ASP B HA   1 
ATOM   2628 H  HB2  . ASP C 2 64 ? -23.723 20.342 -2.337  1.00 59.73  ? 64  ASP B HB2  1 
ATOM   2629 H  HB3  . ASP C 2 64 ? -23.303 21.873 -2.372  1.00 59.73  ? 64  ASP B HB3  1 
ATOM   2630 N  N    . GLY C 2 65 ? -21.457 19.441 0.867   1.00 49.14  ? 65  GLY B N    1 
ATOM   2631 C  CA   . GLY C 2 65 ? -21.138 18.246 1.620   1.00 48.42  ? 65  GLY B CA   1 
ATOM   2632 C  C    . GLY C 2 65 ? -20.393 17.139 0.914   1.00 44.40  ? 65  GLY B C    1 
ATOM   2633 O  O    . GLY C 2 65 ? -20.084 16.121 1.522   1.00 43.77  ? 65  GLY B O    1 
ATOM   2634 H  H    . GLY C 2 65 ? -21.026 20.131 1.143   1.00 58.97  ? 65  GLY B H    1 
ATOM   2635 H  HA2  . GLY C 2 65 ? -20.607 18.505 2.388   1.00 58.10  ? 65  GLY B HA2  1 
ATOM   2636 H  HA3  . GLY C 2 65 ? -21.967 17.868 1.953   1.00 58.10  ? 65  GLY B HA3  1 
ATOM   2637 N  N    . ASP C 2 66 ? -20.089 17.327 -0.350  1.00 42.39  ? 66  ASP B N    1 
ATOM   2638 C  CA   . ASP C 2 66 ? -19.431 16.274 -1.088  1.00 42.66  ? 66  ASP B CA   1 
ATOM   2639 C  C    . ASP C 2 66 ? -17.890 16.169 -0.848  1.00 45.49  ? 66  ASP B C    1 
ATOM   2640 O  O    . ASP C 2 66 ? -17.266 15.155 -1.232  1.00 40.01  ? 66  ASP B O    1 
ATOM   2641 C  CB   . ASP C 2 66 ? -19.726 16.506 -2.572  1.00 42.13  ? 66  ASP B CB   1 
ATOM   2642 C  CG   . ASP C 2 66 ? -18.950 17.710 -3.167  1.00 41.08  ? 66  ASP B CG   1 
ATOM   2643 O  OD1  . ASP C 2 66 ? -18.290 18.439 -2.396  1.00 42.31  ? 66  ASP B OD1  1 
ATOM   2644 O  OD2  . ASP C 2 66 ? -19.005 17.913 -4.402  1.00 39.79  ? 66  ASP B OD2  1 
ATOM   2645 H  H    . ASP C 2 66 ? -20.249 18.042 -0.800  1.00 50.87  ? 66  ASP B H    1 
ATOM   2646 H  HA   . ASP C 2 66 ? -19.826 15.424 -0.836  1.00 51.19  ? 66  ASP B HA   1 
ATOM   2647 H  HB2  . ASP C 2 66 ? -19.475 15.713 -3.071  1.00 50.55  ? 66  ASP B HB2  1 
ATOM   2648 H  HB3  . ASP C 2 66 ? -20.675 16.679 -2.681  1.00 50.55  ? 66  ASP B HB3  1 
ATOM   2649 N  N    . GLY C 2 67 ? -17.303 17.159 -0.145  1.00 43.17  ? 67  GLY B N    1 
ATOM   2650 C  CA   . GLY C 2 67 ? -15.893 17.084 0.226   1.00 41.26  ? 67  GLY B CA   1 
ATOM   2651 C  C    . GLY C 2 67 ? -14.959 17.595 -0.875  1.00 40.44  ? 67  GLY B C    1 
ATOM   2652 O  O    . GLY C 2 67 ? -13.731 17.417 -0.809  1.00 39.78  ? 67  GLY B O    1 
ATOM   2653 H  H    . GLY C 2 67 ? -17.702 17.873 0.122   1.00 51.80  ? 67  GLY B H    1 
ATOM   2654 H  HA2  . GLY C 2 67 ? -15.742 17.613 1.025   1.00 49.51  ? 67  GLY B HA2  1 
ATOM   2655 H  HA3  . GLY C 2 67 ? -15.661 16.162 0.421   1.00 49.51  ? 67  GLY B HA3  1 
ATOM   2656 N  N    . GLU C 2 68 ? -15.567 18.155 -1.922  1.00 40.28  ? 68  GLU B N    1 
ATOM   2657 C  CA   . GLU C 2 68 ? -14.833 18.702 -3.060  1.00 41.78  ? 68  GLU B CA   1 
ATOM   2658 C  C    . GLU C 2 68 ? -15.201 20.137 -3.243  1.00 41.13  ? 68  GLU B C    1 
ATOM   2659 O  O    . GLU C 2 68 ? -16.180 20.616 -2.659  1.00 43.73  ? 68  GLU B O    1 
ATOM   2660 C  CB   . GLU C 2 68 ? -15.128 17.909 -4.352  1.00 39.40  ? 68  GLU B CB   1 
ATOM   2661 C  CG   . GLU C 2 68 ? -14.717 16.468 -4.236  1.00 38.81  ? 68  GLU B CG   1 
ATOM   2662 C  CD   . GLU C 2 68 ? -14.271 15.820 -5.531  1.00 41.01  ? 68  GLU B CD   1 
ATOM   2663 O  OE1  . GLU C 2 68 ? -13.657 16.510 -6.379  1.00 39.35  ? 68  GLU B OE1  1 
ATOM   2664 O  OE2  . GLU C 2 68 ? -14.471 14.575 -5.679  1.00 52.76  ? 68  GLU B OE2  1 
ATOM   2665 H  H    . GLU C 2 68 ? -16.421 18.232 -1.995  1.00 48.34  ? 68  GLU B H    1 
ATOM   2666 H  HA   . GLU C 2 68 ? -13.881 18.651 -2.882  1.00 50.14  ? 68  GLU B HA   1 
ATOM   2667 H  HB2  . GLU C 2 68 ? -16.081 17.937 -4.533  1.00 47.28  ? 68  GLU B HB2  1 
ATOM   2668 H  HB3  . GLU C 2 68 ? -14.636 18.305 -5.088  1.00 47.28  ? 68  GLU B HB3  1 
ATOM   2669 H  HG2  . GLU C 2 68 ? -13.978 16.409 -3.610  1.00 46.57  ? 68  GLU B HG2  1 
ATOM   2670 H  HG3  . GLU C 2 68 ? -15.470 15.959 -3.898  1.00 46.57  ? 68  GLU B HG3  1 
ATOM   2671 N  N    . CYS C 2 69 ? -14.400 20.829 -4.039  1.00 39.42  ? 69  CYS B N    1 
ATOM   2672 C  CA   . CYS C 2 69 ? -14.650 22.217 -4.354  1.00 38.91  ? 69  CYS B CA   1 
ATOM   2673 C  C    . CYS C 2 69 ? -15.073 22.371 -5.804  1.00 38.37  ? 69  CYS B C    1 
ATOM   2674 O  O    . CYS C 2 69 ? -14.247 22.098 -6.686  1.00 36.12  ? 69  CYS B O    1 
ATOM   2675 C  CB   . CYS C 2 69 ? -13.383 23.067 -4.078  1.00 39.87  ? 69  CYS B CB   1 
ATOM   2676 S  SG   . CYS C 2 69 ? -13.615 24.820 -4.536  1.00 33.51  ? 69  CYS B SG   1 
ATOM   2677 H  H    . CYS C 2 69 ? -13.695 20.508 -4.413  1.00 47.30  ? 69  CYS B H    1 
ATOM   2678 H  HA   . CYS C 2 69 ? -15.367 22.549 -3.791  1.00 46.69  ? 69  CYS B HA   1 
ATOM   2679 H  HB2  . CYS C 2 69 ? -13.174 23.028 -3.132  1.00 47.84  ? 69  CYS B HB2  1 
ATOM   2680 H  HB3  . CYS C 2 69 ? -12.644 22.715 -4.598  1.00 47.84  ? 69  CYS B HB3  1 
ATOM   2681 H  HG   . CYS C 2 69 ? -14.523 25.275 -3.895  1.00 40.21  ? 69  CYS B HG   1 
ATOM   2682 N  N    . ASP C 2 70 ? -16.332 22.739 -6.079  1.00 38.21  ? 70  ASP B N    1 
ATOM   2683 C  CA   . ASP C 2 70 ? -16.720 23.006 -7.475  1.00 39.02  ? 70  ASP B CA   1 
ATOM   2684 C  C    . ASP C 2 70 ? -16.308 24.431 -7.839  1.00 39.81  ? 70  ASP B C    1 
ATOM   2685 O  O    . ASP C 2 70 ? -15.757 25.129 -6.999  1.00 37.76  ? 70  ASP B O    1 
ATOM   2686 C  CB   . ASP C 2 70 ? -18.222 22.786 -7.748  1.00 39.94  ? 70  ASP B CB   1 
ATOM   2687 C  CG   . ASP C 2 70 ? -19.146 23.696 -6.951  1.00 42.94  ? 70  ASP B CG   1 
ATOM   2688 O  OD1  . ASP C 2 70 ? -18.769 24.838 -6.627  1.00 45.08  ? 70  ASP B OD1  1 
ATOM   2689 O  OD2  . ASP C 2 70 ? -20.310 23.288 -6.724  1.00 50.84  ? 70  ASP B OD2  1 
ATOM   2690 H  H    . ASP C 2 70 ? -16.960 22.838 -5.500  1.00 45.85  ? 70  ASP B H    1 
ATOM   2691 H  HA   . ASP C 2 70 ? -16.227 22.403 -8.053  1.00 46.83  ? 70  ASP B HA   1 
ATOM   2692 H  HB2  . ASP C 2 70 ? -18.394 22.943 -8.689  1.00 47.92  ? 70  ASP B HB2  1 
ATOM   2693 H  HB3  . ASP C 2 70 ? -18.447 21.869 -7.523  1.00 47.92  ? 70  ASP B HB3  1 
ATOM   2694 N  N    . PHE C 2 71 ? -16.601 24.857 -9.066  1.00 38.92  ? 71  PHE B N    1 
ATOM   2695 C  CA   . PHE C 2 71 ? -16.224 26.177 -9.547  1.00 39.74  ? 71  PHE B CA   1 
ATOM   2696 C  C    . PHE C 2 71 ? -16.884 27.320 -8.766  1.00 40.60  ? 71  PHE B C    1 
ATOM   2697 O  O    . PHE C 2 71 ? -16.260 28.348 -8.491  1.00 38.04  ? 71  PHE B O    1 
ATOM   2698 C  CB   . PHE C 2 71 ? -16.553 26.350 -11.032 1.00 43.66  ? 71  PHE B CB   1 
ATOM   2699 C  CG   . PHE C 2 71 ? -15.962 27.612 -11.599 1.00 45.22  ? 71  PHE B CG   1 
ATOM   2700 C  CD1  . PHE C 2 71 ? -14.611 27.679 -11.923 1.00 48.62  ? 71  PHE B CD1  1 
ATOM   2701 C  CD2  . PHE C 2 71 ? -16.707 28.761 -11.697 1.00 45.88  ? 71  PHE B CD2  1 
ATOM   2702 C  CE1  . PHE C 2 71 ? -14.049 28.868 -12.376 1.00 41.70  ? 71  PHE B CE1  1 
ATOM   2703 C  CE2  . PHE C 2 71 ? -16.132 29.915 -12.158 1.00 43.63  ? 71  PHE B CE2  1 
ATOM   2704 C  CZ   . PHE C 2 71 ? -14.813 29.950 -12.498 1.00 39.89  ? 71  PHE B CZ   1 
ATOM   2705 H  H    . PHE C 2 71 ? -17.026 24.388 -9.648  1.00 46.70  ? 71  PHE B H    1 
ATOM   2706 H  HA   . PHE C 2 71 ? -15.264 26.275 -9.448  1.00 47.68  ? 71  PHE B HA   1 
ATOM   2707 H  HB2  . PHE C 2 71 ? -16.192 25.598 -11.528 1.00 52.39  ? 71  PHE B HB2  1 
ATOM   2708 H  HB3  . PHE C 2 71 ? -17.515 26.392 -11.142 1.00 52.39  ? 71  PHE B HB3  1 
ATOM   2709 H  HD1  . PHE C 2 71 ? -14.079 26.921 -11.839 1.00 58.34  ? 71  PHE B HD1  1 
ATOM   2710 H  HD2  . PHE C 2 71 ? -17.609 28.750 -11.470 1.00 55.05  ? 71  PHE B HD2  1 
ATOM   2711 H  HE1  . PHE C 2 71 ? -13.152 28.899 -12.617 1.00 50.03  ? 71  PHE B HE1  1 
ATOM   2712 H  HE2  . PHE C 2 71 ? -16.649 30.683 -12.245 1.00 52.35  ? 71  PHE B HE2  1 
ATOM   2713 H  HZ   . PHE C 2 71 ? -14.440 30.742 -12.812 1.00 47.87  ? 71  PHE B HZ   1 
ATOM   2714 N  N    . GLN C 2 72 ? -18.132 27.150 -8.395  1.00 40.62  ? 72  GLN B N    1 
ATOM   2715 C  CA   . GLN C 2 72 ? -18.839 28.205 -7.633  1.00 41.01  ? 72  GLN B CA   1 
ATOM   2716 C  C    . GLN C 2 72 ? -18.140 28.383 -6.291  1.00 39.36  ? 72  GLN B C    1 
ATOM   2717 O  O    . GLN C 2 72 ? -17.964 29.492 -5.797  1.00 38.55  ? 72  GLN B O    1 
ATOM   2718 C  CB   . GLN C 2 72 ? -20.326 27.816 -7.426  1.00 43.62  ? 72  GLN B CB   1 
ATOM   2719 C  CG   . GLN C 2 72 ? -21.374 28.913 -7.333  1.00 46.48  ? 72  GLN B CG   1 
ATOM   2720 C  CD   . GLN C 2 72 ? -22.749 28.376 -6.966  0.00 52.09  ? 72  GLN B CD   1 
ATOM   2721 O  OE1  . GLN C 2 72 ? -22.886 27.233 -6.527  0.00 52.55  ? 72  GLN B OE1  1 
ATOM   2722 N  NE2  . GLN C 2 72 ? -23.777 29.195 -7.163  0.00 55.53  ? 72  GLN B NE2  1 
ATOM   2723 H  H    . GLN C 2 72 ? -18.604 26.450 -8.561  1.00 48.74  ? 72  GLN B H    1 
ATOM   2724 H  HA   . GLN C 2 72 ? -18.800 29.043 -8.119  1.00 49.21  ? 72  GLN B HA   1 
ATOM   2725 H  HB2  . GLN C 2 72 ? -20.586 27.246 -8.166  1.00 52.35  ? 72  GLN B HB2  1 
ATOM   2726 H  HB3  . GLN C 2 72 ? -20.384 27.306 -6.602  1.00 52.35  ? 72  GLN B HB3  1 
ATOM   2727 H  HG2  . GLN C 2 72 ? -21.107 29.549 -6.651  1.00 55.77  ? 72  GLN B HG2  1 
ATOM   2728 H  HG3  . GLN C 2 72 ? -21.444 29.357 -8.192  1.00 55.77  ? 72  GLN B HG3  1 
ATOM   2729 H  HE21 . GLN C 2 72 ? -23.644 29.982 -7.484  0.00 66.64  ? 72  GLN B HE21 1 
ATOM   2730 H  HE22 . GLN C 2 72 ? -24.574 28.938 -6.971  0.00 66.64  ? 72  GLN B HE22 1 
ATOM   2731 N  N    . GLU C 2 73 ? -17.747 27.266 -5.691  1.00 39.32  ? 73  GLU B N    1 
ATOM   2732 C  CA   . GLU C 2 73 ? -17.052 27.301 -4.423  1.00 38.63  ? 73  GLU B CA   1 
ATOM   2733 C  C    . GLU C 2 73 ? -15.648 27.899 -4.594  1.00 35.94  ? 73  GLU B C    1 
ATOM   2734 O  O    . GLU C 2 73 ? -15.087 28.473 -3.708  1.00 35.17  ? 73  GLU B O    1 
ATOM   2735 C  CB   . GLU C 2 73 ? -16.989 25.903 -3.844  1.00 40.40  ? 73  GLU B CB   1 
ATOM   2736 C  CG   . GLU C 2 73 ? -18.313 25.465 -3.249  1.00 43.08  ? 73  GLU B CG   1 
ATOM   2737 C  CD   . GLU C 2 73 ? -18.439 23.974 -3.148  1.00 43.40  ? 73  GLU B CD   1 
ATOM   2738 O  OE1  . GLU C 2 73 ? -17.621 23.315 -3.830  1.00 41.88  ? 73  GLU B OE1  1 
ATOM   2739 O  OE2  . GLU C 2 73 ? -19.376 23.475 -2.453  1.00 44.92  ? 73  GLU B OE2  1 
ATOM   2740 H  H    . GLU C 2 73 ? -17.874 26.474 -6.002  1.00 47.19  ? 73  GLU B H    1 
ATOM   2741 H  HA   . GLU C 2 73 ? -17.546 27.862 -3.805  1.00 46.36  ? 73  GLU B HA   1 
ATOM   2742 H  HB2  . GLU C 2 73 ? -16.753 25.278 -4.547  1.00 48.48  ? 73  GLU B HB2  1 
ATOM   2743 H  HB3  . GLU C 2 73 ? -16.321 25.881 -3.141  1.00 48.48  ? 73  GLU B HB3  1 
ATOM   2744 H  HG2  . GLU C 2 73 ? -18.395 25.833 -2.355  1.00 51.69  ? 73  GLU B HG2  1 
ATOM   2745 H  HG3  . GLU C 2 73 ? -19.034 25.790 -3.810  1.00 51.69  ? 73  GLU B HG3  1 
ATOM   2746 N  N    . PHE C 2 74 ? -15.065 27.691 -5.739  1.00 35.95  ? 74  PHE B N    1 
ATOM   2747 C  CA   . PHE C 2 74 ? -13.760 28.180 -5.980  1.00 34.08  ? 74  PHE B CA   1 
ATOM   2748 C  C    . PHE C 2 74 ? -13.812 29.736 -6.134  1.00 33.84  ? 74  PHE B C    1 
ATOM   2749 O  O    . PHE C 2 74 ? -12.882 30.456 -5.798  1.00 32.64  ? 74  PHE B O    1 
ATOM   2750 C  CB   . PHE C 2 74 ? -13.177 27.494 -7.226  1.00 32.62  ? 74  PHE B CB   1 
ATOM   2751 C  CG   . PHE C 2 74 ? -11.835 28.025 -7.609  1.00 31.98  ? 74  PHE B CG   1 
ATOM   2752 C  CD1  . PHE C 2 74 ? -10.742 27.758 -6.815  1.00 32.33  ? 74  PHE B CD1  1 
ATOM   2753 C  CD2  . PHE C 2 74 ? -11.660 28.801 -8.745  1.00 32.91  ? 74  PHE B CD2  1 
ATOM   2754 C  CE1  . PHE C 2 74 ? -9.500  28.224 -7.155  1.00 31.72  ? 74  PHE B CE1  1 
ATOM   2755 C  CE2  . PHE C 2 74 ? -10.433 29.236 -9.090  1.00 31.36  ? 74  PHE B CE2  1 
ATOM   2756 C  CZ   . PHE C 2 74 ? -9.337  28.948 -8.281  1.00 31.82  ? 74  PHE B CZ   1 
ATOM   2757 H  H    . PHE C 2 74 ? -15.414 27.263 -6.399  1.00 43.14  ? 74  PHE B H    1 
ATOM   2758 H  HA   . PHE C 2 74 ? -13.193 27.967 -5.222  1.00 40.90  ? 74  PHE B HA   1 
ATOM   2759 H  HB2  . PHE C 2 74 ? -13.084 26.545 -7.049  1.00 39.14  ? 74  PHE B HB2  1 
ATOM   2760 H  HB3  . PHE C 2 74 ? -13.778 27.635 -7.974  1.00 39.14  ? 74  PHE B HB3  1 
ATOM   2761 H  HD1  . PHE C 2 74 ? -10.846 27.243 -6.048  1.00 38.80  ? 74  PHE B HD1  1 
ATOM   2762 H  HD2  . PHE C 2 74 ? -12.386 28.979 -9.299  1.00 39.50  ? 74  PHE B HD2  1 
ATOM   2763 H  HE1  . PHE C 2 74 ? -8.767  28.030 -6.617  1.00 38.06  ? 74  PHE B HE1  1 
ATOM   2764 H  HE2  . PHE C 2 74 ? -10.322 29.753 -9.855  1.00 37.63  ? 74  PHE B HE2  1 
ATOM   2765 H  HZ   . PHE C 2 74 ? -8.496  29.274 -8.505  1.00 38.18  ? 74  PHE B HZ   1 
ATOM   2766 N  N    . MET C 2 75 ? -14.870 30.214 -6.753  1.00 36.29  ? 75  MET B N    1 
ATOM   2767 C  CA   . MET C 2 75 ? -15.048 31.637 -6.931  1.00 35.18  ? 75  MET B CA   1 
ATOM   2768 C  C    . MET C 2 75 ? -15.214 32.295 -5.591  1.00 36.72  ? 75  MET B C    1 
ATOM   2769 O  O    . MET C 2 75 ? -14.741 33.415 -5.364  1.00 35.69  ? 75  MET B O    1 
ATOM   2770 C  CB   . MET C 2 75 ? -16.227 31.922 -7.848  1.00 35.69  ? 75  MET B CB   1 
ATOM   2771 C  CG   . MET C 2 75 ? -15.962 31.618 -9.282  1.00 37.26  ? 75  MET B CG   1 
ATOM   2772 S  SD   . MET C 2 75 ? -14.391 32.310 -9.875  1.00 45.97  ? 75  MET B SD   1 
ATOM   2773 C  CE   . MET C 2 75 ? -14.637 34.041 -9.465  1.00 40.02  ? 75  MET B CE   1 
ATOM   2774 H  H    . MET C 2 75 ? -15.504 29.733 -7.080  1.00 43.54  ? 75  MET B H    1 
ATOM   2775 H  HA   . MET C 2 75 ? -14.254 31.997 -7.356  1.00 42.22  ? 75  MET B HA   1 
ATOM   2776 H  HB2  . MET C 2 75 ? -16.981 31.381 -7.565  1.00 42.83  ? 75  MET B HB2  1 
ATOM   2777 H  HB3  . MET C 2 75 ? -16.455 32.862 -7.782  1.00 42.83  ? 75  MET B HB3  1 
ATOM   2778 H  HG2  . MET C 2 75 ? -15.928 30.656 -9.399  1.00 44.71  ? 75  MET B HG2  1 
ATOM   2779 H  HG3  . MET C 2 75 ? -16.677 31.992 -9.821  1.00 44.71  ? 75  MET B HG3  1 
ATOM   2780 H  HE1  . MET C 2 75 ? -13.852 34.544 -9.734  1.00 48.03  ? 75  MET B HE1  1 
ATOM   2781 H  HE2  . MET C 2 75 ? -15.418 34.370 -9.937  1.00 48.03  ? 75  MET B HE2  1 
ATOM   2782 H  HE3  . MET C 2 75 ? -14.769 34.123 -8.508  1.00 48.03  ? 75  MET B HE3  1 
ATOM   2783 N  N    . ALA C 2 76 ? -15.866 31.595 -4.676  1.00 35.37  ? 76  ALA B N    1 
ATOM   2784 C  CA   . ALA C 2 76 ? -15.983 32.121 -3.314  1.00 35.46  ? 76  ALA B CA   1 
ATOM   2785 C  C    . ALA C 2 76 ? -14.605 32.204 -2.640  1.00 36.73  ? 76  ALA B C    1 
ATOM   2786 O  O    . ALA C 2 76 ? -14.297 33.154 -1.935  1.00 38.35  ? 76  ALA B O    1 
ATOM   2787 C  CB   . ALA C 2 76 ? -16.896 31.286 -2.522  1.00 33.73  ? 76  ALA B CB   1 
ATOM   2788 H  H    . ALA C 2 76 ? -16.242 30.832 -4.806  1.00 42.44  ? 76  ALA B H    1 
ATOM   2789 H  HA   . ALA C 2 76 ? -16.353 33.017 -3.352  1.00 42.55  ? 76  ALA B HA   1 
ATOM   2790 H  HB1  . ALA C 2 76 ? -16.959 31.651 -1.625  1.00 40.47  ? 76  ALA B HB1  1 
ATOM   2791 H  HB2  . ALA C 2 76 ? -17.770 31.287 -2.942  1.00 40.47  ? 76  ALA B HB2  1 
ATOM   2792 H  HB3  . ALA C 2 76 ? -16.546 30.382 -2.487  1.00 40.47  ? 76  ALA B HB3  1 
ATOM   2793 N  N    . PHE C 2 77 ? -13.794 31.177 -2.857  1.00 35.14  ? 77  PHE B N    1 
ATOM   2794 C  CA   . PHE C 2 77 ? -12.418 31.153 -2.420  1.00 35.13  ? 77  PHE B CA   1 
ATOM   2795 C  C    . PHE C 2 77 ? -11.565 32.320 -3.035  1.00 35.71  ? 77  PHE B C    1 
ATOM   2796 O  O    . PHE C 2 77 ? -10.852 32.987 -2.334  1.00 36.12  ? 77  PHE B O    1 
ATOM   2797 C  CB   . PHE C 2 77 ? -11.818 29.790 -2.750  1.00 31.58  ? 77  PHE B CB   1 
ATOM   2798 C  CG   . PHE C 2 77 ? -10.418 29.648 -2.334  1.00 31.08  ? 77  PHE B CG   1 
ATOM   2799 C  CD1  . PHE C 2 77 ? -10.069 29.880 -1.024  1.00 32.49  ? 77  PHE B CD1  1 
ATOM   2800 C  CD2  . PHE C 2 77 ? -9.444  29.264 -3.227  1.00 32.13  ? 77  PHE B CD2  1 
ATOM   2801 C  CE1  . PHE C 2 77 ? -8.763  29.746 -0.607  1.00 32.80  ? 77  PHE B CE1  1 
ATOM   2802 C  CE2  . PHE C 2 77 ? -8.132  29.111 -2.818  1.00 33.66  ? 77  PHE B CE2  1 
ATOM   2803 C  CZ   . PHE C 2 77 ? -7.787  29.359 -1.511  1.00 34.11  ? 77  PHE B CZ   1 
ATOM   2804 H  H    . PHE C 2 77 ? -14.032 30.461 -3.270  1.00 42.16  ? 77  PHE B H    1 
ATOM   2805 H  HA   . PHE C 2 77 ? -12.399 31.255 -1.456  1.00 42.15  ? 77  PHE B HA   1 
ATOM   2806 H  HB2  . PHE C 2 77 ? -12.334 29.103 -2.299  1.00 37.90  ? 77  PHE B HB2  1 
ATOM   2807 H  HB3  . PHE C 2 77 ? -11.858 29.654 -3.710  1.00 37.90  ? 77  PHE B HB3  1 
ATOM   2808 H  HD1  . PHE C 2 77 ? -10.721 30.141 -0.415  1.00 38.98  ? 77  PHE B HD1  1 
ATOM   2809 H  HD2  . PHE C 2 77 ? -9.673  29.095 -4.112  1.00 38.56  ? 77  PHE B HD2  1 
ATOM   2810 H  HE1  . PHE C 2 77 ? -8.537  29.909 0.281   1.00 39.36  ? 77  PHE B HE1  1 
ATOM   2811 H  HE2  . PHE C 2 77 ? -7.480  28.857 -3.432  1.00 40.39  ? 77  PHE B HE2  1 
ATOM   2812 H  HZ   . PHE C 2 77 ? -6.905  29.265 -1.234  1.00 40.93  ? 77  PHE B HZ   1 
ATOM   2813 N  N    . VAL C 2 78 ? -11.653 32.529 -4.343  1.00 35.13  ? 78  VAL B N    1 
ATOM   2814 C  CA   . VAL C 2 78 ? -10.932 33.552 -5.039  1.00 36.82  ? 78  VAL B CA   1 
ATOM   2815 C  C    . VAL C 2 78 ? -11.297 34.970 -4.478  1.00 38.40  ? 78  VAL B C    1 
ATOM   2816 O  O    . VAL C 2 78 ? -10.397 35.795 -4.268  1.00 40.06  ? 78  VAL B O    1 
ATOM   2817 C  CB   . VAL C 2 78 ? -11.211 33.419 -6.557  1.00 34.64  ? 78  VAL B CB   1 
ATOM   2818 C  CG1  . VAL C 2 78 ? -10.835 34.682 -7.342  1.00 35.56  ? 78  VAL B CG1  1 
ATOM   2819 C  CG2  . VAL C 2 78 ? -10.524 32.228 -7.086  1.00 33.09  ? 78  VAL B CG2  1 
ATOM   2820 H  H    . VAL C 2 78 ? -12.154 32.060 -4.862  1.00 42.16  ? 78  VAL B H    1 
ATOM   2821 H  HA   . VAL C 2 78 ? -9.982  33.415 -4.899  1.00 44.19  ? 78  VAL B HA   1 
ATOM   2822 H  HB   . VAL C 2 78 ? -12.163 33.279 -6.679  1.00 41.57  ? 78  VAL B HB   1 
ATOM   2823 H  HG11 . VAL C 2 78 ? -11.031 34.540 -8.281  1.00 42.67  ? 78  VAL B HG11 1 
ATOM   2824 H  HG12 . VAL C 2 78 ? -11.355 35.428 -7.004  1.00 42.67  ? 78  VAL B HG12 1 
ATOM   2825 H  HG13 . VAL C 2 78 ? -9.889  34.857 -7.223  1.00 42.67  ? 78  VAL B HG13 1 
ATOM   2826 H  HG21 . VAL C 2 78 ? -10.706 32.154 -8.036  1.00 39.71  ? 78  VAL B HG21 1 
ATOM   2827 H  HG22 . VAL C 2 78 ? -9.570  32.321 -6.937  1.00 39.71  ? 78  VAL B HG22 1 
ATOM   2828 H  HG23 . VAL C 2 78 ? -10.856 31.442 -6.624  1.00 39.71  ? 78  VAL B HG23 1 
ATOM   2829 N  N    . ALA C 2 79 ? -12.569 35.194 -4.169  1.00 37.73  ? 79  ALA B N    1 
ATOM   2830 C  CA   . ALA C 2 79 ? -13.028 36.426 -3.546  1.00 41.25  ? 79  ALA B CA   1 
ATOM   2831 C  C    . ALA C 2 79 ? -12.524 36.620 -2.114  1.00 43.18  ? 79  ALA B C    1 
ATOM   2832 O  O    . ALA C 2 79 ? -12.240 37.757 -1.718  1.00 43.68  ? 79  ALA B O    1 
ATOM   2833 C  CB   . ALA C 2 79 ? -14.512 36.476 -3.555  1.00 42.03  ? 79  ALA B CB   1 
ATOM   2834 H  H    . ALA C 2 79 ? -13.201 34.630 -4.316  1.00 45.27  ? 79  ALA B H    1 
ATOM   2835 H  HA   . ALA C 2 79 ? -12.706 37.175 -4.072  1.00 49.50  ? 79  ALA B HA   1 
ATOM   2836 H  HB1  . ALA C 2 79 ? -14.856 35.716 -3.060  1.00 50.44  ? 79  ALA B HB1  1 
ATOM   2837 H  HB2  . ALA C 2 79 ? -14.801 37.302 -3.136  1.00 50.44  ? 79  ALA B HB2  1 
ATOM   2838 H  HB3  . ALA C 2 79 ? -14.823 36.442 -4.473  1.00 50.44  ? 79  ALA B HB3  1 
ATOM   2839 N  N    . MET C 2 80 ? -12.482 35.544 -1.317  1.00 42.28  ? 80  MET B N    1 
ATOM   2840 C  CA   A MET C 2 80 ? -11.920 35.626 0.026   0.40 45.83  ? 80  MET B CA   1 
ATOM   2841 C  CA   B MET C 2 80 ? -11.899 35.603 0.033   0.60 43.78  ? 80  MET B CA   1 
ATOM   2842 C  C    . MET C 2 80 ? -10.490 36.150 -0.066  1.00 44.57  ? 80  MET B C    1 
ATOM   2843 O  O    . MET C 2 80 ? -10.157 37.144 0.570   1.00 50.65  ? 80  MET B O    1 
ATOM   2844 C  CB   A MET C 2 80 ? -11.975 34.274 0.728   0.40 44.70  ? 80  MET B CB   1 
ATOM   2845 C  CB   B MET C 2 80 ? -11.777 34.231 0.708   0.60 44.76  ? 80  MET B CB   1 
ATOM   2846 C  CG   A MET C 2 80 ? -13.258 34.104 1.557   0.40 47.79  ? 80  MET B CG   1 
ATOM   2847 C  CG   B MET C 2 80 ? -13.022 33.504 1.208   0.60 48.55  ? 80  MET B CG   1 
ATOM   2848 S  SD   A MET C 2 80 ? -13.536 32.498 2.361   0.40 47.58  ? 80  MET B SD   1 
ATOM   2849 S  SD   B MET C 2 80 ? -12.566 31.854 1.881   0.60 46.73  ? 80  MET B SD   1 
ATOM   2850 C  CE   A MET C 2 80 ? -14.173 31.470 1.028   0.40 42.87  ? 80  MET B CE   1 
ATOM   2851 C  CE   B MET C 2 80 ? -11.620 32.306 3.349   0.60 48.00  ? 80  MET B CE   1 
ATOM   2852 H  H    . MET C 2 80 ? -12.777 34.766 -1.533  1.00 50.74  ? 80  MET B H    1 
ATOM   2853 H  HA   . MET C 2 80 ? -12.442 36.217 0.573   0.40 52.54  ? 80  MET B HA   1 
ATOM   2854 H  HB2  A MET C 2 80 ? -11.950 33.568 0.063   0.40 53.64  ? 80  MET B HB2  1 
ATOM   2855 H  HB2  B MET C 2 80 ? -11.348 33.634 0.076   0.60 53.71  ? 80  MET B HB2  1 
ATOM   2856 H  HB3  A MET C 2 80 ? -11.216 34.195 1.327   0.40 53.64  ? 80  MET B HB3  1 
ATOM   2857 H  HB3  B MET C 2 80 ? -11.195 34.338 1.477   0.60 53.71  ? 80  MET B HB3  1 
ATOM   2858 H  HG2  A MET C 2 80 ? -13.252 34.775 2.257   0.40 57.35  ? 80  MET B HG2  1 
ATOM   2859 H  HG2  B MET C 2 80 ? -13.438 34.022 1.916   0.60 58.26  ? 80  MET B HG2  1 
ATOM   2860 H  HG3  A MET C 2 80 ? -14.015 34.262 0.971   0.40 57.35  ? 80  MET B HG3  1 
ATOM   2861 H  HG3  B MET C 2 80 ? -13.641 33.377 0.472   0.60 58.26  ? 80  MET B HG3  1 
ATOM   2862 H  HE1  A MET C 2 80 ? -14.352 30.581 1.373   0.40 51.44  ? 80  MET B HE1  1 
ATOM   2863 H  HE1  B MET C 2 80 ? -11.321 31.498 3.793   0.60 57.59  ? 80  MET B HE1  1 
ATOM   2864 H  HE2  A MET C 2 80 ? -14.992 31.865 0.690   0.40 51.44  ? 80  MET B HE2  1 
ATOM   2865 H  HE2  B MET C 2 80 ? -10.854 32.838 3.079   0.60 57.59  ? 80  MET B HE2  1 
ATOM   2866 H  HE3  A MET C 2 80 ? -13.511 31.424 0.321   0.40 51.44  ? 80  MET B HE3  1 
ATOM   2867 H  HE3  B MET C 2 80 ? -12.187 32.821 3.943   0.60 57.59  ? 80  MET B HE3  1 
ATOM   2868 N  N    . VAL C 2 81 ? -9.673  35.455 -0.854  1.00 41.25  ? 81  VAL B N    1 
ATOM   2869 C  CA   . VAL C 2 81 ? -8.282  35.781 -1.056  1.00 41.43  ? 81  VAL B CA   1 
ATOM   2870 C  C    . VAL C 2 81 ? -8.114  37.192 -1.670  1.00 43.94  ? 81  VAL B C    1 
ATOM   2871 O  O    . VAL C 2 81 ? -7.341  37.979 -1.191  1.00 42.90  ? 81  VAL B O    1 
ATOM   2872 C  CB   . VAL C 2 81 ? -7.598  34.694 -1.941  1.00 40.18  ? 81  VAL B CB   1 
ATOM   2873 C  CG1  . VAL C 2 81 ? -6.101  34.991 -2.200  1.00 40.76  ? 81  VAL B CG1  1 
ATOM   2874 C  CG2  . VAL C 2 81 ? -7.692  33.361 -1.285  1.00 40.10  ? 81  VAL B CG2  1 
ATOM   2875 H  H    . VAL C 2 81 ? -9.923  34.762 -1.297  1.00 49.50  ? 81  VAL B H    1 
ATOM   2876 H  HA   . VAL C 2 81 ? -7.836  35.781 -0.194  1.00 49.71  ? 81  VAL B HA   1 
ATOM   2877 H  HB   . VAL C 2 81 ? -8.052  34.646 -2.797  1.00 48.21  ? 81  VAL B HB   1 
ATOM   2878 H  HG11 . VAL C 2 81 ? -5.731  34.286 -2.753  1.00 48.91  ? 81  VAL B HG11 1 
ATOM   2879 H  HG12 . VAL C 2 81 ? -6.023  35.844 -2.655  1.00 48.91  ? 81  VAL B HG12 1 
ATOM   2880 H  HG13 . VAL C 2 81 ? -5.635  35.025 -1.351  1.00 48.91  ? 81  VAL B HG13 1 
ATOM   2881 H  HG21 . VAL C 2 81 ? -7.262  32.701 -1.850  1.00 48.12  ? 81  VAL B HG21 1 
ATOM   2882 H  HG22 . VAL C 2 81 ? -7.246  33.401 -0.424  1.00 48.12  ? 81  VAL B HG22 1 
ATOM   2883 H  HG23 . VAL C 2 81 ? -8.627  33.135 -1.163  1.00 48.12  ? 81  VAL B HG23 1 
ATOM   2884 N  N    . THR C 2 82 ? -8.858  37.509 -2.716  1.00 43.11  ? 82  THR B N    1 
ATOM   2885 C  CA   . THR C 2 82 ? -8.722  38.794 -3.379  1.00 43.92  ? 82  THR B CA   1 
ATOM   2886 C  C    . THR C 2 82 ? -9.154  39.913 -2.433  1.00 46.59  ? 82  THR B C    1 
ATOM   2887 O  O    . THR C 2 82 ? -8.621  41.040 -2.496  1.00 46.24  ? 82  THR B O    1 
ATOM   2888 C  CB   . THR C 2 82 ? -9.545  38.875 -4.670  1.00 42.37  ? 82  THR B CB   1 
ATOM   2889 O  OG1  . THR C 2 82 ? -9.198  37.783 -5.542  1.00 40.06  ? 82  THR B OG1  1 
ATOM   2890 C  CG2  . THR C 2 82 ? -9.267  40.199 -5.380  1.00 41.70  ? 82  THR B CG2  1 
ATOM   2891 H  H    . THR C 2 82 ? -9.453  36.995 -3.064  1.00 51.74  ? 82  THR B H    1 
ATOM   2892 H  HA   . THR C 2 82 ? -7.790  38.935 -3.607  1.00 52.70  ? 82  THR B HA   1 
ATOM   2893 H  HB   . THR C 2 82 ? -10.491 38.832 -4.456  1.00 50.84  ? 82  THR B HB   1 
ATOM   2894 H  HG1  . THR C 2 82 ? -9.356  37.051 -5.162  1.00 48.07  ? 82  THR B HG1  1 
ATOM   2895 H  HG21 . THR C 2 82 ? -9.788  40.252 -6.197  1.00 50.04  ? 82  THR B HG21 1 
ATOM   2896 H  HG22 . THR C 2 82 ? -9.509  40.941 -4.804  1.00 50.04  ? 82  THR B HG22 1 
ATOM   2897 H  HG23 . THR C 2 82 ? -8.325  40.265 -5.602  1.00 50.04  ? 82  THR B HG23 1 
ATOM   2898 N  N    . THR C 2 83 ? -10.182 39.625 -1.634  1.00 46.30  ? 83  THR B N    1 
ATOM   2899 C  CA   . THR C 2 83 ? -10.666 40.588 -0.653  1.00 46.99  ? 83  THR B CA   1 
ATOM   2900 C  C    . THR C 2 83 ? -9.608  40.783 0.410   1.00 49.98  ? 83  THR B C    1 
ATOM   2901 O  O    . THR C 2 83 ? -9.469  41.863 0.999   1.00 51.04  ? 83  THR B O    1 
ATOM   2902 C  CB   . THR C 2 83 ? -11.948 40.169 -0.022  1.00 46.50  ? 83  THR B CB   1 
ATOM   2903 O  OG1  . THR C 2 83 ? -13.013 40.359 -0.963  1.00 48.03  ? 83  THR B OG1  1 
ATOM   2904 C  CG2  . THR C 2 83 ? -12.217 41.001 1.214   1.00 49.50  ? 83  THR B CG2  1 
ATOM   2905 H  H    . THR C 2 83 ? -10.614 38.881 -1.641  1.00 55.56  ? 83  THR B H    1 
ATOM   2906 H  HA   . THR C 2 83 ? -10.811 41.441 -1.092  1.00 56.39  ? 83  THR B HA   1 
ATOM   2907 H  HB   . THR C 2 83 ? -11.899 39.235 0.234   1.00 55.81  ? 83  THR B HB   1 
ATOM   2908 H  HG1  . THR C 2 83 ? -12.875 39.897 -1.650  1.00 57.63  ? 83  THR B HG1  1 
ATOM   2909 H  HG21 . THR C 2 83 ? -13.053 40.727 1.623   1.00 59.40  ? 83  THR B HG21 1 
ATOM   2910 H  HG22 . THR C 2 83 ? -11.499 40.884 1.855   1.00 59.40  ? 83  THR B HG22 1 
ATOM   2911 H  HG23 . THR C 2 83 ? -12.276 41.940 0.975   1.00 59.40  ? 83  THR B HG23 1 
ATOM   2912 N  N    . ALA C 2 84 ? -8.861  39.721 0.672   1.00 49.40  ? 84  ALA B N    1 
ATOM   2913 C  CA   . ALA C 2 84 ? -7.737  39.846 1.564   1.00 51.16  ? 84  ALA B CA   1 
ATOM   2914 C  C    . ALA C 2 84 ? -6.729  40.819 0.952   1.00 50.99  ? 84  ALA B C    1 
ATOM   2915 O  O    . ALA C 2 84 ? -6.532  41.884 1.491   1.00 53.97  ? 84  ALA B O    1 
ATOM   2916 C  CB   . ALA C 2 84 ? -7.077  38.458 1.845   1.00 49.43  ? 84  ALA B CB   1 
ATOM   2917 H  H    . ALA C 2 84 ? -8.985  38.933 0.350   1.00 59.28  ? 84  ALA B H    1 
ATOM   2918 H  HA   . ALA C 2 84 ? -8.039  40.215 2.408   1.00 61.39  ? 84  ALA B HA   1 
ATOM   2919 H  HB1  . ALA C 2 84 ? -7.736  37.873 2.252   1.00 59.31  ? 84  ALA B HB1  1 
ATOM   2920 H  HB2  . ALA C 2 84 ? -6.771  38.079 1.007   1.00 59.31  ? 84  ALA B HB2  1 
ATOM   2921 H  HB3  . ALA C 2 84 ? -6.327  38.582 2.447   1.00 59.31  ? 84  ALA B HB3  1 
ATOM   2922 N  N    . CYS C 2 85 ? -6.184  40.465 -0.207  1.00 49.92  ? 85  CYS B N    1 
ATOM   2923 C  CA   . CYS C 2 85 ? -5.166  41.230 -0.908  1.00 51.43  ? 85  CYS B CA   1 
ATOM   2924 C  C    . CYS C 2 85 ? -5.549  42.683 -1.041  1.00 54.14  ? 85  CYS B C    1 
ATOM   2925 O  O    . CYS C 2 85 ? -4.726  43.574 -0.898  1.00 56.03  ? 85  CYS B O    1 
ATOM   2926 C  CB   . CYS C 2 85 ? -4.947  40.613 -2.295  1.00 49.13  ? 85  CYS B CB   1 
ATOM   2927 S  SG   . CYS C 2 85 ? -3.899  41.617 -3.373  0.44 51.46  ? 85  CYS B SG   1 
ATOM   2928 H  H    . CYS C 2 85 ? -6.402  39.747 -0.625  1.00 59.90  ? 85  CYS B H    1 
ATOM   2929 H  HA   . CYS C 2 85 ? -4.332  41.178 -0.416  1.00 61.71  ? 85  CYS B HA   1 
ATOM   2930 H  HB2  . CYS C 2 85 ? -4.523  39.747 -2.190  1.00 58.96  ? 85  CYS B HB2  1 
ATOM   2931 H  HB3  . CYS C 2 85 ? -5.807  40.508 -2.731  1.00 58.96  ? 85  CYS B HB3  1 
ATOM   2932 H  HG   . CYS C 2 85 ? -3.782  41.062 -4.430  0.44 61.75  ? 85  CYS B HG   1 
ATOM   2933 N  N    . HIS C 2 86 ? -6.830  42.920 -1.253  1.00 52.78  ? 86  HIS B N    1 
ATOM   2934 C  CA   . HIS C 2 86 ? -7.311  44.277 -1.479  1.00 53.35  ? 86  HIS B CA   1 
ATOM   2935 C  C    . HIS C 2 86 ? -7.233  45.114 -0.207  1.00 56.91  ? 86  HIS B C    1 
ATOM   2936 O  O    . HIS C 2 86 ? -7.015  46.311 -0.282  1.00 58.50  ? 86  HIS B O    1 
ATOM   2937 C  CB   . HIS C 2 86 ? -8.745  44.249 -1.981  1.00 47.72  ? 86  HIS B CB   1 
ATOM   2938 C  CG   . HIS C 2 86 ? -9.431  45.581 -1.965  1.00 47.46  ? 86  HIS B CG   1 
ATOM   2939 N  ND1  . HIS C 2 86 ? -9.417  46.441 -3.046  1.00 45.81  ? 86  HIS B ND1  1 
ATOM   2940 C  CD2  . HIS C 2 86 ? -10.206 46.173 -1.023  1.00 48.75  ? 86  HIS B CD2  1 
ATOM   2941 C  CE1  . HIS C 2 86 ? -10.135 47.514 -2.760  1.00 47.19  ? 86  HIS B CE1  1 
ATOM   2942 N  NE2  . HIS C 2 86 ? -10.636 47.368 -1.545  1.00 48.59  ? 86  HIS B NE2  1 
ATOM   2943 H  H    . HIS C 2 86 ? -7.443  42.318 -1.273  1.00 63.34  ? 86  HIS B H    1 
ATOM   2944 H  HA   . HIS C 2 86 ? -6.762  44.702 -2.155  1.00 64.02  ? 86  HIS B HA   1 
ATOM   2945 H  HB2  . HIS C 2 86 ? -8.747  43.927 -2.896  1.00 57.26  ? 86  HIS B HB2  1 
ATOM   2946 H  HB3  . HIS C 2 86 ? -9.259  43.647 -1.421  1.00 57.26  ? 86  HIS B HB3  1 
ATOM   2947 H  HD2  . HIS C 2 86 ? -10.415 45.830 -0.184  1.00 58.49  ? 86  HIS B HD2  1 
ATOM   2948 H  HE1  . HIS C 2 86 ? -10.272 48.243 -3.321  1.00 56.63  ? 86  HIS B HE1  1 
ATOM   2949 N  N    . GLU C 2 87 ? -7.460  44.493 0.954   1.00 58.07  ? 87  GLU B N    1 
ATOM   2950 C  CA   . GLU C 2 87 ? -7.374  45.212 2.211   1.00 55.76  ? 87  GLU B CA   1 
ATOM   2951 C  C    . GLU C 2 87 ? -5.938  45.690 2.374   1.00 60.54  ? 87  GLU B C    1 
ATOM   2952 O  O    . GLU C 2 87 ? -5.708  46.865 2.709   1.00 61.77  ? 87  GLU B O    1 
ATOM   2953 C  CB   . GLU C 2 87 ? -7.830  44.347 3.390   0.00 53.94  ? 87  GLU B CB   1 
ATOM   2954 C  CG   . GLU C 2 87 ? -9.332  44.083 3.391   0.00 52.13  ? 87  GLU B CG   1 
ATOM   2955 C  CD   . GLU C 2 87 ? -9.783  43.203 4.541   0.00 49.22  ? 87  GLU B CD   1 
ATOM   2956 O  OE1  . GLU C 2 87 ? -10.758 43.577 5.226   0.00 47.46  ? 87  GLU B OE1  1 
ATOM   2957 O  OE2  . GLU C 2 87 ? -9.177  42.132 4.748   0.00 49.26  ? 87  GLU B OE2  1 
ATOM   2958 H  H    . GLU C 2 87 ? -7.664  43.662 1.033   1.00 69.68  ? 87  GLU B H    1 
ATOM   2959 H  HA   . GLU C 2 87 ? -7.949  45.992 2.170   1.00 66.91  ? 87  GLU B HA   1 
ATOM   2960 H  HB2  . GLU C 2 87 ? -7.375  43.492 3.348   0.00 64.72  ? 87  GLU B HB2  1 
ATOM   2961 H  HB3  . GLU C 2 87 ? -7.605  44.801 4.218   0.00 64.72  ? 87  GLU B HB3  1 
ATOM   2962 H  HG2  . GLU C 2 87 ? -9.801  44.929 3.461   0.00 62.56  ? 87  GLU B HG2  1 
ATOM   2963 H  HG3  . GLU C 2 87 ? -9.574  43.639 2.563   0.00 62.56  ? 87  GLU B HG3  1 
ATOM   2964 N  N    . PHE C 2 88 ? -4.970  44.845 2.009   1.00 59.80  ? 88  PHE B N    1 
ATOM   2965 C  CA   . PHE C 2 88 ? -3.563  45.295 1.937   1.00 60.12  ? 88  PHE B CA   1 
ATOM   2966 C  C    . PHE C 2 88 ? -3.346  46.534 1.066   1.00 61.19  ? 88  PHE B C    1 
ATOM   2967 O  O    . PHE C 2 88 ? -2.257  47.067 1.047   1.00 69.50  ? 88  PHE B O    1 
ATOM   2968 C  CB   . PHE C 2 88 ? -2.624  44.186 1.458   1.00 59.71  ? 88  PHE B CB   1 
ATOM   2969 C  CG   . PHE C 2 88 ? -1.183  44.603 1.448   0.00 57.94  ? 88  PHE B CG   1 
ATOM   2970 C  CD1  . PHE C 2 88 ? -0.519  44.881 2.629   0.00 57.04  ? 88  PHE B CD1  1 
ATOM   2971 C  CD2  . PHE C 2 88 ? -0.517  44.789 0.253   0.00 57.70  ? 88  PHE B CD2  1 
ATOM   2972 C  CE1  . PHE C 2 88 ? 0.799   45.293 2.615   0.00 56.58  ? 88  PHE B CE1  1 
ATOM   2973 C  CE2  . PHE C 2 88 ? 0.796   45.199 0.229   0.00 56.63  ? 88  PHE B CE2  1 
ATOM   2974 C  CZ   . PHE C 2 88 ? 1.456   45.457 1.412   0.00 56.21  ? 88  PHE B CZ   1 
ATOM   2975 H  H    . PHE C 2 88 ? -5.091  44.020 1.801   1.00 71.77  ? 88  PHE B H    1 
ATOM   2976 H  HA   . PHE C 2 88 ? -3.283  45.531 2.835   1.00 72.15  ? 88  PHE B HA   1 
ATOM   2977 H  HB2  . PHE C 2 88 ? -2.711  43.423 2.050   1.00 71.65  ? 88  PHE B HB2  1 
ATOM   2978 H  HB3  . PHE C 2 88 ? -2.870  43.934 0.554   1.00 71.65  ? 88  PHE B HB3  1 
ATOM   2979 H  HD1  . PHE C 2 88 ? -0.959  44.771 3.441   0.00 68.45  ? 88  PHE B HD1  1 
ATOM   2980 H  HD2  . PHE C 2 88 ? -0.958  44.617 -0.548  0.00 69.24  ? 88  PHE B HD2  1 
ATOM   2981 H  HE1  . PHE C 2 88 ? 1.242   45.464 3.414   0.00 67.90  ? 88  PHE B HE1  1 
ATOM   2982 H  HE2  . PHE C 2 88 ? 1.236   45.307 -0.583  0.00 67.96  ? 88  PHE B HE2  1 
ATOM   2983 H  HZ   . PHE C 2 88 ? 2.344   45.731 1.399   0.00 67.46  ? 88  PHE B HZ   1 
ATOM   2984 N  N    . PHE C 2 89 ? -4.350  46.965 0.312   1.00 60.75  ? 89  PHE B N    1 
ATOM   2985 C  CA   . PHE C 2 89 ? -4.247  48.172 -0.515  1.00 60.58  ? 89  PHE B CA   1 
ATOM   2986 C  C    . PHE C 2 89 ? -5.152  49.321 -0.156  1.00 60.38  ? 89  PHE B C    1 
ATOM   2987 O  O    . PHE C 2 89 ? -5.370  50.132 -1.015  1.00 60.42  ? 89  PHE B O    1 
ATOM   2988 C  CB   . PHE C 2 89 ? -4.547  47.841 -1.974  1.00 60.32  ? 89  PHE B CB   1 
ATOM   2989 C  CG   . PHE C 2 89 ? -3.638  46.823 -2.573  1.00 62.19  ? 89  PHE B CG   1 
ATOM   2990 C  CD1  . PHE C 2 89 ? -2.386  46.589 -2.054  1.00 63.71  ? 89  PHE B CD1  1 
ATOM   2991 C  CD2  . PHE C 2 89 ? -4.052  46.089 -3.658  1.00 60.55  ? 89  PHE B CD2  1 
ATOM   2992 C  CE1  . PHE C 2 89 ? -1.557  45.650 -2.641  1.00 64.16  ? 89  PHE B CE1  1 
ATOM   2993 C  CE2  . PHE C 2 89 ? -3.234  45.148 -4.241  1.00 58.84  ? 89  PHE B CE2  1 
ATOM   2994 C  CZ   . PHE C 2 89 ? -1.997  44.920 -3.737  1.00 58.07  ? 89  PHE B CZ   1 
ATOM   2995 H  H    . PHE C 2 89 ? -5.115  46.574 0.259   1.00 72.90  ? 89  PHE B H    1 
ATOM   2996 H  HA   . PHE C 2 89 ? -3.333  48.496 -0.470  1.00 72.69  ? 89  PHE B HA   1 
ATOM   2997 H  HB2  . PHE C 2 89 ? -5.453  47.499 -2.035  1.00 72.39  ? 89  PHE B HB2  1 
ATOM   2998 H  HB3  . PHE C 2 89 ? -4.467  48.652 -2.500  1.00 72.39  ? 89  PHE B HB3  1 
ATOM   2999 H  HD1  . PHE C 2 89 ? -2.087  47.079 -1.322  1.00 76.45  ? 89  PHE B HD1  1 
ATOM   3000 H  HD2  . PHE C 2 89 ? -4.898  46.240 -4.015  1.00 72.66  ? 89  PHE B HD2  1 
ATOM   3001 H  HE1  . PHE C 2 89 ? -0.711  45.494 -2.289  1.00 76.99  ? 89  PHE B HE1  1 
ATOM   3002 H  HE2  . PHE C 2 89 ? -3.533  44.664 -4.976  1.00 70.61  ? 89  PHE B HE2  1 
ATOM   3003 H  HZ   . PHE C 2 89 ? -1.443  44.283 -4.127  1.00 69.69  ? 89  PHE B HZ   1 
ATOM   3004 N  N    . GLU C 2 90 ? -5.779  49.350 1.017   1.00 63.35  ? 90  GLU B N    1 
ATOM   3005 C  CA   . GLU C 2 90 ? -6.459  50.573 1.482   1.00 69.44  ? 90  GLU B CA   1 
ATOM   3006 C  C    . GLU C 2 90 ? -5.443  51.416 2.292   1.00 76.08  ? 90  GLU B C    1 
ATOM   3007 O  O    . GLU C 2 90 ? -5.485  51.415 3.537   1.00 80.69  ? 90  GLU B O    1 
ATOM   3008 C  CB   . GLU C 2 90 ? -7.696  50.262 2.348   1.00 67.23  ? 90  GLU B CB   1 
ATOM   3009 C  CG   . GLU C 2 90 ? -8.825  49.509 1.660   0.00 62.35  ? 90  GLU B CG   1 
ATOM   3010 C  CD   . GLU C 2 90 ? -9.819  50.434 0.993   0.00 61.35  ? 90  GLU B CD   1 
ATOM   3011 O  OE1  . GLU C 2 90 ? -11.041 50.258 1.203   0.00 60.32  ? 90  GLU B OE1  1 
ATOM   3012 O  OE2  . GLU C 2 90 ? -9.375  51.322 0.238   0.00 62.69  ? 90  GLU B OE2  1 
ATOM   3013 H  H    . GLU C 2 90 ? -5.830  48.686 1.561   1.00 76.02  ? 90  GLU B H    1 
ATOM   3014 H  HA   . GLU C 2 90 ? -6.746  51.093 0.715   1.00 83.33  ? 90  GLU B HA   1 
ATOM   3015 H  HB2  . GLU C 2 90 ? -7.411  49.726 3.105   1.00 80.68  ? 90  GLU B HB2  1 
ATOM   3016 H  HB3  . GLU C 2 90 ? -8.062  51.102 2.668   1.00 80.68  ? 90  GLU B HB3  1 
ATOM   3017 H  HG2  . GLU C 2 90 ? -8.450  48.929 0.978   0.00 74.82  ? 90  GLU B HG2  1 
ATOM   3018 H  HG3  . GLU C 2 90 ? -9.302  48.981 2.319   0.00 74.82  ? 90  GLU B HG3  1 
ATOM   3019 N  N    . HIS C 2 91 ? -4.538  52.126 1.602   1.00 74.35  ? 91  HIS B N    1 
ATOM   3020 C  CA   . HIS C 2 91 ? -3.491  52.955 2.241   1.00 68.21  ? 91  HIS B CA   1 
ATOM   3021 C  C    . HIS C 2 91 ? -2.412  52.138 2.944   1.00 62.26  ? 91  HIS B C    1 
ATOM   3022 O  O    . HIS C 2 91 ? -1.599  51.480 2.308   1.00 59.08  ? 91  HIS B O    1 
ATOM   3023 C  CB   . HIS C 2 91 ? -4.118  53.905 3.252   1.00 73.23  ? 91  HIS B CB   1 
ATOM   3024 C  CG   . HIS C 2 91 ? -5.497  54.345 2.875   1.00 82.95  ? 91  HIS B CG   1 
ATOM   3025 N  ND1  . HIS C 2 91 ? -6.626  53.790 3.441   1.00 84.12  ? 91  HIS B ND1  1 
ATOM   3026 C  CD2  . HIS C 2 91 ? -5.933  55.245 1.959   1.00 87.37  ? 91  HIS B CD2  1 
ATOM   3027 C  CE1  . HIS C 2 91 ? -7.700  54.351 2.912   1.00 84.85  ? 91  HIS B CE1  1 
ATOM   3028 N  NE2  . HIS C 2 91 ? -7.309  55.236 2.009   1.00 86.78  ? 91  HIS B NE2  1 
ATOM   3029 H  H    . HIS C 2 91 ? -4.507  52.145 0.742   1.00 89.23  ? 91  HIS B H    1 
ATOM   3030 H  HA   . HIS C 2 91 ? -3.059  53.491 1.559   1.00 81.85  ? 91  HIS B HA   1 
ATOM   3031 H  HB2  . HIS C 2 91 ? -4.172  53.459 4.112   1.00 87.87  ? 91  HIS B HB2  1 
ATOM   3032 H  HB3  . HIS C 2 91 ? -3.562  54.697 3.326   1.00 87.87  ? 91  HIS B HB3  1 
ATOM   3033 H  HD2  . HIS C 2 91 ? -5.403  55.779 1.413   1.00 104.84 ? 91  HIS B HD2  1 
ATOM   3034 H  HE1  . HIS C 2 91 ? -8.581  54.154 3.133   1.00 101.83 ? 91  HIS B HE1  1 
ATOM   3035 N  N    . MET D 2 1  ? -5.889  34.599 43.413  1.00 76.27  ? 1   MET C N    1 
ATOM   3036 C  CA   . MET D 2 1  ? -6.282  34.455 41.984  1.00 73.44  ? 1   MET C CA   1 
ATOM   3037 C  C    . MET D 2 1  ? -5.058  34.523 41.057  1.00 70.66  ? 1   MET C C    1 
ATOM   3038 O  O    . MET D 2 1  ? -4.186  35.388 41.255  1.00 68.76  ? 1   MET C O    1 
ATOM   3039 C  CB   . MET D 2 1  ? -7.306  35.532 41.639  1.00 67.55  ? 1   MET C CB   1 
ATOM   3040 C  CG   . MET D 2 1  ? -8.537  35.374 42.497  1.00 66.98  ? 1   MET C CG   1 
ATOM   3041 S  SD   . MET D 2 1  ? -9.565  33.976 41.988  1.00 77.69  ? 1   MET C SD   1 
ATOM   3042 C  CE   . MET D 2 1  ? -10.589 34.737 40.716  1.00 72.25  ? 1   MET C CE   1 
ATOM   3043 H  H1   . MET D 2 1  ? -6.363  34.031 43.909  1.00 91.53  ? 1   MET C H1   1 
ATOM   3044 H  H2   . MET D 2 1  ? -5.022  34.419 43.502  1.00 91.53  ? 1   MET C H2   1 
ATOM   3045 H  H3   . MET D 2 1  ? -6.049  35.432 43.682  1.00 91.53  ? 1   MET C H3   1 
ATOM   3046 H  HA   . MET D 2 1  ? -6.711  33.593 41.866  1.00 88.12  ? 1   MET C HA   1 
ATOM   3047 H  HB2  . MET D 2 1  ? -6.924  36.408 41.805  1.00 81.06  ? 1   MET C HB2  1 
ATOM   3048 H  HB3  . MET D 2 1  ? -7.566  35.446 40.708  1.00 81.06  ? 1   MET C HB3  1 
ATOM   3049 H  HG2  . MET D 2 1  ? -8.265  35.228 43.416  1.00 80.37  ? 1   MET C HG2  1 
ATOM   3050 H  HG3  . MET D 2 1  ? -9.073  36.180 42.433  1.00 80.37  ? 1   MET C HG3  1 
ATOM   3051 H  HE1  . MET D 2 1  ? -11.196 34.070 40.359  1.00 86.70  ? 1   MET C HE1  1 
ATOM   3052 H  HE2  . MET D 2 1  ? -11.093 35.466 41.111  1.00 86.70  ? 1   MET C HE2  1 
ATOM   3053 H  HE3  . MET D 2 1  ? -10.016 35.074 40.010  1.00 86.70  ? 1   MET C HE3  1 
ATOM   3054 N  N    . SER D 2 2  ? -4.948  33.598 40.090  1.00 66.48  ? 2   SER C N    1 
ATOM   3055 C  CA   . SER D 2 2  ? -3.867  33.721 39.100  1.00 67.56  ? 2   SER C CA   1 
ATOM   3056 C  C    . SER D 2 2  ? -4.158  34.887 38.131  1.00 66.88  ? 2   SER C C    1 
ATOM   3057 O  O    . SER D 2 2  ? -5.304  35.355 38.059  1.00 64.28  ? 2   SER C O    1 
ATOM   3058 C  CB   . SER D 2 2  ? -3.688  32.440 38.284  1.00 63.03  ? 2   SER C CB   1 
ATOM   3059 O  OG   . SER D 2 2  ? -4.773  32.233 37.422  1.00 61.96  ? 2   SER C OG   1 
ATOM   3060 H  H    . SER D 2 2  ? -5.463  32.918 39.987  1.00 79.78  ? 2   SER C H    1 
ATOM   3061 H  HA   . SER D 2 2  ? -3.033  33.908 39.559  1.00 81.07  ? 2   SER C HA   1 
ATOM   3062 H  HB2  . SER D 2 2  ? -2.877  32.514 37.756  1.00 75.64  ? 2   SER C HB2  1 
ATOM   3063 H  HB3  . SER D 2 2  ? -3.619  31.687 38.891  1.00 75.64  ? 2   SER C HB3  1 
ATOM   3064 H  HG   . SER D 2 2  ? -4.659  31.527 36.982  1.00 74.36  ? 2   SER C HG   1 
ATOM   3065 N  N    . GLU D 2 3  ? -3.142  35.317 37.373  1.00 64.20  ? 3   GLU C N    1 
ATOM   3066 C  CA   . GLU D 2 3  ? -3.361  36.221 36.248  1.00 63.45  ? 3   GLU C CA   1 
ATOM   3067 C  C    . GLU D 2 3  ? -4.391  35.654 35.276  1.00 63.46  ? 3   GLU C C    1 
ATOM   3068 O  O    . GLU D 2 3  ? -5.277  36.391 34.835  1.00 63.10  ? 3   GLU C O    1 
ATOM   3069 C  CB   . GLU D 2 3  ? -2.060  36.475 35.503  1.00 64.00  ? 3   GLU C CB   1 
ATOM   3070 C  CG   . GLU D 2 3  ? -1.107  37.336 36.245  1.00 65.95  ? 3   GLU C CG   1 
ATOM   3071 C  CD   . GLU D 2 3  ? -1.662  38.720 36.379  1.00 76.20  ? 3   GLU C CD   1 
ATOM   3072 O  OE1  . GLU D 2 3  ? -1.799  39.203 37.527  1.00 79.89  ? 3   GLU C OE1  1 
ATOM   3073 O  OE2  . GLU D 2 3  ? -2.004  39.308 35.325  1.00 80.16  ? 3   GLU C OE2  1 
ATOM   3074 H  H    . GLU D 2 3  ? -2.319  35.097 37.492  1.00 77.04  ? 3   GLU C H    1 
ATOM   3075 H  HA   . GLU D 2 3  ? -3.692  37.070 36.581  1.00 76.14  ? 3   GLU C HA   1 
ATOM   3076 H  HB2  . GLU D 2 3  ? -1.624  35.624 35.336  1.00 76.80  ? 3   GLU C HB2  1 
ATOM   3077 H  HB3  . GLU D 2 3  ? -2.262  36.912 34.661  1.00 76.80  ? 3   GLU C HB3  1 
ATOM   3078 H  HG2  . GLU D 2 3  ? -0.966  36.973 37.134  1.00 79.14  ? 3   GLU C HG2  1 
ATOM   3079 H  HG3  . GLU D 2 3  ? -0.269  37.385 35.760  1.00 79.14  ? 3   GLU C HG3  1 
ATOM   3080 N  N    . LEU D 2 4  ? -4.333  34.344 35.027  1.00 62.89  ? 4   LEU C N    1 
ATOM   3081 C  CA   . LEU D 2 4  ? -5.286  33.681 34.148  1.00 60.92  ? 4   LEU C CA   1 
ATOM   3082 C  C    . LEU D 2 4  ? -6.676  33.773 34.779  1.00 60.62  ? 4   LEU C C    1 
ATOM   3083 O  O    . LEU D 2 4  ? -7.685  33.926 34.100  1.00 58.73  ? 4   LEU C O    1 
ATOM   3084 C  CB   . LEU D 2 4  ? -4.906  32.219 33.893  1.00 58.58  ? 4   LEU C CB   1 
ATOM   3085 C  CG   . LEU D 2 4  ? -5.964  31.402 33.121  1.00 61.44  ? 4   LEU C CG   1 
ATOM   3086 C  CD1  . LEU D 2 4  ? -6.434  32.082 31.844  1.00 59.57  ? 4   LEU C CD1  1 
ATOM   3087 C  CD2  . LEU D 2 4  ? -5.484  29.979 32.803  1.00 62.12  ? 4   LEU C CD2  1 
ATOM   3088 H  H    . LEU D 2 4  ? -3.742  33.815 35.361  1.00 75.47  ? 4   LEU C H    1 
ATOM   3089 H  HA   . LEU D 2 4  ? -5.308  34.142 33.295  1.00 73.10  ? 4   LEU C HA   1 
ATOM   3090 H  HB2  . LEU D 2 4  ? -4.085  32.199 33.376  1.00 70.30  ? 4   LEU C HB2  1 
ATOM   3091 H  HB3  . LEU D 2 4  ? -4.764  31.783 34.748  1.00 70.30  ? 4   LEU C HB3  1 
ATOM   3092 H  HG   . LEU D 2 4  ? -6.742  31.313 33.693  1.00 73.73  ? 4   LEU C HG   1 
ATOM   3093 H  HD11 . LEU D 2 4  ? -7.094  31.518 31.411  1.00 71.48  ? 4   LEU C HD11 1 
ATOM   3094 H  HD12 . LEU D 2 4  ? -6.829  32.939 32.070  1.00 71.48  ? 4   LEU C HD12 1 
ATOM   3095 H  HD13 . LEU D 2 4  ? -5.673  32.212 31.257  1.00 71.48  ? 4   LEU C HD13 1 
ATOM   3096 H  HD21 . LEU D 2 4  ? -6.183  29.511 32.320  1.00 74.54  ? 4   LEU C HD21 1 
ATOM   3097 H  HD22 . LEU D 2 4  ? -4.683  30.031 32.258  1.00 74.54  ? 4   LEU C HD22 1 
ATOM   3098 H  HD23 . LEU D 2 4  ? -5.290  29.518 33.634  1.00 74.54  ? 4   LEU C HD23 1 
ATOM   3099 N  N    . GLU D 2 5  ? -6.758  33.564 36.077  1.00 62.61  ? 5   GLU C N    1 
ATOM   3100 C  CA   . GLU D 2 5  ? -8.061  33.661 36.725  1.00 66.48  ? 5   GLU C CA   1 
ATOM   3101 C  C    . GLU D 2 5  ? -8.614  35.094 36.746  1.00 60.40  ? 5   GLU C C    1 
ATOM   3102 O  O    . GLU D 2 5  ? -9.793  35.290 36.524  1.00 57.21  ? 5   GLU C O    1 
ATOM   3103 C  CB   . GLU D 2 5  ? -7.983  33.090 38.143  1.00 69.34  ? 5   GLU C CB   1 
ATOM   3104 C  CG   . GLU D 2 5  ? -7.884  31.571 38.152  1.00 69.11  ? 5   GLU C CG   1 
ATOM   3105 C  CD   . GLU D 2 5  ? -7.437  31.032 39.496  1.00 68.49  ? 5   GLU C CD   1 
ATOM   3106 O  OE1  . GLU D 2 5  ? -6.699  31.765 40.229  1.00 64.34  ? 5   GLU C OE1  1 
ATOM   3107 O  OE2  . GLU D 2 5  ? -7.790  29.857 39.765  1.00 67.25  ? 5   GLU C OE2  1 
ATOM   3108 H  H    . GLU D 2 5  ? -6.101  33.369 36.597  1.00 75.13  ? 5   GLU C H    1 
ATOM   3109 H  HA   . GLU D 2 5  ? -8.690  33.116 36.228  1.00 79.78  ? 5   GLU C HA   1 
ATOM   3110 H  HB2  . GLU D 2 5  ? -7.196  33.446 38.585  1.00 83.20  ? 5   GLU C HB2  1 
ATOM   3111 H  HB3  . GLU D 2 5  ? -8.782  33.342 38.631  1.00 83.20  ? 5   GLU C HB3  1 
ATOM   3112 H  HG2  . GLU D 2 5  ? -8.755  31.195 37.951  1.00 82.93  ? 5   GLU C HG2  1 
ATOM   3113 H  HG3  . GLU D 2 5  ? -7.237  31.291 37.485  1.00 82.93  ? 5   GLU C HG3  1 
ATOM   3114 N  N    . LYS D 2 6  ? -7.746  36.059 37.034  1.00 59.69  ? 6   LYS C N    1 
ATOM   3115 C  CA   . LYS D 2 6  ? -8.107  37.446 37.061  1.00 58.73  ? 6   LYS C CA   1 
ATOM   3116 C  C    . LYS D 2 6  ? -8.565  37.841 35.648  1.00 57.89  ? 6   LYS C C    1 
ATOM   3117 O  O    . LYS D 2 6  ? -9.574  38.544 35.452  1.00 53.33  ? 6   LYS C O    1 
ATOM   3118 C  CB   . LYS D 2 6  ? -6.912  38.344 37.503  1.00 63.15  ? 6   LYS C CB   1 
ATOM   3119 C  CG   . LYS D 2 6  ? -6.521  38.328 39.006  1.00 60.06  ? 6   LYS C CG   1 
ATOM   3120 C  CD   . LYS D 2 6  ? -5.215  39.098 39.275  1.00 57.07  ? 6   LYS C CD   1 
ATOM   3121 C  CE   . LYS D 2 6  ? -4.946  39.229 40.764  0.00 61.88  ? 6   LYS C CE   1 
ATOM   3122 N  NZ   . LYS D 2 6  ? -3.619  39.840 41.057  0.00 63.07  ? 6   LYS C NZ   1 
ATOM   3123 H  H    . LYS D 2 6  ? -6.919  35.917 37.222  1.00 71.63  ? 6   LYS C H    1 
ATOM   3124 H  HA   . LYS D 2 6  ? -8.844  37.581 37.678  1.00 70.47  ? 6   LYS C HA   1 
ATOM   3125 H  HB2  . LYS D 2 6  ? -6.128  38.068 37.003  1.00 75.78  ? 6   LYS C HB2  1 
ATOM   3126 H  HB3  . LYS D 2 6  ? -7.127  39.263 37.276  1.00 75.78  ? 6   LYS C HB3  1 
ATOM   3127 H  HG2  . LYS D 2 6  ? -7.229  38.744 39.523  1.00 72.08  ? 6   LYS C HG2  1 
ATOM   3128 H  HG3  . LYS D 2 6  ? -6.395  37.410 39.291  1.00 72.08  ? 6   LYS C HG3  1 
ATOM   3129 H  HD2  . LYS D 2 6  ? -4.473  38.620 38.873  1.00 68.48  ? 6   LYS C HD2  1 
ATOM   3130 H  HD3  . LYS D 2 6  ? -5.285  39.989 38.898  1.00 68.48  ? 6   LYS C HD3  1 
ATOM   3131 H  HE2  . LYS D 2 6  ? -5.630  39.793 41.160  0.00 74.25  ? 6   LYS C HE2  1 
ATOM   3132 H  HE3  . LYS D 2 6  ? -4.967  38.348 41.169  0.00 74.25  ? 6   LYS C HE3  1 
ATOM   3133 H  HZ1  . LYS D 2 6  ? -3.499  39.900 41.937  0.00 75.69  ? 6   LYS C HZ1  1 
ATOM   3134 H  HZ2  . LYS D 2 6  ? -2.971  39.338 40.710  0.00 75.69  ? 6   LYS C HZ2  1 
ATOM   3135 H  HZ3  . LYS D 2 6  ? -3.574  40.655 40.702  0.00 75.69  ? 6   LYS C HZ3  1 
ATOM   3136 N  N    . ALA D 2 7  ? -7.816  37.380 34.657  1.00 57.35  ? 7   ALA C N    1 
ATOM   3137 C  CA   . ALA D 2 7  ? -8.145  37.719 33.293  1.00 54.28  ? 7   ALA C CA   1 
ATOM   3138 C  C    . ALA D 2 7  ? -9.541  37.193 33.014  1.00 54.35  ? 7   ALA C C    1 
ATOM   3139 O  O    . ALA D 2 7  ? -10.368 37.860 32.368  1.00 52.33  ? 7   ALA C O    1 
ATOM   3140 C  CB   . ALA D 2 7  ? -7.115  37.144 32.318  1.00 51.76  ? 7   ALA C CB   1 
ATOM   3141 H  H    . ALA D 2 7  ? -7.124  36.877 34.749  1.00 68.82  ? 7   ALA C H    1 
ATOM   3142 H  HA   . ALA D 2 7  ? -8.155  38.684 33.194  1.00 65.13  ? 7   ALA C HA   1 
ATOM   3143 H  HB1  . ALA D 2 7  ? -7.365  37.390 31.414  1.00 62.11  ? 7   ALA C HB1  1 
ATOM   3144 H  HB2  . ALA D 2 7  ? -6.242  37.508 32.531  1.00 62.11  ? 7   ALA C HB2  1 
ATOM   3145 H  HB3  . ALA D 2 7  ? -7.102  36.178 32.408  1.00 62.11  ? 7   ALA C HB3  1 
ATOM   3146 N  N    . MET D 2 8  ? -9.815  36.006 33.532  1.00 54.26  ? 8   MET C N    1 
ATOM   3147 C  CA   . MET D 2 8  ? -11.112 35.416 33.347  1.00 56.01  ? 8   MET C CA   1 
ATOM   3148 C  C    . MET D 2 8  ? -12.230 36.163 34.050  1.00 54.18  ? 8   MET C C    1 
ATOM   3149 O  O    . MET D 2 8  ? -13.359 36.187 33.549  1.00 52.25  ? 8   MET C O    1 
ATOM   3150 C  CB   . MET D 2 8  ? -11.116 33.973 33.806  1.00 60.07  ? 8   MET C CB   1 
ATOM   3151 C  CG   . MET D 2 8  ? -10.573 33.000 32.804  1.00 60.87  ? 8   MET C CG   1 
ATOM   3152 S  SD   . MET D 2 8  ? -10.384 31.355 33.566  1.00 59.89  ? 8   MET C SD   1 
ATOM   3153 C  CE   . MET D 2 8  ? -10.134 30.338 32.104  1.00 64.96  ? 8   MET C CE   1 
ATOM   3154 H  H    . MET D 2 8  ? -9.266  35.529 33.990  1.00 65.11  ? 8   MET C H    1 
ATOM   3155 H  HA   . MET D 2 8  ? -11.306 35.412 32.396  1.00 67.21  ? 8   MET C HA   1 
ATOM   3156 H  HB2  . MET D 2 8  ? -10.574 33.902 34.608  1.00 72.08  ? 8   MET C HB2  1 
ATOM   3157 H  HB3  . MET D 2 8  ? -12.029 33.713 34.005  1.00 72.08  ? 8   MET C HB3  1 
ATOM   3158 H  HG2  . MET D 2 8  ? -11.189 32.925 32.058  1.00 73.04  ? 8   MET C HG2  1 
ATOM   3159 H  HG3  . MET D 2 8  ? -9.703  33.300 32.499  1.00 73.04  ? 8   MET C HG3  1 
ATOM   3160 H  HE1  . MET D 2 8  ? -9.343  30.647 31.637  1.00 77.95  ? 8   MET C HE1  1 
ATOM   3161 H  HE2  . MET D 2 8  ? -10.018 29.415 32.379  1.00 77.95  ? 8   MET C HE2  1 
ATOM   3162 H  HE3  . MET D 2 8  ? -10.911 30.417 31.529  1.00 77.95  ? 8   MET C HE3  1 
ATOM   3163 N  N    . VAL D 2 9  ? -11.944 36.719 35.224  1.00 53.58  ? 9   VAL C N    1 
ATOM   3164 C  CA   . VAL D 2 9  ? -12.972 37.404 35.966  1.00 52.39  ? 9   VAL C CA   1 
ATOM   3165 C  C    . VAL D 2 9  ? -13.250 38.693 35.214  1.00 51.32  ? 9   VAL C C    1 
ATOM   3166 O  O    . VAL D 2 9  ? -14.386 39.131 35.135  1.00 50.67  ? 9   VAL C O    1 
ATOM   3167 C  CB   . VAL D 2 9  ? -12.556 37.670 37.444  1.00 52.38  ? 9   VAL C CB   1 
ATOM   3168 C  CG1  . VAL D 2 9  ? -13.595 38.515 38.171  1.00 51.13  ? 9   VAL C CG1  1 
ATOM   3169 C  CG2  . VAL D 2 9  ? -12.409 36.387 38.187  1.00 53.95  ? 9   VAL C CG2  1 
ATOM   3170 H  H    . VAL D 2 9  ? -11.171 36.710 35.601  1.00 64.30  ? 9   VAL C H    1 
ATOM   3171 H  HA   . VAL D 2 9  ? -13.781 36.868 35.967  1.00 62.87  ? 9   VAL C HA   1 
ATOM   3172 H  HB   . VAL D 2 9  ? -11.706 38.139 37.464  1.00 62.85  ? 9   VAL C HB   1 
ATOM   3173 H  HG11 . VAL D 2 9  ? -13.302 38.659 39.085  1.00 61.36  ? 9   VAL C HG11 1 
ATOM   3174 H  HG12 . VAL D 2 9  ? -13.686 39.366 37.714  1.00 61.36  ? 9   VAL C HG12 1 
ATOM   3175 H  HG13 . VAL D 2 9  ? -14.444 38.045 38.166  1.00 61.36  ? 9   VAL C HG13 1 
ATOM   3176 H  HG21 . VAL D 2 9  ? -12.151 36.580 39.102  1.00 64.74  ? 9   VAL C HG21 1 
ATOM   3177 H  HG22 . VAL D 2 9  ? -13.258 35.917 38.175  1.00 64.74  ? 9   VAL C HG22 1 
ATOM   3178 H  HG23 . VAL D 2 9  ? -11.727 35.849 37.756  1.00 64.74  ? 9   VAL C HG23 1 
ATOM   3179 N  N    . ALA D 2 10 ? -12.215 39.258 34.602  1.00 50.06  ? 10  ALA C N    1 
ATOM   3180 C  CA   . ALA D 2 10 ? -12.370 40.464 33.828  1.00 48.64  ? 10  ALA C CA   1 
ATOM   3181 C  C    . ALA D 2 10 ? -13.278 40.296 32.582  1.00 50.29  ? 10  ALA C C    1 
ATOM   3182 O  O    . ALA D 2 10 ? -14.030 41.189 32.236  1.00 49.45  ? 10  ALA C O    1 
ATOM   3183 C  CB   . ALA D 2 10 ? -11.024 40.975 33.436  1.00 47.40  ? 10  ALA C CB   1 
ATOM   3184 H  H    . ALA D 2 10 ? -11.410 38.954 34.624  1.00 60.07  ? 10  ALA C H    1 
ATOM   3185 H  HA   . ALA D 2 10 ? -12.780 41.137 34.393  1.00 58.37  ? 10  ALA C HA   1 
ATOM   3186 H  HB1  . ALA D 2 10 ? -11.133 41.786 32.916  1.00 56.89  ? 10  ALA C HB1  1 
ATOM   3187 H  HB2  . ALA D 2 10 ? -10.511 41.162 34.238  1.00 56.89  ? 10  ALA C HB2  1 
ATOM   3188 H  HB3  . ALA D 2 10 ? -10.573 40.299 32.905  1.00 56.89  ? 10  ALA C HB3  1 
ATOM   3189 N  N    . LEU D 2 11 ? -13.209 39.169 31.897  1.00 50.06  ? 11  LEU C N    1 
ATOM   3190 C  CA   . LEU D 2 11 ? -14.065 38.973 30.743  1.00 51.52  ? 11  LEU C CA   1 
ATOM   3191 C  C    . LEU D 2 11 ? -15.520 39.020 31.128  1.00 52.48  ? 11  LEU C C    1 
ATOM   3192 O  O    . LEU D 2 11 ? -16.364 39.448 30.325  1.00 53.26  ? 11  LEU C O    1 
ATOM   3193 C  CB   . LEU D 2 11 ? -13.790 37.630 30.064  1.00 55.50  ? 11  LEU C CB   1 
ATOM   3194 C  CG   . LEU D 2 11 ? -12.348 37.439 29.590  1.00 58.89  ? 11  LEU C CG   1 
ATOM   3195 C  CD1  . LEU D 2 11 ? -12.122 35.987 29.141  1.00 53.40  ? 11  LEU C CD1  1 
ATOM   3196 C  CD2  . LEU D 2 11 ? -11.958 38.435 28.491  1.00 52.27  ? 11  LEU C CD2  1 
ATOM   3197 H  H    . LEU D 2 11 ? -12.684 38.512 32.075  1.00 60.07  ? 11  LEU C H    1 
ATOM   3198 H  HA   . LEU D 2 11 ? -13.899 39.678 30.099  1.00 61.82  ? 11  LEU C HA   1 
ATOM   3199 H  HB2  . LEU D 2 11 ? -13.990 36.918 30.692  1.00 66.60  ? 11  LEU C HB2  1 
ATOM   3200 H  HB3  . LEU D 2 11 ? -14.367 37.551 29.288  1.00 66.60  ? 11  LEU C HB3  1 
ATOM   3201 H  HG   . LEU D 2 11 ? -11.759 37.600 30.344  1.00 70.66  ? 11  LEU C HG   1 
ATOM   3202 H  HD11 . LEU D 2 11 ? -11.204 35.887 28.845  1.00 64.07  ? 11  LEU C HD11 1 
ATOM   3203 H  HD12 . LEU D 2 11 ? -12.295 35.395 29.890  1.00 64.07  ? 11  LEU C HD12 1 
ATOM   3204 H  HD13 . LEU D 2 11 ? -12.729 35.785 28.412  1.00 64.07  ? 11  LEU C HD13 1 
ATOM   3205 H  HD21 . LEU D 2 11 ? -11.039 38.270 28.228  1.00 62.72  ? 11  LEU C HD21 1 
ATOM   3206 H  HD22 . LEU D 2 11 ? -12.547 38.311 27.730  1.00 62.72  ? 11  LEU C HD22 1 
ATOM   3207 H  HD23 . LEU D 2 11 ? -12.048 39.337 28.837  1.00 62.72  ? 11  LEU C HD23 1 
ATOM   3208 N  N    . ILE D 2 12 ? -15.826 38.481 32.308  1.00 52.26  ? 12  ILE C N    1 
ATOM   3209 C  CA   . ILE D 2 12 ? -17.189 38.481 32.817  1.00 53.73  ? 12  ILE C CA   1 
ATOM   3210 C  C    . ILE D 2 12 ? -17.657 39.902 33.148  1.00 52.77  ? 12  ILE C C    1 
ATOM   3211 O  O    . ILE D 2 12 ? -18.773 40.263 32.869  1.00 53.46  ? 12  ILE C O    1 
ATOM   3212 C  CB   . ILE D 2 12 ? -17.291 37.577 34.034  1.00 55.26  ? 12  ILE C CB   1 
ATOM   3213 C  CG1  . ILE D 2 12 ? -16.965 36.152 33.631  1.00 54.07  ? 12  ILE C CG1  1 
ATOM   3214 C  CG2  . ILE D 2 12 ? -18.698 37.621 34.651  1.00 58.63  ? 12  ILE C CG2  1 
ATOM   3215 C  CD1  . ILE D 2 12 ? -16.572 35.296 34.805  1.00 53.93  ? 12  ILE C CD1  1 
ATOM   3216 H  H    . ILE D 2 12 ? -15.256 38.109 32.834  1.00 62.71  ? 12  ILE C H    1 
ATOM   3217 H  HA   . ILE D 2 12 ? -17.778 38.126 32.133  1.00 64.48  ? 12  ILE C HA   1 
ATOM   3218 H  HB   . ILE D 2 12 ? -16.647 37.871 34.698  1.00 66.31  ? 12  ILE C HB   1 
ATOM   3219 H  HG12 . ILE D 2 12 ? -17.746 35.754 33.217  1.00 64.89  ? 12  ILE C HG12 1 
ATOM   3220 H  HG13 . ILE D 2 12 ? -16.225 36.162 33.005  1.00 64.89  ? 12  ILE C HG13 1 
ATOM   3221 H  HG21 . ILE D 2 12 ? -18.723 37.033 35.422  1.00 70.35  ? 12  ILE C HG21 1 
ATOM   3222 H  HG22 . ILE D 2 12 ? -18.896 38.531 34.921  1.00 70.35  ? 12  ILE C HG22 1 
ATOM   3223 H  HG23 . ILE D 2 12 ? -19.342 37.325 33.988  1.00 70.35  ? 12  ILE C HG23 1 
ATOM   3224 H  HD11 . ILE D 2 12 ? -16.376 34.400 34.490  1.00 64.71  ? 12  ILE C HD11 1 
ATOM   3225 H  HD12 . ILE D 2 12 ? -15.786 35.679 35.226  1.00 64.71  ? 12  ILE C HD12 1 
ATOM   3226 H  HD13 . ILE D 2 12 ? -17.307 35.272 35.437  1.00 64.71  ? 12  ILE C HD13 1 
ATOM   3227 N  N    . ASP D 2 13 ? -16.790 40.703 33.720  1.00 50.75  ? 13  ASP C N    1 
ATOM   3228 C  CA   . ASP D 2 13 ? -17.147 42.059 34.095  1.00 52.98  ? 13  ASP C CA   1 
ATOM   3229 C  C    . ASP D 2 13 ? -17.516 42.905 32.903  1.00 54.81  ? 13  ASP C C    1 
ATOM   3230 O  O    . ASP D 2 13 ? -18.567 43.548 32.893  1.00 56.51  ? 13  ASP C O    1 
ATOM   3231 C  CB   . ASP D 2 13 ? -15.990 42.769 34.816  1.00 52.13  ? 13  ASP C CB   1 
ATOM   3232 C  CG   . ASP D 2 13 ? -15.638 42.134 36.169  1.00 51.18  ? 13  ASP C CG   1 
ATOM   3233 O  OD1  . ASP D 2 13 ? -16.516 41.482 36.768  1.00 54.49  ? 13  ASP C OD1  1 
ATOM   3234 O  OD2  . ASP D 2 13 ? -14.487 42.310 36.635  1.00 49.68  ? 13  ASP C OD2  1 
ATOM   3235 H  H    . ASP D 2 13 ? -15.978 40.489 33.907  1.00 60.90  ? 13  ASP C H    1 
ATOM   3236 H  HA   . ASP D 2 13 ? -17.909 42.034 34.696  1.00 63.57  ? 13  ASP C HA   1 
ATOM   3237 H  HB2  . ASP D 2 13 ? -15.200 42.732 34.255  1.00 62.55  ? 13  ASP C HB2  1 
ATOM   3238 H  HB3  . ASP D 2 13 ? -16.238 43.693 34.975  1.00 62.55  ? 13  ASP C HB3  1 
ATOM   3239 N  N    . VAL D 2 14 ? -16.641 42.939 31.901  1.00 56.06  ? 14  VAL C N    1 
ATOM   3240 C  CA   . VAL D 2 14 ? -16.853 43.854 30.775  1.00 57.48  ? 14  VAL C CA   1 
ATOM   3241 C  C    . VAL D 2 14 ? -18.080 43.376 30.009  1.00 55.59  ? 14  VAL C C    1 
ATOM   3242 O  O    . VAL D 2 14 ? -18.814 44.181 29.436  1.00 52.41  ? 14  VAL C O    1 
ATOM   3243 C  CB   . VAL D 2 14 ? -15.585 44.020 29.874  1.00 55.88  ? 14  VAL C CB   1 
ATOM   3244 C  CG1  . VAL D 2 14 ? -15.286 42.772 29.063  1.00 58.46  ? 14  VAL C CG1  1 
ATOM   3245 C  CG2  . VAL D 2 14 ? -15.754 45.260 28.960  1.00 56.44  ? 14  VAL C CG2  1 
ATOM   3246 H  H    . VAL D 2 14 ? -15.932 42.455 31.846  1.00 67.27  ? 14  VAL C H    1 
ATOM   3247 H  HA   . VAL D 2 14 ? -17.063 44.731 31.134  1.00 68.97  ? 14  VAL C HA   1 
ATOM   3248 H  HB   . VAL D 2 14 ? -14.821 44.184 30.448  1.00 67.05  ? 14  VAL C HB   1 
ATOM   3249 H  HG11 . VAL D 2 14 ? -14.494 42.928 28.525  1.00 70.16  ? 14  VAL C HG11 1 
ATOM   3250 H  HG12 . VAL D 2 14 ? -15.133 42.030 29.670  1.00 70.16  ? 14  VAL C HG12 1 
ATOM   3251 H  HG13 . VAL D 2 14 ? -16.044 42.579 28.489  1.00 70.16  ? 14  VAL C HG13 1 
ATOM   3252 H  HG21 . VAL D 2 14 ? -14.963 45.353 28.406  1.00 67.72  ? 14  VAL C HG21 1 
ATOM   3253 H  HG22 . VAL D 2 14 ? -16.537 45.136 28.401  1.00 67.72  ? 14  VAL C HG22 1 
ATOM   3254 H  HG23 . VAL D 2 14 ? -15.864 46.048 29.514  1.00 67.72  ? 14  VAL C HG23 1 
ATOM   3255 N  N    . PHE D 2 15 ? -18.329 42.066 30.041  1.00 55.16  ? 15  PHE C N    1 
ATOM   3256 C  CA   . PHE D 2 15 ? -19.543 41.564 29.422  1.00 56.37  ? 15  PHE C CA   1 
ATOM   3257 C  C    . PHE D 2 15 ? -20.751 42.189 30.121  1.00 58.39  ? 15  PHE C C    1 
ATOM   3258 O  O    . PHE D 2 15 ? -21.664 42.703 29.479  1.00 59.28  ? 15  PHE C O    1 
ATOM   3259 C  CB   . PHE D 2 15 ? -19.632 40.055 29.507  1.00 55.52  ? 15  PHE C CB   1 
ATOM   3260 C  CG   . PHE D 2 15 ? -20.965 39.514 29.080  1.00 59.87  ? 15  PHE C CG   1 
ATOM   3261 C  CD1  . PHE D 2 15 ? -21.993 39.352 30.025  1.00 60.80  ? 15  PHE C CD1  1 
ATOM   3262 C  CD2  . PHE D 2 15 ? -21.220 39.197 27.744  1.00 60.37  ? 15  PHE C CD2  1 
ATOM   3263 C  CE1  . PHE D 2 15 ? -23.229 38.838 29.656  1.00 62.60  ? 15  PHE C CE1  1 
ATOM   3264 C  CE2  . PHE D 2 15 ? -22.454 38.686 27.364  1.00 62.61  ? 15  PHE C CE2  1 
ATOM   3265 C  CZ   . PHE D 2 15 ? -23.465 38.514 28.325  1.00 64.82  ? 15  PHE C CZ   1 
ATOM   3266 H  H    . PHE D 2 15 ? -17.827 41.469 30.403  1.00 66.19  ? 15  PHE C H    1 
ATOM   3267 H  HA   . PHE D 2 15 ? -19.561 41.822 28.487  1.00 67.64  ? 15  PHE C HA   1 
ATOM   3268 H  HB2  . PHE D 2 15 ? -18.955 39.667 28.931  1.00 66.62  ? 15  PHE C HB2  1 
ATOM   3269 H  HB3  . PHE D 2 15 ? -19.480 39.783 30.426  1.00 66.62  ? 15  PHE C HB3  1 
ATOM   3270 H  HD1  . PHE D 2 15 ? -21.831 39.560 30.917  1.00 72.96  ? 15  PHE C HD1  1 
ATOM   3271 H  HD2  . PHE D 2 15 ? -20.548 39.302 27.109  1.00 72.44  ? 15  PHE C HD2  1 
ATOM   3272 H  HE1  . PHE D 2 15 ? -23.899 38.729 30.291  1.00 75.12  ? 15  PHE C HE1  1 
ATOM   3273 H  HE2  . PHE D 2 15 ? -22.615 38.470 26.474  1.00 75.14  ? 15  PHE C HE2  1 
ATOM   3274 H  HZ   . PHE D 2 15 ? -24.295 38.181 28.070  1.00 77.78  ? 15  PHE C HZ   1 
ATOM   3275 N  N    . HIS D 2 16 ? -20.720 42.172 31.445  1.00 57.64  ? 16  HIS C N    1 
ATOM   3276 C  CA   . HIS D 2 16 ? -21.767 42.780 32.242  1.00 58.41  ? 16  HIS C CA   1 
ATOM   3277 C  C    . HIS D 2 16 ? -21.780 44.268 32.144  1.00 58.48  ? 16  HIS C C    1 
ATOM   3278 O  O    . HIS D 2 16 ? -22.858 44.835 32.086  1.00 60.97  ? 16  HIS C O    1 
ATOM   3279 C  CB   . HIS D 2 16 ? -21.660 42.323 33.683  1.00 57.62  ? 16  HIS C CB   1 
ATOM   3280 C  CG   . HIS D 2 16 ? -22.105 40.905 33.864  1.00 58.79  ? 16  HIS C CG   1 
ATOM   3281 N  ND1  . HIS D 2 16 ? -23.123 40.356 33.118  1.00 57.76  ? 16  HIS C ND1  1 
ATOM   3282 C  CD2  . HIS D 2 16 ? -21.616 39.904 34.627  1.00 59.21  ? 16  HIS C CD2  1 
ATOM   3283 C  CE1  . HIS D 2 16 ? -23.281 39.093 33.453  1.00 60.15  ? 16  HIS C CE1  1 
ATOM   3284 N  NE2  . HIS D 2 16 ? -22.372 38.792 34.360  1.00 62.48  ? 16  HIS C NE2  1 
ATOM   3285 H  H    . HIS D 2 16 ? -20.094 41.808 31.909  1.00 69.17  ? 16  HIS C H    1 
ATOM   3286 H  HA   . HIS D 2 16 ? -22.622 42.466 31.906  1.00 70.09  ? 16  HIS C HA   1 
ATOM   3287 H  HB2  . HIS D 2 16 ? -20.735 42.388 33.969  1.00 69.15  ? 16  HIS C HB2  1 
ATOM   3288 H  HB3  . HIS D 2 16 ? -22.221 42.888 34.238  1.00 69.15  ? 16  HIS C HB3  1 
ATOM   3289 H  HD2  . HIS D 2 16 ? -20.915 39.963 35.235  1.00 71.06  ? 16  HIS C HD2  1 
ATOM   3290 H  HE1  . HIS D 2 16 ? -23.914 38.510 33.101  1.00 72.18  ? 16  HIS C HE1  1 
ATOM   3291 N  N    . GLN D 2 17 ? -20.608 44.897 32.080  1.00 57.69  ? 17  GLN C N    1 
ATOM   3292 C  CA   . GLN D 2 17 ? -20.541 46.356 31.978  1.00 58.09  ? 17  GLN C CA   1 
ATOM   3293 C  C    . GLN D 2 17 ? -21.441 46.743 30.801  1.00 60.53  ? 17  GLN C C    1 
ATOM   3294 O  O    . GLN D 2 17 ? -22.144 47.746 30.867  1.00 65.77  ? 17  GLN C O    1 
ATOM   3295 C  CB   . GLN D 2 17 ? -19.096 46.846 31.781  1.00 57.54  ? 17  GLN C CB   1 
ATOM   3296 C  CG   . GLN D 2 17 ? -18.879 48.339 31.658  0.00 60.66  ? 17  GLN C CG   1 
ATOM   3297 C  CD   . GLN D 2 17 ? -17.417 48.664 31.390  0.00 61.76  ? 17  GLN C CD   1 
ATOM   3298 O  OE1  . GLN D 2 17 ? -16.542 47.820 31.580  0.00 61.52  ? 17  GLN C OE1  1 
ATOM   3299 N  NE2  . GLN D 2 17 ? -17.148 49.882 30.939  0.00 62.87  ? 17  GLN C NE2  1 
ATOM   3300 H  H    . GLN D 2 17 ? -19.842 44.507 32.093  1.00 69.22  ? 17  GLN C H    1 
ATOM   3301 H  HA   . GLN D 2 17 ? -20.898 46.757 32.786  1.00 69.71  ? 17  GLN C HA   1 
ATOM   3302 H  HB2  . GLN D 2 17 ? -18.571 46.544 32.538  1.00 69.05  ? 17  GLN C HB2  1 
ATOM   3303 H  HB3  . GLN D 2 17 ? -18.749 46.441 30.971  1.00 69.05  ? 17  GLN C HB3  1 
ATOM   3304 H  HG2  . GLN D 2 17 ? -19.407 48.680 30.919  0.00 72.79  ? 17  GLN C HG2  1 
ATOM   3305 H  HG3  . GLN D 2 17 ? -19.140 48.771 32.486  0.00 72.79  ? 17  GLN C HG3  1 
ATOM   3306 H  HE21 . GLN D 2 17 ? -17.786 50.444 30.812  0.00 75.45  ? 17  GLN C HE21 1 
ATOM   3307 H  HE22 . GLN D 2 17 ? -16.335 50.110 30.774  0.00 75.45  ? 17  GLN C HE22 1 
ATOM   3308 N  N    . TYR D 2 18 ? -21.500 45.902 29.767  1.00 60.53  ? 18  TYR C N    1 
ATOM   3309 C  CA   . TYR D 2 18 ? -22.258 46.254 28.566  1.00 60.78  ? 18  TYR C CA   1 
ATOM   3310 C  C    . TYR D 2 18 ? -23.605 45.576 28.439  1.00 63.32  ? 18  TYR C C    1 
ATOM   3311 O  O    . TYR D 2 18 ? -24.510 46.194 27.903  1.00 65.74  ? 18  TYR C O    1 
ATOM   3312 C  CB   . TYR D 2 18 ? -21.410 45.993 27.315  1.00 55.08  ? 18  TYR C CB   1 
ATOM   3313 C  CG   . TYR D 2 18 ? -20.380 47.071 27.214  1.00 54.64  ? 18  TYR C CG   1 
ATOM   3314 C  CD1  . TYR D 2 18 ? -19.191 46.949 27.886  1.00 54.44  ? 18  TYR C CD1  1 
ATOM   3315 C  CD2  . TYR D 2 18 ? -20.627 48.246 26.532  1.00 56.56  ? 18  TYR C CD2  1 
ATOM   3316 C  CE1  . TYR D 2 18 ? -18.253 47.912 27.857  1.00 54.63  ? 18  TYR C CE1  1 
ATOM   3317 C  CE2  . TYR D 2 18 ? -19.686 49.245 26.495  1.00 57.06  ? 18  TYR C CE2  1 
ATOM   3318 C  CZ   . TYR D 2 18 ? -18.489 49.078 27.176  1.00 55.95  ? 18  TYR C CZ   1 
ATOM   3319 O  OH   . TYR D 2 18 ? -17.502 50.055 27.171  1.00 53.18  ? 18  TYR C OH   1 
ATOM   3320 H  H    . TYR D 2 18 ? -21.115 45.134 29.735  1.00 72.64  ? 18  TYR C H    1 
ATOM   3321 H  HA   . TYR D 2 18 ? -22.429 47.209 28.595  1.00 72.94  ? 18  TYR C HA   1 
ATOM   3322 H  HB2  . TYR D 2 18 ? -20.962 45.137 27.392  1.00 66.09  ? 18  TYR C HB2  1 
ATOM   3323 H  HB3  . TYR D 2 18 ? -21.971 46.021 26.524  1.00 66.09  ? 18  TYR C HB3  1 
ATOM   3324 H  HD1  . TYR D 2 18 ? -19.020 46.168 28.361  1.00 65.32  ? 18  TYR C HD1  1 
ATOM   3325 H  HD2  . TYR D 2 18 ? -21.435 48.358 26.085  1.00 67.87  ? 18  TYR C HD2  1 
ATOM   3326 H  HE1  . TYR D 2 18 ? -17.452 47.796 28.316  1.00 65.56  ? 18  TYR C HE1  1 
ATOM   3327 H  HE2  . TYR D 2 18 ? -19.853 50.030 26.025  1.00 68.47  ? 18  TYR C HE2  1 
ATOM   3328 H  HH   . TYR D 2 18 ? -16.838 49.794 27.614  1.00 63.81  ? 18  TYR C HH   1 
ATOM   3329 N  N    . SER D 2 19 ? -23.763 44.351 28.939  1.00 62.43  ? 19  SER C N    1 
ATOM   3330 C  CA   . SER D 2 19 ? -25.023 43.611 28.732  1.00 65.92  ? 19  SER C CA   1 
ATOM   3331 C  C    . SER D 2 19 ? -26.168 44.129 29.591  1.00 68.79  ? 19  SER C C    1 
ATOM   3332 O  O    . SER D 2 19 ? -27.335 43.992 29.227  1.00 68.85  ? 19  SER C O    1 
ATOM   3333 C  CB   . SER D 2 19 ? -24.856 42.118 29.037  1.00 65.56  ? 19  SER C CB   1 
ATOM   3334 O  OG   . SER D 2 19 ? -24.568 41.928 30.416  1.00 64.63  ? 19  SER C OG   1 
ATOM   3335 H  H    . SER D 2 19 ? -23.170 43.926 29.395  1.00 74.92  ? 19  SER C H    1 
ATOM   3336 H  HA   . SER D 2 19 ? -25.286 43.697 27.802  1.00 79.10  ? 19  SER C HA   1 
ATOM   3337 H  HB2  . SER D 2 19 ? -25.679 41.654 28.817  1.00 78.67  ? 19  SER C HB2  1 
ATOM   3338 H  HB3  . SER D 2 19 ? -24.123 41.766 28.507  1.00 78.67  ? 19  SER C HB3  1 
ATOM   3339 H  HG   . SER D 2 19 ? -25.195 42.232 30.885  1.00 77.55  ? 19  SER C HG   1 
ATOM   3340 N  N    . GLY D 2 20 ? -25.836 44.756 30.710  1.00 67.43  ? 20  GLY C N    1 
ATOM   3341 C  CA   . GLY D 2 20 ? -26.850 45.220 31.631  1.00 70.44  ? 20  GLY C CA   1 
ATOM   3342 C  C    . GLY D 2 20 ? -27.395 46.576 31.230  1.00 74.24  ? 20  GLY C C    1 
ATOM   3343 O  O    . GLY D 2 20 ? -28.260 47.124 31.908  1.00 79.98  ? 20  GLY C O    1 
ATOM   3344 H  H    . GLY D 2 20 ? -25.029 44.924 30.957  1.00 80.92  ? 20  GLY C H    1 
ATOM   3345 H  HA2  . GLY D 2 20 ? -27.584 44.586 31.652  1.00 84.53  ? 20  GLY C HA2  1 
ATOM   3346 H  HA3  . GLY D 2 20 ? -26.474 45.288 32.522  1.00 84.53  ? 20  GLY C HA3  1 
ATOM   3347 N  N    . ARG D 2 21 ? -26.875 47.127 30.136  1.00 71.02  ? 21  ARG C N    1 
ATOM   3348 C  CA   . ARG D 2 21 ? -27.211 48.481 29.738  1.00 73.10  ? 21  ARG C CA   1 
ATOM   3349 C  C    . ARG D 2 21 ? -28.660 48.678 29.309  1.00 78.07  ? 21  ARG C C    1 
ATOM   3350 O  O    . ARG D 2 21 ? -29.362 49.548 29.851  1.00 78.34  ? 21  ARG C O    1 
ATOM   3351 C  CB   . ARG D 2 21 ? -26.300 48.938 28.605  1.00 70.41  ? 21  ARG C CB   1 
ATOM   3352 C  CG   . ARG D 2 21 ? -24.913 49.358 29.050  1.00 65.92  ? 21  ARG C CG   1 
ATOM   3353 C  CD   . ARG D 2 21 ? -24.204 49.879 27.879  1.00 61.33  ? 21  ARG C CD   1 
ATOM   3354 N  NE   . ARG D 2 21 ? -22.949 50.477 28.269  1.00 65.02  ? 21  ARG C NE   1 
ATOM   3355 C  CZ   . ARG D 2 21 ? -22.325 51.408 27.542  1.00 65.63  ? 21  ARG C CZ   1 
ATOM   3356 N  NH1  . ARG D 2 21 ? -22.869 51.825 26.405  1.00 61.08  ? 21  ARG C NH1  1 
ATOM   3357 N  NH2  . ARG D 2 21 ? -21.173 51.942 27.958  1.00 64.10  ? 21  ARG C NH2  1 
ATOM   3358 H  H    . ARG D 2 21 ? -26.323 46.732 29.608  1.00 85.22  ? 21  ARG C H    1 
ATOM   3359 H  HA   . ARG D 2 21 ? -27.052 49.069 30.493  1.00 87.72  ? 21  ARG C HA   1 
ATOM   3360 H  HB2  . ARG D 2 21 ? -26.199 48.209 27.974  1.00 84.49  ? 21  ARG C HB2  1 
ATOM   3361 H  HB3  . ARG D 2 21 ? -26.711 49.698 28.164  1.00 84.49  ? 21  ARG C HB3  1 
ATOM   3362 H  HG2  . ARG D 2 21 ? -24.976 50.058 29.717  1.00 79.11  ? 21  ARG C HG2  1 
ATOM   3363 H  HG3  . ARG D 2 21 ? -24.429 48.591 29.395  1.00 79.11  ? 21  ARG C HG3  1 
ATOM   3364 H  HD2  . ARG D 2 21 ? -24.019 49.153 27.263  1.00 73.60  ? 21  ARG C HD2  1 
ATOM   3365 H  HD3  . ARG D 2 21 ? -24.747 50.559 27.449  1.00 73.60  ? 21  ARG C HD3  1 
ATOM   3366 H  HE   . ARG D 2 21 ? -22.668 50.337 29.070  1.00 78.03  ? 21  ARG C HE   1 
ATOM   3367 H  HH11 . ARG D 2 21 ? -23.613 51.490 26.135  1.00 73.29  ? 21  ARG C HH11 1 
ATOM   3368 H  HH12 . ARG D 2 21 ? -22.472 52.425 25.933  1.00 73.29  ? 21  ARG C HH12 1 
ATOM   3369 H  HH21 . ARG D 2 21 ? -20.816 51.676 28.694  1.00 76.92  ? 21  ARG C HH21 1 
ATOM   3370 H  HH22 . ARG D 2 21 ? -20.779 52.539 27.481  1.00 76.92  ? 21  ARG C HH22 1 
ATOM   3371 N  N    . GLU D 2 22 ? -29.082 47.871 28.338  1.00 75.16  ? 22  GLU C N    1 
ATOM   3372 C  CA   . GLU D 2 22 ? -30.416 47.950 27.754  1.00 74.04  ? 22  GLU C CA   1 
ATOM   3373 C  C    . GLU D 2 22 ? -30.999 46.547 27.795  1.00 76.18  ? 22  GLU C C    1 
ATOM   3374 O  O    . GLU D 2 22 ? -30.236 45.578 27.891  1.00 74.90  ? 22  GLU C O    1 
ATOM   3375 C  CB   . GLU D 2 22 ? -30.365 48.441 26.304  1.00 73.78  ? 22  GLU C CB   1 
ATOM   3376 C  CG   . GLU D 2 22 ? -29.397 49.609 26.030  1.00 77.71  ? 22  GLU C CG   1 
ATOM   3377 C  CD   . GLU D 2 22 ? -29.170 49.872 24.521  1.00 77.39  ? 22  GLU C CD   1 
ATOM   3378 O  OE1  . GLU D 2 22 ? -28.025 50.282 24.145  1.00 71.88  ? 22  GLU C OE1  1 
ATOM   3379 O  OE2  . GLU D 2 22 ? -30.120 49.626 23.724  1.00 76.29  ? 22  GLU C OE2  1 
ATOM   3380 H  H    . GLU D 2 22 ? -28.597 47.250 27.993  1.00 90.19  ? 22  GLU C H    1 
ATOM   3381 H  HA   . GLU D 2 22 ? -30.977 48.546 28.274  1.00 88.84  ? 22  GLU C HA   1 
ATOM   3382 H  HB2  . GLU D 2 22 ? -30.094 47.701 25.739  1.00 88.53  ? 22  GLU C HB2  1 
ATOM   3383 H  HB3  . GLU D 2 22 ? -31.254 48.735 26.048  1.00 88.53  ? 22  GLU C HB3  1 
ATOM   3384 H  HG2  . GLU D 2 22 ? -29.760 50.418 26.423  1.00 93.25  ? 22  GLU C HG2  1 
ATOM   3385 H  HG3  . GLU D 2 22 ? -28.537 49.405 26.430  1.00 93.25  ? 22  GLU C HG3  1 
ATOM   3386 N  N    . GLY D 2 23 ? -32.328 46.425 27.725  1.00 76.98  ? 23  GLY C N    1 
ATOM   3387 C  CA   . GLY D 2 23 ? -32.980 45.128 27.517  1.00 75.93  ? 23  GLY C CA   1 
ATOM   3388 C  C    . GLY D 2 23 ? -32.599 44.040 28.517  1.00 73.16  ? 23  GLY C C    1 
ATOM   3389 O  O    . GLY D 2 23 ? -32.392 44.359 29.701  1.00 73.25  ? 23  GLY C O    1 
ATOM   3390 H  H    . GLY D 2 23 ? -32.877 47.083 27.794  1.00 92.38  ? 23  GLY C H    1 
ATOM   3391 H  HA2  . GLY D 2 23 ? -33.942 45.250 27.563  1.00 91.12  ? 23  GLY C HA2  1 
ATOM   3392 H  HA3  . GLY D 2 23 ? -32.762 44.806 26.629  1.00 91.12  ? 23  GLY C HA3  1 
ATOM   3393 N  N    . ASP D 2 24 ? -32.492 42.783 28.046  1.00 70.49  ? 24  ASP C N    1 
ATOM   3394 C  CA   . ASP D 2 24 ? -31.976 41.654 28.869  1.00 71.79  ? 24  ASP C CA   1 
ATOM   3395 C  C    . ASP D 2 24 ? -30.606 41.941 29.462  1.00 71.66  ? 24  ASP C C    1 
ATOM   3396 O  O    . ASP D 2 24 ? -29.644 42.072 28.721  1.00 72.82  ? 24  ASP C O    1 
ATOM   3397 C  CB   . ASP D 2 24 ? -31.859 40.375 28.026  1.00 71.17  ? 24  ASP C CB   1 
ATOM   3398 C  CG   . ASP D 2 24 ? -31.419 39.146 28.845  1.00 73.01  ? 24  ASP C CG   1 
ATOM   3399 O  OD1  . ASP D 2 24 ? -30.799 39.273 29.921  1.00 71.86  ? 24  ASP C OD1  1 
ATOM   3400 O  OD2  . ASP D 2 24 ? -31.652 38.020 28.372  1.00 77.82  ? 24  ASP C OD2  1 
ATOM   3401 H  H    . ASP D 2 24 ? -32.712 42.552 27.248  1.00 84.59  ? 24  ASP C H    1 
ATOM   3402 H  HA   . ASP D 2 24 ? -32.592 41.482 29.598  1.00 86.15  ? 24  ASP C HA   1 
ATOM   3403 H  HB2  . ASP D 2 24 ? -32.724 40.177 27.634  1.00 85.40  ? 24  ASP C HB2  1 
ATOM   3404 H  HB3  . ASP D 2 24 ? -31.203 40.518 27.326  1.00 85.40  ? 24  ASP C HB3  1 
ATOM   3405 N  N    . LYS D 2 25 ? -30.497 41.910 30.788  1.00 71.65  ? 25  LYS C N    1 
ATOM   3406 C  CA   . LYS D 2 25 ? -29.263 42.287 31.470  1.00 71.69  ? 25  LYS C CA   1 
ATOM   3407 C  C    . LYS D 2 25 ? -28.195 41.178 31.435  1.00 71.04  ? 25  LYS C C    1 
ATOM   3408 O  O    . LYS D 2 25 ? -27.089 41.368 31.939  1.00 69.86  ? 25  LYS C O    1 
ATOM   3409 C  CB   . LYS D 2 25 ? -29.576 42.649 32.922  1.00 72.38  ? 25  LYS C CB   1 
ATOM   3410 C  CG   . LYS D 2 25 ? -30.385 43.906 33.076  1.00 71.75  ? 25  LYS C CG   1 
ATOM   3411 C  CD   . LYS D 2 25 ? -30.659 44.226 34.537  0.00 76.81  ? 25  LYS C CD   1 
ATOM   3412 C  CE   . LYS D 2 25 ? -31.393 45.550 34.673  0.00 81.22  ? 25  LYS C CE   1 
ATOM   3413 N  NZ   . LYS D 2 25 ? -31.714 45.889 36.086  0.00 82.06  ? 25  LYS C NZ   1 
ATOM   3414 H  H    . LYS D 2 25 ? -31.130 41.672 31.320  1.00 85.98  ? 25  LYS C H    1 
ATOM   3415 H  HA   . LYS D 2 25 ? -28.892 43.072 31.038  1.00 86.03  ? 25  LYS C HA   1 
ATOM   3416 H  HB2  . LYS D 2 25 ? -30.078 41.923 33.324  1.00 86.85  ? 25  LYS C HB2  1 
ATOM   3417 H  HB3  . LYS D 2 25 ? -28.741 42.774 33.399  1.00 86.85  ? 25  LYS C HB3  1 
ATOM   3418 H  HG2  . LYS D 2 25 ? -29.897 44.649 32.689  1.00 86.10  ? 25  LYS C HG2  1 
ATOM   3419 H  HG3  . LYS D 2 25 ? -31.237 43.794 32.626  1.00 86.10  ? 25  LYS C HG3  1 
ATOM   3420 H  HD2  . LYS D 2 25 ? -31.212 43.529 34.922  0.00 92.18  ? 25  LYS C HD2  1 
ATOM   3421 H  HD3  . LYS D 2 25 ? -29.817 44.293 35.015  0.00 92.18  ? 25  LYS C HD3  1 
ATOM   3422 H  HE2  . LYS D 2 25 ? -30.836 46.259 34.313  0.00 97.47  ? 25  LYS C HE2  1 
ATOM   3423 H  HE3  . LYS D 2 25 ? -32.227 45.501 34.179  0.00 97.47  ? 25  LYS C HE3  1 
ATOM   3424 H  HZ1  . LYS D 2 25 ? -32.142 46.668 36.122  0.00 98.48  ? 25  LYS C HZ1  1 
ATOM   3425 H  HZ2  . LYS D 2 25 ? -32.232 45.258 36.440  0.00 98.48  ? 25  LYS C HZ2  1 
ATOM   3426 H  HZ3  . LYS D 2 25 ? -30.964 45.948 36.562  0.00 98.48  ? 25  LYS C HZ3  1 
ATOM   3427 N  N    . HIS D 2 26 ? -28.547 40.024 30.863  1.00 72.51  ? 26  HIS C N    1 
ATOM   3428 C  CA   . HIS D 2 26 ? -27.651 38.876 30.780  1.00 71.38  ? 26  HIS C CA   1 
ATOM   3429 C  C    . HIS D 2 26 ? -27.287 38.569 29.325  1.00 72.83  ? 26  HIS C C    1 
ATOM   3430 O  O    . HIS D 2 26 ? -26.518 37.634 29.066  1.00 79.93  ? 26  HIS C O    1 
ATOM   3431 C  CB   . HIS D 2 26 ? -28.286 37.632 31.415  0.00 74.95  ? 26  HIS C CB   1 
ATOM   3432 C  CG   . HIS D 2 26 ? -28.474 37.727 32.898  0.00 75.55  ? 26  HIS C CG   1 
ATOM   3433 N  ND1  . HIS D 2 26 ? -29.594 38.283 33.477  0.00 75.37  ? 26  HIS C ND1  1 
ATOM   3434 C  CD2  . HIS D 2 26 ? -27.685 37.319 33.920  0.00 75.73  ? 26  HIS C CD2  1 
ATOM   3435 C  CE1  . HIS D 2 26 ? -29.484 38.220 34.792  0.00 76.22  ? 26  HIS C CE1  1 
ATOM   3436 N  NE2  . HIS D 2 26 ? -28.335 37.640 35.087  0.00 76.67  ? 26  HIS C NE2  1 
ATOM   3437 H  H    . HIS D 2 26 ? -29.318 39.883 30.509  1.00 87.01  ? 26  HIS C H    1 
ATOM   3438 H  HA   . HIS D 2 26 ? -26.833 39.076 31.260  1.00 85.65  ? 26  HIS C HA   1 
ATOM   3439 H  HB2  . HIS D 2 26 ? -29.159 37.490 31.016  0.00 89.93  ? 26  HIS C HB2  1 
ATOM   3440 H  HB3  . HIS D 2 26 ? -27.716 36.867 31.238  0.00 89.93  ? 26  HIS C HB3  1 
ATOM   3441 H  HD2  . HIS D 2 26 ? -26.857 36.903 33.846  0.00 90.88  ? 26  HIS C HD2  1 
ATOM   3442 H  HE1  . HIS D 2 26 ? -30.109 38.532 35.406  0.00 91.46  ? 26  HIS C HE1  1 
ATOM   3443 N  N    . LYS D 2 27 ? -27.822 39.343 28.379  1.00 68.76  ? 27  LYS C N    1 
ATOM   3444 C  CA   . LYS D 2 27 ? -27.461 39.196 26.965  1.00 68.08  ? 27  LYS C CA   1 
ATOM   3445 C  C    . LYS D 2 27 ? -27.035 40.564 26.351  1.00 68.42  ? 27  LYS C C    1 
ATOM   3446 O  O    . LYS D 2 27 ? -27.243 41.619 26.953  1.00 68.15  ? 27  LYS C O    1 
ATOM   3447 C  CB   . LYS D 2 27 ? -28.602 38.560 26.170  1.00 66.55  ? 27  LYS C CB   1 
ATOM   3448 C  CG   . LYS D 2 27 ? -29.032 37.189 26.665  0.00 70.80  ? 27  LYS C CG   1 
ATOM   3449 C  CD   . LYS D 2 27 ? -30.225 36.670 25.876  0.00 73.26  ? 27  LYS C CD   1 
ATOM   3450 C  CE   . LYS D 2 27 ? -30.672 35.305 26.372  0.00 78.81  ? 27  LYS C CE   1 
ATOM   3451 N  NZ   . LYS D 2 27 ? -31.844 34.788 25.610  0.00 79.14  ? 27  LYS C NZ   1 
ATOM   3452 H  H    . LYS D 2 27 ? -28.398 39.964 28.529  1.00 82.51  ? 27  LYS C H    1 
ATOM   3453 H  HA   . LYS D 2 27 ? -26.698 38.600 26.904  1.00 81.69  ? 27  LYS C HA   1 
ATOM   3454 H  HB2  . LYS D 2 27 ? -29.375 39.145 26.216  1.00 79.85  ? 27  LYS C HB2  1 
ATOM   3455 H  HB3  . LYS D 2 27 ? -28.321 38.464 25.247  1.00 79.85  ? 27  LYS C HB3  1 
ATOM   3456 H  HG2  . LYS D 2 27 ? -28.299 36.563 26.557  0.00 84.96  ? 27  LYS C HG2  1 
ATOM   3457 H  HG3  . LYS D 2 27 ? -29.288 37.250 27.599  0.00 84.96  ? 27  LYS C HG3  1 
ATOM   3458 H  HD2  . LYS D 2 27 ? -30.967 37.287 25.976  0.00 87.91  ? 27  LYS C HD2  1 
ATOM   3459 H  HD3  . LYS D 2 27 ? -29.980 36.589 24.941  0.00 87.91  ? 27  LYS C HD3  1 
ATOM   3460 H  HE2  . LYS D 2 27 ? -29.943 34.674 26.267  0.00 94.57  ? 27  LYS C HE2  1 
ATOM   3461 H  HE3  . LYS D 2 27 ? -30.925 35.372 27.306  0.00 94.57  ? 27  LYS C HE3  1 
ATOM   3462 H  HZ1  . LYS D 2 27 ? -32.081 33.989 25.923  0.00 94.97  ? 27  LYS C HZ1  1 
ATOM   3463 H  HZ2  . LYS D 2 27 ? -32.531 35.348 25.694  0.00 94.97  ? 27  LYS C HZ2  1 
ATOM   3464 H  HZ3  . LYS D 2 27 ? -31.636 34.712 24.748  0.00 94.97  ? 27  LYS C HZ3  1 
ATOM   3465 N  N    . LEU D 2 28 ? -26.342 40.527 25.213  1.00 65.23  ? 28  LEU C N    1 
ATOM   3466 C  CA   . LEU D 2 28 ? -25.947 41.743 24.486  1.00 64.98  ? 28  LEU C CA   1 
ATOM   3467 C  C    . LEU D 2 28 ? -26.758 41.981 23.225  1.00 64.78  ? 28  LEU C C    1 
ATOM   3468 O  O    . LEU D 2 28 ? -26.750 41.154 22.318  1.00 63.03  ? 28  LEU C O    1 
ATOM   3469 C  CB   . LEU D 2 28 ? -24.467 41.706 24.075  1.00 65.06  ? 28  LEU C CB   1 
ATOM   3470 C  CG   . LEU D 2 28 ? -23.346 41.619 25.107  1.00 63.81  ? 28  LEU C CG   1 
ATOM   3471 C  CD1  . LEU D 2 28 ? -22.150 41.008 24.433  1.00 56.88  ? 28  LEU C CD1  1 
ATOM   3472 C  CD2  . LEU D 2 28 ? -23.016 43.009 25.661  1.00 62.78  ? 28  LEU C CD2  1 
ATOM   3473 H  H    . LEU D 2 28 ? -26.083 39.800 24.833  1.00 78.28  ? 28  LEU C H    1 
ATOM   3474 H  HA   . LEU D 2 28 ? -26.074 42.508 25.068  1.00 77.97  ? 28  LEU C HA   1 
ATOM   3475 H  HB2  . LEU D 2 28 ? -24.354 40.940 23.491  1.00 78.07  ? 28  LEU C HB2  1 
ATOM   3476 H  HB3  . LEU D 2 28 ? -24.296 42.511 23.561  1.00 78.07  ? 28  LEU C HB3  1 
ATOM   3477 H  HG   . LEU D 2 28 ? -23.618 41.046 25.841  1.00 76.57  ? 28  LEU C HG   1 
ATOM   3478 H  HD11 . LEU D 2 28 ? -21.425 40.944 25.074  1.00 68.26  ? 28  LEU C HD11 1 
ATOM   3479 H  HD12 . LEU D 2 28 ? -22.387 40.124 24.112  1.00 68.26  ? 28  LEU C HD12 1 
ATOM   3480 H  HD13 . LEU D 2 28 ? -21.885 41.571 23.689  1.00 68.26  ? 28  LEU C HD13 1 
ATOM   3481 H  HD21 . LEU D 2 28 ? -22.303 42.927 26.313  1.00 75.33  ? 28  LEU C HD21 1 
ATOM   3482 H  HD22 . LEU D 2 28 ? -22.734 43.581 24.930  1.00 75.33  ? 28  LEU C HD22 1 
ATOM   3483 H  HD23 . LEU D 2 28 ? -23.809 43.376 26.082  1.00 75.33  ? 28  LEU C HD23 1 
ATOM   3484 N  N    . LYS D 2 29 ? -27.424 43.122 23.122  1.00 65.91  ? 29  LYS C N    1 
ATOM   3485 C  CA   . LYS D 2 29 ? -28.037 43.463 21.844  1.00 63.95  ? 29  LYS C CA   1 
ATOM   3486 C  C    . LYS D 2 29 ? -26.998 44.103 20.933  1.00 61.15  ? 29  LYS C C    1 
ATOM   3487 O  O    . LYS D 2 29 ? -25.947 44.541 21.382  1.00 59.44  ? 29  LYS C O    1 
ATOM   3488 C  CB   . LYS D 2 29 ? -29.251 44.370 22.060  0.00 66.75  ? 29  LYS C CB   1 
ATOM   3489 C  CG   . LYS D 2 29 ? -28.974 45.631 22.856  0.00 67.45  ? 29  LYS C CG   1 
ATOM   3490 C  CD   . LYS D 2 29 ? -30.235 46.461 23.080  0.00 71.05  ? 29  LYS C CD   1 
ATOM   3491 C  CE   . LYS D 2 29 ? -31.316 45.688 23.837  0.00 74.28  ? 29  LYS C CE   1 
ATOM   3492 N  NZ   . LYS D 2 29 ? -32.513 46.513 24.154  0.00 77.32  ? 29  LYS C NZ   1 
ATOM   3493 H  H    . LYS D 2 29 ? -27.535 43.698 23.751  1.00 79.10  ? 29  LYS C H    1 
ATOM   3494 H  HA   . LYS D 2 29 ? -28.346 42.649 21.417  1.00 76.73  ? 29  LYS C HA   1 
ATOM   3495 H  HB2  . LYS D 2 29 ? -29.593 44.639 21.193  0.00 80.10  ? 29  LYS C HB2  1 
ATOM   3496 H  HB3  . LYS D 2 29 ? -29.931 43.867 22.535  0.00 80.10  ? 29  LYS C HB3  1 
ATOM   3497 H  HG2  . LYS D 2 29 ? -28.616 45.386 23.723  0.00 80.94  ? 29  LYS C HG2  1 
ATOM   3498 H  HG3  . LYS D 2 29 ? -28.335 46.177 22.373  0.00 80.94  ? 29  LYS C HG3  1 
ATOM   3499 H  HD2  . LYS D 2 29 ? -30.008 47.248 23.600  0.00 85.26  ? 29  LYS C HD2  1 
ATOM   3500 H  HD3  . LYS D 2 29 ? -30.599 46.724 22.221  0.00 85.26  ? 29  LYS C HD3  1 
ATOM   3501 H  HE2  . LYS D 2 29 ? -31.605 44.938 23.294  0.00 89.14  ? 29  LYS C HE2  1 
ATOM   3502 H  HE3  . LYS D 2 29 ? -30.945 45.366 24.674  0.00 89.14  ? 29  LYS C HE3  1 
ATOM   3503 H  HZ1  . LYS D 2 29 ? -33.113 46.023 24.593  0.00 92.78  ? 29  LYS C HZ1  1 
ATOM   3504 H  HZ2  . LYS D 2 29 ? -32.279 47.206 24.661  0.00 92.78  ? 29  LYS C HZ2  1 
ATOM   3505 H  HZ3  . LYS D 2 29 ? -32.881 46.816 23.403  0.00 92.78  ? 29  LYS C HZ3  1 
ATOM   3506 N  N    . LYS D 2 30 ? -27.320 44.150 19.646  1.00 62.84  ? 30  LYS C N    1 
ATOM   3507 C  CA   . LYS D 2 30 ? -26.419 44.671 18.627  1.00 62.31  ? 30  LYS C CA   1 
ATOM   3508 C  C    . LYS D 2 30 ? -25.818 45.991 19.089  1.00 61.68  ? 30  LYS C C    1 
ATOM   3509 O  O    . LYS D 2 30 ? -24.640 46.281 18.833  1.00 60.23  ? 30  LYS C O    1 
ATOM   3510 C  CB   . LYS D 2 30 ? -27.165 44.866 17.298  1.00 61.82  ? 30  LYS C CB   1 
ATOM   3511 C  CG   . LYS D 2 30 ? -27.455 43.593 16.498  1.00 60.66  ? 30  LYS C CG   1 
ATOM   3512 C  CD   . LYS D 2 30 ? -28.310 43.873 15.280  0.00 62.11  ? 30  LYS C CD   1 
ATOM   3513 C  CE   . LYS D 2 30 ? -28.797 42.576 14.653  0.00 62.75  ? 30  LYS C CE   1 
ATOM   3514 N  NZ   . LYS D 2 30 ? -29.459 42.786 13.337  0.00 65.56  ? 30  LYS C NZ   1 
ATOM   3515 H  H    . LYS D 2 30 ? -28.073 43.880 19.332  1.00 75.40  ? 30  LYS C H    1 
ATOM   3516 H  HA   . LYS D 2 30 ? -25.697 44.039 18.483  1.00 74.77  ? 30  LYS C HA   1 
ATOM   3517 H  HB2  . LYS D 2 30 ? -28.017 45.290 17.486  1.00 74.19  ? 30  LYS C HB2  1 
ATOM   3518 H  HB3  . LYS D 2 30 ? -26.633 45.448 16.733  1.00 74.19  ? 30  LYS C HB3  1 
ATOM   3519 H  HG2  . LYS D 2 30 ? -26.617 43.208 16.197  1.00 72.79  ? 30  LYS C HG2  1 
ATOM   3520 H  HG3  . LYS D 2 30 ? -27.929 42.963 17.062  1.00 72.79  ? 30  LYS C HG3  1 
ATOM   3521 H  HD2  . LYS D 2 30 ? -29.084 44.396 15.542  0.00 74.53  ? 30  LYS C HD2  1 
ATOM   3522 H  HD3  . LYS D 2 30 ? -27.785 44.354 14.621  0.00 74.53  ? 30  LYS C HD3  1 
ATOM   3523 H  HE2  . LYS D 2 30 ? -28.039 41.987 14.517  0.00 75.30  ? 30  LYS C HE2  1 
ATOM   3524 H  HE3  . LYS D 2 30 ? -29.439 42.159 15.249  0.00 75.30  ? 30  LYS C HE3  1 
ATOM   3525 H  HZ1  . LYS D 2 30 ? -29.729 42.005 13.005  0.00 78.67  ? 30  LYS C HZ1  1 
ATOM   3526 H  HZ2  . LYS D 2 30 ? -30.166 43.318 13.434  0.00 78.67  ? 30  LYS C HZ2  1 
ATOM   3527 H  HZ3  . LYS D 2 30 ? -28.889 43.162 12.767  0.00 78.67  ? 30  LYS C HZ3  1 
ATOM   3528 N  N    . SER D 2 31 ? -26.652 46.785 19.754  1.00 58.46  ? 31  SER C N    1 
ATOM   3529 C  CA   . SER D 2 31 ? -26.282 48.122 20.185  1.00 57.91  ? 31  SER C CA   1 
ATOM   3530 C  C    . SER D 2 31 ? -25.245 48.066 21.296  1.00 59.23  ? 31  SER C C    1 
ATOM   3531 O  O    . SER D 2 31 ? -24.303 48.861 21.328  1.00 57.14  ? 31  SER C O    1 
ATOM   3532 C  CB   . SER D 2 31 ? -27.542 48.887 20.629  1.00 57.03  ? 31  SER C CB   1 
ATOM   3533 O  OG   . SER D 2 31 ? -27.326 49.660 21.783  1.00 59.22  ? 31  SER C OG   1 
ATOM   3534 H  H    . SER D 2 31 ? -27.455 46.564 19.970  1.00 70.15  ? 31  SER C H    1 
ATOM   3535 H  HA   . SER D 2 31 ? -25.891 48.598 19.435  1.00 69.49  ? 31  SER C HA   1 
ATOM   3536 H  HB2  . SER D 2 31 ? -27.818 49.475 19.909  1.00 68.43  ? 31  SER C HB2  1 
ATOM   3537 H  HB3  . SER D 2 31 ? -28.245 48.245 20.813  1.00 68.43  ? 31  SER C HB3  1 
ATOM   3538 H  HG   . SER D 2 31 ? -26.723 50.227 21.641  1.00 71.06  ? 31  SER C HG   1 
ATOM   3539 N  N    . GLU D 2 32 ? -25.407 47.112 22.201  1.00 59.84  ? 32  GLU C N    1 
ATOM   3540 C  CA   . GLU D 2 32 ? -24.490 46.997 23.316  1.00 59.12  ? 32  GLU C CA   1 
ATOM   3541 C  C    . GLU D 2 32 ? -23.173 46.442 22.842  1.00 57.30  ? 32  GLU C C    1 
ATOM   3542 O  O    . GLU D 2 32 ? -22.128 46.891 23.289  1.00 56.00  ? 32  GLU C O    1 
ATOM   3543 C  CB   . GLU D 2 32 ? -25.077 46.125 24.405  1.00 61.93  ? 32  GLU C CB   1 
ATOM   3544 C  CG   . GLU D 2 32 ? -26.270 46.753 25.050  1.00 66.92  ? 32  GLU C CG   1 
ATOM   3545 C  CD   . GLU D 2 32 ? -26.985 45.811 25.970  1.00 68.58  ? 32  GLU C CD   1 
ATOM   3546 O  OE1  . GLU D 2 32 ? -27.041 44.613 25.621  1.00 66.73  ? 32  GLU C OE1  1 
ATOM   3547 O  OE2  . GLU D 2 32 ? -27.478 46.272 27.030  1.00 69.54  ? 32  GLU C OE2  1 
ATOM   3548 H  H    . GLU D 2 32 ? -26.035 46.524 22.191  1.00 71.81  ? 32  GLU C H    1 
ATOM   3549 H  HA   . GLU D 2 32 ? -24.330 47.878 23.688  1.00 70.94  ? 32  GLU C HA   1 
ATOM   3550 H  HB2  . GLU D 2 32 ? -25.352 45.278 24.021  1.00 74.32  ? 32  GLU C HB2  1 
ATOM   3551 H  HB3  . GLU D 2 32 ? -24.406 45.978 25.091  1.00 74.32  ? 32  GLU C HB3  1 
ATOM   3552 H  HG2  . GLU D 2 32 ? -25.983 47.520 25.569  1.00 80.30  ? 32  GLU C HG2  1 
ATOM   3553 H  HG3  . GLU D 2 32 ? -26.893 47.031 24.360  1.00 80.30  ? 32  GLU C HG3  1 
ATOM   3554 N  N    . LEU D 2 33 ? -23.238 45.459 21.951  1.00 55.48  ? 33  LEU C N    1 
ATOM   3555 C  CA   . LEU D 2 33 ? -22.063 44.850 21.369  1.00 54.92  ? 33  LEU C CA   1 
ATOM   3556 C  C    . LEU D 2 33 ? -21.201 45.856 20.582  1.00 54.06  ? 33  LEU C C    1 
ATOM   3557 O  O    . LEU D 2 33 ? -19.966 45.778 20.566  1.00 50.34  ? 33  LEU C O    1 
ATOM   3558 C  CB   . LEU D 2 33 ? -22.511 43.684 20.470  1.00 56.97  ? 33  LEU C CB   1 
ATOM   3559 C  CG   . LEU D 2 33 ? -21.478 42.942 19.606  1.00 52.18  ? 33  LEU C CG   1 
ATOM   3560 C  CD1  . LEU D 2 33 ? -20.383 42.347 20.457  1.00 49.98  ? 33  LEU C CD1  1 
ATOM   3561 C  CD2  . LEU D 2 33 ? -22.154 41.827 18.776  1.00 55.62  ? 33  LEU C CD2  1 
ATOM   3562 H  H    . LEU D 2 33 ? -23.975 45.123 21.664  1.00 66.57  ? 33  LEU C H    1 
ATOM   3563 H  HA   . LEU D 2 33 ? -21.516 44.483 22.081  1.00 65.90  ? 33  LEU C HA   1 
ATOM   3564 H  HB2  . LEU D 2 33 ? -22.923 43.017 21.041  1.00 68.37  ? 33  LEU C HB2  1 
ATOM   3565 H  HB3  . LEU D 2 33 ? -23.183 44.028 19.860  1.00 68.37  ? 33  LEU C HB3  1 
ATOM   3566 H  HG   . LEU D 2 33 ? -21.071 43.570 18.989  1.00 62.62  ? 33  LEU C HG   1 
ATOM   3567 H  HD11 . LEU D 2 33 ? -19.751 41.889 19.881  1.00 59.97  ? 33  LEU C HD11 1 
ATOM   3568 H  HD12 . LEU D 2 33 ? -19.935 43.061 20.938  1.00 59.97  ? 33  LEU C HD12 1 
ATOM   3569 H  HD13 . LEU D 2 33 ? -20.776 41.720 21.084  1.00 59.97  ? 33  LEU C HD13 1 
ATOM   3570 H  HD21 . LEU D 2 33 ? -21.479 41.377 18.243  1.00 66.75  ? 33  LEU C HD21 1 
ATOM   3571 H  HD22 . LEU D 2 33 ? -22.574 41.194 19.380  1.00 66.75  ? 33  LEU C HD22 1 
ATOM   3572 H  HD23 . LEU D 2 33 ? -22.822 42.226 18.197  1.00 66.75  ? 33  LEU C HD23 1 
ATOM   3573 N  N    . LYS D 2 34 ? -21.861 46.754 19.864  1.00 55.51  ? 34  LYS C N    1 
ATOM   3574 C  CA   . LYS D 2 34 ? -21.179 47.840 19.182  1.00 56.32  ? 34  LYS C CA   1 
ATOM   3575 C  C    . LYS D 2 34 ? -20.500 48.736 20.253  1.00 53.52  ? 34  LYS C C    1 
ATOM   3576 O  O    . LYS D 2 34 ? -19.351 49.129 20.126  1.00 51.20  ? 34  LYS C O    1 
ATOM   3577 C  CB   . LYS D 2 34 ? -22.151 48.611 18.302  1.00 56.41  ? 34  LYS C CB   1 
ATOM   3578 C  CG   . LYS D 2 34 ? -21.506 49.681 17.467  1.00 57.60  ? 34  LYS C CG   1 
ATOM   3579 C  CD   . LYS D 2 34 ? -22.575 50.623 16.949  1.00 60.42  ? 34  LYS C CD   1 
ATOM   3580 C  CE   . LYS D 2 34 ? -22.017 51.830 16.219  1.00 60.93  ? 34  LYS C CE   1 
ATOM   3581 N  NZ   . LYS D 2 34 ? -23.123 52.781 15.935  1.00 66.17  ? 34  LYS C NZ   1 
ATOM   3582 H  H    . LYS D 2 34 ? -22.714 46.755 19.757  1.00 66.62  ? 34  LYS C H    1 
ATOM   3583 H  HA   . LYS D 2 34 ? -20.485 47.472 18.613  1.00 67.58  ? 34  LYS C HA   1 
ATOM   3584 H  HB2  . LYS D 2 34 ? -22.587 47.989 17.700  1.00 67.69  ? 34  LYS C HB2  1 
ATOM   3585 H  HB3  . LYS D 2 34 ? -22.813 49.038 18.869  1.00 67.69  ? 34  LYS C HB3  1 
ATOM   3586 H  HG2  . LYS D 2 34 ? -20.882 50.187 18.009  1.00 69.12  ? 34  LYS C HG2  1 
ATOM   3587 H  HG3  . LYS D 2 34 ? -21.054 49.276 16.710  1.00 69.12  ? 34  LYS C HG3  1 
ATOM   3588 H  HD2  . LYS D 2 34 ? -23.146 50.139 16.332  1.00 72.50  ? 34  LYS C HD2  1 
ATOM   3589 H  HD3  . LYS D 2 34 ? -23.099 50.945 17.699  1.00 72.50  ? 34  LYS C HD3  1 
ATOM   3590 H  HE2  . LYS D 2 34 ? -21.359 52.275 16.776  1.00 73.11  ? 34  LYS C HE2  1 
ATOM   3591 H  HE3  . LYS D 2 34 ? -21.623 51.551 15.377  1.00 73.11  ? 34  LYS C HE3  1 
ATOM   3592 H  HZ1  . LYS D 2 34 ? -22.808 53.494 15.507  1.00 79.41  ? 34  LYS C HZ1  1 
ATOM   3593 H  HZ2  . LYS D 2 34 ? -23.740 52.387 15.428  1.00 79.41  ? 34  LYS C HZ2  1 
ATOM   3594 H  HZ3  . LYS D 2 34 ? -23.500 53.044 16.697  1.00 79.41  ? 34  LYS C HZ3  1 
ATOM   3595 N  N    . GLU D 2 35 ? -21.237 49.064 21.299  1.00 53.91  ? 35  GLU C N    1 
ATOM   3596 C  CA   . GLU D 2 35 ? -20.692 49.875 22.356  1.00 55.91  ? 35  GLU C CA   1 
ATOM   3597 C  C    . GLU D 2 35 ? -19.455 49.189 22.934  1.00 54.49  ? 35  GLU C C    1 
ATOM   3598 O  O    . GLU D 2 35 ? -18.426 49.838 23.163  1.00 54.30  ? 35  GLU C O    1 
ATOM   3599 C  CB   . GLU D 2 35 ? -21.763 50.137 23.410  0.00 58.79  ? 35  GLU C CB   1 
ATOM   3600 C  CG   . GLU D 2 35 ? -22.825 51.107 22.901  0.00 60.58  ? 35  GLU C CG   1 
ATOM   3601 C  CD   . GLU D 2 35 ? -24.031 51.207 23.808  0.00 62.77  ? 35  GLU C CD   1 
ATOM   3602 O  OE1  . GLU D 2 35 ? -24.122 50.417 24.770  0.00 62.73  ? 35  GLU C OE1  1 
ATOM   3603 O  OE2  . GLU D 2 35 ? -24.891 52.078 23.560  0.00 64.12  ? 35  GLU C OE2  1 
ATOM   3604 H  H    . GLU D 2 35 ? -22.055 48.827 21.417  1.00 64.69  ? 35  GLU C H    1 
ATOM   3605 H  HA   . GLU D 2 35 ? -20.416 50.730 21.989  1.00 67.09  ? 35  GLU C HA   1 
ATOM   3606 H  HB2  . GLU D 2 35 ? -22.199 49.301 23.638  0.00 70.55  ? 35  GLU C HB2  1 
ATOM   3607 H  HB3  . GLU D 2 35 ? -21.349 50.526 24.197  0.00 70.55  ? 35  GLU C HB3  1 
ATOM   3608 H  HG2  . GLU D 2 35 ? -22.433 51.991 22.828  0.00 72.69  ? 35  GLU C HG2  1 
ATOM   3609 H  HG3  . GLU D 2 35 ? -23.131 50.808 22.030  0.00 72.69  ? 35  GLU C HG3  1 
ATOM   3610 N  N    . LEU D 2 36 ? -19.533 47.872 23.117  1.00 53.44  ? 36  LEU C N    1 
ATOM   3611 C  CA   . LEU D 2 36 ? -18.415 47.114 23.684  1.00 52.41  ? 36  LEU C CA   1 
ATOM   3612 C  C    . LEU D 2 36 ? -17.197 47.093 22.744  1.00 52.27  ? 36  LEU C C    1 
ATOM   3613 O  O    . LEU D 2 36 ? -16.096 47.422 23.145  1.00 52.23  ? 36  LEU C O    1 
ATOM   3614 C  CB   . LEU D 2 36 ? -18.857 45.706 24.038  1.00 50.24  ? 36  LEU C CB   1 
ATOM   3615 C  CG   . LEU D 2 36 ? -17.888 44.917 24.884  1.00 48.87  ? 36  LEU C CG   1 
ATOM   3616 C  CD1  . LEU D 2 36 ? -18.671 43.923 25.659  1.00 50.59  ? 36  LEU C CD1  1 
ATOM   3617 C  CD2  . LEU D 2 36 ? -16.847 44.214 24.048  1.00 50.35  ? 36  LEU C CD2  1 
ATOM   3618 H  H    . LEU D 2 36 ? -20.220 47.393 22.921  1.00 64.13  ? 36  LEU C H    1 
ATOM   3619 H  HA   . LEU D 2 36 ? -18.138 47.546 24.507  1.00 62.90  ? 36  LEU C HA   1 
ATOM   3620 H  HB2  . LEU D 2 36 ? -19.693 45.761 24.527  1.00 60.29  ? 36  LEU C HB2  1 
ATOM   3621 H  HB3  . LEU D 2 36 ? -18.995 45.211 23.215  1.00 60.29  ? 36  LEU C HB3  1 
ATOM   3622 H  HG   . LEU D 2 36 ? -17.439 45.510 25.506  1.00 58.64  ? 36  LEU C HG   1 
ATOM   3623 H  HD11 . LEU D 2 36 ? -19.139 43.339 25.042  1.00 60.71  ? 36  LEU C HD11 1 
ATOM   3624 H  HD12 . LEU D 2 36 ? -18.065 43.404 26.211  1.00 60.71  ? 36  LEU C HD12 1 
ATOM   3625 H  HD13 . LEU D 2 36 ? -19.310 44.392 26.219  1.00 60.71  ? 36  LEU C HD13 1 
ATOM   3626 H  HD21 . LEU D 2 36 ? -16.250 43.723 24.634  1.00 60.42  ? 36  LEU C HD21 1 
ATOM   3627 H  HD22 . LEU D 2 36 ? -17.291 43.602 23.439  1.00 60.42  ? 36  LEU C HD22 1 
ATOM   3628 H  HD23 . LEU D 2 36 ? -16.347 44.876 23.545  1.00 60.42  ? 36  LEU C HD23 1 
ATOM   3629 N  N    . ILE D 2 37 ? -17.399 46.711 21.496  1.00 51.65  ? 37  ILE C N    1 
ATOM   3630 C  CA   . ILE D 2 37 ? -16.324 46.704 20.540  1.00 50.41  ? 37  ILE C CA   1 
ATOM   3631 C  C    . ILE D 2 37 ? -15.725 48.062 20.407  1.00 51.11  ? 37  ILE C C    1 
ATOM   3632 O  O    . ILE D 2 37 ? -14.513 48.216 20.483  1.00 50.98  ? 37  ILE C O    1 
ATOM   3633 C  CB   . ILE D 2 37 ? -16.815 46.214 19.199  1.00 50.09  ? 37  ILE C CB   1 
ATOM   3634 C  CG1  . ILE D 2 37 ? -17.061 44.711 19.313  1.00 50.32  ? 37  ILE C CG1  1 
ATOM   3635 C  CG2  . ILE D 2 37 ? -15.837 46.534 18.105  1.00 47.43  ? 37  ILE C CG2  1 
ATOM   3636 C  CD1  . ILE D 2 37 ? -17.916 44.130 18.228  1.00 49.10  ? 37  ILE C CD1  1 
ATOM   3637 H  H    . ILE D 2 37 ? -18.156 46.450 21.181  1.00 61.98  ? 37  ILE C H    1 
ATOM   3638 H  HA   . ILE D 2 37 ? -15.631 46.098 20.847  1.00 60.49  ? 37  ILE C HA   1 
ATOM   3639 H  HB   . ILE D 2 37 ? -17.658 46.652 18.999  1.00 60.11  ? 37  ILE C HB   1 
ATOM   3640 H  HG12 . ILE D 2 37 ? -16.206 44.254 19.288  1.00 60.39  ? 37  ILE C HG12 1 
ATOM   3641 H  HG13 . ILE D 2 37 ? -17.501 44.532 20.160  1.00 60.39  ? 37  ILE C HG13 1 
ATOM   3642 H  HG21 . ILE D 2 37 ? -16.188 46.205 17.263  1.00 56.92  ? 37  ILE C HG21 1 
ATOM   3643 H  HG22 . ILE D 2 37 ? -15.718 47.496 18.061  1.00 56.92  ? 37  ILE C HG22 1 
ATOM   3644 H  HG23 . ILE D 2 37 ? -14.991 46.104 18.303  1.00 56.92  ? 37  ILE C HG23 1 
ATOM   3645 H  HD11 . ILE D 2 37 ? -18.785 44.563 18.246  1.00 58.92  ? 37  ILE C HD11 1 
ATOM   3646 H  HD12 . ILE D 2 37 ? -17.487 44.284 17.372  1.00 58.92  ? 37  ILE C HD12 1 
ATOM   3647 H  HD13 . ILE D 2 37 ? -18.018 43.178 18.382  1.00 58.92  ? 37  ILE C HD13 1 
ATOM   3648 N  N    . ASN D 2 38 ? -16.552 49.082 20.258  1.00 51.70  ? 38  ASN C N    1 
ATOM   3649 C  CA   . ASN D 2 38 ? -15.981 50.398 20.037  1.00 51.74  ? 38  ASN C CA   1 
ATOM   3650 C  C    . ASN D 2 38 ? -15.298 50.971 21.304  1.00 52.99  ? 38  ASN C C    1 
ATOM   3651 O  O    . ASN D 2 38 ? -14.272 51.644 21.216  1.00 52.05  ? 38  ASN C O    1 
ATOM   3652 C  CB   . ASN D 2 38 ? -17.047 51.335 19.511  1.00 51.56  ? 38  ASN C CB   1 
ATOM   3653 C  CG   . ASN D 2 38 ? -17.290 51.154 18.046  1.00 52.26  ? 38  ASN C CG   1 
ATOM   3654 O  OD1  . ASN D 2 38 ? -16.618 50.354 17.388  1.00 52.66  ? 38  ASN C OD1  1 
ATOM   3655 N  ND2  . ASN D 2 38 ? -18.305 51.831 17.535  1.00 51.64  ? 38  ASN C ND2  1 
ATOM   3656 H  H    . ASN D 2 38 ? -17.411 49.045 20.278  1.00 62.03  ? 38  ASN C H    1 
ATOM   3657 H  HA   . ASN D 2 38 ? -15.298 50.323 19.352  1.00 62.08  ? 38  ASN C HA   1 
ATOM   3658 H  HB2  . ASN D 2 38 ? -17.879 51.163 19.978  1.00 61.88  ? 38  ASN C HB2  1 
ATOM   3659 H  HB3  . ASN D 2 38 ? -16.765 52.251 19.658  1.00 61.88  ? 38  ASN C HB3  1 
ATOM   3660 H  HD21 . ASN D 2 38 ? -18.781 52.339 18.040  1.00 61.97  ? 38  ASN C HD21 1 
ATOM   3661 H  HD22 . ASN D 2 38 ? -18.488 51.763 16.697  1.00 61.97  ? 38  ASN C HD22 1 
ATOM   3662 N  N    . ASN D 2 39 ? -15.787 50.629 22.485  1.00 54.08  ? 39  ASN C N    1 
ATOM   3663 C  CA   . ASN D 2 39 ? -15.176 51.163 23.695  1.00 54.70  ? 39  ASN C CA   1 
ATOM   3664 C  C    . ASN D 2 39 ? -14.119 50.282 24.364  1.00 53.53  ? 39  ASN C C    1 
ATOM   3665 O  O    . ASN D 2 39 ? -13.282 50.807 25.088  1.00 53.59  ? 39  ASN C O    1 
ATOM   3666 C  CB   . ASN D 2 39 ? -16.260 51.453 24.748  1.00 56.87  ? 39  ASN C CB   1 
ATOM   3667 C  CG   . ASN D 2 39 ? -17.079 52.675 24.419  1.00 55.31  ? 39  ASN C CG   1 
ATOM   3668 O  OD1  . ASN D 2 39 ? -16.699 53.479 23.554  1.00 52.60  ? 39  ASN C OD1  1 
ATOM   3669 N  ND2  . ASN D 2 39 ? -18.216 52.826 25.107  1.00 57.79  ? 39  ASN C ND2  1 
ATOM   3670 H  H    . ASN D 2 39 ? -16.456 50.103 22.614  1.00 64.89  ? 39  ASN C H    1 
ATOM   3671 H  HA   . ASN D 2 39 ? -14.752 52.007 23.475  1.00 65.64  ? 39  ASN C HA   1 
ATOM   3672 H  HB2  . ASN D 2 39 ? -16.862 50.694 24.800  1.00 68.25  ? 39  ASN C HB2  1 
ATOM   3673 H  HB3  . ASN D 2 39 ? -15.835 51.600 25.608  1.00 68.25  ? 39  ASN C HB3  1 
ATOM   3674 H  HD21 . ASN D 2 39 ? -18.722 53.506 24.959  1.00 69.35  ? 39  ASN C HD21 1 
ATOM   3675 H  HD22 . ASN D 2 39 ? -18.442 52.243 25.698  1.00 69.35  ? 39  ASN C HD22 1 
ATOM   3676 N  N    . GLU D 2 40 ? -14.132 48.979 24.115  1.00 52.29  ? 40  GLU C N    1 
ATOM   3677 C  CA   . GLU D 2 40 ? -13.282 48.074 24.870  1.00 51.95  ? 40  GLU C CA   1 
ATOM   3678 C  C    . GLU D 2 40 ? -12.336 47.280 24.001  1.00 50.55  ? 40  GLU C C    1 
ATOM   3679 O  O    . GLU D 2 40 ? -11.481 46.599 24.535  1.00 50.82  ? 40  GLU C O    1 
ATOM   3680 C  CB   . GLU D 2 40 ? -14.130 47.132 25.740  1.00 53.16  ? 40  GLU C CB   1 
ATOM   3681 C  CG   . GLU D 2 40 ? -15.172 47.871 26.588  1.00 52.42  ? 40  GLU C CG   1 
ATOM   3682 C  CD   . GLU D 2 40 ? -14.546 48.873 27.554  1.00 53.67  ? 40  GLU C CD   1 
ATOM   3683 O  OE1  . GLU D 2 40 ? -13.298 48.865 27.643  1.00 53.61  ? 40  GLU C OE1  1 
ATOM   3684 O  OE2  . GLU D 2 40 ? -15.280 49.650 28.248  1.00 54.17  ? 40  GLU C OE2  1 
ATOM   3685 H  H    . GLU D 2 40 ? -14.620 48.597 23.519  1.00 62.75  ? 40  GLU C H    1 
ATOM   3686 H  HA   . GLU D 2 40 ? -12.738 48.606 25.472  1.00 62.34  ? 40  GLU C HA   1 
ATOM   3687 H  HB2  . GLU D 2 40 ? -14.600 46.509 25.164  1.00 63.79  ? 40  GLU C HB2  1 
ATOM   3688 H  HB3  . GLU D 2 40 ? -13.544 46.647 26.343  1.00 63.79  ? 40  GLU C HB3  1 
ATOM   3689 H  HG2  . GLU D 2 40 ? -15.771 48.356 25.999  1.00 62.91  ? 40  GLU C HG2  1 
ATOM   3690 H  HG3  . GLU D 2 40 ? -15.671 47.224 27.109  1.00 62.91  ? 40  GLU C HG3  1 
ATOM   3691 N  N    . LEU D 2 41 ? -12.430 47.411 22.679  1.00 50.52  ? 41  LEU C N    1 
ATOM   3692 C  CA   . LEU D 2 41 ? -11.510 46.712 21.784  1.00 49.51  ? 41  LEU C CA   1 
ATOM   3693 C  C    . LEU D 2 41 ? -10.927 47.637 20.726  1.00 51.64  ? 41  LEU C C    1 
ATOM   3694 O  O    . LEU D 2 41 ? -10.358 47.179 19.724  1.00 52.38  ? 41  LEU C O    1 
ATOM   3695 C  CB   . LEU D 2 41 ? -12.225 45.540 21.121  1.00 49.51  ? 41  LEU C CB   1 
ATOM   3696 C  CG   . LEU D 2 41 ? -12.507 44.340 22.036  1.00 50.37  ? 41  LEU C CG   1 
ATOM   3697 C  CD1  . LEU D 2 41 ? -13.274 43.280 21.321  1.00 49.99  ? 41  LEU C CD1  1 
ATOM   3698 C  CD2  . LEU D 2 41 ? -11.184 43.742 22.512  1.00 51.38  ? 41  LEU C CD2  1 
ATOM   3699 H  H    . LEU D 2 41 ? -13.015 47.896 22.276  1.00 60.62  ? 41  LEU C H    1 
ATOM   3700 H  HA   . LEU D 2 41 ? -10.774 46.356 22.306  1.00 59.42  ? 41  LEU C HA   1 
ATOM   3701 H  HB2  . LEU D 2 41 ? -13.078 45.854 20.781  1.00 59.42  ? 41  LEU C HB2  1 
ATOM   3702 H  HB3  . LEU D 2 41 ? -11.679 45.224 20.385  1.00 59.42  ? 41  LEU C HB3  1 
ATOM   3703 H  HG   . LEU D 2 41 ? -13.017 44.628 22.809  1.00 60.44  ? 41  LEU C HG   1 
ATOM   3704 H  HD11 . LEU D 2 41 ? -13.432 42.541 21.929  1.00 59.99  ? 41  LEU C HD11 1 
ATOM   3705 H  HD12 . LEU D 2 41 ? -14.119 43.650 21.022  1.00 59.99  ? 41  LEU C HD12 1 
ATOM   3706 H  HD13 . LEU D 2 41 ? -12.757 42.977 20.558  1.00 59.99  ? 41  LEU C HD13 1 
ATOM   3707 H  HD21 . LEU D 2 41 ? -11.370 42.984 23.089  1.00 61.65  ? 41  LEU C HD21 1 
ATOM   3708 H  HD22 . LEU D 2 41 ? -10.673 43.452 21.740  1.00 61.65  ? 41  LEU C HD22 1 
ATOM   3709 H  HD23 . LEU D 2 41 ? -10.690 44.418 23.002  1.00 61.65  ? 41  LEU C HD23 1 
ATOM   3710 N  N    . SER D 2 42 ? -10.991 48.937 21.007  1.00 51.00  ? 42  SER C N    1 
ATOM   3711 C  CA   . SER D 2 42 ? -10.572 49.971 20.056  1.00 53.66  ? 42  SER C CA   1 
ATOM   3712 C  C    . SER D 2 42 ? -9.188  49.734 19.541  1.00 53.98  ? 42  SER C C    1 
ATOM   3713 O  O    . SER D 2 42 ? -8.889  50.057 18.393  1.00 59.02  ? 42  SER C O    1 
ATOM   3714 C  CB   . SER D 2 42 ? -10.590 51.370 20.672  1.00 50.52  ? 42  SER C CB   1 
ATOM   3715 O  OG   . SER D 2 42 ? -9.572  51.502 21.621  1.00 51.61  ? 42  SER C OG   1 
ATOM   3716 H  H    . SER D 2 42 ? -11.278 49.253 21.754  1.00 61.21  ? 42  SER C H    1 
ATOM   3717 H  HA   . SER D 2 42 ? -11.179 49.968 19.299  1.00 64.39  ? 42  SER C HA   1 
ATOM   3718 H  HB2  . SER D 2 42 ? -10.457 52.027 19.971  1.00 60.63  ? 42  SER C HB2  1 
ATOM   3719 H  HB3  . SER D 2 42 ? -11.447 51.514 21.104  1.00 60.63  ? 42  SER C HB3  1 
ATOM   3720 H  HG   . SER D 2 42 ? -9.675  50.938 22.234  1.00 61.93  ? 42  SER C HG   1 
ATOM   3721 N  N    . HIS D 2 43 ? -8.347  49.146 20.376  1.00 52.83  ? 43  HIS C N    1 
ATOM   3722 C  CA   . HIS D 2 43 ? -6.977  48.925 19.995  1.00 54.18  ? 43  HIS C CA   1 
ATOM   3723 C  C    . HIS D 2 43 ? -6.777  47.652 19.220  1.00 56.69  ? 43  HIS C C    1 
ATOM   3724 O  O    . HIS D 2 43 ? -5.693  47.386 18.723  1.00 60.45  ? 43  HIS C O    1 
ATOM   3725 C  CB   . HIS D 2 43 ? -6.100  48.910 21.219  1.00 54.08  ? 43  HIS C CB   1 
ATOM   3726 C  CG   . HIS D 2 43 ? -6.197  50.150 22.035  1.00 52.04  ? 43  HIS C CG   1 
ATOM   3727 N  ND1  . HIS D 2 43 ? -6.925  50.212 23.198  1.00 50.78  ? 43  HIS C ND1  1 
ATOM   3728 C  CD2  . HIS D 2 43 ? -5.709  51.392 21.825  1.00 51.05  ? 43  HIS C CD2  1 
ATOM   3729 C  CE1  . HIS D 2 43 ? -6.838  51.427 23.703  1.00 51.32  ? 43  HIS C CE1  1 
ATOM   3730 N  NE2  . HIS D 2 43 ? -6.102  52.160 22.889  1.00 51.14  ? 43  HIS C NE2  1 
ATOM   3731 H  H    . HIS D 2 43 ? -8.549  48.868 21.165  1.00 63.40  ? 43  HIS C H    1 
ATOM   3732 H  HA   . HIS D 2 43 ? -6.688  49.661 19.434  1.00 65.02  ? 43  HIS C HA   1 
ATOM   3733 H  HB2  . HIS D 2 43 ? -6.358  48.163 21.781  1.00 64.90  ? 43  HIS C HB2  1 
ATOM   3734 H  HB3  . HIS D 2 43 ? -5.176  48.809 20.941  1.00 64.90  ? 43  HIS C HB3  1 
ATOM   3735 H  HD2  . HIS D 2 43 ? -5.172  51.663 21.116  1.00 61.26  ? 43  HIS C HD2  1 
ATOM   3736 H  HE1  . HIS D 2 43 ? -7.237  51.721 24.490  1.00 61.59  ? 43  HIS C HE1  1 
ATOM   3737 N  N    . PHE D 2 44 ? -7.783  46.803 19.177  1.00 55.87  ? 44  PHE C N    1 
ATOM   3738 C  CA   . PHE D 2 44 ? -7.592  45.552 18.462  1.00 57.39  ? 44  PHE C CA   1 
ATOM   3739 C  C    . PHE D 2 44 ? -8.431  45.554 17.229  1.00 59.00  ? 44  PHE C C    1 
ATOM   3740 O  O    . PHE D 2 44 ? -8.130  44.794 16.312  1.00 59.03  ? 44  PHE C O    1 
ATOM   3741 C  CB   . PHE D 2 44 ? -7.931  44.317 19.307  1.00 57.46  ? 44  PHE C CB   1 
ATOM   3742 C  CG   . PHE D 2 44 ? -6.962  44.057 20.416  1.00 58.35  ? 44  PHE C CG   1 
ATOM   3743 C  CD1  . PHE D 2 44 ? -5.915  44.930 20.672  1.00 57.84  ? 44  PHE C CD1  1 
ATOM   3744 C  CD2  . PHE D 2 44 ? -7.060  42.914 21.165  1.00 57.21  ? 44  PHE C CD2  1 
ATOM   3745 C  CE1  . PHE D 2 44 ? -5.051  44.690 21.663  1.00 57.76  ? 44  PHE C CE1  1 
ATOM   3746 C  CE2  . PHE D 2 44 ? -6.174  42.675 22.156  1.00 57.51  ? 44  PHE C CE2  1 
ATOM   3747 C  CZ   . PHE D 2 44 ? -5.164  43.562 22.402  1.00 57.29  ? 44  PHE C CZ   1 
ATOM   3748 H  H    . PHE D 2 44 ? -8.557  46.914 19.536  1.00 67.04  ? 44  PHE C H    1 
ATOM   3749 H  HA   . PHE D 2 44 ? -6.663  45.483 18.192  1.00 68.86  ? 44  PHE C HA   1 
ATOM   3750 H  HB2  . PHE D 2 44 ? -8.808  44.441 19.703  1.00 68.96  ? 44  PHE C HB2  1 
ATOM   3751 H  HB3  . PHE D 2 44 ? -7.939  43.537 18.730  1.00 68.96  ? 44  PHE C HB3  1 
ATOM   3752 H  HD1  . PHE D 2 44 ? -5.834  45.709 20.170  1.00 69.41  ? 44  PHE C HD1  1 
ATOM   3753 H  HD2  . PHE D 2 44 ? -7.748  42.310 21.001  1.00 68.65  ? 44  PHE C HD2  1 
ATOM   3754 H  HE1  . PHE D 2 44 ? -4.359  45.288 21.831  1.00 69.31  ? 44  PHE C HE1  1 
ATOM   3755 H  HE2  . PHE D 2 44 ? -6.250  41.904 22.670  1.00 69.01  ? 44  PHE C HE2  1 
ATOM   3756 H  HZ   . PHE D 2 44 ? -4.557  43.394 23.087  1.00 68.75  ? 44  PHE C HZ   1 
ATOM   3757 N  N    . LEU D 2 45 ? -9.485  46.383 17.212  1.00 57.36  ? 45  LEU C N    1 
ATOM   3758 C  CA   . LEU D 2 45 ? -10.455 46.346 16.113  1.00 58.18  ? 45  LEU C CA   1 
ATOM   3759 C  C    . LEU D 2 45 ? -10.753 47.698 15.497  1.00 59.39  ? 45  LEU C C    1 
ATOM   3760 O  O    . LEU D 2 45 ? -10.686 48.723 16.169  1.00 61.93  ? 45  LEU C O    1 
ATOM   3761 C  CB   . LEU D 2 45 ? -11.794 45.727 16.581  1.00 57.60  ? 45  LEU C CB   1 
ATOM   3762 C  CG   . LEU D 2 45 ? -11.849 44.315 17.179  1.00 57.55  ? 45  LEU C CG   1 
ATOM   3763 C  CD1  . LEU D 2 45 ? -13.278 43.932 17.562  1.00 55.45  ? 45  LEU C CD1  1 
ATOM   3764 C  CD2  . LEU D 2 45 ? -11.274 43.266 16.257  1.00 59.83  ? 45  LEU C CD2  1 
ATOM   3765 H  H    . LEU D 2 45 ? -9.657  46.968 17.818  1.00 68.83  ? 45  LEU C H    1 
ATOM   3766 H  HA   . LEU D 2 45 ? -10.101 45.778 15.411  1.00 69.82  ? 45  LEU C HA   1 
ATOM   3767 H  HB2  . LEU D 2 45 ? -12.164 46.320 17.254  1.00 69.11  ? 45  LEU C HB2  1 
ATOM   3768 H  HB3  . LEU D 2 45 ? -12.390 45.720 15.816  1.00 69.11  ? 45  LEU C HB3  1 
ATOM   3769 H  HG   . LEU D 2 45 ? -11.319 44.307 17.992  1.00 69.07  ? 45  LEU C HG   1 
ATOM   3770 H  HD11 . LEU D 2 45 ? -13.608 44.564 18.220  1.00 66.54  ? 45  LEU C HD11 1 
ATOM   3771 H  HD12 . LEU D 2 45 ? -13.835 43.958 16.768  1.00 66.54  ? 45  LEU C HD12 1 
ATOM   3772 H  HD13 . LEU D 2 45 ? -13.275 43.037 17.935  1.00 66.54  ? 45  LEU C HD13 1 
ATOM   3773 H  HD21 . LEU D 2 45 ? -11.337 42.399 16.687  1.00 71.79  ? 45  LEU C HD21 1 
ATOM   3774 H  HD22 . LEU D 2 45 ? -11.781 43.262 15.429  1.00 71.79  ? 45  LEU C HD22 1 
ATOM   3775 H  HD23 . LEU D 2 45 ? -10.346 43.480 16.076  1.00 71.79  ? 45  LEU C HD23 1 
ATOM   3776 N  N    . GLU D 2 46 ? -11.034 47.692 14.192  1.00 62.86  ? 46  GLU C N    1 
ATOM   3777 C  CA   . GLU D 2 46 ? -11.582 48.861 13.510  1.00 62.62  ? 46  GLU C CA   1 
ATOM   3778 C  C    . GLU D 2 46 ? -12.928 49.212 14.190  1.00 60.04  ? 46  GLU C C    1 
ATOM   3779 O  O    . GLU D 2 46 ? -13.766 48.350 14.484  1.00 58.47  ? 46  GLU C O    1 
ATOM   3780 C  CB   . GLU D 2 46 ? -11.773 48.589 12.018  0.00 66.63  ? 46  GLU C CB   1 
ATOM   3781 C  CG   . GLU D 2 46 ? -10.479 48.317 11.271  0.00 70.27  ? 46  GLU C CG   1 
ATOM   3782 C  CD   . GLU D 2 46 ? -10.678 48.226 9.769   0.00 73.62  ? 46  GLU C CD   1 
ATOM   3783 O  OE1  . GLU D 2 46 ? -11.823 48.409 9.305   0.00 74.09  ? 46  GLU C OE1  1 
ATOM   3784 O  OE2  . GLU D 2 46 ? -9.687  47.971 9.051   0.00 74.60  ? 46  GLU C OE2  1 
ATOM   3785 H  H    . GLU D 2 46 ? -10.914 47.015 13.677  1.00 75.43  ? 46  GLU C H    1 
ATOM   3786 H  HA   . GLU D 2 46 ? -10.977 49.612 13.613  1.00 75.14  ? 46  GLU C HA   1 
ATOM   3787 H  HB2  . GLU D 2 46 ? -12.345 47.813 11.913  0.00 79.95  ? 46  GLU C HB2  1 
ATOM   3788 H  HB3  . GLU D 2 46 ? -12.193 49.363 11.611  0.00 79.95  ? 46  GLU C HB3  1 
ATOM   3789 H  HG2  . GLU D 2 46 ? -9.854  49.038 11.447  0.00 84.32  ? 46  GLU C HG2  1 
ATOM   3790 H  HG3  . GLU D 2 46 ? -10.109 47.474 11.576  0.00 84.32  ? 46  GLU C HG3  1 
ATOM   3791 N  N    . GLU D 2 47 ? -13.126 50.483 14.456  1.00 59.45  ? 47  GLU C N    1 
ATOM   3792 C  CA   . GLU D 2 47 ? -14.385 50.959 14.973  1.00 59.31  ? 47  GLU C CA   1 
ATOM   3793 C  C    . GLU D 2 47 ? -15.598 50.519 14.142  1.00 55.87  ? 47  GLU C C    1 
ATOM   3794 O  O    . GLU D 2 47 ? -15.561 50.545 12.925  1.00 56.37  ? 47  GLU C O    1 
ATOM   3795 C  CB   . GLU D 2 47 ? -14.341 52.474 15.041  1.00 57.17  ? 47  GLU C CB   1 
ATOM   3796 C  CG   . GLU D 2 47 ? -15.581 53.033 15.629  1.00 60.67  ? 47  GLU C CG   1 
ATOM   3797 C  CD   . GLU D 2 47 ? -15.483 54.506 15.874  1.00 61.32  ? 47  GLU C CD   1 
ATOM   3798 O  OE1  . GLU D 2 47 ? -14.595 55.126 15.257  1.00 61.45  ? 47  GLU C OE1  1 
ATOM   3799 O  OE2  . GLU D 2 47 ? -16.294 55.033 16.677  1.00 63.86  ? 47  GLU C OE2  1 
ATOM   3800 H  H    . GLU D 2 47 ? -12.537 51.099 14.345  1.00 71.35  ? 47  GLU C H    1 
ATOM   3801 H  HA   . GLU D 2 47 ? -14.502 50.622 15.875  1.00 71.18  ? 47  GLU C HA   1 
ATOM   3802 H  HB2  . GLU D 2 47 ? -13.593 52.747 15.594  1.00 68.60  ? 47  GLU C HB2  1 
ATOM   3803 H  HB3  . GLU D 2 47 ? -14.243 52.831 14.144  1.00 68.60  ? 47  GLU C HB3  1 
ATOM   3804 H  HG2  . GLU D 2 47 ? -16.319 52.878 15.019  1.00 72.81  ? 47  GLU C HG2  1 
ATOM   3805 H  HG3  . GLU D 2 47 ? -15.754 52.597 16.478  1.00 72.81  ? 47  GLU C HG3  1 
ATOM   3806 N  N    . ILE D 2 48 ? -16.669 50.116 14.798  1.00 52.77  ? 48  ILE C N    1 
ATOM   3807 C  CA   . ILE D 2 48 ? -17.877 49.798 14.067  1.00 56.30  ? 48  ILE C CA   1 
ATOM   3808 C  C    . ILE D 2 48 ? -18.743 51.058 13.955  1.00 55.61  ? 48  ILE C C    1 
ATOM   3809 O  O    . ILE D 2 48 ? -19.102 51.685 14.955  1.00 54.58  ? 48  ILE C O    1 
ATOM   3810 C  CB   . ILE D 2 48 ? -18.672 48.685 14.735  1.00 57.22  ? 48  ILE C CB   1 
ATOM   3811 C  CG1  . ILE D 2 48 ? -17.805 47.439 14.788  1.00 58.47  ? 48  ILE C CG1  1 
ATOM   3812 C  CG2  . ILE D 2 48 ? -19.962 48.399 13.958  1.00 56.76  ? 48  ILE C CG2  1 
ATOM   3813 C  CD1  . ILE D 2 48 ? -18.401 46.256 15.511  1.00 57.04  ? 48  ILE C CD1  1 
ATOM   3814 H  H    . ILE D 2 48 ? -16.724 50.020 15.651  1.00 63.33  ? 48  ILE C H    1 
ATOM   3815 H  HA   . ILE D 2 48 ? -17.643 49.509 13.172  1.00 67.56  ? 48  ILE C HA   1 
ATOM   3816 H  HB   . ILE D 2 48 ? -18.899 48.954 15.640  1.00 68.66  ? 48  ILE C HB   1 
ATOM   3817 H  HG12 . ILE D 2 48 ? -17.618 47.159 13.878  1.00 70.17  ? 48  ILE C HG12 1 
ATOM   3818 H  HG13 . ILE D 2 48 ? -16.974 47.663 15.235  1.00 70.17  ? 48  ILE C HG13 1 
ATOM   3819 H  HG21 . ILE D 2 48 ? -20.448 47.688 14.405  1.00 68.11  ? 48  ILE C HG21 1 
ATOM   3820 H  HG22 . ILE D 2 48 ? -20.502 49.205 13.935  1.00 68.11  ? 48  ILE C HG22 1 
ATOM   3821 H  HG23 . ILE D 2 48 ? -19.733 48.128 13.056  1.00 68.11  ? 48  ILE C HG23 1 
ATOM   3822 H  HD11 . ILE D 2 48 ? -17.770 45.520 15.485  1.00 68.44  ? 48  ILE C HD11 1 
ATOM   3823 H  HD12 . ILE D 2 48 ? -18.581 46.507 16.430  1.00 68.44  ? 48  ILE C HD12 1 
ATOM   3824 H  HD13 . ILE D 2 48 ? -19.226 46.000 15.070  1.00 68.44  ? 48  ILE C HD13 1 
ATOM   3825 N  N    . LYS D 2 49 ? -19.046 51.428 12.718  1.00 55.79  ? 49  LYS C N    1 
ATOM   3826 C  CA   . LYS D 2 49 ? -19.832 52.623 12.445  1.00 58.37  ? 49  LYS C CA   1 
ATOM   3827 C  C    . LYS D 2 49 ? -21.087 52.323 11.627  1.00 53.93  ? 49  LYS C C    1 
ATOM   3828 O  O    . LYS D 2 49 ? -22.146 52.832 11.900  1.00 54.90  ? 49  LYS C O    1 
ATOM   3829 C  CB   . LYS D 2 49 ? -18.982 53.602 11.671  1.00 54.43  ? 49  LYS C CB   1 
ATOM   3830 C  CG   . LYS D 2 49 ? -17.764 54.049 12.341  1.00 52.55  ? 49  LYS C CG   1 
ATOM   3831 C  CD   . LYS D 2 49 ? -17.061 54.911 11.295  1.00 56.55  ? 49  LYS C CD   1 
ATOM   3832 C  CE   . LYS D 2 49 ? -15.806 55.619 11.766  1.00 59.52  ? 49  LYS C CE   1 
ATOM   3833 N  NZ   . LYS D 2 49 ? -15.194 56.272 10.578  1.00 68.02  ? 49  LYS C NZ   1 
ATOM   3834 H  H    . LYS D 2 49 ? -18.806 51.000 12.012  1.00 66.95  ? 49  LYS C H    1 
ATOM   3835 H  HA   . LYS D 2 49 ? -20.098 53.036 13.281  1.00 70.04  ? 49  LYS C HA   1 
ATOM   3836 H  HB2  . LYS D 2 49 ? -18.718 53.185 10.836  1.00 65.32  ? 49  LYS C HB2  1 
ATOM   3837 H  HB3  . LYS D 2 49 ? -19.516 54.390 11.485  1.00 65.32  ? 49  LYS C HB3  1 
ATOM   3838 H  HG2  . LYS D 2 49 ? -17.978 54.588 13.118  1.00 63.06  ? 49  LYS C HG2  1 
ATOM   3839 H  HG3  . LYS D 2 49 ? -17.202 53.292 12.571  1.00 63.06  ? 49  LYS C HG3  1 
ATOM   3840 H  HD2  . LYS D 2 49 ? -16.813 54.345 10.548  1.00 67.86  ? 49  LYS C HD2  1 
ATOM   3841 H  HD3  . LYS D 2 49 ? -17.682 55.592 10.992  1.00 67.86  ? 49  LYS C HD3  1 
ATOM   3842 H  HE2  . LYS D 2 49 ? -16.032 56.299 12.420  1.00 71.43  ? 49  LYS C HE2  1 
ATOM   3843 H  HE3  . LYS D 2 49 ? -15.178 54.976 12.132  1.00 71.43  ? 49  LYS C HE3  1 
ATOM   3844 H  HZ1  . LYS D 2 49 ? -14.451 56.700 10.815  1.00 81.62  ? 49  LYS C HZ1  1 
ATOM   3845 H  HZ2  . LYS D 2 49 ? -14.992 55.659 9.965   1.00 81.62  ? 49  LYS C HZ2  1 
ATOM   3846 H  HZ3  . LYS D 2 49 ? -15.765 56.856 10.225  1.00 81.62  ? 49  LYS C HZ3  1 
ATOM   3847 N  N    . GLU D 2 50 ? -20.958 51.410 10.690  1.00 55.26  ? 50  GLU C N    1 
ATOM   3848 C  CA   . GLU D 2 50 ? -22.038 51.057 9.804   1.00 58.23  ? 50  GLU C CA   1 
ATOM   3849 C  C    . GLU D 2 50 ? -22.877 49.980 10.416  1.00 62.97  ? 50  GLU C C    1 
ATOM   3850 O  O    . GLU D 2 50 ? -22.373 49.088 11.083  1.00 66.96  ? 50  GLU C O    1 
ATOM   3851 C  CB   . GLU D 2 50 ? -21.529 50.572 8.451   1.00 58.25  ? 50  GLU C CB   1 
ATOM   3852 C  CG   . GLU D 2 50 ? -20.764 51.594 7.659   1.00 60.53  ? 50  GLU C CG   1 
ATOM   3853 C  CD   . GLU D 2 50 ? -21.499 52.952 7.499   1.00 60.72  ? 50  GLU C CD   1 
ATOM   3854 O  OE1  . GLU D 2 50 ? -22.746 53.080 7.720   1.00 59.37  ? 50  GLU C OE1  1 
ATOM   3855 O  OE2  . GLU D 2 50 ? -20.793 53.894 7.097   1.00 55.16  ? 50  GLU C OE2  1 
ATOM   3856 H  H    . GLU D 2 50 ? -20.233 50.969 10.544  1.00 66.32  ? 50  GLU C H    1 
ATOM   3857 H  HA   . GLU D 2 50 ? -22.600 51.834 9.657   1.00 69.87  ? 50  GLU C HA   1 
ATOM   3858 H  HB2  . GLU D 2 50 ? -20.941 49.815 8.596   1.00 69.90  ? 50  GLU C HB2  1 
ATOM   3859 H  HB3  . GLU D 2 50 ? -22.289 50.296 7.915   1.00 69.90  ? 50  GLU C HB3  1 
ATOM   3860 H  HG2  . GLU D 2 50 ? -19.920 51.765 8.104   1.00 72.64  ? 50  GLU C HG2  1 
ATOM   3861 H  HG3  . GLU D 2 50 ? -20.600 51.241 6.770   1.00 72.64  ? 50  GLU C HG3  1 
ATOM   3862 N  N    . GLN D 2 51 ? -24.176 50.129 10.269  1.00 64.89  ? 51  GLN C N    1 
ATOM   3863 C  CA   . GLN D 2 51 ? -25.125 49.117 10.697  1.00 65.80  ? 51  GLN C CA   1 
ATOM   3864 C  C    . GLN D 2 51 ? -24.867 47.708 10.135  1.00 65.23  ? 51  GLN C C    1 
ATOM   3865 O  O    . GLN D 2 51 ? -24.894 46.725 10.867  1.00 64.37  ? 51  GLN C O    1 
ATOM   3866 C  CB   . GLN D 2 51 ? -26.522 49.592 10.296  1.00 60.86  ? 51  GLN C CB   1 
ATOM   3867 C  CG   . GLN D 2 51 ? -27.624 48.720 10.711  1.00 61.14  ? 51  GLN C CG   1 
ATOM   3868 C  CD   . GLN D 2 51 ? -27.572 48.420 12.170  1.00 65.54  ? 51  GLN C CD   1 
ATOM   3869 O  OE1  . GLN D 2 51 ? -27.228 47.298 12.560  1.00 67.59  ? 51  GLN C OE1  1 
ATOM   3870 N  NE2  . GLN D 2 51 ? -27.824 49.435 12.999  1.00 64.43  ? 51  GLN C NE2  1 
ATOM   3871 H  H    . GLN D 2 51 ? -24.545 50.821 9.917   1.00 77.87  ? 51  GLN C H    1 
ATOM   3872 H  HA   . GLN D 2 51 ? -25.100 49.056 11.665  1.00 78.96  ? 51  GLN C HA   1 
ATOM   3873 H  HB2  . GLN D 2 51 ? -26.675 50.464 10.694  1.00 73.03  ? 51  GLN C HB2  1 
ATOM   3874 H  HB3  . GLN D 2 51 ? -26.556 49.666 9.330   1.00 73.03  ? 51  GLN C HB3  1 
ATOM   3875 H  HG2  . GLN D 2 51 ? -28.467 49.159 10.521  1.00 73.37  ? 51  GLN C HG2  1 
ATOM   3876 H  HG3  . GLN D 2 51 ? -27.566 47.881 10.227  1.00 73.37  ? 51  GLN C HG3  1 
ATOM   3877 H  HE21 . GLN D 2 51 ? -28.005 50.215 12.683  1.00 77.31  ? 51  GLN C HE21 1 
ATOM   3878 H  HE22 . GLN D 2 51 ? -27.806 49.310 13.850  1.00 77.31  ? 51  GLN C HE22 1 
ATOM   3879 N  N    . GLU D 2 52 ? -24.567 47.626 8.849   1.00 65.97  ? 52  GLU C N    1 
ATOM   3880 C  CA   . GLU D 2 52 ? -24.405 46.345 8.187   1.00 63.78  ? 52  GLU C CA   1 
ATOM   3881 C  C    . GLU D 2 52 ? -23.222 45.611 8.796   1.00 65.38  ? 52  GLU C C    1 
ATOM   3882 O  O    . GLU D 2 52 ? -23.232 44.400 8.860   1.00 65.12  ? 52  GLU C O    1 
ATOM   3883 C  CB   . GLU D 2 52 ? -24.249 46.548 6.688   0.00 64.53  ? 52  GLU C CB   1 
ATOM   3884 C  CG   . GLU D 2 52 ? -25.507 47.153 6.085   0.00 63.31  ? 52  GLU C CG   1 
ATOM   3885 C  CD   . GLU D 2 52 ? -25.588 48.664 6.250   0.00 62.77  ? 52  GLU C CD   1 
ATOM   3886 O  OE1  . GLU D 2 52 ? -24.675 49.253 6.866   0.00 63.43  ? 52  GLU C OE1  1 
ATOM   3887 O  OE2  . GLU D 2 52 ? -26.578 49.263 5.780   0.00 62.00  ? 52  GLU C OE2  1 
ATOM   3888 H  H    . GLU D 2 52 ? -24.451 48.304 8.333   1.00 79.16  ? 52  GLU C H    1 
ATOM   3889 H  HA   . GLU D 2 52 ? -25.199 45.809 8.336   1.00 76.53  ? 52  GLU C HA   1 
ATOM   3890 H  HB2  . GLU D 2 52 ? -23.509 47.152 6.520   0.00 77.44  ? 52  GLU C HB2  1 
ATOM   3891 H  HB3  . GLU D 2 52 ? -24.088 45.691 6.262   0.00 77.44  ? 52  GLU C HB3  1 
ATOM   3892 H  HG2  . GLU D 2 52 ? -25.527 46.955 5.136   0.00 75.97  ? 52  GLU C HG2  1 
ATOM   3893 H  HG3  . GLU D 2 52 ? -26.282 46.764 6.520   0.00 75.97  ? 52  GLU C HG3  1 
ATOM   3894 N  N    . VAL D 2 53 ? -22.232 46.337 9.308   1.00 64.67  ? 53  VAL C N    1 
ATOM   3895 C  CA   . VAL D 2 53 ? -21.125 45.681 10.011  1.00 65.44  ? 53  VAL C CA   1 
ATOM   3896 C  C    . VAL D 2 53 ? -21.595 45.081 11.337  1.00 63.43  ? 53  VAL C C    1 
ATOM   3897 O  O    . VAL D 2 53 ? -21.270 43.946 11.652  1.00 63.38  ? 53  VAL C O    1 
ATOM   3898 C  CB   . VAL D 2 53 ? -19.948 46.658 10.272  1.00 62.62  ? 53  VAL C CB   1 
ATOM   3899 C  CG1  . VAL D 2 53 ? -18.889 46.057 11.174  1.00 59.69  ? 53  VAL C CG1  1 
ATOM   3900 C  CG2  . VAL D 2 53 ? -19.318 47.039 8.980   1.00 64.75  ? 53  VAL C CG2  1 
ATOM   3901 H  H    . VAL D 2 53 ? -22.174 47.194 9.265   1.00 77.60  ? 53  VAL C H    1 
ATOM   3902 H  HA   . VAL D 2 53 ? -20.791 44.956 9.460   1.00 78.53  ? 53  VAL C HA   1 
ATOM   3903 H  HB   . VAL D 2 53 ? -20.287 47.463 10.695  1.00 75.14  ? 53  VAL C HB   1 
ATOM   3904 H  HG11 . VAL D 2 53 ? -18.180 46.706 11.304  1.00 71.63  ? 53  VAL C HG11 1 
ATOM   3905 H  HG12 . VAL D 2 53 ? -19.292 45.831 12.027  1.00 71.63  ? 53  VAL C HG12 1 
ATOM   3906 H  HG13 . VAL D 2 53 ? -18.533 45.258 10.754  1.00 71.63  ? 53  VAL C HG13 1 
ATOM   3907 H  HG21 . VAL D 2 53 ? -18.584 47.649 9.155   1.00 77.70  ? 53  VAL C HG21 1 
ATOM   3908 H  HG22 . VAL D 2 53 ? -18.986 46.239 8.543   1.00 77.70  ? 53  VAL C HG22 1 
ATOM   3909 H  HG23 . VAL D 2 53 ? -19.982 47.471 8.420   1.00 77.70  ? 53  VAL C HG23 1 
ATOM   3910 N  N    . VAL D 2 54 ? -22.326 45.856 12.118  1.00 62.91  ? 54  VAL C N    1 
ATOM   3911 C  CA   . VAL D 2 54 ? -22.955 45.351 13.324  1.00 64.31  ? 54  VAL C CA   1 
ATOM   3912 C  C    . VAL D 2 54 ? -23.725 44.071 13.043  1.00 65.45  ? 54  VAL C C    1 
ATOM   3913 O  O    . VAL D 2 54 ? -23.467 43.027 13.642  1.00 62.73  ? 54  VAL C O    1 
ATOM   3914 C  CB   . VAL D 2 54 ? -23.942 46.411 13.923  1.00 63.64  ? 54  VAL C CB   1 
ATOM   3915 C  CG1  . VAL D 2 54 ? -24.675 45.903 15.113  1.00 63.50  ? 54  VAL C CG1  1 
ATOM   3916 C  CG2  . VAL D 2 54 ? -23.213 47.654 14.280  1.00 70.20  ? 54  VAL C CG2  1 
ATOM   3917 H  H    . VAL D 2 54 ? -22.475 46.690 11.970  1.00 75.49  ? 54  VAL C H    1 
ATOM   3918 H  HA   . VAL D 2 54 ? -22.273 45.159 13.987  1.00 77.17  ? 54  VAL C HA   1 
ATOM   3919 H  HB   . VAL D 2 54 ? -24.600 46.638 13.248  1.00 76.37  ? 54  VAL C HB   1 
ATOM   3920 H  HG11 . VAL D 2 54 ? -25.268 46.599 15.439  1.00 76.20  ? 54  VAL C HG11 1 
ATOM   3921 H  HG12 . VAL D 2 54 ? -25.190 45.122 14.857  1.00 76.20  ? 54  VAL C HG12 1 
ATOM   3922 H  HG13 . VAL D 2 54 ? -24.034 45.666 15.801  1.00 76.20  ? 54  VAL C HG13 1 
ATOM   3923 H  HG21 . VAL D 2 54 ? -23.843 48.293 14.648  1.00 84.24  ? 54  VAL C HG21 1 
ATOM   3924 H  HG22 . VAL D 2 54 ? -22.533 47.443 14.938  1.00 84.24  ? 54  VAL C HG22 1 
ATOM   3925 H  HG23 . VAL D 2 54 ? -22.800 48.017 13.481  1.00 84.24  ? 54  VAL C HG23 1 
ATOM   3926 N  N    . ASP D 2 55 ? -24.627 44.147 12.069  1.00 68.02  ? 55  ASP C N    1 
ATOM   3927 C  CA   . ASP D 2 55 ? -25.516 43.032 11.771  1.00 67.39  ? 55  ASP C CA   1 
ATOM   3928 C  C    . ASP D 2 55 ? -24.728 41.779 11.414  1.00 63.30  ? 55  ASP C C    1 
ATOM   3929 O  O    . ASP D 2 55 ? -25.110 40.705 11.840  1.00 62.80  ? 55  ASP C O    1 
ATOM   3930 C  CB   . ASP D 2 55 ? -26.522 43.390 10.656  1.00 68.64  ? 55  ASP C CB   1 
ATOM   3931 C  CG   . ASP D 2 55 ? -27.454 44.569 11.032  1.00 68.16  ? 55  ASP C CG   1 
ATOM   3932 O  OD1  . ASP D 2 55 ? -27.933 44.676 12.190  1.00 64.52  ? 55  ASP C OD1  1 
ATOM   3933 O  OD2  . ASP D 2 55 ? -27.766 45.359 10.121  1.00 70.57  ? 55  ASP C OD2  1 
ATOM   3934 H  H    . ASP D 2 55 ? -24.743 44.834 11.565  1.00 81.63  ? 55  ASP C H    1 
ATOM   3935 H  HA   . ASP D 2 55 ? -26.030 42.832 12.569  1.00 80.86  ? 55  ASP C HA   1 
ATOM   3936 H  HB2  . ASP D 2 55 ? -26.032 43.640 9.858   1.00 82.36  ? 55  ASP C HB2  1 
ATOM   3937 H  HB3  . ASP D 2 55 ? -27.078 42.616 10.474  1.00 82.36  ? 55  ASP C HB3  1 
ATOM   3938 N  N    . LYS D 2 56 ? -23.679 41.927 10.605  1.00 61.39  ? 56  LYS C N    1 
ATOM   3939 C  CA   . LYS D 2 56 ? -22.832 40.813 10.174  1.00 62.88  ? 56  LYS C CA   1 
ATOM   3940 C  C    . LYS D 2 56 ? -22.068 40.177 11.359  1.00 62.83  ? 56  LYS C C    1 
ATOM   3941 O  O    . LYS D 2 56 ? -21.873 38.960 11.399  1.00 62.15  ? 56  LYS C O    1 
ATOM   3942 C  CB   . LYS D 2 56 ? -21.858 41.263 9.073   1.00 60.09  ? 56  LYS C CB   1 
ATOM   3943 C  CG   . LYS D 2 56 ? -22.521 41.559 7.730   0.00 63.84  ? 56  LYS C CG   1 
ATOM   3944 C  CD   . LYS D 2 56 ? -23.074 40.305 7.063   0.00 65.77  ? 56  LYS C CD   1 
ATOM   3945 C  CE   . LYS D 2 56 ? -23.875 40.650 5.816   0.00 67.32  ? 56  LYS C CE   1 
ATOM   3946 N  NZ   . LYS D 2 56 ? -24.409 39.437 5.136   0.00 67.57  ? 56  LYS C NZ   1 
ATOM   3947 H  H    . LYS D 2 56 ? -23.432 42.685 10.283  1.00 73.67  ? 56  LYS C H    1 
ATOM   3948 H  HA   . LYS D 2 56 ? -23.401 40.126 9.794   1.00 75.46  ? 56  LYS C HA   1 
ATOM   3949 H  HB2  . LYS D 2 56 ? -21.411 42.072 9.366   1.00 72.10  ? 56  LYS C HB2  1 
ATOM   3950 H  HB3  . LYS D 2 56 ? -21.204 40.561 8.931   1.00 72.10  ? 56  LYS C HB3  1 
ATOM   3951 H  HG2  . LYS D 2 56 ? -23.257 42.175 7.868   0.00 76.61  ? 56  LYS C HG2  1 
ATOM   3952 H  HG3  . LYS D 2 56 ? -21.866 41.952 7.133   0.00 76.61  ? 56  LYS C HG3  1 
ATOM   3953 H  HD2  . LYS D 2 56 ? -22.339 39.728 6.803   0.00 78.92  ? 56  LYS C HD2  1 
ATOM   3954 H  HD3  . LYS D 2 56 ? -23.660 39.844 7.684   0.00 78.92  ? 56  LYS C HD3  1 
ATOM   3955 H  HE2  . LYS D 2 56 ? -24.626 41.211 6.065   0.00 80.79  ? 56  LYS C HE2  1 
ATOM   3956 H  HE3  . LYS D 2 56 ? -23.302 41.119 5.190   0.00 80.79  ? 56  LYS C HE3  1 
ATOM   3957 H  HZ1  . LYS D 2 56 ? -24.870 39.673 4.412   0.00 81.08  ? 56  LYS C HZ1  1 
ATOM   3958 H  HZ2  . LYS D 2 56 ? -23.738 38.907 4.890   0.00 81.08  ? 56  LYS C HZ2  1 
ATOM   3959 H  HZ3  . LYS D 2 56 ? -24.944 38.990 5.688   0.00 81.08  ? 56  LYS C HZ3  1 
ATOM   3960 N  N    . VAL D 2 57 ? -21.580 40.991 12.290  1.00 63.29  ? 57  VAL C N    1 
ATOM   3961 C  CA   . VAL D 2 57 ? -20.919 40.453 13.482  1.00 60.40  ? 57  VAL C CA   1 
ATOM   3962 C  C    . VAL D 2 57 ? -21.924 39.666 14.284  1.00 60.91  ? 57  VAL C C    1 
ATOM   3963 O  O    . VAL D 2 57 ? -21.676 38.524 14.685  1.00 60.72  ? 57  VAL C O    1 
ATOM   3964 C  CB   . VAL D 2 57 ? -20.327 41.550 14.374  1.00 58.64  ? 57  VAL C CB   1 
ATOM   3965 C  CG1  . VAL D 2 57 ? -19.740 40.977 15.657  1.00 52.22  ? 57  VAL C CG1  1 
ATOM   3966 C  CG2  . VAL D 2 57 ? -19.285 42.333 13.604  1.00 58.82  ? 57  VAL C CG2  1 
ATOM   3967 H  H    . VAL D 2 57 ? -21.617 41.849 12.260  1.00 75.95  ? 57  VAL C H    1 
ATOM   3968 H  HA   . VAL D 2 57 ? -20.204 39.855 13.213  1.00 72.48  ? 57  VAL C HA   1 
ATOM   3969 H  HB   . VAL D 2 57 ? -21.035 42.165 14.623  1.00 70.37  ? 57  VAL C HB   1 
ATOM   3970 H  HG11 . VAL D 2 57 ? -19.378 41.703 16.190  1.00 62.66  ? 57  VAL C HG11 1 
ATOM   3971 H  HG12 . VAL D 2 57 ? -20.441 40.523 16.149  1.00 62.66  ? 57  VAL C HG12 1 
ATOM   3972 H  HG13 . VAL D 2 57 ? -19.036 40.350 15.429  1.00 62.66  ? 57  VAL C HG13 1 
ATOM   3973 H  HG21 . VAL D 2 57 ? -18.920 43.023 14.180  1.00 70.58  ? 57  VAL C HG21 1 
ATOM   3974 H  HG22 . VAL D 2 57 ? -18.581 41.729 13.323  1.00 70.58  ? 57  VAL C HG22 1 
ATOM   3975 H  HG23 . VAL D 2 57 ? -19.705 42.738 12.829  1.00 70.58  ? 57  VAL C HG23 1 
ATOM   3976 N  N    . MET D 2 58 ? -23.072 40.275 14.526  1.00 61.17  ? 58  MET C N    1 
ATOM   3977 C  CA   . MET D 2 58 ? -24.081 39.592 15.301  1.00 61.62  ? 58  MET C CA   1 
ATOM   3978 C  C    . MET D 2 58 ? -24.504 38.277 14.587  1.00 64.52  ? 58  MET C C    1 
ATOM   3979 O  O    . MET D 2 58 ? -24.743 37.248 15.253  1.00 63.71  ? 58  MET C O    1 
ATOM   3980 C  CB   . MET D 2 58 ? -25.280 40.489 15.555  1.00 58.63  ? 58  MET C CB   1 
ATOM   3981 C  CG   . MET D 2 58 ? -26.215 39.826 16.513  1.00 62.33  ? 58  MET C CG   1 
ATOM   3982 S  SD   . MET D 2 58 ? -25.474 39.644 18.147  1.00 59.66  ? 58  MET C SD   1 
ATOM   3983 C  CE   . MET D 2 58 ? -26.103 41.120 18.914  1.00 59.15  ? 58  MET C CE   1 
ATOM   3984 H  H    . MET D 2 58 ? -23.286 41.064 14.259  1.00 73.41  ? 58  MET C H    1 
ATOM   3985 H  HA   . MET D 2 58 ? -23.702 39.364 16.165  1.00 73.95  ? 58  MET C HA   1 
ATOM   3986 H  HB2  . MET D 2 58 ? -24.984 41.328 15.942  1.00 70.36  ? 58  MET C HB2  1 
ATOM   3987 H  HB3  . MET D 2 58 ? -25.752 40.646 14.721  1.00 70.36  ? 58  MET C HB3  1 
ATOM   3988 H  HG2  . MET D 2 58 ? -27.017 40.365 16.602  1.00 74.80  ? 58  MET C HG2  1 
ATOM   3989 H  HG3  . MET D 2 58 ? -26.439 38.943 16.181  1.00 74.80  ? 58  MET C HG3  1 
ATOM   3990 H  HE1  . MET D 2 58 ? -25.791 41.892 18.416  1.00 70.98  ? 58  MET C HE1  1 
ATOM   3991 H  HE2  . MET D 2 58 ? -27.072 41.090 18.907  1.00 70.98  ? 58  MET C HE2  1 
ATOM   3992 H  HE3  . MET D 2 58 ? -25.779 41.163 19.827  1.00 70.98  ? 58  MET C HE3  1 
ATOM   3993 N  N    . GLU D 2 59 ? -24.573 38.306 13.248  1.00 63.82  ? 59  GLU C N    1 
ATOM   3994 C  CA   . GLU D 2 59 ? -24.895 37.103 12.461  1.00 63.71  ? 59  GLU C CA   1 
ATOM   3995 C  C    . GLU D 2 59 ? -23.934 35.962 12.771  1.00 62.13  ? 59  GLU C C    1 
ATOM   3996 O  O    . GLU D 2 59 ? -24.328 34.785 12.854  1.00 62.90  ? 59  GLU C O    1 
ATOM   3997 C  CB   . GLU D 2 59 ? -24.845 37.386 10.941  1.00 60.51  ? 59  GLU C CB   1 
ATOM   3998 C  CG   . GLU D 2 59 ? -26.101 38.040 10.377  0.00 61.27  ? 59  GLU C CG   1 
ATOM   3999 C  CD   . GLU D 2 59 ? -25.995 38.320 8.889   0.00 62.41  ? 59  GLU C CD   1 
ATOM   4000 O  OE1  . GLU D 2 59 ? -25.326 37.537 8.182   0.00 62.45  ? 59  GLU C OE1  1 
ATOM   4001 O  OE2  . GLU D 2 59 ? -26.583 39.319 8.426   0.00 63.57  ? 59  GLU C OE2  1 
ATOM   4002 H  H    . GLU D 2 59 ? -24.437 39.009 12.772  1.00 76.58  ? 59  GLU C H    1 
ATOM   4003 H  HA   . GLU D 2 59 ? -25.792 36.810 12.684  1.00 76.46  ? 59  GLU C HA   1 
ATOM   4004 H  HB2  . GLU D 2 59 ? -24.099 37.979 10.761  1.00 72.62  ? 59  GLU C HB2  1 
ATOM   4005 H  HB3  . GLU D 2 59 ? -24.716 36.546 10.473  1.00 72.62  ? 59  GLU C HB3  1 
ATOM   4006 H  HG2  . GLU D 2 59 ? -26.857 37.448 10.518  0.00 73.53  ? 59  GLU C HG2  1 
ATOM   4007 H  HG3  . GLU D 2 59 ? -26.250 38.884 10.832  0.00 73.53  ? 59  GLU C HG3  1 
ATOM   4008 N  N    . THR D 2 60 ? -22.666 36.323 12.906  1.00 60.62  ? 60  THR C N    1 
ATOM   4009 C  CA   . THR D 2 60 ? -21.633 35.367 13.241  1.00 60.01  ? 60  THR C CA   1 
ATOM   4010 C  C    . THR D 2 60 ? -21.736 34.880 14.701  1.00 62.45  ? 60  THR C C    1 
ATOM   4011 O  O    . THR D 2 60 ? -21.650 33.689 14.959  1.00 63.73  ? 60  THR C O    1 
ATOM   4012 C  CB   . THR D 2 60 ? -20.241 35.963 13.009  1.00 61.35  ? 60  THR C CB   1 
ATOM   4013 O  OG1  . THR D 2 60 ? -20.134 36.536 11.685  1.00 62.06  ? 60  THR C OG1  1 
ATOM   4014 C  CG2  . THR D 2 60 ? -19.186 34.890 13.228  1.00 64.79  ? 60  THR C CG2  1 
ATOM   4015 H  H    . THR D 2 60 ? -22.378 37.127 12.806  1.00 72.74  ? 60  THR C H    1 
ATOM   4016 H  HA   . THR D 2 60 ? -21.725 34.593 12.663  1.00 72.01  ? 60  THR C HA   1 
ATOM   4017 H  HB   . THR D 2 60 ? -20.090 36.662 13.664  1.00 73.63  ? 60  THR C HB   1 
ATOM   4018 H  HG1  . THR D 2 60 ? -20.703 37.147 11.589  1.00 74.47  ? 60  THR C HG1  1 
ATOM   4019 H  HG21 . THR D 2 60 ? -18.302 35.261 13.083  1.00 77.75  ? 60  THR C HG21 1 
ATOM   4020 H  HG22 . THR D 2 60 ? -19.241 34.552 14.135  1.00 77.75  ? 60  THR C HG22 1 
ATOM   4021 H  HG23 . THR D 2 60 ? -19.326 34.157 12.609  1.00 77.75  ? 60  THR C HG23 1 
ATOM   4022 N  N    . LEU D 2 61 ? -21.941 35.787 15.655  1.00 63.05  ? 61  LEU C N    1 
ATOM   4023 C  CA   . LEU D 2 61 ? -21.841 35.402 17.071  1.00 63.18  ? 61  LEU C CA   1 
ATOM   4024 C  C    . LEU D 2 61 ? -23.094 34.722 17.562  1.00 62.77  ? 61  LEU C C    1 
ATOM   4025 O  O    . LEU D 2 61 ? -23.019 33.836 18.416  1.00 61.42  ? 61  LEU C O    1 
ATOM   4026 C  CB   . LEU D 2 61 ? -21.556 36.603 17.983  1.00 57.79  ? 61  LEU C CB   1 
ATOM   4027 C  CG   . LEU D 2 61 ? -20.256 37.359 17.714  1.00 59.22  ? 61  LEU C CG   1 
ATOM   4028 C  CD1  . LEU D 2 61 ? -20.064 38.425 18.805  1.00 56.45  ? 61  LEU C CD1  1 
ATOM   4029 C  CD2  . LEU D 2 61 ? -19.012 36.458 17.524  1.00 59.61  ? 61  LEU C CD2  1 
ATOM   4030 H  H    . LEU D 2 61 ? -22.135 36.614 15.518  1.00 75.66  ? 61  LEU C H    1 
ATOM   4031 H  HA   . LEU D 2 61 ? -21.108 34.776 17.170  1.00 75.82  ? 61  LEU C HA   1 
ATOM   4032 H  HB2  . LEU D 2 61 ? -22.284 37.237 17.887  1.00 69.35  ? 61  LEU C HB2  1 
ATOM   4033 H  HB3  . LEU D 2 61 ? -21.522 36.287 18.899  1.00 69.35  ? 61  LEU C HB3  1 
ATOM   4034 H  HG   . LEU D 2 61 ? -20.371 37.841 16.880  1.00 71.06  ? 61  LEU C HG   1 
ATOM   4035 H  HD11 . LEU D 2 61 ? -19.238 38.906 18.634  1.00 67.75  ? 61  LEU C HD11 1 
ATOM   4036 H  HD12 . LEU D 2 61 ? -20.815 39.039 18.782  1.00 67.75  ? 61  LEU C HD12 1 
ATOM   4037 H  HD13 . LEU D 2 61 ? -20.020 37.988 19.669  1.00 67.75  ? 61  LEU C HD13 1 
ATOM   4038 H  HD21 . LEU D 2 61 ? -18.238 37.019 17.359  1.00 71.53  ? 61  LEU C HD21 1 
ATOM   4039 H  HD22 . LEU D 2 61 ? -18.877 35.934 18.328  1.00 71.53  ? 61  LEU C HD22 1 
ATOM   4040 H  HD23 . LEU D 2 61 ? -19.162 35.870 16.767  1.00 71.53  ? 61  LEU C HD23 1 
ATOM   4041 N  N    . ASP D 2 62 ? -24.234 35.190 17.055  1.00 64.13  ? 62  ASP C N    1 
ATOM   4042 C  CA   . ASP D 2 62 ? -25.535 34.645 17.410  1.00 67.13  ? 62  ASP C CA   1 
ATOM   4043 C  C    . ASP D 2 62 ? -25.597 33.263 16.792  1.00 67.01  ? 62  ASP C C    1 
ATOM   4044 O  O    . ASP D 2 62 ? -25.857 33.107 15.602  1.00 69.72  ? 62  ASP C O    1 
ATOM   4045 C  CB   . ASP D 2 62 ? -26.669 35.532 16.894  1.00 67.48  ? 62  ASP C CB   1 
ATOM   4046 C  CG   . ASP D 2 62 ? -28.044 34.941 17.162  1.00 69.19  ? 62  ASP C CG   1 
ATOM   4047 O  OD1  . ASP D 2 62 ? -28.191 34.242 18.197  1.00 68.43  ? 62  ASP C OD1  1 
ATOM   4048 O  OD2  . ASP D 2 62 ? -28.959 35.175 16.327  1.00 67.04  ? 62  ASP C OD2  1 
ATOM   4049 H  H    . ASP D 2 62 ? -24.276 35.838 16.491  1.00 76.96  ? 62  ASP C H    1 
ATOM   4050 H  HA   . ASP D 2 62 ? -25.609 34.564 18.374  1.00 80.55  ? 62  ASP C HA   1 
ATOM   4051 H  HB2  . ASP D 2 62 ? -26.621 36.394 17.336  1.00 80.98  ? 62  ASP C HB2  1 
ATOM   4052 H  HB3  . ASP D 2 62 ? -26.572 35.644 15.936  1.00 80.98  ? 62  ASP C HB3  1 
ATOM   4053 N  N    . ASN D 2 63 ? -25.326 32.260 17.615  1.00 68.05  ? 63  ASN C N    1 
ATOM   4054 C  CA   . ASN D 2 63 ? -25.279 30.897 17.153  1.00 65.83  ? 63  ASN C CA   1 
ATOM   4055 C  C    . ASN D 2 63 ? -26.631 30.320 17.510  1.00 72.03  ? 63  ASN C C    1 
ATOM   4056 O  O    . ASN D 2 63 ? -27.023 29.295 16.929  1.00 74.46  ? 63  ASN C O    1 
ATOM   4057 C  CB   . ASN D 2 63 ? -24.131 30.117 17.795  1.00 62.18  ? 63  ASN C CB   1 
ATOM   4058 C  CG   . ASN D 2 63 ? -22.771 30.555 17.302  0.00 64.79  ? 63  ASN C CG   1 
ATOM   4059 O  OD1  . ASN D 2 63 ? -22.637 31.109 16.211  0.00 64.92  ? 63  ASN C OD1  1 
ATOM   4060 N  ND2  . ASN D 2 63 ? -21.748 30.306 18.111  0.00 64.08  ? 63  ASN C ND2  1 
ATOM   4061 H  H    . ASN D 2 63 ? -25.165 32.351 18.455  1.00 81.66  ? 63  ASN C H    1 
ATOM   4062 H  HA   . ASN D 2 63 ? -25.172 30.878 16.189  1.00 79.00  ? 63  ASN C HA   1 
ATOM   4063 H  HB2  . ASN D 2 63 ? -24.158 30.250 18.756  1.00 74.62  ? 63  ASN C HB2  1 
ATOM   4064 H  HB3  . ASN D 2 63 ? -24.235 29.175 17.588  1.00 74.62  ? 63  ASN C HB3  1 
ATOM   4065 H  HD21 . ASN D 2 63 ? -20.952 30.535 17.880  0.00 76.90  ? 63  ASN C HD21 1 
ATOM   4066 H  HD22 . ASN D 2 63 ? -21.881 29.916 18.866  0.00 76.90  ? 63  ASN C HD22 1 
ATOM   4067 N  N    . ASP D 2 64 ? -27.375 30.985 18.419  1.00 69.15  ? 64  ASP C N    1 
ATOM   4068 C  CA   . ASP D 2 64 ? -28.706 30.476 18.755  1.00 67.51  ? 64  ASP C CA   1 
ATOM   4069 C  C    . ASP D 2 64 ? -29.843 31.267 18.099  1.00 68.16  ? 64  ASP C C    1 
ATOM   4070 O  O    . ASP D 2 64 ? -30.988 31.158 18.518  1.00 68.36  ? 64  ASP C O    1 
ATOM   4071 C  CB   . ASP D 2 64 ? -28.923 30.393 20.289  1.00 69.48  ? 64  ASP C CB   1 
ATOM   4072 C  CG   . ASP D 2 64 ? -29.141 31.724 20.972  1.00 69.65  ? 64  ASP C CG   1 
ATOM   4073 O  OD1  . ASP D 2 64 ? -29.935 32.536 20.487  1.00 69.35  ? 64  ASP C OD1  1 
ATOM   4074 O  OD2  . ASP D 2 64 ? -28.565 31.935 22.056  1.00 72.33  ? 64  ASP C OD2  1 
ATOM   4075 H  H    . ASP D 2 64 ? -27.138 31.700 18.834  1.00 82.98  ? 64  ASP C H    1 
ATOM   4076 H  HA   . ASP D 2 64 ? -28.768 29.569 18.416  1.00 81.01  ? 64  ASP C HA   1 
ATOM   4077 H  HB2  . ASP D 2 64 ? -29.703 29.844 20.462  1.00 83.38  ? 64  ASP C HB2  1 
ATOM   4078 H  HB3  . ASP D 2 64 ? -28.140 29.983 20.690  1.00 83.38  ? 64  ASP C HB3  1 
ATOM   4079 N  N    . GLY D 2 65 ? -29.544 32.093 17.102  1.00 69.84  ? 65  GLY C N    1 
ATOM   4080 C  CA   . GLY D 2 65 ? -30.599 32.681 16.278  1.00 70.41  ? 65  GLY C CA   1 
ATOM   4081 C  C    . GLY D 2 65 ? -31.639 33.601 16.938  1.00 71.88  ? 65  GLY C C    1 
ATOM   4082 O  O    . GLY D 2 65 ? -32.494 34.145 16.236  1.00 73.69  ? 65  GLY C O    1 
ATOM   4083 H  H    . GLY D 2 65 ? -28.747 32.328 16.882  1.00 83.81  ? 65  GLY C H    1 
ATOM   4084 H  HA2  . GLY D 2 65 ? -30.176 33.193 15.570  1.00 84.49  ? 65  GLY C HA2  1 
ATOM   4085 H  HA3  . GLY D 2 65 ? -31.089 31.957 15.856  1.00 84.49  ? 65  GLY C HA3  1 
ATOM   4086 N  N    . ASP D 2 66 ? -31.595 33.774 18.262  1.00 69.44  ? 66  ASP C N    1 
ATOM   4087 C  CA   . ASP D 2 66 ? -32.556 34.633 18.939  1.00 67.89  ? 66  ASP C CA   1 
ATOM   4088 C  C    . ASP D 2 66 ? -32.065 36.088 18.907  1.00 70.19  ? 66  ASP C C    1 
ATOM   4089 O  O    . ASP D 2 66 ? -32.692 36.969 19.517  1.00 68.24  ? 66  ASP C O    1 
ATOM   4090 C  CB   . ASP D 2 66 ? -32.823 34.179 20.382  0.00 67.07  ? 66  ASP C CB   1 
ATOM   4091 C  CG   . ASP D 2 66 ? -31.711 34.544 21.342  0.00 67.55  ? 66  ASP C CG   1 
ATOM   4092 O  OD1  . ASP D 2 66 ? -30.646 35.020 20.900  0.00 67.31  ? 66  ASP C OD1  1 
ATOM   4093 O  OD2  . ASP D 2 66 ? -31.904 34.355 22.561  0.00 68.42  ? 66  ASP C OD2  1 
ATOM   4094 H  H    . ASP D 2 66 ? -31.019 33.405 18.784  1.00 83.33  ? 66  ASP C H    1 
ATOM   4095 H  HA   . ASP D 2 66 ? -33.397 34.595 18.458  1.00 81.47  ? 66  ASP C HA   1 
ATOM   4096 H  HB2  . ASP D 2 66 ? -33.639 34.599 20.697  0.00 80.48  ? 66  ASP C HB2  1 
ATOM   4097 H  HB3  . ASP D 2 66 ? -32.923 33.214 20.395  0.00 80.48  ? 66  ASP C HB3  1 
ATOM   4098 N  N    . GLY D 2 67 ? -30.902 36.324 18.289  1.00 67.21  ? 67  GLY C N    1 
ATOM   4099 C  CA   . GLY D 2 67 ? -30.492 37.693 17.980  1.00 67.97  ? 67  GLY C CA   1 
ATOM   4100 C  C    . GLY D 2 67 ? -29.737 38.579 18.973  1.00 68.01  ? 67  GLY C C    1 
ATOM   4101 O  O    . GLY D 2 67 ? -29.500 39.778 18.697  1.00 65.62  ? 67  GLY C O    1 
ATOM   4102 H  H    . GLY D 2 67 ? -30.343 35.719 18.042  1.00 80.65  ? 67  GLY C H    1 
ATOM   4103 H  HA2  . GLY D 2 67 ? -29.941 37.652 17.182  1.00 81.56  ? 67  GLY C HA2  1 
ATOM   4104 H  HA3  . GLY D 2 67 ? -31.295 38.182 17.738  1.00 81.56  ? 67  GLY C HA3  1 
ATOM   4105 N  N    . GLU D 2 68 ? -29.376 38.027 20.124  1.00 67.64  ? 68  GLU C N    1 
ATOM   4106 C  CA   . GLU D 2 68 ? -28.552 38.753 21.090  1.00 64.68  ? 68  GLU C CA   1 
ATOM   4107 C  C    . GLU D 2 68 ? -27.312 37.892 21.284  1.00 62.45  ? 68  GLU C C    1 
ATOM   4108 O  O    . GLU D 2 68 ? -27.230 36.814 20.703  1.00 65.18  ? 68  GLU C O    1 
ATOM   4109 C  CB   . GLU D 2 68 ? -29.307 39.052 22.404  1.00 64.43  ? 68  GLU C CB   1 
ATOM   4110 C  CG   . GLU D 2 68 ? -30.537 39.988 22.198  1.00 63.57  ? 68  GLU C CG   1 
ATOM   4111 C  CD   . GLU D 2 68 ? -30.873 40.876 23.413  1.00 72.44  ? 68  GLU C CD   1 
ATOM   4112 O  OE1  . GLU D 2 68 ? -29.931 41.301 24.110  1.00 73.85  ? 68  GLU C OE1  1 
ATOM   4113 O  OE2  . GLU D 2 68 ? -32.069 41.196 23.667  1.00 78.39  ? 68  GLU C OE2  1 
ATOM   4114 H  H    . GLU D 2 68 ? -29.594 37.233 20.373  1.00 81.17  ? 68  GLU C H    1 
ATOM   4115 H  HA   . GLU D 2 68 ? -28.276 39.598 20.702  1.00 77.61  ? 68  GLU C HA   1 
ATOM   4116 H  HB2  . GLU D 2 68 ? -29.626 38.217 22.781  1.00 77.31  ? 68  GLU C HB2  1 
ATOM   4117 H  HB3  . GLU D 2 68 ? -28.701 39.486 23.024  1.00 77.31  ? 68  GLU C HB3  1 
ATOM   4118 H  HG2  . GLU D 2 68 ? -30.359 40.574 21.445  1.00 76.28  ? 68  GLU C HG2  1 
ATOM   4119 H  HG3  . GLU D 2 68 ? -31.316 39.441 22.009  1.00 76.28  ? 68  GLU C HG3  1 
ATOM   4120 N  N    . CYS D 2 69 ? -26.297 38.413 21.965  1.00 62.43  ? 69  CYS C N    1 
ATOM   4121 C  CA   . CYS D 2 69 ? -25.086 37.651 22.247  1.00 60.78  ? 69  CYS C CA   1 
ATOM   4122 C  C    . CYS D 2 69 ? -25.034 37.345 23.749  1.00 63.30  ? 69  CYS C C    1 
ATOM   4123 O  O    . CYS D 2 69 ? -24.852 38.249 24.573  1.00 64.78  ? 69  CYS C O    1 
ATOM   4124 C  CB   . CYS D 2 69 ? -23.851 38.419 21.785  1.00 57.13  ? 69  CYS C CB   1 
ATOM   4125 S  SG   . CYS D 2 69 ? -22.306 37.514 22.052  1.00 52.92  ? 69  CYS C SG   1 
ATOM   4126 H  H    . CYS D 2 69 ? -26.285 39.214 22.278  1.00 74.91  ? 69  CYS C H    1 
ATOM   4127 H  HA   . CYS D 2 69 ? -25.118 36.809 21.767  1.00 72.94  ? 69  CYS C HA   1 
ATOM   4128 H  HB2  . CYS D 2 69 ? -23.930 38.600 20.835  1.00 68.56  ? 69  CYS C HB2  1 
ATOM   4129 H  HB3  . CYS D 2 69 ? -23.797 39.253 22.277  1.00 68.56  ? 69  CYS C HB3  1 
ATOM   4130 H  HG   . CYS D 2 69 ? -22.182 37.290 23.224  1.00 63.50  ? 69  CYS C HG   1 
ATOM   4131 N  N    . ASP D 2 70 ? -25.217 36.074 24.097  1.00 62.43  ? 70  ASP C N    1 
ATOM   4132 C  CA   . ASP D 2 70 ? -25.134 35.631 25.491  1.00 65.32  ? 70  ASP C CA   1 
ATOM   4133 C  C    . ASP D 2 70 ? -23.670 35.447 25.884  1.00 63.72  ? 70  ASP C C    1 
ATOM   4134 O  O    . ASP D 2 70 ? -22.777 35.623 25.053  1.00 61.04  ? 70  ASP C O    1 
ATOM   4135 C  CB   . ASP D 2 70 ? -25.926 34.318 25.703  1.00 64.70  ? 70  ASP C CB   1 
ATOM   4136 C  CG   . ASP D 2 70 ? -25.386 33.133 24.883  1.00 63.64  ? 70  ASP C CG   1 
ATOM   4137 O  OD1  . ASP D 2 70 ? -24.177 32.989 24.660  1.00 64.42  ? 70  ASP C OD1  1 
ATOM   4138 O  OD2  . ASP D 2 70 ? -26.192 32.324 24.410  1.00 70.90  ? 70  ASP C OD2  1 
ATOM   4139 H  H    . ASP D 2 70 ? -25.393 35.441 23.541  1.00 74.92  ? 70  ASP C H    1 
ATOM   4140 H  HA   . ASP D 2 70 ? -25.518 36.312 26.065  1.00 78.38  ? 70  ASP C HA   1 
ATOM   4141 H  HB2  . ASP D 2 70 ? -25.882 34.074 26.641  1.00 77.63  ? 70  ASP C HB2  1 
ATOM   4142 H  HB3  . ASP D 2 70 ? -26.849 34.463 25.443  1.00 77.63  ? 70  ASP C HB3  1 
ATOM   4143 N  N    . PHE D 2 71 ? -23.419 35.045 27.126  1.00 64.91  ? 71  PHE C N    1 
ATOM   4144 C  CA   . PHE D 2 71 ? -22.048 34.946 27.578  1.00 61.85  ? 71  PHE C CA   1 
ATOM   4145 C  C    . PHE D 2 71 ? -21.270 33.857 26.818  1.00 62.34  ? 71  PHE C C    1 
ATOM   4146 O  O    . PHE D 2 71 ? -20.084 34.026 26.519  1.00 60.27  ? 71  PHE C O    1 
ATOM   4147 C  CB   . PHE D 2 71 ? -21.970 34.714 29.078  1.00 61.04  ? 71  PHE C CB   1 
ATOM   4148 C  CG   . PHE D 2 71 ? -20.594 34.919 29.595  1.00 62.35  ? 71  PHE C CG   1 
ATOM   4149 C  CD1  . PHE D 2 71 ? -20.112 36.203 29.757  1.00 60.97  ? 71  PHE C CD1  1 
ATOM   4150 C  CD2  . PHE D 2 71 ? -19.744 33.846 29.825  1.00 64.10  ? 71  PHE C CD2  1 
ATOM   4151 C  CE1  . PHE D 2 71 ? -18.820 36.428 30.186  1.00 60.84  ? 71  PHE C CE1  1 
ATOM   4152 C  CE2  . PHE D 2 71 ? -18.449 34.058 30.256  1.00 65.35  ? 71  PHE C CE2  1 
ATOM   4153 C  CZ   . PHE D 2 71 ? -17.984 35.368 30.437  1.00 60.57  ? 71  PHE C CZ   1 
ATOM   4154 H  H    . PHE D 2 71 ? -24.013 34.830 27.709  1.00 77.90  ? 71  PHE C H    1 
ATOM   4155 H  HA   . PHE D 2 71 ? -21.608 35.792 27.397  1.00 74.22  ? 71  PHE C HA   1 
ATOM   4156 H  HB2  . PHE D 2 71 ? -22.560 35.338 29.529  1.00 73.25  ? 71  PHE C HB2  1 
ATOM   4157 H  HB3  . PHE D 2 71 ? -22.234 33.801 29.274  1.00 73.25  ? 71  PHE C HB3  1 
ATOM   4158 H  HD1  . PHE D 2 71 ? -20.671 36.927 29.586  1.00 73.16  ? 71  PHE C HD1  1 
ATOM   4159 H  HD2  . PHE D 2 71 ? -20.053 32.978 29.702  1.00 76.92  ? 71  PHE C HD2  1 
ATOM   4160 H  HE1  . PHE D 2 71 ? -18.517 37.299 30.308  1.00 73.01  ? 71  PHE C HE1  1 
ATOM   4161 H  HE2  . PHE D 2 71 ? -17.889 33.335 30.427  1.00 78.42  ? 71  PHE C HE2  1 
ATOM   4162 H  HZ   . PHE D 2 71 ? -17.116 35.519 30.735  1.00 72.69  ? 71  PHE C HZ   1 
ATOM   4163 N  N    . GLN D 2 72 ? -21.906 32.731 26.516  1.00 64.93  ? 72  GLN C N    1 
ATOM   4164 C  CA   . GLN D 2 72 ? -21.236 31.708 25.718  1.00 62.92  ? 72  GLN C CA   1 
ATOM   4165 C  C    . GLN D 2 72 ? -20.926 32.272 24.329  1.00 61.91  ? 72  GLN C C    1 
ATOM   4166 O  O    . GLN D 2 72 ? -19.831 32.069 23.795  1.00 59.76  ? 72  GLN C O    1 
ATOM   4167 C  CB   . GLN D 2 72 ? -22.104 30.459 25.593  0.00 67.20  ? 72  GLN C CB   1 
ATOM   4168 C  CG   . GLN D 2 72 ? -21.366 29.258 25.032  0.00 70.49  ? 72  GLN C CG   1 
ATOM   4169 C  CD   . GLN D 2 72 ? -22.288 28.094 24.728  0.00 75.83  ? 72  GLN C CD   1 
ATOM   4170 O  OE1  . GLN D 2 72 ? -23.510 28.240 24.718  0.00 76.23  ? 72  GLN C OE1  1 
ATOM   4171 N  NE2  . GLN D 2 72 ? -21.703 26.939 24.441  0.00 81.39  ? 72  GLN C NE2  1 
ATOM   4172 H  H    . GLN D 2 72 ? -22.709 32.536 26.755  1.00 77.91  ? 72  GLN C H    1 
ATOM   4173 H  HA   . GLN D 2 72 ? -20.400 31.461 26.144  1.00 75.51  ? 72  GLN C HA   1 
ATOM   4174 H  HB2  . GLN D 2 72 ? -22.435 30.219 26.473  0.00 80.65  ? 72  GLN C HB2  1 
ATOM   4175 H  HB3  . GLN D 2 72 ? -22.848 30.653 25.003  0.00 80.65  ? 72  GLN C HB3  1 
ATOM   4176 H  HG2  . GLN D 2 72 ? -20.925 29.515 24.206  0.00 84.59  ? 72  GLN C HG2  1 
ATOM   4177 H  HG3  . GLN D 2 72 ? -20.709 28.959 25.680  0.00 84.59  ? 72  GLN C HG3  1 
ATOM   4178 H  HE21 . GLN D 2 72 ? -20.845 26.881 24.434  0.00 97.67  ? 72  GLN C HE21 1 
ATOM   4179 H  HE22 . GLN D 2 72 ? -22.181 26.247 24.261  0.00 97.67  ? 72  GLN C HE22 1 
ATOM   4180 N  N    . GLU D 2 73 ? -21.877 33.031 23.775  1.00 61.65  ? 73  GLU C N    1 
ATOM   4181 C  CA   . GLU D 2 73 ? -21.732 33.607 22.440  1.00 60.98  ? 73  GLU C CA   1 
ATOM   4182 C  C    . GLU D 2 73 ? -20.625 34.659 22.387  1.00 57.53  ? 73  GLU C C    1 
ATOM   4183 O  O    . GLU D 2 73 ? -19.919 34.732 21.401  1.00 55.65  ? 73  GLU C O    1 
ATOM   4184 C  CB   . GLU D 2 73 ? -23.087 34.170 21.973  1.00 60.73  ? 73  GLU C CB   1 
ATOM   4185 C  CG   . GLU D 2 73 ? -23.997 33.083 21.357  1.00 62.67  ? 73  GLU C CG   1 
ATOM   4186 C  CD   . GLU D 2 73 ? -25.499 33.401 21.353  1.00 65.74  ? 73  GLU C CD   1 
ATOM   4187 O  OE1  . GLU D 2 73 ? -25.950 34.236 22.159  1.00 66.42  ? 73  GLU C OE1  1 
ATOM   4188 O  OE2  . GLU D 2 73 ? -26.230 32.844 20.506  1.00 65.76  ? 73  GLU C OE2  1 
ATOM   4189 H  H    . GLU D 2 73 ? -22.621 33.226 24.159  1.00 73.99  ? 73  GLU C H    1 
ATOM   4190 H  HA   . GLU D 2 73 ? -21.486 32.898 21.826  1.00 73.18  ? 73  GLU C HA   1 
ATOM   4191 H  HB2  . GLU D 2 73 ? -23.550 34.555 22.734  1.00 72.88  ? 73  GLU C HB2  1 
ATOM   4192 H  HB3  . GLU D 2 73 ? -22.932 34.850 21.299  1.00 72.88  ? 73  GLU C HB3  1 
ATOM   4193 H  HG2  . GLU D 2 73 ? -23.727 32.942 20.436  1.00 75.21  ? 73  GLU C HG2  1 
ATOM   4194 H  HG3  . GLU D 2 73 ? -23.876 32.261 21.859  1.00 75.21  ? 73  GLU C HG3  1 
ATOM   4195 N  N    . PHE D 2 74 ? -20.476 35.430 23.464  1.00 57.70  ? 74  PHE C N    1 
ATOM   4196 C  CA   . PHE D 2 74 ? -19.435 36.443 23.623  1.00 54.82  ? 74  PHE C CA   1 
ATOM   4197 C  C    . PHE D 2 74 ? -18.047 35.784 23.786  1.00 56.27  ? 74  PHE C C    1 
ATOM   4198 O  O    . PHE D 2 74 ? -17.082 36.171 23.126  1.00 54.16  ? 74  PHE C O    1 
ATOM   4199 C  CB   . PHE D 2 74 ? -19.780 37.306 24.840  1.00 53.64  ? 74  PHE C CB   1 
ATOM   4200 C  CG   . PHE D 2 74 ? -18.668 38.254 25.310  1.00 55.58  ? 74  PHE C CG   1 
ATOM   4201 C  CD1  . PHE D 2 74 ? -18.320 39.394 24.582  1.00 53.44  ? 74  PHE C CD1  1 
ATOM   4202 C  CD2  . PHE D 2 74 ? -17.980 38.004 26.517  1.00 54.80  ? 74  PHE C CD2  1 
ATOM   4203 C  CE1  . PHE D 2 74 ? -17.311 40.250 25.044  1.00 53.05  ? 74  PHE C CE1  1 
ATOM   4204 C  CE2  . PHE D 2 74 ? -16.982 38.859 26.976  1.00 51.94  ? 74  PHE C CE2  1 
ATOM   4205 C  CZ   . PHE D 2 74 ? -16.643 39.979 26.236  1.00 51.43  ? 74  PHE C CZ   1 
ATOM   4206 H  H    . PHE D 2 74 ? -20.993 35.379 24.149  1.00 69.24  ? 74  PHE C H    1 
ATOM   4207 H  HA   . PHE D 2 74 ? -19.415 37.012 22.838  1.00 65.79  ? 74  PHE C HA   1 
ATOM   4208 H  HB2  . PHE D 2 74 ? -20.554 37.850 24.622  1.00 64.37  ? 74  PHE C HB2  1 
ATOM   4209 H  HB3  . PHE D 2 74 ? -19.995 36.720 25.582  1.00 64.37  ? 74  PHE C HB3  1 
ATOM   4210 H  HD1  . PHE D 2 74 ? -18.759 39.586 23.785  1.00 64.13  ? 74  PHE C HD1  1 
ATOM   4211 H  HD2  . PHE D 2 74 ? -18.202 37.254 27.020  1.00 65.76  ? 74  PHE C HD2  1 
ATOM   4212 H  HE1  . PHE D 2 74 ? -17.083 41.004 24.549  1.00 63.66  ? 74  PHE C HE1  1 
ATOM   4213 H  HE2  . PHE D 2 74 ? -16.537 38.673 27.771  1.00 62.33  ? 74  PHE C HE2  1 
ATOM   4214 H  HZ   . PHE D 2 74 ? -15.973 40.551 26.535  1.00 61.72  ? 74  PHE C HZ   1 
ATOM   4215 N  N    . MET D 2 75 ? -17.982 34.720 24.579  1.00 57.39  ? 75  MET C N    1 
ATOM   4216 C  CA   . MET D 2 75 ? -16.739 33.987 24.804  1.00 58.26  ? 75  MET C CA   1 
ATOM   4217 C  C    . MET D 2 75 ? -16.179 33.429 23.511  1.00 56.94  ? 75  MET C C    1 
ATOM   4218 O  O    . MET D 2 75 ? -14.959 33.324 23.331  1.00 55.02  ? 75  MET C O    1 
ATOM   4219 C  CB   . MET D 2 75 ? -16.953 32.856 25.815  1.00 59.41  ? 75  MET C CB   1 
ATOM   4220 C  CG   . MET D 2 75 ? -17.126 33.339 27.259  1.00 61.94  ? 75  MET C CG   1 
ATOM   4221 S  SD   . MET D 2 75 ? -15.889 34.551 27.792  1.00 67.43  ? 75  MET C SD   1 
ATOM   4222 C  CE   . MET D 2 75 ? -14.415 33.588 27.453  1.00 60.07  ? 75  MET C CE   1 
ATOM   4223 H  H    . MET D 2 75 ? -18.656 34.397 25.006  1.00 68.87  ? 75  MET C H    1 
ATOM   4224 H  HA   . MET D 2 75 ? -16.087 34.597 25.183  1.00 69.92  ? 75  MET C HA   1 
ATOM   4225 H  HB2  . MET D 2 75 ? -17.752 32.365 25.569  1.00 71.29  ? 75  MET C HB2  1 
ATOM   4226 H  HB3  . MET D 2 75 ? -16.184 32.266 25.790  1.00 71.29  ? 75  MET C HB3  1 
ATOM   4227 H  HG2  . MET D 2 75 ? -18.000 33.752 27.347  1.00 74.32  ? 75  MET C HG2  1 
ATOM   4228 H  HG3  . MET D 2 75 ? -17.065 32.574 27.853  1.00 74.32  ? 75  MET C HG3  1 
ATOM   4229 H  HE1  . MET D 2 75 ? -13.634 34.112 27.692  1.00 72.08  ? 75  MET C HE1  1 
ATOM   4230 H  HE2  . MET D 2 75 ? -14.442 32.775 27.981  1.00 72.08  ? 75  MET C HE2  1 
ATOM   4231 H  HE3  . MET D 2 75 ? -14.391 33.370 26.508  1.00 72.08  ? 75  MET C HE3  1 
ATOM   4232 N  N    . ALA D 2 76 ? -17.080 33.048 22.623  1.00 58.34  ? 76  ALA C N    1 
ATOM   4233 C  CA   . ALA D 2 76 ? -16.687 32.600 21.305  1.00 59.60  ? 76  ALA C CA   1 
ATOM   4234 C  C    . ALA D 2 76 ? -16.080 33.752 20.526  1.00 57.29  ? 76  ALA C C    1 
ATOM   4235 O  O    . ALA D 2 76 ? -15.097 33.557 19.829  1.00 57.05  ? 76  ALA C O    1 
ATOM   4236 C  CB   . ALA D 2 76 ? -17.876 32.018 20.568  1.00 60.07  ? 76  ALA C CB   1 
ATOM   4237 H  H    . ALA D 2 76 ? -17.929 33.041 22.761  1.00 70.01  ? 76  ALA C H    1 
ATOM   4238 H  HA   . ALA D 2 76 ? -16.016 31.906 21.392  1.00 71.52  ? 76  ALA C HA   1 
ATOM   4239 H  HB1  . ALA D 2 76 ? -17.589 31.725 19.689  1.00 72.09  ? 76  ALA C HB1  1 
ATOM   4240 H  HB2  . ALA D 2 76 ? -18.222 31.265 21.072  1.00 72.09  ? 76  ALA C HB2  1 
ATOM   4241 H  HB3  . ALA D 2 76 ? -18.559 32.702 20.483  1.00 72.09  ? 76  ALA C HB3  1 
ATOM   4242 N  N    . PHE D 2 77 ? -16.695 34.935 20.635  1.00 55.31  ? 77  PHE C N    1 
ATOM   4243 C  CA   . PHE D 2 77 ? -16.152 36.175 20.069  1.00 56.90  ? 77  PHE C CA   1 
ATOM   4244 C  C    . PHE D 2 77 ? -14.773 36.464 20.671  1.00 56.36  ? 77  PHE C C    1 
ATOM   4245 O  O    . PHE D 2 77 ? -13.818 36.762 19.945  1.00 55.35  ? 77  PHE C O    1 
ATOM   4246 C  CB   . PHE D 2 77 ? -17.107 37.343 20.310  1.00 55.04  ? 77  PHE C CB   1 
ATOM   4247 C  CG   . PHE D 2 77 ? -16.660 38.657 19.728  1.00 53.66  ? 77  PHE C CG   1 
ATOM   4248 C  CD1  . PHE D 2 77 ? -16.360 38.778 18.388  1.00 54.20  ? 77  PHE C CD1  1 
ATOM   4249 C  CD2  . PHE D 2 77 ? -16.612 39.810 20.527  1.00 56.76  ? 77  PHE C CD2  1 
ATOM   4250 C  CE1  . PHE D 2 77 ? -15.973 40.020 17.854  1.00 54.90  ? 77  PHE C CE1  1 
ATOM   4251 C  CE2  . PHE D 2 77 ? -16.243 41.054 20.000  1.00 52.55  ? 77  PHE C CE2  1 
ATOM   4252 C  CZ   . PHE D 2 77 ? -15.929 41.156 18.667  1.00 51.97  ? 77  PHE C CZ   1 
ATOM   4253 H  H    . PHE D 2 77 ? -17.444 35.046 21.041  1.00 66.37  ? 77  PHE C H    1 
ATOM   4254 H  HA   . PHE D 2 77 ? -16.045 36.067 19.111  1.00 68.28  ? 77  PHE C HA   1 
ATOM   4255 H  HB2  . PHE D 2 77 ? -17.967 37.125 19.916  1.00 66.05  ? 77  PHE C HB2  1 
ATOM   4256 H  HB3  . PHE D 2 77 ? -17.210 37.465 21.267  1.00 66.05  ? 77  PHE C HB3  1 
ATOM   4257 H  HD1  . PHE D 2 77 ? -16.393 38.029 17.838  1.00 65.03  ? 77  PHE C HD1  1 
ATOM   4258 H  HD2  . PHE D 2 77 ? -16.831 39.747 21.429  1.00 68.11  ? 77  PHE C HD2  1 
ATOM   4259 H  HE1  . PHE D 2 77 ? -15.762 40.090 16.951  1.00 65.88  ? 77  PHE C HE1  1 
ATOM   4260 H  HE2  . PHE D 2 77 ? -16.205 41.803 20.549  1.00 63.06  ? 77  PHE C HE2  1 
ATOM   4261 H  HZ   . PHE D 2 77 ? -15.669 41.975 18.311  1.00 62.37  ? 77  PHE C HZ   1 
ATOM   4262 N  N    . VAL D 2 78 ? -14.671 36.370 21.994  1.00 54.24  ? 78  VAL C N    1 
ATOM   4263 C  CA   . VAL D 2 78 ? -13.406 36.585 22.650  1.00 54.37  ? 78  VAL C CA   1 
ATOM   4264 C  C    . VAL D 2 78 ? -12.349 35.583 22.180  1.00 55.66  ? 78  VAL C C    1 
ATOM   4265 O  O    . VAL D 2 78 ? -11.183 35.924 22.073  1.00 54.74  ? 78  VAL C O    1 
ATOM   4266 C  CB   . VAL D 2 78 ? -13.540 36.514 24.158  1.00 53.83  ? 78  VAL C CB   1 
ATOM   4267 C  CG1  . VAL D 2 78 ? -12.147 36.511 24.836  1.00 51.88  ? 78  VAL C CG1  1 
ATOM   4268 C  CG2  . VAL D 2 78 ? -14.357 37.688 24.638  1.00 53.44  ? 78  VAL C CG2  1 
ATOM   4269 H  H    . VAL D 2 78 ? -15.322 36.184 22.525  1.00 65.08  ? 78  VAL C H    1 
ATOM   4270 H  HA   . VAL D 2 78 ? -13.089 37.474 22.425  1.00 65.24  ? 78  VAL C HA   1 
ATOM   4271 H  HB   . VAL D 2 78 ? -14.002 35.697 24.404  1.00 64.59  ? 78  VAL C HB   1 
ATOM   4272 H  HG11 . VAL D 2 78 ? -12.264 36.465 25.798  1.00 62.25  ? 78  VAL C HG11 1 
ATOM   4273 H  HG12 . VAL D 2 78 ? -11.647 35.740 24.526  1.00 62.25  ? 78  VAL C HG12 1 
ATOM   4274 H  HG13 . VAL D 2 78 ? -11.679 37.327 24.598  1.00 62.25  ? 78  VAL C HG13 1 
ATOM   4275 H  HG21 . VAL D 2 78 ? -14.441 37.640 25.603  1.00 64.13  ? 78  VAL C HG21 1 
ATOM   4276 H  HG22 . VAL D 2 78 ? -13.908 38.509 24.384  1.00 64.13  ? 78  VAL C HG22 1 
ATOM   4277 H  HG23 . VAL D 2 78 ? -15.235 37.650 24.227  1.00 64.13  ? 78  VAL C HG23 1 
ATOM   4278 N  N    . ALA D 2 79 ? -12.733 34.351 21.893  1.00 57.79  ? 79  ALA C N    1 
ATOM   4279 C  CA   . ALA D 2 79 ? -11.734 33.398 21.437  1.00 58.56  ? 79  ALA C CA   1 
ATOM   4280 C  C    . ALA D 2 79 ? -11.146 33.809 20.084  1.00 57.37  ? 79  ALA C C    1 
ATOM   4281 O  O    . ALA D 2 79 ? -9.938  33.860 19.924  1.00 55.43  ? 79  ALA C O    1 
ATOM   4282 C  CB   . ALA D 2 79 ? -12.346 32.003 21.351  1.00 59.82  ? 79  ALA C CB   1 
ATOM   4283 H  H    . ALA D 2 79 ? -13.535 34.047 21.951  1.00 69.35  ? 79  ALA C H    1 
ATOM   4284 H  HA   . ALA D 2 79 ? -11.010 33.368 22.081  1.00 70.27  ? 79  ALA C HA   1 
ATOM   4285 H  HB1  . ALA D 2 79 ? -13.086 32.021 20.724  1.00 71.79  ? 79  ALA C HB1  1 
ATOM   4286 H  HB2  . ALA D 2 79 ? -11.668 31.380 21.045  1.00 71.79  ? 79  ALA C HB2  1 
ATOM   4287 H  HB3  . ALA D 2 79 ? -12.662 31.743 22.230  1.00 71.79  ? 79  ALA C HB3  1 
ATOM   4288 N  N    . MET D 2 80 ? -12.023 34.190 19.159  1.00 59.41  ? 80  MET C N    1 
ATOM   4289 C  CA   . MET D 2 80 ? -11.651 34.661 17.821  1.00 60.30  ? 80  MET C CA   1 
ATOM   4290 C  C    . MET D 2 80 ? -10.677 35.835 17.874  1.00 56.92  ? 80  MET C C    1 
ATOM   4291 O  O    . MET D 2 80 ? -9.596  35.786 17.320  1.00 57.60  ? 80  MET C O    1 
ATOM   4292 C  CB   . MET D 2 80 ? -12.895 35.123 17.055  1.00 62.85  ? 80  MET C CB   1 
ATOM   4293 C  CG   . MET D 2 80 ? -13.820 34.026 16.501  1.00 70.70  ? 80  MET C CG   1 
ATOM   4294 S  SD   . MET D 2 80 ? -15.365 34.781 15.887  1.00 76.83  ? 80  MET C SD   1 
ATOM   4295 C  CE   . MET D 2 80 ? -16.600 33.573 16.380  1.00 71.40  ? 80  MET C CE   1 
ATOM   4296 H  H    . MET D 2 80 ? -12.874 34.184 19.287  1.00 71.29  ? 80  MET C H    1 
ATOM   4297 H  HA   . MET D 2 80 ? -11.245 33.931 17.327  1.00 72.37  ? 80  MET C HA   1 
ATOM   4298 H  HB2  . MET D 2 80 ? -13.428 35.674 17.649  1.00 75.42  ? 80  MET C HB2  1 
ATOM   4299 H  HB3  . MET D 2 80 ? -12.603 35.658 16.300  1.00 75.42  ? 80  MET C HB3  1 
ATOM   4300 H  HG2  . MET D 2 80 ? -13.383 33.571 15.765  1.00 84.84  ? 80  MET C HG2  1 
ATOM   4301 H  HG3  . MET D 2 80 ? -14.041 33.398 17.208  1.00 84.84  ? 80  MET C HG3  1 
ATOM   4302 H  HE1  . MET D 2 80 ? -17.475 33.883 16.096  1.00 85.68  ? 80  MET C HE1  1 
ATOM   4303 H  HE2  . MET D 2 80 ? -16.397 32.724 15.958  1.00 85.68  ? 80  MET C HE2  1 
ATOM   4304 H  HE3  . MET D 2 80 ? -16.580 33.477 17.345  1.00 85.68  ? 80  MET C HE3  1 
ATOM   4305 N  N    . VAL D 2 81 ? -11.103 36.903 18.521  1.00 55.40  ? 81  VAL C N    1 
ATOM   4306 C  CA   . VAL D 2 81 ? -10.336 38.126 18.589  1.00 54.34  ? 81  VAL C CA   1 
ATOM   4307 C  C    . VAL D 2 81 ? -8.976  37.857 19.242  1.00 55.48  ? 81  VAL C C    1 
ATOM   4308 O  O    . VAL D 2 81 ? -7.933  38.266 18.718  1.00 55.66  ? 81  VAL C O    1 
ATOM   4309 C  CB   . VAL D 2 81 ? -11.119 39.194 19.363  1.00 52.34  ? 81  VAL C CB   1 
ATOM   4310 C  CG1  . VAL D 2 81 ? -10.318 40.480 19.499  1.00 53.01  ? 81  VAL C CG1  1 
ATOM   4311 C  CG2  . VAL D 2 81 ? -12.445 39.449 18.682  1.00 54.35  ? 81  VAL C CG2  1 
ATOM   4312 H  H    . VAL D 2 81 ? -11.854 36.943 18.938  1.00 66.48  ? 81  VAL C H    1 
ATOM   4313 H  HA   . VAL D 2 81 ? -10.181 38.457 17.690  1.00 65.21  ? 81  VAL C HA   1 
ATOM   4314 H  HB   . VAL D 2 81 ? -11.302 38.862 20.256  1.00 62.81  ? 81  VAL C HB   1 
ATOM   4315 H  HG11 . VAL D 2 81 ? -10.844 41.129 19.992  1.00 63.61  ? 81  VAL C HG11 1 
ATOM   4316 H  HG12 . VAL D 2 81 ? -9.494  40.290 19.975  1.00 63.61  ? 81  VAL C HG12 1 
ATOM   4317 H  HG13 . VAL D 2 81 ? -10.117 40.821 18.613  1.00 63.61  ? 81  VAL C HG13 1 
ATOM   4318 H  HG21 . VAL D 2 81 ? -12.931 40.125 19.180  1.00 65.22  ? 81  VAL C HG21 1 
ATOM   4319 H  HG22 . VAL D 2 81 ? -12.281 39.758 17.778  1.00 65.22  ? 81  VAL C HG22 1 
ATOM   4320 H  HG23 . VAL D 2 81 ? -12.953 38.623 18.663  1.00 65.22  ? 81  VAL C HG23 1 
ATOM   4321 N  N    . THR D 2 82 ? -8.982  37.147 20.367  1.00 54.48  ? 82  THR C N    1 
ATOM   4322 C  CA   . THR D 2 82 ? -7.733  36.876 21.068  1.00 54.01  ? 82  THR C CA   1 
ATOM   4323 C  C    . THR D 2 82 ? -6.882  35.988 20.190  1.00 56.55  ? 82  THR C C    1 
ATOM   4324 O  O    . THR D 2 82 ? -5.700  36.261 20.010  1.00 56.68  ? 82  THR C O    1 
ATOM   4325 C  CB   . THR D 2 82 ? -7.925  36.157 22.407  1.00 51.38  ? 82  THR C CB   1 
ATOM   4326 O  OG1  . THR D 2 82 ? -8.908  36.816 23.183  1.00 54.31  ? 82  THR C OG1  1 
ATOM   4327 C  CG2  . THR D 2 82 ? -6.638  36.093 23.190  1.00 50.26  ? 82  THR C CG2  1 
ATOM   4328 H  H    . THR D 2 82 ? -9.683  36.817 20.739  1.00 65.38  ? 82  THR C H    1 
ATOM   4329 H  HA   . THR D 2 82 ? -7.258  37.707 21.226  1.00 64.82  ? 82  THR C HA   1 
ATOM   4330 H  HB   . THR D 2 82 ? -8.217  35.248 22.237  1.00 61.66  ? 82  THR C HB   1 
ATOM   4331 H  HG1  . THR D 2 82 ? -9.010  36.419 23.916  1.00 65.17  ? 82  THR C HG1  1 
ATOM   4332 H  HG21 . THR D 2 82 ? -6.316  36.989 23.372  1.00 60.31  ? 82  THR C HG21 1 
ATOM   4333 H  HG22 . THR D 2 82 ? -6.785  35.634 24.032  1.00 60.31  ? 82  THR C HG22 1 
ATOM   4334 H  HG23 . THR D 2 82 ? -5.965  35.613 22.683  1.00 60.31  ? 82  THR C HG23 1 
ATOM   4335 N  N    . THR D 2 83 ? -7.512  34.980 19.573  1.00 58.01  ? 83  THR C N    1 
ATOM   4336 C  CA   . THR D 2 83 ? -6.812  34.063 18.669  1.00 57.88  ? 83  THR C CA   1 
ATOM   4337 C  C    . THR D 2 83 ? -6.184  34.847 17.484  1.00 62.35  ? 83  THR C C    1 
ATOM   4338 O  O    . THR D 2 83 ? -5.036  34.600 17.133  1.00 65.81  ? 83  THR C O    1 
ATOM   4339 C  CB   . THR D 2 83 ? -7.775  32.973 18.120  1.00 58.49  ? 83  THR C CB   1 
ATOM   4340 O  OG1  . THR D 2 83 ? -8.013  31.958 19.103  1.00 58.96  ? 83  THR C OG1  1 
ATOM   4341 C  CG2  . THR D 2 83 ? -7.216  32.284 16.881  1.00 70.38  ? 83  THR C CG2  1 
ATOM   4342 H  H    . THR D 2 83 ? -8.349  34.807 19.664  1.00 69.62  ? 83  THR C H    1 
ATOM   4343 H  HA   . THR D 2 83 ? -6.097  33.620 19.153  1.00 69.45  ? 83  THR C HA   1 
ATOM   4344 H  HB   . THR D 2 83 ? -8.619  33.386 17.880  1.00 70.19  ? 83  THR C HB   1 
ATOM   4345 H  HG1  . THR D 2 83 ? -8.359  32.299 19.789  1.00 70.75  ? 83  THR C HG1  1 
ATOM   4346 H  HG21 . THR D 2 83 ? -7.840  31.612 16.566  1.00 84.46  ? 83  THR C HG21 1 
ATOM   4347 H  HG22 . THR D 2 83 ? -7.071  32.935 16.177  1.00 84.46  ? 83  THR C HG22 1 
ATOM   4348 H  HG23 . THR D 2 83 ? -6.371  31.856 17.093  1.00 84.46  ? 83  THR C HG23 1 
ATOM   4349 N  N    . ALA D 2 84 ? -6.875  35.865 16.968  1.00 60.26  ? 84  ALA C N    1 
ATOM   4350 C  CA   . ALA D 2 84 ? -6.336  36.750 15.938  1.00 60.07  ? 84  ALA C CA   1 
ATOM   4351 C  C    . ALA D 2 84 ? -5.114  37.473 16.463  1.00 63.94  ? 84  ALA C C    1 
ATOM   4352 O  O    . ALA D 2 84 ? -4.047  37.423 15.848  1.00 66.17  ? 84  ALA C O    1 
ATOM   4353 C  CB   . ALA D 2 84 ? -7.376  37.757 15.495  1.00 60.07  ? 84  ALA C CB   1 
ATOM   4354 H  H    . ALA D 2 84 ? -7.676  36.067 17.206  1.00 72.32  ? 84  ALA C H    1 
ATOM   4355 H  HA   . ALA D 2 84 ? -6.073  36.223 15.168  1.00 72.08  ? 84  ALA C HA   1 
ATOM   4356 H  HB1  . ALA D 2 84 ? -7.645  38.289 16.260  1.00 72.09  ? 84  ALA C HB1  1 
ATOM   4357 H  HB2  . ALA D 2 84 ? -6.990  38.329 14.813  1.00 72.09  ? 84  ALA C HB2  1 
ATOM   4358 H  HB3  . ALA D 2 84 ? -8.141  37.282 15.135  1.00 72.09  ? 84  ALA C HB3  1 
ATOM   4359 N  N    . CYS D 2 85 ? -5.303  38.198 17.567  1.00 63.96  ? 85  CYS C N    1 
ATOM   4360 C  CA   . CYS D 2 85 ? -4.227  38.951 18.228  1.00 63.32  ? 85  CYS C CA   1 
ATOM   4361 C  C    . CYS D 2 85 ? -2.982  38.094 18.494  1.00 63.19  ? 85  CYS C C    1 
ATOM   4362 O  O    . CYS D 2 85 ? -1.857  38.612 18.539  1.00 64.96  ? 85  CYS C O    1 
ATOM   4363 C  CB   . CYS D 2 85 ? -4.727  39.555 19.534  1.00 59.77  ? 85  CYS C CB   1 
ATOM   4364 S  SG   . CYS D 2 85 ? -3.402  40.249 20.524  0.50 64.79  ? 85  CYS C SG   1 
ATOM   4365 H  H    . CYS D 2 85 ? -6.063  38.273 17.962  1.00 76.75  ? 85  CYS C H    1 
ATOM   4366 H  HA   . CYS D 2 85 ? -3.961  39.682 17.649  1.00 75.98  ? 85  CYS C HA   1 
ATOM   4367 H  HB2  . CYS D 2 85 ? -5.357  40.265 19.333  1.00 71.73  ? 85  CYS C HB2  1 
ATOM   4368 H  HB3  . CYS D 2 85 ? -5.162  38.863 20.056  1.00 71.73  ? 85  CYS C HB3  1 
ATOM   4369 H  HG   . CYS D 2 85 ? -3.865  40.705 21.533  0.50 77.75  ? 85  CYS C HG   1 
ATOM   4370 N  N    . HIS D 2 86 ? -3.183  36.795 18.702  1.00 61.16  ? 86  HIS C N    1 
ATOM   4371 C  CA   . HIS D 2 86 ? -2.057  35.930 19.035  1.00 62.58  ? 86  HIS C CA   1 
ATOM   4372 C  C    . HIS D 2 86 ? -1.151  35.811 17.854  1.00 65.69  ? 86  HIS C C    1 
ATOM   4373 O  O    . HIS D 2 86 ? 0.059   35.848 18.030  1.00 66.38  ? 86  HIS C O    1 
ATOM   4374 C  CB   . HIS D 2 86 ? -2.530  34.539 19.464  1.00 59.15  ? 86  HIS C CB   1 
ATOM   4375 C  CG   . HIS D 2 86 ? -1.468  33.473 19.428  1.00 60.19  ? 86  HIS C CG   1 
ATOM   4376 N  ND1  . HIS D 2 86 ? -1.128  32.720 20.533  1.00 62.07  ? 86  HIS C ND1  1 
ATOM   4377 C  CD2  . HIS D 2 86 ? -0.740  32.965 18.404  1.00 63.12  ? 86  HIS C CD2  1 
ATOM   4378 C  CE1  . HIS D 2 86 ? -0.203  31.835 20.211  1.00 58.77  ? 86  HIS C CE1  1 
ATOM   4379 N  NE2  . HIS D 2 86 ? 0.047   31.960 18.922  1.00 63.67  ? 86  HIS C NE2  1 
ATOM   4380 H  H    . HIS D 2 86 ? -3.944  36.398 18.659  1.00 73.40  ? 86  HIS C H    1 
ATOM   4381 H  HA   . HIS D 2 86 ? -1.555  36.322 19.767  1.00 75.10  ? 86  HIS C HA   1 
ATOM   4382 H  HB2  . HIS D 2 86 ? -2.862  34.592 20.374  1.00 70.98  ? 86  HIS C HB2  1 
ATOM   4383 H  HB3  . HIS D 2 86 ? -3.246  34.260 18.872  1.00 70.98  ? 86  HIS C HB3  1 
ATOM   4384 H  HD2  . HIS D 2 86 ? -0.751  33.258 17.522  1.00 75.74  ? 86  HIS C HD2  1 
ATOM   4385 H  HE1  . HIS D 2 86 ? 0.196   31.226 20.789  1.00 70.52  ? 86  HIS C HE1  1 
ATOM   4386 N  N    . GLU D 2 87 ? -1.729  35.729 16.652  1.00 66.61  ? 87  GLU C N    1 
ATOM   4387 C  CA   . GLU D 2 87 ? -0.927  35.594 15.443  1.00 68.01  ? 87  GLU C CA   1 
ATOM   4388 C  C    . GLU D 2 87 ? 0.033   36.789 15.231  1.00 70.99  ? 87  GLU C C    1 
ATOM   4389 O  O    . GLU D 2 87 ? 1.230   36.590 14.911  1.00 70.58  ? 87  GLU C O    1 
ATOM   4390 C  CB   . GLU D 2 87 ? -1.835  35.440 14.221  0.00 66.54  ? 87  GLU C CB   1 
ATOM   4391 C  CG   . GLU D 2 87 ? -2.580  34.116 14.176  0.00 67.01  ? 87  GLU C CG   1 
ATOM   4392 C  CD   . GLU D 2 87 ? -3.496  33.998 12.974  0.00 68.18  ? 87  GLU C CD   1 
ATOM   4393 O  OE1  . GLU D 2 87 ? -4.292  34.930 12.736  0.00 67.44  ? 87  GLU C OE1  1 
ATOM   4394 O  OE2  . GLU D 2 87 ? -3.421  32.970 12.268  0.00 69.84  ? 87  GLU C OE2  1 
ATOM   4395 H  H    . GLU D 2 87 ? -2.578  35.750 16.514  1.00 79.93  ? 87  GLU C H    1 
ATOM   4396 H  HA   . GLU D 2 87 ? -0.388  34.791 15.515  1.00 81.61  ? 87  GLU C HA   1 
ATOM   4397 H  HB2  . GLU D 2 87 ? -2.495  36.152 14.230  0.00 79.85  ? 87  GLU C HB2  1 
ATOM   4398 H  HB3  . GLU D 2 87 ? -1.294  35.503 13.419  0.00 79.85  ? 87  GLU C HB3  1 
ATOM   4399 H  HG2  . GLU D 2 87 ? -1.936  33.392 14.135  0.00 80.41  ? 87  GLU C HG2  1 
ATOM   4400 H  HG3  . GLU D 2 87 ? -3.123  34.032 14.976  0.00 80.41  ? 87  GLU C HG3  1 
ATOM   4401 N  N    . PHE D 2 88 ? -0.439  38.012 15.499  1.00 66.29  ? 88  PHE C N    1 
ATOM   4402 C  CA   . PHE D 2 88 ? 0.467   39.162 15.481  1.00 67.50  ? 88  PHE C CA   1 
ATOM   4403 C  C    . PHE D 2 88 ? 1.703   39.016 16.390  1.00 70.98  ? 88  PHE C C    1 
ATOM   4404 O  O    . PHE D 2 88 ? 2.648   39.808 16.288  1.00 76.05  ? 88  PHE C O    1 
ATOM   4405 C  CB   . PHE D 2 88 ? -0.227  40.456 15.862  1.00 67.36  ? 88  PHE C CB   1 
ATOM   4406 C  CG   . PHE D 2 88 ? 0.671   41.669 15.713  0.00 66.21  ? 88  PHE C CG   1 
ATOM   4407 C  CD1  . PHE D 2 88 ? 1.076   42.117 14.460  0.00 65.09  ? 88  PHE C CD1  1 
ATOM   4408 C  CD2  . PHE D 2 88 ? 1.155   42.312 16.830  0.00 66.01  ? 88  PHE C CD2  1 
ATOM   4409 C  CE1  . PHE D 2 88 ? 1.919   43.215 14.350  0.00 64.21  ? 88  PHE C CE1  1 
ATOM   4410 C  CE2  . PHE D 2 88 ? 1.986   43.397 16.732  0.00 64.94  ? 88  PHE C CE2  1 
ATOM   4411 C  CZ   . PHE D 2 88 ? 2.377   43.850 15.482  0.00 64.09  ? 88  PHE C CZ   1 
ATOM   4412 H  H    . PHE D 2 88 ? -1.257  38.197 15.690  1.00 79.55  ? 88  PHE C H    1 
ATOM   4413 H  HA   . PHE D 2 88 ? 0.793   39.270 14.573  1.00 81.00  ? 88  PHE C HA   1 
ATOM   4414 H  HB2  . PHE D 2 88 ? -0.999  40.581 15.288  1.00 80.83  ? 88  PHE C HB2  1 
ATOM   4415 H  HB3  . PHE D 2 88 ? -0.507  40.402 16.789  1.00 80.83  ? 88  PHE C HB3  1 
ATOM   4416 H  HD1  . PHE D 2 88 ? 0.769   41.690 13.693  0.00 78.11  ? 88  PHE C HD1  1 
ATOM   4417 H  HD2  . PHE D 2 88 ? 0.898   42.014 17.673  0.00 79.21  ? 88  PHE C HD2  1 
ATOM   4418 H  HE1  . PHE D 2 88 ? 2.178   43.519 13.510  0.00 77.05  ? 88  PHE C HE1  1 
ATOM   4419 H  HE2  . PHE D 2 88 ? 2.292   43.823 17.500  0.00 77.93  ? 88  PHE C HE2  1 
ATOM   4420 H  HZ   . PHE D 2 88 ? 2.939   44.587 15.407  0.00 76.91  ? 88  PHE C HZ   1 
ATOM   4421 N  N    . PHE D 2 89 ? 1.703   38.039 17.288  1.00 69.49  ? 89  PHE C N    1 
ATOM   4422 C  CA   . PHE D 2 89 ? 2.858   37.821 18.134  1.00 67.12  ? 89  PHE C CA   1 
ATOM   4423 C  C    . PHE D 2 89 ? 3.535   36.525 17.801  1.00 70.12  ? 89  PHE C C    1 
ATOM   4424 O  O    . PHE D 2 89 ? 4.348   36.044 18.585  1.00 68.85  ? 89  PHE C O    1 
ATOM   4425 C  CB   . PHE D 2 89 ? 2.491   37.772 19.607  1.00 66.96  ? 89  PHE C CB   1 
ATOM   4426 C  CG   . PHE D 2 89 ? 1.771   38.997 20.124  1.00 70.63  ? 89  PHE C CG   1 
ATOM   4427 C  CD1  . PHE D 2 89 ? 1.799   40.207 19.435  1.00 70.52  ? 89  PHE C CD1  1 
ATOM   4428 C  CD2  . PHE D 2 89 ? 1.103   38.936 21.357  1.00 69.59  ? 89  PHE C CD2  1 
ATOM   4429 C  CE1  . PHE D 2 89 ? 1.148   41.341 19.959  1.00 69.54  ? 89  PHE C CE1  1 
ATOM   4430 C  CE2  . PHE D 2 89 ? 0.454   40.046 21.895  1.00 71.55  ? 89  PHE C CE2  1 
ATOM   4431 C  CZ   . PHE D 2 89 ? 0.470   41.262 21.198  1.00 69.11  ? 89  PHE C CZ   1 
ATOM   4432 H  H    . PHE D 2 89 ? 1.051   37.495 17.425  1.00 83.39  ? 89  PHE C H    1 
ATOM   4433 H  HA   . PHE D 2 89 ? 3.494   38.541 18.000  1.00 80.55  ? 89  PHE C HA   1 
ATOM   4434 H  HB2  . PHE D 2 89 ? 1.913   37.008 19.755  1.00 80.35  ? 89  PHE C HB2  1 
ATOM   4435 H  HB3  . PHE D 2 89 ? 3.305   37.671 20.124  1.00 80.35  ? 89  PHE C HB3  1 
ATOM   4436 H  HD1  . PHE D 2 89 ? 2.247   40.266 18.621  1.00 84.62  ? 89  PHE C HD1  1 
ATOM   4437 H  HD2  . PHE D 2 89 ? 1.092   38.133 21.828  1.00 83.50  ? 89  PHE C HD2  1 
ATOM   4438 H  HE1  . PHE D 2 89 ? 1.162   42.143 19.489  1.00 83.45  ? 89  PHE C HE1  1 
ATOM   4439 H  HE2  . PHE D 2 89 ? 0.009   39.980 22.709  1.00 85.86  ? 89  PHE C HE2  1 
ATOM   4440 H  HZ   . PHE D 2 89 ? 0.033   42.007 21.543  1.00 82.93  ? 89  PHE C HZ   1 
ATOM   4441 N  N    . GLU D 2 90 ? 3.139   35.912 16.691  1.00 73.72  ? 90  GLU C N    1 
ATOM   4442 C  CA   . GLU D 2 90 ? 3.915   34.824 16.109  1.00 76.42  ? 90  GLU C CA   1 
ATOM   4443 C  C    . GLU D 2 90 ? 4.981   35.369 15.128  1.00 82.13  ? 90  GLU C C    1 
ATOM   4444 O  O    . GLU D 2 90 ? 4.764   35.375 13.904  1.00 87.62  ? 90  GLU C O    1 
ATOM   4445 C  CB   . GLU D 2 90 ? 2.990   33.798 15.463  1.00 75.30  ? 90  GLU C CB   1 
ATOM   4446 C  CG   . GLU D 2 90 ? 2.172   33.067 16.522  1.00 76.74  ? 90  GLU C CG   1 
ATOM   4447 C  CD   . GLU D 2 90 ? 2.925   31.859 17.130  1.00 80.21  ? 90  GLU C CD   1 
ATOM   4448 O  OE1  . GLU D 2 90 ? 4.091   32.040 17.581  1.00 78.51  ? 90  GLU C OE1  1 
ATOM   4449 O  OE2  . GLU D 2 90 ? 2.341   30.743 17.159  1.00 76.90  ? 90  GLU C OE2  1 
ATOM   4450 H  H    . GLU D 2 90 ? 2.424   36.108 16.255  1.00 88.47  ? 90  GLU C H    1 
ATOM   4451 H  HA   . GLU D 2 90 ? 4.389   34.372 16.825  1.00 91.70  ? 90  GLU C HA   1 
ATOM   4452 H  HB2  . GLU D 2 90 ? 2.378   34.250 14.861  1.00 90.36  ? 90  GLU C HB2  1 
ATOM   4453 H  HB3  . GLU D 2 90 ? 3.520   33.145 14.980  1.00 90.36  ? 90  GLU C HB3  1 
ATOM   4454 H  HG2  . GLU D 2 90 ? 1.962   33.683 17.241  1.00 92.08  ? 90  GLU C HG2  1 
ATOM   4455 H  HG3  . GLU D 2 90 ? 1.354   32.737 16.117  1.00 92.08  ? 90  GLU C HG3  1 
ATOM   4456 N  N    . HIS D 2 91 ? 6.120   35.818 15.683  1.00 75.37  ? 91  HIS C N    1 
ATOM   4457 C  CA   . HIS D 2 91 ? 7.217   36.452 14.926  1.00 71.93  ? 91  HIS C CA   1 
ATOM   4458 C  C    . HIS D 2 91 ? 6.833   37.858 14.432  1.00 69.99  ? 91  HIS C C    1 
ATOM   4459 O  O    . HIS D 2 91 ? 6.399   38.728 15.211  1.00 65.53  ? 91  HIS C O    1 
ATOM   4460 C  CB   . HIS D 2 91 ? 7.658   35.567 13.754  0.00 72.38  ? 91  HIS C CB   1 
ATOM   4461 C  CG   . HIS D 2 91 ? 7.630   34.100 14.057  0.00 74.43  ? 91  HIS C CG   1 
ATOM   4462 N  ND1  . HIS D 2 91 ? 8.599   33.482 14.817  0.00 74.37  ? 91  HIS C ND1  1 
ATOM   4463 C  CD2  . HIS D 2 91 ? 6.758   33.128 13.697  0.00 75.51  ? 91  HIS C CD2  1 
ATOM   4464 C  CE1  . HIS D 2 91 ? 8.323   32.194 14.918  0.00 75.55  ? 91  HIS C CE1  1 
ATOM   4465 N  NE2  . HIS D 2 91 ? 7.210   31.954 14.248  0.00 75.91  ? 91  HIS C NE2  1 
ATOM   4466 H  H    . HIS D 2 91 ? 6.285   35.764 16.525  1.00 90.44  ? 91  HIS C H    1 
ATOM   4467 H  HA   . HIS D 2 91 ? 7.980   36.551 15.518  1.00 86.32  ? 91  HIS C HA   1 
ATOM   4468 H  HB2  . HIS D 2 91 ? 7.065   35.726 13.002  0.00 86.86  ? 91  HIS C HB2  1 
ATOM   4469 H  HB3  . HIS D 2 91 ? 8.567   35.802 13.510  0.00 86.86  ? 91  HIS C HB3  1 
ATOM   4470 H  HD2  . HIS D 2 91 ? 5.994   33.236 13.178  0.00 90.61  ? 91  HIS C HD2  1 
ATOM   4471 H  HE1  . HIS D 2 91 ? 8.826   31.564 15.382  0.00 90.67  ? 91  HIS C HE1  1 
ATOM   4472 N  N    . MET E 2 1  ? -5.243  50.979 26.888  1.00 59.46  ? 1   MET D N    1 
ATOM   4473 C  CA   . MET E 2 1  ? -5.816  49.581 26.745  1.00 53.38  ? 1   MET D CA   1 
ATOM   4474 C  C    . MET E 2 1  ? -6.807  49.243 27.804  1.00 48.56  ? 1   MET D C    1 
ATOM   4475 O  O    . MET E 2 1  ? -6.575  49.528 28.986  1.00 50.35  ? 1   MET D O    1 
ATOM   4476 C  CB   . MET E 2 1  ? -4.739  48.510 26.751  1.00 52.38  ? 1   MET D CB   1 
ATOM   4477 C  CG   . MET E 2 1  ? -3.863  48.560 25.536  1.00 54.42  ? 1   MET D CG   1 
ATOM   4478 S  SD   . MET E 2 1  ? -2.682  47.218 25.514  1.00 76.87  ? 1   MET D SD   1 
ATOM   4479 C  CE   . MET E 2 1  ? -3.748  45.789 25.646  1.00 55.26  ? 1   MET D CE   1 
ATOM   4480 H  H1   . MET E 2 1  ? -5.323  51.413 26.115  1.00 71.36  ? 1   MET D H1   1 
ATOM   4481 H  H2   . MET E 2 1  ? -5.686  51.418 27.523  1.00 71.36  ? 1   MET D H2   1 
ATOM   4482 H  H3   . MET E 2 1  ? -4.383  50.926 27.111  1.00 71.36  ? 1   MET D H3   1 
ATOM   4483 H  HA   . MET E 2 1  ? -6.264  49.529 25.887  1.00 64.06  ? 1   MET D HA   1 
ATOM   4484 H  HB2  . MET E 2 1  ? -4.176  48.631 27.532  1.00 62.86  ? 1   MET D HB2  1 
ATOM   4485 H  HB3  . MET E 2 1  ? -5.162  47.637 26.780  1.00 62.86  ? 1   MET D HB3  1 
ATOM   4486 H  HG2  . MET E 2 1  ? -4.415  48.491 24.741  1.00 65.30  ? 1   MET D HG2  1 
ATOM   4487 H  HG3  . MET E 2 1  ? -3.371  49.396 25.531  1.00 65.30  ? 1   MET D HG3  1 
ATOM   4488 H  HE1  . MET E 2 1  ? -3.202  44.987 25.643  1.00 66.32  ? 1   MET D HE1  1 
ATOM   4489 H  HE2  . MET E 2 1  ? -4.250  45.845 26.474  1.00 66.32  ? 1   MET D HE2  1 
ATOM   4490 H  HE3  . MET E 2 1  ? -4.356  45.778 24.890  1.00 66.32  ? 1   MET D HE3  1 
ATOM   4491 N  N    . SER E 2 2  ? -7.924  48.667 27.372  1.00 45.95  ? 2   SER D N    1 
ATOM   4492 C  CA   . SER E 2 2  ? -8.960  48.222 28.308  1.00 47.89  ? 2   SER D CA   1 
ATOM   4493 C  C    . SER E 2 2  ? -8.606  46.991 29.143  1.00 47.36  ? 2   SER D C    1 
ATOM   4494 O  O    . SER E 2 2  ? -7.665  46.259 28.878  1.00 44.89  ? 2   SER D O    1 
ATOM   4495 C  CB   . SER E 2 2  ? -10.259 47.961 27.550  1.00 47.68  ? 2   SER D CB   1 
ATOM   4496 O  OG   . SER E 2 2  ? -10.100 46.906 26.622  1.00 48.54  ? 2   SER D OG   1 
ATOM   4497 H  H    . SER E 2 2  ? -8.109  48.522 26.544  1.00 55.14  ? 2   SER D H    1 
ATOM   4498 H  HA   . SER E 2 2  ? -9.132  48.946 28.929  1.00 57.47  ? 2   SER D HA   1 
ATOM   4499 H  HB2  . SER E 2 2  ? -10.952 47.721 28.185  1.00 57.21  ? 2   SER D HB2  1 
ATOM   4500 H  HB3  . SER E 2 2  ? -10.512 48.766 27.071  1.00 57.21  ? 2   SER D HB3  1 
ATOM   4501 H  HG   . SER E 2 2  ? -9.502  47.100 26.065  1.00 58.24  ? 2   SER D HG   1 
ATOM   4502 N  N    . GLU E 2 3  ? -9.388  46.815 30.184  1.00 47.29  ? 3   GLU D N    1 
ATOM   4503 C  CA   . GLU E 2 3  ? -9.318  45.631 30.981  1.00 50.64  ? 3   GLU D CA   1 
ATOM   4504 C  C    . GLU E 2 3  ? -9.553  44.394 30.128  1.00 47.31  ? 3   GLU D C    1 
ATOM   4505 O  O    . GLU E 2 3  ? -9.030  43.370 30.447  1.00 47.38  ? 3   GLU D O    1 
ATOM   4506 C  CB   . GLU E 2 3  ? -10.298 45.704 32.128  1.00 51.33  ? 3   GLU D CB   1 
ATOM   4507 C  CG   . GLU E 2 3  ? -9.912  46.780 33.114  1.00 55.94  ? 3   GLU D CG   1 
ATOM   4508 C  CD   . GLU E 2 3  ? -8.553  46.516 33.810  1.00 69.26  ? 3   GLU D CD   1 
ATOM   4509 O  OE1  . GLU E 2 3  ? -8.397  45.397 34.374  1.00 68.37  ? 3   GLU D OE1  1 
ATOM   4510 O  OE2  . GLU E 2 3  ? -7.663  47.438 33.809  1.00 71.63  ? 3   GLU D OE2  1 
ATOM   4511 H  H    . GLU E 2 3  ? -9.978  47.382 30.450  1.00 56.75  ? 3   GLU D H    1 
ATOM   4512 H  HA   . GLU E 2 3  ? -8.427  45.563 31.358  1.00 60.77  ? 3   GLU D HA   1 
ATOM   4513 H  HB2  . GLU E 2 3  ? -11.181 45.910 31.783  1.00 61.59  ? 3   GLU D HB2  1 
ATOM   4514 H  HB3  . GLU E 2 3  ? -10.310 44.854 32.595  1.00 61.59  ? 3   GLU D HB3  1 
ATOM   4515 H  HG2  . GLU E 2 3  ? -9.847  47.627 32.645  1.00 67.13  ? 3   GLU D HG2  1 
ATOM   4516 H  HG3  . GLU E 2 3  ? -10.593 46.835 33.802  1.00 67.13  ? 3   GLU D HG3  1 
ATOM   4517 N  N    . LEU E 2 4  ? -10.369 44.491 29.083  1.00 47.26  ? 4   LEU D N    1 
ATOM   4518 C  CA   . LEU E 2 4  ? -10.621 43.383 28.172  1.00 48.30  ? 4   LEU D CA   1 
ATOM   4519 C  C    . LEU E 2 4  ? -9.402  43.053 27.333  1.00 47.60  ? 4   LEU D C    1 
ATOM   4520 O  O    . LEU E 2 4  ? -8.982  41.903 27.231  1.00 46.67  ? 4   LEU D O    1 
ATOM   4521 C  CB   . LEU E 2 4  ? -11.805 43.687 27.257  1.00 49.40  ? 4   LEU D CB   1 
ATOM   4522 C  CG   . LEU E 2 4  ? -12.120 42.701 26.126  1.00 48.10  ? 4   LEU D CG   1 
ATOM   4523 C  CD1  . LEU E 2 4  ? -12.126 41.312 26.636  1.00 47.93  ? 4   LEU D CD1  1 
ATOM   4524 C  CD2  . LEU E 2 4  ? -13.487 42.972 25.517  1.00 48.91  ? 4   LEU D CD2  1 
ATOM   4525 H  H    . LEU E 2 4  ? -10.797 45.207 28.876  1.00 56.71  ? 4   LEU D H    1 
ATOM   4526 H  HA   . LEU E 2 4  ? -10.843 42.596 28.693  1.00 57.96  ? 4   LEU D HA   1 
ATOM   4527 H  HB2  . LEU E 2 4  ? -12.600 43.744 27.809  1.00 59.28  ? 4   LEU D HB2  1 
ATOM   4528 H  HB3  . LEU E 2 4  ? -11.646 44.549 26.842  1.00 59.28  ? 4   LEU D HB3  1 
ATOM   4529 H  HG   . LEU E 2 4  ? -11.448 42.774 25.430  1.00 57.72  ? 4   LEU D HG   1 
ATOM   4530 H  HD11 . LEU E 2 4  ? -12.327 40.708 25.904  1.00 57.52  ? 4   LEU D HD11 1 
ATOM   4531 H  HD12 . LEU E 2 4  ? -11.252 41.107 27.004  1.00 57.52  ? 4   LEU D HD12 1 
ATOM   4532 H  HD13 . LEU E 2 4  ? -12.803 41.233 27.327  1.00 57.52  ? 4   LEU D HD13 1 
ATOM   4533 H  HD21 . LEU E 2 4  ? -13.649 42.330 24.808  1.00 58.70  ? 4   LEU D HD21 1 
ATOM   4534 H  HD22 . LEU E 2 4  ? -14.163 42.881 26.206  1.00 58.70  ? 4   LEU D HD22 1 
ATOM   4535 H  HD23 . LEU E 2 4  ? -13.499 43.873 25.157  1.00 58.70  ? 4   LEU D HD23 1 
ATOM   4536 N  N    . GLU E 2 5  ? -8.815  44.065 26.743  1.00 47.83  ? 5   GLU D N    1 
ATOM   4537 C  CA   . GLU E 2 5  ? -7.655  43.833 25.908  1.00 49.01  ? 5   GLU D CA   1 
ATOM   4538 C  C    . GLU E 2 5  ? -6.522  43.286 26.768  1.00 46.70  ? 5   GLU D C    1 
ATOM   4539 O  O    . GLU E 2 5  ? -5.797  42.394 26.368  1.00 44.34  ? 5   GLU D O    1 
ATOM   4540 C  CB   . GLU E 2 5  ? -7.258  45.124 25.224  1.00 51.26  ? 5   GLU D CB   1 
ATOM   4541 C  CG   . GLU E 2 5  ? -8.297  45.554 24.195  1.00 56.06  ? 5   GLU D CG   1 
ATOM   4542 C  CD   . GLU E 2 5  ? -8.158  47.016 23.787  1.00 51.85  ? 5   GLU D CD   1 
ATOM   4543 O  OE1  . GLU E 2 5  ? -7.727  47.840 24.630  1.00 47.63  ? 5   GLU D OE1  1 
ATOM   4544 O  OE2  . GLU E 2 5  ? -8.460  47.305 22.610  1.00 51.97  ? 5   GLU D OE2  1 
ATOM   4545 H  H    . GLU E 2 5  ? -9.061  44.887 26.804  1.00 57.40  ? 5   GLU D H    1 
ATOM   4546 H  HA   . GLU E 2 5  ? -7.871  43.176 25.228  1.00 58.82  ? 5   GLU D HA   1 
ATOM   4547 H  HB2  . GLU E 2 5  ? -7.179  45.827 25.888  1.00 61.51  ? 5   GLU D HB2  1 
ATOM   4548 H  HB3  . GLU E 2 5  ? -6.412  44.997 24.767  1.00 61.51  ? 5   GLU D HB3  1 
ATOM   4549 H  HG2  . GLU E 2 5  ? -8.196  45.010 23.398  1.00 67.28  ? 5   GLU D HG2  1 
ATOM   4550 H  HG3  . GLU E 2 5  ? -9.183  45.431 24.570  1.00 67.28  ? 5   GLU D HG3  1 
ATOM   4551 N  N    . LYS E 2 6  ? -6.399  43.851 27.957  1.00 46.12  ? 6   LYS D N    1 
ATOM   4552 C  CA   . LYS E 2 6  ? -5.395  43.442 28.890  1.00 45.74  ? 6   LYS D CA   1 
ATOM   4553 C  C    . LYS E 2 6  ? -5.626  42.013 29.259  1.00 46.43  ? 6   LYS D C    1 
ATOM   4554 O  O    . LYS E 2 6  ? -4.682  41.220 29.328  1.00 46.48  ? 6   LYS D O    1 
ATOM   4555 C  CB   . LYS E 2 6  ? -5.425  44.296 30.132  1.00 46.24  ? 6   LYS D CB   1 
ATOM   4556 C  CG   . LYS E 2 6  ? -4.819  45.636 29.992  1.00 51.77  ? 6   LYS D CG   1 
ATOM   4557 C  CD   . LYS E 2 6  ? -5.236  46.386 31.209  1.00 56.37  ? 6   LYS D CD   1 
ATOM   4558 C  CE   . LYS E 2 6  ? -4.548  47.694 31.355  1.00 55.44  ? 6   LYS D CE   1 
ATOM   4559 N  NZ   . LYS E 2 6  ? -5.256  48.327 32.508  1.00 64.75  ? 6   LYS D NZ   1 
ATOM   4560 H  H    . LYS E 2 6  ? -6.902  44.488 28.243  1.00 55.34  ? 6   LYS D H    1 
ATOM   4561 H  HA   . LYS E 2 6  ? -4.519  43.520 28.481  1.00 54.89  ? 6   LYS D HA   1 
ATOM   4562 H  HB2  . LYS E 2 6  ? -6.350  44.421 30.397  1.00 55.49  ? 6   LYS D HB2  1 
ATOM   4563 H  HB3  . LYS E 2 6  ? -4.946  43.831 30.836  1.00 55.49  ? 6   LYS D HB3  1 
ATOM   4564 H  HG2  . LYS E 2 6  ? -3.851  45.569 29.970  1.00 62.12  ? 6   LYS D HG2  1 
ATOM   4565 H  HG3  . LYS E 2 6  ? -5.163  46.083 29.203  1.00 62.12  ? 6   LYS D HG3  1 
ATOM   4566 H  HD2  . LYS E 2 6  ? -6.190  46.554 31.163  1.00 67.64  ? 6   LYS D HD2  1 
ATOM   4567 H  HD3  . LYS E 2 6  ? -5.032  45.852 31.993  1.00 67.64  ? 6   LYS D HD3  1 
ATOM   4568 H  HE2  . LYS E 2 6  ? -3.611  47.568 31.574  1.00 66.52  ? 6   LYS D HE2  1 
ATOM   4569 H  HE3  . LYS E 2 6  ? -4.665  48.236 30.560  1.00 66.52  ? 6   LYS D HE3  1 
ATOM   4570 H  HZ1  . LYS E 2 6  ? -4.909  49.129 32.675  1.00 77.70  ? 6   LYS D HZ1  1 
ATOM   4571 H  HZ2  . LYS E 2 6  ? -6.121  48.420 32.319  1.00 77.70  ? 6   LYS D HZ2  1 
ATOM   4572 H  HZ3  . LYS E 2 6  ? -5.172  47.818 33.233  1.00 77.70  ? 6   LYS D HZ3  1 
ATOM   4573 N  N    . ALA E 2 7  ? -6.887  41.681 29.499  1.00 46.64  ? 7   ALA D N    1 
ATOM   4574 C  CA   . ALA E 2 7  ? -7.244  40.318 29.818  1.00 46.70  ? 7   ALA D CA   1 
ATOM   4575 C  C    . ALA E 2 7  ? -6.823  39.400 28.658  1.00 44.85  ? 7   ALA D C    1 
ATOM   4576 O  O    . ALA E 2 7  ? -6.374  38.301 28.883  1.00 44.28  ? 7   ALA D O    1 
ATOM   4577 C  CB   . ALA E 2 7  ? -8.748  40.203 30.104  1.00 46.41  ? 7   ALA D CB   1 
ATOM   4578 H  H    . ALA E 2 7  ? -7.550  42.229 29.482  1.00 55.97  ? 7   ALA D H    1 
ATOM   4579 H  HA   . ALA E 2 7  ? -6.763  40.040 30.613  1.00 56.04  ? 7   ALA D HA   1 
ATOM   4580 H  HB1  . ALA E 2 7  ? -9.240  40.485 29.317  1.00 55.70  ? 7   ALA D HB1  1 
ATOM   4581 H  HB2  . ALA E 2 7  ? -8.959  39.280 30.314  1.00 55.70  ? 7   ALA D HB2  1 
ATOM   4582 H  HB3  . ALA E 2 7  ? -8.970  40.774 30.856  1.00 55.70  ? 7   ALA D HB3  1 
ATOM   4583 N  N    . MET E 2 8  ? -6.978  39.866 27.429  1.00 43.85  ? 8   MET D N    1 
ATOM   4584 C  CA   . MET E 2 8  ? -6.609  39.089 26.269  1.00 45.32  ? 8   MET D CA   1 
ATOM   4585 C  C    . MET E 2 8  ? -5.102  38.918 26.196  1.00 46.62  ? 8   MET D C    1 
ATOM   4586 O  O    . MET E 2 8  ? -4.623  37.857 25.804  1.00 53.03  ? 8   MET D O    1 
ATOM   4587 C  CB   . MET E 2 8  ? -7.126  39.740 24.990  1.00 46.58  ? 8   MET D CB   1 
ATOM   4588 C  CG   . MET E 2 8  ? -8.639  39.608 24.770  1.00 48.20  ? 8   MET D CG   1 
ATOM   4589 S  SD   . MET E 2 8  ? -9.204  40.680 23.419  1.00 49.09  ? 8   MET D SD   1 
ATOM   4590 C  CE   . MET E 2 8  ? -10.927 40.241 23.193  1.00 55.03  ? 8   MET D CE   1 
ATOM   4591 H  H    . MET E 2 8  ? -7.301  40.641 27.242  1.00 52.62  ? 8   MET D H    1 
ATOM   4592 H  HA   . MET E 2 8  ? -7.018  38.213 26.339  1.00 54.38  ? 8   MET D HA   1 
ATOM   4593 H  HB2  . MET E 2 8  ? -6.916  40.687 25.017  1.00 55.89  ? 8   MET D HB2  1 
ATOM   4594 H  HB3  . MET E 2 8  ? -6.682  39.329 24.232  1.00 55.89  ? 8   MET D HB3  1 
ATOM   4595 H  HG2  . MET E 2 8  ? -8.850  38.689 24.540  1.00 57.84  ? 8   MET D HG2  1 
ATOM   4596 H  HG3  . MET E 2 8  ? -9.105  39.867 25.580  1.00 57.84  ? 8   MET D HG3  1 
ATOM   4597 H  HE1  . MET E 2 8  ? -11.406 40.411 24.020  1.00 66.04  ? 8   MET D HE1  1 
ATOM   4598 H  HE2  . MET E 2 8  ? -11.299 40.781 22.478  1.00 66.04  ? 8   MET D HE2  1 
ATOM   4599 H  HE3  . MET E 2 8  ? -10.986 39.301 22.963  1.00 66.04  ? 8   MET D HE3  1 
ATOM   4600 N  N    . VAL E 2 9  ? -4.341  39.941 26.563  1.00 45.30  ? 9   VAL D N    1 
ATOM   4601 C  CA   . VAL E 2 9  ? -2.901  39.817 26.511  1.00 45.14  ? 9   VAL D CA   1 
ATOM   4602 C  C    . VAL E 2 9  ? -2.429  38.877 27.636  1.00 46.19  ? 9   VAL D C    1 
ATOM   4603 O  O    . VAL E 2 9  ? -1.467  38.140 27.481  1.00 45.79  ? 9   VAL D O    1 
ATOM   4604 C  CB   . VAL E 2 9  ? -2.223  41.181 26.579  1.00 45.20  ? 9   VAL D CB   1 
ATOM   4605 C  CG1  . VAL E 2 9  ? -0.705  40.994 26.700  1.00 44.99  ? 9   VAL D CG1  1 
ATOM   4606 C  CG2  . VAL E 2 9  ? -2.566  42.015 25.307  1.00 43.91  ? 9   VAL D CG2  1 
ATOM   4607 H  H    . VAL E 2 9  ? -4.631  40.701 26.840  1.00 54.36  ? 9   VAL D H    1 
ATOM   4608 H  HA   . VAL E 2 9  ? -2.655  39.410 25.666  1.00 54.17  ? 9   VAL D HA   1 
ATOM   4609 H  HB   . VAL E 2 9  ? -2.538  41.663 27.360  1.00 54.24  ? 9   VAL D HB   1 
ATOM   4610 H  HG11 . VAL E 2 9  ? -0.282  41.866 26.742  1.00 53.99  ? 9   VAL D HG11 1 
ATOM   4611 H  HG12 . VAL E 2 9  ? -0.512  40.492 27.507  1.00 53.99  ? 9   VAL D HG12 1 
ATOM   4612 H  HG13 . VAL E 2 9  ? -0.384  40.508 25.923  1.00 53.99  ? 9   VAL D HG13 1 
ATOM   4613 H  HG21 . VAL E 2 9  ? -2.126  42.878 25.367  1.00 52.69  ? 9   VAL D HG21 1 
ATOM   4614 H  HG22 . VAL E 2 9  ? -2.252  41.538 24.523  1.00 52.69  ? 9   VAL D HG22 1 
ATOM   4615 H  HG23 . VAL E 2 9  ? -3.527  42.135 25.258  1.00 52.69  ? 9   VAL D HG23 1 
ATOM   4616 N  N    . ALA E 2 10 ? -3.154  38.880 28.748  1.00 46.42  ? 10  ALA D N    1 
ATOM   4617 C  CA   . ALA E 2 10 ? -2.918  37.945 29.831  1.00 47.72  ? 10  ALA D CA   1 
ATOM   4618 C  C    . ALA E 2 10 ? -3.177  36.494 29.383  1.00 46.73  ? 10  ALA D C    1 
ATOM   4619 O  O    . ALA E 2 10 ? -2.424  35.614 29.782  1.00 47.16  ? 10  ALA D O    1 
ATOM   4620 C  CB   . ALA E 2 10 ? -3.770  38.299 31.033  1.00 47.58  ? 10  ALA D CB   1 
ATOM   4621 H  H    . ALA E 2 10 ? -3.801  39.427 28.899  1.00 55.70  ? 10  ALA D H    1 
ATOM   4622 H  HA   . ALA E 2 10 ? -1.988  38.009 30.099  1.00 57.27  ? 10  ALA D HA   1 
ATOM   4623 H  HB1  . ALA E 2 10 ? -4.705  38.262 30.779  1.00 57.09  ? 10  ALA D HB1  1 
ATOM   4624 H  HB2  . ALA E 2 10 ? -3.594  37.660 31.742  1.00 57.09  ? 10  ALA D HB2  1 
ATOM   4625 H  HB3  . ALA E 2 10 ? -3.542  39.194 31.329  1.00 57.09  ? 10  ALA D HB3  1 
ATOM   4626 N  N    . LEU E 2 11 ? -4.205  36.234 28.573  1.00 45.19  ? 11  LEU D N    1 
ATOM   4627 C  CA   . LEU E 2 11 ? -4.404  34.873 28.078  1.00 50.09  ? 11  LEU D CA   1 
ATOM   4628 C  C    . LEU E 2 11 ? -3.256  34.413 27.159  1.00 50.30  ? 11  LEU D C    1 
ATOM   4629 O  O    . LEU E 2 11 ? -2.756  33.298 27.281  1.00 50.49  ? 11  LEU D O    1 
ATOM   4630 C  CB   . LEU E 2 11 ? -5.723  34.708 27.323  1.00 49.29  ? 11  LEU D CB   1 
ATOM   4631 C  CG   . LEU E 2 11 ? -7.030  34.978 28.039  1.00 48.51  ? 11  LEU D CG   1 
ATOM   4632 C  CD1  . LEU E 2 11 ? -8.149  34.877 27.047  1.00 49.53  ? 11  LEU D CD1  1 
ATOM   4633 C  CD2  . LEU E 2 11 ? -7.245  34.020 29.169  1.00 54.59  ? 11  LEU D CD2  1 
ATOM   4634 H  H    . LEU E 2 11 ? -4.784  36.809 28.302  1.00 54.23  ? 11  LEU D H    1 
ATOM   4635 H  HA   . LEU E 2 11 ? -4.427  34.272 28.839  1.00 60.11  ? 11  LEU D HA   1 
ATOM   4636 H  HB2  . LEU E 2 11 ? -5.699  35.303 26.558  1.00 59.15  ? 11  LEU D HB2  1 
ATOM   4637 H  HB3  . LEU E 2 11 ? -5.766  33.792 27.005  1.00 59.15  ? 11  LEU D HB3  1 
ATOM   4638 H  HG   . LEU E 2 11 ? -7.020  35.879 28.398  1.00 58.21  ? 11  LEU D HG   1 
ATOM   4639 H  HD11 . LEU E 2 11 ? -8.989  35.049 27.500  1.00 59.43  ? 11  LEU D HD11 1 
ATOM   4640 H  HD12 . LEU E 2 11 ? -8.010  35.534 26.347  1.00 59.43  ? 11  LEU D HD12 1 
ATOM   4641 H  HD13 . LEU E 2 11 ? -8.155  33.984 26.667  1.00 59.43  ? 11  LEU D HD13 1 
ATOM   4642 H  HD21 . LEU E 2 11 ? -8.089  34.226 29.600  1.00 65.51  ? 11  LEU D HD21 1 
ATOM   4643 H  HD22 . LEU E 2 11 ? -7.264  33.117 28.818  1.00 65.51  ? 11  LEU D HD22 1 
ATOM   4644 H  HD23 . LEU E 2 11 ? -6.517  34.114 29.804  1.00 65.51  ? 11  LEU D HD23 1 
ATOM   4645 N  N    . ILE E 2 12 ? -2.835  35.287 26.262  1.00 49.51  ? 12  ILE D N    1 
ATOM   4646 C  CA   . ILE E 2 12 ? -1.704  35.004 25.385  1.00 50.71  ? 12  ILE D CA   1 
ATOM   4647 C  C    . ILE E 2 12 ? -0.447  34.801 26.217  1.00 50.74  ? 12  ILE D C    1 
ATOM   4648 O  O    . ILE E 2 12 ? 0.350   33.928 25.955  1.00 50.26  ? 12  ILE D O    1 
ATOM   4649 C  CB   . ILE E 2 12 ? -1.495  36.159 24.371  1.00 51.94  ? 12  ILE D CB   1 
ATOM   4650 C  CG1  . ILE E 2 12 ? -2.690  36.200 23.401  1.00 52.07  ? 12  ILE D CG1  1 
ATOM   4651 C  CG2  . ILE E 2 12 ? -0.185  36.020 23.609  1.00 51.55  ? 12  ILE D CG2  1 
ATOM   4652 C  CD1  . ILE E 2 12 ? -2.827  37.517 22.642  1.00 50.88  ? 12  ILE D CD1  1 
ATOM   4653 H  H    . ILE E 2 12 ? -3.189  36.061 26.137  1.00 59.41  ? 12  ILE D H    1 
ATOM   4654 H  HA   . ILE E 2 12 ? -1.878  34.189 24.889  1.00 60.85  ? 12  ILE D HA   1 
ATOM   4655 H  HB   . ILE E 2 12 ? -1.474  36.994 24.863  1.00 62.33  ? 12  ILE D HB   1 
ATOM   4656 H  HG12 . ILE E 2 12 ? -2.586  35.491 22.748  1.00 62.48  ? 12  ILE D HG12 1 
ATOM   4657 H  HG13 . ILE E 2 12 ? -3.507  36.064 23.906  1.00 62.48  ? 12  ILE D HG13 1 
ATOM   4658 H  HG21 . ILE E 2 12 ? -0.101  36.763 22.991  1.00 61.85  ? 12  ILE D HG21 1 
ATOM   4659 H  HG22 . ILE E 2 12 ? 0.550   36.031 24.242  1.00 61.85  ? 12  ILE D HG22 1 
ATOM   4660 H  HG23 . ILE E 2 12 ? -0.191  35.182 23.122  1.00 61.85  ? 12  ILE D HG23 1 
ATOM   4661 H  HD11 . ILE E 2 12 ? -3.598  37.464 22.056  1.00 61.05  ? 12  ILE D HD11 1 
ATOM   4662 H  HD12 . ILE E 2 12 ? -2.945  38.238 23.280  1.00 61.05  ? 12  ILE D HD12 1 
ATOM   4663 H  HD13 . ILE E 2 12 ? -2.024  37.665 22.120  1.00 61.05  ? 12  ILE D HD13 1 
ATOM   4664 N  N    . ASP E 2 13 ? -0.282  35.614 27.233  1.00 49.89  ? 13  ASP D N    1 
ATOM   4665 C  CA   . ASP E 2 13 ? 0.889   35.509 28.056  1.00 50.73  ? 13  ASP D CA   1 
ATOM   4666 C  C    . ASP E 2 13 ? 0.932   34.165 28.819  1.00 51.64  ? 13  ASP D C    1 
ATOM   4667 O  O    . ASP E 2 13 ? 1.963   33.532 28.871  1.00 48.85  ? 13  ASP D O    1 
ATOM   4668 C  CB   . ASP E 2 13 ? 0.954   36.672 29.025  1.00 46.85  ? 13  ASP D CB   1 
ATOM   4669 C  CG   . ASP E 2 13 ? 2.165   36.602 29.918  1.00 51.79  ? 13  ASP D CG   1 
ATOM   4670 O  OD1  . ASP E 2 13 ? 3.295   36.420 29.394  1.00 55.75  ? 13  ASP D OD1  1 
ATOM   4671 O  OD2  . ASP E 2 13 ? 1.999   36.701 31.157  1.00 50.80  ? 13  ASP D OD2  1 
ATOM   4672 H  H    . ASP E 2 13 ? -0.833  36.232 27.465  1.00 59.86  ? 13  ASP D H    1 
ATOM   4673 H  HA   . ASP E 2 13 ? 1.674   35.552 27.489  1.00 60.88  ? 13  ASP D HA   1 
ATOM   4674 H  HB2  . ASP E 2 13 ? 0.998   37.501 28.523  1.00 56.22  ? 13  ASP D HB2  1 
ATOM   4675 H  HB3  . ASP E 2 13 ? 0.164   36.663 29.587  1.00 56.22  ? 13  ASP D HB3  1 
ATOM   4676 N  N    . VAL E 2 14 ? -0.166  33.782 29.468  1.00 51.70  ? 14  VAL D N    1 
ATOM   4677 C  CA   . VAL E 2 14 ? -0.134  32.586 30.309  1.00 54.70  ? 14  VAL D CA   1 
ATOM   4678 C  C    . VAL E 2 14 ? 0.124   31.366 29.414  1.00 55.12  ? 14  VAL D C    1 
ATOM   4679 O  O    . VAL E 2 14 ? 0.843   30.451 29.792  1.00 53.50  ? 14  VAL D O    1 
ATOM   4680 C  CB   . VAL E 2 14 ? -1.434  32.409 31.124  1.00 49.93  ? 14  VAL D CB   1 
ATOM   4681 C  CG1  . VAL E 2 14 ? -2.538  31.967 30.276  1.00 51.48  ? 14  VAL D CG1  1 
ATOM   4682 C  CG2  . VAL E 2 14 ? -1.238  31.406 32.182  1.00 52.99  ? 14  VAL D CG2  1 
ATOM   4683 H  H    . VAL E 2 14 ? -0.926  34.185 29.440  1.00 62.04  ? 14  VAL D H    1 
ATOM   4684 H  HA   . VAL E 2 14 ? 0.604   32.661 30.934  1.00 65.64  ? 14  VAL D HA   1 
ATOM   4685 H  HB   . VAL E 2 14 ? -1.678  33.252 31.537  1.00 59.91  ? 14  VAL D HB   1 
ATOM   4686 H  HG11 . VAL E 2 14 ? -3.334  31.867 30.821  1.00 61.78  ? 14  VAL D HG11 1 
ATOM   4687 H  HG12 . VAL E 2 14 ? -2.691  32.631 29.585  1.00 61.78  ? 14  VAL D HG12 1 
ATOM   4688 H  HG13 . VAL E 2 14 ? -2.304  31.117 29.871  1.00 61.78  ? 14  VAL D HG13 1 
ATOM   4689 H  HG21 . VAL E 2 14 ? -2.064  31.310 32.682  1.00 63.59  ? 14  VAL D HG21 1 
ATOM   4690 H  HG22 . VAL E 2 14 ? -0.997  30.560 31.774  1.00 63.59  ? 14  VAL D HG22 1 
ATOM   4691 H  HG23 . VAL E 2 14 ? -0.528  31.704 32.772  1.00 63.59  ? 14  VAL D HG23 1 
ATOM   4692 N  N    . PHE E 2 15 ? -0.398  31.411 28.194  1.00 54.07  ? 15  PHE D N    1 
ATOM   4693 C  CA   . PHE E 2 15 ? -0.160  30.349 27.258  1.00 57.99  ? 15  PHE D CA   1 
ATOM   4694 C  C    . PHE E 2 15 ? 1.328   30.287 26.886  1.00 58.97  ? 15  PHE D C    1 
ATOM   4695 O  O    . PHE E 2 15 ? 1.923   29.224 26.910  1.00 60.89  ? 15  PHE D O    1 
ATOM   4696 C  CB   . PHE E 2 15 ? -1.019  30.528 26.030  1.00 58.88  ? 15  PHE D CB   1 
ATOM   4697 C  CG   . PHE E 2 15 ? -0.793  29.479 24.985  1.00 61.64  ? 15  PHE D CG   1 
ATOM   4698 C  CD1  . PHE E 2 15 ? -1.492  28.277 25.041  1.00 63.31  ? 15  PHE D CD1  1 
ATOM   4699 C  CD2  . PHE E 2 15 ? 0.094   29.690 23.946  1.00 59.28  ? 15  PHE D CD2  1 
ATOM   4700 C  CE1  . PHE E 2 15 ? -1.319  27.295 24.069  1.00 63.74  ? 15  PHE D CE1  1 
ATOM   4701 C  CE2  . PHE E 2 15 ? 0.271   28.728 22.973  1.00 63.50  ? 15  PHE D CE2  1 
ATOM   4702 C  CZ   . PHE E 2 15 ? -0.440  27.512 23.041  1.00 66.11  ? 15  PHE D CZ   1 
ATOM   4703 H  H    . PHE E 2 15 ? -0.890  32.048 27.893  1.00 64.89  ? 15  PHE D H    1 
ATOM   4704 H  HA   . PHE E 2 15 ? -0.401  29.505 27.672  1.00 69.59  ? 15  PHE D HA   1 
ATOM   4705 H  HB2  . PHE E 2 15 ? -1.952  30.490 26.292  1.00 70.66  ? 15  PHE D HB2  1 
ATOM   4706 H  HB3  . PHE E 2 15 ? -0.823  31.391 25.633  1.00 70.66  ? 15  PHE D HB3  1 
ATOM   4707 H  HD1  . PHE E 2 15 ? -2.093  28.131 25.735  1.00 75.97  ? 15  PHE D HD1  1 
ATOM   4708 H  HD2  . PHE E 2 15 ? 0.561   30.492 23.893  1.00 71.14  ? 15  PHE D HD2  1 
ATOM   4709 H  HE1  . PHE E 2 15 ? -1.792  26.496 24.121  1.00 76.49  ? 15  PHE D HE1  1 
ATOM   4710 H  HE2  . PHE E 2 15 ? 0.872   28.876 22.279  1.00 76.20  ? 15  PHE D HE2  1 
ATOM   4711 H  HZ   . PHE E 2 15 ? -0.312  26.859 22.391  1.00 79.33  ? 15  PHE D HZ   1 
ATOM   4712 N  N    . HIS E 2 16 ? 1.950   31.424 26.617  1.00 56.81  ? 16  HIS D N    1 
ATOM   4713 C  CA   . HIS E 2 16 ? 3.366   31.408 26.299  1.00 57.64  ? 16  HIS D CA   1 
ATOM   4714 C  C    . HIS E 2 16 ? 4.206   30.922 27.458  1.00 59.15  ? 16  HIS D C    1 
ATOM   4715 O  O    . HIS E 2 16 ? 5.093   30.107 27.256  1.00 63.83  ? 16  HIS D O    1 
ATOM   4716 C  CB   . HIS E 2 16 ? 3.912   32.801 25.985  1.00 57.28  ? 16  HIS D CB   1 
ATOM   4717 C  CG   . HIS E 2 16 ? 3.387   33.405 24.733  1.00 54.90  ? 16  HIS D CG   1 
ATOM   4718 N  ND1  . HIS E 2 16 ? 2.991   32.655 23.647  1.00 58.41  ? 16  HIS D ND1  1 
ATOM   4719 C  CD2  . HIS E 2 16 ? 3.216   34.700 24.397  1.00 51.98  ? 16  HIS D CD2  1 
ATOM   4720 C  CE1  . HIS E 2 16 ? 2.559   33.469 22.701  1.00 58.99  ? 16  HIS D CE1  1 
ATOM   4721 N  NE2  . HIS E 2 16 ? 2.701   34.712 23.127  1.00 54.84  ? 16  HIS D NE2  1 
ATOM   4722 H  H    . HIS E 2 16 ? 1.585   32.203 26.612  1.00 68.17  ? 16  HIS D H    1 
ATOM   4723 H  HA   . HIS E 2 16 ? 3.524   30.830 25.536  1.00 69.17  ? 16  HIS D HA   1 
ATOM   4724 H  HB2  . HIS E 2 16 ? 3.683   33.395 26.716  1.00 68.74  ? 16  HIS D HB2  1 
ATOM   4725 H  HB3  . HIS E 2 16 ? 4.877   32.743 25.901  1.00 68.74  ? 16  HIS D HB3  1 
ATOM   4726 H  HD2  . HIS E 2 16 ? 3.401   35.440 24.928  1.00 62.37  ? 16  HIS D HD2  1 
ATOM   4727 H  HE1  . HIS E 2 16 ? 2.241   33.213 21.866  1.00 70.79  ? 16  HIS D HE1  1 
ATOM   4728 N  N    . GLN E 2 17 ? 3.909   31.397 28.664  1.00 56.14  ? 17  GLN D N    1 
ATOM   4729 C  CA   . GLN E 2 17 ? 4.749   31.111 29.822  1.00 57.56  ? 17  GLN D CA   1 
ATOM   4730 C  C    . GLN E 2 17 ? 4.889   29.606 29.975  1.00 63.51  ? 17  GLN D C    1 
ATOM   4731 O  O    . GLN E 2 17 ? 5.944   29.133 30.345  1.00 66.87  ? 17  GLN D O    1 
ATOM   4732 C  CB   . GLN E 2 17 ? 4.199   31.738 31.109  1.00 55.31  ? 17  GLN D CB   1 
ATOM   4733 C  CG   . GLN E 2 17 ? 4.353   33.250 31.192  0.00 55.84  ? 17  GLN D CG   1 
ATOM   4734 C  CD   . GLN E 2 17 ? 3.744   33.834 32.455  0.00 54.48  ? 17  GLN D CD   1 
ATOM   4735 O  OE1  . GLN E 2 17 ? 2.877   33.223 33.081  0.00 54.40  ? 17  GLN D OE1  1 
ATOM   4736 N  NE2  . GLN E 2 17 ? 4.195   35.025 32.834  0.00 54.39  ? 17  GLN D NE2  1 
ATOM   4737 H  H    . GLN E 2 17 ? 3.226   31.889 28.838  1.00 67.37  ? 17  GLN D H    1 
ATOM   4738 H  HA   . GLN E 2 17 ? 5.633   31.478 29.667  1.00 69.07  ? 17  GLN D HA   1 
ATOM   4739 H  HB2  . GLN E 2 17 ? 3.253   31.535 31.173  1.00 66.38  ? 17  GLN D HB2  1 
ATOM   4740 H  HB3  . GLN E 2 17 ? 4.668   31.353 31.866  1.00 66.38  ? 17  GLN D HB3  1 
ATOM   4741 H  HG2  . GLN E 2 17 ? 5.297   33.473 31.183  0.00 67.00  ? 17  GLN D HG2  1 
ATOM   4742 H  HG3  . GLN E 2 17 ? 3.910   33.655 30.430  0.00 67.00  ? 17  GLN D HG3  1 
ATOM   4743 H  HE21 . GLN E 2 17 ? 3.881   35.398 33.542  0.00 65.27  ? 17  GLN D HE21 1 
ATOM   4744 H  HE22 . GLN E 2 17 ? 4.801   35.423 32.370  0.00 65.27  ? 17  GLN D HE22 1 
ATOM   4745 N  N    . TYR E 2 18 ? 3.839   28.877 29.610  1.00 61.98  ? 18  TYR D N    1 
ATOM   4746 C  CA   . TYR E 2 18 ? 3.750   27.450 29.800  1.00 63.69  ? 18  TYR D CA   1 
ATOM   4747 C  C    . TYR E 2 18 ? 4.043   26.657 28.519  1.00 67.75  ? 18  TYR D C    1 
ATOM   4748 O  O    . TYR E 2 18 ? 4.582   25.563 28.573  1.00 66.57  ? 18  TYR D O    1 
ATOM   4749 C  CB   . TYR E 2 18 ? 2.350   27.086 30.337  1.00 63.77  ? 18  TYR D CB   1 
ATOM   4750 C  CG   . TYR E 2 18 ? 2.189   27.378 31.810  1.00 65.51  ? 18  TYR D CG   1 
ATOM   4751 C  CD1  . TYR E 2 18 ? 1.840   28.629 32.255  1.00 63.75  ? 18  TYR D CD1  1 
ATOM   4752 C  CD2  . TYR E 2 18 ? 2.405   26.390 32.756  1.00 69.13  ? 18  TYR D CD2  1 
ATOM   4753 C  CE1  . TYR E 2 18 ? 1.709   28.888 33.576  1.00 66.43  ? 18  TYR D CE1  1 
ATOM   4754 C  CE2  . TYR E 2 18 ? 2.273   26.640 34.090  1.00 68.81  ? 18  TYR D CE2  1 
ATOM   4755 C  CZ   . TYR E 2 18 ? 1.928   27.885 34.498  1.00 70.74  ? 18  TYR D CZ   1 
ATOM   4756 O  OH   . TYR E 2 18 ? 1.806   28.137 35.840  1.00 73.53  ? 18  TYR D OH   1 
ATOM   4757 H  H    . TYR E 2 18 ? 3.141   29.209 29.234  1.00 74.37  ? 18  TYR D H    1 
ATOM   4758 H  HA   . TYR E 2 18 ? 4.402   27.183 30.468  1.00 76.43  ? 18  TYR D HA   1 
ATOM   4759 H  HB2  . TYR E 2 18 ? 1.685   27.602 29.855  1.00 76.53  ? 18  TYR D HB2  1 
ATOM   4760 H  HB3  . TYR E 2 18 ? 2.197   26.138 30.201  1.00 76.53  ? 18  TYR D HB3  1 
ATOM   4761 H  HD1  . TYR E 2 18 ? 1.694   29.309 31.638  1.00 76.50  ? 18  TYR D HD1  1 
ATOM   4762 H  HD2  . TYR E 2 18 ? 2.645   25.536 32.475  1.00 82.95  ? 18  TYR D HD2  1 
ATOM   4763 H  HE1  . TYR E 2 18 ? 1.473   29.741 33.862  1.00 79.71  ? 18  TYR D HE1  1 
ATOM   4764 H  HE2  . TYR E 2 18 ? 2.424   25.965 34.712  1.00 82.57  ? 18  TYR D HE2  1 
ATOM   4765 H  HH   . TYR E 2 18 ? 1.594   28.940 35.963  1.00 88.23  ? 18  TYR D HH   1 
ATOM   4766 N  N    . SER E 2 19 ? 3.699   27.219 27.370  1.00 68.79  ? 19  SER D N    1 
ATOM   4767 C  CA   . SER E 2 19 ? 3.847   26.510 26.105  1.00 67.19  ? 19  SER D CA   1 
ATOM   4768 C  C    . SER E 2 19 ? 5.319   26.426 25.641  1.00 71.22  ? 19  SER D C    1 
ATOM   4769 O  O    . SER E 2 19 ? 5.661   25.555 24.844  1.00 74.84  ? 19  SER D O    1 
ATOM   4770 C  CB   . SER E 2 19 ? 2.990   27.180 25.020  1.00 64.57  ? 19  SER D CB   1 
ATOM   4771 O  OG   . SER E 2 19 ? 3.426   28.504 24.754  1.00 64.37  ? 19  SER D OG   1 
ATOM   4772 H  H    . SER E 2 19 ? 3.376   28.012 27.293  1.00 82.55  ? 19  SER D H    1 
ATOM   4773 H  HA   . SER E 2 19 ? 3.523   25.603 26.218  1.00 80.63  ? 19  SER D HA   1 
ATOM   4774 H  HB2  . SER E 2 19 ? 3.054   26.659 24.204  1.00 77.48  ? 19  SER D HB2  1 
ATOM   4775 H  HB3  . SER E 2 19 ? 2.068   27.208 25.321  1.00 77.48  ? 19  SER D HB3  1 
ATOM   4776 H  HG   . SER E 2 19 ? 4.223   28.496 24.489  1.00 77.24  ? 19  SER D HG   1 
ATOM   4777 N  N    . GLY E 2 20 ? 6.179   27.331 26.106  1.00 67.57  ? 20  GLY D N    1 
ATOM   4778 C  CA   . GLY E 2 20 ? 7.564   27.322 25.690  1.00 67.85  ? 20  GLY D CA   1 
ATOM   4779 C  C    . GLY E 2 20 ? 8.454   26.483 26.579  1.00 70.19  ? 20  GLY D C    1 
ATOM   4780 O  O    . GLY E 2 20 ? 9.612   26.257 26.268  1.00 68.83  ? 20  GLY D O    1 
ATOM   4781 H  H    . GLY E 2 20 ? 5.978   27.956 26.661  1.00 81.09  ? 20  GLY D H    1 
ATOM   4782 H  HA2  . GLY E 2 20 ? 7.624   26.976 24.786  1.00 81.42  ? 20  GLY D HA2  1 
ATOM   4783 H  HA3  . GLY E 2 20 ? 7.904   28.231 25.691  1.00 81.42  ? 20  GLY D HA3  1 
ATOM   4784 N  N    . ARG E 2 21 ? 7.897   25.946 27.654  1.00 73.53  ? 21  ARG D N    1 
ATOM   4785 C  CA   . ARG E 2 21 ? 8.708   25.293 28.689  1.00 73.42  ? 21  ARG D CA   1 
ATOM   4786 C  C    . ARG E 2 21 ? 9.438   24.060 28.149  1.00 76.95  ? 21  ARG D C    1 
ATOM   4787 O  O    . ARG E 2 21 ? 10.652  23.922 28.303  1.00 73.07  ? 21  ARG D O    1 
ATOM   4788 C  CB   . ARG E 2 21 ? 7.824   24.910 29.875  0.00 73.98  ? 21  ARG D CB   1 
ATOM   4789 C  CG   . ARG E 2 21 ? 7.395   26.103 30.713  0.00 73.79  ? 21  ARG D CG   1 
ATOM   4790 C  CD   . ARG E 2 21 ? 6.579   25.687 31.922  0.00 73.54  ? 21  ARG D CD   1 
ATOM   4791 N  NE   . ARG E 2 21 ? 6.279   26.825 32.788  0.00 72.53  ? 21  ARG D NE   1 
ATOM   4792 C  CZ   . ARG E 2 21 ? 5.938   26.728 34.070  0.00 73.61  ? 21  ARG D CZ   1 
ATOM   4793 N  NH1  . ARG E 2 21 ? 5.846   25.541 34.653  0.00 75.49  ? 21  ARG D NH1  1 
ATOM   4794 N  NH2  . ARG E 2 21 ? 5.687   27.825 34.771  0.00 72.94  ? 21  ARG D NH2  1 
ATOM   4795 H  H    . ARG E 2 21 ? 7.052   25.943 27.815  1.00 88.24  ? 21  ARG D H    1 
ATOM   4796 H  HA   . ARG E 2 21 ? 9.376   25.920 29.005  1.00 88.10  ? 21  ARG D HA   1 
ATOM   4797 H  HB2  . ARG E 2 21 ? 7.023   24.475 29.543  0.00 88.78  ? 21  ARG D HB2  1 
ATOM   4798 H  HB3  . ARG E 2 21 ? 8.316   24.303 30.450  0.00 88.78  ? 21  ARG D HB3  1 
ATOM   4799 H  HG2  . ARG E 2 21 ? 8.185   26.571 31.028  0.00 88.55  ? 21  ARG D HG2  1 
ATOM   4800 H  HG3  . ARG E 2 21 ? 6.851   26.694 30.170  0.00 88.55  ? 21  ARG D HG3  1 
ATOM   4801 H  HD2  . ARG E 2 21 ? 5.740   25.303 31.624  0.00 88.25  ? 21  ARG D HD2  1 
ATOM   4802 H  HD3  . ARG E 2 21 ? 7.081   25.037 32.438  0.00 88.25  ? 21  ARG D HD3  1 
ATOM   4803 H  HE   . ARG E 2 21 ? 6.327   27.612 32.445  0.00 87.04  ? 21  ARG D HE   1 
ATOM   4804 H  HH11 . ARG E 2 21 ? 6.008   24.826 34.203  0.00 90.59  ? 21  ARG D HH11 1 
ATOM   4805 H  HH12 . ARG E 2 21 ? 5.624   25.485 35.482  0.00 90.59  ? 21  ARG D HH12 1 
ATOM   4806 H  HH21 . ARG E 2 21 ? 5.745   28.597 34.397  0.00 87.53  ? 21  ARG D HH21 1 
ATOM   4807 H  HH22 . ARG E 2 21 ? 5.465   27.764 35.600  0.00 87.53  ? 21  ARG D HH22 1 
ATOM   4808 N  N    . GLU E 2 22 ? 8.678   23.165 27.521  1.00 79.86  ? 22  GLU D N    1 
ATOM   4809 C  CA   . GLU E 2 22 ? 9.210   21.908 27.016  1.00 79.20  ? 22  GLU D CA   1 
ATOM   4810 C  C    . GLU E 2 22 ? 8.753   21.739 25.551  1.00 80.31  ? 22  GLU D C    1 
ATOM   4811 O  O    . GLU E 2 22 ? 7.748   22.320 25.128  1.00 81.65  ? 22  GLU D O    1 
ATOM   4812 C  CB   . GLU E 2 22 ? 8.725   20.760 27.926  1.00 79.47  ? 22  GLU D CB   1 
ATOM   4813 C  CG   . GLU E 2 22 ? 8.818   21.132 29.441  1.00 82.73  ? 22  GLU D CG   1 
ATOM   4814 C  CD   . GLU E 2 22 ? 8.015   20.236 30.377  1.00 84.39  ? 22  GLU D CD   1 
ATOM   4815 O  OE1  . GLU E 2 22 ? 7.873   19.031 30.068  1.00 95.10  ? 22  GLU D OE1  1 
ATOM   4816 O  OE2  . GLU E 2 22 ? 7.460   20.767 31.383  1.00 78.75  ? 22  GLU D OE2  1 
ATOM   4817 H  H    . GLU E 2 22 ? 7.837   23.267 27.375  1.00 95.84  ? 22  GLU D H    1 
ATOM   4818 H  HA   . GLU E 2 22 ? 10.179  21.932 27.037  1.00 95.05  ? 22  GLU D HA   1 
ATOM   4819 H  HB2  . GLU E 2 22 ? 7.798   20.561 27.719  1.00 95.36  ? 22  GLU D HB2  1 
ATOM   4820 H  HB3  . GLU E 2 22 ? 9.277   19.978 27.772  1.00 95.36  ? 22  GLU D HB3  1 
ATOM   4821 H  HG2  . GLU E 2 22 ? 9.747   21.082 29.714  1.00 99.27  ? 22  GLU D HG2  1 
ATOM   4822 H  HG3  . GLU E 2 22 ? 8.493   22.039 29.556  1.00 99.27  ? 22  GLU D HG3  1 
ATOM   4823 N  N    . GLY E 2 23 ? 9.496   20.956 24.779  1.00 81.43  ? 23  GLY D N    1 
ATOM   4824 C  CA   . GLY E 2 23 ? 9.064   20.543 23.456  1.00 77.39  ? 23  GLY D CA   1 
ATOM   4825 C  C    . GLY E 2 23 ? 8.711   21.695 22.555  1.00 75.30  ? 23  GLY D C    1 
ATOM   4826 O  O    . GLY E 2 23 ? 9.330   22.764 22.646  1.00 73.84  ? 23  GLY D O    1 
ATOM   4827 H  H    . GLY E 2 23 ? 10.266  20.647 25.005  1.00 97.71  ? 23  GLY D H    1 
ATOM   4828 H  HA2  . GLY E 2 23 ? 9.773   20.033 23.033  1.00 92.87  ? 23  GLY D HA2  1 
ATOM   4829 H  HA3  . GLY E 2 23 ? 8.285   19.972 23.538  1.00 92.87  ? 23  GLY D HA3  1 
ATOM   4830 N  N    . ASP E 2 24 ? 7.698   21.480 21.712  1.00 76.28  ? 24  ASP D N    1 
ATOM   4831 C  CA   . ASP E 2 24 ? 7.186   22.533 20.846  1.00 75.47  ? 24  ASP D CA   1 
ATOM   4832 C  C    . ASP E 2 24 ? 6.814   23.725 21.705  1.00 76.44  ? 24  ASP D C    1 
ATOM   4833 O  O    . ASP E 2 24 ? 5.959   23.653 22.596  1.00 75.07  ? 24  ASP D O    1 
ATOM   4834 C  CB   . ASP E 2 24 ? 5.951   22.091 20.057  1.00 75.38  ? 24  ASP D CB   1 
ATOM   4835 C  CG   . ASP E 2 24 ? 5.521   23.124 19.019  1.00 74.67  ? 24  ASP D CG   1 
ATOM   4836 O  OD1  . ASP E 2 24 ? 5.901   24.290 19.165  1.00 75.46  ? 24  ASP D OD1  1 
ATOM   4837 O  OD2  . ASP E 2 24 ? 4.761   22.810 18.084  1.00 75.95  ? 24  ASP D OD2  1 
ATOM   4838 H  H    . ASP E 2 24 ? 7.291   20.728 21.626  1.00 91.54  ? 24  ASP D H    1 
ATOM   4839 H  HA   . ASP E 2 24 ? 7.874   22.804 20.219  1.00 90.57  ? 24  ASP D HA   1 
ATOM   4840 H  HB2  . ASP E 2 24 ? 6.151   21.263 19.592  1.00 90.46  ? 24  ASP D HB2  1 
ATOM   4841 H  HB3  . ASP E 2 24 ? 5.213   21.957 20.672  1.00 90.46  ? 24  ASP D HB3  1 
ATOM   4842 N  N    . LYS E 2 25 ? 7.449   24.838 21.398  1.00 75.70  ? 25  LYS D N    1 
ATOM   4843 C  CA   . LYS E 2 25 ? 7.281   26.037 22.173  1.00 74.70  ? 25  LYS D CA   1 
ATOM   4844 C  C    . LYS E 2 25 ? 5.988   26.806 21.773  1.00 72.17  ? 25  LYS D C    1 
ATOM   4845 O  O    . LYS E 2 25 ? 5.757   27.893 22.277  1.00 71.17  ? 25  LYS D O    1 
ATOM   4846 C  CB   . LYS E 2 25 ? 8.551   26.894 22.080  1.00 71.52  ? 25  LYS D CB   1 
ATOM   4847 C  CG   . LYS E 2 25 ? 9.710   26.263 22.840  0.00 72.95  ? 25  LYS D CG   1 
ATOM   4848 C  CD   . LYS E 2 25 ? 10.965  27.109 22.830  0.00 73.14  ? 25  LYS D CD   1 
ATOM   4849 C  CE   . LYS E 2 25 ? 12.037  26.473 23.705  0.00 75.82  ? 25  LYS D CE   1 
ATOM   4850 N  NZ   . LYS E 2 25 ? 13.304  27.251 23.719  0.00 81.03  ? 25  LYS D NZ   1 
ATOM   4851 H  H    . LYS E 2 25 ? 7.991   24.921 20.735  1.00 90.84  ? 25  LYS D H    1 
ATOM   4852 H  HA   . LYS E 2 25 ? 7.180   25.781 23.103  1.00 89.64  ? 25  LYS D HA   1 
ATOM   4853 H  HB2  . LYS E 2 25 ? 8.810   26.981 21.150  1.00 85.82  ? 25  LYS D HB2  1 
ATOM   4854 H  HB3  . LYS E 2 25 ? 8.376   27.767 22.464  1.00 85.82  ? 25  LYS D HB3  1 
ATOM   4855 H  HG2  . LYS E 2 25 ? 9.446   26.133 23.765  0.00 87.54  ? 25  LYS D HG2  1 
ATOM   4856 H  HG3  . LYS E 2 25 ? 9.924   25.408 22.435  0.00 87.54  ? 25  LYS D HG3  1 
ATOM   4857 H  HD2  . LYS E 2 25 ? 11.306  27.174 21.924  0.00 87.77  ? 25  LYS D HD2  1 
ATOM   4858 H  HD3  . LYS E 2 25 ? 10.765  27.991 23.181  0.00 87.77  ? 25  LYS D HD3  1 
ATOM   4859 H  HE2  . LYS E 2 25 ? 11.709  26.417 24.616  0.00 90.98  ? 25  LYS D HE2  1 
ATOM   4860 H  HE3  . LYS E 2 25 ? 12.234  25.585 23.368  0.00 90.98  ? 25  LYS D HE3  1 
ATOM   4861 H  HZ1  . LYS E 2 25 ? 13.902  26.848 24.240  0.00 97.23  ? 25  LYS D HZ1  1 
ATOM   4862 H  HZ2  . LYS E 2 25 ? 13.632  27.312 22.895  0.00 97.23  ? 25  LYS D HZ2  1 
ATOM   4863 H  HZ3  . LYS E 2 25 ? 13.154  28.071 24.032  0.00 97.23  ? 25  LYS D HZ3  1 
ATOM   4864 N  N    . HIS E 2 26 ? 5.180   26.265 20.856  1.00 71.19  ? 26  HIS D N    1 
ATOM   4865 C  CA   . HIS E 2 26 ? 3.930   26.919 20.451  1.00 69.47  ? 26  HIS D CA   1 
ATOM   4866 C  C    . HIS E 2 26 ? 2.692   26.076 20.824  1.00 68.60  ? 26  HIS D C    1 
ATOM   4867 O  O    . HIS E 2 26 ? 1.536   26.468 20.593  1.00 65.52  ? 26  HIS D O    1 
ATOM   4868 C  CB   . HIS E 2 26 ? 3.917   27.168 18.946  1.00 70.63  ? 26  HIS D CB   1 
ATOM   4869 C  CG   . HIS E 2 26 ? 5.040   28.034 18.468  1.00 75.73  ? 26  HIS D CG   1 
ATOM   4870 N  ND1  . HIS E 2 26 ? 5.061   29.402 18.645  1.00 78.47  ? 26  HIS D ND1  1 
ATOM   4871 C  CD2  . HIS E 2 26 ? 6.154   27.728 17.762  1.00 75.66  ? 26  HIS D CD2  1 
ATOM   4872 C  CE1  . HIS E 2 26 ? 6.160   29.898 18.106  1.00 78.60  ? 26  HIS D CE1  1 
ATOM   4873 N  NE2  . HIS E 2 26 ? 6.835   28.905 17.555  1.00 81.80  ? 26  HIS D NE2  1 
ATOM   4874 H  H    . HIS E 2 26 ? 5.333   25.521 20.452  1.00 85.43  ? 26  HIS D H    1 
ATOM   4875 H  HA   . HIS E 2 26 ? 3.860   27.775 20.900  1.00 83.36  ? 26  HIS D HA   1 
ATOM   4876 H  HB2  . HIS E 2 26 ? 3.984   26.316 18.487  1.00 84.76  ? 26  HIS D HB2  1 
ATOM   4877 H  HB3  . HIS E 2 26 ? 3.084   27.605 18.709  1.00 84.76  ? 26  HIS D HB3  1 
ATOM   4878 H  HD2  . HIS E 2 26 ? 6.416   26.881 17.483  1.00 90.79  ? 26  HIS D HD2  1 
ATOM   4879 H  HE1  . HIS E 2 26 ? 6.408   30.794 18.100  1.00 94.32  ? 26  HIS D HE1  1 
ATOM   4880 N  N    . LYS E 2 27 ? 2.923   24.915 21.412  1.00 72.90  ? 27  LYS D N    1 
ATOM   4881 C  CA   . LYS E 2 27 ? 1.812   24.068 21.823  1.00 72.54  ? 27  LYS D CA   1 
ATOM   4882 C  C    . LYS E 2 27 ? 2.011   23.636 23.271  1.00 71.24  ? 27  LYS D C    1 
ATOM   4883 O  O    . LYS E 2 27 ? 3.134   23.659 23.804  1.00 69.99  ? 27  LYS D O    1 
ATOM   4884 C  CB   . LYS E 2 27 ? 1.696   22.870 20.876  0.00 73.20  ? 27  LYS D CB   1 
ATOM   4885 C  CG   . LYS E 2 27 ? 1.539   23.291 19.415  0.00 72.71  ? 27  LYS D CG   1 
ATOM   4886 C  CD   . LYS E 2 27 ? 1.543   22.115 18.451  0.00 75.39  ? 27  LYS D CD   1 
ATOM   4887 C  CE   . LYS E 2 27 ? 1.440   22.604 17.011  0.00 76.37  ? 27  LYS D CE   1 
ATOM   4888 N  NZ   . LYS E 2 27 ? 1.458   21.502 16.011  0.00 78.59  ? 27  LYS D NZ   1 
ATOM   4889 H  H    . LYS E 2 27 ? 3.703   24.595 21.583  1.00 87.47  ? 27  LYS D H    1 
ATOM   4890 H  HA   . LYS E 2 27 ? 0.987   24.576 21.770  1.00 87.05  ? 27  LYS D HA   1 
ATOM   4891 H  HB2  . LYS E 2 27 ? 2.499   22.330 20.948  0.00 87.84  ? 27  LYS D HB2  1 
ATOM   4892 H  HB3  . LYS E 2 27 ? 0.919   22.345 21.122  0.00 87.84  ? 27  LYS D HB3  1 
ATOM   4893 H  HG2  . LYS E 2 27 ? 0.696   23.760 19.311  0.00 87.26  ? 27  LYS D HG2  1 
ATOM   4894 H  HG3  . LYS E 2 27 ? 2.274   23.876 19.175  0.00 87.26  ? 27  LYS D HG3  1 
ATOM   4895 H  HD2  . LYS E 2 27 ? 2.372   21.620 18.549  0.00 90.46  ? 27  LYS D HD2  1 
ATOM   4896 H  HD3  . LYS E 2 27 ? 0.782   21.542 18.637  0.00 90.46  ? 27  LYS D HD3  1 
ATOM   4897 H  HE2  . LYS E 2 27 ? 0.607   23.090 16.903  0.00 91.64  ? 27  LYS D HE2  1 
ATOM   4898 H  HE3  . LYS E 2 27 ? 2.191   23.189 16.823  0.00 91.64  ? 27  LYS D HE3  1 
ATOM   4899 H  HZ1  . LYS E 2 27 ? 1.396   21.836 15.189  0.00 94.31  ? 27  LYS D HZ1  1 
ATOM   4900 H  HZ2  . LYS E 2 27 ? 2.217   21.042 16.079  0.00 94.31  ? 27  LYS D HZ2  1 
ATOM   4901 H  HZ3  . LYS E 2 27 ? 0.773   20.952 16.152  0.00 94.31  ? 27  LYS D HZ3  1 
ATOM   4902 N  N    . LEU E 2 28 ? 0.913   23.258 23.910  1.00 70.08  ? 28  LEU D N    1 
ATOM   4903 C  CA   . LEU E 2 28 ? 0.987   22.750 25.265  1.00 73.03  ? 28  LEU D CA   1 
ATOM   4904 C  C    . LEU E 2 28 ? 0.873   21.256 25.211  1.00 75.98  ? 28  LEU D C    1 
ATOM   4905 O  O    . LEU E 2 28 ? -0.148  20.740 24.765  1.00 77.04  ? 28  LEU D O    1 
ATOM   4906 C  CB   . LEU E 2 28 ? -0.136  23.295 26.125  1.00 73.19  ? 28  LEU D CB   1 
ATOM   4907 C  CG   . LEU E 2 28 ? -0.240  24.786 26.317  1.00 67.85  ? 28  LEU D CG   1 
ATOM   4908 C  CD1  . LEU E 2 28 ? -1.671  25.127 26.595  1.00 68.09  ? 28  LEU D CD1  1 
ATOM   4909 C  CD2  . LEU E 2 28 ? 0.630   25.149 27.483  1.00 68.57  ? 28  LEU D CD2  1 
ATOM   4910 H  H    . LEU E 2 28 ? 0.119   23.287 23.582  1.00 84.10  ? 28  LEU D H    1 
ATOM   4911 H  HA   . LEU E 2 28 ? 1.838   22.989 25.665  1.00 87.63  ? 28  LEU D HA   1 
ATOM   4912 H  HB2  . LEU E 2 28 ? -0.975  23.004 25.735  1.00 87.82  ? 28  LEU D HB2  1 
ATOM   4913 H  HB3  . LEU E 2 28 ? -0.048  22.904 27.008  1.00 87.82  ? 28  LEU D HB3  1 
ATOM   4914 H  HG   . LEU E 2 28 ? 0.062   25.256 25.523  1.00 81.42  ? 28  LEU D HG   1 
ATOM   4915 H  HD11 . LEU E 2 28 ? -1.748  26.086 26.720  1.00 81.71  ? 28  LEU D HD11 1 
ATOM   4916 H  HD12 . LEU E 2 28 ? -2.214  24.846 25.841  1.00 81.71  ? 28  LEU D HD12 1 
ATOM   4917 H  HD13 . LEU E 2 28 ? -1.954  24.664 27.398  1.00 81.71  ? 28  LEU D HD13 1 
ATOM   4918 H  HD21 . LEU E 2 28 ? 0.580   26.107 27.627  1.00 82.29  ? 28  LEU D HD21 1 
ATOM   4919 H  HD22 . LEU E 2 28 ? 0.314   24.679 28.270  1.00 82.29  ? 28  LEU D HD22 1 
ATOM   4920 H  HD23 . LEU E 2 28 ? 1.544   24.891 27.287  1.00 82.29  ? 28  LEU D HD23 1 
ATOM   4921 N  N    . LYS E 2 29 ? 1.910   20.556 25.664  1.00 79.55  ? 29  LYS D N    1 
ATOM   4922 C  CA   . LYS E 2 29 ? 1.794   19.125 25.870  1.00 79.20  ? 29  LYS D CA   1 
ATOM   4923 C  C    . LYS E 2 29 ? 1.133   18.920 27.237  1.00 81.69  ? 29  LYS D C    1 
ATOM   4924 O  O    . LYS E 2 29 ? 1.034   19.857 28.042  1.00 79.32  ? 29  LYS D O    1 
ATOM   4925 C  CB   . LYS E 2 29 ? 3.148   18.415 25.765  0.00 77.92  ? 29  LYS D CB   1 
ATOM   4926 C  CG   . LYS E 2 29 ? 4.249   18.956 26.659  0.00 78.09  ? 29  LYS D CG   1 
ATOM   4927 C  CD   . LYS E 2 29 ? 5.556   18.179 26.479  0.00 78.13  ? 29  LYS D CD   1 
ATOM   4928 C  CE   . LYS E 2 29 ? 6.059   18.203 25.037  0.00 79.61  ? 29  LYS D CE   1 
ATOM   4929 N  NZ   . LYS E 2 29 ? 7.379   17.533 24.891  0.00 82.69  ? 29  LYS D NZ   1 
ATOM   4930 H  H    . LYS E 2 29 ? 2.681   20.886 25.857  1.00 95.46  ? 29  LYS D H    1 
ATOM   4931 H  HA   . LYS E 2 29 ? 1.207   18.754 25.192  1.00 95.04  ? 29  LYS D HA   1 
ATOM   4932 H  HB2  . LYS E 2 29 ? 3.022   17.481 25.994  0.00 93.51  ? 29  LYS D HB2  1 
ATOM   4933 H  HB3  . LYS E 2 29 ? 3.460   18.483 24.849  0.00 93.51  ? 29  LYS D HB3  1 
ATOM   4934 H  HG2  . LYS E 2 29 ? 4.414   19.886 26.435  0.00 93.71  ? 29  LYS D HG2  1 
ATOM   4935 H  HG3  . LYS E 2 29 ? 3.974   18.878 27.586  0.00 93.71  ? 29  LYS D HG3  1 
ATOM   4936 H  HD2  . LYS E 2 29 ? 6.239   18.575 27.042  0.00 93.75  ? 29  LYS D HD2  1 
ATOM   4937 H  HD3  . LYS E 2 29 ? 5.411   17.254 26.731  0.00 93.75  ? 29  LYS D HD3  1 
ATOM   4938 H  HE2  . LYS E 2 29 ? 5.421   17.741 24.470  0.00 95.53  ? 29  LYS D HE2  1 
ATOM   4939 H  HE3  . LYS E 2 29 ? 6.155   19.125 24.749  0.00 95.53  ? 29  LYS D HE3  1 
ATOM   4940 H  HZ1  . LYS E 2 29 ? 7.644   17.564 24.042  0.00 99.23  ? 29  LYS D HZ1  1 
ATOM   4941 H  HZ2  . LYS E 2 29 ? 7.986   17.942 25.398  0.00 99.23  ? 29  LYS D HZ2  1 
ATOM   4942 H  HZ3  . LYS E 2 29 ? 7.318   16.681 25.144  0.00 99.23  ? 29  LYS D HZ3  1 
ATOM   4943 N  N    . LYS E 2 30 ? 0.682   17.684 27.460  1.00 85.21  ? 30  LYS D N    1 
ATOM   4944 C  CA   . LYS E 2 30 ? -0.030  17.237 28.655  1.00 81.23  ? 30  LYS D CA   1 
ATOM   4945 C  C    . LYS E 2 30 ? 0.632   17.744 29.934  1.00 80.68  ? 30  LYS D C    1 
ATOM   4946 O  O    . LYS E 2 30 ? -0.034  18.148 30.884  1.00 77.98  ? 30  LYS D O    1 
ATOM   4947 C  CB   . LYS E 2 30 ? -0.033  15.712 28.649  0.00 85.20  ? 30  LYS D CB   1 
ATOM   4948 C  CG   . LYS E 2 30 ? -0.930  15.100 27.594  0.00 88.90  ? 30  LYS D CG   1 
ATOM   4949 C  CD   . LYS E 2 30 ? -0.720  13.599 27.519  0.00 93.91  ? 30  LYS D CD   1 
ATOM   4950 C  CE   . LYS E 2 30 ? -1.382  13.008 26.282  0.00 98.35  ? 30  LYS D CE   1 
ATOM   4951 N  NZ   . LYS E 2 30 ? -1.356  11.520 26.272  0.00 101.13 ? 30  LYS D NZ   1 
ATOM   4952 H  H    . LYS E 2 30 ? 0.786   17.048 26.891  1.00 102.25 ? 30  LYS D H    1 
ATOM   4953 H  HA   . LYS E 2 30 ? -0.947  17.553 28.630  1.00 97.47  ? 30  LYS D HA   1 
ATOM   4954 H  HB2  . LYS E 2 30 ? 0.871   15.399 28.486  0.00 102.24 ? 30  LYS D HB2  1 
ATOM   4955 H  HB3  . LYS E 2 30 ? -0.337  15.397 29.515  0.00 102.24 ? 30  LYS D HB3  1 
ATOM   4956 H  HG2  . LYS E 2 30 ? -1.857  15.268 27.822  0.00 106.68 ? 30  LYS D HG2  1 
ATOM   4957 H  HG3  . LYS E 2 30 ? -0.718  15.483 26.729  0.00 106.68 ? 30  LYS D HG3  1 
ATOM   4958 H  HD2  . LYS E 2 30 ? 0.230   13.410 27.474  0.00 112.69 ? 30  LYS D HD2  1 
ATOM   4959 H  HD3  . LYS E 2 30 ? -1.110  13.181 28.302  0.00 112.69 ? 30  LYS D HD3  1 
ATOM   4960 H  HE2  . LYS E 2 30 ? -2.309  13.292 26.254  0.00 118.03 ? 30  LYS D HE2  1 
ATOM   4961 H  HE3  . LYS E 2 30 ? -0.915  13.322 25.493  0.00 118.03 ? 30  LYS D HE3  1 
ATOM   4962 H  HZ1  . LYS E 2 30 ? -1.751  11.214 25.535  0.00 121.36 ? 30  LYS D HZ1  1 
ATOM   4963 H  HZ2  . LYS E 2 30 ? -0.514  11.231 26.289  0.00 121.36 ? 30  LYS D HZ2  1 
ATOM   4964 H  HZ3  . LYS E 2 30 ? -1.786  11.203 26.984  0.00 121.36 ? 30  LYS D HZ3  1 
ATOM   4965 N  N    . SER E 2 31 ? 1.961   17.711 29.940  1.00 81.92  ? 31  SER D N    1 
ATOM   4966 C  CA   . SER E 2 31 ? 2.734   18.086 31.112  1.00 80.63  ? 31  SER D CA   1 
ATOM   4967 C  C    . SER E 2 31 ? 2.629   19.554 31.358  1.00 82.53  ? 31  SER D C    1 
ATOM   4968 O  O    . SER E 2 31 ? 2.541   20.007 32.498  1.00 82.68  ? 31  SER D O    1 
ATOM   4969 C  CB   . SER E 2 31 ? 4.187   17.704 30.927  1.00 80.25  ? 31  SER D CB   1 
ATOM   4970 O  OG   . SER E 2 31 ? 4.759   18.510 29.929  1.00 80.15  ? 31  SER D OG   1 
ATOM   4971 H  H    . SER E 2 31 ? 2.441   17.472 29.268  1.00 98.30  ? 31  SER D H    1 
ATOM   4972 H  HA   . SER E 2 31 ? 2.390   17.619 31.889  1.00 96.75  ? 31  SER D HA   1 
ATOM   4973 H  HB2  . SER E 2 31 ? 4.663   17.842 31.761  1.00 96.30  ? 31  SER D HB2  1 
ATOM   4974 H  HB3  . SER E 2 31 ? 4.242   16.774 30.659  1.00 96.30  ? 31  SER D HB3  1 
ATOM   4975 H  HG   . SER E 2 31 ? 5.566   18.304 29.820  1.00 96.18  ? 31  SER D HG   1 
ATOM   4976 N  N    . GLU E 2 32 ? 2.656   20.303 30.265  1.00 83.04  ? 32  GLU D N    1 
ATOM   4977 C  CA   . GLU E 2 32 ? 2.588   21.746 30.344  1.00 80.59  ? 32  GLU D CA   1 
ATOM   4978 C  C    . GLU E 2 32 ? 1.152   22.165 30.700  1.00 78.38  ? 32  GLU D C    1 
ATOM   4979 O  O    . GLU E 2 32 ? 0.961   22.971 31.598  1.00 76.06  ? 32  GLU D O    1 
ATOM   4980 C  CB   . GLU E 2 32 ? 3.050   22.367 29.028  1.00 79.02  ? 32  GLU D CB   1 
ATOM   4981 C  CG   . GLU E 2 32 ? 4.534   22.131 28.713  1.00 79.09  ? 32  GLU D CG   1 
ATOM   4982 C  CD   . GLU E 2 32 ? 4.918   22.621 27.321  1.00 75.35  ? 32  GLU D CD   1 
ATOM   4983 O  OE1  . GLU E 2 32 ? 4.071   22.482 26.404  1.00 74.25  ? 32  GLU D OE1  1 
ATOM   4984 O  OE2  . GLU E 2 32 ? 6.046   23.151 27.160  1.00 71.16  ? 32  GLU D OE2  1 
ATOM   4985 H  H    . GLU E 2 32 ? 2.715   19.995 29.464  1.00 99.65  ? 32  GLU D H    1 
ATOM   4986 H  HA   . GLU E 2 32 ? 3.177   22.056 31.049  1.00 96.70  ? 32  GLU D HA   1 
ATOM   4987 H  HB2  . GLU E 2 32 ? 2.530   21.986 28.303  1.00 94.83  ? 32  GLU D HB2  1 
ATOM   4988 H  HB3  . GLU E 2 32 ? 2.904   23.326 29.067  1.00 94.83  ? 32  GLU D HB3  1 
ATOM   4989 H  HG2  . GLU E 2 32 ? 5.075   22.610 29.361  1.00 94.90  ? 32  GLU D HG2  1 
ATOM   4990 H  HG3  . GLU E 2 32 ? 4.721   21.181 28.761  1.00 94.90  ? 32  GLU D HG3  1 
ATOM   4991 N  N    . LEU E 2 33 ? 0.155   21.558 30.060  1.00 77.50  ? 33  LEU D N    1 
ATOM   4992 C  CA   . LEU E 2 33 ? -1.227  21.834 30.404  1.00 77.22  ? 33  LEU D CA   1 
ATOM   4993 C  C    . LEU E 2 33 ? -1.399  21.462 31.855  1.00 78.83  ? 33  LEU D C    1 
ATOM   4994 O  O    . LEU E 2 33 ? -2.077  22.150 32.610  1.00 78.05  ? 33  LEU D O    1 
ATOM   4995 C  CB   . LEU E 2 33 ? -2.208  21.058 29.526  1.00 75.83  ? 33  LEU D CB   1 
ATOM   4996 C  CG   . LEU E 2 33 ? -3.697  21.177 29.854  0.00 83.25  ? 33  LEU D CG   1 
ATOM   4997 C  CD1  . LEU E 2 33 ? -4.144  22.628 29.761  0.00 82.68  ? 33  LEU D CD1  1 
ATOM   4998 C  CD2  . LEU E 2 33 ? -4.518  20.309 28.915  0.00 88.48  ? 33  LEU D CD2  1 
ATOM   4999 H  H    . LEU E 2 33 ? 0.256   20.985 29.426  1.00 93.00  ? 33  LEU D H    1 
ATOM   5000 H  HA   . LEU E 2 33 ? -1.405  22.782 30.304  1.00 92.66  ? 33  LEU D HA   1 
ATOM   5001 H  HB2  . LEU E 2 33 ? -2.094  21.358 28.611  1.00 91.00  ? 33  LEU D HB2  1 
ATOM   5002 H  HB3  . LEU E 2 33 ? -1.980  20.116 29.582  1.00 91.00  ? 33  LEU D HB3  1 
ATOM   5003 H  HG   . LEU E 2 33 ? -3.849  20.870 30.762  0.00 99.90  ? 33  LEU D HG   1 
ATOM   5004 H  HD11 . LEU E 2 33 ? -5.089  22.681 29.972  0.00 99.21  ? 33  LEU D HD11 1 
ATOM   5005 H  HD12 . LEU E 2 33 ? -3.633  23.157 30.393  0.00 99.21  ? 33  LEU D HD12 1 
ATOM   5006 H  HD13 . LEU E 2 33 ? -3.988  22.949 28.859  0.00 99.21  ? 33  LEU D HD13 1 
ATOM   5007 H  HD21 . LEU E 2 33 ? -5.457  20.400 29.141  0.00 106.18 ? 33  LEU D HD21 1 
ATOM   5008 H  HD22 . LEU E 2 33 ? -4.367  20.601 28.002  0.00 106.18 ? 33  LEU D HD22 1 
ATOM   5009 H  HD23 . LEU E 2 33 ? -4.241  19.384 29.017  0.00 106.18 ? 33  LEU D HD23 1 
ATOM   5010 N  N    . LYS E 2 34 ? -0.739  20.389 32.264  1.00 80.61  ? 34  LYS D N    1 
ATOM   5011 C  CA   . LYS E 2 34 ? -0.826  19.961 33.647  1.00 79.73  ? 34  LYS D CA   1 
ATOM   5012 C  C    . LYS E 2 34 ? -0.332  21.048 34.588  1.00 78.82  ? 34  LYS D C    1 
ATOM   5013 O  O    . LYS E 2 34 ? -1.091  21.520 35.429  1.00 78.19  ? 34  LYS D O    1 
ATOM   5014 C  CB   . LYS E 2 34 ? -0.037  18.660 33.823  0.00 81.47  ? 34  LYS D CB   1 
ATOM   5015 C  CG   . LYS E 2 34 ? -0.044  18.029 35.193  0.00 80.24  ? 34  LYS D CG   1 
ATOM   5016 C  CD   . LYS E 2 34 ? 1.051   16.970 35.236  0.00 82.45  ? 34  LYS D CD   1 
ATOM   5017 C  CE   . LYS E 2 34 ? 1.227   16.356 36.606  0.00 84.23  ? 34  LYS D CE   1 
ATOM   5018 N  NZ   . LYS E 2 34 ? 2.432   15.481 36.636  0.00 85.45  ? 34  LYS D NZ   1 
ATOM   5019 H  H    . LYS E 2 34 ? -0.240  19.897 31.766  1.00 96.74  ? 34  LYS D H    1 
ATOM   5020 H  HA   . LYS E 2 34 ? -1.755  19.778 33.862  1.00 95.68  ? 34  LYS D HA   1 
ATOM   5021 H  HB2  . LYS E 2 34 ? -0.396  18.004 33.205  0.00 97.76  ? 34  LYS D HB2  1 
ATOM   5022 H  HB3  . LYS E 2 34 ? 0.890   18.837 33.596  0.00 97.76  ? 34  LYS D HB3  1 
ATOM   5023 H  HG2  . LYS E 2 34 ? 0.142   18.701 35.867  0.00 96.28  ? 34  LYS D HG2  1 
ATOM   5024 H  HG3  . LYS E 2 34 ? -0.900  17.603 35.356  0.00 96.28  ? 34  LYS D HG3  1 
ATOM   5025 H  HD2  . LYS E 2 34 ? 0.825   16.258 34.617  0.00 98.94  ? 34  LYS D HD2  1 
ATOM   5026 H  HD3  . LYS E 2 34 ? 1.893   17.377 34.980  0.00 98.94  ? 34  LYS D HD3  1 
ATOM   5027 H  HE2  . LYS E 2 34 ? 1.343   17.060 37.263  0.00 101.07 ? 34  LYS D HE2  1 
ATOM   5028 H  HE3  . LYS E 2 34 ? 0.450   15.817 36.821  0.00 101.07 ? 34  LYS D HE3  1 
ATOM   5029 H  HZ1  . LYS E 2 34 ? 2.529   15.124 37.446  0.00 102.54 ? 34  LYS D HZ1  1 
ATOM   5030 H  HZ2  . LYS E 2 34 ? 2.347   14.826 36.039  0.00 102.54 ? 34  LYS D HZ2  1 
ATOM   5031 H  HZ3  . LYS E 2 34 ? 3.159   15.957 36.441  0.00 102.54 ? 34  LYS D HZ3  1 
ATOM   5032 N  N    . GLU E 2 35 ? 0.891   21.522 34.384  1.00 80.84  ? 35  GLU D N    1 
ATOM   5033 C  CA   . GLU E 2 35 ? 1.463   22.542 35.260  1.00 80.00  ? 35  GLU D CA   1 
ATOM   5034 C  C    . GLU E 2 35 ? 0.584   23.793 35.291  1.00 79.27  ? 35  GLU D C    1 
ATOM   5035 O  O    . GLU E 2 35 ? 0.401   24.398 36.352  1.00 78.46  ? 35  GLU D O    1 
ATOM   5036 C  CB   . GLU E 2 35 ? 2.879   22.902 34.813  0.00 81.40  ? 35  GLU D CB   1 
ATOM   5037 C  CG   . GLU E 2 35 ? 3.898   21.812 35.097  0.00 83.11  ? 35  GLU D CG   1 
ATOM   5038 C  CD   . GLU E 2 35 ? 5.253   22.100 34.483  0.00 84.38  ? 35  GLU D CD   1 
ATOM   5039 O  OE1  . GLU E 2 35 ? 5.366   23.077 33.713  0.00 80.75  ? 35  GLU D OE1  1 
ATOM   5040 O  OE2  . GLU E 2 35 ? 6.208   21.350 34.773  0.00 88.57  ? 35  GLU D OE2  1 
ATOM   5041 H  H    . GLU E 2 35 ? 1.412   21.271 33.747  1.00 97.00  ? 35  GLU D H    1 
ATOM   5042 H  HA   . GLU E 2 35 ? 1.515   22.190 36.162  1.00 95.99  ? 35  GLU D HA   1 
ATOM   5043 H  HB2  . GLU E 2 35 ? 2.874   23.063 33.856  0.00 97.69  ? 35  GLU D HB2  1 
ATOM   5044 H  HB3  . GLU E 2 35 ? 3.162   23.703 35.281  0.00 97.69  ? 35  GLU D HB3  1 
ATOM   5045 H  HG2  . GLU E 2 35 ? 4.015   21.731 36.056  0.00 99.73  ? 35  GLU D HG2  1 
ATOM   5046 H  HG3  . GLU E 2 35 ? 3.575   20.974 34.730  0.00 99.73  ? 35  GLU D HG3  1 
ATOM   5047 N  N    . LEU E 2 36 ? 0.053   24.162 34.118  1.00 79.05  ? 36  LEU D N    1 
ATOM   5048 C  CA   . LEU E 2 36 ? -0.789  25.356 33.946  1.00 78.20  ? 36  LEU D CA   1 
ATOM   5049 C  C    . LEU E 2 36 ? -2.084  25.195 34.739  1.00 77.95  ? 36  LEU D C    1 
ATOM   5050 O  O    . LEU E 2 36 ? -2.356  25.987 35.639  1.00 77.66  ? 36  LEU D O    1 
ATOM   5051 C  CB   . LEU E 2 36 ? -1.102  25.614 32.437  1.00 73.59  ? 36  LEU D CB   1 
ATOM   5052 C  CG   . LEU E 2 36 ? -1.778  26.922 31.953  1.00 68.84  ? 36  LEU D CG   1 
ATOM   5053 C  CD1  . LEU E 2 36 ? -1.496  27.182 30.486  1.00 66.60  ? 36  LEU D CD1  1 
ATOM   5054 C  CD2  . LEU E 2 36 ? -3.268  26.942 32.158  1.00 65.42  ? 36  LEU D CD2  1 
ATOM   5055 H  H    . LEU E 2 36 ? 0.170   23.724 33.387  1.00 94.85  ? 36  LEU D H    1 
ATOM   5056 H  HA   . LEU E 2 36 ? -0.318  26.129 34.293  1.00 93.84  ? 36  LEU D HA   1 
ATOM   5057 H  HB2  . LEU E 2 36 ? -0.261  25.555 31.959  1.00 88.31  ? 36  LEU D HB2  1 
ATOM   5058 H  HB3  . LEU E 2 36 ? -1.675  24.891 32.139  1.00 88.31  ? 36  LEU D HB3  1 
ATOM   5059 H  HG   . LEU E 2 36 ? -1.406  27.663 32.456  1.00 82.61  ? 36  LEU D HG   1 
ATOM   5060 H  HD11 . LEU E 2 36 ? -1.934  28.006 30.222  1.00 79.92  ? 36  LEU D HD11 1 
ATOM   5061 H  HD12 . LEU E 2 36 ? -0.538  27.261 30.359  1.00 79.92  ? 36  LEU D HD12 1 
ATOM   5062 H  HD13 . LEU E 2 36 ? -1.840  26.441 29.963  1.00 79.92  ? 36  LEU D HD13 1 
ATOM   5063 H  HD21 . LEU E 2 36 ? -3.620  27.785 31.833  1.00 78.50  ? 36  LEU D HD21 1 
ATOM   5064 H  HD22 . LEU E 2 36 ? -3.664  26.206 31.665  1.00 78.50  ? 36  LEU D HD22 1 
ATOM   5065 H  HD23 . LEU E 2 36 ? -3.457  26.846 33.105  1.00 78.50  ? 36  LEU D HD23 1 
ATOM   5066 N  N    . ILE E 2 37 ? -2.839  24.134 34.480  1.00 76.70  ? 37  ILE D N    1 
ATOM   5067 C  CA   . ILE E 2 37 ? -4.074  23.925 35.223  1.00 76.59  ? 37  ILE D CA   1 
ATOM   5068 C  C    . ILE E 2 37 ? -3.805  23.898 36.739  1.00 78.11  ? 37  ILE D C    1 
ATOM   5069 O  O    . ILE E 2 37 ? -4.510  24.551 37.511  1.00 78.10  ? 37  ILE D O    1 
ATOM   5070 C  CB   . ILE E 2 37 ? -4.784  22.630 34.778  1.00 74.34  ? 37  ILE D CB   1 
ATOM   5071 C  CG1  . ILE E 2 37 ? -5.412  22.825 33.398  0.00 77.19  ? 37  ILE D CG1  1 
ATOM   5072 C  CG2  . ILE E 2 37 ? -5.873  22.223 35.776  0.00 76.37  ? 37  ILE D CG2  1 
ATOM   5073 C  CD1  . ILE E 2 37 ? -5.779  21.535 32.705  0.00 80.92  ? 37  ILE D CD1  1 
ATOM   5074 H  H    . ILE E 2 37 ? -2.663  23.532 33.892  1.00 92.04  ? 37  ILE D H    1 
ATOM   5075 H  HA   . ILE E 2 37 ? -4.674  24.666 35.043  1.00 91.90  ? 37  ILE D HA   1 
ATOM   5076 H  HB   . ILE E 2 37 ? -4.128  21.917 34.725  1.00 89.21  ? 37  ILE D HB   1 
ATOM   5077 H  HG12 . ILE E 2 37 ? -6.222  23.350 33.494  0.00 92.62  ? 37  ILE D HG12 1 
ATOM   5078 H  HG13 . ILE E 2 37 ? -4.781  23.296 32.831  0.00 92.62  ? 37  ILE D HG13 1 
ATOM   5079 H  HG21 . ILE E 2 37 ? -6.296  21.408 35.465  0.00 91.65  ? 37  ILE D HG21 1 
ATOM   5080 H  HG22 . ILE E 2 37 ? -5.466  22.075 36.644  0.00 91.65  ? 37  ILE D HG22 1 
ATOM   5081 H  HG23 . ILE E 2 37 ? -6.529  22.935 35.834  0.00 91.65  ? 37  ILE D HG23 1 
ATOM   5082 H  HD11 . ILE E 2 37 ? -6.169  21.740 31.841  0.00 97.10  ? 37  ILE D HD11 1 
ATOM   5083 H  HD12 . ILE E 2 37 ? -4.978  21.000 32.589  0.00 97.10  ? 37  ILE D HD12 1 
ATOM   5084 H  HD13 . ILE E 2 37 ? -6.420  21.055 33.252  0.00 97.10  ? 37  ILE D HD13 1 
ATOM   5085 N  N    . ASN E 2 38 ? -2.764  23.194 37.168  1.00 77.08  ? 38  ASN D N    1 
ATOM   5086 C  CA   . ASN E 2 38 ? -2.563  23.009 38.595  1.00 78.09  ? 38  ASN D CA   1 
ATOM   5087 C  C    . ASN E 2 38 ? -2.109  24.267 39.306  1.00 77.66  ? 38  ASN D C    1 
ATOM   5088 O  O    . ASN E 2 38 ? -2.492  24.516 40.452  1.00 80.33  ? 38  ASN D O    1 
ATOM   5089 C  CB   . ASN E 2 38 ? -1.553  21.881 38.828  0.00 80.53  ? 38  ASN D CB   1 
ATOM   5090 C  CG   . ASN E 2 38 ? -2.163  20.501 38.632  0.00 82.78  ? 38  ASN D CG   1 
ATOM   5091 O  OD1  . ASN E 2 38 ? -3.346  20.369 38.317  0.00 82.67  ? 38  ASN D OD1  1 
ATOM   5092 N  ND2  . ASN E 2 38 ? -1.352  19.464 38.814  0.00 84.58  ? 38  ASN D ND2  1 
ATOM   5093 H  H    . ASN E 2 38 ? -2.173  22.822 36.666  1.00 92.50  ? 38  ASN D H    1 
ATOM   5094 H  HA   . ASN E 2 38 ? -3.405  22.736 38.992  1.00 93.71  ? 38  ASN D HA   1 
ATOM   5095 H  HB2  . ASN E 2 38 ? -0.820  21.978 38.200  0.00 96.63  ? 38  ASN D HB2  1 
ATOM   5096 H  HB3  . ASN E 2 38 ? -1.221  21.937 39.738  0.00 96.63  ? 38  ASN D HB3  1 
ATOM   5097 H  HD21 . ASN E 2 38 ? -0.530  19.594 39.031  0.00 101.50 ? 38  ASN D HD21 1 
ATOM   5098 H  HD22 . ASN E 2 38 ? -1.649  18.663 38.715  0.00 101.50 ? 38  ASN D HD22 1 
ATOM   5099 N  N    . ASN E 2 39 ? -1.318  25.079 38.626  1.00 76.96  ? 39  ASN D N    1 
ATOM   5100 C  CA   . ASN E 2 39 ? -0.833  26.321 39.223  1.00 78.35  ? 39  ASN D CA   1 
ATOM   5101 C  C    . ASN E 2 39 ? -1.669  27.567 38.799  1.00 76.24  ? 39  ASN D C    1 
ATOM   5102 O  O    . ASN E 2 39 ? -1.598  28.607 39.455  1.00 73.25  ? 39  ASN D O    1 
ATOM   5103 C  CB   . ASN E 2 39 ? 0.660   26.521 38.902  1.00 77.87  ? 39  ASN D CB   1 
ATOM   5104 C  CG   . ASN E 2 39 ? 1.562   25.616 39.717  1.00 77.61  ? 39  ASN D CG   1 
ATOM   5105 O  OD1  . ASN E 2 39 ? 1.852   25.900 40.880  0.00 81.94  ? 39  ASN D OD1  1 
ATOM   5106 N  ND2  . ASN E 2 39 ? 2.020   24.526 39.111  0.00 80.98  ? 39  ASN D ND2  1 
ATOM   5107 H  H    . ASN E 2 39 ? -1.047  24.940 37.822  1.00 92.35  ? 39  ASN D H    1 
ATOM   5108 H  HA   . ASN E 2 39 ? -0.910  26.241 40.186  1.00 94.02  ? 39  ASN D HA   1 
ATOM   5109 H  HB2  . ASN E 2 39 ? 0.811   26.328 37.963  1.00 93.44  ? 39  ASN D HB2  1 
ATOM   5110 H  HB3  . ASN E 2 39 ? 0.904   27.440 39.094  1.00 93.44  ? 39  ASN D HB3  1 
ATOM   5111 H  HD21 . ASN E 2 39 ? 2.535   23.983 39.534  0.00 97.18  ? 39  ASN D HD21 1 
ATOM   5112 H  HD22 . ASN E 2 39 ? 1.801   24.364 38.295  0.00 97.18  ? 39  ASN D HD22 1 
ATOM   5113 N  N    . GLU E 2 40 ? -2.452  27.466 37.719  1.00 76.25  ? 40  GLU D N    1 
ATOM   5114 C  CA   . GLU E 2 40 ? -3.139  28.640 37.141  1.00 73.55  ? 40  GLU D CA   1 
ATOM   5115 C  C    . GLU E 2 40 ? -4.663  28.520 37.099  1.00 71.38  ? 40  GLU D C    1 
ATOM   5116 O  O    . GLU E 2 40 ? -5.341  29.482 36.781  1.00 68.22  ? 40  GLU D O    1 
ATOM   5117 C  CB   . GLU E 2 40 ? -2.633  28.901 35.712  1.00 69.23  ? 40  GLU D CB   1 
ATOM   5118 C  CG   . GLU E 2 40 ? -1.842  30.152 35.546  1.00 68.35  ? 40  GLU D CG   1 
ATOM   5119 C  CD   . GLU E 2 40 ? -0.791  30.307 36.601  1.00 69.83  ? 40  GLU D CD   1 
ATOM   5120 O  OE1  . GLU E 2 40 ? 0.368   29.900 36.367  1.00 68.92  ? 40  GLU D OE1  1 
ATOM   5121 O  OE2  . GLU E 2 40 ? -1.134  30.829 37.681  1.00 73.37  ? 40  GLU D OE2  1 
ATOM   5122 H  H    . GLU E 2 40 ? -2.605  26.731 37.300  1.00 91.49  ? 40  GLU D H    1 
ATOM   5123 H  HA   . GLU E 2 40 ? -2.922  29.419 37.676  1.00 88.26  ? 40  GLU D HA   1 
ATOM   5124 H  HB2  . GLU E 2 40 ? -2.068  28.160 35.445  1.00 83.08  ? 40  GLU D HB2  1 
ATOM   5125 H  HB3  . GLU E 2 40 ? -3.399  28.958 35.119  1.00 83.08  ? 40  GLU D HB3  1 
ATOM   5126 H  HG2  . GLU E 2 40 ? -1.402  30.137 34.682  1.00 82.02  ? 40  GLU D HG2  1 
ATOM   5127 H  HG3  . GLU E 2 40 ? -2.439  30.915 35.602  1.00 82.02  ? 40  GLU D HG3  1 
ATOM   5128 N  N    . LEU E 2 41 ? -5.207  27.357 37.427  1.00 73.50  ? 41  LEU D N    1 
ATOM   5129 C  CA   . LEU E 2 41 ? -6.662  27.208 37.445  1.00 75.57  ? 41  LEU D CA   1 
ATOM   5130 C  C    . LEU E 2 41 ? -7.148  26.452 38.672  1.00 74.54  ? 41  LEU D C    1 
ATOM   5131 O  O    . LEU E 2 41 ? -8.249  25.885 38.669  1.00 75.28  ? 41  LEU D O    1 
ATOM   5132 C  CB   . LEU E 2 41 ? -7.157  26.496 36.184  1.00 74.88  ? 41  LEU D CB   1 
ATOM   5133 C  CG   . LEU E 2 41 ? -7.081  27.270 34.874  1.00 74.51  ? 41  LEU D CG   1 
ATOM   5134 C  CD1  . LEU E 2 41 ? -7.541  26.382 33.711  1.00 69.87  ? 41  LEU D CD1  1 
ATOM   5135 C  CD2  . LEU E 2 41 ? -7.880  28.581 34.945  1.00 73.13  ? 41  LEU D CD2  1 
ATOM   5136 H  H    . LEU E 2 41 ? -4.769  26.648 37.640  1.00 88.20  ? 41  LEU D H    1 
ATOM   5137 H  HA   . LEU E 2 41 ? -7.065  28.090 37.463  1.00 90.68  ? 41  LEU D HA   1 
ATOM   5138 H  HB2  . LEU E 2 41 ? -6.632  25.688 36.069  1.00 89.86  ? 41  LEU D HB2  1 
ATOM   5139 H  HB3  . LEU E 2 41 ? -8.087  26.255 36.319  1.00 89.86  ? 41  LEU D HB3  1 
ATOM   5140 H  HG   . LEU E 2 41 ? -6.154  27.504 34.710  1.00 89.41  ? 41  LEU D HG   1 
ATOM   5141 H  HD11 . LEU E 2 41 ? -7.486  26.890 32.886  1.00 83.84  ? 41  LEU D HD11 1 
ATOM   5142 H  HD12 . LEU E 2 41 ? -6.963  25.605 33.660  1.00 83.84  ? 41  LEU D HD12 1 
ATOM   5143 H  HD13 . LEU E 2 41 ? -8.457  26.105 33.869  1.00 83.84  ? 41  LEU D HD13 1 
ATOM   5144 H  HD21 . LEU E 2 41 ? -7.806  29.042 34.094  1.00 87.76  ? 41  LEU D HD21 1 
ATOM   5145 H  HD22 . LEU E 2 41 ? -8.809  28.375 35.130  1.00 87.76  ? 41  LEU D HD22 1 
ATOM   5146 H  HD23 . LEU E 2 41 ? -7.515  29.134 35.654  1.00 87.76  ? 41  LEU D HD23 1 
ATOM   5147 N  N    . SER E 2 42 ? -6.348  26.473 39.726  1.00 74.08  ? 42  SER D N    1 
ATOM   5148 C  CA   . SER E 2 42 ? -6.644  25.691 40.921  1.00 73.43  ? 42  SER D CA   1 
ATOM   5149 C  C    . SER E 2 42 ? -8.102  25.867 41.440  1.00 73.37  ? 42  SER D C    1 
ATOM   5150 O  O    . SER E 2 42 ? -8.698  24.897 41.931  1.00 74.18  ? 42  SER D O    1 
ATOM   5151 C  CB   . SER E 2 42 ? -5.573  26.041 41.980  1.00 72.77  ? 42  SER D CB   1 
ATOM   5152 O  OG   . SER E 2 42 ? -5.517  27.442 42.255  1.00 66.94  ? 42  SER D OG   1 
ATOM   5153 H  H    . SER E 2 42 ? -5.624  26.934 39.778  1.00 88.90  ? 42  SER D H    1 
ATOM   5154 H  HA   . SER E 2 42 ? -6.532  24.752 40.702  1.00 88.11  ? 42  SER D HA   1 
ATOM   5155 H  HB2  . SER E 2 42 ? -5.783  25.571 42.802  1.00 87.32  ? 42  SER D HB2  1 
ATOM   5156 H  HB3  . SER E 2 42 ? -4.706  25.754 41.652  1.00 87.32  ? 42  SER D HB3  1 
ATOM   5157 H  HG   . SER E 2 42 ? -4.927  27.598 42.833  1.00 80.32  ? 42  SER D HG   1 
ATOM   5158 N  N    . HIS E 2 43 ? -8.693  27.052 41.230  1.00 68.80  ? 43  HIS D N    1 
ATOM   5159 C  CA   . HIS E 2 43 ? -10.038 27.404 41.719  1.00 67.63  ? 43  HIS D CA   1 
ATOM   5160 C  C    . HIS E 2 43 ? -11.229 27.009 40.850  1.00 71.10  ? 43  HIS D C    1 
ATOM   5161 O  O    . HIS E 2 43 ? -12.395 27.077 41.315  1.00 67.06  ? 43  HIS D O    1 
ATOM   5162 C  CB   . HIS E 2 43 ? -10.098 28.906 41.911  1.00 64.79  ? 43  HIS D CB   1 
ATOM   5163 C  CG   . HIS E 2 43 ? -9.110  29.413 42.904  1.00 61.83  ? 43  HIS D CG   1 
ATOM   5164 N  ND1  . HIS E 2 43 ? -7.848  29.820 42.548  1.00 60.23  ? 43  HIS D ND1  1 
ATOM   5165 C  CD2  . HIS E 2 43 ? -9.222  29.646 44.227  1.00 58.55  ? 43  HIS D CD2  1 
ATOM   5166 C  CE1  . HIS E 2 43 ? -7.204  30.233 43.617  1.00 60.41  ? 43  HIS D CE1  1 
ATOM   5167 N  NE2  . HIS E 2 43 ? -8.021  30.146 44.649  1.00 58.20  ? 43  HIS D NE2  1 
ATOM   5168 H  H    . HIS E 2 43 ? -8.320  27.691 40.791  1.00 82.56  ? 43  HIS D H    1 
ATOM   5169 H  HA   . HIS E 2 43 ? -10.165 26.993 42.588  1.00 81.16  ? 43  HIS D HA   1 
ATOM   5170 H  HB2  . HIS E 2 43 ? -9.917  29.339 41.062  1.00 77.74  ? 43  HIS D HB2  1 
ATOM   5171 H  HB3  . HIS E 2 43 ? -10.985 29.148 42.222  1.00 77.74  ? 43  HIS D HB3  1 
ATOM   5172 H  HD2  . HIS E 2 43 ? -9.967  29.476 44.758  1.00 70.26  ? 43  HIS D HD2  1 
ATOM   5173 H  HE1  . HIS E 2 43 ? -6.330  30.551 43.639  1.00 72.49  ? 43  HIS D HE1  1 
ATOM   5174 N  N    . PHE E 2 44 ? -10.944 26.628 39.598  1.00 74.14  ? 44  PHE D N    1 
ATOM   5175 C  CA   . PHE E 2 44 ? -11.993 26.333 38.608  1.00 74.92  ? 44  PHE D CA   1 
ATOM   5176 C  C    . PHE E 2 44 ? -12.054 24.854 38.256  1.00 76.79  ? 44  PHE D C    1 
ATOM   5177 O  O    . PHE E 2 44 ? -13.111 24.336 37.863  1.00 78.04  ? 44  PHE D O    1 
ATOM   5178 C  CB   . PHE E 2 44 ? -11.761 27.147 37.332  0.00 72.85  ? 44  PHE D CB   1 
ATOM   5179 C  CG   . PHE E 2 44 ? -11.987 28.629 37.494  0.00 69.63  ? 44  PHE D CG   1 
ATOM   5180 C  CD1  . PHE E 2 44 ? -12.374 29.169 38.711  0.00 68.88  ? 44  PHE D CD1  1 
ATOM   5181 C  CD2  . PHE E 2 44 ? -11.803 29.483 36.421  0.00 67.39  ? 44  PHE D CD2  1 
ATOM   5182 C  CE1  . PHE E 2 44 ? -12.575 30.527 38.851  0.00 67.02  ? 44  PHE D CE1  1 
ATOM   5183 C  CE2  . PHE E 2 44 ? -12.004 30.843 36.556  0.00 65.61  ? 44  PHE D CE2  1 
ATOM   5184 C  CZ   . PHE E 2 44 ? -12.389 31.365 37.772  0.00 64.99  ? 44  PHE D CZ   1 
ATOM   5185 H  H    . PHE E 2 44 ? -10.145 26.531 39.295  1.00 88.97  ? 44  PHE D H    1 
ATOM   5186 H  HA   . PHE E 2 44 ? -12.853 26.589 38.975  1.00 89.90  ? 44  PHE D HA   1 
ATOM   5187 H  HB2  . PHE E 2 44 ? -10.844 27.019 37.043  0.00 87.42  ? 44  PHE D HB2  1 
ATOM   5188 H  HB3  . PHE E 2 44 ? -12.368 26.829 36.645  0.00 87.42  ? 44  PHE D HB3  1 
ATOM   5189 H  HD1  . PHE E 2 44 ? -12.500 28.609 39.443  0.00 82.66  ? 44  PHE D HD1  1 
ATOM   5190 H  HD2  . PHE E 2 44 ? -11.543 29.137 35.598  0.00 80.87  ? 44  PHE D HD2  1 
ATOM   5191 H  HE1  . PHE E 2 44 ? -12.835 30.877 39.673  0.00 80.42  ? 44  PHE D HE1  1 
ATOM   5192 H  HE2  . PHE E 2 44 ? -11.878 31.407 35.827  0.00 78.73  ? 44  PHE D HE2  1 
ATOM   5193 H  HZ   . PHE E 2 44 ? -12.525 32.280 37.865  0.00 77.99  ? 44  PHE D HZ   1 
ATOM   5194 N  N    . LEU E 2 45 ? -10.921 24.177 38.423  1.00 77.94  ? 45  LEU D N    1 
ATOM   5195 C  CA   . LEU E 2 45 ? -10.791 22.765 38.061  1.00 82.86  ? 45  LEU D CA   1 
ATOM   5196 C  C    . LEU E 2 45 ? -10.181 21.963 39.215  1.00 86.40  ? 45  LEU D C    1 
ATOM   5197 O  O    . LEU E 2 45 ? -9.299  22.465 39.946  1.00 82.39  ? 45  LEU D O    1 
ATOM   5198 C  CB   . LEU E 2 45 ? -9.928  22.610 36.812  0.00 79.83  ? 45  LEU D CB   1 
ATOM   5199 C  CG   . LEU E 2 45 ? -10.410 23.329 35.551  0.00 77.35  ? 45  LEU D CG   1 
ATOM   5200 C  CD1  . LEU E 2 45 ? -9.401  23.135 34.434  0.00 76.05  ? 45  LEU D CD1  1 
ATOM   5201 C  CD2  . LEU E 2 45 ? -11.786 22.843 35.121  0.00 77.89  ? 45  LEU D CD2  1 
ATOM   5202 H  H    . LEU E 2 45 ? -10.201 24.518 38.750  1.00 93.53  ? 45  LEU D H    1 
ATOM   5203 H  HA   . LEU E 2 45 ? -11.670 22.402 37.870  1.00 99.43  ? 45  LEU D HA   1 
ATOM   5204 H  HB2  . LEU E 2 45 ? -9.041  22.947 37.013  0.00 95.80  ? 45  LEU D HB2  1 
ATOM   5205 H  HB3  . LEU E 2 45 ? -9.870  21.665 36.599  0.00 95.80  ? 45  LEU D HB3  1 
ATOM   5206 H  HG   . LEU E 2 45 ? -10.472 24.279 35.735  0.00 92.82  ? 45  LEU D HG   1 
ATOM   5207 H  HD11 . LEU E 2 45 ? -9.717  23.595 33.641  0.00 91.26  ? 45  LEU D HD11 1 
ATOM   5208 H  HD12 . LEU E 2 45 ? -8.548  23.503 34.713  0.00 91.26  ? 45  LEU D HD12 1 
ATOM   5209 H  HD13 . LEU E 2 45 ? -9.310  22.186 34.253  0.00 91.26  ? 45  LEU D HD13 1 
ATOM   5210 H  HD21 . LEU E 2 45 ? -12.053 23.323 34.321  0.00 93.47  ? 45  LEU D HD21 1 
ATOM   5211 H  HD22 . LEU E 2 45 ? -11.742 21.892 34.937  0.00 93.47  ? 45  LEU D HD22 1 
ATOM   5212 H  HD23 . LEU E 2 45 ? -12.419 23.014 35.836  0.00 93.47  ? 45  LEU D HD23 1 
ATOM   5213 N  N    . GLU E 2 46 ? -10.623 20.710 39.357  1.00 87.59  ? 46  GLU D N    1 
ATOM   5214 C  CA   . GLU E 2 46 ? -10.010 19.811 40.327  1.00 88.04  ? 46  GLU D CA   1 
ATOM   5215 C  C    . GLU E 2 46 ? -8.508  19.701 40.016  1.00 90.12  ? 46  GLU D C    1 
ATOM   5216 O  O    . GLU E 2 46 ? -8.133  19.593 38.837  1.00 88.29  ? 46  GLU D O    1 
ATOM   5217 C  CB   . GLU E 2 46 ? -10.687 18.436 40.291  0.00 88.02  ? 46  GLU D CB   1 
ATOM   5218 C  CG   . GLU E 2 46 ? -12.160 18.464 40.694  0.00 87.86  ? 46  GLU D CG   1 
ATOM   5219 C  CD   . GLU E 2 46 ? -12.766 17.078 40.820  0.00 88.65  ? 46  GLU D CD   1 
ATOM   5220 O  OE1  . GLU E 2 46 ? -12.034 16.084 40.630  0.00 88.73  ? 46  GLU D OE1  1 
ATOM   5221 O  OE2  . GLU E 2 46 ? -13.978 16.983 41.110  0.00 89.16  ? 46  GLU D OE2  1 
ATOM   5222 H  H    . GLU E 2 46 ? -11.269 20.364 38.907  1.00 105.11 ? 46  GLU D H    1 
ATOM   5223 H  HA   . GLU E 2 46 ? -10.113 20.179 41.218  1.00 105.65 ? 46  GLU D HA   1 
ATOM   5224 H  HB2  . GLU E 2 46 ? -10.632 18.085 39.389  0.00 105.63 ? 46  GLU D HB2  1 
ATOM   5225 H  HB3  . GLU E 2 46 ? -10.223 17.844 40.904  0.00 105.63 ? 46  GLU D HB3  1 
ATOM   5226 H  HG2  . GLU E 2 46 ? -12.243 18.907 41.553  0.00 105.43 ? 46  GLU D HG2  1 
ATOM   5227 H  HG3  . GLU E 2 46 ? -12.661 18.950 40.020  0.00 105.43 ? 46  GLU D HG3  1 
ATOM   5228 N  N    . GLU E 2 47 ? -7.654  19.779 41.048  1.00 90.20  ? 47  GLU D N    1 
ATOM   5229 C  CA   . GLU E 2 47 ? -6.226  19.548 40.846  1.00 86.11  ? 47  GLU D CA   1 
ATOM   5230 C  C    . GLU E 2 47 ? -6.108  18.215 40.122  1.00 89.95  ? 47  GLU D C    1 
ATOM   5231 O  O    . GLU E 2 47 ? -6.716  17.227 40.554  1.00 91.83  ? 47  GLU D O    1 
ATOM   5232 C  CB   . GLU E 2 47 ? -5.469  19.531 42.171  0.00 86.95  ? 47  GLU D CB   1 
ATOM   5233 C  CG   . GLU E 2 47 ? -5.469  20.865 42.891  0.00 87.26  ? 47  GLU D CG   1 
ATOM   5234 C  CD   . GLU E 2 47 ? -4.727  20.814 44.211  0.00 87.57  ? 47  GLU D CD   1 
ATOM   5235 O  OE1  . GLU E 2 47 ? -4.343  19.704 44.636  0.00 87.85  ? 47  GLU D OE1  1 
ATOM   5236 O  OE2  . GLU E 2 47 ? -4.527  21.884 44.824  0.00 87.64  ? 47  GLU D OE2  1 
ATOM   5237 H  H    . GLU E 2 47 ? -7.876  19.962 41.858  1.00 108.24 ? 47  GLU D H    1 
ATOM   5238 H  HA   . GLU E 2 47 ? -5.856  20.245 40.282  1.00 103.33 ? 47  GLU D HA   1 
ATOM   5239 H  HB2  . GLU E 2 47 ? -5.880  18.877 42.758  0.00 104.34 ? 47  GLU D HB2  1 
ATOM   5240 H  HB3  . GLU E 2 47 ? -4.546  19.285 42.001  0.00 104.34 ? 47  GLU D HB3  1 
ATOM   5241 H  HG2  . GLU E 2 47 ? -5.037  21.528 42.329  0.00 104.72 ? 47  GLU D HG2  1 
ATOM   5242 H  HG3  . GLU E 2 47 ? -6.385  21.128 43.071  0.00 104.72 ? 47  GLU D HG3  1 
ATOM   5243 N  N    . ILE E 2 48 ? -5.329  18.196 39.033  1.00 90.56  ? 48  ILE D N    1 
ATOM   5244 C  CA   . ILE E 2 48 ? -5.104  16.998 38.210  1.00 86.56  ? 48  ILE D CA   1 
ATOM   5245 C  C    . ILE E 2 48 ? -3.838  16.259 38.634  1.00 89.16  ? 48  ILE D C    1 
ATOM   5246 O  O    . ILE E 2 48 ? -2.754  16.845 38.646  1.00 90.54  ? 48  ILE D O    1 
ATOM   5247 C  CB   . ILE E 2 48 ? -5.006  17.358 36.709  0.00 87.20  ? 48  ILE D CB   1 
ATOM   5248 C  CG1  . ILE E 2 48 ? -6.298  18.045 36.252  0.00 86.46  ? 48  ILE D CG1  1 
ATOM   5249 C  CG2  . ILE E 2 48 ? -4.733  16.105 35.868  0.00 89.68  ? 48  ILE D CG2  1 
ATOM   5250 C  CD1  . ILE E 2 48 ? -6.296  18.493 34.801  0.00 87.12  ? 48  ILE D CD1  1 
ATOM   5251 H  H    . ILE E 2 48 ? -4.907  18.887 38.743  1.00 108.68 ? 48  ILE D H    1 
ATOM   5252 H  HA   . ILE E 2 48 ? -5.854  16.394 38.323  1.00 103.87 ? 48  ILE D HA   1 
ATOM   5253 H  HB   . ILE E 2 48 ? -4.269  17.977 36.588  0.00 104.64 ? 48  ILE D HB   1 
ATOM   5254 H  HG12 . ILE E 2 48 ? -7.036  17.425 36.367  0.00 103.76 ? 48  ILE D HG12 1 
ATOM   5255 H  HG13 . ILE E 2 48 ? -6.443  18.830 36.802  0.00 103.76 ? 48  ILE D HG13 1 
ATOM   5256 H  HG21 . ILE E 2 48 ? -4.677  16.358 34.934  0.00 107.61 ? 48  ILE D HG21 1 
ATOM   5257 H  HG22 . ILE E 2 48 ? -3.895  15.709 36.155  0.00 107.61 ? 48  ILE D HG22 1 
ATOM   5258 H  HG23 . ILE E 2 48 ? -5.459  15.474 35.997  0.00 107.61 ? 48  ILE D HG23 1 
ATOM   5259 H  HD11 . ILE E 2 48 ? -7.147  18.914 34.600  0.00 104.54 ? 48  ILE D HD11 1 
ATOM   5260 H  HD12 . ILE E 2 48 ? -5.573  19.126 34.668  0.00 104.54 ? 48  ILE D HD12 1 
ATOM   5261 H  HD13 . ILE E 2 48 ? -6.167  17.719 34.232  0.00 104.54 ? 48  ILE D HD13 1 
ATOM   5262 N  N    . LYS E 2 49 ? -3.988  14.981 38.999  1.00 90.33  ? 49  LYS D N    1 
ATOM   5263 C  CA   . LYS E 2 49 ? -2.870  14.167 39.481  1.00 91.44  ? 49  LYS D CA   1 
ATOM   5264 C  C    . LYS E 2 49 ? -2.624  12.858 38.708  1.00 93.22  ? 49  LYS D C    1 
ATOM   5265 O  O    . LYS E 2 49 ? -1.470  12.420 38.593  1.00 89.95  ? 49  LYS D O    1 
ATOM   5266 C  CB   . LYS E 2 49 ? -3.063  13.840 40.963  0.00 89.04  ? 49  LYS D CB   1 
ATOM   5267 C  CG   . LYS E 2 49 ? -3.067  15.066 41.857  0.00 88.39  ? 49  LYS D CG   1 
ATOM   5268 C  CD   . LYS E 2 49 ? -3.296  14.696 43.309  0.00 88.08  ? 49  LYS D CD   1 
ATOM   5269 C  CE   . LYS E 2 49 ? -3.165  15.912 44.208  0.00 88.82  ? 49  LYS D CE   1 
ATOM   5270 N  NZ   . LYS E 2 49 ? -3.478  15.596 45.627  0.00 89.24  ? 49  LYS D NZ   1 
ATOM   5271 H  H    . LYS E 2 49 ? -4.737  14.560 38.976  1.00 108.39 ? 49  LYS D H    1 
ATOM   5272 H  HA   . LYS E 2 49 ? -2.060  14.696 39.408  1.00 109.73 ? 49  LYS D HA   1 
ATOM   5273 H  HB2  . LYS E 2 49 ? -3.914  13.387 41.076  0.00 106.85 ? 49  LYS D HB2  1 
ATOM   5274 H  HB3  . LYS E 2 49 ? -2.341  13.262 41.254  0.00 106.85 ? 49  LYS D HB3  1 
ATOM   5275 H  HG2  . LYS E 2 49 ? -2.209  15.514 41.789  0.00 106.07 ? 49  LYS D HG2  1 
ATOM   5276 H  HG3  . LYS E 2 49 ? -3.780  15.662 41.579  0.00 106.07 ? 49  LYS D HG3  1 
ATOM   5277 H  HD2  . LYS E 2 49 ? -4.190  14.335 43.412  0.00 105.69 ? 49  LYS D HD2  1 
ATOM   5278 H  HD3  . LYS E 2 49 ? -2.634  14.042 43.582  0.00 105.69 ? 49  LYS D HD3  1 
ATOM   5279 H  HE2  . LYS E 2 49 ? -2.253  16.242 44.166  0.00 106.58 ? 49  LYS D HE2  1 
ATOM   5280 H  HE3  . LYS E 2 49 ? -3.782  16.597 43.908  0.00 106.58 ? 49  LYS D HE3  1 
ATOM   5281 H  HZ1  . LYS E 2 49 ? -3.392  16.327 46.127  0.00 107.09 ? 49  LYS D HZ1  1 
ATOM   5282 H  HZ2  . LYS E 2 49 ? -4.312  15.295 45.694  0.00 107.09 ? 49  LYS D HZ2  1 
ATOM   5283 H  HZ3  . LYS E 2 49 ? -2.920  14.971 45.929  0.00 107.09 ? 49  LYS D HZ3  1 
ATOM   5284 N  N    . GLU E 2 50 ? -3.672  12.232 38.174  1.00 91.24  ? 50  GLU D N    1 
ATOM   5285 C  CA   . GLU E 2 50 ? -3.461  10.965 37.492  1.00 91.48  ? 50  GLU D CA   1 
ATOM   5286 C  C    . GLU E 2 50 ? -3.125  11.271 36.046  1.00 93.13  ? 50  GLU D C    1 
ATOM   5287 O  O    . GLU E 2 50 ? -3.923  11.871 35.332  1.00 94.16  ? 50  GLU D O    1 
ATOM   5288 C  CB   . GLU E 2 50 ? -4.710  10.092 37.593  0.00 89.64  ? 50  GLU D CB   1 
ATOM   5289 C  CG   . GLU E 2 50 ? -5.087  9.716  39.019  0.00 85.41  ? 50  GLU D CG   1 
ATOM   5290 C  CD   . GLU E 2 50 ? -6.450  9.054  39.112  0.00 78.78  ? 50  GLU D CD   1 
ATOM   5291 O  OE1  . GLU E 2 50 ? -7.161  8.997  38.088  0.00 78.85  ? 50  GLU D OE1  1 
ATOM   5292 O  OE2  . GLU E 2 50 ? -6.821  8.606  40.215  0.00 75.35  ? 50  GLU D OE2  1 
ATOM   5293 H  H    . GLU E 2 50 ? -4.486  12.509 38.193  1.00 109.49 ? 50  GLU D H    1 
ATOM   5294 H  HA   . GLU E 2 50 ? -2.716  10.493 37.895  1.00 109.77 ? 50  GLU D HA   1 
ATOM   5295 H  HB2  . GLU E 2 50 ? -5.459  10.571 37.205  0.00 107.56 ? 50  GLU D HB2  1 
ATOM   5296 H  HB3  . GLU E 2 50 ? -4.557  9.270  37.101  0.00 107.56 ? 50  GLU D HB3  1 
ATOM   5297 H  HG2  . GLU E 2 50 ? -4.428  9.095  39.367  0.00 102.49 ? 50  GLU D HG2  1 
ATOM   5298 H  HG3  . GLU E 2 50 ? -5.105  10.519 39.563  0.00 102.49 ? 50  GLU D HG3  1 
ATOM   5299 N  N    . GLN E 2 51 ? -1.959  10.802 35.607  1.00 94.26  ? 51  GLN D N    1 
ATOM   5300 C  CA   . GLN E 2 51 ? -1.501  11.002 34.233  1.00 96.25  ? 51  GLN D CA   1 
ATOM   5301 C  C    . GLN E 2 51 ? -2.567  10.469 33.271  1.00 98.24  ? 51  GLN D C    1 
ATOM   5302 O  O    . GLN E 2 51 ? -2.813  11.030 32.189  1.00 100.04 ? 51  GLN D O    1 
ATOM   5303 C  CB   . GLN E 2 51 ? -0.150  10.324 33.994  0.00 94.57  ? 51  GLN D CB   1 
ATOM   5304 C  CG   . GLN E 2 51 ? 0.518   10.702 32.670  0.00 93.87  ? 51  GLN D CG   1 
ATOM   5305 C  CD   . GLN E 2 51 ? 0.820   12.193 32.564  0.00 95.66  ? 51  GLN D CD   1 
ATOM   5306 O  OE1  . GLN E 2 51 ? 0.113   12.937 31.886  0.00 95.51  ? 51  GLN D OE1  1 
ATOM   5307 N  NE2  . GLN E 2 51 ? 1.902   12.625 33.209  0.00 95.46  ? 51  GLN D NE2  1 
ATOM   5308 H  H    . GLN E 2 51 ? -1.407  10.357 36.093  1.00 113.11 ? 51  GLN D H    1 
ATOM   5309 H  HA   . GLN E 2 51 ? -1.395  11.952 34.069  1.00 115.50 ? 51  GLN D HA   1 
ATOM   5310 H  HB2  . GLN E 2 51 ? 0.454   10.573 34.711  0.00 113.48 ? 51  GLN D HB2  1 
ATOM   5311 H  HB3  . GLN E 2 51 ? -0.280  9.363  33.995  0.00 113.48 ? 51  GLN D HB3  1 
ATOM   5312 H  HG2  . GLN E 2 51 ? 1.355   10.220 32.589  0.00 112.64 ? 51  GLN D HG2  1 
ATOM   5313 H  HG3  . GLN E 2 51 ? -0.074  10.464 31.939  0.00 112.64 ? 51  GLN D HG3  1 
ATOM   5314 H  HE21 . GLN E 2 51 ? 2.387   12.072 33.655  0.00 114.55 ? 51  GLN D HE21 1 
ATOM   5315 H  HE22 . GLN E 2 51 ? 2.116   13.458 33.181  0.00 114.55 ? 51  GLN D HE22 1 
ATOM   5316 N  N    . GLU E 2 52 ? -3.191  9.364  33.656  1.00 93.98  ? 52  GLU D N    1 
ATOM   5317 C  CA   . GLU E 2 52 ? -4.199  8.785  32.798  1.00 94.98  ? 52  GLU D CA   1 
ATOM   5318 C  C    . GLU E 2 52 ? -5.336  9.804  32.659  1.00 100.15 ? 52  GLU D C    1 
ATOM   5319 O  O    . GLU E 2 52 ? -5.966  9.911  31.602  1.00 100.92 ? 52  GLU D O    1 
ATOM   5320 C  CB   . GLU E 2 52 ? -4.709  7.465  33.376  0.00 92.08  ? 52  GLU D CB   1 
ATOM   5321 C  CG   . GLU E 2 52 ? -3.649  6.369  33.456  0.00 89.82  ? 52  GLU D CG   1 
ATOM   5322 C  CD   . GLU E 2 52 ? -2.737  6.503  34.667  0.00 89.13  ? 52  GLU D CD   1 
ATOM   5323 O  OE1  . GLU E 2 52 ? -2.888  7.479  35.433  0.00 89.93  ? 52  GLU D OE1  1 
ATOM   5324 O  OE2  . GLU E 2 52 ? -1.868  5.626  34.854  0.00 87.84  ? 52  GLU D OE2  1 
ATOM   5325 H  H    . GLU E 2 52 ? -3.050  8.942  34.392  1.00 112.77 ? 52  GLU D H    1 
ATOM   5326 H  HA   . GLU E 2 52 ? -3.823  8.616  31.920  1.00 113.97 ? 52  GLU D HA   1 
ATOM   5327 H  HB2  . GLU E 2 52 ? -5.038  7.624  34.274  0.00 110.50 ? 52  GLU D HB2  1 
ATOM   5328 H  HB3  . GLU E 2 52 ? -5.430  7.138  32.816  0.00 110.50 ? 52  GLU D HB3  1 
ATOM   5329 H  HG2  . GLU E 2 52 ? -4.092  5.508  33.510  0.00 107.79 ? 52  GLU D HG2  1 
ATOM   5330 H  HG3  . GLU E 2 52 ? -3.096  6.407  32.660  0.00 107.79 ? 52  GLU D HG3  1 
ATOM   5331 N  N    . VAL E 2 53 ? -5.566  10.578 33.723  1.00 100.18 ? 53  VAL D N    1 
ATOM   5332 C  CA   . VAL E 2 53 ? -6.578  11.641 33.714  1.00 99.07  ? 53  VAL D CA   1 
ATOM   5333 C  C    . VAL E 2 53 ? -6.088  12.800 32.891  1.00 98.45  ? 53  VAL D C    1 
ATOM   5334 O  O    . VAL E 2 53 ? -6.861  13.401 32.154  1.00 101.49 ? 53  VAL D O    1 
ATOM   5335 C  CB   . VAL E 2 53 ? -6.968  12.099 35.130  1.00 96.81  ? 53  VAL D CB   1 
ATOM   5336 C  CG1  . VAL E 2 53 ? -7.878  13.337 35.091  1.00 95.08  ? 53  VAL D CG1  1 
ATOM   5337 C  CG2  . VAL E 2 53 ? -7.665  10.948 35.854  1.00 95.79  ? 53  VAL D CG2  1 
ATOM   5338 H  H    . VAL E 2 53 ? -5.145  10.508 34.470  1.00 120.22 ? 53  VAL D H    1 
ATOM   5339 H  HA   . VAL E 2 53 ? -7.380  11.299 33.288  1.00 118.88 ? 53  VAL D HA   1 
ATOM   5340 H  HB   . VAL E 2 53 ? -6.165  12.327 35.625  1.00 116.18 ? 53  VAL D HB   1 
ATOM   5341 H  HG11 . VAL E 2 53 ? -8.028  13.588 34.166  1.00 114.10 ? 53  VAL D HG11 1 
ATOM   5342 H  HG12 . VAL E 2 53 ? -8.722  13.121 35.517  1.00 114.10 ? 53  VAL D HG12 1 
ATOM   5343 H  HG13 . VAL E 2 53 ? -7.443  14.063 35.565  1.00 114.10 ? 53  VAL D HG13 1 
ATOM   5344 H  HG21 . VAL E 2 53 ? -7.910  11.239 36.747  1.00 114.95 ? 53  VAL D HG21 1 
ATOM   5345 H  HG22 . VAL E 2 53 ? -8.460  10.699 35.358  1.00 114.95 ? 53  VAL D HG22 1 
ATOM   5346 H  HG23 . VAL E 2 53 ? -7.057  10.194 35.907  1.00 114.95 ? 53  VAL D HG23 1 
ATOM   5347 N  N    . VAL E 2 54 ? -4.822  13.152 33.056  1.00 96.80  ? 54  VAL D N    1 
ATOM   5348 C  CA   . VAL E 2 54 ? -4.218  14.162 32.199  1.00 97.92  ? 54  VAL D CA   1 
ATOM   5349 C  C    . VAL E 2 54 ? -4.553  13.824 30.751  1.00 99.76  ? 54  VAL D C    1 
ATOM   5350 O  O    . VAL E 2 54 ? -4.985  14.700 29.985  1.00 99.30  ? 54  VAL D O    1 
ATOM   5351 C  CB   . VAL E 2 54 ? -2.692  14.250 32.380  0.00 98.18  ? 54  VAL D CB   1 
ATOM   5352 C  CG1  . VAL E 2 54 ? -2.112  15.321 31.470  0.00 96.52  ? 54  VAL D CG1  1 
ATOM   5353 C  CG2  . VAL E 2 54 ? -2.334  14.552 33.827  0.00 96.76  ? 54  VAL D CG2  1 
ATOM   5354 H  H    . VAL E 2 54 ? -4.294  12.825 33.652  1.00 116.17 ? 54  VAL D H    1 
ATOM   5355 H  HA   . VAL E 2 54 ? -4.600  15.029 32.407  1.00 117.51 ? 54  VAL D HA   1 
ATOM   5356 H  HB   . VAL E 2 54 ? -2.292  13.400 32.140  0.00 117.82 ? 54  VAL D HB   1 
ATOM   5357 H  HG11 . VAL E 2 54 ? -1.152  15.359 31.600  0.00 115.82 ? 54  VAL D HG11 1 
ATOM   5358 H  HG12 . VAL E 2 54 ? -2.313  15.094 30.548  0.00 115.82 ? 54  VAL D HG12 1 
ATOM   5359 H  HG13 . VAL E 2 54 ? -2.511  16.176 31.695  0.00 115.82 ? 54  VAL D HG13 1 
ATOM   5360 H  HG21 . VAL E 2 54 ? -1.369  14.602 33.909  0.00 116.11 ? 54  VAL D HG21 1 
ATOM   5361 H  HG22 . VAL E 2 54 ? -2.732  15.400 34.080  0.00 116.11 ? 54  VAL D HG22 1 
ATOM   5362 H  HG23 . VAL E 2 54 ? -2.679  13.843 34.391  0.00 116.11 ? 54  VAL D HG23 1 
ATOM   5363 N  N    . ASP E 2 55 ? -4.356  12.550 30.392  1.00 100.63 ? 55  ASP D N    1 
ATOM   5364 C  CA   . ASP E 2 55 ? -4.639  12.061 29.037  1.00 102.15 ? 55  ASP D CA   1 
ATOM   5365 C  C    . ASP E 2 55 ? -6.097  12.355 28.637  1.00 105.69 ? 55  ASP D C    1 
ATOM   5366 O  O    . ASP E 2 55 ? -6.375  12.682 27.477  1.00 105.14 ? 55  ASP D O    1 
ATOM   5367 C  CB   . ASP E 2 55 ? -4.350  10.565 28.909  1.00 98.20  ? 55  ASP D CB   1 
ATOM   5368 C  CG   . ASP E 2 55 ? -2.895  10.226 29.163  0.00 98.48  ? 55  ASP D CG   1 
ATOM   5369 O  OD1  . ASP E 2 55 ? -2.017  10.946 28.650  0.00 98.25  ? 55  ASP D OD1  1 
ATOM   5370 O  OD2  . ASP E 2 55 ? -2.629  9.229  29.865  0.00 97.21  ? 55  ASP D OD2  1 
ATOM   5371 H  H    . ASP E 2 55 ? -4.056  11.943 30.922  1.00 120.76 ? 55  ASP D H    1 
ATOM   5372 H  HA   . ASP E 2 55 ? -4.062  12.527 28.411  1.00 122.58 ? 55  ASP D HA   1 
ATOM   5373 H  HB2  . ASP E 2 55 ? -4.888  10.083 29.557  1.00 117.85 ? 55  ASP D HB2  1 
ATOM   5374 H  HB3  . ASP E 2 55 ? -4.573  10.276 28.011  1.00 117.85 ? 55  ASP D HB3  1 
ATOM   5375 N  N    . LYS E 2 56 ? -7.027  12.189 29.579  1.00 105.86 ? 56  LYS D N    1 
ATOM   5376 C  CA   . LYS E 2 56 ? -8.446  12.431 29.315  1.00 105.32 ? 56  LYS D CA   1 
ATOM   5377 C  C    . LYS E 2 56 ? -8.731  13.905 28.972  1.00 104.69 ? 56  LYS D C    1 
ATOM   5378 O  O    . LYS E 2 56 ? -9.465  14.197 28.018  1.00 105.10 ? 56  LYS D O    1 
ATOM   5379 C  CB   . LYS E 2 56 ? -9.277  12.026 30.535  0.00 105.42 ? 56  LYS D CB   1 
ATOM   5380 C  CG   . LYS E 2 56 ? -9.315  10.532 30.802  0.00 105.35 ? 56  LYS D CG   1 
ATOM   5381 C  CD   . LYS E 2 56 ? -10.203 10.210 31.994  0.00 104.18 ? 56  LYS D CD   1 
ATOM   5382 C  CE   . LYS E 2 56 ? -10.251 8.716  32.266  0.00 103.79 ? 56  LYS D CE   1 
ATOM   5383 N  NZ   . LYS E 2 56 ? -11.039 8.395  33.488  0.00 100.01 ? 56  LYS D NZ   1 
ATOM   5384 H  H    . LYS E 2 56 ? -6.860  11.935 30.383  1.00 127.03 ? 56  LYS D H    1 
ATOM   5385 H  HA   . LYS E 2 56 ? -8.727  11.887 28.563  1.00 126.39 ? 56  LYS D HA   1 
ATOM   5386 H  HB2  . LYS E 2 56 ? -8.905  12.456 31.321  0.00 126.50 ? 56  LYS D HB2  1 
ATOM   5387 H  HB3  . LYS E 2 56 ? -10.190 12.324 30.401  0.00 126.50 ? 56  LYS D HB3  1 
ATOM   5388 H  HG2  . LYS E 2 56 ? -9.672  10.076 30.024  0.00 126.42 ? 56  LYS D HG2  1 
ATOM   5389 H  HG3  . LYS E 2 56 ? -8.418  10.218 30.995  0.00 126.42 ? 56  LYS D HG3  1 
ATOM   5390 H  HD2  . LYS E 2 56 ? -9.851  10.651 32.783  0.00 125.02 ? 56  LYS D HD2  1 
ATOM   5391 H  HD3  . LYS E 2 56 ? -11.105 10.516 31.812  0.00 125.02 ? 56  LYS D HD3  1 
ATOM   5392 H  HE2  . LYS E 2 56 ? -10.667 8.269  31.512  0.00 124.55 ? 56  LYS D HE2  1 
ATOM   5393 H  HE3  . LYS E 2 56 ? -9.348  8.386  32.393  0.00 124.55 ? 56  LYS D HE3  1 
ATOM   5394 H  HZ1  . LYS E 2 56 ? -11.050 7.515  33.621  0.00 120.01 ? 56  LYS D HZ1  1 
ATOM   5395 H  HZ2  . LYS E 2 56 ? -10.675 8.791  34.197  0.00 120.01 ? 56  LYS D HZ2  1 
ATOM   5396 H  HZ3  . LYS E 2 56 ? -11.876 8.684  33.394  0.00 120.01 ? 56  LYS D HZ3  1 
ATOM   5397 N  N    . VAL E 2 57 ? -8.130  14.824 29.731  1.00 101.34 ? 57  VAL D N    1 
ATOM   5398 C  CA   . VAL E 2 57 ? -8.355  16.254 29.524  1.00 100.98 ? 57  VAL D CA   1 
ATOM   5399 C  C    . VAL E 2 57 ? -7.865  16.702 28.154  1.00 100.37 ? 57  VAL D C    1 
ATOM   5400 O  O    . VAL E 2 57 ? -8.605  17.342 27.394  1.00 98.46  ? 57  VAL D O    1 
ATOM   5401 C  CB   . VAL E 2 57 ? -7.665  17.103 30.611  0.00 97.38  ? 57  VAL D CB   1 
ATOM   5402 C  CG1  . VAL E 2 57 ? -7.888  18.595 30.359  0.00 93.07  ? 57  VAL D CG1  1 
ATOM   5403 C  CG2  . VAL E 2 57 ? -8.178  16.715 31.987  0.00 96.34  ? 57  VAL D CG2  1 
ATOM   5404 H  H    . VAL E 2 57 ? -7.587  14.644 30.374  1.00 121.61 ? 57  VAL D H    1 
ATOM   5405 H  HA   . VAL E 2 57 ? -9.307  16.430 29.571  1.00 121.17 ? 57  VAL D HA   1 
ATOM   5406 H  HB   . VAL E 2 57 ? -6.710  16.933 30.588  0.00 116.85 ? 57  VAL D HB   1 
ATOM   5407 H  HG11 . VAL E 2 57 ? -7.445  19.103 31.056  0.00 111.68 ? 57  VAL D HG11 1 
ATOM   5408 H  HG12 . VAL E 2 57 ? -7.518  18.828 29.493  0.00 111.68 ? 57  VAL D HG12 1 
ATOM   5409 H  HG13 . VAL E 2 57 ? -8.841  18.778 30.371  0.00 111.68 ? 57  VAL D HG13 1 
ATOM   5410 H  HG21 . VAL E 2 57 ? -7.733  17.260 32.655  0.00 115.61 ? 57  VAL D HG21 1 
ATOM   5411 H  HG22 . VAL E 2 57 ? -9.136  16.867 32.020  0.00 115.61 ? 57  VAL D HG22 1 
ATOM   5412 H  HG23 . VAL E 2 57 ? -7.986  15.777 32.142  0.00 115.61 ? 57  VAL D HG23 1 
ATOM   5413 N  N    . MET E 2 58 ? -6.638  16.327 27.822  1.00 96.80  ? 58  MET D N    1 
ATOM   5414 C  CA   . MET E 2 58 ? -6.042  16.732 26.553  1.00 99.87  ? 58  MET D CA   1 
ATOM   5415 C  C    . MET E 2 58 ? -6.893  16.276 25.355  1.00 101.76 ? 58  MET D C    1 
ATOM   5416 O  O    . MET E 2 58 ? -7.036  17.018 24.371  1.00 99.63  ? 58  MET D O    1 
ATOM   5417 C  CB   . MET E 2 58 ? -4.612  16.168 26.444  1.00 96.16  ? 58  MET D CB   1 
ATOM   5418 C  CG   . MET E 2 58 ? -3.778  16.558 25.184  1.00 93.95  ? 58  MET D CG   1 
ATOM   5419 S  SD   . MET E 2 58 ? -3.207  18.271 24.911  1.00 91.12  ? 58  MET D SD   1 
ATOM   5420 C  CE   . MET E 2 58 ? -1.628  18.176 25.767  1.00 77.81  ? 58  MET D CE   1 
ATOM   5421 H  H    . MET E 2 58 ? -6.128  15.838 28.313  1.00 116.16 ? 58  MET D H    1 
ATOM   5422 H  HA   . MET E 2 58 ? -5.978  17.700 26.536  1.00 119.84 ? 58  MET D HA   1 
ATOM   5423 H  HB2  . MET E 2 58 ? -4.111  16.468 27.219  1.00 115.40 ? 58  MET D HB2  1 
ATOM   5424 H  HB3  . MET E 2 58 ? -4.669  15.200 26.458  1.00 115.40 ? 58  MET D HB3  1 
ATOM   5425 H  HG2  . MET E 2 58 ? -2.981  16.006 25.187  1.00 112.74 ? 58  MET D HG2  1 
ATOM   5426 H  HG3  . MET E 2 58 ? -4.310  16.324 24.407  1.00 112.74 ? 58  MET D HG3  1 
ATOM   5427 H  HE1  . MET E 2 58 ? -1.186  19.037 25.711  1.00 93.38  ? 58  MET D HE1  1 
ATOM   5428 H  HE2  . MET E 2 58 ? -1.786  17.945 26.696  1.00 93.38  ? 58  MET D HE2  1 
ATOM   5429 H  HE3  . MET E 2 58 ? -1.081  17.495 25.345  1.00 93.38  ? 58  MET D HE3  1 
ATOM   5430 N  N    . GLU E 2 59 ? -7.479  15.080 25.458  1.00 101.77 ? 59  GLU D N    1 
ATOM   5431 C  CA   . GLU E 2 59 ? -8.294  14.505 24.381  1.00 103.86 ? 59  GLU D CA   1 
ATOM   5432 C  C    . GLU E 2 59 ? -9.466  15.367 23.925  1.00 99.96  ? 59  GLU D C    1 
ATOM   5433 O  O    . GLU E 2 59 ? -9.781  15.424 22.734  1.00 98.72  ? 59  GLU D O    1 
ATOM   5434 C  CB   . GLU E 2 59 ? -8.825  13.135 24.805  0.00 109.16 ? 59  GLU D CB   1 
ATOM   5435 C  CG   . GLU E 2 59 ? -7.815  12.015 24.648  0.00 105.63 ? 59  GLU D CG   1 
ATOM   5436 C  CD   . GLU E 2 59 ? -8.354  10.680 25.111  0.00 95.91  ? 59  GLU D CD   1 
ATOM   5437 O  OE1  . GLU E 2 59 ? -9.141  10.065 24.361  0.00 85.97  ? 59  GLU D OE1  1 
ATOM   5438 O  OE2  . GLU E 2 59 ? -7.994  10.247 26.226  0.00 96.90  ? 59  GLU D OE2  1 
ATOM   5439 H  H    . GLU E 2 59 ? -7.418  14.574 26.151  1.00 122.12 ? 59  GLU D H    1 
ATOM   5440 H  HA   . GLU E 2 59 ? -7.723  14.367 23.609  1.00 124.63 ? 59  GLU D HA   1 
ATOM   5441 H  HB2  . GLU E 2 59 ? -9.082  13.174 25.739  0.00 130.99 ? 59  GLU D HB2  1 
ATOM   5442 H  HB3  . GLU E 2 59 ? -9.597  12.916 24.260  0.00 130.99 ? 59  GLU D HB3  1 
ATOM   5443 H  HG2  . GLU E 2 59 ? -7.574  11.934 23.712  0.00 126.76 ? 59  GLU D HG2  1 
ATOM   5444 H  HG3  . GLU E 2 59 ? -7.029  12.222 25.177  0.00 126.76 ? 59  GLU D HG3  1 
ATOM   5445 N  N    . THR E 2 60 ? -10.092 16.047 24.874  1.00 100.71 ? 60  THR D N    1 
ATOM   5446 C  CA   . THR E 2 60 ? -11.213 16.921 24.572  1.00 99.38  ? 60  THR D CA   1 
ATOM   5447 C  C    . THR E 2 60 ? -10.753 18.049 23.669  1.00 102.46 ? 60  THR D C    1 
ATOM   5448 O  O    . THR E 2 60 ? -11.450 18.435 22.723  1.00 100.82 ? 60  THR D O    1 
ATOM   5449 C  CB   . THR E 2 60 ? -11.781 17.554 25.820  1.00 92.94  ? 60  THR D CB   1 
ATOM   5450 O  OG1  . THR E 2 60 ? -11.960 16.557 26.824  1.00 97.36  ? 60  THR D OG1  1 
ATOM   5451 C  CG2  . THR E 2 60 ? -13.070 18.272 25.487  1.00 84.12  ? 60  THR D CG2  1 
ATOM   5452 H  H    . THR E 2 60 ? -9.885  16.018 25.709  1.00 120.85 ? 60  THR D H    1 
ATOM   5453 H  HA   . THR E 2 60 ? -11.913 16.422 24.124  1.00 119.25 ? 60  THR D HA   1 
ATOM   5454 H  HB   . THR E 2 60 ? -11.151 18.216 26.147  1.00 111.53 ? 60  THR D HB   1 
ATOM   5455 H  HG1  . THR E 2 60 ? -12.276 16.904 27.521  1.00 116.84 ? 60  THR D HG1  1 
ATOM   5456 H  HG21 . THR E 2 60 ? -13.438 18.680 26.286  1.00 100.94 ? 60  THR D HG21 1 
ATOM   5457 H  HG22 . THR E 2 60 ? -12.903 18.964 24.828  1.00 100.94 ? 60  THR D HG22 1 
ATOM   5458 H  HG23 . THR E 2 60 ? -13.716 17.644 25.128  1.00 100.94 ? 60  THR D HG23 1 
ATOM   5459 N  N    . LEU E 2 61 ? -9.570  18.572 23.996  1.00 101.60 ? 61  LEU D N    1 
ATOM   5460 C  CA   . LEU E 2 61 ? -9.020  19.767 23.362  1.00 101.18 ? 61  LEU D CA   1 
ATOM   5461 C  C    . LEU E 2 61 ? -8.385  19.475 22.029  1.00 102.29 ? 61  LEU D C    1 
ATOM   5462 O  O    . LEU E 2 61 ? -8.495  20.261 21.081  1.00 98.93  ? 61  LEU D O    1 
ATOM   5463 C  CB   . LEU E 2 61 ? -7.972  20.417 24.270  1.00 93.38  ? 61  LEU D CB   1 
ATOM   5464 C  CG   . LEU E 2 61 ? -8.495  20.928 25.605  1.00 87.48  ? 61  LEU D CG   1 
ATOM   5465 C  CD1  . LEU E 2 61 ? -7.370  21.541 26.394  1.00 81.58  ? 61  LEU D CD1  1 
ATOM   5466 C  CD2  . LEU E 2 61 ? -9.625  21.924 25.366  1.00 80.79  ? 61  LEU D CD2  1 
ATOM   5467 H  H    . LEU E 2 61 ? -9.055  18.242 24.600  1.00 121.92 ? 61  LEU D H    1 
ATOM   5468 H  HA   . LEU E 2 61 ? -9.734  20.408 23.221  1.00 121.42 ? 61  LEU D HA   1 
ATOM   5469 H  HB2  . LEU E 2 61 ? -7.281  19.763 24.458  1.00 112.05 ? 61  LEU D HB2  1 
ATOM   5470 H  HB3  . LEU E 2 61 ? -7.585  21.172 23.800  1.00 112.05 ? 61  LEU D HB3  1 
ATOM   5471 H  HG   . LEU E 2 61 ? -8.852  20.183 26.114  1.00 104.98 ? 61  LEU D HG   1 
ATOM   5472 H  HD11 . LEU E 2 61 ? -7.718  21.861 27.241  1.00 97.90  ? 61  LEU D HD11 1 
ATOM   5473 H  HD12 . LEU E 2 61 ? -6.690  20.867 26.549  1.00 97.90  ? 61  LEU D HD12 1 
ATOM   5474 H  HD13 . LEU E 2 61 ? -6.996  22.279 25.889  1.00 97.90  ? 61  LEU D HD13 1 
ATOM   5475 H  HD21 . LEU E 2 61 ? -10.341 21.480 24.884  1.00 96.95  ? 61  LEU D HD21 1 
ATOM   5476 H  HD22 . LEU E 2 61 ? -9.951  22.243 26.222  1.00 96.95  ? 61  LEU D HD22 1 
ATOM   5477 H  HD23 . LEU E 2 61 ? -9.285  22.667 24.843  1.00 96.95  ? 61  LEU D HD23 1 
ATOM   5478 N  N    . ASP E 2 62 ? -7.721  18.340 21.934  1.00 103.49 ? 62  ASP D N    1 
ATOM   5479 C  CA   . ASP E 2 62 ? -7.076  18.051 20.685  1.00 103.76 ? 62  ASP D CA   1 
ATOM   5480 C  C    . ASP E 2 62 ? -8.139  17.734 19.626  1.00 105.13 ? 62  ASP D C    1 
ATOM   5481 O  O    . ASP E 2 62 ? -8.658  16.610 19.535  1.00 104.64 ? 62  ASP D O    1 
ATOM   5482 C  CB   . ASP E 2 62 ? -6.094  16.916 20.849  1.00 100.67 ? 62  ASP D CB   1 
ATOM   5483 C  CG   . ASP E 2 62 ? -5.473  16.531 19.553  1.00 102.01 ? 62  ASP D CG   1 
ATOM   5484 O  OD1  . ASP E 2 62 ? -5.338  17.429 18.694  1.00 100.88 ? 62  ASP D OD1  1 
ATOM   5485 O  OD2  . ASP E 2 62 ? -5.117  15.345 19.400  1.00 105.08 ? 62  ASP D OD2  1 
ATOM   5486 H  H    . ASP E 2 62 ? -7.633  17.747 22.551  1.00 124.18 ? 62  ASP D H    1 
ATOM   5487 H  HA   . ASP E 2 62 ? -6.584  18.834 20.393  1.00 124.52 ? 62  ASP D HA   1 
ATOM   5488 H  HB2  . ASP E 2 62 ? -5.387  17.190 21.454  1.00 120.80 ? 62  ASP D HB2  1 
ATOM   5489 H  HB3  . ASP E 2 62 ? -6.557  16.141 21.205  1.00 120.80 ? 62  ASP D HB3  1 
ATOM   5490 N  N    . ASN E 2 63 ? -8.455  18.775 18.857  1.00 104.56 ? 63  ASN D N    1 
ATOM   5491 C  CA   . ASN E 2 63 ? -9.429  18.735 17.774  1.00 108.07 ? 63  ASN D CA   1 
ATOM   5492 C  C    . ASN E 2 63 ? -8.744  18.670 16.405  1.00 110.08 ? 63  ASN D C    1 
ATOM   5493 O  O    . ASN E 2 63 ? -9.408  18.443 15.395  1.00 117.55 ? 63  ASN D O    1 
ATOM   5494 C  CB   . ASN E 2 63 ? -10.371 19.944 17.851  1.00 107.55 ? 63  ASN D CB   1 
ATOM   5495 C  CG   . ASN E 2 63 ? -11.353 19.843 19.007  0.00 109.41 ? 63  ASN D CG   1 
ATOM   5496 O  OD1  . ASN E 2 63 ? -11.649 18.752 19.492  0.00 109.03 ? 63  ASN D OD1  1 
ATOM   5497 N  ND2  . ASN E 2 63 ? -11.874 20.984 19.443  0.00 109.23 ? 63  ASN D ND2  1 
ATOM   5498 H  H    . ASN E 2 63 ? -8.098  19.552 18.952  1.00 125.48 ? 63  ASN D H    1 
ATOM   5499 H  HA   . ASN E 2 63 ? -9.968  17.935 17.871  1.00 129.68 ? 63  ASN D HA   1 
ATOM   5500 H  HB2  . ASN E 2 63 ? -9.844  20.749 17.974  1.00 129.06 ? 63  ASN D HB2  1 
ATOM   5501 H  HB3  . ASN E 2 63 ? -10.880 20.001 17.028  1.00 129.06 ? 63  ASN D HB3  1 
ATOM   5502 H  HD21 . ASN E 2 63 ? -12.435 20.979 20.095  0.00 131.08 ? 63  ASN D HD21 1 
ATOM   5503 H  HD22 . ASN E 2 63 ? -11.650 21.728 19.074  0.00 131.08 ? 63  ASN D HD22 1 
ATOM   5504 N  N    . ASP E 2 64 ? -7.447  18.976 16.357  1.00 108.41 ? 64  ASP D N    1 
ATOM   5505 C  CA   . ASP E 2 64 ? -6.656  18.805 15.127  1.00 106.40 ? 64  ASP D CA   1 
ATOM   5506 C  C    . ASP E 2 64 ? -5.740  17.577 15.271  1.00 104.98 ? 64  ASP D C    1 
ATOM   5507 O  O    . ASP E 2 64 ? -4.860  17.332 14.444  1.00 99.53  ? 64  ASP D O    1 
ATOM   5508 C  CB   . ASP E 2 64 ? -5.864  20.104 14.777  1.00 106.88 ? 64  ASP D CB   1 
ATOM   5509 C  CG   . ASP E 2 64 ? -4.819  20.522 15.836  1.00 103.31 ? 64  ASP D CG   1 
ATOM   5510 O  OD1  . ASP E 2 64 ? -4.013  19.686 16.312  1.00 101.48 ? 64  ASP D OD1  1 
ATOM   5511 O  OD2  . ASP E 2 64 ? -4.823  21.727 16.191  1.00 100.93 ? 64  ASP D OD2  1 
ATOM   5512 H  H    . ASP E 2 64 ? -6.997  19.286 17.022  1.00 130.09 ? 64  ASP D H    1 
ATOM   5513 H  HA   . ASP E 2 64 ? -7.264  18.629 14.392  1.00 127.68 ? 64  ASP D HA   1 
ATOM   5514 H  HB2  . ASP E 2 64 ? -5.394  19.965 13.939  1.00 128.25 ? 64  ASP D HB2  1 
ATOM   5515 H  HB3  . ASP E 2 64 ? -6.494  20.835 14.680  1.00 128.25 ? 64  ASP D HB3  1 
ATOM   5516 N  N    . GLY E 2 65 ? -5.987  16.791 16.319  1.00 103.67 ? 65  GLY D N    1 
ATOM   5517 C  CA   . GLY E 2 65 ? -5.345  15.498 16.509  1.00 96.50  ? 65  GLY D CA   1 
ATOM   5518 C  C    . GLY E 2 65 ? -3.838  15.389 16.765  1.00 92.82  ? 65  GLY D C    1 
ATOM   5519 O  O    . GLY E 2 65 ? -3.384  14.300 17.088  1.00 88.03  ? 65  GLY D O    1 
ATOM   5520 H  H    . GLY E 2 65 ? -6.537  16.994 16.948  1.00 124.41 ? 65  GLY D H    1 
ATOM   5521 H  HA2  . GLY E 2 65 ? -5.784  15.062 17.256  1.00 115.80 ? 65  GLY D HA2  1 
ATOM   5522 H  HA3  . GLY E 2 65 ? -5.529  14.963 15.721  1.00 115.80 ? 65  GLY D HA3  1 
ATOM   5523 N  N    . ASP E 2 66 ? -3.063  16.474 16.755  1.00 95.85  ? 66  ASP D N    1 
ATOM   5524 C  CA   . ASP E 2 66 ? -1.596  16.302 16.847  1.00 95.82  ? 66  ASP D CA   1 
ATOM   5525 C  C    . ASP E 2 66 ? -1.065  16.069 18.267  1.00 93.88  ? 66  ASP D C    1 
ATOM   5526 O  O    . ASP E 2 66 ? 0.154   16.107 18.486  1.00 91.39  ? 66  ASP D O    1 
ATOM   5527 C  CB   . ASP E 2 66 ? -0.845  17.482 16.205  1.00 92.36  ? 66  ASP D CB   1 
ATOM   5528 C  CG   . ASP E 2 66 ? -0.831  18.722 17.053  1.00 88.90  ? 66  ASP D CG   1 
ATOM   5529 O  OD1  . ASP E 2 66 ? -1.515  18.774 18.097  1.00 90.14  ? 66  ASP D OD1  1 
ATOM   5530 O  OD2  . ASP E 2 66 ? -0.111  19.660 16.652  1.00 83.57  ? 66  ASP D OD2  1 
ATOM   5531 H  H    . ASP E 2 66 ? -3.337  17.287 16.700  1.00 115.02 ? 66  ASP D H    1 
ATOM   5532 H  HA   . ASP E 2 66 ? -1.364  15.513 16.333  1.00 114.99 ? 66  ASP D HA   1 
ATOM   5533 H  HB2  . ASP E 2 66 ? 0.076   17.219 16.049  1.00 110.83 ? 66  ASP D HB2  1 
ATOM   5534 H  HB3  . ASP E 2 66 ? -1.271  17.704 15.362  1.00 110.83 ? 66  ASP D HB3  1 
ATOM   5535 N  N    . GLY E 2 67 ? -1.973  15.950 19.235  1.00 92.86  ? 67  GLY D N    1 
ATOM   5536 C  CA   . GLY E 2 67 ? -1.622  15.491 20.572  1.00 89.40  ? 67  GLY D CA   1 
ATOM   5537 C  C    . GLY E 2 67 ? -1.097  16.518 21.554  1.00 89.57  ? 67  GLY D C    1 
ATOM   5538 O  O    . GLY E 2 67 ? -0.759  16.166 22.688  1.00 93.55  ? 67  GLY D O    1 
ATOM   5539 H  H    . GLY E 2 67 ? -2.808  16.133 19.139  1.00 111.43 ? 67  GLY D H    1 
ATOM   5540 H  HA2  . GLY E 2 67 ? -2.408  15.086 20.971  1.00 107.27 ? 67  GLY D HA2  1 
ATOM   5541 H  HA3  . GLY E 2 67 ? -0.947  14.799 20.489  1.00 107.27 ? 67  GLY D HA3  1 
ATOM   5542 N  N    . GLU E 2 68 ? -1.022  17.775 21.124  1.00 85.27  ? 68  GLU D N    1 
ATOM   5543 C  CA   . GLU E 2 68 ? -0.652  18.895 21.990  1.00 80.52  ? 68  GLU D CA   1 
ATOM   5544 C  C    . GLU E 2 68 ? -1.793  19.903 21.936  1.00 79.78  ? 68  GLU D C    1 
ATOM   5545 O  O    . GLU E 2 68 ? -2.721  19.754 21.138  1.00 83.53  ? 68  GLU D O    1 
ATOM   5546 C  CB   . GLU E 2 68 ? 0.670   19.541 21.556  1.00 77.40  ? 68  GLU D CB   1 
ATOM   5547 C  CG   . GLU E 2 68 ? 1.905   18.668 21.688  1.00 76.84  ? 68  GLU D CG   1 
ATOM   5548 C  CD   . GLU E 2 68 ? 3.205   19.488 21.793  1.00 81.76  ? 68  GLU D CD   1 
ATOM   5549 O  OE1  . GLU E 2 68 ? 3.164   20.596 22.391  1.00 77.27  ? 68  GLU D OE1  1 
ATOM   5550 O  OE2  . GLU E 2 68 ? 4.273   19.034 21.260  1.00 83.33  ? 68  GLU D OE2  1 
ATOM   5551 H  H    . GLU E 2 68 ? -1.186  18.012 20.314  1.00 102.32 ? 68  GLU D H    1 
ATOM   5552 H  HA   . GLU E 2 68 ? -0.558  18.582 22.904  1.00 96.63  ? 68  GLU D HA   1 
ATOM   5553 H  HB2  . GLU E 2 68 ? 0.594   19.796 20.623  1.00 92.88  ? 68  GLU D HB2  1 
ATOM   5554 H  HB3  . GLU E 2 68 ? 0.815   20.333 22.096  1.00 92.88  ? 68  GLU D HB3  1 
ATOM   5555 H  HG2  . GLU E 2 68 ? 1.826   18.128 22.489  1.00 92.20  ? 68  GLU D HG2  1 
ATOM   5556 H  HG3  . GLU E 2 68 ? 1.974   18.097 20.907  1.00 92.20  ? 68  GLU D HG3  1 
ATOM   5557 N  N    . CYS E 2 69 ? -1.738  20.915 22.792  1.00 78.87  ? 69  CYS D N    1 
ATOM   5558 C  CA   . CYS E 2 69 ? -2.733  21.997 22.769  1.00 79.06  ? 69  CYS D CA   1 
ATOM   5559 C  C    . CYS E 2 69 ? -2.161  23.298 22.182  1.00 73.51  ? 69  CYS D C    1 
ATOM   5560 O  O    . CYS E 2 69 ? -1.231  23.869 22.757  1.00 70.72  ? 69  CYS D O    1 
ATOM   5561 C  CB   . CYS E 2 69 ? -3.270  22.276 24.165  1.00 75.30  ? 69  CYS D CB   1 
ATOM   5562 S  SG   . CYS E 2 69 ? -4.464  23.597 24.159  1.00 72.70  ? 69  CYS D SG   1 
ATOM   5563 H  H    . CYS E 2 69 ? -1.136  21.005 23.400  1.00 94.64  ? 69  CYS D H    1 
ATOM   5564 H  HA   . CYS E 2 69 ? -3.479  21.723 22.213  1.00 94.87  ? 69  CYS D HA   1 
ATOM   5565 H  HB2  . CYS E 2 69 ? -3.702  21.478 24.506  1.00 90.36  ? 69  CYS D HB2  1 
ATOM   5566 H  HB3  . CYS E 2 69 ? -2.535  22.534 24.744  1.00 90.36  ? 69  CYS D HB3  1 
ATOM   5567 H  HG   . CYS E 2 69 ? -5.383  23.290 23.450  1.00 87.23  ? 69  CYS D HG   1 
ATOM   5568 N  N    . ASP E 2 70 ? -2.653  23.721 21.014  1.00 71.80  ? 70  ASP D N    1 
ATOM   5569 C  CA   . ASP E 2 70 ? -2.228  25.010 20.473  1.00 72.12  ? 70  ASP D CA   1 
ATOM   5570 C  C    . ASP E 2 70 ? -3.050  26.128 21.117  1.00 70.15  ? 70  ASP D C    1 
ATOM   5571 O  O    . ASP E 2 70 ? -3.964  25.868 21.916  1.00 69.07  ? 70  ASP D O    1 
ATOM   5572 C  CB   . ASP E 2 70 ? -2.352  25.073 18.932  1.00 71.71  ? 70  ASP D CB   1 
ATOM   5573 C  CG   . ASP E 2 70 ? -3.779  24.973 18.438  1.00 74.88  ? 70  ASP D CG   1 
ATOM   5574 O  OD1  . ASP E 2 70 ? -4.683  24.712 19.262  1.00 76.82  ? 70  ASP D OD1  1 
ATOM   5575 O  OD2  . ASP E 2 70 ? -3.994  25.156 17.218  1.00 74.68  ? 70  ASP D OD2  1 
ATOM   5576 H  H    . ASP E 2 70 ? -3.218  23.292 20.529  1.00 86.15  ? 70  ASP D H    1 
ATOM   5577 H  HA   . ASP E 2 70 ? -1.296  25.155 20.703  1.00 86.54  ? 70  ASP D HA   1 
ATOM   5578 H  HB2  . ASP E 2 70 ? -1.988  25.917 18.622  1.00 86.06  ? 70  ASP D HB2  1 
ATOM   5579 H  HB3  . ASP E 2 70 ? -1.851  24.337 18.546  1.00 86.06  ? 70  ASP D HB3  1 
ATOM   5580 N  N    . PHE E 2 71 ? -2.744  27.366 20.732  1.00 67.24  ? 71  PHE D N    1 
ATOM   5581 C  CA   . PHE E 2 71 ? -3.415  28.513 21.318  1.00 64.32  ? 71  PHE D CA   1 
ATOM   5582 C  C    . PHE E 2 71 ? -4.868  28.488 20.962  1.00 62.94  ? 71  PHE D C    1 
ATOM   5583 O  O    . PHE E 2 71 ? -5.717  28.852 21.754  1.00 59.23  ? 71  PHE D O    1 
ATOM   5584 C  CB   . PHE E 2 71 ? -2.823  29.857 20.871  1.00 62.04  ? 71  PHE D CB   1 
ATOM   5585 C  CG   . PHE E 2 71 ? -3.379  30.998 21.650  1.00 58.04  ? 71  PHE D CG   1 
ATOM   5586 C  CD1  . PHE E 2 71 ? -2.919  31.260 22.930  1.00 55.30  ? 71  PHE D CD1  1 
ATOM   5587 C  CD2  . PHE E 2 71 ? -4.449  31.737 21.157  1.00 56.58  ? 71  PHE D CD2  1 
ATOM   5588 C  CE1  . PHE E 2 71 ? -3.484  32.271 23.673  1.00 55.11  ? 71  PHE D CE1  1 
ATOM   5589 C  CE2  . PHE E 2 71 ? -5.022  32.762 21.910  1.00 53.86  ? 71  PHE D CE2  1 
ATOM   5590 C  CZ   . PHE E 2 71 ? -4.544  33.029 23.155  1.00 52.43  ? 71  PHE D CZ   1 
ATOM   5591 H  H    . PHE E 2 71 ? -2.155  27.563 20.138  1.00 80.68  ? 71  PHE D H    1 
ATOM   5592 H  HA   . PHE E 2 71 ? -3.342  28.461 22.284  1.00 77.19  ? 71  PHE D HA   1 
ATOM   5593 H  HB2  . PHE E 2 71 ? -1.862  29.841 21.003  1.00 74.45  ? 71  PHE D HB2  1 
ATOM   5594 H  HB3  . PHE E 2 71 ? -3.029  30.000 19.935  1.00 74.45  ? 71  PHE D HB3  1 
ATOM   5595 H  HD1  . PHE E 2 71 ? -2.220  30.760 23.284  1.00 66.37  ? 71  PHE D HD1  1 
ATOM   5596 H  HD2  . PHE E 2 71 ? -4.781  31.552 20.308  1.00 67.90  ? 71  PHE D HD2  1 
ATOM   5597 H  HE1  . PHE E 2 71 ? -3.156  32.458 24.523  1.00 66.13  ? 71  PHE D HE1  1 
ATOM   5598 H  HE2  . PHE E 2 71 ? -5.722  33.264 21.560  1.00 64.64  ? 71  PHE D HE2  1 
ATOM   5599 H  HZ   . PHE E 2 71 ? -4.912  33.719 23.658  1.00 62.92  ? 71  PHE D HZ   1 
ATOM   5600 N  N    . GLN E 2 72 ? -5.147  28.070 19.743  1.00 67.48  ? 72  GLN D N    1 
ATOM   5601 C  CA   . GLN E 2 72 ? -6.525  28.020 19.281  1.00 69.73  ? 72  GLN D CA   1 
ATOM   5602 C  C    . GLN E 2 72 ? -7.314  27.027 20.093  1.00 71.25  ? 72  GLN D C    1 
ATOM   5603 O  O    . GLN E 2 72 ? -8.481  27.271 20.380  1.00 69.84  ? 72  GLN D O    1 
ATOM   5604 C  CB   . GLN E 2 72 ? -6.631  27.608 17.824  1.00 73.22  ? 72  GLN D CB   1 
ATOM   5605 C  CG   . GLN E 2 72 ? -7.807  28.214 17.132  1.00 71.82  ? 72  GLN D CG   1 
ATOM   5606 C  CD   . GLN E 2 72 ? -8.119  27.534 15.814  1.00 79.04  ? 72  GLN D CD   1 
ATOM   5607 O  OE1  . GLN E 2 72 ? -7.651  26.412 15.545  1.00 78.02  ? 72  GLN D OE1  1 
ATOM   5608 N  NE2  . GLN E 2 72 ? -8.916  28.203 14.978  1.00 80.77  ? 72  GLN D NE2  1 
ATOM   5609 H  H    . GLN E 2 72 ? -4.564  27.810 19.166  1.00 80.98  ? 72  GLN D H    1 
ATOM   5610 H  HA   . GLN E 2 72 ? -6.933  28.894 19.384  1.00 83.68  ? 72  GLN D HA   1 
ATOM   5611 H  HB2  . GLN E 2 72 ? -5.829  27.893 17.357  1.00 87.86  ? 72  GLN D HB2  1 
ATOM   5612 H  HB3  . GLN E 2 72 ? -6.718  26.643 17.774  1.00 87.86  ? 72  GLN D HB3  1 
ATOM   5613 H  HG2  . GLN E 2 72 ? -8.587  28.134 17.704  1.00 86.18  ? 72  GLN D HG2  1 
ATOM   5614 H  HG3  . GLN E 2 72 ? -7.622  29.149 16.952  1.00 86.18  ? 72  GLN D HG3  1 
ATOM   5615 H  HE21 . GLN E 2 72 ? -9.221  28.975 15.201  1.00 96.93  ? 72  GLN D HE21 1 
ATOM   5616 H  HE22 . GLN E 2 72 ? -9.124  27.862 14.216  1.00 96.93  ? 72  GLN D HE22 1 
ATOM   5617 N  N    . GLU E 2 73 ? -6.697  25.891 20.429  1.00 70.12  ? 73  GLU D N    1 
ATOM   5618 C  CA   . GLU E 2 73 ? -7.408  24.888 21.202  1.00 72.53  ? 73  GLU D CA   1 
ATOM   5619 C  C    . GLU E 2 73 ? -7.639  25.366 22.606  1.00 67.54  ? 73  GLU D C    1 
ATOM   5620 O  O    . GLU E 2 73 ? -8.683  25.087 23.211  1.00 65.75  ? 73  GLU D O    1 
ATOM   5621 C  CB   . GLU E 2 73 ? -6.651  23.555 21.225  1.00 78.19  ? 73  GLU D CB   1 
ATOM   5622 C  CG   . GLU E 2 73 ? -6.855  22.746 19.951  1.00 86.23  ? 73  GLU D CG   1 
ATOM   5623 C  CD   . GLU E 2 73 ? -5.846  21.653 19.791  1.00 88.61  ? 73  GLU D CD   1 
ATOM   5624 O  OE1  . GLU E 2 73 ? -4.837  21.722 20.499  1.00 86.14  ? 73  GLU D OE1  1 
ATOM   5625 O  OE2  . GLU E 2 73 ? -6.049  20.749 18.953  1.00 93.58  ? 73  GLU D OE2  1 
ATOM   5626 H  H    . GLU E 2 73 ? -5.887  25.685 20.225  1.00 84.14  ? 73  GLU D H    1 
ATOM   5627 H  HA   . GLU E 2 73 ? -8.274  24.733 20.794  1.00 87.04  ? 73  GLU D HA   1 
ATOM   5628 H  HB2  . GLU E 2 73 ? -5.702  23.731 21.320  1.00 93.83  ? 73  GLU D HB2  1 
ATOM   5629 H  HB3  . GLU E 2 73 ? -6.967  23.024 21.972  1.00 93.83  ? 73  GLU D HB3  1 
ATOM   5630 H  HG2  . GLU E 2 73 ? -7.736  22.340 19.972  1.00 103.48 ? 73  GLU D HG2  1 
ATOM   5631 H  HG3  . GLU E 2 73 ? -6.781  23.337 19.186  1.00 103.48 ? 73  GLU D HG3  1 
ATOM   5632 N  N    . PHE E 2 74 ? -6.637  26.097 23.092  1.00 66.70  ? 74  PHE D N    1 
ATOM   5633 C  CA   . PHE E 2 74 ? -6.587  26.634 24.453  1.00 64.86  ? 74  PHE D CA   1 
ATOM   5634 C  C    . PHE E 2 74 ? -7.635  27.736 24.676  1.00 62.55  ? 74  PHE D C    1 
ATOM   5635 O  O    . PHE E 2 74 ? -8.199  27.841 25.750  1.00 61.29  ? 74  PHE D O    1 
ATOM   5636 C  CB   . PHE E 2 74 ? -5.161  27.126 24.725  1.00 62.21  ? 74  PHE D CB   1 
ATOM   5637 C  CG   . PHE E 2 74 ? -4.992  27.890 26.003  1.00 60.90  ? 74  PHE D CG   1 
ATOM   5638 C  CD1  . PHE E 2 74 ? -5.086  27.263 27.221  1.00 60.19  ? 74  PHE D CD1  1 
ATOM   5639 C  CD2  . PHE E 2 74 ? -4.687  29.244 25.974  1.00 59.53  ? 74  PHE D CD2  1 
ATOM   5640 C  CE1  . PHE E 2 74 ? -4.909  27.975 28.389  1.00 61.04  ? 74  PHE D CE1  1 
ATOM   5641 C  CE2  . PHE E 2 74 ? -4.502  29.956 27.132  1.00 58.47  ? 74  PHE D CE2  1 
ATOM   5642 C  CZ   . PHE E 2 74 ? -4.606  29.326 28.341  1.00 59.26  ? 74  PHE D CZ   1 
ATOM   5643 H  H    . PHE E 2 74 ? -5.943  26.305 22.629  1.00 80.04  ? 74  PHE D H    1 
ATOM   5644 H  HA   . PHE E 2 74 ? -6.777  25.917 25.078  1.00 77.83  ? 74  PHE D HA   1 
ATOM   5645 H  HB2  . PHE E 2 74 ? -4.571  26.357 24.763  1.00 74.65  ? 74  PHE D HB2  1 
ATOM   5646 H  HB3  . PHE E 2 74 ? -4.891  27.708 23.997  1.00 74.65  ? 74  PHE D HB3  1 
ATOM   5647 H  HD1  . PHE E 2 74 ? -5.284  26.356 27.259  1.00 72.22  ? 74  PHE D HD1  1 
ATOM   5648 H  HD2  . PHE E 2 74 ? -4.609  29.677 25.154  1.00 71.43  ? 74  PHE D HD2  1 
ATOM   5649 H  HE1  . PHE E 2 74 ? -4.981  27.544 29.211  1.00 73.25  ? 74  PHE D HE1  1 
ATOM   5650 H  HE2  . PHE E 2 74 ? -4.306  30.864 27.095  1.00 70.17  ? 74  PHE D HE2  1 
ATOM   5651 H  HZ   . PHE E 2 74 ? -4.490  29.807 29.129  1.00 71.11  ? 74  PHE D HZ   1 
ATOM   5652 N  N    . MET E 2 75 ? -7.875  28.570 23.673  1.00 61.64  ? 75  MET D N    1 
ATOM   5653 C  CA   . MET E 2 75 ? -8.941  29.553 23.754  1.00 60.10  ? 75  MET D CA   1 
ATOM   5654 C  C    . MET E 2 75 ? -10.288 28.861 23.871  1.00 61.48  ? 75  MET D C    1 
ATOM   5655 O  O    . MET E 2 75 ? -11.186 29.359 24.541  1.00 59.12  ? 75  MET D O    1 
ATOM   5656 C  CB   . MET E 2 75 ? -8.925  30.479 22.522  1.00 58.58  ? 75  MET D CB   1 
ATOM   5657 C  CG   . MET E 2 75 ? -7.823  31.506 22.536  1.00 57.94  ? 75  MET D CG   1 
ATOM   5658 S  SD   . MET E 2 75 ? -7.761  32.431 24.094  1.00 56.46  ? 75  MET D SD   1 
ATOM   5659 C  CE   . MET E 2 75 ? -9.400  33.113 24.105  1.00 56.38  ? 75  MET D CE   1 
ATOM   5660 H  H    . MET E 2 75 ? -7.434  28.586 22.935  1.00 73.96  ? 75  MET D H    1 
ATOM   5661 H  HA   . MET E 2 75 ? -8.802  30.102 24.541  1.00 72.12  ? 75  MET D HA   1 
ATOM   5662 H  HB2  . MET E 2 75 ? -8.812  29.936 21.726  1.00 70.30  ? 75  MET D HB2  1 
ATOM   5663 H  HB3  . MET E 2 75 ? -9.770  30.953 22.478  1.00 70.30  ? 75  MET D HB3  1 
ATOM   5664 H  HG2  . MET E 2 75 ? -6.971  31.059 22.417  1.00 69.53  ? 75  MET D HG2  1 
ATOM   5665 H  HG3  . MET E 2 75 ? -7.971  32.139 21.815  1.00 69.53  ? 75  MET D HG3  1 
ATOM   5666 H  HE1  . MET E 2 75 ? -9.513  33.648 24.906  1.00 67.66  ? 75  MET D HE1  1 
ATOM   5667 H  HE2  . MET E 2 75 ? -9.516  33.667 23.317  1.00 67.66  ? 75  MET D HE2  1 
ATOM   5668 H  HE3  . MET E 2 75 ? -10.043 32.387 24.098  1.00 67.66  ? 75  MET D HE3  1 
ATOM   5669 N  N    . ALA E 2 76 ? -10.445 27.727 23.187  1.00 64.22  ? 76  ALA D N    1 
ATOM   5670 C  CA   . ALA E 2 76 ? -11.678 26.951 23.293  1.00 64.27  ? 76  ALA D CA   1 
ATOM   5671 C  C    . ALA E 2 76 ? -11.806 26.407 24.697  1.00 64.18  ? 76  ALA D C    1 
ATOM   5672 O  O    . ALA E 2 76 ? -12.867 26.438 25.299  1.00 65.58  ? 76  ALA D O    1 
ATOM   5673 C  CB   . ALA E 2 76 ? -11.705 25.832 22.282  1.00 67.50  ? 76  ALA D CB   1 
ATOM   5674 H  H    . ALA E 2 76 ? -9.857  27.389 22.658  1.00 77.06  ? 76  ALA D H    1 
ATOM   5675 H  HA   . ALA E 2 76 ? -12.436 27.531 23.123  1.00 77.12  ? 76  ALA D HA   1 
ATOM   5676 H  HB1  . ALA E 2 76 ? -10.949 25.245 22.440  1.00 81.01  ? 76  ALA D HB1  1 
ATOM   5677 H  HB2  . ALA E 2 76 ? -12.534 25.338 22.380  1.00 81.01  ? 76  ALA D HB2  1 
ATOM   5678 H  HB3  . ALA E 2 76 ? -11.648 26.211 21.391  1.00 81.01  ? 76  ALA D HB3  1 
ATOM   5679 N  N    . PHE E 2 77 ? -10.697 25.927 25.226  1.00 64.55  ? 77  PHE D N    1 
ATOM   5680 C  CA   . PHE E 2 77 ? -10.642 25.508 26.610  1.00 67.13  ? 77  PHE D CA   1 
ATOM   5681 C  C    . PHE E 2 77 ? -11.031 26.634 27.544  1.00 65.69  ? 77  PHE D C    1 
ATOM   5682 O  O    . PHE E 2 77 ? -11.920 26.486 28.366  1.00 64.54  ? 77  PHE D O    1 
ATOM   5683 C  CB   . PHE E 2 77 ? -9.225  25.010 26.917  1.00 69.93  ? 77  PHE D CB   1 
ATOM   5684 C  CG   . PHE E 2 77 ? -8.985  24.686 28.358  1.00 72.18  ? 77  PHE D CG   1 
ATOM   5685 C  CD1  . PHE E 2 77 ? -9.809  23.826 29.045  1.00 73.56  ? 77  PHE D CD1  1 
ATOM   5686 C  CD2  . PHE E 2 77 ? -7.885  25.214 29.011  1.00 72.02  ? 77  PHE D CD2  1 
ATOM   5687 C  CE1  . PHE E 2 77 ? -9.560  23.525 30.370  1.00 73.70  ? 77  PHE D CE1  1 
ATOM   5688 C  CE2  . PHE E 2 77 ? -7.629  24.907 30.330  1.00 74.17  ? 77  PHE D CE2  1 
ATOM   5689 C  CZ   . PHE E 2 77 ? -8.473  24.061 31.010  1.00 73.97  ? 77  PHE D CZ   1 
ATOM   5690 H  H    . PHE E 2 77 ? -9.955  25.832 24.800  1.00 77.47  ? 77  PHE D H    1 
ATOM   5691 H  HA   . PHE E 2 77 ? -11.260 24.773 26.747  1.00 80.56  ? 77  PHE D HA   1 
ATOM   5692 H  HB2  . PHE E 2 77 ? -9.061  24.204 26.403  1.00 83.92  ? 77  PHE D HB2  1 
ATOM   5693 H  HB3  . PHE E 2 77 ? -8.592  25.697 26.660  1.00 83.92  ? 77  PHE D HB3  1 
ATOM   5694 H  HD1  . PHE E 2 77 ? -10.549 23.458 28.620  1.00 88.27  ? 77  PHE D HD1  1 
ATOM   5695 H  HD2  . PHE E 2 77 ? -7.312  25.788 28.555  1.00 86.42  ? 77  PHE D HD2  1 
ATOM   5696 H  HE1  . PHE E 2 77 ? -10.129 22.950 30.828  1.00 88.44  ? 77  PHE D HE1  1 
ATOM   5697 H  HE2  . PHE E 2 77 ? -6.893  25.278 30.761  1.00 89.00  ? 77  PHE D HE2  1 
ATOM   5698 H  HZ   . PHE E 2 77 ? -8.309  23.855 31.902  1.00 88.77  ? 77  PHE D HZ   1 
ATOM   5699 N  N    . VAL E 2 78 ? -10.381 27.780 27.359  1.00 68.67  ? 78  VAL D N    1 
ATOM   5700 C  CA   . VAL E 2 78 ? -10.605 28.944 28.202  1.00 64.38  ? 78  VAL D CA   1 
ATOM   5701 C  C    . VAL E 2 78 ? -12.036 29.423 28.083  1.00 62.18  ? 78  VAL D C    1 
ATOM   5702 O  O    . VAL E 2 78 ? -12.634 29.776 29.079  1.00 64.06  ? 78  VAL D O    1 
ATOM   5703 C  CB   . VAL E 2 78 ? -9.614  30.104 27.859  1.00 60.12  ? 78  VAL D CB   1 
ATOM   5704 C  CG1  . VAL E 2 78 ? -9.976  31.357 28.589  1.00 58.18  ? 78  VAL D CG1  1 
ATOM   5705 C  CG2  . VAL E 2 78 ? -8.218  29.736 28.243  1.00 61.00  ? 78  VAL D CG2  1 
ATOM   5706 H  H    . VAL E 2 78 ? -9.797  27.908 26.741  1.00 82.40  ? 78  VAL D H    1 
ATOM   5707 H  HA   . VAL E 2 78 ? -10.454 28.692 29.127  1.00 77.26  ? 78  VAL D HA   1 
ATOM   5708 H  HB   . VAL E 2 78 ? -9.638  30.283 26.906  1.00 72.15  ? 78  VAL D HB   1 
ATOM   5709 H  HG11 . VAL E 2 78 ? -9.343  32.053 28.353  1.00 69.82  ? 78  VAL D HG11 1 
ATOM   5710 H  HG12 . VAL E 2 78 ? -10.873 31.624 28.332  1.00 69.82  ? 78  VAL D HG12 1 
ATOM   5711 H  HG13 . VAL E 2 78 ? -9.942  31.187 29.543  1.00 69.82  ? 78  VAL D HG13 1 
ATOM   5712 H  HG21 . VAL E 2 78 ? -7.626  30.471 28.020  1.00 73.19  ? 78  VAL D HG21 1 
ATOM   5713 H  HG22 . VAL E 2 78 ? -8.188  29.564 29.197  1.00 73.19  ? 78  VAL D HG22 1 
ATOM   5714 H  HG23 . VAL E 2 78 ? -7.957  28.940 27.754  1.00 73.19  ? 78  VAL D HG23 1 
ATOM   5715 N  N    . ALA E 2 79 ? -12.618 29.402 26.895  1.00 60.57  ? 79  ALA D N    1 
ATOM   5716 C  CA   . ALA E 2 79 ? -14.005 29.831 26.782  1.00 61.40  ? 79  ALA D CA   1 
ATOM   5717 C  C    . ALA E 2 79 ? -14.943 28.877 27.524  1.00 66.85  ? 79  ALA D C    1 
ATOM   5718 O  O    . ALA E 2 79 ? -15.831 29.354 28.239  1.00 67.29  ? 79  ALA D O    1 
ATOM   5719 C  CB   . ALA E 2 79 ? -14.407 29.935 25.354  1.00 59.40  ? 79  ALA D CB   1 
ATOM   5720 H  H    . ALA E 2 79 ? -12.247 29.153 26.160  1.00 72.68  ? 79  ALA D H    1 
ATOM   5721 H  HA   . ALA E 2 79 ? -14.095 30.710 27.182  1.00 73.68  ? 79  ALA D HA   1 
ATOM   5722 H  HB1  . ALA E 2 79 ? -14.308 29.066 24.935  1.00 71.29  ? 79  ALA D HB1  1 
ATOM   5723 H  HB2  . ALA E 2 79 ? -15.332 30.221 25.308  1.00 71.29  ? 79  ALA D HB2  1 
ATOM   5724 H  HB3  . ALA E 2 79 ? -13.837 30.583 24.913  1.00 71.29  ? 79  ALA D HB3  1 
ATOM   5725 N  N    . MET E 2 80 ? -14.731 27.551 27.379  1.00 68.57  ? 80  MET D N    1 
ATOM   5726 C  CA   . MET E 2 80 ? -15.523 26.533 28.099  1.00 67.99  ? 80  MET D CA   1 
ATOM   5727 C  C    . MET E 2 80 ? -15.430 26.794 29.595  1.00 68.43  ? 80  MET D C    1 
ATOM   5728 O  O    . MET E 2 80 ? -16.433 27.040 30.265  1.00 69.36  ? 80  MET D O    1 
ATOM   5729 C  CB   . MET E 2 80 ? -15.058 25.102 27.797  0.00 70.13  ? 80  MET D CB   1 
ATOM   5730 C  CG   . MET E 2 80 ? -15.587 24.514 26.495  0.00 72.86  ? 80  MET D CG   1 
ATOM   5731 S  SD   . MET E 2 80 ? -14.872 22.896 26.124  0.00 80.86  ? 80  MET D SD   1 
ATOM   5732 C  CE   . MET E 2 80 ? -13.454 23.325 25.125  0.00 75.38  ? 80  MET D CE   1 
ATOM   5733 H  H    . MET E 2 80 ? -14.129 27.216 26.864  1.00 82.28  ? 80  MET D H    1 
ATOM   5734 H  HA   . MET E 2 80 ? -16.450 26.607 27.825  1.00 81.59  ? 80  MET D HA   1 
ATOM   5735 H  HB2  . MET E 2 80 ? -14.089 25.097 27.748  0.00 84.16  ? 80  MET D HB2  1 
ATOM   5736 H  HB3  . MET E 2 80 ? -15.350 24.524 28.519  0.00 84.16  ? 80  MET D HB3  1 
ATOM   5737 H  HG2  . MET E 2 80 ? -16.549 24.409 26.563  0.00 87.44  ? 80  MET D HG2  1 
ATOM   5738 H  HG3  . MET E 2 80 ? -15.369 25.114 25.765  0.00 87.44  ? 80  MET D HG3  1 
ATOM   5739 H  HE1  . MET E 2 80 ? -12.991 22.512 24.868  0.00 90.45  ? 80  MET D HE1  1 
ATOM   5740 H  HE2  . MET E 2 80 ? -13.757 23.798 24.334  0.00 90.45  ? 80  MET D HE2  1 
ATOM   5741 H  HE3  . MET E 2 80 ? -12.862 23.893 25.644  0.00 90.45  ? 80  MET D HE3  1 
ATOM   5742 N  N    . VAL E 2 81 ? -14.216 26.786 30.112  1.00 66.00  ? 81  VAL D N    1 
ATOM   5743 C  CA   . VAL E 2 81 ? -14.013 26.994 31.524  1.00 65.60  ? 81  VAL D CA   1 
ATOM   5744 C  C    . VAL E 2 81 ? -14.672 28.272 32.014  1.00 69.51  ? 81  VAL D C    1 
ATOM   5745 O  O    . VAL E 2 81 ? -15.288 28.288 33.079  1.00 72.53  ? 81  VAL D O    1 
ATOM   5746 C  CB   . VAL E 2 81 ? -12.541 27.076 31.824  1.00 65.46  ? 81  VAL D CB   1 
ATOM   5747 C  CG1  . VAL E 2 81 ? -12.301 27.555 33.258  1.00 64.12  ? 81  VAL D CG1  1 
ATOM   5748 C  CG2  . VAL E 2 81 ? -11.862 25.751 31.464  1.00 68.49  ? 81  VAL D CG2  1 
ATOM   5749 H  H    . VAL E 2 81 ? -13.494 26.661 29.663  1.00 79.20  ? 81  VAL D H    1 
ATOM   5750 H  HA   . VAL E 2 81 ? -14.386 26.247 32.017  1.00 78.72  ? 81  VAL D HA   1 
ATOM   5751 H  HB   . VAL E 2 81 ? -12.159 27.750 31.241  1.00 78.56  ? 81  VAL D HB   1 
ATOM   5752 H  HG11 . VAL E 2 81 ? -11.345 27.597 33.421  1.00 76.94  ? 81  VAL D HG11 1 
ATOM   5753 H  HG12 . VAL E 2 81 ? -12.694 28.435 33.367  1.00 76.94  ? 81  VAL D HG12 1 
ATOM   5754 H  HG13 . VAL E 2 81 ? -12.714 26.929 33.873  1.00 76.94  ? 81  VAL D HG13 1 
ATOM   5755 H  HG21 . VAL E 2 81 ? -10.915 25.818 31.662  1.00 82.19  ? 81  VAL D HG21 1 
ATOM   5756 H  HG22 . VAL E 2 81 ? -12.261 25.039 31.988  1.00 82.19  ? 81  VAL D HG22 1 
ATOM   5757 H  HG23 . VAL E 2 81 ? -11.990 25.578 30.518  1.00 82.19  ? 81  VAL D HG23 1 
ATOM   5758 N  N    . THR E 2 82 ? -14.486 29.364 31.283  1.00 68.85  ? 82  THR D N    1 
ATOM   5759 C  CA   . THR E 2 82 ? -15.074 30.650 31.671  1.00 70.06  ? 82  THR D CA   1 
ATOM   5760 C  C    . THR E 2 82 ? -16.597 30.604 31.532  1.00 68.20  ? 82  THR D C    1 
ATOM   5761 O  O    . THR E 2 82 ? -17.299 31.160 32.355  1.00 66.37  ? 82  THR D O    1 
ATOM   5762 C  CB   . THR E 2 82 ? -14.465 31.796 30.850  1.00 67.61  ? 82  THR D CB   1 
ATOM   5763 O  OG1  . THR E 2 82 ? -13.055 31.791 31.078  1.00 63.69  ? 82  THR D OG1  1 
ATOM   5764 C  CG2  . THR E 2 82 ? -15.014 33.161 31.286  1.00 65.13  ? 82  THR D CG2  1 
ATOM   5765 H  H    . THR E 2 82 ? -14.024 29.391 30.558  1.00 82.62  ? 82  THR D H    1 
ATOM   5766 H  HA   . THR E 2 82 ? -14.869 30.816 32.605  1.00 84.07  ? 82  THR D HA   1 
ATOM   5767 H  HB   . THR E 2 82 ? -14.650 31.665 29.907  1.00 81.13  ? 82  THR D HB   1 
ATOM   5768 H  HG1  . THR E 2 82 ? -12.895 31.904 31.895  1.00 76.43  ? 82  THR D HG1  1 
ATOM   5769 H  HG21 . THR E 2 82 ? -14.614 33.865 30.752  1.00 78.16  ? 82  THR D HG21 1 
ATOM   5770 H  HG22 . THR E 2 82 ? -15.977 33.184 31.166  1.00 78.16  ? 82  THR D HG22 1 
ATOM   5771 H  HG23 . THR E 2 82 ? -14.809 33.317 32.221  1.00 78.16  ? 82  THR D HG23 1 
ATOM   5772 N  N    . THR E 2 83 ? -17.077 29.917 30.493  1.00 68.44  ? 83  THR D N    1 
ATOM   5773 C  CA   . THR E 2 83 ? -18.504 29.723 30.258  1.00 68.40  ? 83  THR D CA   1 
ATOM   5774 C  C    . THR E 2 83 ? -19.112 29.001 31.467  1.00 71.98  ? 83  THR D C    1 
ATOM   5775 O  O    . THR E 2 83 ? -20.285 29.174 31.767  1.00 72.86  ? 83  THR D O    1 
ATOM   5776 C  CB   . THR E 2 83 ? -18.764 28.921 28.960  0.00 69.60  ? 83  THR D CB   1 
ATOM   5777 O  OG1  . THR E 2 83 ? -18.528 29.757 27.820  0.00 67.73  ? 83  THR D OG1  1 
ATOM   5778 C  CG2  . THR E 2 83 ? -20.194 28.386 28.906  0.00 69.67  ? 83  THR D CG2  1 
ATOM   5779 H  H    . THR E 2 83 ? -16.580 29.546 29.897  1.00 82.13  ? 83  THR D H    1 
ATOM   5780 H  HA   . THR E 2 83 ? -18.935 30.588 30.171  1.00 82.07  ? 83  THR D HA   1 
ATOM   5781 H  HB   . THR E 2 83 ? -18.158 28.164 28.929  0.00 83.52  ? 83  THR D HB   1 
ATOM   5782 H  HG1  . THR E 2 83 ? -17.732 30.027 27.822  0.00 81.27  ? 83  THR D HG1  1 
ATOM   5783 H  HG21 . THR E 2 83 ? -20.331 27.888 28.085  0.00 83.61  ? 83  THR D HG21 1 
ATOM   5784 H  HG22 . THR E 2 83 ? -20.357 27.799 29.661  0.00 83.61  ? 83  THR D HG22 1 
ATOM   5785 H  HG23 . THR E 2 83 ? -20.825 29.122 28.937  0.00 83.61  ? 83  THR D HG23 1 
ATOM   5786 N  N    . ALA E 2 84 ? -18.340 28.144 32.134  1.00 73.53  ? 84  ALA D N    1 
ATOM   5787 C  CA   . ALA E 2 84 ? -18.803 27.529 33.389  1.00 76.69  ? 84  ALA D CA   1 
ATOM   5788 C  C    . ALA E 2 84 ? -18.947 28.511 34.586  1.00 76.02  ? 84  ALA D C    1 
ATOM   5789 O  O    . ALA E 2 84 ? -20.045 28.740 35.109  1.00 81.11  ? 84  ALA D O    1 
ATOM   5790 C  CB   . ALA E 2 84 ? -17.871 26.388 33.775  0.00 72.69  ? 84  ALA D CB   1 
ATOM   5791 H  H    . ALA E 2 84 ? -17.552 27.901 31.889  1.00 88.23  ? 84  ALA D H    1 
ATOM   5792 H  HA   . ALA E 2 84 ? -19.679 27.143 33.230  1.00 92.03  ? 84  ALA D HA   1 
ATOM   5793 H  HB1  . ALA E 2 84 ? -18.185 25.991 34.603  0.00 87.23  ? 84  ALA D HB1  1 
ATOM   5794 H  HB2  . ALA E 2 84 ? -17.874 25.725 33.067  0.00 87.23  ? 84  ALA D HB2  1 
ATOM   5795 H  HB3  . ALA E 2 84 ? -16.975 26.740 33.896  0.00 87.23  ? 84  ALA D HB3  1 
ATOM   5796 N  N    . CYS E 2 85 ? -17.827 29.088 34.992  1.00 71.92  ? 85  CYS D N    1 
ATOM   5797 C  CA   . CYS E 2 85 ? -17.735 29.993 36.136  1.00 73.69  ? 85  CYS D CA   1 
ATOM   5798 C  C    . CYS E 2 85 ? -18.781 31.108 36.154  1.00 77.48  ? 85  CYS D C    1 
ATOM   5799 O  O    . CYS E 2 85 ? -19.106 31.671 37.202  1.00 78.62  ? 85  CYS D O    1 
ATOM   5800 C  CB   . CYS E 2 85 ? -16.355 30.612 36.138  1.00 68.55  ? 85  CYS D CB   1 
ATOM   5801 S  SG   . CYS E 2 85 ? -15.110 29.340 35.993  0.67 67.57  ? 85  CYS D SG   1 
ATOM   5802 H  H    . CYS E 2 85 ? -17.070 28.965 34.604  1.00 86.30  ? 85  CYS D H    1 
ATOM   5803 H  HA   . CYS E 2 85 ? -17.834 29.479 36.953  1.00 88.43  ? 85  CYS D HA   1 
ATOM   5804 H  HB2  . CYS E 2 85 ? -16.269 31.215 35.384  1.00 82.25  ? 85  CYS D HB2  1 
ATOM   5805 H  HB3  . CYS E 2 85 ? -16.214 31.088 36.972  1.00 82.25  ? 85  CYS D HB3  1 
ATOM   5806 H  HG   . CYS E 2 85 ? -15.210 28.588 36.923  0.67 81.09  ? 85  CYS D HG   1 
ATOM   5807 N  N    . HIS E 2 86 ? -19.265 31.463 34.974  1.00 76.14  ? 86  HIS D N    1 
ATOM   5808 C  CA   . HIS E 2 86 ? -20.095 32.642 34.824  1.00 73.63  ? 86  HIS D CA   1 
ATOM   5809 C  C    . HIS E 2 86 ? -21.442 32.531 35.515  1.00 80.03  ? 86  HIS D C    1 
ATOM   5810 O  O    . HIS E 2 86 ? -22.018 33.547 35.954  1.00 80.77  ? 86  HIS D O    1 
ATOM   5811 C  CB   . HIS E 2 86 ? -20.343 32.924 33.364  1.00 68.22  ? 86  HIS D CB   1 
ATOM   5812 C  CG   . HIS E 2 86 ? -21.364 33.988 33.140  1.00 68.40  ? 86  HIS D CG   1 
ATOM   5813 N  ND1  . HIS E 2 86 ? -22.513 33.760 32.413  1.00 63.90  ? 86  HIS D ND1  1 
ATOM   5814 C  CD2  . HIS E 2 86 ? -21.418 35.277 33.552  1.00 66.42  ? 86  HIS D CD2  1 
ATOM   5815 C  CE1  . HIS E 2 86 ? -23.238 34.863 32.404  1.00 66.32  ? 86  HIS D CE1  1 
ATOM   5816 N  NE2  . HIS E 2 86 ? -22.595 35.798 33.082  1.00 67.94  ? 86  HIS D NE2  1 
ATOM   5817 H  H    . HIS E 2 86 ? -19.125 31.034 34.242  1.00 91.37  ? 86  HIS D H    1 
ATOM   5818 H  HA   . HIS E 2 86 ? -19.628 33.405 35.200  1.00 88.36  ? 86  HIS D HA   1 
ATOM   5819 H  HB2  . HIS E 2 86 ? -19.513 33.215 32.954  1.00 81.86  ? 86  HIS D HB2  1 
ATOM   5820 H  HB3  . HIS E 2 86 ? -20.657 32.113 32.936  1.00 81.86  ? 86  HIS D HB3  1 
ATOM   5821 H  HD2  . HIS E 2 86 ? -20.783 35.721 34.067  1.00 79.71  ? 86  HIS D HD2  1 
ATOM   5822 H  HE1  . HIS E 2 86 ? -24.056 34.970 31.975  1.00 79.59  ? 86  HIS D HE1  1 
ATOM   5823 N  N    . GLU E 2 87 ? -21.950 31.302 35.589  1.00 81.51  ? 87  GLU D N    1 
ATOM   5824 C  CA   . GLU E 2 87 ? -23.247 31.031 36.206  1.00 84.13  ? 87  GLU D CA   1 
ATOM   5825 C  C    . GLU E 2 87 ? -23.285 31.535 37.646  1.00 84.75  ? 87  GLU D C    1 
ATOM   5826 O  O    . GLU E 2 87 ? -24.333 31.989 38.128  1.00 88.83  ? 87  GLU D O    1 
ATOM   5827 C  CB   . GLU E 2 87 ? -23.532 29.559 36.072  1.00 85.39  ? 87  GLU D CB   1 
ATOM   5828 C  CG   . GLU E 2 87 ? -23.829 29.272 34.632  1.00 87.19  ? 87  GLU D CG   1 
ATOM   5829 C  CD   . GLU E 2 87 ? -24.001 27.834 34.382  1.00 97.34  ? 87  GLU D CD   1 
ATOM   5830 O  OE1  . GLU E 2 87 ? -23.081 27.093 34.791  1.00 94.11  ? 87  GLU D OE1  1 
ATOM   5831 O  OE2  . GLU E 2 87 ? -25.053 27.445 33.817  1.00 107.87 ? 87  GLU D OE2  1 
ATOM   5832 H  H    . GLU E 2 87 ? -21.557 30.600 35.285  1.00 97.82  ? 87  GLU D H    1 
ATOM   5833 H  HA   . GLU E 2 87 ? -23.932 31.509 35.711  1.00 100.95 ? 87  GLU D HA   1 
ATOM   5834 H  HB2  . GLU E 2 87 ? -22.754 29.046 36.341  1.00 102.47 ? 87  GLU D HB2  1 
ATOM   5835 H  HB3  . GLU E 2 87 ? -24.306 29.322 36.606  1.00 102.47 ? 87  GLU D HB3  1 
ATOM   5836 H  HG2  . GLU E 2 87 ? -24.650 29.723 34.380  1.00 104.62 ? 87  GLU D HG2  1 
ATOM   5837 H  HG3  . GLU E 2 87 ? -23.093 29.588 34.086  1.00 104.62 ? 87  GLU D HG3  1 
ATOM   5838 N  N    . PHE E 2 88 ? -22.132 31.477 38.312  1.00 82.40  ? 88  PHE D N    1 
ATOM   5839 C  CA   . PHE E 2 88 ? -21.910 32.276 39.515  1.00 80.30  ? 88  PHE D CA   1 
ATOM   5840 C  C    . PHE E 2 88 ? -22.220 33.778 39.238  1.00 78.86  ? 88  PHE D C    1 
ATOM   5841 O  O    . PHE E 2 88 ? -22.674 34.542 40.120  1.00 77.09  ? 88  PHE D O    1 
ATOM   5842 C  CB   . PHE E 2 88 ? -20.468 32.105 39.991  1.00 76.27  ? 88  PHE D CB   1 
ATOM   5843 C  CG   . PHE E 2 88 ? -20.165 32.837 41.258  1.00 73.57  ? 88  PHE D CG   1 
ATOM   5844 C  CD1  . PHE E 2 88 ? -20.197 34.226 41.308  1.00 72.06  ? 88  PHE D CD1  1 
ATOM   5845 C  CD2  . PHE E 2 88 ? -19.829 32.139 42.391  1.00 74.44  ? 88  PHE D CD2  1 
ATOM   5846 C  CE1  . PHE E 2 88 ? -19.921 34.897 42.462  1.00 71.65  ? 88  PHE D CE1  1 
ATOM   5847 C  CE2  . PHE E 2 88 ? -19.537 32.793 43.567  1.00 73.70  ? 88  PHE D CE2  1 
ATOM   5848 C  CZ   . PHE E 2 88 ? -19.587 34.183 43.603  1.00 74.43  ? 88  PHE D CZ   1 
ATOM   5849 H  H    . PHE E 2 88 ? -21.464 30.984 38.087  1.00 98.88  ? 88  PHE D H    1 
ATOM   5850 H  HA   . PHE E 2 88 ? -22.502 31.967 40.218  1.00 96.36  ? 88  PHE D HA   1 
ATOM   5851 H  HB2  . PHE E 2 88 ? -20.299 31.162 40.145  1.00 91.53  ? 88  PHE D HB2  1 
ATOM   5852 H  HB3  . PHE E 2 88 ? -19.870 32.439 39.305  1.00 91.53  ? 88  PHE D HB3  1 
ATOM   5853 H  HD1  . PHE E 2 88 ? -20.424 34.705 40.544  1.00 86.47  ? 88  PHE D HD1  1 
ATOM   5854 H  HD2  . PHE E 2 88 ? -19.799 31.210 42.365  1.00 89.32  ? 88  PHE D HD2  1 
ATOM   5855 H  HE1  . PHE E 2 88 ? -19.950 35.826 42.482  1.00 85.98  ? 88  PHE D HE1  1 
ATOM   5856 H  HE2  . PHE E 2 88 ? -19.316 32.311 44.331  1.00 88.44  ? 88  PHE D HE2  1 
ATOM   5857 H  HZ   . PHE E 2 88 ? -19.392 34.634 44.393  1.00 89.32  ? 88  PHE D HZ   1 
HETATM 5858 CA CA   . CA  F 3 .  ? -23.220 48.697 -1.042  1.00 44.16  ? 501 CA  A CA   1 
HETATM 5859 CA CA   . CA  G 3 .  ? -16.555 56.129 -7.208  1.00 34.33  ? 502 CA  A CA   1 
HETATM 5860 CA CA   . CA  H 3 .  ? -18.549 20.909 -2.856  1.00 38.94  ? 501 CA  B CA   1 
HETATM 5861 CA CA   . CA  I 3 .  ? -10.812 16.694 -10.031 1.00 39.30  ? 502 CA  B CA   1 
HETATM 5862 CA CA   . CA  J 3 .  ? -28.482 43.591 27.331  1.00 70.72  ? 501 CA  C CA   1 
HETATM 5863 CA CA   . CA  K 3 .  ? -28.030 34.440 20.938  1.00 65.87  ? 502 CA  C CA   1 
HETATM 5864 CA CA   . CA  L 3 .  ? 5.389   23.341 24.737  1.00 71.95  ? 501 CA  D CA   1 
HETATM 5865 CA CA   . CA  M 3 .  ? -3.637  19.355 19.044  1.00 93.38  ? 502 CA  D CA   1 
HETATM 5866 O  O    . HOH N 4 .  ? -33.170 44.444 -22.688 1.00 69.98  ? 101 HOH P O    1 
HETATM 5867 O  O    . HOH O 4 .  ? -34.031 46.797 -22.523 1.00 55.63  ? 601 HOH A O    1 
HETATM 5868 O  O    . HOH O 4 .  ? 5.878   33.608 -9.637  1.00 38.30  ? 602 HOH A O    1 
HETATM 5869 O  O    . HOH O 4 .  ? -19.971 58.320 -4.781  1.00 41.10  ? 603 HOH A O    1 
HETATM 5870 O  O    . HOH O 4 .  ? -19.948 57.011 1.533   1.00 41.12  ? 604 HOH A O    1 
HETATM 5871 O  O    . HOH O 4 .  ? -21.083 49.921 -0.630  1.00 43.04  ? 605 HOH A O    1 
HETATM 5872 O  O    . HOH O 4 .  ? -18.264 56.453 -5.979  1.00 45.52  ? 606 HOH A O    1 
HETATM 5873 O  O    . HOH O 4 .  ? -2.112  41.369 -13.025 1.00 36.28  ? 607 HOH A O    1 
HETATM 5874 O  O    . HOH O 4 .  ? -30.058 46.861 -2.138  1.00 49.66  ? 608 HOH A O    1 
HETATM 5875 O  O    . HOH O 4 .  ? -10.709 45.594 -17.598 1.00 34.09  ? 609 HOH A O    1 
HETATM 5876 O  O    . HOH O 4 .  ? -8.285  47.347 -16.518 1.00 39.08  ? 610 HOH A O    1 
HETATM 5877 O  O    . HOH O 4 .  ? -11.064 47.944 -21.944 1.00 49.49  ? 611 HOH A O    1 
HETATM 5878 O  O    . HOH O 4 .  ? -18.809 51.000 -24.356 1.00 51.78  ? 612 HOH A O    1 
HETATM 5879 O  O    . HOH O 4 .  ? -13.021 37.600 3.105   1.00 48.03  ? 613 HOH A O    1 
HETATM 5880 O  O    . HOH O 4 .  ? -4.360  44.319 -14.686 1.00 46.21  ? 614 HOH A O    1 
HETATM 5881 O  O    . HOH P 4 .  ? -13.356 13.456 -7.542  1.00 39.49  ? 601 HOH B O    1 
HETATM 5882 O  O    . HOH P 4 .  ? -11.946 15.760 -1.294  1.00 42.46  ? 602 HOH B O    1 
HETATM 5883 O  O    . HOH P 4 .  ? -11.979 15.967 -8.139  1.00 39.18  ? 603 HOH B O    1 
HETATM 5884 O  O    . HOH P 4 .  ? -18.813 20.349 -4.877  1.00 37.56  ? 604 HOH B O    1 
HETATM 5885 O  O    . HOH P 4 .  ? 2.403   31.344 -6.935  1.00 33.86  ? 605 HOH B O    1 
HETATM 5886 O  O    . HOH P 4 .  ? -20.368 25.255 -9.655  1.00 46.15  ? 606 HOH B O    1 
HETATM 5887 O  O    . HOH P 4 .  ? -2.061  30.252 -11.873 1.00 37.60  ? 607 HOH B O    1 
HETATM 5888 O  O    . HOH P 4 .  ? 0.765   28.550 -0.689  1.00 40.86  ? 608 HOH B O    1 
HETATM 5889 O  O    . HOH P 4 .  ? -21.906 24.278 -3.539  1.00 47.32  ? 609 HOH B O    1 
HETATM 5890 O  O    . HOH P 4 .  ? -2.774  28.418 3.910   1.00 45.92  ? 610 HOH B O    1 
HETATM 5891 O  O    . HOH Q 4 .  ? -30.077 43.348 25.532  1.00 70.54  ? 601 HOH C O    1 
HETATM 5892 O  O    . HOH Q 4 .  ? -29.301 35.578 22.293  1.00 64.29  ? 602 HOH C O    1 
HETATM 5893 O  O    . HOH Q 4 .  ? -13.047 43.897 32.978  1.00 47.02  ? 603 HOH C O    1 
HETATM 5894 O  O    . HOH R 4 .  ? -26.274 24.933 33.574  1.00 106.05 ? 601 HOH D O    1 
HETATM 5895 O  O    . HOH R 4 .  ? 5.027   21.595 23.258  1.00 74.68  ? 602 HOH D O    1 
HETATM 5896 O  O    . HOH R 4 .  ? -2.792  21.466 18.211  1.00 84.67  ? 603 HOH D O    1 
HETATM 5897 O  O    . HOH R 4 .  ? -0.182  27.361 19.406  1.00 62.94  ? 604 HOH D O    1 
HETATM 5898 O  O    . HOH R 4 .  ? -2.482  42.024 30.232  1.00 44.56  ? 605 HOH D O    1 
HETATM 5899 O  O    . HOH R 4 .  ? -5.533  45.770 34.851  1.00 54.23  ? 606 HOH D O    1 
HETATM 5900 O  O    . HOH R 4 .  ? -11.140 44.216 35.032  1.00 54.27  ? 607 HOH D O    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ASN 1  54 ?  ?   ?   P . n 
A 1 2  THR 2  55 ?  ?   ?   P . n 
A 1 3  GLY 3  56 ?  ?   ?   P . n 
A 1 4  ARG 4  57 57 ARG ARG P . n 
A 1 5  THR 5  58 58 THR THR P . n 
A 1 6  GLU 6  59 59 GLU GLU P . n 
A 1 7  ALA 7  60 60 ALA ALA P . n 
A 1 8  TRP 8  61 61 TRP TRP P . n 
A 1 9  LYS 9  62 62 LYS LYS P . n 
A 1 10 VAL 10 63 63 VAL VAL P . n 
A 1 11 LEU 11 64 64 LEU LEU P . n 
A 1 12 SER 12 65 65 SER SER P . n 
A 1 13 PRO 13 66 ?  ?   ?   P . n 
A 1 14 GLN 14 67 ?  ?   ?   P . n 
A 1 15 GLY 15 68 ?  ?   ?   P . n 
B 2 1  MET 1  1  1  MET MET A . n 
B 2 2  SER 2  2  2  SER SER A . n 
B 2 3  GLU 3  3  3  GLU GLU A . n 
B 2 4  LEU 4  4  4  LEU LEU A . n 
B 2 5  GLU 5  5  5  GLU GLU A . n 
B 2 6  LYS 6  6  6  LYS LYS A . n 
B 2 7  ALA 7  7  7  ALA ALA A . n 
B 2 8  MET 8  8  8  MET MET A . n 
B 2 9  VAL 9  9  9  VAL VAL A . n 
B 2 10 ALA 10 10 10 ALA ALA A . n 
B 2 11 LEU 11 11 11 LEU LEU A . n 
B 2 12 ILE 12 12 12 ILE ILE A . n 
B 2 13 ASP 13 13 13 ASP ASP A . n 
B 2 14 VAL 14 14 14 VAL VAL A . n 
B 2 15 PHE 15 15 15 PHE PHE A . n 
B 2 16 HIS 16 16 16 HIS HIS A . n 
B 2 17 GLN 17 17 17 GLN GLN A . n 
B 2 18 TYR 18 18 18 TYR TYR A . n 
B 2 19 SER 19 19 19 SER SER A . n 
B 2 20 GLY 20 20 20 GLY GLY A . n 
B 2 21 ARG 21 21 21 ARG ARG A . n 
B 2 22 GLU 22 22 22 GLU GLU A . n 
B 2 23 GLY 23 23 23 GLY GLY A . n 
B 2 24 ASP 24 24 24 ASP ASP A . n 
B 2 25 LYS 25 25 25 LYS LYS A . n 
B 2 26 HIS 26 26 26 HIS HIS A . n 
B 2 27 LYS 27 27 27 LYS LYS A . n 
B 2 28 LEU 28 28 28 LEU LEU A . n 
B 2 29 LYS 29 29 29 LYS LYS A . n 
B 2 30 LYS 30 30 30 LYS LYS A . n 
B 2 31 SER 31 31 31 SER SER A . n 
B 2 32 GLU 32 32 32 GLU GLU A . n 
B 2 33 LEU 33 33 33 LEU LEU A . n 
B 2 34 LYS 34 34 34 LYS LYS A . n 
B 2 35 GLU 35 35 35 GLU GLU A . n 
B 2 36 LEU 36 36 36 LEU LEU A . n 
B 2 37 ILE 37 37 37 ILE ILE A . n 
B 2 38 ASN 38 38 38 ASN ASN A . n 
B 2 39 ASN 39 39 39 ASN ASN A . n 
B 2 40 GLU 40 40 40 GLU GLU A . n 
B 2 41 LEU 41 41 41 LEU LEU A . n 
B 2 42 SER 42 42 42 SER SER A . n 
B 2 43 HIS 43 43 43 HIS HIS A . n 
B 2 44 PHE 44 44 44 PHE PHE A . n 
B 2 45 LEU 45 45 45 LEU LEU A . n 
B 2 46 GLU 46 46 46 GLU GLU A . n 
B 2 47 GLU 47 47 47 GLU GLU A . n 
B 2 48 ILE 48 48 48 ILE ILE A . n 
B 2 49 LYS 49 49 49 LYS LYS A . n 
B 2 50 GLU 50 50 50 GLU GLU A . n 
B 2 51 GLN 51 51 51 GLN GLN A . n 
B 2 52 GLU 52 52 52 GLU GLU A . n 
B 2 53 VAL 53 53 53 VAL VAL A . n 
B 2 54 VAL 54 54 54 VAL VAL A . n 
B 2 55 ASP 55 55 55 ASP ASP A . n 
B 2 56 LYS 56 56 56 LYS LYS A . n 
B 2 57 VAL 57 57 57 VAL VAL A . n 
B 2 58 MET 58 58 58 MET MET A . n 
B 2 59 GLU 59 59 59 GLU GLU A . n 
B 2 60 THR 60 60 60 THR THR A . n 
B 2 61 LEU 61 61 61 LEU LEU A . n 
B 2 62 ASP 62 62 62 ASP ASP A . n 
B 2 63 ASN 63 63 63 ASN ASN A . n 
B 2 64 ASP 64 64 64 ASP ASP A . n 
B 2 65 GLY 65 65 65 GLY GLY A . n 
B 2 66 ASP 66 66 66 ASP ASP A . n 
B 2 67 GLY 67 67 67 GLY GLY A . n 
B 2 68 GLU 68 68 68 GLU GLU A . n 
B 2 69 CYS 69 69 69 CYS CYS A . n 
B 2 70 ASP 70 70 70 ASP ASP A . n 
B 2 71 PHE 71 71 71 PHE PHE A . n 
B 2 72 GLN 72 72 72 GLN GLN A . n 
B 2 73 GLU 73 73 73 GLU GLU A . n 
B 2 74 PHE 74 74 74 PHE PHE A . n 
B 2 75 MET 75 75 75 MET MET A . n 
B 2 76 ALA 76 76 76 ALA ALA A . n 
B 2 77 PHE 77 77 77 PHE PHE A . n 
B 2 78 VAL 78 78 78 VAL VAL A . n 
B 2 79 ALA 79 79 79 ALA ALA A . n 
B 2 80 MET 80 80 80 MET MET A . n 
B 2 81 VAL 81 81 81 VAL VAL A . n 
B 2 82 THR 82 82 82 THR THR A . n 
B 2 83 THR 83 83 83 THR THR A . n 
B 2 84 ALA 84 84 84 ALA ALA A . n 
B 2 85 CYS 85 85 85 CYS CYS A . n 
B 2 86 HIS 86 86 86 HIS HIS A . n 
B 2 87 GLU 87 87 87 GLU GLU A . n 
B 2 88 PHE 88 88 88 PHE PHE A . n 
B 2 89 PHE 89 89 89 PHE PHE A . n 
B 2 90 GLU 90 90 90 GLU GLU A . n 
B 2 91 HIS 91 91 ?  ?   ?   A . n 
B 2 92 GLU 92 92 ?  ?   ?   A . n 
C 2 1  MET 1  1  1  MET MET B . n 
C 2 2  SER 2  2  2  SER SER B . n 
C 2 3  GLU 3  3  3  GLU GLU B . n 
C 2 4  LEU 4  4  4  LEU LEU B . n 
C 2 5  GLU 5  5  5  GLU GLU B . n 
C 2 6  LYS 6  6  6  LYS LYS B . n 
C 2 7  ALA 7  7  7  ALA ALA B . n 
C 2 8  MET 8  8  8  MET MET B . n 
C 2 9  VAL 9  9  9  VAL VAL B . n 
C 2 10 ALA 10 10 10 ALA ALA B . n 
C 2 11 LEU 11 11 11 LEU LEU B . n 
C 2 12 ILE 12 12 12 ILE ILE B . n 
C 2 13 ASP 13 13 13 ASP ASP B . n 
C 2 14 VAL 14 14 14 VAL VAL B . n 
C 2 15 PHE 15 15 15 PHE PHE B . n 
C 2 16 HIS 16 16 16 HIS HIS B . n 
C 2 17 GLN 17 17 17 GLN GLN B . n 
C 2 18 TYR 18 18 18 TYR TYR B . n 
C 2 19 SER 19 19 19 SER SER B . n 
C 2 20 GLY 20 20 20 GLY GLY B . n 
C 2 21 ARG 21 21 21 ARG ARG B . n 
C 2 22 GLU 22 22 22 GLU GLU B . n 
C 2 23 GLY 23 23 23 GLY GLY B . n 
C 2 24 ASP 24 24 24 ASP ASP B . n 
C 2 25 LYS 25 25 25 LYS LYS B . n 
C 2 26 HIS 26 26 26 HIS HIS B . n 
C 2 27 LYS 27 27 27 LYS LYS B . n 
C 2 28 LEU 28 28 28 LEU LEU B . n 
C 2 29 LYS 29 29 29 LYS LYS B . n 
C 2 30 LYS 30 30 30 LYS LYS B . n 
C 2 31 SER 31 31 31 SER SER B . n 
C 2 32 GLU 32 32 32 GLU GLU B . n 
C 2 33 LEU 33 33 33 LEU LEU B . n 
C 2 34 LYS 34 34 34 LYS LYS B . n 
C 2 35 GLU 35 35 35 GLU GLU B . n 
C 2 36 LEU 36 36 36 LEU LEU B . n 
C 2 37 ILE 37 37 37 ILE ILE B . n 
C 2 38 ASN 38 38 38 ASN ASN B . n 
C 2 39 ASN 39 39 39 ASN ASN B . n 
C 2 40 GLU 40 40 40 GLU GLU B . n 
C 2 41 LEU 41 41 41 LEU LEU B . n 
C 2 42 SER 42 42 42 SER SER B . n 
C 2 43 HIS 43 43 43 HIS HIS B . n 
C 2 44 PHE 44 44 44 PHE PHE B . n 
C 2 45 LEU 45 45 45 LEU LEU B . n 
C 2 46 GLU 46 46 46 GLU GLU B . n 
C 2 47 GLU 47 47 47 GLU GLU B . n 
C 2 48 ILE 48 48 48 ILE ILE B . n 
C 2 49 LYS 49 49 49 LYS LYS B . n 
C 2 50 GLU 50 50 50 GLU GLU B . n 
C 2 51 GLN 51 51 51 GLN GLN B . n 
C 2 52 GLU 52 52 52 GLU GLU B . n 
C 2 53 VAL 53 53 53 VAL VAL B . n 
C 2 54 VAL 54 54 54 VAL VAL B . n 
C 2 55 ASP 55 55 55 ASP ASP B . n 
C 2 56 LYS 56 56 56 LYS LYS B . n 
C 2 57 VAL 57 57 57 VAL VAL B . n 
C 2 58 MET 58 58 58 MET MET B . n 
C 2 59 GLU 59 59 59 GLU GLU B . n 
C 2 60 THR 60 60 60 THR THR B . n 
C 2 61 LEU 61 61 61 LEU LEU B . n 
C 2 62 ASP 62 62 62 ASP ASP B . n 
C 2 63 ASN 63 63 63 ASN ASN B . n 
C 2 64 ASP 64 64 64 ASP ASP B . n 
C 2 65 GLY 65 65 65 GLY GLY B . n 
C 2 66 ASP 66 66 66 ASP ASP B . n 
C 2 67 GLY 67 67 67 GLY GLY B . n 
C 2 68 GLU 68 68 68 GLU GLU B . n 
C 2 69 CYS 69 69 69 CYS CYS B . n 
C 2 70 ASP 70 70 70 ASP ASP B . n 
C 2 71 PHE 71 71 71 PHE PHE B . n 
C 2 72 GLN 72 72 72 GLN GLN B . n 
C 2 73 GLU 73 73 73 GLU GLU B . n 
C 2 74 PHE 74 74 74 PHE PHE B . n 
C 2 75 MET 75 75 75 MET MET B . n 
C 2 76 ALA 76 76 76 ALA ALA B . n 
C 2 77 PHE 77 77 77 PHE PHE B . n 
C 2 78 VAL 78 78 78 VAL VAL B . n 
C 2 79 ALA 79 79 79 ALA ALA B . n 
C 2 80 MET 80 80 80 MET MET B . n 
C 2 81 VAL 81 81 81 VAL VAL B . n 
C 2 82 THR 82 82 82 THR THR B . n 
C 2 83 THR 83 83 83 THR THR B . n 
C 2 84 ALA 84 84 84 ALA ALA B . n 
C 2 85 CYS 85 85 85 CYS CYS B . n 
C 2 86 HIS 86 86 86 HIS HIS B . n 
C 2 87 GLU 87 87 87 GLU GLU B . n 
C 2 88 PHE 88 88 88 PHE PHE B . n 
C 2 89 PHE 89 89 89 PHE PHE B . n 
C 2 90 GLU 90 90 90 GLU GLU B . n 
C 2 91 HIS 91 91 91 HIS HIS B . n 
C 2 92 GLU 92 92 ?  ?   ?   B . n 
D 2 1  MET 1  1  1  MET MET C . n 
D 2 2  SER 2  2  2  SER SER C . n 
D 2 3  GLU 3  3  3  GLU GLU C . n 
D 2 4  LEU 4  4  4  LEU LEU C . n 
D 2 5  GLU 5  5  5  GLU GLU C . n 
D 2 6  LYS 6  6  6  LYS LYS C . n 
D 2 7  ALA 7  7  7  ALA ALA C . n 
D 2 8  MET 8  8  8  MET MET C . n 
D 2 9  VAL 9  9  9  VAL VAL C . n 
D 2 10 ALA 10 10 10 ALA ALA C . n 
D 2 11 LEU 11 11 11 LEU LEU C . n 
D 2 12 ILE 12 12 12 ILE ILE C . n 
D 2 13 ASP 13 13 13 ASP ASP C . n 
D 2 14 VAL 14 14 14 VAL VAL C . n 
D 2 15 PHE 15 15 15 PHE PHE C . n 
D 2 16 HIS 16 16 16 HIS HIS C . n 
D 2 17 GLN 17 17 17 GLN GLN C . n 
D 2 18 TYR 18 18 18 TYR TYR C . n 
D 2 19 SER 19 19 19 SER SER C . n 
D 2 20 GLY 20 20 20 GLY GLY C . n 
D 2 21 ARG 21 21 21 ARG ARG C . n 
D 2 22 GLU 22 22 22 GLU GLU C . n 
D 2 23 GLY 23 23 23 GLY GLY C . n 
D 2 24 ASP 24 24 24 ASP ASP C . n 
D 2 25 LYS 25 25 25 LYS LYS C . n 
D 2 26 HIS 26 26 26 HIS HIS C . n 
D 2 27 LYS 27 27 27 LYS LYS C . n 
D 2 28 LEU 28 28 28 LEU LEU C . n 
D 2 29 LYS 29 29 29 LYS LYS C . n 
D 2 30 LYS 30 30 30 LYS LYS C . n 
D 2 31 SER 31 31 31 SER SER C . n 
D 2 32 GLU 32 32 32 GLU GLU C . n 
D 2 33 LEU 33 33 33 LEU LEU C . n 
D 2 34 LYS 34 34 34 LYS LYS C . n 
D 2 35 GLU 35 35 35 GLU GLU C . n 
D 2 36 LEU 36 36 36 LEU LEU C . n 
D 2 37 ILE 37 37 37 ILE ILE C . n 
D 2 38 ASN 38 38 38 ASN ASN C . n 
D 2 39 ASN 39 39 39 ASN ASN C . n 
D 2 40 GLU 40 40 40 GLU GLU C . n 
D 2 41 LEU 41 41 41 LEU LEU C . n 
D 2 42 SER 42 42 42 SER SER C . n 
D 2 43 HIS 43 43 43 HIS HIS C . n 
D 2 44 PHE 44 44 44 PHE PHE C . n 
D 2 45 LEU 45 45 45 LEU LEU C . n 
D 2 46 GLU 46 46 46 GLU GLU C . n 
D 2 47 GLU 47 47 47 GLU GLU C . n 
D 2 48 ILE 48 48 48 ILE ILE C . n 
D 2 49 LYS 49 49 49 LYS LYS C . n 
D 2 50 GLU 50 50 50 GLU GLU C . n 
D 2 51 GLN 51 51 51 GLN GLN C . n 
D 2 52 GLU 52 52 52 GLU GLU C . n 
D 2 53 VAL 53 53 53 VAL VAL C . n 
D 2 54 VAL 54 54 54 VAL VAL C . n 
D 2 55 ASP 55 55 55 ASP ASP C . n 
D 2 56 LYS 56 56 56 LYS LYS C . n 
D 2 57 VAL 57 57 57 VAL VAL C . n 
D 2 58 MET 58 58 58 MET MET C . n 
D 2 59 GLU 59 59 59 GLU GLU C . n 
D 2 60 THR 60 60 60 THR THR C . n 
D 2 61 LEU 61 61 61 LEU LEU C . n 
D 2 62 ASP 62 62 62 ASP ASP C . n 
D 2 63 ASN 63 63 63 ASN ASN C . n 
D 2 64 ASP 64 64 64 ASP ASP C . n 
D 2 65 GLY 65 65 65 GLY GLY C . n 
D 2 66 ASP 66 66 66 ASP ASP C . n 
D 2 67 GLY 67 67 67 GLY GLY C . n 
D 2 68 GLU 68 68 68 GLU GLU C . n 
D 2 69 CYS 69 69 69 CYS CYS C . n 
D 2 70 ASP 70 70 70 ASP ASP C . n 
D 2 71 PHE 71 71 71 PHE PHE C . n 
D 2 72 GLN 72 72 72 GLN GLN C . n 
D 2 73 GLU 73 73 73 GLU GLU C . n 
D 2 74 PHE 74 74 74 PHE PHE C . n 
D 2 75 MET 75 75 75 MET MET C . n 
D 2 76 ALA 76 76 76 ALA ALA C . n 
D 2 77 PHE 77 77 77 PHE PHE C . n 
D 2 78 VAL 78 78 78 VAL VAL C . n 
D 2 79 ALA 79 79 79 ALA ALA C . n 
D 2 80 MET 80 80 80 MET MET C . n 
D 2 81 VAL 81 81 81 VAL VAL C . n 
D 2 82 THR 82 82 82 THR THR C . n 
D 2 83 THR 83 83 83 THR THR C . n 
D 2 84 ALA 84 84 84 ALA ALA C . n 
D 2 85 CYS 85 85 85 CYS CYS C . n 
D 2 86 HIS 86 86 86 HIS HIS C . n 
D 2 87 GLU 87 87 87 GLU GLU C . n 
D 2 88 PHE 88 88 88 PHE PHE C . n 
D 2 89 PHE 89 89 89 PHE PHE C . n 
D 2 90 GLU 90 90 90 GLU GLU C . n 
D 2 91 HIS 91 91 91 HIS HIS C . n 
D 2 92 GLU 92 92 ?  ?   ?   C . n 
E 2 1  MET 1  1  1  MET MET D . n 
E 2 2  SER 2  2  2  SER SER D . n 
E 2 3  GLU 3  3  3  GLU GLU D . n 
E 2 4  LEU 4  4  4  LEU LEU D . n 
E 2 5  GLU 5  5  5  GLU GLU D . n 
E 2 6  LYS 6  6  6  LYS LYS D . n 
E 2 7  ALA 7  7  7  ALA ALA D . n 
E 2 8  MET 8  8  8  MET MET D . n 
E 2 9  VAL 9  9  9  VAL VAL D . n 
E 2 10 ALA 10 10 10 ALA ALA D . n 
E 2 11 LEU 11 11 11 LEU LEU D . n 
E 2 12 ILE 12 12 12 ILE ILE D . n 
E 2 13 ASP 13 13 13 ASP ASP D . n 
E 2 14 VAL 14 14 14 VAL VAL D . n 
E 2 15 PHE 15 15 15 PHE PHE D . n 
E 2 16 HIS 16 16 16 HIS HIS D . n 
E 2 17 GLN 17 17 17 GLN GLN D . n 
E 2 18 TYR 18 18 18 TYR TYR D . n 
E 2 19 SER 19 19 19 SER SER D . n 
E 2 20 GLY 20 20 20 GLY GLY D . n 
E 2 21 ARG 21 21 21 ARG ARG D . n 
E 2 22 GLU 22 22 22 GLU GLU D . n 
E 2 23 GLY 23 23 23 GLY GLY D . n 
E 2 24 ASP 24 24 24 ASP ASP D . n 
E 2 25 LYS 25 25 25 LYS LYS D . n 
E 2 26 HIS 26 26 26 HIS HIS D . n 
E 2 27 LYS 27 27 27 LYS LYS D . n 
E 2 28 LEU 28 28 28 LEU LEU D . n 
E 2 29 LYS 29 29 29 LYS LYS D . n 
E 2 30 LYS 30 30 30 LYS LYS D . n 
E 2 31 SER 31 31 31 SER SER D . n 
E 2 32 GLU 32 32 32 GLU GLU D . n 
E 2 33 LEU 33 33 33 LEU LEU D . n 
E 2 34 LYS 34 34 34 LYS LYS D . n 
E 2 35 GLU 35 35 35 GLU GLU D . n 
E 2 36 LEU 36 36 36 LEU LEU D . n 
E 2 37 ILE 37 37 37 ILE ILE D . n 
E 2 38 ASN 38 38 38 ASN ASN D . n 
E 2 39 ASN 39 39 39 ASN ASN D . n 
E 2 40 GLU 40 40 40 GLU GLU D . n 
E 2 41 LEU 41 41 41 LEU LEU D . n 
E 2 42 SER 42 42 42 SER SER D . n 
E 2 43 HIS 43 43 43 HIS HIS D . n 
E 2 44 PHE 44 44 44 PHE PHE D . n 
E 2 45 LEU 45 45 45 LEU LEU D . n 
E 2 46 GLU 46 46 46 GLU GLU D . n 
E 2 47 GLU 47 47 47 GLU GLU D . n 
E 2 48 ILE 48 48 48 ILE ILE D . n 
E 2 49 LYS 49 49 49 LYS LYS D . n 
E 2 50 GLU 50 50 50 GLU GLU D . n 
E 2 51 GLN 51 51 51 GLN GLN D . n 
E 2 52 GLU 52 52 52 GLU GLU D . n 
E 2 53 VAL 53 53 53 VAL VAL D . n 
E 2 54 VAL 54 54 54 VAL VAL D . n 
E 2 55 ASP 55 55 55 ASP ASP D . n 
E 2 56 LYS 56 56 56 LYS LYS D . n 
E 2 57 VAL 57 57 57 VAL VAL D . n 
E 2 58 MET 58 58 58 MET MET D . n 
E 2 59 GLU 59 59 59 GLU GLU D . n 
E 2 60 THR 60 60 60 THR THR D . n 
E 2 61 LEU 61 61 61 LEU LEU D . n 
E 2 62 ASP 62 62 62 ASP ASP D . n 
E 2 63 ASN 63 63 63 ASN ASN D . n 
E 2 64 ASP 64 64 64 ASP ASP D . n 
E 2 65 GLY 65 65 65 GLY GLY D . n 
E 2 66 ASP 66 66 66 ASP ASP D . n 
E 2 67 GLY 67 67 67 GLY GLY D . n 
E 2 68 GLU 68 68 68 GLU GLU D . n 
E 2 69 CYS 69 69 69 CYS CYS D . n 
E 2 70 ASP 70 70 70 ASP ASP D . n 
E 2 71 PHE 71 71 71 PHE PHE D . n 
E 2 72 GLN 72 72 72 GLN GLN D . n 
E 2 73 GLU 73 73 73 GLU GLU D . n 
E 2 74 PHE 74 74 74 PHE PHE D . n 
E 2 75 MET 75 75 75 MET MET D . n 
E 2 76 ALA 76 76 76 ALA ALA D . n 
E 2 77 PHE 77 77 77 PHE PHE D . n 
E 2 78 VAL 78 78 78 VAL VAL D . n 
E 2 79 ALA 79 79 79 ALA ALA D . n 
E 2 80 MET 80 80 80 MET MET D . n 
E 2 81 VAL 81 81 81 VAL VAL D . n 
E 2 82 THR 82 82 82 THR THR D . n 
E 2 83 THR 83 83 83 THR THR D . n 
E 2 84 ALA 84 84 84 ALA ALA D . n 
E 2 85 CYS 85 85 85 CYS CYS D . n 
E 2 86 HIS 86 86 86 HIS HIS D . n 
E 2 87 GLU 87 87 87 GLU GLU D . n 
E 2 88 PHE 88 88 88 PHE PHE D . n 
E 2 89 PHE 89 89 ?  ?   ?   D . n 
E 2 90 GLU 90 90 ?  ?   ?   D . n 
E 2 91 HIS 91 91 ?  ?   ?   D . n 
E 2 92 GLU 92 92 ?  ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
F 3 CA  1  501 501 CA  CA  A . 
G 3 CA  1  502 502 CA  CA  A . 
H 3 CA  1  501 501 CA  CA  B . 
I 3 CA  1  502 502 CA  CA  B . 
J 3 CA  1  501 501 CA  CA  C . 
K 3 CA  1  502 502 CA  CA  C . 
L 3 CA  1  501 501 CA  CA  D . 
M 3 CA  1  502 502 CA  CA  D . 
N 4 HOH 1  101 35  HOH HOH P . 
O 4 HOH 1  601 34  HOH HOH A . 
O 4 HOH 2  602 11  HOH HOH A . 
O 4 HOH 3  603 18  HOH HOH A . 
O 4 HOH 4  604 23  HOH HOH A . 
O 4 HOH 5  605 1   HOH HOH A . 
O 4 HOH 6  606 2   HOH HOH A . 
O 4 HOH 7  607 9   HOH HOH A . 
O 4 HOH 8  608 10  HOH HOH A . 
O 4 HOH 9  609 12  HOH HOH A . 
O 4 HOH 10 610 17  HOH HOH A . 
O 4 HOH 11 611 26  HOH HOH A . 
O 4 HOH 12 612 31  HOH HOH A . 
O 4 HOH 13 613 32  HOH HOH A . 
O 4 HOH 14 614 33  HOH HOH A . 
P 4 HOH 1  601 28  HOH HOH B . 
P 4 HOH 2  602 29  HOH HOH B . 
P 4 HOH 3  603 4   HOH HOH B . 
P 4 HOH 4  604 3   HOH HOH B . 
P 4 HOH 5  605 14  HOH HOH B . 
P 4 HOH 6  606 15  HOH HOH B . 
P 4 HOH 7  607 19  HOH HOH B . 
P 4 HOH 8  608 20  HOH HOH B . 
P 4 HOH 9  609 21  HOH HOH B . 
P 4 HOH 10 610 25  HOH HOH B . 
Q 4 HOH 1  601 5   HOH HOH C . 
Q 4 HOH 2  602 6   HOH HOH C . 
Q 4 HOH 3  603 13  HOH HOH C . 
R 4 HOH 1  601 16  HOH HOH D . 
R 4 HOH 2  602 7   HOH HOH D . 
R 4 HOH 3  603 8   HOH HOH D . 
R 4 HOH 4  604 22  HOH HOH D . 
R 4 HOH 5  605 24  HOH HOH D . 
R 4 HOH 6  606 27  HOH HOH D . 
R 4 HOH 7  607 30  HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA dimeric  2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,F,G,H,I,N,O,P 
2 1 D,E,J,K,L,M,Q,R     
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4260  ? 
1 MORE         -92   ? 
1 'SSA (A^2)'  10000 ? 
2 'ABSA (A^2)' 3060  ? 
2 MORE         -70   ? 
2 'SSA (A^2)'  9550  ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   O   ? B SER 19 ? A SER 19 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? B GLU 22 ? A GLU 22  ? 1_555 100.7 ? 
2   O   ? B SER 19 ? A SER 19 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? B ASP 24 ? A ASP 24  ? 1_555 73.2  ? 
3   O   ? B GLU 22 ? A GLU 22 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? B ASP 24 ? A ASP 24  ? 1_555 75.9  ? 
4   O   ? B SER 19 ? A SER 19 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? B LYS 27 ? A LYS 27  ? 1_555 75.7  ? 
5   O   ? B GLU 22 ? A GLU 22 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? B LYS 27 ? A LYS 27  ? 1_555 157.1 ? 
6   O   ? B ASP 24 ? A ASP 24 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? B LYS 27 ? A LYS 27  ? 1_555 81.5  ? 
7   O   ? B SER 19 ? A SER 19 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 OE1 ? B GLU 32 ? A GLU 32  ? 1_555 120.7 ? 
8   O   ? B GLU 22 ? A GLU 22 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 OE1 ? B GLU 32 ? A GLU 32  ? 1_555 114.0 ? 
9   O   ? B ASP 24 ? A ASP 24 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 OE1 ? B GLU 32 ? A GLU 32  ? 1_555 158.6 ? 
10  O   ? B LYS 27 ? A LYS 27 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 OE1 ? B GLU 32 ? A GLU 32  ? 1_555 86.3  ? 
11  O   ? B SER 19 ? A SER 19 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 OE2 ? B GLU 32 ? A GLU 32  ? 1_555 94.3  ? 
12  O   ? B GLU 22 ? A GLU 22 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 OE2 ? B GLU 32 ? A GLU 32  ? 1_555 75.0  ? 
13  O   ? B ASP 24 ? A ASP 24 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 OE2 ? B GLU 32 ? A GLU 32  ? 1_555 145.4 ? 
14  O   ? B LYS 27 ? A LYS 27 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 OE2 ? B GLU 32 ? A GLU 32  ? 1_555 127.4 ? 
15  OE1 ? B GLU 32 ? A GLU 32 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 OE2 ? B GLU 32 ? A GLU 32  ? 1_555 54.5  ? 
16  O   ? B SER 19 ? A SER 19 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? O HOH .  ? A HOH 606 ? 1_555 140.2 ? 
17  O   ? B GLU 22 ? A GLU 22 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? O HOH .  ? A HOH 606 ? 1_555 85.2  ? 
18  O   ? B ASP 24 ? A ASP 24 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? O HOH .  ? A HOH 606 ? 1_555 70.2  ? 
19  O   ? B LYS 27 ? A LYS 27 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? O HOH .  ? A HOH 606 ? 1_555 83.9  ? 
20  OE1 ? B GLU 32 ? A GLU 32 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? O HOH .  ? A HOH 606 ? 1_555 91.1  ? 
21  OE2 ? B GLU 32 ? A GLU 32 ? 1_555 CA ? G CA . ? A CA 502 ? 1_555 O   ? O HOH .  ? A HOH 606 ? 1_555 124.9 ? 
22  OD1 ? B ASP 62 ? A ASP 62 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OD1 ? B ASP 64 ? A ASP 64  ? 1_555 83.2  ? 
23  OD1 ? B ASP 62 ? A ASP 62 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OD1 ? B ASP 66 ? A ASP 66  ? 1_555 75.1  ? 
24  OD1 ? B ASP 64 ? A ASP 64 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OD1 ? B ASP 66 ? A ASP 66  ? 1_555 79.7  ? 
25  OD1 ? B ASP 62 ? A ASP 62 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 O   ? B GLU 68 ? A GLU 68  ? 1_555 92.2  ? 
26  OD1 ? B ASP 64 ? A ASP 64 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 O   ? B GLU 68 ? A GLU 68  ? 1_555 155.4 ? 
27  OD1 ? B ASP 66 ? A ASP 66 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 O   ? B GLU 68 ? A GLU 68  ? 1_555 75.7  ? 
28  OD1 ? B ASP 62 ? A ASP 62 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OE1 ? B GLU 73 ? A GLU 73  ? 1_555 133.5 ? 
29  OD1 ? B ASP 64 ? A ASP 64 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OE1 ? B GLU 73 ? A GLU 73  ? 1_555 126.6 ? 
30  OD1 ? B ASP 66 ? A ASP 66 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OE1 ? B GLU 73 ? A GLU 73  ? 1_555 137.6 ? 
31  O   ? B GLU 68 ? A GLU 68 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OE1 ? B GLU 73 ? A GLU 73  ? 1_555 73.1  ? 
32  OD1 ? B ASP 62 ? A ASP 62 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OE2 ? B GLU 73 ? A GLU 73  ? 1_555 104.5 ? 
33  OD1 ? B ASP 64 ? A ASP 64 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OE2 ? B GLU 73 ? A GLU 73  ? 1_555 85.8  ? 
34  OD1 ? B ASP 66 ? A ASP 66 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OE2 ? B GLU 73 ? A GLU 73  ? 1_555 165.4 ? 
35  O   ? B GLU 68 ? A GLU 68 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OE2 ? B GLU 73 ? A GLU 73  ? 1_555 118.7 ? 
36  OE1 ? B GLU 73 ? A GLU 73 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 OE2 ? B GLU 73 ? A GLU 73  ? 1_555 52.6  ? 
37  OD1 ? B ASP 62 ? A ASP 62 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 O   ? O HOH .  ? A HOH 605 ? 1_555 145.6 ? 
38  OD1 ? B ASP 64 ? A ASP 64 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 O   ? O HOH .  ? A HOH 605 ? 1_555 88.4  ? 
39  OD1 ? B ASP 66 ? A ASP 66 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 O   ? O HOH .  ? A HOH 605 ? 1_555 70.5  ? 
40  O   ? B GLU 68 ? A GLU 68 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 O   ? O HOH .  ? A HOH 605 ? 1_555 81.8  ? 
41  OE1 ? B GLU 73 ? A GLU 73 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 O   ? O HOH .  ? A HOH 605 ? 1_555 77.1  ? 
42  OE2 ? B GLU 73 ? A GLU 73 ? 1_555 CA ? F CA . ? A CA 501 ? 1_555 O   ? O HOH .  ? A HOH 605 ? 1_555 108.1 ? 
43  O   ? C SER 19 ? B SER 19 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? C GLU 22 ? B GLU 22  ? 1_555 102.3 ? 
44  O   ? C SER 19 ? B SER 19 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? C ASP 24 ? B ASP 24  ? 1_555 83.9  ? 
45  O   ? C GLU 22 ? B GLU 22 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? C ASP 24 ? B ASP 24  ? 1_555 86.6  ? 
46  O   ? C SER 19 ? B SER 19 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? C LYS 27 ? B LYS 27  ? 1_555 89.3  ? 
47  O   ? C GLU 22 ? B GLU 22 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? C LYS 27 ? B LYS 27  ? 1_555 162.9 ? 
48  O   ? C ASP 24 ? B ASP 24 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? C LYS 27 ? B LYS 27  ? 1_555 82.2  ? 
49  O   ? C SER 19 ? B SER 19 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 OE1 ? C GLU 32 ? B GLU 32  ? 1_555 104.3 ? 
50  O   ? C GLU 22 ? B GLU 22 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 OE1 ? C GLU 32 ? B GLU 32  ? 1_555 110.7 ? 
51  O   ? C ASP 24 ? B ASP 24 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 OE1 ? C GLU 32 ? B GLU 32  ? 1_555 158.2 ? 
52  O   ? C LYS 27 ? B LYS 27 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 OE1 ? C GLU 32 ? B GLU 32  ? 1_555 77.8  ? 
53  O   ? C SER 19 ? B SER 19 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 OE2 ? C GLU 32 ? B GLU 32  ? 1_555 78.4  ? 
54  O   ? C GLU 22 ? B GLU 22 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 OE2 ? C GLU 32 ? B GLU 32  ? 1_555 75.4  ? 
55  O   ? C ASP 24 ? B ASP 24 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 OE2 ? C GLU 32 ? B GLU 32  ? 1_555 151.2 ? 
56  O   ? C LYS 27 ? B LYS 27 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 OE2 ? C GLU 32 ? B GLU 32  ? 1_555 119.7 ? 
57  OE1 ? C GLU 32 ? B GLU 32 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 OE2 ? C GLU 32 ? B GLU 32  ? 1_555 50.2  ? 
58  O   ? C SER 19 ? B SER 19 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? P HOH .  ? B HOH 603 ? 1_555 161.2 ? 
59  O   ? C GLU 22 ? B GLU 22 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? P HOH .  ? B HOH 603 ? 1_555 91.7  ? 
60  O   ? C ASP 24 ? B ASP 24 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? P HOH .  ? B HOH 603 ? 1_555 84.5  ? 
61  O   ? C LYS 27 ? B LYS 27 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? P HOH .  ? B HOH 603 ? 1_555 74.5  ? 
62  OE1 ? C GLU 32 ? B GLU 32 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? P HOH .  ? B HOH 603 ? 1_555 81.9  ? 
63  OE2 ? C GLU 32 ? B GLU 32 ? 1_555 CA ? I CA . ? B CA 502 ? 1_555 O   ? P HOH .  ? B HOH 603 ? 1_555 117.7 ? 
64  OD1 ? C ASP 62 ? B ASP 62 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OD1 ? C ASP 64 ? B ASP 64  ? 1_555 81.3  ? 
65  OD1 ? C ASP 62 ? B ASP 62 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OD1 ? C ASP 66 ? B ASP 66  ? 1_555 74.1  ? 
66  OD1 ? C ASP 64 ? B ASP 64 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OD1 ? C ASP 66 ? B ASP 66  ? 1_555 86.5  ? 
67  OD1 ? C ASP 62 ? B ASP 62 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 O   ? C GLU 68 ? B GLU 68  ? 1_555 84.7  ? 
68  OD1 ? C ASP 64 ? B ASP 64 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 O   ? C GLU 68 ? B GLU 68  ? 1_555 160.3 ? 
69  OD1 ? C ASP 66 ? B ASP 66 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 O   ? C GLU 68 ? B GLU 68  ? 1_555 76.3  ? 
70  OD1 ? C ASP 62 ? B ASP 62 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OE1 ? C GLU 73 ? B GLU 73  ? 1_555 115.8 ? 
71  OD1 ? C ASP 64 ? B ASP 64 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OE1 ? C GLU 73 ? B GLU 73  ? 1_555 120.0 ? 
72  OD1 ? C ASP 66 ? B ASP 66 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OE1 ? C GLU 73 ? B GLU 73  ? 1_555 152.1 ? 
73  O   ? C GLU 68 ? B GLU 68 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OE1 ? C GLU 73 ? B GLU 73  ? 1_555 78.6  ? 
74  OD1 ? C ASP 62 ? B ASP 62 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OE2 ? C GLU 73 ? B GLU 73  ? 1_555 86.7  ? 
75  OD1 ? C ASP 64 ? B ASP 64 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OE2 ? C GLU 73 ? B GLU 73  ? 1_555 79.2  ? 
76  OD1 ? C ASP 66 ? B ASP 66 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OE2 ? C GLU 73 ? B GLU 73  ? 1_555 157.6 ? 
77  O   ? C GLU 68 ? B GLU 68 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OE2 ? C GLU 73 ? B GLU 73  ? 1_555 113.8 ? 
78  OE1 ? C GLU 73 ? B GLU 73 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 OE2 ? C GLU 73 ? B GLU 73  ? 1_555 48.1  ? 
79  OD1 ? C ASP 62 ? B ASP 62 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 O   ? P HOH .  ? B HOH 604 ? 1_555 157.9 ? 
80  OD1 ? C ASP 64 ? B ASP 64 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 O   ? P HOH .  ? B HOH 604 ? 1_555 88.4  ? 
81  OD1 ? C ASP 66 ? B ASP 66 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 O   ? P HOH .  ? B HOH 604 ? 1_555 85.9  ? 
82  O   ? C GLU 68 ? B GLU 68 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 O   ? P HOH .  ? B HOH 604 ? 1_555 99.8  ? 
83  OE1 ? C GLU 73 ? B GLU 73 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 O   ? P HOH .  ? B HOH 604 ? 1_555 86.3  ? 
84  OE2 ? C GLU 73 ? B GLU 73 ? 1_555 CA ? H CA . ? B CA 501 ? 1_555 O   ? P HOH .  ? B HOH 604 ? 1_555 110.7 ? 
85  O   ? D SER 19 ? C SER 19 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? D GLU 22 ? C GLU 22  ? 1_555 91.4  ? 
86  O   ? D SER 19 ? C SER 19 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? D ASP 24 ? C ASP 24  ? 1_555 82.5  ? 
87  O   ? D GLU 22 ? C GLU 22 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? D ASP 24 ? C ASP 24  ? 1_555 91.8  ? 
88  O   ? D SER 19 ? C SER 19 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? D LYS 27 ? C LYS 27  ? 1_555 90.9  ? 
89  O   ? D GLU 22 ? C GLU 22 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? D LYS 27 ? C LYS 27  ? 1_555 170.5 ? 
90  O   ? D ASP 24 ? C ASP 24 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? D LYS 27 ? C LYS 27  ? 1_555 79.4  ? 
91  O   ? D SER 19 ? C SER 19 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 OE1 ? D GLU 32 ? C GLU 32  ? 1_555 102.3 ? 
92  O   ? D GLU 22 ? C GLU 22 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 OE1 ? D GLU 32 ? C GLU 32  ? 1_555 102.6 ? 
93  O   ? D ASP 24 ? C ASP 24 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 OE1 ? D GLU 32 ? C GLU 32  ? 1_555 164.6 ? 
94  O   ? D LYS 27 ? C LYS 27 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 OE1 ? D GLU 32 ? C GLU 32  ? 1_555 85.9  ? 
95  O   ? D SER 19 ? C SER 19 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 OE2 ? D GLU 32 ? C GLU 32  ? 1_555 75.2  ? 
96  O   ? D GLU 22 ? C GLU 22 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 OE2 ? D GLU 32 ? C GLU 32  ? 1_555 64.2  ? 
97  O   ? D ASP 24 ? C ASP 24 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 OE2 ? D GLU 32 ? C GLU 32  ? 1_555 146.2 ? 
98  O   ? D LYS 27 ? C LYS 27 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 OE2 ? D GLU 32 ? C GLU 32  ? 1_555 125.3 ? 
99  OE1 ? D GLU 32 ? C GLU 32 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 OE2 ? D GLU 32 ? C GLU 32  ? 1_555 48.4  ? 
100 O   ? D SER 19 ? C SER 19 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? Q HOH .  ? C HOH 601 ? 1_555 168.8 ? 
101 O   ? D GLU 22 ? C GLU 22 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? Q HOH .  ? C HOH 601 ? 1_555 78.5  ? 
102 O   ? D ASP 24 ? C ASP 24 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? Q HOH .  ? C HOH 601 ? 1_555 92.8  ? 
103 O   ? D LYS 27 ? C LYS 27 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? Q HOH .  ? C HOH 601 ? 1_555 98.2  ? 
104 OE1 ? D GLU 32 ? C GLU 32 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? Q HOH .  ? C HOH 601 ? 1_555 84.9  ? 
105 OE2 ? D GLU 32 ? C GLU 32 ? 1_555 CA ? J CA . ? C CA 501 ? 1_555 O   ? Q HOH .  ? C HOH 601 ? 1_555 104.2 ? 
106 OD1 ? D ASP 62 ? C ASP 62 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OD1 ? D ASP 64 ? C ASP 64  ? 1_555 75.2  ? 
107 OD1 ? D ASP 62 ? C ASP 62 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OD2 ? D ASP 64 ? C ASP 64  ? 1_555 108.8 ? 
108 OD1 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OD2 ? D ASP 64 ? C ASP 64  ? 1_555 46.2  ? 
109 OD1 ? D ASP 62 ? C ASP 62 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OD1 ? D ASP 66 ? C ASP 66  ? 1_555 86.8  ? 
110 OD1 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OD1 ? D ASP 66 ? C ASP 66  ? 1_555 57.8  ? 
111 OD2 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OD1 ? D ASP 66 ? C ASP 66  ? 1_555 90.7  ? 
112 OD1 ? D ASP 62 ? C ASP 62 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? D GLU 68 ? C GLU 68  ? 1_555 89.6  ? 
113 OD1 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? D GLU 68 ? C GLU 68  ? 1_555 149.8 ? 
114 OD2 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? D GLU 68 ? C GLU 68  ? 1_555 160.7 ? 
115 OD1 ? D ASP 66 ? C ASP 66 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? D GLU 68 ? C GLU 68  ? 1_555 96.0  ? 
116 OD1 ? D ASP 62 ? C ASP 62 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE1 ? D GLU 73 ? C GLU 73  ? 1_555 123.1 ? 
117 OD1 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE1 ? D GLU 73 ? C GLU 73  ? 1_555 128.6 ? 
118 OD2 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE1 ? D GLU 73 ? C GLU 73  ? 1_555 83.5  ? 
119 OD1 ? D ASP 66 ? C ASP 66 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE1 ? D GLU 73 ? C GLU 73  ? 1_555 149.8 ? 
120 O   ? D GLU 68 ? C GLU 68 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE1 ? D GLU 73 ? C GLU 73  ? 1_555 81.6  ? 
121 OD1 ? D ASP 62 ? C ASP 62 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE2 ? D GLU 73 ? C GLU 73  ? 1_555 79.6  ? 
122 OD1 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE2 ? D GLU 73 ? C GLU 73  ? 1_555 91.7  ? 
123 OD2 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE2 ? D GLU 73 ? C GLU 73  ? 1_555 68.1  ? 
124 OD1 ? D ASP 66 ? C ASP 66 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE2 ? D GLU 73 ? C GLU 73  ? 1_555 149.1 ? 
125 O   ? D GLU 68 ? C GLU 68 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE2 ? D GLU 73 ? C GLU 73  ? 1_555 111.4 ? 
126 OE1 ? D GLU 73 ? C GLU 73 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 OE2 ? D GLU 73 ? C GLU 73  ? 1_555 53.2  ? 
127 OD1 ? D ASP 62 ? C ASP 62 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? Q HOH .  ? C HOH 602 ? 1_555 128.5 ? 
128 OD1 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? Q HOH .  ? C HOH 602 ? 1_555 93.4  ? 
129 OD2 ? D ASP 64 ? C ASP 64 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? Q HOH .  ? C HOH 602 ? 1_555 96.2  ? 
130 OD1 ? D ASP 66 ? C ASP 66 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? Q HOH .  ? C HOH 602 ? 1_555 47.6  ? 
131 O   ? D GLU 68 ? C GLU 68 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? Q HOH .  ? C HOH 602 ? 1_555 75.6  ? 
132 OE1 ? D GLU 73 ? C GLU 73 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? Q HOH .  ? C HOH 602 ? 1_555 103.4 ? 
133 OE2 ? D GLU 73 ? C GLU 73 ? 1_555 CA ? K CA . ? C CA 502 ? 1_555 O   ? Q HOH .  ? C HOH 602 ? 1_555 151.7 ? 
134 O   ? E SER 19 ? D SER 19 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? E GLU 22 ? D GLU 22  ? 1_555 105.8 ? 
135 O   ? E SER 19 ? D SER 19 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? E ASP 24 ? D ASP 24  ? 1_555 82.9  ? 
136 O   ? E GLU 22 ? D GLU 22 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? E ASP 24 ? D ASP 24  ? 1_555 88.1  ? 
137 O   ? E SER 19 ? D SER 19 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? E LYS 27 ? D LYS 27  ? 1_555 90.1  ? 
138 O   ? E GLU 22 ? D GLU 22 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? E LYS 27 ? D LYS 27  ? 1_555 159.9 ? 
139 O   ? E ASP 24 ? D ASP 24 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? E LYS 27 ? D LYS 27  ? 1_555 81.5  ? 
140 O   ? E SER 19 ? D SER 19 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 OE1 ? E GLU 32 ? D GLU 32  ? 1_555 114.0 ? 
141 O   ? E GLU 22 ? D GLU 22 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 OE1 ? E GLU 32 ? D GLU 32  ? 1_555 105.4 ? 
142 O   ? E ASP 24 ? D ASP 24 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 OE1 ? E GLU 32 ? D GLU 32  ? 1_555 153.5 ? 
143 O   ? E LYS 27 ? D LYS 27 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 OE1 ? E GLU 32 ? D GLU 32  ? 1_555 78.3  ? 
144 O   ? E SER 19 ? D SER 19 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 OE2 ? E GLU 32 ? D GLU 32  ? 1_555 89.8  ? 
145 O   ? E GLU 22 ? D GLU 22 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 OE2 ? E GLU 32 ? D GLU 32  ? 1_555 65.7  ? 
146 O   ? E ASP 24 ? D ASP 24 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 OE2 ? E GLU 32 ? D GLU 32  ? 1_555 149.9 ? 
147 O   ? E LYS 27 ? D LYS 27 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 OE2 ? E GLU 32 ? D GLU 32  ? 1_555 127.9 ? 
148 OE1 ? E GLU 32 ? D GLU 32 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 OE2 ? E GLU 32 ? D GLU 32  ? 1_555 54.7  ? 
149 O   ? E SER 19 ? D SER 19 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? R HOH .  ? D HOH 602 ? 1_555 142.8 ? 
150 O   ? E GLU 22 ? D GLU 22 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? R HOH .  ? D HOH 602 ? 1_555 86.7  ? 
151 O   ? E ASP 24 ? D ASP 24 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? R HOH .  ? D HOH 602 ? 1_555 62.2  ? 
152 O   ? E LYS 27 ? D LYS 27 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? R HOH .  ? D HOH 602 ? 1_555 73.3  ? 
153 OE1 ? E GLU 32 ? D GLU 32 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? R HOH .  ? D HOH 602 ? 1_555 95.3  ? 
154 OE2 ? E GLU 32 ? D GLU 32 ? 1_555 CA ? L CA . ? D CA 501 ? 1_555 O   ? R HOH .  ? D HOH 602 ? 1_555 126.7 ? 
155 OD1 ? E ASP 62 ? D ASP 62 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OD1 ? E ASP 64 ? D ASP 64  ? 1_555 82.4  ? 
156 OD1 ? E ASP 62 ? D ASP 62 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OD1 ? E ASP 66 ? D ASP 66  ? 1_555 110.3 ? 
157 OD1 ? E ASP 64 ? D ASP 64 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OD1 ? E ASP 66 ? D ASP 66  ? 1_555 76.1  ? 
158 OD1 ? E ASP 62 ? D ASP 62 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 O   ? E GLU 68 ? D GLU 68  ? 1_555 120.6 ? 
159 OD1 ? E ASP 64 ? D ASP 64 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 O   ? E GLU 68 ? D GLU 68  ? 1_555 157.0 ? 
160 OD1 ? E ASP 66 ? D ASP 66 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 O   ? E GLU 68 ? D GLU 68  ? 1_555 92.8  ? 
161 OD1 ? E ASP 62 ? D ASP 62 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OE1 ? E GLU 73 ? D GLU 73  ? 1_555 112.7 ? 
162 OD1 ? E ASP 64 ? D ASP 64 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OE1 ? E GLU 73 ? D GLU 73  ? 1_555 109.0 ? 
163 OD1 ? E ASP 66 ? D ASP 66 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OE1 ? E GLU 73 ? D GLU 73  ? 1_555 137.0 ? 
164 O   ? E GLU 68 ? D GLU 68 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OE1 ? E GLU 73 ? D GLU 73  ? 1_555 65.7  ? 
165 OD1 ? E ASP 62 ? D ASP 62 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OE2 ? E GLU 73 ? D GLU 73  ? 1_555 78.4  ? 
166 OD1 ? E ASP 64 ? D ASP 64 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OE2 ? E GLU 73 ? D GLU 73  ? 1_555 77.9  ? 
167 OD1 ? E ASP 66 ? D ASP 66 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OE2 ? E GLU 73 ? D GLU 73  ? 1_555 151.0 ? 
168 O   ? E GLU 68 ? D GLU 68 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OE2 ? E GLU 73 ? D GLU 73  ? 1_555 106.6 ? 
169 OE1 ? E GLU 73 ? D GLU 73 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 OE2 ? E GLU 73 ? D GLU 73  ? 1_555 44.1  ? 
170 OD1 ? E ASP 62 ? D ASP 62 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 O   ? R HOH .  ? D HOH 603 ? 1_555 146.1 ? 
171 OD1 ? E ASP 64 ? D ASP 64 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 O   ? R HOH .  ? D HOH 603 ? 1_555 66.7  ? 
172 OD1 ? E ASP 66 ? D ASP 66 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 O   ? R HOH .  ? D HOH 603 ? 1_555 76.5  ? 
173 O   ? E GLU 68 ? D GLU 68 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 O   ? R HOH .  ? D HOH 603 ? 1_555 91.3  ? 
174 OE1 ? E GLU 73 ? D GLU 73 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 O   ? R HOH .  ? D HOH 603 ? 1_555 67.8  ? 
175 OE2 ? E GLU 73 ? D GLU 73 ? 1_555 CA ? M CA . ? D CA 502 ? 1_555 O   ? R HOH .  ? D HOH 603 ? 1_555 81.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-05-13 
2 'Structure model' 1 1 2015-05-20 
3 'Structure model' 1 2 2015-05-27 
4 'Structure model' 1 3 2017-11-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 4 'Structure model' Advisory                 
4 4 'Structure model' 'Derived calculations'   
5 4 'Structure model' 'Refinement description' 
6 4 'Structure model' 'Source and taxonomy'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' entity_src_gen               
2 4 'Structure model' pdbx_entity_src_syn          
3 4 'Structure model' pdbx_struct_oper_list        
4 4 'Structure model' pdbx_unobs_or_zero_occ_atoms 
5 4 'Structure model' pdbx_validate_close_contact  
6 4 'Structure model' software                     
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'      
2 4 'Structure model' '_pdbx_entity_src_syn.pdbx_alt_source_flag' 
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 4 'Structure model' '_software.classification'                  
5 4 'Structure model' '_software.name'                            
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(phenix.refine: 1.8.4_1496)' 1 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? ADSC     ? ? ? .                             2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XDS      ? ? ? .                             3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? AutoPROC ? ? ? .                             4 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless  ? ? ? .                             5 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot     ? ? ? .                             6 
? phasing           ? ? ? ? ? ? ? ? ? ? ? BALBES   ? ? ? .                             7 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 HZ3 B LYS 30 ? ? OD1 B ASP 55  ? ? 1.47 
2 1 OD1 C ASP 66 ? ? O   C HOH 602 ? ? 2.02 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU P 64 ? ? -122.55 -68.03 
2 1 PHE B 88 ? ? -53.88  -9.94  
3 1 ASP C 62 ? ? -69.65  98.80  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 P ASN 54 ? A ASN 1  
2  1 Y 1 P THR 55 ? A THR 2  
3  1 Y 1 P GLY 56 ? A GLY 3  
4  1 Y 1 P PRO 66 ? A PRO 13 
5  1 Y 1 P GLN 67 ? A GLN 14 
6  1 Y 1 P GLY 68 ? A GLY 15 
7  1 Y 1 A HIS 91 ? B HIS 91 
8  1 Y 1 A GLU 92 ? B GLU 92 
9  1 Y 1 B GLU 92 ? C GLU 92 
10 1 Y 1 C GLU 92 ? D GLU 92 
11 1 Y 1 D PHE 89 ? E PHE 89 
12 1 Y 1 D GLU 90 ? E GLU 90 
13 1 Y 1 D HIS 91 ? E HIS 91 
14 1 Y 1 D GLU 92 ? E GLU 92 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CALCIUM ION' CA  
4 water         HOH 
#