data_4XZC
# 
_entry.id   4XZC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4XZC         
WWPDB D_1000206583 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4XZ8 PDB . 
unspecified 4XZC PDB . 
unspecified 4XZE PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4XZC 
_pdbx_database_status.recvd_initial_deposition_date   2015-02-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Guo, Y.'  1 
'Wang, W.' 2 
'Liu, X.'  3 
'Wang, X.' 4 
'Wang, J.' 5 
'Huo, T.'  6 
'Liu, B.'  7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Virol. 
_citation.journal_id_ASTM           JOVIAM 
_citation.journal_id_CSD            0825 
_citation.journal_id_ISSN           1098-5514 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            89 
_citation.language                  ? 
_citation.page_first                11740 
_citation.page_last                 11749 
_citation.title                     'Structural and Functional Diversity of Nairovirus-Encoded Nucleoproteins.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1128/JVI.01680-15 
_citation.pdbx_database_id_PubMed   26246561 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, W.' 1  ? 
primary 'Liu, X.'  2  ? 
primary 'Wang, X.' 3  ? 
primary 'Dong, H.' 4  ? 
primary 'Ma, C.'   5  ? 
primary 'Wang, J.' 6  ? 
primary 'Liu, B.'  7  ? 
primary 'Mao, Y.'  8  ? 
primary 'Wang, Y.' 9  ? 
primary 'Li, T.'   10 ? 
primary 'Yang, C.' 11 ? 
primary 'Guo, Y.'  12 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4XZC 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     73.981 
_cell.length_a_esd                 ? 
_cell.length_b                     73.981 
_cell.length_b_esd                 ? 
_cell.length_c                     423.978 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4XZC 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Nucleoprotein 54188.879 2  ? ? ? ? 
2 water   nat water         18.015    92 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Nucleocapsid protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MENQIKANTKKEYDEWFKPYAEKTHLKSVLTNSASFCDALPDLSIFEVKMGLATDDREKDSIYACAMVEATKFCAPIYEC
GWACCTGMVENGLKWFDKNKDVIKLWDGKYSDLMKNVPEPEQLVAYQRAAQKWRQDNKFEINQYTRSLTHSVQADYKVPG
EYAVEVKEMLSDMVRRRNILLNGNGDDAGKKGPVSREHVNWGRELAAGKFQVVFNPPWGDINKTGRSGIPLAVTSMVKVA
ELDGHKRLEDIRKTLLDLKKWIEDNKDELEDGKGDELVKTLTKQLADAIELAKKSSALRAQGAQIDSIFSSYYWAWKAGI
TPVTFPTLSQFLFEMGQGPRGGKKMIKALTNTPLKWGKKIISLFAEDDFNGNKLYMHPGVLTAGRMSEMGACFGVVPVSN
PEDAVLGSGHSKSLLNYKIDTNAGNPCAKEIVQLFRIQKAGFDLDSMDIVASEHLLHQSLVGKRCHFQNAYKVKGNATNV
EIV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MENQIKANTKKEYDEWFKPYAEKTHLKSVLTNSASFCDALPDLSIFEVKMGLATDDREKDSIYACAMVEATKFCAPIYEC
GWACCTGMVENGLKWFDKNKDVIKLWDGKYSDLMKNVPEPEQLVAYQRAAQKWRQDNKFEINQYTRSLTHSVQADYKVPG
EYAVEVKEMLSDMVRRRNILLNGNGDDAGKKGPVSREHVNWGRELAAGKFQVVFNPPWGDINKTGRSGIPLAVTSMVKVA
ELDGHKRLEDIRKTLLDLKKWIEDNKDELEDGKGDELVKTLTKQLADAIELAKKSSALRAQGAQIDSIFSSYYWAWKAGI
TPVTFPTLSQFLFEMGQGPRGGKKMIKALTNTPLKWGKKIISLFAEDDFNGNKLYMHPGVLTAGRMSEMGACFGVVPVSN
PEDAVLGSGHSKSLLNYKIDTNAGNPCAKEIVQLFRIQKAGFDLDSMDIVASEHLLHQSLVGKRCHFQNAYKVKGNATNV
EIV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   ASN n 
1 4   GLN n 
1 5   ILE n 
1 6   LYS n 
1 7   ALA n 
1 8   ASN n 
1 9   THR n 
1 10  LYS n 
1 11  LYS n 
1 12  GLU n 
1 13  TYR n 
1 14  ASP n 
1 15  GLU n 
1 16  TRP n 
1 17  PHE n 
1 18  LYS n 
1 19  PRO n 
1 20  TYR n 
1 21  ALA n 
1 22  GLU n 
1 23  LYS n 
1 24  THR n 
1 25  HIS n 
1 26  LEU n 
1 27  LYS n 
1 28  SER n 
1 29  VAL n 
1 30  LEU n 
1 31  THR n 
1 32  ASN n 
1 33  SER n 
1 34  ALA n 
1 35  SER n 
1 36  PHE n 
1 37  CYS n 
1 38  ASP n 
1 39  ALA n 
1 40  LEU n 
1 41  PRO n 
1 42  ASP n 
1 43  LEU n 
1 44  SER n 
1 45  ILE n 
1 46  PHE n 
1 47  GLU n 
1 48  VAL n 
1 49  LYS n 
1 50  MET n 
1 51  GLY n 
1 52  LEU n 
1 53  ALA n 
1 54  THR n 
1 55  ASP n 
1 56  ASP n 
1 57  ARG n 
1 58  GLU n 
1 59  LYS n 
1 60  ASP n 
1 61  SER n 
1 62  ILE n 
1 63  TYR n 
1 64  ALA n 
1 65  CYS n 
1 66  ALA n 
1 67  MET n 
1 68  VAL n 
1 69  GLU n 
1 70  ALA n 
1 71  THR n 
1 72  LYS n 
1 73  PHE n 
1 74  CYS n 
1 75  ALA n 
1 76  PRO n 
1 77  ILE n 
1 78  TYR n 
1 79  GLU n 
1 80  CYS n 
1 81  GLY n 
1 82  TRP n 
1 83  ALA n 
1 84  CYS n 
1 85  CYS n 
1 86  THR n 
1 87  GLY n 
1 88  MET n 
1 89  VAL n 
1 90  GLU n 
1 91  ASN n 
1 92  GLY n 
1 93  LEU n 
1 94  LYS n 
1 95  TRP n 
1 96  PHE n 
1 97  ASP n 
1 98  LYS n 
1 99  ASN n 
1 100 LYS n 
1 101 ASP n 
1 102 VAL n 
1 103 ILE n 
1 104 LYS n 
1 105 LEU n 
1 106 TRP n 
1 107 ASP n 
1 108 GLY n 
1 109 LYS n 
1 110 TYR n 
1 111 SER n 
1 112 ASP n 
1 113 LEU n 
1 114 MET n 
1 115 LYS n 
1 116 ASN n 
1 117 VAL n 
1 118 PRO n 
1 119 GLU n 
1 120 PRO n 
1 121 GLU n 
1 122 GLN n 
1 123 LEU n 
1 124 VAL n 
1 125 ALA n 
1 126 TYR n 
1 127 GLN n 
1 128 ARG n 
1 129 ALA n 
1 130 ALA n 
1 131 GLN n 
1 132 LYS n 
1 133 TRP n 
1 134 ARG n 
1 135 GLN n 
1 136 ASP n 
1 137 ASN n 
1 138 LYS n 
1 139 PHE n 
1 140 GLU n 
1 141 ILE n 
1 142 ASN n 
1 143 GLN n 
1 144 TYR n 
1 145 THR n 
1 146 ARG n 
1 147 SER n 
1 148 LEU n 
1 149 THR n 
1 150 HIS n 
1 151 SER n 
1 152 VAL n 
1 153 GLN n 
1 154 ALA n 
1 155 ASP n 
1 156 TYR n 
1 157 LYS n 
1 158 VAL n 
1 159 PRO n 
1 160 GLY n 
1 161 GLU n 
1 162 TYR n 
1 163 ALA n 
1 164 VAL n 
1 165 GLU n 
1 166 VAL n 
1 167 LYS n 
1 168 GLU n 
1 169 MET n 
1 170 LEU n 
1 171 SER n 
1 172 ASP n 
1 173 MET n 
1 174 VAL n 
1 175 ARG n 
1 176 ARG n 
1 177 ARG n 
1 178 ASN n 
1 179 ILE n 
1 180 LEU n 
1 181 LEU n 
1 182 ASN n 
1 183 GLY n 
1 184 ASN n 
1 185 GLY n 
1 186 ASP n 
1 187 ASP n 
1 188 ALA n 
1 189 GLY n 
1 190 LYS n 
1 191 LYS n 
1 192 GLY n 
1 193 PRO n 
1 194 VAL n 
1 195 SER n 
1 196 ARG n 
1 197 GLU n 
1 198 HIS n 
1 199 VAL n 
1 200 ASN n 
1 201 TRP n 
1 202 GLY n 
1 203 ARG n 
1 204 GLU n 
1 205 LEU n 
1 206 ALA n 
1 207 ALA n 
1 208 GLY n 
1 209 LYS n 
1 210 PHE n 
1 211 GLN n 
1 212 VAL n 
1 213 VAL n 
1 214 PHE n 
1 215 ASN n 
1 216 PRO n 
1 217 PRO n 
1 218 TRP n 
1 219 GLY n 
1 220 ASP n 
1 221 ILE n 
1 222 ASN n 
1 223 LYS n 
1 224 THR n 
1 225 GLY n 
1 226 ARG n 
1 227 SER n 
1 228 GLY n 
1 229 ILE n 
1 230 PRO n 
1 231 LEU n 
1 232 ALA n 
1 233 VAL n 
1 234 THR n 
1 235 SER n 
1 236 MET n 
1 237 VAL n 
1 238 LYS n 
1 239 VAL n 
1 240 ALA n 
1 241 GLU n 
1 242 LEU n 
1 243 ASP n 
1 244 GLY n 
1 245 HIS n 
1 246 LYS n 
1 247 ARG n 
1 248 LEU n 
1 249 GLU n 
1 250 ASP n 
1 251 ILE n 
1 252 ARG n 
1 253 LYS n 
1 254 THR n 
1 255 LEU n 
1 256 LEU n 
1 257 ASP n 
1 258 LEU n 
1 259 LYS n 
1 260 LYS n 
1 261 TRP n 
1 262 ILE n 
1 263 GLU n 
1 264 ASP n 
1 265 ASN n 
1 266 LYS n 
1 267 ASP n 
1 268 GLU n 
1 269 LEU n 
1 270 GLU n 
1 271 ASP n 
1 272 GLY n 
1 273 LYS n 
1 274 GLY n 
1 275 ASP n 
1 276 GLU n 
1 277 LEU n 
1 278 VAL n 
1 279 LYS n 
1 280 THR n 
1 281 LEU n 
1 282 THR n 
1 283 LYS n 
1 284 GLN n 
1 285 LEU n 
1 286 ALA n 
1 287 ASP n 
1 288 ALA n 
1 289 ILE n 
1 290 GLU n 
1 291 LEU n 
1 292 ALA n 
1 293 LYS n 
1 294 LYS n 
1 295 SER n 
1 296 SER n 
1 297 ALA n 
1 298 LEU n 
1 299 ARG n 
1 300 ALA n 
1 301 GLN n 
1 302 GLY n 
1 303 ALA n 
1 304 GLN n 
1 305 ILE n 
1 306 ASP n 
1 307 SER n 
1 308 ILE n 
1 309 PHE n 
1 310 SER n 
1 311 SER n 
1 312 TYR n 
1 313 TYR n 
1 314 TRP n 
1 315 ALA n 
1 316 TRP n 
1 317 LYS n 
1 318 ALA n 
1 319 GLY n 
1 320 ILE n 
1 321 THR n 
1 322 PRO n 
1 323 VAL n 
1 324 THR n 
1 325 PHE n 
1 326 PRO n 
1 327 THR n 
1 328 LEU n 
1 329 SER n 
1 330 GLN n 
1 331 PHE n 
1 332 LEU n 
1 333 PHE n 
1 334 GLU n 
1 335 MET n 
1 336 GLY n 
1 337 GLN n 
1 338 GLY n 
1 339 PRO n 
1 340 ARG n 
1 341 GLY n 
1 342 GLY n 
1 343 LYS n 
1 344 LYS n 
1 345 MET n 
1 346 ILE n 
1 347 LYS n 
1 348 ALA n 
1 349 LEU n 
1 350 THR n 
1 351 ASN n 
1 352 THR n 
1 353 PRO n 
1 354 LEU n 
1 355 LYS n 
1 356 TRP n 
1 357 GLY n 
1 358 LYS n 
1 359 LYS n 
1 360 ILE n 
1 361 ILE n 
1 362 SER n 
1 363 LEU n 
1 364 PHE n 
1 365 ALA n 
1 366 GLU n 
1 367 ASP n 
1 368 ASP n 
1 369 PHE n 
1 370 ASN n 
1 371 GLY n 
1 372 ASN n 
1 373 LYS n 
1 374 LEU n 
1 375 TYR n 
1 376 MET n 
1 377 HIS n 
1 378 PRO n 
1 379 GLY n 
1 380 VAL n 
1 381 LEU n 
1 382 THR n 
1 383 ALA n 
1 384 GLY n 
1 385 ARG n 
1 386 MET n 
1 387 SER n 
1 388 GLU n 
1 389 MET n 
1 390 GLY n 
1 391 ALA n 
1 392 CYS n 
1 393 PHE n 
1 394 GLY n 
1 395 VAL n 
1 396 VAL n 
1 397 PRO n 
1 398 VAL n 
1 399 SER n 
1 400 ASN n 
1 401 PRO n 
1 402 GLU n 
1 403 ASP n 
1 404 ALA n 
1 405 VAL n 
1 406 LEU n 
1 407 GLY n 
1 408 SER n 
1 409 GLY n 
1 410 HIS n 
1 411 SER n 
1 412 LYS n 
1 413 SER n 
1 414 LEU n 
1 415 LEU n 
1 416 ASN n 
1 417 TYR n 
1 418 LYS n 
1 419 ILE n 
1 420 ASP n 
1 421 THR n 
1 422 ASN n 
1 423 ALA n 
1 424 GLY n 
1 425 ASN n 
1 426 PRO n 
1 427 CYS n 
1 428 ALA n 
1 429 LYS n 
1 430 GLU n 
1 431 ILE n 
1 432 VAL n 
1 433 GLN n 
1 434 LEU n 
1 435 PHE n 
1 436 ARG n 
1 437 ILE n 
1 438 GLN n 
1 439 LYS n 
1 440 ALA n 
1 441 GLY n 
1 442 PHE n 
1 443 ASP n 
1 444 LEU n 
1 445 ASP n 
1 446 SER n 
1 447 MET n 
1 448 ASP n 
1 449 ILE n 
1 450 VAL n 
1 451 ALA n 
1 452 SER n 
1 453 GLU n 
1 454 HIS n 
1 455 LEU n 
1 456 LEU n 
1 457 HIS n 
1 458 GLN n 
1 459 SER n 
1 460 LEU n 
1 461 VAL n 
1 462 GLY n 
1 463 LYS n 
1 464 ARG n 
1 465 CYS n 
1 466 HIS n 
1 467 PHE n 
1 468 GLN n 
1 469 ASN n 
1 470 ALA n 
1 471 TYR n 
1 472 LYS n 
1 473 VAL n 
1 474 LYS n 
1 475 GLY n 
1 476 ASN n 
1 477 ALA n 
1 478 THR n 
1 479 ASN n 
1 480 VAL n 
1 481 GLU n 
1 482 ILE n 
1 483 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   483 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Kupe virus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     498356 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    B8PWH3_DUGBV 
_struct_ref.pdbx_db_accession          B8PWH3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MENQIKANTKKEYDEWFKPYAEKTHLKSVLTNSASFCDALPDLSIFEVKMGLATDDREKDSIYACAMVEATKFCAPIYEC
GWACCTGMVENGLKWFDKNKDVIKLWDGKYSDLMKNVPEPEQLVAYQRAAQKWRQDNKFEINQYTRSLTHSVQADYKVPG
EYAVEVKEMLSDMVRRRNILLNGNGDDAGKKGPVSREHVNWGRELAAGKFQVVFNPPWGDINKTGRSGIPLAVTSMVKVA
ELDGHKRLEDIRKTLLDLKKWIEDNKDELEDGKGDELVKTLTKQLADAIELAKKSSALRAQGAQIDSIFSSYYWAWKAGI
TPVTFPTLSQFLFEMGQGPRGGKKMIKALTNTPLKWGKKIISLFAEDDFNGNKLYMHPGVLTAGRMSEMGACFGVVPVSN
PEDAVLGSGHSKSLLNYKIDTNAGNPCAKEIVQLFRIQKAGFDLDSMDIVASEHLLHQSLVGKRCHFQNAYKVKGNATNV
EIV
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4XZC A 1 ? 483 ? B8PWH3 1 ? 483 ? 1 483 
2 1 4XZC B 1 ? 483 ? B8PWH3 1 ? 483 ? 1 483 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4XZC 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.68 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.04 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '200mM sodium nitrate (PH 8.0), 5mM cobalt chloride, 8% (wt/vol) PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 270' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-05-25 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.00 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-17A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.00 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL-17A 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4XZC 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.6 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       37285 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.3 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.92 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.Rmerge_I_obs                0.422 
_reflns_shell.d_res_high                  2.60 
_reflns_shell.d_res_low                   2.64 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_sigI_obs         4.296 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_measured_obs         19 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rsym_value             0.420 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_redundancy             10.0 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.percent_possible_all        93.9 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.percent_possible_obs        ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4XZC 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.601 
_refine.ls_d_res_low                             49.059 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     37162 
_refine.ls_number_reflns_R_free                  1999 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.48 
_refine.ls_percent_reflns_R_free                 5.38 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2153 
_refine.ls_R_factor_R_free                       0.2804 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2116 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3U3I 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.25 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.40 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7340 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             92 
_refine_hist.number_atoms_total               7432 
_refine_hist.d_res_high                       2.601 
_refine_hist.d_res_low                        49.059 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 7495  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.150  ? 10118 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 15.660 ? 2776  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 1097  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 1299  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.6007 2.6658  . . 133 2336 94.00  . . . 0.3645 . 0.2759 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6658 2.7379  . . 136 2382 96.00  . . . 0.3230 . 0.2543 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7379 2.8184  . . 136 2400 97.00  . . . 0.2917 . 0.2450 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8184 2.9094  . . 138 2434 97.00  . . . 0.3209 . 0.2508 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9094 3.0133  . . 139 2447 98.00  . . . 0.3393 . 0.2595 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0133 3.1340  . . 141 2471 99.00  . . . 0.3330 . 0.2615 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1340 3.2766  . . 141 2485 99.00  . . . 0.3571 . 0.2593 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2766 3.4493  . . 143 2514 100.00 . . . 0.3384 . 0.2387 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4493 3.6653  . . 145 2535 100.00 . . . 0.2960 . 0.2310 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6653 3.9482  . . 144 2545 100.00 . . . 0.3038 . 0.2049 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9482 4.3453  . . 147 2589 100.00 . . . 0.2397 . 0.1949 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3453 4.9736  . . 147 2581 100.00 . . . 0.2365 . 0.1753 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9736 6.2641  . . 150 2626 100.00 . . . 0.2553 . 0.1895 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.2641 49.0681 . . 159 2818 99.00  . . . 0.2273 . 0.1730 . . . . . . . . . . 
# 
_struct.entry_id                     4XZC 
_struct.title                        'The crystal structure of Kupe virus nucleoprotein' 
_struct.pdbx_descriptor              nucleoprotein 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4XZC 
_struct_keywords.text            'nucleoprotein, Kupe virus, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 9   ? HIS A 25  ? THR A 9   HIS A 25  1 ? 17 
HELX_P HELX_P2  AA2 LEU A 43  ? LEU A 52  ? LEU A 43  LEU A 52  1 ? 10 
HELX_P HELX_P3  AA3 ASP A 55  ? LYS A 72  ? ASP A 55  LYS A 72  1 ? 18 
HELX_P HELX_P4  AA4 PRO A 76  ? CYS A 85  ? PRO A 76  CYS A 85  1 ? 10 
HELX_P HELX_P5  AA5 CYS A 85  ? ASN A 99  ? CYS A 85  ASN A 99  1 ? 15 
HELX_P HELX_P6  AA6 ILE A 103 ? GLY A 108 ? ILE A 103 GLY A 108 1 ? 6  
HELX_P HELX_P7  AA7 LYS A 109 ? MET A 114 ? LYS A 109 MET A 114 1 ? 6  
HELX_P HELX_P8  AA8 GLU A 119 ? ASN A 137 ? GLU A 119 ASN A 137 1 ? 19 
HELX_P HELX_P9  AA9 ASN A 142 ? ARG A 146 ? ASN A 142 ARG A 146 5 ? 5  
HELX_P HELX_P10 AB1 PRO A 159 ? ASN A 182 ? PRO A 159 ASN A 182 1 ? 24 
HELX_P HELX_P11 AB2 VAL A 199 ? ALA A 207 ? VAL A 199 ALA A 207 1 ? 9  
HELX_P HELX_P12 AB3 LYS A 209 ? ASN A 215 ? LYS A 209 ASN A 215 5 ? 7  
HELX_P HELX_P13 AB4 GLY A 225 ? ILE A 229 ? GLY A 225 ILE A 229 5 ? 5  
HELX_P HELX_P14 AB5 PRO A 230 ? GLY A 244 ? PRO A 230 GLY A 244 1 ? 15 
HELX_P HELX_P15 AB6 LYS A 246 ? ASN A 265 ? LYS A 246 ASN A 265 1 ? 20 
HELX_P HELX_P16 AB7 LYS A 266 ? LEU A 269 ? LYS A 266 LEU A 269 5 ? 4  
HELX_P HELX_P17 AB8 GLY A 274 ? GLY A 302 ? GLY A 274 GLY A 302 1 ? 29 
HELX_P HELX_P18 AB9 ASP A 306 ? GLY A 319 ? ASP A 306 GLY A 319 1 ? 14 
HELX_P HELX_P19 AC1 THR A 324 ? GLY A 336 ? THR A 324 GLY A 336 1 ? 13 
HELX_P HELX_P20 AC2 GLY A 341 ? THR A 352 ? GLY A 341 THR A 352 1 ? 12 
HELX_P HELX_P21 AC3 LYS A 355 ? SER A 362 ? LYS A 355 SER A 362 1 ? 8  
HELX_P HELX_P22 AC4 ASN A 372 ? MET A 376 ? ASN A 372 MET A 376 5 ? 5  
HELX_P HELX_P23 AC5 ARG A 385 ? GLY A 394 ? ARG A 385 GLY A 394 1 ? 10 
HELX_P HELX_P24 AC6 ASN A 400 ? GLY A 407 ? ASN A 400 GLY A 407 5 ? 8  
HELX_P HELX_P25 AC7 HIS A 410 ? TYR A 417 ? HIS A 410 TYR A 417 5 ? 8  
HELX_P HELX_P26 AC8 ASN A 425 ? PHE A 442 ? ASN A 425 PHE A 442 1 ? 18 
HELX_P HELX_P27 AC9 ASP A 443 ? MET A 447 ? ASP A 443 MET A 447 5 ? 5  
HELX_P HELX_P28 AD1 VAL A 450 ? VAL A 461 ? VAL A 450 VAL A 461 1 ? 12 
HELX_P HELX_P29 AD2 THR B 9   ? LYS B 23  ? THR B 9   LYS B 23  1 ? 15 
HELX_P HELX_P30 AD3 LEU B 43  ? ALA B 53  ? LEU B 43  ALA B 53  1 ? 11 
HELX_P HELX_P31 AD4 ASP B 55  ? LYS B 72  ? ASP B 55  LYS B 72  1 ? 18 
HELX_P HELX_P32 AD5 PRO B 76  ? ALA B 83  ? PRO B 76  ALA B 83  1 ? 8  
HELX_P HELX_P33 AD6 CYS B 85  ? TRP B 95  ? CYS B 85  TRP B 95  1 ? 11 
HELX_P HELX_P34 AD7 PHE B 96  ? LYS B 98  ? PHE B 96  LYS B 98  5 ? 3  
HELX_P HELX_P35 AD8 ASN B 99  ? GLY B 108 ? ASN B 99  GLY B 108 1 ? 10 
HELX_P HELX_P36 AD9 LYS B 109 ? MET B 114 ? LYS B 109 MET B 114 1 ? 6  
HELX_P HELX_P37 AE1 GLU B 119 ? ASN B 137 ? GLU B 119 ASN B 137 1 ? 19 
HELX_P HELX_P38 AE2 ASN B 142 ? ARG B 146 ? ASN B 142 ARG B 146 5 ? 5  
HELX_P HELX_P39 AE3 PRO B 159 ? ASN B 178 ? PRO B 159 ASN B 178 1 ? 20 
HELX_P HELX_P40 AE4 ARG B 196 ? ALA B 207 ? ARG B 196 ALA B 207 1 ? 12 
HELX_P HELX_P41 AE5 GLY B 208 ? PHE B 214 ? GLY B 208 PHE B 214 5 ? 7  
HELX_P HELX_P42 AE6 PRO B 230 ? GLY B 244 ? PRO B 230 GLY B 244 1 ? 15 
HELX_P HELX_P43 AE7 LYS B 246 ? ASN B 265 ? LYS B 246 ASN B 265 1 ? 20 
HELX_P HELX_P44 AE8 LYS B 266 ? LEU B 269 ? LYS B 266 LEU B 269 5 ? 4  
HELX_P HELX_P45 AE9 GLY B 274 ? ALA B 292 ? GLY B 274 ALA B 292 1 ? 19 
HELX_P HELX_P46 AF1 SER B 295 ? ALA B 303 ? SER B 295 ALA B 303 1 ? 9  
HELX_P HELX_P47 AF2 ASP B 306 ? GLY B 319 ? ASP B 306 GLY B 319 1 ? 14 
HELX_P HELX_P48 AF3 THR B 324 ? GLY B 336 ? THR B 324 GLY B 336 1 ? 13 
HELX_P HELX_P49 AF4 GLY B 342 ? THR B 352 ? GLY B 342 THR B 352 1 ? 11 
HELX_P HELX_P50 AF5 LYS B 355 ? LEU B 363 ? LYS B 355 LEU B 363 1 ? 9  
HELX_P HELX_P51 AF6 ARG B 385 ? GLY B 394 ? ARG B 385 GLY B 394 1 ? 10 
HELX_P HELX_P52 AF7 ASN B 400 ? GLY B 407 ? ASN B 400 GLY B 407 5 ? 8  
HELX_P HELX_P53 AF8 HIS B 410 ? TYR B 417 ? HIS B 410 TYR B 417 5 ? 8  
HELX_P HELX_P54 AF9 ASP B 420 ? GLY B 424 ? ASP B 420 GLY B 424 5 ? 5  
HELX_P HELX_P55 AG1 ASN B 425 ? PHE B 442 ? ASN B 425 PHE B 442 1 ? 18 
HELX_P HELX_P56 AG2 VAL B 450 ? GLY B 462 ? VAL B 450 GLY B 462 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA1 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASP A 155 ? LYS A 157 ? ASP A 155 LYS A 157 
AA1 2 GLU A 481 ? VAL A 483 ? GLU A 481 VAL A 483 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA1 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   TYR 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    156 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    TYR 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     156 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   GLU 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    481 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    GLU 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     481 
# 
_atom_sites.entry_id                    4XZC 
_atom_sites.fract_transf_matrix[1][1]   0.013517 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013517 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.002359 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 1   ? 19.115  18.709  44.645  1.00 48.66  ? 1   MET A N   1 
ATOM   2    C CA  . MET A 1 1   ? 18.790  20.031  44.105  1.00 51.34  ? 1   MET A CA  1 
ATOM   3    C C   . MET A 1 1   ? 17.711  20.705  44.952  1.00 51.24  ? 1   MET A C   1 
ATOM   4    O O   . MET A 1 1   ? 17.406  20.243  46.044  1.00 50.73  ? 1   MET A O   1 
ATOM   5    C CB  . MET A 1 1   ? 18.347  19.923  42.641  1.00 51.06  ? 1   MET A CB  1 
ATOM   6    C CG  . MET A 1 1   ? 19.500  19.928  41.636  1.00 63.76  ? 1   MET A CG  1 
ATOM   7    S SD  . MET A 1 1   ? 20.399  21.500  41.666  1.00 80.92  ? 1   MET A SD  1 
ATOM   8    C CE  . MET A 1 1   ? 19.024  22.634  41.451  1.00 60.80  ? 1   MET A CE  1 
ATOM   9    N N   . GLU A 1 2   ? 17.142  21.799  44.455  1.00 55.31  ? 2   GLU A N   1 
ATOM   10   C CA  . GLU A 1 2   ? 16.187  22.587  45.234  1.00 48.92  ? 2   GLU A CA  1 
ATOM   11   C C   . GLU A 1 2   ? 14.798  22.625  44.607  1.00 45.14  ? 2   GLU A C   1 
ATOM   12   O O   . GLU A 1 2   ? 14.646  22.408  43.404  1.00 44.63  ? 2   GLU A O   1 
ATOM   13   C CB  . GLU A 1 2   ? 16.688  24.013  45.399  1.00 42.65  ? 2   GLU A CB  1 
ATOM   14   C CG  . GLU A 1 2   ? 16.627  24.795  44.106  1.00 56.46  ? 2   GLU A CG  1 
ATOM   15   C CD  . GLU A 1 2   ? 16.696  26.299  44.318  1.00 66.23  ? 2   GLU A CD  1 
ATOM   16   O OE1 . GLU A 1 2   ? 17.089  26.728  45.426  1.00 68.38  ? 2   GLU A OE1 1 
ATOM   17   O OE2 . GLU A 1 2   ? 16.350  27.050  43.377  1.00 66.89  ? 2   GLU A OE2 1 
ATOM   18   N N   . ASN A 1 3   ? 13.793  22.903  45.439  1.00 40.47  ? 3   ASN A N   1 
ATOM   19   C CA  . ASN A 1 3   ? 12.393  23.048  45.018  1.00 37.01  ? 3   ASN A CA  1 
ATOM   20   C C   . ASN A 1 3   ? 12.184  24.173  43.978  1.00 36.80  ? 3   ASN A C   1 
ATOM   21   O O   . ASN A 1 3   ? 12.266  25.366  44.305  1.00 33.90  ? 3   ASN A O   1 
ATOM   22   C CB  . ASN A 1 3   ? 11.537  23.301  46.269  1.00 39.16  ? 3   ASN A CB  1 
ATOM   23   C CG  . ASN A 1 3   ? 10.051  23.105  46.033  1.00 36.05  ? 3   ASN A CG  1 
ATOM   24   O OD1 . ASN A 1 3   ? 9.559   23.216  44.902  1.00 31.28  ? 3   ASN A OD1 1 
ATOM   25   N ND2 . ASN A 1 3   ? 9.323   22.813  47.117  1.00 25.39  ? 3   ASN A ND2 1 
ATOM   26   N N   . GLN A 1 4   ? 11.930  23.787  42.731  1.00 35.10  ? 4   GLN A N   1 
ATOM   27   C CA  . GLN A 1 4   ? 11.826  24.739  41.625  1.00 32.60  ? 4   GLN A CA  1 
ATOM   28   C C   . GLN A 1 4   ? 10.478  25.408  41.523  1.00 35.80  ? 4   GLN A C   1 
ATOM   29   O O   . GLN A 1 4   ? 10.274  26.271  40.678  1.00 40.30  ? 4   GLN A O   1 
ATOM   30   C CB  . GLN A 1 4   ? 12.106  24.053  40.283  1.00 34.55  ? 4   GLN A CB  1 
ATOM   31   C CG  . GLN A 1 4   ? 13.555  23.699  40.055  1.00 40.63  ? 4   GLN A CG  1 
ATOM   32   C CD  . GLN A 1 4   ? 14.479  24.869  40.310  1.00 46.12  ? 4   GLN A CD  1 
ATOM   33   O OE1 . GLN A 1 4   ? 15.301  24.832  41.231  1.00 44.66  ? 4   GLN A OE1 1 
ATOM   34   N NE2 . GLN A 1 4   ? 14.342  25.927  39.499  1.00 42.39  ? 4   GLN A NE2 1 
ATOM   35   N N   . ILE A 1 5   ? 9.529   24.980  42.341  1.00 36.61  ? 5   ILE A N   1 
ATOM   36   C CA  . ILE A 1 5   ? 8.204   25.564  42.272  1.00 36.79  ? 5   ILE A CA  1 
ATOM   37   C C   . ILE A 1 5   ? 8.159   26.738  43.259  1.00 36.87  ? 5   ILE A C   1 
ATOM   38   O O   . ILE A 1 5   ? 7.587   26.665  44.350  1.00 41.02  ? 5   ILE A O   1 
ATOM   39   C CB  . ILE A 1 5   ? 7.132   24.504  42.546  1.00 34.91  ? 5   ILE A CB  1 
ATOM   40   C CG1 . ILE A 1 5   ? 7.519   23.216  41.797  1.00 32.26  ? 5   ILE A CG1 1 
ATOM   41   C CG2 . ILE A 1 5   ? 5.760   25.037  42.147  1.00 34.85  ? 5   ILE A CG2 1 
ATOM   42   C CD1 . ILE A 1 5   ? 6.507   22.092  41.823  1.00 26.52  ? 5   ILE A CD1 1 
ATOM   43   N N   . LYS A 1 6   ? 8.820   27.822  42.880  1.00 40.83  ? 6   LYS A N   1 
ATOM   44   C CA  . LYS A 1 6   ? 8.979   28.933  43.798  1.00 40.21  ? 6   LYS A CA  1 
ATOM   45   C C   . LYS A 1 6   ? 7.712   29.746  43.729  1.00 39.75  ? 6   LYS A C   1 
ATOM   46   O O   . LYS A 1 6   ? 7.417   30.362  42.713  1.00 47.61  ? 6   LYS A O   1 
ATOM   47   C CB  . LYS A 1 6   ? 10.207  29.779  43.459  1.00 33.96  ? 6   LYS A CB  1 
ATOM   48   C CG  . LYS A 1 6   ? 11.527  29.091  43.668  1.00 34.63  ? 6   LYS A CG  1 
ATOM   49   C CD  . LYS A 1 6   ? 12.548  29.679  42.696  1.00 45.62  ? 6   LYS A CD  1 
ATOM   50   C CE  . LYS A 1 6   ? 13.888  28.955  42.711  1.00 41.27  ? 6   LYS A CE  1 
ATOM   51   N NZ  . LYS A 1 6   ? 14.781  29.448  41.601  1.00 50.96  ? 6   LYS A NZ  1 
ATOM   52   N N   . ALA A 1 7   ? 6.950   29.714  44.812  1.00 44.36  ? 7   ALA A N   1 
ATOM   53   C CA  . ALA A 1 7   ? 5.681   30.414  44.875  1.00 41.61  ? 7   ALA A CA  1 
ATOM   54   C C   . ALA A 1 7   ? 5.278   30.576  46.338  1.00 42.54  ? 7   ALA A C   1 
ATOM   55   O O   . ALA A 1 7   ? 5.324   29.620  47.101  1.00 46.21  ? 7   ALA A O   1 
ATOM   56   C CB  . ALA A 1 7   ? 4.637   29.671  44.098  1.00 28.90  ? 7   ALA A CB  1 
ATOM   57   N N   . ASN A 1 8   ? 4.926   31.795  46.742  1.00 46.50  ? 8   ASN A N   1 
ATOM   58   C CA  . ASN A 1 8   ? 4.484   32.033  48.113  1.00 39.05  ? 8   ASN A CA  1 
ATOM   59   C C   . ASN A 1 8   ? 3.013   32.412  48.190  1.00 36.83  ? 8   ASN A C   1 
ATOM   60   O O   . ASN A 1 8   ? 2.478   32.591  49.273  1.00 40.96  ? 8   ASN A O   1 
ATOM   61   C CB  . ASN A 1 8   ? 5.334   33.109  48.775  1.00 39.06  ? 8   ASN A CB  1 
ATOM   62   C CG  . ASN A 1 8   ? 6.676   32.576  49.244  1.00 52.85  ? 8   ASN A CG  1 
ATOM   63   O OD1 . ASN A 1 8   ? 6.765   31.961  50.310  1.00 56.76  ? 8   ASN A OD1 1 
ATOM   64   N ND2 . ASN A 1 8   ? 7.730   32.795  48.446  1.00 52.39  ? 8   ASN A ND2 1 
ATOM   65   N N   . THR A 1 9   ? 2.356   32.516  47.038  1.00 40.30  ? 9   THR A N   1 
ATOM   66   C CA  . THR A 1 9   ? 0.926   32.827  46.977  1.00 37.61  ? 9   THR A CA  1 
ATOM   67   C C   . THR A 1 9   ? 0.290   32.114  45.800  1.00 36.49  ? 9   THR A C   1 
ATOM   68   O O   . THR A 1 9   ? 0.983   31.691  44.877  1.00 40.80  ? 9   THR A O   1 
ATOM   69   C CB  . THR A 1 9   ? 0.632   34.353  46.811  1.00 40.99  ? 9   THR A CB  1 
ATOM   70   O OG1 . THR A 1 9   ? 1.028   34.795  45.493  1.00 35.82  ? 9   THR A OG1 1 
ATOM   71   C CG2 . THR A 1 9   ? 1.301   35.201  47.918  1.00 26.34  ? 9   THR A CG2 1 
ATOM   72   N N   . LYS A 1 10  ? -1.032  32.015  45.815  1.00 31.98  ? 10  LYS A N   1 
ATOM   73   C CA  . LYS A 1 10  ? -1.767  31.528  44.661  1.00 34.05  ? 10  LYS A CA  1 
ATOM   74   C C   . LYS A 1 10  ? -1.410  32.342  43.422  1.00 41.30  ? 10  LYS A C   1 
ATOM   75   O O   . LYS A 1 10  ? -1.341  31.801  42.310  1.00 44.08  ? 10  LYS A O   1 
ATOM   76   C CB  . LYS A 1 10  ? -3.270  31.582  44.942  1.00 37.47  ? 10  LYS A CB  1 
ATOM   77   C CG  . LYS A 1 10  ? -4.169  31.551  43.712  1.00 40.18  ? 10  LYS A CG  1 
ATOM   78   C CD  . LYS A 1 10  ? -5.635  31.454  44.118  1.00 43.38  ? 10  LYS A CD  1 
ATOM   79   C CE  . LYS A 1 10  ? -6.522  31.280  42.906  1.00 36.70  ? 10  LYS A CE  1 
ATOM   80   N NZ  . LYS A 1 10  ? -5.937  30.267  42.006  1.00 37.25  ? 10  LYS A NZ  1 
ATOM   81   N N   . LYS A 1 11  ? -1.178  33.647  43.616  1.00 49.62  ? 11  LYS A N   1 
ATOM   82   C CA  . LYS A 1 11  ? -0.743  34.535  42.534  1.00 49.06  ? 11  LYS A CA  1 
ATOM   83   C C   . LYS A 1 11  ? 0.608   34.046  41.980  1.00 45.36  ? 11  LYS A C   1 
ATOM   84   O O   . LYS A 1 11  ? 0.677   33.594  40.840  1.00 43.53  ? 11  LYS A O   1 
ATOM   85   C CB  . LYS A 1 11  ? -0.652  35.992  43.019  1.00 53.13  ? 11  LYS A CB  1 
ATOM   86   C CG  . LYS A 1 11  ? -0.642  37.066  41.901  1.00 58.74  ? 11  LYS A CG  1 
ATOM   87   C CD  . LYS A 1 11  ? -2.058  37.488  41.467  1.00 69.51  ? 11  LYS A CD  1 
ATOM   88   C CE  . LYS A 1 11  ? -2.041  38.536  40.328  1.00 75.31  ? 11  LYS A CE  1 
ATOM   89   N NZ  . LYS A 1 11  ? -3.408  38.885  39.781  1.00 64.96  ? 11  LYS A NZ  1 
ATOM   90   N N   . GLU A 1 12  ? 1.660   34.104  42.798  1.00 44.76  ? 12  GLU A N   1 
ATOM   91   C CA  . GLU A 1 12  ? 2.988   33.624  42.402  1.00 42.89  ? 12  GLU A CA  1 
ATOM   92   C C   . GLU A 1 12  ? 2.971   32.200  41.864  1.00 42.90  ? 12  GLU A C   1 
ATOM   93   O O   . GLU A 1 12  ? 3.703   31.890  40.918  1.00 50.22  ? 12  GLU A O   1 
ATOM   94   C CB  . GLU A 1 12  ? 3.971   33.686  43.574  1.00 45.85  ? 12  GLU A CB  1 
ATOM   95   C CG  . GLU A 1 12  ? 4.232   35.074  44.127  1.00 38.09  ? 12  GLU A CG  1 
ATOM   96   C CD  . GLU A 1 12  ? 5.184   35.038  45.312  1.00 50.11  ? 12  GLU A CD  1 
ATOM   97   O OE1 . GLU A 1 12  ? 5.668   33.936  45.658  1.00 44.42  ? 12  GLU A OE1 1 
ATOM   98   O OE2 . GLU A 1 12  ? 5.451   36.108  45.903  1.00 62.02  ? 12  GLU A OE2 1 
ATOM   99   N N   . TYR A 1 13  ? 2.156   31.324  42.452  1.00 41.93  ? 13  TYR A N   1 
ATOM   100  C CA  . TYR A 1 13  ? 2.103   29.959  41.934  1.00 40.71  ? 13  TYR A CA  1 
ATOM   101  C C   . TYR A 1 13  ? 1.534   29.965  40.506  1.00 35.60  ? 13  TYR A C   1 
ATOM   102  O O   . TYR A 1 13  ? 2.094   29.310  39.641  1.00 36.67  ? 13  TYR A O   1 
ATOM   103  C CB  . TYR A 1 13  ? 1.309   28.986  42.850  1.00 36.40  ? 13  TYR A CB  1 
ATOM   104  C CG  . TYR A 1 13  ? 1.200   27.644  42.155  1.00 35.54  ? 13  TYR A CG  1 
ATOM   105  C CD1 . TYR A 1 13  ? 2.316   26.842  41.999  1.00 31.87  ? 13  TYR A CD1 1 
ATOM   106  C CD2 . TYR A 1 13  ? 0.015   27.232  41.561  1.00 37.74  ? 13  TYR A CD2 1 
ATOM   107  C CE1 . TYR A 1 13  ? 2.253   25.658  41.310  1.00 29.16  ? 13  TYR A CE1 1 
ATOM   108  C CE2 . TYR A 1 13  ? -0.055  26.042  40.864  1.00 36.29  ? 13  TYR A CE2 1 
ATOM   109  C CZ  . TYR A 1 13  ? 1.073   25.258  40.739  1.00 32.80  ? 13  TYR A CZ  1 
ATOM   110  O OH  . TYR A 1 13  ? 1.024   24.070  40.039  1.00 27.68  ? 13  TYR A OH  1 
ATOM   111  N N   . ASP A 1 14  ? 0.448   30.707  40.262  1.00 40.01  ? 14  ASP A N   1 
ATOM   112  C CA  . ASP A 1 14  ? -0.112  30.877  38.902  1.00 42.81  ? 14  ASP A CA  1 
ATOM   113  C C   . ASP A 1 14  ? 0.915   31.406  37.901  1.00 40.58  ? 14  ASP A C   1 
ATOM   114  O O   . ASP A 1 14  ? 0.922   31.028  36.721  1.00 37.89  ? 14  ASP A O   1 
ATOM   115  C CB  . ASP A 1 14  ? -1.302  31.848  38.898  1.00 45.09  ? 14  ASP A CB  1 
ATOM   116  C CG  . ASP A 1 14  ? -2.566  31.257  39.499  1.00 45.60  ? 14  ASP A CG  1 
ATOM   117  O OD1 . ASP A 1 14  ? -2.842  30.059  39.292  1.00 42.71  ? 14  ASP A OD1 1 
ATOM   118  O OD2 . ASP A 1 14  ? -3.308  32.015  40.159  1.00 46.20  ? 14  ASP A OD2 1 
ATOM   119  N N   . GLU A 1 15  ? 1.757   32.318  38.383  1.00 41.44  ? 15  GLU A N   1 
ATOM   120  C CA  . GLU A 1 15  ? 2.776   32.951  37.558  1.00 42.97  ? 15  GLU A CA  1 
ATOM   121  C C   . GLU A 1 15  ? 3.844   31.921  37.174  1.00 44.04  ? 15  GLU A C   1 
ATOM   122  O O   . GLU A 1 15  ? 4.432   31.990  36.088  1.00 39.42  ? 15  GLU A O   1 
ATOM   123  C CB  . GLU A 1 15  ? 3.385   34.147  38.300  1.00 42.98  ? 15  GLU A CB  1 
ATOM   124  C CG  . GLU A 1 15  ? 2.424   35.323  38.455  1.00 45.54  ? 15  GLU A CG  1 
ATOM   125  C CD  . GLU A 1 15  ? 2.908   36.392  39.442  1.00 57.47  ? 15  GLU A CD  1 
ATOM   126  O OE1 . GLU A 1 15  ? 4.072   36.320  39.914  1.00 56.58  ? 15  GLU A OE1 1 
ATOM   127  O OE2 . GLU A 1 15  ? 2.109   37.308  39.754  1.00 62.52  ? 15  GLU A OE2 1 
ATOM   128  N N   . TRP A 1 16  ? 4.072   30.960  38.071  1.00 43.73  ? 16  TRP A N   1 
ATOM   129  C CA  . TRP A 1 16  ? 4.904   29.798  37.772  1.00 39.48  ? 16  TRP A CA  1 
ATOM   130  C C   . TRP A 1 16  ? 4.239   28.836  36.783  1.00 40.44  ? 16  TRP A C   1 
ATOM   131  O O   . TRP A 1 16  ? 4.894   28.295  35.893  1.00 38.42  ? 16  TRP A O   1 
ATOM   132  C CB  . TRP A 1 16  ? 5.251   29.042  39.062  1.00 40.42  ? 16  TRP A CB  1 
ATOM   133  C CG  . TRP A 1 16  ? 6.114   27.827  38.822  1.00 41.62  ? 16  TRP A CG  1 
ATOM   134  C CD1 . TRP A 1 16  ? 7.476   27.790  38.768  1.00 42.72  ? 16  TRP A CD1 1 
ATOM   135  C CD2 . TRP A 1 16  ? 5.672   26.482  38.598  1.00 40.95  ? 16  TRP A CD2 1 
ATOM   136  N NE1 . TRP A 1 16  ? 7.909   26.511  38.529  1.00 40.71  ? 16  TRP A NE1 1 
ATOM   137  C CE2 . TRP A 1 16  ? 6.822   25.689  38.415  1.00 39.11  ? 16  TRP A CE2 1 
ATOM   138  C CE3 . TRP A 1 16  ? 4.413   25.870  38.523  1.00 39.01  ? 16  TRP A CE3 1 
ATOM   139  C CZ2 . TRP A 1 16  ? 6.754   24.318  38.174  1.00 40.10  ? 16  TRP A CZ2 1 
ATOM   140  C CZ3 . TRP A 1 16  ? 4.349   24.517  38.288  1.00 35.31  ? 16  TRP A CZ3 1 
ATOM   141  C CH2 . TRP A 1 16  ? 5.512   23.752  38.120  1.00 38.92  ? 16  TRP A CH2 1 
ATOM   142  N N   . PHE A 1 17  ? 2.935   28.625  36.940  1.00 42.67  ? 17  PHE A N   1 
ATOM   143  C CA  . PHE A 1 17  ? 2.273   27.495  36.287  1.00 40.61  ? 17  PHE A CA  1 
ATOM   144  C C   . PHE A 1 17  ? 1.975   27.714  34.804  1.00 41.26  ? 17  PHE A C   1 
ATOM   145  O O   . PHE A 1 17  ? 1.984   26.749  34.021  1.00 39.79  ? 17  PHE A O   1 
ATOM   146  C CB  . PHE A 1 17  ? 0.974   27.142  37.029  1.00 35.89  ? 17  PHE A CB  1 
ATOM   147  C CG  . PHE A 1 17  ? 0.231   25.975  36.430  1.00 32.43  ? 17  PHE A CG  1 
ATOM   148  C CD1 . PHE A 1 17  ? 0.564   24.675  36.777  1.00 29.98  ? 17  PHE A CD1 1 
ATOM   149  C CD2 . PHE A 1 17  ? -0.801  26.182  35.517  1.00 30.19  ? 17  PHE A CD2 1 
ATOM   150  C CE1 . PHE A 1 17  ? -0.110  23.601  36.228  1.00 33.10  ? 17  PHE A CE1 1 
ATOM   151  C CE2 . PHE A 1 17  ? -1.474  25.109  34.961  1.00 32.05  ? 17  PHE A CE2 1 
ATOM   152  C CZ  . PHE A 1 17  ? -1.137  23.812  35.317  1.00 28.84  ? 17  PHE A CZ  1 
ATOM   153  N N   . LYS A 1 18  ? 1.693   28.962  34.420  1.00 44.94  ? 18  LYS A N   1 
ATOM   154  C CA  . LYS A 1 18  ? 1.365   29.276  33.018  1.00 44.91  ? 18  LYS A CA  1 
ATOM   155  C C   . LYS A 1 18  ? 2.487   28.834  32.063  1.00 46.10  ? 18  LYS A C   1 
ATOM   156  O O   . LYS A 1 18  ? 2.216   28.117  31.093  1.00 44.67  ? 18  LYS A O   1 
ATOM   157  C CB  . LYS A 1 18  ? 1.058   30.778  32.852  1.00 48.34  ? 18  LYS A CB  1 
ATOM   158  C CG  . LYS A 1 18  ? 1.242   31.331  31.437  1.00 52.61  ? 18  LYS A CG  1 
ATOM   159  C CD  . LYS A 1 18  ? 0.097   30.921  30.509  1.00 60.17  ? 18  LYS A CD  1 
ATOM   160  C CE  . LYS A 1 18  ? 0.151   31.671  29.180  1.00 60.58  ? 18  LYS A CE  1 
ATOM   161  N NZ  . LYS A 1 18  ? -1.076  31.480  28.360  1.00 56.07  ? 18  LYS A NZ  1 
ATOM   162  N N   . PRO A 1 19  ? 3.754   29.228  32.347  1.00 45.17  ? 19  PRO A N   1 
ATOM   163  C CA  . PRO A 1 19  ? 4.776   28.767  31.406  1.00 43.17  ? 19  PRO A CA  1 
ATOM   164  C C   . PRO A 1 19  ? 5.011   27.277  31.510  1.00 44.24  ? 19  PRO A C   1 
ATOM   165  O O   . PRO A 1 19  ? 5.228   26.625  30.480  1.00 45.33  ? 19  PRO A O   1 
ATOM   166  C CB  . PRO A 1 19  ? 6.027   29.559  31.809  1.00 37.22  ? 19  PRO A CB  1 
ATOM   167  C CG  . PRO A 1 19  ? 5.768   30.087  33.129  1.00 37.08  ? 19  PRO A CG  1 
ATOM   168  C CD  . PRO A 1 19  ? 4.299   30.205  33.311  1.00 42.63  ? 19  PRO A CD  1 
ATOM   169  N N   . TYR A 1 20  ? 4.942   26.751  32.731  1.00 42.40  ? 20  TYR A N   1 
ATOM   170  C CA  . TYR A 1 20  ? 5.148   25.329  32.962  1.00 40.70  ? 20  TYR A CA  1 
ATOM   171  C C   . TYR A 1 20  ? 4.113   24.495  32.206  1.00 44.09  ? 20  TYR A C   1 
ATOM   172  O O   . TYR A 1 20  ? 4.472   23.507  31.562  1.00 44.46  ? 20  TYR A O   1 
ATOM   173  C CB  . TYR A 1 20  ? 5.112   25.015  34.467  1.00 37.82  ? 20  TYR A CB  1 
ATOM   174  C CG  . TYR A 1 20  ? 5.163   23.536  34.775  1.00 44.80  ? 20  TYR A CG  1 
ATOM   175  C CD1 . TYR A 1 20  ? 6.358   22.828  34.680  1.00 41.60  ? 20  TYR A CD1 1 
ATOM   176  C CD2 . TYR A 1 20  ? 4.014   22.842  35.168  1.00 37.53  ? 20  TYR A CD2 1 
ATOM   177  C CE1 . TYR A 1 20  ? 6.406   21.473  34.949  1.00 36.16  ? 20  TYR A CE1 1 
ATOM   178  C CE2 . TYR A 1 20  ? 4.062   21.490  35.444  1.00 35.68  ? 20  TYR A CE2 1 
ATOM   179  C CZ  . TYR A 1 20  ? 5.256   20.817  35.324  1.00 37.73  ? 20  TYR A CZ  1 
ATOM   180  O OH  . TYR A 1 20  ? 5.306   19.481  35.589  1.00 38.03  ? 20  TYR A OH  1 
ATOM   181  N N   . ALA A 1 21  ? 2.840   24.899  32.267  1.00 44.00  ? 21  ALA A N   1 
ATOM   182  C CA  . ALA A 1 21  ? 1.766   24.136  31.623  1.00 41.58  ? 21  ALA A CA  1 
ATOM   183  C C   . ALA A 1 21  ? 1.939   24.141  30.124  1.00 44.01  ? 21  ALA A C   1 
ATOM   184  O O   . ALA A 1 21  ? 1.692   23.137  29.446  1.00 44.62  ? 21  ALA A O   1 
ATOM   185  C CB  . ALA A 1 21  ? 0.406   24.696  31.985  1.00 38.11  ? 21  ALA A CB  1 
ATOM   186  N N   . GLU A 1 22  ? 2.334   25.299  29.611  1.00 48.81  ? 22  GLU A N   1 
ATOM   187  C CA  . GLU A 1 22  ? 2.625   25.446  28.195  1.00 51.18  ? 22  GLU A CA  1 
ATOM   188  C C   . GLU A 1 22  ? 3.762   24.532  27.770  1.00 45.76  ? 22  GLU A C   1 
ATOM   189  O O   . GLU A 1 22  ? 3.682   23.905  26.721  1.00 55.93  ? 22  GLU A O   1 
ATOM   190  C CB  . GLU A 1 22  ? 2.980   26.885  27.871  1.00 51.86  ? 22  GLU A CB  1 
ATOM   191  C CG  . GLU A 1 22  ? 1.809   27.785  27.639  1.00 47.64  ? 22  GLU A CG  1 
ATOM   192  C CD  . GLU A 1 22  ? 2.259   29.225  27.456  1.00 63.30  ? 22  GLU A CD  1 
ATOM   193  O OE1 . GLU A 1 22  ? 1.923   29.818  26.409  1.00 67.44  ? 22  GLU A OE1 1 
ATOM   194  O OE2 . GLU A 1 22  ? 2.958   29.758  28.357  1.00 61.63  ? 22  GLU A OE2 1 
ATOM   195  N N   . LYS A 1 23  ? 4.815   24.463  28.584  1.00 42.04  ? 23  LYS A N   1 
ATOM   196  C CA  . LYS A 1 23  ? 5.961   23.595  28.301  1.00 45.89  ? 23  LYS A CA  1 
ATOM   197  C C   . LYS A 1 23  ? 5.597   22.101  28.249  1.00 44.97  ? 23  LYS A C   1 
ATOM   198  O O   . LYS A 1 23  ? 5.918   21.410  27.279  1.00 43.84  ? 23  LYS A O   1 
ATOM   199  C CB  . LYS A 1 23  ? 7.055   23.824  29.342  1.00 49.87  ? 23  LYS A CB  1 
ATOM   200  C CG  . LYS A 1 23  ? 8.434   23.364  28.925  1.00 55.06  ? 23  LYS A CG  1 
ATOM   201  C CD  . LYS A 1 23  ? 9.496   24.127  29.713  1.00 61.80  ? 23  LYS A CD  1 
ATOM   202  C CE  . LYS A 1 23  ? 10.622  24.650  28.817  1.00 67.27  ? 23  LYS A CE  1 
ATOM   203  N NZ  . LYS A 1 23  ? 11.469  25.692  29.489  1.00 67.40  ? 23  LYS A NZ  1 
ATOM   204  N N   . THR A 1 24  ? 4.914   21.615  29.283  1.00 44.89  ? 24  THR A N   1 
ATOM   205  C CA  . THR A 1 24  ? 4.606   20.192  29.413  1.00 42.59  ? 24  THR A CA  1 
ATOM   206  C C   . THR A 1 24  ? 3.403   19.690  28.588  1.00 39.23  ? 24  THR A C   1 
ATOM   207  O O   . THR A 1 24  ? 3.117   18.497  28.580  1.00 41.58  ? 24  THR A O   1 
ATOM   208  C CB  . THR A 1 24  ? 4.376   19.839  30.894  1.00 45.77  ? 24  THR A CB  1 
ATOM   209  O OG1 . THR A 1 24  ? 3.283   20.614  31.408  1.00 44.95  ? 24  THR A OG1 1 
ATOM   210  C CG2 . THR A 1 24  ? 5.645   20.132  31.706  1.00 40.51  ? 24  THR A CG2 1 
ATOM   211  N N   . HIS A 1 25  ? 2.726   20.587  27.878  1.00 44.26  ? 25  HIS A N   1 
ATOM   212  C CA  . HIS A 1 25  ? 1.629   20.217  26.966  1.00 44.72  ? 25  HIS A CA  1 
ATOM   213  C C   . HIS A 1 25  ? 0.572   19.376  27.689  1.00 45.56  ? 25  HIS A C   1 
ATOM   214  O O   . HIS A 1 25  ? 0.437   18.177  27.438  1.00 49.65  ? 25  HIS A O   1 
ATOM   215  C CB  . HIS A 1 25  ? 2.158   19.462  25.717  1.00 47.63  ? 25  HIS A CB  1 
ATOM   216  C CG  . HIS A 1 25  ? 3.354   20.100  25.062  1.00 50.62  ? 25  HIS A CG  1 
ATOM   217  N ND1 . HIS A 1 25  ? 3.375   21.420  24.645  1.00 46.84  ? 25  HIS A ND1 1 
ATOM   218  C CD2 . HIS A 1 25  ? 4.573   19.598  24.740  1.00 55.32  ? 25  HIS A CD2 1 
ATOM   219  C CE1 . HIS A 1 25  ? 4.549   21.698  24.112  1.00 50.83  ? 25  HIS A CE1 1 
ATOM   220  N NE2 . HIS A 1 25  ? 5.299   20.609  24.160  1.00 50.50  ? 25  HIS A NE2 1 
ATOM   221  N N   . LEU A 1 26  ? -0.172  20.017  28.590  1.00 42.35  ? 26  LEU A N   1 
ATOM   222  C CA  . LEU A 1 26  ? -1.180  19.341  29.389  1.00 38.06  ? 26  LEU A CA  1 
ATOM   223  C C   . LEU A 1 26  ? -2.489  19.108  28.631  1.00 42.00  ? 26  LEU A C   1 
ATOM   224  O O   . LEU A 1 26  ? -2.763  19.754  27.626  1.00 48.82  ? 26  LEU A O   1 
ATOM   225  C CB  . LEU A 1 26  ? -1.450  20.147  30.649  1.00 41.38  ? 26  LEU A CB  1 
ATOM   226  C CG  . LEU A 1 26  ? -0.370  20.162  31.715  1.00 32.41  ? 26  LEU A CG  1 
ATOM   227  C CD1 . LEU A 1 26  ? -0.752  21.148  32.800  1.00 31.65  ? 26  LEU A CD1 1 
ATOM   228  C CD2 . LEU A 1 26  ? -0.252  18.777  32.272  1.00 32.00  ? 26  LEU A CD2 1 
ATOM   229  N N   . LYS A 1 27  ? -3.306  18.180  29.115  1.00 46.01  ? 27  LYS A N   1 
ATOM   230  C CA  . LYS A 1 27  ? -4.535  17.803  28.404  1.00 45.84  ? 27  LYS A CA  1 
ATOM   231  C C   . LYS A 1 27  ? -5.758  17.691  29.315  1.00 46.16  ? 27  LYS A C   1 
ATOM   232  O O   . LYS A 1 27  ? -5.642  17.370  30.504  1.00 43.12  ? 27  LYS A O   1 
ATOM   233  C CB  . LYS A 1 27  ? -4.344  16.483  27.669  1.00 42.77  ? 27  LYS A CB  1 
ATOM   234  C CG  . LYS A 1 27  ? -3.534  16.606  26.400  1.00 49.50  ? 27  LYS A CG  1 
ATOM   235  C CD  . LYS A 1 27  ? -2.362  15.633  26.391  1.00 52.17  ? 27  LYS A CD  1 
ATOM   236  C CE  . LYS A 1 27  ? -1.646  15.686  25.046  1.00 68.23  ? 27  LYS A CE  1 
ATOM   237  N NZ  . LYS A 1 27  ? -1.327  17.088  24.622  1.00 67.30  ? 27  LYS A NZ  1 
ATOM   238  N N   . SER A 1 28  ? -6.931  17.944  28.737  1.00 46.16  ? 28  SER A N   1 
ATOM   239  C CA  . SER A 1 28  ? -8.167  17.974  29.506  1.00 43.59  ? 28  SER A CA  1 
ATOM   240  C C   . SER A 1 28  ? -9.217  17.059  28.908  1.00 43.68  ? 28  SER A C   1 
ATOM   241  O O   . SER A 1 28  ? -10.372 17.107  29.317  1.00 45.91  ? 28  SER A O   1 
ATOM   242  C CB  . SER A 1 28  ? -8.721  19.402  29.592  1.00 44.31  ? 28  SER A CB  1 
ATOM   243  O OG  . SER A 1 28  ? -7.707  20.340  29.928  1.00 50.01  ? 28  SER A OG  1 
ATOM   244  N N   . VAL A 1 29  ? -8.832  16.221  27.951  1.00 40.39  ? 29  VAL A N   1 
ATOM   245  C CA  . VAL A 1 29  ? -9.838  15.436  27.258  1.00 43.12  ? 29  VAL A CA  1 
ATOM   246  C C   . VAL A 1 29  ? -10.463 14.424  28.229  1.00 47.73  ? 29  VAL A C   1 
ATOM   247  O O   . VAL A 1 29  ? -11.686 14.396  28.386  1.00 47.33  ? 29  VAL A O   1 
ATOM   248  C CB  . VAL A 1 29  ? -9.273  14.736  25.980  1.00 41.96  ? 29  VAL A CB  1 
ATOM   249  C CG1 . VAL A 1 29  ? -8.128  13.759  26.314  1.00 45.88  ? 29  VAL A CG1 1 
ATOM   250  C CG2 . VAL A 1 29  ? -10.393 14.039  25.195  1.00 35.84  ? 29  VAL A CG2 1 
ATOM   251  N N   . LEU A 1 30  ? -9.650  13.645  28.935  1.00 45.70  ? 30  LEU A N   1 
ATOM   252  C CA  . LEU A 1 30  ? -10.217 12.575  29.752  1.00 44.59  ? 30  LEU A CA  1 
ATOM   253  C C   . LEU A 1 30  ? -10.187 12.827  31.268  1.00 39.32  ? 30  LEU A C   1 
ATOM   254  O O   . LEU A 1 30  ? -10.631 11.982  32.018  1.00 45.60  ? 30  LEU A O   1 
ATOM   255  C CB  . LEU A 1 30  ? -9.514  11.247  29.423  1.00 42.35  ? 30  LEU A CB  1 
ATOM   256  C CG  . LEU A 1 30  ? -9.789  10.670  28.022  1.00 39.62  ? 30  LEU A CG  1 
ATOM   257  C CD1 . LEU A 1 30  ? -8.808  9.572   27.648  1.00 40.21  ? 30  LEU A CD1 1 
ATOM   258  C CD2 . LEU A 1 30  ? -11.194 10.133  27.929  1.00 39.96  ? 30  LEU A CD2 1 
ATOM   259  N N   . THR A 1 31  ? -9.703  13.981  31.727  1.00 39.31  ? 31  THR A N   1 
ATOM   260  C CA  . THR A 1 31  ? -9.547  14.207  33.169  1.00 34.27  ? 31  THR A CA  1 
ATOM   261  C C   . THR A 1 31  ? -10.008 15.594  33.606  1.00 35.93  ? 31  THR A C   1 
ATOM   262  O O   . THR A 1 31  ? -9.923  16.550  32.841  1.00 43.29  ? 31  THR A O   1 
ATOM   263  C CB  . THR A 1 31  ? -8.052  14.033  33.636  1.00 39.59  ? 31  THR A CB  1 
ATOM   264  O OG1 . THR A 1 31  ? -7.249  15.131  33.173  1.00 30.59  ? 31  THR A OG1 1 
ATOM   265  C CG2 . THR A 1 31  ? -7.461  12.710  33.162  1.00 33.92  ? 31  THR A CG2 1 
ATOM   266  N N   . ASN A 1 32  ? -10.457 15.720  34.849  1.00 31.17  ? 32  ASN A N   1 
ATOM   267  C CA  . ASN A 1 32  ? -11.019 16.982  35.325  1.00 35.34  ? 32  ASN A CA  1 
ATOM   268  C C   . ASN A 1 32  ? -9.979  18.106  35.323  1.00 37.58  ? 32  ASN A C   1 
ATOM   269  O O   . ASN A 1 32  ? -10.053 19.009  34.487  1.00 40.27  ? 32  ASN A O   1 
ATOM   270  C CB  . ASN A 1 32  ? -11.636 16.815  36.726  1.00 33.28  ? 32  ASN A CB  1 
ATOM   271  C CG  . ASN A 1 32  ? -12.419 15.511  36.869  1.00 37.59  ? 32  ASN A CG  1 
ATOM   272  O OD1 . ASN A 1 32  ? -13.004 15.025  35.911  1.00 39.26  ? 32  ASN A OD1 1 
ATOM   273  N ND2 . ASN A 1 32  ? -12.421 14.940  38.068  1.00 38.32  ? 32  ASN A ND2 1 
ATOM   274  N N   . SER A 1 33  ? -9.027  18.052  36.257  1.00 38.19  ? 33  SER A N   1 
ATOM   275  C CA  . SER A 1 33  ? -7.859  18.933  36.242  1.00 34.41  ? 33  SER A CA  1 
ATOM   276  C C   . SER A 1 33  ? -6.919  18.453  35.144  1.00 34.85  ? 33  SER A C   1 
ATOM   277  O O   . SER A 1 33  ? -6.788  17.250  34.928  1.00 38.53  ? 33  SER A O   1 
ATOM   278  C CB  . SER A 1 33  ? -7.179  18.949  37.610  1.00 33.65  ? 33  SER A CB  1 
ATOM   279  O OG  . SER A 1 33  ? -5.959  19.657  37.575  1.00 32.17  ? 33  SER A OG  1 
ATOM   280  N N   . ALA A 1 34  ? -6.301  19.371  34.415  1.00 39.38  ? 34  ALA A N   1 
ATOM   281  C CA  . ALA A 1 34  ? -5.542  18.971  33.219  1.00 36.38  ? 34  ALA A CA  1 
ATOM   282  C C   . ALA A 1 34  ? -4.346  18.070  33.546  1.00 38.13  ? 34  ALA A C   1 
ATOM   283  O O   . ALA A 1 34  ? -3.572  18.341  34.469  1.00 36.04  ? 34  ALA A O   1 
ATOM   284  C CB  . ALA A 1 34  ? -5.082  20.184  32.452  1.00 31.84  ? 34  ALA A CB  1 
ATOM   285  N N   . SER A 1 35  ? -4.207  17.002  32.764  1.00 37.26  ? 35  SER A N   1 
ATOM   286  C CA  . SER A 1 35  ? -3.259  15.950  33.060  1.00 33.90  ? 35  SER A CA  1 
ATOM   287  C C   . SER A 1 35  ? -2.383  15.637  31.849  1.00 41.11  ? 35  SER A C   1 
ATOM   288  O O   . SER A 1 35  ? -2.344  16.418  30.896  1.00 40.59  ? 35  SER A O   1 
ATOM   289  C CB  . SER A 1 35  ? -3.997  14.690  33.510  1.00 34.65  ? 35  SER A CB  1 
ATOM   290  O OG  . SER A 1 35  ? -4.548  14.012  32.401  1.00 35.70  ? 35  SER A OG  1 
ATOM   291  N N   . PHE A 1 36  ? -1.679  14.501  31.895  1.00 37.98  ? 36  PHE A N   1 
ATOM   292  C CA  . PHE A 1 36  ? -0.844  14.068  30.778  1.00 37.39  ? 36  PHE A CA  1 
ATOM   293  C C   . PHE A 1 36  ? -1.561  13.025  29.970  1.00 32.74  ? 36  PHE A C   1 
ATOM   294  O O   . PHE A 1 36  ? -0.976  12.396  29.104  1.00 35.96  ? 36  PHE A O   1 
ATOM   295  C CB  . PHE A 1 36  ? 0.511   13.528  31.271  1.00 32.60  ? 36  PHE A CB  1 
ATOM   296  C CG  . PHE A 1 36  ? 1.413   14.602  31.819  1.00 34.84  ? 36  PHE A CG  1 
ATOM   297  C CD1 . PHE A 1 36  ? 1.761   15.696  31.032  1.00 35.20  ? 36  PHE A CD1 1 
ATOM   298  C CD2 . PHE A 1 36  ? 1.894   14.538  33.119  1.00 31.11  ? 36  PHE A CD2 1 
ATOM   299  C CE1 . PHE A 1 36  ? 2.556   16.691  31.532  1.00 34.31  ? 36  PHE A CE1 1 
ATOM   300  C CE2 . PHE A 1 36  ? 2.693   15.534  33.630  1.00 28.61  ? 36  PHE A CE2 1 
ATOM   301  C CZ  . PHE A 1 36  ? 3.030   16.607  32.838  1.00 35.62  ? 36  PHE A CZ  1 
ATOM   302  N N   . CYS A 1 37  ? -2.839  12.848  30.255  1.00 31.58  ? 37  CYS A N   1 
ATOM   303  C CA  . CYS A 1 37  ? -3.590  11.770  29.632  1.00 43.39  ? 37  CYS A CA  1 
ATOM   304  C C   . CYS A 1 37  ? -4.107  12.145  28.233  1.00 48.67  ? 37  CYS A C   1 
ATOM   305  O O   . CYS A 1 37  ? -4.876  13.097  28.084  1.00 43.12  ? 37  CYS A O   1 
ATOM   306  C CB  . CYS A 1 37  ? -4.761  11.347  30.531  1.00 40.47  ? 37  CYS A CB  1 
ATOM   307  S SG  . CYS A 1 37  ? -5.555  9.788   30.040  1.00 46.60  ? 37  CYS A SG  1 
ATOM   308  N N   . ASP A 1 38  ? -3.689  11.401  27.207  1.00 48.62  ? 38  ASP A N   1 
ATOM   309  C CA  . ASP A 1 38  ? -4.225  11.655  25.870  1.00 52.40  ? 38  ASP A CA  1 
ATOM   310  C C   . ASP A 1 38  ? -5.163  10.536  25.469  1.00 53.73  ? 38  ASP A C   1 
ATOM   311  O O   . ASP A 1 38  ? -5.978  10.702  24.554  1.00 55.61  ? 38  ASP A O   1 
ATOM   312  C CB  . ASP A 1 38  ? -3.107  11.842  24.813  1.00 50.16  ? 38  ASP A CB  1 
ATOM   313  C CG  . ASP A 1 38  ? -2.182  10.634  24.680  1.00 59.19  ? 38  ASP A CG  1 
ATOM   314  O OD1 . ASP A 1 38  ? -2.680  9.485   24.635  1.00 58.34  ? 38  ASP A OD1 1 
ATOM   315  O OD2 . ASP A 1 38  ? -0.943  10.844  24.597  1.00 63.05  ? 38  ASP A OD2 1 
ATOM   316  N N   . ALA A 1 39  ? -5.050  9.410   26.170  1.00 45.45  ? 39  ALA A N   1 
ATOM   317  C CA  . ALA A 1 39  ? -5.825  8.215   25.856  1.00 40.47  ? 39  ALA A CA  1 
ATOM   318  C C   . ALA A 1 39  ? -6.053  7.341   27.103  1.00 48.14  ? 39  ALA A C   1 
ATOM   319  O O   . ALA A 1 39  ? -5.315  7.431   28.096  1.00 48.73  ? 39  ALA A O   1 
ATOM   320  C CB  . ALA A 1 39  ? -5.140  7.424   24.766  1.00 35.27  ? 39  ALA A CB  1 
ATOM   321  N N   . LEU A 1 40  ? -7.080  6.499   27.041  1.00 40.84  ? 40  LEU A N   1 
ATOM   322  C CA  . LEU A 1 40  ? -7.521  5.735   28.193  1.00 38.38  ? 40  LEU A CA  1 
ATOM   323  C C   . LEU A 1 40  ? -6.803  4.406   28.269  1.00 33.97  ? 40  LEU A C   1 
ATOM   324  O O   . LEU A 1 40  ? -6.959  3.583   27.380  1.00 41.02  ? 40  LEU A O   1 
ATOM   325  C CB  . LEU A 1 40  ? -9.031  5.516   28.138  1.00 34.29  ? 40  LEU A CB  1 
ATOM   326  C CG  . LEU A 1 40  ? -9.663  4.869   29.372  1.00 43.09  ? 40  LEU A CG  1 
ATOM   327  C CD1 . LEU A 1 40  ? -9.432  5.690   30.645  1.00 35.11  ? 40  LEU A CD1 1 
ATOM   328  C CD2 . LEU A 1 40  ? -11.143 4.667   29.150  1.00 43.07  ? 40  LEU A CD2 1 
ATOM   329  N N   . PRO A 1 41  ? -6.011  4.203   29.332  1.00 30.93  ? 41  PRO A N   1 
ATOM   330  C CA  . PRO A 1 41  ? -5.226  2.986   29.541  1.00 31.17  ? 41  PRO A CA  1 
ATOM   331  C C   . PRO A 1 41  ? -6.067  1.731   29.418  1.00 38.64  ? 41  PRO A C   1 
ATOM   332  O O   . PRO A 1 41  ? -7.133  1.644   30.019  1.00 42.75  ? 41  PRO A O   1 
ATOM   333  C CB  . PRO A 1 41  ? -4.705  3.137   30.976  1.00 31.92  ? 41  PRO A CB  1 
ATOM   334  C CG  . PRO A 1 41  ? -4.737  4.582   31.250  1.00 30.19  ? 41  PRO A CG  1 
ATOM   335  C CD  . PRO A 1 41  ? -5.823  5.181   30.420  1.00 32.40  ? 41  PRO A CD  1 
ATOM   336  N N   . ASP A 1 42  ? -5.590  0.771   28.642  1.00 35.96  ? 42  ASP A N   1 
ATOM   337  C CA  . ASP A 1 42  ? -6.252  -0.502  28.522  1.00 32.57  ? 42  ASP A CA  1 
ATOM   338  C C   . ASP A 1 42  ? -5.507  -1.474  29.437  1.00 42.32  ? 42  ASP A C   1 
ATOM   339  O O   . ASP A 1 42  ? -4.366  -1.876  29.166  1.00 42.52  ? 42  ASP A O   1 
ATOM   340  C CB  . ASP A 1 42  ? -6.274  -0.959  27.055  1.00 34.75  ? 42  ASP A CB  1 
ATOM   341  C CG  . ASP A 1 42  ? -6.771  -2.409  26.863  1.00 42.94  ? 42  ASP A CG  1 
ATOM   342  O OD1 . ASP A 1 42  ? -7.387  -3.025  27.759  1.00 39.86  ? 42  ASP A OD1 1 
ATOM   343  O OD2 . ASP A 1 42  ? -6.550  -2.938  25.763  1.00 51.06  ? 42  ASP A OD2 1 
ATOM   344  N N   . LEU A 1 43  ? -6.161  -1.846  30.533  1.00 40.76  ? 43  LEU A N   1 
ATOM   345  C CA  . LEU A 1 43  ? -5.525  -2.661  31.546  1.00 40.64  ? 43  LEU A CA  1 
ATOM   346  C C   . LEU A 1 43  ? -5.758  -4.145  31.339  1.00 42.90  ? 43  LEU A C   1 
ATOM   347  O O   . LEU A 1 43  ? -5.420  -4.925  32.222  1.00 44.56  ? 43  LEU A O   1 
ATOM   348  C CB  . LEU A 1 43  ? -6.015  -2.253  32.939  1.00 38.09  ? 43  LEU A CB  1 
ATOM   349  C CG  . LEU A 1 43  ? -5.802  -0.792  33.348  1.00 35.93  ? 43  LEU A CG  1 
ATOM   350  C CD1 . LEU A 1 43  ? -6.378  -0.529  34.748  1.00 34.77  ? 43  LEU A CD1 1 
ATOM   351  C CD2 . LEU A 1 43  ? -4.343  -0.478  33.321  1.00 33.21  ? 43  LEU A CD2 1 
ATOM   352  N N   . SER A 1 44  ? -6.298  -4.537  30.178  1.00 44.17  ? 44  SER A N   1 
ATOM   353  C CA  . SER A 1 44  ? -6.715  -5.937  29.933  1.00 47.14  ? 44  SER A CA  1 
ATOM   354  C C   . SER A 1 44  ? -5.582  -6.970  29.967  1.00 42.24  ? 44  SER A C   1 
ATOM   355  O O   . SER A 1 44  ? -5.749  -8.065  30.521  1.00 48.23  ? 44  SER A O   1 
ATOM   356  C CB  . SER A 1 44  ? -7.449  -6.053  28.591  1.00 41.93  ? 44  SER A CB  1 
ATOM   357  O OG  . SER A 1 44  ? -6.731  -5.385  27.574  1.00 52.83  ? 44  SER A OG  1 
ATOM   358  N N   . ILE A 1 45  ? -4.451  -6.635  29.366  1.00 38.14  ? 45  ILE A N   1 
ATOM   359  C CA  . ILE A 1 45  ? -3.240  -7.443  29.462  1.00 36.84  ? 45  ILE A CA  1 
ATOM   360  C C   . ILE A 1 45  ? -3.006  -8.000  30.857  1.00 43.01  ? 45  ILE A C   1 
ATOM   361  O O   . ILE A 1 45  ? -2.546  -9.128  31.028  1.00 46.30  ? 45  ILE A O   1 
ATOM   362  C CB  . ILE A 1 45  ? -1.992  -6.639  29.092  1.00 39.39  ? 45  ILE A CB  1 
ATOM   363  C CG1 . ILE A 1 45  ? -2.207  -5.849  27.786  1.00 53.74  ? 45  ILE A CG1 1 
ATOM   364  C CG2 . ILE A 1 45  ? -0.796  -7.574  28.993  1.00 32.31  ? 45  ILE A CG2 1 
ATOM   365  C CD1 . ILE A 1 45  ? -2.796  -4.422  27.942  1.00 47.03  ? 45  ILE A CD1 1 
ATOM   366  N N   . PHE A 1 46  ? -3.322  -7.199  31.866  1.00 45.43  ? 46  PHE A N   1 
ATOM   367  C CA  . PHE A 1 46  ? -3.088  -7.609  33.243  1.00 40.88  ? 46  PHE A CA  1 
ATOM   368  C C   . PHE A 1 46  ? -4.079  -8.688  33.738  1.00 43.13  ? 46  PHE A C   1 
ATOM   369  O O   . PHE A 1 46  ? -3.681  -9.553  34.515  1.00 45.32  ? 46  PHE A O   1 
ATOM   370  C CB  . PHE A 1 46  ? -3.098  -6.386  34.154  1.00 37.07  ? 46  PHE A CB  1 
ATOM   371  C CG  . PHE A 1 46  ? -2.002  -5.398  33.847  1.00 37.79  ? 46  PHE A CG  1 
ATOM   372  C CD1 . PHE A 1 46  ? -0.686  -5.700  34.127  1.00 31.06  ? 46  PHE A CD1 1 
ATOM   373  C CD2 . PHE A 1 46  ? -2.296  -4.168  33.259  1.00 38.31  ? 46  PHE A CD2 1 
ATOM   374  C CE1 . PHE A 1 46  ? 0.314   -4.799  33.852  1.00 33.35  ? 46  PHE A CE1 1 
ATOM   375  C CE2 . PHE A 1 46  ? -1.295  -3.262  32.974  1.00 33.71  ? 46  PHE A CE2 1 
ATOM   376  C CZ  . PHE A 1 46  ? 0.010   -3.579  33.266  1.00 33.33  ? 46  PHE A CZ  1 
ATOM   377  N N   . GLU A 1 47  ? -5.338  -8.671  33.296  1.00 42.16  ? 47  GLU A N   1 
ATOM   378  C CA  . GLU A 1 47  ? -6.228  -9.820  33.553  1.00 43.92  ? 47  GLU A CA  1 
ATOM   379  C C   . GLU A 1 47  ? -5.558  -11.097 33.084  1.00 45.11  ? 47  GLU A C   1 
ATOM   380  O O   . GLU A 1 47  ? -5.568  -12.118 33.776  1.00 51.00  ? 47  GLU A O   1 
ATOM   381  C CB  . GLU A 1 47  ? -7.573  -9.712  32.833  1.00 42.52  ? 47  GLU A CB  1 
ATOM   382  C CG  . GLU A 1 47  ? -8.555  -8.691  33.333  1.00 40.93  ? 47  GLU A CG  1 
ATOM   383  C CD  . GLU A 1 47  ? -9.865  -8.781  32.566  1.00 48.41  ? 47  GLU A CD  1 
ATOM   384  O OE1 . GLU A 1 47  ? -10.369 -7.745  32.079  1.00 53.78  ? 47  GLU A OE1 1 
ATOM   385  O OE2 . GLU A 1 47  ? -10.388 -9.907  32.437  1.00 56.33  ? 47  GLU A OE2 1 
ATOM   386  N N   . VAL A 1 48  ? -4.994  -11.032 31.885  1.00 46.90  ? 48  VAL A N   1 
ATOM   387  C CA  . VAL A 1 48  ? -4.387  -12.200 31.277  1.00 41.43  ? 48  VAL A CA  1 
ATOM   388  C C   . VAL A 1 48  ? -3.199  -12.648 32.100  1.00 42.11  ? 48  VAL A C   1 
ATOM   389  O O   . VAL A 1 48  ? -3.123  -13.815 32.476  1.00 46.31  ? 48  VAL A O   1 
ATOM   390  C CB  . VAL A 1 48  ? -3.955  -11.926 29.830  1.00 38.88  ? 48  VAL A CB  1 
ATOM   391  C CG1 . VAL A 1 48  ? -3.199  -13.095 29.295  1.00 45.72  ? 48  VAL A CG1 1 
ATOM   392  C CG2 . VAL A 1 48  ? -5.168  -11.654 28.973  1.00 44.87  ? 48  VAL A CG2 1 
ATOM   393  N N   . LYS A 1 49  ? -2.278  -11.725 32.383  1.00 44.12  ? 49  LYS A N   1 
ATOM   394  C CA  . LYS A 1 49  ? -1.099  -12.034 33.202  1.00 40.60  ? 49  LYS A CA  1 
ATOM   395  C C   . LYS A 1 49  ? -1.532  -12.635 34.521  1.00 42.29  ? 49  LYS A C   1 
ATOM   396  O O   . LYS A 1 49  ? -0.984  -13.634 34.977  1.00 51.33  ? 49  LYS A O   1 
ATOM   397  C CB  . LYS A 1 49  ? -0.261  -10.783 33.476  1.00 41.15  ? 49  LYS A CB  1 
ATOM   398  C CG  . LYS A 1 49  ? 0.836   -10.486 32.486  1.00 41.36  ? 49  LYS A CG  1 
ATOM   399  C CD  . LYS A 1 49  ? 1.967   -9.752  33.180  1.00 45.78  ? 49  LYS A CD  1 
ATOM   400  C CE  . LYS A 1 49  ? 3.337   -10.245 32.706  1.00 65.24  ? 49  LYS A CE  1 
ATOM   401  N NZ  . LYS A 1 49  ? 4.433   -10.010 33.708  1.00 62.97  ? 49  LYS A NZ  1 
ATOM   402  N N   . MET A 1 50  ? -2.529  -12.001 35.128  1.00 41.32  ? 50  MET A N   1 
ATOM   403  C CA  . MET A 1 50  ? -3.076  -12.428 36.395  1.00 43.18  ? 50  MET A CA  1 
ATOM   404  C C   . MET A 1 50  ? -3.615  -13.850 36.310  1.00 47.37  ? 50  MET A C   1 
ATOM   405  O O   . MET A 1 50  ? -3.142  -14.744 37.016  1.00 49.92  ? 50  MET A O   1 
ATOM   406  C CB  . MET A 1 50  ? -4.178  -11.469 36.830  1.00 47.51  ? 50  MET A CB  1 
ATOM   407  C CG  . MET A 1 50  ? -4.588  -11.630 38.256  1.00 44.17  ? 50  MET A CG  1 
ATOM   408  S SD  . MET A 1 50  ? -3.223  -11.249 39.362  1.00 44.77  ? 50  MET A SD  1 
ATOM   409  C CE  . MET A 1 50  ? -3.751  -9.633  39.927  1.00 36.68  ? 50  MET A CE  1 
ATOM   410  N N   . GLY A 1 51  ? -4.600  -14.058 35.439  1.00 45.13  ? 51  GLY A N   1 
ATOM   411  C CA  . GLY A 1 51  ? -5.153  -15.382 35.204  1.00 42.65  ? 51  GLY A CA  1 
ATOM   412  C C   . GLY A 1 51  ? -4.153  -16.483 34.886  1.00 39.71  ? 51  GLY A C   1 
ATOM   413  O O   . GLY A 1 51  ? -4.528  -17.642 34.840  1.00 42.09  ? 51  GLY A O   1 
ATOM   414  N N   . LEU A 1 52  ? -2.887  -16.129 34.675  1.00 41.27  ? 52  LEU A N   1 
ATOM   415  C CA  . LEU A 1 52  ? -1.845  -17.106 34.373  1.00 46.36  ? 52  LEU A CA  1 
ATOM   416  C C   . LEU A 1 52  ? -0.742  -17.145 35.426  1.00 50.97  ? 52  LEU A C   1 
ATOM   417  O O   . LEU A 1 52  ? 0.386   -17.539 35.135  1.00 51.17  ? 52  LEU A O   1 
ATOM   418  C CB  . LEU A 1 52  ? -1.206  -16.818 33.011  1.00 43.65  ? 52  LEU A CB  1 
ATOM   419  C CG  . LEU A 1 52  ? -2.122  -16.854 31.794  1.00 48.37  ? 52  LEU A CG  1 
ATOM   420  C CD1 . LEU A 1 52  ? -1.295  -16.921 30.524  1.00 50.21  ? 52  LEU A CD1 1 
ATOM   421  C CD2 . LEU A 1 52  ? -3.075  -18.027 31.894  1.00 43.73  ? 52  LEU A CD2 1 
ATOM   422  N N   . ALA A 1 53  ? -1.062  -16.737 36.647  1.00 56.47  ? 53  ALA A N   1 
ATOM   423  C CA  . ALA A 1 53  ? -0.057  -16.677 37.706  1.00 53.81  ? 53  ALA A CA  1 
ATOM   424  C C   . ALA A 1 53  ? -0.362  -17.682 38.801  1.00 52.72  ? 53  ALA A C   1 
ATOM   425  O O   . ALA A 1 53  ? -1.507  -18.082 38.988  1.00 49.86  ? 53  ALA A O   1 
ATOM   426  C CB  . ALA A 1 53  ? 0.017   -15.275 38.284  1.00 54.00  ? 53  ALA A CB  1 
ATOM   427  N N   . THR A 1 54  ? 0.672   -18.072 39.535  1.00 55.22  ? 54  THR A N   1 
ATOM   428  C CA  . THR A 1 54  ? 0.518   -19.055 40.597  1.00 59.79  ? 54  THR A CA  1 
ATOM   429  C C   . THR A 1 54  ? 0.579   -18.456 42.011  1.00 62.70  ? 54  THR A C   1 
ATOM   430  O O   . THR A 1 54  ? -0.440  -18.434 42.713  1.00 60.80  ? 54  THR A O   1 
ATOM   431  C CB  . THR A 1 54  ? 1.580   -20.146 40.477  1.00 63.08  ? 54  THR A CB  1 
ATOM   432  O OG1 . THR A 1 54  ? 2.859   -19.534 40.239  1.00 60.00  ? 54  THR A OG1 1 
ATOM   433  C CG2 . THR A 1 54  ? 1.221   -21.093 39.327  1.00 54.26  ? 54  THR A CG2 1 
ATOM   434  N N   . ASP A 1 55  ? 1.756   -17.986 42.438  1.00 59.85  ? 55  ASP A N   1 
ATOM   435  C CA  . ASP A 1 55  ? 1.875   -17.456 43.798  1.00 60.69  ? 55  ASP A CA  1 
ATOM   436  C C   . ASP A 1 55  ? 1.438   -15.999 43.866  1.00 62.14  ? 55  ASP A C   1 
ATOM   437  O O   . ASP A 1 55  ? 1.507   -15.258 42.877  1.00 59.90  ? 55  ASP A O   1 
ATOM   438  C CB  . ASP A 1 55  ? 3.296   -17.618 44.362  1.00 65.43  ? 55  ASP A CB  1 
ATOM   439  C CG  . ASP A 1 55  ? 4.365   -17.026 43.468  1.00 69.83  ? 55  ASP A CG  1 
ATOM   440  O OD1 . ASP A 1 55  ? 4.531   -15.790 43.469  1.00 67.70  ? 55  ASP A OD1 1 
ATOM   441  O OD2 . ASP A 1 55  ? 5.063   -17.803 42.786  1.00 66.46  ? 55  ASP A OD2 1 
ATOM   442  N N   . ASP A 1 56  ? 0.968   -15.615 45.051  1.00 63.75  ? 56  ASP A N   1 
ATOM   443  C CA  . ASP A 1 56  ? 0.254   -14.364 45.252  1.00 59.26  ? 56  ASP A CA  1 
ATOM   444  C C   . ASP A 1 56  ? 1.167   -13.149 45.259  1.00 52.50  ? 56  ASP A C   1 
ATOM   445  O O   . ASP A 1 56  ? 0.702   -12.016 45.181  1.00 52.93  ? 56  ASP A O   1 
ATOM   446  C CB  . ASP A 1 56  ? -0.543  -14.429 46.556  1.00 61.02  ? 56  ASP A CB  1 
ATOM   447  C CG  . ASP A 1 56  ? -1.729  -15.363 46.458  1.00 71.83  ? 56  ASP A CG  1 
ATOM   448  O OD1 . ASP A 1 56  ? -1.552  -16.493 45.940  1.00 77.81  ? 56  ASP A OD1 1 
ATOM   449  O OD2 . ASP A 1 56  ? -2.840  -14.961 46.880  1.00 66.88  ? 56  ASP A OD2 1 
ATOM   450  N N   . ARG A 1 57  ? 2.464   -13.381 45.357  1.00 53.26  ? 57  ARG A N   1 
ATOM   451  C CA  . ARG A 1 57  ? 3.404   -12.285 45.324  1.00 50.12  ? 57  ARG A CA  1 
ATOM   452  C C   . ARG A 1 57  ? 3.642   -11.872 43.868  1.00 56.77  ? 57  ARG A C   1 
ATOM   453  O O   . ARG A 1 57  ? 3.863   -10.697 43.584  1.00 56.80  ? 57  ARG A O   1 
ATOM   454  C CB  . ARG A 1 57  ? 4.704   -12.663 46.038  1.00 57.49  ? 57  ARG A CB  1 
ATOM   455  C CG  . ARG A 1 57  ? 5.210   -14.079 45.778  1.00 69.99  ? 57  ARG A CG  1 
ATOM   456  C CD  . ARG A 1 57  ? 4.765   -15.117 46.835  1.00 71.73  ? 57  ARG A CD  1 
ATOM   457  N NE  . ARG A 1 57  ? 5.728   -16.221 46.948  1.00 78.88  ? 57  ARG A NE  1 
ATOM   458  C CZ  . ARG A 1 57  ? 5.842   -17.032 48.002  1.00 85.07  ? 57  ARG A CZ  1 
ATOM   459  N NH1 . ARG A 1 57  ? 5.045   -16.884 49.056  1.00 83.75  ? 57  ARG A NH1 1 
ATOM   460  N NH2 . ARG A 1 57  ? 6.763   -17.995 48.007  1.00 79.76  ? 57  ARG A NH2 1 
ATOM   461  N N   . GLU A 1 58  ? 3.569   -12.831 42.944  1.00 59.22  ? 58  GLU A N   1 
ATOM   462  C CA  . GLU A 1 58  ? 3.497   -12.496 41.523  1.00 54.77  ? 58  GLU A CA  1 
ATOM   463  C C   . GLU A 1 58  ? 2.216   -11.727 41.245  1.00 50.80  ? 58  GLU A C   1 
ATOM   464  O O   . GLU A 1 58  ? 2.222   -10.752 40.497  1.00 50.08  ? 58  GLU A O   1 
ATOM   465  C CB  . GLU A 1 58  ? 3.547   -13.740 40.629  1.00 57.25  ? 58  GLU A CB  1 
ATOM   466  C CG  . GLU A 1 58  ? 3.420   -13.409 39.124  1.00 55.53  ? 58  GLU A CG  1 
ATOM   467  C CD  . GLU A 1 58  ? 3.206   -14.633 38.214  1.00 57.32  ? 58  GLU A CD  1 
ATOM   468  O OE1 . GLU A 1 58  ? 3.319   -15.791 38.684  1.00 59.23  ? 58  GLU A OE1 1 
ATOM   469  O OE2 . GLU A 1 58  ? 2.899   -14.428 37.019  1.00 60.38  ? 58  GLU A OE2 1 
ATOM   470  N N   . LYS A 1 59  ? 1.118   -12.162 41.857  1.00 53.26  ? 59  LYS A N   1 
ATOM   471  C CA  . LYS A 1 59  ? -0.188  -11.540 41.619  1.00 49.09  ? 59  LYS A CA  1 
ATOM   472  C C   . LYS A 1 59  ? -0.225  -10.123 42.178  1.00 48.13  ? 59  LYS A C   1 
ATOM   473  O O   . LYS A 1 59  ? -0.878  -9.240  41.620  1.00 44.04  ? 59  LYS A O   1 
ATOM   474  C CB  . LYS A 1 59  ? -1.317  -12.375 42.235  1.00 45.75  ? 59  LYS A CB  1 
ATOM   475  C CG  . LYS A 1 59  ? -1.247  -13.876 41.939  1.00 51.05  ? 59  LYS A CG  1 
ATOM   476  C CD  . LYS A 1 59  ? -2.642  -14.489 41.971  1.00 58.28  ? 59  LYS A CD  1 
ATOM   477  C CE  . LYS A 1 59  ? -2.627  -16.002 41.775  1.00 53.79  ? 59  LYS A CE  1 
ATOM   478  N NZ  . LYS A 1 59  ? -4.012  -16.523 41.752  1.00 42.07  ? 59  LYS A NZ  1 
ATOM   479  N N   . ASP A 1 60  ? 0.483   -9.903  43.278  1.00 45.68  ? 60  ASP A N   1 
ATOM   480  C CA  . ASP A 1 60  ? 0.486   -8.596  43.901  1.00 43.05  ? 60  ASP A CA  1 
ATOM   481  C C   . ASP A 1 60  ? 1.218   -7.637  43.004  1.00 46.11  ? 60  ASP A C   1 
ATOM   482  O O   . ASP A 1 60  ? 0.787   -6.489  42.817  1.00 45.50  ? 60  ASP A O   1 
ATOM   483  C CB  . ASP A 1 60  ? 1.136   -8.642  45.286  1.00 51.71  ? 60  ASP A CB  1 
ATOM   484  C CG  . ASP A 1 60  ? 0.217   -9.234  46.356  1.00 49.46  ? 60  ASP A CG  1 
ATOM   485  O OD1 . ASP A 1 60  ? -1.021  -9.010  46.300  1.00 44.07  ? 60  ASP A OD1 1 
ATOM   486  O OD2 . ASP A 1 60  ? 0.754   -9.912  47.260  1.00 49.22  ? 60  ASP A OD2 1 
ATOM   487  N N   . SER A 1 61  ? 2.317   -8.131  42.435  1.00 47.66  ? 61  SER A N   1 
ATOM   488  C CA  . SER A 1 61  ? 3.157   -7.366  41.514  1.00 41.21  ? 61  SER A CA  1 
ATOM   489  C C   . SER A 1 61  ? 2.382   -6.979  40.264  1.00 39.00  ? 61  SER A C   1 
ATOM   490  O O   . SER A 1 61  ? 2.504   -5.846  39.767  1.00 35.15  ? 61  SER A O   1 
ATOM   491  C CB  . SER A 1 61  ? 4.399   -8.172  41.138  1.00 46.57  ? 61  SER A CB  1 
ATOM   492  O OG  . SER A 1 61  ? 5.564   -7.370  41.166  1.00 57.57  ? 61  SER A OG  1 
ATOM   493  N N   . ILE A 1 62  ? 1.574   -7.923  39.776  1.00 38.87  ? 62  ILE A N   1 
ATOM   494  C CA  . ILE A 1 62  ? 0.740   -7.712  38.589  1.00 40.90  ? 62  ILE A CA  1 
ATOM   495  C C   . ILE A 1 62  ? -0.287  -6.590  38.792  1.00 36.99  ? 62  ILE A C   1 
ATOM   496  O O   . ILE A 1 62  ? -0.400  -5.667  37.972  1.00 33.18  ? 62  ILE A O   1 
ATOM   497  C CB  . ILE A 1 62  ? -0.005  -8.999  38.195  1.00 40.84  ? 62  ILE A CB  1 
ATOM   498  C CG1 . ILE A 1 62  ? 0.985   -10.085 37.776  1.00 35.94  ? 62  ILE A CG1 1 
ATOM   499  C CG2 . ILE A 1 62  ? -1.008  -8.712  37.089  1.00 37.23  ? 62  ILE A CG2 1 
ATOM   500  C CD1 . ILE A 1 62  ? 0.367   -11.453 37.619  1.00 38.66  ? 62  ILE A CD1 1 
ATOM   501  N N   . TYR A 1 63  ? -1.021  -6.670  39.897  1.00 32.86  ? 63  TYR A N   1 
ATOM   502  C CA  . TYR A 1 63  ? -1.976  -5.632  40.258  1.00 35.27  ? 63  TYR A CA  1 
ATOM   503  C C   . TYR A 1 63  ? -1.297  -4.268  40.453  1.00 33.85  ? 63  TYR A C   1 
ATOM   504  O O   . TYR A 1 63  ? -1.804  -3.243  39.996  1.00 32.92  ? 63  TYR A O   1 
ATOM   505  C CB  . TYR A 1 63  ? -2.743  -6.021  41.527  1.00 32.45  ? 63  TYR A CB  1 
ATOM   506  C CG  . TYR A 1 63  ? -3.711  -4.965  41.940  1.00 30.36  ? 63  TYR A CG  1 
ATOM   507  C CD1 . TYR A 1 63  ? -4.813  -4.664  41.149  1.00 32.93  ? 63  TYR A CD1 1 
ATOM   508  C CD2 . TYR A 1 63  ? -3.515  -4.238  43.103  1.00 36.53  ? 63  TYR A CD2 1 
ATOM   509  C CE1 . TYR A 1 63  ? -5.693  -3.678  41.506  1.00 36.32  ? 63  TYR A CE1 1 
ATOM   510  C CE2 . TYR A 1 63  ? -4.393  -3.255  43.482  1.00 34.20  ? 63  TYR A CE2 1 
ATOM   511  C CZ  . TYR A 1 63  ? -5.480  -2.977  42.680  1.00 42.90  ? 63  TYR A CZ  1 
ATOM   512  O OH  . TYR A 1 63  ? -6.365  -1.993  43.065  1.00 50.30  ? 63  TYR A OH  1 
ATOM   513  N N   . ALA A 1 64  ? -0.151  -4.255  41.121  1.00 29.24  ? 64  ALA A N   1 
ATOM   514  C CA  . ALA A 1 64  ? 0.578   -3.013  41.305  1.00 26.61  ? 64  ALA A CA  1 
ATOM   515  C C   . ALA A 1 64  ? 0.973   -2.413  39.962  1.00 36.65  ? 64  ALA A C   1 
ATOM   516  O O   . ALA A 1 64  ? 0.951   -1.194  39.813  1.00 36.66  ? 64  ALA A O   1 
ATOM   517  C CB  . ALA A 1 64  ? 1.808   -3.232  42.180  1.00 27.81  ? 64  ALA A CB  1 
ATOM   518  N N   . CYS A 1 65  ? 1.306   -3.254  38.975  1.00 35.88  ? 65  CYS A N   1 
ATOM   519  C CA  . CYS A 1 65  ? 1.664   -2.734  37.649  1.00 31.02  ? 65  CYS A CA  1 
ATOM   520  C C   . CYS A 1 65  ? 0.468   -2.147  36.914  1.00 33.39  ? 65  CYS A C   1 
ATOM   521  O O   . CYS A 1 65  ? 0.602   -1.184  36.134  1.00 36.08  ? 65  CYS A O   1 
ATOM   522  C CB  . CYS A 1 65  ? 2.294   -3.814  36.782  1.00 31.18  ? 65  CYS A CB  1 
ATOM   523  S SG  . CYS A 1 65  ? 3.905   -4.343  37.339  1.00 29.45  ? 65  CYS A SG  1 
ATOM   524  N N   . ALA A 1 66  ? -0.700  -2.737  37.134  1.00 30.49  ? 66  ALA A N   1 
ATOM   525  C CA  . ALA A 1 66  ? -1.898  -2.247  36.468  1.00 31.99  ? 66  ALA A CA  1 
ATOM   526  C C   . ALA A 1 66  ? -2.293  -0.913  37.094  1.00 38.20  ? 66  ALA A C   1 
ATOM   527  O O   . ALA A 1 66  ? -2.799  -0.014  36.419  1.00 34.61  ? 66  ALA A O   1 
ATOM   528  C CB  . ALA A 1 66  ? -3.028  -3.251  36.572  1.00 35.02  ? 66  ALA A CB  1 
ATOM   529  N N   . MET A 1 67  ? -2.041  -0.776  38.390  1.00 34.07  ? 67  MET A N   1 
ATOM   530  C CA  . MET A 1 67  ? -2.401  0.457   39.048  1.00 34.31  ? 67  MET A CA  1 
ATOM   531  C C   . MET A 1 67  ? -1.503  1.580   38.547  1.00 32.87  ? 67  MET A C   1 
ATOM   532  O O   . MET A 1 67  ? -1.957  2.690   38.314  1.00 33.40  ? 67  MET A O   1 
ATOM   533  C CB  . MET A 1 67  ? -2.298  0.325   40.547  1.00 29.77  ? 67  MET A CB  1 
ATOM   534  C CG  . MET A 1 67  ? -2.743  1.566   41.239  1.00 40.94  ? 67  MET A CG  1 
ATOM   535  S SD  . MET A 1 67  ? -4.484  1.878   40.931  1.00 47.94  ? 67  MET A SD  1 
ATOM   536  C CE  . MET A 1 67  ? -5.206  0.517   41.811  1.00 42.49  ? 67  MET A CE  1 
ATOM   537  N N   . VAL A 1 68  ? -0.227  1.279   38.359  1.00 36.21  ? 68  VAL A N   1 
ATOM   538  C CA  . VAL A 1 68  ? 0.698   2.250   37.795  1.00 29.38  ? 68  VAL A CA  1 
ATOM   539  C C   . VAL A 1 68  ? 0.250   2.657   36.390  1.00 31.13  ? 68  VAL A C   1 
ATOM   540  O O   . VAL A 1 68  ? 0.259   3.838   36.064  1.00 32.58  ? 68  VAL A O   1 
ATOM   541  C CB  . VAL A 1 68  ? 2.143   1.703   37.758  1.00 32.00  ? 68  VAL A CB  1 
ATOM   542  C CG1 . VAL A 1 68  ? 3.107   2.684   37.047  1.00 24.93  ? 68  VAL A CG1 1 
ATOM   543  C CG2 . VAL A 1 68  ? 2.624   1.413   39.158  1.00 28.11  ? 68  VAL A CG2 1 
ATOM   544  N N   . GLU A 1 69  ? -0.158  1.701   35.556  1.00 34.02  ? 69  GLU A N   1 
ATOM   545  C CA  . GLU A 1 69  ? -0.575  2.054   34.189  1.00 30.97  ? 69  GLU A CA  1 
ATOM   546  C C   . GLU A 1 69  ? -1.836  2.890   34.140  1.00 28.99  ? 69  GLU A C   1 
ATOM   547  O O   . GLU A 1 69  ? -1.980  3.777   33.294  1.00 35.56  ? 69  GLU A O   1 
ATOM   548  C CB  . GLU A 1 69  ? -0.773  0.805   33.348  1.00 30.71  ? 69  GLU A CB  1 
ATOM   549  C CG  . GLU A 1 69  ? 0.507   0.091   33.112  1.00 40.15  ? 69  GLU A CG  1 
ATOM   550  C CD  . GLU A 1 69  ? 1.525   1.000   32.453  1.00 44.82  ? 69  GLU A CD  1 
ATOM   551  O OE1 . GLU A 1 69  ? 1.157   1.648   31.436  1.00 39.31  ? 69  GLU A OE1 1 
ATOM   552  O OE2 . GLU A 1 69  ? 2.671   1.075   32.970  1.00 44.41  ? 69  GLU A OE2 1 
ATOM   553  N N   . ALA A 1 70  ? -2.753  2.602   35.048  1.00 29.28  ? 70  ALA A N   1 
ATOM   554  C CA  . ALA A 1 70  ? -4.002  3.318   35.090  1.00 28.72  ? 70  ALA A CA  1 
ATOM   555  C C   . ALA A 1 70  ? -3.800  4.769   35.511  1.00 25.19  ? 70  ALA A C   1 
ATOM   556  O O   . ALA A 1 70  ? -4.559  5.628   35.103  1.00 31.50  ? 70  ALA A O   1 
ATOM   557  C CB  . ALA A 1 70  ? -4.987  2.606   36.024  1.00 30.54  ? 70  ALA A CB  1 
ATOM   558  N N   . THR A 1 71  ? -2.779  5.056   36.306  1.00 27.61  ? 71  THR A N   1 
ATOM   559  C CA  . THR A 1 71  ? -2.685  6.381   36.923  1.00 29.51  ? 71  THR A CA  1 
ATOM   560  C C   . THR A 1 71  ? -1.426  7.188   36.643  1.00 25.71  ? 71  THR A C   1 
ATOM   561  O O   . THR A 1 71  ? -1.300  8.323   37.097  1.00 27.33  ? 71  THR A O   1 
ATOM   562  C CB  . THR A 1 71  ? -2.801  6.269   38.446  1.00 29.05  ? 71  THR A CB  1 
ATOM   563  O OG1 . THR A 1 71  ? -1.765  5.415   38.924  1.00 26.02  ? 71  THR A OG1 1 
ATOM   564  C CG2 . THR A 1 71  ? -4.166  5.714   38.852  1.00 25.89  ? 71  THR A CG2 1 
ATOM   565  N N   . LYS A 1 72  ? -0.496  6.575   35.929  1.00 29.18  ? 72  LYS A N   1 
ATOM   566  C CA  . LYS A 1 72  ? 0.777   7.166   35.511  1.00 30.32  ? 72  LYS A CA  1 
ATOM   567  C C   . LYS A 1 72  ? 0.576   8.570   34.887  1.00 31.39  ? 72  LYS A C   1 
ATOM   568  O O   . LYS A 1 72  ? 1.325   9.496   35.148  1.00 29.45  ? 72  LYS A O   1 
ATOM   569  C CB  . LYS A 1 72  ? 1.444   6.191   34.506  1.00 34.92  ? 72  LYS A CB  1 
ATOM   570  C CG  . LYS A 1 72  ? 2.952   6.196   34.304  1.00 27.08  ? 72  LYS A CG  1 
ATOM   571  C CD  . LYS A 1 72  ? 3.233   5.590   32.932  1.00 38.29  ? 72  LYS A CD  1 
ATOM   572  C CE  . LYS A 1 72  ? 4.715   5.354   32.604  1.00 42.64  ? 72  LYS A CE  1 
ATOM   573  N NZ  . LYS A 1 72  ? 5.222   4.035   33.113  1.00 50.49  ? 72  LYS A NZ  1 
ATOM   574  N N   . PHE A 1 73  ? -0.460  8.733   34.075  1.00 32.41  ? 73  PHE A N   1 
ATOM   575  C CA  . PHE A 1 73  ? -0.599  9.971   33.327  1.00 32.78  ? 73  PHE A CA  1 
ATOM   576  C C   . PHE A 1 73  ? -1.866  10.754  33.611  1.00 38.07  ? 73  PHE A C   1 
ATOM   577  O O   . PHE A 1 73  ? -2.194  11.663  32.829  1.00 38.68  ? 73  PHE A O   1 
ATOM   578  C CB  . PHE A 1 73  ? -0.526  9.700   31.816  1.00 33.70  ? 73  PHE A CB  1 
ATOM   579  C CG  . PHE A 1 73  ? 0.826   9.195   31.356  1.00 37.35  ? 73  PHE A CG  1 
ATOM   580  C CD1 . PHE A 1 73  ? 1.970   9.980   31.517  1.00 36.69  ? 73  PHE A CD1 1 
ATOM   581  C CD2 . PHE A 1 73  ? 0.954   7.944   30.771  1.00 33.00  ? 73  PHE A CD2 1 
ATOM   582  C CE1 . PHE A 1 73  ? 3.216   9.523   31.103  1.00 36.15  ? 73  PHE A CE1 1 
ATOM   583  C CE2 . PHE A 1 73  ? 2.193   7.484   30.348  1.00 35.05  ? 73  PHE A CE2 1 
ATOM   584  C CZ  . PHE A 1 73  ? 3.323   8.273   30.516  1.00 36.84  ? 73  PHE A CZ  1 
ATOM   585  N N   . CYS A 1 74  ? -2.569  10.452  34.710  1.00 28.61  ? 74  CYS A N   1 
ATOM   586  C CA  . CYS A 1 74  ? -3.834  11.154  34.940  1.00 27.17  ? 74  CYS A CA  1 
ATOM   587  C C   . CYS A 1 74  ? -3.860  12.054  36.163  1.00 31.86  ? 74  CYS A C   1 
ATOM   588  O O   . CYS A 1 74  ? -4.923  12.530  36.547  1.00 34.93  ? 74  CYS A O   1 
ATOM   589  C CB  . CYS A 1 74  ? -4.981  10.161  35.037  1.00 28.59  ? 74  CYS A CB  1 
ATOM   590  S SG  . CYS A 1 74  ? -4.952  9.108   36.472  1.00 32.98  ? 74  CYS A SG  1 
ATOM   591  N N   . ALA A 1 75  ? -2.709  12.300  36.770  1.00 25.87  ? 75  ALA A N   1 
ATOM   592  C CA  . ALA A 1 75  ? -2.679  13.101  37.988  1.00 31.98  ? 75  ALA A CA  1 
ATOM   593  C C   . ALA A 1 75  ? -2.959  14.588  37.707  1.00 34.94  ? 75  ALA A C   1 
ATOM   594  O O   . ALA A 1 75  ? -2.576  15.120  36.655  1.00 30.35  ? 75  ALA A O   1 
ATOM   595  C CB  . ALA A 1 75  ? -1.335  12.944  38.705  1.00 26.95  ? 75  ALA A CB  1 
ATOM   596  N N   . PRO A 1 76  ? -3.651  15.253  38.654  1.00 35.29  ? 76  PRO A N   1 
ATOM   597  C CA  . PRO A 1 76  ? -3.959  16.687  38.553  1.00 28.60  ? 76  PRO A CA  1 
ATOM   598  C C   . PRO A 1 76  ? -2.694  17.526  38.742  1.00 31.02  ? 76  PRO A C   1 
ATOM   599  O O   . PRO A 1 76  ? -2.271  17.790  39.889  1.00 29.91  ? 76  PRO A O   1 
ATOM   600  C CB  . PRO A 1 76  ? -4.969  16.908  39.687  1.00 28.68  ? 76  PRO A CB  1 
ATOM   601  C CG  . PRO A 1 76  ? -4.680  15.797  40.675  1.00 28.01  ? 76  PRO A CG  1 
ATOM   602  C CD  . PRO A 1 76  ? -4.280  14.624  39.835  1.00 26.81  ? 76  PRO A CD  1 
ATOM   603  N N   . ILE A 1 77  ? -2.092  17.939  37.627  1.00 26.75  ? 77  ILE A N   1 
ATOM   604  C CA  . ILE A 1 77  ? -0.784  18.582  37.674  1.00 24.89  ? 77  ILE A CA  1 
ATOM   605  C C   . ILE A 1 77  ? -0.835  19.916  38.398  1.00 29.33  ? 77  ILE A C   1 
ATOM   606  O O   . ILE A 1 77  ? -0.036  20.171  39.322  1.00 28.21  ? 77  ILE A O   1 
ATOM   607  C CB  . ILE A 1 77  ? -0.213  18.794  36.278  1.00 26.47  ? 77  ILE A CB  1 
ATOM   608  C CG1 . ILE A 1 77  ? -0.023  17.440  35.587  1.00 30.69  ? 77  ILE A CG1 1 
ATOM   609  C CG2 . ILE A 1 77  ? 1.089   19.609  36.359  1.00 22.36  ? 77  ILE A CG2 1 
ATOM   610  C CD1 . ILE A 1 77  ? 0.652   16.363  36.456  1.00 27.62  ? 77  ILE A CD1 1 
ATOM   611  N N   . TYR A 1 78  ? -1.787  20.751  37.996  1.00 26.85  ? 78  TYR A N   1 
ATOM   612  C CA  . TYR A 1 78  ? -1.980  22.052  38.617  1.00 28.62  ? 78  TYR A CA  1 
ATOM   613  C C   . TYR A 1 78  ? -2.091  21.966  40.139  1.00 31.93  ? 78  TYR A C   1 
ATOM   614  O O   . TYR A 1 78  ? -1.452  22.744  40.849  1.00 35.63  ? 78  TYR A O   1 
ATOM   615  C CB  . TYR A 1 78  ? -3.224  22.747  38.049  1.00 36.70  ? 78  TYR A CB  1 
ATOM   616  C CG  . TYR A 1 78  ? -3.455  24.119  38.662  1.00 33.65  ? 78  TYR A CG  1 
ATOM   617  C CD1 . TYR A 1 78  ? -2.675  25.208  38.287  1.00 32.60  ? 78  TYR A CD1 1 
ATOM   618  C CD2 . TYR A 1 78  ? -4.436  24.317  39.620  1.00 28.76  ? 78  TYR A CD2 1 
ATOM   619  C CE1 . TYR A 1 78  ? -2.860  26.446  38.848  1.00 29.12  ? 78  TYR A CE1 1 
ATOM   620  C CE2 . TYR A 1 78  ? -4.630  25.553  40.189  1.00 33.19  ? 78  TYR A CE2 1 
ATOM   621  C CZ  . TYR A 1 78  ? -3.842  26.618  39.791  1.00 38.02  ? 78  TYR A CZ  1 
ATOM   622  O OH  . TYR A 1 78  ? -4.030  27.856  40.363  1.00 45.73  ? 78  TYR A OH  1 
ATOM   623  N N   . GLU A 1 79  ? -2.884  21.029  40.654  1.00 29.61  ? 79  GLU A N   1 
ATOM   624  C CA  . GLU A 1 79  ? -3.044  20.947  42.109  1.00 29.57  ? 79  GLU A CA  1 
ATOM   625  C C   . GLU A 1 79  ? -1.793  20.351  42.753  1.00 29.30  ? 79  GLU A C   1 
ATOM   626  O O   . GLU A 1 79  ? -1.355  20.806  43.807  1.00 27.41  ? 79  GLU A O   1 
ATOM   627  C CB  . GLU A 1 79  ? -4.283  20.126  42.476  1.00 32.48  ? 79  GLU A CB  1 
ATOM   628  C CG  . GLU A 1 79  ? -5.615  20.770  42.074  1.00 26.68  ? 79  GLU A CG  1 
ATOM   629  C CD  . GLU A 1 79  ? -5.851  20.758  40.582  1.00 34.81  ? 79  GLU A CD  1 
ATOM   630  O OE1 . GLU A 1 79  ? -5.147  20.018  39.853  1.00 36.82  ? 79  GLU A OE1 1 
ATOM   631  O OE2 . GLU A 1 79  ? -6.752  21.492  40.127  1.00 46.85  ? 79  GLU A OE2 1 
ATOM   632  N N   . CYS A 1 80  ? -1.206  19.343  42.109  1.00 30.04  ? 80  CYS A N   1 
ATOM   633  C CA  . CYS A 1 80  ? 0.033   18.760  42.614  1.00 30.46  ? 80  CYS A CA  1 
ATOM   634  C C   . CYS A 1 80  ? 1.151   19.803  42.744  1.00 33.47  ? 80  CYS A C   1 
ATOM   635  O O   . CYS A 1 80  ? 1.856   19.848  43.758  1.00 31.87  ? 80  CYS A O   1 
ATOM   636  C CB  . CYS A 1 80  ? 0.480   17.616  41.722  1.00 31.87  ? 80  CYS A CB  1 
ATOM   637  S SG  . CYS A 1 80  ? -0.564  16.162  41.865  1.00 37.15  ? 80  CYS A SG  1 
ATOM   638  N N   . GLY A 1 81  ? 1.303   20.651  41.727  1.00 33.19  ? 81  GLY A N   1 
ATOM   639  C CA  . GLY A 1 81  ? 2.274   21.725  41.809  1.00 30.11  ? 81  GLY A CA  1 
ATOM   640  C C   . GLY A 1 81  ? 2.022   22.570  43.041  1.00 33.96  ? 81  GLY A C   1 
ATOM   641  O O   . GLY A 1 81  ? 2.944   22.840  43.837  1.00 29.21  ? 81  GLY A O   1 
ATOM   642  N N   . TRP A 1 82  ? 0.753   22.949  43.208  1.00 32.89  ? 82  TRP A N   1 
ATOM   643  C CA  . TRP A 1 82  ? 0.317   23.832  44.292  1.00 34.51  ? 82  TRP A CA  1 
ATOM   644  C C   . TRP A 1 82  ? 0.484   23.195  45.679  1.00 33.89  ? 82  TRP A C   1 
ATOM   645  O O   . TRP A 1 82  ? 0.796   23.876  46.666  1.00 30.27  ? 82  TRP A O   1 
ATOM   646  C CB  . TRP A 1 82  ? -1.146  24.258  44.048  1.00 33.05  ? 82  TRP A CB  1 
ATOM   647  C CG  . TRP A 1 82  ? -1.842  24.927  45.221  1.00 34.82  ? 82  TRP A CG  1 
ATOM   648  C CD1 . TRP A 1 82  ? -2.870  24.406  45.965  1.00 33.71  ? 82  TRP A CD1 1 
ATOM   649  C CD2 . TRP A 1 82  ? -1.556  26.225  45.786  1.00 32.74  ? 82  TRP A CD2 1 
ATOM   650  N NE1 . TRP A 1 82  ? -3.233  25.295  46.960  1.00 41.76  ? 82  TRP A NE1 1 
ATOM   651  C CE2 . TRP A 1 82  ? -2.447  26.417  46.871  1.00 36.64  ? 82  TRP A CE2 1 
ATOM   652  C CE3 . TRP A 1 82  ? -0.622  27.228  45.498  1.00 33.77  ? 82  TRP A CE3 1 
ATOM   653  C CZ2 . TRP A 1 82  ? -2.446  27.589  47.652  1.00 33.34  ? 82  TRP A CZ2 1 
ATOM   654  C CZ3 . TRP A 1 82  ? -0.621  28.397  46.282  1.00 32.44  ? 82  TRP A CZ3 1 
ATOM   655  C CH2 . TRP A 1 82  ? -1.529  28.562  47.343  1.00 28.45  ? 82  TRP A CH2 1 
ATOM   656  N N   . ALA A 1 83  ? 0.282   21.886  45.754  1.00 33.56  ? 83  ALA A N   1 
ATOM   657  C CA  . ALA A 1 83  ? 0.474   21.201  47.013  1.00 29.57  ? 83  ALA A CA  1 
ATOM   658  C C   . ALA A 1 83  ? 1.954   21.185  47.322  1.00 28.60  ? 83  ALA A C   1 
ATOM   659  O O   . ALA A 1 83  ? 2.358   21.068  48.467  1.00 39.03  ? 83  ALA A O   1 
ATOM   660  C CB  . ALA A 1 83  ? -0.081  19.803  46.952  1.00 26.28  ? 83  ALA A CB  1 
ATOM   661  N N   . CYS A 1 84  ? 2.767   21.321  46.291  1.00 29.11  ? 84  CYS A N   1 
ATOM   662  C CA  . CYS A 1 84  ? 4.199   21.112  46.439  1.00 35.85  ? 84  CYS A CA  1 
ATOM   663  C C   . CYS A 1 84  ? 5.061   22.383  46.307  1.00 37.50  ? 84  CYS A C   1 
ATOM   664  O O   . CYS A 1 84  ? 6.284   22.302  46.409  1.00 39.29  ? 84  CYS A O   1 
ATOM   665  C CB  . CYS A 1 84  ? 4.670   20.080  45.410  1.00 37.06  ? 84  CYS A CB  1 
ATOM   666  S SG  . CYS A 1 84  ? 4.050   18.384  45.655  1.00 30.64  ? 84  CYS A SG  1 
ATOM   667  N N   . CYS A 1 85  ? 4.433   23.540  46.099  1.00 34.45  ? 85  CYS A N   1 
ATOM   668  C CA  . CYS A 1 85  ? 5.145   24.797  45.883  1.00 31.66  ? 85  CYS A CA  1 
ATOM   669  C C   . CYS A 1 85  ? 5.787   25.252  47.182  1.00 33.60  ? 85  CYS A C   1 
ATOM   670  O O   . CYS A 1 85  ? 5.393   24.813  48.259  1.00 33.39  ? 85  CYS A O   1 
ATOM   671  C CB  . CYS A 1 85  ? 4.197   25.874  45.328  1.00 30.32  ? 85  CYS A CB  1 
ATOM   672  S SG  . CYS A 1 85  ? 3.161   26.655  46.572  1.00 28.16  ? 85  CYS A SG  1 
ATOM   673  N N   . THR A 1 86  ? 6.773   26.139  47.076  1.00 33.67  ? 86  THR A N   1 
ATOM   674  C CA  . THR A 1 86  ? 7.663   26.436  48.197  1.00 34.99  ? 86  THR A CA  1 
ATOM   675  C C   . THR A 1 86  ? 6.978   27.060  49.402  1.00 35.23  ? 86  THR A C   1 
ATOM   676  O O   . THR A 1 86  ? 7.417   26.862  50.536  1.00 38.46  ? 86  THR A O   1 
ATOM   677  C CB  . THR A 1 86  ? 8.817   27.373  47.758  1.00 35.97  ? 86  THR A CB  1 
ATOM   678  O OG1 . THR A 1 86  ? 8.289   28.457  46.986  1.00 36.39  ? 86  THR A OG1 1 
ATOM   679  C CG2 . THR A 1 86  ? 9.822   26.603  46.923  1.00 31.89  ? 86  THR A CG2 1 
ATOM   680  N N   . GLY A 1 87  ? 5.917   27.828  49.173  1.00 38.19  ? 87  GLY A N   1 
ATOM   681  C CA  . GLY A 1 87  ? 5.190   28.431  50.281  1.00 41.25  ? 87  GLY A CA  1 
ATOM   682  C C   . GLY A 1 87  ? 4.422   27.366  51.039  1.00 35.97  ? 87  GLY A C   1 
ATOM   683  O O   . GLY A 1 87  ? 4.418   27.310  52.278  1.00 33.00  ? 87  GLY A O   1 
ATOM   684  N N   . MET A 1 88  ? 3.781   26.502  50.260  1.00 31.54  ? 88  MET A N   1 
ATOM   685  C CA  . MET A 1 88  ? 3.029   25.401  50.806  1.00 31.16  ? 88  MET A CA  1 
ATOM   686  C C   . MET A 1 88  ? 3.917   24.479  51.630  1.00 34.28  ? 88  MET A C   1 
ATOM   687  O O   . MET A 1 88  ? 3.518   24.060  52.714  1.00 30.05  ? 88  MET A O   1 
ATOM   688  C CB  . MET A 1 88  ? 2.335   24.613  49.692  1.00 30.38  ? 88  MET A CB  1 
ATOM   689  C CG  . MET A 1 88  ? 1.181   23.761  50.215  1.00 39.05  ? 88  MET A CG  1 
ATOM   690  S SD  . MET A 1 88  ? -0.075  24.778  51.050  1.00 34.01  ? 88  MET A SD  1 
ATOM   691  C CE  . MET A 1 88  ? -0.908  25.365  49.602  1.00 32.20  ? 88  MET A CE  1 
ATOM   692  N N   . VAL A 1 89  ? 5.116   24.174  51.125  1.00 34.17  ? 89  VAL A N   1 
ATOM   693  C CA  . VAL A 1 89  ? 5.988   23.226  51.807  1.00 30.33  ? 89  VAL A CA  1 
ATOM   694  C C   . VAL A 1 89  ? 6.392   23.822  53.133  1.00 33.99  ? 89  VAL A C   1 
ATOM   695  O O   . VAL A 1 89  ? 6.237   23.180  54.186  1.00 33.77  ? 89  VAL A O   1 
ATOM   696  C CB  . VAL A 1 89  ? 7.231   22.865  50.979  1.00 29.34  ? 89  VAL A CB  1 
ATOM   697  C CG1 . VAL A 1 89  ? 8.295   22.210  51.866  1.00 26.01  ? 89  VAL A CG1 1 
ATOM   698  C CG2 . VAL A 1 89  ? 6.835   21.943  49.818  1.00 27.13  ? 89  VAL A CG2 1 
ATOM   699  N N   . GLU A 1 90  ? 6.876   25.061  53.070  1.00 32.13  ? 90  GLU A N   1 
ATOM   700  C CA  . GLU A 1 90  ? 7.281   25.824  54.244  1.00 32.49  ? 90  GLU A CA  1 
ATOM   701  C C   . GLU A 1 90  ? 6.157   25.964  55.307  1.00 34.65  ? 90  GLU A C   1 
ATOM   702  O O   . GLU A 1 90  ? 6.376   25.748  56.513  1.00 33.19  ? 90  GLU A O   1 
ATOM   703  C CB  . GLU A 1 90  ? 7.777   27.205  53.790  1.00 33.32  ? 90  GLU A CB  1 
ATOM   704  C CG  . GLU A 1 90  ? 8.865   27.799  54.663  1.00 41.99  ? 90  GLU A CG  1 
ATOM   705  C CD  . GLU A 1 90  ? 9.660   28.903  53.977  1.00 60.54  ? 90  GLU A CD  1 
ATOM   706  O OE1 . GLU A 1 90  ? 10.515  29.508  54.661  1.00 67.47  ? 90  GLU A OE1 1 
ATOM   707  O OE2 . GLU A 1 90  ? 9.442   29.165  52.769  1.00 61.51  ? 90  GLU A OE2 1 
ATOM   708  N N   . ASN A 1 91  ? 4.951   26.296  54.859  1.00 32.15  ? 91  ASN A N   1 
ATOM   709  C CA  . ASN A 1 91  ? 3.872   26.578  55.793  1.00 34.25  ? 91  ASN A CA  1 
ATOM   710  C C   . ASN A 1 91  ? 3.108   25.339  56.245  1.00 37.14  ? 91  ASN A C   1 
ATOM   711  O O   . ASN A 1 91  ? 2.839   25.178  57.439  1.00 38.66  ? 91  ASN A O   1 
ATOM   712  C CB  . ASN A 1 91  ? 2.923   27.597  55.172  1.00 38.65  ? 91  ASN A CB  1 
ATOM   713  C CG  . ASN A 1 91  ? 3.504   28.998  55.184  1.00 41.85  ? 91  ASN A CG  1 
ATOM   714  O OD1 . ASN A 1 91  ? 4.423   29.301  55.965  1.00 41.16  ? 91  ASN A OD1 1 
ATOM   715  N ND2 . ASN A 1 91  ? 2.970   29.866  54.336  1.00 39.17  ? 91  ASN A ND2 1 
ATOM   716  N N   . GLY A 1 92  ? 2.757   24.474  55.291  1.00 35.82  ? 92  GLY A N   1 
ATOM   717  C CA  . GLY A 1 92  ? 2.169   23.174  55.582  1.00 29.06  ? 92  GLY A CA  1 
ATOM   718  C C   . GLY A 1 92  ? 2.940   22.355  56.608  1.00 35.24  ? 92  GLY A C   1 
ATOM   719  O O   . GLY A 1 92  ? 2.346   21.635  57.417  1.00 34.06  ? 92  GLY A O   1 
ATOM   720  N N   . LEU A 1 93  ? 4.265   22.464  56.589  1.00 35.26  ? 93  LEU A N   1 
ATOM   721  C CA  . LEU A 1 93  ? 5.073   21.727  57.546  1.00 35.08  ? 93  LEU A CA  1 
ATOM   722  C C   . LEU A 1 93  ? 5.133   22.448  58.888  1.00 39.00  ? 93  LEU A C   1 
ATOM   723  O O   . LEU A 1 93  ? 4.906   21.821  59.930  1.00 41.88  ? 93  LEU A O   1 
ATOM   724  C CB  . LEU A 1 93  ? 6.489   21.476  57.010  1.00 35.54  ? 93  LEU A CB  1 
ATOM   725  C CG  . LEU A 1 93  ? 6.706   20.305  56.039  1.00 36.49  ? 93  LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 93  ? 8.147   20.252  55.541  1.00 41.02  ? 93  LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 93  ? 6.354   19.004  56.685  1.00 28.52  ? 93  LEU A CD2 1 
ATOM   728  N N   . LYS A 1 94  ? 5.424   23.752  58.888  1.00 42.54  ? 94  LYS A N   1 
ATOM   729  C CA  . LYS A 1 94  ? 5.540   24.475  60.171  1.00 43.03  ? 94  LYS A CA  1 
ATOM   730  C C   . LYS A 1 94  ? 4.176   24.629  60.866  1.00 37.72  ? 94  LYS A C   1 
ATOM   731  O O   . LYS A 1 94  ? 4.133   24.763  62.077  1.00 40.09  ? 94  LYS A O   1 
ATOM   732  C CB  . LYS A 1 94  ? 6.234   25.843  59.982  1.00 39.84  ? 94  LYS A CB  1 
ATOM   733  C CG  . LYS A 1 94  ? 5.355   27.030  59.639  1.00 40.07  ? 94  LYS A CG  1 
ATOM   734  C CD  . LYS A 1 94  ? 6.155   28.126  58.886  1.00 48.53  ? 94  LYS A CD  1 
ATOM   735  C CE  . LYS A 1 94  ? 7.632   28.236  59.354  1.00 49.35  ? 94  LYS A CE  1 
ATOM   736  N NZ  . LYS A 1 94  ? 8.448   29.292  58.629  1.00 45.72  ? 94  LYS A NZ  1 
ATOM   737  N N   . TRP A 1 95  ? 3.077   24.550  60.111  1.00 39.03  ? 95  TRP A N   1 
ATOM   738  C CA  . TRP A 1 95  ? 1.736   24.557  60.689  1.00 36.33  ? 95  TRP A CA  1 
ATOM   739  C C   . TRP A 1 95  ? 1.618   23.634  61.862  1.00 40.43  ? 95  TRP A C   1 
ATOM   740  O O   . TRP A 1 95  ? 0.981   23.975  62.849  1.00 48.07  ? 95  TRP A O   1 
ATOM   741  C CB  . TRP A 1 95  ? 0.663   24.154  59.685  1.00 41.65  ? 95  TRP A CB  1 
ATOM   742  C CG  . TRP A 1 95  ? -0.718  24.220  60.301  1.00 40.50  ? 95  TRP A CG  1 
ATOM   743  C CD1 . TRP A 1 95  ? -1.507  25.330  60.407  1.00 43.69  ? 95  TRP A CD1 1 
ATOM   744  C CD2 . TRP A 1 95  ? -1.458  23.152  60.910  1.00 40.09  ? 95  TRP A CD2 1 
ATOM   745  N NE1 . TRP A 1 95  ? -2.696  25.020  61.030  1.00 40.08  ? 95  TRP A NE1 1 
ATOM   746  C CE2 . TRP A 1 95  ? -2.690  23.691  61.350  1.00 40.66  ? 95  TRP A CE2 1 
ATOM   747  C CE3 . TRP A 1 95  ? -1.202  21.798  61.130  1.00 42.87  ? 95  TRP A CE3 1 
ATOM   748  C CZ2 . TRP A 1 95  ? -3.659  22.922  61.992  1.00 39.23  ? 95  TRP A CZ2 1 
ATOM   749  C CZ3 . TRP A 1 95  ? -2.174  21.031  61.762  1.00 42.21  ? 95  TRP A CZ3 1 
ATOM   750  C CH2 . TRP A 1 95  ? -3.387  21.599  62.187  1.00 40.33  ? 95  TRP A CH2 1 
ATOM   751  N N   . PHE A 1 96  ? 2.231   22.462  61.767  1.00 42.82  ? 96  PHE A N   1 
ATOM   752  C CA  . PHE A 1 96  ? 2.112   21.480  62.840  1.00 38.90  ? 96  PHE A CA  1 
ATOM   753  C C   . PHE A 1 96  ? 2.839   21.910  64.107  1.00 44.90  ? 96  PHE A C   1 
ATOM   754  O O   . PHE A 1 96  ? 2.358   21.639  65.208  1.00 49.78  ? 96  PHE A O   1 
ATOM   755  C CB  . PHE A 1 96  ? 2.605   20.117  62.366  1.00 34.50  ? 96  PHE A CB  1 
ATOM   756  C CG  . PHE A 1 96  ? 1.713   19.499  61.341  1.00 38.81  ? 96  PHE A CG  1 
ATOM   757  C CD1 . PHE A 1 96  ? 0.629   18.730  61.728  1.00 37.44  ? 96  PHE A CD1 1 
ATOM   758  C CD2 . PHE A 1 96  ? 1.924   19.731  59.989  1.00 32.96  ? 96  PHE A CD2 1 
ATOM   759  C CE1 . PHE A 1 96  ? -0.210  18.193  60.787  1.00 34.32  ? 96  PHE A CE1 1 
ATOM   760  C CE2 . PHE A 1 96  ? 1.090   19.209  59.047  1.00 28.59  ? 96  PHE A CE2 1 
ATOM   761  C CZ  . PHE A 1 96  ? 0.022   18.439  59.435  1.00 36.59  ? 96  PHE A CZ  1 
ATOM   762  N N   . ASP A 1 97  ? 3.978   22.589  63.961  1.00 45.97  ? 97  ASP A N   1 
ATOM   763  C CA  . ASP A 1 97  ? 4.734   23.072  65.125  1.00 42.17  ? 97  ASP A CA  1 
ATOM   764  C C   . ASP A 1 97  ? 3.972   24.144  65.911  1.00 46.13  ? 97  ASP A C   1 
ATOM   765  O O   . ASP A 1 97  ? 4.193   24.292  67.114  1.00 48.55  ? 97  ASP A O   1 
ATOM   766  C CB  . ASP A 1 97  ? 6.089   23.626  64.702  1.00 43.33  ? 97  ASP A CB  1 
ATOM   767  C CG  . ASP A 1 97  ? 7.035   22.550  64.223  1.00 44.88  ? 97  ASP A CG  1 
ATOM   768  O OD1 . ASP A 1 97  ? 7.385   21.664  65.029  1.00 44.14  ? 97  ASP A OD1 1 
ATOM   769  O OD2 . ASP A 1 97  ? 7.444   22.598  63.044  1.00 45.96  ? 97  ASP A OD2 1 
ATOM   770  N N   . LYS A 1 98  ? 3.099   24.888  65.224  1.00 42.56  ? 98  LYS A N   1 
ATOM   771  C CA  . LYS A 1 98  ? 2.264   25.919  65.846  1.00 45.09  ? 98  LYS A CA  1 
ATOM   772  C C   . LYS A 1 98  ? 1.029   25.320  66.509  1.00 47.89  ? 98  LYS A C   1 
ATOM   773  O O   . LYS A 1 98  ? 0.489   25.903  67.441  1.00 52.66  ? 98  LYS A O   1 
ATOM   774  C CB  . LYS A 1 98  ? 1.779   26.966  64.831  1.00 37.10  ? 98  LYS A CB  1 
ATOM   775  C CG  . LYS A 1 98  ? 2.813   27.761  64.104  1.00 42.94  ? 98  LYS A CG  1 
ATOM   776  C CD  . LYS A 1 98  ? 2.228   28.274  62.795  1.00 39.68  ? 98  LYS A CD  1 
ATOM   777  C CE  . LYS A 1 98  ? 2.710   29.667  62.438  1.00 42.83  ? 98  LYS A CE  1 
ATOM   778  N NZ  . LYS A 1 98  ? 1.587   30.428  61.793  1.00 45.08  ? 98  LYS A NZ  1 
ATOM   779  N N   . ASN A 1 99  ? 0.574   24.176  66.004  1.00 46.53  ? 99  ASN A N   1 
ATOM   780  C CA  . ASN A 1 99  ? -0.726  23.629  66.370  1.00 42.28  ? 99  ASN A CA  1 
ATOM   781  C C   . ASN A 1 99  ? -0.625  22.294  67.097  1.00 45.09  ? 99  ASN A C   1 
ATOM   782  O O   . ASN A 1 99  ? -1.438  21.390  66.893  1.00 49.10  ? 99  ASN A O   1 
ATOM   783  C CB  . ASN A 1 99  ? -1.600  23.486  65.123  1.00 34.78  ? 99  ASN A CB  1 
ATOM   784  C CG  . ASN A 1 99  ? -2.080  24.818  64.602  1.00 43.73  ? 99  ASN A CG  1 
ATOM   785  O OD1 . ASN A 1 99  ? -3.193  25.253  64.904  1.00 48.84  ? 99  ASN A OD1 1 
ATOM   786  N ND2 . ASN A 1 99  ? -1.240  25.487  63.828  1.00 43.69  ? 99  ASN A ND2 1 
ATOM   787  N N   . LYS A 1 100 ? 0.366   22.178  67.967  1.00 44.72  ? 100 LYS A N   1 
ATOM   788  C CA  . LYS A 1 100 ? 0.544   20.969  68.752  1.00 49.35  ? 100 LYS A CA  1 
ATOM   789  C C   . LYS A 1 100 ? -0.686  20.586  69.568  1.00 52.78  ? 100 LYS A C   1 
ATOM   790  O O   . LYS A 1 100 ? -0.871  19.417  69.901  1.00 62.47  ? 100 LYS A O   1 
ATOM   791  C CB  . LYS A 1 100 ? 1.746   21.134  69.673  1.00 49.49  ? 100 LYS A CB  1 
ATOM   792  C CG  . LYS A 1 100 ? 3.061   21.002  68.940  1.00 53.39  ? 100 LYS A CG  1 
ATOM   793  C CD  . LYS A 1 100 ? 3.221   19.594  68.389  1.00 50.39  ? 100 LYS A CD  1 
ATOM   794  C CE  . LYS A 1 100 ? 3.094   18.532  69.503  1.00 61.44  ? 100 LYS A CE  1 
ATOM   795  N NZ  . LYS A 1 100 ? 4.066   18.712  70.639  1.00 70.72  ? 100 LYS A NZ  1 
ATOM   796  N N   . ASP A 1 101 ? -1.527  21.563  69.887  1.00 54.77  ? 101 ASP A N   1 
ATOM   797  C CA  . ASP A 1 101 ? -2.696  21.318  70.732  1.00 57.90  ? 101 ASP A CA  1 
ATOM   798  C C   . ASP A 1 101 ? -3.902  20.827  69.937  1.00 55.98  ? 101 ASP A C   1 
ATOM   799  O O   . ASP A 1 101 ? -4.654  19.975  70.416  1.00 60.47  ? 101 ASP A O   1 
ATOM   800  C CB  . ASP A 1 101 ? -3.068  22.585  71.513  1.00 66.34  ? 101 ASP A CB  1 
ATOM   801  C CG  . ASP A 1 101 ? -2.840  22.437  73.013  1.00 73.16  ? 101 ASP A CG  1 
ATOM   802  O OD1 . ASP A 1 101 ? -1.933  21.667  73.409  1.00 75.97  ? 101 ASP A OD1 1 
ATOM   803  O OD2 . ASP A 1 101 ? -3.568  23.090  73.796  1.00 75.89  ? 101 ASP A OD2 1 
ATOM   804  N N   . VAL A 1 102 ? -4.083  21.374  68.733  1.00 56.40  ? 102 VAL A N   1 
ATOM   805  C CA  . VAL A 1 102 ? -5.142  20.963  67.802  1.00 48.27  ? 102 VAL A CA  1 
ATOM   806  C C   . VAL A 1 102 ? -4.987  19.494  67.355  1.00 50.16  ? 102 VAL A C   1 
ATOM   807  O O   . VAL A 1 102 ? -5.957  18.858  66.928  1.00 58.31  ? 102 VAL A O   1 
ATOM   808  C CB  . VAL A 1 102 ? -5.158  21.909  66.565  1.00 42.88  ? 102 VAL A CB  1 
ATOM   809  C CG1 . VAL A 1 102 ? -6.087  21.421  65.473  1.00 41.24  ? 102 VAL A CG1 1 
ATOM   810  C CG2 . VAL A 1 102 ? -5.572  23.290  66.986  1.00 44.65  ? 102 VAL A CG2 1 
ATOM   811  N N   . ILE A 1 103 ? -3.781  18.941  67.481  1.00 46.89  ? 103 ILE A N   1 
ATOM   812  C CA  . ILE A 1 103 ? -3.531  17.572  67.033  1.00 46.77  ? 103 ILE A CA  1 
ATOM   813  C C   . ILE A 1 103 ? -3.201  16.592  68.173  1.00 46.70  ? 103 ILE A C   1 
ATOM   814  O O   . ILE A 1 103 ? -3.037  15.402  67.930  1.00 46.93  ? 103 ILE A O   1 
ATOM   815  C CB  . ILE A 1 103 ? -2.375  17.524  65.989  1.00 41.92  ? 103 ILE A CB  1 
ATOM   816  C CG1 . ILE A 1 103 ? -1.029  17.826  66.657  1.00 49.02  ? 103 ILE A CG1 1 
ATOM   817  C CG2 . ILE A 1 103 ? -2.653  18.485  64.827  1.00 36.79  ? 103 ILE A CG2 1 
ATOM   818  C CD1 . ILE A 1 103 ? 0.159   17.771  65.726  1.00 44.26  ? 103 ILE A CD1 1 
ATOM   819  N N   . LYS A 1 104 ? -3.135  17.079  69.409  1.00 46.79  ? 104 LYS A N   1 
ATOM   820  C CA  . LYS A 1 104 ? -2.700  16.262  70.548  1.00 46.28  ? 104 LYS A CA  1 
ATOM   821  C C   . LYS A 1 104 ? -3.487  14.963  70.787  1.00 45.16  ? 104 LYS A C   1 
ATOM   822  O O   . LYS A 1 104 ? -2.928  13.975  71.265  1.00 50.46  ? 104 LYS A O   1 
ATOM   823  C CB  . LYS A 1 104 ? -2.748  17.102  71.829  1.00 54.54  ? 104 LYS A CB  1 
ATOM   824  C CG  . LYS A 1 104 ? -2.227  16.383  73.093  1.00 57.03  ? 104 LYS A CG  1 
ATOM   825  C CD  . LYS A 1 104 ? -1.806  17.366  74.204  1.00 61.01  ? 104 LYS A CD  1 
ATOM   826  C CE  . LYS A 1 104 ? -0.618  18.242  73.773  1.00 58.92  ? 104 LYS A CE  1 
ATOM   827  N NZ  . LYS A 1 104 ? -0.298  19.300  74.767  1.00 58.88  ? 104 LYS A NZ  1 
ATOM   828  N N   . LEU A 1 105 ? -4.777  14.959  70.471  1.00 44.61  ? 105 LEU A N   1 
ATOM   829  C CA  . LEU A 1 105 ? -5.620  13.813  70.804  1.00 41.97  ? 105 LEU A CA  1 
ATOM   830  C C   . LEU A 1 105 ? -5.180  12.549  70.094  1.00 40.86  ? 105 LEU A C   1 
ATOM   831  O O   . LEU A 1 105 ? -5.295  11.462  70.656  1.00 46.54  ? 105 LEU A O   1 
ATOM   832  C CB  . LEU A 1 105 ? -7.092  14.109  70.491  1.00 48.76  ? 105 LEU A CB  1 
ATOM   833  C CG  . LEU A 1 105 ? -7.861  14.710  71.679  1.00 44.70  ? 105 LEU A CG  1 
ATOM   834  C CD1 . LEU A 1 105 ? -9.291  15.014  71.324  1.00 37.89  ? 105 LEU A CD1 1 
ATOM   835  C CD2 . LEU A 1 105 ? -7.800  13.746  72.847  1.00 43.95  ? 105 LEU A CD2 1 
ATOM   836  N N   . TRP A 1 106 ? -4.664  12.692  68.870  1.00 48.87  ? 106 TRP A N   1 
ATOM   837  C CA  . TRP A 1 106 ? -4.173  11.549  68.091  1.00 42.61  ? 106 TRP A CA  1 
ATOM   838  C C   . TRP A 1 106 ? -2.659  11.523  67.993  1.00 43.85  ? 106 TRP A C   1 
ATOM   839  O O   . TRP A 1 106 ? -2.037  10.493  68.234  1.00 45.91  ? 106 TRP A O   1 
ATOM   840  C CB  . TRP A 1 106 ? -4.781  11.533  66.683  1.00 43.41  ? 106 TRP A CB  1 
ATOM   841  C CG  . TRP A 1 106 ? -4.895  12.851  66.007  1.00 45.60  ? 106 TRP A CG  1 
ATOM   842  C CD1 . TRP A 1 106 ? -5.762  13.866  66.319  1.00 47.86  ? 106 TRP A CD1 1 
ATOM   843  C CD2 . TRP A 1 106 ? -4.156  13.296  64.862  1.00 46.87  ? 106 TRP A CD2 1 
ATOM   844  N NE1 . TRP A 1 106 ? -5.596  14.927  65.446  1.00 49.94  ? 106 TRP A NE1 1 
ATOM   845  C CE2 . TRP A 1 106 ? -4.616  14.603  64.543  1.00 45.42  ? 106 TRP A CE2 1 
ATOM   846  C CE3 . TRP A 1 106 ? -3.135  12.734  64.092  1.00 37.63  ? 106 TRP A CE3 1 
ATOM   847  C CZ2 . TRP A 1 106 ? -4.090  15.348  63.492  1.00 38.18  ? 106 TRP A CZ2 1 
ATOM   848  C CZ3 . TRP A 1 106 ? -2.629  13.468  63.042  1.00 40.62  ? 106 TRP A CZ3 1 
ATOM   849  C CH2 . TRP A 1 106 ? -3.106  14.764  62.748  1.00 37.44  ? 106 TRP A CH2 1 
ATOM   850  N N   . ASP A 1 107 ? -2.072  12.660  67.650  1.00 40.25  ? 107 ASP A N   1 
ATOM   851  C CA  . ASP A 1 107 ? -0.625  12.777  67.535  1.00 41.76  ? 107 ASP A CA  1 
ATOM   852  C C   . ASP A 1 107 ? 0.071   12.315  68.817  1.00 46.15  ? 107 ASP A C   1 
ATOM   853  O O   . ASP A 1 107 ? 1.077   11.601  68.769  1.00 42.86  ? 107 ASP A O   1 
ATOM   854  C CB  . ASP A 1 107 ? -0.267  14.223  67.195  1.00 44.50  ? 107 ASP A CB  1 
ATOM   855  C CG  . ASP A 1 107 ? 1.218   14.471  67.113  1.00 48.59  ? 107 ASP A CG  1 
ATOM   856  O OD1 . ASP A 1 107 ? 1.972   13.586  66.649  1.00 49.81  ? 107 ASP A OD1 1 
ATOM   857  O OD2 . ASP A 1 107 ? 1.624   15.585  67.506  1.00 51.95  ? 107 ASP A OD2 1 
ATOM   858  N N   . GLY A 1 108 ? -0.496  12.700  69.958  1.00 49.75  ? 108 GLY A N   1 
ATOM   859  C CA  . GLY A 1 108 ? 0.083   12.410  71.255  1.00 42.26  ? 108 GLY A CA  1 
ATOM   860  C C   . GLY A 1 108 ? -0.198  10.993  71.680  1.00 45.48  ? 108 GLY A C   1 
ATOM   861  O O   . GLY A 1 108 ? 0.287   10.523  72.700  1.00 49.91  ? 108 GLY A O   1 
ATOM   862  N N   . LYS A 1 109 ? -1.012  10.312  70.891  1.00 48.31  ? 109 LYS A N   1 
ATOM   863  C CA  . LYS A 1 109 ? -1.339  8.921   71.159  1.00 52.88  ? 109 LYS A CA  1 
ATOM   864  C C   . LYS A 1 109 ? -1.050  8.116   69.908  1.00 51.07  ? 109 LYS A C   1 
ATOM   865  O O   . LYS A 1 109 ? -1.705  7.111   69.625  1.00 48.31  ? 109 LYS A O   1 
ATOM   866  C CB  . LYS A 1 109 ? -2.808  8.768   71.598  1.00 54.30  ? 109 LYS A CB  1 
ATOM   867  C CG  . LYS A 1 109 ? -3.020  9.025   73.104  1.00 62.56  ? 109 LYS A CG  1 
ATOM   868  C CD  . LYS A 1 109 ? -2.104  8.131   73.947  1.00 66.81  ? 109 LYS A CD  1 
ATOM   869  C CE  . LYS A 1 109 ? -2.002  8.586   75.399  1.00 72.72  ? 109 LYS A CE  1 
ATOM   870  N NZ  . LYS A 1 109 ? -1.065  7.706   76.175  1.00 66.57  ? 109 LYS A NZ  1 
ATOM   871  N N   . TYR A 1 110 ? -0.055  8.584   69.160  1.00 51.17  ? 110 TYR A N   1 
ATOM   872  C CA  . TYR A 1 110 ? 0.277   7.995   67.877  1.00 46.84  ? 110 TYR A CA  1 
ATOM   873  C C   . TYR A 1 110 ? 0.693   6.549   68.041  1.00 43.78  ? 110 TYR A C   1 
ATOM   874  O O   . TYR A 1 110 ? 0.214   5.678   67.325  1.00 44.77  ? 110 TYR A O   1 
ATOM   875  C CB  . TYR A 1 110 ? 1.394   8.787   67.174  1.00 48.10  ? 110 TYR A CB  1 
ATOM   876  C CG  . TYR A 1 110 ? 1.638   8.322   65.748  1.00 42.32  ? 110 TYR A CG  1 
ATOM   877  C CD1 . TYR A 1 110 ? 0.899   8.846   64.685  1.00 35.88  ? 110 TYR A CD1 1 
ATOM   878  C CD2 . TYR A 1 110 ? 2.577   7.349   65.471  1.00 34.26  ? 110 TYR A CD2 1 
ATOM   879  C CE1 . TYR A 1 110 ? 1.103   8.414   63.383  1.00 38.19  ? 110 TYR A CE1 1 
ATOM   880  C CE2 . TYR A 1 110 ? 2.784   6.912   64.175  1.00 47.25  ? 110 TYR A CE2 1 
ATOM   881  C CZ  . TYR A 1 110 ? 2.046   7.444   63.135  1.00 42.33  ? 110 TYR A CZ  1 
ATOM   882  O OH  . TYR A 1 110 ? 2.264   7.005   61.856  1.00 36.86  ? 110 TYR A OH  1 
ATOM   883  N N   . SER A 1 111 ? 1.588   6.311   68.987  1.00 43.48  ? 111 SER A N   1 
ATOM   884  C CA  . SER A 1 111 ? 2.142   4.990   69.204  1.00 44.98  ? 111 SER A CA  1 
ATOM   885  C C   . SER A 1 111 ? 1.033   3.978   69.486  1.00 46.26  ? 111 SER A C   1 
ATOM   886  O O   . SER A 1 111 ? 1.092   2.829   69.035  1.00 51.61  ? 111 SER A O   1 
ATOM   887  C CB  . SER A 1 111 ? 3.152   5.033   70.349  1.00 44.40  ? 111 SER A CB  1 
ATOM   888  O OG  . SER A 1 111 ? 3.755   3.770   70.541  1.00 56.35  ? 111 SER A OG  1 
ATOM   889  N N   . ASP A 1 112 ? 0.018   4.418   70.219  1.00 42.91  ? 112 ASP A N   1 
ATOM   890  C CA  . ASP A 1 112 ? -1.130  3.576   70.531  1.00 47.89  ? 112 ASP A CA  1 
ATOM   891  C C   . ASP A 1 112 ? -2.006  3.303   69.287  1.00 45.17  ? 112 ASP A C   1 
ATOM   892  O O   . ASP A 1 112 ? -2.527  2.204   69.122  1.00 44.84  ? 112 ASP A O   1 
ATOM   893  C CB  . ASP A 1 112 ? -1.961  4.225   71.654  1.00 51.86  ? 112 ASP A CB  1 
ATOM   894  C CG  . ASP A 1 112 ? -3.250  3.451   71.978  1.00 60.06  ? 112 ASP A CG  1 
ATOM   895  O OD1 . ASP A 1 112 ? -3.184  2.217   72.215  1.00 61.68  ? 112 ASP A OD1 1 
ATOM   896  O OD2 . ASP A 1 112 ? -4.335  4.089   71.997  1.00 52.79  ? 112 ASP A OD2 1 
ATOM   897  N N   . LEU A 1 113 ? -2.158  4.295   68.411  1.00 46.89  ? 113 LEU A N   1 
ATOM   898  C CA  . LEU A 1 113 ? -3.070  4.186   67.266  1.00 44.07  ? 113 LEU A CA  1 
ATOM   899  C C   . LEU A 1 113 ? -2.457  3.400   66.113  1.00 46.67  ? 113 LEU A C   1 
ATOM   900  O O   . LEU A 1 113 ? -3.143  3.099   65.127  1.00 45.09  ? 113 LEU A O   1 
ATOM   901  C CB  . LEU A 1 113 ? -3.504  5.576   66.783  1.00 43.64  ? 113 LEU A CB  1 
ATOM   902  C CG  . LEU A 1 113 ? -4.429  6.321   67.753  1.00 41.21  ? 113 LEU A CG  1 
ATOM   903  C CD1 . LEU A 1 113 ? -4.908  7.656   67.198  1.00 42.59  ? 113 LEU A CD1 1 
ATOM   904  C CD2 . LEU A 1 113 ? -5.609  5.443   68.077  1.00 39.31  ? 113 LEU A CD2 1 
ATOM   905  N N   . MET A 1 114 ? -1.170  3.074   66.246  1.00 40.49  ? 114 MET A N   1 
ATOM   906  C CA  . MET A 1 114 ? -0.522  2.082   65.394  1.00 41.96  ? 114 MET A CA  1 
ATOM   907  C C   . MET A 1 114 ? -1.026  0.662   65.679  1.00 47.07  ? 114 MET A C   1 
ATOM   908  O O   . MET A 1 114 ? -0.791  -0.253  64.899  1.00 51.56  ? 114 MET A O   1 
ATOM   909  C CB  . MET A 1 114 ? 0.997   2.120   65.584  1.00 43.17  ? 114 MET A CB  1 
ATOM   910  C CG  . MET A 1 114 ? 1.676   3.370   65.053  1.00 42.20  ? 114 MET A CG  1 
ATOM   911  S SD  . MET A 1 114 ? 3.321   3.585   65.742  1.00 43.22  ? 114 MET A SD  1 
ATOM   912  C CE  . MET A 1 114 ? 4.110   2.129   65.062  1.00 45.76  ? 114 MET A CE  1 
ATOM   913  N N   . LYS A 1 115 ? -1.707  0.479   66.810  1.00 52.41  ? 115 LYS A N   1 
ATOM   914  C CA  . LYS A 1 115 ? -2.084  -0.858  67.268  1.00 50.22  ? 115 LYS A CA  1 
ATOM   915  C C   . LYS A 1 115 ? -3.570  -1.031  67.538  1.00 45.29  ? 115 LYS A C   1 
ATOM   916  O O   . LYS A 1 115 ? -4.074  -2.132  67.392  1.00 52.76  ? 115 LYS A O   1 
ATOM   917  C CB  . LYS A 1 115 ? -1.295  -1.220  68.525  1.00 53.77  ? 115 LYS A CB  1 
ATOM   918  C CG  . LYS A 1 115 ? 0.213   -1.155  68.337  1.00 53.49  ? 115 LYS A CG  1 
ATOM   919  C CD  . LYS A 1 115 ? 0.937   -1.425  69.639  1.00 59.61  ? 115 LYS A CD  1 
ATOM   920  C CE  . LYS A 1 115 ? 0.367   -0.604  70.764  1.00 48.78  ? 115 LYS A CE  1 
ATOM   921  N NZ  . LYS A 1 115 ? 1.232   -0.690  71.975  1.00 58.91  ? 115 LYS A NZ  1 
ATOM   922  N N   . ASN A 1 116 ? -4.272  0.044   67.902  1.00 46.38  ? 116 ASN A N   1 
ATOM   923  C CA  . ASN A 1 116 ? -5.708  -0.040  68.228  1.00 47.65  ? 116 ASN A CA  1 
ATOM   924  C C   . ASN A 1 116 ? -6.638  0.985   67.541  1.00 44.97  ? 116 ASN A C   1 
ATOM   925  O O   . ASN A 1 116 ? -6.231  2.086   67.180  1.00 43.86  ? 116 ASN A O   1 
ATOM   926  C CB  . ASN A 1 116 ? -5.887  0.071   69.743  1.00 43.10  ? 116 ASN A CB  1 
ATOM   927  C CG  . ASN A 1 116 ? -5.059  -0.955  70.500  1.00 54.43  ? 116 ASN A CG  1 
ATOM   928  O OD1 . ASN A 1 116 ? -5.386  -2.142  70.502  1.00 58.05  ? 116 ASN A OD1 1 
ATOM   929  N ND2 . ASN A 1 116 ? -3.981  -0.503  71.148  1.00 49.24  ? 116 ASN A ND2 1 
ATOM   930  N N   . VAL A 1 117 ? -7.895  0.597   67.366  1.00 43.19  ? 117 VAL A N   1 
ATOM   931  C CA  . VAL A 1 117 ? -8.924  1.460   66.783  1.00 46.89  ? 117 VAL A CA  1 
ATOM   932  C C   . VAL A 1 117 ? -9.119  2.756   67.587  1.00 51.36  ? 117 VAL A C   1 
ATOM   933  O O   . VAL A 1 117 ? -9.138  2.723   68.811  1.00 59.91  ? 117 VAL A O   1 
ATOM   934  C CB  . VAL A 1 117 ? -10.238 0.682   66.701  1.00 47.45  ? 117 VAL A CB  1 
ATOM   935  C CG1 . VAL A 1 117 ? -11.364 1.530   66.131  1.00 43.89  ? 117 VAL A CG1 1 
ATOM   936  C CG2 . VAL A 1 117 ? -10.007 -0.590  65.897  1.00 45.57  ? 117 VAL A CG2 1 
ATOM   937  N N   . PRO A 1 118 ? -9.241  3.910   66.912  1.00 47.08  ? 118 PRO A N   1 
ATOM   938  C CA  . PRO A 1 118 ? -9.297  5.151   67.685  1.00 46.10  ? 118 PRO A CA  1 
ATOM   939  C C   . PRO A 1 118 ? -10.660 5.416   68.346  1.00 48.71  ? 118 PRO A C   1 
ATOM   940  O O   . PRO A 1 118 ? -11.669 4.832   67.957  1.00 52.07  ? 118 PRO A O   1 
ATOM   941  C CB  . PRO A 1 118 ? -9.005  6.211   66.629  1.00 39.29  ? 118 PRO A CB  1 
ATOM   942  C CG  . PRO A 1 118 ? -9.538  5.639   65.399  1.00 37.42  ? 118 PRO A CG  1 
ATOM   943  C CD  . PRO A 1 118 ? -9.265  4.176   65.466  1.00 38.82  ? 118 PRO A CD  1 
ATOM   944  N N   . GLU A 1 119 ? -10.682 6.294   69.341  1.00 47.78  ? 119 GLU A N   1 
ATOM   945  C CA  . GLU A 1 119 ? -11.933 6.744   69.942  1.00 46.29  ? 119 GLU A CA  1 
ATOM   946  C C   . GLU A 1 119 ? -12.542 7.802   69.042  1.00 43.28  ? 119 GLU A C   1 
ATOM   947  O O   . GLU A 1 119 ? -11.830 8.422   68.268  1.00 42.52  ? 119 GLU A O   1 
ATOM   948  C CB  . GLU A 1 119 ? -11.690 7.311   71.337  1.00 50.53  ? 119 GLU A CB  1 
ATOM   949  C CG  . GLU A 1 119 ? -10.541 6.651   72.097  1.00 57.86  ? 119 GLU A CG  1 
ATOM   950  C CD  . GLU A 1 119 ? -10.948 5.359   72.800  1.00 62.24  ? 119 GLU A CD  1 
ATOM   951  O OE1 . GLU A 1 119 ? -12.118 4.914   72.648  1.00 55.26  ? 119 GLU A OE1 1 
ATOM   952  O OE2 . GLU A 1 119 ? -10.082 4.802   73.514  1.00 66.56  ? 119 GLU A OE2 1 
ATOM   953  N N   . PRO A 1 120 ? -13.859 8.019   69.138  1.00 44.38  ? 120 PRO A N   1 
ATOM   954  C CA  . PRO A 1 120 ? -14.486 8.999   68.245  1.00 45.05  ? 120 PRO A CA  1 
ATOM   955  C C   . PRO A 1 120 ? -13.850 10.387  68.304  1.00 43.46  ? 120 PRO A C   1 
ATOM   956  O O   . PRO A 1 120 ? -13.709 11.023  67.272  1.00 45.94  ? 120 PRO A O   1 
ATOM   957  C CB  . PRO A 1 120 ? -15.927 9.051   68.744  1.00 41.63  ? 120 PRO A CB  1 
ATOM   958  C CG  . PRO A 1 120 ? -16.153 7.719   69.328  1.00 45.43  ? 120 PRO A CG  1 
ATOM   959  C CD  . PRO A 1 120 ? -14.853 7.305   69.950  1.00 43.62  ? 120 PRO A CD  1 
ATOM   960  N N   . GLU A 1 121 ? -13.462 10.844  69.485  1.00 45.10  ? 121 GLU A N   1 
ATOM   961  C CA  . GLU A 1 121 ? -12.982 12.211  69.617  1.00 44.47  ? 121 GLU A CA  1 
ATOM   962  C C   . GLU A 1 121 ? -11.626 12.402  68.904  1.00 42.69  ? 121 GLU A C   1 
ATOM   963  O O   . GLU A 1 121 ? -11.300 13.510  68.456  1.00 37.41  ? 121 GLU A O   1 
ATOM   964  C CB  . GLU A 1 121 ? -12.905 12.615  71.105  1.00 40.96  ? 121 GLU A CB  1 
ATOM   965  C CG  . GLU A 1 121 ? -11.886 11.863  71.954  1.00 42.50  ? 121 GLU A CG  1 
ATOM   966  C CD  . GLU A 1 121 ? -12.443 10.607  72.593  1.00 47.76  ? 121 GLU A CD  1 
ATOM   967  O OE1 . GLU A 1 121 ? -13.443 10.054  72.071  1.00 40.70  ? 121 GLU A OE1 1 
ATOM   968  O OE2 . GLU A 1 121 ? -11.864 10.166  73.615  1.00 52.88  ? 121 GLU A OE2 1 
ATOM   969  N N   . GLN A 1 122 ? -10.857 11.324  68.782  1.00 37.53  ? 122 GLN A N   1 
ATOM   970  C CA  . GLN A 1 122 ? -9.619  11.356  68.006  1.00 37.16  ? 122 GLN A CA  1 
ATOM   971  C C   . GLN A 1 122 ? -9.875  11.567  66.513  1.00 43.52  ? 122 GLN A C   1 
ATOM   972  O O   . GLN A 1 122 ? -9.109  12.258  65.831  1.00 44.98  ? 122 GLN A O   1 
ATOM   973  C CB  . GLN A 1 122 ? -8.828  10.078  68.219  1.00 31.46  ? 122 GLN A CB  1 
ATOM   974  C CG  . GLN A 1 122 ? -7.916  10.145  69.414  1.00 39.68  ? 122 GLN A CG  1 
ATOM   975  C CD  . GLN A 1 122 ? -7.420  8.787   69.855  1.00 41.73  ? 122 GLN A CD  1 
ATOM   976  O OE1 . GLN A 1 122 ? -8.128  7.772   69.721  1.00 38.00  ? 122 GLN A OE1 1 
ATOM   977  N NE2 . GLN A 1 122 ? -6.197  8.755   70.393  1.00 35.62  ? 122 GLN A NE2 1 
ATOM   978  N N   . LEU A 1 123 ? -10.954 10.974  66.012  1.00 39.67  ? 123 LEU A N   1 
ATOM   979  C CA  . LEU A 1 123 ? -11.388 11.188  64.639  1.00 39.39  ? 123 LEU A CA  1 
ATOM   980  C C   . LEU A 1 123 ? -11.969 12.608  64.439  1.00 45.88  ? 123 LEU A C   1 
ATOM   981  O O   . LEU A 1 123 ? -11.690 13.265  63.423  1.00 46.28  ? 123 LEU A O   1 
ATOM   982  C CB  . LEU A 1 123 ? -12.424 10.135  64.236  1.00 40.64  ? 123 LEU A CB  1 
ATOM   983  C CG  . LEU A 1 123 ? -12.069 8.651   64.363  1.00 41.04  ? 123 LEU A CG  1 
ATOM   984  C CD1 . LEU A 1 123 ? -13.280 7.813   64.019  1.00 46.65  ? 123 LEU A CD1 1 
ATOM   985  C CD2 . LEU A 1 123 ? -10.921 8.271   63.469  1.00 37.84  ? 123 LEU A CD2 1 
ATOM   986  N N   . VAL A 1 124 ? -12.773 13.081  65.395  1.00 40.41  ? 124 VAL A N   1 
ATOM   987  C CA  . VAL A 1 124 ? -13.286 14.454  65.345  1.00 39.77  ? 124 VAL A CA  1 
ATOM   988  C C   . VAL A 1 124 ? -12.127 15.464  65.365  1.00 39.25  ? 124 VAL A C   1 
ATOM   989  O O   . VAL A 1 124 ? -12.154 16.484  64.667  1.00 41.95  ? 124 VAL A O   1 
ATOM   990  C CB  . VAL A 1 124 ? -14.254 14.762  66.528  1.00 38.00  ? 124 VAL A CB  1 
ATOM   991  C CG1 . VAL A 1 124 ? -14.804 16.163  66.413  1.00 37.09  ? 124 VAL A CG1 1 
ATOM   992  C CG2 . VAL A 1 124 ? -15.397 13.770  66.564  1.00 41.54  ? 124 VAL A CG2 1 
ATOM   993  N N   . ALA A 1 125 ? -11.110 15.172  66.162  1.00 29.81  ? 125 ALA A N   1 
ATOM   994  C CA  . ALA A 1 125 ? -9.961  16.041  66.245  1.00 34.54  ? 125 ALA A CA  1 
ATOM   995  C C   . ALA A 1 125 ? -9.226  16.085  64.904  1.00 40.52  ? 125 ALA A C   1 
ATOM   996  O O   . ALA A 1 125 ? -8.922  17.160  64.405  1.00 41.36  ? 125 ALA A O   1 
ATOM   997  C CB  . ALA A 1 125 ? -9.028  15.592  67.358  1.00 34.06  ? 125 ALA A CB  1 
ATOM   998  N N   . TYR A 1 126 ? -8.957  14.919  64.324  1.00 41.17  ? 126 TYR A N   1 
ATOM   999  C CA  . TYR A 1 126 ? -8.243  14.835  63.056  1.00 40.46  ? 126 TYR A CA  1 
ATOM   1000 C C   . TYR A 1 126 ? -8.953  15.580  61.927  1.00 39.39  ? 126 TYR A C   1 
ATOM   1001 O O   . TYR A 1 126 ? -8.305  16.284  61.159  1.00 38.60  ? 126 TYR A O   1 
ATOM   1002 C CB  . TYR A 1 126 ? -8.037  13.364  62.643  1.00 45.19  ? 126 TYR A CB  1 
ATOM   1003 C CG  . TYR A 1 126 ? -7.504  13.206  61.228  1.00 37.77  ? 126 TYR A CG  1 
ATOM   1004 C CD1 . TYR A 1 126 ? -6.143  13.295  60.957  1.00 34.89  ? 126 TYR A CD1 1 
ATOM   1005 C CD2 . TYR A 1 126 ? -8.368  12.995  60.157  1.00 40.85  ? 126 TYR A CD2 1 
ATOM   1006 C CE1 . TYR A 1 126 ? -5.660  13.161  59.659  1.00 31.14  ? 126 TYR A CE1 1 
ATOM   1007 C CE2 . TYR A 1 126 ? -7.895  12.873  58.867  1.00 35.19  ? 126 TYR A CE2 1 
ATOM   1008 C CZ  . TYR A 1 126 ? -6.541  12.956  58.619  1.00 29.38  ? 126 TYR A CZ  1 
ATOM   1009 O OH  . TYR A 1 126 ? -6.077  12.825  57.322  1.00 29.78  ? 126 TYR A OH  1 
ATOM   1010 N N   . GLN A 1 127 ? -10.270 15.416  61.806  1.00 41.42  ? 127 GLN A N   1 
ATOM   1011 C CA  . GLN A 1 127 ? -11.017 16.051  60.706  1.00 41.15  ? 127 GLN A CA  1 
ATOM   1012 C C   . GLN A 1 127 ? -11.130 17.555  60.838  1.00 39.53  ? 127 GLN A C   1 
ATOM   1013 O O   . GLN A 1 127 ? -11.235 18.277  59.854  1.00 39.55  ? 127 GLN A O   1 
ATOM   1014 C CB  . GLN A 1 127 ? -12.422 15.485  60.611  1.00 44.07  ? 127 GLN A CB  1 
ATOM   1015 C CG  . GLN A 1 127 ? -12.472 14.044  60.228  1.00 47.72  ? 127 GLN A CG  1 
ATOM   1016 C CD  . GLN A 1 127 ? -11.882 13.800  58.877  1.00 44.22  ? 127 GLN A CD  1 
ATOM   1017 O OE1 . GLN A 1 127 ? -11.984 14.638  57.965  1.00 43.55  ? 127 GLN A OE1 1 
ATOM   1018 N NE2 . GLN A 1 127 ? -11.255 12.651  58.729  1.00 35.84  ? 127 GLN A NE2 1 
ATOM   1019 N N   . ARG A 1 128 ? -11.152 18.031  62.068  1.00 46.53  ? 128 ARG A N   1 
ATOM   1020 C CA  . ARG A 1 128 ? -11.245 19.458  62.283  1.00 47.87  ? 128 ARG A CA  1 
ATOM   1021 C C   . ARG A 1 128 ? -9.856  20.078  62.151  1.00 42.44  ? 128 ARG A C   1 
ATOM   1022 O O   . ARG A 1 128 ? -9.716  21.178  61.589  1.00 40.35  ? 128 ARG A O   1 
ATOM   1023 C CB  . ARG A 1 128 ? -11.904 19.752  63.636  1.00 47.02  ? 128 ARG A CB  1 
ATOM   1024 C CG  . ARG A 1 128 ? -13.398 19.390  63.619  1.00 56.37  ? 128 ARG A CG  1 
ATOM   1025 C CD  . ARG A 1 128 ? -14.166 19.931  64.812  1.00 58.69  ? 128 ARG A CD  1 
ATOM   1026 N NE  . ARG A 1 128 ? -13.485 19.628  66.069  1.00 68.06  ? 128 ARG A NE  1 
ATOM   1027 C CZ  . ARG A 1 128 ? -14.098 19.427  67.234  1.00 66.64  ? 128 ARG A CZ  1 
ATOM   1028 N NH1 . ARG A 1 128 ? -15.428 19.480  67.314  1.00 52.58  ? 128 ARG A NH1 1 
ATOM   1029 N NH2 . ARG A 1 128 ? -13.371 19.161  68.319  1.00 61.75  ? 128 ARG A NH2 1 
ATOM   1030 N N   . ALA A 1 129 ? -8.839  19.354  62.630  1.00 36.19  ? 129 ALA A N   1 
ATOM   1031 C CA  . ALA A 1 129 ? -7.435  19.720  62.406  1.00 35.87  ? 129 ALA A CA  1 
ATOM   1032 C C   . ALA A 1 129 ? -7.159  19.945  60.915  1.00 35.48  ? 129 ALA A C   1 
ATOM   1033 O O   . ALA A 1 129 ? -6.598  20.963  60.530  1.00 36.35  ? 129 ALA A O   1 
ATOM   1034 C CB  . ALA A 1 129 ? -6.513  18.657  62.952  1.00 35.30  ? 129 ALA A CB  1 
ATOM   1035 N N   . ALA A 1 130 ? -7.597  19.003  60.084  1.00 35.05  ? 130 ALA A N   1 
ATOM   1036 C CA  . ALA A 1 130 ? -7.452  19.092  58.638  1.00 28.58  ? 130 ALA A CA  1 
ATOM   1037 C C   . ALA A 1 130 ? -8.100  20.338  58.075  1.00 35.88  ? 130 ALA A C   1 
ATOM   1038 O O   . ALA A 1 130 ? -7.574  20.967  57.157  1.00 37.05  ? 130 ALA A O   1 
ATOM   1039 C CB  . ALA A 1 130 ? -8.042  17.861  57.976  1.00 29.48  ? 130 ALA A CB  1 
ATOM   1040 N N   . GLN A 1 131 ? -9.266  20.694  58.601  1.00 44.71  ? 131 GLN A N   1 
ATOM   1041 C CA  . GLN A 1 131 ? -9.956  21.861  58.074  1.00 40.22  ? 131 GLN A CA  1 
ATOM   1042 C C   . GLN A 1 131 ? -9.156  23.093  58.455  1.00 36.96  ? 131 GLN A C   1 
ATOM   1043 O O   . GLN A 1 131 ? -8.994  24.004  57.641  1.00 38.35  ? 131 GLN A O   1 
ATOM   1044 C CB  . GLN A 1 131 ? -11.402 21.946  58.579  1.00 36.56  ? 131 GLN A CB  1 
ATOM   1045 C CG  . GLN A 1 131 ? -12.391 21.141  57.737  1.00 42.23  ? 131 GLN A CG  1 
ATOM   1046 C CD  . GLN A 1 131 ? -12.386 21.556  56.265  1.00 42.56  ? 131 GLN A CD  1 
ATOM   1047 O OE1 . GLN A 1 131 ? -12.629 22.719  55.933  1.00 48.40  ? 131 GLN A OE1 1 
ATOM   1048 N NE2 . GLN A 1 131 ? -12.098 20.608  55.383  1.00 34.13  ? 131 GLN A NE2 1 
ATOM   1049 N N   . LYS A 1 132 ? -8.635  23.104  59.681  1.00 36.92  ? 132 LYS A N   1 
ATOM   1050 C CA  . LYS A 1 132 ? -7.880  24.260  60.159  1.00 36.09  ? 132 LYS A CA  1 
ATOM   1051 C C   . LYS A 1 132 ? -6.671  24.472  59.246  1.00 39.37  ? 132 LYS A C   1 
ATOM   1052 O O   . LYS A 1 132 ? -6.457  25.577  58.733  1.00 36.21  ? 132 LYS A O   1 
ATOM   1053 C CB  . LYS A 1 132 ? -7.455  24.076  61.607  1.00 31.58  ? 132 LYS A CB  1 
ATOM   1054 C CG  . LYS A 1 132 ? -7.075  25.357  62.314  1.00 33.23  ? 132 LYS A CG  1 
ATOM   1055 C CD  . LYS A 1 132 ? -6.734  25.056  63.769  1.00 38.02  ? 132 LYS A CD  1 
ATOM   1056 C CE  . LYS A 1 132 ? -6.392  26.292  64.552  1.00 34.47  ? 132 LYS A CE  1 
ATOM   1057 N NZ  . LYS A 1 132 ? -5.220  27.009  63.951  1.00 42.88  ? 132 LYS A NZ  1 
ATOM   1058 N N   . TRP A 1 133 ? -5.927  23.391  59.015  1.00 36.72  ? 133 TRP A N   1 
ATOM   1059 C CA  . TRP A 1 133 ? -4.823  23.368  58.062  1.00 33.48  ? 133 TRP A CA  1 
ATOM   1060 C C   . TRP A 1 133 ? -5.177  24.017  56.711  1.00 37.12  ? 133 TRP A C   1 
ATOM   1061 O O   . TRP A 1 133 ? -4.473  24.924  56.247  1.00 36.84  ? 133 TRP A O   1 
ATOM   1062 C CB  . TRP A 1 133 ? -4.364  21.924  57.862  1.00 33.70  ? 133 TRP A CB  1 
ATOM   1063 C CG  . TRP A 1 133 ? -2.995  21.818  57.257  1.00 37.19  ? 133 TRP A CG  1 
ATOM   1064 C CD1 . TRP A 1 133 ? -1.790  21.865  57.918  1.00 32.65  ? 133 TRP A CD1 1 
ATOM   1065 C CD2 . TRP A 1 133 ? -2.685  21.674  55.863  1.00 29.71  ? 133 TRP A CD2 1 
ATOM   1066 N NE1 . TRP A 1 133 ? -0.757  21.756  57.011  1.00 32.99  ? 133 TRP A NE1 1 
ATOM   1067 C CE2 . TRP A 1 133 ? -1.279  21.650  55.743  1.00 25.45  ? 133 TRP A CE2 1 
ATOM   1068 C CE3 . TRP A 1 133 ? -3.464  21.561  54.704  1.00 25.61  ? 133 TRP A CE3 1 
ATOM   1069 C CZ2 . TRP A 1 133 ? -0.633  21.502  54.522  1.00 29.46  ? 133 TRP A CZ2 1 
ATOM   1070 C CZ3 . TRP A 1 133 ? -2.819  21.419  53.483  1.00 32.09  ? 133 TRP A CZ3 1 
ATOM   1071 C CH2 . TRP A 1 133 ? -1.411  21.393  53.400  1.00 26.87  ? 133 TRP A CH2 1 
ATOM   1072 N N   . ARG A 1 134 ? -6.283  23.587  56.106  1.00 32.73  ? 134 ARG A N   1 
ATOM   1073 C CA  . ARG A 1 134 ? -6.681  24.096  54.798  1.00 31.33  ? 134 ARG A CA  1 
ATOM   1074 C C   . ARG A 1 134 ? -7.112  25.569  54.816  1.00 39.23  ? 134 ARG A C   1 
ATOM   1075 O O   . ARG A 1 134 ? -7.016  26.277  53.809  1.00 43.15  ? 134 ARG A O   1 
ATOM   1076 C CB  . ARG A 1 134 ? -7.809  23.247  54.233  1.00 29.58  ? 134 ARG A CB  1 
ATOM   1077 C CG  . ARG A 1 134 ? -7.508  21.785  54.137  1.00 31.33  ? 134 ARG A CG  1 
ATOM   1078 C CD  . ARG A 1 134 ? -8.687  21.060  53.536  1.00 30.62  ? 134 ARG A CD  1 
ATOM   1079 N NE  . ARG A 1 134 ? -8.289  19.809  52.903  1.00 29.30  ? 134 ARG A NE  1 
ATOM   1080 C CZ  . ARG A 1 134 ? -8.404  19.569  51.606  1.00 34.72  ? 134 ARG A CZ  1 
ATOM   1081 N NH1 . ARG A 1 134 ? -8.912  20.504  50.795  1.00 33.69  ? 134 ARG A NH1 1 
ATOM   1082 N NH2 . ARG A 1 134 ? -8.013  18.398  51.114  1.00 32.97  ? 134 ARG A NH2 1 
ATOM   1083 N N   . GLN A 1 135 ? -7.624  26.021  55.951  1.00 42.41  ? 135 GLN A N   1 
ATOM   1084 C CA  . GLN A 1 135 ? -7.890  27.442  56.141  1.00 43.20  ? 135 GLN A CA  1 
ATOM   1085 C C   . GLN A 1 135 ? -6.560  28.166  56.414  1.00 39.02  ? 135 GLN A C   1 
ATOM   1086 O O   . GLN A 1 135 ? -6.153  29.019  55.633  1.00 39.13  ? 135 GLN A O   1 
ATOM   1087 C CB  . GLN A 1 135 ? -8.911  27.661  57.275  1.00 33.90  ? 135 GLN A CB  1 
ATOM   1088 C CG  . GLN A 1 135 ? -10.376 27.597  56.797  1.00 50.54  ? 135 GLN A CG  1 
ATOM   1089 C CD  . GLN A 1 135 ? -11.356 27.015  57.826  1.00 48.05  ? 135 GLN A CD  1 
ATOM   1090 O OE1 . GLN A 1 135 ? -11.284 27.308  59.023  1.00 48.97  ? 135 GLN A OE1 1 
ATOM   1091 N NE2 . GLN A 1 135 ? -12.286 26.195  57.349  1.00 45.52  ? 135 GLN A NE2 1 
ATOM   1092 N N   . ASP A 1 136 ? -5.869  27.784  57.487  1.00 31.33  ? 136 ASP A N   1 
ATOM   1093 C CA  . ASP A 1 136 ? -4.625  28.442  57.872  1.00 36.28  ? 136 ASP A CA  1 
ATOM   1094 C C   . ASP A 1 136 ? -3.639  28.575  56.707  1.00 44.55  ? 136 ASP A C   1 
ATOM   1095 O O   . ASP A 1 136 ? -3.017  29.633  56.541  1.00 47.27  ? 136 ASP A O   1 
ATOM   1096 C CB  . ASP A 1 136 ? -3.951  27.702  59.036  1.00 32.02  ? 136 ASP A CB  1 
ATOM   1097 C CG  . ASP A 1 136 ? -4.666  27.921  60.346  1.00 37.66  ? 136 ASP A CG  1 
ATOM   1098 O OD1 . ASP A 1 136 ? -5.722  28.593  60.304  1.00 38.26  ? 136 ASP A OD1 1 
ATOM   1099 O OD2 . ASP A 1 136 ? -4.186  27.438  61.403  1.00 34.55  ? 136 ASP A OD2 1 
ATOM   1100 N N   . ASN A 1 137 ? -3.518  27.529  55.888  1.00 37.40  ? 137 ASN A N   1 
ATOM   1101 C CA  . ASN A 1 137 ? -2.509  27.526  54.843  1.00 32.51  ? 137 ASN A CA  1 
ATOM   1102 C C   . ASN A 1 137 ? -3.061  27.946  53.492  1.00 37.10  ? 137 ASN A C   1 
ATOM   1103 O O   . ASN A 1 137 ? -2.342  27.974  52.491  1.00 41.04  ? 137 ASN A O   1 
ATOM   1104 C CB  . ASN A 1 137 ? -1.851  26.151  54.784  1.00 33.27  ? 137 ASN A CB  1 
ATOM   1105 C CG  . ASN A 1 137 ? -0.971  25.900  56.005  1.00 41.35  ? 137 ASN A CG  1 
ATOM   1106 O OD1 . ASN A 1 137 ? -0.205  26.775  56.398  1.00 43.18  ? 137 ASN A OD1 1 
ATOM   1107 N ND2 . ASN A 1 137 ? -1.116  24.742  56.636  1.00 34.75  ? 137 ASN A ND2 1 
ATOM   1108 N N   . LYS A 1 138 ? -4.337  28.300  53.476  1.00 33.84  ? 138 LYS A N   1 
ATOM   1109 C CA  . LYS A 1 138 ? -4.959  28.875  52.284  1.00 42.36  ? 138 LYS A CA  1 
ATOM   1110 C C   . LYS A 1 138 ? -4.926  27.891  51.132  1.00 36.86  ? 138 LYS A C   1 
ATOM   1111 O O   . LYS A 1 138 ? -4.775  28.262  49.966  1.00 36.60  ? 138 LYS A O   1 
ATOM   1112 C CB  . LYS A 1 138 ? -4.270  30.185  51.886  1.00 44.68  ? 138 LYS A CB  1 
ATOM   1113 C CG  . LYS A 1 138 ? -4.285  31.266  52.959  1.00 36.74  ? 138 LYS A CG  1 
ATOM   1114 C CD  . LYS A 1 138 ? -3.806  32.576  52.371  1.00 46.68  ? 138 LYS A CD  1 
ATOM   1115 C CE  . LYS A 1 138 ? -4.095  33.720  53.307  1.00 55.84  ? 138 LYS A CE  1 
ATOM   1116 N NZ  . LYS A 1 138 ? -5.511  33.670  53.774  1.00 55.38  ? 138 LYS A NZ  1 
ATOM   1117 N N   . PHE A 1 139 ? -5.106  26.625  51.468  1.00 36.25  ? 139 PHE A N   1 
ATOM   1118 C CA  . PHE A 1 139 ? -4.964  25.583  50.481  1.00 36.55  ? 139 PHE A CA  1 
ATOM   1119 C C   . PHE A 1 139 ? -6.096  25.550  49.439  1.00 38.29  ? 139 PHE A C   1 
ATOM   1120 O O   . PHE A 1 139 ? -5.855  25.228  48.272  1.00 42.83  ? 139 PHE A O   1 
ATOM   1121 C CB  . PHE A 1 139 ? -4.847  24.226  51.173  1.00 38.58  ? 139 PHE A CB  1 
ATOM   1122 C CG  . PHE A 1 139 ? -4.650  23.103  50.214  1.00 39.16  ? 139 PHE A CG  1 
ATOM   1123 C CD1 . PHE A 1 139 ? -3.386  22.803  49.738  1.00 36.12  ? 139 PHE A CD1 1 
ATOM   1124 C CD2 . PHE A 1 139 ? -5.735  22.375  49.748  1.00 31.23  ? 139 PHE A CD2 1 
ATOM   1125 C CE1 . PHE A 1 139 ? -3.214  21.793  48.831  1.00 32.53  ? 139 PHE A CE1 1 
ATOM   1126 C CE2 . PHE A 1 139 ? -5.558  21.363  48.848  1.00 29.96  ? 139 PHE A CE2 1 
ATOM   1127 C CZ  . PHE A 1 139 ? -4.299  21.073  48.387  1.00 29.49  ? 139 PHE A CZ  1 
ATOM   1128 N N   . GLU A 1 140 ? -7.325  25.867  49.833  1.00 35.68  ? 140 GLU A N   1 
ATOM   1129 C CA  . GLU A 1 140 ? -8.446  25.666  48.911  1.00 36.73  ? 140 GLU A CA  1 
ATOM   1130 C C   . GLU A 1 140 ? -8.587  26.826  47.944  1.00 42.86  ? 140 GLU A C   1 
ATOM   1131 O O   . GLU A 1 140 ? -9.097  27.888  48.296  1.00 50.61  ? 140 GLU A O   1 
ATOM   1132 C CB  . GLU A 1 140 ? -9.739  25.451  49.678  1.00 33.58  ? 140 GLU A CB  1 
ATOM   1133 C CG  . GLU A 1 140 ? -9.556  24.405  50.762  1.00 34.65  ? 140 GLU A CG  1 
ATOM   1134 C CD  . GLU A 1 140 ? -10.846 23.866  51.266  1.00 30.15  ? 140 GLU A CD  1 
ATOM   1135 O OE1 . GLU A 1 140 ? -11.900 24.392  50.862  1.00 37.81  ? 140 GLU A OE1 1 
ATOM   1136 O OE2 . GLU A 1 140 ? -10.802 22.907  52.051  1.00 30.85  ? 140 GLU A OE2 1 
ATOM   1137 N N   . ILE A 1 141 ? -8.130  26.593  46.717  1.00 41.29  ? 141 ILE A N   1 
ATOM   1138 C CA  . ILE A 1 141 ? -7.964  27.645  45.730  1.00 38.97  ? 141 ILE A CA  1 
ATOM   1139 C C   . ILE A 1 141 ? -8.798  27.395  44.480  1.00 37.70  ? 141 ILE A C   1 
ATOM   1140 O O   . ILE A 1 141 ? -8.718  28.156  43.519  1.00 40.75  ? 141 ILE A O   1 
ATOM   1141 C CB  . ILE A 1 141 ? -6.490  27.787  45.306  1.00 34.19  ? 141 ILE A CB  1 
ATOM   1142 C CG1 . ILE A 1 141 ? -5.980  26.456  44.756  1.00 35.26  ? 141 ILE A CG1 1 
ATOM   1143 C CG2 . ILE A 1 141 ? -5.627  28.223  46.473  1.00 35.87  ? 141 ILE A CG2 1 
ATOM   1144 C CD1 . ILE A 1 141 ? -4.697  26.585  43.961  1.00 39.69  ? 141 ILE A CD1 1 
ATOM   1145 N N   . ASN A 1 142 ? -9.593  26.332  44.492  1.00 37.04  ? 142 ASN A N   1 
ATOM   1146 C CA  . ASN A 1 142 ? -10.446 25.990  43.347  1.00 35.64  ? 142 ASN A CA  1 
ATOM   1147 C C   . ASN A 1 142 ? -11.382 24.831  43.692  1.00 32.71  ? 142 ASN A C   1 
ATOM   1148 O O   . ASN A 1 142 ? -11.470 24.410  44.832  1.00 38.73  ? 142 ASN A O   1 
ATOM   1149 C CB  . ASN A 1 142 ? -9.590  25.644  42.112  1.00 30.79  ? 142 ASN A CB  1 
ATOM   1150 C CG  . ASN A 1 142 ? -8.768  24.354  42.298  1.00 37.60  ? 142 ASN A CG  1 
ATOM   1151 O OD1 . ASN A 1 142 ? -8.656  23.809  43.414  1.00 37.03  ? 142 ASN A OD1 1 
ATOM   1152 N ND2 . ASN A 1 142 ? -8.183  23.872  41.208  1.00 30.62  ? 142 ASN A ND2 1 
ATOM   1153 N N   . GLN A 1 143 ? -12.080 24.301  42.708  1.00 36.61  ? 143 GLN A N   1 
ATOM   1154 C CA  . GLN A 1 143 ? -13.010 23.220  42.983  1.00 38.52  ? 143 GLN A CA  1 
ATOM   1155 C C   . GLN A 1 143 ? -12.307 21.948  43.413  1.00 41.15  ? 143 GLN A C   1 
ATOM   1156 O O   . GLN A 1 143 ? -12.781 21.240  44.303  1.00 46.88  ? 143 GLN A O   1 
ATOM   1157 C CB  . GLN A 1 143 ? -13.856 22.936  41.757  1.00 46.31  ? 143 GLN A CB  1 
ATOM   1158 C CG  . GLN A 1 143 ? -13.094 23.042  40.460  1.00 42.48  ? 143 GLN A CG  1 
ATOM   1159 C CD  . GLN A 1 143 ? -14.000 22.819  39.278  1.00 46.82  ? 143 GLN A CD  1 
ATOM   1160 O OE1 . GLN A 1 143 ? -15.106 22.298  39.431  1.00 47.63  ? 143 GLN A OE1 1 
ATOM   1161 N NE2 . GLN A 1 143 ? -13.550 23.221  38.094  1.00 42.45  ? 143 GLN A NE2 1 
ATOM   1162 N N   . TYR A 1 144 ? -11.168 21.670  42.786  1.00 37.23  ? 144 TYR A N   1 
ATOM   1163 C CA  . TYR A 1 144 ? -10.492 20.397  42.970  1.00 38.22  ? 144 TYR A CA  1 
ATOM   1164 C C   . TYR A 1 144 ? -9.599  20.368  44.223  1.00 34.94  ? 144 TYR A C   1 
ATOM   1165 O O   . TYR A 1 144 ? -8.942  19.365  44.501  1.00 35.34  ? 144 TYR A O   1 
ATOM   1166 C CB  . TYR A 1 144 ? -9.705  20.062  41.700  1.00 37.86  ? 144 TYR A CB  1 
ATOM   1167 C CG  . TYR A 1 144 ? -10.621 19.973  40.502  1.00 40.74  ? 144 TYR A CG  1 
ATOM   1168 C CD1 . TYR A 1 144 ? -11.753 19.164  40.538  1.00 39.80  ? 144 TYR A CD1 1 
ATOM   1169 C CD2 . TYR A 1 144 ? -10.399 20.733  39.363  1.00 41.14  ? 144 TYR A CD2 1 
ATOM   1170 C CE1 . TYR A 1 144 ? -12.615 19.086  39.475  1.00 33.39  ? 144 TYR A CE1 1 
ATOM   1171 C CE2 . TYR A 1 144 ? -11.264 20.670  38.290  1.00 38.64  ? 144 TYR A CE2 1 
ATOM   1172 C CZ  . TYR A 1 144 ? -12.373 19.847  38.352  1.00 42.66  ? 144 TYR A CZ  1 
ATOM   1173 O OH  . TYR A 1 144 ? -13.239 19.769  37.283  1.00 40.59  ? 144 TYR A OH  1 
ATOM   1174 N N   . THR A 1 145 ? -9.616  21.446  44.999  1.00 32.41  ? 145 THR A N   1 
ATOM   1175 C CA  . THR A 1 145 ? -8.922  21.468  46.290  1.00 35.16  ? 145 THR A CA  1 
ATOM   1176 C C   . THR A 1 145 ? -9.868  21.866  47.428  1.00 33.66  ? 145 THR A C   1 
ATOM   1177 O O   . THR A 1 145 ? -9.438  22.077  48.550  1.00 35.66  ? 145 THR A O   1 
ATOM   1178 C CB  . THR A 1 145 ? -7.708  22.426  46.272  1.00 33.70  ? 145 THR A CB  1 
ATOM   1179 O OG1 . THR A 1 145 ? -8.118  23.725  45.834  1.00 37.50  ? 145 THR A OG1 1 
ATOM   1180 C CG2 . THR A 1 145 ? -6.661  21.915  45.316  1.00 31.05  ? 145 THR A CG2 1 
ATOM   1181 N N   . ARG A 1 146 ? -11.162 21.921  47.131  1.00 37.06  ? 146 ARG A N   1 
ATOM   1182 C CA  . ARG A 1 146 ? -12.168 22.371  48.085  1.00 40.30  ? 146 ARG A CA  1 
ATOM   1183 C C   . ARG A 1 146 ? -12.680 21.241  48.983  1.00 37.87  ? 146 ARG A C   1 
ATOM   1184 O O   . ARG A 1 146 ? -12.684 20.069  48.606  1.00 37.95  ? 146 ARG A O   1 
ATOM   1185 C CB  . ARG A 1 146 ? -13.341 23.018  47.330  1.00 45.05  ? 146 ARG A CB  1 
ATOM   1186 C CG  . ARG A 1 146 ? -14.495 23.521  48.204  1.00 47.94  ? 146 ARG A CG  1 
ATOM   1187 C CD  . ARG A 1 146 ? -15.495 24.352  47.405  1.00 52.03  ? 146 ARG A CD  1 
ATOM   1188 N NE  . ARG A 1 146 ? -14.836 25.524  46.838  1.00 59.73  ? 146 ARG A NE  1 
ATOM   1189 C CZ  . ARG A 1 146 ? -15.056 25.989  45.615  1.00 55.91  ? 146 ARG A CZ  1 
ATOM   1190 N NH1 . ARG A 1 146 ? -15.931 25.380  44.820  1.00 53.89  ? 146 ARG A NH1 1 
ATOM   1191 N NH2 . ARG A 1 146 ? -14.393 27.061  45.190  1.00 53.15  ? 146 ARG A NH2 1 
ATOM   1192 N N   . SER A 1 147 ? -13.082 21.603  50.193  1.00 36.75  ? 147 SER A N   1 
ATOM   1193 C CA  . SER A 1 147 ? -13.839 20.700  51.032  1.00 35.61  ? 147 SER A CA  1 
ATOM   1194 C C   . SER A 1 147 ? -15.252 20.588  50.483  1.00 42.02  ? 147 SER A C   1 
ATOM   1195 O O   . SER A 1 147 ? -15.902 21.612  50.281  1.00 46.21  ? 147 SER A O   1 
ATOM   1196 C CB  . SER A 1 147 ? -13.856 21.203  52.465  1.00 34.10  ? 147 SER A CB  1 
ATOM   1197 O OG  . SER A 1 147 ? -12.560 21.109  53.044  1.00 35.60  ? 147 SER A OG  1 
ATOM   1198 N N   . LEU A 1 148 ? -15.725 19.367  50.219  1.00 39.05  ? 148 LEU A N   1 
ATOM   1199 C CA  . LEU A 1 148 ? -17.081 19.177  49.689  1.00 44.34  ? 148 LEU A CA  1 
ATOM   1200 C C   . LEU A 1 148 ? -18.097 19.125  50.828  1.00 49.25  ? 148 LEU A C   1 
ATOM   1201 O O   . LEU A 1 148 ? -17.847 18.480  51.846  1.00 45.83  ? 148 LEU A O   1 
ATOM   1202 C CB  . LEU A 1 148 ? -17.181 17.897  48.855  1.00 42.39  ? 148 LEU A CB  1 
ATOM   1203 C CG  . LEU A 1 148 ? -16.148 17.573  47.775  1.00 39.41  ? 148 LEU A CG  1 
ATOM   1204 C CD1 . LEU A 1 148 ? -16.249 16.094  47.427  1.00 34.23  ? 148 LEU A CD1 1 
ATOM   1205 C CD2 . LEU A 1 148 ? -16.298 18.446  46.518  1.00 30.94  ? 148 LEU A CD2 1 
ATOM   1206 N N   . THR A 1 149 ? -19.237 19.799  50.671  1.00 52.11  ? 149 THR A N   1 
ATOM   1207 C CA  . THR A 1 149 ? -20.265 19.742  51.716  1.00 57.44  ? 149 THR A CA  1 
ATOM   1208 C C   . THR A 1 149 ? -21.641 19.353  51.183  1.00 54.13  ? 149 THR A C   1 
ATOM   1209 O O   . THR A 1 149 ? -22.588 19.235  51.952  1.00 55.28  ? 149 THR A O   1 
ATOM   1210 C CB  . THR A 1 149 ? -20.398 21.084  52.498  1.00 51.12  ? 149 THR A CB  1 
ATOM   1211 O OG1 . THR A 1 149 ? -20.584 22.166  51.587  1.00 53.40  ? 149 THR A OG1 1 
ATOM   1212 C CG2 . THR A 1 149 ? -19.163 21.348  53.361  1.00 48.91  ? 149 THR A CG2 1 
ATOM   1213 N N   . HIS A 1 150 ? -21.741 19.131  49.875  1.00 55.23  ? 150 HIS A N   1 
ATOM   1214 C CA  . HIS A 1 150 ? -22.965 18.607  49.254  1.00 52.47  ? 150 HIS A CA  1 
ATOM   1215 C C   . HIS A 1 150 ? -23.366 17.241  49.823  1.00 57.15  ? 150 HIS A C   1 
ATOM   1216 O O   . HIS A 1 150 ? -22.667 16.686  50.682  1.00 55.63  ? 150 HIS A O   1 
ATOM   1217 C CB  . HIS A 1 150 ? -22.773 18.487  47.750  1.00 49.91  ? 150 HIS A CB  1 
ATOM   1218 C CG  . HIS A 1 150 ? -21.706 17.506  47.362  1.00 58.70  ? 150 HIS A CG  1 
ATOM   1219 N ND1 . HIS A 1 150 ? -21.941 16.151  47.259  1.00 59.53  ? 150 HIS A ND1 1 
ATOM   1220 C CD2 . HIS A 1 150 ? -20.396 17.685  47.067  1.00 53.53  ? 150 HIS A CD2 1 
ATOM   1221 C CE1 . HIS A 1 150 ? -20.826 15.539  46.905  1.00 50.48  ? 150 HIS A CE1 1 
ATOM   1222 N NE2 . HIS A 1 150 ? -19.876 16.444  46.786  1.00 52.28  ? 150 HIS A NE2 1 
ATOM   1223 N N   . SER A 1 151 ? -24.470 16.680  49.329  1.00 55.11  ? 151 SER A N   1 
ATOM   1224 C CA  . SER A 1 151 ? -24.924 15.388  49.838  1.00 54.62  ? 151 SER A CA  1 
ATOM   1225 C C   . SER A 1 151 ? -24.962 14.329  48.735  1.00 54.11  ? 151 SER A C   1 
ATOM   1226 O O   . SER A 1 151 ? -25.223 14.640  47.574  1.00 55.29  ? 151 SER A O   1 
ATOM   1227 C CB  . SER A 1 151 ? -26.293 15.529  50.524  1.00 58.76  ? 151 SER A CB  1 
ATOM   1228 O OG  . SER A 1 151 ? -26.176 16.189  51.788  1.00 55.14  ? 151 SER A OG  1 
ATOM   1229 N N   . VAL A 1 152 ? -24.667 13.084  49.112  1.00 50.19  ? 152 VAL A N   1 
ATOM   1230 C CA  . VAL A 1 152 ? -24.447 12.002  48.150  1.00 49.84  ? 152 VAL A CA  1 
ATOM   1231 C C   . VAL A 1 152 ? -25.579 11.936  47.150  1.00 57.63  ? 152 VAL A C   1 
ATOM   1232 O O   . VAL A 1 152 ? -26.690 11.545  47.489  1.00 68.57  ? 152 VAL A O   1 
ATOM   1233 C CB  . VAL A 1 152 ? -24.333 10.629  48.817  1.00 51.37  ? 152 VAL A CB  1 
ATOM   1234 C CG1 . VAL A 1 152 ? -24.276 9.538   47.771  1.00 48.86  ? 152 VAL A CG1 1 
ATOM   1235 C CG2 . VAL A 1 152 ? -23.119 10.573  49.719  1.00 50.41  ? 152 VAL A CG2 1 
ATOM   1236 N N   . GLN A 1 153 ? -25.293 12.343  45.922  1.00 58.65  ? 153 GLN A N   1 
ATOM   1237 C CA  . GLN A 1 153 ? -26.240 12.272  44.824  1.00 56.33  ? 153 GLN A CA  1 
ATOM   1238 C C   . GLN A 1 153 ? -26.815 10.862  44.627  1.00 61.02  ? 153 GLN A C   1 
ATOM   1239 O O   . GLN A 1 153 ? -26.080 9.869   44.580  1.00 65.47  ? 153 GLN A O   1 
ATOM   1240 C CB  . GLN A 1 153 ? -25.554 12.747  43.554  1.00 59.82  ? 153 GLN A CB  1 
ATOM   1241 C CG  . GLN A 1 153 ? -26.266 12.384  42.280  1.00 68.69  ? 153 GLN A CG  1 
ATOM   1242 C CD  . GLN A 1 153 ? -25.563 12.948  41.067  1.00 73.60  ? 153 GLN A CD  1 
ATOM   1243 O OE1 . GLN A 1 153 ? -25.751 12.470  39.944  1.00 74.56  ? 153 GLN A OE1 1 
ATOM   1244 N NE2 . GLN A 1 153 ? -24.742 13.975  41.286  1.00 66.96  ? 153 GLN A NE2 1 
ATOM   1245 N N   . ALA A 1 154 ? -28.136 10.786  44.501  1.00 59.30  ? 154 ALA A N   1 
ATOM   1246 C CA  . ALA A 1 154 ? -28.852 9.510   44.381  1.00 63.86  ? 154 ALA A CA  1 
ATOM   1247 C C   . ALA A 1 154 ? -28.585 8.813   43.053  1.00 61.86  ? 154 ALA A C   1 
ATOM   1248 O O   . ALA A 1 154 ? -28.974 7.657   42.849  1.00 56.81  ? 154 ALA A O   1 
ATOM   1249 C CB  . ALA A 1 154 ? -30.345 9.732   44.545  1.00 57.12  ? 154 ALA A CB  1 
ATOM   1250 N N   . ASP A 1 155 ? -27.906 9.525   42.161  1.00 63.77  ? 155 ASP A N   1 
ATOM   1251 C CA  . ASP A 1 155 ? -27.760 9.112   40.779  1.00 62.89  ? 155 ASP A CA  1 
ATOM   1252 C C   . ASP A 1 155 ? -26.298 8.905   40.385  1.00 65.05  ? 155 ASP A C   1 
ATOM   1253 O O   . ASP A 1 155 ? -25.442 9.714   40.735  1.00 63.24  ? 155 ASP A O   1 
ATOM   1254 C CB  . ASP A 1 155 ? -28.398 10.166  39.882  1.00 63.67  ? 155 ASP A CB  1 
ATOM   1255 C CG  . ASP A 1 155 ? -29.184 9.559   38.764  1.00 66.89  ? 155 ASP A CG  1 
ATOM   1256 O OD1 . ASP A 1 155 ? -29.360 8.324   38.804  1.00 72.82  ? 155 ASP A OD1 1 
ATOM   1257 O OD2 . ASP A 1 155 ? -29.631 10.302  37.859  1.00 70.29  ? 155 ASP A OD2 1 
ATOM   1258 N N   . TYR A 1 156 ? -26.008 7.837   39.646  1.00 60.21  ? 156 TYR A N   1 
ATOM   1259 C CA  . TYR A 1 156 ? -24.650 7.627   39.163  1.00 51.71  ? 156 TYR A CA  1 
ATOM   1260 C C   . TYR A 1 156 ? -24.609 6.919   37.809  1.00 52.25  ? 156 TYR A C   1 
ATOM   1261 O O   . TYR A 1 156 ? -24.943 5.735   37.708  1.00 53.35  ? 156 TYR A O   1 
ATOM   1262 C CB  . TYR A 1 156 ? -23.828 6.837   40.189  1.00 51.43  ? 156 TYR A CB  1 
ATOM   1263 C CG  . TYR A 1 156 ? -22.341 6.877   39.894  1.00 46.59  ? 156 TYR A CG  1 
ATOM   1264 C CD1 . TYR A 1 156 ? -21.574 7.981   40.246  1.00 40.56  ? 156 TYR A CD1 1 
ATOM   1265 C CD2 . TYR A 1 156 ? -21.717 5.819   39.235  1.00 46.17  ? 156 TYR A CD2 1 
ATOM   1266 C CE1 . TYR A 1 156 ? -20.228 8.027   39.967  1.00 44.47  ? 156 TYR A CE1 1 
ATOM   1267 C CE2 . TYR A 1 156 ? -20.373 5.849   38.951  1.00 46.43  ? 156 TYR A CE2 1 
ATOM   1268 C CZ  . TYR A 1 156 ? -19.631 6.952   39.315  1.00 49.00  ? 156 TYR A CZ  1 
ATOM   1269 O OH  . TYR A 1 156 ? -18.291 6.974   39.020  1.00 40.88  ? 156 TYR A OH  1 
ATOM   1270 N N   . LYS A 1 157 ? -24.163 7.638   36.782  1.00 41.56  ? 157 LYS A N   1 
ATOM   1271 C CA  . LYS A 1 157 ? -24.299 7.144   35.421  1.00 52.53  ? 157 LYS A CA  1 
ATOM   1272 C C   . LYS A 1 157 ? -23.049 6.477   34.850  1.00 54.75  ? 157 LYS A C   1 
ATOM   1273 O O   . LYS A 1 157 ? -21.925 6.977   34.959  1.00 54.65  ? 157 LYS A O   1 
ATOM   1274 C CB  . LYS A 1 157 ? -24.737 8.270   34.476  1.00 57.46  ? 157 LYS A CB  1 
ATOM   1275 C CG  . LYS A 1 157 ? -25.461 7.718   33.237  1.00 57.27  ? 157 LYS A CG  1 
ATOM   1276 C CD  . LYS A 1 157 ? -25.230 8.550   31.986  1.00 56.80  ? 157 LYS A CD  1 
ATOM   1277 C CE  . LYS A 1 157 ? -25.970 7.938   30.807  1.00 63.67  ? 157 LYS A CE  1 
ATOM   1278 N NZ  . LYS A 1 157 ? -26.008 6.443   30.901  1.00 68.26  ? 157 LYS A NZ  1 
ATOM   1279 N N   . VAL A 1 158 ? -23.283 5.349   34.198  1.00 49.77  ? 158 VAL A N   1 
ATOM   1280 C CA  . VAL A 1 158 ? -22.227 4.476   33.745  1.00 51.18  ? 158 VAL A CA  1 
ATOM   1281 C C   . VAL A 1 158 ? -22.624 3.928   32.366  1.00 59.03  ? 158 VAL A C   1 
ATOM   1282 O O   . VAL A 1 158 ? -23.807 3.719   32.098  1.00 64.15  ? 158 VAL A O   1 
ATOM   1283 C CB  . VAL A 1 158 ? -21.992 3.342   34.775  1.00 48.34  ? 158 VAL A CB  1 
ATOM   1284 C CG1 . VAL A 1 158 ? -21.142 2.246   34.202  1.00 53.29  ? 158 VAL A CG1 1 
ATOM   1285 C CG2 . VAL A 1 158 ? -21.346 3.890   36.028  1.00 46.76  ? 158 VAL A CG2 1 
ATOM   1286 N N   . PRO A 1 159 ? -21.647 3.756   31.464  1.00 54.16  ? 159 PRO A N   1 
ATOM   1287 C CA  . PRO A 1 159 ? -21.897 3.134   30.157  1.00 51.85  ? 159 PRO A CA  1 
ATOM   1288 C C   . PRO A 1 159 ? -22.469 1.721   30.283  1.00 55.64  ? 159 PRO A C   1 
ATOM   1289 O O   . PRO A 1 159 ? -22.178 1.029   31.265  1.00 51.49  ? 159 PRO A O   1 
ATOM   1290 C CB  . PRO A 1 159 ? -20.509 3.099   29.516  1.00 52.10  ? 159 PRO A CB  1 
ATOM   1291 C CG  . PRO A 1 159 ? -19.794 4.246   30.127  1.00 59.58  ? 159 PRO A CG  1 
ATOM   1292 C CD  . PRO A 1 159 ? -20.301 4.353   31.543  1.00 61.51  ? 159 PRO A CD  1 
ATOM   1293 N N   . GLY A 1 160 ? -23.260 1.307   29.294  1.00 53.27  ? 160 GLY A N   1 
ATOM   1294 C CA  . GLY A 1 160 ? -23.954 0.035   29.340  1.00 53.04  ? 160 GLY A CA  1 
ATOM   1295 C C   . GLY A 1 160 ? -23.076 -1.156  29.687  1.00 59.53  ? 160 GLY A C   1 
ATOM   1296 O O   . GLY A 1 160 ? -23.320 -1.859  30.687  1.00 55.49  ? 160 GLY A O   1 
ATOM   1297 N N   . GLU A 1 161 ? -22.056 -1.372  28.856  1.00 59.50  ? 161 GLU A N   1 
ATOM   1298 C CA  . GLU A 1 161 ? -21.084 -2.456  29.019  1.00 52.00  ? 161 GLU A CA  1 
ATOM   1299 C C   . GLU A 1 161 ? -20.582 -2.596  30.444  1.00 55.76  ? 161 GLU A C   1 
ATOM   1300 O O   . GLU A 1 161 ? -20.475 -3.700  30.979  1.00 61.12  ? 161 GLU A O   1 
ATOM   1301 C CB  . GLU A 1 161 ? -19.908 -2.219  28.083  1.00 55.96  ? 161 GLU A CB  1 
ATOM   1302 C CG  . GLU A 1 161 ? -19.610 -0.739  27.871  1.00 64.03  ? 161 GLU A CG  1 
ATOM   1303 C CD  . GLU A 1 161 ? -18.948 -0.460  26.536  1.00 67.23  ? 161 GLU A CD  1 
ATOM   1304 O OE1 . GLU A 1 161 ? -17.705 -0.307  26.493  1.00 69.04  ? 161 GLU A OE1 1 
ATOM   1305 O OE2 . GLU A 1 161 ? -19.678 -0.394  25.528  1.00 70.46  ? 161 GLU A OE2 1 
ATOM   1306 N N   . TYR A 1 162 ? -20.296 -1.465  31.073  1.00 56.09  ? 162 TYR A N   1 
ATOM   1307 C CA  . TYR A 1 162 ? -19.774 -1.489  32.424  1.00 55.20  ? 162 TYR A CA  1 
ATOM   1308 C C   . TYR A 1 162 ? -20.873 -1.449  33.492  1.00 57.42  ? 162 TYR A C   1 
ATOM   1309 O O   . TYR A 1 162 ? -20.637 -1.876  34.623  1.00 59.71  ? 162 TYR A O   1 
ATOM   1310 C CB  . TYR A 1 162 ? -18.802 -0.327  32.628  1.00 53.21  ? 162 TYR A CB  1 
ATOM   1311 C CG  . TYR A 1 162 ? -17.558 -0.374  31.754  1.00 55.33  ? 162 TYR A CG  1 
ATOM   1312 C CD1 . TYR A 1 162 ? -16.488 -1.207  32.070  1.00 54.71  ? 162 TYR A CD1 1 
ATOM   1313 C CD2 . TYR A 1 162 ? -17.443 0.436   30.629  1.00 57.85  ? 162 TYR A CD2 1 
ATOM   1314 C CE1 . TYR A 1 162 ? -15.348 -1.240  31.277  1.00 57.36  ? 162 TYR A CE1 1 
ATOM   1315 C CE2 . TYR A 1 162 ? -16.310 0.407   29.837  1.00 52.72  ? 162 TYR A CE2 1 
ATOM   1316 C CZ  . TYR A 1 162 ? -15.266 -0.427  30.163  1.00 52.41  ? 162 TYR A CZ  1 
ATOM   1317 O OH  . TYR A 1 162 ? -14.139 -0.458  29.365  1.00 58.15  ? 162 TYR A OH  1 
ATOM   1318 N N   . ALA A 1 163 ? -22.069 -0.966  33.141  1.00 55.05  ? 163 ALA A N   1 
ATOM   1319 C CA  . ALA A 1 163 ? -23.106 -0.715  34.150  1.00 51.71  ? 163 ALA A CA  1 
ATOM   1320 C C   . ALA A 1 163 ? -23.478 -1.979  34.907  1.00 57.77  ? 163 ALA A C   1 
ATOM   1321 O O   . ALA A 1 163 ? -24.035 -1.913  35.996  1.00 67.21  ? 163 ALA A O   1 
ATOM   1322 C CB  . ALA A 1 163 ? -24.333 -0.102  33.523  1.00 50.45  ? 163 ALA A CB  1 
ATOM   1323 N N   . VAL A 1 164 ? -23.158 -3.130  34.331  1.00 58.51  ? 164 VAL A N   1 
ATOM   1324 C CA  . VAL A 1 164 ? -23.340 -4.412  35.002  1.00 55.44  ? 164 VAL A CA  1 
ATOM   1325 C C   . VAL A 1 164 ? -22.400 -4.569  36.182  1.00 50.90  ? 164 VAL A C   1 
ATOM   1326 O O   . VAL A 1 164 ? -22.821 -4.682  37.329  1.00 49.00  ? 164 VAL A O   1 
ATOM   1327 C CB  . VAL A 1 164 ? -23.081 -5.581  34.037  1.00 57.25  ? 164 VAL A CB  1 
ATOM   1328 C CG1 . VAL A 1 164 ? -23.661 -6.872  34.591  1.00 39.52  ? 164 VAL A CG1 1 
ATOM   1329 C CG2 . VAL A 1 164 ? -23.628 -5.245  32.647  1.00 52.56  ? 164 VAL A CG2 1 
ATOM   1330 N N   . GLU A 1 165 ? -21.110 -4.583  35.865  1.00 56.10  ? 165 GLU A N   1 
ATOM   1331 C CA  . GLU A 1 165 ? -20.063 -4.908  36.819  1.00 50.86  ? 165 GLU A CA  1 
ATOM   1332 C C   . GLU A 1 165 ? -19.974 -3.902  37.941  1.00 47.58  ? 165 GLU A C   1 
ATOM   1333 O O   . GLU A 1 165 ? -19.615 -4.254  39.068  1.00 43.84  ? 165 GLU A O   1 
ATOM   1334 C CB  . GLU A 1 165 ? -18.727 -5.004  36.101  1.00 56.23  ? 165 GLU A CB  1 
ATOM   1335 C CG  . GLU A 1 165 ? -18.406 -6.401  35.617  1.00 48.72  ? 165 GLU A CG  1 
ATOM   1336 C CD  . GLU A 1 165 ? -17.658 -6.369  34.319  1.00 56.30  ? 165 GLU A CD  1 
ATOM   1337 O OE1 . GLU A 1 165 ? -17.949 -5.461  33.498  1.00 55.44  ? 165 GLU A OE1 1 
ATOM   1338 O OE2 . GLU A 1 165 ? -16.778 -7.241  34.128  1.00 57.82  ? 165 GLU A OE2 1 
ATOM   1339 N N   . VAL A 1 166 ? -20.295 -2.653  37.620  1.00 45.58  ? 166 VAL A N   1 
ATOM   1340 C CA  . VAL A 1 166 ? -20.437 -1.606  38.622  1.00 46.60  ? 166 VAL A CA  1 
ATOM   1341 C C   . VAL A 1 166 ? -21.465 -2.006  39.686  1.00 49.75  ? 166 VAL A C   1 
ATOM   1342 O O   . VAL A 1 166 ? -21.182 -1.984  40.885  1.00 50.93  ? 166 VAL A O   1 
ATOM   1343 C CB  . VAL A 1 166 ? -20.865 -0.281  37.976  1.00 46.23  ? 166 VAL A CB  1 
ATOM   1344 C CG1 . VAL A 1 166 ? -21.057 0.790   39.041  1.00 43.53  ? 166 VAL A CG1 1 
ATOM   1345 C CG2 . VAL A 1 166 ? -19.844 0.146   36.946  1.00 44.76  ? 166 VAL A CG2 1 
ATOM   1346 N N   . LYS A 1 167 ? -22.657 -2.382  39.232  1.00 49.68  ? 167 LYS A N   1 
ATOM   1347 C CA  . LYS A 1 167 ? -23.716 -2.840  40.118  1.00 48.19  ? 167 LYS A CA  1 
ATOM   1348 C C   . LYS A 1 167 ? -23.238 -4.063  40.901  1.00 44.96  ? 167 LYS A C   1 
ATOM   1349 O O   . LYS A 1 167 ? -23.561 -4.213  42.082  1.00 46.61  ? 167 LYS A O   1 
ATOM   1350 C CB  . LYS A 1 167 ? -25.001 -3.146  39.319  1.00 52.65  ? 167 LYS A CB  1 
ATOM   1351 C CG  . LYS A 1 167 ? -25.734 -1.893  38.800  1.00 48.85  ? 167 LYS A CG  1 
ATOM   1352 C CD  . LYS A 1 167 ? -26.832 -2.225  37.774  1.00 51.71  ? 167 LYS A CD  1 
ATOM   1353 C CE  . LYS A 1 167 ? -27.580 -0.964  37.301  1.00 51.73  ? 167 LYS A CE  1 
ATOM   1354 N NZ  . LYS A 1 167 ? -28.751 -1.173  36.371  1.00 51.45  ? 167 LYS A NZ  1 
ATOM   1355 N N   . GLU A 1 168 ? -22.445 -4.918  40.262  1.00 42.26  ? 168 GLU A N   1 
ATOM   1356 C CA  . GLU A 1 168 ? -21.846 -6.042  40.979  1.00 43.64  ? 168 GLU A CA  1 
ATOM   1357 C C   . GLU A 1 168 ? -20.917 -5.548  42.089  1.00 46.40  ? 168 GLU A C   1 
ATOM   1358 O O   . GLU A 1 168 ? -20.859 -6.119  43.181  1.00 47.34  ? 168 GLU A O   1 
ATOM   1359 C CB  . GLU A 1 168 ? -21.067 -6.958  40.038  1.00 40.26  ? 168 GLU A CB  1 
ATOM   1360 C CG  . GLU A 1 168 ? -20.343 -8.069  40.785  1.00 36.54  ? 168 GLU A CG  1 
ATOM   1361 C CD  . GLU A 1 168 ? -19.471 -8.947  39.900  1.00 52.53  ? 168 GLU A CD  1 
ATOM   1362 O OE1 . GLU A 1 168 ? -19.376 -8.671  38.678  1.00 53.98  ? 168 GLU A OE1 1 
ATOM   1363 O OE2 . GLU A 1 168 ? -18.880 -9.920  40.436  1.00 51.78  ? 168 GLU A OE2 1 
ATOM   1364 N N   . MET A 1 169 ? -20.177 -4.485  41.799  1.00 47.49  ? 169 MET A N   1 
ATOM   1365 C CA  . MET A 1 169 ? -19.328 -3.881  42.810  1.00 45.10  ? 169 MET A CA  1 
ATOM   1366 C C   . MET A 1 169 ? -20.217 -3.326  43.910  1.00 48.04  ? 169 MET A C   1 
ATOM   1367 O O   . MET A 1 169 ? -19.956 -3.552  45.092  1.00 46.90  ? 169 MET A O   1 
ATOM   1368 C CB  . MET A 1 169 ? -18.446 -2.780  42.218  1.00 41.12  ? 169 MET A CB  1 
ATOM   1369 C CG  . MET A 1 169 ? -17.357 -3.280  41.291  1.00 38.92  ? 169 MET A CG  1 
ATOM   1370 S SD  . MET A 1 169 ? -16.350 -1.932  40.609  1.00 40.32  ? 169 MET A SD  1 
ATOM   1371 C CE  . MET A 1 169 ? -15.323 -1.584  42.038  1.00 36.38  ? 169 MET A CE  1 
ATOM   1372 N N   . LEU A 1 170 ? -21.272 -2.615  43.511  1.00 44.10  ? 170 LEU A N   1 
ATOM   1373 C CA  . LEU A 1 170 ? -22.210 -2.054  44.470  1.00 43.96  ? 170 LEU A CA  1 
ATOM   1374 C C   . LEU A 1 170 ? -22.704 -3.134  45.421  1.00 44.81  ? 170 LEU A C   1 
ATOM   1375 O O   . LEU A 1 170 ? -22.700 -2.945  46.632  1.00 45.13  ? 170 LEU A O   1 
ATOM   1376 C CB  . LEU A 1 170 ? -23.375 -1.377  43.755  1.00 44.67  ? 170 LEU A CB  1 
ATOM   1377 C CG  . LEU A 1 170 ? -23.999 -0.176  44.472  1.00 52.49  ? 170 LEU A CG  1 
ATOM   1378 C CD1 . LEU A 1 170 ? -22.935 0.821   44.916  1.00 50.38  ? 170 LEU A CD1 1 
ATOM   1379 C CD2 . LEU A 1 170 ? -25.032 0.524   43.588  1.00 52.73  ? 170 LEU A CD2 1 
ATOM   1380 N N   . SER A 1 171 ? -23.087 -4.279  44.867  1.00 46.35  ? 171 SER A N   1 
ATOM   1381 C CA  . SER A 1 171 ? -23.634 -5.369  45.666  1.00 44.15  ? 171 SER A CA  1 
ATOM   1382 C C   . SER A 1 171 ? -22.662 -5.822  46.745  1.00 41.05  ? 171 SER A C   1 
ATOM   1383 O O   . SER A 1 171 ? -23.051 -5.991  47.902  1.00 43.90  ? 171 SER A O   1 
ATOM   1384 C CB  . SER A 1 171 ? -24.016 -6.561  44.777  1.00 43.33  ? 171 SER A CB  1 
ATOM   1385 O OG  . SER A 1 171 ? -23.757 -7.798  45.438  1.00 47.53  ? 171 SER A OG  1 
ATOM   1386 N N   . ASP A 1 172 ? -21.400 -6.021  46.384  1.00 42.75  ? 172 ASP A N   1 
ATOM   1387 C CA  . ASP A 1 172 ? -20.449 -6.523  47.370  1.00 42.15  ? 172 ASP A CA  1 
ATOM   1388 C C   . ASP A 1 172 ? -20.197 -5.461  48.424  1.00 38.63  ? 172 ASP A C   1 
ATOM   1389 O O   . ASP A 1 172 ? -19.916 -5.772  49.573  1.00 45.49  ? 172 ASP A O   1 
ATOM   1390 C CB  . ASP A 1 172 ? -19.133 -6.945  46.727  1.00 34.64  ? 172 ASP A CB  1 
ATOM   1391 C CG  . ASP A 1 172 ? -18.195 -7.606  47.714  1.00 40.22  ? 172 ASP A CG  1 
ATOM   1392 O OD1 . ASP A 1 172 ? -18.639 -8.500  48.470  1.00 47.15  ? 172 ASP A OD1 1 
ATOM   1393 O OD2 . ASP A 1 172 ? -17.006 -7.228  47.754  1.00 44.10  ? 172 ASP A OD2 1 
ATOM   1394 N N   . MET A 1 173 ? -20.302 -4.203  48.036  1.00 34.67  ? 173 MET A N   1 
ATOM   1395 C CA  . MET A 1 173 ? -20.044 -3.135  48.975  1.00 42.80  ? 173 MET A CA  1 
ATOM   1396 C C   . MET A 1 173 ? -21.166 -3.081  50.014  1.00 46.15  ? 173 MET A C   1 
ATOM   1397 O O   . MET A 1 173 ? -20.929 -2.851  51.210  1.00 44.56  ? 173 MET A O   1 
ATOM   1398 C CB  . MET A 1 173 ? -19.890 -1.805  48.237  1.00 41.18  ? 173 MET A CB  1 
ATOM   1399 C CG  . MET A 1 173 ? -18.670 -1.781  47.311  1.00 33.62  ? 173 MET A CG  1 
ATOM   1400 S SD  . MET A 1 173 ? -18.470 -0.230  46.415  1.00 38.69  ? 173 MET A SD  1 
ATOM   1401 C CE  . MET A 1 173 ? -19.680 -0.207  45.184  1.00 39.27  ? 173 MET A CE  1 
ATOM   1402 N N   . VAL A 1 174 ? -22.382 -3.331  49.549  1.00 42.25  ? 174 VAL A N   1 
ATOM   1403 C CA  . VAL A 1 174 ? -23.550 -3.352  50.409  1.00 41.78  ? 174 VAL A CA  1 
ATOM   1404 C C   . VAL A 1 174 ? -23.440 -4.529  51.390  1.00 47.84  ? 174 VAL A C   1 
ATOM   1405 O O   . VAL A 1 174 ? -23.607 -4.375  52.613  1.00 46.48  ? 174 VAL A O   1 
ATOM   1406 C CB  . VAL A 1 174 ? -24.835 -3.431  49.557  1.00 44.30  ? 174 VAL A CB  1 
ATOM   1407 C CG1 . VAL A 1 174 ? -26.027 -3.772  50.411  1.00 40.99  ? 174 VAL A CG1 1 
ATOM   1408 C CG2 . VAL A 1 174 ? -25.046 -2.105  48.783  1.00 34.77  ? 174 VAL A CG2 1 
ATOM   1409 N N   . ARG A 1 175 ? -23.116 -5.690  50.835  1.00 43.28  ? 175 ARG A N   1 
ATOM   1410 C CA  . ARG A 1 175 ? -22.815 -6.890  51.601  1.00 38.28  ? 175 ARG A CA  1 
ATOM   1411 C C   . ARG A 1 175 ? -21.862 -6.557  52.739  1.00 45.76  ? 175 ARG A C   1 
ATOM   1412 O O   . ARG A 1 175 ? -22.112 -6.885  53.911  1.00 49.73  ? 175 ARG A O   1 
ATOM   1413 C CB  . ARG A 1 175 ? -22.203 -7.949  50.668  1.00 42.22  ? 175 ARG A CB  1 
ATOM   1414 C CG  . ARG A 1 175 ? -22.003 -9.341  51.233  1.00 39.99  ? 175 ARG A CG  1 
ATOM   1415 C CD  . ARG A 1 175 ? -21.137 -10.205 50.295  1.00 41.64  ? 175 ARG A CD  1 
ATOM   1416 N NE  . ARG A 1 175 ? -19.705 -9.892  50.396  1.00 41.47  ? 175 ARG A NE  1 
ATOM   1417 C CZ  . ARG A 1 175 ? -18.923 -10.312 51.390  1.00 44.88  ? 175 ARG A CZ  1 
ATOM   1418 N NH1 . ARG A 1 175 ? -19.435 -11.053 52.367  1.00 46.32  ? 175 ARG A NH1 1 
ATOM   1419 N NH2 . ARG A 1 175 ? -17.637 -9.991  51.421  1.00 45.65  ? 175 ARG A NH2 1 
ATOM   1420 N N   . ARG A 1 176 ? -20.772 -5.889  52.369  1.00 47.32  ? 176 ARG A N   1 
ATOM   1421 C CA  . ARG A 1 176 ? -19.685 -5.563  53.280  1.00 45.89  ? 176 ARG A CA  1 
ATOM   1422 C C   . ARG A 1 176 ? -20.125 -4.616  54.378  1.00 46.34  ? 176 ARG A C   1 
ATOM   1423 O O   . ARG A 1 176 ? -19.748 -4.804  55.548  1.00 50.44  ? 176 ARG A O   1 
ATOM   1424 C CB  . ARG A 1 176 ? -18.507 -4.964  52.507  1.00 40.86  ? 176 ARG A CB  1 
ATOM   1425 C CG  . ARG A 1 176 ? -17.696 -6.024  51.816  1.00 40.66  ? 176 ARG A CG  1 
ATOM   1426 C CD  . ARG A 1 176 ? -16.785 -5.486  50.742  1.00 39.43  ? 176 ARG A CD  1 
ATOM   1427 N NE  . ARG A 1 176 ? -15.942 -6.565  50.259  1.00 37.26  ? 176 ARG A NE  1 
ATOM   1428 C CZ  . ARG A 1 176 ? -14.880 -7.022  50.913  1.00 45.94  ? 176 ARG A CZ  1 
ATOM   1429 N NH1 . ARG A 1 176 ? -14.517 -6.477  52.066  1.00 43.97  ? 176 ARG A NH1 1 
ATOM   1430 N NH2 . ARG A 1 176 ? -14.167 -8.022  50.410  1.00 52.61  ? 176 ARG A NH2 1 
ATOM   1431 N N   . ARG A 1 177 ? -20.919 -3.613  54.002  1.00 40.68  ? 177 ARG A N   1 
ATOM   1432 C CA  . ARG A 1 177 ? -21.413 -2.609  54.947  1.00 45.88  ? 177 ARG A CA  1 
ATOM   1433 C C   . ARG A 1 177 ? -22.179 -3.277  56.098  1.00 47.37  ? 177 ARG A C   1 
ATOM   1434 O O   . ARG A 1 177 ? -21.911 -3.001  57.271  1.00 42.85  ? 177 ARG A O   1 
ATOM   1435 C CB  . ARG A 1 177 ? -22.301 -1.582  54.224  1.00 43.16  ? 177 ARG A CB  1 
ATOM   1436 C CG  . ARG A 1 177 ? -22.360 -0.206  54.885  1.00 43.74  ? 177 ARG A CG  1 
ATOM   1437 C CD  . ARG A 1 177 ? -23.199 0.787   54.073  1.00 45.07  ? 177 ARG A CD  1 
ATOM   1438 N NE  . ARG A 1 177 ? -23.981 1.690   54.921  1.00 43.26  ? 177 ARG A NE  1 
ATOM   1439 C CZ  . ARG A 1 177 ? -23.668 2.959   55.177  1.00 54.16  ? 177 ARG A CZ  1 
ATOM   1440 N NH1 . ARG A 1 177 ? -22.580 3.505   54.645  1.00 63.44  ? 177 ARG A NH1 1 
ATOM   1441 N NH2 . ARG A 1 177 ? -24.448 3.693   55.965  1.00 57.19  ? 177 ARG A NH2 1 
ATOM   1442 N N   . ASN A 1 178 ? -23.105 -4.172  55.736  1.00 48.15  ? 178 ASN A N   1 
ATOM   1443 C CA  . ASN A 1 178 ? -23.902 -4.972  56.673  1.00 41.63  ? 178 ASN A CA  1 
ATOM   1444 C C   . ASN A 1 178 ? -23.111 -5.808  57.678  1.00 46.16  ? 178 ASN A C   1 
ATOM   1445 O O   . ASN A 1 178 ? -23.463 -5.860  58.867  1.00 45.87  ? 178 ASN A O   1 
ATOM   1446 C CB  . ASN A 1 178 ? -24.825 -5.907  55.897  1.00 46.04  ? 178 ASN A CB  1 
ATOM   1447 C CG  . ASN A 1 178 ? -26.148 -5.262  55.558  1.00 62.76  ? 178 ASN A CG  1 
ATOM   1448 O OD1 . ASN A 1 178 ? -26.227 -4.042  55.369  1.00 64.81  ? 178 ASN A OD1 1 
ATOM   1449 N ND2 . ASN A 1 178 ? -27.206 -6.071  55.496  1.00 68.79  ? 178 ASN A ND2 1 
ATOM   1450 N N   . ILE A 1 179 ? -22.058 -6.471  57.209  1.00 41.61  ? 179 ILE A N   1 
ATOM   1451 C CA  . ILE A 1 179 ? -21.216 -7.245  58.105  1.00 48.70  ? 179 ILE A CA  1 
ATOM   1452 C C   . ILE A 1 179 ? -20.430 -6.321  59.049  1.00 48.92  ? 179 ILE A C   1 
ATOM   1453 O O   . ILE A 1 179 ? -19.947 -6.743  60.106  1.00 51.48  ? 179 ILE A O   1 
ATOM   1454 C CB  . ILE A 1 179 ? -20.244 -8.145  57.324  1.00 49.38  ? 179 ILE A CB  1 
ATOM   1455 C CG1 . ILE A 1 179 ? -20.973 -8.837  56.173  1.00 45.73  ? 179 ILE A CG1 1 
ATOM   1456 C CG2 . ILE A 1 179 ? -19.596 -9.157  58.249  1.00 47.61  ? 179 ILE A CG2 1 
ATOM   1457 C CD1 . ILE A 1 179 ? -20.146 -9.914  55.499  1.00 41.45  ? 179 ILE A CD1 1 
ATOM   1458 N N   . LEU A 1 180 ? -20.316 -5.052  58.685  1.00 39.47  ? 180 LEU A N   1 
ATOM   1459 C CA  . LEU A 1 180 ? -19.660 -4.114  59.584  1.00 51.14  ? 180 LEU A CA  1 
ATOM   1460 C C   . LEU A 1 180 ? -20.648 -3.555  60.612  1.00 45.73  ? 180 LEU A C   1 
ATOM   1461 O O   . LEU A 1 180 ? -20.316 -3.427  61.797  1.00 44.94  ? 180 LEU A O   1 
ATOM   1462 C CB  . LEU A 1 180 ? -18.991 -2.988  58.790  1.00 52.16  ? 180 LEU A CB  1 
ATOM   1463 C CG  . LEU A 1 180 ? -17.886 -3.515  57.878  1.00 37.91  ? 180 LEU A CG  1 
ATOM   1464 C CD1 . LEU A 1 180 ? -17.283 -2.407  57.069  1.00 42.65  ? 180 LEU A CD1 1 
ATOM   1465 C CD2 . LEU A 1 180 ? -16.859 -4.211  58.728  1.00 37.53  ? 180 LEU A CD2 1 
ATOM   1466 N N   . LEU A 1 181 ? -21.859 -3.246  60.169  1.00 40.80  ? 181 LEU A N   1 
ATOM   1467 C CA  . LEU A 1 181 ? -22.877 -2.774  61.094  1.00 43.36  ? 181 LEU A CA  1 
ATOM   1468 C C   . LEU A 1 181 ? -23.229 -3.879  62.078  1.00 49.28  ? 181 LEU A C   1 
ATOM   1469 O O   . LEU A 1 181 ? -23.101 -3.692  63.281  1.00 62.95  ? 181 LEU A O   1 
ATOM   1470 C CB  . LEU A 1 181 ? -24.126 -2.292  60.345  1.00 38.05  ? 181 LEU A CB  1 
ATOM   1471 C CG  . LEU A 1 181 ? -23.802 -1.214  59.303  1.00 46.11  ? 181 LEU A CG  1 
ATOM   1472 C CD1 . LEU A 1 181 ? -25.023 -0.878  58.441  1.00 43.53  ? 181 LEU A CD1 1 
ATOM   1473 C CD2 . LEU A 1 181 ? -23.149 0.050   59.916  1.00 27.22  ? 181 LEU A CD2 1 
ATOM   1474 N N   . ASN A 1 182 ? -23.631 -5.042  61.571  1.00 51.02  ? 182 ASN A N   1 
ATOM   1475 C CA  . ASN A 1 182 ? -24.164 -6.112  62.420  1.00 46.21  ? 182 ASN A CA  1 
ATOM   1476 C C   . ASN A 1 182 ? -23.112 -6.922  63.165  1.00 43.53  ? 182 ASN A C   1 
ATOM   1477 O O   . ASN A 1 182 ? -22.173 -6.376  63.724  1.00 44.39  ? 182 ASN A O   1 
ATOM   1478 C CB  . ASN A 1 182 ? -25.012 -7.052  61.567  1.00 45.08  ? 182 ASN A CB  1 
ATOM   1479 C CG  . ASN A 1 182 ? -26.038 -6.308  60.740  1.00 44.97  ? 182 ASN A CG  1 
ATOM   1480 O OD1 . ASN A 1 182 ? -26.526 -5.254  61.141  1.00 47.01  ? 182 ASN A OD1 1 
ATOM   1481 N ND2 . ASN A 1 182 ? -26.366 -6.848  59.578  1.00 48.31  ? 182 ASN A ND2 1 
ATOM   1482 N N   . HIS A 1 198 ? -22.988 1.909   83.381  1.00 70.55  ? 198 HIS A N   1 
ATOM   1483 C CA  . HIS A 1 198 ? -23.204 3.309   83.020  1.00 57.52  ? 198 HIS A CA  1 
ATOM   1484 C C   . HIS A 1 198 ? -23.827 3.386   81.625  1.00 56.70  ? 198 HIS A C   1 
ATOM   1485 O O   . HIS A 1 198 ? -24.083 4.462   81.102  1.00 61.64  ? 198 HIS A O   1 
ATOM   1486 C CB  . HIS A 1 198 ? -21.880 4.106   83.123  1.00 56.39  ? 198 HIS A CB  1 
ATOM   1487 C CG  . HIS A 1 198 ? -21.292 4.538   81.803  1.00 69.35  ? 198 HIS A CG  1 
ATOM   1488 N ND1 . HIS A 1 198 ? -21.363 5.839   81.343  1.00 66.54  ? 198 HIS A ND1 1 
ATOM   1489 C CD2 . HIS A 1 198 ? -20.597 3.850   80.863  1.00 69.89  ? 198 HIS A CD2 1 
ATOM   1490 C CE1 . HIS A 1 198 ? -20.756 5.931   80.172  1.00 53.80  ? 198 HIS A CE1 1 
ATOM   1491 N NE2 . HIS A 1 198 ? -20.282 4.737   79.857  1.00 57.65  ? 198 HIS A NE2 1 
ATOM   1492 N N   . VAL A 1 199 ? -24.111 2.229   81.045  1.00 51.98  ? 199 VAL A N   1 
ATOM   1493 C CA  . VAL A 1 199 ? -24.747 2.154   79.735  1.00 48.25  ? 199 VAL A CA  1 
ATOM   1494 C C   . VAL A 1 199 ? -26.258 1.887   79.840  1.00 45.79  ? 199 VAL A C   1 
ATOM   1495 O O   . VAL A 1 199 ? -27.024 2.205   78.929  1.00 49.49  ? 199 VAL A O   1 
ATOM   1496 C CB  . VAL A 1 199 ? -24.045 1.065   78.861  1.00 57.98  ? 199 VAL A CB  1 
ATOM   1497 C CG1 . VAL A 1 199 ? -25.041 0.131   78.156  1.00 35.46  ? 199 VAL A CG1 1 
ATOM   1498 C CG2 . VAL A 1 199 ? -23.101 1.728   77.864  1.00 52.39  ? 199 VAL A CG2 1 
ATOM   1499 N N   . ASN A 1 200 ? -26.697 1.316   80.958  1.00 53.26  ? 200 ASN A N   1 
ATOM   1500 C CA  . ASN A 1 200 ? -28.128 1.116   81.190  1.00 47.95  ? 200 ASN A CA  1 
ATOM   1501 C C   . ASN A 1 200 ? -28.825 2.450   81.534  1.00 49.94  ? 200 ASN A C   1 
ATOM   1502 O O   . ASN A 1 200 ? -30.036 2.628   81.321  1.00 47.75  ? 200 ASN A O   1 
ATOM   1503 C CB  . ASN A 1 200 ? -28.343 0.087   82.304  1.00 42.53  ? 200 ASN A CB  1 
ATOM   1504 C CG  . ASN A 1 200 ? -29.813 -0.322  82.460  1.00 46.33  ? 200 ASN A CG  1 
ATOM   1505 O OD1 . ASN A 1 200 ? -30.431 -0.068  83.495  1.00 43.85  ? 200 ASN A OD1 1 
ATOM   1506 N ND2 . ASN A 1 200 ? -30.373 -0.952  81.427  1.00 49.46  ? 200 ASN A ND2 1 
ATOM   1507 N N   . TRP A 1 201 ? -28.044 3.377   82.076  1.00 43.52  ? 201 TRP A N   1 
ATOM   1508 C CA  . TRP A 1 201 ? -28.507 4.731   82.333  1.00 47.09  ? 201 TRP A CA  1 
ATOM   1509 C C   . TRP A 1 201 ? -29.033 5.342   81.058  1.00 50.79  ? 201 TRP A C   1 
ATOM   1510 O O   . TRP A 1 201 ? -30.169 5.829   81.015  1.00 51.68  ? 201 TRP A O   1 
ATOM   1511 C CB  . TRP A 1 201 ? -27.378 5.595   82.891  1.00 52.17  ? 201 TRP A CB  1 
ATOM   1512 C CG  . TRP A 1 201 ? -27.781 7.001   83.131  1.00 52.65  ? 201 TRP A CG  1 
ATOM   1513 C CD1 . TRP A 1 201 ? -28.463 7.480   84.208  1.00 54.39  ? 201 TRP A CD1 1 
ATOM   1514 C CD2 . TRP A 1 201 ? -27.540 8.123   82.278  1.00 53.42  ? 201 TRP A CD2 1 
ATOM   1515 N NE1 . TRP A 1 201 ? -28.653 8.831   84.085  1.00 53.50  ? 201 TRP A NE1 1 
ATOM   1516 C CE2 . TRP A 1 201 ? -28.092 9.254   82.909  1.00 53.46  ? 201 TRP A CE2 1 
ATOM   1517 C CE3 . TRP A 1 201 ? -26.905 8.285   81.045  1.00 52.14  ? 201 TRP A CE3 1 
ATOM   1518 C CZ2 . TRP A 1 201 ? -28.035 10.530  82.348  1.00 58.63  ? 201 TRP A CZ2 1 
ATOM   1519 C CZ3 . TRP A 1 201 ? -26.839 9.560   80.490  1.00 55.29  ? 201 TRP A CZ3 1 
ATOM   1520 C CH2 . TRP A 1 201 ? -27.405 10.662  81.139  1.00 55.01  ? 201 TRP A CH2 1 
ATOM   1521 N N   . GLY A 1 202 ? -28.195 5.290   80.022  1.00 51.01  ? 202 GLY A N   1 
ATOM   1522 C CA  . GLY A 1 202 ? -28.544 5.765   78.701  1.00 44.65  ? 202 GLY A CA  1 
ATOM   1523 C C   . GLY A 1 202 ? -29.745 5.053   78.129  1.00 47.33  ? 202 GLY A C   1 
ATOM   1524 O O   . GLY A 1 202 ? -30.642 5.685   77.558  1.00 49.78  ? 202 GLY A O   1 
ATOM   1525 N N   . ARG A 1 203 ? -29.777 3.734   78.282  1.00 50.98  ? 203 ARG A N   1 
ATOM   1526 C CA  . ARG A 1 203 ? -30.872 2.959   77.716  1.00 49.15  ? 203 ARG A CA  1 
ATOM   1527 C C   . ARG A 1 203 ? -32.180 3.265   78.474  1.00 49.40  ? 203 ARG A C   1 
ATOM   1528 O O   . ARG A 1 203 ? -33.275 3.154   77.913  1.00 52.71  ? 203 ARG A O   1 
ATOM   1529 C CB  . ARG A 1 203 ? -30.538 1.464   77.735  1.00 42.44  ? 203 ARG A CB  1 
ATOM   1530 N N   . GLU A 1 204 ? -32.073 3.666   79.738  1.00 44.02  ? 204 GLU A N   1 
ATOM   1531 C CA  . GLU A 1 204 ? -33.274 3.984   80.507  1.00 48.40  ? 204 GLU A CA  1 
ATOM   1532 C C   . GLU A 1 204 ? -33.735 5.386   80.144  1.00 41.46  ? 204 GLU A C   1 
ATOM   1533 O O   . GLU A 1 204 ? -34.922 5.652   79.979  1.00 39.70  ? 204 GLU A O   1 
ATOM   1534 C CB  . GLU A 1 204 ? -33.035 3.867   82.026  1.00 49.40  ? 204 GLU A CB  1 
ATOM   1535 C CG  . GLU A 1 204 ? -33.089 2.428   82.612  1.00 53.49  ? 204 GLU A CG  1 
ATOM   1536 C CD  . GLU A 1 204 ? -34.437 1.703   82.421  1.00 49.68  ? 204 GLU A CD  1 
ATOM   1537 O OE1 . GLU A 1 204 ? -34.479 0.758   81.607  1.00 55.62  ? 204 GLU A OE1 1 
ATOM   1538 O OE2 . GLU A 1 204 ? -35.440 2.043   83.094  1.00 53.79  ? 204 GLU A OE2 1 
ATOM   1539 N N   . LEU A 1 205 ? -32.780 6.286   80.002  1.00 43.21  ? 205 LEU A N   1 
ATOM   1540 C CA  . LEU A 1 205 ? -33.110 7.631   79.568  1.00 45.81  ? 205 LEU A CA  1 
ATOM   1541 C C   . LEU A 1 205 ? -33.807 7.627   78.212  1.00 47.53  ? 205 LEU A C   1 
ATOM   1542 O O   . LEU A 1 205 ? -34.624 8.490   77.950  1.00 52.06  ? 205 LEU A O   1 
ATOM   1543 C CB  . LEU A 1 205 ? -31.859 8.492   79.517  1.00 43.84  ? 205 LEU A CB  1 
ATOM   1544 C CG  . LEU A 1 205 ? -32.070 9.971   79.238  1.00 40.57  ? 205 LEU A CG  1 
ATOM   1545 C CD1 . LEU A 1 205 ? -33.118 10.514  80.168  1.00 43.44  ? 205 LEU A CD1 1 
ATOM   1546 C CD2 . LEU A 1 205 ? -30.760 10.672  79.446  1.00 41.69  ? 205 LEU A CD2 1 
ATOM   1547 N N   . ALA A 1 206 ? -33.507 6.639   77.370  1.00 47.90  ? 206 ALA A N   1 
ATOM   1548 C CA  . ALA A 1 206 ? -34.091 6.556   76.035  1.00 47.24  ? 206 ALA A CA  1 
ATOM   1549 C C   . ALA A 1 206 ? -35.491 5.960   76.029  1.00 48.33  ? 206 ALA A C   1 
ATOM   1550 O O   . ALA A 1 206 ? -36.295 6.232   75.140  1.00 48.46  ? 206 ALA A O   1 
ATOM   1551 C CB  . ALA A 1 206 ? -33.185 5.750   75.131  1.00 52.03  ? 206 ALA A CB  1 
ATOM   1552 N N   . ALA A 1 207 ? -35.779 5.125   77.013  1.00 51.88  ? 207 ALA A N   1 
ATOM   1553 C CA  . ALA A 1 207 ? -37.078 4.474   77.073  1.00 51.32  ? 207 ALA A CA  1 
ATOM   1554 C C   . ALA A 1 207 ? -38.073 5.356   77.811  1.00 57.89  ? 207 ALA A C   1 
ATOM   1555 O O   . ALA A 1 207 ? -39.226 4.964   78.006  1.00 62.44  ? 207 ALA A O   1 
ATOM   1556 C CB  . ALA A 1 207 ? -36.968 3.131   77.742  1.00 50.22  ? 207 ALA A CB  1 
ATOM   1557 N N   . GLY A 1 208 ? -37.617 6.534   78.240  1.00 52.72  ? 208 GLY A N   1 
ATOM   1558 C CA  . GLY A 1 208 ? -38.510 7.551   78.779  1.00 54.45  ? 208 GLY A CA  1 
ATOM   1559 C C   . GLY A 1 208 ? -38.380 7.851   80.258  1.00 56.57  ? 208 GLY A C   1 
ATOM   1560 O O   . GLY A 1 208 ? -39.078 8.720   80.790  1.00 57.61  ? 208 GLY A O   1 
ATOM   1561 N N   . LYS A 1 209 ? -37.484 7.129   80.921  1.00 54.47  ? 209 LYS A N   1 
ATOM   1562 C CA  . LYS A 1 209 ? -37.316 7.239   82.363  1.00 46.88  ? 209 LYS A CA  1 
ATOM   1563 C C   . LYS A 1 209 ? -36.395 8.385   82.695  1.00 41.04  ? 209 LYS A C   1 
ATOM   1564 O O   . LYS A 1 209 ? -35.274 8.183   83.155  1.00 46.18  ? 209 LYS A O   1 
ATOM   1565 C CB  . LYS A 1 209 ? -36.777 5.927   82.933  1.00 47.18  ? 209 LYS A CB  1 
ATOM   1566 C CG  . LYS A 1 209 ? -37.726 4.771   82.699  1.00 54.69  ? 209 LYS A CG  1 
ATOM   1567 C CD  . LYS A 1 209 ? -39.045 5.073   83.386  1.00 61.65  ? 209 LYS A CD  1 
ATOM   1568 C CE  . LYS A 1 209 ? -40.232 5.176   82.442  1.00 63.43  ? 209 LYS A CE  1 
ATOM   1569 N NZ  . LYS A 1 209 ? -41.442 5.524   83.261  1.00 61.25  ? 209 LYS A NZ  1 
ATOM   1570 N N   . PHE A 1 210 ? -36.880 9.594   82.471  1.00 41.42  ? 210 PHE A N   1 
ATOM   1571 C CA  . PHE A 1 210 ? -36.030 10.767  82.577  1.00 42.41  ? 210 PHE A CA  1 
ATOM   1572 C C   . PHE A 1 210 ? -35.513 10.951  83.993  1.00 39.38  ? 210 PHE A C   1 
ATOM   1573 O O   . PHE A 1 210 ? -34.405 11.442  84.175  1.00 37.89  ? 210 PHE A O   1 
ATOM   1574 C CB  . PHE A 1 210 ? -36.770 12.033  82.087  1.00 45.61  ? 210 PHE A CB  1 
ATOM   1575 C CG  . PHE A 1 210 ? -38.158 12.209  82.659  1.00 44.58  ? 210 PHE A CG  1 
ATOM   1576 C CD1 . PHE A 1 210 ? -39.256 11.675  82.019  1.00 42.07  ? 210 PHE A CD1 1 
ATOM   1577 C CD2 . PHE A 1 210 ? -38.357 12.933  83.823  1.00 47.71  ? 210 PHE A CD2 1 
ATOM   1578 C CE1 . PHE A 1 210 ? -40.528 11.838  82.537  1.00 50.30  ? 210 PHE A CE1 1 
ATOM   1579 C CE2 . PHE A 1 210 ? -39.633 13.101  84.347  1.00 48.48  ? 210 PHE A CE2 1 
ATOM   1580 C CZ  . PHE A 1 210 ? -40.717 12.551  83.703  1.00 47.16  ? 210 PHE A CZ  1 
ATOM   1581 N N   . GLN A 1 211 ? -36.292 10.521  84.988  1.00 44.95  ? 211 GLN A N   1 
ATOM   1582 C CA  . GLN A 1 211 ? -35.888 10.655  86.401  1.00 46.91  ? 211 GLN A CA  1 
ATOM   1583 C C   . GLN A 1 211 ? -34.513 10.040  86.697  1.00 41.06  ? 211 GLN A C   1 
ATOM   1584 O O   . GLN A 1 211 ? -33.851 10.446  87.652  1.00 44.56  ? 211 GLN A O   1 
ATOM   1585 C CB  . GLN A 1 211 ? -36.940 10.048  87.334  1.00 43.92  ? 211 GLN A CB  1 
ATOM   1586 C CG  . GLN A 1 211 ? -36.803 8.566   87.595  1.00 39.00  ? 211 GLN A CG  1 
ATOM   1587 C CD  . GLN A 1 211 ? -38.055 7.990   88.249  1.00 51.60  ? 211 GLN A CD  1 
ATOM   1588 O OE1 . GLN A 1 211 ? -38.335 8.246   89.423  1.00 47.84  ? 211 GLN A OE1 1 
ATOM   1589 N NE2 . GLN A 1 211 ? -38.821 7.221   87.483  1.00 50.91  ? 211 GLN A NE2 1 
ATOM   1590 N N   . VAL A 1 212 ? -34.054 9.119   85.856  1.00 33.32  ? 212 VAL A N   1 
ATOM   1591 C CA  . VAL A 1 212 ? -32.693 8.626   85.987  1.00 37.24  ? 212 VAL A CA  1 
ATOM   1592 C C   . VAL A 1 212 ? -31.680 9.786   85.913  1.00 45.06  ? 212 VAL A C   1 
ATOM   1593 O O   . VAL A 1 212 ? -30.555 9.658   86.414  1.00 51.27  ? 212 VAL A O   1 
ATOM   1594 C CB  . VAL A 1 212 ? -32.342 7.533   84.911  1.00 43.87  ? 212 VAL A CB  1 
ATOM   1595 C CG1 . VAL A 1 212 ? -33.331 6.380   84.970  1.00 36.35  ? 212 VAL A CG1 1 
ATOM   1596 C CG2 . VAL A 1 212 ? -32.288 8.117   83.494  1.00 45.95  ? 212 VAL A CG2 1 
ATOM   1597 N N   . VAL A 1 213 ? -32.056 10.926  85.331  1.00 37.30  ? 213 VAL A N   1 
ATOM   1598 C CA  . VAL A 1 213 ? -31.117 12.052  85.302  1.00 41.51  ? 213 VAL A CA  1 
ATOM   1599 C C   . VAL A 1 213 ? -30.983 12.743  86.671  1.00 45.35  ? 213 VAL A C   1 
ATOM   1600 O O   . VAL A 1 213 ? -30.034 13.506  86.893  1.00 43.71  ? 213 VAL A O   1 
ATOM   1601 C CB  . VAL A 1 213 ? -31.493 13.098  84.219  1.00 44.06  ? 213 VAL A CB  1 
ATOM   1602 C CG1 . VAL A 1 213 ? -31.662 12.397  82.864  1.00 47.13  ? 213 VAL A CG1 1 
ATOM   1603 C CG2 . VAL A 1 213 ? -32.735 13.899  84.596  1.00 36.93  ? 213 VAL A CG2 1 
ATOM   1604 N N   . PHE A 1 214 ? -31.913 12.457  87.590  1.00 48.25  ? 214 PHE A N   1 
ATOM   1605 C CA  . PHE A 1 214 ? -31.830 12.973  88.969  1.00 52.96  ? 214 PHE A CA  1 
ATOM   1606 C C   . PHE A 1 214 ? -30.763 12.239  89.764  1.00 54.42  ? 214 PHE A C   1 
ATOM   1607 O O   . PHE A 1 214 ? -30.252 12.741  90.769  1.00 57.09  ? 214 PHE A O   1 
ATOM   1608 C CB  . PHE A 1 214 ? -33.168 12.835  89.697  1.00 45.73  ? 214 PHE A CB  1 
ATOM   1609 C CG  . PHE A 1 214 ? -34.296 13.549  89.028  1.00 46.57  ? 214 PHE A CG  1 
ATOM   1610 C CD1 . PHE A 1 214 ? -34.102 14.789  88.452  1.00 45.85  ? 214 PHE A CD1 1 
ATOM   1611 C CD2 . PHE A 1 214 ? -35.549 12.981  88.974  1.00 44.39  ? 214 PHE A CD2 1 
ATOM   1612 C CE1 . PHE A 1 214 ? -35.140 15.441  87.846  1.00 49.53  ? 214 PHE A CE1 1 
ATOM   1613 C CE2 . PHE A 1 214 ? -36.587 13.627  88.360  1.00 44.93  ? 214 PHE A CE2 1 
ATOM   1614 C CZ  . PHE A 1 214 ? -36.385 14.857  87.797  1.00 42.57  ? 214 PHE A CZ  1 
ATOM   1615 N N   . ASN A 1 215 ? -30.436 11.042  89.298  1.00 51.96  ? 215 ASN A N   1 
ATOM   1616 C CA  . ASN A 1 215 ? -29.628 10.120  90.067  1.00 53.59  ? 215 ASN A CA  1 
ATOM   1617 C C   . ASN A 1 215 ? -28.860 9.145   89.176  1.00 54.28  ? 215 ASN A C   1 
ATOM   1618 O O   . ASN A 1 215 ? -29.256 7.982   89.027  1.00 47.47  ? 215 ASN A O   1 
ATOM   1619 C CB  . ASN A 1 215 ? -30.533 9.358   91.027  1.00 50.52  ? 215 ASN A CB  1 
ATOM   1620 C CG  . ASN A 1 215 ? -29.763 8.529   92.004  1.00 50.33  ? 215 ASN A CG  1 
ATOM   1621 O OD1 . ASN A 1 215 ? -28.624 8.858   92.358  1.00 52.75  ? 215 ASN A OD1 1 
ATOM   1622 N ND2 . ASN A 1 215 ? -30.377 7.438   92.456  1.00 47.12  ? 215 ASN A ND2 1 
ATOM   1623 N N   . PRO A 1 216 ? -27.778 9.630   88.548  1.00 54.62  ? 216 PRO A N   1 
ATOM   1624 C CA  . PRO A 1 216 ? -26.939 8.789   87.696  1.00 53.19  ? 216 PRO A CA  1 
ATOM   1625 C C   . PRO A 1 216 ? -26.136 7.778   88.518  1.00 55.37  ? 216 PRO A C   1 
ATOM   1626 O O   . PRO A 1 216 ? -25.651 8.117   89.590  1.00 59.54  ? 216 PRO A O   1 
ATOM   1627 C CB  . PRO A 1 216 ? -26.018 9.801   87.005  1.00 48.86  ? 216 PRO A CB  1 
ATOM   1628 C CG  . PRO A 1 216 ? -26.710 11.099  87.126  1.00 48.83  ? 216 PRO A CG  1 
ATOM   1629 C CD  . PRO A 1 216 ? -27.396 11.047  88.448  1.00 54.00  ? 216 PRO A CD  1 
ATOM   1630 N N   . PRO A 1 217 ? -25.989 6.547   88.016  1.00 56.40  ? 217 PRO A N   1 
ATOM   1631 C CA  . PRO A 1 217 ? -25.274 5.534   88.793  1.00 56.17  ? 217 PRO A CA  1 
ATOM   1632 C C   . PRO A 1 217 ? -23.806 5.884   89.061  1.00 52.45  ? 217 PRO A C   1 
ATOM   1633 O O   . PRO A 1 217 ? -23.264 5.413   90.052  1.00 65.45  ? 217 PRO A O   1 
ATOM   1634 C CB  . PRO A 1 217 ? -25.389 4.282   87.918  1.00 51.44  ? 217 PRO A CB  1 
ATOM   1635 C CG  . PRO A 1 217 ? -25.641 4.806   86.538  1.00 48.09  ? 217 PRO A CG  1 
ATOM   1636 C CD  . PRO A 1 217 ? -26.473 6.021   86.730  1.00 49.34  ? 217 PRO A CD  1 
ATOM   1637 N N   . TRP A 1 218 ? -23.181 6.695   88.218  1.00 50.60  ? 218 TRP A N   1 
ATOM   1638 C CA  . TRP A 1 218 ? -21.768 7.058   88.397  1.00 54.67  ? 218 TRP A CA  1 
ATOM   1639 C C   . TRP A 1 218 ? -21.551 8.296   89.259  1.00 54.19  ? 218 TRP A C   1 
ATOM   1640 O O   . TRP A 1 218 ? -20.412 8.686   89.517  1.00 55.28  ? 218 TRP A O   1 
ATOM   1641 C CB  . TRP A 1 218 ? -21.099 7.316   87.045  1.00 55.68  ? 218 TRP A CB  1 
ATOM   1642 C CG  . TRP A 1 218 ? -21.710 8.476   86.321  1.00 51.30  ? 218 TRP A CG  1 
ATOM   1643 C CD1 . TRP A 1 218 ? -21.442 9.801   86.514  1.00 51.25  ? 218 TRP A CD1 1 
ATOM   1644 C CD2 . TRP A 1 218 ? -22.711 8.415   85.301  1.00 54.33  ? 218 TRP A CD2 1 
ATOM   1645 N NE1 . TRP A 1 218 ? -22.212 10.564  85.674  1.00 48.39  ? 218 TRP A NE1 1 
ATOM   1646 C CE2 . TRP A 1 218 ? -23.000 9.731   84.916  1.00 50.92  ? 218 TRP A CE2 1 
ATOM   1647 C CE3 . TRP A 1 218 ? -23.393 7.365   84.672  1.00 51.52  ? 218 TRP A CE3 1 
ATOM   1648 C CZ2 . TRP A 1 218 ? -23.929 10.029  83.937  1.00 49.58  ? 218 TRP A CZ2 1 
ATOM   1649 C CZ3 . TRP A 1 218 ? -24.317 7.666   83.708  1.00 47.88  ? 218 TRP A CZ3 1 
ATOM   1650 C CH2 . TRP A 1 218 ? -24.576 8.980   83.349  1.00 48.76  ? 218 TRP A CH2 1 
ATOM   1651 N N   . GLY A 1 219 ? -22.635 8.941   89.668  1.00 54.90  ? 219 GLY A N   1 
ATOM   1652 C CA  . GLY A 1 219 ? -22.510 10.167  90.426  1.00 51.76  ? 219 GLY A CA  1 
ATOM   1653 C C   . GLY A 1 219 ? -23.118 11.372  89.742  1.00 52.53  ? 219 GLY A C   1 
ATOM   1654 O O   . GLY A 1 219 ? -24.197 11.300  89.150  1.00 50.38  ? 219 GLY A O   1 
ATOM   1655 N N   . ASP A 1 220 ? -22.413 12.489  89.835  1.00 44.12  ? 220 ASP A N   1 
ATOM   1656 C CA  . ASP A 1 220 ? -22.900 13.747  89.301  1.00 49.30  ? 220 ASP A CA  1 
ATOM   1657 C C   . ASP A 1 220 ? -23.124 13.749  87.768  1.00 58.26  ? 220 ASP A C   1 
ATOM   1658 O O   . ASP A 1 220 ? -22.318 13.178  87.015  1.00 53.34  ? 220 ASP A O   1 
ATOM   1659 C CB  . ASP A 1 220 ? -21.924 14.846  89.661  1.00 44.98  ? 220 ASP A CB  1 
ATOM   1660 C CG  . ASP A 1 220 ? -22.442 16.191  89.284  1.00 58.57  ? 220 ASP A CG  1 
ATOM   1661 O OD1 . ASP A 1 220 ? -23.652 16.412  89.530  1.00 59.77  ? 220 ASP A OD1 1 
ATOM   1662 O OD2 . ASP A 1 220 ? -21.663 16.998  88.716  1.00 53.38  ? 220 ASP A OD2 1 
ATOM   1663 N N   . ILE A 1 221 ? -24.194 14.412  87.310  1.00 53.70  ? 221 ILE A N   1 
ATOM   1664 C CA  . ILE A 1 221 ? -24.546 14.418  85.884  1.00 50.96  ? 221 ILE A CA  1 
ATOM   1665 C C   . ILE A 1 221 ? -23.520 15.157  85.013  1.00 53.53  ? 221 ILE A C   1 
ATOM   1666 O O   . ILE A 1 221 ? -23.365 14.856  83.826  1.00 59.34  ? 221 ILE A O   1 
ATOM   1667 C CB  . ILE A 1 221 ? -25.944 15.039  85.643  1.00 47.68  ? 221 ILE A CB  1 
ATOM   1668 C CG1 . ILE A 1 221 ? -26.402 14.811  84.196  1.00 43.93  ? 221 ILE A CG1 1 
ATOM   1669 C CG2 . ILE A 1 221 ? -25.927 16.522  85.974  1.00 48.22  ? 221 ILE A CG2 1 
ATOM   1670 C CD1 . ILE A 1 221 ? -26.997 13.447  83.928  1.00 45.93  ? 221 ILE A CD1 1 
ATOM   1671 N N   . ASN A 1 222 ? -22.801 16.103  85.597  1.00 50.53  ? 222 ASN A N   1 
ATOM   1672 C CA  . ASN A 1 222 ? -21.812 16.844  84.835  1.00 46.19  ? 222 ASN A CA  1 
ATOM   1673 C C   . ASN A 1 222 ? -20.448 16.158  84.838  1.00 50.36  ? 222 ASN A C   1 
ATOM   1674 O O   . ASN A 1 222 ? -19.493 16.688  84.279  1.00 50.90  ? 222 ASN A O   1 
ATOM   1675 C CB  . ASN A 1 222 ? -21.695 18.277  85.370  1.00 41.90  ? 222 ASN A CB  1 
ATOM   1676 C CG  . ASN A 1 222 ? -22.789 19.196  84.826  1.00 56.55  ? 222 ASN A CG  1 
ATOM   1677 O OD1 . ASN A 1 222 ? -22.948 19.332  83.609  1.00 61.58  ? 222 ASN A OD1 1 
ATOM   1678 N ND2 . ASN A 1 222 ? -23.556 19.819  85.723  1.00 44.37  ? 222 ASN A ND2 1 
ATOM   1679 N N   . LYS A 1 223 ? -20.368 14.973  85.445  1.00 47.24  ? 223 LYS A N   1 
ATOM   1680 C CA  . LYS A 1 223 ? -19.085 14.281  85.647  1.00 48.90  ? 223 LYS A CA  1 
ATOM   1681 C C   . LYS A 1 223 ? -18.463 13.664  84.378  1.00 52.19  ? 223 LYS A C   1 
ATOM   1682 O O   . LYS A 1 223 ? -19.146 13.065  83.550  1.00 53.49  ? 223 LYS A O   1 
ATOM   1683 C CB  . LYS A 1 223 ? -19.254 13.182  86.695  1.00 52.31  ? 223 LYS A CB  1 
ATOM   1684 C CG  . LYS A 1 223 ? -17.971 12.485  87.074  1.00 51.24  ? 223 LYS A CG  1 
ATOM   1685 C CD  . LYS A 1 223 ? -18.256 11.199  87.828  1.00 54.13  ? 223 LYS A CD  1 
ATOM   1686 C CE  . LYS A 1 223 ? -16.963 10.571  88.330  1.00 58.59  ? 223 LYS A CE  1 
ATOM   1687 N NZ  . LYS A 1 223 ? -17.161 9.201   88.891  1.00 61.44  ? 223 LYS A NZ  1 
ATOM   1688 N N   . THR A 1 224 ? -17.146 13.783  84.265  1.00 58.62  ? 224 THR A N   1 
ATOM   1689 C CA  . THR A 1 224 ? -16.422 13.344  83.078  1.00 54.96  ? 224 THR A CA  1 
ATOM   1690 C C   . THR A 1 224 ? -15.669 12.001  83.208  1.00 58.81  ? 224 THR A C   1 
ATOM   1691 O O   . THR A 1 224 ? -15.651 11.370  84.268  1.00 55.82  ? 224 THR A O   1 
ATOM   1692 C CB  . THR A 1 224 ? -15.415 14.416  82.675  1.00 54.95  ? 224 THR A CB  1 
ATOM   1693 O OG1 . THR A 1 224 ? -14.281 14.355  83.548  1.00 52.70  ? 224 THR A OG1 1 
ATOM   1694 C CG2 . THR A 1 224 ? -16.061 15.780  82.770  1.00 42.27  ? 224 THR A CG2 1 
ATOM   1695 N N   . GLY A 1 225 ? -15.046 11.570  82.111  1.00 59.49  ? 225 GLY A N   1 
ATOM   1696 C CA  . GLY A 1 225 ? -14.195 10.390  82.124  1.00 53.87  ? 225 GLY A CA  1 
ATOM   1697 C C   . GLY A 1 225 ? -12.958 10.537  81.248  1.00 60.64  ? 225 GLY A C   1 
ATOM   1698 O O   . GLY A 1 225 ? -12.139 11.434  81.448  1.00 66.31  ? 225 GLY A O   1 
ATOM   1699 N N   . ARG A 1 226 ? -12.831 9.633   80.281  1.00 62.37  ? 226 ARG A N   1 
ATOM   1700 C CA  . ARG A 1 226 ? -11.802 9.677   79.249  1.00 55.50  ? 226 ARG A CA  1 
ATOM   1701 C C   . ARG A 1 226 ? -11.964 10.895  78.335  1.00 60.62  ? 226 ARG A C   1 
ATOM   1702 O O   . ARG A 1 226 ? -13.081 11.259  77.971  1.00 58.85  ? 226 ARG A O   1 
ATOM   1703 C CB  . ARG A 1 226 ? -11.859 8.392   78.417  1.00 60.29  ? 226 ARG A CB  1 
ATOM   1704 C CG  . ARG A 1 226 ? -10.968 8.364   77.187  1.00 60.02  ? 226 ARG A CG  1 
ATOM   1705 C CD  . ARG A 1 226 ? -11.541 7.421   76.133  1.00 62.95  ? 226 ARG A CD  1 
ATOM   1706 N NE  . ARG A 1 226 ? -12.659 8.019   75.400  1.00 64.83  ? 226 ARG A NE  1 
ATOM   1707 C CZ  . ARG A 1 226 ? -13.696 7.337   74.918  1.00 59.84  ? 226 ARG A CZ  1 
ATOM   1708 N NH1 . ARG A 1 226 ? -13.766 6.024   75.093  1.00 65.90  ? 226 ARG A NH1 1 
ATOM   1709 N NH2 . ARG A 1 226 ? -14.665 7.966   74.265  1.00 49.47  ? 226 ARG A NH2 1 
ATOM   1710 N N   . SER A 1 227 ? -10.844 11.511  77.960  1.00 59.35  ? 227 SER A N   1 
ATOM   1711 C CA  . SER A 1 227 ? -10.838 12.723  77.146  1.00 55.90  ? 227 SER A CA  1 
ATOM   1712 C C   . SER A 1 227 ? -11.726 13.807  77.741  1.00 60.59  ? 227 SER A C   1 
ATOM   1713 O O   . SER A 1 227 ? -12.207 14.671  77.025  1.00 60.37  ? 227 SER A O   1 
ATOM   1714 C CB  . SER A 1 227 ? -11.292 12.431  75.709  1.00 60.85  ? 227 SER A CB  1 
ATOM   1715 O OG  . SER A 1 227 ? -10.258 11.863  74.919  1.00 63.99  ? 227 SER A OG  1 
ATOM   1716 N N   . GLY A 1 228 ? -11.962 13.753  79.045  1.00 59.19  ? 228 GLY A N   1 
ATOM   1717 C CA  . GLY A 1 228 ? -12.818 14.728  79.687  1.00 52.37  ? 228 GLY A CA  1 
ATOM   1718 C C   . GLY A 1 228 ? -14.234 14.805  79.133  1.00 61.91  ? 228 GLY A C   1 
ATOM   1719 O O   . GLY A 1 228 ? -14.949 15.769  79.409  1.00 68.88  ? 228 GLY A O   1 
ATOM   1720 N N   . ILE A 1 229 ? -14.651 13.819  78.341  1.00 52.91  ? 229 ILE A N   1 
ATOM   1721 C CA  . ILE A 1 229 ? -16.044 13.769  77.900  1.00 51.85  ? 229 ILE A CA  1 
ATOM   1722 C C   . ILE A 1 229 ? -16.925 13.430  79.114  1.00 51.49  ? 229 ILE A C   1 
ATOM   1723 O O   . ILE A 1 229 ? -16.554 12.578  79.931  1.00 51.36  ? 229 ILE A O   1 
ATOM   1724 C CB  . ILE A 1 229 ? -16.264 12.718  76.758  1.00 54.07  ? 229 ILE A CB  1 
ATOM   1725 C CG1 . ILE A 1 229 ? -15.235 12.876  75.629  1.00 52.09  ? 229 ILE A CG1 1 
ATOM   1726 C CG2 . ILE A 1 229 ? -17.686 12.769  76.214  1.00 44.25  ? 229 ILE A CG2 1 
ATOM   1727 C CD1 . ILE A 1 229 ? -15.267 14.205  74.915  1.00 52.42  ? 229 ILE A CD1 1 
ATOM   1728 N N   . PRO A 1 230 ? -18.080 14.110  79.258  1.00 52.85  ? 230 PRO A N   1 
ATOM   1729 C CA  . PRO A 1 230 ? -19.033 13.725  80.312  1.00 46.94  ? 230 PRO A CA  1 
ATOM   1730 C C   . PRO A 1 230 ? -19.429 12.268  80.185  1.00 47.84  ? 230 PRO A C   1 
ATOM   1731 O O   . PRO A 1 230 ? -19.629 11.812  79.057  1.00 47.74  ? 230 PRO A O   1 
ATOM   1732 C CB  . PRO A 1 230 ? -20.239 14.631  80.058  1.00 41.74  ? 230 PRO A CB  1 
ATOM   1733 C CG  . PRO A 1 230 ? -19.651 15.834  79.403  1.00 49.04  ? 230 PRO A CG  1 
ATOM   1734 C CD  . PRO A 1 230 ? -18.494 15.342  78.565  1.00 50.76  ? 230 PRO A CD  1 
ATOM   1735 N N   . LEU A 1 231 ? -19.534 11.563  81.312  1.00 47.65  ? 231 LEU A N   1 
ATOM   1736 C CA  . LEU A 1 231 ? -19.982 10.176  81.324  1.00 45.54  ? 231 LEU A CA  1 
ATOM   1737 C C   . LEU A 1 231 ? -21.384 10.066  80.738  1.00 42.96  ? 231 LEU A C   1 
ATOM   1738 O O   . LEU A 1 231 ? -21.742 9.046   80.153  1.00 43.72  ? 231 LEU A O   1 
ATOM   1739 C CB  . LEU A 1 231 ? -19.950 9.601   82.752  1.00 48.34  ? 231 LEU A CB  1 
ATOM   1740 C CG  . LEU A 1 231 ? -18.611 9.516   83.507  1.00 51.02  ? 231 LEU A CG  1 
ATOM   1741 C CD1 . LEU A 1 231 ? -18.771 8.704   84.768  1.00 49.60  ? 231 LEU A CD1 1 
ATOM   1742 C CD2 . LEU A 1 231 ? -17.483 8.925   82.668  1.00 47.24  ? 231 LEU A CD2 1 
ATOM   1743 N N   . ALA A 1 232 ? -22.167 11.128  80.910  1.00 45.70  ? 232 ALA A N   1 
ATOM   1744 C CA  . ALA A 1 232 ? -23.509 11.233  80.341  1.00 46.77  ? 232 ALA A CA  1 
ATOM   1745 C C   . ALA A 1 232 ? -23.483 11.079  78.826  1.00 47.21  ? 232 ALA A C   1 
ATOM   1746 O O   . ALA A 1 232 ? -24.327 10.399  78.239  1.00 45.27  ? 232 ALA A O   1 
ATOM   1747 C CB  . ALA A 1 232 ? -24.131 12.558  80.710  1.00 38.94  ? 232 ALA A CB  1 
ATOM   1748 N N   . VAL A 1 233 ? -22.506 11.732  78.208  1.00 48.23  ? 233 VAL A N   1 
ATOM   1749 C CA  . VAL A 1 233 ? -22.356 11.763  76.756  1.00 47.73  ? 233 VAL A CA  1 
ATOM   1750 C C   . VAL A 1 233 ? -21.833 10.430  76.211  1.00 50.18  ? 233 VAL A C   1 
ATOM   1751 O O   . VAL A 1 233 ? -22.414 9.873   75.281  1.00 47.62  ? 233 VAL A O   1 
ATOM   1752 C CB  . VAL A 1 233 ? -21.416 12.899  76.343  1.00 42.76  ? 233 VAL A CB  1 
ATOM   1753 C CG1 . VAL A 1 233 ? -21.389 13.039  74.850  1.00 50.21  ? 233 VAL A CG1 1 
ATOM   1754 C CG2 . VAL A 1 233 ? -21.875 14.187  76.985  1.00 44.48  ? 233 VAL A CG2 1 
ATOM   1755 N N   . THR A 1 234 ? -20.751 9.914   76.804  1.00 48.36  ? 234 THR A N   1 
ATOM   1756 C CA  . THR A 1 234 ? -20.219 8.613   76.410  1.00 47.54  ? 234 THR A CA  1 
ATOM   1757 C C   . THR A 1 234 ? -21.241 7.508   76.622  1.00 45.21  ? 234 THR A C   1 
ATOM   1758 O O   . THR A 1 234 ? -21.265 6.545   75.876  1.00 49.14  ? 234 THR A O   1 
ATOM   1759 C CB  . THR A 1 234 ? -18.939 8.250   77.167  1.00 43.99  ? 234 THR A CB  1 
ATOM   1760 O OG1 . THR A 1 234 ? -19.215 8.181   78.566  1.00 55.53  ? 234 THR A OG1 1 
ATOM   1761 C CG2 . THR A 1 234 ? -17.873 9.278   76.920  1.00 41.58  ? 234 THR A CG2 1 
ATOM   1762 N N   . SER A 1 235 ? -22.095 7.650   77.624  1.00 45.07  ? 235 SER A N   1 
ATOM   1763 C CA  . SER A 1 235 ? -23.158 6.682   77.819  1.00 44.75  ? 235 SER A CA  1 
ATOM   1764 C C   . SER A 1 235 ? -24.129 6.715   76.666  1.00 49.35  ? 235 SER A C   1 
ATOM   1765 O O   . SER A 1 235 ? -24.603 5.661   76.222  1.00 53.08  ? 235 SER A O   1 
ATOM   1766 C CB  . SER A 1 235 ? -23.916 6.935   79.118  1.00 49.57  ? 235 SER A CB  1 
ATOM   1767 O OG  . SER A 1 235 ? -25.083 6.125   79.168  1.00 46.97  ? 235 SER A OG  1 
ATOM   1768 N N   . MET A 1 236 ? -24.432 7.927   76.191  1.00 50.79  ? 236 MET A N   1 
ATOM   1769 C CA  . MET A 1 236 ? -25.406 8.129   75.116  1.00 46.21  ? 236 MET A CA  1 
ATOM   1770 C C   . MET A 1 236 ? -24.833 7.698   73.759  1.00 43.36  ? 236 MET A C   1 
ATOM   1771 O O   . MET A 1 236 ? -25.530 7.078   72.955  1.00 44.36  ? 236 MET A O   1 
ATOM   1772 C CB  . MET A 1 236 ? -25.873 9.595   75.078  1.00 43.53  ? 236 MET A CB  1 
ATOM   1773 C CG  . MET A 1 236 ? -27.208 9.835   75.801  1.00 49.48  ? 236 MET A CG  1 
ATOM   1774 S SD  . MET A 1 236 ? -27.858 11.532  75.852  1.00 49.37  ? 236 MET A SD  1 
ATOM   1775 C CE  . MET A 1 236 ? -26.746 12.283  77.021  1.00 46.55  ? 236 MET A CE  1 
ATOM   1776 N N   . VAL A 1 237 ? -23.567 8.015   73.509  1.00 42.64  ? 237 VAL A N   1 
ATOM   1777 C CA  . VAL A 1 237 ? -22.891 7.540   72.305  1.00 45.65  ? 237 VAL A CA  1 
ATOM   1778 C C   . VAL A 1 237 ? -22.942 6.013   72.264  1.00 48.44  ? 237 VAL A C   1 
ATOM   1779 O O   . VAL A 1 237 ? -23.411 5.450   71.285  1.00 54.18  ? 237 VAL A O   1 
ATOM   1780 C CB  . VAL A 1 237 ? -21.417 8.020   72.229  1.00 49.61  ? 237 VAL A CB  1 
ATOM   1781 C CG1 . VAL A 1 237 ? -20.789 7.608   70.912  1.00 55.24  ? 237 VAL A CG1 1 
ATOM   1782 C CG2 . VAL A 1 237 ? -21.326 9.530   72.378  1.00 49.35  ? 237 VAL A CG2 1 
ATOM   1783 N N   . LYS A 1 238 ? -22.507 5.358   73.348  1.00 51.79  ? 238 LYS A N   1 
ATOM   1784 C CA  . LYS A 1 238 ? -22.574 3.892   73.499  1.00 48.76  ? 238 LYS A CA  1 
ATOM   1785 C C   . LYS A 1 238 ? -23.986 3.286   73.305  1.00 51.58  ? 238 LYS A C   1 
ATOM   1786 O O   . LYS A 1 238 ? -24.123 2.183   72.777  1.00 53.75  ? 238 LYS A O   1 
ATOM   1787 C CB  . LYS A 1 238 ? -22.024 3.475   74.867  1.00 40.78  ? 238 LYS A CB  1 
ATOM   1788 C CG  . LYS A 1 238 ? -20.522 3.711   75.039  1.00 45.26  ? 238 LYS A CG  1 
ATOM   1789 C CD  . LYS A 1 238 ? -19.698 2.426   74.934  1.00 53.30  ? 238 LYS A CD  1 
ATOM   1790 C CE  . LYS A 1 238 ? -18.197 2.708   74.675  1.00 66.48  ? 238 LYS A CE  1 
ATOM   1791 N NZ  . LYS A 1 238 ? -17.451 3.437   75.770  1.00 55.72  ? 238 LYS A NZ  1 
ATOM   1792 N N   . VAL A 1 239 ? -25.033 3.994   73.710  1.00 48.02  ? 239 VAL A N   1 
ATOM   1793 C CA  . VAL A 1 239 ? -26.381 3.516   73.433  1.00 44.37  ? 239 VAL A CA  1 
ATOM   1794 C C   . VAL A 1 239 ? -26.705 3.656   71.940  1.00 49.00  ? 239 VAL A C   1 
ATOM   1795 O O   . VAL A 1 239 ? -27.415 2.831   71.372  1.00 50.81  ? 239 VAL A O   1 
ATOM   1796 C CB  . VAL A 1 239 ? -27.429 4.264   74.274  1.00 47.45  ? 239 VAL A CB  1 
ATOM   1797 C CG1 . VAL A 1 239 ? -28.828 3.896   73.838  1.00 46.10  ? 239 VAL A CG1 1 
ATOM   1798 C CG2 . VAL A 1 239 ? -27.234 3.963   75.760  1.00 44.41  ? 239 VAL A CG2 1 
ATOM   1799 N N   . ALA A 1 240 ? -26.168 4.683   71.290  1.00 48.30  ? 240 ALA A N   1 
ATOM   1800 C CA  . ALA A 1 240 ? -26.373 4.842   69.850  1.00 52.36  ? 240 ALA A CA  1 
ATOM   1801 C C   . ALA A 1 240 ? -25.683 3.705   69.094  1.00 47.39  ? 240 ALA A C   1 
ATOM   1802 O O   . ALA A 1 240 ? -26.256 3.091   68.192  1.00 43.74  ? 240 ALA A O   1 
ATOM   1803 C CB  . ALA A 1 240 ? -25.848 6.196   69.379  1.00 53.30  ? 240 ALA A CB  1 
ATOM   1804 N N   . GLU A 1 241 ? -24.453 3.425   69.513  1.00 48.45  ? 241 GLU A N   1 
ATOM   1805 C CA  . GLU A 1 241 ? -23.622 2.373   68.939  1.00 53.33  ? 241 GLU A CA  1 
ATOM   1806 C C   . GLU A 1 241 ? -24.216 0.974   69.025  1.00 52.37  ? 241 GLU A C   1 
ATOM   1807 O O   . GLU A 1 241 ? -23.842 0.110   68.238  1.00 57.54  ? 241 GLU A O   1 
ATOM   1808 C CB  . GLU A 1 241 ? -22.242 2.365   69.608  1.00 51.86  ? 241 GLU A CB  1 
ATOM   1809 C CG  . GLU A 1 241 ? -21.517 3.706   69.537  1.00 50.33  ? 241 GLU A CG  1 
ATOM   1810 C CD  . GLU A 1 241 ? -20.042 3.587   69.874  1.00 59.66  ? 241 GLU A CD  1 
ATOM   1811 O OE1 . GLU A 1 241 ? -19.556 2.441   70.058  1.00 65.20  ? 241 GLU A OE1 1 
ATOM   1812 O OE2 . GLU A 1 241 ? -19.368 4.643   69.945  1.00 56.90  ? 241 GLU A OE2 1 
ATOM   1813 N N   . LEU A 1 242 ? -25.134 0.749   69.966  1.00 52.48  ? 242 LEU A N   1 
ATOM   1814 C CA  . LEU A 1 242 ? -25.676 -0.593  70.192  1.00 48.62  ? 242 LEU A CA  1 
ATOM   1815 C C   . LEU A 1 242 ? -27.141 -0.731  69.823  1.00 49.37  ? 242 LEU A C   1 
ATOM   1816 O O   . LEU A 1 242 ? -27.543 -1.705  69.203  1.00 57.62  ? 242 LEU A O   1 
ATOM   1817 C CB  . LEU A 1 242 ? -25.484 -1.002  71.647  1.00 46.98  ? 242 LEU A CB  1 
ATOM   1818 C CG  . LEU A 1 242 ? -24.199 -1.766  71.978  1.00 43.71  ? 242 LEU A CG  1 
ATOM   1819 C CD1 . LEU A 1 242 ? -22.986 -1.203  71.261  1.00 55.61  ? 242 LEU A CD1 1 
ATOM   1820 C CD2 . LEU A 1 242 ? -23.962 -1.743  73.441  1.00 34.51  ? 242 LEU A CD2 1 
ATOM   1821 N N   . ASP A 1 243 ? -27.949 0.242   70.198  1.00 53.12  ? 243 ASP A N   1 
ATOM   1822 C CA  . ASP A 1 243 ? -29.374 0.154   69.906  1.00 57.95  ? 243 ASP A CA  1 
ATOM   1823 C C   . ASP A 1 243 ? -29.716 0.957   68.660  1.00 57.16  ? 243 ASP A C   1 
ATOM   1824 O O   . ASP A 1 243 ? -30.890 1.151   68.329  1.00 62.96  ? 243 ASP A O   1 
ATOM   1825 C CB  . ASP A 1 243 ? -30.199 0.629   71.106  1.00 62.25  ? 243 ASP A CB  1 
ATOM   1826 C CG  . ASP A 1 243 ? -29.946 -0.211  72.358  1.00 61.52  ? 243 ASP A CG  1 
ATOM   1827 O OD1 . ASP A 1 243 ? -28.982 -1.015  72.341  1.00 51.86  ? 243 ASP A OD1 1 
ATOM   1828 O OD2 . ASP A 1 243 ? -30.708 -0.058  73.348  1.00 61.99  ? 243 ASP A OD2 1 
ATOM   1829 N N   . GLY A 1 244 ? -28.680 1.422   67.970  1.00 52.81  ? 244 GLY A N   1 
ATOM   1830 C CA  . GLY A 1 244 ? -28.877 2.085   66.701  1.00 58.50  ? 244 GLY A CA  1 
ATOM   1831 C C   . GLY A 1 244 ? -29.028 3.575   66.850  1.00 61.06  ? 244 GLY A C   1 
ATOM   1832 O O   . GLY A 1 244 ? -29.260 4.081   67.944  1.00 61.92  ? 244 GLY A O   1 
ATOM   1833 N N   . HIS A 1 245 ? -28.914 4.275   65.730  1.00 69.78  ? 245 HIS A N   1 
ATOM   1834 C CA  . HIS A 1 245 ? -28.847 5.728   65.737  1.00 69.77  ? 245 HIS A CA  1 
ATOM   1835 C C   . HIS A 1 245 ? -30.128 6.388   66.234  1.00 63.31  ? 245 HIS A C   1 
ATOM   1836 O O   . HIS A 1 245 ? -30.064 7.328   67.031  1.00 60.73  ? 245 HIS A O   1 
ATOM   1837 C CB  . HIS A 1 245 ? -28.516 6.236   64.334  1.00 73.22  ? 245 HIS A CB  1 
ATOM   1838 C CG  . HIS A 1 245 ? -28.178 7.694   64.292  1.00 78.02  ? 245 HIS A CG  1 
ATOM   1839 N ND1 . HIS A 1 245 ? -27.291 8.271   65.170  1.00 78.28  ? 245 HIS A ND1 1 
ATOM   1840 C CD2 . HIS A 1 245 ? -28.616 8.687   63.478  1.00 84.03  ? 245 HIS A CD2 1 
ATOM   1841 C CE1 . HIS A 1 245 ? -27.193 9.568   64.904  1.00 79.69  ? 245 HIS A CE1 1 
ATOM   1842 N NE2 . HIS A 1 245 ? -27.986 9.843   63.885  1.00 86.23  ? 245 HIS A NE2 1 
ATOM   1843 N N   . LYS A 1 246 ? -31.282 5.881   65.793  1.00 59.67  ? 246 LYS A N   1 
ATOM   1844 C CA  . LYS A 1 246 ? -32.574 6.542   66.039  1.00 53.71  ? 246 LYS A CA  1 
ATOM   1845 C C   . LYS A 1 246 ? -32.959 6.657   67.501  1.00 59.14  ? 246 LYS A C   1 
ATOM   1846 O O   . LYS A 1 246 ? -33.975 7.225   67.849  1.00 58.41  ? 246 LYS A O   1 
ATOM   1847 C CB  . LYS A 1 246 ? -33.681 5.812   65.262  1.00 53.37  ? 246 LYS A CB  1 
ATOM   1848 N N   . ARG A 1 247 ? -32.126 6.092   68.351  1.00 60.93  ? 247 ARG A N   1 
ATOM   1849 C CA  . ARG A 1 247 ? -32.433 6.004   69.762  1.00 57.04  ? 247 ARG A CA  1 
ATOM   1850 C C   . ARG A 1 247 ? -32.117 7.314   70.488  1.00 53.96  ? 247 ARG A C   1 
ATOM   1851 O O   . ARG A 1 247 ? -32.774 7.660   71.467  1.00 52.58  ? 247 ARG A O   1 
ATOM   1852 C CB  . ARG A 1 247 ? -31.661 4.836   70.386  1.00 58.43  ? 247 ARG A CB  1 
ATOM   1853 C CG  . ARG A 1 247 ? -32.363 4.141   71.501  1.00 57.30  ? 247 ARG A CG  1 
ATOM   1854 C CD  . ARG A 1 247 ? -33.257 3.013   71.023  1.00 57.57  ? 247 ARG A CD  1 
ATOM   1855 N NE  . ARG A 1 247 ? -33.937 2.430   72.182  1.00 73.35  ? 247 ARG A NE  1 
ATOM   1856 C CZ  . ARG A 1 247 ? -35.197 2.689   72.535  1.00 62.68  ? 247 ARG A CZ  1 
ATOM   1857 N NH1 . ARG A 1 247 ? -35.952 3.489   71.797  1.00 58.84  ? 247 ARG A NH1 1 
ATOM   1858 N NH2 . ARG A 1 247 ? -35.710 2.130   73.623  1.00 60.72  ? 247 ARG A NH2 1 
ATOM   1859 N N   . LEU A 1 248 ? -31.121 8.048   69.995  1.00 53.30  ? 248 LEU A N   1 
ATOM   1860 C CA  . LEU A 1 248 ? -30.779 9.365   70.535  1.00 44.69  ? 248 LEU A CA  1 
ATOM   1861 C C   . LEU A 1 248 ? -31.928 10.358  70.377  1.00 52.43  ? 248 LEU A C   1 
ATOM   1862 O O   . LEU A 1 248 ? -31.940 11.406  71.023  1.00 51.72  ? 248 LEU A O   1 
ATOM   1863 C CB  . LEU A 1 248 ? -29.554 9.947   69.847  1.00 41.06  ? 248 LEU A CB  1 
ATOM   1864 C CG  . LEU A 1 248 ? -28.195 9.305   70.026  1.00 49.95  ? 248 LEU A CG  1 
ATOM   1865 C CD1 . LEU A 1 248 ? -27.307 9.700   68.848  1.00 51.18  ? 248 LEU A CD1 1 
ATOM   1866 C CD2 . LEU A 1 248 ? -27.580 9.755   71.335  1.00 49.25  ? 248 LEU A CD2 1 
ATOM   1867 N N   . GLU A 1 249 ? -32.875 10.046  69.496  1.00 52.62  ? 249 GLU A N   1 
ATOM   1868 C CA  . GLU A 1 249 ? -34.019 10.912  69.287  1.00 50.57  ? 249 GLU A CA  1 
ATOM   1869 C C   . GLU A 1 249 ? -35.159 10.536  70.210  1.00 49.54  ? 249 GLU A C   1 
ATOM   1870 O O   . GLU A 1 249 ? -36.008 11.362  70.524  1.00 54.07  ? 249 GLU A O   1 
ATOM   1871 C CB  . GLU A 1 249 ? -34.459 10.869  67.827  1.00 58.30  ? 249 GLU A CB  1 
ATOM   1872 C CG  . GLU A 1 249 ? -33.781 11.943  66.994  1.00 60.20  ? 249 GLU A CG  1 
ATOM   1873 C CD  . GLU A 1 249 ? -33.783 11.633  65.520  1.00 78.92  ? 249 GLU A CD  1 
ATOM   1874 O OE1 . GLU A 1 249 ? -34.352 10.586  65.126  1.00 73.34  ? 249 GLU A OE1 1 
ATOM   1875 O OE2 . GLU A 1 249 ? -33.211 12.444  64.755  1.00 85.24  ? 249 GLU A OE2 1 
ATOM   1876 N N   . ASP A 1 250 ? -35.177 9.288   70.655  1.00 52.97  ? 250 ASP A N   1 
ATOM   1877 C CA  . ASP A 1 250 ? -36.061 8.910   71.752  1.00 52.31  ? 250 ASP A CA  1 
ATOM   1878 C C   . ASP A 1 250 ? -35.649 9.681   73.003  1.00 50.73  ? 250 ASP A C   1 
ATOM   1879 O O   . ASP A 1 250 ? -36.491 10.049  73.822  1.00 50.22  ? 250 ASP A O   1 
ATOM   1880 C CB  . ASP A 1 250 ? -36.018 7.406   71.993  1.00 48.77  ? 250 ASP A CB  1 
ATOM   1881 C CG  . ASP A 1 250 ? -36.621 6.625   70.845  1.00 51.49  ? 250 ASP A CG  1 
ATOM   1882 O OD1 . ASP A 1 250 ? -37.866 6.571   70.740  1.00 43.61  ? 250 ASP A OD1 1 
ATOM   1883 O OD2 . ASP A 1 250 ? -35.849 6.076   70.032  1.00 60.41  ? 250 ASP A OD2 1 
ATOM   1884 N N   . ILE A 1 251 ? -34.349 9.944   73.119  1.00 46.11  ? 251 ILE A N   1 
ATOM   1885 C CA  . ILE A 1 251 ? -33.796 10.707  74.231  1.00 48.48  ? 251 ILE A CA  1 
ATOM   1886 C C   . ILE A 1 251 ? -34.098 12.214  74.126  1.00 49.74  ? 251 ILE A C   1 
ATOM   1887 O O   . ILE A 1 251 ? -34.212 12.890  75.141  1.00 52.54  ? 251 ILE A O   1 
ATOM   1888 C CB  . ILE A 1 251 ? -32.278 10.479  74.344  1.00 46.48  ? 251 ILE A CB  1 
ATOM   1889 C CG1 . ILE A 1 251 ? -32.005 9.078   74.859  1.00 44.78  ? 251 ILE A CG1 1 
ATOM   1890 C CG2 . ILE A 1 251 ? -31.634 11.441  75.305  1.00 47.59  ? 251 ILE A CG2 1 
ATOM   1891 C CD1 . ILE A 1 251 ? -30.573 8.819   75.138  1.00 42.72  ? 251 ILE A CD1 1 
ATOM   1892 N N   . ARG A 1 252 ? -34.262 12.743  72.918  1.00 50.71  ? 252 ARG A N   1 
ATOM   1893 C CA  . ARG A 1 252 ? -34.742 14.118  72.790  1.00 46.96  ? 252 ARG A CA  1 
ATOM   1894 C C   . ARG A 1 252 ? -36.215 14.192  73.193  1.00 48.82  ? 252 ARG A C   1 
ATOM   1895 O O   . ARG A 1 252 ? -36.634 15.137  73.851  1.00 52.13  ? 252 ARG A O   1 
ATOM   1896 C CB  . ARG A 1 252 ? -34.563 14.669  71.374  1.00 49.44  ? 252 ARG A CB  1 
ATOM   1897 C CG  . ARG A 1 252 ? -35.039 16.121  71.265  1.00 52.89  ? 252 ARG A CG  1 
ATOM   1898 C CD  . ARG A 1 252 ? -35.003 16.686  69.862  1.00 47.99  ? 252 ARG A CD  1 
ATOM   1899 N NE  . ARG A 1 252 ? -33.652 16.805  69.347  1.00 45.08  ? 252 ARG A NE  1 
ATOM   1900 C CZ  . ARG A 1 252 ? -33.092 15.907  68.547  1.00 54.62  ? 252 ARG A CZ  1 
ATOM   1901 N NH1 . ARG A 1 252 ? -33.780 14.829  68.187  1.00 56.96  ? 252 ARG A NH1 1 
ATOM   1902 N NH2 . ARG A 1 252 ? -31.854 16.084  68.104  1.00 52.35  ? 252 ARG A NH2 1 
ATOM   1903 N N   . LYS A 1 253 ? -36.998 13.191  72.817  1.00 47.16  ? 253 LYS A N   1 
ATOM   1904 C CA  . LYS A 1 253 ? -38.395 13.146  73.232  1.00 46.79  ? 253 LYS A CA  1 
ATOM   1905 C C   . LYS A 1 253 ? -38.497 12.959  74.747  1.00 52.80  ? 253 LYS A C   1 
ATOM   1906 O O   . LYS A 1 253 ? -39.441 13.433  75.389  1.00 54.07  ? 253 LYS A O   1 
ATOM   1907 C CB  . LYS A 1 253 ? -39.139 12.023  72.503  1.00 44.73  ? 253 LYS A CB  1 
ATOM   1908 C CG  . LYS A 1 253 ? -40.604 12.346  72.231  1.00 53.37  ? 253 LYS A CG  1 
ATOM   1909 C CD  . LYS A 1 253 ? -41.272 11.341  71.282  1.00 62.34  ? 253 LYS A CD  1 
ATOM   1910 C CE  . LYS A 1 253 ? -40.511 11.184  69.965  1.00 59.06  ? 253 LYS A CE  1 
ATOM   1911 N NZ  . LYS A 1 253 ? -41.414 10.742  68.865  1.00 52.40  ? 253 LYS A NZ  1 
ATOM   1912 N N   . THR A 1 254 ? -37.515 12.272  75.321  1.00 52.33  ? 254 THR A N   1 
ATOM   1913 C CA  . THR A 1 254 ? -37.515 12.021  76.753  1.00 52.41  ? 254 THR A CA  1 
ATOM   1914 C C   . THR A 1 254 ? -37.157 13.293  77.505  1.00 50.15  ? 254 THR A C   1 
ATOM   1915 O O   . THR A 1 254 ? -37.796 13.639  78.490  1.00 51.27  ? 254 THR A O   1 
ATOM   1916 C CB  . THR A 1 254 ? -36.541 10.900  77.116  1.00 49.95  ? 254 THR A CB  1 
ATOM   1917 O OG1 . THR A 1 254 ? -37.041 9.667   76.587  1.00 48.10  ? 254 THR A OG1 1 
ATOM   1918 C CG2 . THR A 1 254 ? -36.388 10.792  78.622  1.00 43.00  ? 254 THR A CG2 1 
ATOM   1919 N N   . LEU A 1 255 ? -36.139 13.998  77.026  1.00 48.98  ? 255 LEU A N   1 
ATOM   1920 C CA  . LEU A 1 255 ? -35.802 15.294  77.584  1.00 50.54  ? 255 LEU A CA  1 
ATOM   1921 C C   . LEU A 1 255 ? -37.000 16.247  77.518  1.00 49.44  ? 255 LEU A C   1 
ATOM   1922 O O   . LEU A 1 255 ? -37.166 17.117  78.367  1.00 53.84  ? 255 LEU A O   1 
ATOM   1923 C CB  . LEU A 1 255 ? -34.604 15.905  76.849  1.00 49.99  ? 255 LEU A CB  1 
ATOM   1924 C CG  . LEU A 1 255 ? -33.275 15.160  76.865  1.00 42.33  ? 255 LEU A CG  1 
ATOM   1925 C CD1 . LEU A 1 255 ? -32.166 16.035  76.294  1.00 44.24  ? 255 LEU A CD1 1 
ATOM   1926 C CD2 . LEU A 1 255 ? -32.929 14.663  78.266  1.00 49.05  ? 255 LEU A CD2 1 
ATOM   1927 N N   . LEU A 1 256 ? -37.835 16.090  76.504  1.00 51.11  ? 256 LEU A N   1 
ATOM   1928 C CA  . LEU A 1 256 ? -39.038 16.903  76.414  1.00 54.52  ? 256 LEU A CA  1 
ATOM   1929 C C   . LEU A 1 256 ? -39.978 16.590  77.567  1.00 50.14  ? 256 LEU A C   1 
ATOM   1930 O O   . LEU A 1 256 ? -40.549 17.495  78.171  1.00 50.19  ? 256 LEU A O   1 
ATOM   1931 C CB  . LEU A 1 256 ? -39.758 16.687  75.079  1.00 52.14  ? 256 LEU A CB  1 
ATOM   1932 C CG  . LEU A 1 256 ? -39.314 17.532  73.885  1.00 55.99  ? 256 LEU A CG  1 
ATOM   1933 C CD1 . LEU A 1 256 ? -40.290 17.352  72.733  1.00 51.26  ? 256 LEU A CD1 1 
ATOM   1934 C CD2 . LEU A 1 256 ? -39.190 18.993  74.288  1.00 53.10  ? 256 LEU A CD2 1 
ATOM   1935 N N   . ASP A 1 257 ? -40.146 15.305  77.857  1.00 49.74  ? 257 ASP A N   1 
ATOM   1936 C CA  . ASP A 1 257 ? -40.997 14.886  78.961  1.00 49.33  ? 257 ASP A CA  1 
ATOM   1937 C C   . ASP A 1 257 ? -40.435 15.363  80.297  1.00 53.79  ? 257 ASP A C   1 
ATOM   1938 O O   . ASP A 1 257 ? -41.203 15.753  81.195  1.00 49.02  ? 257 ASP A O   1 
ATOM   1939 C CB  . ASP A 1 257 ? -41.159 13.376  78.952  1.00 46.75  ? 257 ASP A CB  1 
ATOM   1940 C CG  . ASP A 1 257 ? -42.207 12.934  77.988  1.00 55.26  ? 257 ASP A CG  1 
ATOM   1941 O OD1 . ASP A 1 257 ? -43.398 13.049  78.349  1.00 66.14  ? 257 ASP A OD1 1 
ATOM   1942 O OD2 . ASP A 1 257 ? -41.851 12.501  76.870  1.00 57.81  ? 257 ASP A OD2 1 
ATOM   1943 N N   . LEU A 1 258 ? -39.104 15.339  80.413  1.00 40.02  ? 258 LEU A N   1 
ATOM   1944 C CA  . LEU A 1 258 ? -38.429 15.908  81.565  1.00 46.12  ? 258 LEU A CA  1 
ATOM   1945 C C   . LEU A 1 258 ? -38.770 17.395  81.745  1.00 55.11  ? 258 LEU A C   1 
ATOM   1946 O O   . LEU A 1 258 ? -39.110 17.834  82.849  1.00 54.32  ? 258 LEU A O   1 
ATOM   1947 C CB  . LEU A 1 258 ? -36.920 15.730  81.439  1.00 47.80  ? 258 LEU A CB  1 
ATOM   1948 C CG  . LEU A 1 258 ? -36.128 16.418  82.548  1.00 46.35  ? 258 LEU A CG  1 
ATOM   1949 C CD1 . LEU A 1 258 ? -36.631 15.913  83.868  1.00 49.07  ? 258 LEU A CD1 1 
ATOM   1950 C CD2 . LEU A 1 258 ? -34.618 16.196  82.407  1.00 40.89  ? 258 LEU A CD2 1 
ATOM   1951 N N   . LYS A 1 259 ? -38.672 18.156  80.653  1.00 60.13  ? 259 LYS A N   1 
ATOM   1952 C CA  . LYS A 1 259 ? -38.908 19.604  80.661  1.00 56.87  ? 259 LYS A CA  1 
ATOM   1953 C C   . LYS A 1 259 ? -40.336 19.920  81.065  1.00 54.32  ? 259 LYS A C   1 
ATOM   1954 O O   . LYS A 1 259 ? -40.568 20.812  81.877  1.00 56.10  ? 259 LYS A O   1 
ATOM   1955 C CB  . LYS A 1 259 ? -38.599 20.209  79.284  1.00 57.98  ? 259 LYS A CB  1 
ATOM   1956 C CG  . LYS A 1 259 ? -38.722 21.728  79.197  1.00 54.47  ? 259 LYS A CG  1 
ATOM   1957 C CD  . LYS A 1 259 ? -37.940 22.266  78.009  1.00 58.94  ? 259 LYS A CD  1 
ATOM   1958 C CE  . LYS A 1 259 ? -38.352 23.682  77.619  1.00 64.95  ? 259 LYS A CE  1 
ATOM   1959 N NZ  . LYS A 1 259 ? -39.577 23.695  76.748  1.00 72.00  ? 259 LYS A NZ  1 
ATOM   1960 N N   . LYS A 1 260 ? -41.287 19.184  80.500  1.00 47.72  ? 260 LYS A N   1 
ATOM   1961 C CA  . LYS A 1 260 ? -42.691 19.325  80.875  1.00 51.38  ? 260 LYS A CA  1 
ATOM   1962 C C   . LYS A 1 260 ? -42.889 18.929  82.334  1.00 61.18  ? 260 LYS A C   1 
ATOM   1963 O O   . LYS A 1 260 ? -43.811 19.406  82.985  1.00 64.32  ? 260 LYS A O   1 
ATOM   1964 C CB  . LYS A 1 260 ? -43.586 18.474  79.972  1.00 55.24  ? 260 LYS A CB  1 
ATOM   1965 C CG  . LYS A 1 260 ? -45.082 18.552  80.269  1.00 65.14  ? 260 LYS A CG  1 
ATOM   1966 C CD  . LYS A 1 260 ? -45.717 19.866  79.803  1.00 65.72  ? 260 LYS A CD  1 
ATOM   1967 C CE  . LYS A 1 260 ? -47.193 19.929  80.194  1.00 66.36  ? 260 LYS A CE  1 
ATOM   1968 N NZ  . LYS A 1 260 ? -47.914 18.654  79.880  1.00 61.26  ? 260 LYS A NZ  1 
ATOM   1969 N N   . TRP A 1 261 ? -42.028 18.055  82.851  1.00 58.93  ? 261 TRP A N   1 
ATOM   1970 C CA  . TRP A 1 261 ? -42.134 17.662  84.246  1.00 49.35  ? 261 TRP A CA  1 
ATOM   1971 C C   . TRP A 1 261 ? -41.743 18.810  85.135  1.00 53.63  ? 261 TRP A C   1 
ATOM   1972 O O   . TRP A 1 261 ? -42.447 19.154  86.077  1.00 58.88  ? 261 TRP A O   1 
ATOM   1973 C CB  . TRP A 1 261 ? -41.248 16.459  84.586  1.00 53.71  ? 261 TRP A CB  1 
ATOM   1974 C CG  . TRP A 1 261 ? -41.423 16.041  86.017  1.00 50.51  ? 261 TRP A CG  1 
ATOM   1975 C CD1 . TRP A 1 261 ? -40.662 16.413  87.099  1.00 46.54  ? 261 TRP A CD1 1 
ATOM   1976 C CD2 . TRP A 1 261 ? -42.461 15.211  86.525  1.00 46.12  ? 261 TRP A CD2 1 
ATOM   1977 N NE1 . TRP A 1 261 ? -41.166 15.845  88.243  1.00 45.87  ? 261 TRP A NE1 1 
ATOM   1978 C CE2 . TRP A 1 261 ? -42.268 15.101  87.913  1.00 44.49  ? 261 TRP A CE2 1 
ATOM   1979 C CE3 . TRP A 1 261 ? -43.531 14.540  85.934  1.00 51.49  ? 261 TRP A CE3 1 
ATOM   1980 C CZ2 . TRP A 1 261 ? -43.100 14.340  88.712  1.00 55.04  ? 261 TRP A CZ2 1 
ATOM   1981 C CZ3 . TRP A 1 261 ? -44.359 13.788  86.733  1.00 58.56  ? 261 TRP A CZ3 1 
ATOM   1982 C CH2 . TRP A 1 261 ? -44.142 13.694  88.105  1.00 56.44  ? 261 TRP A CH2 1 
ATOM   1983 N N   . ILE A 1 262 ? -40.591 19.391  84.861  1.00 53.19  ? 262 ILE A N   1 
ATOM   1984 C CA  . ILE A 1 262 ? -40.109 20.441  85.729  1.00 56.16  ? 262 ILE A CA  1 
ATOM   1985 C C   . ILE A 1 262 ? -41.073 21.625  85.675  1.00 60.12  ? 262 ILE A C   1 
ATOM   1986 O O   . ILE A 1 262 ? -41.433 22.187  86.705  1.00 62.36  ? 262 ILE A O   1 
ATOM   1987 C CB  . ILE A 1 262 ? -38.700 20.845  85.352  1.00 53.06  ? 262 ILE A CB  1 
ATOM   1988 C CG1 . ILE A 1 262 ? -37.758 19.678  85.651  1.00 50.34  ? 262 ILE A CG1 1 
ATOM   1989 C CG2 . ILE A 1 262 ? -38.283 22.069  86.133  1.00 63.42  ? 262 ILE A CG2 1 
ATOM   1990 C CD1 . ILE A 1 262 ? -36.579 19.583  84.720  1.00 51.99  ? 262 ILE A CD1 1 
ATOM   1991 N N   . GLU A 1 263 ? -41.529 21.956  84.473  1.00 65.97  ? 263 GLU A N   1 
ATOM   1992 C CA  . GLU A 1 263 ? -42.499 23.026  84.275  1.00 65.73  ? 263 GLU A CA  1 
ATOM   1993 C C   . GLU A 1 263 ? -43.803 22.743  85.029  1.00 62.66  ? 263 GLU A C   1 
ATOM   1994 O O   . GLU A 1 263 ? -44.432 23.664  85.542  1.00 70.38  ? 263 GLU A O   1 
ATOM   1995 C CB  . GLU A 1 263 ? -42.759 23.226  82.772  1.00 62.16  ? 263 GLU A CB  1 
ATOM   1996 C CG  . GLU A 1 263 ? -44.176 23.667  82.388  1.00 64.67  ? 263 GLU A CG  1 
ATOM   1997 C CD  . GLU A 1 263 ? -44.554 23.226  80.964  1.00 73.25  ? 263 GLU A CD  1 
ATOM   1998 O OE1 . GLU A 1 263 ? -43.640 22.832  80.198  1.00 73.01  ? 263 GLU A OE1 1 
ATOM   1999 O OE2 . GLU A 1 263 ? -45.759 23.264  80.608  1.00 71.03  ? 263 GLU A OE2 1 
ATOM   2000 N N   . ASP A 1 264 ? -44.200 21.479  85.125  1.00 57.08  ? 264 ASP A N   1 
ATOM   2001 C CA  . ASP A 1 264 ? -45.468 21.142  85.781  1.00 59.78  ? 264 ASP A CA  1 
ATOM   2002 C C   . ASP A 1 264 ? -45.336 21.004  87.302  1.00 59.70  ? 264 ASP A C   1 
ATOM   2003 O O   . ASP A 1 264 ? -46.332 20.816  88.001  1.00 45.17  ? 264 ASP A O   1 
ATOM   2004 C CB  . ASP A 1 264 ? -46.044 19.847  85.204  1.00 54.25  ? 264 ASP A CB  1 
ATOM   2005 C CG  . ASP A 1 264 ? -46.745 20.061  83.882  1.00 65.31  ? 264 ASP A CG  1 
ATOM   2006 O OD1 . ASP A 1 264 ? -46.461 21.077  83.210  1.00 63.89  ? 264 ASP A OD1 1 
ATOM   2007 O OD2 . ASP A 1 264 ? -47.581 19.211  83.510  1.00 72.05  ? 264 ASP A OD2 1 
ATOM   2008 N N   . ASN A 1 265 ? -44.099 21.103  87.795  1.00 64.46  ? 265 ASN A N   1 
ATOM   2009 C CA  . ASN A 1 265 ? -43.767 20.840  89.195  1.00 56.42  ? 265 ASN A CA  1 
ATOM   2010 C C   . ASN A 1 265 ? -42.555 21.627  89.657  1.00 55.65  ? 265 ASN A C   1 
ATOM   2011 O O   . ASN A 1 265 ? -41.806 21.137  90.495  1.00 58.07  ? 265 ASN A O   1 
ATOM   2012 C CB  . ASN A 1 265 ? -43.482 19.350  89.422  1.00 47.69  ? 265 ASN A CB  1 
ATOM   2013 C CG  . ASN A 1 265 ? -44.681 18.479  89.162  1.00 46.95  ? 265 ASN A CG  1 
ATOM   2014 O OD1 . ASN A 1 265 ? -45.625 18.479  89.941  1.00 57.66  ? 265 ASN A OD1 1 
ATOM   2015 N ND2 . ASN A 1 265 ? -44.650 17.716  88.074  1.00 47.74  ? 265 ASN A ND2 1 
ATOM   2016 N N   . LYS A 1 266 ? -42.357 22.829  89.112  1.00 58.92  ? 266 LYS A N   1 
ATOM   2017 C CA  . LYS A 1 266 ? -41.205 23.678  89.451  1.00 60.12  ? 266 LYS A CA  1 
ATOM   2018 C C   . LYS A 1 266 ? -41.041 23.802  90.957  1.00 61.18  ? 266 LYS A C   1 
ATOM   2019 O O   . LYS A 1 266 ? -39.937 24.041  91.459  1.00 61.67  ? 266 LYS A O   1 
ATOM   2020 C CB  . LYS A 1 266 ? -41.357 25.074  88.836  1.00 54.57  ? 266 LYS A CB  1 
ATOM   2021 N N   . ASP A 1 267 ? -42.169 23.623  91.645  1.00 60.51  ? 267 ASP A N   1 
ATOM   2022 C CA  . ASP A 1 267 ? -42.311 23.729  93.094  1.00 66.91  ? 267 ASP A CA  1 
ATOM   2023 C C   . ASP A 1 267 ? -41.363 22.787  93.849  1.00 66.47  ? 267 ASP A C   1 
ATOM   2024 O O   . ASP A 1 267 ? -40.750 23.162  94.857  1.00 63.59  ? 267 ASP A O   1 
ATOM   2025 C CB  . ASP A 1 267 ? -43.774 23.425  93.462  1.00 72.43  ? 267 ASP A CB  1 
ATOM   2026 C CG  . ASP A 1 267 ? -44.229 24.107  94.754  1.00 83.99  ? 267 ASP A CG  1 
ATOM   2027 O OD1 . ASP A 1 267 ? -43.397 24.335  95.661  1.00 88.41  ? 267 ASP A OD1 1 
ATOM   2028 O OD2 . ASP A 1 267 ? -45.440 24.403  94.866  1.00 83.10  ? 267 ASP A OD2 1 
ATOM   2029 N N   . GLU A 1 268 ? -41.242 21.561  93.349  1.00 63.85  ? 268 GLU A N   1 
ATOM   2030 C CA  . GLU A 1 268 ? -40.503 20.527  94.049  1.00 56.95  ? 268 GLU A CA  1 
ATOM   2031 C C   . GLU A 1 268 ? -39.033 20.450  93.646  1.00 57.23  ? 268 GLU A C   1 
ATOM   2032 O O   . GLU A 1 268 ? -38.376 19.434  93.854  1.00 59.32  ? 268 GLU A O   1 
ATOM   2033 C CB  . GLU A 1 268 ? -41.186 19.186  93.827  1.00 53.95  ? 268 GLU A CB  1 
ATOM   2034 C CG  . GLU A 1 268 ? -41.710 18.607  95.112  1.00 55.02  ? 268 GLU A CG  1 
ATOM   2035 C CD  . GLU A 1 268 ? -43.151 18.186  95.015  1.00 57.86  ? 268 GLU A CD  1 
ATOM   2036 O OE1 . GLU A 1 268 ? -43.678 18.097  93.883  1.00 56.58  ? 268 GLU A OE1 1 
ATOM   2037 O OE2 . GLU A 1 268 ? -43.750 17.931  96.082  1.00 65.58  ? 268 GLU A OE2 1 
ATOM   2038 N N   . LEU A 1 269 ? -38.524 21.544  93.093  1.00 59.43  ? 269 LEU A N   1 
ATOM   2039 C CA  . LEU A 1 269 ? -37.142 21.638  92.651  1.00 54.86  ? 269 LEU A CA  1 
ATOM   2040 C C   . LEU A 1 269 ? -36.507 22.919  93.174  1.00 57.40  ? 269 LEU A C   1 
ATOM   2041 O O   . LEU A 1 269 ? -37.162 23.960  93.193  1.00 60.92  ? 269 LEU A O   1 
ATOM   2042 C CB  . LEU A 1 269 ? -37.072 21.597  91.123  1.00 57.54  ? 269 LEU A CB  1 
ATOM   2043 C CG  . LEU A 1 269 ? -36.831 20.244  90.451  1.00 51.29  ? 269 LEU A CG  1 
ATOM   2044 C CD1 . LEU A 1 269 ? -38.101 19.631  89.888  1.00 47.22  ? 269 LEU A CD1 1 
ATOM   2045 C CD2 . LEU A 1 269 ? -35.799 20.428  89.360  1.00 60.83  ? 269 LEU A CD2 1 
ATOM   2046 N N   . GLU A 1 270 ? -35.242 22.846  93.593  1.00 56.27  ? 270 GLU A N   1 
ATOM   2047 C CA  . GLU A 1 270 ? -34.522 24.016  94.110  1.00 58.61  ? 270 GLU A CA  1 
ATOM   2048 C C   . GLU A 1 270 ? -34.549 25.168  93.120  1.00 56.12  ? 270 GLU A C   1 
ATOM   2049 O O   . GLU A 1 270 ? -34.670 24.953  91.921  1.00 61.83  ? 270 GLU A O   1 
ATOM   2050 C CB  . GLU A 1 270 ? -33.072 23.659  94.451  1.00 57.21  ? 270 GLU A CB  1 
ATOM   2051 C CG  . GLU A 1 270 ? -32.925 22.259  95.014  1.00 64.03  ? 270 GLU A CG  1 
ATOM   2052 C CD  . GLU A 1 270 ? -31.866 22.154  96.098  1.00 69.69  ? 270 GLU A CD  1 
ATOM   2053 O OE1 . GLU A 1 270 ? -30.662 22.204  95.767  1.00 78.39  ? 270 GLU A OE1 1 
ATOM   2054 O OE2 . GLU A 1 270 ? -32.245 22.013  97.283  1.00 74.43  ? 270 GLU A OE2 1 
ATOM   2055 N N   . ASP A 1 271 ? -34.434 26.382  93.644  1.00 63.11  ? 271 ASP A N   1 
ATOM   2056 C CA  . ASP A 1 271 ? -34.599 27.606  92.873  1.00 66.63  ? 271 ASP A CA  1 
ATOM   2057 C C   . ASP A 1 271 ? -33.937 27.537  91.491  1.00 67.66  ? 271 ASP A C   1 
ATOM   2058 O O   . ASP A 1 271 ? -34.637 27.470  90.473  1.00 63.81  ? 271 ASP A O   1 
ATOM   2059 C CB  . ASP A 1 271 ? -34.056 28.802  93.670  1.00 63.58  ? 271 ASP A CB  1 
ATOM   2060 N N   . GLY A 1 272 ? -32.606 27.515  91.454  1.00 58.54  ? 272 GLY A N   1 
ATOM   2061 C CA  . GLY A 1 272 ? -31.895 27.623  90.193  1.00 65.15  ? 272 GLY A CA  1 
ATOM   2062 C C   . GLY A 1 272 ? -31.963 26.360  89.353  1.00 67.25  ? 272 GLY A C   1 
ATOM   2063 O O   . GLY A 1 272 ? -32.068 26.397  88.123  1.00 61.46  ? 272 GLY A O   1 
ATOM   2064 N N   . LYS A 1 273 ? -31.911 25.231  90.049  1.00 68.44  ? 273 LYS A N   1 
ATOM   2065 C CA  . LYS A 1 273 ? -31.844 23.910  89.441  1.00 58.76  ? 273 LYS A CA  1 
ATOM   2066 C C   . LYS A 1 273 ? -33.118 23.581  88.673  1.00 61.47  ? 273 LYS A C   1 
ATOM   2067 O O   . LYS A 1 273 ? -34.193 24.111  88.976  1.00 67.71  ? 273 LYS A O   1 
ATOM   2068 C CB  . LYS A 1 273 ? -31.577 22.855  90.524  1.00 55.17  ? 273 LYS A CB  1 
ATOM   2069 C CG  . LYS A 1 273 ? -30.177 22.916  91.140  1.00 50.30  ? 273 LYS A CG  1 
ATOM   2070 C CD  . LYS A 1 273 ? -30.012 24.069  92.114  1.00 54.63  ? 273 LYS A CD  1 
ATOM   2071 C CE  . LYS A 1 273 ? -28.656 24.054  92.815  1.00 61.04  ? 273 LYS A CE  1 
ATOM   2072 N NZ  . LYS A 1 273 ? -27.501 24.256  91.899  1.00 61.36  ? 273 LYS A NZ  1 
ATOM   2073 N N   . GLY A 1 274 ? -32.999 22.711  87.678  1.00 49.23  ? 274 GLY A N   1 
ATOM   2074 C CA  . GLY A 1 274 ? -34.149 22.350  86.877  1.00 53.00  ? 274 GLY A CA  1 
ATOM   2075 C C   . GLY A 1 274 ? -34.028 22.911  85.473  1.00 55.83  ? 274 GLY A C   1 
ATOM   2076 O O   . GLY A 1 274 ? -34.082 22.173  84.493  1.00 52.57  ? 274 GLY A O   1 
ATOM   2077 N N   . ASP A 1 275 ? -33.874 24.228  85.375  1.00 60.43  ? 275 ASP A N   1 
ATOM   2078 C CA  . ASP A 1 275 ? -33.579 24.862  84.094  1.00 54.62  ? 275 ASP A CA  1 
ATOM   2079 C C   . ASP A 1 275 ? -32.141 24.551  83.745  1.00 53.07  ? 275 ASP A C   1 
ATOM   2080 O O   . ASP A 1 275 ? -31.815 24.255  82.595  1.00 44.39  ? 275 ASP A O   1 
ATOM   2081 C CB  . ASP A 1 275 ? -33.803 26.385  84.143  1.00 55.32  ? 275 ASP A CB  1 
ATOM   2082 C CG  . ASP A 1 275 ? -35.273 26.761  84.064  1.00 53.79  ? 275 ASP A CG  1 
ATOM   2083 O OD1 . ASP A 1 275 ? -36.105 25.830  84.050  1.00 48.04  ? 275 ASP A OD1 1 
ATOM   2084 O OD2 . ASP A 1 275 ? -35.593 27.972  84.024  1.00 51.36  ? 275 ASP A OD2 1 
ATOM   2085 N N   . GLU A 1 276 ? -31.278 24.624  84.754  1.00 57.97  ? 276 GLU A N   1 
ATOM   2086 C CA  . GLU A 1 276 ? -29.871 24.343  84.544  1.00 56.20  ? 276 GLU A CA  1 
ATOM   2087 C C   . GLU A 1 276 ? -29.682 22.859  84.228  1.00 54.99  ? 276 GLU A C   1 
ATOM   2088 O O   . GLU A 1 276 ? -28.731 22.488  83.551  1.00 61.91  ? 276 GLU A O   1 
ATOM   2089 C CB  . GLU A 1 276 ? -29.043 24.772  85.757  1.00 54.30  ? 276 GLU A CB  1 
ATOM   2090 C CG  . GLU A 1 276 ? -27.514 24.667  85.565  1.00 67.02  ? 276 GLU A CG  1 
ATOM   2091 C CD  . GLU A 1 276 ? -26.966 25.405  84.317  1.00 75.76  ? 276 GLU A CD  1 
ATOM   2092 O OE1 . GLU A 1 276 ? -27.628 26.330  83.787  1.00 68.77  ? 276 GLU A OE1 1 
ATOM   2093 O OE2 . GLU A 1 276 ? -25.850 25.053  83.862  1.00 76.64  ? 276 GLU A OE2 1 
ATOM   2094 N N   . LEU A 1 277 ? -30.602 22.012  84.680  1.00 50.52  ? 277 LEU A N   1 
ATOM   2095 C CA  . LEU A 1 277 ? -30.491 20.589  84.379  1.00 54.05  ? 277 LEU A CA  1 
ATOM   2096 C C   . LEU A 1 277 ? -30.822 20.307  82.905  1.00 51.94  ? 277 LEU A C   1 
ATOM   2097 O O   . LEU A 1 277 ? -30.022 19.704  82.190  1.00 50.14  ? 277 LEU A O   1 
ATOM   2098 C CB  . LEU A 1 277 ? -31.395 19.749  85.294  1.00 53.05  ? 277 LEU A CB  1 
ATOM   2099 C CG  . LEU A 1 277 ? -31.251 18.242  85.045  1.00 44.94  ? 277 LEU A CG  1 
ATOM   2100 C CD1 . LEU A 1 277 ? -29.851 17.778  85.427  1.00 44.62  ? 277 LEU A CD1 1 
ATOM   2101 C CD2 . LEU A 1 277 ? -32.313 17.433  85.763  1.00 44.95  ? 277 LEU A CD2 1 
ATOM   2102 N N   . VAL A 1 278 ? -32.000 20.746  82.467  1.00 49.85  ? 278 VAL A N   1 
ATOM   2103 C CA  . VAL A 1 278 ? -32.464 20.531  81.105  1.00 44.87  ? 278 VAL A CA  1 
ATOM   2104 C C   . VAL A 1 278 ? -31.495 21.120  80.074  1.00 52.73  ? 278 VAL A C   1 
ATOM   2105 O O   . VAL A 1 278 ? -31.256 20.528  79.013  1.00 54.45  ? 278 VAL A O   1 
ATOM   2106 C CB  . VAL A 1 278 ? -33.868 21.117  80.923  1.00 45.53  ? 278 VAL A CB  1 
ATOM   2107 C CG1 . VAL A 1 278 ? -34.268 21.193  79.446  1.00 45.47  ? 278 VAL A CG1 1 
ATOM   2108 C CG2 . VAL A 1 278 ? -34.857 20.277  81.690  1.00 47.17  ? 278 VAL A CG2 1 
ATOM   2109 N N   . LYS A 1 279 ? -30.912 22.266  80.395  1.00 50.85  ? 279 LYS A N   1 
ATOM   2110 C CA  . LYS A 1 279 ? -29.942 22.880  79.504  1.00 45.12  ? 279 LYS A CA  1 
ATOM   2111 C C   . LYS A 1 279 ? -28.731 21.957  79.415  1.00 57.15  ? 279 LYS A C   1 
ATOM   2112 O O   . LYS A 1 279 ? -28.269 21.643  78.308  1.00 54.84  ? 279 LYS A O   1 
ATOM   2113 C CB  . LYS A 1 279 ? -29.547 24.274  79.993  1.00 44.45  ? 279 LYS A CB  1 
ATOM   2114 C CG  . LYS A 1 279 ? -28.597 25.045  79.091  1.00 50.98  ? 279 LYS A CG  1 
ATOM   2115 C CD  . LYS A 1 279 ? -28.231 26.422  79.685  1.00 51.03  ? 279 LYS A CD  1 
ATOM   2116 C CE  . LYS A 1 279 ? -29.461 27.320  79.816  1.00 56.63  ? 279 LYS A CE  1 
ATOM   2117 N NZ  . LYS A 1 279 ? -29.179 28.614  80.523  1.00 62.87  ? 279 LYS A NZ  1 
ATOM   2118 N N   . THR A 1 280 ? -28.226 21.505  80.567  1.00 53.86  ? 280 THR A N   1 
ATOM   2119 C CA  . THR A 1 280 ? -27.036 20.654  80.569  1.00 50.88  ? 280 THR A CA  1 
ATOM   2120 C C   . THR A 1 280 ? -27.274 19.405  79.723  1.00 47.10  ? 280 THR A C   1 
ATOM   2121 O O   . THR A 1 280 ? -26.424 19.037  78.928  1.00 39.37  ? 280 THR A O   1 
ATOM   2122 C CB  . THR A 1 280 ? -26.601 20.258  81.998  1.00 49.38  ? 280 THR A CB  1 
ATOM   2123 O OG1 . THR A 1 280 ? -25.689 21.243  82.489  1.00 58.70  ? 280 THR A OG1 1 
ATOM   2124 C CG2 . THR A 1 280 ? -25.879 18.918  82.005  1.00 44.98  ? 280 THR A CG2 1 
ATOM   2125 N N   . LEU A 1 281 ? -28.456 18.807  79.863  1.00 48.52  ? 281 LEU A N   1 
ATOM   2126 C CA  . LEU A 1 281 ? -28.801 17.556  79.192  1.00 46.07  ? 281 LEU A CA  1 
ATOM   2127 C C   . LEU A 1 281 ? -28.928 17.709  77.688  1.00 50.39  ? 281 LEU A C   1 
ATOM   2128 O O   . LEU A 1 281 ? -28.333 16.945  76.929  1.00 58.10  ? 281 LEU A O   1 
ATOM   2129 C CB  . LEU A 1 281 ? -30.104 16.998  79.757  1.00 46.82  ? 281 LEU A CB  1 
ATOM   2130 C CG  . LEU A 1 281 ? -29.958 15.729  80.588  1.00 41.03  ? 281 LEU A CG  1 
ATOM   2131 C CD1 . LEU A 1 281 ? -28.799 15.900  81.503  1.00 45.28  ? 281 LEU A CD1 1 
ATOM   2132 C CD2 . LEU A 1 281 ? -31.214 15.500  81.383  1.00 41.62  ? 281 LEU A CD2 1 
ATOM   2133 N N   . THR A 1 282 ? -29.726 18.689  77.274  1.00 55.14  ? 282 THR A N   1 
ATOM   2134 C CA  . THR A 1 282 ? -29.855 19.120  75.888  1.00 42.37  ? 282 THR A CA  1 
ATOM   2135 C C   . THR A 1 282 ? -28.513 19.255  75.170  1.00 42.54  ? 282 THR A C   1 
ATOM   2136 O O   . THR A 1 282 ? -28.357 18.798  74.049  1.00 46.71  ? 282 THR A O   1 
ATOM   2137 C CB  . THR A 1 282 ? -30.587 20.474  75.839  1.00 53.02  ? 282 THR A CB  1 
ATOM   2138 O OG1 . THR A 1 282 ? -31.855 20.351  76.502  1.00 52.25  ? 282 THR A OG1 1 
ATOM   2139 C CG2 . THR A 1 282 ? -30.776 20.959  74.390  1.00 50.20  ? 282 THR A CG2 1 
ATOM   2140 N N   . LYS A 1 283 ? -27.553 19.902  75.823  1.00 47.76  ? 283 LYS A N   1 
ATOM   2141 C CA  . LYS A 1 283 ? -26.199 20.027  75.296  1.00 46.77  ? 283 LYS A CA  1 
ATOM   2142 C C   . LYS A 1 283 ? -25.532 18.670  75.139  1.00 51.14  ? 283 LYS A C   1 
ATOM   2143 O O   . LYS A 1 283 ? -24.922 18.378  74.112  1.00 54.71  ? 283 LYS A O   1 
ATOM   2144 C CB  . LYS A 1 283 ? -25.341 20.893  76.202  1.00 43.21  ? 283 LYS A CB  1 
ATOM   2145 C CG  . LYS A 1 283 ? -23.878 20.928  75.803  1.00 47.99  ? 283 LYS A CG  1 
ATOM   2146 C CD  . LYS A 1 283 ? -23.553 22.177  74.993  1.00 54.83  ? 283 LYS A CD  1 
ATOM   2147 C CE  . LYS A 1 283 ? -22.363 21.945  74.057  1.00 57.63  ? 283 LYS A CE  1 
ATOM   2148 N NZ  . LYS A 1 283 ? -22.782 21.396  72.728  1.00 54.24  ? 283 LYS A NZ  1 
ATOM   2149 N N   . GLN A 1 284 ? -25.642 17.852  76.177  1.00 46.70  ? 284 GLN A N   1 
ATOM   2150 C CA  . GLN A 1 284 ? -25.083 16.511  76.184  1.00 46.19  ? 284 GLN A CA  1 
ATOM   2151 C C   . GLN A 1 284 ? -25.687 15.629  75.096  1.00 45.18  ? 284 GLN A C   1 
ATOM   2152 O O   . GLN A 1 284 ? -25.025 14.752  74.562  1.00 45.76  ? 284 GLN A O   1 
ATOM   2153 C CB  . GLN A 1 284 ? -25.291 15.864  77.549  1.00 44.87  ? 284 GLN A CB  1 
ATOM   2154 C CG  . GLN A 1 284 ? -24.442 16.451  78.665  1.00 41.87  ? 284 GLN A CG  1 
ATOM   2155 C CD  . GLN A 1 284 ? -24.830 15.868  80.000  1.00 43.04  ? 284 GLN A CD  1 
ATOM   2156 O OE1 . GLN A 1 284 ? -25.947 15.391  80.157  1.00 45.57  ? 284 GLN A OE1 1 
ATOM   2157 N NE2 . GLN A 1 284 ? -23.906 15.874  80.960  1.00 42.55  ? 284 GLN A NE2 1 
ATOM   2158 N N   . LEU A 1 285 ? -26.943 15.854  74.758  1.00 42.77  ? 285 LEU A N   1 
ATOM   2159 C CA  . LEU A 1 285 ? -27.518 15.110  73.645  1.00 50.26  ? 285 LEU A CA  1 
ATOM   2160 C C   . LEU A 1 285 ? -26.896 15.551  72.321  1.00 47.26  ? 285 LEU A C   1 
ATOM   2161 O O   . LEU A 1 285 ? -26.545 14.726  71.497  1.00 52.17  ? 285 LEU A O   1 
ATOM   2162 C CB  . LEU A 1 285 ? -29.035 15.279  73.594  1.00 44.83  ? 285 LEU A CB  1 
ATOM   2163 C CG  . LEU A 1 285 ? -29.718 14.351  72.595  1.00 43.98  ? 285 LEU A CG  1 
ATOM   2164 C CD1 . LEU A 1 285 ? -29.197 12.943  72.766  1.00 44.28  ? 285 LEU A CD1 1 
ATOM   2165 C CD2 . LEU A 1 285 ? -31.226 14.383  72.768  1.00 48.35  ? 285 LEU A CD2 1 
ATOM   2166 N N   . ALA A 1 286 ? -26.779 16.859  72.122  1.00 50.54  ? 286 ALA A N   1 
ATOM   2167 C CA  . ALA A 1 286 ? -26.163 17.398  70.919  1.00 49.24  ? 286 ALA A CA  1 
ATOM   2168 C C   . ALA A 1 286 ? -24.740 16.867  70.732  1.00 46.84  ? 286 ALA A C   1 
ATOM   2169 O O   . ALA A 1 286 ? -24.332 16.512  69.622  1.00 53.34  ? 286 ALA A O   1 
ATOM   2170 C CB  . ALA A 1 286 ? -26.156 18.912  70.967  1.00 36.47  ? 286 ALA A CB  1 
ATOM   2171 N N   . ASP A 1 287 ? -23.997 16.814  71.826  1.00 43.63  ? 287 ASP A N   1 
ATOM   2172 C CA  . ASP A 1 287 ? -22.635 16.329  71.810  1.00 47.53  ? 287 ASP A CA  1 
ATOM   2173 C C   . ASP A 1 287 ? -22.564 14.864  71.446  1.00 52.50  ? 287 ASP A C   1 
ATOM   2174 O O   . ASP A 1 287 ? -21.664 14.442  70.728  1.00 51.50  ? 287 ASP A O   1 
ATOM   2175 C CB  . ASP A 1 287 ? -21.987 16.556  73.169  1.00 53.70  ? 287 ASP A CB  1 
ATOM   2176 C CG  . ASP A 1 287 ? -21.718 18.018  73.429  1.00 61.03  ? 287 ASP A CG  1 
ATOM   2177 O OD1 . ASP A 1 287 ? -21.355 18.724  72.457  1.00 62.97  ? 287 ASP A OD1 1 
ATOM   2178 O OD2 . ASP A 1 287 ? -21.888 18.466  74.585  1.00 65.42  ? 287 ASP A OD2 1 
ATOM   2179 N N   . ALA A 1 288 ? -23.521 14.096  71.950  1.00 52.49  ? 288 ALA A N   1 
ATOM   2180 C CA  . ALA A 1 288 ? -23.569 12.668  71.706  1.00 49.48  ? 288 ALA A CA  1 
ATOM   2181 C C   . ALA A 1 288 ? -23.884 12.359  70.247  1.00 49.74  ? 288 ALA A C   1 
ATOM   2182 O O   . ALA A 1 288 ? -23.245 11.500  69.643  1.00 53.14  ? 288 ALA A O   1 
ATOM   2183 C CB  . ALA A 1 288 ? -24.596 12.021  72.613  1.00 45.91  ? 288 ALA A CB  1 
ATOM   2184 N N   . ILE A 1 289 ? -24.876 13.047  69.692  1.00 46.60  ? 289 ILE A N   1 
ATOM   2185 C CA  . ILE A 1 289 ? -25.270 12.835  68.308  1.00 49.96  ? 289 ILE A CA  1 
ATOM   2186 C C   . ILE A 1 289 ? -24.085 13.089  67.373  1.00 54.49  ? 289 ILE A C   1 
ATOM   2187 O O   . ILE A 1 289 ? -23.810 12.314  66.450  1.00 49.71  ? 289 ILE A O   1 
ATOM   2188 C CB  . ILE A 1 289 ? -26.427 13.744  67.922  1.00 50.36  ? 289 ILE A CB  1 
ATOM   2189 C CG1 . ILE A 1 289 ? -27.683 13.359  68.689  1.00 50.64  ? 289 ILE A CG1 1 
ATOM   2190 C CG2 . ILE A 1 289 ? -26.691 13.651  66.443  1.00 50.10  ? 289 ILE A CG2 1 
ATOM   2191 C CD1 . ILE A 1 289 ? -28.866 14.180  68.298  1.00 50.93  ? 289 ILE A CD1 1 
ATOM   2192 N N   . GLU A 1 290 ? -23.371 14.173  67.651  1.00 50.78  ? 290 GLU A N   1 
ATOM   2193 C CA  . GLU A 1 290 ? -22.182 14.534  66.894  1.00 53.43  ? 290 GLU A CA  1 
ATOM   2194 C C   . GLU A 1 290 ? -21.003 13.542  67.046  1.00 54.97  ? 290 GLU A C   1 
ATOM   2195 O O   . GLU A 1 290 ? -20.188 13.386  66.125  1.00 55.98  ? 290 GLU A O   1 
ATOM   2196 C CB  . GLU A 1 290 ? -21.747 15.947  67.296  1.00 47.69  ? 290 GLU A CB  1 
ATOM   2197 C CG  . GLU A 1 290 ? -20.370 16.349  66.793  1.00 53.00  ? 290 GLU A CG  1 
ATOM   2198 C CD  . GLU A 1 290 ? -20.292 16.449  65.280  1.00 55.58  ? 290 GLU A CD  1 
ATOM   2199 O OE1 . GLU A 1 290 ? -21.357 16.384  64.619  1.00 57.66  ? 290 GLU A OE1 1 
ATOM   2200 O OE2 . GLU A 1 290 ? -19.161 16.598  64.760  1.00 53.75  ? 290 GLU A OE2 1 
ATOM   2201 N N   . LEU A 1 291 ? -20.918 12.872  68.195  1.00 52.52  ? 291 LEU A N   1 
ATOM   2202 C CA  . LEU A 1 291 ? -19.872 11.877  68.444  1.00 49.24  ? 291 LEU A CA  1 
ATOM   2203 C C   . LEU A 1 291 ? -20.232 10.506  67.875  1.00 57.84  ? 291 LEU A C   1 
ATOM   2204 O O   . LEU A 1 291 ? -19.357 9.796   67.339  1.00 49.44  ? 291 LEU A O   1 
ATOM   2205 C CB  . LEU A 1 291 ? -19.601 11.755  69.936  1.00 53.50  ? 291 LEU A CB  1 
ATOM   2206 C CG  . LEU A 1 291 ? -18.665 12.809  70.528  1.00 57.12  ? 291 LEU A CG  1 
ATOM   2207 C CD1 . LEU A 1 291 ? -18.847 12.860  72.042  1.00 51.91  ? 291 LEU A CD1 1 
ATOM   2208 C CD2 . LEU A 1 291 ? -17.209 12.516  70.153  1.00 42.38  ? 291 LEU A CD2 1 
ATOM   2209 N N   . ALA A 1 292 ? -21.516 10.154  68.020  1.00 52.64  ? 292 ALA A N   1 
ATOM   2210 C CA  . ALA A 1 292 ? -22.091 8.928   67.485  1.00 42.86  ? 292 ALA A CA  1 
ATOM   2211 C C   . ALA A 1 292 ? -21.944 8.881   65.983  1.00 50.99  ? 292 ALA A C   1 
ATOM   2212 O O   . ALA A 1 292 ? -21.486 7.887   65.425  1.00 59.24  ? 292 ALA A O   1 
ATOM   2213 C CB  . ALA A 1 292 ? -23.558 8.816   67.858  1.00 48.32  ? 292 ALA A CB  1 
ATOM   2214 N N   . LYS A 1 293 ? -22.337 9.970   65.335  1.00 53.11  ? 293 LYS A N   1 
ATOM   2215 C CA  . LYS A 1 293 ? -22.339 10.055  63.886  1.00 51.31  ? 293 LYS A CA  1 
ATOM   2216 C C   . LYS A 1 293 ? -20.922 9.876   63.304  1.00 54.45  ? 293 LYS A C   1 
ATOM   2217 O O   . LYS A 1 293 ? -20.762 9.403   62.168  1.00 50.58  ? 293 LYS A O   1 
ATOM   2218 C CB  . LYS A 1 293 ? -22.949 11.388  63.447  1.00 54.04  ? 293 LYS A CB  1 
ATOM   2219 C CG  . LYS A 1 293 ? -23.856 11.294  62.224  1.00 68.72  ? 293 LYS A CG  1 
ATOM   2220 C CD  . LYS A 1 293 ? -25.339 11.186  62.582  1.00 73.59  ? 293 LYS A CD  1 
ATOM   2221 C CE  . LYS A 1 293 ? -26.224 10.915  61.346  1.00 74.48  ? 293 LYS A CE  1 
ATOM   2222 N NZ  . LYS A 1 293 ? -26.134 9.518   60.804  1.00 56.34  ? 293 LYS A NZ  1 
ATOM   2223 N N   . LYS A 1 294 ? -19.898 10.240  64.078  1.00 52.14  ? 294 LYS A N   1 
ATOM   2224 C CA  . LYS A 1 294 ? -18.523 9.975   63.664  1.00 44.29  ? 294 LYS A CA  1 
ATOM   2225 C C   . LYS A 1 294 ? -18.267 8.482   63.731  1.00 52.04  ? 294 LYS A C   1 
ATOM   2226 O O   . LYS A 1 294 ? -17.567 7.910   62.883  1.00 54.53  ? 294 LYS A O   1 
ATOM   2227 C CB  . LYS A 1 294 ? -17.507 10.710  64.535  1.00 46.70  ? 294 LYS A CB  1 
ATOM   2228 C CG  . LYS A 1 294 ? -16.793 11.876  63.862  1.00 45.56  ? 294 LYS A CG  1 
ATOM   2229 C CD  . LYS A 1 294 ? -17.767 13.011  63.548  1.00 50.35  ? 294 LYS A CD  1 
ATOM   2230 C CE  . LYS A 1 294 ? -17.049 14.347  63.382  1.00 44.75  ? 294 LYS A CE  1 
ATOM   2231 N NZ  . LYS A 1 294 ? -17.963 15.499  63.065  1.00 42.28  ? 294 LYS A NZ  1 
ATOM   2232 N N   . SER A 1 295 ? -18.846 7.846   64.742  1.00 56.37  ? 295 SER A N   1 
ATOM   2233 C CA  . SER A 1 295 ? -18.623 6.428   64.952  1.00 52.02  ? 295 SER A CA  1 
ATOM   2234 C C   . SER A 1 295 ? -19.381 5.590   63.944  1.00 48.19  ? 295 SER A C   1 
ATOM   2235 O O   . SER A 1 295 ? -18.806 4.674   63.348  1.00 47.99  ? 295 SER A O   1 
ATOM   2236 C CB  . SER A 1 295 ? -18.999 6.037   66.366  1.00 48.14  ? 295 SER A CB  1 
ATOM   2237 O OG  . SER A 1 295 ? -17.878 6.281   67.191  1.00 59.61  ? 295 SER A OG  1 
ATOM   2238 N N   . SER A 1 296 ? -20.654 5.905   63.733  1.00 44.16  ? 296 SER A N   1 
ATOM   2239 C CA  . SER A 1 296 ? -21.430 5.156   62.749  1.00 47.77  ? 296 SER A CA  1 
ATOM   2240 C C   . SER A 1 296 ? -20.775 5.250   61.367  1.00 46.12  ? 296 SER A C   1 
ATOM   2241 O O   . SER A 1 296 ? -20.828 4.295   60.612  1.00 51.05  ? 296 SER A O   1 
ATOM   2242 C CB  . SER A 1 296 ? -22.878 5.642   62.682  1.00 35.87  ? 296 SER A CB  1 
ATOM   2243 O OG  . SER A 1 296 ? -23.116 6.669   63.621  1.00 53.11  ? 296 SER A OG  1 
ATOM   2244 N N   . ALA A 1 297 ? -20.135 6.378   61.063  1.00 42.20  ? 297 ALA A N   1 
ATOM   2245 C CA  . ALA A 1 297 ? -19.506 6.574   59.762  1.00 45.89  ? 297 ALA A CA  1 
ATOM   2246 C C   . ALA A 1 297 ? -18.212 5.801   59.674  1.00 43.07  ? 297 ALA A C   1 
ATOM   2247 O O   . ALA A 1 297 ? -17.895 5.238   58.628  1.00 44.46  ? 297 ALA A O   1 
ATOM   2248 C CB  . ALA A 1 297 ? -19.252 8.056   59.483  1.00 37.54  ? 297 ALA A CB  1 
ATOM   2249 N N   . LEU A 1 298 ? -17.462 5.767   60.766  1.00 42.00  ? 298 LEU A N   1 
ATOM   2250 C CA  . LEU A 1 298 ? -16.203 5.058   60.731  1.00 37.52  ? 298 LEU A CA  1 
ATOM   2251 C C   . LEU A 1 298 ? -16.496 3.579   60.568  1.00 43.40  ? 298 LEU A C   1 
ATOM   2252 O O   . LEU A 1 298 ? -15.886 2.914   59.738  1.00 44.08  ? 298 LEU A O   1 
ATOM   2253 C CB  . LEU A 1 298 ? -15.376 5.312   61.988  1.00 41.97  ? 298 LEU A CB  1 
ATOM   2254 C CG  . LEU A 1 298 ? -14.074 4.495   61.960  1.00 44.49  ? 298 LEU A CG  1 
ATOM   2255 C CD1 . LEU A 1 298 ? -13.059 5.087   60.960  1.00 41.20  ? 298 LEU A CD1 1 
ATOM   2256 C CD2 . LEU A 1 298 ? -13.445 4.307   63.348  1.00 42.26  ? 298 LEU A CD2 1 
ATOM   2257 N N   . ARG A 1 299 ? -17.446 3.084   61.363  1.00 44.65  ? 299 ARG A N   1 
ATOM   2258 C CA  . ARG A 1 299 ? -17.911 1.697   61.305  1.00 46.29  ? 299 ARG A CA  1 
ATOM   2259 C C   . ARG A 1 299 ? -18.329 1.315   59.887  1.00 44.34  ? 299 ARG A C   1 
ATOM   2260 O O   . ARG A 1 299 ? -17.855 0.337   59.326  1.00 43.98  ? 299 ARG A O   1 
ATOM   2261 C CB  . ARG A 1 299 ? -19.086 1.505   62.271  1.00 52.10  ? 299 ARG A CB  1 
ATOM   2262 C CG  . ARG A 1 299 ? -19.496 0.053   62.550  1.00 50.68  ? 299 ARG A CG  1 
ATOM   2263 C CD  . ARG A 1 299 ? -18.470 -0.681  63.419  1.00 53.17  ? 299 ARG A CD  1 
ATOM   2264 N NE  . ARG A 1 299 ? -19.080 -1.350  64.572  1.00 62.76  ? 299 ARG A NE  1 
ATOM   2265 C CZ  . ARG A 1 299 ? -18.435 -2.167  65.407  1.00 61.43  ? 299 ARG A CZ  1 
ATOM   2266 N NH1 . ARG A 1 299 ? -17.148 -2.447  65.223  1.00 54.77  ? 299 ARG A NH1 1 
ATOM   2267 N NH2 . ARG A 1 299 ? -19.084 -2.720  66.425  1.00 62.73  ? 299 ARG A NH2 1 
ATOM   2268 N N   . ALA A 1 300 ? -19.211 2.116   59.314  1.00 38.24  ? 300 ALA A N   1 
ATOM   2269 C CA  . ALA A 1 300 ? -19.700 1.903   57.964  1.00 40.55  ? 300 ALA A CA  1 
ATOM   2270 C C   . ALA A 1 300 ? -18.591 1.867   56.897  1.00 50.57  ? 300 ALA A C   1 
ATOM   2271 O O   . ALA A 1 300 ? -18.418 0.843   56.231  1.00 53.09  ? 300 ALA A O   1 
ATOM   2272 C CB  . ALA A 1 300 ? -20.712 2.982   57.617  1.00 42.01  ? 300 ALA A CB  1 
ATOM   2273 N N   . GLN A 1 301 ? -17.847 2.971   56.736  1.00 41.67  ? 301 GLN A N   1 
ATOM   2274 C CA  . GLN A 1 301 ? -16.979 3.136   55.576  1.00 37.72  ? 301 GLN A CA  1 
ATOM   2275 C C   . GLN A 1 301 ? -15.465 3.212   55.848  1.00 38.78  ? 301 GLN A C   1 
ATOM   2276 O O   . GLN A 1 301 ? -14.647 3.377   54.921  1.00 42.21  ? 301 GLN A O   1 
ATOM   2277 C CB  . GLN A 1 301 ? -17.416 4.377   54.797  1.00 41.95  ? 301 GLN A CB  1 
ATOM   2278 C CG  . GLN A 1 301 ? -17.296 5.699   55.522  1.00 40.59  ? 301 GLN A CG  1 
ATOM   2279 C CD  . GLN A 1 301 ? -17.479 6.877   54.563  1.00 50.38  ? 301 GLN A CD  1 
ATOM   2280 O OE1 . GLN A 1 301 ? -16.725 7.028   53.588  1.00 52.35  ? 301 GLN A OE1 1 
ATOM   2281 N NE2 . GLN A 1 301 ? -18.492 7.706   54.825  1.00 44.98  ? 301 GLN A NE2 1 
ATOM   2282 N N   . GLY A 1 302 ? -15.084 3.061   57.103  1.00 33.59  ? 302 GLY A N   1 
ATOM   2283 C CA  . GLY A 1 302 ? -13.691 3.140   57.459  1.00 35.06  ? 302 GLY A CA  1 
ATOM   2284 C C   . GLY A 1 302 ? -13.174 4.569   57.483  1.00 39.96  ? 302 GLY A C   1 
ATOM   2285 O O   . GLY A 1 302 ? -13.891 5.536   57.159  1.00 34.76  ? 302 GLY A O   1 
ATOM   2286 N N   . ALA A 1 303 ? -11.909 4.688   57.875  1.00 41.06  ? 303 ALA A N   1 
ATOM   2287 C CA  . ALA A 1 303 ? -11.213 5.963   57.979  1.00 31.10  ? 303 ALA A CA  1 
ATOM   2288 C C   . ALA A 1 303 ? -11.339 6.763   56.708  1.00 31.35  ? 303 ALA A C   1 
ATOM   2289 O O   . ALA A 1 303 ? -11.391 6.198   55.611  1.00 39.51  ? 303 ALA A O   1 
ATOM   2290 C CB  . ALA A 1 303 ? -9.772  5.733   58.294  1.00 29.82  ? 303 ALA A CB  1 
ATOM   2291 N N   . GLN A 1 304 ? -11.429 8.075   56.851  1.00 30.34  ? 304 GLN A N   1 
ATOM   2292 C CA  . GLN A 1 304 ? -11.371 8.943   55.686  1.00 34.93  ? 304 GLN A CA  1 
ATOM   2293 C C   . GLN A 1 304 ? -10.102 9.777   55.767  1.00 35.91  ? 304 GLN A C   1 
ATOM   2294 O O   . GLN A 1 304 ? -10.008 10.716  56.557  1.00 39.11  ? 304 GLN A O   1 
ATOM   2295 C CB  . GLN A 1 304 ? -12.630 9.806   55.583  1.00 37.83  ? 304 GLN A CB  1 
ATOM   2296 C CG  . GLN A 1 304 ? -13.872 8.994   55.173  1.00 36.26  ? 304 GLN A CG  1 
ATOM   2297 C CD  . GLN A 1 304 ? -15.138 9.824   55.088  1.00 43.03  ? 304 GLN A CD  1 
ATOM   2298 O OE1 . GLN A 1 304 ? -15.936 9.871   56.031  1.00 42.37  ? 304 GLN A OE1 1 
ATOM   2299 N NE2 . GLN A 1 304 ? -15.338 10.480  53.944  1.00 48.00  ? 304 GLN A NE2 1 
ATOM   2300 N N   . ILE A 1 305 ? -9.099  9.372   54.992  1.00 34.01  ? 305 ILE A N   1 
ATOM   2301 C CA  . ILE A 1 305 ? -7.845  10.110  54.901  1.00 29.62  ? 305 ILE A CA  1 
ATOM   2302 C C   . ILE A 1 305 ? -7.958  11.349  54.041  1.00 24.77  ? 305 ILE A C   1 
ATOM   2303 O O   . ILE A 1 305 ? -8.354  11.291  52.883  1.00 24.28  ? 305 ILE A O   1 
ATOM   2304 C CB  . ILE A 1 305 ? -6.731  9.245   54.325  1.00 27.70  ? 305 ILE A CB  1 
ATOM   2305 C CG1 . ILE A 1 305 ? -6.479  8.059   55.248  1.00 33.00  ? 305 ILE A CG1 1 
ATOM   2306 C CG2 . ILE A 1 305 ? -5.447  10.075  54.135  1.00 23.68  ? 305 ILE A CG2 1 
ATOM   2307 C CD1 . ILE A 1 305 ? -5.527  7.036   54.689  1.00 27.35  ? 305 ILE A CD1 1 
ATOM   2308 N N   . ASP A 1 306 ? -7.594  12.473  54.626  1.00 26.04  ? 306 ASP A N   1 
ATOM   2309 C CA  . ASP A 1 306 ? -7.386  13.695  53.865  1.00 28.42  ? 306 ASP A CA  1 
ATOM   2310 C C   . ASP A 1 306 ? -5.952  13.620  53.348  1.00 27.71  ? 306 ASP A C   1 
ATOM   2311 O O   . ASP A 1 306 ? -5.015  13.875  54.106  1.00 29.54  ? 306 ASP A O   1 
ATOM   2312 C CB  . ASP A 1 306 ? -7.627  14.924  54.765  1.00 30.35  ? 306 ASP A CB  1 
ATOM   2313 C CG  . ASP A 1 306 ? -7.725  16.223  53.999  1.00 29.23  ? 306 ASP A CG  1 
ATOM   2314 O OD1 . ASP A 1 306 ? -7.125  16.347  52.929  1.00 29.95  ? 306 ASP A OD1 1 
ATOM   2315 O OD2 . ASP A 1 306 ? -8.395  17.149  54.489  1.00 36.59  ? 306 ASP A OD2 1 
ATOM   2316 N N   . SER A 1 307 ? -5.779  13.255  52.075  1.00 27.24  ? 307 SER A N   1 
ATOM   2317 C CA  . SER A 1 307 ? -4.453  12.935  51.540  1.00 23.72  ? 307 SER A CA  1 
ATOM   2318 C C   . SER A 1 307 ? -3.393  13.976  51.845  1.00 26.91  ? 307 SER A C   1 
ATOM   2319 O O   . SER A 1 307 ? -2.428  13.680  52.557  1.00 29.77  ? 307 SER A O   1 
ATOM   2320 C CB  . SER A 1 307 ? -4.525  12.715  50.039  1.00 29.52  ? 307 SER A CB  1 
ATOM   2321 O OG  . SER A 1 307 ? -5.314  11.576  49.757  1.00 36.66  ? 307 SER A OG  1 
ATOM   2322 N N   . ILE A 1 308 ? -3.575  15.194  51.344  1.00 32.27  ? 308 ILE A N   1 
ATOM   2323 C CA  . ILE A 1 308 ? -2.564  16.232  51.540  1.00 30.29  ? 308 ILE A CA  1 
ATOM   2324 C C   . ILE A 1 308 ? -2.297  16.557  53.005  1.00 28.96  ? 308 ILE A C   1 
ATOM   2325 O O   . ILE A 1 308 ? -1.148  16.785  53.376  1.00 29.73  ? 308 ILE A O   1 
ATOM   2326 C CB  . ILE A 1 308 ? -2.924  17.537  50.800  1.00 30.93  ? 308 ILE A CB  1 
ATOM   2327 C CG1 . ILE A 1 308 ? -1.735  18.526  50.869  1.00 27.63  ? 308 ILE A CG1 1 
ATOM   2328 C CG2 . ILE A 1 308 ? -4.202  18.141  51.342  1.00 29.90  ? 308 ILE A CG2 1 
ATOM   2329 C CD1 . ILE A 1 308 ? -0.495  18.038  50.153  1.00 23.17  ? 308 ILE A CD1 1 
ATOM   2330 N N   . PHE A 1 309 ? -3.328  16.537  53.850  1.00 30.27  ? 309 PHE A N   1 
ATOM   2331 C CA  . PHE A 1 309 ? -3.131  16.916  55.241  1.00 23.82  ? 309 PHE A CA  1 
ATOM   2332 C C   . PHE A 1 309 ? -2.358  15.849  56.004  1.00 28.17  ? 309 PHE A C   1 
ATOM   2333 O O   . PHE A 1 309 ? -1.539  16.155  56.877  1.00 28.52  ? 309 PHE A O   1 
ATOM   2334 C CB  . PHE A 1 309 ? -4.469  17.178  55.951  1.00 31.13  ? 309 PHE A CB  1 
ATOM   2335 C CG  . PHE A 1 309 ? -4.321  17.330  57.440  1.00 32.58  ? 309 PHE A CG  1 
ATOM   2336 C CD1 . PHE A 1 309 ? -3.741  18.472  57.972  1.00 27.85  ? 309 PHE A CD1 1 
ATOM   2337 C CD2 . PHE A 1 309 ? -4.702  16.307  58.301  1.00 28.56  ? 309 PHE A CD2 1 
ATOM   2338 C CE1 . PHE A 1 309 ? -3.563  18.607  59.348  1.00 31.14  ? 309 PHE A CE1 1 
ATOM   2339 C CE2 . PHE A 1 309 ? -4.533  16.435  59.671  1.00 30.64  ? 309 PHE A CE2 1 
ATOM   2340 C CZ  . PHE A 1 309 ? -3.961  17.588  60.198  1.00 32.18  ? 309 PHE A CZ  1 
ATOM   2341 N N   . SER A 1 310 ? -2.639  14.587  55.700  1.00 29.20  ? 310 SER A N   1 
ATOM   2342 C CA  . SER A 1 310 ? -1.883  13.501  56.314  1.00 27.61  ? 310 SER A CA  1 
ATOM   2343 C C   . SER A 1 310 ? -0.480  13.438  55.713  1.00 26.99  ? 310 SER A C   1 
ATOM   2344 O O   . SER A 1 310 ? 0.489   13.270  56.433  1.00 27.77  ? 310 SER A O   1 
ATOM   2345 C CB  . SER A 1 310 ? -2.614  12.171  56.164  1.00 29.21  ? 310 SER A CB  1 
ATOM   2346 O OG  . SER A 1 310 ? -3.586  12.035  57.184  1.00 27.11  ? 310 SER A OG  1 
ATOM   2347 N N   . SER A 1 311 ? -0.363  13.608  54.397  1.00 31.17  ? 311 SER A N   1 
ATOM   2348 C CA  . SER A 1 311 ? 0.960   13.691  53.780  1.00 26.45  ? 311 SER A CA  1 
ATOM   2349 C C   . SER A 1 311 ? 1.851   14.710  54.501  1.00 27.98  ? 311 SER A C   1 
ATOM   2350 O O   . SER A 1 311 ? 2.964   14.370  54.881  1.00 27.17  ? 311 SER A O   1 
ATOM   2351 C CB  . SER A 1 311 ? 0.847   14.029  52.302  1.00 26.07  ? 311 SER A CB  1 
ATOM   2352 O OG  . SER A 1 311 ? 0.274   12.954  51.570  1.00 25.32  ? 311 SER A OG  1 
ATOM   2353 N N   . TYR A 1 312 ? 1.364   15.927  54.748  1.00 27.63  ? 312 TYR A N   1 
ATOM   2354 C CA  . TYR A 1 312 ? 2.213   16.920  55.420  1.00 28.39  ? 312 TYR A CA  1 
ATOM   2355 C C   . TYR A 1 312 ? 2.413   16.562  56.884  1.00 28.15  ? 312 TYR A C   1 
ATOM   2356 O O   . TYR A 1 312 ? 3.484   16.819  57.434  1.00 29.14  ? 312 TYR A O   1 
ATOM   2357 C CB  . TYR A 1 312 ? 1.653   18.347  55.299  1.00 29.62  ? 312 TYR A CB  1 
ATOM   2358 C CG  . TYR A 1 312 ? 2.153   19.133  54.081  1.00 31.75  ? 312 TYR A CG  1 
ATOM   2359 C CD1 . TYR A 1 312 ? 3.354   19.819  54.116  1.00 30.15  ? 312 TYR A CD1 1 
ATOM   2360 C CD2 . TYR A 1 312 ? 1.403   19.208  52.914  1.00 24.86  ? 312 TYR A CD2 1 
ATOM   2361 C CE1 . TYR A 1 312 ? 3.795   20.535  53.020  1.00 30.86  ? 312 TYR A CE1 1 
ATOM   2362 C CE2 . TYR A 1 312 ? 1.833   19.926  51.832  1.00 25.71  ? 312 TYR A CE2 1 
ATOM   2363 C CZ  . TYR A 1 312 ? 3.028   20.583  51.884  1.00 31.99  ? 312 TYR A CZ  1 
ATOM   2364 O OH  . TYR A 1 312 ? 3.458   21.291  50.793  1.00 31.51  ? 312 TYR A OH  1 
ATOM   2365 N N   . TYR A 1 313 ? 1.414   15.952  57.519  1.00 28.32  ? 313 TYR A N   1 
ATOM   2366 C CA  . TYR A 1 313 ? 1.611   15.450  58.883  1.00 26.99  ? 313 TYR A CA  1 
ATOM   2367 C C   . TYR A 1 313 ? 2.741   14.405  58.927  1.00 30.33  ? 313 TYR A C   1 
ATOM   2368 O O   . TYR A 1 313 ? 3.646   14.495  59.765  1.00 33.92  ? 313 TYR A O   1 
ATOM   2369 C CB  . TYR A 1 313 ? 0.317   14.852  59.454  1.00 28.56  ? 313 TYR A CB  1 
ATOM   2370 C CG  . TYR A 1 313 ? 0.486   14.145  60.796  1.00 30.80  ? 313 TYR A CG  1 
ATOM   2371 C CD1 . TYR A 1 313 ? 0.943   14.831  61.915  1.00 33.24  ? 313 TYR A CD1 1 
ATOM   2372 C CD2 . TYR A 1 313 ? 0.190   12.816  60.940  1.00 28.01  ? 313 TYR A CD2 1 
ATOM   2373 C CE1 . TYR A 1 313 ? 1.093   14.216  63.130  1.00 31.57  ? 313 TYR A CE1 1 
ATOM   2374 C CE2 . TYR A 1 313 ? 0.351   12.175  62.165  1.00 30.46  ? 313 TYR A CE2 1 
ATOM   2375 C CZ  . TYR A 1 313 ? 0.796   12.883  63.252  1.00 34.05  ? 313 TYR A CZ  1 
ATOM   2376 O OH  . TYR A 1 313 ? 0.959   12.263  64.468  1.00 35.03  ? 313 TYR A OH  1 
ATOM   2377 N N   . TRP A 1 314 ? 2.698   13.415  58.035  1.00 27.72  ? 314 TRP A N   1 
ATOM   2378 C CA  . TRP A 1 314 ? 3.756   12.399  57.999  1.00 31.47  ? 314 TRP A CA  1 
ATOM   2379 C C   . TRP A 1 314 ? 5.113   12.987  57.636  1.00 29.16  ? 314 TRP A C   1 
ATOM   2380 O O   . TRP A 1 314 ? 6.105   12.647  58.281  1.00 33.95  ? 314 TRP A O   1 
ATOM   2381 C CB  . TRP A 1 314 ? 3.390   11.260  57.038  1.00 36.84  ? 314 TRP A CB  1 
ATOM   2382 C CG  . TRP A 1 314 ? 2.169   10.530  57.510  1.00 31.90  ? 314 TRP A CG  1 
ATOM   2383 C CD1 . TRP A 1 314 ? 1.815   10.267  58.813  1.00 26.18  ? 314 TRP A CD1 1 
ATOM   2384 C CD2 . TRP A 1 314 ? 1.112   10.023  56.693  1.00 27.58  ? 314 TRP A CD2 1 
ATOM   2385 N NE1 . TRP A 1 314 ? 0.612   9.617   58.846  1.00 27.43  ? 314 TRP A NE1 1 
ATOM   2386 C CE2 . TRP A 1 314 ? 0.154   9.457   57.560  1.00 28.11  ? 314 TRP A CE2 1 
ATOM   2387 C CE3 . TRP A 1 314 ? 0.881   10.001  55.318  1.00 25.39  ? 314 TRP A CE3 1 
ATOM   2388 C CZ2 . TRP A 1 314 ? -1.009  8.864   57.089  1.00 25.59  ? 314 TRP A CZ2 1 
ATOM   2389 C CZ3 . TRP A 1 314 ? -0.283  9.425   54.847  1.00 24.96  ? 314 TRP A CZ3 1 
ATOM   2390 C CH2 . TRP A 1 314 ? -1.216  8.863   55.730  1.00 30.13  ? 314 TRP A CH2 1 
ATOM   2391 N N   . ALA A 1 315 ? 5.162   13.864  56.628  1.00 28.31  ? 315 ALA A N   1 
ATOM   2392 C CA  . ALA A 1 315 ? 6.391   14.602  56.328  1.00 29.55  ? 315 ALA A CA  1 
ATOM   2393 C C   . ALA A 1 315 ? 6.938   15.309  57.576  1.00 32.70  ? 315 ALA A C   1 
ATOM   2394 O O   . ALA A 1 315 ? 8.118   15.226  57.882  1.00 35.95  ? 315 ALA A O   1 
ATOM   2395 C CB  . ALA A 1 315 ? 6.162   15.606  55.226  1.00 28.13  ? 315 ALA A CB  1 
ATOM   2396 N N   . TRP A 1 316 ? 6.064   15.987  58.305  1.00 34.87  ? 316 TRP A N   1 
ATOM   2397 C CA  . TRP A 1 316 ? 6.467   16.736  59.486  1.00 31.84  ? 316 TRP A CA  1 
ATOM   2398 C C   . TRP A 1 316 ? 6.999   15.818  60.610  1.00 37.48  ? 316 TRP A C   1 
ATOM   2399 O O   . TRP A 1 316 ? 8.059   16.090  61.195  1.00 35.59  ? 316 TRP A O   1 
ATOM   2400 C CB  . TRP A 1 316 ? 5.284   17.592  59.956  1.00 28.93  ? 316 TRP A CB  1 
ATOM   2401 C CG  . TRP A 1 316 ? 5.473   18.228  61.275  1.00 37.50  ? 316 TRP A CG  1 
ATOM   2402 C CD1 . TRP A 1 316 ? 6.200   19.355  61.550  1.00 40.38  ? 316 TRP A CD1 1 
ATOM   2403 C CD2 . TRP A 1 316 ? 4.927   17.788  62.523  1.00 33.62  ? 316 TRP A CD2 1 
ATOM   2404 N NE1 . TRP A 1 316 ? 6.142   19.637  62.892  1.00 38.03  ? 316 TRP A NE1 1 
ATOM   2405 C CE2 . TRP A 1 316 ? 5.366   18.690  63.513  1.00 39.40  ? 316 TRP A CE2 1 
ATOM   2406 C CE3 . TRP A 1 316 ? 4.101   16.727  62.897  1.00 30.92  ? 316 TRP A CE3 1 
ATOM   2407 C CZ2 . TRP A 1 316 ? 5.004   18.563  64.857  1.00 43.35  ? 316 TRP A CZ2 1 
ATOM   2408 C CZ3 . TRP A 1 316 ? 3.749   16.593  64.214  1.00 38.27  ? 316 TRP A CZ3 1 
ATOM   2409 C CH2 . TRP A 1 316 ? 4.202   17.507  65.189  1.00 44.39  ? 316 TRP A CH2 1 
ATOM   2410 N N   . LYS A 1 317 ? 6.286   14.727  60.897  1.00 34.57  ? 317 LYS A N   1 
ATOM   2411 C CA  . LYS A 1 317 ? 6.743   13.777  61.902  1.00 31.87  ? 317 LYS A CA  1 
ATOM   2412 C C   . LYS A 1 317 ? 8.058   13.097  61.512  1.00 35.41  ? 317 LYS A C   1 
ATOM   2413 O O   . LYS A 1 317 ? 8.882   12.809  62.370  1.00 38.03  ? 317 LYS A O   1 
ATOM   2414 C CB  . LYS A 1 317 ? 5.668   12.729  62.158  1.00 36.28  ? 317 LYS A CB  1 
ATOM   2415 C CG  . LYS A 1 317 ? 4.723   13.088  63.291  1.00 34.11  ? 317 LYS A CG  1 
ATOM   2416 C CD  . LYS A 1 317 ? 4.005   11.862  63.829  1.00 34.16  ? 317 LYS A CD  1 
ATOM   2417 C CE  . LYS A 1 317 ? 4.667   11.307  65.083  1.00 36.25  ? 317 LYS A CE  1 
ATOM   2418 N NZ  . LYS A 1 317 ? 4.239   12.069  66.294  1.00 35.79  ? 317 LYS A NZ  1 
ATOM   2419 N N   . ALA A 1 318 ? 8.251   12.841  60.219  1.00 37.59  ? 318 ALA A N   1 
ATOM   2420 C CA  . ALA A 1 318 ? 9.527   12.335  59.705  1.00 35.62  ? 318 ALA A CA  1 
ATOM   2421 C C   . ALA A 1 318 ? 10.646  13.384  59.836  1.00 41.28  ? 318 ALA A C   1 
ATOM   2422 O O   . ALA A 1 318 ? 11.844  13.056  59.869  1.00 46.01  ? 318 ALA A O   1 
ATOM   2423 C CB  . ALA A 1 318 ? 9.378   11.899  58.253  1.00 31.73  ? 318 ALA A CB  1 
ATOM   2424 N N   . GLY A 1 319 ? 10.258  14.651  59.915  1.00 36.80  ? 319 GLY A N   1 
ATOM   2425 C CA  . GLY A 1 319 ? 11.221  15.716  60.099  1.00 29.59  ? 319 GLY A CA  1 
ATOM   2426 C C   . GLY A 1 319 ? 11.673  16.342  58.801  1.00 32.88  ? 319 GLY A C   1 
ATOM   2427 O O   . GLY A 1 319 ? 12.734  16.950  58.756  1.00 40.00  ? 319 GLY A O   1 
ATOM   2428 N N   . ILE A 1 320 ? 10.876  16.201  57.752  1.00 25.93  ? 320 ILE A N   1 
ATOM   2429 C CA  . ILE A 1 320 ? 11.185  16.805  56.473  1.00 31.41  ? 320 ILE A CA  1 
ATOM   2430 C C   . ILE A 1 320 ? 11.289  18.326  56.601  1.00 36.36  ? 320 ILE A C   1 
ATOM   2431 O O   . ILE A 1 320 ? 10.573  18.929  57.393  1.00 35.65  ? 320 ILE A O   1 
ATOM   2432 C CB  . ILE A 1 320 ? 10.127  16.426  55.420  1.00 33.42  ? 320 ILE A CB  1 
ATOM   2433 C CG1 . ILE A 1 320 ? 10.175  14.922  55.141  1.00 29.63  ? 320 ILE A CG1 1 
ATOM   2434 C CG2 . ILE A 1 320 ? 10.336  17.192  54.136  1.00 30.27  ? 320 ILE A CG2 1 
ATOM   2435 C CD1 . ILE A 1 320 ? 11.269  14.508  54.191  1.00 26.66  ? 320 ILE A CD1 1 
ATOM   2436 N N   . THR A 1 321 ? 12.208  18.946  55.859  1.00 35.76  ? 321 THR A N   1 
ATOM   2437 C CA  . THR A 1 321 ? 12.298  20.407  55.850  1.00 37.44  ? 321 THR A CA  1 
ATOM   2438 C C   . THR A 1 321 ? 12.110  20.873  54.424  1.00 39.61  ? 321 THR A C   1 
ATOM   2439 O O   . THR A 1 321 ? 12.135  20.053  53.503  1.00 43.13  ? 321 THR A O   1 
ATOM   2440 C CB  . THR A 1 321 ? 13.644  20.914  56.399  1.00 37.83  ? 321 THR A CB  1 
ATOM   2441 O OG1 . THR A 1 321 ? 14.698  20.520  55.511  1.00 45.88  ? 321 THR A OG1 1 
ATOM   2442 C CG2 . THR A 1 321 ? 13.900  20.336  57.771  1.00 29.94  ? 321 THR A CG2 1 
ATOM   2443 N N   . PRO A 1 322 ? 11.890  22.180  54.217  1.00 38.20  ? 322 PRO A N   1 
ATOM   2444 C CA  . PRO A 1 322 ? 11.838  22.607  52.816  1.00 35.11  ? 322 PRO A CA  1 
ATOM   2445 C C   . PRO A 1 322 ? 13.131  22.251  52.076  1.00 35.80  ? 322 PRO A C   1 
ATOM   2446 O O   . PRO A 1 322 ? 13.137  22.067  50.857  1.00 33.23  ? 322 PRO A O   1 
ATOM   2447 C CB  . PRO A 1 322 ? 11.650  24.117  52.926  1.00 35.06  ? 322 PRO A CB  1 
ATOM   2448 C CG  . PRO A 1 322 ? 10.900  24.295  54.192  1.00 32.44  ? 322 PRO A CG  1 
ATOM   2449 C CD  . PRO A 1 322 ? 11.324  23.192  55.124  1.00 33.87  ? 322 PRO A CD  1 
ATOM   2450 N N   . VAL A 1 323 ? 14.220  22.149  52.827  1.00 37.92  ? 323 VAL A N   1 
ATOM   2451 C CA  . VAL A 1 323 ? 15.507  21.805  52.246  1.00 43.60  ? 323 VAL A CA  1 
ATOM   2452 C C   . VAL A 1 323 ? 15.501  20.353  51.793  1.00 38.79  ? 323 VAL A C   1 
ATOM   2453 O O   . VAL A 1 323 ? 16.024  19.997  50.745  1.00 35.06  ? 323 VAL A O   1 
ATOM   2454 C CB  . VAL A 1 323 ? 16.652  22.030  53.247  1.00 38.58  ? 323 VAL A CB  1 
ATOM   2455 C CG1 . VAL A 1 323 ? 17.986  21.647  52.618  1.00 32.64  ? 323 VAL A CG1 1 
ATOM   2456 C CG2 . VAL A 1 323 ? 16.659  23.480  53.678  1.00 38.68  ? 323 VAL A CG2 1 
ATOM   2457 N N   . THR A 1 324 ? 14.877  19.517  52.596  1.00 38.98  ? 324 THR A N   1 
ATOM   2458 C CA  . THR A 1 324 ? 14.963  18.098  52.395  1.00 33.71  ? 324 THR A CA  1 
ATOM   2459 C C   . THR A 1 324 ? 13.709  17.566  51.716  1.00 35.78  ? 324 THR A C   1 
ATOM   2460 O O   . THR A 1 324 ? 13.674  16.424  51.287  1.00 38.89  ? 324 THR A O   1 
ATOM   2461 C CB  . THR A 1 324 ? 15.195  17.420  53.724  1.00 36.36  ? 324 THR A CB  1 
ATOM   2462 O OG1 . THR A 1 324 ? 16.192  16.420  53.574  1.00 45.10  ? 324 THR A OG1 1 
ATOM   2463 C CG2 . THR A 1 324 ? 13.926  16.823  54.253  1.00 38.69  ? 324 THR A CG2 1 
ATOM   2464 N N   . PHE A 1 325 ? 12.690  18.413  51.591  1.00 36.36  ? 325 PHE A N   1 
ATOM   2465 C CA  . PHE A 1 325 ? 11.456  18.048  50.890  1.00 33.84  ? 325 PHE A CA  1 
ATOM   2466 C C   . PHE A 1 325 ? 11.673  17.559  49.454  1.00 34.61  ? 325 PHE A C   1 
ATOM   2467 O O   . PHE A 1 325 ? 11.039  16.584  49.051  1.00 35.45  ? 325 PHE A O   1 
ATOM   2468 C CB  . PHE A 1 325 ? 10.463  19.221  50.881  1.00 31.75  ? 325 PHE A CB  1 
ATOM   2469 C CG  . PHE A 1 325 ? 9.173   18.887  50.231  1.00 31.21  ? 325 PHE A CG  1 
ATOM   2470 C CD1 . PHE A 1 325 ? 8.164   18.265  50.948  1.00 34.75  ? 325 PHE A CD1 1 
ATOM   2471 C CD2 . PHE A 1 325 ? 8.965   19.155  48.893  1.00 31.45  ? 325 PHE A CD2 1 
ATOM   2472 C CE1 . PHE A 1 325 ? 6.959   17.912  50.326  1.00 33.83  ? 325 PHE A CE1 1 
ATOM   2473 C CE2 . PHE A 1 325 ? 7.761   18.814  48.269  1.00 29.31  ? 325 PHE A CE2 1 
ATOM   2474 C CZ  . PHE A 1 325 ? 6.765   18.190  48.981  1.00 25.16  ? 325 PHE A CZ  1 
ATOM   2475 N N   . PRO A 1 326 ? 12.558  18.222  48.669  1.00 35.66  ? 326 PRO A N   1 
ATOM   2476 C CA  . PRO A 1 326 ? 12.743  17.706  47.299  1.00 31.00  ? 326 PRO A CA  1 
ATOM   2477 C C   . PRO A 1 326 ? 13.229  16.255  47.223  1.00 31.18  ? 326 PRO A C   1 
ATOM   2478 O O   . PRO A 1 326 ? 12.969  15.600  46.219  1.00 34.49  ? 326 PRO A O   1 
ATOM   2479 C CB  . PRO A 1 326 ? 13.792  18.659  46.707  1.00 36.81  ? 326 PRO A CB  1 
ATOM   2480 C CG  . PRO A 1 326 ? 13.628  19.928  47.487  1.00 36.07  ? 326 PRO A CG  1 
ATOM   2481 C CD  . PRO A 1 326 ? 13.266  19.503  48.871  1.00 28.77  ? 326 PRO A CD  1 
ATOM   2482 N N   . THR A 1 327 ? 13.917  15.752  48.245  1.00 33.57  ? 327 THR A N   1 
ATOM   2483 C CA  . THR A 1 327 ? 14.296  14.342  48.236  1.00 32.82  ? 327 THR A CA  1 
ATOM   2484 C C   . THR A 1 327 ? 13.084  13.444  48.493  1.00 33.18  ? 327 THR A C   1 
ATOM   2485 O O   . THR A 1 327 ? 13.070  12.303  48.033  1.00 32.31  ? 327 THR A O   1 
ATOM   2486 C CB  . THR A 1 327 ? 15.406  13.983  49.284  1.00 33.52  ? 327 THR A CB  1 
ATOM   2487 O OG1 . THR A 1 327 ? 14.858  13.975  50.600  1.00 30.68  ? 327 THR A OG1 1 
ATOM   2488 C CG2 . THR A 1 327 ? 16.578  14.942  49.216  1.00 30.79  ? 327 THR A CG2 1 
ATOM   2489 N N   . LEU A 1 328 ? 12.075  13.944  49.218  1.00 32.72  ? 328 LEU A N   1 
ATOM   2490 C CA  . LEU A 1 328 ? 10.862  13.157  49.492  1.00 28.96  ? 328 LEU A CA  1 
ATOM   2491 C C   . LEU A 1 328 ? 10.059  13.042  48.214  1.00 32.50  ? 328 LEU A C   1 
ATOM   2492 O O   . LEU A 1 328 ? 9.642   11.946  47.803  1.00 29.57  ? 328 LEU A O   1 
ATOM   2493 C CB  . LEU A 1 328 ? 10.028  13.799  50.597  1.00 29.69  ? 328 LEU A CB  1 
ATOM   2494 C CG  . LEU A 1 328 ? 8.698   13.181  51.048  1.00 32.40  ? 328 LEU A CG  1 
ATOM   2495 C CD1 . LEU A 1 328 ? 8.872   11.798  51.698  1.00 25.83  ? 328 LEU A CD1 1 
ATOM   2496 C CD2 . LEU A 1 328 ? 7.984   14.139  52.009  1.00 28.25  ? 328 LEU A CD2 1 
ATOM   2497 N N   . SER A 1 329 ? 9.872   14.199  47.587  1.00 29.96  ? 329 SER A N   1 
ATOM   2498 C CA  . SER A 1 329 ? 9.259   14.310  46.282  1.00 25.84  ? 329 SER A CA  1 
ATOM   2499 C C   . SER A 1 329 ? 9.931   13.383  45.257  1.00 27.19  ? 329 SER A C   1 
ATOM   2500 O O   . SER A 1 329 ? 9.260   12.620  44.556  1.00 26.84  ? 329 SER A O   1 
ATOM   2501 C CB  . SER A 1 329 ? 9.318   15.772  45.834  1.00 28.78  ? 329 SER A CB  1 
ATOM   2502 O OG  . SER A 1 329 ? 8.600   15.989  44.642  1.00 27.66  ? 329 SER A OG  1 
ATOM   2503 N N   . GLN A 1 330 ? 11.255  13.427  45.162  1.00 28.42  ? 330 GLN A N   1 
ATOM   2504 C CA  . GLN A 1 330 ? 11.945  12.545  44.212  1.00 28.61  ? 330 GLN A CA  1 
ATOM   2505 C C   . GLN A 1 330 ? 11.753  11.059  44.584  1.00 27.27  ? 330 GLN A C   1 
ATOM   2506 O O   . GLN A 1 330 ? 11.458  10.243  43.718  1.00 27.04  ? 330 GLN A O   1 
ATOM   2507 C CB  . GLN A 1 330 ? 13.442  12.901  44.135  1.00 29.28  ? 330 GLN A CB  1 
ATOM   2508 C CG  . GLN A 1 330 ? 14.172  12.462  42.867  1.00 22.97  ? 330 GLN A CG  1 
ATOM   2509 C CD  . GLN A 1 330 ? 13.621  13.100  41.592  1.00 36.51  ? 330 GLN A CD  1 
ATOM   2510 O OE1 . GLN A 1 330 ? 13.416  14.318  41.523  1.00 29.19  ? 330 GLN A OE1 1 
ATOM   2511 N NE2 . GLN A 1 330 ? 13.376  12.266  40.568  1.00 31.41  ? 330 GLN A NE2 1 
ATOM   2512 N N   . PHE A 1 331 ? 11.915  10.713  45.865  1.00 24.88  ? 331 PHE A N   1 
ATOM   2513 C CA  . PHE A 1 331 ? 11.709  9.337   46.301  1.00 25.56  ? 331 PHE A CA  1 
ATOM   2514 C C   . PHE A 1 331 ? 10.331  8.837   45.839  1.00 32.58  ? 331 PHE A C   1 
ATOM   2515 O O   . PHE A 1 331 ? 10.242  7.823   45.125  1.00 31.90  ? 331 PHE A O   1 
ATOM   2516 C CB  . PHE A 1 331 ? 11.843  9.195   47.822  1.00 25.70  ? 331 PHE A CB  1 
ATOM   2517 C CG  . PHE A 1 331 ? 11.685  7.781   48.306  1.00 31.95  ? 331 PHE A CG  1 
ATOM   2518 C CD1 . PHE A 1 331 ? 10.421  7.244   48.555  1.00 33.75  ? 331 PHE A CD1 1 
ATOM   2519 C CD2 . PHE A 1 331 ? 12.796  6.971   48.488  1.00 34.01  ? 331 PHE A CD2 1 
ATOM   2520 C CE1 . PHE A 1 331 ? 10.279  5.924   48.966  1.00 32.84  ? 331 PHE A CE1 1 
ATOM   2521 C CE2 . PHE A 1 331 ? 12.667  5.658   48.909  1.00 30.51  ? 331 PHE A CE2 1 
ATOM   2522 C CZ  . PHE A 1 331 ? 11.412  5.131   49.143  1.00 32.21  ? 331 PHE A CZ  1 
ATOM   2523 N N   . LEU A 1 332 ? 9.276   9.572   46.222  1.00 29.50  ? 332 LEU A N   1 
ATOM   2524 C CA  . LEU A 1 332 ? 7.881   9.213   45.915  1.00 29.89  ? 332 LEU A CA  1 
ATOM   2525 C C   . LEU A 1 332 ? 7.553   9.238   44.416  1.00 28.46  ? 332 LEU A C   1 
ATOM   2526 O O   . LEU A 1 332 ? 6.733   8.468   43.954  1.00 29.88  ? 332 LEU A O   1 
ATOM   2527 C CB  . LEU A 1 332 ? 6.922   10.147  46.662  1.00 31.46  ? 332 LEU A CB  1 
ATOM   2528 C CG  . LEU A 1 332 ? 6.952   10.019  48.186  1.00 25.37  ? 332 LEU A CG  1 
ATOM   2529 C CD1 . LEU A 1 332 ? 6.323   11.234  48.802  1.00 23.40  ? 332 LEU A CD1 1 
ATOM   2530 C CD2 . LEU A 1 332 ? 6.234   8.759   48.587  1.00 22.29  ? 332 LEU A CD2 1 
ATOM   2531 N N   . PHE A 1 333 ? 8.189   10.134  43.671  1.00 26.63  ? 333 PHE A N   1 
ATOM   2532 C CA  . PHE A 1 333 ? 8.164   10.091  42.220  1.00 23.86  ? 333 PHE A CA  1 
ATOM   2533 C C   . PHE A 1 333 ? 8.771   8.787   41.671  1.00 28.88  ? 333 PHE A C   1 
ATOM   2534 O O   . PHE A 1 333 ? 8.157   8.131   40.824  1.00 28.06  ? 333 PHE A O   1 
ATOM   2535 C CB  . PHE A 1 333 ? 8.896   11.316  41.653  1.00 25.23  ? 333 PHE A CB  1 
ATOM   2536 C CG  . PHE A 1 333 ? 8.787   11.470  40.163  1.00 22.52  ? 333 PHE A CG  1 
ATOM   2537 C CD1 . PHE A 1 333 ? 7.561   11.705  39.566  1.00 26.22  ? 333 PHE A CD1 1 
ATOM   2538 C CD2 . PHE A 1 333 ? 9.909   11.403  39.369  1.00 22.23  ? 333 PHE A CD2 1 
ATOM   2539 C CE1 . PHE A 1 333 ? 7.451   11.855  38.184  1.00 28.92  ? 333 PHE A CE1 1 
ATOM   2540 C CE2 . PHE A 1 333 ? 9.827   11.547  38.006  1.00 25.29  ? 333 PHE A CE2 1 
ATOM   2541 C CZ  . PHE A 1 333 ? 8.590   11.777  37.396  1.00 30.99  ? 333 PHE A CZ  1 
ATOM   2542 N N   . GLU A 1 334 ? 9.967   8.407   42.135  1.00 33.09  ? 334 GLU A N   1 
ATOM   2543 C CA  . GLU A 1 334 ? 10.584  7.144   41.675  1.00 34.58  ? 334 GLU A CA  1 
ATOM   2544 C C   . GLU A 1 334 ? 9.657   5.968   42.012  1.00 34.36  ? 334 GLU A C   1 
ATOM   2545 O O   . GLU A 1 334 ? 9.442   5.081   41.193  1.00 34.51  ? 334 GLU A O   1 
ATOM   2546 C CB  . GLU A 1 334 ? 11.978  6.897   42.311  1.00 36.77  ? 334 GLU A CB  1 
ATOM   2547 C CG  . GLU A 1 334 ? 13.093  7.894   41.983  1.00 32.69  ? 334 GLU A CG  1 
ATOM   2548 C CD  . GLU A 1 334 ? 13.170  8.233   40.514  1.00 40.54  ? 334 GLU A CD  1 
ATOM   2549 O OE1 . GLU A 1 334 ? 13.159  7.304   39.665  1.00 49.33  ? 334 GLU A OE1 1 
ATOM   2550 O OE2 . GLU A 1 334 ? 13.236  9.443   40.207  1.00 45.14  ? 334 GLU A OE2 1 
ATOM   2551 N N   . MET A 1 335 ? 9.109   5.984   43.230  1.00 32.38  ? 335 MET A N   1 
ATOM   2552 C CA  . MET A 1 335 ? 8.266   4.911   43.720  1.00 31.82  ? 335 MET A CA  1 
ATOM   2553 C C   . MET A 1 335 ? 7.075   4.619   42.797  1.00 27.57  ? 335 MET A C   1 
ATOM   2554 O O   . MET A 1 335 ? 6.600   3.492   42.734  1.00 28.91  ? 335 MET A O   1 
ATOM   2555 C CB  . MET A 1 335 ? 7.786   5.255   45.123  1.00 31.66  ? 335 MET A CB  1 
ATOM   2556 C CG  . MET A 1 335 ? 6.806   4.265   45.763  1.00 30.44  ? 335 MET A CG  1 
ATOM   2557 S SD  . MET A 1 335 ? 6.166   4.952   47.316  1.00 36.45  ? 335 MET A SD  1 
ATOM   2558 C CE  . MET A 1 335 ? 4.745   5.887   46.720  1.00 30.49  ? 335 MET A CE  1 
ATOM   2559 N N   . GLY A 1 336 ? 6.617   5.625   42.061  1.00 26.62  ? 336 GLY A N   1 
ATOM   2560 C CA  . GLY A 1 336 ? 5.476   5.456   41.174  1.00 29.88  ? 336 GLY A CA  1 
ATOM   2561 C C   . GLY A 1 336 ? 5.791   5.075   39.730  1.00 35.91  ? 336 GLY A C   1 
ATOM   2562 O O   . GLY A 1 336 ? 4.883   4.994   38.904  1.00 36.55  ? 336 GLY A O   1 
ATOM   2563 N N   . GLN A 1 337 ? 7.067   4.838   39.421  1.00 37.09  ? 337 GLN A N   1 
ATOM   2564 C CA  . GLN A 1 337 ? 7.485   4.507   38.064  1.00 34.54  ? 337 GLN A CA  1 
ATOM   2565 C C   . GLN A 1 337 ? 7.563   3.010   37.830  1.00 35.27  ? 337 GLN A C   1 
ATOM   2566 O O   . GLN A 1 337 ? 8.181   2.556   36.886  1.00 48.72  ? 337 GLN A O   1 
ATOM   2567 C CB  . GLN A 1 337 ? 8.826   5.189   37.770  1.00 32.84  ? 337 GLN A CB  1 
ATOM   2568 C CG  . GLN A 1 337 ? 8.665   6.692   37.575  1.00 28.47  ? 337 GLN A CG  1 
ATOM   2569 C CD  . GLN A 1 337 ? 9.963   7.385   37.302  1.00 45.05  ? 337 GLN A CD  1 
ATOM   2570 O OE1 . GLN A 1 337 ? 9.953   8.477   36.754  1.00 46.41  ? 337 GLN A OE1 1 
ATOM   2571 N NE2 . GLN A 1 337 ? 11.099  6.775   37.699  1.00 39.85  ? 337 GLN A NE2 1 
ATOM   2572 N N   . GLY A 1 338 ? 6.925   2.253   38.708  1.00 33.41  ? 338 GLY A N   1 
ATOM   2573 C CA  . GLY A 1 338 ? 6.816   0.811   38.581  1.00 34.54  ? 338 GLY A CA  1 
ATOM   2574 C C   . GLY A 1 338 ? 6.469   0.212   39.934  1.00 36.34  ? 338 GLY A C   1 
ATOM   2575 O O   . GLY A 1 338 ? 6.303   0.940   40.899  1.00 37.57  ? 338 GLY A O   1 
ATOM   2576 N N   . PRO A 1 339 ? 6.364   -1.120  40.026  1.00 42.41  ? 339 PRO A N   1 
ATOM   2577 C CA  . PRO A 1 339 ? 6.108   -1.741  41.340  1.00 37.38  ? 339 PRO A CA  1 
ATOM   2578 C C   . PRO A 1 339 ? 7.262   -1.568  42.334  1.00 39.03  ? 339 PRO A C   1 
ATOM   2579 O O   . PRO A 1 339 ? 8.008   -2.509  42.594  1.00 34.52  ? 339 PRO A O   1 
ATOM   2580 C CB  . PRO A 1 339 ? 5.905   -3.230  40.997  1.00 39.70  ? 339 PRO A CB  1 
ATOM   2581 C CG  . PRO A 1 339 ? 6.535   -3.408  39.650  1.00 46.07  ? 339 PRO A CG  1 
ATOM   2582 C CD  . PRO A 1 339 ? 6.326   -2.101  38.927  1.00 40.96  ? 339 PRO A CD  1 
ATOM   2583 N N   . ARG A 1 340 ? 7.388   -0.373  42.901  1.00 41.13  ? 340 ARG A N   1 
ATOM   2584 C CA  . ARG A 1 340 ? 8.474   -0.082  43.818  1.00 38.35  ? 340 ARG A CA  1 
ATOM   2585 C C   . ARG A 1 340 ? 7.955   0.295   45.202  1.00 36.63  ? 340 ARG A C   1 
ATOM   2586 O O   . ARG A 1 340 ? 8.649   0.956   45.981  1.00 36.44  ? 340 ARG A O   1 
ATOM   2587 C CB  . ARG A 1 340 ? 9.344   1.033   43.256  1.00 37.29  ? 340 ARG A CB  1 
ATOM   2588 C CG  . ARG A 1 340 ? 9.796   0.772   41.847  1.00 35.14  ? 340 ARG A CG  1 
ATOM   2589 C CD  . ARG A 1 340 ? 10.483  1.985   41.308  1.00 38.69  ? 340 ARG A CD  1 
ATOM   2590 N NE  . ARG A 1 340 ? 11.211  1.723   40.079  1.00 45.59  ? 340 ARG A NE  1 
ATOM   2591 C CZ  . ARG A 1 340 ? 11.955  2.628   39.458  1.00 38.83  ? 340 ARG A CZ  1 
ATOM   2592 N NH1 . ARG A 1 340 ? 12.058  3.841   39.974  1.00 34.88  ? 340 ARG A NH1 1 
ATOM   2593 N NH2 . ARG A 1 340 ? 12.596  2.315   38.334  1.00 41.61  ? 340 ARG A NH2 1 
ATOM   2594 N N   . GLY A 1 341 ? 6.728   -0.119  45.497  1.00 29.70  ? 341 GLY A N   1 
ATOM   2595 C CA  . GLY A 1 341 ? 6.186   0.013   46.841  1.00 36.73  ? 341 GLY A CA  1 
ATOM   2596 C C   . GLY A 1 341 ? 6.647   -1.132  47.740  1.00 39.83  ? 341 GLY A C   1 
ATOM   2597 O O   . GLY A 1 341 ? 7.693   -1.739  47.493  1.00 41.87  ? 341 GLY A O   1 
ATOM   2598 N N   . GLY A 1 342 ? 5.878   -1.416  48.791  1.00 40.74  ? 342 GLY A N   1 
ATOM   2599 C CA  . GLY A 1 342 ? 6.111   -2.573  49.654  1.00 42.43  ? 342 GLY A CA  1 
ATOM   2600 C C   . GLY A 1 342 ? 7.510   -2.756  50.226  1.00 46.56  ? 342 GLY A C   1 
ATOM   2601 O O   . GLY A 1 342 ? 8.070   -1.844  50.847  1.00 49.77  ? 342 GLY A O   1 
ATOM   2602 N N   . LYS A 1 343 ? 8.091   -3.933  50.016  1.00 44.96  ? 343 LYS A N   1 
ATOM   2603 C CA  . LYS A 1 343 ? 9.385   -4.221  50.620  1.00 37.41  ? 343 LYS A CA  1 
ATOM   2604 C C   . LYS A 1 343 ? 10.525  -3.531  49.874  1.00 42.02  ? 343 LYS A C   1 
ATOM   2605 O O   . LYS A 1 343 ? 11.564  -3.244  50.482  1.00 42.61  ? 343 LYS A O   1 
ATOM   2606 C CB  . LYS A 1 343 ? 9.617   -5.732  50.699  1.00 44.75  ? 343 LYS A CB  1 
ATOM   2607 C CG  . LYS A 1 343 ? 8.553   -6.468  51.514  1.00 49.66  ? 343 LYS A CG  1 
ATOM   2608 C CD  . LYS A 1 343 ? 9.158   -7.461  52.513  1.00 67.59  ? 343 LYS A CD  1 
ATOM   2609 C CE  . LYS A 1 343 ? 9.821   -8.668  51.833  1.00 66.89  ? 343 LYS A CE  1 
ATOM   2610 N NZ  . LYS A 1 343 ? 10.498  -9.565  52.831  1.00 59.32  ? 343 LYS A NZ  1 
ATOM   2611 N N   . LYS A 1 344 ? 10.331  -3.237  48.582  1.00 39.71  ? 344 LYS A N   1 
ATOM   2612 C CA  . LYS A 1 344 ? 11.332  -2.477  47.819  1.00 40.01  ? 344 LYS A CA  1 
ATOM   2613 C C   . LYS A 1 344 ? 11.450  -1.071  48.389  1.00 36.83  ? 344 LYS A C   1 
ATOM   2614 O O   . LYS A 1 344 ? 12.534  -0.509  48.503  1.00 42.17  ? 344 LYS A O   1 
ATOM   2615 C CB  . LYS A 1 344 ? 10.992  -2.415  46.317  1.00 41.07  ? 344 LYS A CB  1 
ATOM   2616 C CG  . LYS A 1 344 ? 12.168  -1.900  45.443  1.00 44.38  ? 344 LYS A CG  1 
ATOM   2617 C CD  . LYS A 1 344 ? 11.949  -1.999  43.907  1.00 44.32  ? 344 LYS A CD  1 
ATOM   2618 C CE  . LYS A 1 344 ? 12.846  -0.962  43.144  1.00 57.98  ? 344 LYS A CE  1 
ATOM   2619 N NZ  . LYS A 1 344 ? 12.854  -1.004  41.619  1.00 44.86  ? 344 LYS A NZ  1 
ATOM   2620 N N   . MET A 1 345 ? 10.319  -0.509  48.772  1.00 38.43  ? 345 MET A N   1 
ATOM   2621 C CA  . MET A 1 345 ? 10.303  0.828   49.331  1.00 36.06  ? 345 MET A CA  1 
ATOM   2622 C C   . MET A 1 345 ? 10.923  0.883   50.733  1.00 41.49  ? 345 MET A C   1 
ATOM   2623 O O   . MET A 1 345 ? 11.757  1.757   51.028  1.00 38.64  ? 345 MET A O   1 
ATOM   2624 C CB  . MET A 1 345 ? 8.873   1.334   49.366  1.00 36.62  ? 345 MET A CB  1 
ATOM   2625 C CG  . MET A 1 345 ? 8.706   2.603   50.131  1.00 30.68  ? 345 MET A CG  1 
ATOM   2626 S SD  . MET A 1 345 ? 6.980   2.750   50.513  1.00 44.16  ? 345 MET A SD  1 
ATOM   2627 C CE  . MET A 1 345 ? 6.722   1.315   51.582  1.00 28.57  ? 345 MET A CE  1 
ATOM   2628 N N   . ILE A 1 346 ? 10.506  -0.053  51.588  1.00 39.75  ? 346 ILE A N   1 
ATOM   2629 C CA  . ILE A 1 346 ? 11.029  -0.160  52.942  1.00 38.49  ? 346 ILE A CA  1 
ATOM   2630 C C   . ILE A 1 346 ? 12.537  -0.284  52.900  1.00 40.04  ? 346 ILE A C   1 
ATOM   2631 O O   . ILE A 1 346 ? 13.258  0.418   53.638  1.00 39.35  ? 346 ILE A O   1 
ATOM   2632 C CB  . ILE A 1 346 ? 10.430  -1.372  53.696  1.00 40.09  ? 346 ILE A CB  1 
ATOM   2633 C CG1 . ILE A 1 346 ? 8.939   -1.149  53.962  1.00 37.90  ? 346 ILE A CG1 1 
ATOM   2634 C CG2 . ILE A 1 346 ? 11.166  -1.593  54.992  1.00 30.67  ? 346 ILE A CG2 1 
ATOM   2635 C CD1 . ILE A 1 346 ? 8.175   -2.404  54.324  1.00 37.51  ? 346 ILE A CD1 1 
ATOM   2636 N N   . LYS A 1 347 ? 13.008  -1.169  52.021  1.00 35.49  ? 347 LYS A N   1 
ATOM   2637 C CA  . LYS A 1 347 ? 14.443  -1.378  51.843  1.00 34.75  ? 347 LYS A CA  1 
ATOM   2638 C C   . LYS A 1 347 ? 15.128  -0.095  51.383  1.00 38.56  ? 347 LYS A C   1 
ATOM   2639 O O   . LYS A 1 347 ? 16.203  0.236   51.876  1.00 37.72  ? 347 LYS A O   1 
ATOM   2640 C CB  . LYS A 1 347 ? 14.698  -2.509  50.847  1.00 34.97  ? 347 LYS A CB  1 
ATOM   2641 C CG  . LYS A 1 347 ? 16.107  -3.014  50.831  1.00 38.62  ? 347 LYS A CG  1 
ATOM   2642 C CD  . LYS A 1 347 ? 16.143  -4.502  50.496  1.00 52.34  ? 347 LYS A CD  1 
ATOM   2643 C CE  . LYS A 1 347 ? 17.220  -5.236  51.315  1.00 51.58  ? 347 LYS A CE  1 
ATOM   2644 N NZ  . LYS A 1 347 ? 16.802  -5.486  52.730  1.00 44.02  ? 347 LYS A NZ  1 
ATOM   2645 N N   . ALA A 1 348 ? 14.509  0.632   50.448  1.00 35.97  ? 348 ALA A N   1 
ATOM   2646 C CA  . ALA A 1 348 ? 15.106  1.870   49.963  1.00 32.60  ? 348 ALA A CA  1 
ATOM   2647 C C   . ALA A 1 348 ? 15.155  2.917   51.081  1.00 35.87  ? 348 ALA A C   1 
ATOM   2648 O O   . ALA A 1 348 ? 16.164  3.605   51.252  1.00 32.97  ? 348 ALA A O   1 
ATOM   2649 C CB  . ALA A 1 348 ? 14.354  2.386   48.778  1.00 27.80  ? 348 ALA A CB  1 
ATOM   2650 N N   . LEU A 1 349 ? 14.070  3.005   51.853  1.00 32.18  ? 349 LEU A N   1 
ATOM   2651 C CA  . LEU A 1 349 ? 13.988  3.933   52.973  1.00 35.50  ? 349 LEU A CA  1 
ATOM   2652 C C   . LEU A 1 349 ? 14.960  3.557   54.100  1.00 37.29  ? 349 LEU A C   1 
ATOM   2653 O O   . LEU A 1 349 ? 15.509  4.425   54.786  1.00 36.09  ? 349 LEU A O   1 
ATOM   2654 C CB  . LEU A 1 349 ? 12.557  3.980   53.522  1.00 39.99  ? 349 LEU A CB  1 
ATOM   2655 C CG  . LEU A 1 349 ? 11.388  4.370   52.618  1.00 31.95  ? 349 LEU A CG  1 
ATOM   2656 C CD1 . LEU A 1 349 ? 10.126  3.870   53.265  1.00 34.44  ? 349 LEU A CD1 1 
ATOM   2657 C CD2 . LEU A 1 349 ? 11.311  5.841   52.418  1.00 26.30  ? 349 LEU A CD2 1 
ATOM   2658 N N   . THR A 1 350 ? 15.145  2.255   54.299  1.00 37.68  ? 350 THR A N   1 
ATOM   2659 C CA  . THR A 1 350 ? 16.156  1.731   55.216  1.00 38.09  ? 350 THR A CA  1 
ATOM   2660 C C   . THR A 1 350 ? 17.590  2.033   54.743  1.00 35.26  ? 350 THR A C   1 
ATOM   2661 O O   . THR A 1 350 ? 18.511  2.126   55.539  1.00 40.41  ? 350 THR A O   1 
ATOM   2662 C CB  . THR A 1 350 ? 15.978  0.189   55.391  1.00 41.63  ? 350 THR A CB  1 
ATOM   2663 O OG1 . THR A 1 350 ? 14.732  -0.077  56.041  1.00 37.29  ? 350 THR A OG1 1 
ATOM   2664 C CG2 . THR A 1 350 ? 17.106  -0.429  56.204  1.00 38.04  ? 350 THR A CG2 1 
ATOM   2665 N N   . ASN A 1 351 ? 17.780  2.193   53.446  1.00 35.24  ? 351 ASN A N   1 
ATOM   2666 C CA  . ASN A 1 351 ? 19.128  2.321   52.928  1.00 38.32  ? 351 ASN A CA  1 
ATOM   2667 C C   . ASN A 1 351 ? 19.553  3.745   52.730  1.00 36.29  ? 351 ASN A C   1 
ATOM   2668 O O   . ASN A 1 351 ? 20.735  4.031   52.734  1.00 44.21  ? 351 ASN A O   1 
ATOM   2669 C CB  . ASN A 1 351 ? 19.275  1.560   51.602  1.00 40.76  ? 351 ASN A CB  1 
ATOM   2670 C CG  . ASN A 1 351 ? 19.361  0.041   51.807  1.00 44.71  ? 351 ASN A CG  1 
ATOM   2671 O OD1 . ASN A 1 351 ? 19.529  -0.434  52.934  1.00 47.13  ? 351 ASN A OD1 1 
ATOM   2672 N ND2 . ASN A 1 351 ? 19.251  -0.721  50.718  1.00 48.07  ? 351 ASN A ND2 1 
ATOM   2673 N N   . THR A 1 352 ? 18.600  4.645   52.550  1.00 40.15  ? 352 THR A N   1 
ATOM   2674 C CA  . THR A 1 352 ? 18.951  6.022   52.222  1.00 35.60  ? 352 THR A CA  1 
ATOM   2675 C C   . THR A 1 352 ? 19.753  6.681   53.330  1.00 37.63  ? 352 THR A C   1 
ATOM   2676 O O   . THR A 1 352 ? 19.484  6.496   54.514  1.00 37.71  ? 352 THR A O   1 
ATOM   2677 C CB  . THR A 1 352 ? 17.716  6.873   51.930  1.00 33.44  ? 352 THR A CB  1 
ATOM   2678 O OG1 . THR A 1 352 ? 18.127  8.221   51.674  1.00 37.64  ? 352 THR A OG1 1 
ATOM   2679 C CG2 . THR A 1 352 ? 16.740  6.853   53.106  1.00 28.63  ? 352 THR A CG2 1 
ATOM   2680 N N   . PRO A 1 353 ? 20.769  7.441   52.938  1.00 38.77  ? 353 PRO A N   1 
ATOM   2681 C CA  . PRO A 1 353 ? 21.599  8.141   53.919  1.00 38.08  ? 353 PRO A CA  1 
ATOM   2682 C C   . PRO A 1 353 ? 20.833  9.285   54.596  1.00 41.73  ? 353 PRO A C   1 
ATOM   2683 O O   . PRO A 1 353 ? 21.222  9.756   55.670  1.00 45.14  ? 353 PRO A O   1 
ATOM   2684 C CB  . PRO A 1 353 ? 22.766  8.659   53.075  1.00 40.73  ? 353 PRO A CB  1 
ATOM   2685 C CG  . PRO A 1 353 ? 22.209  8.721   51.653  1.00 35.31  ? 353 PRO A CG  1 
ATOM   2686 C CD  . PRO A 1 353 ? 21.238  7.611   51.551  1.00 34.32  ? 353 PRO A CD  1 
ATOM   2687 N N   . LEU A 1 354 ? 19.748  9.722   53.966  1.00 42.55  ? 354 LEU A N   1 
ATOM   2688 C CA  . LEU A 1 354 ? 18.890  10.771  54.519  1.00 42.15  ? 354 LEU A CA  1 
ATOM   2689 C C   . LEU A 1 354 ? 18.187  10.303  55.795  1.00 40.33  ? 354 LEU A C   1 
ATOM   2690 O O   . LEU A 1 354 ? 17.656  9.192   55.850  1.00 34.09  ? 354 LEU A O   1 
ATOM   2691 C CB  . LEU A 1 354 ? 17.867  11.213  53.468  1.00 34.60  ? 354 LEU A CB  1 
ATOM   2692 C CG  . LEU A 1 354 ? 18.547  11.739  52.196  1.00 37.62  ? 354 LEU A CG  1 
ATOM   2693 C CD1 . LEU A 1 354 ? 17.738  11.415  50.959  1.00 39.49  ? 354 LEU A CD1 1 
ATOM   2694 C CD2 . LEU A 1 354 ? 18.733  13.226  52.309  1.00 36.61  ? 354 LEU A CD2 1 
ATOM   2695 N N   . LYS A 1 355 ? 18.200  11.155  56.819  1.00 43.43  ? 355 LYS A N   1 
ATOM   2696 C CA  . LYS A 1 355 ? 17.629  10.811  58.121  1.00 41.04  ? 355 LYS A CA  1 
ATOM   2697 C C   . LYS A 1 355 ? 16.143  10.451  58.093  1.00 39.03  ? 355 LYS A C   1 
ATOM   2698 O O   . LYS A 1 355 ? 15.702  9.621   58.891  1.00 39.02  ? 355 LYS A O   1 
ATOM   2699 C CB  . LYS A 1 355 ? 17.825  11.964  59.108  1.00 43.57  ? 355 LYS A CB  1 
ATOM   2700 C CG  . LYS A 1 355 ? 19.233  12.142  59.595  1.00 47.20  ? 355 LYS A CG  1 
ATOM   2701 C CD  . LYS A 1 355 ? 19.285  13.120  60.755  1.00 47.30  ? 355 LYS A CD  1 
ATOM   2702 C CE  . LYS A 1 355 ? 20.686  13.182  61.363  1.00 47.86  ? 355 LYS A CE  1 
ATOM   2703 N NZ  . LYS A 1 355 ? 20.834  14.322  62.312  1.00 59.21  ? 355 LYS A NZ  1 
ATOM   2704 N N   . TRP A 1 356 ? 15.376  11.083  57.198  1.00 39.25  ? 356 TRP A N   1 
ATOM   2705 C CA  . TRP A 1 356 ? 13.921  10.960  57.232  1.00 30.23  ? 356 TRP A CA  1 
ATOM   2706 C C   . TRP A 1 356 ? 13.484  9.589   56.795  1.00 34.66  ? 356 TRP A C   1 
ATOM   2707 O O   . TRP A 1 356 ? 12.388  9.136   57.154  1.00 33.77  ? 356 TRP A O   1 
ATOM   2708 C CB  . TRP A 1 356 ? 13.229  12.030  56.375  1.00 29.34  ? 356 TRP A CB  1 
ATOM   2709 C CG  . TRP A 1 356 ? 13.536  12.048  54.917  1.00 32.30  ? 356 TRP A CG  1 
ATOM   2710 C CD1 . TRP A 1 356 ? 14.368  12.911  54.278  1.00 35.23  ? 356 TRP A CD1 1 
ATOM   2711 C CD2 . TRP A 1 356 ? 12.989  11.189  53.895  1.00 33.71  ? 356 TRP A CD2 1 
ATOM   2712 N NE1 . TRP A 1 356 ? 14.393  12.639  52.929  1.00 33.70  ? 356 TRP A NE1 1 
ATOM   2713 C CE2 . TRP A 1 356 ? 13.550  11.589  52.669  1.00 32.73  ? 356 TRP A CE2 1 
ATOM   2714 C CE3 . TRP A 1 356 ? 12.089  10.127  53.901  1.00 30.78  ? 356 TRP A CE3 1 
ATOM   2715 C CZ2 . TRP A 1 356 ? 13.247  10.957  51.462  1.00 31.27  ? 356 TRP A CZ2 1 
ATOM   2716 C CZ3 . TRP A 1 356 ? 11.792  9.507   52.702  1.00 34.00  ? 356 TRP A CZ3 1 
ATOM   2717 C CH2 . TRP A 1 356 ? 12.370  9.927   51.502  1.00 31.20  ? 356 TRP A CH2 1 
ATOM   2718 N N   . GLY A 1 357 ? 14.353  8.929   56.036  1.00 32.76  ? 357 GLY A N   1 
ATOM   2719 C CA  . GLY A 1 357 ? 14.106  7.577   55.575  1.00 35.10  ? 357 GLY A CA  1 
ATOM   2720 C C   . GLY A 1 357 ? 13.688  6.619   56.668  1.00 34.37  ? 357 GLY A C   1 
ATOM   2721 O O   . GLY A 1 357 ? 12.593  6.057   56.635  1.00 32.97  ? 357 GLY A O   1 
ATOM   2722 N N   . LYS A 1 358 ? 14.549  6.441   57.656  1.00 34.71  ? 358 LYS A N   1 
ATOM   2723 C CA  . LYS A 1 358 ? 14.232  5.511   58.731  1.00 36.34  ? 358 LYS A CA  1 
ATOM   2724 C C   . LYS A 1 358 ? 13.176  6.088   59.676  1.00 37.78  ? 358 LYS A C   1 
ATOM   2725 O O   . LYS A 1 358 ? 12.434  5.329   60.307  1.00 37.63  ? 358 LYS A O   1 
ATOM   2726 C CB  . LYS A 1 358 ? 15.496  5.122   59.505  1.00 35.37  ? 358 LYS A CB  1 
ATOM   2727 C CG  . LYS A 1 358 ? 16.385  4.123   58.763  1.00 34.33  ? 358 LYS A CG  1 
ATOM   2728 C CD  . LYS A 1 358 ? 17.368  3.427   59.709  1.00 40.14  ? 358 LYS A CD  1 
ATOM   2729 C CE  . LYS A 1 358 ? 18.543  2.785   58.962  1.00 33.60  ? 358 LYS A CE  1 
ATOM   2730 N NZ  . LYS A 1 358 ? 19.520  3.799   58.457  1.00 30.12  ? 358 LYS A NZ  1 
ATOM   2731 N N   . LYS A 1 359 ? 13.099  7.423   59.762  1.00 38.10  ? 359 LYS A N   1 
ATOM   2732 C CA  . LYS A 1 359 ? 12.069  8.092   60.568  1.00 33.64  ? 359 LYS A CA  1 
ATOM   2733 C C   . LYS A 1 359 ? 10.676  7.852   59.997  1.00 36.82  ? 359 LYS A C   1 
ATOM   2734 O O   . LYS A 1 359 ? 9.722   7.718   60.753  1.00 39.46  ? 359 LYS A O   1 
ATOM   2735 C CB  . LYS A 1 359 ? 12.332  9.604   60.669  1.00 35.10  ? 359 LYS A CB  1 
ATOM   2736 C CG  . LYS A 1 359 ? 13.131  10.039  61.896  1.00 36.94  ? 359 LYS A CG  1 
ATOM   2737 C CD  . LYS A 1 359 ? 13.828  11.401  61.698  1.00 43.66  ? 359 LYS A CD  1 
ATOM   2738 C CE  . LYS A 1 359 ? 14.747  11.722  62.890  1.00 50.23  ? 359 LYS A CE  1 
ATOM   2739 N NZ  . LYS A 1 359 ? 15.328  13.097  62.888  1.00 49.27  ? 359 LYS A NZ  1 
ATOM   2740 N N   . ILE A 1 360 ? 10.559  7.811   58.665  1.00 36.48  ? 360 ILE A N   1 
ATOM   2741 C CA  . ILE A 1 360 ? 9.290   7.471   57.998  1.00 32.72  ? 360 ILE A CA  1 
ATOM   2742 C C   . ILE A 1 360 ? 8.904   6.030   58.309  1.00 35.69  ? 360 ILE A C   1 
ATOM   2743 O O   . ILE A 1 360 ? 7.746   5.737   58.623  1.00 34.62  ? 360 ILE A O   1 
ATOM   2744 C CB  . ILE A 1 360 ? 9.380   7.696   56.456  1.00 30.64  ? 360 ILE A CB  1 
ATOM   2745 C CG1 . ILE A 1 360 ? 8.836   9.068   56.084  1.00 28.71  ? 360 ILE A CG1 1 
ATOM   2746 C CG2 . ILE A 1 360 ? 8.629   6.644   55.680  1.00 27.94  ? 360 ILE A CG2 1 
ATOM   2747 C CD1 . ILE A 1 360 ? 7.386   9.038   55.720  1.00 34.74  ? 360 ILE A CD1 1 
ATOM   2748 N N   . ILE A 1 361 ? 9.893   5.138   58.241  1.00 40.48  ? 361 ILE A N   1 
ATOM   2749 C CA  . ILE A 1 361 ? 9.677   3.714   58.475  1.00 39.97  ? 361 ILE A CA  1 
ATOM   2750 C C   . ILE A 1 361 ? 9.121   3.452   59.859  1.00 36.94  ? 361 ILE A C   1 
ATOM   2751 O O   . ILE A 1 361 ? 8.220   2.631   60.029  1.00 39.19  ? 361 ILE A O   1 
ATOM   2752 C CB  . ILE A 1 361 ? 10.980  2.906   58.302  1.00 39.45  ? 361 ILE A CB  1 
ATOM   2753 C CG1 . ILE A 1 361 ? 11.441  2.969   56.852  1.00 38.74  ? 361 ILE A CG1 1 
ATOM   2754 C CG2 . ILE A 1 361 ? 10.781  1.445   58.705  1.00 31.28  ? 361 ILE A CG2 1 
ATOM   2755 C CD1 . ILE A 1 361 ? 12.644  2.138   56.617  1.00 42.12  ? 361 ILE A CD1 1 
ATOM   2756 N N   . SER A 1 362 ? 9.645   4.166   60.848  1.00 38.92  ? 362 SER A N   1 
ATOM   2757 C CA  . SER A 1 362 ? 9.211   3.972   62.226  1.00 37.66  ? 362 SER A CA  1 
ATOM   2758 C C   . SER A 1 362 ? 7.771   4.505   62.451  1.00 37.76  ? 362 SER A C   1 
ATOM   2759 O O   . SER A 1 362 ? 7.115   4.177   63.441  1.00 41.01  ? 362 SER A O   1 
ATOM   2760 C CB  . SER A 1 362 ? 10.203  4.632   63.181  1.00 29.04  ? 362 SER A CB  1 
ATOM   2761 O OG  . SER A 1 362 ? 10.006  6.027   63.203  1.00 33.79  ? 362 SER A OG  1 
ATOM   2762 N N   . LEU A 1 363 ? 7.268   5.298   61.521  1.00 33.66  ? 363 LEU A N   1 
ATOM   2763 C CA  . LEU A 1 363 ? 5.868   5.686   61.569  1.00 39.33  ? 363 LEU A CA  1 
ATOM   2764 C C   . LEU A 1 363 ? 4.922   4.572   61.111  1.00 40.04  ? 363 LEU A C   1 
ATOM   2765 O O   . LEU A 1 363 ? 3.703   4.695   61.290  1.00 40.43  ? 363 LEU A O   1 
ATOM   2766 C CB  . LEU A 1 363 ? 5.637   6.933   60.716  1.00 33.78  ? 363 LEU A CB  1 
ATOM   2767 C CG  . LEU A 1 363 ? 6.308   8.185   61.257  1.00 31.40  ? 363 LEU A CG  1 
ATOM   2768 C CD1 . LEU A 1 363 ? 6.346   9.274   60.213  1.00 35.40  ? 363 LEU A CD1 1 
ATOM   2769 C CD2 . LEU A 1 363 ? 5.540   8.643   62.461  1.00 38.96  ? 363 LEU A CD2 1 
ATOM   2770 N N   . PHE A 1 364 ? 5.458   3.499   60.523  1.00 38.64  ? 364 PHE A N   1 
ATOM   2771 C CA  . PHE A 1 364 ? 4.599   2.473   59.905  1.00 37.35  ? 364 PHE A CA  1 
ATOM   2772 C C   . PHE A 1 364 ? 3.907   1.611   60.957  1.00 44.29  ? 364 PHE A C   1 
ATOM   2773 O O   . PHE A 1 364 ? 4.553   0.967   61.774  1.00 45.83  ? 364 PHE A O   1 
ATOM   2774 C CB  . PHE A 1 364 ? 5.383   1.559   58.966  1.00 33.19  ? 364 PHE A CB  1 
ATOM   2775 C CG  . PHE A 1 364 ? 5.855   2.217   57.687  1.00 36.46  ? 364 PHE A CG  1 
ATOM   2776 C CD1 . PHE A 1 364 ? 5.603   3.558   57.420  1.00 40.23  ? 364 PHE A CD1 1 
ATOM   2777 C CD2 . PHE A 1 364 ? 6.539   1.477   56.742  1.00 27.76  ? 364 PHE A CD2 1 
ATOM   2778 C CE1 . PHE A 1 364 ? 6.049   4.141   56.246  1.00 33.45  ? 364 PHE A CE1 1 
ATOM   2779 C CE2 . PHE A 1 364 ? 6.971   2.040   55.578  1.00 32.48  ? 364 PHE A CE2 1 
ATOM   2780 C CZ  . PHE A 1 364 ? 6.737   3.381   55.325  1.00 34.57  ? 364 PHE A CZ  1 
ATOM   2781 N N   . ALA A 1 365 ? 2.586   1.599   60.938  1.00 45.10  ? 365 ALA A N   1 
ATOM   2782 C CA  . ALA A 1 365 ? 1.870   0.725   61.837  1.00 50.70  ? 365 ALA A CA  1 
ATOM   2783 C C   . ALA A 1 365 ? 2.193   -0.714  61.469  1.00 59.88  ? 365 ALA A C   1 
ATOM   2784 O O   . ALA A 1 365 ? 2.030   -1.127  60.318  1.00 53.18  ? 365 ALA A O   1 
ATOM   2785 C CB  . ALA A 1 365 ? 0.379   0.980   61.773  1.00 47.27  ? 365 ALA A CB  1 
ATOM   2786 N N   . GLU A 1 366 ? 2.689   -1.458  62.453  1.00 72.21  ? 366 GLU A N   1 
ATOM   2787 C CA  . GLU A 1 366 ? 2.900   -2.895  62.318  1.00 73.56  ? 366 GLU A CA  1 
ATOM   2788 C C   . GLU A 1 366 ? 1.619   -3.540  61.834  1.00 72.24  ? 366 GLU A C   1 
ATOM   2789 O O   . GLU A 1 366 ? 0.530   -3.054  62.149  1.00 74.02  ? 366 GLU A O   1 
ATOM   2790 C CB  . GLU A 1 366 ? 3.320   -3.489  63.656  1.00 74.82  ? 366 GLU A CB  1 
ATOM   2791 C CG  . GLU A 1 366 ? 2.522   -2.912  64.822  1.00 73.87  ? 366 GLU A CG  1 
ATOM   2792 C CD  . GLU A 1 366 ? 3.177   -3.186  66.162  1.00 86.32  ? 366 GLU A CD  1 
ATOM   2793 O OE1 . GLU A 1 366 ? 3.788   -4.273  66.312  1.00 94.09  ? 366 GLU A OE1 1 
ATOM   2794 O OE2 . GLU A 1 366 ? 3.088   -2.312  67.057  1.00 77.09  ? 366 GLU A OE2 1 
ATOM   2795 N N   . ASP A 1 367 ? 1.727   -4.627  61.075  1.00 70.02  ? 367 ASP A N   1 
ATOM   2796 C CA  . ASP A 1 367 ? 0.522   -5.326  60.628  1.00 72.59  ? 367 ASP A CA  1 
ATOM   2797 C C   . ASP A 1 367 ? -0.115  -6.049  61.822  1.00 72.13  ? 367 ASP A C   1 
ATOM   2798 O O   . ASP A 1 367 ? -1.163  -6.679  61.688  1.00 69.06  ? 367 ASP A O   1 
ATOM   2799 C CB  . ASP A 1 367 ? 0.836   -6.299  59.482  1.00 75.05  ? 367 ASP A CB  1 
ATOM   2800 C CG  . ASP A 1 367 ? 1.156   -5.578  58.158  1.00 82.81  ? 367 ASP A CG  1 
ATOM   2801 O OD1 . ASP A 1 367 ? 2.303   -5.095  57.998  1.00 80.36  ? 367 ASP A OD1 1 
ATOM   2802 O OD2 . ASP A 1 367 ? 0.269   -5.509  57.270  1.00 75.88  ? 367 ASP A OD2 1 
ATOM   2803 N N   . ASP A 1 368 ? 0.532   -5.922  62.984  1.00 71.04  ? 368 ASP A N   1 
ATOM   2804 C CA  . ASP A 1 368 ? 0.042   -6.397  64.282  1.00 75.72  ? 368 ASP A CA  1 
ATOM   2805 C C   . ASP A 1 368 ? -1.150  -5.575  64.827  1.00 71.70  ? 368 ASP A C   1 
ATOM   2806 O O   . ASP A 1 368 ? -1.134  -5.137  65.983  1.00 71.10  ? 368 ASP A O   1 
ATOM   2807 C CB  . ASP A 1 368 ? 1.196   -6.360  65.298  1.00 80.90  ? 368 ASP A CB  1 
ATOM   2808 C CG  . ASP A 1 368 ? 1.495   -7.716  65.909  1.00 87.55  ? 368 ASP A CG  1 
ATOM   2809 O OD1 . ASP A 1 368 ? 1.232   -8.747  65.247  1.00 91.50  ? 368 ASP A OD1 1 
ATOM   2810 O OD2 . ASP A 1 368 ? 2.006   -7.751  67.052  1.00 84.05  ? 368 ASP A OD2 1 
ATOM   2811 N N   . PHE A 1 369 ? -2.186  -5.381  64.014  1.00 65.07  ? 369 PHE A N   1 
ATOM   2812 C CA  . PHE A 1 369 ? -3.222  -4.404  64.344  1.00 62.77  ? 369 PHE A CA  1 
ATOM   2813 C C   . PHE A 1 369 ? -4.524  -5.003  64.911  1.00 59.82  ? 369 PHE A C   1 
ATOM   2814 O O   . PHE A 1 369 ? -5.256  -5.727  64.222  1.00 54.04  ? 369 PHE A O   1 
ATOM   2815 C CB  . PHE A 1 369 ? -3.535  -3.540  63.110  1.00 59.23  ? 369 PHE A CB  1 
ATOM   2816 C CG  . PHE A 1 369 ? -4.400  -2.346  63.411  1.00 46.30  ? 369 PHE A CG  1 
ATOM   2817 C CD1 . PHE A 1 369 ? -3.866  -1.226  64.029  1.00 46.12  ? 369 PHE A CD1 1 
ATOM   2818 C CD2 . PHE A 1 369 ? -5.750  -2.348  63.084  1.00 47.17  ? 369 PHE A CD2 1 
ATOM   2819 C CE1 . PHE A 1 369 ? -4.664  -0.121  64.313  1.00 44.93  ? 369 PHE A CE1 1 
ATOM   2820 C CE2 . PHE A 1 369 ? -6.557  -1.250  63.371  1.00 48.19  ? 369 PHE A CE2 1 
ATOM   2821 C CZ  . PHE A 1 369 ? -6.004  -0.127  63.984  1.00 40.31  ? 369 PHE A CZ  1 
ATOM   2822 N N   . ASN A 1 370 ? -4.792  -4.654  66.175  1.00 58.12  ? 370 ASN A N   1 
ATOM   2823 C CA  . ASN A 1 370 ? -6.005  -5.039  66.896  1.00 53.34  ? 370 ASN A CA  1 
ATOM   2824 C C   . ASN A 1 370 ? -7.295  -4.505  66.290  1.00 51.62  ? 370 ASN A C   1 
ATOM   2825 O O   . ASN A 1 370 ? -7.898  -3.589  66.847  1.00 53.05  ? 370 ASN A O   1 
ATOM   2826 C CB  . ASN A 1 370 ? -5.940  -4.561  68.347  1.00 54.75  ? 370 ASN A CB  1 
ATOM   2827 C CG  . ASN A 1 370 ? -4.920  -5.317  69.169  1.00 66.86  ? 370 ASN A CG  1 
ATOM   2828 O OD1 . ASN A 1 370 ? -5.209  -6.384  69.716  1.00 80.26  ? 370 ASN A OD1 1 
ATOM   2829 N ND2 . ASN A 1 370 ? -3.717  -4.761  69.275  1.00 66.70  ? 370 ASN A ND2 1 
ATOM   2830 N N   . GLY A 1 371 ? -7.733  -5.075  65.170  1.00 48.62  ? 371 GLY A N   1 
ATOM   2831 C CA  . GLY A 1 371 ? -9.030  -4.728  64.611  1.00 43.82  ? 371 GLY A CA  1 
ATOM   2832 C C   . GLY A 1 371 ? -8.990  -4.625  63.104  1.00 41.63  ? 371 GLY A C   1 
ATOM   2833 O O   . GLY A 1 371 ? -7.915  -4.702  62.518  1.00 48.23  ? 371 GLY A O   1 
ATOM   2834 N N   . ASN A 1 372 ? -10.155 -4.469  62.481  1.00 43.60  ? 372 ASN A N   1 
ATOM   2835 C CA  . ASN A 1 372 ? -10.245 -4.301  61.027  1.00 45.28  ? 372 ASN A CA  1 
ATOM   2836 C C   . ASN A 1 372 ? -9.414  -3.098  60.577  1.00 49.93  ? 372 ASN A C   1 
ATOM   2837 O O   . ASN A 1 372 ? -9.502  -1.998  61.153  1.00 45.27  ? 372 ASN A O   1 
ATOM   2838 C CB  . ASN A 1 372 ? -11.704 -4.143  60.592  1.00 32.59  ? 372 ASN A CB  1 
ATOM   2839 C CG  . ASN A 1 372 ? -11.893 -4.233  59.095  1.00 49.76  ? 372 ASN A CG  1 
ATOM   2840 O OD1 . ASN A 1 372 ? -10.997 -3.906  58.314  1.00 60.31  ? 372 ASN A OD1 1 
ATOM   2841 N ND2 . ASN A 1 372 ? -13.080 -4.664  58.678  1.00 50.30  ? 372 ASN A ND2 1 
ATOM   2842 N N   . LYS A 1 373 ? -8.598  -3.327  59.554  1.00 48.26  ? 373 LYS A N   1 
ATOM   2843 C CA  . LYS A 1 373 ? -7.673  -2.318  59.062  1.00 47.27  ? 373 LYS A CA  1 
ATOM   2844 C C   . LYS A 1 373 ? -8.406  -1.084  58.554  1.00 43.76  ? 373 LYS A C   1 
ATOM   2845 O O   . LYS A 1 373 ? -7.827  -0.001  58.562  1.00 41.39  ? 373 LYS A O   1 
ATOM   2846 C CB  . LYS A 1 373 ? -6.779  -2.896  57.958  1.00 51.81  ? 373 LYS A CB  1 
ATOM   2847 C CG  . LYS A 1 373 ? -5.288  -2.874  58.282  1.00 43.22  ? 373 LYS A CG  1 
ATOM   2848 C CD  . LYS A 1 373 ? -4.887  -4.052  59.153  1.00 44.61  ? 373 LYS A CD  1 
ATOM   2849 C CE  . LYS A 1 373 ? -3.366  -4.229  59.161  1.00 56.12  ? 373 LYS A CE  1 
ATOM   2850 N NZ  . LYS A 1 373 ? -2.924  -5.436  59.931  1.00 61.79  ? 373 LYS A NZ  1 
ATOM   2851 N N   . LEU A 1 374 ? -9.665  -1.253  58.127  1.00 42.78  ? 374 LEU A N   1 
ATOM   2852 C CA  . LEU A 1 374 ? -10.565 -0.135  57.773  1.00 42.47  ? 374 LEU A CA  1 
ATOM   2853 C C   . LEU A 1 374 ? -10.585 0.996   58.814  1.00 39.45  ? 374 LEU A C   1 
ATOM   2854 O O   . LEU A 1 374 ? -10.732 2.173   58.491  1.00 31.23  ? 374 LEU A O   1 
ATOM   2855 C CB  . LEU A 1 374 ? -12.004 -0.639  57.582  1.00 35.11  ? 374 LEU A CB  1 
ATOM   2856 C CG  . LEU A 1 374 ? -12.359 -1.105  56.174  1.00 46.57  ? 374 LEU A CG  1 
ATOM   2857 C CD1 . LEU A 1 374 ? -13.861 -1.188  55.972  1.00 43.32  ? 374 LEU A CD1 1 
ATOM   2858 C CD2 . LEU A 1 374 ? -11.745 -0.161  55.173  1.00 49.19  ? 374 LEU A CD2 1 
ATOM   2859 N N   . TYR A 1 375 ? -10.434 0.621   60.073  1.00 39.00  ? 375 TYR A N   1 
ATOM   2860 C CA  . TYR A 1 375 ? -10.649 1.561   61.148  1.00 40.25  ? 375 TYR A CA  1 
ATOM   2861 C C   . TYR A 1 375 ? -9.348  2.086   61.712  1.00 38.56  ? 375 TYR A C   1 
ATOM   2862 O O   . TYR A 1 375 ? -9.358  2.740   62.743  1.00 39.47  ? 375 TYR A O   1 
ATOM   2863 C CB  . TYR A 1 375 ? -11.450 0.920   62.277  1.00 32.99  ? 375 TYR A CB  1 
ATOM   2864 C CG  . TYR A 1 375 ? -12.741 0.253   61.875  1.00 32.03  ? 375 TYR A CG  1 
ATOM   2865 C CD1 . TYR A 1 375 ? -13.546 0.776   60.883  1.00 34.00  ? 375 TYR A CD1 1 
ATOM   2866 C CD2 . TYR A 1 375 ? -13.164 -0.902  62.528  1.00 35.66  ? 375 TYR A CD2 1 
ATOM   2867 C CE1 . TYR A 1 375 ? -14.744 0.161   60.544  1.00 41.38  ? 375 TYR A CE1 1 
ATOM   2868 C CE2 . TYR A 1 375 ? -14.346 -1.519  62.203  1.00 38.92  ? 375 TYR A CE2 1 
ATOM   2869 C CZ  . TYR A 1 375 ? -15.135 -0.987  61.215  1.00 41.83  ? 375 TYR A CZ  1 
ATOM   2870 O OH  . TYR A 1 375 ? -16.318 -1.615  60.915  1.00 44.07  ? 375 TYR A OH  1 
ATOM   2871 N N   . MET A 1 376 ? -8.225  1.782   61.075  1.00 37.95  ? 376 MET A N   1 
ATOM   2872 C CA  . MET A 1 376 ? -6.990  2.471   61.435  1.00 33.20  ? 376 MET A CA  1 
ATOM   2873 C C   . MET A 1 376 ? -7.141  3.992   61.277  1.00 34.78  ? 376 MET A C   1 
ATOM   2874 O O   . MET A 1 376 ? -7.600  4.478   60.231  1.00 32.76  ? 376 MET A O   1 
ATOM   2875 C CB  . MET A 1 376 ? -5.832  1.968   60.594  1.00 32.03  ? 376 MET A CB  1 
ATOM   2876 C CG  . MET A 1 376 ? -4.505  2.605   60.949  1.00 37.24  ? 376 MET A CG  1 
ATOM   2877 S SD  . MET A 1 376 ? -3.112  1.722   60.242  1.00 42.70  ? 376 MET A SD  1 
ATOM   2878 C CE  . MET A 1 376 ? -3.670  0.032   60.503  1.00 33.86  ? 376 MET A CE  1 
ATOM   2879 N N   . HIS A 1 377 ? -6.784  4.728   62.328  1.00 29.04  ? 377 HIS A N   1 
ATOM   2880 C CA  . HIS A 1 377 ? -6.947  6.168   62.340  1.00 31.57  ? 377 HIS A CA  1 
ATOM   2881 C C   . HIS A 1 377 ? -6.248  6.779   61.118  1.00 38.24  ? 377 HIS A C   1 
ATOM   2882 O O   . HIS A 1 377 ? -5.111  6.413   60.811  1.00 37.41  ? 377 HIS A O   1 
ATOM   2883 C CB  . HIS A 1 377 ? -6.386  6.739   63.635  1.00 36.63  ? 377 HIS A CB  1 
ATOM   2884 C CG  . HIS A 1 377 ? -6.665  8.197   63.831  1.00 41.87  ? 377 HIS A CG  1 
ATOM   2885 N ND1 . HIS A 1 377 ? -5.755  9.180   63.508  1.00 42.68  ? 377 HIS A ND1 1 
ATOM   2886 C CD2 . HIS A 1 377 ? -7.747  8.837   64.336  1.00 39.04  ? 377 HIS A CD2 1 
ATOM   2887 C CE1 . HIS A 1 377 ? -6.263  10.363  63.804  1.00 42.80  ? 377 HIS A CE1 1 
ATOM   2888 N NE2 . HIS A 1 377 ? -7.471  10.182  64.306  1.00 41.90  ? 377 HIS A NE2 1 
ATOM   2889 N N   . PRO A 1 378 ? -6.923  7.709   60.417  1.00 38.83  ? 378 PRO A N   1 
ATOM   2890 C CA  . PRO A 1 378 ? -6.408  8.222   59.142  1.00 39.38  ? 378 PRO A CA  1 
ATOM   2891 C C   . PRO A 1 378 ? -5.157  9.127   59.287  1.00 36.20  ? 378 PRO A C   1 
ATOM   2892 O O   . PRO A 1 378 ? -4.674  9.692   58.297  1.00 32.43  ? 378 PRO A O   1 
ATOM   2893 C CB  . PRO A 1 378 ? -7.607  9.000   58.579  1.00 36.78  ? 378 PRO A CB  1 
ATOM   2894 C CG  . PRO A 1 378 ? -8.312  9.479   59.776  1.00 35.96  ? 378 PRO A CG  1 
ATOM   2895 C CD  . PRO A 1 378 ? -8.182  8.376   60.801  1.00 37.33  ? 378 PRO A CD  1 
ATOM   2896 N N   . GLY A 1 379 ? -4.624  9.226   60.497  1.00 30.73  ? 379 GLY A N   1 
ATOM   2897 C CA  . GLY A 1 379 ? -3.398  9.956   60.709  1.00 27.53  ? 379 GLY A CA  1 
ATOM   2898 C C   . GLY A 1 379 ? -2.234  9.046   61.000  1.00 28.76  ? 379 GLY A C   1 
ATOM   2899 O O   . GLY A 1 379 ? -1.126  9.519   61.241  1.00 31.05  ? 379 GLY A O   1 
ATOM   2900 N N   . VAL A 1 380 ? -2.476  7.739   60.990  1.00 30.75  ? 380 VAL A N   1 
ATOM   2901 C CA  . VAL A 1 380 ? -1.401  6.751   61.168  1.00 34.57  ? 380 VAL A CA  1 
ATOM   2902 C C   . VAL A 1 380 ? -0.853  6.255   59.823  1.00 32.50  ? 380 VAL A C   1 
ATOM   2903 O O   . VAL A 1 380 ? -1.626  5.942   58.925  1.00 31.87  ? 380 VAL A O   1 
ATOM   2904 C CB  . VAL A 1 380 ? -1.895  5.546   61.996  1.00 37.24  ? 380 VAL A CB  1 
ATOM   2905 C CG1 . VAL A 1 380 ? -0.819  4.476   62.090  1.00 35.61  ? 380 VAL A CG1 1 
ATOM   2906 C CG2 . VAL A 1 380 ? -2.309  6.004   63.384  1.00 31.72  ? 380 VAL A CG2 1 
ATOM   2907 N N   . LEU A 1 381 ? 0.475   6.196   59.677  1.00 35.31  ? 381 LEU A N   1 
ATOM   2908 C CA  . LEU A 1 381 ? 1.083   5.843   58.393  1.00 31.55  ? 381 LEU A CA  1 
ATOM   2909 C C   . LEU A 1 381 ? 1.298   4.348   58.311  1.00 40.37  ? 381 LEU A C   1 
ATOM   2910 O O   . LEU A 1 381 ? 1.558   3.704   59.335  1.00 43.26  ? 381 LEU A O   1 
ATOM   2911 C CB  . LEU A 1 381 ? 2.416   6.576   58.185  1.00 33.15  ? 381 LEU A CB  1 
ATOM   2912 C CG  . LEU A 1 381 ? 3.125   6.448   56.824  1.00 30.75  ? 381 LEU A CG  1 
ATOM   2913 C CD1 . LEU A 1 381 ? 2.185   6.802   55.715  1.00 26.42  ? 381 LEU A CD1 1 
ATOM   2914 C CD2 . LEU A 1 381 ? 4.388   7.327   56.736  1.00 26.94  ? 381 LEU A CD2 1 
ATOM   2915 N N   . THR A 1 382 ? 1.161   3.794   57.105  1.00 33.77  ? 382 THR A N   1 
ATOM   2916 C CA  . THR A 1 382 ? 1.554   2.416   56.845  1.00 31.34  ? 382 THR A CA  1 
ATOM   2917 C C   . THR A 1 382 ? 2.338   2.390   55.565  1.00 30.17  ? 382 THR A C   1 
ATOM   2918 O O   . THR A 1 382 ? 2.241   3.321   54.782  1.00 33.71  ? 382 THR A O   1 
ATOM   2919 C CB  . THR A 1 382 ? 0.354   1.445   56.714  1.00 34.47  ? 382 THR A CB  1 
ATOM   2920 O OG1 . THR A 1 382 ? -0.427  1.782   55.560  1.00 29.03  ? 382 THR A OG1 1 
ATOM   2921 C CG2 . THR A 1 382 ? -0.509  1.459   57.975  1.00 31.53  ? 382 THR A CG2 1 
ATOM   2922 N N   . ALA A 1 383 ? 3.109   1.329   55.350  1.00 29.50  ? 383 ALA A N   1 
ATOM   2923 C CA  . ALA A 1 383 ? 3.825   1.142   54.090  1.00 29.72  ? 383 ALA A CA  1 
ATOM   2924 C C   . ALA A 1 383 ? 2.890   1.369   52.913  1.00 28.58  ? 383 ALA A C   1 
ATOM   2925 O O   . ALA A 1 383 ? 3.283   1.982   51.921  1.00 32.66  ? 383 ALA A O   1 
ATOM   2926 C CB  . ALA A 1 383 ? 4.450   -0.254  54.010  1.00 22.97  ? 383 ALA A CB  1 
ATOM   2927 N N   . GLY A 1 384 ? 1.648   0.903   53.039  1.00 21.45  ? 384 GLY A N   1 
ATOM   2928 C CA  . GLY A 1 384 ? 0.676   0.984   51.964  1.00 24.06  ? 384 GLY A CA  1 
ATOM   2929 C C   . GLY A 1 384 ? 0.084   2.374   51.813  1.00 30.99  ? 384 GLY A C   1 
ATOM   2930 O O   . GLY A 1 384 ? -0.275  2.823   50.720  1.00 31.00  ? 384 GLY A O   1 
ATOM   2931 N N   . ARG A 1 385 ? -0.022  3.077   52.927  1.00 30.29  ? 385 ARG A N   1 
ATOM   2932 C CA  . ARG A 1 385 ? -0.566  4.413   52.891  1.00 30.02  ? 385 ARG A CA  1 
ATOM   2933 C C   . ARG A 1 385 ? 0.440   5.400   52.313  1.00 32.36  ? 385 ARG A C   1 
ATOM   2934 O O   . ARG A 1 385 ? 0.147   6.589   52.227  1.00 28.38  ? 385 ARG A O   1 
ATOM   2935 C CB  . ARG A 1 385 ? -1.019  4.840   54.291  1.00 28.73  ? 385 ARG A CB  1 
ATOM   2936 C CG  . ARG A 1 385 ? -2.382  4.262   54.656  1.00 29.87  ? 385 ARG A CG  1 
ATOM   2937 C CD  . ARG A 1 385 ? -2.745  4.514   56.115  1.00 31.01  ? 385 ARG A CD  1 
ATOM   2938 N NE  . ARG A 1 385 ? -4.148  4.204   56.330  1.00 31.00  ? 385 ARG A NE  1 
ATOM   2939 C CZ  . ARG A 1 385 ? -4.832  4.450   57.441  1.00 27.89  ? 385 ARG A CZ  1 
ATOM   2940 N NH1 . ARG A 1 385 ? -4.248  5.030   58.473  1.00 25.81  ? 385 ARG A NH1 1 
ATOM   2941 N NH2 . ARG A 1 385 ? -6.118  4.116   57.504  1.00 28.97  ? 385 ARG A NH2 1 
ATOM   2942 N N   . MET A 1 386 ? 1.614   4.916   51.898  1.00 30.71  ? 386 MET A N   1 
ATOM   2943 C CA  . MET A 1 386 ? 2.567   5.795   51.240  1.00 24.54  ? 386 MET A CA  1 
ATOM   2944 C C   . MET A 1 386 ? 2.037   6.214   49.871  1.00 24.94  ? 386 MET A C   1 
ATOM   2945 O O   . MET A 1 386 ? 2.520   7.159   49.260  1.00 27.23  ? 386 MET A O   1 
ATOM   2946 C CB  . MET A 1 386 ? 3.919   5.131   51.123  1.00 23.70  ? 386 MET A CB  1 
ATOM   2947 C CG  . MET A 1 386 ? 4.645   5.007   52.433  1.00 24.27  ? 386 MET A CG  1 
ATOM   2948 S SD  . MET A 1 386 ? 5.216   6.586   53.062  1.00 31.06  ? 386 MET A SD  1 
ATOM   2949 C CE  . MET A 1 386 ? 6.629   6.899   52.005  1.00 29.74  ? 386 MET A CE  1 
ATOM   2950 N N   . SER A 1 387 ? 1.012   5.532   49.397  1.00 24.27  ? 387 SER A N   1 
ATOM   2951 C CA  . SER A 1 387 ? 0.405   5.932   48.150  1.00 20.42  ? 387 SER A CA  1 
ATOM   2952 C C   . SER A 1 387 ? -0.268  7.281   48.323  1.00 29.08  ? 387 SER A C   1 
ATOM   2953 O O   . SER A 1 387 ? -0.396  8.044   47.365  1.00 28.17  ? 387 SER A O   1 
ATOM   2954 C CB  . SER A 1 387 ? -0.588  4.878   47.667  1.00 18.78  ? 387 SER A CB  1 
ATOM   2955 O OG  . SER A 1 387 ? -1.533  4.573   48.666  1.00 30.87  ? 387 SER A OG  1 
ATOM   2956 N N   . GLU A 1 388 ? -0.712  7.577   49.547  1.00 30.37  ? 388 GLU A N   1 
ATOM   2957 C CA  . GLU A 1 388 ? -1.260  8.896   49.848  1.00 23.69  ? 388 GLU A CA  1 
ATOM   2958 C C   . GLU A 1 388 ? -0.206  9.986   49.608  1.00 22.97  ? 388 GLU A C   1 
ATOM   2959 O O   . GLU A 1 388 ? -0.474  10.947  48.897  1.00 26.95  ? 388 GLU A O   1 
ATOM   2960 C CB  . GLU A 1 388 ? -1.784  8.968   51.294  1.00 26.49  ? 388 GLU A CB  1 
ATOM   2961 C CG  . GLU A 1 388 ? -2.917  7.975   51.662  1.00 25.47  ? 388 GLU A CG  1 
ATOM   2962 C CD  . GLU A 1 388 ? -4.209  8.266   50.946  1.00 30.04  ? 388 GLU A CD  1 
ATOM   2963 O OE1 . GLU A 1 388 ? -4.570  9.450   50.831  1.00 30.97  ? 388 GLU A OE1 1 
ATOM   2964 O OE2 . GLU A 1 388 ? -4.863  7.315   50.471  1.00 36.56  ? 388 GLU A OE2 1 
ATOM   2965 N N   . MET A 1 389 ? 0.988   9.833   50.182  1.00 23.44  ? 389 MET A N   1 
ATOM   2966 C CA  . MET A 1 389 ? 2.064   10.814  49.992  1.00 23.70  ? 389 MET A CA  1 
ATOM   2967 C C   . MET A 1 389 ? 2.579   10.845  48.551  1.00 26.97  ? 389 MET A C   1 
ATOM   2968 O O   . MET A 1 389 ? 3.044   11.879  48.083  1.00 30.28  ? 389 MET A O   1 
ATOM   2969 C CB  . MET A 1 389 ? 3.229   10.547  50.932  1.00 22.63  ? 389 MET A CB  1 
ATOM   2970 C CG  . MET A 1 389 ? 2.856   10.262  52.370  1.00 18.43  ? 389 MET A CG  1 
ATOM   2971 S SD  . MET A 1 389 ? 4.350   10.156  53.408  1.00 29.33  ? 389 MET A SD  1 
ATOM   2972 C CE  . MET A 1 389 ? 4.983   11.831  53.288  1.00 23.09  ? 389 MET A CE  1 
ATOM   2973 N N   . GLY A 1 390 ? 2.498   9.719   47.849  1.00 23.98  ? 390 GLY A N   1 
ATOM   2974 C CA  . GLY A 1 390 ? 2.775   9.697   46.428  1.00 23.15  ? 390 GLY A CA  1 
ATOM   2975 C C   . GLY A 1 390 ? 1.847   10.557  45.574  1.00 26.74  ? 390 GLY A C   1 
ATOM   2976 O O   . GLY A 1 390 ? 2.318   11.384  44.787  1.00 24.52  ? 390 GLY A O   1 
ATOM   2977 N N   . ALA A 1 391 ? 0.533   10.360  45.703  1.00 27.55  ? 391 ALA A N   1 
ATOM   2978 C CA  . ALA A 1 391 ? -0.442  11.145  44.929  1.00 25.00  ? 391 ALA A CA  1 
ATOM   2979 C C   . ALA A 1 391 ? -0.340  12.637  45.192  1.00 26.79  ? 391 ALA A C   1 
ATOM   2980 O O   . ALA A 1 391 ? -0.790  13.429  44.374  1.00 29.58  ? 391 ALA A O   1 
ATOM   2981 C CB  . ALA A 1 391 ? -1.860  10.681  45.206  1.00 23.25  ? 391 ALA A CB  1 
ATOM   2982 N N   . CYS A 1 392 ? 0.217   13.030  46.338  1.00 28.25  ? 392 CYS A N   1 
ATOM   2983 C CA  . CYS A 1 392 ? 0.368   14.458  46.622  1.00 27.39  ? 392 CYS A CA  1 
ATOM   2984 C C   . CYS A 1 392 ? 1.770   14.953  46.257  1.00 32.03  ? 392 CYS A C   1 
ATOM   2985 O O   . CYS A 1 392 ? 1.912   15.935  45.512  1.00 35.70  ? 392 CYS A O   1 
ATOM   2986 C CB  . CYS A 1 392 ? 0.074   14.781  48.088  1.00 27.78  ? 392 CYS A CB  1 
ATOM   2987 S SG  . CYS A 1 392 ? -1.570  14.328  48.741  1.00 27.47  ? 392 CYS A SG  1 
ATOM   2988 N N   . PHE A 1 393 ? 2.802   14.265  46.747  1.00 30.13  ? 393 PHE A N   1 
ATOM   2989 C CA  . PHE A 1 393 ? 4.175   14.762  46.615  1.00 26.29  ? 393 PHE A CA  1 
ATOM   2990 C C   . PHE A 1 393 ? 4.981   14.179  45.453  1.00 23.75  ? 393 PHE A C   1 
ATOM   2991 O O   . PHE A 1 393 ? 6.021   14.705  45.089  1.00 31.93  ? 393 PHE A O   1 
ATOM   2992 C CB  . PHE A 1 393 ? 4.937   14.507  47.917  1.00 26.44  ? 393 PHE A CB  1 
ATOM   2993 C CG  . PHE A 1 393 ? 4.355   15.216  49.122  1.00 29.42  ? 393 PHE A CG  1 
ATOM   2994 C CD1 . PHE A 1 393 ? 3.672   16.412  48.983  1.00 23.86  ? 393 PHE A CD1 1 
ATOM   2995 C CD2 . PHE A 1 393 ? 4.511   14.688  50.392  1.00 27.14  ? 393 PHE A CD2 1 
ATOM   2996 C CE1 . PHE A 1 393 ? 3.165   17.063  50.075  1.00 21.49  ? 393 PHE A CE1 1 
ATOM   2997 C CE2 . PHE A 1 393 ? 3.997   15.351  51.499  1.00 29.43  ? 393 PHE A CE2 1 
ATOM   2998 C CZ  . PHE A 1 393 ? 3.327   16.532  51.337  1.00 25.53  ? 393 PHE A CZ  1 
ATOM   2999 N N   . GLY A 1 394 ? 4.530   13.082  44.882  1.00 26.84  ? 394 GLY A N   1 
ATOM   3000 C CA  . GLY A 1 394 ? 5.365   12.342  43.953  1.00 23.34  ? 394 GLY A CA  1 
ATOM   3001 C C   . GLY A 1 394 ? 4.865   12.325  42.534  1.00 23.50  ? 394 GLY A C   1 
ATOM   3002 O O   . GLY A 1 394 ? 5.075   11.357  41.810  1.00 24.25  ? 394 GLY A O   1 
ATOM   3003 N N   . VAL A 1 395 ? 4.207   13.404  42.131  1.00 24.90  ? 395 VAL A N   1 
ATOM   3004 C CA  . VAL A 1 395 ? 3.678   13.521  40.784  1.00 26.36  ? 395 VAL A CA  1 
ATOM   3005 C C   . VAL A 1 395 ? 4.538   14.487  39.986  1.00 24.19  ? 395 VAL A C   1 
ATOM   3006 O O   . VAL A 1 395 ? 4.980   14.171  38.896  1.00 23.26  ? 395 VAL A O   1 
ATOM   3007 C CB  . VAL A 1 395 ? 2.195   13.999  40.814  1.00 32.51  ? 395 VAL A CB  1 
ATOM   3008 C CG1 . VAL A 1 395 ? 1.765   14.567  39.451  1.00 28.22  ? 395 VAL A CG1 1 
ATOM   3009 C CG2 . VAL A 1 395 ? 1.296   12.868  41.243  1.00 25.42  ? 395 VAL A CG2 1 
ATOM   3010 N N   . VAL A 1 396 ? 4.760   15.662  40.564  1.00 23.96  ? 396 VAL A N   1 
ATOM   3011 C CA  . VAL A 1 396 ? 5.665   16.672  40.043  1.00 26.73  ? 396 VAL A CA  1 
ATOM   3012 C C   . VAL A 1 396 ? 6.911   16.605  40.904  1.00 24.71  ? 396 VAL A C   1 
ATOM   3013 O O   . VAL A 1 396 ? 6.851   16.919  42.082  1.00 25.49  ? 396 VAL A O   1 
ATOM   3014 C CB  . VAL A 1 396 ? 5.020   18.099  40.099  1.00 27.47  ? 396 VAL A CB  1 
ATOM   3015 C CG1 . VAL A 1 396 ? 5.961   19.208  39.534  1.00 25.09  ? 396 VAL A CG1 1 
ATOM   3016 C CG2 . VAL A 1 396 ? 3.692   18.098  39.370  1.00 26.89  ? 396 VAL A CG2 1 
ATOM   3017 N N   . PRO A 1 397 ? 8.047   16.154  40.352  1.00 29.01  ? 397 PRO A N   1 
ATOM   3018 C CA  . PRO A 1 397 ? 9.167   16.130  41.299  1.00 26.10  ? 397 PRO A CA  1 
ATOM   3019 C C   . PRO A 1 397 ? 9.781   17.529  41.395  1.00 30.74  ? 397 PRO A C   1 
ATOM   3020 O O   . PRO A 1 397 ? 10.375  18.014  40.437  1.00 32.61  ? 397 PRO A O   1 
ATOM   3021 C CB  . PRO A 1 397 ? 10.111  15.099  40.696  1.00 21.20  ? 397 PRO A CB  1 
ATOM   3022 C CG  . PRO A 1 397 ? 9.806   15.088  39.280  1.00 21.60  ? 397 PRO A CG  1 
ATOM   3023 C CD  . PRO A 1 397 ? 8.416   15.593  39.047  1.00 23.93  ? 397 PRO A CD  1 
ATOM   3024 N N   . VAL A 1 398 ? 9.596   18.187  42.532  1.00 29.66  ? 398 VAL A N   1 
ATOM   3025 C CA  . VAL A 1 398 ? 9.909   19.610  42.643  1.00 32.07  ? 398 VAL A CA  1 
ATOM   3026 C C   . VAL A 1 398 ? 11.351  20.002  42.289  1.00 31.89  ? 398 VAL A C   1 
ATOM   3027 O O   . VAL A 1 398 ? 11.588  21.134  41.878  1.00 34.18  ? 398 VAL A O   1 
ATOM   3028 C CB  . VAL A 1 398 ? 9.594   20.137  44.053  1.00 30.09  ? 398 VAL A CB  1 
ATOM   3029 C CG1 . VAL A 1 398 ? 8.129   19.906  44.358  1.00 31.77  ? 398 VAL A CG1 1 
ATOM   3030 C CG2 . VAL A 1 398 ? 10.486  19.496  45.102  1.00 26.79  ? 398 VAL A CG2 1 
ATOM   3031 N N   . SER A 1 399 ? 12.304  19.083  42.412  1.00 33.54  ? 399 SER A N   1 
ATOM   3032 C CA  . SER A 1 399 ? 13.661  19.368  41.935  1.00 37.47  ? 399 SER A CA  1 
ATOM   3033 C C   . SER A 1 399 ? 13.746  19.540  40.409  1.00 36.71  ? 399 SER A C   1 
ATOM   3034 O O   . SER A 1 399 ? 14.573  20.303  39.920  1.00 38.50  ? 399 SER A O   1 
ATOM   3035 C CB  . SER A 1 399 ? 14.624  18.283  42.383  1.00 38.08  ? 399 SER A CB  1 
ATOM   3036 O OG  . SER A 1 399 ? 14.880  18.405  43.771  1.00 48.04  ? 399 SER A OG  1 
ATOM   3037 N N   . ASN A 1 400 ? 12.911  18.828  39.655  1.00 36.04  ? 400 ASN A N   1 
ATOM   3038 C CA  . ASN A 1 400 ? 12.858  19.012  38.202  1.00 33.40  ? 400 ASN A CA  1 
ATOM   3039 C C   . ASN A 1 400 ? 11.456  18.832  37.669  1.00 35.44  ? 400 ASN A C   1 
ATOM   3040 O O   . ASN A 1 400 ? 11.175  17.840  37.000  1.00 32.45  ? 400 ASN A O   1 
ATOM   3041 C CB  . ASN A 1 400 ? 13.794  18.038  37.479  1.00 36.27  ? 400 ASN A CB  1 
ATOM   3042 C CG  . ASN A 1 400 ? 14.951  17.601  38.343  1.00 52.01  ? 400 ASN A CG  1 
ATOM   3043 O OD1 . ASN A 1 400 ? 16.024  18.231  38.335  1.00 51.35  ? 400 ASN A OD1 1 
ATOM   3044 N ND2 . ASN A 1 400 ? 14.730  16.533  39.137  1.00 46.05  ? 400 ASN A ND2 1 
ATOM   3045 N N   . PRO A 1 401 ? 10.571  19.805  37.956  1.00 40.00  ? 401 PRO A N   1 
ATOM   3046 C CA  . PRO A 1 401 ? 9.142   19.779  37.613  1.00 32.74  ? 401 PRO A CA  1 
ATOM   3047 C C   . PRO A 1 401 ? 8.836   19.157  36.257  1.00 35.93  ? 401 PRO A C   1 
ATOM   3048 O O   . PRO A 1 401 ? 7.842   18.440  36.076  1.00 37.92  ? 401 PRO A O   1 
ATOM   3049 C CB  . PRO A 1 401 ? 8.772   21.258  37.625  1.00 34.96  ? 401 PRO A CB  1 
ATOM   3050 C CG  . PRO A 1 401 ? 9.647   21.821  38.709  1.00 33.25  ? 401 PRO A CG  1 
ATOM   3051 C CD  . PRO A 1 401 ? 10.948  21.076  38.615  1.00 33.40  ? 401 PRO A CD  1 
ATOM   3052 N N   . GLU A 1 402 ? 9.719   19.393  35.307  1.00 34.76  ? 402 GLU A N   1 
ATOM   3053 C CA  . GLU A 1 402 ? 9.381   19.094  33.934  1.00 38.96  ? 402 GLU A CA  1 
ATOM   3054 C C   . GLU A 1 402 ? 9.582   17.618  33.641  1.00 32.70  ? 402 GLU A C   1 
ATOM   3055 O O   . GLU A 1 402 ? 9.229   17.144  32.566  1.00 33.67  ? 402 GLU A O   1 
ATOM   3056 C CB  . GLU A 1 402 ? 10.201  20.001  33.009  1.00 46.32  ? 402 GLU A CB  1 
ATOM   3057 C CG  . GLU A 1 402 ? 10.334  21.415  33.613  1.00 53.32  ? 402 GLU A CG  1 
ATOM   3058 C CD  . GLU A 1 402 ? 10.456  22.526  32.585  1.00 61.05  ? 402 GLU A CD  1 
ATOM   3059 O OE1 . GLU A 1 402 ? 11.233  22.358  31.612  1.00 59.80  ? 402 GLU A OE1 1 
ATOM   3060 O OE2 . GLU A 1 402 ? 9.777   23.568  32.770  1.00 59.92  ? 402 GLU A OE2 1 
ATOM   3061 N N   . ASP A 1 403 ? 10.120  16.888  34.616  1.00 36.75  ? 403 ASP A N   1 
ATOM   3062 C CA  . ASP A 1 403 ? 10.203  15.429  34.526  1.00 31.73  ? 403 ASP A CA  1 
ATOM   3063 C C   . ASP A 1 403 ? 8.845   14.775  34.773  1.00 34.75  ? 403 ASP A C   1 
ATOM   3064 O O   . ASP A 1 403 ? 8.688   13.585  34.509  1.00 37.70  ? 403 ASP A O   1 
ATOM   3065 C CB  . ASP A 1 403 ? 11.220  14.854  35.517  1.00 32.16  ? 403 ASP A CB  1 
ATOM   3066 C CG  . ASP A 1 403 ? 12.666  15.149  35.128  1.00 37.65  ? 403 ASP A CG  1 
ATOM   3067 O OD1 . ASP A 1 403 ? 12.919  15.464  33.958  1.00 45.04  ? 403 ASP A OD1 1 
ATOM   3068 O OD2 . ASP A 1 403 ? 13.560  15.060  35.992  1.00 43.30  ? 403 ASP A OD2 1 
ATOM   3069 N N   . ALA A 1 404 ? 7.866   15.536  35.271  1.00 33.70  ? 404 ALA A N   1 
ATOM   3070 C CA  . ALA A 1 404 ? 6.534   14.985  35.511  1.00 26.25  ? 404 ALA A CA  1 
ATOM   3071 C C   . ALA A 1 404 ? 5.961   14.318  34.273  1.00 30.61  ? 404 ALA A C   1 
ATOM   3072 O O   . ALA A 1 404 ? 5.192   13.367  34.392  1.00 30.85  ? 404 ALA A O   1 
ATOM   3073 C CB  . ALA A 1 404 ? 5.600   16.040  36.008  1.00 27.24  ? 404 ALA A CB  1 
ATOM   3074 N N   . VAL A 1 405 ? 6.359   14.781  33.088  1.00 31.81  ? 405 VAL A N   1 
ATOM   3075 C CA  . VAL A 1 405 ? 5.821   14.256  31.826  1.00 31.25  ? 405 VAL A CA  1 
ATOM   3076 C C   . VAL A 1 405 ? 6.127   12.778  31.651  1.00 30.17  ? 405 VAL A C   1 
ATOM   3077 O O   . VAL A 1 405 ? 5.558   12.113  30.802  1.00 38.48  ? 405 VAL A O   1 
ATOM   3078 C CB  . VAL A 1 405 ? 6.389   15.009  30.608  1.00 39.21  ? 405 VAL A CB  1 
ATOM   3079 C CG1 . VAL A 1 405 ? 5.585   14.677  29.366  1.00 45.14  ? 405 VAL A CG1 1 
ATOM   3080 C CG2 . VAL A 1 405 ? 6.380   16.521  30.850  1.00 38.08  ? 405 VAL A CG2 1 
ATOM   3081 N N   . LEU A 1 406 ? 7.052   12.269  32.450  1.00 32.57  ? 406 LEU A N   1 
ATOM   3082 C CA  . LEU A 1 406 ? 7.430   10.860  32.393  1.00 37.15  ? 406 LEU A CA  1 
ATOM   3083 C C   . LEU A 1 406 ? 6.316   10.011  32.983  1.00 35.06  ? 406 LEU A C   1 
ATOM   3084 O O   . LEU A 1 406 ? 6.066   8.898   32.533  1.00 36.54  ? 406 LEU A O   1 
ATOM   3085 C CB  . LEU A 1 406 ? 8.750   10.618  33.148  1.00 40.51  ? 406 LEU A CB  1 
ATOM   3086 C CG  . LEU A 1 406 ? 10.098  10.747  32.398  1.00 47.82  ? 406 LEU A CG  1 
ATOM   3087 C CD1 . LEU A 1 406 ? 10.141  11.968  31.485  1.00 32.26  ? 406 LEU A CD1 1 
ATOM   3088 C CD2 . LEU A 1 406 ? 11.294  10.751  33.363  1.00 35.62  ? 406 LEU A CD2 1 
ATOM   3089 N N   . GLY A 1 407 ? 5.644   10.571  33.986  1.00 32.25  ? 407 GLY A N   1 
ATOM   3090 C CA  . GLY A 1 407 ? 4.571   9.894   34.683  1.00 31.18  ? 407 GLY A CA  1 
ATOM   3091 C C   . GLY A 1 407 ? 4.991   9.329   36.023  1.00 26.28  ? 407 GLY A C   1 
ATOM   3092 O O   . GLY A 1 407 ? 6.168   9.082   36.261  1.00 26.42  ? 407 GLY A O   1 
ATOM   3093 N N   . SER A 1 408 ? 4.011   9.130   36.892  1.00 27.98  ? 408 SER A N   1 
ATOM   3094 C CA  . SER A 1 408 ? 4.200   8.453   38.176  1.00 29.27  ? 408 SER A CA  1 
ATOM   3095 C C   . SER A 1 408 ? 2.825   8.011   38.678  1.00 28.30  ? 408 SER A C   1 
ATOM   3096 O O   . SER A 1 408 ? 1.918   8.830   38.780  1.00 31.06  ? 408 SER A O   1 
ATOM   3097 C CB  . SER A 1 408 ? 4.887   9.369   39.189  1.00 26.19  ? 408 SER A CB  1 
ATOM   3098 O OG  . SER A 1 408 ? 5.444   8.614   40.239  1.00 29.81  ? 408 SER A OG  1 
ATOM   3099 N N   . GLY A 1 409 ? 2.656   6.721   38.953  1.00 28.95  ? 409 GLY A N   1 
ATOM   3100 C CA  . GLY A 1 409 ? 1.335   6.172   39.224  1.00 28.20  ? 409 GLY A CA  1 
ATOM   3101 C C   . GLY A 1 409 ? 0.948   6.038   40.689  1.00 25.19  ? 409 GLY A C   1 
ATOM   3102 O O   . GLY A 1 409 ? 1.496   5.236   41.415  1.00 26.46  ? 409 GLY A O   1 
ATOM   3103 N N   . HIS A 1 410 ? -0.002  6.843   41.129  1.00 29.36  ? 410 HIS A N   1 
ATOM   3104 C CA  . HIS A 1 410 ? -0.537  6.705   42.477  1.00 28.11  ? 410 HIS A CA  1 
ATOM   3105 C C   . HIS A 1 410 ? -2.046  6.557   42.367  1.00 31.52  ? 410 HIS A C   1 
ATOM   3106 O O   . HIS A 1 410 ? -2.670  7.209   41.524  1.00 30.52  ? 410 HIS A O   1 
ATOM   3107 C CB  . HIS A 1 410 ? -0.106  7.894   43.331  1.00 28.34  ? 410 HIS A CB  1 
ATOM   3108 C CG  . HIS A 1 410 ? 1.349   8.194   43.182  1.00 31.19  ? 410 HIS A CG  1 
ATOM   3109 N ND1 . HIS A 1 410 ? 2.326   7.452   43.816  1.00 28.22  ? 410 HIS A ND1 1 
ATOM   3110 C CD2 . HIS A 1 410 ? 1.998   9.097   42.408  1.00 22.67  ? 410 HIS A CD2 1 
ATOM   3111 C CE1 . HIS A 1 410 ? 3.512   7.908   43.463  1.00 24.80  ? 410 HIS A CE1 1 
ATOM   3112 N NE2 . HIS A 1 410 ? 3.342   8.902   42.610  1.00 26.61  ? 410 HIS A NE2 1 
ATOM   3113 N N   . SER A 1 411 ? -2.628  5.686   43.192  1.00 30.35  ? 411 SER A N   1 
ATOM   3114 C CA  . SER A 1 411 ? -3.993  5.226   42.935  1.00 31.88  ? 411 SER A CA  1 
ATOM   3115 C C   . SER A 1 411 ? -5.049  6.321   43.046  1.00 24.45  ? 411 SER A C   1 
ATOM   3116 O O   . SER A 1 411 ? -5.968  6.360   42.239  1.00 30.72  ? 411 SER A O   1 
ATOM   3117 C CB  . SER A 1 411 ? -4.351  4.067   43.865  1.00 31.60  ? 411 SER A CB  1 
ATOM   3118 O OG  . SER A 1 411 ? -4.054  4.392   45.204  1.00 29.72  ? 411 SER A OG  1 
ATOM   3119 N N   . LYS A 1 412 ? -4.916  7.226   44.001  1.00 25.10  ? 412 LYS A N   1 
ATOM   3120 C CA  . LYS A 1 412 ? -5.935  8.266   44.170  1.00 28.01  ? 412 LYS A CA  1 
ATOM   3121 C C   . LYS A 1 412 ? -5.908  9.244   43.014  1.00 28.86  ? 412 LYS A C   1 
ATOM   3122 O O   . LYS A 1 412 ? -6.780  10.092  42.915  1.00 33.19  ? 412 LYS A O   1 
ATOM   3123 C CB  . LYS A 1 412 ? -5.765  9.026   45.491  1.00 27.41  ? 412 LYS A CB  1 
ATOM   3124 C CG  . LYS A 1 412 ? -6.271  8.274   46.680  1.00 29.86  ? 412 LYS A CG  1 
ATOM   3125 C CD  . LYS A 1 412 ? -7.352  9.059   47.401  1.00 34.24  ? 412 LYS A CD  1 
ATOM   3126 C CE  . LYS A 1 412 ? -8.012  8.207   48.459  1.00 33.54  ? 412 LYS A CE  1 
ATOM   3127 N NZ  . LYS A 1 412 ? -7.050  7.704   49.494  1.00 39.77  ? 412 LYS A NZ  1 
ATOM   3128 N N   . SER A 1 413 ? -4.918  9.130   42.136  1.00 28.66  ? 413 SER A N   1 
ATOM   3129 C CA  . SER A 1 413 ? -4.897  9.957   40.938  1.00 26.60  ? 413 SER A CA  1 
ATOM   3130 C C   . SER A 1 413 ? -6.082  9.621   40.056  1.00 29.19  ? 413 SER A C   1 
ATOM   3131 O O   . SER A 1 413 ? -6.579  10.456  39.308  1.00 32.93  ? 413 SER A O   1 
ATOM   3132 C CB  . SER A 1 413 ? -3.590  9.772   40.160  1.00 30.75  ? 413 SER A CB  1 
ATOM   3133 O OG  . SER A 1 413 ? -2.497  10.481  40.749  1.00 34.83  ? 413 SER A OG  1 
ATOM   3134 N N   . LEU A 1 414 ? -6.534  8.386   40.133  1.00 24.88  ? 414 LEU A N   1 
ATOM   3135 C CA  . LEU A 1 414 ? -7.662  7.956   39.325  1.00 30.16  ? 414 LEU A CA  1 
ATOM   3136 C C   . LEU A 1 414 ? -8.960  8.819   39.497  1.00 32.52  ? 414 LEU A C   1 
ATOM   3137 O O   . LEU A 1 414 ? -9.754  8.927   38.571  1.00 35.05  ? 414 LEU A O   1 
ATOM   3138 C CB  . LEU A 1 414 ? -7.914  6.482   39.639  1.00 30.47  ? 414 LEU A CB  1 
ATOM   3139 C CG  . LEU A 1 414 ? -8.982  5.709   38.898  1.00 32.75  ? 414 LEU A CG  1 
ATOM   3140 C CD1 . LEU A 1 414 ? -8.455  4.343   38.569  1.00 30.39  ? 414 LEU A CD1 1 
ATOM   3141 C CD2 . LEU A 1 414 ? -10.182 5.626   39.834  1.00 34.03  ? 414 LEU A CD2 1 
ATOM   3142 N N   . LEU A 1 415 ? -9.150  9.463   40.650  1.00 28.17  ? 415 LEU A N   1 
ATOM   3143 C CA  . LEU A 1 415 ? -10.331 10.310  40.868  1.00 34.68  ? 415 LEU A CA  1 
ATOM   3144 C C   . LEU A 1 415 ? -10.345 11.523  39.922  1.00 43.54  ? 415 LEU A C   1 
ATOM   3145 O O   . LEU A 1 415 ? -11.399 12.156  39.710  1.00 46.64  ? 415 LEU A O   1 
ATOM   3146 C CB  . LEU A 1 415 ? -10.422 10.797  42.325  1.00 27.45  ? 415 LEU A CB  1 
ATOM   3147 C CG  . LEU A 1 415 ? -10.373 9.747   43.448  1.00 30.87  ? 415 LEU A CG  1 
ATOM   3148 C CD1 . LEU A 1 415 ? -10.269 10.392  44.846  1.00 24.65  ? 415 LEU A CD1 1 
ATOM   3149 C CD2 . LEU A 1 415 ? -11.565 8.830   43.376  1.00 28.99  ? 415 LEU A CD2 1 
ATOM   3150 N N   . ASN A 1 416 ? -9.183  11.835  39.350  1.00 38.29  ? 416 ASN A N   1 
ATOM   3151 C CA  . ASN A 1 416 ? -9.050  12.952  38.427  1.00 35.37  ? 416 ASN A CA  1 
ATOM   3152 C C   . ASN A 1 416 ? -9.591  12.612  37.044  1.00 35.84  ? 416 ASN A C   1 
ATOM   3153 O O   . ASN A 1 416 ? -9.835  13.510  36.251  1.00 38.35  ? 416 ASN A O   1 
ATOM   3154 C CB  . ASN A 1 416 ? -7.589  13.391  38.316  1.00 35.63  ? 416 ASN A CB  1 
ATOM   3155 C CG  . ASN A 1 416 ? -7.433  14.725  37.591  1.00 38.73  ? 416 ASN A CG  1 
ATOM   3156 O OD1 . ASN A 1 416 ? -8.235  15.645  37.765  1.00 30.25  ? 416 ASN A OD1 1 
ATOM   3157 N ND2 . ASN A 1 416 ? -6.402  14.823  36.758  1.00 37.89  ? 416 ASN A ND2 1 
ATOM   3158 N N   . TYR A 1 417 ? -9.766  11.326  36.750  1.00 29.00  ? 417 TYR A N   1 
ATOM   3159 C CA  . TYR A 1 417 ? -10.527 10.930  35.564  1.00 38.01  ? 417 TYR A CA  1 
ATOM   3160 C C   . TYR A 1 417 ? -11.939 11.526  35.566  1.00 40.13  ? 417 TYR A C   1 
ATOM   3161 O O   . TYR A 1 417 ? -12.648 11.510  36.579  1.00 47.05  ? 417 TYR A O   1 
ATOM   3162 C CB  . TYR A 1 417 ? -10.642 9.413   35.463  1.00 40.04  ? 417 TYR A CB  1 
ATOM   3163 C CG  . TYR A 1 417 ? -9.441  8.736   34.884  1.00 41.50  ? 417 TYR A CG  1 
ATOM   3164 C CD1 . TYR A 1 417 ? -8.807  9.252   33.771  1.00 38.77  ? 417 TYR A CD1 1 
ATOM   3165 C CD2 . TYR A 1 417 ? -8.931  7.562   35.455  1.00 45.94  ? 417 TYR A CD2 1 
ATOM   3166 C CE1 . TYR A 1 417 ? -7.689  8.622   33.235  1.00 41.57  ? 417 TYR A CE1 1 
ATOM   3167 C CE2 . TYR A 1 417 ? -7.808  6.922   34.920  1.00 37.40  ? 417 TYR A CE2 1 
ATOM   3168 C CZ  . TYR A 1 417 ? -7.198  7.464   33.819  1.00 35.92  ? 417 TYR A CZ  1 
ATOM   3169 O OH  . TYR A 1 417 ? -6.104  6.854   33.283  1.00 37.71  ? 417 TYR A OH  1 
ATOM   3170 N N   . LYS A 1 418 ? -12.348 12.030  34.413  1.00 45.91  ? 418 LYS A N   1 
ATOM   3171 C CA  . LYS A 1 418 ? -13.697 12.549  34.214  1.00 42.46  ? 418 LYS A CA  1 
ATOM   3172 C C   . LYS A 1 418 ? -14.821 11.537  34.496  1.00 46.35  ? 418 LYS A C   1 
ATOM   3173 O O   . LYS A 1 418 ? -14.761 10.374  34.083  1.00 43.37  ? 418 LYS A O   1 
ATOM   3174 C CB  . LYS A 1 418 ? -13.831 13.065  32.783  1.00 42.43  ? 418 LYS A CB  1 
ATOM   3175 C CG  . LYS A 1 418 ? -13.464 14.526  32.612  1.00 37.45  ? 418 LYS A CG  1 
ATOM   3176 C CD  . LYS A 1 418 ? -13.357 14.908  31.143  1.00 38.75  ? 418 LYS A CD  1 
ATOM   3177 C CE  . LYS A 1 418 ? -13.097 16.401  31.034  1.00 48.47  ? 418 LYS A CE  1 
ATOM   3178 N NZ  . LYS A 1 418 ? -12.568 16.812  29.699  1.00 49.32  ? 418 LYS A NZ  1 
ATOM   3179 N N   . ILE A 1 419 ? -15.844 12.004  35.205  1.00 43.24  ? 419 ILE A N   1 
ATOM   3180 C CA  . ILE A 1 419 ? -17.086 11.260  35.349  1.00 45.48  ? 419 ILE A CA  1 
ATOM   3181 C C   . ILE A 1 419 ? -17.957 11.403  34.086  1.00 52.14  ? 419 ILE A C   1 
ATOM   3182 O O   . ILE A 1 419 ? -18.597 10.431  33.674  1.00 52.76  ? 419 ILE A O   1 
ATOM   3183 C CB  . ILE A 1 419 ? -17.873 11.723  36.593  1.00 42.36  ? 419 ILE A CB  1 
ATOM   3184 C CG1 . ILE A 1 419 ? -17.226 11.166  37.845  1.00 48.57  ? 419 ILE A CG1 1 
ATOM   3185 C CG2 . ILE A 1 419 ? -19.247 11.154  36.598  1.00 54.19  ? 419 ILE A CG2 1 
ATOM   3186 C CD1 . ILE A 1 419 ? -17.017 9.681   37.767  1.00 47.01  ? 419 ILE A CD1 1 
ATOM   3187 N N   . ASP A 1 420 ? -17.941 12.604  33.485  1.00 49.57  ? 420 ASP A N   1 
ATOM   3188 C CA  . ASP A 1 420 ? -18.725 12.990  32.296  1.00 58.51  ? 420 ASP A CA  1 
ATOM   3189 C C   . ASP A 1 420 ? -19.113 11.838  31.383  1.00 62.18  ? 420 ASP A C   1 
ATOM   3190 O O   . ASP A 1 420 ? -18.243 11.123  30.870  1.00 55.58  ? 420 ASP A O   1 
ATOM   3191 C CB  . ASP A 1 420 ? -17.958 14.006  31.426  1.00 61.80  ? 420 ASP A CB  1 
ATOM   3192 C CG  . ASP A 1 420 ? -17.342 15.146  32.226  1.00 64.70  ? 420 ASP A CG  1 
ATOM   3193 O OD1 . ASP A 1 420 ? -16.921 14.921  33.380  1.00 56.43  ? 420 ASP A OD1 1 
ATOM   3194 O OD2 . ASP A 1 420 ? -17.256 16.270  31.677  1.00 71.71  ? 420 ASP A OD2 1 
ATOM   3195 N N   . THR A 1 421 ? -20.418 11.682  31.167  1.00 65.30  ? 421 THR A N   1 
ATOM   3196 C CA  . THR A 1 421 ? -20.935 10.694  30.229  1.00 64.33  ? 421 THR A CA  1 
ATOM   3197 C C   . THR A 1 421 ? -20.441 11.073  28.824  1.00 67.72  ? 421 THR A C   1 
ATOM   3198 O O   . THR A 1 421 ? -20.314 10.220  27.942  1.00 68.46  ? 421 THR A O   1 
ATOM   3199 C CB  . THR A 1 421 ? -22.482 10.613  30.301  1.00 70.71  ? 421 THR A CB  1 
ATOM   3200 O OG1 . THR A 1 421 ? -23.070 11.262  29.170  1.00 72.33  ? 421 THR A OG1 1 
ATOM   3201 C CG2 . THR A 1 421 ? -22.991 11.286  31.575  1.00 65.84  ? 421 THR A CG2 1 
ATOM   3202 N N   . ASN A 1 422 ? -20.161 12.368  28.655  1.00 68.22  ? 422 ASN A N   1 
ATOM   3203 C CA  . ASN A 1 422 ? -19.393 12.939  27.538  1.00 68.09  ? 422 ASN A CA  1 
ATOM   3204 C C   . ASN A 1 422 ? -18.146 12.123  27.142  1.00 70.28  ? 422 ASN A C   1 
ATOM   3205 O O   . ASN A 1 422 ? -18.056 11.601  26.022  1.00 72.17  ? 422 ASN A O   1 
ATOM   3206 C CB  . ASN A 1 422 ? -18.973 14.366  27.915  1.00 70.27  ? 422 ASN A CB  1 
ATOM   3207 C CG  . ASN A 1 422 ? -18.346 15.131  26.768  1.00 76.19  ? 422 ASN A CG  1 
ATOM   3208 O OD1 . ASN A 1 422 ? -18.096 14.583  25.693  1.00 83.08  ? 422 ASN A OD1 1 
ATOM   3209 N ND2 . ASN A 1 422 ? -18.078 16.415  26.998  1.00 72.57  ? 422 ASN A ND2 1 
ATOM   3210 N N   . ALA A 1 423 ? -17.182 12.034  28.060  1.00 62.69  ? 423 ALA A N   1 
ATOM   3211 C CA  . ALA A 1 423 ? -15.958 11.272  27.832  1.00 55.79  ? 423 ALA A CA  1 
ATOM   3212 C C   . ALA A 1 423 ? -16.219 9.771   27.928  1.00 61.47  ? 423 ALA A C   1 
ATOM   3213 O O   . ALA A 1 423 ? -15.332 8.956   27.648  1.00 60.80  ? 423 ALA A O   1 
ATOM   3214 C CB  . ALA A 1 423 ? -14.896 11.683  28.814  1.00 50.96  ? 423 ALA A CB  1 
ATOM   3215 N N   . GLY A 1 424 ? -17.441 9.416   28.323  1.00 62.03  ? 424 GLY A N   1 
ATOM   3216 C CA  . GLY A 1 424 ? -17.832 8.030   28.485  1.00 58.79  ? 424 GLY A CA  1 
ATOM   3217 C C   . GLY A 1 424 ? -17.398 7.459   29.814  1.00 55.54  ? 424 GLY A C   1 
ATOM   3218 O O   . GLY A 1 424 ? -16.917 6.326   29.862  1.00 51.67  ? 424 GLY A O   1 
ATOM   3219 N N   . ASN A 1 425 ? -17.595 8.245   30.878  1.00 56.65  ? 425 ASN A N   1 
ATOM   3220 C CA  . ASN A 1 425 ? -17.085 7.975   32.244  1.00 51.92  ? 425 ASN A CA  1 
ATOM   3221 C C   . ASN A 1 425 ? -15.852 7.077   32.342  1.00 47.98  ? 425 ASN A C   1 
ATOM   3222 O O   . ASN A 1 425 ? -15.939 5.946   32.807  1.00 49.24  ? 425 ASN A O   1 
ATOM   3223 C CB  . ASN A 1 425 ? -18.206 7.391   33.122  1.00 52.75  ? 425 ASN A CB  1 
ATOM   3224 C CG  . ASN A 1 425 ? -17.931 7.546   34.617  1.00 49.87  ? 425 ASN A CG  1 
ATOM   3225 O OD1 . ASN A 1 425 ? -16.957 8.170   35.020  1.00 47.23  ? 425 ASN A OD1 1 
ATOM   3226 N ND2 . ASN A 1 425 ? -18.805 6.977   35.445  1.00 53.03  ? 425 ASN A ND2 1 
ATOM   3227 N N   . PRO A 1 426 ? -14.692 7.599   31.904  1.00 44.25  ? 426 PRO A N   1 
ATOM   3228 C CA  . PRO A 1 426 ? -13.414 6.888   32.000  1.00 43.16  ? 426 PRO A CA  1 
ATOM   3229 C C   . PRO A 1 426 ? -13.051 6.494   33.434  1.00 44.00  ? 426 PRO A C   1 
ATOM   3230 O O   . PRO A 1 426 ? -12.493 5.419   33.641  1.00 41.21  ? 426 PRO A O   1 
ATOM   3231 C CB  . PRO A 1 426 ? -12.403 7.908   31.443  1.00 41.16  ? 426 PRO A CB  1 
ATOM   3232 C CG  . PRO A 1 426 ? -13.065 9.215   31.652  1.00 46.65  ? 426 PRO A CG  1 
ATOM   3233 C CD  . PRO A 1 426 ? -14.503 8.956   31.370  1.00 47.37  ? 426 PRO A CD  1 
ATOM   3234 N N   . CYS A 1 427 ? -13.372 7.344   34.404  1.00 40.95  ? 427 CYS A N   1 
ATOM   3235 C CA  . CYS A 1 427 ? -13.139 6.994   35.794  1.00 42.56  ? 427 CYS A CA  1 
ATOM   3236 C C   . CYS A 1 427 ? -13.748 5.635   36.149  1.00 43.64  ? 427 CYS A C   1 
ATOM   3237 O O   . CYS A 1 427 ? -13.090 4.790   36.769  1.00 42.92  ? 427 CYS A O   1 
ATOM   3238 C CB  . CYS A 1 427 ? -13.691 8.070   36.727  1.00 47.03  ? 427 CYS A CB  1 
ATOM   3239 S SG  . CYS A 1 427 ? -13.267 7.782   38.469  1.00 43.24  ? 427 CYS A SG  1 
ATOM   3240 N N   . ALA A 1 428 ? -14.985 5.408   35.722  1.00 45.83  ? 428 ALA A N   1 
ATOM   3241 C CA  . ALA A 1 428 ? -15.672 4.169   36.066  1.00 43.47  ? 428 ALA A CA  1 
ATOM   3242 C C   . ALA A 1 428 ? -15.173 3.010   35.229  1.00 41.88  ? 428 ALA A C   1 
ATOM   3243 O O   . ALA A 1 428 ? -15.143 1.877   35.697  1.00 45.07  ? 428 ALA A O   1 
ATOM   3244 C CB  . ALA A 1 428 ? -17.154 4.327   35.900  1.00 52.07  ? 428 ALA A CB  1 
ATOM   3245 N N   . LYS A 1 429 ? -14.781 3.295   33.991  1.00 44.21  ? 429 LYS A N   1 
ATOM   3246 C CA  . LYS A 1 429 ? -14.152 2.283   33.154  1.00 42.86  ? 429 LYS A CA  1 
ATOM   3247 C C   . LYS A 1 429 ? -12.900 1.734   33.831  1.00 42.74  ? 429 LYS A C   1 
ATOM   3248 O O   . LYS A 1 429 ? -12.737 0.511   33.944  1.00 42.09  ? 429 LYS A O   1 
ATOM   3249 C CB  . LYS A 1 429 ? -13.798 2.850   31.776  1.00 52.03  ? 429 LYS A CB  1 
ATOM   3250 C CG  . LYS A 1 429 ? -14.990 3.347   30.949  1.00 54.22  ? 429 LYS A CG  1 
ATOM   3251 C CD  . LYS A 1 429 ? -14.553 3.862   29.568  1.00 48.67  ? 429 LYS A CD  1 
ATOM   3252 C CE  . LYS A 1 429 ? -15.705 3.850   28.564  1.00 51.82  ? 429 LYS A CE  1 
ATOM   3253 N NZ  . LYS A 1 429 ? -15.303 4.326   27.204  1.00 52.96  ? 429 LYS A NZ  1 
ATOM   3254 N N   . GLU A 1 430 ? -12.023 2.633   34.287  1.00 40.09  ? 430 GLU A N   1 
ATOM   3255 C CA  . GLU A 1 430 ? -10.758 2.215   34.890  1.00 39.11  ? 430 GLU A CA  1 
ATOM   3256 C C   . GLU A 1 430 ? -11.005 1.458   36.171  1.00 37.48  ? 430 GLU A C   1 
ATOM   3257 O O   . GLU A 1 430 ? -10.342 0.463   36.433  1.00 39.28  ? 430 GLU A O   1 
ATOM   3258 C CB  . GLU A 1 430 ? -9.834  3.404   35.169  1.00 40.72  ? 430 GLU A CB  1 
ATOM   3259 C CG  . GLU A 1 430 ? -9.160  3.986   33.932  1.00 39.92  ? 430 GLU A CG  1 
ATOM   3260 C CD  . GLU A 1 430 ? -8.343  2.959   33.157  1.00 41.72  ? 430 GLU A CD  1 
ATOM   3261 O OE1 . GLU A 1 430 ? -7.528  2.234   33.775  1.00 43.72  ? 430 GLU A OE1 1 
ATOM   3262 O OE2 . GLU A 1 430 ? -8.510  2.884   31.928  1.00 33.84  ? 430 GLU A OE2 1 
ATOM   3263 N N   . ILE A 1 431 ? -11.950 1.929   36.977  1.00 38.21  ? 431 ILE A N   1 
ATOM   3264 C CA  . ILE A 1 431 ? -12.272 1.220   38.214  1.00 38.04  ? 431 ILE A CA  1 
ATOM   3265 C C   . ILE A 1 431 ? -12.707 -0.223  37.915  1.00 35.89  ? 431 ILE A C   1 
ATOM   3266 O O   . ILE A 1 431 ? -12.246 -1.151  38.544  1.00 32.56  ? 431 ILE A O   1 
ATOM   3267 C CB  . ILE A 1 431 ? -13.362 1.955   39.015  1.00 38.95  ? 431 ILE A CB  1 
ATOM   3268 C CG1 . ILE A 1 431 ? -12.841 3.308   39.479  1.00 32.19  ? 431 ILE A CG1 1 
ATOM   3269 C CG2 . ILE A 1 431 ? -13.772 1.152   40.235  1.00 35.49  ? 431 ILE A CG2 1 
ATOM   3270 C CD1 . ILE A 1 431 ? -13.910 4.303   39.797  1.00 31.41  ? 431 ILE A CD1 1 
ATOM   3271 N N   . VAL A 1 432 ? -13.564 -0.413  36.918  1.00 41.89  ? 432 VAL A N   1 
ATOM   3272 C CA  . VAL A 1 432 ? -14.017 -1.757  36.569  1.00 38.46  ? 432 VAL A CA  1 
ATOM   3273 C C   . VAL A 1 432 ? -12.862 -2.631  36.111  1.00 42.31  ? 432 VAL A C   1 
ATOM   3274 O O   . VAL A 1 432 ? -12.711 -3.767  36.581  1.00 39.00  ? 432 VAL A O   1 
ATOM   3275 C CB  . VAL A 1 432 ? -15.110 -1.718  35.469  1.00 48.01  ? 432 VAL A CB  1 
ATOM   3276 C CG1 . VAL A 1 432 ? -15.173 -3.046  34.714  1.00 43.53  ? 432 VAL A CG1 1 
ATOM   3277 C CG2 . VAL A 1 432 ? -16.486 -1.346  36.081  1.00 44.58  ? 432 VAL A CG2 1 
ATOM   3278 N N   . GLN A 1 433 ? -12.041 -2.094  35.207  1.00 40.02  ? 433 GLN A N   1 
ATOM   3279 C CA  . GLN A 1 433 ? -10.885 -2.820  34.705  1.00 35.78  ? 433 GLN A CA  1 
ATOM   3280 C C   . GLN A 1 433 ? -10.005 -3.308  35.846  1.00 35.52  ? 433 GLN A C   1 
ATOM   3281 O O   . GLN A 1 433 ? -9.621  -4.477  35.897  1.00 40.99  ? 433 GLN A O   1 
ATOM   3282 C CB  . GLN A 1 433 ? -10.089 -1.949  33.740  1.00 40.62  ? 433 GLN A CB  1 
ATOM   3283 C CG  . GLN A 1 433 ? -10.829 -1.688  32.432  1.00 46.98  ? 433 GLN A CG  1 
ATOM   3284 C CD  . GLN A 1 433 ? -9.958  -1.040  31.378  1.00 44.27  ? 433 GLN A CD  1 
ATOM   3285 O OE1 . GLN A 1 433 ? -8.905  -1.557  31.026  1.00 45.96  ? 433 GLN A OE1 1 
ATOM   3286 N NE2 . GLN A 1 433 ? -10.396 0.099   30.868  1.00 46.53  ? 433 GLN A NE2 1 
ATOM   3287 N N   . LEU A 1 434 ? -9.716  -2.413  36.779  1.00 37.69  ? 434 LEU A N   1 
ATOM   3288 C CA  . LEU A 1 434 ? -8.944  -2.765  37.959  1.00 33.97  ? 434 LEU A CA  1 
ATOM   3289 C C   . LEU A 1 434 ? -9.670  -3.824  38.770  1.00 37.28  ? 434 LEU A C   1 
ATOM   3290 O O   . LEU A 1 434 ? -9.062  -4.786  39.237  1.00 33.69  ? 434 LEU A O   1 
ATOM   3291 C CB  . LEU A 1 434 ? -8.693  -1.538  38.807  1.00 34.18  ? 434 LEU A CB  1 
ATOM   3292 C CG  . LEU A 1 434 ? -7.655  -0.539  38.319  1.00 31.71  ? 434 LEU A CG  1 
ATOM   3293 C CD1 . LEU A 1 434 ? -7.864  0.748   39.086  1.00 31.41  ? 434 LEU A CD1 1 
ATOM   3294 C CD2 . LEU A 1 434 ? -6.252  -1.094  38.559  1.00 33.05  ? 434 LEU A CD2 1 
ATOM   3295 N N   . PHE A 1 435 ? -10.985 -3.646  38.920  1.00 45.88  ? 435 PHE A N   1 
ATOM   3296 C CA  . PHE A 1 435 ? -11.837 -4.625  39.601  1.00 42.46  ? 435 PHE A CA  1 
ATOM   3297 C C   . PHE A 1 435 ? -11.704 -6.027  38.983  1.00 41.61  ? 435 PHE A C   1 
ATOM   3298 O O   . PHE A 1 435 ? -11.385 -6.988  39.692  1.00 39.75  ? 435 PHE A O   1 
ATOM   3299 C CB  . PHE A 1 435 ? -13.295 -4.177  39.577  1.00 39.43  ? 435 PHE A CB  1 
ATOM   3300 C CG  . PHE A 1 435 ? -14.202 -5.065  40.360  1.00 41.56  ? 435 PHE A CG  1 
ATOM   3301 C CD1 . PHE A 1 435 ? -14.266 -4.965  41.736  1.00 41.33  ? 435 PHE A CD1 1 
ATOM   3302 C CD2 . PHE A 1 435 ? -14.976 -6.025  39.725  1.00 43.23  ? 435 PHE A CD2 1 
ATOM   3303 C CE1 . PHE A 1 435 ? -15.099 -5.793  42.463  1.00 42.62  ? 435 PHE A CE1 1 
ATOM   3304 C CE2 . PHE A 1 435 ? -15.815 -6.854  40.455  1.00 39.01  ? 435 PHE A CE2 1 
ATOM   3305 C CZ  . PHE A 1 435 ? -15.872 -6.738  41.820  1.00 36.88  ? 435 PHE A CZ  1 
ATOM   3306 N N   . ARG A 1 436 ? -11.924 -6.128  37.668  1.00 44.27  ? 436 ARG A N   1 
ATOM   3307 C CA  . ARG A 1 436 ? -11.689 -7.380  36.928  1.00 41.85  ? 436 ARG A CA  1 
ATOM   3308 C C   . ARG A 1 436 ? -10.342 -8.009  37.263  1.00 39.41  ? 436 ARG A C   1 
ATOM   3309 O O   . ARG A 1 436 ? -10.280 -9.185  37.586  1.00 47.61  ? 436 ARG A O   1 
ATOM   3310 C CB  . ARG A 1 436 ? -11.750 -7.156  35.416  1.00 47.35  ? 436 ARG A CB  1 
ATOM   3311 C CG  . ARG A 1 436 ? -13.102 -6.797  34.832  1.00 45.16  ? 436 ARG A CG  1 
ATOM   3312 C CD  . ARG A 1 436 ? -12.922 -6.427  33.366  1.00 48.05  ? 436 ARG A CD  1 
ATOM   3313 N NE  . ARG A 1 436 ? -14.090 -5.774  32.778  1.00 55.61  ? 436 ARG A NE  1 
ATOM   3314 C CZ  . ARG A 1 436 ? -14.053 -5.062  31.652  1.00 62.98  ? 436 ARG A CZ  1 
ATOM   3315 N NH1 . ARG A 1 436 ? -12.902 -4.904  31.000  1.00 61.93  ? 436 ARG A NH1 1 
ATOM   3316 N NH2 . ARG A 1 436 ? -15.162 -4.502  31.173  1.00 58.46  ? 436 ARG A NH2 1 
ATOM   3317 N N   . ILE A 1 437 ? -9.266  -7.226  37.189  1.00 40.89  ? 437 ILE A N   1 
ATOM   3318 C CA  . ILE A 1 437 ? -7.918  -7.737  37.476  1.00 39.60  ? 437 ILE A CA  1 
ATOM   3319 C C   . ILE A 1 437 ? -7.791  -8.268  38.904  1.00 32.43  ? 437 ILE A C   1 
ATOM   3320 O O   . ILE A 1 437 ? -7.066  -9.212  39.146  1.00 36.16  ? 437 ILE A O   1 
ATOM   3321 C CB  . ILE A 1 437 ? -6.831  -6.640  37.225  1.00 32.69  ? 437 ILE A CB  1 
ATOM   3322 C CG1 . ILE A 1 437 ? -6.844  -6.201  35.764  1.00 35.88  ? 437 ILE A CG1 1 
ATOM   3323 C CG2 . ILE A 1 437 ? -5.453  -7.128  37.593  1.00 30.21  ? 437 ILE A CG2 1 
ATOM   3324 C CD1 . ILE A 1 437 ? -6.023  -4.960  35.500  1.00 38.19  ? 437 ILE A CD1 1 
ATOM   3325 N N   . GLN A 1 438 ? -8.502  -7.655  39.846  1.00 39.40  ? 438 GLN A N   1 
ATOM   3326 C CA  . GLN A 1 438 ? -8.469  -8.076  41.253  1.00 39.91  ? 438 GLN A CA  1 
ATOM   3327 C C   . GLN A 1 438 ? -9.237  -9.390  41.459  1.00 45.78  ? 438 GLN A C   1 
ATOM   3328 O O   . GLN A 1 438 ? -8.787  -10.278 42.197  1.00 47.23  ? 438 GLN A O   1 
ATOM   3329 C CB  . GLN A 1 438 ? -9.047  -6.979  42.159  1.00 44.43  ? 438 GLN A CB  1 
ATOM   3330 C CG  . GLN A 1 438 ? -8.018  -6.170  42.976  1.00 43.31  ? 438 GLN A CG  1 
ATOM   3331 C CD  . GLN A 1 438 ? -8.672  -5.064  43.793  1.00 42.32  ? 438 GLN A CD  1 
ATOM   3332 O OE1 . GLN A 1 438 ? -9.616  -4.418  43.343  1.00 40.09  ? 438 GLN A OE1 1 
ATOM   3333 N NE2 . GLN A 1 438 ? -8.179  -4.851  44.999  1.00 47.71  ? 438 GLN A NE2 1 
ATOM   3334 N N   . LYS A 1 439 ? -10.394 -9.500  40.808  1.00 41.74  ? 439 LYS A N   1 
ATOM   3335 C CA  . LYS A 1 439 ? -11.160 -10.742 40.762  1.00 43.02  ? 439 LYS A CA  1 
ATOM   3336 C C   . LYS A 1 439 ? -10.323 -11.929 40.289  1.00 48.70  ? 439 LYS A C   1 
ATOM   3337 O O   . LYS A 1 439 ? -10.285 -12.977 40.956  1.00 45.55  ? 439 LYS A O   1 
ATOM   3338 C CB  . LYS A 1 439 ? -12.372 -10.581 39.844  1.00 39.83  ? 439 LYS A CB  1 
ATOM   3339 C CG  . LYS A 1 439 ? -13.665 -10.477 40.590  1.00 44.93  ? 439 LYS A CG  1 
ATOM   3340 C CD  . LYS A 1 439 ? -14.849 -10.754 39.701  1.00 43.30  ? 439 LYS A CD  1 
ATOM   3341 C CE  . LYS A 1 439 ? -15.111 -9.597  38.766  1.00 40.38  ? 439 LYS A CE  1 
ATOM   3342 N NZ  . LYS A 1 439 ? -16.365 -9.823  37.983  1.00 45.68  ? 439 LYS A NZ  1 
ATOM   3343 N N   . ALA A 1 440 ? -9.650  -11.746 39.147  1.00 42.40  ? 440 ALA A N   1 
ATOM   3344 C CA  . ALA A 1 440 ? -8.868  -12.803 38.493  1.00 42.17  ? 440 ALA A CA  1 
ATOM   3345 C C   . ALA A 1 440 ? -7.794  -13.419 39.379  1.00 44.42  ? 440 ALA A C   1 
ATOM   3346 O O   . ALA A 1 440 ? -7.511  -14.609 39.281  1.00 56.50  ? 440 ALA A O   1 
ATOM   3347 C CB  . ALA A 1 440 ? -8.226  -12.270 37.213  1.00 41.09  ? 440 ALA A CB  1 
ATOM   3348 N N   . GLY A 1 441 ? -7.186  -12.622 40.241  1.00 41.88  ? 441 GLY A N   1 
ATOM   3349 C CA  . GLY A 1 441 ? -6.095  -13.128 41.038  1.00 45.58  ? 441 GLY A CA  1 
ATOM   3350 C C   . GLY A 1 441 ? -6.474  -13.520 42.445  1.00 57.10  ? 441 GLY A C   1 
ATOM   3351 O O   . GLY A 1 441 ? -5.742  -14.287 43.090  1.00 56.80  ? 441 GLY A O   1 
ATOM   3352 N N   . PHE A 1 442 ? -7.601  -12.994 42.932  1.00 54.01  ? 442 PHE A N   1 
ATOM   3353 C CA  . PHE A 1 442 ? -7.961  -13.184 44.343  1.00 58.32  ? 442 PHE A CA  1 
ATOM   3354 C C   . PHE A 1 442 ? -9.414  -13.603 44.626  1.00 59.78  ? 442 PHE A C   1 
ATOM   3355 O O   . PHE A 1 442 ? -10.334 -13.381 43.822  1.00 49.57  ? 442 PHE A O   1 
ATOM   3356 C CB  . PHE A 1 442 ? -7.684  -11.905 45.139  1.00 53.96  ? 442 PHE A CB  1 
ATOM   3357 C CG  . PHE A 1 442 ? -6.305  -11.353 44.957  1.00 51.44  ? 442 PHE A CG  1 
ATOM   3358 C CD1 . PHE A 1 442 ? -5.251  -11.797 45.751  1.00 54.64  ? 442 PHE A CD1 1 
ATOM   3359 C CD2 . PHE A 1 442 ? -6.061  -10.368 44.011  1.00 47.46  ? 442 PHE A CD2 1 
ATOM   3360 C CE1 . PHE A 1 442 ? -3.965  -11.280 45.597  1.00 47.73  ? 442 PHE A CE1 1 
ATOM   3361 C CE2 . PHE A 1 442 ? -4.782  -9.851  43.845  1.00 51.29  ? 442 PHE A CE2 1 
ATOM   3362 C CZ  . PHE A 1 442 ? -3.730  -10.307 44.642  1.00 49.42  ? 442 PHE A CZ  1 
ATOM   3363 N N   . ASP A 1 443 ? -9.576  -14.251 45.780  1.00 69.12  ? 443 ASP A N   1 
ATOM   3364 C CA  . ASP A 1 443 ? -10.859 -14.362 46.457  1.00 66.35  ? 443 ASP A CA  1 
ATOM   3365 C C   . ASP A 1 443 ? -10.957 -13.130 47.342  1.00 66.93  ? 443 ASP A C   1 
ATOM   3366 O O   . ASP A 1 443 ? -10.172 -12.957 48.291  1.00 59.75  ? 443 ASP A O   1 
ATOM   3367 C CB  . ASP A 1 443 ? -10.962 -15.656 47.270  1.00 75.74  ? 443 ASP A CB  1 
ATOM   3368 C CG  . ASP A 1 443 ? -12.020 -15.583 48.375  1.00 77.75  ? 443 ASP A CG  1 
ATOM   3369 O OD1 . ASP A 1 443 ? -13.228 -15.691 48.051  1.00 79.56  ? 443 ASP A OD1 1 
ATOM   3370 O OD2 . ASP A 1 443 ? -11.635 -15.431 49.565  1.00 69.06  ? 443 ASP A OD2 1 
ATOM   3371 N N   . LEU A 1 444 ? -11.905 -12.263 46.998  1.00 63.10  ? 444 LEU A N   1 
ATOM   3372 C CA  . LEU A 1 444 ? -11.970 -10.926 47.568  1.00 59.14  ? 444 LEU A CA  1 
ATOM   3373 C C   . LEU A 1 444 ? -12.617 -10.928 48.963  1.00 60.81  ? 444 LEU A C   1 
ATOM   3374 O O   . LEU A 1 444 ? -12.342 -10.056 49.798  1.00 51.61  ? 444 LEU A O   1 
ATOM   3375 C CB  . LEU A 1 444 ? -12.722 -10.004 46.605  1.00 53.12  ? 444 LEU A CB  1 
ATOM   3376 C CG  . LEU A 1 444 ? -12.039 -9.816  45.240  1.00 53.34  ? 444 LEU A CG  1 
ATOM   3377 C CD1 . LEU A 1 444 ? -12.775 -8.820  44.357  1.00 49.81  ? 444 LEU A CD1 1 
ATOM   3378 C CD2 . LEU A 1 444 ? -10.594 -9.395  45.412  1.00 54.62  ? 444 LEU A CD2 1 
ATOM   3379 N N   . ASP A 1 445 ? -13.453 -11.935 49.207  1.00 61.42  ? 445 ASP A N   1 
ATOM   3380 C CA  . ASP A 1 445 ? -14.124 -12.100 50.483  1.00 54.90  ? 445 ASP A CA  1 
ATOM   3381 C C   . ASP A 1 445 ? -13.135 -12.181 51.621  1.00 56.65  ? 445 ASP A C   1 
ATOM   3382 O O   . ASP A 1 445 ? -13.491 -11.905 52.763  1.00 66.44  ? 445 ASP A O   1 
ATOM   3383 C CB  . ASP A 1 445 ? -15.001 -13.352 50.472  1.00 54.96  ? 445 ASP A CB  1 
ATOM   3384 C CG  . ASP A 1 445 ? -16.088 -13.284 49.428  1.00 59.49  ? 445 ASP A CG  1 
ATOM   3385 O OD1 . ASP A 1 445 ? -16.272 -12.195 48.834  1.00 53.25  ? 445 ASP A OD1 1 
ATOM   3386 O OD2 . ASP A 1 445 ? -16.755 -14.316 49.203  1.00 63.57  ? 445 ASP A OD2 1 
ATOM   3387 N N   . SER A 1 446 ? -11.895 -12.551 51.313  1.00 54.62  ? 446 SER A N   1 
ATOM   3388 C CA  . SER A 1 446 ? -10.865 -12.711 52.337  1.00 55.68  ? 446 SER A CA  1 
ATOM   3389 C C   . SER A 1 446 ? -10.178 -11.395 52.731  1.00 58.69  ? 446 SER A C   1 
ATOM   3390 O O   . SER A 1 446 ? -9.490  -11.317 53.756  1.00 60.44  ? 446 SER A O   1 
ATOM   3391 C CB  . SER A 1 446 ? -9.813  -13.698 51.858  1.00 60.52  ? 446 SER A CB  1 
ATOM   3392 O OG  . SER A 1 446 ? -8.972  -13.084 50.902  1.00 66.24  ? 446 SER A OG  1 
ATOM   3393 N N   . MET A 1 447 ? -10.366 -10.360 51.923  1.00 56.17  ? 447 MET A N   1 
ATOM   3394 C CA  . MET A 1 447 ? -9.700  -9.090  52.171  1.00 56.91  ? 447 MET A CA  1 
ATOM   3395 C C   . MET A 1 447 ? -10.638 -8.104  52.828  1.00 51.42  ? 447 MET A C   1 
ATOM   3396 O O   . MET A 1 447 ? -11.784 -7.967  52.403  1.00 54.26  ? 447 MET A O   1 
ATOM   3397 C CB  . MET A 1 447 ? -9.163  -8.487  50.867  1.00 58.20  ? 447 MET A CB  1 
ATOM   3398 C CG  . MET A 1 447 ? -8.337  -9.432  50.008  1.00 55.23  ? 447 MET A CG  1 
ATOM   3399 S SD  . MET A 1 447 ? -8.042  -8.717  48.377  1.00 77.11  ? 447 MET A SD  1 
ATOM   3400 C CE  . MET A 1 447 ? -9.479  -7.665  48.219  1.00 55.84  ? 447 MET A CE  1 
ATOM   3401 N N   . ASP A 1 448 ? -10.140 -7.407  53.848  1.00 55.75  ? 448 ASP A N   1 
ATOM   3402 C CA  . ASP A 1 448 ? -10.909 -6.365  54.539  1.00 60.11  ? 448 ASP A CA  1 
ATOM   3403 C C   . ASP A 1 448 ? -11.132 -5.146  53.649  1.00 60.04  ? 448 ASP A C   1 
ATOM   3404 O O   . ASP A 1 448 ? -12.010 -4.324  53.914  1.00 65.94  ? 448 ASP A O   1 
ATOM   3405 C CB  . ASP A 1 448 ? -10.206 -5.927  55.832  1.00 55.36  ? 448 ASP A CB  1 
ATOM   3406 C CG  . ASP A 1 448 ? -10.312 -6.953  56.927  1.00 49.14  ? 448 ASP A CG  1 
ATOM   3407 O OD1 . ASP A 1 448 ? -11.432 -7.419  57.210  1.00 54.33  ? 448 ASP A OD1 1 
ATOM   3408 O OD2 . ASP A 1 448 ? -9.268  -7.300  57.499  1.00 51.80  ? 448 ASP A OD2 1 
ATOM   3409 N N   . ILE A 1 449 ? -10.305 -5.016  52.617  1.00 57.15  ? 449 ILE A N   1 
ATOM   3410 C CA  . ILE A 1 449 ? -10.391 -3.891  51.706  1.00 53.65  ? 449 ILE A CA  1 
ATOM   3411 C C   . ILE A 1 449 ? -10.204 -4.369  50.265  1.00 52.57  ? 449 ILE A C   1 
ATOM   3412 O O   . ILE A 1 449 ? -9.249  -5.068  49.957  1.00 52.23  ? 449 ILE A O   1 
ATOM   3413 C CB  . ILE A 1 449 ? -9.334  -2.803  52.038  1.00 58.16  ? 449 ILE A CB  1 
ATOM   3414 C CG1 . ILE A 1 449 ? -9.324  -2.476  53.540  1.00 56.94  ? 449 ILE A CG1 1 
ATOM   3415 C CG2 . ILE A 1 449 ? -9.593  -1.537  51.219  1.00 57.60  ? 449 ILE A CG2 1 
ATOM   3416 C CD1 . ILE A 1 449 ? -8.355  -1.377  53.930  1.00 57.20  ? 449 ILE A CD1 1 
ATOM   3417 N N   . VAL A 1 450 ? -11.148 -4.017  49.400  1.00 45.44  ? 450 VAL A N   1 
ATOM   3418 C CA  . VAL A 1 450 ? -10.960 -4.129  47.964  1.00 44.67  ? 450 VAL A CA  1 
ATOM   3419 C C   . VAL A 1 450 ? -10.691 -2.723  47.408  1.00 42.13  ? 450 VAL A C   1 
ATOM   3420 O O   . VAL A 1 450 ? -11.557 -1.851  47.464  1.00 44.30  ? 450 VAL A O   1 
ATOM   3421 C CB  . VAL A 1 450 ? -12.186 -4.741  47.270  1.00 43.63  ? 450 VAL A CB  1 
ATOM   3422 C CG1 . VAL A 1 450 ? -11.800 -5.288  45.922  1.00 42.32  ? 450 VAL A CG1 1 
ATOM   3423 C CG2 . VAL A 1 450 ? -12.781 -5.832  48.131  1.00 44.03  ? 450 VAL A CG2 1 
ATOM   3424 N N   . ALA A 1 451 ? -9.491  -2.516  46.877  1.00 39.81  ? 451 ALA A N   1 
ATOM   3425 C CA  . ALA A 1 451 ? -9.042  -1.206  46.433  1.00 34.55  ? 451 ALA A CA  1 
ATOM   3426 C C   . ALA A 1 451 ? -9.984  -0.544  45.436  1.00 36.96  ? 451 ALA A C   1 
ATOM   3427 O O   . ALA A 1 451 ? -10.291 0.641   45.564  1.00 34.90  ? 451 ALA A O   1 
ATOM   3428 C CB  . ALA A 1 451 ? -7.666  -1.319  45.837  1.00 37.35  ? 451 ALA A CB  1 
ATOM   3429 N N   . SER A 1 452 ? -10.449 -1.309  44.451  1.00 38.95  ? 452 SER A N   1 
ATOM   3430 C CA  . SER A 1 452 ? -11.337 -0.763  43.426  1.00 37.56  ? 452 SER A CA  1 
ATOM   3431 C C   . SER A 1 452 ? -12.692 -0.378  43.984  1.00 33.34  ? 452 SER A C   1 
ATOM   3432 O O   . SER A 1 452 ? -13.349 0.515   43.458  1.00 32.29  ? 452 SER A O   1 
ATOM   3433 C CB  . SER A 1 452 ? -11.525 -1.759  42.279  1.00 38.51  ? 452 SER A CB  1 
ATOM   3434 O OG  . SER A 1 452 ? -11.902 -3.026  42.761  1.00 44.62  ? 452 SER A OG  1 
ATOM   3435 N N   . GLU A 1 453 ? -13.109 -1.053  45.048  1.00 34.27  ? 453 GLU A N   1 
ATOM   3436 C CA  . GLU A 1 453 ? -14.393 -0.758  45.662  1.00 34.64  ? 453 GLU A CA  1 
ATOM   3437 C C   . GLU A 1 453 ? -14.289 0.552   46.440  1.00 38.16  ? 453 GLU A C   1 
ATOM   3438 O O   . GLU A 1 453 ? -15.180 1.406   46.352  1.00 32.96  ? 453 GLU A O   1 
ATOM   3439 C CB  . GLU A 1 453 ? -14.844 -1.923  46.541  1.00 32.25  ? 453 GLU A CB  1 
ATOM   3440 C CG  . GLU A 1 453 ? -15.500 -3.034  45.721  1.00 38.99  ? 453 GLU A CG  1 
ATOM   3441 C CD  . GLU A 1 453 ? -15.914 -4.254  46.554  1.00 44.24  ? 453 GLU A CD  1 
ATOM   3442 O OE1 . GLU A 1 453 ? -15.508 -4.347  47.725  1.00 40.35  ? 453 GLU A OE1 1 
ATOM   3443 O OE2 . GLU A 1 453 ? -16.661 -5.119  46.030  1.00 46.75  ? 453 GLU A OE2 1 
ATOM   3444 N N   . HIS A 1 454 ? -13.170 0.726   47.147  1.00 34.02  ? 454 HIS A N   1 
ATOM   3445 C CA  . HIS A 1 454 ? -12.893 1.976   47.838  1.00 33.33  ? 454 HIS A CA  1 
ATOM   3446 C C   . HIS A 1 454 ? -12.774 3.168   46.903  1.00 33.70  ? 454 HIS A C   1 
ATOM   3447 O O   . HIS A 1 454 ? -13.137 4.275   47.267  1.00 36.38  ? 454 HIS A O   1 
ATOM   3448 C CB  . HIS A 1 454 ? -11.617 1.864   48.673  1.00 39.26  ? 454 HIS A CB  1 
ATOM   3449 C CG  . HIS A 1 454 ? -11.410 3.029   49.592  1.00 40.97  ? 454 HIS A CG  1 
ATOM   3450 N ND1 . HIS A 1 454 ? -10.460 4.005   49.365  1.00 49.65  ? 454 HIS A ND1 1 
ATOM   3451 C CD2 . HIS A 1 454 ? -12.059 3.392   50.724  1.00 37.91  ? 454 HIS A CD2 1 
ATOM   3452 C CE1 . HIS A 1 454 ? -10.522 4.911   50.325  1.00 41.05  ? 454 HIS A CE1 1 
ATOM   3453 N NE2 . HIS A 1 454 ? -11.487 4.567   51.156  1.00 42.48  ? 454 HIS A NE2 1 
ATOM   3454 N N   . LEU A 1 455 ? -12.270 2.948   45.697  1.00 34.23  ? 455 LEU A N   1 
ATOM   3455 C CA  . LEU A 1 455 ? -12.121 4.043   44.746  1.00 34.02  ? 455 LEU A CA  1 
ATOM   3456 C C   . LEU A 1 455 ? -13.473 4.474   44.212  1.00 34.05  ? 455 LEU A C   1 
ATOM   3457 O O   . LEU A 1 455 ? -13.792 5.662   44.183  1.00 36.35  ? 455 LEU A O   1 
ATOM   3458 C CB  . LEU A 1 455 ? -11.212 3.639   43.590  1.00 33.54  ? 455 LEU A CB  1 
ATOM   3459 C CG  . LEU A 1 455 ? -9.740  3.788   43.908  1.00 30.02  ? 455 LEU A CG  1 
ATOM   3460 C CD1 . LEU A 1 455 ? -8.896  2.996   42.929  1.00 28.01  ? 455 LEU A CD1 1 
ATOM   3461 C CD2 . LEU A 1 455 ? -9.367  5.267   43.906  1.00 25.29  ? 455 LEU A CD2 1 
ATOM   3462 N N   . LEU A 1 456 ? -14.255 3.485   43.789  1.00 33.33  ? 456 LEU A N   1 
ATOM   3463 C CA  . LEU A 1 456 ? -15.622 3.685   43.311  1.00 35.94  ? 456 LEU A CA  1 
ATOM   3464 C C   . LEU A 1 456 ? -16.507 4.348   44.354  1.00 35.52  ? 456 LEU A C   1 
ATOM   3465 O O   . LEU A 1 456 ? -17.303 5.227   44.045  1.00 35.61  ? 456 LEU A O   1 
ATOM   3466 C CB  . LEU A 1 456 ? -16.233 2.360   42.920  1.00 34.82  ? 456 LEU A CB  1 
ATOM   3467 C CG  . LEU A 1 456 ? -17.682 2.444   42.532  1.00 32.61  ? 456 LEU A CG  1 
ATOM   3468 C CD1 . LEU A 1 456 ? -17.757 3.288   41.288  1.00 38.50  ? 456 LEU A CD1 1 
ATOM   3469 C CD2 . LEU A 1 456 ? -18.161 1.028   42.281  1.00 38.43  ? 456 LEU A CD2 1 
ATOM   3470 N N   . HIS A 1 457 ? -16.356 3.924   45.595  1.00 32.80  ? 457 HIS A N   1 
ATOM   3471 C CA  . HIS A 1 457 ? -17.047 4.581   46.676  1.00 35.91  ? 457 HIS A CA  1 
ATOM   3472 C C   . HIS A 1 457 ? -16.718 6.077   46.694  1.00 39.37  ? 457 HIS A C   1 
ATOM   3473 O O   . HIS A 1 457 ? -17.599 6.906   46.908  1.00 40.66  ? 457 HIS A O   1 
ATOM   3474 C CB  . HIS A 1 457 ? -16.694 3.926   48.008  1.00 30.80  ? 457 HIS A CB  1 
ATOM   3475 C CG  . HIS A 1 457 ? -17.376 4.553   49.182  1.00 46.87  ? 457 HIS A CG  1 
ATOM   3476 N ND1 . HIS A 1 457 ? -16.964 5.754   49.735  1.00 51.27  ? 457 HIS A ND1 1 
ATOM   3477 C CD2 . HIS A 1 457 ? -18.445 4.158   49.912  1.00 40.63  ? 457 HIS A CD2 1 
ATOM   3478 C CE1 . HIS A 1 457 ? -17.739 6.057   50.753  1.00 45.68  ? 457 HIS A CE1 1 
ATOM   3479 N NE2 . HIS A 1 457 ? -18.652 5.104   50.884  1.00 43.63  ? 457 HIS A NE2 1 
ATOM   3480 N N   . GLN A 1 458 ? -15.460 6.435   46.449  1.00 41.47  ? 458 GLN A N   1 
ATOM   3481 C CA  . GLN A 1 458 ? -15.095 7.849   46.506  1.00 39.12  ? 458 GLN A CA  1 
ATOM   3482 C C   . GLN A 1 458 ? -15.633 8.606   45.306  1.00 36.74  ? 458 GLN A C   1 
ATOM   3483 O O   . GLN A 1 458 ? -15.989 9.776   45.403  1.00 36.69  ? 458 GLN A O   1 
ATOM   3484 C CB  . GLN A 1 458 ? -13.598 8.014   46.605  1.00 31.60  ? 458 GLN A CB  1 
ATOM   3485 C CG  . GLN A 1 458 ? -13.055 7.536   47.919  1.00 39.34  ? 458 GLN A CG  1 
ATOM   3486 C CD  . GLN A 1 458 ? -11.577 7.783   48.018  1.00 36.36  ? 458 GLN A CD  1 
ATOM   3487 O OE1 . GLN A 1 458 ? -11.151 8.828   48.501  1.00 42.90  ? 458 GLN A OE1 1 
ATOM   3488 N NE2 . GLN A 1 458 ? -10.781 6.841   47.525  1.00 36.82  ? 458 GLN A NE2 1 
ATOM   3489 N N   . SER A 1 459 ? -15.704 7.936   44.170  1.00 34.74  ? 459 SER A N   1 
ATOM   3490 C CA  . SER A 1 459 ? -16.353 8.543   43.025  1.00 39.64  ? 459 SER A CA  1 
ATOM   3491 C C   . SER A 1 459 ? -17.842 8.813   43.343  1.00 40.94  ? 459 SER A C   1 
ATOM   3492 O O   . SER A 1 459 ? -18.325 9.914   43.114  1.00 36.26  ? 459 SER A O   1 
ATOM   3493 C CB  . SER A 1 459 ? -16.195 7.652   41.799  1.00 39.40  ? 459 SER A CB  1 
ATOM   3494 O OG  . SER A 1 459 ? -16.560 8.344   40.629  1.00 41.69  ? 459 SER A OG  1 
ATOM   3495 N N   . LEU A 1 460 ? -18.538 7.815   43.902  1.00 41.76  ? 460 LEU A N   1 
ATOM   3496 C CA  . LEU A 1 460 ? -19.940 7.938   44.336  1.00 41.81  ? 460 LEU A CA  1 
ATOM   3497 C C   . LEU A 1 460 ? -20.207 9.132   45.247  1.00 41.12  ? 460 LEU A C   1 
ATOM   3498 O O   . LEU A 1 460 ? -21.176 9.870   45.061  1.00 42.70  ? 460 LEU A O   1 
ATOM   3499 C CB  . LEU A 1 460 ? -20.391 6.659   45.058  1.00 36.53  ? 460 LEU A CB  1 
ATOM   3500 C CG  . LEU A 1 460 ? -20.557 5.476   44.113  1.00 35.43  ? 460 LEU A CG  1 
ATOM   3501 C CD1 . LEU A 1 460 ? -20.936 4.217   44.813  1.00 29.87  ? 460 LEU A CD1 1 
ATOM   3502 C CD2 . LEU A 1 460 ? -21.559 5.840   43.058  1.00 43.32  ? 460 LEU A CD2 1 
ATOM   3503 N N   . VAL A 1 461 ? -19.344 9.306   46.236  1.00 38.88  ? 461 VAL A N   1 
ATOM   3504 C CA  . VAL A 1 461 ? -19.468 10.391  47.201  1.00 40.70  ? 461 VAL A CA  1 
ATOM   3505 C C   . VAL A 1 461 ? -19.223 11.768  46.535  1.00 41.35  ? 461 VAL A C   1 
ATOM   3506 O O   . VAL A 1 461 ? -19.478 12.826  47.114  1.00 45.16  ? 461 VAL A O   1 
ATOM   3507 C CB  . VAL A 1 461 ? -18.508 10.099  48.400  1.00 40.84  ? 461 VAL A CB  1 
ATOM   3508 C CG1 . VAL A 1 461 ? -17.972 11.327  49.060  1.00 36.17  ? 461 VAL A CG1 1 
ATOM   3509 C CG2 . VAL A 1 461 ? -19.218 9.226   49.420  1.00 38.84  ? 461 VAL A CG2 1 
ATOM   3510 N N   . GLY A 1 462 ? -18.767 11.757  45.290  1.00 42.54  ? 462 GLY A N   1 
ATOM   3511 C CA  . GLY A 1 462 ? -18.494 12.998  44.581  1.00 41.01  ? 462 GLY A CA  1 
ATOM   3512 C C   . GLY A 1 462 ? -17.075 13.577  44.539  1.00 38.17  ? 462 GLY A C   1 
ATOM   3513 O O   . GLY A 1 462 ? -16.930 14.732  44.158  1.00 34.44  ? 462 GLY A O   1 
ATOM   3514 N N   . LYS A 1 463 ? -16.043 12.815  44.930  1.00 38.64  ? 463 LYS A N   1 
ATOM   3515 C CA  . LYS A 1 463 ? -14.645 13.286  44.785  1.00 40.83  ? 463 LYS A CA  1 
ATOM   3516 C C   . LYS A 1 463 ? -14.219 13.208  43.331  1.00 37.15  ? 463 LYS A C   1 
ATOM   3517 O O   . LYS A 1 463 ? -14.134 12.120  42.749  1.00 37.33  ? 463 LYS A O   1 
ATOM   3518 C CB  . LYS A 1 463 ? -13.646 12.493  45.647  1.00 31.46  ? 463 LYS A CB  1 
ATOM   3519 C CG  . LYS A 1 463 ? -13.769 12.784  47.117  1.00 29.40  ? 463 LYS A CG  1 
ATOM   3520 C CD  . LYS A 1 463 ? -12.933 11.844  47.952  1.00 36.14  ? 463 LYS A CD  1 
ATOM   3521 C CE  . LYS A 1 463 ? -11.454 12.177  47.854  1.00 39.50  ? 463 LYS A CE  1 
ATOM   3522 N NZ  . LYS A 1 463 ? -10.749 11.751  49.103  1.00 43.25  ? 463 LYS A NZ  1 
ATOM   3523 N N   . ARG A 1 464 ? -13.963 14.383  42.764  1.00 36.57  ? 464 ARG A N   1 
ATOM   3524 C CA  . ARG A 1 464 ? -13.562 14.528  41.382  1.00 35.27  ? 464 ARG A CA  1 
ATOM   3525 C C   . ARG A 1 464 ? -12.057 14.794  41.346  1.00 38.72  ? 464 ARG A C   1 
ATOM   3526 O O   . ARG A 1 464 ? -11.462 14.996  40.286  1.00 32.50  ? 464 ARG A O   1 
ATOM   3527 C CB  . ARG A 1 464 ? -14.351 15.662  40.730  1.00 37.46  ? 464 ARG A CB  1 
ATOM   3528 C CG  . ARG A 1 464 ? -15.840 15.696  41.098  1.00 33.93  ? 464 ARG A CG  1 
ATOM   3529 C CD  . ARG A 1 464 ? -16.702 14.954  40.072  1.00 35.86  ? 464 ARG A CD  1 
ATOM   3530 N NE  . ARG A 1 464 ? -16.767 13.520  40.335  1.00 47.29  ? 464 ARG A NE  1 
ATOM   3531 C CZ  . ARG A 1 464 ? -17.823 12.875  40.847  1.00 49.12  ? 464 ARG A CZ  1 
ATOM   3532 N NH1 . ARG A 1 464 ? -18.955 13.515  41.138  1.00 39.58  ? 464 ARG A NH1 1 
ATOM   3533 N NH2 . ARG A 1 464 ? -17.745 11.566  41.061  1.00 42.03  ? 464 ARG A NH2 1 
ATOM   3534 N N   . CYS A 1 465 ? -11.463 14.800  42.537  1.00 38.24  ? 465 CYS A N   1 
ATOM   3535 C CA  . CYS A 1 465 ? -10.043 15.012  42.723  1.00 30.94  ? 465 CYS A CA  1 
ATOM   3536 C C   . CYS A 1 465 ? -9.680  14.732  44.175  1.00 28.44  ? 465 CYS A C   1 
ATOM   3537 O O   . CYS A 1 465 ? -10.385 15.174  45.078  1.00 29.91  ? 465 CYS A O   1 
ATOM   3538 C CB  . CYS A 1 465 ? -9.645  16.440  42.341  1.00 35.26  ? 465 CYS A CB  1 
ATOM   3539 S SG  . CYS A 1 465 ? -7.842  16.781  42.524  1.00 29.68  ? 465 CYS A SG  1 
ATOM   3540 N N   . HIS A 1 466 ? -8.569  14.030  44.394  1.00 29.30  ? 466 HIS A N   1 
ATOM   3541 C CA  . HIS A 1 466 ? -8.171  13.583  45.730  1.00 29.89  ? 466 HIS A CA  1 
ATOM   3542 C C   . HIS A 1 466 ? -7.707  14.709  46.662  1.00 27.46  ? 466 HIS A C   1 
ATOM   3543 O O   . HIS A 1 466 ? -7.481  14.474  47.843  1.00 29.06  ? 466 HIS A O   1 
ATOM   3544 C CB  . HIS A 1 466 ? -7.065  12.518  45.629  1.00 28.44  ? 466 HIS A CB  1 
ATOM   3545 C CG  . HIS A 1 466 ? -5.746  13.060  45.172  1.00 28.84  ? 466 HIS A CG  1 
ATOM   3546 N ND1 . HIS A 1 466 ? -4.690  13.292  46.035  1.00 27.69  ? 466 HIS A ND1 1 
ATOM   3547 C CD2 . HIS A 1 466 ? -5.313  13.432  43.948  1.00 28.28  ? 466 HIS A CD2 1 
ATOM   3548 C CE1 . HIS A 1 466 ? -3.675  13.787  45.363  1.00 24.87  ? 466 HIS A CE1 1 
ATOM   3549 N NE2 . HIS A 1 466 ? -4.028  13.886  44.093  1.00 30.87  ? 466 HIS A NE2 1 
ATOM   3550 N N   . PHE A 1 467 ? -7.554  15.921  46.147  1.00 27.78  ? 467 PHE A N   1 
ATOM   3551 C CA  . PHE A 1 467 ? -7.194  17.047  47.014  1.00 29.54  ? 467 PHE A CA  1 
ATOM   3552 C C   . PHE A 1 467 ? -8.436  17.678  47.651  1.00 30.46  ? 467 PHE A C   1 
ATOM   3553 O O   . PHE A 1 467 ? -8.336  18.635  48.432  1.00 28.61  ? 467 PHE A O   1 
ATOM   3554 C CB  . PHE A 1 467 ? -6.406  18.115  46.250  1.00 28.93  ? 467 PHE A CB  1 
ATOM   3555 C CG  . PHE A 1 467 ? -4.977  17.740  45.946  1.00 27.17  ? 467 PHE A CG  1 
ATOM   3556 C CD1 . PHE A 1 467 ? -4.033  17.640  46.953  1.00 22.74  ? 467 PHE A CD1 1 
ATOM   3557 C CD2 . PHE A 1 467 ? -4.566  17.543  44.632  1.00 29.95  ? 467 PHE A CD2 1 
ATOM   3558 C CE1 . PHE A 1 467 ? -2.710  17.337  46.653  1.00 24.77  ? 467 PHE A CE1 1 
ATOM   3559 C CE2 . PHE A 1 467 ? -3.241  17.236  44.325  1.00 26.38  ? 467 PHE A CE2 1 
ATOM   3560 C CZ  . PHE A 1 467 ? -2.313  17.142  45.342  1.00 25.68  ? 467 PHE A CZ  1 
ATOM   3561 N N   . GLN A 1 468 ? -9.592  17.113  47.313  1.00 30.53  ? 468 GLN A N   1 
ATOM   3562 C CA  . GLN A 1 468 ? -10.873 17.433  47.932  1.00 28.56  ? 468 GLN A CA  1 
ATOM   3563 C C   . GLN A 1 468 ? -11.057 16.694  49.247  1.00 35.11  ? 468 GLN A C   1 
ATOM   3564 O O   . GLN A 1 468 ? -10.853 15.482  49.333  1.00 36.41  ? 468 GLN A O   1 
ATOM   3565 C CB  . GLN A 1 468 ? -12.015 17.074  46.990  1.00 32.49  ? 468 GLN A CB  1 
ATOM   3566 C CG  . GLN A 1 468 ? -12.083 17.931  45.743  1.00 28.39  ? 468 GLN A CG  1 
ATOM   3567 C CD  . GLN A 1 468 ? -13.115 17.440  44.771  1.00 33.06  ? 468 GLN A CD  1 
ATOM   3568 O OE1 . GLN A 1 468 ? -13.520 16.284  44.814  1.00 34.72  ? 468 GLN A OE1 1 
ATOM   3569 N NE2 . GLN A 1 468 ? -13.556 18.319  43.884  1.00 37.18  ? 468 GLN A NE2 1 
ATOM   3570 N N   . ASN A 1 469 ? -11.419 17.440  50.283  1.00 35.60  ? 469 ASN A N   1 
ATOM   3571 C CA  . ASN A 1 469 ? -11.833 16.859  51.542  1.00 28.31  ? 469 ASN A CA  1 
ATOM   3572 C C   . ASN A 1 469 ? -13.334 16.598  51.438  1.00 34.92  ? 469 ASN A C   1 
ATOM   3573 O O   . ASN A 1 469 ? -14.114 17.529  51.216  1.00 36.06  ? 469 ASN A O   1 
ATOM   3574 C CB  . ASN A 1 469 ? -11.475 17.794  52.694  1.00 34.30  ? 469 ASN A CB  1 
ATOM   3575 C CG  . ASN A 1 469 ? -12.007 17.331  54.034  1.00 32.30  ? 469 ASN A CG  1 
ATOM   3576 O OD1 . ASN A 1 469 ? -13.168 16.944  54.171  1.00 35.82  ? 469 ASN A OD1 1 
ATOM   3577 N ND2 . ASN A 1 469 ? -11.160 17.401  55.042  1.00 31.30  ? 469 ASN A ND2 1 
ATOM   3578 N N   . ALA A 1 470 ? -13.730 15.331  51.572  1.00 36.95  ? 470 ALA A N   1 
ATOM   3579 C CA  . ALA A 1 470 ? -15.126 14.923  51.393  1.00 34.63  ? 470 ALA A CA  1 
ATOM   3580 C C   . ALA A 1 470 ? -15.799 14.445  52.688  1.00 33.67  ? 470 ALA A C   1 
ATOM   3581 O O   . ALA A 1 470 ? -16.850 13.818  52.643  1.00 33.55  ? 470 ALA A O   1 
ATOM   3582 C CB  . ALA A 1 470 ? -15.216 13.849  50.344  1.00 30.48  ? 470 ALA A CB  1 
ATOM   3583 N N   . TYR A 1 471 ? -15.219 14.771  53.840  1.00 38.37  ? 471 TYR A N   1 
ATOM   3584 C CA  . TYR A 1 471 ? -15.758 14.256  55.100  1.00 45.47  ? 471 TYR A CA  1 
ATOM   3585 C C   . TYR A 1 471 ? -17.163 14.760  55.412  1.00 46.22  ? 471 TYR A C   1 
ATOM   3586 O O   . TYR A 1 471 ? -18.001 14.005  55.885  1.00 45.20  ? 471 TYR A O   1 
ATOM   3587 C CB  . TYR A 1 471 ? -14.870 14.589  56.301  1.00 41.71  ? 471 TYR A CB  1 
ATOM   3588 C CG  . TYR A 1 471 ? -15.397 13.832  57.489  1.00 42.46  ? 471 TYR A CG  1 
ATOM   3589 C CD1 . TYR A 1 471 ? -15.273 12.459  57.546  1.00 43.14  ? 471 TYR A CD1 1 
ATOM   3590 C CD2 . TYR A 1 471 ? -16.099 14.467  58.502  1.00 51.16  ? 471 TYR A CD2 1 
ATOM   3591 C CE1 . TYR A 1 471 ? -15.787 11.733  58.597  1.00 49.30  ? 471 TYR A CE1 1 
ATOM   3592 C CE2 . TYR A 1 471 ? -16.615 13.746  59.579  1.00 50.24  ? 471 TYR A CE2 1 
ATOM   3593 C CZ  . TYR A 1 471 ? -16.457 12.372  59.619  1.00 48.19  ? 471 TYR A CZ  1 
ATOM   3594 O OH  . TYR A 1 471 ? -16.968 11.617  60.660  1.00 44.19  ? 471 TYR A OH  1 
ATOM   3595 N N   . LYS A 1 472 ? -17.399 16.041  55.156  1.00 50.10  ? 472 LYS A N   1 
ATOM   3596 C CA  . LYS A 1 472 ? -18.695 16.657  55.380  1.00 45.41  ? 472 LYS A CA  1 
ATOM   3597 C C   . LYS A 1 472 ? -19.708 16.340  54.274  1.00 48.23  ? 472 LYS A C   1 
ATOM   3598 O O   . LYS A 1 472 ? -20.706 17.049  54.131  1.00 58.11  ? 472 LYS A O   1 
ATOM   3599 C CB  . LYS A 1 472 ? -18.540 18.178  55.511  1.00 49.38  ? 472 LYS A CB  1 
ATOM   3600 C CG  . LYS A 1 472 ? -18.019 18.659  56.871  1.00 49.10  ? 472 LYS A CG  1 
ATOM   3601 C CD  . LYS A 1 472 ? -18.595 20.038  57.208  1.00 50.61  ? 472 LYS A CD  1 
ATOM   3602 C CE  . LYS A 1 472 ? -18.240 20.488  58.621  1.00 52.56  ? 472 LYS A CE  1 
ATOM   3603 N NZ  . LYS A 1 472 ? -16.771 20.713  58.807  1.00 49.54  ? 472 LYS A NZ  1 
ATOM   3604 N N   . VAL A 1 473 ? -19.471 15.299  53.482  1.00 44.27  ? 473 VAL A N   1 
ATOM   3605 C CA  . VAL A 1 473 ? -20.485 14.909  52.507  1.00 46.53  ? 473 VAL A CA  1 
ATOM   3606 C C   . VAL A 1 473 ? -21.495 13.981  53.193  1.00 52.15  ? 473 VAL A C   1 
ATOM   3607 O O   . VAL A 1 473 ? -21.132 12.954  53.766  1.00 50.79  ? 473 VAL A O   1 
ATOM   3608 C CB  . VAL A 1 473 ? -19.882 14.217  51.278  1.00 41.90  ? 473 VAL A CB  1 
ATOM   3609 C CG1 . VAL A 1 473 ? -20.983 13.744  50.360  1.00 46.78  ? 473 VAL A CG1 1 
ATOM   3610 C CG2 . VAL A 1 473 ? -18.972 15.163  50.525  1.00 40.54  ? 473 VAL A CG2 1 
ATOM   3611 N N   . LYS A 1 474 ? -22.763 14.365  53.166  1.00 50.12  ? 474 LYS A N   1 
ATOM   3612 C CA  . LYS A 1 474 ? -23.794 13.577  53.827  1.00 54.75  ? 474 LYS A CA  1 
ATOM   3613 C C   . LYS A 1 474 ? -24.401 12.594  52.839  1.00 49.20  ? 474 LYS A C   1 
ATOM   3614 O O   . LYS A 1 474 ? -24.593 12.910  51.664  1.00 46.99  ? 474 LYS A O   1 
ATOM   3615 C CB  . LYS A 1 474 ? -24.875 14.488  54.446  1.00 46.75  ? 474 LYS A CB  1 
ATOM   3616 C CG  . LYS A 1 474 ? -24.322 15.438  55.512  1.00 51.45  ? 474 LYS A CG  1 
ATOM   3617 C CD  . LYS A 1 474 ? -25.418 16.089  56.359  1.00 65.12  ? 474 LYS A CD  1 
ATOM   3618 C CE  . LYS A 1 474 ? -26.357 15.060  57.015  1.00 60.90  ? 474 LYS A CE  1 
ATOM   3619 N NZ  . LYS A 1 474 ? -27.663 14.929  56.283  1.00 59.31  ? 474 LYS A NZ  1 
ATOM   3620 N N   . GLY A 1 475 ? -24.673 11.386  53.313  1.00 45.20  ? 475 GLY A N   1 
ATOM   3621 C CA  . GLY A 1 475 ? -25.338 10.396  52.486  1.00 42.58  ? 475 GLY A CA  1 
ATOM   3622 C C   . GLY A 1 475 ? -24.880 8.975   52.716  1.00 45.84  ? 475 GLY A C   1 
ATOM   3623 O O   . GLY A 1 475 ? -24.157 8.673   53.664  1.00 55.15  ? 475 GLY A O   1 
ATOM   3624 N N   . ASN A 1 476 ? -25.333 8.088   51.848  1.00 49.44  ? 476 ASN A N   1 
ATOM   3625 C CA  . ASN A 1 476 ? -24.860 6.723   51.842  1.00 44.40  ? 476 ASN A CA  1 
ATOM   3626 C C   . ASN A 1 476 ? -24.476 6.432   50.421  1.00 49.52  ? 476 ASN A C   1 
ATOM   3627 O O   . ASN A 1 476 ? -25.319 6.479   49.526  1.00 55.83  ? 476 ASN A O   1 
ATOM   3628 C CB  . ASN A 1 476 ? -25.930 5.756   52.338  1.00 49.18  ? 476 ASN A CB  1 
ATOM   3629 C CG  . ASN A 1 476 ? -25.470 4.316   52.323  1.00 51.50  ? 476 ASN A CG  1 
ATOM   3630 O OD1 . ASN A 1 476 ? -24.276 4.036   52.291  1.00 57.05  ? 476 ASN A OD1 1 
ATOM   3631 N ND2 . ASN A 1 476 ? -26.420 3.392   52.351  1.00 51.19  ? 476 ASN A ND2 1 
ATOM   3632 N N   . ALA A 1 477 ? -23.196 6.169   50.205  1.00 48.41  ? 477 ALA A N   1 
ATOM   3633 C CA  . ALA A 1 477 ? -22.703 5.986   48.855  1.00 48.02  ? 477 ALA A CA  1 
ATOM   3634 C C   . ALA A 1 477 ? -23.126 4.629   48.318  1.00 47.56  ? 477 ALA A C   1 
ATOM   3635 O O   . ALA A 1 477 ? -23.397 4.505   47.123  1.00 47.42  ? 477 ALA A O   1 
ATOM   3636 C CB  . ALA A 1 477 ? -21.189 6.142   48.812  1.00 49.58  ? 477 ALA A CB  1 
ATOM   3637 N N   . THR A 1 478 ? -23.211 3.627   49.200  1.00 50.05  ? 478 THR A N   1 
ATOM   3638 C CA  . THR A 1 478 ? -23.566 2.259   48.779  1.00 49.79  ? 478 THR A CA  1 
ATOM   3639 C C   . THR A 1 478 ? -25.022 2.166   48.356  1.00 51.57  ? 478 THR A C   1 
ATOM   3640 O O   . THR A 1 478 ? -25.419 1.215   47.680  1.00 56.13  ? 478 THR A O   1 
ATOM   3641 C CB  . THR A 1 478 ? -23.315 1.190   49.878  1.00 40.11  ? 478 THR A CB  1 
ATOM   3642 O OG1 . THR A 1 478 ? -23.916 1.594   51.109  1.00 49.25  ? 478 THR A OG1 1 
ATOM   3643 C CG2 . THR A 1 478 ? -21.839 0.970   50.103  1.00 42.35  ? 478 THR A CG2 1 
ATOM   3644 N N   . ASN A 1 479 ? -25.818 3.157   48.739  1.00 51.43  ? 479 ASN A N   1 
ATOM   3645 C CA  . ASN A 1 479 ? -27.217 3.163   48.342  1.00 57.42  ? 479 ASN A CA  1 
ATOM   3646 C C   . ASN A 1 479 ? -27.497 4.178   47.240  1.00 55.87  ? 479 ASN A C   1 
ATOM   3647 O O   . ASN A 1 479 ? -28.291 5.095   47.421  1.00 65.54  ? 479 ASN A O   1 
ATOM   3648 C CB  . ASN A 1 479 ? -28.119 3.430   49.565  1.00 62.89  ? 479 ASN A CB  1 
ATOM   3649 C CG  . ASN A 1 479 ? -29.607 3.285   49.245  1.00 69.87  ? 479 ASN A CG  1 
ATOM   3650 O OD1 . ASN A 1 479 ? -30.342 4.279   49.199  1.00 72.65  ? 479 ASN A OD1 1 
ATOM   3651 N ND2 . ASN A 1 479 ? -30.051 2.048   49.001  1.00 62.79  ? 479 ASN A ND2 1 
ATOM   3652 N N   . VAL A 1 480 ? -26.845 4.035   46.091  1.00 57.22  ? 480 VAL A N   1 
ATOM   3653 C CA  . VAL A 1 480 ? -27.201 4.910   44.988  1.00 53.84  ? 480 VAL A CA  1 
ATOM   3654 C C   . VAL A 1 480 ? -27.567 4.102   43.759  1.00 56.08  ? 480 VAL A C   1 
ATOM   3655 O O   . VAL A 1 480 ? -27.342 2.891   43.692  1.00 57.92  ? 480 VAL A O   1 
ATOM   3656 C CB  . VAL A 1 480 ? -26.081 5.919   44.644  1.00 57.18  ? 480 VAL A CB  1 
ATOM   3657 C CG1 . VAL A 1 480 ? -25.751 6.792   45.855  1.00 53.33  ? 480 VAL A CG1 1 
ATOM   3658 C CG2 . VAL A 1 480 ? -24.852 5.212   44.141  1.00 53.65  ? 480 VAL A CG2 1 
ATOM   3659 N N   . GLU A 1 481 ? -28.145 4.803   42.792  1.00 58.19  ? 481 GLU A N   1 
ATOM   3660 C CA  . GLU A 1 481 ? -28.744 4.193   41.617  1.00 59.47  ? 481 GLU A CA  1 
ATOM   3661 C C   . GLU A 1 481 ? -27.791 4.242   40.426  1.00 58.20  ? 481 GLU A C   1 
ATOM   3662 O O   . GLU A 1 481 ? -27.419 5.330   39.960  1.00 58.92  ? 481 GLU A O   1 
ATOM   3663 C CB  . GLU A 1 481 ? -30.061 4.914   41.271  1.00 61.49  ? 481 GLU A CB  1 
ATOM   3664 C CG  . GLU A 1 481 ? -31.255 4.008   40.994  1.00 58.78  ? 481 GLU A CG  1 
ATOM   3665 C CD  . GLU A 1 481 ? -31.805 3.377   42.256  1.00 68.23  ? 481 GLU A CD  1 
ATOM   3666 O OE1 . GLU A 1 481 ? -32.796 3.919   42.799  1.00 62.62  ? 481 GLU A OE1 1 
ATOM   3667 O OE2 . GLU A 1 481 ? -31.245 2.342   42.704  1.00 67.35  ? 481 GLU A OE2 1 
ATOM   3668 N N   . ILE A 1 482 ? -27.404 3.072   39.925  1.00 59.29  ? 482 ILE A N   1 
ATOM   3669 C CA  . ILE A 1 482 ? -26.540 3.009   38.745  1.00 56.92  ? 482 ILE A CA  1 
ATOM   3670 C C   . ILE A 1 482 ? -27.333 3.085   37.441  1.00 58.37  ? 482 ILE A C   1 
ATOM   3671 O O   . ILE A 1 482 ? -27.905 2.092   36.995  1.00 61.01  ? 482 ILE A O   1 
ATOM   3672 C CB  . ILE A 1 482 ? -25.706 1.726   38.720  1.00 50.70  ? 482 ILE A CB  1 
ATOM   3673 C CG1 . ILE A 1 482 ? -25.039 1.487   40.068  1.00 49.05  ? 482 ILE A CG1 1 
ATOM   3674 C CG2 . ILE A 1 482 ? -24.670 1.800   37.609  1.00 58.84  ? 482 ILE A CG2 1 
ATOM   3675 C CD1 . ILE A 1 482 ? -24.215 2.644   40.551  1.00 52.56  ? 482 ILE A CD1 1 
ATOM   3676 N N   . VAL A 1 483 ? -27.360 4.259   36.824  1.00 59.52  ? 483 VAL A N   1 
ATOM   3677 C CA  . VAL A 1 483 ? -28.135 4.444   35.606  1.00 58.87  ? 483 VAL A CA  1 
ATOM   3678 C C   . VAL A 1 483 ? -27.532 3.687   34.433  1.00 58.69  ? 483 VAL A C   1 
ATOM   3679 O O   . VAL A 1 483 ? -26.381 3.916   34.077  1.00 64.78  ? 483 VAL A O   1 
ATOM   3680 C CB  . VAL A 1 483 ? -28.245 5.929   35.243  1.00 62.64  ? 483 VAL A CB  1 
ATOM   3681 C CG1 . VAL A 1 483 ? -28.583 6.111   33.747  1.00 61.64  ? 483 VAL A CG1 1 
ATOM   3682 C CG2 . VAL A 1 483 ? -29.264 6.599   36.138  1.00 51.63  ? 483 VAL A CG2 1 
ATOM   3683 N N   . MET B 1 1   ? 4.897   47.122  18.679  1.00 41.84  ? 1   MET B N   1 
ATOM   3684 C CA  . MET B 1 1   ? 5.938   46.415  19.431  1.00 58.51  ? 1   MET B CA  1 
ATOM   3685 C C   . MET B 1 1   ? 6.912   45.743  18.467  1.00 65.26  ? 1   MET B C   1 
ATOM   3686 O O   . MET B 1 1   ? 6.491   45.165  17.470  1.00 62.10  ? 1   MET B O   1 
ATOM   3687 C CB  . MET B 1 1   ? 5.327   45.379  20.378  1.00 59.99  ? 1   MET B CB  1 
ATOM   3688 C CG  . MET B 1 1   ? 6.341   44.473  21.071  1.00 61.32  ? 1   MET B CG  1 
ATOM   3689 S SD  . MET B 1 1   ? 6.843   45.031  22.719  1.00 75.00  ? 1   MET B SD  1 
ATOM   3690 C CE  . MET B 1 1   ? 5.258   45.480  23.423  1.00 62.66  ? 1   MET B CE  1 
ATOM   3691 N N   . GLU B 1 2   ? 8.207   45.809  18.781  1.00 68.25  ? 2   GLU B N   1 
ATOM   3692 C CA  . GLU B 1 2   ? 9.280   45.487  17.829  1.00 66.54  ? 2   GLU B CA  1 
ATOM   3693 C C   . GLU B 1 2   ? 9.233   44.079  17.208  1.00 63.28  ? 2   GLU B C   1 
ATOM   3694 O O   . GLU B 1 2   ? 8.821   43.112  17.847  1.00 60.91  ? 2   GLU B O   1 
ATOM   3695 C CB  . GLU B 1 2   ? 10.649  45.693  18.499  1.00 68.52  ? 2   GLU B CB  1 
ATOM   3696 C CG  . GLU B 1 2   ? 10.866  44.909  19.798  1.00 80.74  ? 2   GLU B CG  1 
ATOM   3697 C CD  . GLU B 1 2   ? 12.253  45.130  20.400  1.00 86.74  ? 2   GLU B CD  1 
ATOM   3698 O OE1 . GLU B 1 2   ? 13.197  45.387  19.617  1.00 85.13  ? 2   GLU B OE1 1 
ATOM   3699 O OE2 . GLU B 1 2   ? 12.397  45.052  21.647  1.00 85.33  ? 2   GLU B OE2 1 
ATOM   3700 N N   . ASN B 1 3   ? 9.664   44.000  15.946  1.00 63.91  ? 3   ASN B N   1 
ATOM   3701 C CA  . ASN B 1 3   ? 9.781   42.748  15.191  1.00 54.25  ? 3   ASN B CA  1 
ATOM   3702 C C   . ASN B 1 3   ? 10.741  41.770  15.858  1.00 57.81  ? 3   ASN B C   1 
ATOM   3703 O O   . ASN B 1 3   ? 11.960  41.997  15.884  1.00 59.72  ? 3   ASN B O   1 
ATOM   3704 C CB  . ASN B 1 3   ? 10.244  43.054  13.766  1.00 51.62  ? 3   ASN B CB  1 
ATOM   3705 C CG  . ASN B 1 3   ? 10.289  41.823  12.864  1.00 58.95  ? 3   ASN B CG  1 
ATOM   3706 O OD1 . ASN B 1 3   ? 10.190  40.673  13.315  1.00 53.40  ? 3   ASN B OD1 1 
ATOM   3707 N ND2 . ASN B 1 3   ? 10.465  42.070  11.562  1.00 50.75  ? 3   ASN B ND2 1 
ATOM   3708 N N   . GLN B 1 4   ? 10.200  40.677  16.387  1.00 55.33  ? 4   GLN B N   1 
ATOM   3709 C CA  . GLN B 1 4   ? 11.011  39.768  17.195  1.00 56.27  ? 4   GLN B CA  1 
ATOM   3710 C C   . GLN B 1 4   ? 11.811  38.779  16.365  1.00 52.61  ? 4   GLN B C   1 
ATOM   3711 O O   . GLN B 1 4   ? 12.609  38.018  16.913  1.00 49.23  ? 4   GLN B O   1 
ATOM   3712 C CB  . GLN B 1 4   ? 10.134  39.012  18.196  1.00 53.70  ? 4   GLN B CB  1 
ATOM   3713 C CG  . GLN B 1 4   ? 9.789   39.824  19.448  1.00 62.07  ? 4   GLN B CG  1 
ATOM   3714 C CD  . GLN B 1 4   ? 11.015  40.142  20.302  1.00 67.19  ? 4   GLN B CD  1 
ATOM   3715 O OE1 . GLN B 1 4   ? 11.954  39.344  20.391  1.00 67.79  ? 4   GLN B OE1 1 
ATOM   3716 N NE2 . GLN B 1 4   ? 11.014  41.317  20.928  1.00 71.79  ? 4   GLN B NE2 1 
ATOM   3717 N N   . ILE B 1 5   ? 11.587  38.788  15.051  1.00 56.92  ? 5   ILE B N   1 
ATOM   3718 C CA  . ILE B 1 5   ? 12.246  37.837  14.157  1.00 59.14  ? 5   ILE B CA  1 
ATOM   3719 C C   . ILE B 1 5   ? 13.534  38.452  13.627  1.00 57.99  ? 5   ILE B C   1 
ATOM   3720 O O   . ILE B 1 5   ? 13.596  38.967  12.508  1.00 57.91  ? 5   ILE B O   1 
ATOM   3721 C CB  . ILE B 1 5   ? 11.345  37.417  12.983  1.00 53.99  ? 5   ILE B CB  1 
ATOM   3722 C CG1 . ILE B 1 5   ? 9.883   37.361  13.423  1.00 55.88  ? 5   ILE B CG1 1 
ATOM   3723 C CG2 . ILE B 1 5   ? 11.801  36.069  12.427  1.00 52.29  ? 5   ILE B CG2 1 
ATOM   3724 C CD1 . ILE B 1 5   ? 9.007   36.511  12.519  1.00 56.95  ? 5   ILE B CD1 1 
ATOM   3725 N N   . LYS B 1 6   ? 14.567  38.387  14.455  1.00 57.89  ? 6   LYS B N   1 
ATOM   3726 C CA  . LYS B 1 6   ? 15.761  39.179  14.245  1.00 55.28  ? 6   LYS B CA  1 
ATOM   3727 C C   . LYS B 1 6   ? 16.801  38.380  13.469  1.00 63.02  ? 6   LYS B C   1 
ATOM   3728 O O   . LYS B 1 6   ? 17.399  37.437  14.008  1.00 58.89  ? 6   LYS B O   1 
ATOM   3729 C CB  . LYS B 1 6   ? 16.302  39.657  15.601  1.00 61.50  ? 6   LYS B CB  1 
ATOM   3730 C CG  . LYS B 1 6   ? 15.279  40.484  16.423  1.00 56.43  ? 6   LYS B CG  1 
ATOM   3731 C CD  . LYS B 1 6   ? 15.727  40.700  17.860  1.00 47.02  ? 6   LYS B CD  1 
ATOM   3732 C CE  . LYS B 1 6   ? 14.740  41.587  18.615  1.00 61.81  ? 6   LYS B CE  1 
ATOM   3733 N NZ  . LYS B 1 6   ? 14.935  41.562  20.094  1.00 67.08  ? 6   LYS B NZ  1 
ATOM   3734 N N   . ALA B 1 7   ? 16.986  38.750  12.197  1.00 59.17  ? 7   ALA B N   1 
ATOM   3735 C CA  . ALA B 1 7   ? 17.994  38.130  11.334  1.00 64.07  ? 7   ALA B CA  1 
ATOM   3736 C C   . ALA B 1 7   ? 18.259  38.972  10.084  1.00 73.03  ? 7   ALA B C   1 
ATOM   3737 O O   . ALA B 1 7   ? 17.358  39.670  9.576   1.00 68.57  ? 7   ALA B O   1 
ATOM   3738 C CB  . ALA B 1 7   ? 17.576  36.719  10.937  1.00 63.20  ? 7   ALA B CB  1 
ATOM   3739 N N   . ASN B 1 8   ? 19.506  38.899  9.608   1.00 73.71  ? 8   ASN B N   1 
ATOM   3740 C CA  . ASN B 1 8   ? 19.954  39.589  8.393   1.00 75.01  ? 8   ASN B CA  1 
ATOM   3741 C C   . ASN B 1 8   ? 20.255  38.593  7.269   1.00 70.46  ? 8   ASN B C   1 
ATOM   3742 O O   . ASN B 1 8   ? 19.779  38.746  6.145   1.00 74.58  ? 8   ASN B O   1 
ATOM   3743 C CB  . ASN B 1 8   ? 21.208  40.437  8.668   1.00 74.93  ? 8   ASN B CB  1 
ATOM   3744 C CG  . ASN B 1 8   ? 20.975  41.545  9.688   1.00 70.95  ? 8   ASN B CG  1 
ATOM   3745 O OD1 . ASN B 1 8   ? 19.897  42.143  9.755   1.00 69.88  ? 8   ASN B OD1 1 
ATOM   3746 N ND2 . ASN B 1 8   ? 22.006  41.839  10.475  1.00 69.38  ? 8   ASN B ND2 1 
ATOM   3747 N N   . THR B 1 9   ? 21.065  37.585  7.585   1.00 66.25  ? 9   THR B N   1 
ATOM   3748 C CA  . THR B 1 9   ? 21.377  36.522  6.644   1.00 69.19  ? 9   THR B CA  1 
ATOM   3749 C C   . THR B 1 9   ? 20.497  35.304  6.891   1.00 75.75  ? 9   THR B C   1 
ATOM   3750 O O   . THR B 1 9   ? 19.905  35.173  7.959   1.00 75.85  ? 9   THR B O   1 
ATOM   3751 C CB  . THR B 1 9   ? 22.852  36.091  6.741   1.00 74.26  ? 9   THR B CB  1 
ATOM   3752 O OG1 . THR B 1 9   ? 23.144  35.669  8.079   1.00 75.61  ? 9   THR B OG1 1 
ATOM   3753 C CG2 . THR B 1 9   ? 23.775  37.235  6.353   1.00 72.40  ? 9   THR B CG2 1 
ATOM   3754 N N   . LYS B 1 10  ? 20.420  34.409  5.909   1.00 75.72  ? 10  LYS B N   1 
ATOM   3755 C CA  . LYS B 1 10  ? 19.738  33.132  6.102   1.00 71.69  ? 10  LYS B CA  1 
ATOM   3756 C C   . LYS B 1 10  ? 20.402  32.333  7.212   1.00 69.31  ? 10  LYS B C   1 
ATOM   3757 O O   . LYS B 1 10  ? 19.725  31.658  7.981   1.00 73.61  ? 10  LYS B O   1 
ATOM   3758 C CB  . LYS B 1 10  ? 19.712  32.311  4.808   1.00 67.52  ? 10  LYS B CB  1 
ATOM   3759 C CG  . LYS B 1 10  ? 19.763  30.801  5.035   1.00 70.10  ? 10  LYS B CG  1 
ATOM   3760 C CD  . LYS B 1 10  ? 19.098  30.040  3.900   1.00 69.48  ? 10  LYS B CD  1 
ATOM   3761 C CE  . LYS B 1 10  ? 19.473  28.563  3.887   1.00 61.11  ? 10  LYS B CE  1 
ATOM   3762 N NZ  . LYS B 1 10  ? 18.948  27.831  5.051   1.00 66.26  ? 10  LYS B NZ  1 
ATOM   3763 N N   . LYS B 1 11  ? 21.726  32.416  7.301   1.00 75.12  ? 11  LYS B N   1 
ATOM   3764 C CA  . LYS B 1 11  ? 22.453  31.711  8.353   1.00 77.07  ? 11  LYS B CA  1 
ATOM   3765 C C   . LYS B 1 11  ? 21.934  32.132  9.730   1.00 77.15  ? 11  LYS B C   1 
ATOM   3766 O O   . LYS B 1 11  ? 21.655  31.288  10.577  1.00 71.24  ? 11  LYS B O   1 
ATOM   3767 C CB  . LYS B 1 11  ? 23.954  31.967  8.237   1.00 73.35  ? 11  LYS B CB  1 
ATOM   3768 C CG  . LYS B 1 11  ? 24.816  30.823  8.759   1.00 73.08  ? 11  LYS B CG  1 
ATOM   3769 C CD  . LYS B 1 11  ? 25.039  30.926  10.244  1.00 74.49  ? 11  LYS B CD  1 
ATOM   3770 C CE  . LYS B 1 11  ? 25.569  32.299  10.620  1.00 77.27  ? 11  LYS B CE  1 
ATOM   3771 N NZ  . LYS B 1 11  ? 25.964  32.355  12.058  1.00 71.80  ? 11  LYS B NZ  1 
ATOM   3772 N N   . GLU B 1 12  ? 21.788  33.439  9.928   1.00 78.12  ? 12  GLU B N   1 
ATOM   3773 C CA  . GLU B 1 12  ? 21.214  33.990  11.157  1.00 76.74  ? 12  GLU B CA  1 
ATOM   3774 C C   . GLU B 1 12  ? 19.809  33.446  11.449  1.00 75.84  ? 12  GLU B C   1 
ATOM   3775 O O   . GLU B 1 12  ? 19.563  32.898  12.526  1.00 72.68  ? 12  GLU B O   1 
ATOM   3776 C CB  . GLU B 1 12  ? 21.167  35.524  11.087  1.00 72.82  ? 12  GLU B CB  1 
ATOM   3777 C CG  . GLU B 1 12  ? 22.508  36.205  11.315  1.00 70.70  ? 12  GLU B CG  1 
ATOM   3778 C CD  . GLU B 1 12  ? 22.365  37.692  11.567  1.00 67.13  ? 12  GLU B CD  1 
ATOM   3779 O OE1 . GLU B 1 12  ? 21.239  38.207  11.437  1.00 70.04  ? 12  GLU B OE1 1 
ATOM   3780 O OE2 . GLU B 1 12  ? 23.374  38.347  11.900  1.00 71.48  ? 12  GLU B OE2 1 
ATOM   3781 N N   . TYR B 1 13  ? 18.897  33.617  10.491  1.00 76.82  ? 13  TYR B N   1 
ATOM   3782 C CA  . TYR B 1 13  ? 17.523  33.123  10.592  1.00 66.24  ? 13  TYR B CA  1 
ATOM   3783 C C   . TYR B 1 13  ? 17.463  31.622  10.885  1.00 69.77  ? 13  TYR B C   1 
ATOM   3784 O O   . TYR B 1 13  ? 16.663  31.169  11.700  1.00 71.51  ? 13  TYR B O   1 
ATOM   3785 C CB  . TYR B 1 13  ? 16.771  33.427  9.301   1.00 66.16  ? 13  TYR B CB  1 
ATOM   3786 C CG  . TYR B 1 13  ? 15.338  32.942  9.286   1.00 71.02  ? 13  TYR B CG  1 
ATOM   3787 C CD1 . TYR B 1 13  ? 15.025  31.619  8.973   1.00 66.89  ? 13  TYR B CD1 1 
ATOM   3788 C CD2 . TYR B 1 13  ? 14.296  33.811  9.566   1.00 66.02  ? 13  TYR B CD2 1 
ATOM   3789 C CE1 . TYR B 1 13  ? 13.726  31.181  8.964   1.00 62.24  ? 13  TYR B CE1 1 
ATOM   3790 C CE2 . TYR B 1 13  ? 12.992  33.380  9.553   1.00 63.21  ? 13  TYR B CE2 1 
ATOM   3791 C CZ  . TYR B 1 13  ? 12.715  32.066  9.254   1.00 59.93  ? 13  TYR B CZ  1 
ATOM   3792 O OH  . TYR B 1 13  ? 11.415  31.643  9.241   1.00 53.44  ? 13  TYR B OH  1 
ATOM   3793 N N   . ASP B 1 14  ? 18.309  30.858  10.207  1.00 71.51  ? 14  ASP B N   1 
ATOM   3794 C CA  . ASP B 1 14  ? 18.423  29.421  10.426  1.00 66.25  ? 14  ASP B CA  1 
ATOM   3795 C C   . ASP B 1 14  ? 18.604  29.056  11.904  1.00 73.18  ? 14  ASP B C   1 
ATOM   3796 O O   . ASP B 1 14  ? 18.227  27.960  12.332  1.00 76.53  ? 14  ASP B O   1 
ATOM   3797 C CB  . ASP B 1 14  ? 19.597  28.872  9.611   1.00 72.43  ? 14  ASP B CB  1 
ATOM   3798 C CG  . ASP B 1 14  ? 19.168  27.842  8.590   1.00 76.95  ? 14  ASP B CG  1 
ATOM   3799 O OD1 . ASP B 1 14  ? 17.949  27.741  8.326   1.00 75.66  ? 14  ASP B OD1 1 
ATOM   3800 O OD2 . ASP B 1 14  ? 20.050  27.136  8.049   1.00 75.88  ? 14  ASP B OD2 1 
ATOM   3801 N N   . GLU B 1 15  ? 19.188  29.976  12.672  1.00 74.59  ? 15  GLU B N   1 
ATOM   3802 C CA  . GLU B 1 15  ? 19.508  29.742  14.077  1.00 72.07  ? 15  GLU B CA  1 
ATOM   3803 C C   . GLU B 1 15  ? 18.413  30.293  14.992  1.00 74.11  ? 15  GLU B C   1 
ATOM   3804 O O   . GLU B 1 15  ? 18.267  29.843  16.127  1.00 80.40  ? 15  GLU B O   1 
ATOM   3805 C CB  . GLU B 1 15  ? 20.860  30.366  14.438  1.00 74.31  ? 15  GLU B CB  1 
ATOM   3806 C CG  . GLU B 1 15  ? 22.076  29.697  13.802  1.00 78.74  ? 15  GLU B CG  1 
ATOM   3807 C CD  . GLU B 1 15  ? 23.378  30.440  14.097  1.00 81.34  ? 15  GLU B CD  1 
ATOM   3808 O OE1 . GLU B 1 15  ? 23.520  30.990  15.209  1.00 87.23  ? 15  GLU B OE1 1 
ATOM   3809 O OE2 . GLU B 1 15  ? 24.262  30.481  13.217  1.00 82.47  ? 15  GLU B OE2 1 
ATOM   3810 N N   . TRP B 1 16  ? 17.654  31.268  14.505  1.00 65.38  ? 16  TRP B N   1 
ATOM   3811 C CA  . TRP B 1 16  ? 16.439  31.712  15.187  1.00 62.61  ? 16  TRP B CA  1 
ATOM   3812 C C   . TRP B 1 16  ? 15.369  30.634  15.111  1.00 67.48  ? 16  TRP B C   1 
ATOM   3813 O O   . TRP B 1 16  ? 14.642  30.369  16.075  1.00 65.92  ? 16  TRP B O   1 
ATOM   3814 C CB  . TRP B 1 16  ? 15.909  33.001  14.563  1.00 61.40  ? 16  TRP B CB  1 
ATOM   3815 C CG  . TRP B 1 16  ? 14.588  33.475  15.103  1.00 56.69  ? 16  TRP B CG  1 
ATOM   3816 C CD1 . TRP B 1 16  ? 14.396  34.362  16.115  1.00 61.00  ? 16  TRP B CD1 1 
ATOM   3817 C CD2 . TRP B 1 16  ? 13.284  33.117  14.634  1.00 58.74  ? 16  TRP B CD2 1 
ATOM   3818 N NE1 . TRP B 1 16  ? 13.057  34.577  16.316  1.00 54.50  ? 16  TRP B NE1 1 
ATOM   3819 C CE2 . TRP B 1 16  ? 12.349  33.822  15.422  1.00 60.18  ? 16  TRP B CE2 1 
ATOM   3820 C CE3 . TRP B 1 16  ? 12.813  32.269  13.625  1.00 58.87  ? 16  TRP B CE3 1 
ATOM   3821 C CZ2 . TRP B 1 16  ? 10.966  33.701  15.241  1.00 61.94  ? 16  TRP B CZ2 1 
ATOM   3822 C CZ3 . TRP B 1 16  ? 11.439  32.152  13.443  1.00 59.80  ? 16  TRP B CZ3 1 
ATOM   3823 C CH2 . TRP B 1 16  ? 10.532  32.867  14.248  1.00 57.47  ? 16  TRP B CH2 1 
ATOM   3824 N N   . PHE B 1 17  ? 15.293  30.016  13.940  1.00 67.83  ? 17  PHE B N   1 
ATOM   3825 C CA  . PHE B 1 17  ? 14.265  29.043  13.629  1.00 61.11  ? 17  PHE B CA  1 
ATOM   3826 C C   . PHE B 1 17  ? 14.407  27.747  14.419  1.00 60.45  ? 17  PHE B C   1 
ATOM   3827 O O   . PHE B 1 17  ? 13.412  27.085  14.710  1.00 62.04  ? 17  PHE B O   1 
ATOM   3828 C CB  . PHE B 1 17  ? 14.293  28.743  12.127  1.00 61.47  ? 17  PHE B CB  1 
ATOM   3829 C CG  . PHE B 1 17  ? 13.196  27.833  11.669  1.00 51.09  ? 17  PHE B CG  1 
ATOM   3830 C CD1 . PHE B 1 17  ? 11.924  28.334  11.429  1.00 45.13  ? 17  PHE B CD1 1 
ATOM   3831 C CD2 . PHE B 1 17  ? 13.439  26.487  11.470  1.00 49.55  ? 17  PHE B CD2 1 
ATOM   3832 C CE1 . PHE B 1 17  ? 10.915  27.514  11.007  1.00 44.00  ? 17  PHE B CE1 1 
ATOM   3833 C CE2 . PHE B 1 17  ? 12.434  25.651  11.048  1.00 52.23  ? 17  PHE B CE2 1 
ATOM   3834 C CZ  . PHE B 1 17  ? 11.166  26.164  10.813  1.00 54.34  ? 17  PHE B CZ  1 
ATOM   3835 N N   . LYS B 1 18  ? 15.641  27.378  14.747  1.00 61.49  ? 18  LYS B N   1 
ATOM   3836 C CA  . LYS B 1 18  ? 15.913  26.091  15.392  1.00 63.87  ? 18  LYS B CA  1 
ATOM   3837 C C   . LYS B 1 18  ? 15.173  25.926  16.737  1.00 70.56  ? 18  LYS B C   1 
ATOM   3838 O O   . LYS B 1 18  ? 14.461  24.930  16.930  1.00 70.99  ? 18  LYS B O   1 
ATOM   3839 C CB  . LYS B 1 18  ? 17.426  25.904  15.572  1.00 59.43  ? 18  LYS B CB  1 
ATOM   3840 C CG  . LYS B 1 18  ? 17.830  24.715  16.412  1.00 61.88  ? 18  LYS B CG  1 
ATOM   3841 C CD  . LYS B 1 18  ? 19.337  24.700  16.622  1.00 68.77  ? 18  LYS B CD  1 
ATOM   3842 C CE  . LYS B 1 18  ? 19.805  25.990  17.284  1.00 76.72  ? 18  LYS B CE  1 
ATOM   3843 N NZ  . LYS B 1 18  ? 21.282  26.181  17.185  1.00 82.65  ? 18  LYS B NZ  1 
ATOM   3844 N N   . PRO B 1 19  ? 15.318  26.893  17.667  1.00 64.63  ? 19  PRO B N   1 
ATOM   3845 C CA  . PRO B 1 19  ? 14.538  26.703  18.886  1.00 66.92  ? 19  PRO B CA  1 
ATOM   3846 C C   . PRO B 1 19  ? 13.047  26.898  18.635  1.00 66.51  ? 19  PRO B C   1 
ATOM   3847 O O   . PRO B 1 19  ? 12.253  26.134  19.178  1.00 65.35  ? 19  PRO B O   1 
ATOM   3848 C CB  . PRO B 1 19  ? 15.088  27.782  19.819  1.00 66.25  ? 19  PRO B CB  1 
ATOM   3849 C CG  . PRO B 1 19  ? 15.553  28.843  18.915  1.00 66.90  ? 19  PRO B CG  1 
ATOM   3850 C CD  . PRO B 1 19  ? 16.130  28.121  17.740  1.00 67.48  ? 19  PRO B CD  1 
ATOM   3851 N N   . TYR B 1 20  ? 12.692  27.886  17.813  1.00 59.03  ? 20  TYR B N   1 
ATOM   3852 C CA  . TYR B 1 20  ? 11.298  28.209  17.526  1.00 56.93  ? 20  TYR B CA  1 
ATOM   3853 C C   . TYR B 1 20  ? 10.504  27.013  17.041  1.00 62.75  ? 20  TYR B C   1 
ATOM   3854 O O   . TYR B 1 20  ? 9.381   26.796  17.487  1.00 64.74  ? 20  TYR B O   1 
ATOM   3855 C CB  . TYR B 1 20  ? 11.201  29.321  16.480  1.00 53.76  ? 20  TYR B CB  1 
ATOM   3856 C CG  . TYR B 1 20  ? 9.777   29.759  16.150  1.00 55.36  ? 20  TYR B CG  1 
ATOM   3857 C CD1 . TYR B 1 20  ? 8.993   29.053  15.247  1.00 52.42  ? 20  TYR B CD1 1 
ATOM   3858 C CD2 . TYR B 1 20  ? 9.225   30.895  16.733  1.00 54.58  ? 20  TYR B CD2 1 
ATOM   3859 C CE1 . TYR B 1 20  ? 7.704   29.465  14.938  1.00 45.18  ? 20  TYR B CE1 1 
ATOM   3860 C CE2 . TYR B 1 20  ? 7.935   31.312  16.430  1.00 47.55  ? 20  TYR B CE2 1 
ATOM   3861 C CZ  . TYR B 1 20  ? 7.180   30.595  15.528  1.00 46.10  ? 20  TYR B CZ  1 
ATOM   3862 O OH  . TYR B 1 20  ? 5.890   31.010  15.227  1.00 43.64  ? 20  TYR B OH  1 
ATOM   3863 N N   . ALA B 1 21  ? 11.065  26.258  16.104  1.00 66.01  ? 21  ALA B N   1 
ATOM   3864 C CA  . ALA B 1 21  ? 10.376  25.079  15.589  1.00 66.71  ? 21  ALA B CA  1 
ATOM   3865 C C   . ALA B 1 21  ? 10.262  24.017  16.679  1.00 64.91  ? 21  ALA B C   1 
ATOM   3866 O O   . ALA B 1 21  ? 9.247   23.338  16.795  1.00 65.95  ? 21  ALA B O   1 
ATOM   3867 C CB  . ALA B 1 21  ? 11.095  24.527  14.369  1.00 62.95  ? 21  ALA B CB  1 
ATOM   3868 N N   . GLU B 1 22  ? 11.308  23.888  17.484  1.00 70.28  ? 22  GLU B N   1 
ATOM   3869 C CA  . GLU B 1 22  ? 11.283  22.966  18.610  1.00 73.32  ? 22  GLU B CA  1 
ATOM   3870 C C   . GLU B 1 22  ? 10.186  23.331  19.612  1.00 70.18  ? 22  GLU B C   1 
ATOM   3871 O O   . GLU B 1 22  ? 9.573   22.461  20.223  1.00 74.99  ? 22  GLU B O   1 
ATOM   3872 C CB  . GLU B 1 22  ? 12.642  22.946  19.305  1.00 77.23  ? 22  GLU B CB  1 
ATOM   3873 C CG  . GLU B 1 22  ? 12.688  22.029  20.510  1.00 83.97  ? 22  GLU B CG  1 
ATOM   3874 C CD  . GLU B 1 22  ? 14.105  21.663  20.902  1.00 98.22  ? 22  GLU B CD  1 
ATOM   3875 O OE1 . GLU B 1 22  ? 15.051  22.286  20.362  1.00 90.86  ? 22  GLU B OE1 1 
ATOM   3876 O OE2 . GLU B 1 22  ? 14.269  20.748  21.744  1.00 99.32  ? 22  GLU B OE2 1 
ATOM   3877 N N   . LYS B 1 23  ? 9.931   24.625  19.759  1.00 67.01  ? 23  LYS B N   1 
ATOM   3878 C CA  . LYS B 1 23  ? 8.990   25.108  20.753  1.00 62.57  ? 23  LYS B CA  1 
ATOM   3879 C C   . LYS B 1 23  ? 7.609   25.371  20.166  1.00 64.75  ? 23  LYS B C   1 
ATOM   3880 O O   . LYS B 1 23  ? 6.742   25.899  20.850  1.00 69.55  ? 23  LYS B O   1 
ATOM   3881 C CB  . LYS B 1 23  ? 9.526   26.383  21.410  1.00 62.22  ? 23  LYS B CB  1 
ATOM   3882 C CG  . LYS B 1 23  ? 10.910  26.220  22.033  1.00 67.61  ? 23  LYS B CG  1 
ATOM   3883 C CD  . LYS B 1 23  ? 11.579  27.566  22.312  1.00 69.66  ? 23  LYS B CD  1 
ATOM   3884 C CE  . LYS B 1 23  ? 13.050  27.379  22.692  1.00 69.58  ? 23  LYS B CE  1 
ATOM   3885 N NZ  . LYS B 1 23  ? 13.828  28.658  22.748  1.00 53.71  ? 23  LYS B NZ  1 
ATOM   3886 N N   . THR B 1 24  ? 7.401   25.018  18.903  1.00 57.29  ? 24  THR B N   1 
ATOM   3887 C CA  . THR B 1 24  ? 6.065   25.129  18.305  1.00 61.49  ? 24  THR B CA  1 
ATOM   3888 C C   . THR B 1 24  ? 5.643   23.780  17.714  1.00 60.01  ? 24  THR B C   1 
ATOM   3889 O O   . THR B 1 24  ? 4.602   23.671  17.057  1.00 52.85  ? 24  THR B O   1 
ATOM   3890 C CB  . THR B 1 24  ? 5.974   26.245  17.210  1.00 63.80  ? 24  THR B CB  1 
ATOM   3891 O OG1 . THR B 1 24  ? 7.010   26.071  16.231  1.00 65.36  ? 24  THR B OG1 1 
ATOM   3892 C CG2 . THR B 1 24  ? 6.071   27.653  17.828  1.00 50.43  ? 24  THR B CG2 1 
ATOM   3893 N N   . HIS B 1 25  ? 6.477   22.772  17.973  1.00 65.66  ? 25  HIS B N   1 
ATOM   3894 C CA  . HIS B 1 25  ? 6.157   21.363  17.770  1.00 62.05  ? 25  HIS B CA  1 
ATOM   3895 C C   . HIS B 1 25  ? 5.461   21.182  16.366  1.00 66.32  ? 25  HIS B C   1 
ATOM   3896 O O   . HIS B 1 25  ? 4.322   20.724  16.284  1.00 71.51  ? 25  HIS B O   1 
ATOM   3897 C CB  . HIS B 1 25  ? 5.296   20.832  18.990  1.00 57.26  ? 25  HIS B CB  1 
ATOM   3898 C CG  . HIS B 1 25  ? 5.998   20.827  20.348  1.00 49.93  ? 25  HIS B CG  1 
ATOM   3899 N ND1 . HIS B 1 25  ? 6.264   21.974  21.076  1.00 67.18  ? 25  HIS B ND1 1 
ATOM   3900 C CD2 . HIS B 1 25  ? 6.427   19.801  21.132  1.00 54.30  ? 25  HIS B CD2 1 
ATOM   3901 C CE1 . HIS B 1 25  ? 6.870   21.663  22.214  1.00 56.36  ? 25  HIS B CE1 1 
ATOM   3902 N NE2 . HIS B 1 25  ? 6.970   20.348  22.280  1.00 51.50  ? 25  HIS B NE2 1 
ATOM   3903 N N   . LEU B 1 26  ? 6.164   21.556  15.277  1.00 68.87  ? 26  LEU B N   1 
ATOM   3904 C CA  . LEU B 1 26  ? 5.631   21.637  13.872  1.00 61.98  ? 26  LEU B CA  1 
ATOM   3905 C C   . LEU B 1 26  ? 5.456   20.316  13.061  1.00 60.88  ? 26  LEU B C   1 
ATOM   3906 O O   . LEU B 1 26  ? 6.149   19.324  13.320  1.00 60.03  ? 26  LEU B O   1 
ATOM   3907 C CB  . LEU B 1 26  ? 6.537   22.549  13.032  1.00 54.90  ? 26  LEU B CB  1 
ATOM   3908 C CG  . LEU B 1 26  ? 6.423   24.076  13.033  1.00 55.20  ? 26  LEU B CG  1 
ATOM   3909 C CD1 . LEU B 1 26  ? 7.641   24.698  12.365  1.00 47.63  ? 26  LEU B CD1 1 
ATOM   3910 C CD2 . LEU B 1 26  ? 5.174   24.519  12.319  1.00 51.93  ? 26  LEU B CD2 1 
ATOM   3911 N N   . LYS B 1 27  ? 4.585   20.333  12.040  1.00 50.26  ? 27  LYS B N   1 
ATOM   3912 C CA  . LYS B 1 27  ? 4.109   19.080  11.405  1.00 60.73  ? 27  LYS B CA  1 
ATOM   3913 C C   . LYS B 1 27  ? 4.245   18.951  9.875   1.00 59.27  ? 27  LYS B C   1 
ATOM   3914 O O   . LYS B 1 27  ? 3.704   19.762  9.115   1.00 53.49  ? 27  LYS B O   1 
ATOM   3915 C CB  . LYS B 1 27  ? 2.632   18.856  11.762  1.00 60.87  ? 27  LYS B CB  1 
ATOM   3916 C CG  . LYS B 1 27  ? 2.411   18.514  13.226  1.00 67.09  ? 27  LYS B CG  1 
ATOM   3917 C CD  . LYS B 1 27  ? 0.988   18.801  13.684  1.00 65.66  ? 27  LYS B CD  1 
ATOM   3918 C CE  . LYS B 1 27  ? 0.872   18.632  15.197  1.00 77.05  ? 27  LYS B CE  1 
ATOM   3919 N NZ  . LYS B 1 27  ? -0.397  19.188  15.758  1.00 83.47  ? 27  LYS B NZ  1 
ATOM   3920 N N   . SER B 1 28  ? 4.917   17.887  9.439   1.00 56.07  ? 28  SER B N   1 
ATOM   3921 C CA  . SER B 1 28  ? 5.175   17.657  8.011   1.00 61.55  ? 28  SER B CA  1 
ATOM   3922 C C   . SER B 1 28  ? 4.152   16.762  7.309   1.00 61.77  ? 28  SER B C   1 
ATOM   3923 O O   . SER B 1 28  ? 4.141   16.674  6.077   1.00 53.64  ? 28  SER B O   1 
ATOM   3924 C CB  . SER B 1 28  ? 6.563   17.043  7.822   1.00 57.42  ? 28  SER B CB  1 
ATOM   3925 O OG  . SER B 1 28  ? 7.565   18.032  7.948   1.00 66.87  ? 28  SER B OG  1 
ATOM   3926 N N   . VAL B 1 29  ? 3.296   16.117  8.098   1.00 61.62  ? 29  VAL B N   1 
ATOM   3927 C CA  . VAL B 1 29  ? 2.414   15.049  7.624   1.00 55.56  ? 29  VAL B CA  1 
ATOM   3928 C C   . VAL B 1 29  ? 1.457   15.437  6.481   1.00 63.11  ? 29  VAL B C   1 
ATOM   3929 O O   . VAL B 1 29  ? 1.229   14.635  5.569   1.00 66.12  ? 29  VAL B O   1 
ATOM   3930 C CB  . VAL B 1 29  ? 1.570   14.494  8.793   1.00 59.88  ? 29  VAL B CB  1 
ATOM   3931 C CG1 . VAL B 1 29  ? 0.878   13.206  8.385   1.00 53.06  ? 29  VAL B CG1 1 
ATOM   3932 C CG2 . VAL B 1 29  ? 2.445   14.272  10.027  1.00 59.78  ? 29  VAL B CG2 1 
ATOM   3933 N N   . LEU B 1 30  ? 0.909   16.653  6.512   1.00 55.23  ? 30  LEU B N   1 
ATOM   3934 C CA  . LEU B 1 30  ? -0.108  17.036  5.524   1.00 52.56  ? 30  LEU B CA  1 
ATOM   3935 C C   . LEU B 1 30  ? 0.270   18.189  4.572   1.00 53.35  ? 30  LEU B C   1 
ATOM   3936 O O   . LEU B 1 30  ? -0.332  18.364  3.509   1.00 52.21  ? 30  LEU B O   1 
ATOM   3937 C CB  . LEU B 1 30  ? -1.405  17.402  6.246   1.00 54.74  ? 30  LEU B CB  1 
ATOM   3938 C CG  . LEU B 1 30  ? -2.383  16.274  6.549   1.00 53.22  ? 30  LEU B CG  1 
ATOM   3939 C CD1 . LEU B 1 30  ? -3.818  16.796  6.453   1.00 50.30  ? 30  LEU B CD1 1 
ATOM   3940 C CD2 . LEU B 1 30  ? -2.159  15.133  5.572   1.00 63.74  ? 30  LEU B CD2 1 
ATOM   3941 N N   . THR B 1 31  ? 1.260   18.980  4.953   1.00 55.96  ? 31  THR B N   1 
ATOM   3942 C CA  . THR B 1 31  ? 1.609   20.175  4.194   1.00 49.36  ? 31  THR B CA  1 
ATOM   3943 C C   . THR B 1 31  ? 3.057   20.073  3.716   1.00 45.69  ? 31  THR B C   1 
ATOM   3944 O O   . THR B 1 31  ? 3.838   19.304  4.279   1.00 52.91  ? 31  THR B O   1 
ATOM   3945 C CB  . THR B 1 31  ? 1.421   21.462  5.045   1.00 45.30  ? 31  THR B CB  1 
ATOM   3946 O OG1 . THR B 1 31  ? 2.182   21.342  6.247   1.00 45.89  ? 31  THR B OG1 1 
ATOM   3947 C CG2 . THR B 1 31  ? -0.043  21.671  5.405   1.00 41.75  ? 31  THR B CG2 1 
ATOM   3948 N N   . ASN B 1 32  ? 3.423   20.857  2.708   1.00 38.33  ? 32  ASN B N   1 
ATOM   3949 C CA  . ASN B 1 32  ? 4.769   20.772  2.123   1.00 46.43  ? 32  ASN B CA  1 
ATOM   3950 C C   . ASN B 1 32  ? 5.942   21.202  3.018   1.00 46.94  ? 32  ASN B C   1 
ATOM   3951 O O   . ASN B 1 32  ? 6.854   20.420  3.275   1.00 42.33  ? 32  ASN B O   1 
ATOM   3952 C CB  . ASN B 1 32  ? 4.788   21.569  0.829   1.00 47.79  ? 32  ASN B CB  1 
ATOM   3953 C CG  . ASN B 1 32  ? 4.132   20.819  -0.288  1.00 43.58  ? 32  ASN B CG  1 
ATOM   3954 O OD1 . ASN B 1 32  ? 4.387   19.624  -0.453  1.00 51.97  ? 32  ASN B OD1 1 
ATOM   3955 N ND2 . ASN B 1 32  ? 3.260   21.483  -1.037  1.00 41.83  ? 32  ASN B ND2 1 
ATOM   3956 N N   . SER B 1 33  ? 5.943   22.448  3.469   1.00 49.71  ? 33  SER B N   1 
ATOM   3957 C CA  . SER B 1 33  ? 6.815   22.818  4.583   1.00 51.07  ? 33  SER B CA  1 
ATOM   3958 C C   . SER B 1 33  ? 6.003   22.626  5.859   1.00 45.15  ? 33  SER B C   1 
ATOM   3959 O O   . SER B 1 33  ? 4.793   22.824  5.836   1.00 45.53  ? 33  SER B O   1 
ATOM   3960 C CB  . SER B 1 33  ? 7.311   24.262  4.462   1.00 50.27  ? 33  SER B CB  1 
ATOM   3961 O OG  . SER B 1 33  ? 8.209   24.563  5.519   1.00 55.56  ? 33  SER B OG  1 
ATOM   3962 N N   . ALA B 1 34  ? 6.644   22.241  6.958   1.00 43.08  ? 34  ALA B N   1 
ATOM   3963 C CA  . ALA B 1 34  ? 5.909   21.954  8.192   1.00 44.20  ? 34  ALA B CA  1 
ATOM   3964 C C   . ALA B 1 34  ? 4.993   23.113  8.611   1.00 51.28  ? 34  ALA B C   1 
ATOM   3965 O O   . ALA B 1 34  ? 5.386   24.291  8.572   1.00 53.41  ? 34  ALA B O   1 
ATOM   3966 C CB  . ALA B 1 34  ? 6.853   21.617  9.285   1.00 42.88  ? 34  ALA B CB  1 
ATOM   3967 N N   . SER B 1 35  ? 3.751   22.774  8.955   1.00 45.71  ? 35  SER B N   1 
ATOM   3968 C CA  . SER B 1 35  ? 2.781   23.770  9.374   1.00 45.96  ? 35  SER B CA  1 
ATOM   3969 C C   . SER B 1 35  ? 2.208   23.402  10.735  1.00 52.39  ? 35  SER B C   1 
ATOM   3970 O O   . SER B 1 35  ? 2.816   22.644  11.506  1.00 48.54  ? 35  SER B O   1 
ATOM   3971 C CB  . SER B 1 35  ? 1.657   23.892  8.355   1.00 45.94  ? 35  SER B CB  1 
ATOM   3972 O OG  . SER B 1 35  ? 0.846   22.735  8.381   1.00 48.44  ? 35  SER B OG  1 
ATOM   3973 N N   . PHE B 1 36  ? 1.024   23.931  11.016  1.00 48.90  ? 36  PHE B N   1 
ATOM   3974 C CA  . PHE B 1 36  ? 0.279   23.529  12.208  1.00 55.40  ? 36  PHE B CA  1 
ATOM   3975 C C   . PHE B 1 36  ? -0.833  22.548  11.873  1.00 52.31  ? 36  PHE B C   1 
ATOM   3976 O O   . PHE B 1 36  ? -1.693  22.298  12.703  1.00 55.51  ? 36  PHE B O   1 
ATOM   3977 C CB  . PHE B 1 36  ? -0.320  24.751  12.913  1.00 51.00  ? 36  PHE B CB  1 
ATOM   3978 C CG  . PHE B 1 36  ? 0.706   25.684  13.466  1.00 53.18  ? 36  PHE B CG  1 
ATOM   3979 C CD1 . PHE B 1 36  ? 1.733   25.200  14.285  1.00 48.36  ? 36  PHE B CD1 1 
ATOM   3980 C CD2 . PHE B 1 36  ? 0.667   27.042  13.154  1.00 45.97  ? 36  PHE B CD2 1 
ATOM   3981 C CE1 . PHE B 1 36  ? 2.689   26.052  14.798  1.00 49.16  ? 36  PHE B CE1 1 
ATOM   3982 C CE2 . PHE B 1 36  ? 1.630   27.905  13.661  1.00 48.04  ? 36  PHE B CE2 1 
ATOM   3983 C CZ  . PHE B 1 36  ? 2.642   27.407  14.485  1.00 50.71  ? 36  PHE B CZ  1 
ATOM   3984 N N   . CYS B 1 37  ? -0.834  22.004  10.660  1.00 50.18  ? 37  CYS B N   1 
ATOM   3985 C CA  . CYS B 1 37  ? -1.906  21.093  10.284  1.00 56.50  ? 37  CYS B CA  1 
ATOM   3986 C C   . CYS B 1 37  ? -1.664  19.671  10.799  1.00 60.40  ? 37  CYS B C   1 
ATOM   3987 O O   . CYS B 1 37  ? -0.723  18.991  10.375  1.00 63.23  ? 37  CYS B O   1 
ATOM   3988 C CB  . CYS B 1 37  ? -2.094  21.070  8.768   1.00 50.10  ? 37  CYS B CB  1 
ATOM   3989 S SG  . CYS B 1 37  ? -3.811  20.779  8.267   1.00 55.19  ? 37  CYS B SG  1 
ATOM   3990 N N   . ASP B 1 38  ? -2.514  19.226  11.720  1.00 60.87  ? 38  ASP B N   1 
ATOM   3991 C CA  . ASP B 1 38  ? -2.504  17.819  12.113  1.00 66.27  ? 38  ASP B CA  1 
ATOM   3992 C C   . ASP B 1 38  ? -3.694  17.079  11.493  1.00 59.51  ? 38  ASP B C   1 
ATOM   3993 O O   . ASP B 1 38  ? -3.640  15.863  11.309  1.00 52.00  ? 38  ASP B O   1 
ATOM   3994 C CB  . ASP B 1 38  ? -2.486  17.653  13.646  1.00 70.33  ? 38  ASP B CB  1 
ATOM   3995 C CG  . ASP B 1 38  ? -3.608  18.398  14.349  1.00 74.21  ? 38  ASP B CG  1 
ATOM   3996 O OD1 . ASP B 1 38  ? -4.274  19.250  13.714  1.00 83.17  ? 38  ASP B OD1 1 
ATOM   3997 O OD2 . ASP B 1 38  ? -3.807  18.137  15.556  1.00 76.77  ? 38  ASP B OD2 1 
ATOM   3998 N N   . ALA B 1 39  ? -4.747  17.814  11.134  1.00 60.31  ? 39  ALA B N   1 
ATOM   3999 C CA  . ALA B 1 39  ? -5.873  17.207  10.428  1.00 53.58  ? 39  ALA B CA  1 
ATOM   4000 C C   . ALA B 1 39  ? -6.370  18.043  9.259   1.00 50.31  ? 39  ALA B C   1 
ATOM   4001 O O   . ALA B 1 39  ? -6.271  19.263  9.261   1.00 52.06  ? 39  ALA B O   1 
ATOM   4002 C CB  . ALA B 1 39  ? -7.006  16.948  11.385  1.00 54.54  ? 39  ALA B CB  1 
ATOM   4003 N N   . LEU B 1 40  ? -6.936  17.363  8.269   1.00 53.35  ? 40  LEU B N   1 
ATOM   4004 C CA  . LEU B 1 40  ? -7.512  18.021  7.107   1.00 50.19  ? 40  LEU B CA  1 
ATOM   4005 C C   . LEU B 1 40  ? -8.884  18.619  7.431   1.00 49.14  ? 40  LEU B C   1 
ATOM   4006 O O   . LEU B 1 40  ? -9.816  17.900  7.757   1.00 50.58  ? 40  LEU B O   1 
ATOM   4007 C CB  . LEU B 1 40  ? -7.613  17.018  5.946   1.00 57.22  ? 40  LEU B CB  1 
ATOM   4008 C CG  . LEU B 1 40  ? -8.019  17.459  4.532   1.00 54.69  ? 40  LEU B CG  1 
ATOM   4009 C CD1 . LEU B 1 40  ? -7.249  18.677  4.097   1.00 54.85  ? 40  LEU B CD1 1 
ATOM   4010 C CD2 . LEU B 1 40  ? -7.755  16.315  3.565   1.00 63.61  ? 40  LEU B CD2 1 
ATOM   4011 N N   . PRO B 1 41  ? -9.006  19.945  7.343   1.00 49.77  ? 41  PRO B N   1 
ATOM   4012 C CA  . PRO B 1 41  ? -10.272 20.642  7.595   1.00 52.96  ? 41  PRO B CA  1 
ATOM   4013 C C   . PRO B 1 41  ? -11.459 20.072  6.822   1.00 50.86  ? 41  PRO B C   1 
ATOM   4014 O O   . PRO B 1 41  ? -11.319 19.801  5.639   1.00 50.47  ? 41  PRO B O   1 
ATOM   4015 C CB  . PRO B 1 41  ? -9.978  22.072  7.123   1.00 49.55  ? 41  PRO B CB  1 
ATOM   4016 C CG  . PRO B 1 41  ? -8.509  22.219  7.274   1.00 47.07  ? 41  PRO B CG  1 
ATOM   4017 C CD  . PRO B 1 41  ? -7.910  20.874  7.031   1.00 48.29  ? 41  PRO B CD  1 
ATOM   4018 N N   . ASP B 1 42  ? -12.606 19.917  7.483   1.00 55.05  ? 42  ASP B N   1 
ATOM   4019 C CA  . ASP B 1 42  ? -13.862 19.543  6.826   1.00 47.41  ? 42  ASP B CA  1 
ATOM   4020 C C   . ASP B 1 42  ? -14.788 20.751  6.791   1.00 49.59  ? 42  ASP B C   1 
ATOM   4021 O O   . ASP B 1 42  ? -15.043 21.363  7.820   1.00 54.97  ? 42  ASP B O   1 
ATOM   4022 C CB  . ASP B 1 42  ? -14.531 18.371  7.559   1.00 49.91  ? 42  ASP B CB  1 
ATOM   4023 C CG  . ASP B 1 42  ? -15.876 17.950  6.932   1.00 58.31  ? 42  ASP B CG  1 
ATOM   4024 O OD1 . ASP B 1 42  ? -16.743 18.809  6.657   1.00 46.74  ? 42  ASP B OD1 1 
ATOM   4025 O OD2 . ASP B 1 42  ? -16.069 16.734  6.717   1.00 65.91  ? 42  ASP B OD2 1 
ATOM   4026 N N   . LEU B 1 43  ? -15.341 21.061  5.625   1.00 47.53  ? 43  LEU B N   1 
ATOM   4027 C CA  . LEU B 1 43  ? -16.063 22.318  5.454   1.00 48.52  ? 43  LEU B CA  1 
ATOM   4028 C C   . LEU B 1 43  ? -17.586 22.171  5.319   1.00 50.51  ? 43  LEU B C   1 
ATOM   4029 O O   . LEU B 1 43  ? -18.274 23.163  5.033   1.00 45.42  ? 43  LEU B O   1 
ATOM   4030 C CB  . LEU B 1 43  ? -15.514 23.070  4.230   1.00 49.53  ? 43  LEU B CB  1 
ATOM   4031 C CG  . LEU B 1 43  ? -13.993 23.215  4.050   1.00 45.97  ? 43  LEU B CG  1 
ATOM   4032 C CD1 . LEU B 1 43  ? -13.675 24.218  2.951   1.00 48.52  ? 43  LEU B CD1 1 
ATOM   4033 C CD2 . LEU B 1 43  ? -13.309 23.611  5.335   1.00 46.60  ? 43  LEU B CD2 1 
ATOM   4034 N N   . SER B 1 44  ? -18.101 20.955  5.540   1.00 53.57  ? 44  SER B N   1 
ATOM   4035 C CA  . SER B 1 44  ? -19.535 20.638  5.382   1.00 48.82  ? 44  SER B CA  1 
ATOM   4036 C C   . SER B 1 44  ? -20.435 21.709  5.953   1.00 52.78  ? 44  SER B C   1 
ATOM   4037 O O   . SER B 1 44  ? -21.387 22.163  5.314   1.00 50.82  ? 44  SER B O   1 
ATOM   4038 C CB  . SER B 1 44  ? -19.890 19.321  6.063   1.00 42.43  ? 44  SER B CB  1 
ATOM   4039 O OG  . SER B 1 44  ? -18.755 18.520  6.315   1.00 48.40  ? 44  SER B OG  1 
ATOM   4040 N N   . ILE B 1 45  ? -20.095 22.096  7.176   1.00 52.27  ? 45  ILE B N   1 
ATOM   4041 C CA  . ILE B 1 45  ? -20.827 23.060  7.973   1.00 49.86  ? 45  ILE B CA  1 
ATOM   4042 C C   . ILE B 1 45  ? -21.100 24.329  7.186   1.00 53.70  ? 45  ILE B C   1 
ATOM   4043 O O   . ILE B 1 45  ? -22.210 24.858  7.217   1.00 54.66  ? 45  ILE B O   1 
ATOM   4044 C CB  . ILE B 1 45  ? -20.049 23.393  9.275   1.00 65.93  ? 45  ILE B CB  1 
ATOM   4045 C CG1 . ILE B 1 45  ? -19.494 22.107  9.935   1.00 66.86  ? 45  ILE B CG1 1 
ATOM   4046 C CG2 . ILE B 1 45  ? -20.929 24.195  10.245  1.00 57.29  ? 45  ILE B CG2 1 
ATOM   4047 C CD1 . ILE B 1 45  ? -18.183 21.508  9.303   1.00 52.85  ? 45  ILE B CD1 1 
ATOM   4048 N N   . PHE B 1 46  ? -20.093 24.803  6.454   1.00 57.13  ? 46  PHE B N   1 
ATOM   4049 C CA  . PHE B 1 46  ? -20.240 26.035  5.666   1.00 56.80  ? 46  PHE B CA  1 
ATOM   4050 C C   . PHE B 1 46  ? -21.006 25.761  4.373   1.00 58.36  ? 46  PHE B C   1 
ATOM   4051 O O   . PHE B 1 46  ? -21.748 26.622  3.883   1.00 56.20  ? 46  PHE B O   1 
ATOM   4052 C CB  . PHE B 1 46  ? -18.868 26.666  5.367   1.00 52.11  ? 46  PHE B CB  1 
ATOM   4053 C CG  . PHE B 1 46  ? -17.996 26.820  6.589   1.00 51.49  ? 46  PHE B CG  1 
ATOM   4054 C CD1 . PHE B 1 46  ? -18.227 27.853  7.495   1.00 47.80  ? 46  PHE B CD1 1 
ATOM   4055 C CD2 . PHE B 1 46  ? -16.969 25.917  6.844   1.00 43.12  ? 46  PHE B CD2 1 
ATOM   4056 C CE1 . PHE B 1 46  ? -17.455 27.983  8.616   1.00 44.35  ? 46  PHE B CE1 1 
ATOM   4057 C CE2 . PHE B 1 46  ? -16.185 26.038  7.964   1.00 43.56  ? 46  PHE B CE2 1 
ATOM   4058 C CZ  . PHE B 1 46  ? -16.425 27.074  8.858   1.00 47.06  ? 46  PHE B CZ  1 
ATOM   4059 N N   . GLU B 1 47  ? -20.834 24.557  3.831   1.00 54.34  ? 47  GLU B N   1 
ATOM   4060 C CA  . GLU B 1 47  ? -21.576 24.159  2.641   1.00 57.61  ? 47  GLU B CA  1 
ATOM   4061 C C   . GLU B 1 47  ? -23.074 24.157  2.945   1.00 57.37  ? 47  GLU B C   1 
ATOM   4062 O O   . GLU B 1 47  ? -23.871 24.705  2.180   1.00 59.60  ? 47  GLU B O   1 
ATOM   4063 C CB  . GLU B 1 47  ? -21.115 22.781  2.145   1.00 59.67  ? 47  GLU B CB  1 
ATOM   4064 C CG  . GLU B 1 47  ? -21.458 22.494  0.681   1.00 61.69  ? 47  GLU B CG  1 
ATOM   4065 C CD  . GLU B 1 47  ? -20.678 21.321  0.101   1.00 60.37  ? 47  GLU B CD  1 
ATOM   4066 O OE1 . GLU B 1 47  ? -19.628 20.938  0.669   1.00 60.75  ? 47  GLU B OE1 1 
ATOM   4067 O OE2 . GLU B 1 47  ? -21.124 20.784  -0.930  1.00 53.25  ? 47  GLU B OE2 1 
ATOM   4068 N N   . VAL B 1 48  ? -23.448 23.557  4.073   1.00 55.64  ? 48  VAL B N   1 
ATOM   4069 C CA  . VAL B 1 48  ? -24.846 23.523  4.485   1.00 59.25  ? 48  VAL B CA  1 
ATOM   4070 C C   . VAL B 1 48  ? -25.387 24.952  4.698   1.00 62.16  ? 48  VAL B C   1 
ATOM   4071 O O   . VAL B 1 48  ? -26.424 25.328  4.133   1.00 66.65  ? 48  VAL B O   1 
ATOM   4072 C CB  . VAL B 1 48  ? -25.046 22.683  5.781   1.00 48.52  ? 48  VAL B CB  1 
ATOM   4073 C CG1 . VAL B 1 48  ? -26.510 22.596  6.110   1.00 53.28  ? 48  VAL B CG1 1 
ATOM   4074 C CG2 . VAL B 1 48  ? -24.468 21.293  5.634   1.00 41.32  ? 48  VAL B CG2 1 
ATOM   4075 N N   . LYS B 1 49  ? -24.680 25.742  5.502   1.00 58.07  ? 49  LYS B N   1 
ATOM   4076 C CA  . LYS B 1 49  ? -25.041 27.142  5.720   1.00 62.89  ? 49  LYS B CA  1 
ATOM   4077 C C   . LYS B 1 49  ? -25.208 27.882  4.396   1.00 62.83  ? 49  LYS B C   1 
ATOM   4078 O O   . LYS B 1 49  ? -26.202 28.561  4.169   1.00 63.88  ? 49  LYS B O   1 
ATOM   4079 C CB  . LYS B 1 49  ? -23.981 27.850  6.569   1.00 67.47  ? 49  LYS B CB  1 
ATOM   4080 C CG  . LYS B 1 49  ? -23.890 27.392  8.019   1.00 64.70  ? 49  LYS B CG  1 
ATOM   4081 C CD  . LYS B 1 49  ? -23.919 28.584  8.968   1.00 67.22  ? 49  LYS B CD  1 
ATOM   4082 C CE  . LYS B 1 49  ? -22.876 29.632  8.587   1.00 69.72  ? 49  LYS B CE  1 
ATOM   4083 N NZ  . LYS B 1 49  ? -23.055 30.935  9.290   1.00 67.00  ? 49  LYS B NZ  1 
ATOM   4084 N N   . MET B 1 50  ? -24.210 27.743  3.532   1.00 65.09  ? 50  MET B N   1 
ATOM   4085 C CA  . MET B 1 50  ? -24.230 28.337  2.200   1.00 68.31  ? 50  MET B CA  1 
ATOM   4086 C C   . MET B 1 50  ? -25.519 28.026  1.432   1.00 68.91  ? 50  MET B C   1 
ATOM   4087 O O   . MET B 1 50  ? -26.130 28.926  0.843   1.00 68.02  ? 50  MET B O   1 
ATOM   4088 C CB  . MET B 1 50  ? -23.014 27.855  1.397   1.00 65.64  ? 50  MET B CB  1 
ATOM   4089 C CG  . MET B 1 50  ? -22.842 28.552  0.069   1.00 67.08  ? 50  MET B CG  1 
ATOM   4090 S SD  . MET B 1 50  ? -22.641 30.328  0.271   1.00 72.32  ? 50  MET B SD  1 
ATOM   4091 C CE  . MET B 1 50  ? -20.908 30.394  0.728   1.00 69.31  ? 50  MET B CE  1 
ATOM   4092 N N   . GLY B 1 51  ? -25.920 26.753  1.431   1.00 66.51  ? 51  GLY B N   1 
ATOM   4093 C CA  . GLY B 1 51  ? -27.173 26.344  0.815   1.00 63.83  ? 51  GLY B CA  1 
ATOM   4094 C C   . GLY B 1 51  ? -28.368 27.081  1.406   1.00 73.95  ? 51  GLY B C   1 
ATOM   4095 O O   . GLY B 1 51  ? -29.217 27.611  0.679   1.00 72.67  ? 51  GLY B O   1 
ATOM   4096 N N   . LEU B 1 52  ? -28.426 27.128  2.734   1.00 70.09  ? 52  LEU B N   1 
ATOM   4097 C CA  . LEU B 1 52  ? -29.486 27.842  3.430   1.00 63.71  ? 52  LEU B CA  1 
ATOM   4098 C C   . LEU B 1 52  ? -29.397 29.366  3.271   1.00 70.50  ? 52  LEU B C   1 
ATOM   4099 O O   . LEU B 1 52  ? -30.391 30.061  3.474   1.00 77.19  ? 52  LEU B O   1 
ATOM   4100 C CB  . LEU B 1 52  ? -29.473 27.483  4.924   1.00 62.95  ? 52  LEU B CB  1 
ATOM   4101 C CG  . LEU B 1 52  ? -30.307 26.296  5.410   1.00 61.01  ? 52  LEU B CG  1 
ATOM   4102 C CD1 . LEU B 1 52  ? -29.914 25.006  4.703   1.00 60.98  ? 52  LEU B CD1 1 
ATOM   4103 C CD2 . LEU B 1 52  ? -30.149 26.152  6.901   1.00 57.86  ? 52  LEU B CD2 1 
ATOM   4104 N N   . ALA B 1 53  ? -28.220 29.886  2.920   1.00 69.94  ? 53  ALA B N   1 
ATOM   4105 C CA  . ALA B 1 53  ? -27.997 31.339  2.897   1.00 71.63  ? 53  ALA B CA  1 
ATOM   4106 C C   . ALA B 1 53  ? -28.957 32.082  1.971   1.00 75.33  ? 53  ALA B C   1 
ATOM   4107 O O   . ALA B 1 53  ? -29.290 31.610  0.880   1.00 74.85  ? 53  ALA B O   1 
ATOM   4108 C CB  . ALA B 1 53  ? -26.565 31.649  2.506   1.00 73.00  ? 53  ALA B CB  1 
ATOM   4109 N N   . THR B 1 54  ? -29.389 33.256  2.423   1.00 84.19  ? 54  THR B N   1 
ATOM   4110 C CA  . THR B 1 54  ? -30.409 34.044  1.729   1.00 88.38  ? 54  THR B CA  1 
ATOM   4111 C C   . THR B 1 54  ? -29.811 34.998  0.691   1.00 89.56  ? 54  THR B C   1 
ATOM   4112 O O   . THR B 1 54  ? -30.024 34.849  -0.519  1.00 84.13  ? 54  THR B O   1 
ATOM   4113 C CB  . THR B 1 54  ? -31.259 34.868  2.741   1.00 90.75  ? 54  THR B CB  1 
ATOM   4114 O OG1 . THR B 1 54  ? -30.437 35.275  3.848   1.00 91.31  ? 54  THR B OG1 1 
ATOM   4115 C CG2 . THR B 1 54  ? -32.422 34.043  3.273   1.00 83.88  ? 54  THR B CG2 1 
ATOM   4116 N N   . ASP B 1 55  ? -29.057 35.975  1.189   1.00 94.34  ? 55  ASP B N   1 
ATOM   4117 C CA  . ASP B 1 55  ? -28.483 37.037  0.373   1.00 91.30  ? 55  ASP B CA  1 
ATOM   4118 C C   . ASP B 1 55  ? -26.980 36.852  0.199   1.00 85.30  ? 55  ASP B C   1 
ATOM   4119 O O   . ASP B 1 55  ? -26.388 35.934  0.769   1.00 75.96  ? 55  ASP B O   1 
ATOM   4120 C CB  . ASP B 1 55  ? -28.768 38.385  1.017   1.00 88.09  ? 55  ASP B CB  1 
ATOM   4121 C CG  . ASP B 1 55  ? -28.325 38.424  2.458   1.00 92.23  ? 55  ASP B CG  1 
ATOM   4122 O OD1 . ASP B 1 55  ? -29.048 37.884  3.325   1.00 93.11  ? 55  ASP B OD1 1 
ATOM   4123 O OD2 . ASP B 1 55  ? -27.238 38.972  2.721   1.00 94.81  ? 55  ASP B OD2 1 
ATOM   4124 N N   . ASP B 1 56  ? -26.363 37.735  -0.579  1.00 89.60  ? 56  ASP B N   1 
ATOM   4125 C CA  . ASP B 1 56  ? -24.954 37.575  -0.920  1.00 84.54  ? 56  ASP B CA  1 
ATOM   4126 C C   . ASP B 1 56  ? -24.017 38.090  0.176   1.00 87.44  ? 56  ASP B C   1 
ATOM   4127 O O   . ASP B 1 56  ? -22.845 37.712  0.223   1.00 83.88  ? 56  ASP B O   1 
ATOM   4128 C CB  . ASP B 1 56  ? -24.652 38.265  -2.252  1.00 83.11  ? 56  ASP B CB  1 
ATOM   4129 C CG  . ASP B 1 56  ? -24.834 37.334  -3.443  1.00 84.79  ? 56  ASP B CG  1 
ATOM   4130 O OD1 . ASP B 1 56  ? -25.804 36.542  -3.441  1.00 79.08  ? 56  ASP B OD1 1 
ATOM   4131 O OD2 . ASP B 1 56  ? -23.997 37.383  -4.374  1.00 84.33  ? 56  ASP B OD2 1 
ATOM   4132 N N   . ARG B 1 57  ? -24.532 38.941  1.059   1.00 90.66  ? 57  ARG B N   1 
ATOM   4133 C CA  . ARG B 1 57  ? -23.752 39.402  2.206   1.00 85.47  ? 57  ARG B CA  1 
ATOM   4134 C C   . ARG B 1 57  ? -23.380 38.214  3.084   1.00 83.32  ? 57  ARG B C   1 
ATOM   4135 O O   . ARG B 1 57  ? -22.217 38.049  3.459   1.00 82.00  ? 57  ARG B O   1 
ATOM   4136 C CB  . ARG B 1 57  ? -24.532 40.435  3.019   1.00 91.73  ? 57  ARG B CB  1 
ATOM   4137 C CG  . ARG B 1 57  ? -25.257 41.471  2.174   1.00 94.73  ? 57  ARG B CG  1 
ATOM   4138 C CD  . ARG B 1 57  ? -26.247 42.253  3.014   1.00 95.99  ? 57  ARG B CD  1 
ATOM   4139 N NE  . ARG B 1 57  ? -25.965 43.685  2.994   1.00 97.52  ? 57  ARG B NE  1 
ATOM   4140 C CZ  . ARG B 1 57  ? -26.664 44.577  2.299   1.00 98.27  ? 57  ARG B CZ  1 
ATOM   4141 N NH1 . ARG B 1 57  ? -27.703 44.189  1.566   1.00 92.95  ? 57  ARG B NH1 1 
ATOM   4142 N NH2 . ARG B 1 57  ? -26.329 45.859  2.345   1.00 92.20  ? 57  ARG B NH2 1 
ATOM   4143 N N   . GLU B 1 58  ? -24.376 37.382  3.389   1.00 79.91  ? 58  GLU B N   1 
ATOM   4144 C CA  . GLU B 1 58  ? -24.174 36.202  4.219   1.00 75.31  ? 58  GLU B CA  1 
ATOM   4145 C C   . GLU B 1 58  ? -23.431 35.079  3.495   1.00 75.73  ? 58  GLU B C   1 
ATOM   4146 O O   . GLU B 1 58  ? -22.663 34.342  4.107   1.00 74.72  ? 58  GLU B O   1 
ATOM   4147 C CB  . GLU B 1 58  ? -25.506 35.672  4.729   1.00 77.53  ? 58  GLU B CB  1 
ATOM   4148 C CG  . GLU B 1 58  ? -25.346 34.462  5.620   1.00 75.47  ? 58  GLU B CG  1 
ATOM   4149 C CD  . GLU B 1 58  ? -26.655 34.001  6.182   1.00 80.16  ? 58  GLU B CD  1 
ATOM   4150 O OE1 . GLU B 1 58  ? -27.700 34.511  5.722   1.00 84.27  ? 58  GLU B OE1 1 
ATOM   4151 O OE2 . GLU B 1 58  ? -26.638 33.136  7.082   1.00 77.63  ? 58  GLU B OE2 1 
ATOM   4152 N N   . LYS B 1 59  ? -23.663 34.934  2.196   1.00 78.32  ? 59  LYS B N   1 
ATOM   4153 C CA  . LYS B 1 59  ? -22.895 33.973  1.413   1.00 69.69  ? 59  LYS B CA  1 
ATOM   4154 C C   . LYS B 1 59  ? -21.438 34.414  1.432   1.00 68.07  ? 59  LYS B C   1 
ATOM   4155 O O   . LYS B 1 59  ? -20.525 33.594  1.485   1.00 63.82  ? 59  LYS B O   1 
ATOM   4156 C CB  . LYS B 1 59  ? -23.427 33.876  -0.023  1.00 68.95  ? 59  LYS B CB  1 
ATOM   4157 C CG  . LYS B 1 59  ? -24.785 33.176  -0.159  1.00 70.18  ? 59  LYS B CG  1 
ATOM   4158 C CD  . LYS B 1 59  ? -25.474 33.485  -1.492  1.00 65.60  ? 59  LYS B CD  1 
ATOM   4159 C CE  . LYS B 1 59  ? -26.733 32.651  -1.688  1.00 65.11  ? 59  LYS B CE  1 
ATOM   4160 N NZ  . LYS B 1 59  ? -27.490 33.021  -2.918  1.00 72.37  ? 59  LYS B NZ  1 
ATOM   4161 N N   . ASP B 1 60  ? -21.234 35.729  1.414   1.00 75.73  ? 60  ASP B N   1 
ATOM   4162 C CA  . ASP B 1 60  ? -19.893 36.299  1.440   1.00 74.49  ? 60  ASP B CA  1 
ATOM   4163 C C   . ASP B 1 60  ? -19.171 35.938  2.737   1.00 69.70  ? 60  ASP B C   1 
ATOM   4164 O O   . ASP B 1 60  ? -18.062 35.403  2.698   1.00 67.36  ? 60  ASP B O   1 
ATOM   4165 C CB  . ASP B 1 60  ? -19.946 37.823  1.256   1.00 80.21  ? 60  ASP B CB  1 
ATOM   4166 C CG  . ASP B 1 60  ? -19.741 38.246  -0.193  1.00 75.45  ? 60  ASP B CG  1 
ATOM   4167 O OD1 . ASP B 1 60  ? -19.010 37.530  -0.915  1.00 63.16  ? 60  ASP B OD1 1 
ATOM   4168 O OD2 . ASP B 1 60  ? -20.307 39.288  -0.604  1.00 75.33  ? 60  ASP B OD2 1 
ATOM   4169 N N   . SER B 1 61  ? -19.804 36.218  3.877   1.00 69.31  ? 61  SER B N   1 
ATOM   4170 C CA  . SER B 1 61  ? -19.245 35.874  5.187   1.00 61.87  ? 61  SER B CA  1 
ATOM   4171 C C   . SER B 1 61  ? -18.898 34.398  5.307   1.00 61.11  ? 61  SER B C   1 
ATOM   4172 O O   . SER B 1 61  ? -17.802 34.051  5.764   1.00 58.10  ? 61  SER B O   1 
ATOM   4173 C CB  . SER B 1 61  ? -20.219 36.242  6.303   1.00 57.22  ? 61  SER B CB  1 
ATOM   4174 O OG  . SER B 1 61  ? -21.139 37.222  5.862   1.00 68.72  ? 61  SER B OG  1 
ATOM   4175 N N   . ILE B 1 62  ? -19.837 33.541  4.897   1.00 60.39  ? 62  ILE B N   1 
ATOM   4176 C CA  . ILE B 1 62  ? -19.721 32.094  5.082   1.00 60.08  ? 62  ILE B CA  1 
ATOM   4177 C C   . ILE B 1 62  ? -18.530 31.556  4.314   1.00 61.41  ? 62  ILE B C   1 
ATOM   4178 O O   . ILE B 1 62  ? -17.740 30.741  4.821   1.00 56.22  ? 62  ILE B O   1 
ATOM   4179 C CB  . ILE B 1 62  ? -20.993 31.334  4.610   1.00 65.97  ? 62  ILE B CB  1 
ATOM   4180 C CG1 . ILE B 1 62  ? -22.224 31.738  5.423   1.00 67.70  ? 62  ILE B CG1 1 
ATOM   4181 C CG2 . ILE B 1 62  ? -20.789 29.839  4.751   1.00 63.80  ? 62  ILE B CG2 1 
ATOM   4182 C CD1 . ILE B 1 62  ? -23.534 31.271  4.825   1.00 61.79  ? 62  ILE B CD1 1 
ATOM   4183 N N   . TYR B 1 63  ? -18.408 32.013  3.075   1.00 58.64  ? 63  TYR B N   1 
ATOM   4184 C CA  . TYR B 1 63  ? -17.320 31.559  2.246   1.00 58.02  ? 63  TYR B CA  1 
ATOM   4185 C C   . TYR B 1 63  ? -16.005 31.975  2.911   1.00 57.31  ? 63  TYR B C   1 
ATOM   4186 O O   . TYR B 1 63  ? -15.099 31.151  3.099   1.00 53.97  ? 63  TYR B O   1 
ATOM   4187 C CB  . TYR B 1 63  ? -17.443 32.106  0.820   1.00 56.38  ? 63  TYR B CB  1 
ATOM   4188 C CG  . TYR B 1 63  ? -16.257 31.714  -0.010  1.00 63.66  ? 63  TYR B CG  1 
ATOM   4189 C CD1 . TYR B 1 63  ? -15.936 30.377  -0.196  1.00 60.94  ? 63  TYR B CD1 1 
ATOM   4190 C CD2 . TYR B 1 63  ? -15.423 32.674  -0.566  1.00 69.55  ? 63  TYR B CD2 1 
ATOM   4191 C CE1 . TYR B 1 63  ? -14.830 30.005  -0.928  1.00 59.24  ? 63  TYR B CE1 1 
ATOM   4192 C CE2 . TYR B 1 63  ? -14.312 32.309  -1.299  1.00 67.17  ? 63  TYR B CE2 1 
ATOM   4193 C CZ  . TYR B 1 63  ? -14.025 30.972  -1.471  1.00 61.86  ? 63  TYR B CZ  1 
ATOM   4194 O OH  . TYR B 1 63  ? -12.928 30.606  -2.197  1.00 68.74  ? 63  TYR B OH  1 
ATOM   4195 N N   . ALA B 1 64  ? -15.925 33.245  3.307   1.00 59.20  ? 64  ALA B N   1 
ATOM   4196 C CA  . ALA B 1 64  ? -14.758 33.758  4.033   1.00 58.38  ? 64  ALA B CA  1 
ATOM   4197 C C   . ALA B 1 64  ? -14.390 32.870  5.221   1.00 52.42  ? 64  ALA B C   1 
ATOM   4198 O O   . ALA B 1 64  ? -13.207 32.602  5.449   1.00 53.57  ? 64  ALA B O   1 
ATOM   4199 C CB  . ALA B 1 64  ? -15.007 35.193  4.498   1.00 57.68  ? 64  ALA B CB  1 
ATOM   4200 N N   . CYS B 1 65  ? -15.399 32.400  5.958   1.00 47.87  ? 65  CYS B N   1 
ATOM   4201 C CA  . CYS B 1 65  ? -15.158 31.533  7.113   1.00 49.20  ? 65  CYS B CA  1 
ATOM   4202 C C   . CYS B 1 65  ? -14.603 30.180  6.694   1.00 48.06  ? 65  CYS B C   1 
ATOM   4203 O O   . CYS B 1 65  ? -13.666 29.658  7.316   1.00 42.60  ? 65  CYS B O   1 
ATOM   4204 C CB  . CYS B 1 65  ? -16.440 31.337  7.925   1.00 51.48  ? 65  CYS B CB  1 
ATOM   4205 S SG  . CYS B 1 65  ? -17.192 32.869  8.491   1.00 48.41  ? 65  CYS B SG  1 
ATOM   4206 N N   . ALA B 1 66  ? -15.183 29.618  5.633   1.00 50.75  ? 66  ALA B N   1 
ATOM   4207 C CA  . ALA B 1 66  ? -14.734 28.326  5.110   1.00 49.61  ? 66  ALA B CA  1 
ATOM   4208 C C   . ALA B 1 66  ? -13.263 28.373  4.710   1.00 47.90  ? 66  ALA B C   1 
ATOM   4209 O O   . ALA B 1 66  ? -12.485 27.451  5.027   1.00 44.98  ? 66  ALA B O   1 
ATOM   4210 C CB  . ALA B 1 66  ? -15.584 27.909  3.932   1.00 51.36  ? 66  ALA B CB  1 
ATOM   4211 N N   . MET B 1 67  ? -12.882 29.453  4.025   1.00 49.00  ? 67  MET B N   1 
ATOM   4212 C CA  . MET B 1 67  ? -11.497 29.596  3.594   1.00 50.53  ? 67  MET B CA  1 
ATOM   4213 C C   . MET B 1 67  ? -10.595 29.706  4.807   1.00 47.08  ? 67  MET B C   1 
ATOM   4214 O O   . MET B 1 67  ? -9.535  29.074  4.849   1.00 48.92  ? 67  MET B O   1 
ATOM   4215 C CB  . MET B 1 67  ? -11.311 30.799  2.673   1.00 53.57  ? 67  MET B CB  1 
ATOM   4216 C CG  . MET B 1 67  ? -9.873  30.940  2.158   1.00 53.25  ? 67  MET B CG  1 
ATOM   4217 S SD  . MET B 1 67  ? -9.345  29.756  0.891   1.00 52.38  ? 67  MET B SD  1 
ATOM   4218 C CE  . MET B 1 67  ? -10.196 30.471  -0.522  1.00 46.15  ? 67  MET B CE  1 
ATOM   4219 N N   . VAL B 1 68  ? -11.024 30.471  5.808   1.00 45.40  ? 68  VAL B N   1 
ATOM   4220 C CA  . VAL B 1 68  ? -10.222 30.585  7.020   1.00 45.22  ? 68  VAL B CA  1 
ATOM   4221 C C   . VAL B 1 68  ? -9.986  29.211  7.639   1.00 45.39  ? 68  VAL B C   1 
ATOM   4222 O O   . VAL B 1 68  ? -8.848  28.895  7.964   1.00 48.53  ? 68  VAL B O   1 
ATOM   4223 C CB  . VAL B 1 68  ? -10.856 31.543  8.068   1.00 50.50  ? 68  VAL B CB  1 
ATOM   4224 C CG1 . VAL B 1 68  ? -10.254 31.312  9.463   1.00 42.32  ? 68  VAL B CG1 1 
ATOM   4225 C CG2 . VAL B 1 68  ? -10.671 32.985  7.645   1.00 38.43  ? 68  VAL B CG2 1 
ATOM   4226 N N   . GLU B 1 69  ? -11.030 28.382  7.759   1.00 46.08  ? 69  GLU B N   1 
ATOM   4227 C CA  . GLU B 1 69  ? -10.876 27.042  8.360   1.00 47.16  ? 69  GLU B CA  1 
ATOM   4228 C C   . GLU B 1 69  ? -9.992  26.105  7.536   1.00 44.23  ? 69  GLU B C   1 
ATOM   4229 O O   . GLU B 1 69  ? -9.240  25.291  8.092   1.00 39.36  ? 69  GLU B O   1 
ATOM   4230 C CB  . GLU B 1 69  ? -12.239 26.370  8.577   1.00 49.43  ? 69  GLU B CB  1 
ATOM   4231 C CG  . GLU B 1 69  ? -13.057 26.928  9.735   1.00 48.91  ? 69  GLU B CG  1 
ATOM   4232 C CD  . GLU B 1 69  ? -12.218 27.254  10.955  1.00 48.06  ? 69  GLU B CD  1 
ATOM   4233 O OE1 . GLU B 1 69  ? -11.492 26.370  11.452  1.00 53.33  ? 69  GLU B OE1 1 
ATOM   4234 O OE2 . GLU B 1 69  ? -12.278 28.411  11.413  1.00 50.97  ? 69  GLU B OE2 1 
ATOM   4235 N N   . ALA B 1 70  ? -10.091 26.231  6.211   1.00 46.53  ? 70  ALA B N   1 
ATOM   4236 C CA  . ALA B 1 70  ? -9.297  25.417  5.282   1.00 46.94  ? 70  ALA B CA  1 
ATOM   4237 C C   . ALA B 1 70  ? -7.804  25.726  5.358   1.00 49.15  ? 70  ALA B C   1 
ATOM   4238 O O   . ALA B 1 70  ? -6.967  24.826  5.174   1.00 45.94  ? 70  ALA B O   1 
ATOM   4239 C CB  . ALA B 1 70  ? -9.796  25.611  3.854   1.00 47.15  ? 70  ALA B CB  1 
ATOM   4240 N N   . THR B 1 71  ? -7.479  26.989  5.653   1.00 46.80  ? 71  THR B N   1 
ATOM   4241 C CA  . THR B 1 71  ? -6.091  27.473  5.651   1.00 52.35  ? 71  THR B CA  1 
ATOM   4242 C C   . THR B 1 71  ? -5.464  27.843  7.021   1.00 52.47  ? 71  THR B C   1 
ATOM   4243 O O   . THR B 1 71  ? -4.231  27.907  7.149   1.00 45.66  ? 71  THR B O   1 
ATOM   4244 C CB  . THR B 1 71  ? -5.996  28.693  4.779   1.00 51.43  ? 71  THR B CB  1 
ATOM   4245 O OG1 . THR B 1 71  ? -6.846  29.706  5.339   1.00 46.89  ? 71  THR B OG1 1 
ATOM   4246 C CG2 . THR B 1 71  ? -6.443  28.342  3.339   1.00 44.70  ? 71  THR B CG2 1 
ATOM   4247 N N   . LYS B 1 72  ? -6.321  28.086  8.017   1.00 51.34  ? 72  LYS B N   1 
ATOM   4248 C CA  . LYS B 1 72  ? -5.937  28.460  9.385   1.00 43.58  ? 72  LYS B CA  1 
ATOM   4249 C C   . LYS B 1 72  ? -4.605  27.918  9.873   1.00 44.29  ? 72  LYS B C   1 
ATOM   4250 O O   . LYS B 1 72  ? -3.763  28.690  10.317  1.00 47.89  ? 72  LYS B O   1 
ATOM   4251 C CB  . LYS B 1 72  ? -7.022  27.999  10.353  1.00 47.06  ? 72  LYS B CB  1 
ATOM   4252 C CG  . LYS B 1 72  ? -7.131  28.827  11.607  1.00 47.47  ? 72  LYS B CG  1 
ATOM   4253 C CD  . LYS B 1 72  ? -8.523  28.685  12.212  1.00 52.74  ? 72  LYS B CD  1 
ATOM   4254 C CE  . LYS B 1 72  ? -8.792  29.697  13.320  1.00 48.49  ? 72  LYS B CE  1 
ATOM   4255 N NZ  . LYS B 1 72  ? -10.125 29.429  13.908  1.00 54.28  ? 72  LYS B NZ  1 
ATOM   4256 N N   . PHE B 1 73  ? -4.418  26.599  9.789   1.00 42.67  ? 73  PHE B N   1 
ATOM   4257 C CA  . PHE B 1 73  ? -3.211  25.945  10.309  1.00 43.92  ? 73  PHE B CA  1 
ATOM   4258 C C   . PHE B 1 73  ? -2.313  25.293  9.260   1.00 41.24  ? 73  PHE B C   1 
ATOM   4259 O O   . PHE B 1 73  ? -1.453  24.495  9.612   1.00 43.12  ? 73  PHE B O   1 
ATOM   4260 C CB  . PHE B 1 73  ? -3.597  24.875  11.345  1.00 53.14  ? 73  PHE B CB  1 
ATOM   4261 C CG  . PHE B 1 73  ? -4.451  25.404  12.455  1.00 51.71  ? 73  PHE B CG  1 
ATOM   4262 C CD1 . PHE B 1 73  ? -3.877  26.059  13.537  1.00 51.21  ? 73  PHE B CD1 1 
ATOM   4263 C CD2 . PHE B 1 73  ? -5.826  25.286  12.400  1.00 50.98  ? 73  PHE B CD2 1 
ATOM   4264 C CE1 . PHE B 1 73  ? -4.656  26.576  14.551  1.00 49.20  ? 73  PHE B CE1 1 
ATOM   4265 C CE2 . PHE B 1 73  ? -6.616  25.801  13.409  1.00 55.44  ? 73  PHE B CE2 1 
ATOM   4266 C CZ  . PHE B 1 73  ? -6.029  26.447  14.489  1.00 52.94  ? 73  PHE B CZ  1 
ATOM   4267 N N   . CYS B 1 74  ? -2.487  25.621  7.984   1.00 40.58  ? 74  CYS B N   1 
ATOM   4268 C CA  . CYS B 1 74  ? -1.721  24.916  6.947   1.00 47.59  ? 74  CYS B CA  1 
ATOM   4269 C C   . CYS B 1 74  ? -0.575  25.740  6.343   1.00 51.48  ? 74  CYS B C   1 
ATOM   4270 O O   . CYS B 1 74  ? 0.291   25.181  5.666   1.00 49.27  ? 74  CYS B O   1 
ATOM   4271 C CB  . CYS B 1 74  ? -2.643  24.459  5.824   1.00 38.87  ? 74  CYS B CB  1 
ATOM   4272 S SG  . CYS B 1 74  ? -3.157  25.783  4.690   1.00 45.81  ? 74  CYS B SG  1 
ATOM   4273 N N   . ALA B 1 75  ? -0.579  27.053  6.592   1.00 48.74  ? 75  ALA B N   1 
ATOM   4274 C CA  . ALA B 1 75  ? 0.429   27.982  6.063   1.00 48.51  ? 75  ALA B CA  1 
ATOM   4275 C C   . ALA B 1 75  ? 1.890   27.503  6.260   1.00 50.70  ? 75  ALA B C   1 
ATOM   4276 O O   . ALA B 1 75  ? 2.198   26.795  7.225   1.00 47.82  ? 75  ALA B O   1 
ATOM   4277 C CB  . ALA B 1 75  ? 0.243   29.343  6.689   1.00 38.10  ? 75  ALA B CB  1 
ATOM   4278 N N   . PRO B 1 76  ? 2.786   27.871  5.319   1.00 49.81  ? 76  PRO B N   1 
ATOM   4279 C CA  . PRO B 1 76  ? 4.204   27.490  5.416   1.00 47.43  ? 76  PRO B CA  1 
ATOM   4280 C C   . PRO B 1 76  ? 4.957   28.386  6.398   1.00 50.93  ? 76  PRO B C   1 
ATOM   4281 O O   . PRO B 1 76  ? 5.153   29.589  6.150   1.00 53.31  ? 76  PRO B O   1 
ATOM   4282 C CB  . PRO B 1 76  ? 4.714   27.671  3.986   1.00 46.23  ? 76  PRO B CB  1 
ATOM   4283 C CG  . PRO B 1 76  ? 3.827   28.763  3.416   1.00 42.15  ? 76  PRO B CG  1 
ATOM   4284 C CD  . PRO B 1 76  ? 2.483   28.606  4.072   1.00 42.77  ? 76  PRO B CD  1 
ATOM   4285 N N   . ILE B 1 77  ? 5.378   27.798  7.512   1.00 47.96  ? 77  ILE B N   1 
ATOM   4286 C CA  . ILE B 1 77  ? 5.840   28.591  8.648   1.00 48.23  ? 77  ILE B CA  1 
ATOM   4287 C C   . ILE B 1 77  ? 7.286   29.039  8.461   1.00 49.76  ? 77  ILE B C   1 
ATOM   4288 O O   . ILE B 1 77  ? 7.597   30.227  8.606   1.00 47.17  ? 77  ILE B O   1 
ATOM   4289 C CB  . ILE B 1 77  ? 5.675   27.806  9.989   1.00 48.65  ? 77  ILE B CB  1 
ATOM   4290 C CG1 . ILE B 1 77  ? 4.181   27.643  10.344  1.00 49.00  ? 77  ILE B CG1 1 
ATOM   4291 C CG2 . ILE B 1 77  ? 6.421   28.484  11.108  1.00 42.11  ? 77  ILE B CG2 1 
ATOM   4292 C CD1 . ILE B 1 77  ? 3.318   28.897  10.127  1.00 40.38  ? 77  ILE B CD1 1 
ATOM   4293 N N   . TYR B 1 78  ? 8.168   28.099  8.126   1.00 52.78  ? 78  TYR B N   1 
ATOM   4294 C CA  . TYR B 1 78  ? 9.553   28.447  7.829   1.00 50.32  ? 78  TYR B CA  1 
ATOM   4295 C C   . TYR B 1 78  ? 9.616   29.565  6.789   1.00 51.89  ? 78  TYR B C   1 
ATOM   4296 O O   . TYR B 1 78  ? 10.407  30.489  6.904   1.00 58.87  ? 78  TYR B O   1 
ATOM   4297 C CB  . TYR B 1 78  ? 10.328  27.233  7.331   1.00 50.03  ? 78  TYR B CB  1 
ATOM   4298 C CG  . TYR B 1 78  ? 11.806  27.485  7.120   1.00 54.54  ? 78  TYR B CG  1 
ATOM   4299 C CD1 . TYR B 1 78  ? 12.275  28.167  5.999   1.00 56.10  ? 78  TYR B CD1 1 
ATOM   4300 C CD2 . TYR B 1 78  ? 12.740  27.009  8.030   1.00 56.99  ? 78  TYR B CD2 1 
ATOM   4301 C CE1 . TYR B 1 78  ? 13.632  28.387  5.812   1.00 58.46  ? 78  TYR B CE1 1 
ATOM   4302 C CE2 . TYR B 1 78  ? 14.098  27.218  7.850   1.00 59.27  ? 78  TYR B CE2 1 
ATOM   4303 C CZ  . TYR B 1 78  ? 14.535  27.910  6.743   1.00 63.69  ? 78  TYR B CZ  1 
ATOM   4304 O OH  . TYR B 1 78  ? 15.883  28.111  6.574   1.00 68.27  ? 78  TYR B OH  1 
ATOM   4305 N N   . GLU B 1 79  ? 8.767   29.486  5.780   1.00 47.42  ? 79  GLU B N   1 
ATOM   4306 C CA  . GLU B 1 79  ? 8.846   30.434  4.686   1.00 53.69  ? 79  GLU B CA  1 
ATOM   4307 C C   . GLU B 1 79  ? 8.256   31.764  5.117   1.00 52.29  ? 79  GLU B C   1 
ATOM   4308 O O   . GLU B 1 79  ? 8.783   32.822  4.774   1.00 53.03  ? 79  GLU B O   1 
ATOM   4309 C CB  . GLU B 1 79  ? 8.130   29.891  3.426   1.00 50.15  ? 79  GLU B CB  1 
ATOM   4310 C CG  . GLU B 1 79  ? 8.873   28.762  2.716   1.00 41.07  ? 79  GLU B CG  1 
ATOM   4311 C CD  . GLU B 1 79  ? 8.928   27.494  3.542   1.00 45.19  ? 79  GLU B CD  1 
ATOM   4312 O OE1 . GLU B 1 79  ? 8.036   27.317  4.398   1.00 54.03  ? 79  GLU B OE1 1 
ATOM   4313 O OE2 . GLU B 1 79  ? 9.845   26.674  3.345   1.00 38.56  ? 79  GLU B OE2 1 
ATOM   4314 N N   . CYS B 1 80  ? 7.164   31.713  5.873   1.00 52.16  ? 80  CYS B N   1 
ATOM   4315 C CA  . CYS B 1 80  ? 6.483   32.943  6.260   1.00 55.49  ? 80  CYS B CA  1 
ATOM   4316 C C   . CYS B 1 80  ? 7.377   33.777  7.178   1.00 51.29  ? 80  CYS B C   1 
ATOM   4317 O O   . CYS B 1 80  ? 7.372   35.008  7.124   1.00 54.87  ? 80  CYS B O   1 
ATOM   4318 C CB  . CYS B 1 80  ? 5.146   32.633  6.937   1.00 52.40  ? 80  CYS B CB  1 
ATOM   4319 S SG  . CYS B 1 80  ? 3.701   32.728  5.849   1.00 49.58  ? 80  CYS B SG  1 
ATOM   4320 N N   . GLY B 1 81  ? 8.147   33.086  8.007   1.00 48.93  ? 81  GLY B N   1 
ATOM   4321 C CA  . GLY B 1 81  ? 9.053   33.735  8.928   1.00 56.58  ? 81  GLY B CA  1 
ATOM   4322 C C   . GLY B 1 81  ? 10.121  34.472  8.163   1.00 56.36  ? 81  GLY B C   1 
ATOM   4323 O O   . GLY B 1 81  ? 10.370  35.650  8.423   1.00 54.34  ? 81  GLY B O   1 
ATOM   4324 N N   . TRP B 1 82  ? 10.739  33.773  7.212   1.00 57.36  ? 82  TRP B N   1 
ATOM   4325 C CA  . TRP B 1 82  ? 11.772  34.356  6.350   1.00 57.74  ? 82  TRP B CA  1 
ATOM   4326 C C   . TRP B 1 82  ? 11.296  35.665  5.716   1.00 55.49  ? 82  TRP B C   1 
ATOM   4327 O O   . TRP B 1 82  ? 11.886  36.725  5.930   1.00 51.08  ? 82  TRP B O   1 
ATOM   4328 C CB  . TRP B 1 82  ? 12.192  33.355  5.267   1.00 58.97  ? 82  TRP B CB  1 
ATOM   4329 C CG  . TRP B 1 82  ? 13.161  33.919  4.265   1.00 67.84  ? 82  TRP B CG  1 
ATOM   4330 C CD1 . TRP B 1 82  ? 12.918  34.177  2.943   1.00 63.57  ? 82  TRP B CD1 1 
ATOM   4331 C CD2 . TRP B 1 82  ? 14.521  34.308  4.504   1.00 67.28  ? 82  TRP B CD2 1 
ATOM   4332 N NE1 . TRP B 1 82  ? 14.040  34.696  2.348   1.00 61.66  ? 82  TRP B NE1 1 
ATOM   4333 C CE2 . TRP B 1 82  ? 15.041  34.787  3.282   1.00 67.29  ? 82  TRP B CE2 1 
ATOM   4334 C CE3 . TRP B 1 82  ? 15.353  34.293  5.628   1.00 67.77  ? 82  TRP B CE3 1 
ATOM   4335 C CZ2 . TRP B 1 82  ? 16.358  35.254  3.155   1.00 65.59  ? 82  TRP B CZ2 1 
ATOM   4336 C CZ3 . TRP B 1 82  ? 16.664  34.758  5.497   1.00 71.03  ? 82  TRP B CZ3 1 
ATOM   4337 C CH2 . TRP B 1 82  ? 17.150  35.227  4.269   1.00 66.06  ? 82  TRP B CH2 1 
ATOM   4338 N N   . ALA B 1 83  ? 10.188  35.599  4.983   1.00 54.82  ? 83  ALA B N   1 
ATOM   4339 C CA  . ALA B 1 83  ? 9.625   36.778  4.323   1.00 52.61  ? 83  ALA B CA  1 
ATOM   4340 C C   . ALA B 1 83  ? 9.332   37.935  5.280   1.00 50.22  ? 83  ALA B C   1 
ATOM   4341 O O   . ALA B 1 83  ? 9.033   39.046  4.846   1.00 49.04  ? 83  ALA B O   1 
ATOM   4342 C CB  . ALA B 1 83  ? 8.349   36.389  3.576   1.00 49.75  ? 83  ALA B CB  1 
ATOM   4343 N N   . CYS B 1 84  ? 9.412   37.663  6.582   1.00 54.78  ? 84  CYS B N   1 
ATOM   4344 C CA  . CYS B 1 84  ? 8.976   38.611  7.601   1.00 56.14  ? 84  CYS B CA  1 
ATOM   4345 C C   . CYS B 1 84  ? 10.104  39.022  8.568   1.00 53.76  ? 84  CYS B C   1 
ATOM   4346 O O   . CYS B 1 84  ? 9.921   39.917  9.387   1.00 49.22  ? 84  CYS B O   1 
ATOM   4347 C CB  . CYS B 1 84  ? 7.801   38.019  8.387   1.00 48.47  ? 84  CYS B CB  1 
ATOM   4348 S SG  . CYS B 1 84  ? 6.168   38.324  7.678   1.00 45.80  ? 84  CYS B SG  1 
ATOM   4349 N N   . CYS B 1 85  ? 11.265  38.380  8.466   1.00 49.54  ? 85  CYS B N   1 
ATOM   4350 C CA  . CYS B 1 85  ? 12.367  38.687  9.372   1.00 50.54  ? 85  CYS B CA  1 
ATOM   4351 C C   . CYS B 1 85  ? 12.909  40.102  9.124   1.00 60.94  ? 85  CYS B C   1 
ATOM   4352 O O   . CYS B 1 85  ? 12.663  40.697  8.057   1.00 54.61  ? 85  CYS B O   1 
ATOM   4353 C CB  . CYS B 1 85  ? 13.475  37.651  9.237   1.00 53.95  ? 85  CYS B CB  1 
ATOM   4354 S SG  . CYS B 1 85  ? 14.538  37.861  7.816   1.00 57.45  ? 85  CYS B SG  1 
ATOM   4355 N N   . THR B 1 86  ? 13.629  40.638  10.116  1.00 54.79  ? 86  THR B N   1 
ATOM   4356 C CA  . THR B 1 86  ? 13.961  42.074  10.157  1.00 58.81  ? 86  THR B CA  1 
ATOM   4357 C C   . THR B 1 86  ? 14.777  42.554  8.949   1.00 57.69  ? 86  THR B C   1 
ATOM   4358 O O   . THR B 1 86  ? 14.484  43.605  8.379   1.00 50.93  ? 86  THR B O   1 
ATOM   4359 C CB  . THR B 1 86  ? 14.733  42.440  11.449  1.00 49.65  ? 86  THR B CB  1 
ATOM   4360 O OG1 . THR B 1 86  ? 15.634  41.376  11.796  1.00 51.01  ? 86  THR B OG1 1 
ATOM   4361 C CG2 . THR B 1 86  ? 13.755  42.692  12.593  1.00 50.57  ? 86  THR B CG2 1 
ATOM   4362 N N   . GLY B 1 87  ? 15.793  41.777  8.571   1.00 56.35  ? 87  GLY B N   1 
ATOM   4363 C CA  . GLY B 1 87  ? 16.609  42.102  7.421   1.00 59.69  ? 87  GLY B CA  1 
ATOM   4364 C C   . GLY B 1 87  ? 15.780  42.179  6.151   1.00 60.00  ? 87  GLY B C   1 
ATOM   4365 O O   . GLY B 1 87  ? 15.989  43.062  5.309   1.00 60.18  ? 87  GLY B O   1 
ATOM   4366 N N   . MET B 1 88  ? 14.827  41.256  6.025   1.00 56.96  ? 88  MET B N   1 
ATOM   4367 C CA  . MET B 1 88  ? 13.995  41.148  4.833   1.00 53.09  ? 88  MET B CA  1 
ATOM   4368 C C   . MET B 1 88  ? 12.885  42.202  4.799   1.00 48.95  ? 88  MET B C   1 
ATOM   4369 O O   . MET B 1 88  ? 12.413  42.583  3.734   1.00 52.50  ? 88  MET B O   1 
ATOM   4370 C CB  . MET B 1 88  ? 13.406  39.741  4.751   1.00 51.51  ? 88  MET B CB  1 
ATOM   4371 C CG  . MET B 1 88  ? 12.570  39.486  3.523   1.00 55.38  ? 88  MET B CG  1 
ATOM   4372 S SD  . MET B 1 88  ? 13.552  39.469  2.011   1.00 45.27  ? 88  MET B SD  1 
ATOM   4373 C CE  . MET B 1 88  ? 14.709  38.159  2.396   1.00 48.24  ? 88  MET B CE  1 
ATOM   4374 N N   . VAL B 1 89  ? 12.471  42.674  5.967   1.00 55.07  ? 89  VAL B N   1 
ATOM   4375 C CA  . VAL B 1 89  ? 11.478  43.737  6.035   1.00 50.29  ? 89  VAL B CA  1 
ATOM   4376 C C   . VAL B 1 89  ? 12.175  45.038  5.695   1.00 58.08  ? 89  VAL B C   1 
ATOM   4377 O O   . VAL B 1 89  ? 11.610  45.917  5.033   1.00 58.03  ? 89  VAL B O   1 
ATOM   4378 C CB  . VAL B 1 89  ? 10.830  43.822  7.424   1.00 48.70  ? 89  VAL B CB  1 
ATOM   4379 C CG1 . VAL B 1 89  ? 9.886   44.997  7.510   1.00 51.06  ? 89  VAL B CG1 1 
ATOM   4380 C CG2 . VAL B 1 89  ? 10.103  42.552  7.728   1.00 48.08  ? 89  VAL B CG2 1 
ATOM   4381 N N   . GLU B 1 90  ? 13.423  45.143  6.147   1.00 55.37  ? 90  GLU B N   1 
ATOM   4382 C CA  . GLU B 1 90  ? 14.249  46.298  5.849   1.00 59.28  ? 90  GLU B CA  1 
ATOM   4383 C C   . GLU B 1 90  ? 14.620  46.317  4.366   1.00 56.43  ? 90  GLU B C   1 
ATOM   4384 O O   . GLU B 1 90  ? 14.359  47.294  3.664   1.00 50.37  ? 90  GLU B O   1 
ATOM   4385 C CB  . GLU B 1 90  ? 15.503  46.302  6.726   1.00 58.26  ? 90  GLU B CB  1 
ATOM   4386 C CG  . GLU B 1 90  ? 16.253  47.623  6.697   1.00 69.60  ? 90  GLU B CG  1 
ATOM   4387 C CD  . GLU B 1 90  ? 17.011  47.902  7.983   1.00 75.04  ? 90  GLU B CD  1 
ATOM   4388 O OE1 . GLU B 1 90  ? 18.240  48.133  7.908   1.00 77.15  ? 90  GLU B OE1 1 
ATOM   4389 O OE2 . GLU B 1 90  ? 16.375  47.902  9.062   1.00 67.59  ? 90  GLU B OE2 1 
ATOM   4390 N N   . ASN B 1 91  ? 15.207  45.225  3.890   1.00 53.26  ? 91  ASN B N   1 
ATOM   4391 C CA  . ASN B 1 91  ? 15.674  45.169  2.515   1.00 49.73  ? 91  ASN B CA  1 
ATOM   4392 C C   . ASN B 1 91  ? 14.548  45.185  1.505   1.00 53.97  ? 91  ASN B C   1 
ATOM   4393 O O   . ASN B 1 91  ? 14.642  45.858  0.482   1.00 55.05  ? 91  ASN B O   1 
ATOM   4394 C CB  . ASN B 1 91  ? 16.548  43.941  2.305   1.00 49.26  ? 91  ASN B CB  1 
ATOM   4395 C CG  . ASN B 1 91  ? 17.950  44.159  2.808   1.00 56.86  ? 91  ASN B CG  1 
ATOM   4396 O OD1 . ASN B 1 91  ? 18.373  45.305  2.981   1.00 61.91  ? 91  ASN B OD1 1 
ATOM   4397 N ND2 . ASN B 1 91  ? 18.686  43.074  3.040   1.00 55.87  ? 91  ASN B ND2 1 
ATOM   4398 N N   . GLY B 1 92  ? 13.485  44.444  1.790   1.00 55.01  ? 92  GLY B N   1 
ATOM   4399 C CA  . GLY B 1 92  ? 12.365  44.356  0.875   1.00 47.60  ? 92  GLY B CA  1 
ATOM   4400 C C   . GLY B 1 92  ? 11.643  45.678  0.711   1.00 49.30  ? 92  GLY B C   1 
ATOM   4401 O O   . GLY B 1 92  ? 11.088  45.962  -0.335  1.00 52.84  ? 92  GLY B O   1 
ATOM   4402 N N   . LEU B 1 93  ? 11.651  46.504  1.746   1.00 54.92  ? 93  LEU B N   1 
ATOM   4403 C CA  . LEU B 1 93  ? 10.936  47.771  1.675   1.00 53.82  ? 93  LEU B CA  1 
ATOM   4404 C C   . LEU B 1 93  ? 11.732  48.878  0.972   1.00 55.11  ? 93  LEU B C   1 
ATOM   4405 O O   . LEU B 1 93  ? 11.177  49.645  0.173   1.00 52.80  ? 93  LEU B O   1 
ATOM   4406 C CB  . LEU B 1 93  ? 10.552  48.241  3.079   1.00 52.01  ? 93  LEU B CB  1 
ATOM   4407 C CG  . LEU B 1 93  ? 9.350   47.618  3.775   1.00 48.46  ? 93  LEU B CG  1 
ATOM   4408 C CD1 . LEU B 1 93  ? 9.330   48.132  5.192   1.00 57.87  ? 93  LEU B CD1 1 
ATOM   4409 C CD2 . LEU B 1 93  ? 8.055   47.974  3.063   1.00 44.65  ? 93  LEU B CD2 1 
ATOM   4410 N N   . LYS B 1 94  ? 13.021  48.979  1.274   1.00 47.42  ? 94  LYS B N   1 
ATOM   4411 C CA  . LYS B 1 94  ? 13.756  50.151  0.833   1.00 58.84  ? 94  LYS B CA  1 
ATOM   4412 C C   . LYS B 1 94  ? 14.319  49.923  -0.572  1.00 58.74  ? 94  LYS B C   1 
ATOM   4413 O O   . LYS B 1 94  ? 14.533  50.893  -1.307  1.00 56.63  ? 94  LYS B O   1 
ATOM   4414 C CB  . LYS B 1 94  ? 14.850  50.534  1.844   1.00 51.57  ? 94  LYS B CB  1 
ATOM   4415 C CG  . LYS B 1 94  ? 15.928  49.505  2.067   1.00 50.61  ? 94  LYS B CG  1 
ATOM   4416 C CD  . LYS B 1 94  ? 16.785  49.910  3.271   1.00 61.14  ? 94  LYS B CD  1 
ATOM   4417 C CE  . LYS B 1 94  ? 17.972  48.969  3.483   1.00 65.11  ? 94  LYS B CE  1 
ATOM   4418 N NZ  . LYS B 1 94  ? 18.857  49.403  4.609   1.00 64.93  ? 94  LYS B NZ  1 
ATOM   4419 N N   . TRP B 1 95  ? 14.514  48.652  -0.944  1.00 53.25  ? 95  TRP B N   1 
ATOM   4420 C CA  . TRP B 1 95  ? 14.806  48.247  -2.324  1.00 48.71  ? 95  TRP B CA  1 
ATOM   4421 C C   . TRP B 1 95  ? 14.007  49.085  -3.312  1.00 51.98  ? 95  TRP B C   1 
ATOM   4422 O O   . TRP B 1 95  ? 14.511  49.472  -4.364  1.00 57.13  ? 95  TRP B O   1 
ATOM   4423 C CB  . TRP B 1 95  ? 14.488  46.752  -2.538  1.00 47.11  ? 95  TRP B CB  1 
ATOM   4424 C CG  . TRP B 1 95  ? 14.669  46.187  -3.969  1.00 46.45  ? 95  TRP B CG  1 
ATOM   4425 C CD1 . TRP B 1 95  ? 15.714  45.422  -4.419  1.00 48.21  ? 95  TRP B CD1 1 
ATOM   4426 C CD2 . TRP B 1 95  ? 13.760  46.299  -5.085  1.00 46.23  ? 95  TRP B CD2 1 
ATOM   4427 N NE1 . TRP B 1 95  ? 15.520  45.070  -5.731  1.00 45.63  ? 95  TRP B NE1 1 
ATOM   4428 C CE2 . TRP B 1 95  ? 14.333  45.600  -6.167  1.00 42.66  ? 95  TRP B CE2 1 
ATOM   4429 C CE3 . TRP B 1 95  ? 12.525  46.932  -5.277  1.00 46.71  ? 95  TRP B CE3 1 
ATOM   4430 C CZ2 . TRP B 1 95  ? 13.725  45.522  -7.419  1.00 45.98  ? 95  TRP B CZ2 1 
ATOM   4431 C CZ3 . TRP B 1 95  ? 11.921  46.856  -6.525  1.00 49.12  ? 95  TRP B CZ3 1 
ATOM   4432 C CH2 . TRP B 1 95  ? 12.523  46.154  -7.580  1.00 48.43  ? 95  TRP B CH2 1 
ATOM   4433 N N   . PHE B 1 96  ? 12.759  49.378  -2.978  1.00 48.84  ? 96  PHE B N   1 
ATOM   4434 C CA  . PHE B 1 96  ? 11.915  50.076  -3.925  1.00 52.53  ? 96  PHE B CA  1 
ATOM   4435 C C   . PHE B 1 96  ? 12.410  51.486  -4.143  1.00 56.05  ? 96  PHE B C   1 
ATOM   4436 O O   . PHE B 1 96  ? 12.416  51.980  -5.274  1.00 58.11  ? 96  PHE B O   1 
ATOM   4437 C CB  . PHE B 1 96  ? 10.459  50.044  -3.475  1.00 51.17  ? 96  PHE B CB  1 
ATOM   4438 C CG  . PHE B 1 96  ? 9.801   48.729  -3.754  1.00 56.71  ? 96  PHE B CG  1 
ATOM   4439 C CD1 . PHE B 1 96  ? 9.979   47.657  -2.891  1.00 55.81  ? 96  PHE B CD1 1 
ATOM   4440 C CD2 . PHE B 1 96  ? 9.063   48.540  -4.911  1.00 55.78  ? 96  PHE B CD2 1 
ATOM   4441 C CE1 . PHE B 1 96  ? 9.405   46.433  -3.156  1.00 53.57  ? 96  PHE B CE1 1 
ATOM   4442 C CE2 . PHE B 1 96  ? 8.483   47.321  -5.180  1.00 52.59  ? 96  PHE B CE2 1 
ATOM   4443 C CZ  . PHE B 1 96  ? 8.654   46.264  -4.304  1.00 53.87  ? 96  PHE B CZ  1 
ATOM   4444 N N   . ASP B 1 97  ? 12.874  52.119  -3.079  1.00 54.21  ? 97  ASP B N   1 
ATOM   4445 C CA  . ASP B 1 97  ? 13.484  53.429  -3.222  1.00 59.87  ? 97  ASP B CA  1 
ATOM   4446 C C   . ASP B 1 97  ? 14.792  53.363  -4.064  1.00 53.31  ? 97  ASP B C   1 
ATOM   4447 O O   . ASP B 1 97  ? 15.081  54.274  -4.850  1.00 53.79  ? 97  ASP B O   1 
ATOM   4448 C CB  . ASP B 1 97  ? 13.719  54.025  -1.834  1.00 50.71  ? 97  ASP B CB  1 
ATOM   4449 C CG  . ASP B 1 97  ? 12.441  54.536  -1.205  1.00 55.02  ? 97  ASP B CG  1 
ATOM   4450 O OD1 . ASP B 1 97  ? 11.683  55.253  -1.899  1.00 57.86  ? 97  ASP B OD1 1 
ATOM   4451 O OD2 . ASP B 1 97  ? 12.193  54.231  -0.020  1.00 53.00  ? 97  ASP B OD2 1 
ATOM   4452 N N   . LYS B 1 98  ? 15.544  52.274  -3.914  1.00 45.75  ? 98  LYS B N   1 
ATOM   4453 C CA  . LYS B 1 98  ? 16.796  52.052  -4.642  1.00 47.09  ? 98  LYS B CA  1 
ATOM   4454 C C   . LYS B 1 98  ? 16.616  51.518  -6.074  1.00 54.63  ? 98  LYS B C   1 
ATOM   4455 O O   . LYS B 1 98  ? 17.595  51.119  -6.716  1.00 51.93  ? 98  LYS B O   1 
ATOM   4456 C CB  . LYS B 1 98  ? 17.686  51.068  -3.871  1.00 44.85  ? 98  LYS B CB  1 
ATOM   4457 C CG  . LYS B 1 98  ? 18.058  51.515  -2.472  1.00 45.70  ? 98  LYS B CG  1 
ATOM   4458 C CD  . LYS B 1 98  ? 19.065  50.589  -1.834  1.00 52.26  ? 98  LYS B CD  1 
ATOM   4459 C CE  . LYS B 1 98  ? 18.457  49.251  -1.465  1.00 53.16  ? 98  LYS B CE  1 
ATOM   4460 N NZ  . LYS B 1 98  ? 19.359  48.513  -0.557  1.00 47.01  ? 98  LYS B NZ  1 
ATOM   4461 N N   . ASN B 1 99  ? 15.376  51.507  -6.567  1.00 56.78  ? 99  ASN B N   1 
ATOM   4462 C CA  . ASN B 1 99  ? 15.042  50.815  -7.808  1.00 50.42  ? 99  ASN B CA  1 
ATOM   4463 C C   . ASN B 1 99  ? 13.854  51.450  -8.496  1.00 51.12  ? 99  ASN B C   1 
ATOM   4464 O O   . ASN B 1 99  ? 13.042  50.768  -9.117  1.00 47.25  ? 99  ASN B O   1 
ATOM   4465 C CB  . ASN B 1 99  ? 14.749  49.332  -7.546  1.00 43.20  ? 99  ASN B CB  1 
ATOM   4466 C CG  . ASN B 1 99  ? 15.982  48.468  -7.641  1.00 46.22  ? 99  ASN B CG  1 
ATOM   4467 O OD1 . ASN B 1 99  ? 16.513  48.258  -8.727  1.00 57.97  ? 99  ASN B OD1 1 
ATOM   4468 N ND2 . ASN B 1 99  ? 16.439  47.952  -6.514  1.00 41.22  ? 99  ASN B ND2 1 
ATOM   4469 N N   . LYS B 1 100 ? 13.768  52.767  -8.387  1.00 53.74  ? 100 LYS B N   1 
ATOM   4470 C CA  . LYS B 1 100 ? 12.683  53.523  -8.997  1.00 61.70  ? 100 LYS B CA  1 
ATOM   4471 C C   . LYS B 1 100 ? 12.572  53.277  -10.500 1.00 65.28  ? 100 LYS B C   1 
ATOM   4472 O O   . LYS B 1 100 ? 11.476  53.351  -11.066 1.00 65.37  ? 100 LYS B O   1 
ATOM   4473 C CB  . LYS B 1 100 ? 12.879  55.015  -8.726  1.00 59.97  ? 100 LYS B CB  1 
ATOM   4474 C CG  . LYS B 1 100 ? 12.936  55.354  -7.257  1.00 59.56  ? 100 LYS B CG  1 
ATOM   4475 C CD  . LYS B 1 100 ? 11.656  54.916  -6.583  1.00 62.51  ? 100 LYS B CD  1 
ATOM   4476 C CE  . LYS B 1 100 ? 11.007  56.067  -5.837  1.00 68.45  ? 100 LYS B CE  1 
ATOM   4477 N NZ  . LYS B 1 100 ? 11.786  56.461  -4.621  1.00 64.43  ? 100 LYS B NZ  1 
ATOM   4478 N N   . ASP B 1 101 ? 13.712  52.977  -11.127 1.00 63.24  ? 101 ASP B N   1 
ATOM   4479 C CA  . ASP B 1 101 ? 13.802  52.805  -12.581 1.00 70.85  ? 101 ASP B CA  1 
ATOM   4480 C C   . ASP B 1 101 ? 13.275  51.467  -13.097 1.00 64.96  ? 101 ASP B C   1 
ATOM   4481 O O   . ASP B 1 101 ? 12.752  51.386  -14.206 1.00 66.15  ? 101 ASP B O   1 
ATOM   4482 C CB  . ASP B 1 101 ? 15.256  52.971  -13.041 1.00 76.09  ? 101 ASP B CB  1 
ATOM   4483 C CG  . ASP B 1 101 ? 15.678  54.421  -13.117 1.00 81.46  ? 101 ASP B CG  1 
ATOM   4484 O OD1 . ASP B 1 101 ? 15.331  55.090  -14.119 1.00 74.05  ? 101 ASP B OD1 1 
ATOM   4485 O OD2 . ASP B 1 101 ? 16.352  54.892  -12.171 1.00 87.97  ? 101 ASP B OD2 1 
ATOM   4486 N N   . VAL B 1 102 ? 13.444  50.415  -12.307 1.00 63.27  ? 102 VAL B N   1 
ATOM   4487 C CA  . VAL B 1 102 ? 12.983  49.097  -12.701 1.00 58.35  ? 102 VAL B CA  1 
ATOM   4488 C C   . VAL B 1 102 ? 11.465  49.041  -12.697 1.00 56.73  ? 102 VAL B C   1 
ATOM   4489 O O   . VAL B 1 102 ? 10.849  48.442  -13.584 1.00 59.48  ? 102 VAL B O   1 
ATOM   4490 C CB  . VAL B 1 102 ? 13.542  48.025  -11.772 1.00 57.22  ? 102 VAL B CB  1 
ATOM   4491 C CG1 . VAL B 1 102 ? 13.199  46.642  -12.290 1.00 61.67  ? 102 VAL B CG1 1 
ATOM   4492 C CG2 . VAL B 1 102 ? 15.044  48.188  -11.655 1.00 52.39  ? 102 VAL B CG2 1 
ATOM   4493 N N   . ILE B 1 103 ? 10.873  49.705  -11.706 1.00 58.89  ? 103 ILE B N   1 
ATOM   4494 C CA  . ILE B 1 103 ? 9.429   49.657  -11.463 1.00 61.08  ? 103 ILE B CA  1 
ATOM   4495 C C   . ILE B 1 103 ? 8.631   50.800  -12.101 1.00 64.31  ? 103 ILE B C   1 
ATOM   4496 O O   . ILE B 1 103 ? 7.403   50.724  -12.154 1.00 63.60  ? 103 ILE B O   1 
ATOM   4497 C CB  . ILE B 1 103 ? 9.103   49.667  -9.934  1.00 60.23  ? 103 ILE B CB  1 
ATOM   4498 C CG1 . ILE B 1 103 ? 9.327   51.057  -9.329  1.00 57.67  ? 103 ILE B CG1 1 
ATOM   4499 C CG2 . ILE B 1 103 ? 9.908   48.606  -9.187  1.00 58.60  ? 103 ILE B CG2 1 
ATOM   4500 C CD1 . ILE B 1 103 ? 8.703   51.231  -7.962  1.00 58.15  ? 103 ILE B CD1 1 
ATOM   4501 N N   . LYS B 1 104 ? 9.320   51.840  -12.579 1.00 65.98  ? 104 LYS B N   1 
ATOM   4502 C CA  . LYS B 1 104 ? 8.676   53.082  -13.050 1.00 70.05  ? 104 LYS B CA  1 
ATOM   4503 C C   . LYS B 1 104 ? 7.516   52.882  -14.033 1.00 66.88  ? 104 LYS B C   1 
ATOM   4504 O O   . LYS B 1 104 ? 6.605   53.719  -14.100 1.00 63.14  ? 104 LYS B O   1 
ATOM   4505 C CB  . LYS B 1 104 ? 9.716   54.016  -13.704 1.00 65.37  ? 104 LYS B CB  1 
ATOM   4506 C CG  . LYS B 1 104 ? 10.466  53.403  -14.878 1.00 65.03  ? 104 LYS B CG  1 
ATOM   4507 C CD  . LYS B 1 104 ? 11.328  54.415  -15.616 1.00 68.79  ? 104 LYS B CD  1 
ATOM   4508 C CE  . LYS B 1 104 ? 12.196  55.214  -14.656 1.00 78.45  ? 104 LYS B CE  1 
ATOM   4509 N NZ  . LYS B 1 104 ? 13.296  55.959  -15.349 1.00 83.14  ? 104 LYS B NZ  1 
ATOM   4510 N N   . LEU B 1 105 ? 7.547   51.777  -14.778 1.00 59.99  ? 105 LEU B N   1 
ATOM   4511 C CA  . LEU B 1 105 ? 6.585   51.553  -15.851 1.00 61.79  ? 105 LEU B CA  1 
ATOM   4512 C C   . LEU B 1 105 ? 5.131   51.454  -15.356 1.00 67.74  ? 105 LEU B C   1 
ATOM   4513 O O   . LEU B 1 105 ? 4.266   52.178  -15.852 1.00 63.07  ? 105 LEU B O   1 
ATOM   4514 C CB  . LEU B 1 105 ? 6.971   50.300  -16.640 1.00 63.34  ? 105 LEU B CB  1 
ATOM   4515 C CG  . LEU B 1 105 ? 6.378   50.176  -18.051 1.00 62.82  ? 105 LEU B CG  1 
ATOM   4516 C CD1 . LEU B 1 105 ? 6.071   51.544  -18.638 1.00 61.19  ? 105 LEU B CD1 1 
ATOM   4517 C CD2 . LEU B 1 105 ? 7.326   49.416  -18.975 1.00 59.33  ? 105 LEU B CD2 1 
ATOM   4518 N N   . TRP B 1 106 ? 4.853   50.578  -14.385 1.00 71.09  ? 106 TRP B N   1 
ATOM   4519 C CA  . TRP B 1 106 ? 3.487   50.470  -13.849 1.00 67.16  ? 106 TRP B CA  1 
ATOM   4520 C C   . TRP B 1 106 ? 3.251   51.403  -12.643 1.00 65.30  ? 106 TRP B C   1 
ATOM   4521 O O   . TRP B 1 106 ? 2.212   52.056  -12.574 1.00 66.88  ? 106 TRP B O   1 
ATOM   4522 C CB  . TRP B 1 106 ? 3.154   49.017  -13.487 1.00 59.94  ? 106 TRP B CB  1 
ATOM   4523 C CG  . TRP B 1 106 ? 3.763   48.518  -12.213 1.00 68.45  ? 106 TRP B CG  1 
ATOM   4524 C CD1 . TRP B 1 106 ? 3.195   48.527  -10.962 1.00 65.62  ? 106 TRP B CD1 1 
ATOM   4525 C CD2 . TRP B 1 106 ? 5.049   47.917  -12.061 1.00 63.41  ? 106 TRP B CD2 1 
ATOM   4526 N NE1 . TRP B 1 106 ? 4.058   47.969  -10.043 1.00 59.00  ? 106 TRP B NE1 1 
ATOM   4527 C CE2 . TRP B 1 106 ? 5.203   47.594  -10.692 1.00 58.22  ? 106 TRP B CE2 1 
ATOM   4528 C CE3 . TRP B 1 106 ? 6.087   47.626  -12.945 1.00 60.85  ? 106 TRP B CE3 1 
ATOM   4529 C CZ2 . TRP B 1 106 ? 6.346   47.003  -10.196 1.00 54.72  ? 106 TRP B CZ2 1 
ATOM   4530 C CZ3 . TRP B 1 106 ? 7.223   47.044  -12.449 1.00 66.26  ? 106 TRP B CZ3 1 
ATOM   4531 C CH2 . TRP B 1 106 ? 7.345   46.732  -11.086 1.00 60.73  ? 106 TRP B CH2 1 
ATOM   4532 N N   . ASP B 1 107 ? 4.213   51.480  -11.721 1.00 62.02  ? 107 ASP B N   1 
ATOM   4533 C CA  . ASP B 1 107 ? 4.185   52.436  -10.601 1.00 58.54  ? 107 ASP B CA  1 
ATOM   4534 C C   . ASP B 1 107 ? 3.793   53.854  -11.029 1.00 65.89  ? 107 ASP B C   1 
ATOM   4535 O O   . ASP B 1 107 ? 2.960   54.512  -10.384 1.00 65.73  ? 107 ASP B O   1 
ATOM   4536 C CB  . ASP B 1 107 ? 5.559   52.473  -9.907  1.00 57.71  ? 107 ASP B CB  1 
ATOM   4537 C CG  . ASP B 1 107 ? 5.531   53.209  -8.561  1.00 63.36  ? 107 ASP B CG  1 
ATOM   4538 O OD1 . ASP B 1 107 ? 5.191   52.576  -7.538  1.00 60.71  ? 107 ASP B OD1 1 
ATOM   4539 O OD2 . ASP B 1 107 ? 5.854   54.416  -8.516  1.00 62.01  ? 107 ASP B OD2 1 
ATOM   4540 N N   . GLY B 1 108 ? 4.402   54.324  -12.119 1.00 72.45  ? 108 GLY B N   1 
ATOM   4541 C CA  . GLY B 1 108 ? 4.117   55.648  -12.648 1.00 69.53  ? 108 GLY B CA  1 
ATOM   4542 C C   . GLY B 1 108 ? 2.705   55.745  -13.190 1.00 71.96  ? 108 GLY B C   1 
ATOM   4543 O O   . GLY B 1 108 ? 2.082   56.803  -13.164 1.00 79.88  ? 108 GLY B O   1 
ATOM   4544 N N   . LYS B 1 109 ? 2.199   54.618  -13.670 1.00 71.18  ? 109 LYS B N   1 
ATOM   4545 C CA  . LYS B 1 109 ? 0.873   54.546  -14.261 1.00 74.80  ? 109 LYS B CA  1 
ATOM   4546 C C   . LYS B 1 109 ? -0.101  53.882  -13.277 1.00 73.48  ? 109 LYS B C   1 
ATOM   4547 O O   . LYS B 1 109 ? -0.970  53.111  -13.693 1.00 73.32  ? 109 LYS B O   1 
ATOM   4548 C CB  . LYS B 1 109 ? 0.946   53.764  -15.589 1.00 75.46  ? 109 LYS B CB  1 
ATOM   4549 C CG  . LYS B 1 109 ? -0.132  54.066  -16.644 1.00 77.73  ? 109 LYS B CG  1 
ATOM   4550 C CD  . LYS B 1 109 ? 0.058   55.423  -17.327 1.00 77.76  ? 109 LYS B CD  1 
ATOM   4551 C CE  . LYS B 1 109 ? -0.967  55.611  -18.446 1.00 79.75  ? 109 LYS B CE  1 
ATOM   4552 N NZ  . LYS B 1 109 ? -1.104  57.034  -18.871 1.00 87.28  ? 109 LYS B NZ  1 
ATOM   4553 N N   . TYR B 1 110 ? 0.044   54.172  -11.978 1.00 73.28  ? 110 TYR B N   1 
ATOM   4554 C CA  . TYR B 1 110 ? -0.716  53.434  -10.953 1.00 71.38  ? 110 TYR B CA  1 
ATOM   4555 C C   . TYR B 1 110 ? -2.180  53.835  -10.905 1.00 69.59  ? 110 TYR B C   1 
ATOM   4556 O O   . TYR B 1 110 ? -3.060  52.978  -10.931 1.00 66.73  ? 110 TYR B O   1 
ATOM   4557 C CB  . TYR B 1 110 ? -0.116  53.600  -9.549  1.00 67.10  ? 110 TYR B CB  1 
ATOM   4558 C CG  . TYR B 1 110 ? -0.566  52.488  -8.612  1.00 64.75  ? 110 TYR B CG  1 
ATOM   4559 C CD1 . TYR B 1 110 ? -1.866  52.456  -8.101  1.00 67.96  ? 110 TYR B CD1 1 
ATOM   4560 C CD2 . TYR B 1 110 ? 0.295   51.455  -8.263  1.00 63.02  ? 110 TYR B CD2 1 
ATOM   4561 C CE1 . TYR B 1 110 ? -2.294  51.436  -7.266  1.00 63.37  ? 110 TYR B CE1 1 
ATOM   4562 C CE2 . TYR B 1 110 ? -0.120  50.426  -7.422  1.00 62.26  ? 110 TYR B CE2 1 
ATOM   4563 C CZ  . TYR B 1 110 ? -1.418  50.424  -6.931  1.00 64.63  ? 110 TYR B CZ  1 
ATOM   4564 O OH  . TYR B 1 110 ? -1.844  49.407  -6.103  1.00 61.65  ? 110 TYR B OH  1 
ATOM   4565 N N   . SER B 1 111 ? -2.441  55.132  -10.820 1.00 70.61  ? 111 SER B N   1 
ATOM   4566 C CA  . SER B 1 111 ? -3.812  55.615  -10.796 1.00 73.26  ? 111 SER B CA  1 
ATOM   4567 C C   . SER B 1 111 ? -4.567  55.152  -12.038 1.00 80.21  ? 111 SER B C   1 
ATOM   4568 O O   . SER B 1 111 ? -5.801  55.092  -12.041 1.00 81.17  ? 111 SER B O   1 
ATOM   4569 C CB  . SER B 1 111 ? -3.847  57.140  -10.699 1.00 71.04  ? 111 SER B CB  1 
ATOM   4570 O OG  . SER B 1 111 ? -5.183  57.604  -10.758 1.00 79.19  ? 111 SER B OG  1 
ATOM   4571 N N   . ASP B 1 112 ? -3.813  54.829  -13.089 1.00 76.49  ? 112 ASP B N   1 
ATOM   4572 C CA  . ASP B 1 112 ? -4.385  54.357  -14.340 1.00 75.46  ? 112 ASP B CA  1 
ATOM   4573 C C   . ASP B 1 112 ? -4.750  52.886  -14.212 1.00 75.75  ? 112 ASP B C   1 
ATOM   4574 O O   . ASP B 1 112 ? -5.892  52.492  -14.464 1.00 80.26  ? 112 ASP B O   1 
ATOM   4575 C CB  . ASP B 1 112 ? -3.402  54.571  -15.495 1.00 82.26  ? 112 ASP B CB  1 
ATOM   4576 C CG  . ASP B 1 112 ? -4.095  54.699  -16.852 1.00 81.80  ? 112 ASP B CG  1 
ATOM   4577 O OD1 . ASP B 1 112 ? -5.038  55.515  -16.957 1.00 80.83  ? 112 ASP B OD1 1 
ATOM   4578 O OD2 . ASP B 1 112 ? -3.693  53.990  -17.809 1.00 74.72  ? 112 ASP B OD2 1 
ATOM   4579 N N   . LEU B 1 113 ? -3.780  52.079  -13.794 1.00 70.16  ? 113 LEU B N   1 
ATOM   4580 C CA  . LEU B 1 113 ? -3.987  50.643  -13.635 1.00 70.88  ? 113 LEU B CA  1 
ATOM   4581 C C   . LEU B 1 113 ? -5.077  50.302  -12.614 1.00 68.81  ? 113 LEU B C   1 
ATOM   4582 O O   . LEU B 1 113 ? -5.521  49.156  -12.534 1.00 68.07  ? 113 LEU B O   1 
ATOM   4583 C CB  . LEU B 1 113 ? -2.673  49.974  -13.242 1.00 66.79  ? 113 LEU B CB  1 
ATOM   4584 C CG  . LEU B 1 113 ? -1.555  50.057  -14.284 1.00 62.64  ? 113 LEU B CG  1 
ATOM   4585 C CD1 . LEU B 1 113 ? -0.321  49.341  -13.807 1.00 65.48  ? 113 LEU B CD1 1 
ATOM   4586 C CD2 . LEU B 1 113 ? -2.007  49.475  -15.605 1.00 62.04  ? 113 LEU B CD2 1 
ATOM   4587 N N   . MET B 1 114 ? -5.503  51.309  -11.854 1.00 67.99  ? 114 MET B N   1 
ATOM   4588 C CA  . MET B 1 114 ? -6.577  51.177  -10.870 1.00 76.89  ? 114 MET B CA  1 
ATOM   4589 C C   . MET B 1 114 ? -7.947  51.274  -11.515 1.00 77.42  ? 114 MET B C   1 
ATOM   4590 O O   . MET B 1 114 ? -8.967  50.900  -10.926 1.00 70.61  ? 114 MET B O   1 
ATOM   4591 C CB  . MET B 1 114 ? -6.456  52.255  -9.793  1.00 74.42  ? 114 MET B CB  1 
ATOM   4592 C CG  . MET B 1 114 ? -5.400  51.978  -8.742  1.00 71.65  ? 114 MET B CG  1 
ATOM   4593 S SD  . MET B 1 114 ? -5.178  53.382  -7.635  1.00 69.27  ? 114 MET B SD  1 
ATOM   4594 C CE  . MET B 1 114 ? -6.832  54.071  -7.610  1.00 69.11  ? 114 MET B CE  1 
ATOM   4595 N N   . LYS B 1 115 ? -7.965  51.813  -12.724 1.00 79.75  ? 115 LYS B N   1 
ATOM   4596 C CA  . LYS B 1 115 ? -9.201  51.904  -13.479 1.00 84.46  ? 115 LYS B CA  1 
ATOM   4597 C C   . LYS B 1 115 ? -9.054  51.202  -14.825 1.00 82.70  ? 115 LYS B C   1 
ATOM   4598 O O   . LYS B 1 115 ? -10.046 50.964  -15.507 1.00 85.56  ? 115 LYS B O   1 
ATOM   4599 C CB  . LYS B 1 115 ? -9.611  53.368  -13.677 1.00 80.58  ? 115 LYS B CB  1 
ATOM   4600 C CG  . LYS B 1 115 ? -9.959  54.099  -12.386 1.00 83.99  ? 115 LYS B CG  1 
ATOM   4601 C CD  . LYS B 1 115 ? -10.304 55.552  -12.650 1.00 72.61  ? 115 LYS B CD  1 
ATOM   4602 C CE  . LYS B 1 115 ? -9.175  56.257  -13.388 1.00 79.06  ? 115 LYS B CE  1 
ATOM   4603 N NZ  . LYS B 1 115 ? -7.888  56.307  -12.626 1.00 77.24  ? 115 LYS B NZ  1 
ATOM   4604 N N   . ASN B 1 116 ? -7.822  50.853  -15.193 1.00 76.95  ? 116 ASN B N   1 
ATOM   4605 C CA  . ASN B 1 116 ? -7.563  50.299  -16.522 1.00 79.68  ? 116 ASN B CA  1 
ATOM   4606 C C   . ASN B 1 116 ? -6.655  49.071  -16.551 1.00 75.20  ? 116 ASN B C   1 
ATOM   4607 O O   . ASN B 1 116 ? -5.838  48.845  -15.653 1.00 71.33  ? 116 ASN B O   1 
ATOM   4608 C CB  . ASN B 1 116 ? -6.958  51.377  -17.429 1.00 80.56  ? 116 ASN B CB  1 
ATOM   4609 C CG  . ASN B 1 116 ? -7.894  52.560  -17.643 1.00 85.03  ? 116 ASN B CG  1 
ATOM   4610 O OD1 . ASN B 1 116 ? -9.096  52.385  -17.877 1.00 85.76  ? 116 ASN B OD1 1 
ATOM   4611 N ND2 . ASN B 1 116 ? -7.347  53.772  -17.560 1.00 70.96  ? 116 ASN B ND2 1 
ATOM   4612 N N   . VAL B 1 117 ? -6.808  48.298  -17.619 1.00 71.78  ? 117 VAL B N   1 
ATOM   4613 C CA  . VAL B 1 117 ? -6.029  47.093  -17.860 1.00 68.69  ? 117 VAL B CA  1 
ATOM   4614 C C   . VAL B 1 117 ? -4.577  47.422  -18.225 1.00 73.44  ? 117 VAL B C   1 
ATOM   4615 O O   . VAL B 1 117 ? -4.324  48.367  -18.969 1.00 74.16  ? 117 VAL B O   1 
ATOM   4616 C CB  . VAL B 1 117 ? -6.696  46.269  -18.977 1.00 65.52  ? 117 VAL B CB  1 
ATOM   4617 C CG1 . VAL B 1 117 ? -7.339  47.205  -19.988 1.00 63.50  ? 117 VAL B CG1 1 
ATOM   4618 C CG2 . VAL B 1 117 ? -5.713  45.310  -19.657 1.00 65.10  ? 117 VAL B CG2 1 
ATOM   4619 N N   . PRO B 1 118 ? -3.614  46.642  -17.699 1.00 68.09  ? 118 PRO B N   1 
ATOM   4620 C CA  . PRO B 1 118 ? -2.200  46.839  -18.022 1.00 66.42  ? 118 PRO B CA  1 
ATOM   4621 C C   . PRO B 1 118 ? -1.886  46.617  -19.494 1.00 75.77  ? 118 PRO B C   1 
ATOM   4622 O O   . PRO B 1 118 ? -2.527  45.780  -20.139 1.00 73.25  ? 118 PRO B O   1 
ATOM   4623 C CB  . PRO B 1 118 ? -1.503  45.768  -17.183 1.00 67.36  ? 118 PRO B CB  1 
ATOM   4624 C CG  . PRO B 1 118 ? -2.521  44.688  -17.082 1.00 70.84  ? 118 PRO B CG  1 
ATOM   4625 C CD  . PRO B 1 118 ? -3.802  45.446  -16.862 1.00 73.09  ? 118 PRO B CD  1 
ATOM   4626 N N   . GLU B 1 119 ? -0.907  47.362  -20.005 1.00 76.68  ? 119 GLU B N   1 
ATOM   4627 C CA  . GLU B 1 119 ? -0.294  47.052  -21.289 1.00 72.72  ? 119 GLU B CA  1 
ATOM   4628 C C   . GLU B 1 119 ? 0.636   45.873  -21.080 1.00 70.24  ? 119 GLU B C   1 
ATOM   4629 O O   . GLU B 1 119 ? 1.031   45.598  -19.947 1.00 72.38  ? 119 GLU B O   1 
ATOM   4630 C CB  . GLU B 1 119 ? 0.458   48.260  -21.856 1.00 74.60  ? 119 GLU B CB  1 
ATOM   4631 C CG  . GLU B 1 119 ? -0.449  49.376  -22.359 1.00 80.00  ? 119 GLU B CG  1 
ATOM   4632 C CD  . GLU B 1 119 ? -1.542  48.889  -23.313 1.00 90.61  ? 119 GLU B CD  1 
ATOM   4633 O OE1 . GLU B 1 119 ? -1.320  47.906  -24.058 1.00 82.88  ? 119 GLU B OE1 1 
ATOM   4634 O OE2 . GLU B 1 119 ? -2.632  49.504  -23.319 1.00 95.56  ? 119 GLU B OE2 1 
ATOM   4635 N N   . PRO B 1 120 ? 0.976   45.158  -22.162 1.00 71.82  ? 120 PRO B N   1 
ATOM   4636 C CA  . PRO B 1 120 ? 1.749   43.919  -22.026 1.00 63.11  ? 120 PRO B CA  1 
ATOM   4637 C C   . PRO B 1 120 ? 3.160   44.138  -21.527 1.00 64.01  ? 120 PRO B C   1 
ATOM   4638 O O   . PRO B 1 120 ? 3.740   43.222  -20.951 1.00 64.12  ? 120 PRO B O   1 
ATOM   4639 C CB  . PRO B 1 120 ? 1.770   43.363  -23.453 1.00 77.01  ? 120 PRO B CB  1 
ATOM   4640 C CG  . PRO B 1 120 ? 0.604   44.013  -24.136 1.00 68.87  ? 120 PRO B CG  1 
ATOM   4641 C CD  . PRO B 1 120 ? 0.539   45.377  -23.552 1.00 66.36  ? 120 PRO B CD  1 
ATOM   4642 N N   . GLU B 1 121 ? 3.716   45.322  -21.770 1.00 73.31  ? 121 GLU B N   1 
ATOM   4643 C CA  . GLU B 1 121 ? 5.071   45.630  -21.313 1.00 76.40  ? 121 GLU B CA  1 
ATOM   4644 C C   . GLU B 1 121 ? 5.066   45.978  -19.818 1.00 72.35  ? 121 GLU B C   1 
ATOM   4645 O O   . GLU B 1 121 ? 5.994   45.615  -19.086 1.00 70.74  ? 121 GLU B O   1 
ATOM   4646 C CB  . GLU B 1 121 ? 5.691   46.769  -22.143 1.00 76.53  ? 121 GLU B CB  1 
ATOM   4647 C CG  . GLU B 1 121 ? 4.776   47.959  -22.411 1.00 70.84  ? 121 GLU B CG  1 
ATOM   4648 C CD  . GLU B 1 121 ? 4.045   47.860  -23.750 1.00 89.83  ? 121 GLU B CD  1 
ATOM   4649 O OE1 . GLU B 1 121 ? 4.395   46.982  -24.575 1.00 90.17  ? 121 GLU B OE1 1 
ATOM   4650 O OE2 . GLU B 1 121 ? 3.115   48.667  -23.980 1.00 92.54  ? 121 GLU B OE2 1 
ATOM   4651 N N   . GLN B 1 122 ? 4.015   46.671  -19.378 1.00 72.39  ? 122 GLN B N   1 
ATOM   4652 C CA  . GLN B 1 122 ? 3.782   46.917  -17.959 1.00 66.00  ? 122 GLN B CA  1 
ATOM   4653 C C   . GLN B 1 122 ? 3.812   45.586  -17.196 1.00 70.45  ? 122 GLN B C   1 
ATOM   4654 O O   . GLN B 1 122 ? 4.422   45.487  -16.126 1.00 66.28  ? 122 GLN B O   1 
ATOM   4655 C CB  . GLN B 1 122 ? 2.453   47.655  -17.752 1.00 60.44  ? 122 GLN B CB  1 
ATOM   4656 C CG  . GLN B 1 122 ? 2.380   48.975  -18.520 1.00 64.78  ? 122 GLN B CG  1 
ATOM   4657 C CD  . GLN B 1 122 ? 1.313   49.934  -18.004 1.00 60.74  ? 122 GLN B CD  1 
ATOM   4658 O OE1 . GLN B 1 122 ? 0.122   49.737  -18.220 1.00 54.81  ? 122 GLN B OE1 1 
ATOM   4659 N NE2 . GLN B 1 122 ? 1.749   50.993  -17.337 1.00 60.90  ? 122 GLN B NE2 1 
ATOM   4660 N N   . LEU B 1 123 ? 3.184   44.561  -17.776 1.00 61.84  ? 123 LEU B N   1 
ATOM   4661 C CA  . LEU B 1 123 ? 3.210   43.218  -17.210 1.00 64.95  ? 123 LEU B CA  1 
ATOM   4662 C C   . LEU B 1 123 ? 4.625   42.627  -17.144 1.00 63.44  ? 123 LEU B C   1 
ATOM   4663 O O   . LEU B 1 123 ? 5.045   42.128  -16.101 1.00 62.24  ? 123 LEU B O   1 
ATOM   4664 C CB  . LEU B 1 123 ? 2.306   42.282  -18.016 1.00 66.14  ? 123 LEU B CB  1 
ATOM   4665 C CG  . LEU B 1 123 ? 0.818   42.603  -18.045 1.00 64.59  ? 123 LEU B CG  1 
ATOM   4666 C CD1 . LEU B 1 123 ? 0.145   41.583  -18.925 1.00 60.80  ? 123 LEU B CD1 1 
ATOM   4667 C CD2 . LEU B 1 123 ? 0.248   42.574  -16.645 1.00 58.68  ? 123 LEU B CD2 1 
ATOM   4668 N N   . VAL B 1 124 ? 5.351   42.666  -18.256 1.00 62.17  ? 124 VAL B N   1 
ATOM   4669 C CA  . VAL B 1 124 ? 6.687   42.083  -18.293 1.00 64.17  ? 124 VAL B CA  1 
ATOM   4670 C C   . VAL B 1 124 ? 7.637   42.928  -17.438 1.00 63.34  ? 124 VAL B C   1 
ATOM   4671 O O   . VAL B 1 124 ? 8.558   42.402  -16.813 1.00 61.40  ? 124 VAL B O   1 
ATOM   4672 C CB  . VAL B 1 124 ? 7.222   41.960  -19.741 1.00 59.89  ? 124 VAL B CB  1 
ATOM   4673 C CG1 . VAL B 1 124 ? 8.572   41.279  -19.755 1.00 59.36  ? 124 VAL B CG1 1 
ATOM   4674 C CG2 . VAL B 1 124 ? 6.250   41.178  -20.595 1.00 56.26  ? 124 VAL B CG2 1 
ATOM   4675 N N   . ALA B 1 125 ? 7.394   44.235  -17.388 1.00 60.92  ? 125 ALA B N   1 
ATOM   4676 C CA  . ALA B 1 125 ? 8.200   45.117  -16.539 1.00 70.06  ? 125 ALA B CA  1 
ATOM   4677 C C   . ALA B 1 125 ? 8.007   44.779  -15.061 1.00 69.67  ? 125 ALA B C   1 
ATOM   4678 O O   . ALA B 1 125 ? 8.945   44.894  -14.252 1.00 59.52  ? 125 ALA B O   1 
ATOM   4679 C CB  . ALA B 1 125 ? 7.854   46.583  -16.793 1.00 65.15  ? 125 ALA B CB  1 
ATOM   4680 N N   . TYR B 1 126 ? 6.777   44.373  -14.729 1.00 67.15  ? 126 TYR B N   1 
ATOM   4681 C CA  . TYR B 1 126 ? 6.423   43.964  -13.381 1.00 56.63  ? 126 TYR B CA  1 
ATOM   4682 C C   . TYR B 1 126 ? 7.109   42.656  -13.024 1.00 53.67  ? 126 TYR B C   1 
ATOM   4683 O O   . TYR B 1 126 ? 7.553   42.476  -11.899 1.00 59.63  ? 126 TYR B O   1 
ATOM   4684 C CB  . TYR B 1 126 ? 4.899   43.842  -13.224 1.00 56.04  ? 126 TYR B CB  1 
ATOM   4685 C CG  . TYR B 1 126 ? 4.482   43.087  -11.972 1.00 62.70  ? 126 TYR B CG  1 
ATOM   4686 C CD1 . TYR B 1 126 ? 4.345   43.735  -10.750 1.00 57.17  ? 126 TYR B CD1 1 
ATOM   4687 C CD2 . TYR B 1 126 ? 4.242   41.712  -12.012 1.00 59.20  ? 126 TYR B CD2 1 
ATOM   4688 C CE1 . TYR B 1 126 ? 3.973   43.031  -9.607  1.00 58.54  ? 126 TYR B CE1 1 
ATOM   4689 C CE2 . TYR B 1 126 ? 3.879   41.012  -10.888 1.00 53.27  ? 126 TYR B CE2 1 
ATOM   4690 C CZ  . TYR B 1 126 ? 3.741   41.668  -9.683  1.00 57.72  ? 126 TYR B CZ  1 
ATOM   4691 O OH  . TYR B 1 126 ? 3.378   40.946  -8.559  1.00 51.75  ? 126 TYR B OH  1 
ATOM   4692 N N   . GLN B 1 127 ? 7.209   41.746  -13.983 1.00 54.56  ? 127 GLN B N   1 
ATOM   4693 C CA  . GLN B 1 127 ? 7.694   40.403  -13.693 1.00 53.46  ? 127 GLN B CA  1 
ATOM   4694 C C   . GLN B 1 127 ? 9.180   40.372  -13.414 1.00 58.19  ? 127 GLN B C   1 
ATOM   4695 O O   . GLN B 1 127 ? 9.639   39.725  -12.477 1.00 59.69  ? 127 GLN B O   1 
ATOM   4696 C CB  . GLN B 1 127 ? 7.374   39.476  -14.848 1.00 54.33  ? 127 GLN B CB  1 
ATOM   4697 C CG  . GLN B 1 127 ? 5.905   39.337  -15.084 1.00 57.98  ? 127 GLN B CG  1 
ATOM   4698 C CD  . GLN B 1 127 ? 5.213   38.597  -13.972 1.00 55.55  ? 127 GLN B CD  1 
ATOM   4699 O OE1 . GLN B 1 127 ? 5.789   37.701  -13.345 1.00 54.20  ? 127 GLN B OE1 1 
ATOM   4700 N NE2 . GLN B 1 127 ? 3.965   38.961  -13.722 1.00 48.44  ? 127 GLN B NE2 1 
ATOM   4701 N N   . ARG B 1 128 ? 9.943   41.069  -14.239 1.00 65.16  ? 128 ARG B N   1 
ATOM   4702 C CA  . ARG B 1 128 ? 11.382  41.067  -14.070 1.00 64.49  ? 128 ARG B CA  1 
ATOM   4703 C C   . ARG B 1 128 ? 11.747  41.933  -12.872 1.00 59.42  ? 128 ARG B C   1 
ATOM   4704 O O   . ARG B 1 128 ? 12.712  41.636  -12.176 1.00 61.66  ? 128 ARG B O   1 
ATOM   4705 C CB  . ARG B 1 128 ? 12.079  41.525  -15.359 1.00 66.80  ? 128 ARG B CB  1 
ATOM   4706 C CG  . ARG B 1 128 ? 12.071  40.432  -16.449 1.00 72.66  ? 128 ARG B CG  1 
ATOM   4707 C CD  . ARG B 1 128 ? 12.478  40.944  -17.835 1.00 74.43  ? 128 ARG B CD  1 
ATOM   4708 N NE  . ARG B 1 128 ? 11.548  41.947  -18.362 1.00 67.93  ? 128 ARG B NE  1 
ATOM   4709 C CZ  . ARG B 1 128 ? 11.870  43.218  -18.591 1.00 70.98  ? 128 ARG B CZ  1 
ATOM   4710 N NH1 . ARG B 1 128 ? 13.106  43.646  -18.351 1.00 78.72  ? 128 ARG B NH1 1 
ATOM   4711 N NH2 . ARG B 1 128 ? 10.961  44.061  -19.070 1.00 71.49  ? 128 ARG B NH2 1 
ATOM   4712 N N   . ALA B 1 129 ? 10.965  42.985  -12.622 1.00 58.80  ? 129 ALA B N   1 
ATOM   4713 C CA  . ALA B 1 129 ? 11.119  43.763  -11.396 1.00 56.34  ? 129 ALA B CA  1 
ATOM   4714 C C   . ALA B 1 129 ? 11.065  42.811  -10.225 1.00 62.38  ? 129 ALA B C   1 
ATOM   4715 O O   . ALA B 1 129 ? 11.955  42.812  -9.371  1.00 60.35  ? 129 ALA B O   1 
ATOM   4716 C CB  . ALA B 1 129 ? 10.048  44.815  -11.264 1.00 56.37  ? 129 ALA B CB  1 
ATOM   4717 N N   . ALA B 1 130 ? 10.032  41.971  -10.213 1.00 64.56  ? 130 ALA B N   1 
ATOM   4718 C CA  . ALA B 1 130 ? 9.895   40.944  -9.188  1.00 59.00  ? 130 ALA B CA  1 
ATOM   4719 C C   . ALA B 1 130 ? 11.105  40.028  -9.142  1.00 56.17  ? 130 ALA B C   1 
ATOM   4720 O O   . ALA B 1 130 ? 11.510  39.598  -8.058  1.00 58.56  ? 130 ALA B O   1 
ATOM   4721 C CB  . ALA B 1 130 ? 8.638   40.132  -9.413  1.00 57.20  ? 130 ALA B CB  1 
ATOM   4722 N N   . GLN B 1 131 ? 11.684  39.721  -10.305 1.00 59.75  ? 131 GLN B N   1 
ATOM   4723 C CA  . GLN B 1 131 ? 12.829  38.807  -10.347 1.00 54.75  ? 131 GLN B CA  1 
ATOM   4724 C C   . GLN B 1 131 ? 14.020  39.495  -9.722  1.00 49.45  ? 131 GLN B C   1 
ATOM   4725 O O   . GLN B 1 131 ? 14.821  38.870  -9.024  1.00 45.05  ? 131 GLN B O   1 
ATOM   4726 C CB  . GLN B 1 131 ? 13.158  38.373  -11.775 1.00 46.69  ? 131 GLN B CB  1 
ATOM   4727 C CG  . GLN B 1 131 ? 12.047  37.639  -12.476 1.00 57.44  ? 131 GLN B CG  1 
ATOM   4728 C CD  . GLN B 1 131 ? 11.794  36.261  -11.897 1.00 66.23  ? 131 GLN B CD  1 
ATOM   4729 O OE1 . GLN B 1 131 ? 12.685  35.656  -11.284 1.00 63.85  ? 131 GLN B OE1 1 
ATOM   4730 N NE2 . GLN B 1 131 ? 10.571  35.751  -12.092 1.00 58.93  ? 131 GLN B NE2 1 
ATOM   4731 N N   . LYS B 1 132 ? 14.105  40.799  -9.975  1.00 50.82  ? 132 LYS B N   1 
ATOM   4732 C CA  . LYS B 1 132 ? 15.219  41.621  -9.513  1.00 56.61  ? 132 LYS B CA  1 
ATOM   4733 C C   . LYS B 1 132 ? 15.174  41.815  -7.991  1.00 52.76  ? 132 LYS B C   1 
ATOM   4734 O O   . LYS B 1 132 ? 16.179  41.609  -7.295  1.00 45.44  ? 132 LYS B O   1 
ATOM   4735 C CB  . LYS B 1 132 ? 15.207  42.976  -10.224 1.00 49.73  ? 132 LYS B CB  1 
ATOM   4736 C CG  . LYS B 1 132 ? 16.512  43.696  -10.086 1.00 48.24  ? 132 LYS B CG  1 
ATOM   4737 C CD  . LYS B 1 132 ? 16.428  45.104  -10.593 1.00 46.38  ? 132 LYS B CD  1 
ATOM   4738 C CE  . LYS B 1 132 ? 17.731  45.822  -10.312 1.00 45.18  ? 132 LYS B CE  1 
ATOM   4739 N NZ  . LYS B 1 132 ? 17.985  45.884  -8.853  1.00 47.75  ? 132 LYS B NZ  1 
ATOM   4740 N N   . TRP B 1 133 ? 13.994  42.212  -7.507  1.00 52.87  ? 133 TRP B N   1 
ATOM   4741 C CA  . TRP B 1 133 ? 13.676  42.249  -6.085  1.00 51.79  ? 133 TRP B CA  1 
ATOM   4742 C C   . TRP B 1 133 ? 14.042  40.935  -5.433  1.00 50.60  ? 133 TRP B C   1 
ATOM   4743 O O   . TRP B 1 133 ? 14.686  40.902  -4.387  1.00 58.13  ? 133 TRP B O   1 
ATOM   4744 C CB  . TRP B 1 133 ? 12.189  42.546  -5.861  1.00 50.42  ? 133 TRP B CB  1 
ATOM   4745 C CG  . TRP B 1 133 ? 11.807  42.652  -4.389  1.00 55.29  ? 133 TRP B CG  1 
ATOM   4746 C CD1 . TRP B 1 133 ? 11.603  43.805  -3.674  1.00 51.79  ? 133 TRP B CD1 1 
ATOM   4747 C CD2 . TRP B 1 133 ? 11.577  41.565  -3.465  1.00 54.39  ? 133 TRP B CD2 1 
ATOM   4748 N NE1 . TRP B 1 133 ? 11.263  43.499  -2.373  1.00 51.12  ? 133 TRP B NE1 1 
ATOM   4749 C CE2 . TRP B 1 133 ? 11.245  42.136  -2.221  1.00 50.37  ? 133 TRP B CE2 1 
ATOM   4750 C CE3 . TRP B 1 133 ? 11.614  40.165  -3.574  1.00 54.58  ? 133 TRP B CE3 1 
ATOM   4751 C CZ2 . TRP B 1 133 ? 10.963  41.358  -1.102  1.00 50.04  ? 133 TRP B CZ2 1 
ATOM   4752 C CZ3 . TRP B 1 133 ? 11.336  39.394  -2.451  1.00 50.21  ? 133 TRP B CZ3 1 
ATOM   4753 C CH2 . TRP B 1 133 ? 11.011  39.992  -1.241  1.00 50.04  ? 133 TRP B CH2 1 
ATOM   4754 N N   . ARG B 1 134 ? 13.617  39.849  -6.051  1.00 47.22  ? 134 ARG B N   1 
ATOM   4755 C CA  . ARG B 1 134 ? 13.900  38.529  -5.521  1.00 52.39  ? 134 ARG B CA  1 
ATOM   4756 C C   . ARG B 1 134 ? 15.402  38.308  -5.483  1.00 44.45  ? 134 ARG B C   1 
ATOM   4757 O O   . ARG B 1 134 ? 15.944  37.762  -4.524  1.00 51.16  ? 134 ARG B O   1 
ATOM   4758 C CB  . ARG B 1 134 ? 13.191  37.465  -6.370  1.00 53.09  ? 134 ARG B CB  1 
ATOM   4759 C CG  . ARG B 1 134 ? 12.954  36.138  -5.680  1.00 48.82  ? 134 ARG B CG  1 
ATOM   4760 C CD  . ARG B 1 134 ? 12.009  35.268  -6.502  1.00 50.97  ? 134 ARG B CD  1 
ATOM   4761 N NE  . ARG B 1 134 ? 10.598  35.641  -6.362  1.00 47.35  ? 134 ARG B NE  1 
ATOM   4762 C CZ  . ARG B 1 134 ? 9.684   34.861  -5.789  1.00 49.98  ? 134 ARG B CZ  1 
ATOM   4763 N NH1 . ARG B 1 134 ? 10.033  33.675  -5.299  1.00 46.39  ? 134 ARG B NH1 1 
ATOM   4764 N NH2 . ARG B 1 134 ? 8.428   35.264  -5.701  1.00 42.14  ? 134 ARG B NH2 1 
ATOM   4765 N N   . GLN B 1 135 ? 16.066  38.771  -6.536  1.00 56.22  ? 135 GLN B N   1 
ATOM   4766 C CA  . GLN B 1 135 ? 17.499  38.560  -6.745  1.00 56.78  ? 135 GLN B CA  1 
ATOM   4767 C C   . GLN B 1 135 ? 18.331  39.332  -5.723  1.00 54.49  ? 135 GLN B C   1 
ATOM   4768 O O   . GLN B 1 135 ? 19.165  38.758  -5.005  1.00 47.77  ? 135 GLN B O   1 
ATOM   4769 C CB  . GLN B 1 135 ? 17.881  38.982  -8.171  1.00 53.50  ? 135 GLN B CB  1 
ATOM   4770 C CG  . GLN B 1 135 ? 19.174  38.375  -8.695  1.00 62.97  ? 135 GLN B CG  1 
ATOM   4771 C CD  . GLN B 1 135 ? 19.043  36.895  -9.024  1.00 74.60  ? 135 GLN B CD  1 
ATOM   4772 O OE1 . GLN B 1 135 ? 19.285  36.035  -8.168  1.00 74.83  ? 135 GLN B OE1 1 
ATOM   4773 N NE2 . GLN B 1 135 ? 18.662  36.587  -10.273 1.00 65.62  ? 135 GLN B NE2 1 
ATOM   4774 N N   . ASP B 1 136 ? 18.086  40.639  -5.679  1.00 50.72  ? 136 ASP B N   1 
ATOM   4775 C CA  . ASP B 1 136 ? 18.778  41.544  -4.768  1.00 52.38  ? 136 ASP B CA  1 
ATOM   4776 C C   . ASP B 1 136 ? 18.601  41.150  -3.312  1.00 53.01  ? 136 ASP B C   1 
ATOM   4777 O O   . ASP B 1 136 ? 19.577  40.938  -2.594  1.00 54.58  ? 136 ASP B O   1 
ATOM   4778 C CB  . ASP B 1 136 ? 18.283  42.974  -4.977  1.00 50.31  ? 136 ASP B CB  1 
ATOM   4779 C CG  . ASP B 1 136 ? 18.529  43.454  -6.379  1.00 50.40  ? 136 ASP B CG  1 
ATOM   4780 O OD1 . ASP B 1 136 ? 19.548  43.005  -6.956  1.00 41.42  ? 136 ASP B OD1 1 
ATOM   4781 O OD2 . ASP B 1 136 ? 17.702  44.249  -6.900  1.00 48.13  ? 136 ASP B OD2 1 
ATOM   4782 N N   . ASN B 1 137 ? 17.354  41.024  -2.879  1.00 51.31  ? 137 ASN B N   1 
ATOM   4783 C CA  . ASN B 1 137 ? 17.095  40.749  -1.477  1.00 51.58  ? 137 ASN B CA  1 
ATOM   4784 C C   . ASN B 1 137 ? 17.425  39.311  -1.078  1.00 51.50  ? 137 ASN B C   1 
ATOM   4785 O O   . ASN B 1 137 ? 17.166  38.914  0.053   1.00 53.26  ? 137 ASN B O   1 
ATOM   4786 C CB  . ASN B 1 137 ? 15.646  41.090  -1.145  1.00 41.77  ? 137 ASN B CB  1 
ATOM   4787 C CG  . ASN B 1 137 ? 15.334  42.553  -1.398  1.00 47.13  ? 137 ASN B CG  1 
ATOM   4788 O OD1 . ASN B 1 137 ? 16.112  43.431  -1.045  1.00 50.95  ? 137 ASN B OD1 1 
ATOM   4789 N ND2 . ASN B 1 137 ? 14.212  42.818  -2.038  1.00 52.93  ? 137 ASN B ND2 1 
ATOM   4790 N N   . LYS B 1 138 ? 18.020  38.553  -1.997  1.00 45.64  ? 138 LYS B N   1 
ATOM   4791 C CA  . LYS B 1 138 ? 18.498  37.199  -1.712  1.00 52.08  ? 138 LYS B CA  1 
ATOM   4792 C C   . LYS B 1 138 ? 17.406  36.312  -1.126  1.00 55.38  ? 138 LYS B C   1 
ATOM   4793 O O   . LYS B 1 138 ? 17.644  35.533  -0.197  1.00 51.68  ? 138 LYS B O   1 
ATOM   4794 C CB  . LYS B 1 138 ? 19.697  37.238  -0.762  1.00 55.52  ? 138 LYS B CB  1 
ATOM   4795 C CG  . LYS B 1 138 ? 20.937  37.865  -1.368  1.00 58.27  ? 138 LYS B CG  1 
ATOM   4796 C CD  . LYS B 1 138 ? 22.076  37.910  -0.361  1.00 69.34  ? 138 LYS B CD  1 
ATOM   4797 C CE  . LYS B 1 138 ? 23.351  38.505  -0.971  1.00 77.77  ? 138 LYS B CE  1 
ATOM   4798 N NZ  . LYS B 1 138 ? 24.449  38.669  0.030   1.00 77.53  ? 138 LYS B NZ  1 
ATOM   4799 N N   . PHE B 1 139 ? 16.215  36.433  -1.699  1.00 51.95  ? 139 PHE B N   1 
ATOM   4800 C CA  . PHE B 1 139 ? 15.018  35.800  -1.170  1.00 54.41  ? 139 PHE B CA  1 
ATOM   4801 C C   . PHE B 1 139 ? 14.995  34.268  -1.334  1.00 56.52  ? 139 PHE B C   1 
ATOM   4802 O O   . PHE B 1 139 ? 14.674  33.538  -0.398  1.00 54.32  ? 139 PHE B O   1 
ATOM   4803 C CB  . PHE B 1 139 ? 13.792  36.434  -1.836  1.00 53.06  ? 139 PHE B CB  1 
ATOM   4804 C CG  . PHE B 1 139 ? 12.485  35.939  -1.301  1.00 60.60  ? 139 PHE B CG  1 
ATOM   4805 C CD1 . PHE B 1 139 ? 11.981  36.424  -0.109  1.00 62.83  ? 139 PHE B CD1 1 
ATOM   4806 C CD2 . PHE B 1 139 ? 11.756  34.993  -1.996  1.00 57.59  ? 139 PHE B CD2 1 
ATOM   4807 C CE1 . PHE B 1 139 ? 10.774  35.969  0.379   1.00 63.67  ? 139 PHE B CE1 1 
ATOM   4808 C CE2 . PHE B 1 139 ? 10.554  34.539  -1.516  1.00 57.26  ? 139 PHE B CE2 1 
ATOM   4809 C CZ  . PHE B 1 139 ? 10.059  35.026  -0.329  1.00 61.92  ? 139 PHE B CZ  1 
ATOM   4810 N N   . GLU B 1 140 ? 15.334  33.771  -2.514  1.00 60.50  ? 140 GLU B N   1 
ATOM   4811 C CA  . GLU B 1 140 ? 15.254  32.337  -2.739  1.00 58.11  ? 140 GLU B CA  1 
ATOM   4812 C C   . GLU B 1 140 ? 16.278  31.580  -1.902  1.00 60.66  ? 140 GLU B C   1 
ATOM   4813 O O   . GLU B 1 140 ? 17.468  31.612  -2.202  1.00 63.78  ? 140 GLU B O   1 
ATOM   4814 C CB  . GLU B 1 140 ? 15.448  32.021  -4.216  1.00 55.91  ? 140 GLU B CB  1 
ATOM   4815 C CG  . GLU B 1 140 ? 14.640  32.897  -5.158  1.00 56.92  ? 140 GLU B CG  1 
ATOM   4816 C CD  . GLU B 1 140 ? 14.620  32.358  -6.589  1.00 61.83  ? 140 GLU B CD  1 
ATOM   4817 O OE1 . GLU B 1 140 ? 15.518  31.564  -6.963  1.00 63.86  ? 140 GLU B OE1 1 
ATOM   4818 O OE2 . GLU B 1 140 ? 13.690  32.723  -7.338  1.00 59.02  ? 140 GLU B OE2 1 
ATOM   4819 N N   . ILE B 1 141 ? 15.817  30.903  -0.848  1.00 63.59  ? 141 ILE B N   1 
ATOM   4820 C CA  . ILE B 1 141 ? 16.711  30.103  0.002   1.00 59.13  ? 141 ILE B CA  1 
ATOM   4821 C C   . ILE B 1 141 ? 16.391  28.598  -0.014  1.00 63.46  ? 141 ILE B C   1 
ATOM   4822 O O   . ILE B 1 141 ? 17.183  27.788  0.471   1.00 63.60  ? 141 ILE B O   1 
ATOM   4823 C CB  . ILE B 1 141 ? 16.697  30.590  1.479   1.00 59.70  ? 141 ILE B CB  1 
ATOM   4824 C CG1 . ILE B 1 141 ? 15.295  30.514  2.083   1.00 62.76  ? 141 ILE B CG1 1 
ATOM   4825 C CG2 . ILE B 1 141 ? 17.213  32.008  1.584   1.00 64.22  ? 141 ILE B CG2 1 
ATOM   4826 C CD1 . ILE B 1 141 ? 15.180  31.173  3.445   1.00 58.79  ? 141 ILE B CD1 1 
ATOM   4827 N N   . ASN B 1 142 ? 15.243  28.221  -0.578  1.00 63.71  ? 142 ASN B N   1 
ATOM   4828 C CA  . ASN B 1 142 ? 14.854  26.809  -0.626  1.00 59.94  ? 142 ASN B CA  1 
ATOM   4829 C C   . ASN B 1 142 ? 13.775  26.507  -1.669  1.00 55.59  ? 142 ASN B C   1 
ATOM   4830 O O   . ASN B 1 142 ? 13.340  27.406  -2.403  1.00 53.40  ? 142 ASN B O   1 
ATOM   4831 C CB  . ASN B 1 142 ? 14.368  26.357  0.750   1.00 53.58  ? 142 ASN B CB  1 
ATOM   4832 C CG  . ASN B 1 142 ? 13.004  26.912  1.089   1.00 54.69  ? 142 ASN B CG  1 
ATOM   4833 O OD1 . ASN B 1 142 ? 12.560  27.927  0.528   1.00 52.02  ? 142 ASN B OD1 1 
ATOM   4834 N ND2 . ASN B 1 142 ? 12.325  26.249  2.015   1.00 56.53  ? 142 ASN B ND2 1 
ATOM   4835 N N   . GLN B 1 143 ? 13.324  25.250  -1.703  1.00 51.32  ? 143 GLN B N   1 
ATOM   4836 C CA  . GLN B 1 143 ? 12.411  24.783  -2.749  1.00 51.30  ? 143 GLN B CA  1 
ATOM   4837 C C   . GLN B 1 143 ? 11.107  25.564  -2.825  1.00 51.48  ? 143 GLN B C   1 
ATOM   4838 O O   . GLN B 1 143 ? 10.514  25.679  -3.894  1.00 51.61  ? 143 GLN B O   1 
ATOM   4839 C CB  . GLN B 1 143 ? 12.103  23.294  -2.565  1.00 60.61  ? 143 GLN B CB  1 
ATOM   4840 C CG  . GLN B 1 143 ? 12.320  22.761  -1.141  1.00 70.60  ? 143 GLN B CG  1 
ATOM   4841 C CD  . GLN B 1 143 ? 12.072  21.256  -1.031  1.00 71.78  ? 143 GLN B CD  1 
ATOM   4842 O OE1 . GLN B 1 143 ? 11.285  20.687  -1.793  1.00 68.18  ? 143 GLN B OE1 1 
ATOM   4843 N NE2 . GLN B 1 143 ? 12.748  20.609  -0.083  1.00 63.91  ? 143 GLN B NE2 1 
ATOM   4844 N N   . TYR B 1 144 ? 10.667  26.125  -1.704  1.00 58.95  ? 144 TYR B N   1 
ATOM   4845 C CA  . TYR B 1 144 ? 9.351   26.760  -1.666  1.00 55.46  ? 144 TYR B CA  1 
ATOM   4846 C C   . TYR B 1 144 ? 9.457   28.277  -1.822  1.00 50.76  ? 144 TYR B C   1 
ATOM   4847 O O   . TYR B 1 144 ? 8.460   29.006  -1.750  1.00 49.62  ? 144 TYR B O   1 
ATOM   4848 C CB  . TYR B 1 144 ? 8.626   26.353  -0.379  1.00 51.98  ? 144 TYR B CB  1 
ATOM   4849 C CG  . TYR B 1 144 ? 8.543   24.836  -0.228  1.00 54.66  ? 144 TYR B CG  1 
ATOM   4850 C CD1 . TYR B 1 144 ? 7.857   24.052  -1.168  1.00 50.54  ? 144 TYR B CD1 1 
ATOM   4851 C CD2 . TYR B 1 144 ? 9.166   24.181  0.839   1.00 55.55  ? 144 TYR B CD2 1 
ATOM   4852 C CE1 . TYR B 1 144 ? 7.790   22.652  -1.045  1.00 45.34  ? 144 TYR B CE1 1 
ATOM   4853 C CE2 . TYR B 1 144 ? 9.107   22.782  0.968   1.00 56.68  ? 144 TYR B CE2 1 
ATOM   4854 C CZ  . TYR B 1 144 ? 8.418   22.025  0.021   1.00 56.07  ? 144 TYR B CZ  1 
ATOM   4855 O OH  . TYR B 1 144 ? 8.365   20.650  0.155   1.00 52.14  ? 144 TYR B OH  1 
ATOM   4856 N N   . THR B 1 145 ? 10.675  28.747  -2.086  1.00 59.07  ? 145 THR B N   1 
ATOM   4857 C CA  . THR B 1 145 ? 10.895  30.159  -2.429  1.00 59.53  ? 145 THR B CA  1 
ATOM   4858 C C   . THR B 1 145 ? 11.632  30.323  -3.753  1.00 54.61  ? 145 THR B C   1 
ATOM   4859 O O   . THR B 1 145 ? 12.176  31.393  -4.020  1.00 57.68  ? 145 THR B O   1 
ATOM   4860 C CB  . THR B 1 145 ? 11.685  30.917  -1.330  1.00 55.89  ? 145 THR B CB  1 
ATOM   4861 O OG1 . THR B 1 145 ? 12.928  30.256  -1.067  1.00 53.10  ? 145 THR B OG1 1 
ATOM   4862 C CG2 . THR B 1 145 ? 10.876  30.981  -0.049  1.00 55.35  ? 145 THR B CG2 1 
ATOM   4863 N N   . ARG B 1 146 ? 11.636  29.264  -4.570  1.00 57.71  ? 146 ARG B N   1 
ATOM   4864 C CA  . ARG B 1 146 ? 12.212  29.277  -5.927  1.00 52.04  ? 146 ARG B CA  1 
ATOM   4865 C C   . ARG B 1 146 ? 11.392  30.050  -6.950  1.00 51.75  ? 146 ARG B C   1 
ATOM   4866 O O   . ARG B 1 146 ? 10.163  30.064  -6.901  1.00 48.89  ? 146 ARG B O   1 
ATOM   4867 C CB  . ARG B 1 146 ? 12.378  27.845  -6.472  1.00 57.08  ? 146 ARG B CB  1 
ATOM   4868 C CG  . ARG B 1 146 ? 13.564  27.056  -5.936  1.00 54.07  ? 146 ARG B CG  1 
ATOM   4869 C CD  . ARG B 1 146 ? 14.842  27.855  -6.034  1.00 59.69  ? 146 ARG B CD  1 
ATOM   4870 N NE  . ARG B 1 146 ? 15.637  27.739  -4.809  1.00 65.05  ? 146 ARG B NE  1 
ATOM   4871 C CZ  . ARG B 1 146 ? 16.680  28.514  -4.513  1.00 69.92  ? 146 ARG B CZ  1 
ATOM   4872 N NH1 . ARG B 1 146 ? 17.060  29.469  -5.362  1.00 71.94  ? 146 ARG B NH1 1 
ATOM   4873 N NH2 . ARG B 1 146 ? 17.347  28.334  -3.375  1.00 64.66  ? 146 ARG B NH2 1 
ATOM   4874 N N   . SER B 1 147 ? 12.085  30.684  -7.891  1.00 55.09  ? 147 SER B N   1 
ATOM   4875 C CA  . SER B 1 147 ? 11.477  30.966  -9.173  1.00 49.27  ? 147 SER B CA  1 
ATOM   4876 C C   . SER B 1 147 ? 11.456  29.637  -9.899  1.00 54.15  ? 147 SER B C   1 
ATOM   4877 O O   . SER B 1 147 ? 12.494  28.975  -9.993  1.00 60.97  ? 147 SER B O   1 
ATOM   4878 C CB  . SER B 1 147 ? 12.257  32.012  -9.955  1.00 53.99  ? 147 SER B CB  1 
ATOM   4879 O OG  . SER B 1 147 ? 11.982  33.305  -9.466  1.00 50.42  ? 147 SER B OG  1 
ATOM   4880 N N   . LEU B 1 148 ? 10.288  29.221  -10.379 1.00 55.94  ? 148 LEU B N   1 
ATOM   4881 C CA  . LEU B 1 148 ? 10.157  27.905  -11.004 1.00 59.27  ? 148 LEU B CA  1 
ATOM   4882 C C   . LEU B 1 148 ? 10.525  27.937  -12.490 1.00 59.38  ? 148 LEU B C   1 
ATOM   4883 O O   . LEU B 1 148 ? 10.130  28.853  -13.211 1.00 54.80  ? 148 LEU B O   1 
ATOM   4884 C CB  . LEU B 1 148 ? 8.734   27.373  -10.813 1.00 55.05  ? 148 LEU B CB  1 
ATOM   4885 C CG  . LEU B 1 148 ? 8.366   26.991  -9.379  1.00 54.00  ? 148 LEU B CG  1 
ATOM   4886 C CD1 . LEU B 1 148 ? 6.853   26.762  -9.213  1.00 41.48  ? 148 LEU B CD1 1 
ATOM   4887 C CD2 . LEU B 1 148 ? 9.173   25.766  -8.951  1.00 46.62  ? 148 LEU B CD2 1 
ATOM   4888 N N   . THR B 1 149 ? 11.290  26.935  -12.930 1.00 66.84  ? 149 THR B N   1 
ATOM   4889 C CA  . THR B 1 149 ? 11.730  26.828  -14.330 1.00 64.80  ? 149 THR B CA  1 
ATOM   4890 C C   . THR B 1 149 ? 11.155  25.615  -15.052 1.00 71.81  ? 149 THR B C   1 
ATOM   4891 O O   . THR B 1 149 ? 11.196  25.558  -16.285 1.00 82.83  ? 149 THR B O   1 
ATOM   4892 C CB  . THR B 1 149 ? 13.268  26.731  -14.462 1.00 61.22  ? 149 THR B CB  1 
ATOM   4893 O OG1 . THR B 1 149 ? 13.763  25.685  -13.613 1.00 60.69  ? 149 THR B OG1 1 
ATOM   4894 C CG2 . THR B 1 149 ? 13.940  28.050  -14.108 1.00 60.42  ? 149 THR B CG2 1 
ATOM   4895 N N   . HIS B 1 150 ? 10.642  24.643  -14.295 1.00 65.78  ? 150 HIS B N   1 
ATOM   4896 C CA  . HIS B 1 150 ? 10.061  23.426  -14.871 1.00 62.72  ? 150 HIS B CA  1 
ATOM   4897 C C   . HIS B 1 150 ? 8.912   23.744  -15.835 1.00 61.44  ? 150 HIS B C   1 
ATOM   4898 O O   . HIS B 1 150 ? 8.503   24.896  -15.975 1.00 64.49  ? 150 HIS B O   1 
ATOM   4899 C CB  . HIS B 1 150 ? 9.556   22.498  -13.761 1.00 60.60  ? 150 HIS B CB  1 
ATOM   4900 C CG  . HIS B 1 150 ? 8.225   22.902  -13.202 1.00 60.92  ? 150 HIS B CG  1 
ATOM   4901 N ND1 . HIS B 1 150 ? 8.086   23.876  -12.238 1.00 64.31  ? 150 HIS B ND1 1 
ATOM   4902 C CD2 . HIS B 1 150 ? 6.971   22.471  -13.485 1.00 62.92  ? 150 HIS B CD2 1 
ATOM   4903 C CE1 . HIS B 1 150 ? 6.803   24.029  -11.952 1.00 60.20  ? 150 HIS B CE1 1 
ATOM   4904 N NE2 . HIS B 1 150 ? 6.107   23.191  -12.697 1.00 60.71  ? 150 HIS B NE2 1 
ATOM   4905 N N   . SER B 1 151 ? 8.387   22.726  -16.507 1.00 61.16  ? 151 SER B N   1 
ATOM   4906 C CA  . SER B 1 151 ? 7.196   22.938  -17.328 1.00 64.14  ? 151 SER B CA  1 
ATOM   4907 C C   . SER B 1 151 ? 6.043   22.060  -16.855 1.00 62.97  ? 151 SER B C   1 
ATOM   4908 O O   . SER B 1 151 ? 6.262   20.974  -16.299 1.00 55.39  ? 151 SER B O   1 
ATOM   4909 C CB  . SER B 1 151 ? 7.492   22.684  -18.807 1.00 62.78  ? 151 SER B CB  1 
ATOM   4910 O OG  . SER B 1 151 ? 7.411   23.894  -19.548 1.00 65.22  ? 151 SER B OG  1 
ATOM   4911 N N   . VAL B 1 152 ? 4.827   22.564  -17.073 1.00 57.69  ? 152 VAL B N   1 
ATOM   4912 C CA  . VAL B 1 152 ? 3.576   21.944  -16.628 1.00 60.64  ? 152 VAL B CA  1 
ATOM   4913 C C   . VAL B 1 152 ? 3.530   20.447  -16.919 1.00 63.47  ? 152 VAL B C   1 
ATOM   4914 O O   . VAL B 1 152 ? 3.751   20.031  -18.050 1.00 71.92  ? 152 VAL B O   1 
ATOM   4915 C CB  . VAL B 1 152 ? 2.343   22.631  -17.309 1.00 68.66  ? 152 VAL B CB  1 
ATOM   4916 C CG1 . VAL B 1 152 ? 1.033   21.991  -16.880 1.00 68.55  ? 152 VAL B CG1 1 
ATOM   4917 C CG2 . VAL B 1 152 ? 2.319   24.130  -17.025 1.00 63.70  ? 152 VAL B CG2 1 
ATOM   4918 N N   . GLN B 1 153 ? 3.271   19.633  -15.902 1.00 66.01  ? 153 GLN B N   1 
ATOM   4919 C CA  . GLN B 1 153 ? 3.060   18.208  -16.137 1.00 73.58  ? 153 GLN B CA  1 
ATOM   4920 C C   . GLN B 1 153 ? 1.697   17.986  -16.789 1.00 75.91  ? 153 GLN B C   1 
ATOM   4921 O O   . GLN B 1 153 ? 0.836   18.867  -16.745 1.00 73.93  ? 153 GLN B O   1 
ATOM   4922 C CB  . GLN B 1 153 ? 3.163   17.410  -14.837 1.00 74.31  ? 153 GLN B CB  1 
ATOM   4923 C CG  . GLN B 1 153 ? 4.589   17.242  -14.333 1.00 82.35  ? 153 GLN B CG  1 
ATOM   4924 C CD  . GLN B 1 153 ? 4.749   16.045  -13.401 1.00 91.50  ? 153 GLN B CD  1 
ATOM   4925 O OE1 . GLN B 1 153 ? 3.773   15.373  -13.050 1.00 90.79  ? 153 GLN B OE1 1 
ATOM   4926 N NE2 . GLN B 1 153 ? 5.989   15.770  -13.003 1.00 91.01  ? 153 GLN B NE2 1 
ATOM   4927 N N   . ALA B 1 154 ? 1.515   16.822  -17.414 1.00 79.91  ? 154 ALA B N   1 
ATOM   4928 C CA  . ALA B 1 154 ? 0.214   16.424  -17.955 1.00 81.12  ? 154 ALA B CA  1 
ATOM   4929 C C   . ALA B 1 154 ? -0.352  15.316  -17.080 1.00 75.27  ? 154 ALA B C   1 
ATOM   4930 O O   . ALA B 1 154 ? -0.930  14.352  -17.562 1.00 78.07  ? 154 ALA B O   1 
ATOM   4931 C CB  . ALA B 1 154 ? 0.332   15.975  -19.411 1.00 76.87  ? 154 ALA B CB  1 
ATOM   4932 N N   . ASP B 1 155 ? -0.144  15.476  -15.779 1.00 81.07  ? 155 ASP B N   1 
ATOM   4933 C CA  . ASP B 1 155 ? -0.596  14.540  -14.759 1.00 79.14  ? 155 ASP B CA  1 
ATOM   4934 C C   . ASP B 1 155 ? -1.511  15.219  -13.747 1.00 74.53  ? 155 ASP B C   1 
ATOM   4935 O O   . ASP B 1 155 ? -2.490  15.857  -14.126 1.00 76.32  ? 155 ASP B O   1 
ATOM   4936 C CB  . ASP B 1 155 ? 0.598   13.920  -14.031 1.00 82.24  ? 155 ASP B CB  1 
ATOM   4937 C CG  . ASP B 1 155 ? 1.205   12.759  -14.791 1.00 89.12  ? 155 ASP B CG  1 
ATOM   4938 O OD1 . ASP B 1 155 ? 0.921   12.626  -16.003 1.00 88.51  ? 155 ASP B OD1 1 
ATOM   4939 O OD2 . ASP B 1 155 ? 1.961   11.980  -14.171 1.00 89.24  ? 155 ASP B OD2 1 
ATOM   4940 N N   . TYR B 1 156 ? -1.141  15.083  -12.474 1.00 73.16  ? 156 TYR B N   1 
ATOM   4941 C CA  . TYR B 1 156 ? -1.932  15.455  -11.284 1.00 74.31  ? 156 TYR B CA  1 
ATOM   4942 C C   . TYR B 1 156 ? -2.848  14.303  -10.842 1.00 69.44  ? 156 TYR B C   1 
ATOM   4943 O O   . TYR B 1 156 ? -4.007  14.192  -11.282 1.00 60.33  ? 156 TYR B O   1 
ATOM   4944 C CB  . TYR B 1 156 ? -2.754  16.729  -11.505 1.00 71.83  ? 156 TYR B CB  1 
ATOM   4945 C CG  . TYR B 1 156 ? -3.047  17.502  -10.241 1.00 69.50  ? 156 TYR B CG  1 
ATOM   4946 C CD1 . TYR B 1 156 ? -2.057  17.719  -9.296  1.00 62.63  ? 156 TYR B CD1 1 
ATOM   4947 C CD2 . TYR B 1 156 ? -4.313  18.030  -10.005 1.00 64.55  ? 156 TYR B CD2 1 
ATOM   4948 C CE1 . TYR B 1 156 ? -2.319  18.433  -8.148  1.00 67.20  ? 156 TYR B CE1 1 
ATOM   4949 C CE2 . TYR B 1 156 ? -4.586  18.755  -8.865  1.00 67.12  ? 156 TYR B CE2 1 
ATOM   4950 C CZ  . TYR B 1 156 ? -3.584  18.951  -7.934  1.00 70.25  ? 156 TYR B CZ  1 
ATOM   4951 O OH  . TYR B 1 156 ? -3.845  19.668  -6.789  1.00 65.91  ? 156 TYR B OH  1 
ATOM   4952 N N   . LYS B 1 157 ? -2.300  13.449  -9.974  1.00 63.01  ? 157 LYS B N   1 
ATOM   4953 C CA  . LYS B 1 157 ? -3.044  12.350  -9.375  1.00 66.29  ? 157 LYS B CA  1 
ATOM   4954 C C   . LYS B 1 157 ? -4.014  12.873  -8.331  1.00 71.74  ? 157 LYS B C   1 
ATOM   4955 O O   . LYS B 1 157 ? -3.614  13.492  -7.341  1.00 67.69  ? 157 LYS B O   1 
ATOM   4956 C CB  . LYS B 1 157 ? -2.109  11.317  -8.731  1.00 67.13  ? 157 LYS B CB  1 
ATOM   4957 C CG  . LYS B 1 157 ? -2.838  10.094  -8.168  1.00 66.32  ? 157 LYS B CG  1 
ATOM   4958 C CD  . LYS B 1 157 ? -3.513  9.277   -9.279  1.00 68.23  ? 157 LYS B CD  1 
ATOM   4959 C CE  . LYS B 1 157 ? -4.247  8.040   -8.742  1.00 69.77  ? 157 LYS B CE  1 
ATOM   4960 N NZ  . LYS B 1 157 ? -5.523  8.374   -8.032  1.00 70.53  ? 157 LYS B NZ  1 
ATOM   4961 N N   . VAL B 1 158 ? -5.295  12.618  -8.571  1.00 74.57  ? 158 VAL B N   1 
ATOM   4962 C CA  . VAL B 1 158 ? -6.340  12.923  -7.615  1.00 65.90  ? 158 VAL B CA  1 
ATOM   4963 C C   . VAL B 1 158 ? -7.105  11.653  -7.282  1.00 71.38  ? 158 VAL B C   1 
ATOM   4964 O O   . VAL B 1 158 ? -7.587  10.967  -8.190  1.00 69.92  ? 158 VAL B O   1 
ATOM   4965 C CB  . VAL B 1 158 ? -7.318  13.968  -8.155  1.00 59.00  ? 158 VAL B CB  1 
ATOM   4966 C CG1 . VAL B 1 158 ? -8.275  14.380  -7.059  1.00 68.86  ? 158 VAL B CG1 1 
ATOM   4967 C CG2 . VAL B 1 158 ? -6.573  15.166  -8.681  1.00 57.30  ? 158 VAL B CG2 1 
ATOM   4968 N N   . PRO B 1 159 ? -7.194  11.317  -5.982  1.00 71.51  ? 159 PRO B N   1 
ATOM   4969 C CA  . PRO B 1 159 ? -8.045  10.209  -5.525  1.00 64.41  ? 159 PRO B CA  1 
ATOM   4970 C C   . PRO B 1 159 ? -9.457  10.266  -6.128  1.00 63.54  ? 159 PRO B C   1 
ATOM   4971 O O   . PRO B 1 159 ? -10.019 11.352  -6.299  1.00 61.62  ? 159 PRO B O   1 
ATOM   4972 C CB  . PRO B 1 159 ? -8.058  10.401  -4.011  1.00 64.40  ? 159 PRO B CB  1 
ATOM   4973 C CG  . PRO B 1 159 ? -6.669  10.919  -3.726  1.00 63.87  ? 159 PRO B CG  1 
ATOM   4974 C CD  . PRO B 1 159 ? -6.302  11.801  -4.912  1.00 62.82  ? 159 PRO B CD  1 
ATOM   4975 N N   . GLY B 1 160 ? -9.999  9.093   -6.455  1.00 64.65  ? 160 GLY B N   1 
ATOM   4976 C CA  . GLY B 1 160 ? -11.233 8.956   -7.216  1.00 57.51  ? 160 GLY B CA  1 
ATOM   4977 C C   . GLY B 1 160 ? -12.451 9.770   -6.807  1.00 62.57  ? 160 GLY B C   1 
ATOM   4978 O O   . GLY B 1 160 ? -13.220 10.205  -7.671  1.00 61.53  ? 160 GLY B O   1 
ATOM   4979 N N   . GLU B 1 161 ? -12.628 9.985   -5.504  1.00 63.28  ? 161 GLU B N   1 
ATOM   4980 C CA  . GLU B 1 161 ? -13.817 10.660  -4.981  1.00 57.43  ? 161 GLU B CA  1 
ATOM   4981 C C   . GLU B 1 161 ? -13.918 12.120  -5.457  1.00 69.53  ? 161 GLU B C   1 
ATOM   4982 O O   . GLU B 1 161 ? -15.017 12.670  -5.664  1.00 65.22  ? 161 GLU B O   1 
ATOM   4983 C CB  . GLU B 1 161 ? -13.808 10.589  -3.458  1.00 62.39  ? 161 GLU B CB  1 
ATOM   4984 C CG  . GLU B 1 161 ? -12.700 9.686   -2.894  1.00 69.24  ? 161 GLU B CG  1 
ATOM   4985 C CD  . GLU B 1 161 ? -12.241 10.102  -1.485  1.00 81.64  ? 161 GLU B CD  1 
ATOM   4986 O OE1 . GLU B 1 161 ? -13.091 10.488  -0.641  1.00 75.18  ? 161 GLU B OE1 1 
ATOM   4987 O OE2 . GLU B 1 161 ? -11.014 10.047  -1.230  1.00 84.54  ? 161 GLU B OE2 1 
ATOM   4988 N N   . TYR B 1 162 ? -12.754 12.739  -5.649  1.00 72.11  ? 162 TYR B N   1 
ATOM   4989 C CA  . TYR B 1 162 ? -12.687 14.125  -6.084  1.00 61.14  ? 162 TYR B CA  1 
ATOM   4990 C C   . TYR B 1 162 ? -12.396 14.201  -7.564  1.00 63.20  ? 162 TYR B C   1 
ATOM   4991 O O   . TYR B 1 162 ? -12.739 15.191  -8.206  1.00 64.54  ? 162 TYR B O   1 
ATOM   4992 C CB  . TYR B 1 162 ? -11.631 14.886  -5.284  1.00 62.57  ? 162 TYR B CB  1 
ATOM   4993 C CG  . TYR B 1 162 ? -11.947 14.899  -3.805  1.00 63.33  ? 162 TYR B CG  1 
ATOM   4994 C CD1 . TYR B 1 162 ? -12.760 15.879  -3.260  1.00 59.09  ? 162 TYR B CD1 1 
ATOM   4995 C CD2 . TYR B 1 162 ? -11.457 13.910  -2.963  1.00 60.84  ? 162 TYR B CD2 1 
ATOM   4996 C CE1 . TYR B 1 162 ? -13.065 15.884  -1.918  1.00 58.20  ? 162 TYR B CE1 1 
ATOM   4997 C CE2 . TYR B 1 162 ? -11.760 13.902  -1.623  1.00 59.61  ? 162 TYR B CE2 1 
ATOM   4998 C CZ  . TYR B 1 162 ? -12.561 14.891  -1.101  1.00 59.03  ? 162 TYR B CZ  1 
ATOM   4999 O OH  . TYR B 1 162 ? -12.869 14.882  0.246   1.00 58.75  ? 162 TYR B OH  1 
ATOM   5000 N N   . ALA B 1 163 ? -11.793 13.139  -8.099  1.00 62.19  ? 163 ALA B N   1 
ATOM   5001 C CA  . ALA B 1 163 ? -11.424 13.062  -9.517  1.00 62.90  ? 163 ALA B CA  1 
ATOM   5002 C C   . ALA B 1 163 ? -12.526 13.547  -10.455 1.00 62.95  ? 163 ALA B C   1 
ATOM   5003 O O   . ALA B 1 163 ? -12.251 14.158  -11.485 1.00 63.52  ? 163 ALA B O   1 
ATOM   5004 C CB  . ALA B 1 163 ? -11.033 11.641  -9.880  1.00 60.65  ? 163 ALA B CB  1 
ATOM   5005 N N   . VAL B 1 164 ? -13.774 13.295  -10.087 1.00 60.96  ? 164 VAL B N   1 
ATOM   5006 C CA  . VAL B 1 164 ? -14.889 13.651  -10.950 1.00 61.13  ? 164 VAL B CA  1 
ATOM   5007 C C   . VAL B 1 164 ? -15.183 15.151  -10.893 1.00 61.78  ? 164 VAL B C   1 
ATOM   5008 O O   . VAL B 1 164 ? -15.476 15.775  -11.912 1.00 60.43  ? 164 VAL B O   1 
ATOM   5009 C CB  . VAL B 1 164 ? -16.151 12.825  -10.577 1.00 62.45  ? 164 VAL B CB  1 
ATOM   5010 C CG1 . VAL B 1 164 ? -16.306 12.719  -9.051  1.00 68.88  ? 164 VAL B CG1 1 
ATOM   5011 C CG2 . VAL B 1 164 ? -17.400 13.384  -11.263 1.00 44.10  ? 164 VAL B CG2 1 
ATOM   5012 N N   . GLU B 1 165 ? -15.086 15.728  -9.698  1.00 65.03  ? 165 GLU B N   1 
ATOM   5013 C CA  . GLU B 1 165 ? -15.285 17.165  -9.514  1.00 62.88  ? 165 GLU B CA  1 
ATOM   5014 C C   . GLU B 1 165 ? -14.075 17.990  -9.983  1.00 64.14  ? 165 GLU B C   1 
ATOM   5015 O O   . GLU B 1 165 ? -14.243 19.104  -10.476 1.00 61.80  ? 165 GLU B O   1 
ATOM   5016 C CB  . GLU B 1 165 ? -15.581 17.473  -8.044  1.00 63.74  ? 165 GLU B CB  1 
ATOM   5017 C CG  . GLU B 1 165 ? -16.803 16.773  -7.497  1.00 61.43  ? 165 GLU B CG  1 
ATOM   5018 C CD  . GLU B 1 165 ? -17.319 17.399  -6.218  1.00 56.86  ? 165 GLU B CD  1 
ATOM   5019 O OE1 . GLU B 1 165 ? -17.054 16.808  -5.147  1.00 57.50  ? 165 GLU B OE1 1 
ATOM   5020 O OE2 . GLU B 1 165 ? -17.999 18.458  -6.282  1.00 54.38  ? 165 GLU B OE2 1 
ATOM   5021 N N   . VAL B 1 166 ? -12.869 17.441  -9.808  1.00 62.41  ? 166 VAL B N   1 
ATOM   5022 C CA  . VAL B 1 166 ? -11.626 18.056  -10.286 1.00 59.20  ? 166 VAL B CA  1 
ATOM   5023 C C   . VAL B 1 166 ? -11.693 18.301  -11.781 1.00 67.40  ? 166 VAL B C   1 
ATOM   5024 O O   . VAL B 1 166 ? -11.233 19.329  -12.274 1.00 67.61  ? 166 VAL B O   1 
ATOM   5025 C CB  . VAL B 1 166 ? -10.376 17.170  -9.990  1.00 69.38  ? 166 VAL B CB  1 
ATOM   5026 C CG1 . VAL B 1 166 ? -9.126  17.739  -10.661 1.00 64.41  ? 166 VAL B CG1 1 
ATOM   5027 C CG2 . VAL B 1 166 ? -10.148 17.020  -8.496  1.00 58.47  ? 166 VAL B CG2 1 
ATOM   5028 N N   . LYS B 1 167 ? -12.276 17.347  -12.503 1.00 67.67  ? 167 LYS B N   1 
ATOM   5029 C CA  . LYS B 1 167 ? -12.443 17.484  -13.941 1.00 61.75  ? 167 LYS B CA  1 
ATOM   5030 C C   . LYS B 1 167 ? -13.561 18.471  -14.268 1.00 60.88  ? 167 LYS B C   1 
ATOM   5031 O O   . LYS B 1 167 ? -13.449 19.228  -15.223 1.00 68.35  ? 167 LYS B O   1 
ATOM   5032 C CB  . LYS B 1 167 ? -12.703 16.116  -14.582 1.00 63.11  ? 167 LYS B CB  1 
ATOM   5033 C CG  . LYS B 1 167 ? -11.509 15.163  -14.462 1.00 66.83  ? 167 LYS B CG  1 
ATOM   5034 C CD  . LYS B 1 167 ? -11.832 13.723  -14.869 1.00 60.43  ? 167 LYS B CD  1 
ATOM   5035 C CE  . LYS B 1 167 ? -10.658 12.815  -14.532 1.00 62.12  ? 167 LYS B CE  1 
ATOM   5036 N NZ  . LYS B 1 167 ? -10.840 11.409  -14.986 1.00 62.26  ? 167 LYS B NZ  1 
ATOM   5037 N N   . GLU B 1 168 ? -14.629 18.485  -13.476 1.00 62.11  ? 168 GLU B N   1 
ATOM   5038 C CA  . GLU B 1 168 ? -15.698 19.462  -13.692 1.00 61.61  ? 168 GLU B CA  1 
ATOM   5039 C C   . GLU B 1 168 ? -15.170 20.876  -13.525 1.00 69.44  ? 168 GLU B C   1 
ATOM   5040 O O   . GLU B 1 168 ? -15.587 21.799  -14.233 1.00 69.00  ? 168 GLU B O   1 
ATOM   5041 C CB  . GLU B 1 168 ? -16.863 19.251  -12.734 1.00 57.40  ? 168 GLU B CB  1 
ATOM   5042 C CG  . GLU B 1 168 ? -17.941 20.292  -12.939 1.00 61.84  ? 168 GLU B CG  1 
ATOM   5043 C CD  . GLU B 1 168 ? -18.840 20.483  -11.739 1.00 62.60  ? 168 GLU B CD  1 
ATOM   5044 O OE1 . GLU B 1 168 ? -18.852 19.614  -10.839 1.00 60.33  ? 168 GLU B OE1 1 
ATOM   5045 O OE2 . GLU B 1 168 ? -19.539 21.515  -11.712 1.00 60.01  ? 168 GLU B OE2 1 
ATOM   5046 N N   . MET B 1 169 ? -14.255 21.043  -12.574 1.00 67.32  ? 169 MET B N   1 
ATOM   5047 C CA  . MET B 1 169 ? -13.589 22.327  -12.397 1.00 72.80  ? 169 MET B CA  1 
ATOM   5048 C C   . MET B 1 169 ? -12.793 22.646  -13.644 1.00 76.65  ? 169 MET B C   1 
ATOM   5049 O O   . MET B 1 169 ? -13.010 23.675  -14.288 1.00 78.27  ? 169 MET B O   1 
ATOM   5050 C CB  . MET B 1 169 ? -12.660 22.321  -11.183 1.00 68.79  ? 169 MET B CB  1 
ATOM   5051 C CG  . MET B 1 169 ? -13.335 21.980  -9.885  1.00 66.87  ? 169 MET B CG  1 
ATOM   5052 S SD  . MET B 1 169 ? -12.215 22.105  -8.490  1.00 54.18  ? 169 MET B SD  1 
ATOM   5053 C CE  . MET B 1 169 ? -12.209 23.891  -8.288  1.00 62.12  ? 169 MET B CE  1 
ATOM   5054 N N   . LEU B 1 170 ? -11.873 21.738  -13.963 1.00 71.99  ? 170 LEU B N   1 
ATOM   5055 C CA  . LEU B 1 170 ? -11.017 21.831  -15.142 1.00 76.57  ? 170 LEU B CA  1 
ATOM   5056 C C   . LEU B 1 170 ? -11.825 22.079  -16.408 1.00 78.97  ? 170 LEU B C   1 
ATOM   5057 O O   . LEU B 1 170 ? -11.432 22.876  -17.255 1.00 79.37  ? 170 LEU B O   1 
ATOM   5058 C CB  . LEU B 1 170 ? -10.191 20.553  -15.294 1.00 71.23  ? 170 LEU B CB  1 
ATOM   5059 C CG  . LEU B 1 170 ? -9.249  20.476  -16.487 1.00 72.12  ? 170 LEU B CG  1 
ATOM   5060 C CD1 . LEU B 1 170 ? -8.173  21.534  -16.376 1.00 70.84  ? 170 LEU B CD1 1 
ATOM   5061 C CD2 . LEU B 1 170 ? -8.641  19.089  -16.573 1.00 78.16  ? 170 LEU B CD2 1 
ATOM   5062 N N   . SER B 1 171 ? -12.964 21.400  -16.523 1.00 80.48  ? 171 SER B N   1 
ATOM   5063 C CA  . SER B 1 171 ? -13.826 21.554  -17.687 1.00 81.16  ? 171 SER B CA  1 
ATOM   5064 C C   . SER B 1 171 ? -14.416 22.961  -17.722 1.00 86.25  ? 171 SER B C   1 
ATOM   5065 O O   . SER B 1 171 ? -14.706 23.489  -18.790 1.00 89.23  ? 171 SER B O   1 
ATOM   5066 C CB  . SER B 1 171 ? -14.936 20.501  -17.681 1.00 75.76  ? 171 SER B CB  1 
ATOM   5067 O OG  . SER B 1 171 ? -15.542 20.386  -18.956 1.00 81.74  ? 171 SER B OG  1 
ATOM   5068 N N   . ASP B 1 172 ? -14.589 23.569  -16.551 1.00 87.44  ? 172 ASP B N   1 
ATOM   5069 C CA  . ASP B 1 172 ? -15.038 24.955  -16.488 1.00 86.58  ? 172 ASP B CA  1 
ATOM   5070 C C   . ASP B 1 172 ? -13.858 25.892  -16.746 1.00 89.11  ? 172 ASP B C   1 
ATOM   5071 O O   . ASP B 1 172 ? -14.042 27.047  -17.131 1.00 90.19  ? 172 ASP B O   1 
ATOM   5072 C CB  . ASP B 1 172 ? -15.687 25.262  -15.135 1.00 82.28  ? 172 ASP B CB  1 
ATOM   5073 C CG  . ASP B 1 172 ? -16.283 26.662  -15.078 1.00 86.20  ? 172 ASP B CG  1 
ATOM   5074 O OD1 . ASP B 1 172 ? -17.035 27.024  -16.007 1.00 83.59  ? 172 ASP B OD1 1 
ATOM   5075 O OD2 . ASP B 1 172 ? -15.994 27.406  -14.111 1.00 81.69  ? 172 ASP B OD2 1 
ATOM   5076 N N   . MET B 1 173 ? -12.644 25.382  -16.537 1.00 90.33  ? 173 MET B N   1 
ATOM   5077 C CA  . MET B 1 173 ? -11.420 26.152  -16.788 1.00 91.30  ? 173 MET B CA  1 
ATOM   5078 C C   . MET B 1 173 ? -11.098 26.153  -18.278 1.00 94.09  ? 173 MET B C   1 
ATOM   5079 O O   . MET B 1 173 ? -10.775 27.195  -18.854 1.00 96.50  ? 173 MET B O   1 
ATOM   5080 C CB  . MET B 1 173 ? -10.234 25.589  -15.985 1.00 85.89  ? 173 MET B CB  1 
ATOM   5081 C CG  . MET B 1 173 ? -10.502 25.469  -14.483 1.00 78.10  ? 173 MET B CG  1 
ATOM   5082 S SD  . MET B 1 173 ? -9.046  25.477  -13.427 1.00 76.15  ? 173 MET B SD  1 
ATOM   5083 C CE  . MET B 1 173 ? -8.341  23.849  -13.677 1.00 67.86  ? 173 MET B CE  1 
ATOM   5084 N N   . VAL B 1 174 ? -11.180 24.970  -18.887 1.00 98.36  ? 174 VAL B N   1 
ATOM   5085 C CA  . VAL B 1 174 ? -11.143 24.818  -20.340 1.00 97.83  ? 174 VAL B CA  1 
ATOM   5086 C C   . VAL B 1 174 ? -12.151 25.772  -20.997 1.00 97.42  ? 174 VAL B C   1 
ATOM   5087 O O   . VAL B 1 174 ? -11.795 26.552  -21.879 1.00 102.68 ? 174 VAL B O   1 
ATOM   5088 C CB  . VAL B 1 174 ? -11.450 23.344  -20.766 1.00 91.46  ? 174 VAL B CB  1 
ATOM   5089 C CG1 . VAL B 1 174 ? -11.852 23.258  -22.237 1.00 87.95  ? 174 VAL B CG1 1 
ATOM   5090 C CG2 . VAL B 1 174 ? -10.270 22.424  -20.460 1.00 80.53  ? 174 VAL B CG2 1 
ATOM   5091 N N   . ARG B 1 175 ? -13.395 25.734  -20.523 1.00 94.39  ? 175 ARG B N   1 
ATOM   5092 C CA  . ARG B 1 175 ? -14.498 26.441  -21.169 1.00 94.30  ? 175 ARG B CA  1 
ATOM   5093 C C   . ARG B 1 175 ? -14.432 27.966  -21.055 1.00 100.94 ? 175 ARG B C   1 
ATOM   5094 O O   . ARG B 1 175 ? -15.228 28.666  -21.683 1.00 104.18 ? 175 ARG B O   1 
ATOM   5095 C CB  . ARG B 1 175 ? -15.840 25.950  -20.606 1.00 94.24  ? 175 ARG B CB  1 
ATOM   5096 C CG  . ARG B 1 175 ? -16.345 26.713  -19.385 1.00 97.30  ? 175 ARG B CG  1 
ATOM   5097 C CD  . ARG B 1 175 ? -17.840 26.485  -19.148 1.00 95.26  ? 175 ARG B CD  1 
ATOM   5098 N NE  . ARG B 1 175 ? -18.492 27.666  -18.579 1.00 94.78  ? 175 ARG B NE  1 
ATOM   5099 C CZ  . ARG B 1 175 ? -18.862 28.727  -19.291 1.00 95.56  ? 175 ARG B CZ  1 
ATOM   5100 N NH1 . ARG B 1 175 ? -18.643 28.760  -20.600 1.00 89.20  ? 175 ARG B NH1 1 
ATOM   5101 N NH2 . ARG B 1 175 ? -19.449 29.760  -18.699 1.00 95.36  ? 175 ARG B NH2 1 
ATOM   5102 N N   . ARG B 1 176 ? -13.498 28.488  -20.264 1.00 103.82 ? 176 ARG B N   1 
ATOM   5103 C CA  . ARG B 1 176 ? -13.380 29.937  -20.102 1.00 102.77 ? 176 ARG B CA  1 
ATOM   5104 C C   . ARG B 1 176 ? -12.274 30.522  -20.989 1.00 104.71 ? 176 ARG B C   1 
ATOM   5105 O O   . ARG B 1 176 ? -12.427 31.613  -21.541 1.00 105.98 ? 176 ARG B O   1 
ATOM   5106 C CB  . ARG B 1 176 ? -13.131 30.296  -18.631 1.00 93.99  ? 176 ARG B CB  1 
ATOM   5107 C CG  . ARG B 1 176 ? -14.357 30.141  -17.729 1.00 94.60  ? 176 ARG B CG  1 
ATOM   5108 C CD  . ARG B 1 176 ? -14.095 30.624  -16.293 1.00 90.86  ? 176 ARG B CD  1 
ATOM   5109 N NE  . ARG B 1 176 ? -15.278 30.493  -15.444 1.00 84.21  ? 176 ARG B NE  1 
ATOM   5110 C CZ  . ARG B 1 176 ? -15.831 31.486  -14.754 1.00 84.30  ? 176 ARG B CZ  1 
ATOM   5111 N NH1 . ARG B 1 176 ? -15.309 32.707  -14.793 1.00 83.43  ? 176 ARG B NH1 1 
ATOM   5112 N NH2 . ARG B 1 176 ? -16.909 31.253  -14.021 1.00 85.84  ? 176 ARG B NH2 1 
ATOM   5113 N N   . ARG B 1 177 ? -11.177 29.781  -21.135 1.00 101.61 ? 177 ARG B N   1 
ATOM   5114 C CA  . ARG B 1 177 ? -10.002 30.241  -21.876 1.00 109.90 ? 177 ARG B CA  1 
ATOM   5115 C C   . ARG B 1 177 ? -10.302 30.526  -23.358 1.00 116.95 ? 177 ARG B C   1 
ATOM   5116 O O   . ARG B 1 177 ? -9.652  31.371  -23.988 1.00 110.16 ? 177 ARG B O   1 
ATOM   5117 C CB  . ARG B 1 177 ? -8.875  29.204  -21.745 1.00 101.79 ? 177 ARG B CB  1 
ATOM   5118 C CG  . ARG B 1 177 ? -7.622  29.509  -22.558 1.00 99.16  ? 177 ARG B CG  1 
ATOM   5119 C CD  . ARG B 1 177 ? -6.517  28.499  -22.278 1.00 103.46 ? 177 ARG B CD  1 
ATOM   5120 N NE  . ARG B 1 177 ? -5.672  28.896  -21.154 1.00 104.95 ? 177 ARG B NE  1 
ATOM   5121 C CZ  . ARG B 1 177 ? -4.784  28.100  -20.560 1.00 100.87 ? 177 ARG B CZ  1 
ATOM   5122 N NH1 . ARG B 1 177 ? -4.627  26.847  -20.969 1.00 94.88  ? 177 ARG B NH1 1 
ATOM   5123 N NH2 . ARG B 1 177 ? -4.058  28.554  -19.548 1.00 93.23  ? 177 ARG B NH2 1 
ATOM   5124 N N   . ASN B 1 178 ? -11.304 29.839  -23.899 1.00 116.43 ? 178 ASN B N   1 
ATOM   5125 C CA  . ASN B 1 178 ? -11.645 29.961  -25.313 1.00 119.08 ? 178 ASN B CA  1 
ATOM   5126 C C   . ASN B 1 178 ? -12.510 31.186  -25.632 1.00 122.93 ? 178 ASN B C   1 
ATOM   5127 O O   . ASN B 1 178 ? -13.271 31.183  -26.605 1.00 127.26 ? 178 ASN B O   1 
ATOM   5128 C CB  . ASN B 1 178 ? -12.351 28.688  -25.792 1.00 121.92 ? 178 ASN B CB  1 
ATOM   5129 C CG  . ASN B 1 178 ? -13.709 28.490  -25.140 1.00 122.06 ? 178 ASN B CG  1 
ATOM   5130 O OD1 . ASN B 1 178 ? -14.052 29.166  -24.168 1.00 121.12 ? 178 ASN B OD1 1 
ATOM   5131 N ND2 . ASN B 1 178 ? -14.489 27.553  -25.671 1.00 128.95 ? 178 ASN B ND2 1 
ATOM   5132 N N   . ILE B 1 179 ? -12.393 32.227  -24.811 1.00 117.65 ? 179 ILE B N   1 
ATOM   5133 C CA  . ILE B 1 179 ? -13.091 33.479  -25.070 1.00 112.71 ? 179 ILE B CA  1 
ATOM   5134 C C   . ILE B 1 179 ? -12.082 34.607  -25.226 1.00 102.76 ? 179 ILE B C   1 
ATOM   5135 O O   . ILE B 1 179 ? -10.892 34.415  -24.981 1.00 98.09  ? 179 ILE B O   1 
ATOM   5136 C CB  . ILE B 1 179 ? -14.083 33.825  -23.948 1.00 107.29 ? 179 ILE B CB  1 
ATOM   5137 C CG1 . ILE B 1 179 ? -15.047 32.663  -23.703 1.00 108.88 ? 179 ILE B CG1 1 
ATOM   5138 C CG2 . ILE B 1 179 ? -14.852 35.085  -24.298 1.00 111.12 ? 179 ILE B CG2 1 
ATOM   5139 C CD1 . ILE B 1 179 ? -16.016 32.409  -24.842 1.00 106.07 ? 179 ILE B CD1 1 
ATOM   5140 N N   . SER B 1 195 ? -2.742  17.015  -33.645 1.00 65.60  ? 195 SER B N   1 
ATOM   5141 C CA  . SER B 1 195 ? -2.688  18.262  -32.885 1.00 64.20  ? 195 SER B CA  1 
ATOM   5142 C C   . SER B 1 195 ? -1.458  18.328  -31.991 1.00 64.11  ? 195 SER B C   1 
ATOM   5143 O O   . SER B 1 195 ? -1.064  19.407  -31.538 1.00 68.44  ? 195 SER B O   1 
ATOM   5144 C CB  . SER B 1 195 ? -3.948  18.439  -32.035 1.00 72.61  ? 195 SER B CB  1 
ATOM   5145 O OG  . SER B 1 195 ? -3.838  19.587  -31.207 1.00 77.17  ? 195 SER B OG  1 
ATOM   5146 N N   . ARG B 1 196 ? -0.868  17.171  -31.716 1.00 58.38  ? 196 ARG B N   1 
ATOM   5147 C CA  . ARG B 1 196 ? 0.388   17.116  -30.990 1.00 55.19  ? 196 ARG B CA  1 
ATOM   5148 C C   . ARG B 1 196 ? 1.471   16.951  -32.035 1.00 57.21  ? 196 ARG B C   1 
ATOM   5149 O O   . ARG B 1 196 ? 2.641   17.267  -31.819 1.00 53.50  ? 196 ARG B O   1 
ATOM   5150 C CB  . ARG B 1 196 ? 0.399   15.976  -29.966 1.00 56.69  ? 196 ARG B CB  1 
ATOM   5151 C CG  . ARG B 1 196 ? 1.671   15.900  -29.116 1.00 67.13  ? 196 ARG B CG  1 
ATOM   5152 C CD  . ARG B 1 196 ? 2.171   17.284  -28.636 1.00 63.72  ? 196 ARG B CD  1 
ATOM   5153 N NE  . ARG B 1 196 ? 1.437   17.828  -27.484 1.00 65.50  ? 196 ARG B NE  1 
ATOM   5154 C CZ  . ARG B 1 196 ? 1.807   18.918  -26.805 1.00 71.07  ? 196 ARG B CZ  1 
ATOM   5155 N NH1 . ARG B 1 196 ? 2.900   19.578  -27.164 1.00 71.13  ? 196 ARG B NH1 1 
ATOM   5156 N NH2 . ARG B 1 196 ? 1.094   19.354  -25.767 1.00 71.56  ? 196 ARG B NH2 1 
ATOM   5157 N N   . GLU B 1 197 ? 1.043   16.477  -33.198 1.00 62.52  ? 197 GLU B N   1 
ATOM   5158 C CA  . GLU B 1 197 ? 1.914   16.376  -34.353 1.00 55.91  ? 197 GLU B CA  1 
ATOM   5159 C C   . GLU B 1 197 ? 2.115   17.772  -34.931 1.00 51.21  ? 197 GLU B C   1 
ATOM   5160 O O   . GLU B 1 197 ? 3.033   17.999  -35.721 1.00 50.18  ? 197 GLU B O   1 
ATOM   5161 C CB  . GLU B 1 197 ? 1.320   15.426  -35.413 1.00 59.90  ? 197 GLU B CB  1 
ATOM   5162 C CG  . GLU B 1 197 ? 0.435   14.296  -34.864 1.00 71.17  ? 197 GLU B CG  1 
ATOM   5163 C CD  . GLU B 1 197 ? -1.062  14.648  -34.836 1.00 75.86  ? 197 GLU B CD  1 
ATOM   5164 O OE1 . GLU B 1 197 ? -1.652  14.821  -35.927 1.00 85.52  ? 197 GLU B OE1 1 
ATOM   5165 O OE2 . GLU B 1 197 ? -1.647  14.743  -33.729 1.00 72.01  ? 197 GLU B OE2 1 
ATOM   5166 N N   . HIS B 1 198 ? 1.245   18.698  -34.527 1.00 49.33  ? 198 HIS B N   1 
ATOM   5167 C CA  . HIS B 1 198 ? 1.248   20.054  -35.061 1.00 44.94  ? 198 HIS B CA  1 
ATOM   5168 C C   . HIS B 1 198 ? 2.151   20.934  -34.254 1.00 41.80  ? 198 HIS B C   1 
ATOM   5169 O O   . HIS B 1 198 ? 2.892   21.733  -34.811 1.00 45.43  ? 198 HIS B O   1 
ATOM   5170 C CB  . HIS B 1 198 ? -0.172  20.625  -35.115 1.00 44.86  ? 198 HIS B CB  1 
ATOM   5171 C CG  . HIS B 1 198 ? -1.023  19.969  -36.160 1.00 57.28  ? 198 HIS B CG  1 
ATOM   5172 N ND1 . HIS B 1 198 ? -0.892  18.636  -36.492 1.00 54.10  ? 198 HIS B ND1 1 
ATOM   5173 C CD2 . HIS B 1 198 ? -1.995  20.464  -36.961 1.00 57.05  ? 198 HIS B CD2 1 
ATOM   5174 C CE1 . HIS B 1 198 ? -1.756  18.335  -37.446 1.00 50.33  ? 198 HIS B CE1 1 
ATOM   5175 N NE2 . HIS B 1 198 ? -2.437  19.423  -37.747 1.00 50.84  ? 198 HIS B NE2 1 
ATOM   5176 N N   . VAL B 1 199 ? 2.102   20.791  -32.941 1.00 45.25  ? 199 VAL B N   1 
ATOM   5177 C CA  . VAL B 1 199 ? 3.087   21.445  -32.103 1.00 45.57  ? 199 VAL B CA  1 
ATOM   5178 C C   . VAL B 1 199 ? 4.475   20.918  -32.480 1.00 48.16  ? 199 VAL B C   1 
ATOM   5179 O O   . VAL B 1 199 ? 5.456   21.676  -32.613 1.00 41.77  ? 199 VAL B O   1 
ATOM   5180 C CB  . VAL B 1 199 ? 2.810   21.191  -30.634 1.00 44.52  ? 199 VAL B CB  1 
ATOM   5181 C CG1 . VAL B 1 199 ? 3.704   22.051  -29.784 1.00 50.71  ? 199 VAL B CG1 1 
ATOM   5182 C CG2 . VAL B 1 199 ? 1.359   21.478  -30.343 1.00 48.14  ? 199 VAL B CG2 1 
ATOM   5183 N N   . ASN B 1 200 ? 4.526   19.603  -32.679 1.00 46.84  ? 200 ASN B N   1 
ATOM   5184 C CA  . ASN B 1 200 ? 5.753   18.910  -33.037 1.00 46.24  ? 200 ASN B CA  1 
ATOM   5185 C C   . ASN B 1 200 ? 6.424   19.468  -34.296 1.00 42.16  ? 200 ASN B C   1 
ATOM   5186 O O   . ASN B 1 200 ? 7.642   19.610  -34.341 1.00 38.71  ? 200 ASN B O   1 
ATOM   5187 C CB  . ASN B 1 200 ? 5.461   17.420  -33.206 1.00 49.99  ? 200 ASN B CB  1 
ATOM   5188 C CG  . ASN B 1 200 ? 6.698   16.618  -33.542 1.00 53.76  ? 200 ASN B CG  1 
ATOM   5189 O OD1 . ASN B 1 200 ? 7.756   16.786  -32.917 1.00 48.13  ? 200 ASN B OD1 1 
ATOM   5190 N ND2 . ASN B 1 200 ? 6.578   15.740  -34.553 1.00 54.55  ? 200 ASN B ND2 1 
ATOM   5191 N N   . TRP B 1 201 ? 5.625   19.796  -35.306 1.00 38.47  ? 201 TRP B N   1 
ATOM   5192 C CA  . TRP B 1 201 ? 6.142   20.404  -36.526 1.00 39.57  ? 201 TRP B CA  1 
ATOM   5193 C C   . TRP B 1 201 ? 6.798   21.763  -36.248 1.00 43.59  ? 201 TRP B C   1 
ATOM   5194 O O   . TRP B 1 201 ? 7.844   22.101  -36.826 1.00 39.93  ? 201 TRP B O   1 
ATOM   5195 C CB  . TRP B 1 201 ? 5.023   20.562  -37.542 1.00 38.17  ? 201 TRP B CB  1 
ATOM   5196 C CG  . TRP B 1 201 ? 5.443   21.166  -38.862 1.00 36.94  ? 201 TRP B CG  1 
ATOM   5197 C CD1 . TRP B 1 201 ? 5.873   20.497  -39.971 1.00 35.54  ? 201 TRP B CD1 1 
ATOM   5198 C CD2 . TRP B 1 201 ? 5.426   22.554  -39.212 1.00 33.43  ? 201 TRP B CD2 1 
ATOM   5199 N NE1 . TRP B 1 201 ? 6.133   21.385  -40.988 1.00 39.99  ? 201 TRP B NE1 1 
ATOM   5200 C CE2 . TRP B 1 201 ? 5.870   22.655  -40.545 1.00 37.31  ? 201 TRP B CE2 1 
ATOM   5201 C CE3 . TRP B 1 201 ? 5.084   23.722  -38.526 1.00 38.36  ? 201 TRP B CE3 1 
ATOM   5202 C CZ2 . TRP B 1 201 ? 5.978   23.885  -41.208 1.00 37.51  ? 201 TRP B CZ2 1 
ATOM   5203 C CZ3 . TRP B 1 201 ? 5.198   24.946  -39.185 1.00 36.50  ? 201 TRP B CZ3 1 
ATOM   5204 C CH2 . TRP B 1 201 ? 5.646   25.015  -40.508 1.00 32.22  ? 201 TRP B CH2 1 
ATOM   5205 N N   . GLY B 1 202 ? 6.183   22.537  -35.359 1.00 41.56  ? 202 GLY B N   1 
ATOM   5206 C CA  . GLY B 1 202 ? 6.742   23.813  -34.950 1.00 41.06  ? 202 GLY B CA  1 
ATOM   5207 C C   . GLY B 1 202 ? 8.083   23.638  -34.252 1.00 45.58  ? 202 GLY B C   1 
ATOM   5208 O O   . GLY B 1 202 ? 9.072   24.295  -34.597 1.00 40.59  ? 202 GLY B O   1 
ATOM   5209 N N   . ARG B 1 203 ? 8.113   22.732  -33.277 1.00 43.30  ? 203 ARG B N   1 
ATOM   5210 C CA  . ARG B 1 203 ? 9.330   22.467  -32.521 1.00 39.41  ? 203 ARG B CA  1 
ATOM   5211 C C   . ARG B 1 203 ? 10.444  21.995  -33.438 1.00 38.69  ? 203 ARG B C   1 
ATOM   5212 O O   . ARG B 1 203 ? 11.587  22.406  -33.283 1.00 40.88  ? 203 ARG B O   1 
ATOM   5213 C CB  . ARG B 1 203 ? 9.071   21.430  -31.432 1.00 39.43  ? 203 ARG B CB  1 
ATOM   5214 C CG  . ARG B 1 203 ? 8.024   21.846  -30.434 1.00 44.49  ? 203 ARG B CG  1 
ATOM   5215 C CD  . ARG B 1 203 ? 7.972   20.918  -29.234 1.00 42.31  ? 203 ARG B CD  1 
ATOM   5216 N NE  . ARG B 1 203 ? 7.379   21.605  -28.098 1.00 38.81  ? 203 ARG B NE  1 
ATOM   5217 C CZ  . ARG B 1 203 ? 6.339   21.156  -27.407 1.00 52.04  ? 203 ARG B CZ  1 
ATOM   5218 N NH1 . ARG B 1 203 ? 5.774   19.993  -27.725 1.00 48.95  ? 203 ARG B NH1 1 
ATOM   5219 N NH2 . ARG B 1 203 ? 5.868   21.872  -26.388 1.00 58.16  ? 203 ARG B NH2 1 
ATOM   5220 N N   . GLU B 1 204 ? 10.107  21.119  -34.379 1.00 39.31  ? 204 GLU B N   1 
ATOM   5221 C CA  . GLU B 1 204 ? 11.071  20.643  -35.358 1.00 44.27  ? 204 GLU B CA  1 
ATOM   5222 C C   . GLU B 1 204 ? 11.643  21.811  -36.150 1.00 45.93  ? 204 GLU B C   1 
ATOM   5223 O O   . GLU B 1 204 ? 12.856  21.898  -36.351 1.00 47.63  ? 204 GLU B O   1 
ATOM   5224 C CB  . GLU B 1 204 ? 10.436  19.627  -36.317 1.00 43.99  ? 204 GLU B CB  1 
ATOM   5225 C CG  . GLU B 1 204 ? 10.084  18.279  -35.687 1.00 49.12  ? 204 GLU B CG  1 
ATOM   5226 C CD  . GLU B 1 204 ? 11.304  17.425  -35.409 1.00 56.97  ? 204 GLU B CD  1 
ATOM   5227 O OE1 . GLU B 1 204 ? 11.803  16.775  -36.363 1.00 62.33  ? 204 GLU B OE1 1 
ATOM   5228 O OE2 . GLU B 1 204 ? 11.764  17.408  -34.243 1.00 56.21  ? 204 GLU B OE2 1 
ATOM   5229 N N   . LEU B 1 205 ? 10.769  22.705  -36.596 1.00 42.78  ? 205 LEU B N   1 
ATOM   5230 C CA  . LEU B 1 205 ? 11.208  23.823  -37.422 1.00 43.20  ? 205 LEU B CA  1 
ATOM   5231 C C   . LEU B 1 205 ? 12.050  24.768  -36.581 1.00 42.32  ? 205 LEU B C   1 
ATOM   5232 O O   . LEU B 1 205 ? 13.044  25.305  -37.049 1.00 45.43  ? 205 LEU B O   1 
ATOM   5233 C CB  . LEU B 1 205 ? 10.012  24.554  -38.037 1.00 39.84  ? 205 LEU B CB  1 
ATOM   5234 C CG  . LEU B 1 205 ? 10.354  25.680  -38.995 1.00 36.08  ? 205 LEU B CG  1 
ATOM   5235 C CD1 . LEU B 1 205 ? 11.030  25.119  -40.226 1.00 38.55  ? 205 LEU B CD1 1 
ATOM   5236 C CD2 . LEU B 1 205 ? 9.101   26.486  -39.354 1.00 38.11  ? 205 LEU B CD2 1 
ATOM   5237 N N   . ALA B 1 206 ? 11.655  24.941  -35.325 1.00 43.58  ? 206 ALA B N   1 
ATOM   5238 C CA  . ALA B 1 206 ? 12.377  25.785  -34.380 1.00 44.59  ? 206 ALA B CA  1 
ATOM   5239 C C   . ALA B 1 206 ? 13.792  25.259  -34.091 1.00 49.01  ? 206 ALA B C   1 
ATOM   5240 O O   . ALA B 1 206 ? 14.667  26.012  -33.662 1.00 52.97  ? 206 ALA B O   1 
ATOM   5241 C CB  . ALA B 1 206 ? 11.588  25.908  -33.078 1.00 38.88  ? 206 ALA B CB  1 
ATOM   5242 N N   . ALA B 1 207 ? 14.016  23.972  -34.322 1.00 42.08  ? 207 ALA B N   1 
ATOM   5243 C CA  . ALA B 1 207 ? 15.312  23.378  -34.019 1.00 43.03  ? 207 ALA B CA  1 
ATOM   5244 C C   . ALA B 1 207 ? 16.165  23.183  -35.248 1.00 43.66  ? 207 ALA B C   1 
ATOM   5245 O O   . ALA B 1 207 ? 17.089  22.369  -35.221 1.00 41.83  ? 207 ALA B O   1 
ATOM   5246 C CB  . ALA B 1 207 ? 15.144  22.064  -33.329 1.00 38.53  ? 207 ALA B CB  1 
ATOM   5247 N N   . GLY B 1 208 ? 15.841  23.906  -36.320 1.00 36.14  ? 208 GLY B N   1 
ATOM   5248 C CA  . GLY B 1 208 ? 16.685  23.945  -37.498 1.00 39.93  ? 208 GLY B CA  1 
ATOM   5249 C C   . GLY B 1 208 ? 16.191  23.128  -38.674 1.00 42.53  ? 208 GLY B C   1 
ATOM   5250 O O   . GLY B 1 208 ? 16.479  23.436  -39.822 1.00 48.92  ? 208 GLY B O   1 
ATOM   5251 N N   . LYS B 1 209 ? 15.425  22.088  -38.388 1.00 44.33  ? 209 LYS B N   1 
ATOM   5252 C CA  . LYS B 1 209 ? 15.004  21.137  -39.405 1.00 43.08  ? 209 LYS B CA  1 
ATOM   5253 C C   . LYS B 1 209 ? 14.029  21.738  -40.409 1.00 43.65  ? 209 LYS B C   1 
ATOM   5254 O O   . LYS B 1 209 ? 12.853  21.383  -40.421 1.00 46.29  ? 209 LYS B O   1 
ATOM   5255 C CB  . LYS B 1 209 ? 14.386  19.923  -38.728 1.00 40.05  ? 209 LYS B CB  1 
ATOM   5256 C CG  . LYS B 1 209 ? 15.377  19.161  -37.896 1.00 39.57  ? 209 LYS B CG  1 
ATOM   5257 C CD  . LYS B 1 209 ? 14.666  18.228  -36.945 1.00 51.88  ? 209 LYS B CD  1 
ATOM   5258 C CE  . LYS B 1 209 ? 15.652  17.348  -36.180 1.00 53.07  ? 209 LYS B CE  1 
ATOM   5259 N NZ  . LYS B 1 209 ? 14.941  16.487  -35.196 1.00 55.60  ? 209 LYS B NZ  1 
ATOM   5260 N N   . PHE B 1 210 ? 14.526  22.627  -41.263 1.00 39.08  ? 210 PHE B N   1 
ATOM   5261 C CA  . PHE B 1 210 ? 13.665  23.320  -42.210 1.00 44.12  ? 210 PHE B CA  1 
ATOM   5262 C C   . PHE B 1 210 ? 12.919  22.381  -43.161 1.00 46.34  ? 210 PHE B C   1 
ATOM   5263 O O   . PHE B 1 210 ? 11.819  22.696  -43.623 1.00 43.48  ? 210 PHE B O   1 
ATOM   5264 C CB  . PHE B 1 210 ? 14.472  24.328  -43.027 1.00 46.90  ? 210 PHE B CB  1 
ATOM   5265 C CG  . PHE B 1 210 ? 15.677  23.750  -43.683 1.00 39.59  ? 210 PHE B CG  1 
ATOM   5266 C CD1 . PHE B 1 210 ? 15.573  23.098  -44.907 1.00 39.11  ? 210 PHE B CD1 1 
ATOM   5267 C CD2 . PHE B 1 210 ? 16.920  23.874  -43.090 1.00 41.34  ? 210 PHE B CD2 1 
ATOM   5268 C CE1 . PHE B 1 210 ? 16.690  22.557  -45.532 1.00 38.53  ? 210 PHE B CE1 1 
ATOM   5269 C CE2 . PHE B 1 210 ? 18.044  23.339  -43.699 1.00 49.35  ? 210 PHE B CE2 1 
ATOM   5270 C CZ  . PHE B 1 210 ? 17.924  22.674  -44.932 1.00 48.98  ? 210 PHE B CZ  1 
ATOM   5271 N N   . GLN B 1 211 ? 13.494  21.221  -43.445 1.00 44.69  ? 211 GLN B N   1 
ATOM   5272 C CA  . GLN B 1 211 ? 12.891  20.348  -44.436 1.00 40.59  ? 211 GLN B CA  1 
ATOM   5273 C C   . GLN B 1 211 ? 11.489  19.882  -44.035 1.00 40.70  ? 211 GLN B C   1 
ATOM   5274 O O   . GLN B 1 211 ? 10.793  19.288  -44.859 1.00 45.17  ? 211 GLN B O   1 
ATOM   5275 C CB  . GLN B 1 211 ? 13.791  19.146  -44.705 1.00 43.65  ? 211 GLN B CB  1 
ATOM   5276 C CG  . GLN B 1 211 ? 13.951  18.190  -43.527 1.00 43.02  ? 211 GLN B CG  1 
ATOM   5277 C CD  . GLN B 1 211 ? 14.709  16.936  -43.931 1.00 48.35  ? 211 GLN B CD  1 
ATOM   5278 O OE1 . GLN B 1 211 ? 14.515  16.410  -45.031 1.00 41.46  ? 211 GLN B OE1 1 
ATOM   5279 N NE2 . GLN B 1 211 ? 15.587  16.457  -43.050 1.00 51.29  ? 211 GLN B NE2 1 
ATOM   5280 N N   . VAL B 1 212 ? 11.058  20.171  -42.803 1.00 35.98  ? 212 VAL B N   1 
ATOM   5281 C CA  . VAL B 1 212 ? 9.690   19.840  -42.389 1.00 37.74  ? 212 VAL B CA  1 
ATOM   5282 C C   . VAL B 1 212 ? 8.664   20.716  -43.081 1.00 41.17  ? 212 VAL B C   1 
ATOM   5283 O O   . VAL B 1 212 ? 7.470   20.436  -43.060 1.00 43.78  ? 212 VAL B O   1 
ATOM   5284 C CB  . VAL B 1 212 ? 9.465   19.987  -40.882 1.00 34.52  ? 212 VAL B CB  1 
ATOM   5285 C CG1 . VAL B 1 212 ? 10.494  19.209  -40.114 1.00 40.71  ? 212 VAL B CG1 1 
ATOM   5286 C CG2 . VAL B 1 212 ? 9.493   21.445  -40.480 1.00 36.99  ? 212 VAL B CG2 1 
ATOM   5287 N N   . VAL B 1 213 ? 9.119   21.801  -43.680 1.00 42.53  ? 213 VAL B N   1 
ATOM   5288 C CA  . VAL B 1 213 ? 8.201   22.653  -44.403 1.00 38.58  ? 213 VAL B CA  1 
ATOM   5289 C C   . VAL B 1 213 ? 7.804   21.976  -45.719 1.00 37.93  ? 213 VAL B C   1 
ATOM   5290 O O   . VAL B 1 213 ? 6.747   22.264  -46.270 1.00 37.16  ? 213 VAL B O   1 
ATOM   5291 C CB  . VAL B 1 213 ? 8.812   24.053  -44.636 1.00 42.39  ? 213 VAL B CB  1 
ATOM   5292 C CG1 . VAL B 1 213 ? 9.340   24.602  -43.318 1.00 36.38  ? 213 VAL B CG1 1 
ATOM   5293 C CG2 . VAL B 1 213 ? 9.918   24.030  -45.692 1.00 40.12  ? 213 VAL B CG2 1 
ATOM   5294 N N   . PHE B 1 214 ? 8.632   21.042  -46.187 1.00 38.02  ? 214 PHE B N   1 
ATOM   5295 C CA  . PHE B 1 214 ? 8.366   20.307  -47.426 1.00 39.86  ? 214 PHE B CA  1 
ATOM   5296 C C   . PHE B 1 214 ? 7.171   19.356  -47.339 1.00 37.70  ? 214 PHE B C   1 
ATOM   5297 O O   . PHE B 1 214 ? 6.444   19.167  -48.315 1.00 40.75  ? 214 PHE B O   1 
ATOM   5298 C CB  . PHE B 1 214 ? 9.608   19.519  -47.847 1.00 39.47  ? 214 PHE B CB  1 
ATOM   5299 C CG  . PHE B 1 214 ? 10.769  20.387  -48.222 1.00 38.90  ? 214 PHE B CG  1 
ATOM   5300 C CD1 . PHE B 1 214 ? 10.572  21.688  -48.648 1.00 42.51  ? 214 PHE B CD1 1 
ATOM   5301 C CD2 . PHE B 1 214 ? 12.053  19.914  -48.139 1.00 39.04  ? 214 PHE B CD2 1 
ATOM   5302 C CE1 . PHE B 1 214 ? 11.635  22.493  -48.995 1.00 39.18  ? 214 PHE B CE1 1 
ATOM   5303 C CE2 . PHE B 1 214 ? 13.133  20.725  -48.480 1.00 42.53  ? 214 PHE B CE2 1 
ATOM   5304 C CZ  . PHE B 1 214 ? 12.921  22.011  -48.902 1.00 40.27  ? 214 PHE B CZ  1 
ATOM   5305 N N   . ASN B 1 215 ? 6.968   18.763  -46.170 1.00 38.29  ? 215 ASN B N   1 
ATOM   5306 C CA  . ASN B 1 215 ? 5.905   17.779  -45.983 1.00 40.56  ? 215 ASN B CA  1 
ATOM   5307 C C   . ASN B 1 215 ? 5.367   17.874  -44.549 1.00 37.11  ? 215 ASN B C   1 
ATOM   5308 O O   . ASN B 1 215 ? 5.701   17.061  -43.689 1.00 42.37  ? 215 ASN B O   1 
ATOM   5309 C CB  . ASN B 1 215 ? 6.439   16.364  -46.356 1.00 39.46  ? 215 ASN B CB  1 
ATOM   5310 C CG  . ASN B 1 215 ? 5.605   15.210  -45.788 1.00 40.32  ? 215 ASN B CG  1 
ATOM   5311 O OD1 . ASN B 1 215 ? 4.422   15.029  -46.107 1.00 32.60  ? 215 ASN B OD1 1 
ATOM   5312 N ND2 . ASN B 1 215 ? 6.250   14.403  -44.948 1.00 41.81  ? 215 ASN B ND2 1 
ATOM   5313 N N   . PRO B 1 216 ? 4.559   18.906  -44.274 1.00 34.79  ? 216 PRO B N   1 
ATOM   5314 C CA  . PRO B 1 216 ? 3.995   19.023  -42.923 1.00 35.09  ? 216 PRO B CA  1 
ATOM   5315 C C   . PRO B 1 216 ? 2.983   17.919  -42.684 1.00 32.74  ? 216 PRO B C   1 
ATOM   5316 O O   . PRO B 1 216 ? 2.457   17.389  -43.659 1.00 39.48  ? 216 PRO B O   1 
ATOM   5317 C CB  . PRO B 1 216 ? 3.341   20.418  -42.915 1.00 38.63  ? 216 PRO B CB  1 
ATOM   5318 C CG  . PRO B 1 216 ? 3.211   20.832  -44.336 1.00 32.35  ? 216 PRO B CG  1 
ATOM   5319 C CD  . PRO B 1 216 ? 4.174   20.024  -45.161 1.00 38.31  ? 216 PRO B CD  1 
ATOM   5320 N N   . PRO B 1 217 ? 2.737   17.555  -41.419 1.00 31.49  ? 217 PRO B N   1 
ATOM   5321 C CA  . PRO B 1 217 ? 1.860   16.434  -41.041 1.00 36.23  ? 217 PRO B CA  1 
ATOM   5322 C C   . PRO B 1 217 ? 0.362   16.628  -41.320 1.00 39.52  ? 217 PRO B C   1 
ATOM   5323 O O   . PRO B 1 217 ? -0.414  15.692  -41.159 1.00 49.78  ? 217 PRO B O   1 
ATOM   5324 C CB  . PRO B 1 217 ? 2.087   16.308  -39.524 1.00 36.15  ? 217 PRO B CB  1 
ATOM   5325 C CG  . PRO B 1 217 ? 2.569   17.646  -39.101 1.00 35.90  ? 217 PRO B CG  1 
ATOM   5326 C CD  . PRO B 1 217 ? 3.415   18.129  -40.249 1.00 33.38  ? 217 PRO B CD  1 
ATOM   5327 N N   . TRP B 1 218 ? -0.057  17.816  -41.714 1.00 39.55  ? 218 TRP B N   1 
ATOM   5328 C CA  . TRP B 1 218 ? -1.485  18.071  -41.834 1.00 39.72  ? 218 TRP B CA  1 
ATOM   5329 C C   . TRP B 1 218 ? -1.864  18.210  -43.274 1.00 35.02  ? 218 TRP B C   1 
ATOM   5330 O O   . TRP B 1 218 ? -3.035  18.347  -43.590 1.00 41.58  ? 218 TRP B O   1 
ATOM   5331 C CB  . TRP B 1 218 ? -1.895  19.346  -41.097 1.00 39.97  ? 218 TRP B CB  1 
ATOM   5332 C CG  . TRP B 1 218 ? -1.076  20.513  -41.531 1.00 35.17  ? 218 TRP B CG  1 
ATOM   5333 C CD1 . TRP B 1 218 ? -1.131  21.160  -42.728 1.00 35.07  ? 218 TRP B CD1 1 
ATOM   5334 C CD2 . TRP B 1 218 ? -0.055  21.151  -40.775 1.00 37.35  ? 218 TRP B CD2 1 
ATOM   5335 N NE1 . TRP B 1 218 ? -0.206  22.169  -42.765 1.00 36.62  ? 218 TRP B NE1 1 
ATOM   5336 C CE2 . TRP B 1 218 ? 0.462   22.191  -41.571 1.00 39.31  ? 218 TRP B CE2 1 
ATOM   5337 C CE3 . TRP B 1 218 ? 0.460   20.955  -39.492 1.00 35.21  ? 218 TRP B CE3 1 
ATOM   5338 C CZ2 . TRP B 1 218 ? 1.483   23.028  -41.129 1.00 35.32  ? 218 TRP B CZ2 1 
ATOM   5339 C CZ3 . TRP B 1 218 ? 1.459   21.777  -39.059 1.00 39.57  ? 218 TRP B CZ3 1 
ATOM   5340 C CH2 . TRP B 1 218 ? 1.966   22.807  -39.877 1.00 35.20  ? 218 TRP B CH2 1 
ATOM   5341 N N   . GLY B 1 219 ? -0.868  18.224  -44.146 1.00 34.58  ? 219 GLY B N   1 
ATOM   5342 C CA  . GLY B 1 219 ? -1.127  18.448  -45.554 1.00 33.73  ? 219 GLY B CA  1 
ATOM   5343 C C   . GLY B 1 219 ? -0.331  19.629  -46.074 1.00 41.79  ? 219 GLY B C   1 
ATOM   5344 O O   . GLY B 1 219 ? 0.846   19.789  -45.752 1.00 44.56  ? 219 GLY B O   1 
ATOM   5345 N N   . ASP B 1 220 ? -0.980  20.461  -46.876 1.00 39.27  ? 220 ASP B N   1 
ATOM   5346 C CA  . ASP B 1 220 ? -0.319  21.556  -47.560 1.00 37.73  ? 220 ASP B CA  1 
ATOM   5347 C C   . ASP B 1 220 ? 0.275   22.609  -46.600 1.00 43.79  ? 220 ASP B C   1 
ATOM   5348 O O   . ASP B 1 220 ? -0.196  22.794  -45.471 1.00 37.62  ? 220 ASP B O   1 
ATOM   5349 C CB  . ASP B 1 220 ? -1.316  22.214  -48.514 1.00 41.34  ? 220 ASP B CB  1 
ATOM   5350 C CG  . ASP B 1 220 ? -0.654  23.189  -49.460 1.00 52.53  ? 220 ASP B CG  1 
ATOM   5351 O OD1 . ASP B 1 220 ? 0.341   22.803  -50.122 1.00 58.29  ? 220 ASP B OD1 1 
ATOM   5352 O OD2 . ASP B 1 220 ? -1.124  24.344  -49.542 1.00 56.55  ? 220 ASP B OD2 1 
ATOM   5353 N N   . ILE B 1 221 ? 1.310   23.303  -47.070 1.00 43.04  ? 221 ILE B N   1 
ATOM   5354 C CA  . ILE B 1 221 ? 2.006   24.315  -46.278 1.00 42.86  ? 221 ILE B CA  1 
ATOM   5355 C C   . ILE B 1 221 ? 1.067   25.516  -46.068 1.00 46.65  ? 221 ILE B C   1 
ATOM   5356 O O   . ILE B 1 221 ? 1.215   26.282  -45.110 1.00 41.61  ? 221 ILE B O   1 
ATOM   5357 C CB  . ILE B 1 221 ? 3.367   24.727  -46.962 1.00 38.60  ? 221 ILE B CB  1 
ATOM   5358 C CG1 . ILE B 1 221 ? 4.272   25.513  -46.021 1.00 38.70  ? 221 ILE B CG1 1 
ATOM   5359 C CG2 . ILE B 1 221 ? 3.139   25.500  -48.253 1.00 38.11  ? 221 ILE B CG2 1 
ATOM   5360 C CD1 . ILE B 1 221 ? 4.296   25.017  -44.601 1.00 40.49  ? 221 ILE B CD1 1 
ATOM   5361 N N   . ASN B 1 222 ? 0.059   25.626  -46.937 1.00 47.82  ? 222 ASN B N   1 
ATOM   5362 C CA  . ASN B 1 222 ? -0.918  26.712  -46.873 1.00 41.81  ? 222 ASN B CA  1 
ATOM   5363 C C   . ASN B 1 222 ? -2.235  26.294  -46.273 1.00 42.54  ? 222 ASN B C   1 
ATOM   5364 O O   . ASN B 1 222 ? -3.129  27.111  -46.129 1.00 49.72  ? 222 ASN B O   1 
ATOM   5365 C CB  . ASN B 1 222 ? -1.176  27.283  -48.259 1.00 42.26  ? 222 ASN B CB  1 
ATOM   5366 C CG  . ASN B 1 222 ? -0.008  28.074  -48.783 1.00 44.53  ? 222 ASN B CG  1 
ATOM   5367 O OD1 . ASN B 1 222 ? 0.449   29.029  -48.151 1.00 49.21  ? 222 ASN B OD1 1 
ATOM   5368 N ND2 . ASN B 1 222 ? 0.494   27.679  -49.940 1.00 48.26  ? 222 ASN B ND2 1 
ATOM   5369 N N   . LYS B 1 223 ? -2.366  25.018  -45.939 1.00 47.58  ? 223 LYS B N   1 
ATOM   5370 C CA  . LYS B 1 223 ? -3.625  24.515  -45.421 1.00 40.58  ? 223 LYS B CA  1 
ATOM   5371 C C   . LYS B 1 223 ? -4.009  25.293  -44.174 1.00 46.04  ? 223 LYS B C   1 
ATOM   5372 O O   . LYS B 1 223 ? -3.284  25.302  -43.180 1.00 47.45  ? 223 LYS B O   1 
ATOM   5373 C CB  . LYS B 1 223 ? -3.538  23.021  -45.123 1.00 36.68  ? 223 LYS B CB  1 
ATOM   5374 C CG  . LYS B 1 223 ? -4.738  22.485  -44.354 1.00 41.99  ? 223 LYS B CG  1 
ATOM   5375 C CD  . LYS B 1 223 ? -4.836  20.960  -44.405 1.00 41.38  ? 223 LYS B CD  1 
ATOM   5376 C CE  . LYS B 1 223 ? -6.059  20.470  -43.632 1.00 48.62  ? 223 LYS B CE  1 
ATOM   5377 N NZ  . LYS B 1 223 ? -6.279  18.996  -43.681 1.00 49.31  ? 223 LYS B NZ  1 
ATOM   5378 N N   . THR B 1 224 ? -5.144  25.974  -44.242 1.00 49.08  ? 224 THR B N   1 
ATOM   5379 C CA  . THR B 1 224 ? -5.634  26.741  -43.104 1.00 45.66  ? 224 THR B CA  1 
ATOM   5380 C C   . THR B 1 224 ? -6.487  25.849  -42.223 1.00 46.15  ? 224 THR B C   1 
ATOM   5381 O O   . THR B 1 224 ? -6.819  24.735  -42.615 1.00 57.14  ? 224 THR B O   1 
ATOM   5382 C CB  . THR B 1 224 ? -6.435  27.955  -43.563 1.00 49.75  ? 224 THR B CB  1 
ATOM   5383 O OG1 . THR B 1 224 ? -7.662  27.515  -44.162 1.00 58.32  ? 224 THR B OG1 1 
ATOM   5384 C CG2 . THR B 1 224 ? -5.624  28.758  -44.584 1.00 48.66  ? 224 THR B CG2 1 
ATOM   5385 N N   . GLY B 1 225 ? -6.850  26.324  -41.039 1.00 49.26  ? 225 GLY B N   1 
ATOM   5386 C CA  . GLY B 1 225 ? -7.531  25.465  -40.089 1.00 45.90  ? 225 GLY B CA  1 
ATOM   5387 C C   . GLY B 1 225 ? -8.908  25.938  -39.677 1.00 54.52  ? 225 GLY B C   1 
ATOM   5388 O O   . GLY B 1 225 ? -9.734  26.302  -40.519 1.00 50.86  ? 225 GLY B O   1 
ATOM   5389 N N   . ARG B 1 226 ? -9.143  25.901  -38.366 1.00 59.48  ? 226 ARG B N   1 
ATOM   5390 C CA  . ARG B 1 226 ? -10.384 26.357  -37.735 1.00 63.76  ? 226 ARG B CA  1 
ATOM   5391 C C   . ARG B 1 226 ? -10.830 27.698  -38.253 1.00 58.02  ? 226 ARG B C   1 
ATOM   5392 O O   . ARG B 1 226 ? -11.850 27.830  -38.930 1.00 65.81  ? 226 ARG B O   1 
ATOM   5393 C CB  . ARG B 1 226 ? -10.195 26.454  -36.208 1.00 76.56  ? 226 ARG B CB  1 
ATOM   5394 C CG  . ARG B 1 226 ? -11.341 27.120  -35.426 1.00 69.28  ? 226 ARG B CG  1 
ATOM   5395 C CD  . ARG B 1 226 ? -12.552 26.199  -35.323 1.00 81.01  ? 226 ARG B CD  1 
ATOM   5396 N NE  . ARG B 1 226 ? -12.166 24.818  -35.024 1.00 90.97  ? 226 ARG B NE  1 
ATOM   5397 C CZ  . ARG B 1 226 ? -12.667 23.743  -35.630 1.00 95.81  ? 226 ARG B CZ  1 
ATOM   5398 N NH1 . ARG B 1 226 ? -13.590 23.877  -36.576 1.00 96.03  ? 226 ARG B NH1 1 
ATOM   5399 N NH2 . ARG B 1 226 ? -12.247 22.529  -35.286 1.00 97.03  ? 226 ARG B NH2 1 
ATOM   5400 N N   . SER B 1 227 ? -10.017 28.690  -37.939 1.00 54.89  ? 227 SER B N   1 
ATOM   5401 C CA  . SER B 1 227 ? -10.389 30.079  -38.071 1.00 52.92  ? 227 SER B CA  1 
ATOM   5402 C C   . SER B 1 227 ? -9.702  30.761  -39.232 1.00 48.44  ? 227 SER B C   1 
ATOM   5403 O O   . SER B 1 227 ? -9.431  31.960  -39.174 1.00 49.96  ? 227 SER B O   1 
ATOM   5404 C CB  . SER B 1 227 ? -10.034 30.789  -36.782 1.00 54.92  ? 227 SER B CB  1 
ATOM   5405 O OG  . SER B 1 227 ? -8.759  30.325  -36.377 1.00 52.43  ? 227 SER B OG  1 
ATOM   5406 N N   . GLY B 1 228 ? -9.388  30.003  -40.273 1.00 45.96  ? 228 GLY B N   1 
ATOM   5407 C CA  . GLY B 1 228 ? -8.748  30.580  -41.440 1.00 47.84  ? 228 GLY B CA  1 
ATOM   5408 C C   . GLY B 1 228 ? -7.270  30.856  -41.272 1.00 40.86  ? 228 GLY B C   1 
ATOM   5409 O O   . GLY B 1 228 ? -6.593  31.245  -42.216 1.00 48.17  ? 228 GLY B O   1 
ATOM   5410 N N   . ILE B 1 229 ? -6.762  30.654  -40.066 1.00 46.52  ? 229 ILE B N   1 
ATOM   5411 C CA  . ILE B 1 229 ? -5.339  30.805  -39.818 1.00 43.30  ? 229 ILE B CA  1 
ATOM   5412 C C   . ILE B 1 229 ? -4.647  29.541  -40.308 1.00 44.34  ? 229 ILE B C   1 
ATOM   5413 O O   . ILE B 1 229 ? -5.019  28.426  -39.910 1.00 44.17  ? 229 ILE B O   1 
ATOM   5414 C CB  . ILE B 1 229 ? -5.035  31.053  -38.319 1.00 44.62  ? 229 ILE B CB  1 
ATOM   5415 C CG1 . ILE B 1 229 ? -5.851  32.237  -37.785 1.00 45.17  ? 229 ILE B CG1 1 
ATOM   5416 C CG2 . ILE B 1 229 ? -3.542  31.301  -38.102 1.00 41.89  ? 229 ILE B CG2 1 
ATOM   5417 C CD1 . ILE B 1 229 ? -5.331  32.807  -36.456 1.00 43.48  ? 229 ILE B CD1 1 
ATOM   5418 N N   . PRO B 1 230 ? -3.663  29.702  -41.207 1.00 44.61  ? 230 PRO B N   1 
ATOM   5419 C CA  . PRO B 1 230 ? -2.897  28.546  -41.685 1.00 40.38  ? 230 PRO B CA  1 
ATOM   5420 C C   . PRO B 1 230 ? -2.365  27.747  -40.505 1.00 41.39  ? 230 PRO B C   1 
ATOM   5421 O O   . PRO B 1 230 ? -1.870  28.379  -39.562 1.00 41.55  ? 230 PRO B O   1 
ATOM   5422 C CB  . PRO B 1 230 ? -1.760  29.177  -42.507 1.00 38.68  ? 230 PRO B CB  1 
ATOM   5423 C CG  . PRO B 1 230 ? -1.898  30.685  -42.350 1.00 33.39  ? 230 PRO B CG  1 
ATOM   5424 C CD  . PRO B 1 230 ? -3.286  30.951  -41.892 1.00 39.95  ? 230 PRO B CD  1 
ATOM   5425 N N   . LEU B 1 231 ? -2.498  26.416  -40.533 1.00 40.97  ? 231 LEU B N   1 
ATOM   5426 C CA  . LEU B 1 231 ? -2.028  25.574  -39.431 1.00 33.94  ? 231 LEU B CA  1 
ATOM   5427 C C   . LEU B 1 231 ? -0.573  25.843  -39.110 1.00 35.37  ? 231 LEU B C   1 
ATOM   5428 O O   . LEU B 1 231 ? -0.155  25.688  -37.967 1.00 40.74  ? 231 LEU B O   1 
ATOM   5429 C CB  . LEU B 1 231 ? -2.176  24.089  -39.744 1.00 39.16  ? 231 LEU B CB  1 
ATOM   5430 C CG  . LEU B 1 231 ? -3.502  23.335  -39.679 1.00 42.70  ? 231 LEU B CG  1 
ATOM   5431 C CD1 . LEU B 1 231 ? -4.385  23.804  -38.517 1.00 35.39  ? 231 LEU B CD1 1 
ATOM   5432 C CD2 . LEU B 1 231 ? -4.204  23.413  -41.019 1.00 36.96  ? 231 LEU B CD2 1 
ATOM   5433 N N   . ALA B 1 232 ? 0.201   26.212  -40.128 1.00 31.54  ? 232 ALA B N   1 
ATOM   5434 C CA  . ALA B 1 232 ? 1.598   26.585  -39.946 1.00 32.26  ? 232 ALA B CA  1 
ATOM   5435 C C   . ALA B 1 232 ? 1.761   27.703  -38.899 1.00 44.11  ? 232 ALA B C   1 
ATOM   5436 O O   . ALA B 1 232 ? 2.621   27.619  -38.002 1.00 42.13  ? 232 ALA B O   1 
ATOM   5437 C CB  . ALA B 1 232 ? 2.200   27.013  -41.267 1.00 33.19  ? 232 ALA B CB  1 
ATOM   5438 N N   . VAL B 1 233 ? 0.920   28.733  -39.013 1.00 41.72  ? 233 VAL B N   1 
ATOM   5439 C CA  . VAL B 1 233 ? 0.944   29.855  -38.087 1.00 43.48  ? 233 VAL B CA  1 
ATOM   5440 C C   . VAL B 1 233 ? 0.540   29.466  -36.672 1.00 37.01  ? 233 VAL B C   1 
ATOM   5441 O O   . VAL B 1 233 ? 1.228   29.820  -35.712 1.00 43.37  ? 233 VAL B O   1 
ATOM   5442 C CB  . VAL B 1 233 ? 0.039   30.998  -38.562 1.00 40.33  ? 233 VAL B CB  1 
ATOM   5443 C CG1 . VAL B 1 233 ? -0.098  32.033  -37.472 1.00 34.50  ? 233 VAL B CG1 1 
ATOM   5444 C CG2 . VAL B 1 233 ? 0.627   31.628  -39.823 1.00 34.21  ? 233 VAL B CG2 1 
ATOM   5445 N N   . THR B 1 234 ? -0.559  28.747  -36.523 1.00 34.70  ? 234 THR B N   1 
ATOM   5446 C CA  . THR B 1 234 ? -0.989  28.365  -35.173 1.00 38.56  ? 234 THR B CA  1 
ATOM   5447 C C   . THR B 1 234 ? 0.016   27.421  -34.519 1.00 38.96  ? 234 THR B C   1 
ATOM   5448 O O   . THR B 1 234 ? 0.124   27.361  -33.304 1.00 37.65  ? 234 THR B O   1 
ATOM   5449 C CB  . THR B 1 234 ? -2.393  27.696  -35.159 1.00 41.13  ? 234 THR B CB  1 
ATOM   5450 O OG1 . THR B 1 234 ? -2.426  26.582  -36.064 1.00 41.21  ? 234 THR B OG1 1 
ATOM   5451 C CG2 . THR B 1 234 ? -3.480  28.703  -35.540 1.00 35.46  ? 234 THR B CG2 1 
ATOM   5452 N N   . SER B 1 235 ? 0.759   26.685  -35.333 1.00 42.49  ? 235 SER B N   1 
ATOM   5453 C CA  . SER B 1 235 ? 1.749   25.778  -34.796 1.00 38.31  ? 235 SER B CA  1 
ATOM   5454 C C   . SER B 1 235 ? 2.904   26.572  -34.201 1.00 39.59  ? 235 SER B C   1 
ATOM   5455 O O   . SER B 1 235 ? 3.335   26.301  -33.087 1.00 46.36  ? 235 SER B O   1 
ATOM   5456 C CB  . SER B 1 235 ? 2.238   24.826  -35.874 1.00 40.59  ? 235 SER B CB  1 
ATOM   5457 O OG  . SER B 1 235 ? 3.321   24.078  -35.381 1.00 41.45  ? 235 SER B OG  1 
ATOM   5458 N N   . MET B 1 236 ? 3.385   27.568  -34.940 1.00 41.96  ? 236 MET B N   1 
ATOM   5459 C CA  . MET B 1 236 ? 4.414   28.478  -34.445 1.00 38.95  ? 236 MET B CA  1 
ATOM   5460 C C   . MET B 1 236 ? 3.970   29.257  -33.209 1.00 39.95  ? 236 MET B C   1 
ATOM   5461 O O   . MET B 1 236 ? 4.728   29.409  -32.261 1.00 44.45  ? 236 MET B O   1 
ATOM   5462 C CB  . MET B 1 236 ? 4.813   29.449  -35.530 1.00 39.19  ? 236 MET B CB  1 
ATOM   5463 C CG  . MET B 1 236 ? 5.368   28.809  -36.750 1.00 35.54  ? 236 MET B CG  1 
ATOM   5464 S SD  . MET B 1 236 ? 6.026   30.081  -37.817 1.00 40.65  ? 236 MET B SD  1 
ATOM   5465 C CE  . MET B 1 236 ? 5.907   29.300  -39.406 1.00 23.79  ? 236 MET B CE  1 
ATOM   5466 N N   . VAL B 1 237 ? 2.735   29.741  -33.214 1.00 41.86  ? 237 VAL B N   1 
ATOM   5467 C CA  . VAL B 1 237 ? 2.156   30.349  -32.015 1.00 44.87  ? 237 VAL B CA  1 
ATOM   5468 C C   . VAL B 1 237 ? 2.145   29.386  -30.835 1.00 45.95  ? 237 VAL B C   1 
ATOM   5469 O O   . VAL B 1 237 ? 2.488   29.765  -29.711 1.00 47.85  ? 237 VAL B O   1 
ATOM   5470 C CB  . VAL B 1 237 ? 0.720   30.834  -32.270 1.00 39.57  ? 237 VAL B CB  1 
ATOM   5471 C CG1 . VAL B 1 237 ? 0.058   31.217  -30.973 1.00 42.24  ? 237 VAL B CG1 1 
ATOM   5472 C CG2 . VAL B 1 237 ? 0.732   32.014  -33.235 1.00 40.79  ? 237 VAL B CG2 1 
ATOM   5473 N N   . LYS B 1 238 ? 1.755   28.137  -31.097 1.00 46.65  ? 238 LYS B N   1 
ATOM   5474 C CA  . LYS B 1 238 ? 1.690   27.120  -30.053 1.00 40.17  ? 238 LYS B CA  1 
ATOM   5475 C C   . LYS B 1 238 ? 3.073   26.854  -29.494 1.00 43.63  ? 238 LYS B C   1 
ATOM   5476 O O   . LYS B 1 238 ? 3.234   26.729  -28.290 1.00 49.71  ? 238 LYS B O   1 
ATOM   5477 C CB  . LYS B 1 238 ? 1.067   25.824  -30.577 1.00 42.55  ? 238 LYS B CB  1 
ATOM   5478 C CG  . LYS B 1 238 ? -0.365  25.531  -30.053 1.00 45.99  ? 238 LYS B CG  1 
ATOM   5479 C CD  . LYS B 1 238 ? -0.395  25.301  -28.548 1.00 44.58  ? 238 LYS B CD  1 
ATOM   5480 C CE  . LYS B 1 238 ? -1.724  24.716  -28.106 1.00 56.40  ? 238 LYS B CE  1 
ATOM   5481 N NZ  . LYS B 1 238 ? -1.695  24.233  -26.683 1.00 64.09  ? 238 LYS B NZ  1 
ATOM   5482 N N   . VAL B 1 239 ? 4.076   26.793  -30.359 1.00 42.35  ? 239 VAL B N   1 
ATOM   5483 C CA  . VAL B 1 239 ? 5.453   26.611  -29.895 1.00 44.39  ? 239 VAL B CA  1 
ATOM   5484 C C   . VAL B 1 239 ? 5.881   27.757  -28.990 1.00 51.03  ? 239 VAL B C   1 
ATOM   5485 O O   . VAL B 1 239 ? 6.530   27.529  -27.974 1.00 54.89  ? 239 VAL B O   1 
ATOM   5486 C CB  . VAL B 1 239 ? 6.449   26.480  -31.080 1.00 46.19  ? 239 VAL B CB  1 
ATOM   5487 C CG1 . VAL B 1 239 ? 7.866   26.751  -30.639 1.00 41.75  ? 239 VAL B CG1 1 
ATOM   5488 C CG2 . VAL B 1 239 ? 6.343   25.088  -31.713 1.00 44.19  ? 239 VAL B CG2 1 
ATOM   5489 N N   . ALA B 1 240 ? 5.493   28.984  -29.338 1.00 53.94  ? 240 ALA B N   1 
ATOM   5490 C CA  . ALA B 1 240 ? 5.847   30.151  -28.532 1.00 47.69  ? 240 ALA B CA  1 
ATOM   5491 C C   . ALA B 1 240 ? 5.319   30.026  -27.112 1.00 50.95  ? 240 ALA B C   1 
ATOM   5492 O O   . ALA B 1 240 ? 6.055   30.215  -26.153 1.00 55.46  ? 240 ALA B O   1 
ATOM   5493 C CB  . ALA B 1 240 ? 5.325   31.414  -29.165 1.00 48.85  ? 240 ALA B CB  1 
ATOM   5494 N N   . GLU B 1 241 ? 4.044   29.687  -26.981 1.00 51.70  ? 241 GLU B N   1 
ATOM   5495 C CA  . GLU B 1 241 ? 3.414   29.624  -25.672 1.00 51.08  ? 241 GLU B CA  1 
ATOM   5496 C C   . GLU B 1 241 ? 4.022   28.550  -24.776 1.00 55.27  ? 241 GLU B C   1 
ATOM   5497 O O   . GLU B 1 241 ? 4.148   28.723  -23.560 1.00 60.15  ? 241 GLU B O   1 
ATOM   5498 C CB  . GLU B 1 241 ? 1.930   29.356  -25.823 1.00 46.12  ? 241 GLU B CB  1 
ATOM   5499 C CG  . GLU B 1 241 ? 1.251   30.213  -26.838 1.00 52.11  ? 241 GLU B CG  1 
ATOM   5500 C CD  . GLU B 1 241 ? -0.246  30.044  -26.752 1.00 63.59  ? 241 GLU B CD  1 
ATOM   5501 O OE1 . GLU B 1 241 ? -0.672  29.114  -26.017 1.00 49.75  ? 241 GLU B OE1 1 
ATOM   5502 O OE2 . GLU B 1 241 ? -0.979  30.838  -27.398 1.00 61.87  ? 241 GLU B OE2 1 
ATOM   5503 N N   . LEU B 1 242 ? 4.388   27.435  -25.384 1.00 51.09  ? 242 LEU B N   1 
ATOM   5504 C CA  . LEU B 1 242 ? 4.719   26.252  -24.615 1.00 56.74  ? 242 LEU B CA  1 
ATOM   5505 C C   . LEU B 1 242 ? 6.227   26.136  -24.422 1.00 57.01  ? 242 LEU B C   1 
ATOM   5506 O O   . LEU B 1 242 ? 6.694   25.394  -23.560 1.00 58.14  ? 242 LEU B O   1 
ATOM   5507 C CB  . LEU B 1 242 ? 4.161   24.994  -25.304 1.00 51.52  ? 242 LEU B CB  1 
ATOM   5508 C CG  . LEU B 1 242 ? 2.649   24.872  -25.585 1.00 46.24  ? 242 LEU B CG  1 
ATOM   5509 C CD1 . LEU B 1 242 ? 2.348   23.745  -26.588 1.00 50.24  ? 242 LEU B CD1 1 
ATOM   5510 C CD2 . LEU B 1 242 ? 1.850   24.654  -24.320 1.00 47.74  ? 242 LEU B CD2 1 
ATOM   5511 N N   . ASP B 1 243 ? 6.995   26.862  -25.222 1.00 49.27  ? 243 ASP B N   1 
ATOM   5512 C CA  . ASP B 1 243 ? 8.449   26.704  -25.183 1.00 53.88  ? 243 ASP B CA  1 
ATOM   5513 C C   . ASP B 1 243 ? 9.154   28.025  -24.909 1.00 54.22  ? 243 ASP B C   1 
ATOM   5514 O O   . ASP B 1 243 ? 10.342  28.052  -24.588 1.00 55.29  ? 243 ASP B O   1 
ATOM   5515 C CB  . ASP B 1 243 ? 8.975   26.110  -26.502 1.00 52.41  ? 243 ASP B CB  1 
ATOM   5516 C CG  . ASP B 1 243 ? 8.574   24.646  -26.711 1.00 54.21  ? 243 ASP B CG  1 
ATOM   5517 O OD1 . ASP B 1 243 ? 7.702   24.123  -25.976 1.00 51.92  ? 243 ASP B OD1 1 
ATOM   5518 O OD2 . ASP B 1 243 ? 9.129   24.020  -27.643 1.00 56.25  ? 243 ASP B OD2 1 
ATOM   5519 N N   . GLY B 1 244 ? 8.415   29.120  -25.050 1.00 56.49  ? 244 GLY B N   1 
ATOM   5520 C CA  . GLY B 1 244 ? 8.985   30.444  -24.922 1.00 56.13  ? 244 GLY B CA  1 
ATOM   5521 C C   . GLY B 1 244 ? 8.766   31.292  -26.159 1.00 54.59  ? 244 GLY B C   1 
ATOM   5522 O O   . GLY B 1 244 ? 8.876   30.815  -27.288 1.00 53.93  ? 244 GLY B O   1 
ATOM   5523 N N   . HIS B 1 245 ? 8.467   32.567  -25.940 1.00 59.70  ? 245 HIS B N   1 
ATOM   5524 C CA  . HIS B 1 245 ? 8.254   33.524  -27.021 1.00 59.45  ? 245 HIS B CA  1 
ATOM   5525 C C   . HIS B 1 245 ? 9.564   33.809  -27.772 1.00 57.45  ? 245 HIS B C   1 
ATOM   5526 O O   . HIS B 1 245 ? 9.608   34.662  -28.649 1.00 66.19  ? 245 HIS B O   1 
ATOM   5527 C CB  . HIS B 1 245 ? 7.650   34.815  -26.449 1.00 63.48  ? 245 HIS B CB  1 
ATOM   5528 C CG  . HIS B 1 245 ? 7.139   35.779  -27.478 1.00 67.25  ? 245 HIS B CG  1 
ATOM   5529 N ND1 . HIS B 1 245 ? 7.973   36.560  -28.253 1.00 68.00  ? 245 HIS B ND1 1 
ATOM   5530 C CD2 . HIS B 1 245 ? 5.874   36.118  -27.832 1.00 66.23  ? 245 HIS B CD2 1 
ATOM   5531 C CE1 . HIS B 1 245 ? 7.245   37.320  -29.055 1.00 71.80  ? 245 HIS B CE1 1 
ATOM   5532 N NE2 . HIS B 1 245 ? 5.968   37.071  -28.820 1.00 72.48  ? 245 HIS B NE2 1 
ATOM   5533 N N   . LYS B 1 246 ? 10.628  33.088  -27.434 1.00 52.54  ? 246 LYS B N   1 
ATOM   5534 C CA  . LYS B 1 246 ? 11.913  33.280  -28.096 1.00 56.48  ? 246 LYS B CA  1 
ATOM   5535 C C   . LYS B 1 246 ? 12.181  32.251  -29.198 1.00 57.11  ? 246 LYS B C   1 
ATOM   5536 O O   . LYS B 1 246 ? 13.089  32.430  -30.023 1.00 57.58  ? 246 LYS B O   1 
ATOM   5537 C CB  . LYS B 1 246 ? 13.053  33.250  -27.066 1.00 57.76  ? 246 LYS B CB  1 
ATOM   5538 C CG  . LYS B 1 246 ? 12.993  34.389  -26.051 1.00 63.88  ? 246 LYS B CG  1 
ATOM   5539 C CD  . LYS B 1 246 ? 12.590  35.713  -26.715 1.00 58.49  ? 246 LYS B CD  1 
ATOM   5540 C CE  . LYS B 1 246 ? 13.684  36.240  -27.649 1.00 64.72  ? 246 LYS B CE  1 
ATOM   5541 N NZ  . LYS B 1 246 ? 13.160  36.691  -28.976 1.00 63.99  ? 246 LYS B NZ  1 
ATOM   5542 N N   . ARG B 1 247 ? 11.391  31.180  -29.211 1.00 58.09  ? 247 ARG B N   1 
ATOM   5543 C CA  . ARG B 1 247 ? 11.534  30.131  -30.217 1.00 53.50  ? 247 ARG B CA  1 
ATOM   5544 C C   . ARG B 1 247 ? 11.201  30.669  -31.603 1.00 53.37  ? 247 ARG B C   1 
ATOM   5545 O O   . ARG B 1 247 ? 11.731  30.188  -32.615 1.00 49.92  ? 247 ARG B O   1 
ATOM   5546 C CB  . ARG B 1 247 ? 10.641  28.940  -29.874 1.00 51.57  ? 247 ARG B CB  1 
ATOM   5547 C CG  . ARG B 1 247 ? 10.889  28.397  -28.487 1.00 53.34  ? 247 ARG B CG  1 
ATOM   5548 C CD  . ARG B 1 247 ? 12.348  28.021  -28.344 1.00 53.94  ? 247 ARG B CD  1 
ATOM   5549 N NE  . ARG B 1 247 ? 12.696  26.917  -29.230 1.00 52.08  ? 247 ARG B NE  1 
ATOM   5550 C CZ  . ARG B 1 247 ? 13.923  26.662  -29.659 1.00 47.58  ? 247 ARG B CZ  1 
ATOM   5551 N NH1 . ARG B 1 247 ? 14.923  27.449  -29.295 1.00 48.04  ? 247 ARG B NH1 1 
ATOM   5552 N NH2 . ARG B 1 247 ? 14.145  25.628  -30.462 1.00 46.59  ? 247 ARG B NH2 1 
ATOM   5553 N N   . LEU B 1 248 ? 10.332  31.681  -31.632 1.00 49.17  ? 248 LEU B N   1 
ATOM   5554 C CA  . LEU B 1 248 ? 9.995   32.379  -32.871 1.00 52.25  ? 248 LEU B CA  1 
ATOM   5555 C C   . LEU B 1 248 ? 11.245  32.926  -33.574 1.00 49.38  ? 248 LEU B C   1 
ATOM   5556 O O   . LEU B 1 248 ? 11.290  33.022  -34.799 1.00 45.33  ? 248 LEU B O   1 
ATOM   5557 C CB  . LEU B 1 248 ? 9.004   33.503  -32.582 1.00 49.43  ? 248 LEU B CB  1 
ATOM   5558 C CG  . LEU B 1 248 ? 7.606   33.035  -32.189 1.00 49.03  ? 248 LEU B CG  1 
ATOM   5559 C CD1 . LEU B 1 248 ? 6.775   34.162  -31.600 1.00 52.21  ? 248 LEU B CD1 1 
ATOM   5560 C CD2 . LEU B 1 248 ? 6.927   32.470  -33.414 1.00 46.86  ? 248 LEU B CD2 1 
ATOM   5561 N N   . GLU B 1 249 ? 12.268  33.252  -32.784 1.00 57.43  ? 249 GLU B N   1 
ATOM   5562 C CA  . GLU B 1 249 ? 13.507  33.809  -33.314 1.00 54.30  ? 249 GLU B CA  1 
ATOM   5563 C C   . GLU B 1 249 ? 14.395  32.729  -33.903 1.00 59.67  ? 249 GLU B C   1 
ATOM   5564 O O   . GLU B 1 249 ? 15.106  32.956  -34.891 1.00 63.38  ? 249 GLU B O   1 
ATOM   5565 C CB  . GLU B 1 249 ? 14.264  34.579  -32.230 1.00 60.94  ? 249 GLU B CB  1 
ATOM   5566 C CG  . GLU B 1 249 ? 13.992  36.090  -32.238 1.00 62.43  ? 249 GLU B CG  1 
ATOM   5567 C CD  . GLU B 1 249 ? 13.833  36.657  -33.649 1.00 64.26  ? 249 GLU B CD  1 
ATOM   5568 O OE1 . GLU B 1 249 ? 14.735  36.442  -34.503 1.00 62.69  ? 249 GLU B OE1 1 
ATOM   5569 O OE2 . GLU B 1 249 ? 12.790  37.307  -33.907 1.00 57.65  ? 249 GLU B OE2 1 
ATOM   5570 N N   . ASP B 1 250 ? 14.347  31.547  -33.303 1.00 58.86  ? 250 ASP B N   1 
ATOM   5571 C CA  . ASP B 1 250 ? 15.095  30.411  -33.827 1.00 56.91  ? 250 ASP B CA  1 
ATOM   5572 C C   . ASP B 1 250 ? 14.479  29.939  -35.154 1.00 53.70  ? 250 ASP B C   1 
ATOM   5573 O O   . ASP B 1 250 ? 15.198  29.531  -36.072 1.00 52.76  ? 250 ASP B O   1 
ATOM   5574 C CB  . ASP B 1 250 ? 15.135  29.287  -32.784 1.00 60.28  ? 250 ASP B CB  1 
ATOM   5575 C CG  . ASP B 1 250 ? 15.621  29.776  -31.414 1.00 56.21  ? 250 ASP B CG  1 
ATOM   5576 O OD1 . ASP B 1 250 ? 16.851  29.853  -31.210 1.00 71.32  ? 250 ASP B OD1 1 
ATOM   5577 O OD2 . ASP B 1 250 ? 14.781  30.091  -30.545 1.00 51.85  ? 250 ASP B OD2 1 
ATOM   5578 N N   . ILE B 1 251 ? 13.152  30.027  -35.257 1.00 54.73  ? 251 ILE B N   1 
ATOM   5579 C CA  . ILE B 1 251 ? 12.445  29.702  -36.496 1.00 47.49  ? 251 ILE B CA  1 
ATOM   5580 C C   . ILE B 1 251 ? 12.890  30.648  -37.592 1.00 47.74  ? 251 ILE B C   1 
ATOM   5581 O O   . ILE B 1 251 ? 13.025  30.249  -38.745 1.00 50.75  ? 251 ILE B O   1 
ATOM   5582 C CB  . ILE B 1 251 ? 10.903  29.781  -36.318 1.00 51.69  ? 251 ILE B CB  1 
ATOM   5583 C CG1 . ILE B 1 251 ? 10.440  28.875  -35.165 1.00 42.31  ? 251 ILE B CG1 1 
ATOM   5584 C CG2 . ILE B 1 251 ? 10.179  29.451  -37.633 1.00 49.68  ? 251 ILE B CG2 1 
ATOM   5585 C CD1 . ILE B 1 251 ? 8.956   28.664  -35.109 1.00 40.07  ? 251 ILE B CD1 1 
ATOM   5586 N N   . ARG B 1 252 ? 13.138  31.904  -37.222 1.00 55.40  ? 252 ARG B N   1 
ATOM   5587 C CA  . ARG B 1 252 ? 13.663  32.899  -38.165 1.00 57.33  ? 252 ARG B CA  1 
ATOM   5588 C C   . ARG B 1 252 ? 15.047  32.505  -38.648 1.00 55.77  ? 252 ARG B C   1 
ATOM   5589 O O   . ARG B 1 252 ? 15.361  32.609  -39.845 1.00 56.81  ? 252 ARG B O   1 
ATOM   5590 C CB  . ARG B 1 252 ? 13.720  34.294  -37.534 1.00 54.64  ? 252 ARG B CB  1 
ATOM   5591 C CG  . ARG B 1 252 ? 14.385  35.330  -38.437 1.00 50.31  ? 252 ARG B CG  1 
ATOM   5592 C CD  . ARG B 1 252 ? 14.214  36.754  -37.931 1.00 52.57  ? 252 ARG B CD  1 
ATOM   5593 N NE  . ARG B 1 252 ? 12.921  37.336  -38.297 1.00 61.53  ? 252 ARG B NE  1 
ATOM   5594 C CZ  . ARG B 1 252 ? 11.948  37.639  -37.431 1.00 68.75  ? 252 ARG B CZ  1 
ATOM   5595 N NH1 . ARG B 1 252 ? 12.105  37.416  -36.129 1.00 61.72  ? 252 ARG B NH1 1 
ATOM   5596 N NH2 . ARG B 1 252 ? 10.809  38.170  -37.869 1.00 62.46  ? 252 ARG B NH2 1 
ATOM   5597 N N   . LYS B 1 253 ? 15.861  32.041  -37.706 1.00 51.07  ? 253 LYS B N   1 
ATOM   5598 C CA  . LYS B 1 253 ? 17.207  31.577  -37.997 1.00 52.25  ? 253 LYS B CA  1 
ATOM   5599 C C   . LYS B 1 253 ? 17.201  30.357  -38.910 1.00 54.39  ? 253 LYS B C   1 
ATOM   5600 O O   . LYS B 1 253 ? 18.164  30.117  -39.644 1.00 61.00  ? 253 LYS B O   1 
ATOM   5601 C CB  . LYS B 1 253 ? 17.944  31.261  -36.699 1.00 54.54  ? 253 LYS B CB  1 
ATOM   5602 N N   . THR B 1 254 ? 16.109  29.595  -38.871 1.00 58.70  ? 254 THR B N   1 
ATOM   5603 C CA  . THR B 1 254 ? 15.965  28.374  -39.673 1.00 46.14  ? 254 THR B CA  1 
ATOM   5604 C C   . THR B 1 254 ? 15.571  28.708  -41.092 1.00 48.40  ? 254 THR B C   1 
ATOM   5605 O O   . THR B 1 254 ? 16.124  28.155  -42.049 1.00 48.95  ? 254 THR B O   1 
ATOM   5606 C CB  . THR B 1 254 ? 14.906  27.422  -39.074 1.00 46.67  ? 254 THR B CB  1 
ATOM   5607 O OG1 . THR B 1 254 ? 15.326  26.985  -37.781 1.00 44.88  ? 254 THR B OG1 1 
ATOM   5608 C CG2 . THR B 1 254 ? 14.704  26.196  -39.950 1.00 45.45  ? 254 THR B CG2 1 
ATOM   5609 N N   . LEU B 1 255 ? 14.611  29.622  -41.223 1.00 50.04  ? 255 LEU B N   1 
ATOM   5610 C CA  . LEU B 1 255 ? 14.125  30.047  -42.533 1.00 45.40  ? 255 LEU B CA  1 
ATOM   5611 C C   . LEU B 1 255 ? 15.234  30.704  -43.331 1.00 45.49  ? 255 LEU B C   1 
ATOM   5612 O O   . LEU B 1 255 ? 15.143  30.820  -44.545 1.00 47.30  ? 255 LEU B O   1 
ATOM   5613 C CB  . LEU B 1 255 ? 12.944  30.995  -42.377 1.00 45.03  ? 255 LEU B CB  1 
ATOM   5614 C CG  . LEU B 1 255 ? 11.795  30.329  -41.623 1.00 48.15  ? 255 LEU B CG  1 
ATOM   5615 C CD1 . LEU B 1 255 ? 10.589  31.228  -41.503 1.00 41.48  ? 255 LEU B CD1 1 
ATOM   5616 C CD2 . LEU B 1 255 ? 11.433  29.033  -42.317 1.00 50.08  ? 255 LEU B CD2 1 
ATOM   5617 N N   . LEU B 1 256 ? 16.284  31.129  -42.634 1.00 48.98  ? 256 LEU B N   1 
ATOM   5618 C CA  . LEU B 1 256 ? 17.518  31.551  -43.277 1.00 48.50  ? 256 LEU B CA  1 
ATOM   5619 C C   . LEU B 1 256 ? 18.232  30.347  -43.881 1.00 53.96  ? 256 LEU B C   1 
ATOM   5620 O O   . LEU B 1 256 ? 18.577  30.351  -45.064 1.00 54.67  ? 256 LEU B O   1 
ATOM   5621 C CB  . LEU B 1 256 ? 18.423  32.265  -42.278 1.00 56.30  ? 256 LEU B CB  1 
ATOM   5622 C CG  . LEU B 1 256 ? 17.896  33.637  -41.839 1.00 63.87  ? 256 LEU B CG  1 
ATOM   5623 C CD1 . LEU B 1 256 ? 18.825  34.283  -40.821 1.00 50.46  ? 256 LEU B CD1 1 
ATOM   5624 C CD2 . LEU B 1 256 ? 17.666  34.560  -43.058 1.00 51.41  ? 256 LEU B CD2 1 
ATOM   5625 N N   . ASP B 1 257 ? 18.430  29.309  -43.072 1.00 50.00  ? 257 ASP B N   1 
ATOM   5626 C CA  . ASP B 1 257 ? 19.070  28.092  -43.542 1.00 49.40  ? 257 ASP B CA  1 
ATOM   5627 C C   . ASP B 1 257 ? 18.226  27.426  -44.635 1.00 53.21  ? 257 ASP B C   1 
ATOM   5628 O O   . ASP B 1 257 ? 18.764  26.890  -45.615 1.00 51.85  ? 257 ASP B O   1 
ATOM   5629 C CB  . ASP B 1 257 ? 19.329  27.141  -42.365 1.00 50.87  ? 257 ASP B CB  1 
ATOM   5630 C CG  . ASP B 1 257 ? 20.316  27.726  -41.351 1.00 57.91  ? 257 ASP B CG  1 
ATOM   5631 O OD1 . ASP B 1 257 ? 21.170  28.547  -41.757 1.00 64.19  ? 257 ASP B OD1 1 
ATOM   5632 O OD2 . ASP B 1 257 ? 20.243  27.380  -40.149 1.00 55.80  ? 257 ASP B OD2 1 
ATOM   5633 N N   . LEU B 1 258 ? 16.904  27.483  -44.486 1.00 52.46  ? 258 LEU B N   1 
ATOM   5634 C CA  . LEU B 1 258 ? 16.000  27.028  -45.547 1.00 48.71  ? 258 LEU B CA  1 
ATOM   5635 C C   . LEU B 1 258 ? 16.267  27.751  -46.865 1.00 50.97  ? 258 LEU B C   1 
ATOM   5636 O O   . LEU B 1 258 ? 16.362  27.120  -47.927 1.00 51.34  ? 258 LEU B O   1 
ATOM   5637 C CB  . LEU B 1 258 ? 14.534  27.232  -45.145 1.00 46.55  ? 258 LEU B CB  1 
ATOM   5638 C CG  . LEU B 1 258 ? 13.568  27.076  -46.320 1.00 45.30  ? 258 LEU B CG  1 
ATOM   5639 C CD1 . LEU B 1 258 ? 13.669  25.690  -46.934 1.00 48.36  ? 258 LEU B CD1 1 
ATOM   5640 C CD2 . LEU B 1 258 ? 12.153  27.376  -45.921 1.00 43.95  ? 258 LEU B CD2 1 
ATOM   5641 N N   . LYS B 1 259 ? 16.369  29.078  -46.789 1.00 52.89  ? 259 LYS B N   1 
ATOM   5642 C CA  . LYS B 1 259 ? 16.542  29.909  -47.979 1.00 55.67  ? 259 LYS B CA  1 
ATOM   5643 C C   . LYS B 1 259 ? 17.832  29.567  -48.714 1.00 55.43  ? 259 LYS B C   1 
ATOM   5644 O O   . LYS B 1 259 ? 17.830  29.333  -49.928 1.00 52.50  ? 259 LYS B O   1 
ATOM   5645 C CB  . LYS B 1 259 ? 16.533  31.387  -47.605 1.00 58.13  ? 259 LYS B CB  1 
ATOM   5646 C CG  . LYS B 1 259 ? 16.777  32.307  -48.787 1.00 62.33  ? 259 LYS B CG  1 
ATOM   5647 C CD  . LYS B 1 259 ? 16.802  33.766  -48.363 1.00 65.79  ? 259 LYS B CD  1 
ATOM   5648 C CE  . LYS B 1 259 ? 17.213  34.664  -49.521 1.00 62.31  ? 259 LYS B CE  1 
ATOM   5649 N NZ  . LYS B 1 259 ? 17.217  36.098  -49.138 1.00 74.35  ? 259 LYS B NZ  1 
ATOM   5650 N N   . LYS B 1 260 ? 18.928  29.536  -47.963 1.00 55.06  ? 260 LYS B N   1 
ATOM   5651 C CA  . LYS B 1 260 ? 20.227  29.150  -48.504 1.00 54.93  ? 260 LYS B CA  1 
ATOM   5652 C C   . LYS B 1 260 ? 20.161  27.806  -49.202 1.00 60.91  ? 260 LYS B C   1 
ATOM   5653 O O   . LYS B 1 260 ? 20.600  27.680  -50.347 1.00 63.27  ? 260 LYS B O   1 
ATOM   5654 C CB  . LYS B 1 260 ? 21.283  29.102  -47.406 1.00 58.43  ? 260 LYS B CB  1 
ATOM   5655 C CG  . LYS B 1 260 ? 22.615  28.590  -47.911 1.00 67.31  ? 260 LYS B CG  1 
ATOM   5656 C CD  . LYS B 1 260 ? 23.760  28.977  -46.996 1.00 65.90  ? 260 LYS B CD  1 
ATOM   5657 C CE  . LYS B 1 260 ? 25.069  28.419  -47.528 1.00 70.40  ? 260 LYS B CE  1 
ATOM   5658 N NZ  . LYS B 1 260 ? 25.052  26.925  -47.583 1.00 68.07  ? 260 LYS B NZ  1 
ATOM   5659 N N   . TRP B 1 261 ? 19.593  26.814  -48.517 1.00 57.41  ? 261 TRP B N   1 
ATOM   5660 C CA  . TRP B 1 261 ? 19.512  25.467  -49.067 1.00 55.96  ? 261 TRP B CA  1 
ATOM   5661 C C   . TRP B 1 261 ? 18.832  25.435  -50.431 1.00 51.97  ? 261 TRP B C   1 
ATOM   5662 O O   . TRP B 1 261 ? 19.280  24.743  -51.348 1.00 56.73  ? 261 TRP B O   1 
ATOM   5663 C CB  . TRP B 1 261 ? 18.779  24.516  -48.115 1.00 52.91  ? 261 TRP B CB  1 
ATOM   5664 C CG  . TRP B 1 261 ? 18.876  23.114  -48.622 1.00 52.34  ? 261 TRP B CG  1 
ATOM   5665 C CD1 . TRP B 1 261 ? 19.888  22.222  -48.383 1.00 47.61  ? 261 TRP B CD1 1 
ATOM   5666 C CD2 . TRP B 1 261 ? 17.959  22.455  -49.510 1.00 46.48  ? 261 TRP B CD2 1 
ATOM   5667 N NE1 . TRP B 1 261 ? 19.639  21.044  -49.047 1.00 52.44  ? 261 TRP B NE1 1 
ATOM   5668 C CE2 . TRP B 1 261 ? 18.460  21.158  -49.739 1.00 46.91  ? 261 TRP B CE2 1 
ATOM   5669 C CE3 . TRP B 1 261 ? 16.747  22.827  -50.107 1.00 40.67  ? 261 TRP B CE3 1 
ATOM   5670 C CZ2 . TRP B 1 261 ? 17.798  20.232  -50.551 1.00 50.27  ? 261 TRP B CZ2 1 
ATOM   5671 C CZ3 . TRP B 1 261 ? 16.095  21.914  -50.913 1.00 45.11  ? 261 TRP B CZ3 1 
ATOM   5672 C CH2 . TRP B 1 261 ? 16.621  20.631  -51.134 1.00 46.70  ? 261 TRP B CH2 1 
ATOM   5673 N N   . ILE B 1 262 ? 17.754  26.190  -50.563 1.00 55.45  ? 262 ILE B N   1 
ATOM   5674 C CA  . ILE B 1 262 ? 17.013  26.259  -51.821 1.00 57.74  ? 262 ILE B CA  1 
ATOM   5675 C C   . ILE B 1 262 ? 17.829  26.857  -52.980 1.00 58.93  ? 262 ILE B C   1 
ATOM   5676 O O   . ILE B 1 262 ? 17.849  26.313  -54.083 1.00 57.01  ? 262 ILE B O   1 
ATOM   5677 C CB  . ILE B 1 262 ? 15.731  27.069  -51.629 1.00 50.96  ? 262 ILE B CB  1 
ATOM   5678 C CG1 . ILE B 1 262 ? 14.758  26.266  -50.770 1.00 50.87  ? 262 ILE B CG1 1 
ATOM   5679 C CG2 . ILE B 1 262 ? 15.120  27.414  -52.959 1.00 52.95  ? 262 ILE B CG2 1 
ATOM   5680 C CD1 . ILE B 1 262 ? 13.535  27.020  -50.382 1.00 56.91  ? 262 ILE B CD1 1 
ATOM   5681 N N   . GLU B 1 263 ? 18.513  27.966  -52.722 1.00 62.01  ? 263 GLU B N   1 
ATOM   5682 C CA  . GLU B 1 263 ? 19.316  28.629  -53.753 1.00 66.36  ? 263 GLU B CA  1 
ATOM   5683 C C   . GLU B 1 263 ? 20.538  27.791  -54.164 1.00 60.34  ? 263 GLU B C   1 
ATOM   5684 O O   . GLU B 1 263 ? 20.875  27.707  -55.344 1.00 61.66  ? 263 GLU B O   1 
ATOM   5685 C CB  . GLU B 1 263 ? 19.748  30.017  -53.262 1.00 69.78  ? 263 GLU B CB  1 
ATOM   5686 C CG  . GLU B 1 263 ? 18.567  30.934  -52.928 1.00 68.61  ? 263 GLU B CG  1 
ATOM   5687 C CD  . GLU B 1 263 ? 18.935  32.081  -51.995 1.00 75.16  ? 263 GLU B CD  1 
ATOM   5688 O OE1 . GLU B 1 263 ? 19.985  32.011  -51.319 1.00 71.12  ? 263 GLU B OE1 1 
ATOM   5689 O OE2 . GLU B 1 263 ? 18.163  33.060  -51.937 1.00 81.95  ? 263 GLU B OE2 1 
ATOM   5690 N N   . ASP B 1 264 ? 21.195  27.167  -53.193 1.00 62.41  ? 264 ASP B N   1 
ATOM   5691 C CA  . ASP B 1 264 ? 22.270  26.232  -53.500 1.00 60.18  ? 264 ASP B CA  1 
ATOM   5692 C C   . ASP B 1 264 ? 21.763  25.091  -54.379 1.00 61.25  ? 264 ASP B C   1 
ATOM   5693 O O   . ASP B 1 264 ? 22.510  24.559  -55.202 1.00 59.63  ? 264 ASP B O   1 
ATOM   5694 C CB  . ASP B 1 264 ? 22.881  25.653  -52.221 1.00 62.05  ? 264 ASP B CB  1 
ATOM   5695 C CG  . ASP B 1 264 ? 23.648  26.680  -51.417 1.00 62.28  ? 264 ASP B CG  1 
ATOM   5696 O OD1 . ASP B 1 264 ? 23.748  27.838  -51.875 1.00 66.40  ? 264 ASP B OD1 1 
ATOM   5697 O OD2 . ASP B 1 264 ? 24.160  26.321  -50.331 1.00 57.88  ? 264 ASP B OD2 1 
ATOM   5698 N N   . ASN B 1 265 ? 20.490  24.729  -54.198 1.00 63.31  ? 265 ASN B N   1 
ATOM   5699 C CA  . ASN B 1 265 ? 19.903  23.546  -54.833 1.00 60.69  ? 265 ASN B CA  1 
ATOM   5700 C C   . ASN B 1 265 ? 18.663  23.818  -55.695 1.00 59.01  ? 265 ASN B C   1 
ATOM   5701 O O   . ASN B 1 265 ? 17.805  22.937  -55.841 1.00 59.12  ? 265 ASN B O   1 
ATOM   5702 C CB  . ASN B 1 265 ? 19.535  22.511  -53.760 1.00 56.08  ? 265 ASN B CB  1 
ATOM   5703 C CG  . ASN B 1 265 ? 20.742  22.009  -52.994 1.00 53.63  ? 265 ASN B CG  1 
ATOM   5704 O OD1 . ASN B 1 265 ? 21.466  21.127  -53.462 1.00 54.72  ? 265 ASN B OD1 1 
ATOM   5705 N ND2 . ASN B 1 265 ? 20.971  22.574  -51.814 1.00 47.14  ? 265 ASN B ND2 1 
ATOM   5706 N N   . LYS B 1 266 ? 18.578  25.023  -56.261 1.00 57.67  ? 266 LYS B N   1 
ATOM   5707 C CA  . LYS B 1 266 ? 17.441  25.448  -57.087 1.00 53.43  ? 266 LYS B CA  1 
ATOM   5708 C C   . LYS B 1 266 ? 16.966  24.358  -58.047 1.00 48.36  ? 266 LYS B C   1 
ATOM   5709 O O   . LYS B 1 266 ? 15.774  24.167  -58.244 1.00 48.15  ? 266 LYS B O   1 
ATOM   5710 C CB  . LYS B 1 266 ? 17.809  26.707  -57.875 1.00 52.66  ? 266 LYS B CB  1 
ATOM   5711 N N   . ASP B 1 267 ? 17.912  23.624  -58.619 1.00 58.57  ? 267 ASP B N   1 
ATOM   5712 C CA  . ASP B 1 267 ? 17.603  22.616  -59.630 1.00 63.18  ? 267 ASP B CA  1 
ATOM   5713 C C   . ASP B 1 267 ? 16.733  21.464  -59.120 1.00 60.77  ? 267 ASP B C   1 
ATOM   5714 O O   . ASP B 1 267 ? 16.091  20.775  -59.927 1.00 55.65  ? 267 ASP B O   1 
ATOM   5715 C CB  . ASP B 1 267 ? 18.900  22.050  -60.207 1.00 65.44  ? 267 ASP B CB  1 
ATOM   5716 C CG  . ASP B 1 267 ? 19.612  23.033  -61.107 1.00 78.46  ? 267 ASP B CG  1 
ATOM   5717 O OD1 . ASP B 1 267 ? 18.923  23.922  -61.664 1.00 78.35  ? 267 ASP B OD1 1 
ATOM   5718 O OD2 . ASP B 1 267 ? 20.852  22.911  -61.261 1.00 79.96  ? 267 ASP B OD2 1 
ATOM   5719 N N   . GLU B 1 268 ? 16.716  21.258  -57.798 1.00 52.03  ? 268 GLU B N   1 
ATOM   5720 C CA  . GLU B 1 268 ? 15.988  20.140  -57.204 1.00 51.83  ? 268 GLU B CA  1 
ATOM   5721 C C   . GLU B 1 268 ? 14.517  20.449  -56.975 1.00 48.54  ? 268 GLU B C   1 
ATOM   5722 O O   . GLU B 1 268 ? 13.715  19.540  -56.746 1.00 46.37  ? 268 GLU B O   1 
ATOM   5723 C CB  . GLU B 1 268 ? 16.635  19.714  -55.878 1.00 52.47  ? 268 GLU B CB  1 
ATOM   5724 C CG  . GLU B 1 268 ? 18.142  19.360  -55.965 1.00 55.39  ? 268 GLU B CG  1 
ATOM   5725 C CD  . GLU B 1 268 ? 18.466  18.137  -56.850 1.00 51.68  ? 268 GLU B CD  1 
ATOM   5726 O OE1 . GLU B 1 268 ? 17.553  17.551  -57.485 1.00 46.53  ? 268 GLU B OE1 1 
ATOM   5727 O OE2 . GLU B 1 268 ? 19.659  17.765  -56.910 1.00 49.51  ? 268 GLU B OE2 1 
ATOM   5728 N N   . LEU B 1 269 ? 14.159  21.728  -57.039 1.00 51.58  ? 269 LEU B N   1 
ATOM   5729 C CA  . LEU B 1 269 ? 12.777  22.137  -56.785 1.00 48.14  ? 269 LEU B CA  1 
ATOM   5730 C C   . LEU B 1 269 ? 12.072  22.503  -58.075 1.00 47.61  ? 269 LEU B C   1 
ATOM   5731 O O   . LEU B 1 269 ? 12.715  22.887  -59.058 1.00 46.11  ? 269 LEU B O   1 
ATOM   5732 C CB  . LEU B 1 269 ? 12.733  23.310  -55.808 1.00 45.48  ? 269 LEU B CB  1 
ATOM   5733 C CG  . LEU B 1 269 ? 13.499  23.052  -54.506 1.00 45.74  ? 269 LEU B CG  1 
ATOM   5734 C CD1 . LEU B 1 269 ? 13.574  24.314  -53.699 1.00 49.11  ? 269 LEU B CD1 1 
ATOM   5735 C CD2 . LEU B 1 269 ? 12.856  21.951  -53.701 1.00 37.04  ? 269 LEU B CD2 1 
ATOM   5736 N N   . GLU B 1 270 ? 10.750  22.366  -58.078 1.00 46.83  ? 270 GLU B N   1 
ATOM   5737 C CA  . GLU B 1 270 ? 9.976   22.762  -59.240 1.00 45.00  ? 270 GLU B CA  1 
ATOM   5738 C C   . GLU B 1 270 ? 10.135  24.254  -59.383 1.00 52.88  ? 270 GLU B C   1 
ATOM   5739 O O   . GLU B 1 270 ? 10.446  24.943  -58.405 1.00 49.92  ? 270 GLU B O   1 
ATOM   5740 C CB  . GLU B 1 270 ? 8.516   22.370  -59.109 1.00 40.43  ? 270 GLU B CB  1 
ATOM   5741 C CG  . GLU B 1 270 ? 8.244   20.931  -59.506 1.00 48.49  ? 270 GLU B CG  1 
ATOM   5742 C CD  . GLU B 1 270 ? 6.791   20.514  -59.272 1.00 53.14  ? 270 GLU B CD  1 
ATOM   5743 O OE1 . GLU B 1 270 ? 6.371   19.488  -59.862 1.00 43.58  ? 270 GLU B OE1 1 
ATOM   5744 O OE2 . GLU B 1 270 ? 6.082   21.204  -58.488 1.00 60.96  ? 270 GLU B OE2 1 
ATOM   5745 N N   . ASP B 1 271 ? 9.944   24.749  -60.603 1.00 58.13  ? 271 ASP B N   1 
ATOM   5746 C CA  . ASP B 1 271 ? 10.216  26.146  -60.905 1.00 50.46  ? 271 ASP B CA  1 
ATOM   5747 C C   . ASP B 1 271 ? 9.491   27.114  -59.992 1.00 53.77  ? 271 ASP B C   1 
ATOM   5748 O O   . ASP B 1 271 ? 8.266   27.060  -59.839 1.00 56.06  ? 271 ASP B O   1 
ATOM   5749 C CB  . ASP B 1 271 ? 9.864   26.431  -62.350 1.00 55.60  ? 271 ASP B CB  1 
ATOM   5750 C CG  . ASP B 1 271 ? 10.729  25.653  -63.300 1.00 66.78  ? 271 ASP B CG  1 
ATOM   5751 O OD1 . ASP B 1 271 ? 10.799  24.409  -63.137 1.00 66.37  ? 271 ASP B OD1 1 
ATOM   5752 O OD2 . ASP B 1 271 ? 11.364  26.287  -64.172 1.00 59.57  ? 271 ASP B OD2 1 
ATOM   5753 N N   . GLY B 1 272 ? 10.275  27.974  -59.352 1.00 54.25  ? 272 GLY B N   1 
ATOM   5754 C CA  . GLY B 1 272 ? 9.740   29.056  -58.548 1.00 56.75  ? 272 GLY B CA  1 
ATOM   5755 C C   . GLY B 1 272 ? 9.040   28.617  -57.279 1.00 56.65  ? 272 GLY B C   1 
ATOM   5756 O O   . GLY B 1 272 ? 8.697   29.456  -56.447 1.00 54.29  ? 272 GLY B O   1 
ATOM   5757 N N   . LYS B 1 273 ? 8.829   27.310  -57.125 1.00 58.49  ? 273 LYS B N   1 
ATOM   5758 C CA  . LYS B 1 273 ? 8.143   26.782  -55.952 1.00 54.11  ? 273 LYS B CA  1 
ATOM   5759 C C   . LYS B 1 273 ? 8.952   27.059  -54.677 1.00 55.49  ? 273 LYS B C   1 
ATOM   5760 O O   . LYS B 1 273 ? 8.392   27.147  -53.580 1.00 59.53  ? 273 LYS B O   1 
ATOM   5761 C CB  . LYS B 1 273 ? 7.874   25.287  -56.116 1.00 47.65  ? 273 LYS B CB  1 
ATOM   5762 C CG  . LYS B 1 273 ? 6.654   24.963  -56.972 1.00 51.93  ? 273 LYS B CG  1 
ATOM   5763 C CD  . LYS B 1 273 ? 5.378   25.495  -56.324 1.00 62.52  ? 273 LYS B CD  1 
ATOM   5764 C CE  . LYS B 1 273 ? 4.171   25.390  -57.252 1.00 59.64  ? 273 LYS B CE  1 
ATOM   5765 N NZ  . LYS B 1 273 ? 2.981   26.090  -56.691 1.00 66.65  ? 273 LYS B NZ  1 
ATOM   5766 N N   . GLY B 1 274 ? 10.261  27.222  -54.827 1.00 44.92  ? 274 GLY B N   1 
ATOM   5767 C CA  . GLY B 1 274 ? 11.116  27.610  -53.714 1.00 51.18  ? 274 GLY B CA  1 
ATOM   5768 C C   . GLY B 1 274 ? 11.051  29.075  -53.285 1.00 48.44  ? 274 GLY B C   1 
ATOM   5769 O O   . GLY B 1 274 ? 11.314  29.387  -52.133 1.00 42.76  ? 274 GLY B O   1 
ATOM   5770 N N   . ASP B 1 275 ? 10.730  29.985  -54.206 1.00 57.69  ? 275 ASP B N   1 
ATOM   5771 C CA  . ASP B 1 275 ? 10.500  31.384  -53.831 1.00 54.02  ? 275 ASP B CA  1 
ATOM   5772 C C   . ASP B 1 275 ? 9.162   31.495  -53.132 1.00 46.76  ? 275 ASP B C   1 
ATOM   5773 O O   . ASP B 1 275 ? 9.085   32.045  -52.049 1.00 44.18  ? 275 ASP B O   1 
ATOM   5774 C CB  . ASP B 1 275 ? 10.551  32.315  -55.043 1.00 53.46  ? 275 ASP B CB  1 
ATOM   5775 C CG  . ASP B 1 275 ? 11.960  32.514  -55.552 1.00 66.87  ? 275 ASP B CG  1 
ATOM   5776 O OD1 . ASP B 1 275 ? 12.907  32.143  -54.814 1.00 67.21  ? 275 ASP B OD1 1 
ATOM   5777 O OD2 . ASP B 1 275 ? 12.122  33.037  -56.679 1.00 71.91  ? 275 ASP B OD2 1 
ATOM   5778 N N   . GLU B 1 276 ? 8.126   30.932  -53.749 1.00 47.61  ? 276 GLU B N   1 
ATOM   5779 C CA  . GLU B 1 276 ? 6.787   30.857  -53.167 1.00 53.47  ? 276 GLU B CA  1 
ATOM   5780 C C   . GLU B 1 276 ? 6.775   30.283  -51.739 1.00 51.99  ? 276 GLU B C   1 
ATOM   5781 O O   . GLU B 1 276 ? 5.822   30.500  -50.990 1.00 54.78  ? 276 GLU B O   1 
ATOM   5782 C CB  . GLU B 1 276 ? 5.876   30.015  -54.081 1.00 60.48  ? 276 GLU B CB  1 
ATOM   5783 C CG  . GLU B 1 276 ? 4.415   29.862  -53.621 1.00 66.42  ? 276 GLU B CG  1 
ATOM   5784 C CD  . GLU B 1 276 ? 3.682   28.750  -54.366 1.00 73.64  ? 276 GLU B CD  1 
ATOM   5785 O OE1 . GLU B 1 276 ? 4.233   28.247  -55.369 1.00 73.43  ? 276 GLU B OE1 1 
ATOM   5786 O OE2 . GLU B 1 276 ? 2.562   28.375  -53.947 1.00 78.01  ? 276 GLU B OE2 1 
ATOM   5787 N N   . LEU B 1 277 ? 7.834   29.570  -51.358 1.00 49.51  ? 277 LEU B N   1 
ATOM   5788 C CA  . LEU B 1 277 ? 7.865   28.878  -50.074 1.00 44.43  ? 277 LEU B CA  1 
ATOM   5789 C C   . LEU B 1 277 ? 8.549   29.721  -49.013 1.00 42.97  ? 277 LEU B C   1 
ATOM   5790 O O   . LEU B 1 277 ? 8.022   29.893  -47.910 1.00 47.18  ? 277 LEU B O   1 
ATOM   5791 C CB  . LEU B 1 277 ? 8.565   27.523  -50.204 1.00 45.58  ? 277 LEU B CB  1 
ATOM   5792 C CG  . LEU B 1 277 ? 8.609   26.637  -48.955 1.00 43.69  ? 277 LEU B CG  1 
ATOM   5793 C CD1 . LEU B 1 277 ? 7.227   26.123  -48.546 1.00 36.21  ? 277 LEU B CD1 1 
ATOM   5794 C CD2 . LEU B 1 277 ? 9.572   25.498  -49.176 1.00 42.43  ? 277 LEU B CD2 1 
ATOM   5795 N N   . VAL B 1 278 ? 9.730   30.229  -49.344 1.00 42.47  ? 278 VAL B N   1 
ATOM   5796 C CA  . VAL B 1 278 ? 10.447  31.163  -48.482 1.00 41.49  ? 278 VAL B CA  1 
ATOM   5797 C C   . VAL B 1 278 ? 9.519   32.331  -48.142 1.00 46.36  ? 278 VAL B C   1 
ATOM   5798 O O   . VAL B 1 278 ? 9.421   32.765  -46.999 1.00 48.44  ? 278 VAL B O   1 
ATOM   5799 C CB  . VAL B 1 278 ? 11.735  31.689  -49.161 1.00 40.88  ? 278 VAL B CB  1 
ATOM   5800 C CG1 . VAL B 1 278 ? 12.505  32.616  -48.227 1.00 44.68  ? 278 VAL B CG1 1 
ATOM   5801 C CG2 . VAL B 1 278 ? 12.609  30.542  -49.572 1.00 44.36  ? 278 VAL B CG2 1 
ATOM   5802 N N   . LYS B 1 279 ? 8.826   32.810  -49.165 1.00 48.97  ? 279 LYS B N   1 
ATOM   5803 C CA  . LYS B 1 279 ? 7.849   33.878  -49.051 1.00 49.69  ? 279 LYS B CA  1 
ATOM   5804 C C   . LYS B 1 279 ? 6.779   33.496  -48.061 1.00 46.63  ? 279 LYS B C   1 
ATOM   5805 O O   . LYS B 1 279 ? 6.530   34.217  -47.098 1.00 51.02  ? 279 LYS B O   1 
ATOM   5806 C CB  . LYS B 1 279 ? 7.216   34.169  -50.419 1.00 58.13  ? 279 LYS B CB  1 
ATOM   5807 C CG  . LYS B 1 279 ? 6.925   35.625  -50.717 1.00 56.44  ? 279 LYS B CG  1 
ATOM   5808 C CD  . LYS B 1 279 ? 6.947   35.851  -52.226 1.00 58.34  ? 279 LYS B CD  1 
ATOM   5809 C CE  . LYS B 1 279 ? 6.623   37.297  -52.576 1.00 67.83  ? 279 LYS B CE  1 
ATOM   5810 N NZ  . LYS B 1 279 ? 6.839   37.596  -54.023 1.00 64.11  ? 279 LYS B NZ  1 
ATOM   5811 N N   . THR B 1 280 ? 6.147   32.356  -48.304 1.00 44.65  ? 280 THR B N   1 
ATOM   5812 C CA  . THR B 1 280 ? 5.025   31.938  -47.479 1.00 46.62  ? 280 THR B CA  1 
ATOM   5813 C C   . THR B 1 280 ? 5.427   31.829  -46.021 1.00 45.94  ? 280 THR B C   1 
ATOM   5814 O O   . THR B 1 280 ? 4.804   32.435  -45.149 1.00 45.20  ? 280 THR B O   1 
ATOM   5815 C CB  . THR B 1 280 ? 4.459   30.601  -47.952 1.00 44.51  ? 280 THR B CB  1 
ATOM   5816 O OG1 . THR B 1 280 ? 3.808   30.793  -49.209 1.00 45.14  ? 280 THR B OG1 1 
ATOM   5817 C CG2 . THR B 1 280 ? 3.453   30.059  -46.948 1.00 43.97  ? 280 THR B CG2 1 
ATOM   5818 N N   . LEU B 1 281 ? 6.499   31.084  -45.777 1.00 44.74  ? 281 LEU B N   1 
ATOM   5819 C CA  . LEU B 1 281 ? 6.938   30.795  -44.428 1.00 44.46  ? 281 LEU B CA  1 
ATOM   5820 C C   . LEU B 1 281 ? 7.378   32.035  -43.664 1.00 45.14  ? 281 LEU B C   1 
ATOM   5821 O O   . LEU B 1 281 ? 7.351   32.052  -42.439 1.00 45.28  ? 281 LEU B O   1 
ATOM   5822 C CB  . LEU B 1 281 ? 8.064   29.770  -44.474 1.00 49.76  ? 281 LEU B CB  1 
ATOM   5823 C CG  . LEU B 1 281 ? 7.513   28.348  -44.601 1.00 48.79  ? 281 LEU B CG  1 
ATOM   5824 C CD1 . LEU B 1 281 ? 8.476   27.467  -45.357 1.00 43.15  ? 281 LEU B CD1 1 
ATOM   5825 C CD2 . LEU B 1 281 ? 7.252   27.803  -43.201 1.00 40.67  ? 281 LEU B CD2 1 
ATOM   5826 N N   . THR B 1 282 ? 7.788   33.068  -44.392 1.00 47.83  ? 282 THR B N   1 
ATOM   5827 C CA  . THR B 1 282 ? 8.201   34.337  -43.798 1.00 43.95  ? 282 THR B CA  1 
ATOM   5828 C C   . THR B 1 282 ? 6.990   35.146  -43.377 1.00 43.65  ? 282 THR B C   1 
ATOM   5829 O O   . THR B 1 282 ? 7.041   35.893  -42.407 1.00 46.24  ? 282 THR B O   1 
ATOM   5830 C CB  . THR B 1 282 ? 9.026   35.170  -44.783 1.00 53.38  ? 282 THR B CB  1 
ATOM   5831 O OG1 . THR B 1 282 ? 10.034  34.338  -45.363 1.00 55.65  ? 282 THR B OG1 1 
ATOM   5832 C CG2 . THR B 1 282 ? 9.675   36.380  -44.089 1.00 45.14  ? 282 THR B CG2 1 
ATOM   5833 N N   . LYS B 1 283 ? 5.901   34.988  -44.117 1.00 39.25  ? 283 LYS B N   1 
ATOM   5834 C CA  . LYS B 1 283 ? 4.682   35.713  -43.833 1.00 39.60  ? 283 LYS B CA  1 
ATOM   5835 C C   . LYS B 1 283 ? 3.998   35.047  -42.674 1.00 41.91  ? 283 LYS B C   1 
ATOM   5836 O O   . LYS B 1 283 ? 3.357   35.705  -41.861 1.00 46.21  ? 283 LYS B O   1 
ATOM   5837 C CB  . LYS B 1 283 ? 3.761   35.746  -45.055 1.00 40.81  ? 283 LYS B CB  1 
ATOM   5838 C CG  . LYS B 1 283 ? 2.300   36.061  -44.740 1.00 49.11  ? 283 LYS B CG  1 
ATOM   5839 C CD  . LYS B 1 283 ? 2.110   37.541  -44.381 1.00 59.62  ? 283 LYS B CD  1 
ATOM   5840 C CE  . LYS B 1 283 ? 0.684   37.823  -43.917 1.00 56.69  ? 283 LYS B CE  1 
ATOM   5841 N NZ  . LYS B 1 283 ? -0.353  37.229  -44.829 1.00 53.44  ? 283 LYS B NZ  1 
ATOM   5842 N N   . GLN B 1 284 ? 4.133   33.727  -42.609 1.00 41.27  ? 284 GLN B N   1 
ATOM   5843 C CA  . GLN B 1 284 ? 3.485   32.941  -41.566 1.00 41.04  ? 284 GLN B CA  1 
ATOM   5844 C C   . GLN B 1 284 ? 4.121   33.232  -40.235 1.00 38.32  ? 284 GLN B C   1 
ATOM   5845 O O   . GLN B 1 284 ? 3.425   33.308  -39.217 1.00 37.09  ? 284 GLN B O   1 
ATOM   5846 C CB  . GLN B 1 284 ? 3.579   31.446  -41.862 1.00 41.16  ? 284 GLN B CB  1 
ATOM   5847 C CG  . GLN B 1 284 ? 2.788   31.017  -43.070 1.00 41.28  ? 284 GLN B CG  1 
ATOM   5848 C CD  . GLN B 1 284 ? 3.133   29.615  -43.506 1.00 37.28  ? 284 GLN B CD  1 
ATOM   5849 O OE1 . GLN B 1 284 ? 4.279   29.197  -43.418 1.00 41.71  ? 284 GLN B OE1 1 
ATOM   5850 N NE2 . GLN B 1 284 ? 2.144   28.884  -43.977 1.00 36.21  ? 284 GLN B NE2 1 
ATOM   5851 N N   . LEU B 1 285 ? 5.443   33.395  -40.263 1.00 34.80  ? 285 LEU B N   1 
ATOM   5852 C CA  . LEU B 1 285 ? 6.218   33.752  -39.077 1.00 41.28  ? 285 LEU B CA  1 
ATOM   5853 C C   . LEU B 1 285 ? 5.880   35.161  -38.561 1.00 41.28  ? 285 LEU B C   1 
ATOM   5854 O O   . LEU B 1 285 ? 5.739   35.363  -37.367 1.00 42.54  ? 285 LEU B O   1 
ATOM   5855 C CB  . LEU B 1 285 ? 7.719   33.649  -39.374 1.00 40.19  ? 285 LEU B CB  1 
ATOM   5856 C CG  . LEU B 1 285 ? 8.684   34.022  -38.244 1.00 41.35  ? 285 LEU B CG  1 
ATOM   5857 C CD1 . LEU B 1 285 ? 8.446   33.137  -37.037 1.00 42.29  ? 285 LEU B CD1 1 
ATOM   5858 C CD2 . LEU B 1 285 ? 10.126  33.919  -38.709 1.00 41.85  ? 285 LEU B CD2 1 
ATOM   5859 N N   . ALA B 1 286 ? 5.754   36.125  -39.469 1.00 40.99  ? 286 ALA B N   1 
ATOM   5860 C CA  . ALA B 1 286 ? 5.361   37.482  -39.111 1.00 35.86  ? 286 ALA B CA  1 
ATOM   5861 C C   . ALA B 1 286 ? 4.005   37.480  -38.446 1.00 41.59  ? 286 ALA B C   1 
ATOM   5862 O O   . ALA B 1 286 ? 3.796   38.154  -37.434 1.00 42.16  ? 286 ALA B O   1 
ATOM   5863 C CB  . ALA B 1 286 ? 5.337   38.360  -40.333 1.00 39.37  ? 286 ALA B CB  1 
ATOM   5864 N N   . ASP B 1 287 ? 3.089   36.720  -39.046 1.00 38.41  ? 287 ASP B N   1 
ATOM   5865 C CA  . ASP B 1 287 ? 1.767   36.457  -38.498 1.00 39.16  ? 287 ASP B CA  1 
ATOM   5866 C C   . ASP B 1 287 ? 1.807   35.799  -37.120 1.00 43.13  ? 287 ASP B C   1 
ATOM   5867 O O   . ASP B 1 287 ? 0.983   36.099  -36.255 1.00 47.26  ? 287 ASP B O   1 
ATOM   5868 C CB  . ASP B 1 287 ? 0.971   35.566  -39.452 1.00 37.89  ? 287 ASP B CB  1 
ATOM   5869 C CG  . ASP B 1 287 ? 0.326   36.338  -40.574 1.00 43.98  ? 287 ASP B CG  1 
ATOM   5870 O OD1 . ASP B 1 287 ? 0.670   37.522  -40.750 1.00 47.54  ? 287 ASP B OD1 1 
ATOM   5871 O OD2 . ASP B 1 287 ? -0.522  35.757  -41.285 1.00 43.00  ? 287 ASP B OD2 1 
ATOM   5872 N N   . ALA B 1 288 ? 2.744   34.878  -36.919 1.00 44.52  ? 288 ALA B N   1 
ATOM   5873 C CA  . ALA B 1 288 ? 2.847   34.197  -35.626 1.00 44.68  ? 288 ALA B CA  1 
ATOM   5874 C C   . ALA B 1 288 ? 3.365   35.171  -34.584 1.00 45.57  ? 288 ALA B C   1 
ATOM   5875 O O   . ALA B 1 288 ? 2.805   35.279  -33.489 1.00 45.90  ? 288 ALA B O   1 
ATOM   5876 C CB  . ALA B 1 288 ? 3.760   32.983  -35.717 1.00 38.15  ? 288 ALA B CB  1 
ATOM   5877 N N   . ILE B 1 289 ? 4.446   35.863  -34.945 1.00 36.73  ? 289 ILE B N   1 
ATOM   5878 C CA  . ILE B 1 289 ? 5.025   36.901  -34.120 1.00 42.26  ? 289 ILE B CA  1 
ATOM   5879 C C   . ILE B 1 289 ? 3.968   37.888  -33.607 1.00 49.35  ? 289 ILE B C   1 
ATOM   5880 O O   . ILE B 1 289 ? 3.976   38.228  -32.421 1.00 48.30  ? 289 ILE B O   1 
ATOM   5881 C CB  . ILE B 1 289 ? 6.107   37.645  -34.886 1.00 43.54  ? 289 ILE B CB  1 
ATOM   5882 C CG1 . ILE B 1 289 ? 7.395   36.824  -34.857 1.00 44.57  ? 289 ILE B CG1 1 
ATOM   5883 C CG2 . ILE B 1 289 ? 6.333   39.005  -34.276 1.00 48.83  ? 289 ILE B CG2 1 
ATOM   5884 C CD1 . ILE B 1 289 ? 8.479   37.324  -35.783 1.00 48.80  ? 289 ILE B CD1 1 
ATOM   5885 N N   . GLU B 1 290 ? 3.045   38.296  -34.487 1.00 43.42  ? 290 GLU B N   1 
ATOM   5886 C CA  . GLU B 1 290 ? 1.942   39.190  -34.130 1.00 42.15  ? 290 GLU B CA  1 
ATOM   5887 C C   . GLU B 1 290 ? 0.935   38.579  -33.175 1.00 48.70  ? 290 GLU B C   1 
ATOM   5888 O O   . GLU B 1 290 ? 0.602   39.169  -32.146 1.00 51.74  ? 290 GLU B O   1 
ATOM   5889 C CB  . GLU B 1 290 ? 1.190   39.650  -35.378 1.00 49.09  ? 290 GLU B CB  1 
ATOM   5890 C CG  . GLU B 1 290 ? 1.691   40.960  -35.963 1.00 57.37  ? 290 GLU B CG  1 
ATOM   5891 C CD  . GLU B 1 290 ? 1.944   42.019  -34.904 1.00 52.60  ? 290 GLU B CD  1 
ATOM   5892 O OE1 . GLU B 1 290 ? 0.975   42.706  -34.506 1.00 49.49  ? 290 GLU B OE1 1 
ATOM   5893 O OE2 . GLU B 1 290 ? 3.116   42.147  -34.472 1.00 52.96  ? 290 GLU B OE2 1 
ATOM   5894 N N   . LEU B 1 291 ? 0.424   37.409  -33.540 1.00 47.21  ? 291 LEU B N   1 
ATOM   5895 C CA  . LEU B 1 291 ? -0.589  36.731  -32.740 1.00 48.70  ? 291 LEU B CA  1 
ATOM   5896 C C   . LEU B 1 291 ? -0.121  36.404  -31.326 1.00 47.07  ? 291 LEU B C   1 
ATOM   5897 O O   . LEU B 1 291 ? -0.925  36.378  -30.399 1.00 47.57  ? 291 LEU B O   1 
ATOM   5898 C CB  . LEU B 1 291 ? -1.028  35.445  -33.435 1.00 47.60  ? 291 LEU B CB  1 
ATOM   5899 C CG  . LEU B 1 291 ? -1.924  35.612  -34.659 1.00 47.77  ? 291 LEU B CG  1 
ATOM   5900 C CD1 . LEU B 1 291 ? -1.656  34.471  -35.591 1.00 48.23  ? 291 LEU B CD1 1 
ATOM   5901 C CD2 . LEU B 1 291 ? -3.401  35.638  -34.266 1.00 40.54  ? 291 LEU B CD2 1 
ATOM   5902 N N   . ALA B 1 292 ? 1.177   36.143  -31.184 1.00 49.22  ? 292 ALA B N   1 
ATOM   5903 C CA  . ALA B 1 292 ? 1.781   35.730  -29.915 1.00 50.44  ? 292 ALA B CA  1 
ATOM   5904 C C   . ALA B 1 292 ? 1.999   36.930  -29.013 1.00 58.84  ? 292 ALA B C   1 
ATOM   5905 O O   . ALA B 1 292 ? 2.254   36.804  -27.813 1.00 57.23  ? 292 ALA B O   1 
ATOM   5906 C CB  . ALA B 1 292 ? 3.092   35.020  -30.161 1.00 46.81  ? 292 ALA B CB  1 
ATOM   5907 N N   . LYS B 1 293 ? 1.922   38.104  -29.619 1.00 56.26  ? 293 LYS B N   1 
ATOM   5908 C CA  . LYS B 1 293 ? 2.001   39.335  -28.874 1.00 53.70  ? 293 LYS B CA  1 
ATOM   5909 C C   . LYS B 1 293 ? 0.572   39.751  -28.554 1.00 56.69  ? 293 LYS B C   1 
ATOM   5910 O O   . LYS B 1 293 ? 0.293   40.926  -28.360 1.00 67.32  ? 293 LYS B O   1 
ATOM   5911 C CB  . LYS B 1 293 ? 2.762   40.398  -29.676 1.00 51.64  ? 293 LYS B CB  1 
ATOM   5912 C CG  . LYS B 1 293 ? 4.255   40.054  -29.883 1.00 50.40  ? 293 LYS B CG  1 
ATOM   5913 C CD  . LYS B 1 293 ? 4.941   41.035  -30.820 1.00 50.79  ? 293 LYS B CD  1 
ATOM   5914 C CE  . LYS B 1 293 ? 4.260   42.403  -30.753 1.00 55.55  ? 293 LYS B CE  1 
ATOM   5915 N NZ  . LYS B 1 293 ? 4.828   43.340  -31.750 1.00 62.86  ? 293 LYS B NZ  1 
ATOM   5916 N N   . LYS B 1 294 ? -0.328  38.768  -28.517 1.00 50.65  ? 294 LYS B N   1 
ATOM   5917 C CA  . LYS B 1 294 ? -1.724  38.988  -28.149 1.00 51.21  ? 294 LYS B CA  1 
ATOM   5918 C C   . LYS B 1 294 ? -2.346  37.737  -27.518 1.00 51.99  ? 294 LYS B C   1 
ATOM   5919 O O   . LYS B 1 294 ? -3.552  37.687  -27.271 1.00 50.60  ? 294 LYS B O   1 
ATOM   5920 C CB  . LYS B 1 294 ? -2.536  39.424  -29.365 1.00 48.95  ? 294 LYS B CB  1 
ATOM   5921 N N   . SER B 1 295 ? -1.525  36.722  -27.263 1.00 51.02  ? 295 SER B N   1 
ATOM   5922 C CA  . SER B 1 295 ? -2.032  35.469  -26.711 1.00 53.71  ? 295 SER B CA  1 
ATOM   5923 C C   . SER B 1 295 ? -2.764  35.713  -25.404 1.00 60.36  ? 295 SER B C   1 
ATOM   5924 O O   . SER B 1 295 ? -2.265  36.404  -24.520 1.00 67.36  ? 295 SER B O   1 
ATOM   5925 C CB  . SER B 1 295 ? -0.900  34.465  -26.505 1.00 47.05  ? 295 SER B CB  1 
ATOM   5926 N N   . SER B 1 296 ? -3.966  35.173  -25.301 1.00 58.97  ? 296 SER B N   1 
ATOM   5927 C CA  . SER B 1 296 ? -4.633  35.107  -24.023 1.00 58.18  ? 296 SER B CA  1 
ATOM   5928 C C   . SER B 1 296 ? -3.691  34.453  -23.009 1.00 70.31  ? 296 SER B C   1 
ATOM   5929 O O   . SER B 1 296 ? -3.557  34.945  -21.886 1.00 74.31  ? 296 SER B O   1 
ATOM   5930 C CB  . SER B 1 296 ? -5.930  34.333  -24.136 1.00 56.58  ? 296 SER B CB  1 
ATOM   5931 N N   . ALA B 1 297 ? -3.016  33.374  -23.423 1.00 62.71  ? 297 ALA B N   1 
ATOM   5932 C CA  . ALA B 1 297 ? -2.130  32.597  -22.542 1.00 64.57  ? 297 ALA B CA  1 
ATOM   5933 C C   . ALA B 1 297 ? -0.908  33.369  -22.047 1.00 68.49  ? 297 ALA B C   1 
ATOM   5934 O O   . ALA B 1 297 ? -0.386  33.102  -20.957 1.00 65.19  ? 297 ALA B O   1 
ATOM   5935 C CB  . ALA B 1 297 ? -1.663  31.328  -23.246 1.00 57.43  ? 297 ALA B CB  1 
ATOM   5936 N N   . LEU B 1 298 ? -0.438  34.310  -22.857 1.00 66.43  ? 298 LEU B N   1 
ATOM   5937 C CA  . LEU B 1 298 ? 0.781   35.026  -22.534 1.00 62.48  ? 298 LEU B CA  1 
ATOM   5938 C C   . LEU B 1 298 ? 0.459   36.262  -21.676 1.00 68.53  ? 298 LEU B C   1 
ATOM   5939 O O   . LEU B 1 298 ? 1.314   36.750  -20.932 1.00 69.32  ? 298 LEU B O   1 
ATOM   5940 C CB  . LEU B 1 298 ? 1.537   35.385  -23.825 1.00 60.19  ? 298 LEU B CB  1 
ATOM   5941 C CG  . LEU B 1 298 ? 1.991   34.129  -24.609 1.00 63.95  ? 298 LEU B CG  1 
ATOM   5942 C CD1 . LEU B 1 298 ? 2.849   34.429  -25.844 1.00 48.19  ? 298 LEU B CD1 1 
ATOM   5943 C CD2 . LEU B 1 298 ? 2.703   33.129  -23.694 1.00 67.43  ? 298 LEU B CD2 1 
ATOM   5944 N N   . ARG B 1 299 ? -0.782  36.741  -21.755 1.00 64.14  ? 299 ARG B N   1 
ATOM   5945 C CA  . ARG B 1 299 ? -1.235  37.848  -20.917 1.00 64.35  ? 299 ARG B CA  1 
ATOM   5946 C C   . ARG B 1 299 ? -1.643  37.320  -19.534 1.00 67.37  ? 299 ARG B C   1 
ATOM   5947 O O   . ARG B 1 299 ? -1.755  38.076  -18.568 1.00 64.55  ? 299 ARG B O   1 
ATOM   5948 C CB  . ARG B 1 299 ? -2.394  38.590  -21.594 1.00 64.89  ? 299 ARG B CB  1 
ATOM   5949 C CG  . ARG B 1 299 ? -2.856  39.877  -20.904 1.00 70.19  ? 299 ARG B CG  1 
ATOM   5950 C CD  . ARG B 1 299 ? -3.838  40.671  -21.781 1.00 76.26  ? 299 ARG B CD  1 
ATOM   5951 N NE  . ARG B 1 299 ? -5.080  39.941  -22.066 1.00 82.45  ? 299 ARG B NE  1 
ATOM   5952 C CZ  . ARG B 1 299 ? -5.330  39.254  -23.185 1.00 84.18  ? 299 ARG B CZ  1 
ATOM   5953 N NH1 . ARG B 1 299 ? -4.424  39.186  -24.156 1.00 76.27  ? 299 ARG B NH1 1 
ATOM   5954 N NH2 . ARG B 1 299 ? -6.494  38.625  -23.337 1.00 84.24  ? 299 ARG B NH2 1 
ATOM   5955 N N   . ALA B 1 300 ? -1.851  36.011  -19.447 1.00 60.97  ? 300 ALA B N   1 
ATOM   5956 C CA  . ALA B 1 300 ? -2.169  35.377  -18.181 1.00 62.08  ? 300 ALA B CA  1 
ATOM   5957 C C   . ALA B 1 300 ? -0.898  35.072  -17.393 1.00 61.06  ? 300 ALA B C   1 
ATOM   5958 O O   . ALA B 1 300 ? -0.856  35.277  -16.181 1.00 56.20  ? 300 ALA B O   1 
ATOM   5959 C CB  . ALA B 1 300 ? -2.974  34.109  -18.398 1.00 49.54  ? 300 ALA B CB  1 
ATOM   5960 N N   . GLN B 1 301 ? 0.136   34.584  -18.069 1.00 59.40  ? 301 GLN B N   1 
ATOM   5961 C CA  . GLN B 1 301 ? 1.423   34.401  -17.409 1.00 60.75  ? 301 GLN B CA  1 
ATOM   5962 C C   . GLN B 1 301 ? 1.992   35.765  -17.022 1.00 64.32  ? 301 GLN B C   1 
ATOM   5963 O O   . GLN B 1 301 ? 2.823   35.874  -16.122 1.00 65.12  ? 301 GLN B O   1 
ATOM   5964 C CB  . GLN B 1 301 ? 2.404   33.655  -18.309 1.00 56.77  ? 301 GLN B CB  1 
ATOM   5965 C CG  . GLN B 1 301 ? 2.048   32.203  -18.583 1.00 62.93  ? 301 GLN B CG  1 
ATOM   5966 C CD  . GLN B 1 301 ? 2.742   31.664  -19.838 1.00 79.80  ? 301 GLN B CD  1 
ATOM   5967 O OE1 . GLN B 1 301 ? 3.740   32.225  -20.306 1.00 80.22  ? 301 GLN B OE1 1 
ATOM   5968 N NE2 . GLN B 1 301 ? 2.202   30.582  -20.396 1.00 75.44  ? 301 GLN B NE2 1 
ATOM   5969 N N   . GLY B 1 302 ? 1.526   36.802  -17.711 1.00 61.28  ? 302 GLY B N   1 
ATOM   5970 C CA  . GLY B 1 302 ? 2.024   38.146  -17.514 1.00 61.45  ? 302 GLY B CA  1 
ATOM   5971 C C   . GLY B 1 302 ? 1.428   38.849  -16.314 1.00 64.10  ? 302 GLY B C   1 
ATOM   5972 O O   . GLY B 1 302 ? 2.120   39.622  -15.652 1.00 64.31  ? 302 GLY B O   1 
ATOM   5973 N N   . ALA B 1 303 ? 0.152   38.582  -16.031 1.00 64.41  ? 303 ALA B N   1 
ATOM   5974 C CA  . ALA B 1 303 ? -0.551  39.232  -14.915 1.00 62.08  ? 303 ALA B CA  1 
ATOM   5975 C C   . ALA B 1 303 ? -0.511  38.401  -13.625 1.00 59.59  ? 303 ALA B C   1 
ATOM   5976 O O   . ALA B 1 303 ? -1.207  38.707  -12.660 1.00 62.80  ? 303 ALA B O   1 
ATOM   5977 C CB  . ALA B 1 303 ? -1.987  39.530  -15.303 1.00 57.54  ? 303 ALA B CB  1 
ATOM   5978 N N   . GLN B 1 304 ? 0.327   37.368  -13.623 1.00 59.07  ? 304 GLN B N   1 
ATOM   5979 C CA  . GLN B 1 304 ? 0.514   36.448  -12.502 1.00 48.77  ? 304 GLN B CA  1 
ATOM   5980 C C   . GLN B 1 304 ? 1.156   37.098  -11.259 1.00 56.95  ? 304 GLN B C   1 
ATOM   5981 O O   . GLN B 1 304 ? 2.355   37.392  -11.276 1.00 54.76  ? 304 GLN B O   1 
ATOM   5982 C CB  . GLN B 1 304 ? 1.381   35.297  -12.987 1.00 46.19  ? 304 GLN B CB  1 
ATOM   5983 C CG  . GLN B 1 304 ? 1.478   34.118  -12.071 1.00 55.02  ? 304 GLN B CG  1 
ATOM   5984 C CD  . GLN B 1 304 ? 2.405   33.054  -12.623 1.00 64.00  ? 304 GLN B CD  1 
ATOM   5985 O OE1 . GLN B 1 304 ? 2.756   32.105  -11.925 1.00 69.58  ? 304 GLN B OE1 1 
ATOM   5986 N NE2 . GLN B 1 304 ? 2.807   33.208  -13.882 1.00 59.16  ? 304 GLN B NE2 1 
ATOM   5987 N N   . ILE B 1 305 ? 0.380   37.301  -10.187 1.00 53.83  ? 305 ILE B N   1 
ATOM   5988 C CA  . ILE B 1 305 ? 0.864   38.012  -8.988  1.00 47.76  ? 305 ILE B CA  1 
ATOM   5989 C C   . ILE B 1 305 ? 1.985   37.256  -8.289  1.00 45.56  ? 305 ILE B C   1 
ATOM   5990 O O   . ILE B 1 305 ? 1.885   36.053  -8.068  1.00 47.56  ? 305 ILE B O   1 
ATOM   5991 C CB  . ILE B 1 305 ? -0.268  38.271  -7.949  1.00 46.14  ? 305 ILE B CB  1 
ATOM   5992 C CG1 . ILE B 1 305 ? -1.445  38.995  -8.594  1.00 56.93  ? 305 ILE B CG1 1 
ATOM   5993 C CG2 . ILE B 1 305 ? 0.233   39.128  -6.812  1.00 49.51  ? 305 ILE B CG2 1 
ATOM   5994 C CD1 . ILE B 1 305 ? -2.589  39.287  -7.651  1.00 53.45  ? 305 ILE B CD1 1 
ATOM   5995 N N   . ASP B 1 306 ? 3.067   37.965  -7.971  1.00 45.92  ? 306 ASP B N   1 
ATOM   5996 C CA  . ASP B 1 306 ? 4.148   37.401  -7.161  1.00 48.26  ? 306 ASP B CA  1 
ATOM   5997 C C   . ASP B 1 306 ? 3.909   37.814  -5.706  1.00 49.44  ? 306 ASP B C   1 
ATOM   5998 O O   . ASP B 1 306 ? 4.348   38.887  -5.286  1.00 42.49  ? 306 ASP B O   1 
ATOM   5999 C CB  . ASP B 1 306 ? 5.523   37.876  -7.656  1.00 47.23  ? 306 ASP B CB  1 
ATOM   6000 C CG  . ASP B 1 306 ? 6.696   37.212  -6.910  1.00 51.51  ? 306 ASP B CG  1 
ATOM   6001 O OD1 . ASP B 1 306 ? 6.482   36.597  -5.843  1.00 50.55  ? 306 ASP B OD1 1 
ATOM   6002 O OD2 . ASP B 1 306 ? 7.861   37.305  -7.377  1.00 52.72  ? 306 ASP B OD2 1 
ATOM   6003 N N   . SER B 1 307 ? 3.207   36.946  -4.969  1.00 52.70  ? 307 SER B N   1 
ATOM   6004 C CA  . SER B 1 307 ? 2.770   37.175  -3.580  1.00 52.62  ? 307 SER B CA  1 
ATOM   6005 C C   . SER B 1 307 ? 3.691   38.058  -2.728  1.00 50.12  ? 307 SER B C   1 
ATOM   6006 O O   . SER B 1 307 ? 3.331   39.172  -2.344  1.00 48.09  ? 307 SER B O   1 
ATOM   6007 C CB  . SER B 1 307 ? 2.590   35.830  -2.875  1.00 47.38  ? 307 SER B CB  1 
ATOM   6008 O OG  . SER B 1 307 ? 1.221   35.467  -2.832  1.00 46.04  ? 307 SER B OG  1 
ATOM   6009 N N   . ILE B 1 308 ? 4.888   37.565  -2.448  1.00 49.83  ? 308 ILE B N   1 
ATOM   6010 C CA  . ILE B 1 308 ? 5.788   38.306  -1.601  1.00 46.06  ? 308 ILE B CA  1 
ATOM   6011 C C   . ILE B 1 308 ? 6.267   39.605  -2.260  1.00 55.04  ? 308 ILE B C   1 
ATOM   6012 O O   . ILE B 1 308 ? 6.627   40.556  -1.558  1.00 54.54  ? 308 ILE B O   1 
ATOM   6013 C CB  . ILE B 1 308 ? 6.989   37.441  -1.181  1.00 48.70  ? 308 ILE B CB  1 
ATOM   6014 C CG1 . ILE B 1 308 ? 7.756   38.151  -0.069  1.00 50.78  ? 308 ILE B CG1 1 
ATOM   6015 C CG2 . ILE B 1 308 ? 7.876   37.099  -2.364  1.00 54.47  ? 308 ILE B CG2 1 
ATOM   6016 C CD1 . ILE B 1 308 ? 6.834   38.682  1.013   1.00 46.91  ? 308 ILE B CD1 1 
ATOM   6017 N N   . PHE B 1 309 ? 6.253   39.672  -3.592  1.00 50.72  ? 309 PHE B N   1 
ATOM   6018 C CA  . PHE B 1 309 ? 6.701   40.896  -4.255  1.00 51.22  ? 309 PHE B CA  1 
ATOM   6019 C C   . PHE B 1 309 ? 5.656   41.995  -4.157  1.00 52.44  ? 309 PHE B C   1 
ATOM   6020 O O   . PHE B 1 309 ? 5.932   43.075  -3.635  1.00 58.58  ? 309 PHE B O   1 
ATOM   6021 C CB  . PHE B 1 309 ? 7.054   40.656  -5.726  1.00 55.15  ? 309 PHE B CB  1 
ATOM   6022 C CG  . PHE B 1 309 ? 7.414   41.922  -6.474  1.00 56.91  ? 309 PHE B CG  1 
ATOM   6023 C CD1 . PHE B 1 309 ? 8.655   42.518  -6.306  1.00 60.50  ? 309 PHE B CD1 1 
ATOM   6024 C CD2 . PHE B 1 309 ? 6.512   42.522  -7.338  1.00 58.86  ? 309 PHE B CD2 1 
ATOM   6025 C CE1 . PHE B 1 309 ? 8.986   43.685  -6.984  1.00 55.00  ? 309 PHE B CE1 1 
ATOM   6026 C CE2 . PHE B 1 309 ? 6.848   43.698  -8.014  1.00 57.56  ? 309 PHE B CE2 1 
ATOM   6027 C CZ  . PHE B 1 309 ? 8.085   44.273  -7.833  1.00 47.52  ? 309 PHE B CZ  1 
ATOM   6028 N N   . SER B 1 310 ? 4.462   41.735  -4.668  1.00 48.02  ? 310 SER B N   1 
ATOM   6029 C CA  . SER B 1 310 ? 3.398   42.720  -4.583  1.00 50.98  ? 310 SER B CA  1 
ATOM   6030 C C   . SER B 1 310 ? 3.153   43.130  -3.135  1.00 52.05  ? 310 SER B C   1 
ATOM   6031 O O   . SER B 1 310 ? 2.790   44.274  -2.863  1.00 51.34  ? 310 SER B O   1 
ATOM   6032 C CB  . SER B 1 310 ? 2.103   42.180  -5.193  1.00 51.96  ? 310 SER B CB  1 
ATOM   6033 O OG  . SER B 1 310 ? 2.271   41.831  -6.547  1.00 53.79  ? 310 SER B OG  1 
ATOM   6034 N N   . SER B 1 311 ? 3.349   42.194  -2.211  1.00 45.75  ? 311 SER B N   1 
ATOM   6035 C CA  . SER B 1 311 ? 3.110   42.491  -0.807  1.00 54.58  ? 311 SER B CA  1 
ATOM   6036 C C   . SER B 1 311 ? 4.007   43.640  -0.365  1.00 54.52  ? 311 SER B C   1 
ATOM   6037 O O   . SER B 1 311 ? 3.512   44.696  0.054   1.00 54.63  ? 311 SER B O   1 
ATOM   6038 C CB  . SER B 1 311 ? 3.336   41.260  0.074   1.00 51.77  ? 311 SER B CB  1 
ATOM   6039 O OG  . SER B 1 311 ? 2.161   40.474  0.155   1.00 46.00  ? 311 SER B OG  1 
ATOM   6040 N N   . TYR B 1 312 ? 5.318   43.439  -0.486  1.00 49.46  ? 312 TYR B N   1 
ATOM   6041 C CA  . TYR B 1 312 ? 6.287   44.468  -0.132  1.00 48.77  ? 312 TYR B CA  1 
ATOM   6042 C C   . TYR B 1 312 ? 6.139   45.751  -0.963  1.00 51.66  ? 312 TYR B C   1 
ATOM   6043 O O   . TYR B 1 312 ? 6.320   46.847  -0.434  1.00 49.24  ? 312 TYR B O   1 
ATOM   6044 C CB  . TYR B 1 312 ? 7.698   43.923  -0.269  1.00 45.39  ? 312 TYR B CB  1 
ATOM   6045 C CG  . TYR B 1 312 ? 8.194   43.243  0.977   1.00 51.41  ? 312 TYR B CG  1 
ATOM   6046 C CD1 . TYR B 1 312 ? 8.406   43.968  2.155   1.00 52.47  ? 312 TYR B CD1 1 
ATOM   6047 C CD2 . TYR B 1 312 ? 8.469   41.883  0.985   1.00 50.61  ? 312 TYR B CD2 1 
ATOM   6048 C CE1 . TYR B 1 312 ? 8.872   43.345  3.309   1.00 50.72  ? 312 TYR B CE1 1 
ATOM   6049 C CE2 . TYR B 1 312 ? 8.941   41.252  2.124   1.00 51.52  ? 312 TYR B CE2 1 
ATOM   6050 C CZ  . TYR B 1 312 ? 9.136   41.986  3.285   1.00 55.25  ? 312 TYR B CZ  1 
ATOM   6051 O OH  . TYR B 1 312 ? 9.603   41.344  4.412   1.00 48.33  ? 312 TYR B OH  1 
ATOM   6052 N N   . TYR B 1 313 ? 5.810   45.621  -2.247  1.00 50.59  ? 313 TYR B N   1 
ATOM   6053 C CA  . TYR B 1 313 ? 5.526   46.797  -3.066  1.00 47.51  ? 313 TYR B CA  1 
ATOM   6054 C C   . TYR B 1 313 ? 4.390   47.591  -2.444  1.00 51.75  ? 313 TYR B C   1 
ATOM   6055 O O   . TYR B 1 313 ? 4.524   48.797  -2.223  1.00 57.52  ? 313 TYR B O   1 
ATOM   6056 C CB  . TYR B 1 313 ? 5.182   46.419  -4.523  1.00 50.26  ? 313 TYR B CB  1 
ATOM   6057 C CG  . TYR B 1 313 ? 4.623   47.591  -5.319  1.00 49.29  ? 313 TYR B CG  1 
ATOM   6058 C CD1 . TYR B 1 313 ? 5.423   48.680  -5.642  1.00 51.53  ? 313 TYR B CD1 1 
ATOM   6059 C CD2 . TYR B 1 313 ? 3.297   47.623  -5.713  1.00 47.72  ? 313 TYR B CD2 1 
ATOM   6060 C CE1 . TYR B 1 313 ? 4.923   49.751  -6.328  1.00 48.66  ? 313 TYR B CE1 1 
ATOM   6061 C CE2 . TYR B 1 313 ? 2.785   48.699  -6.409  1.00 50.96  ? 313 TYR B CE2 1 
ATOM   6062 C CZ  . TYR B 1 313 ? 3.605   49.764  -6.714  1.00 56.52  ? 313 TYR B CZ  1 
ATOM   6063 O OH  . TYR B 1 313 ? 3.108   50.846  -7.412  1.00 61.65  ? 313 TYR B OH  1 
ATOM   6064 N N   . TRP B 1 314 ? 3.274   46.918  -2.158  1.00 55.83  ? 314 TRP B N   1 
ATOM   6065 C CA  . TRP B 1 314 ? 2.137   47.556  -1.493  1.00 52.42  ? 314 TRP B CA  1 
ATOM   6066 C C   . TRP B 1 314 ? 2.492   48.076  -0.102  1.00 50.27  ? 314 TRP B C   1 
ATOM   6067 O O   . TRP B 1 314 ? 2.045   49.157  0.292   1.00 54.68  ? 314 TRP B O   1 
ATOM   6068 C CB  . TRP B 1 314 ? 0.969   46.584  -1.370  1.00 58.19  ? 314 TRP B CB  1 
ATOM   6069 C CG  . TRP B 1 314 ? 0.335   46.230  -2.649  1.00 59.16  ? 314 TRP B CG  1 
ATOM   6070 C CD1 . TRP B 1 314 ? 0.094   47.058  -3.703  1.00 56.65  ? 314 TRP B CD1 1 
ATOM   6071 C CD2 . TRP B 1 314 ? -0.141  44.937  -3.030  1.00 62.21  ? 314 TRP B CD2 1 
ATOM   6072 N NE1 . TRP B 1 314 ? -0.511  46.360  -4.720  1.00 59.34  ? 314 TRP B NE1 1 
ATOM   6073 C CE2 . TRP B 1 314 ? -0.663  45.053  -4.334  1.00 58.85  ? 314 TRP B CE2 1 
ATOM   6074 C CE3 . TRP B 1 314 ? -0.172  43.688  -2.397  1.00 59.26  ? 314 TRP B CE3 1 
ATOM   6075 C CZ2 . TRP B 1 314 ? -1.216  43.974  -5.016  1.00 58.29  ? 314 TRP B CZ2 1 
ATOM   6076 C CZ3 . TRP B 1 314 ? -0.716  42.609  -3.082  1.00 59.78  ? 314 TRP B CZ3 1 
ATOM   6077 C CH2 . TRP B 1 314 ? -1.237  42.762  -4.376  1.00 58.99  ? 314 TRP B CH2 1 
ATOM   6078 N N   . ALA B 1 315 ? 3.262   47.289  0.649   1.00 49.09  ? 315 ALA B N   1 
ATOM   6079 C CA  . ALA B 1 315 ? 3.735   47.715  1.965   1.00 51.27  ? 315 ALA B CA  1 
ATOM   6080 C C   . ALA B 1 315 ? 4.545   48.997  1.825   1.00 59.67  ? 315 ALA B C   1 
ATOM   6081 O O   . ALA B 1 315 ? 4.214   50.008  2.459   1.00 60.70  ? 315 ALA B O   1 
ATOM   6082 C CB  . ALA B 1 315 ? 4.554   46.636  2.627   1.00 41.57  ? 315 ALA B CB  1 
ATOM   6083 N N   . TRP B 1 316 ? 5.591   48.950  0.991   1.00 56.58  ? 316 TRP B N   1 
ATOM   6084 C CA  . TRP B 1 316 ? 6.379   50.142  0.644   1.00 55.51  ? 316 TRP B CA  1 
ATOM   6085 C C   . TRP B 1 316 ? 5.485   51.307  0.226   1.00 55.43  ? 316 TRP B C   1 
ATOM   6086 O O   . TRP B 1 316 ? 5.495   52.353  0.860   1.00 60.36  ? 316 TRP B O   1 
ATOM   6087 C CB  . TRP B 1 316 ? 7.378   49.824  -0.474  1.00 55.97  ? 316 TRP B CB  1 
ATOM   6088 C CG  . TRP B 1 316 ? 8.080   51.027  -1.047  1.00 63.21  ? 316 TRP B CG  1 
ATOM   6089 C CD1 . TRP B 1 316 ? 9.108   51.741  -0.474  1.00 61.35  ? 316 TRP B CD1 1 
ATOM   6090 C CD2 . TRP B 1 316 ? 7.823   51.647  -2.313  1.00 59.86  ? 316 TRP B CD2 1 
ATOM   6091 N NE1 . TRP B 1 316 ? 9.491   52.770  -1.304  1.00 57.50  ? 316 TRP B NE1 1 
ATOM   6092 C CE2 . TRP B 1 316 ? 8.720   52.734  -2.439  1.00 61.64  ? 316 TRP B CE2 1 
ATOM   6093 C CE3 . TRP B 1 316 ? 6.924   51.390  -3.351  1.00 57.91  ? 316 TRP B CE3 1 
ATOM   6094 C CZ2 . TRP B 1 316 ? 8.736   53.561  -3.560  1.00 61.12  ? 316 TRP B CZ2 1 
ATOM   6095 C CZ3 . TRP B 1 316 ? 6.934   52.216  -4.455  1.00 61.44  ? 316 TRP B CZ3 1 
ATOM   6096 C CH2 . TRP B 1 316 ? 7.836   53.289  -4.553  1.00 61.98  ? 316 TRP B CH2 1 
ATOM   6097 N N   . LYS B 1 317 ? 4.691   51.112  -0.819  1.00 51.65  ? 317 LYS B N   1 
ATOM   6098 C CA  . LYS B 1 317 ? 3.875   52.187  -1.356  1.00 52.62  ? 317 LYS B CA  1 
ATOM   6099 C C   . LYS B 1 317 ? 2.963   52.830  -0.317  1.00 56.05  ? 317 LYS B C   1 
ATOM   6100 O O   . LYS B 1 317 ? 2.659   54.022  -0.404  1.00 57.61  ? 317 LYS B O   1 
ATOM   6101 C CB  . LYS B 1 317 ? 3.039   51.671  -2.531  1.00 59.71  ? 317 LYS B CB  1 
ATOM   6102 C CG  . LYS B 1 317 ? 2.181   52.739  -3.195  1.00 48.77  ? 317 LYS B CG  1 
ATOM   6103 C CD  . LYS B 1 317 ? 2.522   52.949  -4.659  1.00 48.49  ? 317 LYS B CD  1 
ATOM   6104 C CE  . LYS B 1 317 ? 1.651   54.075  -5.212  1.00 58.80  ? 317 LYS B CE  1 
ATOM   6105 N NZ  . LYS B 1 317 ? 1.999   54.467  -6.599  1.00 65.15  ? 317 LYS B NZ  1 
ATOM   6106 N N   . ALA B 1 318 ? 2.538   52.043  0.672   1.00 63.84  ? 318 ALA B N   1 
ATOM   6107 C CA  . ALA B 1 318 ? 1.576   52.510  1.672   1.00 60.71  ? 318 ALA B CA  1 
ATOM   6108 C C   . ALA B 1 318 ? 2.233   53.215  2.862   1.00 62.93  ? 318 ALA B C   1 
ATOM   6109 O O   . ALA B 1 318 ? 1.544   53.850  3.662   1.00 64.06  ? 318 ALA B O   1 
ATOM   6110 C CB  . ALA B 1 318 ? 0.737   51.359  2.161   1.00 60.30  ? 318 ALA B CB  1 
ATOM   6111 N N   . GLY B 1 319 ? 3.552   53.087  2.990   1.00 56.83  ? 319 GLY B N   1 
ATOM   6112 C CA  . GLY B 1 319 ? 4.302   53.893  3.940   1.00 58.25  ? 319 GLY B CA  1 
ATOM   6113 C C   . GLY B 1 319 ? 4.820   53.140  5.146   1.00 56.92  ? 319 GLY B C   1 
ATOM   6114 O O   . GLY B 1 319 ? 5.104   53.726  6.188   1.00 61.54  ? 319 GLY B O   1 
ATOM   6115 N N   . ILE B 1 320 ? 4.943   51.832  4.997   1.00 55.24  ? 320 ILE B N   1 
ATOM   6116 C CA  . ILE B 1 320 ? 5.409   50.981  6.069   1.00 49.07  ? 320 ILE B CA  1 
ATOM   6117 C C   . ILE B 1 320 ? 6.941   51.009  6.167   1.00 57.00  ? 320 ILE B C   1 
ATOM   6118 O O   . ILE B 1 320 ? 7.637   50.951  5.155   1.00 61.45  ? 320 ILE B O   1 
ATOM   6119 C CB  . ILE B 1 320 ? 4.909   49.531  5.872   1.00 48.28  ? 320 ILE B CB  1 
ATOM   6120 C CG1 . ILE B 1 320 ? 3.532   49.354  6.502   1.00 53.67  ? 320 ILE B CG1 1 
ATOM   6121 C CG2 . ILE B 1 320 ? 5.862   48.518  6.496   1.00 43.36  ? 320 ILE B CG2 1 
ATOM   6122 C CD1 . ILE B 1 320 ? 2.432   50.062  5.791   1.00 55.19  ? 320 ILE B CD1 1 
ATOM   6123 N N   . THR B 1 321 ? 7.451   51.117  7.393   1.00 55.13  ? 321 THR B N   1 
ATOM   6124 C CA  . THR B 1 321 ? 8.880   51.015  7.693   1.00 55.55  ? 321 THR B CA  1 
ATOM   6125 C C   . THR B 1 321 ? 9.054   49.862  8.675   1.00 52.95  ? 321 THR B C   1 
ATOM   6126 O O   . THR B 1 321 ? 8.061   49.424  9.251   1.00 53.12  ? 321 THR B O   1 
ATOM   6127 C CB  . THR B 1 321 ? 9.421   52.317  8.294   1.00 57.75  ? 321 THR B CB  1 
ATOM   6128 O OG1 . THR B 1 321 ? 8.651   52.652  9.457   1.00 59.51  ? 321 THR B OG1 1 
ATOM   6129 C CG2 . THR B 1 321 ? 9.353   53.460  7.267   1.00 61.03  ? 321 THR B CG2 1 
ATOM   6130 N N   . PRO B 1 322 ? 10.300  49.370  8.887   1.00 50.20  ? 322 PRO B N   1 
ATOM   6131 C CA  . PRO B 1 322 ? 10.487  48.218  9.791   1.00 47.39  ? 322 PRO B CA  1 
ATOM   6132 C C   . PRO B 1 322 ? 9.987   48.436  11.229  1.00 51.71  ? 322 PRO B C   1 
ATOM   6133 O O   . PRO B 1 322 ? 10.032  47.519  12.052  1.00 53.28  ? 322 PRO B O   1 
ATOM   6134 C CB  . PRO B 1 322 ? 12.010  48.013  9.794   1.00 47.60  ? 322 PRO B CB  1 
ATOM   6135 C CG  . PRO B 1 322 ? 12.482  48.630  8.530   1.00 51.43  ? 322 PRO B CG  1 
ATOM   6136 C CD  . PRO B 1 322 ? 11.577  49.793  8.278   1.00 42.20  ? 322 PRO B CD  1 
ATOM   6137 N N   . VAL B 1 323 ? 9.513   49.642  11.520  1.00 53.08  ? 323 VAL B N   1 
ATOM   6138 C CA  . VAL B 1 323 ? 9.030   49.994  12.845  1.00 54.05  ? 323 VAL B CA  1 
ATOM   6139 C C   . VAL B 1 323 ? 7.502   49.940  12.890  1.00 52.35  ? 323 VAL B C   1 
ATOM   6140 O O   . VAL B 1 323 ? 6.911   49.606  13.913  1.00 56.04  ? 323 VAL B O   1 
ATOM   6141 C CB  . VAL B 1 323 ? 9.553   51.412  13.267  1.00 51.16  ? 323 VAL B CB  1 
ATOM   6142 C CG1 . VAL B 1 323 ? 8.477   52.232  13.991  1.00 41.96  ? 323 VAL B CG1 1 
ATOM   6143 C CG2 . VAL B 1 323 ? 10.847  51.290  14.098  1.00 36.73  ? 323 VAL B CG2 1 
ATOM   6144 N N   . THR B 1 324 ? 6.861   50.262  11.775  1.00 52.25  ? 324 THR B N   1 
ATOM   6145 C CA  . THR B 1 324 ? 5.410   50.257  11.727  1.00 51.80  ? 324 THR B CA  1 
ATOM   6146 C C   . THR B 1 324 ? 4.931   48.917  11.131  1.00 55.57  ? 324 THR B C   1 
ATOM   6147 O O   . THR B 1 324 ? 3.746   48.566  11.211  1.00 53.83  ? 324 THR B O   1 
ATOM   6148 C CB  . THR B 1 324 ? 4.885   51.479  10.923  1.00 50.34  ? 324 THR B CB  1 
ATOM   6149 O OG1 . THR B 1 324 ? 3.463   51.594  11.034  1.00 60.44  ? 324 THR B OG1 1 
ATOM   6150 C CG2 . THR B 1 324 ? 5.225   51.345  9.500   1.00 56.25  ? 324 THR B CG2 1 
ATOM   6151 N N   . PHE B 1 325 ? 5.867   48.151  10.575  1.00 49.96  ? 325 PHE B N   1 
ATOM   6152 C CA  . PHE B 1 325 ? 5.549   46.877  9.920   1.00 52.75  ? 325 PHE B CA  1 
ATOM   6153 C C   . PHE B 1 325 ? 4.908   45.806  10.835  1.00 52.92  ? 325 PHE B C   1 
ATOM   6154 O O   . PHE B 1 325 ? 4.035   45.060  10.382  1.00 50.15  ? 325 PHE B O   1 
ATOM   6155 C CB  . PHE B 1 325 ? 6.815   46.307  9.266   1.00 40.98  ? 325 PHE B CB  1 
ATOM   6156 C CG  . PHE B 1 325 ? 6.638   44.942  8.668   1.00 40.96  ? 325 PHE B CG  1 
ATOM   6157 C CD1 . PHE B 1 325 ? 6.081   44.788  7.407   1.00 49.32  ? 325 PHE B CD1 1 
ATOM   6158 C CD2 . PHE B 1 325 ? 7.060   43.810  9.349   1.00 48.00  ? 325 PHE B CD2 1 
ATOM   6159 C CE1 . PHE B 1 325 ? 5.930   43.522  6.833   1.00 45.50  ? 325 PHE B CE1 1 
ATOM   6160 C CE2 . PHE B 1 325 ? 6.915   42.542  8.789   1.00 54.33  ? 325 PHE B CE2 1 
ATOM   6161 C CZ  . PHE B 1 325 ? 6.347   42.400  7.525   1.00 49.04  ? 325 PHE B CZ  1 
ATOM   6162 N N   . PRO B 1 326 ? 5.357   45.697  12.102  1.00 48.22  ? 326 PRO B N   1 
ATOM   6163 C CA  . PRO B 1 326 ? 4.683   44.716  12.956  1.00 48.35  ? 326 PRO B CA  1 
ATOM   6164 C C   . PRO B 1 326 ? 3.214   45.009  13.269  1.00 48.12  ? 326 PRO B C   1 
ATOM   6165 O O   . PRO B 1 326 ? 2.535   44.087  13.700  1.00 53.18  ? 326 PRO B O   1 
ATOM   6166 C CB  . PRO B 1 326 ? 5.523   44.753  14.241  1.00 53.02  ? 326 PRO B CB  1 
ATOM   6167 C CG  . PRO B 1 326 ? 6.883   45.088  13.770  1.00 50.68  ? 326 PRO B CG  1 
ATOM   6168 C CD  . PRO B 1 326 ? 6.636   46.125  12.701  1.00 50.62  ? 326 PRO B CD  1 
ATOM   6169 N N   . THR B 1 327 ? 2.720   46.228  13.063  1.00 45.48  ? 327 THR B N   1 
ATOM   6170 C CA  . THR B 1 327 ? 1.292   46.465  13.266  1.00 47.26  ? 327 THR B CA  1 
ATOM   6171 C C   . THR B 1 327 ? 0.496   46.073  12.024  1.00 53.25  ? 327 THR B C   1 
ATOM   6172 O O   . THR B 1 327 ? -0.718  45.851  12.099  1.00 51.12  ? 327 THR B O   1 
ATOM   6173 C CB  . THR B 1 327 ? 0.976   47.932  13.620  1.00 49.50  ? 327 THR B CB  1 
ATOM   6174 O OG1 . THR B 1 327 ? 1.384   48.790  12.547  1.00 53.17  ? 327 THR B OG1 1 
ATOM   6175 C CG2 . THR B 1 327 ? 1.667   48.335  14.912  1.00 43.64  ? 327 THR B CG2 1 
ATOM   6176 N N   . LEU B 1 328 ? 1.192   46.033  10.885  1.00 57.24  ? 328 LEU B N   1 
ATOM   6177 C CA  . LEU B 1 328 ? 0.674   45.481  9.638   1.00 49.56  ? 328 LEU B CA  1 
ATOM   6178 C C   . LEU B 1 328 ? 0.575   43.973  9.773   1.00 48.33  ? 328 LEU B C   1 
ATOM   6179 O O   . LEU B 1 328 ? -0.475  43.395  9.508   1.00 41.65  ? 328 LEU B O   1 
ATOM   6180 C CB  . LEU B 1 328 ? 1.583   45.837  8.456   1.00 56.57  ? 328 LEU B CB  1 
ATOM   6181 C CG  . LEU B 1 328 ? 1.273   45.224  7.079   1.00 47.00  ? 328 LEU B CG  1 
ATOM   6182 C CD1 . LEU B 1 328 ? 0.113   45.952  6.446   1.00 40.64  ? 328 LEU B CD1 1 
ATOM   6183 C CD2 . LEU B 1 328 ? 2.506   45.231  6.153   1.00 50.50  ? 328 LEU B CD2 1 
ATOM   6184 N N   . SER B 1 329 ? 1.687   43.349  10.172  1.00 46.43  ? 329 SER B N   1 
ATOM   6185 C CA  . SER B 1 329 ? 1.718   41.921  10.449  1.00 43.28  ? 329 SER B CA  1 
ATOM   6186 C C   . SER B 1 329 ? 0.610   41.553  11.426  1.00 51.38  ? 329 SER B C   1 
ATOM   6187 O O   . SER B 1 329 ? -0.070  40.545  11.252  1.00 52.00  ? 329 SER B O   1 
ATOM   6188 C CB  . SER B 1 329 ? 3.070   41.506  11.006  1.00 42.74  ? 329 SER B CB  1 
ATOM   6189 O OG  . SER B 1 329 ? 3.061   40.160  11.447  1.00 41.57  ? 329 SER B OG  1 
ATOM   6190 N N   . GLN B 1 330 ? 0.403   42.393  12.432  1.00 46.98  ? 330 GLN B N   1 
ATOM   6191 C CA  . GLN B 1 330 ? -0.610  42.104  13.432  1.00 48.63  ? 330 GLN B CA  1 
ATOM   6192 C C   . GLN B 1 330 ? -1.999  42.214  12.837  1.00 46.17  ? 330 GLN B C   1 
ATOM   6193 O O   . GLN B 1 330 ? -2.850  41.364  13.084  1.00 52.65  ? 330 GLN B O   1 
ATOM   6194 C CB  . GLN B 1 330 ? -0.483  43.042  14.646  1.00 48.77  ? 330 GLN B CB  1 
ATOM   6195 C CG  . GLN B 1 330 ? -1.267  42.579  15.870  1.00 38.68  ? 330 GLN B CG  1 
ATOM   6196 C CD  . GLN B 1 330 ? -0.814  41.226  16.370  1.00 41.32  ? 330 GLN B CD  1 
ATOM   6197 O OE1 . GLN B 1 330 ? 0.380   40.890  16.327  1.00 46.55  ? 330 GLN B OE1 1 
ATOM   6198 N NE2 . GLN B 1 330 ? -1.763  40.428  16.831  1.00 36.37  ? 330 GLN B NE2 1 
ATOM   6199 N N   . PHE B 1 331 ? -2.229  43.266  12.065  1.00 41.85  ? 331 PHE B N   1 
ATOM   6200 C CA  . PHE B 1 331 ? -3.545  43.512  11.498  1.00 45.73  ? 331 PHE B CA  1 
ATOM   6201 C C   . PHE B 1 331 ? -3.938  42.395  10.536  1.00 47.93  ? 331 PHE B C   1 
ATOM   6202 O O   . PHE B 1 331 ? -5.097  41.992  10.492  1.00 49.25  ? 331 PHE B O   1 
ATOM   6203 C CB  . PHE B 1 331 ? -3.581  44.862  10.782  1.00 41.62  ? 331 PHE B CB  1 
ATOM   6204 C CG  . PHE B 1 331 ? -4.917  45.193  10.156  1.00 47.56  ? 331 PHE B CG  1 
ATOM   6205 C CD1 . PHE B 1 331 ? -5.246  44.735  8.886   1.00 45.10  ? 331 PHE B CD1 1 
ATOM   6206 C CD2 . PHE B 1 331 ? -5.836  45.986  10.832  1.00 40.90  ? 331 PHE B CD2 1 
ATOM   6207 C CE1 . PHE B 1 331 ? -6.467  45.050  8.324   1.00 51.71  ? 331 PHE B CE1 1 
ATOM   6208 C CE2 . PHE B 1 331 ? -7.065  46.306  10.268  1.00 43.68  ? 331 PHE B CE2 1 
ATOM   6209 C CZ  . PHE B 1 331 ? -7.382  45.841  9.021   1.00 48.81  ? 331 PHE B CZ  1 
ATOM   6210 N N   . LEU B 1 332 ? -2.966  41.908  9.766   1.00 53.29  ? 332 LEU B N   1 
ATOM   6211 C CA  . LEU B 1 332 ? -3.197  40.828  8.805   1.00 53.10  ? 332 LEU B CA  1 
ATOM   6212 C C   . LEU B 1 332 ? -3.431  39.503  9.534   1.00 48.45  ? 332 LEU B C   1 
ATOM   6213 O O   . LEU B 1 332 ? -4.258  38.703  9.111   1.00 45.71  ? 332 LEU B O   1 
ATOM   6214 C CB  . LEU B 1 332 ? -2.019  40.704  7.818   1.00 37.95  ? 332 LEU B CB  1 
ATOM   6215 C CG  . LEU B 1 332 ? -1.781  41.979  6.993   1.00 40.67  ? 332 LEU B CG  1 
ATOM   6216 C CD1 . LEU B 1 332 ? -0.637  41.818  6.025   1.00 38.25  ? 332 LEU B CD1 1 
ATOM   6217 C CD2 . LEU B 1 332 ? -3.035  42.434  6.261   1.00 39.45  ? 332 LEU B CD2 1 
ATOM   6218 N N   . PHE B 1 333 ? -2.712  39.291  10.632  1.00 45.53  ? 333 PHE B N   1 
ATOM   6219 C CA  . PHE B 1 333 ? -2.874  38.082  11.438  1.00 48.13  ? 333 PHE B CA  1 
ATOM   6220 C C   . PHE B 1 333 ? -4.230  38.037  12.136  1.00 48.19  ? 333 PHE B C   1 
ATOM   6221 O O   . PHE B 1 333 ? -4.830  36.975  12.257  1.00 50.63  ? 333 PHE B O   1 
ATOM   6222 C CB  . PHE B 1 333 ? -1.753  37.981  12.450  1.00 41.65  ? 333 PHE B CB  1 
ATOM   6223 C CG  . PHE B 1 333 ? -1.899  36.856  13.430  1.00 50.50  ? 333 PHE B CG  1 
ATOM   6224 C CD1 . PHE B 1 333 ? -2.533  37.055  14.659  1.00 48.80  ? 333 PHE B CD1 1 
ATOM   6225 C CD2 . PHE B 1 333 ? -1.343  35.616  13.168  1.00 45.98  ? 333 PHE B CD2 1 
ATOM   6226 C CE1 . PHE B 1 333 ? -2.643  36.026  15.576  1.00 38.78  ? 333 PHE B CE1 1 
ATOM   6227 C CE2 . PHE B 1 333 ? -1.446  34.584  14.095  1.00 48.63  ? 333 PHE B CE2 1 
ATOM   6228 C CZ  . PHE B 1 333 ? -2.101  34.796  15.299  1.00 43.30  ? 333 PHE B CZ  1 
ATOM   6229 N N   . GLU B 1 334 ? -4.731  39.179  12.580  1.00 49.07  ? 334 GLU B N   1 
ATOM   6230 C CA  . GLU B 1 334 ? -6.070  39.200  13.163  1.00 53.99  ? 334 GLU B CA  1 
ATOM   6231 C C   . GLU B 1 334 ? -7.139  39.049  12.070  1.00 50.37  ? 334 GLU B C   1 
ATOM   6232 O O   . GLU B 1 334 ? -8.263  38.608  12.334  1.00 47.69  ? 334 GLU B O   1 
ATOM   6233 C CB  . GLU B 1 334 ? -6.307  40.486  13.966  1.00 46.68  ? 334 GLU B CB  1 
ATOM   6234 C CG  . GLU B 1 334 ? -5.324  40.705  15.106  1.00 48.59  ? 334 GLU B CG  1 
ATOM   6235 C CD  . GLU B 1 334 ? -5.488  39.725  16.258  1.00 61.40  ? 334 GLU B CD  1 
ATOM   6236 O OE1 . GLU B 1 334 ? -6.614  39.204  16.477  1.00 66.76  ? 334 GLU B OE1 1 
ATOM   6237 O OE2 . GLU B 1 334 ? -4.475  39.485  16.954  1.00 61.47  ? 334 GLU B OE2 1 
ATOM   6238 N N   . MET B 1 335 ? -6.768  39.413  10.844  1.00 53.71  ? 335 MET B N   1 
ATOM   6239 C CA  . MET B 1 335 ? -7.696  39.474  9.718   1.00 46.71  ? 335 MET B CA  1 
ATOM   6240 C C   . MET B 1 335 ? -8.059  38.070  9.233   1.00 44.29  ? 335 MET B C   1 
ATOM   6241 O O   . MET B 1 335 ? -9.143  37.852  8.698   1.00 54.68  ? 335 MET B O   1 
ATOM   6242 C CB  . MET B 1 335 ? -7.091  40.303  8.587   1.00 40.81  ? 335 MET B CB  1 
ATOM   6243 C CG  . MET B 1 335 ? -7.954  40.377  7.335   1.00 53.22  ? 335 MET B CG  1 
ATOM   6244 S SD  . MET B 1 335 ? -7.139  41.145  5.910   1.00 60.59  ? 335 MET B SD  1 
ATOM   6245 C CE  . MET B 1 335 ? -5.727  40.055  5.683   1.00 43.15  ? 335 MET B CE  1 
ATOM   6246 N N   . GLY B 1 336 ? -7.167  37.114  9.447   1.00 39.39  ? 336 GLY B N   1 
ATOM   6247 C CA  . GLY B 1 336 ? -7.465  35.738  9.122   1.00 48.06  ? 336 GLY B CA  1 
ATOM   6248 C C   . GLY B 1 336 ? -7.877  34.886  10.309  1.00 46.15  ? 336 GLY B C   1 
ATOM   6249 O O   . GLY B 1 336 ? -7.601  33.688  10.318  1.00 47.46  ? 336 GLY B O   1 
ATOM   6250 N N   . GLN B 1 337 ? -8.503  35.491  11.317  1.00 45.14  ? 337 GLN B N   1 
ATOM   6251 C CA  . GLN B 1 337 ? -8.999  34.733  12.471  1.00 54.52  ? 337 GLN B CA  1 
ATOM   6252 C C   . GLN B 1 337 ? -10.475 34.496  12.288  1.00 55.22  ? 337 GLN B C   1 
ATOM   6253 O O   . GLN B 1 337 ? -11.073 33.636  12.937  1.00 55.31  ? 337 GLN B O   1 
ATOM   6254 C CB  . GLN B 1 337 ? -8.769  35.463  13.792  1.00 52.06  ? 337 GLN B CB  1 
ATOM   6255 C CG  . GLN B 1 337 ? -7.420  36.090  13.926  1.00 53.59  ? 337 GLN B CG  1 
ATOM   6256 C CD  . GLN B 1 337 ? -6.574  35.434  14.975  1.00 54.89  ? 337 GLN B CD  1 
ATOM   6257 O OE1 . GLN B 1 337 ? -6.030  34.353  14.753  1.00 47.37  ? 337 GLN B OE1 1 
ATOM   6258 N NE2 . GLN B 1 337 ? -6.450  36.086  16.139  1.00 65.43  ? 337 GLN B NE2 1 
ATOM   6259 N N   . GLY B 1 338 ? -11.056 35.293  11.402  1.00 57.83  ? 338 GLY B N   1 
ATOM   6260 C CA  . GLY B 1 338 ? -12.463 35.199  11.085  1.00 58.27  ? 338 GLY B CA  1 
ATOM   6261 C C   . GLY B 1 338 ? -12.760 35.973  9.820   1.00 64.43  ? 338 GLY B C   1 
ATOM   6262 O O   . GLY B 1 338 ? -11.833 36.422  9.133   1.00 54.48  ? 338 GLY B O   1 
ATOM   6263 N N   . PRO B 1 339 ? -14.058 36.133  9.513   1.00 68.63  ? 339 PRO B N   1 
ATOM   6264 C CA  . PRO B 1 339 ? -14.566 36.834  8.332   1.00 62.56  ? 339 PRO B CA  1 
ATOM   6265 C C   . PRO B 1 339 ? -14.277 38.317  8.419   1.00 68.08  ? 339 PRO B C   1 
ATOM   6266 O O   . PRO B 1 339 ? -15.216 39.104  8.570   1.00 68.97  ? 339 PRO B O   1 
ATOM   6267 C CB  . PRO B 1 339 ? -16.073 36.579  8.397   1.00 66.32  ? 339 PRO B CB  1 
ATOM   6268 C CG  . PRO B 1 339 ? -16.345 36.419  9.857   1.00 64.45  ? 339 PRO B CG  1 
ATOM   6269 C CD  . PRO B 1 339 ? -15.150 35.679  10.391  1.00 61.02  ? 339 PRO B CD  1 
ATOM   6270 N N   . ARG B 1 340 ? -13.007 38.695  8.303   1.00 69.60  ? 340 ARG B N   1 
ATOM   6271 C CA  . ARG B 1 340 ? -12.588 40.062  8.622   1.00 69.25  ? 340 ARG B CA  1 
ATOM   6272 C C   . ARG B 1 340 ? -12.261 40.951  7.405   1.00 68.39  ? 340 ARG B C   1 
ATOM   6273 O O   . ARG B 1 340 ? -12.399 42.173  7.474   1.00 69.78  ? 340 ARG B O   1 
ATOM   6274 C CB  . ARG B 1 340 ? -11.377 40.008  9.569   1.00 62.01  ? 340 ARG B CB  1 
ATOM   6275 C CG  . ARG B 1 340 ? -11.626 39.211  10.850  1.00 59.23  ? 340 ARG B CG  1 
ATOM   6276 C CD  . ARG B 1 340 ? -11.249 39.993  12.105  1.00 63.03  ? 340 ARG B CD  1 
ATOM   6277 N NE  . ARG B 1 340 ? -11.999 39.541  13.276  1.00 58.31  ? 340 ARG B NE  1 
ATOM   6278 C CZ  . ARG B 1 340 ? -11.463 38.924  14.325  1.00 57.61  ? 340 ARG B CZ  1 
ATOM   6279 N NH1 . ARG B 1 340 ? -10.158 38.679  14.373  1.00 53.87  ? 340 ARG B NH1 1 
ATOM   6280 N NH2 . ARG B 1 340 ? -12.237 38.554  15.338  1.00 56.98  ? 340 ARG B NH2 1 
ATOM   6281 N N   . GLY B 1 341 ? -11.866 40.341  6.292   1.00 69.78  ? 341 GLY B N   1 
ATOM   6282 C CA  . GLY B 1 341 ? -11.240 41.071  5.202   1.00 69.19  ? 341 GLY B CA  1 
ATOM   6283 C C   . GLY B 1 341 ? -12.079 41.870  4.221   1.00 71.24  ? 341 GLY B C   1 
ATOM   6284 O O   . GLY B 1 341 ? -11.627 42.131  3.103   1.00 77.12  ? 341 GLY B O   1 
ATOM   6285 N N   . GLY B 1 342 ? -13.275 42.287  4.620   1.00 62.67  ? 342 GLY B N   1 
ATOM   6286 C CA  . GLY B 1 342 ? -14.144 42.988  3.693   1.00 62.28  ? 342 GLY B CA  1 
ATOM   6287 C C   . GLY B 1 342 ? -14.426 44.431  4.058   1.00 69.41  ? 342 GLY B C   1 
ATOM   6288 O O   . GLY B 1 342 ? -13.504 45.233  4.221   1.00 71.21  ? 342 GLY B O   1 
ATOM   6289 N N   . LYS B 1 343 ? -15.711 44.767  4.174   1.00 68.36  ? 343 LYS B N   1 
ATOM   6290 C CA  . LYS B 1 343 ? -16.120 46.093  4.617   1.00 69.27  ? 343 LYS B CA  1 
ATOM   6291 C C   . LYS B 1 343 ? -15.756 46.276  6.101   1.00 69.43  ? 343 LYS B C   1 
ATOM   6292 O O   . LYS B 1 343 ? -15.746 47.397  6.616   1.00 62.80  ? 343 LYS B O   1 
ATOM   6293 C CB  . LYS B 1 343 ? -17.621 46.309  4.382   1.00 58.90  ? 343 LYS B CB  1 
ATOM   6294 N N   . LYS B 1 344 ? -15.448 45.166  6.775   1.00 73.01  ? 344 LYS B N   1 
ATOM   6295 C CA  . LYS B 1 344 ? -14.973 45.201  8.158   1.00 72.20  ? 344 LYS B CA  1 
ATOM   6296 C C   . LYS B 1 344 ? -13.525 45.670  8.179   1.00 67.91  ? 344 LYS B C   1 
ATOM   6297 O O   . LYS B 1 344 ? -13.137 46.529  8.976   1.00 68.45  ? 344 LYS B O   1 
ATOM   6298 C CB  . LYS B 1 344 ? -15.099 43.824  8.828   1.00 66.52  ? 344 LYS B CB  1 
ATOM   6299 N N   . MET B 1 345 ? -12.735 45.100  7.280   1.00 68.80  ? 345 MET B N   1 
ATOM   6300 C CA  . MET B 1 345 ? -11.336 45.461  7.137   1.00 67.58  ? 345 MET B CA  1 
ATOM   6301 C C   . MET B 1 345 ? -11.172 46.931  6.781   1.00 64.88  ? 345 MET B C   1 
ATOM   6302 O O   . MET B 1 345 ? -10.388 47.653  7.404   1.00 61.44  ? 345 MET B O   1 
ATOM   6303 C CB  . MET B 1 345 ? -10.688 44.599  6.065   1.00 63.65  ? 345 MET B CB  1 
ATOM   6304 C CG  . MET B 1 345 ? -9.204  44.795  5.947   1.00 64.27  ? 345 MET B CG  1 
ATOM   6305 S SD  . MET B 1 345 ? -8.682  44.221  4.338   1.00 75.00  ? 345 MET B SD  1 
ATOM   6306 C CE  . MET B 1 345 ? -9.575  45.402  3.324   1.00 65.23  ? 345 MET B CE  1 
ATOM   6307 N N   . ILE B 1 346 ? -11.919 47.365  5.773   1.00 63.80  ? 346 ILE B N   1 
ATOM   6308 C CA  . ILE B 1 346 ? -11.847 48.741  5.301   1.00 65.62  ? 346 ILE B CA  1 
ATOM   6309 C C   . ILE B 1 346 ? -12.301 49.736  6.376   1.00 65.75  ? 346 ILE B C   1 
ATOM   6310 O O   . ILE B 1 346 ? -11.770 50.850  6.461   1.00 63.72  ? 346 ILE B O   1 
ATOM   6311 C CB  . ILE B 1 346 ? -12.687 48.924  4.020   1.00 64.73  ? 346 ILE B CB  1 
ATOM   6312 C CG1 . ILE B 1 346 ? -12.199 47.958  2.940   1.00 67.43  ? 346 ILE B CG1 1 
ATOM   6313 C CG2 . ILE B 1 346 ? -12.612 50.360  3.514   1.00 58.35  ? 346 ILE B CG2 1 
ATOM   6314 C CD1 . ILE B 1 346 ? -13.088 47.913  1.733   1.00 72.49  ? 346 ILE B CD1 1 
ATOM   6315 N N   . LYS B 1 347 ? -13.265 49.340  7.207   1.00 64.00  ? 347 LYS B N   1 
ATOM   6316 C CA  . LYS B 1 347 ? -13.676 50.201  8.312   1.00 65.58  ? 347 LYS B CA  1 
ATOM   6317 C C   . LYS B 1 347 ? -12.565 50.268  9.358   1.00 61.75  ? 347 LYS B C   1 
ATOM   6318 O O   . LYS B 1 347 ? -12.305 51.328  9.934   1.00 60.43  ? 347 LYS B O   1 
ATOM   6319 C CB  . LYS B 1 347 ? -14.986 49.723  8.948   1.00 66.06  ? 347 LYS B CB  1 
ATOM   6320 C CG  . LYS B 1 347 ? -15.703 50.823  9.737   1.00 66.87  ? 347 LYS B CG  1 
ATOM   6321 C CD  . LYS B 1 347 ? -17.145 50.452  10.078  1.00 80.21  ? 347 LYS B CD  1 
ATOM   6322 C CE  . LYS B 1 347 ? -17.963 51.687  10.436  1.00 73.55  ? 347 LYS B CE  1 
ATOM   6323 N NZ  . LYS B 1 347 ? -18.138 52.573  9.244   1.00 74.28  ? 347 LYS B NZ  1 
ATOM   6324 N N   . ALA B 1 348 ? -11.898 49.141  9.586   1.00 59.02  ? 348 ALA B N   1 
ATOM   6325 C CA  . ALA B 1 348 ? -10.808 49.099  10.552  1.00 57.47  ? 348 ALA B CA  1 
ATOM   6326 C C   . ALA B 1 348 ? -9.625  49.932  10.083  1.00 60.63  ? 348 ALA B C   1 
ATOM   6327 O O   . ALA B 1 348 ? -8.891  50.479  10.907  1.00 61.99  ? 348 ALA B O   1 
ATOM   6328 C CB  . ALA B 1 348 ? -10.373 47.666  10.818  1.00 51.60  ? 348 ALA B CB  1 
ATOM   6329 N N   . LEU B 1 349 ? -9.444  50.046  8.768   1.00 58.99  ? 349 LEU B N   1 
ATOM   6330 C CA  . LEU B 1 349 ? -8.327  50.822  8.225   1.00 54.08  ? 349 LEU B CA  1 
ATOM   6331 C C   . LEU B 1 349 ? -8.603  52.332  8.268   1.00 59.46  ? 349 LEU B C   1 
ATOM   6332 O O   . LEU B 1 349 ? -7.678  53.149  8.411   1.00 58.69  ? 349 LEU B O   1 
ATOM   6333 C CB  . LEU B 1 349 ? -8.020  50.365  6.804   1.00 53.07  ? 349 LEU B CB  1 
ATOM   6334 C CG  . LEU B 1 349 ? -7.543  48.914  6.684   1.00 59.70  ? 349 LEU B CG  1 
ATOM   6335 C CD1 . LEU B 1 349 ? -7.510  48.450  5.223   1.00 55.68  ? 349 LEU B CD1 1 
ATOM   6336 C CD2 . LEU B 1 349 ? -6.177  48.737  7.357   1.00 50.86  ? 349 LEU B CD2 1 
ATOM   6337 N N   . THR B 1 350 ? -9.881  52.696  8.170   1.00 60.97  ? 350 THR B N   1 
ATOM   6338 C CA  . THR B 1 350 ? -10.303 54.094  8.246   1.00 60.51  ? 350 THR B CA  1 
ATOM   6339 C C   . THR B 1 350 ? -10.288 54.596  9.693   1.00 65.70  ? 350 THR B C   1 
ATOM   6340 O O   . THR B 1 350 ? -10.188 55.803  9.952   1.00 68.39  ? 350 THR B O   1 
ATOM   6341 C CB  . THR B 1 350 ? -11.722 54.289  7.653   1.00 60.96  ? 350 THR B CB  1 
ATOM   6342 O OG1 . THR B 1 350 ? -11.815 53.647  6.372   1.00 49.17  ? 350 THR B OG1 1 
ATOM   6343 C CG2 . THR B 1 350 ? -12.041 55.769  7.496   1.00 67.58  ? 350 THR B CG2 1 
ATOM   6344 N N   . ASN B 1 351 ? -10.378 53.655  10.632  1.00 61.97  ? 351 ASN B N   1 
ATOM   6345 C CA  . ASN B 1 351 ? -10.493 53.977  12.048  1.00 60.96  ? 351 ASN B CA  1 
ATOM   6346 C C   . ASN B 1 351 ? -9.155  54.009  12.746  1.00 59.88  ? 351 ASN B C   1 
ATOM   6347 O O   . ASN B 1 351 ? -8.977  54.731  13.733  1.00 55.65  ? 351 ASN B O   1 
ATOM   6348 C CB  . ASN B 1 351 ? -11.401 52.967  12.747  1.00 59.51  ? 351 ASN B CB  1 
ATOM   6349 C CG  . ASN B 1 351 ? -12.858 53.168  12.406  1.00 65.33  ? 351 ASN B CG  1 
ATOM   6350 O OD1 . ASN B 1 351 ? -13.286 54.286  12.108  1.00 63.67  ? 351 ASN B OD1 1 
ATOM   6351 N ND2 . ASN B 1 351 ? -13.636 52.086  12.450  1.00 66.70  ? 351 ASN B ND2 1 
ATOM   6352 N N   . THR B 1 352 ? -8.221  53.213  12.239  1.00 54.78  ? 352 THR B N   1 
ATOM   6353 C CA  . THR B 1 352 ? -6.928  53.068  12.887  1.00 51.88  ? 352 THR B CA  1 
ATOM   6354 C C   . THR B 1 352 ? -6.261  54.431  12.988  1.00 58.51  ? 352 THR B C   1 
ATOM   6355 O O   . THR B 1 352 ? -6.448  55.294  12.122  1.00 56.80  ? 352 THR B O   1 
ATOM   6356 C CB  . THR B 1 352 ? -6.021  52.077  12.135  1.00 50.59  ? 352 THR B CB  1 
ATOM   6357 O OG1 . THR B 1 352 ? -4.831  51.836  12.891  1.00 46.61  ? 352 THR B OG1 1 
ATOM   6358 C CG2 . THR B 1 352 ? -5.655  52.615  10.756  1.00 55.28  ? 352 THR B CG2 1 
ATOM   6359 N N   . PRO B 1 353 ? -5.517  54.651  14.079  1.00 61.53  ? 353 PRO B N   1 
ATOM   6360 C CA  . PRO B 1 353 ? -4.819  55.931  14.220  1.00 62.03  ? 353 PRO B CA  1 
ATOM   6361 C C   . PRO B 1 353 ? -3.566  55.990  13.340  1.00 61.15  ? 353 PRO B C   1 
ATOM   6362 O O   . PRO B 1 353 ? -2.999  57.065  13.149  1.00 67.26  ? 353 PRO B O   1 
ATOM   6363 C CB  . PRO B 1 353 ? -4.454  55.966  15.705  1.00 54.55  ? 353 PRO B CB  1 
ATOM   6364 C CG  . PRO B 1 353 ? -4.282  54.530  16.068  1.00 57.57  ? 353 PRO B CG  1 
ATOM   6365 C CD  . PRO B 1 353 ? -5.334  53.787  15.259  1.00 55.09  ? 353 PRO B CD  1 
ATOM   6366 N N   . LEU B 1 354 ? -3.147  54.852  12.803  1.00 52.69  ? 354 LEU B N   1 
ATOM   6367 C CA  . LEU B 1 354 ? -1.930  54.812  12.002  1.00 59.50  ? 354 LEU B CA  1 
ATOM   6368 C C   . LEU B 1 354 ? -2.184  55.354  10.595  1.00 61.97  ? 354 LEU B C   1 
ATOM   6369 O O   . LEU B 1 354 ? -3.206  55.064  9.959   1.00 58.10  ? 354 LEU B O   1 
ATOM   6370 C CB  . LEU B 1 354 ? -1.363  53.389  11.932  1.00 54.75  ? 354 LEU B CB  1 
ATOM   6371 C CG  . LEU B 1 354 ? -0.550  52.872  13.119  1.00 42.89  ? 354 LEU B CG  1 
ATOM   6372 C CD1 . LEU B 1 354 ? -1.215  53.186  14.418  1.00 54.49  ? 354 LEU B CD1 1 
ATOM   6373 C CD2 . LEU B 1 354 ? -0.382  51.386  13.018  1.00 47.05  ? 354 LEU B CD2 1 
ATOM   6374 N N   . LYS B 1 355 ? -1.237  56.157  10.127  1.00 65.46  ? 355 LYS B N   1 
ATOM   6375 C CA  . LYS B 1 355 ? -1.305  56.769  8.810   1.00 63.34  ? 355 LYS B CA  1 
ATOM   6376 C C   . LYS B 1 355 ? -1.513  55.739  7.700   1.00 64.30  ? 355 LYS B C   1 
ATOM   6377 O O   . LYS B 1 355 ? -2.279  55.978  6.762   1.00 64.74  ? 355 LYS B O   1 
ATOM   6378 C CB  . LYS B 1 355 ? -0.026  57.571  8.536   1.00 62.39  ? 355 LYS B CB  1 
ATOM   6379 C CG  . LYS B 1 355 ? -0.005  58.982  9.119   1.00 62.27  ? 355 LYS B CG  1 
ATOM   6380 C CD  . LYS B 1 355 ? 1.256   59.715  8.685   1.00 65.89  ? 355 LYS B CD  1 
ATOM   6381 C CE  . LYS B 1 355 ? 1.204   61.195  9.016   1.00 63.88  ? 355 LYS B CE  1 
ATOM   6382 N NZ  . LYS B 1 355 ? 1.599   61.453  10.419  1.00 60.62  ? 355 LYS B NZ  1 
ATOM   6383 N N   . TRP B 1 356 ? -0.850  54.590  7.820   1.00 58.71  ? 356 TRP B N   1 
ATOM   6384 C CA  . TRP B 1 356 ? -0.764  53.671  6.696   1.00 57.45  ? 356 TRP B CA  1 
ATOM   6385 C C   . TRP B 1 356 ? -2.048  52.904  6.413   1.00 62.61  ? 356 TRP B C   1 
ATOM   6386 O O   . TRP B 1 356 ? -2.191  52.301  5.344   1.00 59.70  ? 356 TRP B O   1 
ATOM   6387 C CB  . TRP B 1 356 ? 0.387   52.688  6.893   1.00 51.89  ? 356 TRP B CB  1 
ATOM   6388 C CG  . TRP B 1 356 ? 0.246   51.721  8.011   1.00 59.67  ? 356 TRP B CG  1 
ATOM   6389 C CD1 . TRP B 1 356 ? 0.888   51.771  9.210   1.00 64.62  ? 356 TRP B CD1 1 
ATOM   6390 C CD2 . TRP B 1 356 ? -0.551  50.524  8.030   1.00 59.92  ? 356 TRP B CD2 1 
ATOM   6391 N NE1 . TRP B 1 356 ? 0.529   50.692  9.984   1.00 61.84  ? 356 TRP B NE1 1 
ATOM   6392 C CE2 . TRP B 1 356 ? -0.353  49.913  9.283   1.00 55.63  ? 356 TRP B CE2 1 
ATOM   6393 C CE3 . TRP B 1 356 ? -1.413  49.913  7.112   1.00 58.01  ? 356 TRP B CE3 1 
ATOM   6394 C CZ2 . TRP B 1 356 ? -0.985  48.722  9.642   1.00 57.13  ? 356 TRP B CZ2 1 
ATOM   6395 C CZ3 . TRP B 1 356 ? -2.045  48.737  7.474   1.00 59.33  ? 356 TRP B CZ3 1 
ATOM   6396 C CH2 . TRP B 1 356 ? -1.828  48.154  8.728   1.00 56.73  ? 356 TRP B CH2 1 
ATOM   6397 N N   . GLY B 1 357 ? -2.985  52.923  7.352   1.00 62.28  ? 357 GLY B N   1 
ATOM   6398 C CA  . GLY B 1 357 ? -4.253  52.251  7.134   1.00 57.55  ? 357 GLY B CA  1 
ATOM   6399 C C   . GLY B 1 357 ? -5.025  52.870  5.983   1.00 60.36  ? 357 GLY B C   1 
ATOM   6400 O O   . GLY B 1 357 ? -5.403  52.191  5.019   1.00 63.98  ? 357 GLY B O   1 
ATOM   6401 N N   . LYS B 1 358 ? -5.244  54.175  6.078   1.00 58.92  ? 358 LYS B N   1 
ATOM   6402 C CA  . LYS B 1 358 ? -6.040  54.883  5.095   1.00 56.43  ? 358 LYS B CA  1 
ATOM   6403 C C   . LYS B 1 358 ? -5.341  54.923  3.739   1.00 56.29  ? 358 LYS B C   1 
ATOM   6404 O O   . LYS B 1 358 ? -5.994  54.897  2.701   1.00 57.89  ? 358 LYS B O   1 
ATOM   6405 C CB  . LYS B 1 358 ? -6.337  56.289  5.599   1.00 60.46  ? 358 LYS B CB  1 
ATOM   6406 C CG  . LYS B 1 358 ? -6.585  56.340  7.101   1.00 71.48  ? 358 LYS B CG  1 
ATOM   6407 C CD  . LYS B 1 358 ? -7.163  57.679  7.545   1.00 70.33  ? 358 LYS B CD  1 
ATOM   6408 C CE  . LYS B 1 358 ? -8.654  57.783  7.321   1.00 64.12  ? 358 LYS B CE  1 
ATOM   6409 N NZ  . LYS B 1 358 ? -9.231  58.793  8.248   1.00 71.60  ? 358 LYS B NZ  1 
ATOM   6410 N N   . LYS B 1 359 ? -4.012  54.970  3.760   1.00 59.67  ? 359 LYS B N   1 
ATOM   6411 C CA  . LYS B 1 359 ? -3.202  54.888  2.539   1.00 62.41  ? 359 LYS B CA  1 
ATOM   6412 C C   . LYS B 1 359 ? -3.429  53.593  1.752   1.00 58.95  ? 359 LYS B C   1 
ATOM   6413 O O   . LYS B 1 359 ? -3.727  53.655  0.554   1.00 55.44  ? 359 LYS B O   1 
ATOM   6414 C CB  . LYS B 1 359 ? -1.711  55.041  2.866   1.00 57.12  ? 359 LYS B CB  1 
ATOM   6415 C CG  . LYS B 1 359 ? -1.264  56.486  2.906   1.00 56.83  ? 359 LYS B CG  1 
ATOM   6416 C CD  . LYS B 1 359 ? 0.189   56.614  3.301   1.00 69.03  ? 359 LYS B CD  1 
ATOM   6417 C CE  . LYS B 1 359 ? 0.829   57.878  2.713   1.00 71.40  ? 359 LYS B CE  1 
ATOM   6418 N NZ  . LYS B 1 359 ? 2.330   57.841  2.773   1.00 75.33  ? 359 LYS B NZ  1 
ATOM   6419 N N   . ILE B 1 360 ? -3.282  52.440  2.408   1.00 51.72  ? 360 ILE B N   1 
ATOM   6420 C CA  . ILE B 1 360 ? -3.619  51.171  1.777   1.00 52.65  ? 360 ILE B CA  1 
ATOM   6421 C C   . ILE B 1 360 ? -5.000  51.247  1.127   1.00 55.12  ? 360 ILE B C   1 
ATOM   6422 O O   . ILE B 1 360 ? -5.184  50.803  -0.005  1.00 55.19  ? 360 ILE B O   1 
ATOM   6423 C CB  . ILE B 1 360 ? -3.603  50.009  2.774   1.00 53.23  ? 360 ILE B CB  1 
ATOM   6424 C CG1 . ILE B 1 360 ? -2.173  49.584  3.073   1.00 52.05  ? 360 ILE B CG1 1 
ATOM   6425 C CG2 . ILE B 1 360 ? -4.307  48.812  2.191   1.00 56.75  ? 360 ILE B CG2 1 
ATOM   6426 C CD1 . ILE B 1 360 ? -1.560  48.726  2.011   1.00 55.76  ? 360 ILE B CD1 1 
ATOM   6427 N N   . ILE B 1 361 ? -5.957  51.843  1.832   1.00 54.88  ? 361 ILE B N   1 
ATOM   6428 C CA  . ILE B 1 361 ? -7.306  52.013  1.297   1.00 57.80  ? 361 ILE B CA  1 
ATOM   6429 C C   . ILE B 1 361 ? -7.308  52.793  -0.029  1.00 60.55  ? 361 ILE B C   1 
ATOM   6430 O O   . ILE B 1 361 ? -8.077  52.481  -0.943  1.00 61.92  ? 361 ILE B O   1 
ATOM   6431 C CB  . ILE B 1 361 ? -8.220  52.722  2.322   1.00 55.76  ? 361 ILE B CB  1 
ATOM   6432 C CG1 . ILE B 1 361 ? -8.688  51.740  3.393   1.00 52.79  ? 361 ILE B CG1 1 
ATOM   6433 C CG2 . ILE B 1 361 ? -9.436  53.364  1.652   1.00 53.13  ? 361 ILE B CG2 1 
ATOM   6434 C CD1 . ILE B 1 361 ? -9.560  52.396  4.424   1.00 53.99  ? 361 ILE B CD1 1 
ATOM   6435 N N   . SER B 1 362 ? -6.435  53.791  -0.146  1.00 57.58  ? 362 SER B N   1 
ATOM   6436 C CA  . SER B 1 362 ? -6.392  54.608  -1.357  1.00 55.48  ? 362 SER B CA  1 
ATOM   6437 C C   . SER B 1 362 ? -5.468  54.011  -2.435  1.00 58.21  ? 362 SER B C   1 
ATOM   6438 O O   . SER B 1 362 ? -5.345  54.566  -3.520  1.00 60.62  ? 362 SER B O   1 
ATOM   6439 C CB  . SER B 1 362 ? -5.977  56.047  -1.019  1.00 52.86  ? 362 SER B CB  1 
ATOM   6440 O OG  . SER B 1 362 ? -4.659  56.353  -1.440  1.00 49.05  ? 362 SER B OG  1 
ATOM   6441 N N   . LEU B 1 363 ? -4.830  52.880  -2.144  1.00 53.04  ? 363 LEU B N   1 
ATOM   6442 C CA  . LEU B 1 363 ? -4.156  52.112  -3.185  1.00 54.14  ? 363 LEU B CA  1 
ATOM   6443 C C   . LEU B 1 363 ? -5.130  51.148  -3.876  1.00 66.29  ? 363 LEU B C   1 
ATOM   6444 O O   . LEU B 1 363 ? -4.771  50.507  -4.870  1.00 66.93  ? 363 LEU B O   1 
ATOM   6445 C CB  . LEU B 1 363 ? -2.982  51.304  -2.616  1.00 52.03  ? 363 LEU B CB  1 
ATOM   6446 C CG  . LEU B 1 363 ? -1.763  51.986  -2.012  1.00 50.81  ? 363 LEU B CG  1 
ATOM   6447 C CD1 . LEU B 1 363 ? -0.712  50.939  -1.679  1.00 49.27  ? 363 LEU B CD1 1 
ATOM   6448 C CD2 . LEU B 1 363 ? -1.208  53.044  -2.949  1.00 51.08  ? 363 LEU B CD2 1 
ATOM   6449 N N   . PHE B 1 364 ? -6.347  51.029  -3.337  1.00 65.96  ? 364 PHE B N   1 
ATOM   6450 C CA  . PHE B 1 364 ? -7.311  50.030  -3.813  1.00 65.86  ? 364 PHE B CA  1 
ATOM   6451 C C   . PHE B 1 364 ? -7.850  50.353  -5.196  1.00 69.63  ? 364 PHE B C   1 
ATOM   6452 O O   . PHE B 1 364 ? -8.138  51.510  -5.495  1.00 74.29  ? 364 PHE B O   1 
ATOM   6453 C CB  . PHE B 1 364 ? -8.490  49.890  -2.846  1.00 65.44  ? 364 PHE B CB  1 
ATOM   6454 C CG  . PHE B 1 364 ? -8.170  49.125  -1.592  1.00 65.75  ? 364 PHE B CG  1 
ATOM   6455 C CD1 . PHE B 1 364 ? -6.978  48.415  -1.475  1.00 59.90  ? 364 PHE B CD1 1 
ATOM   6456 C CD2 . PHE B 1 364 ? -9.076  49.111  -0.530  1.00 62.21  ? 364 PHE B CD2 1 
ATOM   6457 C CE1 . PHE B 1 364 ? -6.690  47.712  -0.319  1.00 58.63  ? 364 PHE B CE1 1 
ATOM   6458 C CE2 . PHE B 1 364 ? -8.802  48.414  0.628   1.00 57.03  ? 364 PHE B CE2 1 
ATOM   6459 C CZ  . PHE B 1 364 ? -7.603  47.711  0.737   1.00 62.74  ? 364 PHE B CZ  1 
ATOM   6460 N N   . ALA B 1 365 ? -7.998  49.330  -6.035  1.00 72.72  ? 365 ALA B N   1 
ATOM   6461 C CA  . ALA B 1 365 ? -8.580  49.529  -7.360  1.00 74.04  ? 365 ALA B CA  1 
ATOM   6462 C C   . ALA B 1 365 ? -10.087 49.703  -7.245  1.00 74.81  ? 365 ALA B C   1 
ATOM   6463 O O   . ALA B 1 365 ? -10.708 49.174  -6.325  1.00 78.24  ? 365 ALA B O   1 
ATOM   6464 C CB  . ALA B 1 365 ? -8.243  48.368  -8.280  1.00 72.73  ? 365 ALA B CB  1 
ATOM   6465 N N   . GLU B 1 366 ? -10.664 50.452  -8.177  1.00 80.35  ? 366 GLU B N   1 
ATOM   6466 C CA  . GLU B 1 366 ? -12.106 50.687  -8.207  1.00 88.29  ? 366 GLU B CA  1 
ATOM   6467 C C   . GLU B 1 366 ? -12.926 49.396  -8.239  1.00 91.82  ? 366 GLU B C   1 
ATOM   6468 O O   . GLU B 1 366 ? -12.396 48.307  -8.473  1.00 87.94  ? 366 GLU B O   1 
ATOM   6469 C CB  . GLU B 1 366 ? -12.479 51.539  -9.424  1.00 92.30  ? 366 GLU B CB  1 
ATOM   6470 C CG  . GLU B 1 366 ? -12.126 53.008  -9.315  1.00 95.02  ? 366 GLU B CG  1 
ATOM   6471 C CD  . GLU B 1 366 ? -13.306 53.909  -9.647  1.00 99.70  ? 366 GLU B CD  1 
ATOM   6472 O OE1 . GLU B 1 366 ? -14.449 53.404  -9.708  1.00 96.86  ? 366 GLU B OE1 1 
ATOM   6473 O OE2 . GLU B 1 366 ? -13.090 55.123  -9.848  1.00 97.95  ? 366 GLU B OE2 1 
ATOM   6474 N N   . ASP B 1 367 ? -14.226 49.528  -7.995  1.00 93.62  ? 367 ASP B N   1 
ATOM   6475 C CA  . ASP B 1 367 ? -15.161 48.437  -8.237  1.00 94.34  ? 367 ASP B CA  1 
ATOM   6476 C C   . ASP B 1 367 ? -15.776 48.660  -9.608  1.00 98.23  ? 367 ASP B C   1 
ATOM   6477 O O   . ASP B 1 367 ? -16.174 47.716  -10.297 1.00 94.24  ? 367 ASP B O   1 
ATOM   6478 C CB  . ASP B 1 367 ? -16.225 48.379  -7.148  1.00 94.23  ? 367 ASP B CB  1 
ATOM   6479 C CG  . ASP B 1 367 ? -15.626 48.158  -5.783  1.00 96.43  ? 367 ASP B CG  1 
ATOM   6480 O OD1 . ASP B 1 367 ? -14.432 48.478  -5.616  1.00 96.12  ? 367 ASP B OD1 1 
ATOM   6481 O OD2 . ASP B 1 367 ? -16.334 47.663  -4.883  1.00 98.60  ? 367 ASP B OD2 1 
ATOM   6482 N N   . ASP B 1 368 ? -15.835 49.937  -9.980  1.00 105.02 ? 368 ASP B N   1 
ATOM   6483 C CA  . ASP B 1 368 ? -16.159 50.380  -11.331 1.00 105.72 ? 368 ASP B CA  1 
ATOM   6484 C C   . ASP B 1 368 ? -14.900 50.309  -12.202 1.00 102.31 ? 368 ASP B C   1 
ATOM   6485 O O   . ASP B 1 368 ? -14.239 51.324  -12.427 1.00 104.66 ? 368 ASP B O   1 
ATOM   6486 C CB  . ASP B 1 368 ? -16.716 51.809  -11.294 1.00 106.05 ? 368 ASP B CB  1 
ATOM   6487 C CG  . ASP B 1 368 ? -17.274 52.265  -12.631 1.00 117.08 ? 368 ASP B CG  1 
ATOM   6488 O OD1 . ASP B 1 368 ? -17.103 51.546  -13.641 1.00 118.73 ? 368 ASP B OD1 1 
ATOM   6489 O OD2 . ASP B 1 368 ? -17.883 53.357  -12.669 1.00 120.32 ? 368 ASP B OD2 1 
ATOM   6490 N N   . PHE B 1 369 ? -14.571 49.110  -12.684 1.00 99.05  ? 369 PHE B N   1 
ATOM   6491 C CA  . PHE B 1 369 ? -13.327 48.883  -13.422 1.00 89.86  ? 369 PHE B CA  1 
ATOM   6492 C C   . PHE B 1 369 ? -13.559 48.665  -14.910 1.00 93.78  ? 369 PHE B C   1 
ATOM   6493 O O   . PHE B 1 369 ? -14.315 47.776  -15.316 1.00 90.99  ? 369 PHE B O   1 
ATOM   6494 C CB  . PHE B 1 369 ? -12.581 47.683  -12.842 1.00 85.72  ? 369 PHE B CB  1 
ATOM   6495 C CG  . PHE B 1 369 ? -11.223 47.444  -13.449 1.00 84.11  ? 369 PHE B CG  1 
ATOM   6496 C CD1 . PHE B 1 369 ? -10.178 48.325  -13.219 1.00 84.52  ? 369 PHE B CD1 1 
ATOM   6497 C CD2 . PHE B 1 369 ? -10.981 46.316  -14.215 1.00 83.11  ? 369 PHE B CD2 1 
ATOM   6498 C CE1 . PHE B 1 369 ? -8.925  48.096  -13.762 1.00 76.91  ? 369 PHE B CE1 1 
ATOM   6499 C CE2 . PHE B 1 369 ? -9.731  46.085  -14.756 1.00 79.73  ? 369 PHE B CE2 1 
ATOM   6500 C CZ  . PHE B 1 369 ? -8.706  46.974  -14.531 1.00 76.29  ? 369 PHE B CZ  1 
ATOM   6501 N N   . ASN B 1 370 ? -12.893 49.494  -15.709 1.00 94.90  ? 370 ASN B N   1 
ATOM   6502 C CA  . ASN B 1 370 ? -12.887 49.380  -17.162 1.00 90.53  ? 370 ASN B CA  1 
ATOM   6503 C C   . ASN B 1 370 ? -12.450 47.990  -17.626 1.00 91.69  ? 370 ASN B C   1 
ATOM   6504 O O   . ASN B 1 370 ? -11.255 47.711  -17.751 1.00 91.36  ? 370 ASN B O   1 
ATOM   6505 C CB  . ASN B 1 370 ? -11.977 50.466  -17.753 1.00 89.62  ? 370 ASN B CB  1 
ATOM   6506 C CG  . ASN B 1 370 ? -11.650 50.241  -19.216 1.00 93.20  ? 370 ASN B CG  1 
ATOM   6507 O OD1 . ASN B 1 370 ? -10.626 49.635  -19.549 1.00 95.56  ? 370 ASN B OD1 1 
ATOM   6508 N ND2 . ASN B 1 370 ? -12.502 50.747  -20.099 1.00 91.77  ? 370 ASN B ND2 1 
ATOM   6509 N N   . GLY B 1 371 ? -13.427 47.113  -17.848 1.00 91.30  ? 371 GLY B N   1 
ATOM   6510 C CA  . GLY B 1 371 ? -13.160 45.790  -18.387 1.00 89.92  ? 371 GLY B CA  1 
ATOM   6511 C C   . GLY B 1 371 ? -13.208 44.656  -17.382 1.00 86.75  ? 371 GLY B C   1 
ATOM   6512 O O   . GLY B 1 371 ? -13.831 44.776  -16.324 1.00 95.09  ? 371 GLY B O   1 
ATOM   6513 N N   . ASN B 1 372 ? -12.550 43.548  -17.723 1.00 78.24  ? 372 ASN B N   1 
ATOM   6514 C CA  . ASN B 1 372 ? -12.513 42.371  -16.862 1.00 83.35  ? 372 ASN B CA  1 
ATOM   6515 C C   . ASN B 1 372 ? -11.573 42.566  -15.684 1.00 86.76  ? 372 ASN B C   1 
ATOM   6516 O O   . ASN B 1 372 ? -10.624 43.344  -15.762 1.00 85.02  ? 372 ASN B O   1 
ATOM   6517 C CB  . ASN B 1 372 ? -12.098 41.130  -17.655 1.00 85.40  ? 372 ASN B CB  1 
ATOM   6518 C CG  . ASN B 1 372 ? -12.022 39.880  -16.786 1.00 92.95  ? 372 ASN B CG  1 
ATOM   6519 O OD1 . ASN B 1 372 ? -10.934 39.412  -16.439 1.00 90.16  ? 372 ASN B OD1 1 
ATOM   6520 N ND2 . ASN B 1 372 ? -13.183 39.350  -16.408 1.00 93.44  ? 372 ASN B ND2 1 
ATOM   6521 N N   . LYS B 1 373 ? -11.838 41.848  -14.596 1.00 89.65  ? 373 LYS B N   1 
ATOM   6522 C CA  . LYS B 1 373 ? -11.064 41.993  -13.368 1.00 85.04  ? 373 LYS B CA  1 
ATOM   6523 C C   . LYS B 1 373 ? -9.880  41.022  -13.255 1.00 82.54  ? 373 LYS B C   1 
ATOM   6524 O O   . LYS B 1 373 ? -9.039  41.189  -12.369 1.00 83.74  ? 373 LYS B O   1 
ATOM   6525 C CB  . LYS B 1 373 ? -11.987 41.826  -12.158 1.00 82.62  ? 373 LYS B CB  1 
ATOM   6526 C CG  . LYS B 1 373 ? -13.029 42.925  -12.000 1.00 78.51  ? 373 LYS B CG  1 
ATOM   6527 C CD  . LYS B 1 373 ? -12.488 44.093  -11.196 1.00 72.40  ? 373 LYS B CD  1 
ATOM   6528 C CE  . LYS B 1 373 ? -13.612 44.978  -10.692 1.00 74.90  ? 373 LYS B CE  1 
ATOM   6529 N NZ  . LYS B 1 373 ? -13.143 45.923  -9.645  1.00 78.41  ? 373 LYS B NZ  1 
ATOM   6530 N N   . LEU B 1 374 ? -9.798  40.019  -14.133 1.00 77.55  ? 374 LEU B N   1 
ATOM   6531 C CA  . LEU B 1 374 ? -8.662  39.091  -14.093 1.00 81.18  ? 374 LEU B CA  1 
ATOM   6532 C C   . LEU B 1 374 ? -7.470  39.678  -14.853 1.00 83.43  ? 374 LEU B C   1 
ATOM   6533 O O   . LEU B 1 374 ? -6.337  39.176  -14.776 1.00 81.67  ? 374 LEU B O   1 
ATOM   6534 C CB  . LEU B 1 374 ? -9.046  37.717  -14.661 1.00 84.20  ? 374 LEU B CB  1 
ATOM   6535 C CG  . LEU B 1 374 ? -8.014  36.579  -14.556 1.00 85.15  ? 374 LEU B CG  1 
ATOM   6536 C CD1 . LEU B 1 374 ? -7.294  36.547  -13.206 1.00 81.41  ? 374 LEU B CD1 1 
ATOM   6537 C CD2 . LEU B 1 374 ? -8.676  35.236  -14.819 1.00 90.78  ? 374 LEU B CD2 1 
ATOM   6538 N N   . TYR B 1 375 ? -7.731  40.758  -15.581 1.00 79.55  ? 375 TYR B N   1 
ATOM   6539 C CA  . TYR B 1 375 ? -6.666  41.480  -16.266 1.00 84.12  ? 375 TYR B CA  1 
ATOM   6540 C C   . TYR B 1 375 ? -6.499  42.867  -15.674 1.00 77.30  ? 375 TYR B C   1 
ATOM   6541 O O   . TYR B 1 375 ? -6.453  43.868  -16.386 1.00 79.88  ? 375 TYR B O   1 
ATOM   6542 C CB  . TYR B 1 375 ? -6.941  41.544  -17.767 1.00 84.43  ? 375 TYR B CB  1 
ATOM   6543 C CG  . TYR B 1 375 ? -6.748  40.196  -18.421 1.00 82.14  ? 375 TYR B CG  1 
ATOM   6544 C CD1 . TYR B 1 375 ? -5.790  39.302  -17.937 1.00 75.84  ? 375 TYR B CD1 1 
ATOM   6545 C CD2 . TYR B 1 375 ? -7.530  39.803  -19.495 1.00 81.41  ? 375 TYR B CD2 1 
ATOM   6546 C CE1 . TYR B 1 375 ? -5.606  38.066  -18.515 1.00 70.88  ? 375 TYR B CE1 1 
ATOM   6547 C CE2 . TYR B 1 375 ? -7.352  38.564  -20.081 1.00 85.66  ? 375 TYR B CE2 1 
ATOM   6548 C CZ  . TYR B 1 375 ? -6.389  37.699  -19.587 1.00 78.08  ? 375 TYR B CZ  1 
ATOM   6549 O OH  . TYR B 1 375 ? -6.217  36.464  -20.176 1.00 78.01  ? 375 TYR B OH  1 
ATOM   6550 N N   . MET B 1 376 ? -6.441  42.890  -14.350 1.00 75.25  ? 376 MET B N   1 
ATOM   6551 C CA  . MET B 1 376 ? -6.011  44.039  -13.584 1.00 73.94  ? 376 MET B CA  1 
ATOM   6552 C C   . MET B 1 376 ? -4.511  43.854  -13.458 1.00 70.77  ? 376 MET B C   1 
ATOM   6553 O O   . MET B 1 376 ? -4.049  42.711  -13.423 1.00 64.85  ? 376 MET B O   1 
ATOM   6554 C CB  . MET B 1 376 ? -6.717  44.067  -12.227 1.00 71.52  ? 376 MET B CB  1 
ATOM   6555 C CG  . MET B 1 376 ? -6.385  45.236  -11.322 1.00 72.13  ? 376 MET B CG  1 
ATOM   6556 S SD  . MET B 1 376 ? -7.351  45.194  -9.782  1.00 71.11  ? 376 MET B SD  1 
ATOM   6557 C CE  . MET B 1 376 ? -9.001  45.586  -10.365 1.00 69.28  ? 376 MET B CE  1 
ATOM   6558 N N   . HIS B 1 377 ? -3.738  44.938  -13.436 1.00 67.25  ? 377 HIS B N   1 
ATOM   6559 C CA  . HIS B 1 377 ? -2.298  44.776  -13.287 1.00 59.81  ? 377 HIS B CA  1 
ATOM   6560 C C   . HIS B 1 377 ? -2.034  44.132  -11.927 1.00 63.89  ? 377 HIS B C   1 
ATOM   6561 O O   . HIS B 1 377 ? -2.722  44.448  -10.958 1.00 63.20  ? 377 HIS B O   1 
ATOM   6562 C CB  . HIS B 1 377 ? -1.550  46.107  -13.420 1.00 62.16  ? 377 HIS B CB  1 
ATOM   6563 C CG  . HIS B 1 377 ? -0.057  45.954  -13.459 1.00 64.28  ? 377 HIS B CG  1 
ATOM   6564 N ND1 . HIS B 1 377 ? 0.601   45.304  -14.485 1.00 63.66  ? 377 HIS B ND1 1 
ATOM   6565 C CD2 . HIS B 1 377 ? 0.905   46.335  -12.586 1.00 61.37  ? 377 HIS B CD2 1 
ATOM   6566 C CE1 . HIS B 1 377 ? 1.898   45.297  -14.244 1.00 60.38  ? 377 HIS B CE1 1 
ATOM   6567 N NE2 . HIS B 1 377 ? 2.112   45.919  -13.098 1.00 65.36  ? 377 HIS B NE2 1 
ATOM   6568 N N   . PRO B 1 378 ? -1.070  43.191  -11.867 1.00 58.69  ? 378 PRO B N   1 
ATOM   6569 C CA  . PRO B 1 378 ? -0.707  42.416  -10.670 1.00 57.89  ? 378 PRO B CA  1 
ATOM   6570 C C   . PRO B 1 378 ? -0.139  43.236  -9.496  1.00 60.36  ? 378 PRO B C   1 
ATOM   6571 O O   . PRO B 1 378 ? -0.097  42.751  -8.362  1.00 60.22  ? 378 PRO B O   1 
ATOM   6572 C CB  . PRO B 1 378 ? 0.361   41.440  -11.198 1.00 60.42  ? 378 PRO B CB  1 
ATOM   6573 C CG  . PRO B 1 378 ? 0.801   42.006  -12.510 1.00 56.90  ? 378 PRO B CG  1 
ATOM   6574 C CD  . PRO B 1 378 ? -0.404  42.665  -13.068 1.00 53.23  ? 378 PRO B CD  1 
ATOM   6575 N N   . GLY B 1 379 ? 0.309   44.453  -9.764  1.00 58.47  ? 379 GLY B N   1 
ATOM   6576 C CA  . GLY B 1 379 ? 0.774   45.319  -8.702  1.00 55.88  ? 379 GLY B CA  1 
ATOM   6577 C C   . GLY B 1 379 ? -0.279  46.315  -8.252  1.00 53.47  ? 379 GLY B C   1 
ATOM   6578 O O   . GLY B 1 379 ? 0.043   47.282  -7.558  1.00 56.37  ? 379 GLY B O   1 
ATOM   6579 N N   . VAL B 1 380 ? -1.532  46.093  -8.646  1.00 54.75  ? 380 VAL B N   1 
ATOM   6580 C CA  . VAL B 1 380 ? -2.640  46.909  -8.144  1.00 60.21  ? 380 VAL B CA  1 
ATOM   6581 C C   . VAL B 1 380 ? -3.380  46.176  -7.038  1.00 60.04  ? 380 VAL B C   1 
ATOM   6582 O O   . VAL B 1 380 ? -3.801  45.028  -7.210  1.00 59.23  ? 380 VAL B O   1 
ATOM   6583 C CB  . VAL B 1 380 ? -3.649  47.285  -9.240  1.00 62.01  ? 380 VAL B CB  1 
ATOM   6584 C CG1 . VAL B 1 380 ? -4.688  48.273  -8.702  1.00 59.42  ? 380 VAL B CG1 1 
ATOM   6585 C CG2 . VAL B 1 380 ? -2.933  47.873  -10.418 1.00 63.87  ? 380 VAL B CG2 1 
ATOM   6586 N N   . LEU B 1 381 ? -3.532  46.862  -5.908  1.00 60.23  ? 381 LEU B N   1 
ATOM   6587 C CA  . LEU B 1 381 ? -4.164  46.307  -4.723  1.00 57.33  ? 381 LEU B CA  1 
ATOM   6588 C C   . LEU B 1 381 ? -5.663  46.553  -4.720  1.00 60.94  ? 381 LEU B C   1 
ATOM   6589 O O   . LEU B 1 381 ? -6.133  47.608  -5.153  1.00 58.23  ? 381 LEU B O   1 
ATOM   6590 C CB  . LEU B 1 381 ? -3.542  46.913  -3.466  1.00 61.68  ? 381 LEU B CB  1 
ATOM   6591 C CG  . LEU B 1 381 ? -3.954  46.332  -2.113  1.00 55.82  ? 381 LEU B CG  1 
ATOM   6592 C CD1 . LEU B 1 381 ? -3.554  44.868  -2.023  1.00 56.38  ? 381 LEU B CD1 1 
ATOM   6593 C CD2 . LEU B 1 381 ? -3.299  47.123  -1.017  1.00 57.47  ? 381 LEU B CD2 1 
ATOM   6594 N N   . THR B 1 382 ? -6.406  45.556  -4.250  1.00 57.82  ? 382 THR B N   1 
ATOM   6595 C CA  . THR B 1 382 ? -7.832  45.699  -3.977  1.00 56.33  ? 382 THR B CA  1 
ATOM   6596 C C   . THR B 1 382 ? -8.112  45.161  -2.587  1.00 57.54  ? 382 THR B C   1 
ATOM   6597 O O   . THR B 1 382 ? -7.241  44.518  -1.972  1.00 56.40  ? 382 THR B O   1 
ATOM   6598 C CB  . THR B 1 382 ? -8.709  44.931  -4.979  1.00 51.01  ? 382 THR B CB  1 
ATOM   6599 O OG1 . THR B 1 382 ? -8.467  43.524  -4.840  1.00 51.49  ? 382 THR B OG1 1 
ATOM   6600 C CG2 . THR B 1 382 ? -8.392  45.348  -6.383  1.00 56.50  ? 382 THR B CG2 1 
ATOM   6601 N N   . ALA B 1 383 ? -9.328  45.407  -2.107  1.00 54.86  ? 383 ALA B N   1 
ATOM   6602 C CA  . ALA B 1 383 ? -9.794  44.835  -0.853  1.00 49.81  ? 383 ALA B CA  1 
ATOM   6603 C C   . ALA B 1 383 ? -9.517  43.343  -0.838  1.00 55.55  ? 383 ALA B C   1 
ATOM   6604 O O   . ALA B 1 383 ? -8.970  42.813  0.136   1.00 58.28  ? 383 ALA B O   1 
ATOM   6605 C CB  . ALA B 1 383 ? -11.261 45.100  -0.663  1.00 49.33  ? 383 ALA B CB  1 
ATOM   6606 N N   . GLY B 1 384 ? -9.859  42.675  -1.936  1.00 46.22  ? 384 GLY B N   1 
ATOM   6607 C CA  . GLY B 1 384 ? -9.657  41.247  -2.037  1.00 37.14  ? 384 GLY B CA  1 
ATOM   6608 C C   . GLY B 1 384 ? -8.199  40.838  -2.049  1.00 46.86  ? 384 GLY B C   1 
ATOM   6609 O O   . GLY B 1 384 ? -7.857  39.770  -1.557  1.00 49.49  ? 384 GLY B O   1 
ATOM   6610 N N   . ARG B 1 385 ? -7.320  41.661  -2.615  1.00 53.25  ? 385 ARG B N   1 
ATOM   6611 C CA  . ARG B 1 385 ? -5.932  41.220  -2.780  1.00 52.14  ? 385 ARG B CA  1 
ATOM   6612 C C   . ARG B 1 385 ? -5.108  41.377  -1.505  1.00 52.52  ? 385 ARG B C   1 
ATOM   6613 O O   . ARG B 1 385 ? -3.980  40.891  -1.429  1.00 48.44  ? 385 ARG B O   1 
ATOM   6614 C CB  . ARG B 1 385 ? -5.265  41.958  -3.935  1.00 53.11  ? 385 ARG B CB  1 
ATOM   6615 C CG  . ARG B 1 385 ? -5.951  41.701  -5.248  1.00 58.68  ? 385 ARG B CG  1 
ATOM   6616 C CD  . ARG B 1 385 ? -4.971  41.757  -6.398  1.00 67.07  ? 385 ARG B CD  1 
ATOM   6617 N NE  . ARG B 1 385 ? -5.644  41.610  -7.683  1.00 69.61  ? 385 ARG B NE  1 
ATOM   6618 C CZ  . ARG B 1 385 ? -5.043  41.762  -8.855  1.00 68.26  ? 385 ARG B CZ  1 
ATOM   6619 N NH1 . ARG B 1 385 ? -3.753  42.066  -8.893  1.00 66.93  ? 385 ARG B NH1 1 
ATOM   6620 N NH2 . ARG B 1 385 ? -5.731  41.616  -9.982  1.00 67.67  ? 385 ARG B NH2 1 
ATOM   6621 N N   . MET B 1 386 ? -5.685  42.032  -0.500  1.00 48.78  ? 386 MET B N   1 
ATOM   6622 C CA  . MET B 1 386 ? -5.112  42.054  0.846   1.00 44.30  ? 386 MET B CA  1 
ATOM   6623 C C   . MET B 1 386 ? -4.777  40.641  1.329   1.00 47.39  ? 386 MET B C   1 
ATOM   6624 O O   . MET B 1 386 ? -3.870  40.437  2.148   1.00 46.88  ? 386 MET B O   1 
ATOM   6625 C CB  . MET B 1 386 ? -6.078  42.734  1.816   1.00 49.53  ? 386 MET B CB  1 
ATOM   6626 C CG  . MET B 1 386 ? -6.321  44.218  1.520   1.00 55.47  ? 386 MET B CG  1 
ATOM   6627 S SD  . MET B 1 386 ? -4.862  45.227  1.898   1.00 53.62  ? 386 MET B SD  1 
ATOM   6628 C CE  . MET B 1 386 ? -4.970  45.271  3.683   1.00 49.98  ? 386 MET B CE  1 
ATOM   6629 N N   . SER B 1 387 ? -5.515  39.677  0.787   1.00 45.94  ? 387 SER B N   1 
ATOM   6630 C CA  . SER B 1 387 ? -5.374  38.250  1.060   1.00 43.72  ? 387 SER B CA  1 
ATOM   6631 C C   . SER B 1 387 ? -4.006  37.711  0.691   1.00 39.95  ? 387 SER B C   1 
ATOM   6632 O O   . SER B 1 387 ? -3.591  36.648  1.164   1.00 40.70  ? 387 SER B O   1 
ATOM   6633 C CB  . SER B 1 387 ? -6.456  37.496  0.290   1.00 48.62  ? 387 SER B CB  1 
ATOM   6634 O OG  . SER B 1 387 ? -6.599  38.060  -1.013  1.00 48.59  ? 387 SER B OG  1 
ATOM   6635 N N   . GLU B 1 388 ? -3.335  38.442  -0.194  1.00 44.43  ? 388 GLU B N   1 
ATOM   6636 C CA  . GLU B 1 388 ? -1.956  38.174  -0.578  1.00 45.09  ? 388 GLU B CA  1 
ATOM   6637 C C   . GLU B 1 388 ? -1.036  38.656  0.521   1.00 43.17  ? 388 GLU B C   1 
ATOM   6638 O O   . GLU B 1 388 ? -0.102  37.963  0.942   1.00 43.35  ? 388 GLU B O   1 
ATOM   6639 C CB  . GLU B 1 388 ? -1.604  38.885  -1.889  1.00 46.68  ? 388 GLU B CB  1 
ATOM   6640 C CG  . GLU B 1 388 ? -2.429  38.448  -3.077  1.00 49.25  ? 388 GLU B CG  1 
ATOM   6641 C CD  . GLU B 1 388 ? -1.901  37.176  -3.717  1.00 51.02  ? 388 GLU B CD  1 
ATOM   6642 O OE1 . GLU B 1 388 ? -0.699  36.869  -3.523  1.00 40.95  ? 388 GLU B OE1 1 
ATOM   6643 O OE2 . GLU B 1 388 ? -2.696  36.493  -4.411  1.00 54.15  ? 388 GLU B OE2 1 
ATOM   6644 N N   . MET B 1 389 ? -1.303  39.876  0.964   1.00 41.07  ? 389 MET B N   1 
ATOM   6645 C CA  . MET B 1 389 ? -0.520  40.466  2.025   1.00 45.19  ? 389 MET B CA  1 
ATOM   6646 C C   . MET B 1 389 ? -0.698  39.626  3.275   1.00 41.94  ? 389 MET B C   1 
ATOM   6647 O O   . MET B 1 389 ? 0.288   39.260  3.922   1.00 39.23  ? 389 MET B O   1 
ATOM   6648 C CB  . MET B 1 389 ? -0.934  41.911  2.255   1.00 44.89  ? 389 MET B CB  1 
ATOM   6649 C CG  . MET B 1 389 ? -0.645  42.810  1.089   1.00 42.94  ? 389 MET B CG  1 
ATOM   6650 S SD  . MET B 1 389 ? -0.840  44.502  1.622   1.00 47.49  ? 389 MET B SD  1 
ATOM   6651 C CE  . MET B 1 389 ? 0.282   44.452  3.016   1.00 53.72  ? 389 MET B CE  1 
ATOM   6652 N N   . GLY B 1 390 ? -1.963  39.316  3.583   1.00 42.26  ? 390 GLY B N   1 
ATOM   6653 C CA  . GLY B 1 390 ? -2.320  38.412  4.661   1.00 33.73  ? 390 GLY B CA  1 
ATOM   6654 C C   . GLY B 1 390 ? -1.505  37.135  4.614   1.00 36.71  ? 390 GLY B C   1 
ATOM   6655 O O   . GLY B 1 390 ? -0.916  36.732  5.621   1.00 35.57  ? 390 GLY B O   1 
ATOM   6656 N N   . ALA B 1 391 ? -1.430  36.517  3.436   1.00 36.16  ? 391 ALA B N   1 
ATOM   6657 C CA  . ALA B 1 391 ? -0.768  35.219  3.292   1.00 35.83  ? 391 ALA B CA  1 
ATOM   6658 C C   . ALA B 1 391 ? 0.718   35.315  3.535   1.00 35.99  ? 391 ALA B C   1 
ATOM   6659 O O   . ALA B 1 391 ? 1.355   34.339  3.900   1.00 39.60  ? 391 ALA B O   1 
ATOM   6660 C CB  . ALA B 1 391 ? -1.032  34.647  1.912   1.00 43.18  ? 391 ALA B CB  1 
ATOM   6661 N N   . CYS B 1 392 ? 1.268   36.506  3.320   1.00 41.06  ? 392 CYS B N   1 
ATOM   6662 C CA  . CYS B 1 392 ? 2.695   36.737  3.500   1.00 42.80  ? 392 CYS B CA  1 
ATOM   6663 C C   . CYS B 1 392 ? 3.045   37.250  4.889   1.00 36.67  ? 392 CYS B C   1 
ATOM   6664 O O   . CYS B 1 392 ? 4.002   36.791  5.489   1.00 39.73  ? 392 CYS B O   1 
ATOM   6665 C CB  . CYS B 1 392 ? 3.199   37.733  2.457   1.00 53.18  ? 392 CYS B CB  1 
ATOM   6666 S SG  . CYS B 1 392 ? 3.152   37.162  0.724   1.00 48.50  ? 392 CYS B SG  1 
ATOM   6667 N N   . PHE B 1 393 ? 2.264   38.203  5.393   1.00 41.95  ? 393 PHE B N   1 
ATOM   6668 C CA  . PHE B 1 393 ? 2.631   38.936  6.616   1.00 51.02  ? 393 PHE B CA  1 
ATOM   6669 C C   . PHE B 1 393 ? 1.783   38.619  7.869   1.00 48.58  ? 393 PHE B C   1 
ATOM   6670 O O   . PHE B 1 393 ? 2.215   38.912  8.978   1.00 44.66  ? 393 PHE B O   1 
ATOM   6671 C CB  . PHE B 1 393 ? 2.580   40.450  6.350   1.00 39.73  ? 393 PHE B CB  1 
ATOM   6672 C CG  . PHE B 1 393 ? 3.506   40.909  5.246   1.00 44.84  ? 393 PHE B CG  1 
ATOM   6673 C CD1 . PHE B 1 393 ? 4.677   40.215  4.973   1.00 40.58  ? 393 PHE B CD1 1 
ATOM   6674 C CD2 . PHE B 1 393 ? 3.200   42.029  4.481   1.00 42.27  ? 393 PHE B CD2 1 
ATOM   6675 C CE1 . PHE B 1 393 ? 5.515   40.624  3.973   1.00 41.74  ? 393 PHE B CE1 1 
ATOM   6676 C CE2 . PHE B 1 393 ? 4.038   42.444  3.465   1.00 40.17  ? 393 PHE B CE2 1 
ATOM   6677 C CZ  . PHE B 1 393 ? 5.195   41.745  3.213   1.00 45.79  ? 393 PHE B CZ  1 
ATOM   6678 N N   . GLY B 1 394 ? 0.598   38.027  7.695   1.00 44.41  ? 394 GLY B N   1 
ATOM   6679 C CA  . GLY B 1 394 ? -0.276  37.715  8.817   1.00 45.94  ? 394 GLY B CA  1 
ATOM   6680 C C   . GLY B 1 394 ? -0.405  36.247  9.216   1.00 42.65  ? 394 GLY B C   1 
ATOM   6681 O O   . GLY B 1 394 ? -1.499  35.770  9.504   1.00 46.75  ? 394 GLY B O   1 
ATOM   6682 N N   . VAL B 1 395 ? 0.716   35.543  9.245   1.00 37.15  ? 395 VAL B N   1 
ATOM   6683 C CA  . VAL B 1 395 ? 0.755   34.125  9.549   1.00 34.98  ? 395 VAL B CA  1 
ATOM   6684 C C   . VAL B 1 395 ? 1.632   33.923  10.784  1.00 44.42  ? 395 VAL B C   1 
ATOM   6685 O O   . VAL B 1 395 ? 1.216   33.322  11.772  1.00 48.82  ? 395 VAL B O   1 
ATOM   6686 C CB  . VAL B 1 395 ? 1.311   33.309  8.339   1.00 34.93  ? 395 VAL B CB  1 
ATOM   6687 C CG1 . VAL B 1 395 ? 1.830   31.957  8.775   1.00 32.66  ? 395 VAL B CG1 1 
ATOM   6688 C CG2 . VAL B 1 395 ? 0.265   33.189  7.237   1.00 30.49  ? 395 VAL B CG2 1 
ATOM   6689 N N   . VAL B 1 396 ? 2.860   34.428  10.715  1.00 45.33  ? 396 VAL B N   1 
ATOM   6690 C CA  . VAL B 1 396 ? 3.707   34.558  11.895  1.00 45.47  ? 396 VAL B CA  1 
ATOM   6691 C C   . VAL B 1 396 ? 3.774   36.029  12.306  1.00 49.11  ? 396 VAL B C   1 
ATOM   6692 O O   . VAL B 1 396 ? 4.631   36.759  11.805  1.00 44.56  ? 396 VAL B O   1 
ATOM   6693 C CB  . VAL B 1 396 ? 5.134   34.042  11.648  1.00 42.82  ? 396 VAL B CB  1 
ATOM   6694 C CG1 . VAL B 1 396 ? 5.938   34.053  12.941  1.00 46.88  ? 396 VAL B CG1 1 
ATOM   6695 C CG2 . VAL B 1 396 ? 5.105   32.654  11.031  1.00 38.72  ? 396 VAL B CG2 1 
ATOM   6696 N N   . PRO B 1 397 ? 2.872   36.463  13.223  1.00 53.14  ? 397 PRO B N   1 
ATOM   6697 C CA  . PRO B 1 397 ? 2.742   37.863  13.675  1.00 48.35  ? 397 PRO B CA  1 
ATOM   6698 C C   . PRO B 1 397 ? 3.996   38.310  14.407  1.00 47.10  ? 397 PRO B C   1 
ATOM   6699 O O   . PRO B 1 397 ? 4.305   37.735  15.445  1.00 55.11  ? 397 PRO B O   1 
ATOM   6700 C CB  . PRO B 1 397 ? 1.534   37.821  14.613  1.00 45.88  ? 397 PRO B CB  1 
ATOM   6701 C CG  . PRO B 1 397 ? 1.523   36.418  15.140  1.00 49.21  ? 397 PRO B CG  1 
ATOM   6702 C CD  . PRO B 1 397 ? 2.020   35.551  14.012  1.00 48.35  ? 397 PRO B CD  1 
ATOM   6703 N N   . VAL B 1 398 ? 4.712   39.297  13.877  1.00 44.18  ? 398 VAL B N   1 
ATOM   6704 C CA  . VAL B 1 398 ? 6.125   39.462  14.237  1.00 51.86  ? 398 VAL B CA  1 
ATOM   6705 C C   . VAL B 1 398 ? 6.370   40.103  15.607  1.00 51.33  ? 398 VAL B C   1 
ATOM   6706 O O   . VAL B 1 398 ? 7.415   39.861  16.220  1.00 50.35  ? 398 VAL B O   1 
ATOM   6707 C CB  . VAL B 1 398 ? 6.899   40.280  13.156  1.00 53.40  ? 398 VAL B CB  1 
ATOM   6708 C CG1 . VAL B 1 398 ? 7.220   39.410  11.968  1.00 48.90  ? 398 VAL B CG1 1 
ATOM   6709 C CG2 . VAL B 1 398 ? 6.113   41.514  12.718  1.00 48.76  ? 398 VAL B CG2 1 
ATOM   6710 N N   . SER B 1 399 ? 5.425   40.920  16.075  1.00 53.77  ? 399 SER B N   1 
ATOM   6711 C CA  . SER B 1 399 ? 5.444   41.396  17.456  1.00 49.41  ? 399 SER B CA  1 
ATOM   6712 C C   . SER B 1 399 ? 5.559   40.225  18.447  1.00 55.93  ? 399 SER B C   1 
ATOM   6713 O O   . SER B 1 399 ? 6.376   40.262  19.383  1.00 56.74  ? 399 SER B O   1 
ATOM   6714 C CB  . SER B 1 399 ? 4.186   42.199  17.756  1.00 52.96  ? 399 SER B CB  1 
ATOM   6715 O OG  . SER B 1 399 ? 4.114   43.385  16.984  1.00 55.44  ? 399 SER B OG  1 
ATOM   6716 N N   . ASN B 1 400 ? 4.737   39.196  18.217  1.00 52.70  ? 400 ASN B N   1 
ATOM   6717 C CA  . ASN B 1 400 ? 4.611   38.025  19.094  1.00 52.32  ? 400 ASN B CA  1 
ATOM   6718 C C   . ASN B 1 400 ? 4.537   36.726  18.303  1.00 55.79  ? 400 ASN B C   1 
ATOM   6719 O O   . ASN B 1 400 ? 3.442   36.227  18.032  1.00 51.67  ? 400 ASN B O   1 
ATOM   6720 C CB  . ASN B 1 400 ? 3.360   38.139  19.955  1.00 50.30  ? 400 ASN B CB  1 
ATOM   6721 C CG  . ASN B 1 400 ? 3.175   39.516  20.516  1.00 57.90  ? 400 ASN B CG  1 
ATOM   6722 O OD1 . ASN B 1 400 ? 2.405   40.328  19.984  1.00 59.99  ? 400 ASN B OD1 1 
ATOM   6723 N ND2 . ASN B 1 400 ? 3.900   39.805  21.593  1.00 61.36  ? 400 ASN B ND2 1 
ATOM   6724 N N   . PRO B 1 401 ? 5.697   36.172  17.938  1.00 53.81  ? 401 PRO B N   1 
ATOM   6725 C CA  . PRO B 1 401 ? 5.742   35.120  16.925  1.00 48.93  ? 401 PRO B CA  1 
ATOM   6726 C C   . PRO B 1 401 ? 5.105   33.804  17.368  1.00 52.01  ? 401 PRO B C   1 
ATOM   6727 O O   . PRO B 1 401 ? 4.441   33.160  16.549  1.00 50.49  ? 401 PRO B O   1 
ATOM   6728 C CB  . PRO B 1 401 ? 7.247   34.945  16.675  1.00 55.11  ? 401 PRO B CB  1 
ATOM   6729 C CG  . PRO B 1 401 ? 7.868   36.219  17.144  1.00 55.44  ? 401 PRO B CG  1 
ATOM   6730 C CD  . PRO B 1 401 ? 7.043   36.621  18.325  1.00 55.99  ? 401 PRO B CD  1 
ATOM   6731 N N   . GLU B 1 402 ? 5.295   33.413  18.626  1.00 50.71  ? 402 GLU B N   1 
ATOM   6732 C CA  . GLU B 1 402 ? 4.751   32.148  19.121  1.00 48.35  ? 402 GLU B CA  1 
ATOM   6733 C C   . GLU B 1 402 ? 3.228   32.118  19.017  1.00 45.56  ? 402 GLU B C   1 
ATOM   6734 O O   . GLU B 1 402 ? 2.615   31.069  19.065  1.00 46.63  ? 402 GLU B O   1 
ATOM   6735 C CB  . GLU B 1 402 ? 5.164   31.901  20.572  1.00 50.37  ? 402 GLU B CB  1 
ATOM   6736 C CG  . GLU B 1 402 ? 6.614   31.518  20.781  1.00 55.71  ? 402 GLU B CG  1 
ATOM   6737 C CD  . GLU B 1 402 ? 7.053   31.784  22.212  1.00 68.77  ? 402 GLU B CD  1 
ATOM   6738 O OE1 . GLU B 1 402 ? 6.528   32.751  22.806  1.00 74.39  ? 402 GLU B OE1 1 
ATOM   6739 O OE2 . GLU B 1 402 ? 7.901   31.034  22.749  1.00 62.04  ? 402 GLU B OE2 1 
ATOM   6740 N N   . ASP B 1 403 ? 2.616   33.282  18.882  1.00 48.05  ? 403 ASP B N   1 
ATOM   6741 C CA  . ASP B 1 403 ? 1.180   33.355  18.726  1.00 43.37  ? 403 ASP B CA  1 
ATOM   6742 C C   . ASP B 1 403 ? 0.722   32.692  17.425  1.00 48.48  ? 403 ASP B C   1 
ATOM   6743 O O   . ASP B 1 403 ? -0.472  32.529  17.218  1.00 52.84  ? 403 ASP B O   1 
ATOM   6744 C CB  . ASP B 1 403 ? 0.712   34.814  18.750  1.00 46.94  ? 403 ASP B CB  1 
ATOM   6745 C CG  . ASP B 1 403 ? 0.702   35.418  20.144  1.00 46.20  ? 403 ASP B CG  1 
ATOM   6746 O OD1 . ASP B 1 403 ? 1.273   34.819  21.074  1.00 50.41  ? 403 ASP B OD1 1 
ATOM   6747 O OD2 . ASP B 1 403 ? 0.118   36.511  20.307  1.00 51.78  ? 403 ASP B OD2 1 
ATOM   6748 N N   . ALA B 1 404 ? 1.650   32.329  16.542  1.00 48.59  ? 404 ALA B N   1 
ATOM   6749 C CA  . ALA B 1 404 ? 1.279   31.742  15.248  1.00 49.60  ? 404 ALA B CA  1 
ATOM   6750 C C   . ALA B 1 404 ? 0.410   30.494  15.414  1.00 48.29  ? 404 ALA B C   1 
ATOM   6751 O O   . ALA B 1 404 ? -0.406  30.168  14.549  1.00 52.73  ? 404 ALA B O   1 
ATOM   6752 C CB  . ALA B 1 404 ? 2.526   31.407  14.425  1.00 41.58  ? 404 ALA B CB  1 
ATOM   6753 N N   . VAL B 1 405 ? 0.578   29.808  16.535  1.00 47.53  ? 405 VAL B N   1 
ATOM   6754 C CA  . VAL B 1 405 ? -0.165  28.585  16.815  1.00 46.47  ? 405 VAL B CA  1 
ATOM   6755 C C   . VAL B 1 405 ? -1.690  28.814  16.846  1.00 47.12  ? 405 VAL B C   1 
ATOM   6756 O O   . VAL B 1 405 ? -2.469  27.943  16.455  1.00 44.93  ? 405 VAL B O   1 
ATOM   6757 C CB  . VAL B 1 405 ? 0.326   27.978  18.131  1.00 43.49  ? 405 VAL B CB  1 
ATOM   6758 C CG1 . VAL B 1 405 ? -0.603  26.884  18.601  1.00 52.74  ? 405 VAL B CG1 1 
ATOM   6759 C CG2 . VAL B 1 405 ? 1.737   27.444  17.943  1.00 42.29  ? 405 VAL B CG2 1 
ATOM   6760 N N   . LEU B 1 406 ? -2.113  29.995  17.282  1.00 45.16  ? 406 LEU B N   1 
ATOM   6761 C CA  . LEU B 1 406 ? -3.511  30.399  17.150  1.00 46.13  ? 406 LEU B CA  1 
ATOM   6762 C C   . LEU B 1 406 ? -4.016  30.196  15.705  1.00 46.69  ? 406 LEU B C   1 
ATOM   6763 O O   . LEU B 1 406 ? -5.198  29.930  15.478  1.00 45.22  ? 406 LEU B O   1 
ATOM   6764 C CB  . LEU B 1 406 ? -3.698  31.873  17.572  1.00 42.90  ? 406 LEU B CB  1 
ATOM   6765 C CG  . LEU B 1 406 ? -3.661  32.336  19.041  1.00 47.62  ? 406 LEU B CG  1 
ATOM   6766 C CD1 . LEU B 1 406 ? -2.311  32.092  19.701  1.00 43.00  ? 406 LEU B CD1 1 
ATOM   6767 C CD2 . LEU B 1 406 ? -4.060  33.819  19.188  1.00 43.56  ? 406 LEU B CD2 1 
ATOM   6768 N N   . GLY B 1 407 ? -3.110  30.330  14.736  1.00 49.03  ? 407 GLY B N   1 
ATOM   6769 C CA  . GLY B 1 407 ? -3.445  30.191  13.325  1.00 45.10  ? 407 GLY B CA  1 
ATOM   6770 C C   . GLY B 1 407 ? -4.084  31.432  12.727  1.00 46.89  ? 407 GLY B C   1 
ATOM   6771 O O   . GLY B 1 407 ? -4.685  32.238  13.422  1.00 49.40  ? 407 GLY B O   1 
ATOM   6772 N N   . SER B 1 408 ? -3.935  31.600  11.423  1.00 50.87  ? 408 SER B N   1 
ATOM   6773 C CA  . SER B 1 408 ? -4.620  32.672  10.725  1.00 49.03  ? 408 SER B CA  1 
ATOM   6774 C C   . SER B 1 408 ? -4.882  32.203  9.309   1.00 48.67  ? 408 SER B C   1 
ATOM   6775 O O   . SER B 1 408 ? -4.057  31.494  8.736   1.00 48.77  ? 408 SER B O   1 
ATOM   6776 C CB  . SER B 1 408 ? -3.800  33.962  10.733  1.00 46.36  ? 408 SER B CB  1 
ATOM   6777 O OG  . SER B 1 408 ? -4.601  35.054  10.303  1.00 42.65  ? 408 SER B OG  1 
ATOM   6778 N N   . GLY B 1 409 ? -6.026  32.588  8.750   1.00 42.38  ? 409 GLY B N   1 
ATOM   6779 C CA  . GLY B 1 409 ? -6.481  31.997  7.503   1.00 40.90  ? 409 GLY B CA  1 
ATOM   6780 C C   . GLY B 1 409 ? -6.303  32.862  6.269   1.00 41.85  ? 409 GLY B C   1 
ATOM   6781 O O   . GLY B 1 409 ? -6.941  33.915  6.116   1.00 45.60  ? 409 GLY B O   1 
ATOM   6782 N N   . HIS B 1 410 ? -5.437  32.426  5.370   1.00 37.00  ? 410 HIS B N   1 
ATOM   6783 C CA  . HIS B 1 410 ? -5.237  33.188  4.151   1.00 40.61  ? 410 HIS B CA  1 
ATOM   6784 C C   . HIS B 1 410 ? -5.219  32.257  2.937   1.00 42.51  ? 410 HIS B C   1 
ATOM   6785 O O   . HIS B 1 410 ? -4.505  31.251  2.938   1.00 34.64  ? 410 HIS B O   1 
ATOM   6786 C CB  . HIS B 1 410 ? -3.951  34.008  4.264   1.00 41.79  ? 410 HIS B CB  1 
ATOM   6787 C CG  . HIS B 1 410 ? -3.919  34.904  5.464   1.00 42.58  ? 410 HIS B CG  1 
ATOM   6788 N ND1 . HIS B 1 410 ? -4.634  36.087  5.526   1.00 41.81  ? 410 HIS B ND1 1 
ATOM   6789 C CD2 . HIS B 1 410 ? -3.282  34.783  6.657   1.00 33.99  ? 410 HIS B CD2 1 
ATOM   6790 C CE1 . HIS B 1 410 ? -4.438  36.651  6.706   1.00 40.92  ? 410 HIS B CE1 1 
ATOM   6791 N NE2 . HIS B 1 410 ? -3.618  35.883  7.409   1.00 40.63  ? 410 HIS B NE2 1 
ATOM   6792 N N   . SER B 1 411 ? -6.009  32.606  1.915   1.00 37.76  ? 411 SER B N   1 
ATOM   6793 C CA  . SER B 1 411 ? -6.299  31.706  0.792   1.00 39.92  ? 411 SER B CA  1 
ATOM   6794 C C   . SER B 1 411 ? -5.066  31.048  0.197   1.00 43.32  ? 411 SER B C   1 
ATOM   6795 O O   . SER B 1 411 ? -4.994  29.812  0.084   1.00 43.73  ? 411 SER B O   1 
ATOM   6796 C CB  . SER B 1 411 ? -7.055  32.455  -0.303  1.00 40.77  ? 411 SER B CB  1 
ATOM   6797 O OG  . SER B 1 411 ? -6.176  33.054  -1.225  1.00 56.88  ? 411 SER B OG  1 
ATOM   6798 N N   . LYS B 1 412 ? -4.074  31.873  -0.117  1.00 45.00  ? 412 LYS B N   1 
ATOM   6799 C CA  . LYS B 1 412 ? -2.867  31.415  -0.796  1.00 47.06  ? 412 LYS B CA  1 
ATOM   6800 C C   . LYS B 1 412 ? -2.138  30.337  -0.017  1.00 40.47  ? 412 LYS B C   1 
ATOM   6801 O O   . LYS B 1 412 ? -1.283  29.642  -0.574  1.00 42.18  ? 412 LYS B O   1 
ATOM   6802 C CB  . LYS B 1 412 ? -1.923  32.604  -1.073  1.00 56.91  ? 412 LYS B CB  1 
ATOM   6803 C CG  . LYS B 1 412 ? -2.342  33.509  -2.263  1.00 48.75  ? 412 LYS B CG  1 
ATOM   6804 C CD  . LYS B 1 412 ? -1.920  32.914  -3.603  1.00 50.84  ? 412 LYS B CD  1 
ATOM   6805 C CE  . LYS B 1 412 ? -2.717  33.500  -4.754  1.00 50.67  ? 412 LYS B CE  1 
ATOM   6806 N NZ  . LYS B 1 412 ? -4.193  33.368  -4.491  1.00 64.15  ? 412 LYS B NZ  1 
ATOM   6807 N N   . SER B 1 413 ? -2.488  30.180  1.259   1.00 43.81  ? 413 SER B N   1 
ATOM   6808 C CA  . SER B 1 413 ? -1.821  29.196  2.106   1.00 43.64  ? 413 SER B CA  1 
ATOM   6809 C C   . SER B 1 413 ? -2.142  27.783  1.669   1.00 40.63  ? 413 SER B C   1 
ATOM   6810 O O   . SER B 1 413 ? -1.340  26.866  1.883   1.00 39.37  ? 413 SER B O   1 
ATOM   6811 C CB  . SER B 1 413 ? -2.201  29.384  3.571   1.00 43.65  ? 413 SER B CB  1 
ATOM   6812 O OG  . SER B 1 413 ? -1.620  30.562  4.093   1.00 48.82  ? 413 SER B OG  1 
ATOM   6813 N N   . LEU B 1 414 ? -3.315  27.631  1.051   1.00 45.55  ? 414 LEU B N   1 
ATOM   6814 C CA  . LEU B 1 414 ? -3.831  26.337  0.574   1.00 48.85  ? 414 LEU B CA  1 
ATOM   6815 C C   . LEU B 1 414 ? -2.805  25.521  -0.222  1.00 50.36  ? 414 LEU B C   1 
ATOM   6816 O O   . LEU B 1 414 ? -2.753  24.283  -0.133  1.00 45.12  ? 414 LEU B O   1 
ATOM   6817 C CB  . LEU B 1 414 ? -5.071  26.580  -0.283  1.00 49.98  ? 414 LEU B CB  1 
ATOM   6818 C CG  . LEU B 1 414 ? -6.003  25.401  -0.521  1.00 51.04  ? 414 LEU B CG  1 
ATOM   6819 C CD1 . LEU B 1 414 ? -6.302  24.757  0.796   1.00 51.80  ? 414 LEU B CD1 1 
ATOM   6820 C CD2 . LEU B 1 414 ? -7.291  25.899  -1.145  1.00 46.89  ? 414 LEU B CD2 1 
ATOM   6821 N N   . LEU B 1 415 ? -1.969  26.238  -0.973  1.00 47.19  ? 415 LEU B N   1 
ATOM   6822 C CA  . LEU B 1 415 ? -0.958  25.629  -1.827  1.00 42.19  ? 415 LEU B CA  1 
ATOM   6823 C C   . LEU B 1 415 ? 0.109   24.881  -1.036  1.00 45.38  ? 415 LEU B C   1 
ATOM   6824 O O   . LEU B 1 415 ? 0.911   24.139  -1.623  1.00 47.25  ? 415 LEU B O   1 
ATOM   6825 C CB  . LEU B 1 415 ? -0.319  26.707  -2.718  1.00 44.06  ? 415 LEU B CB  1 
ATOM   6826 C CG  . LEU B 1 415 ? -1.354  27.437  -3.596  1.00 46.96  ? 415 LEU B CG  1 
ATOM   6827 C CD1 . LEU B 1 415 ? -0.815  28.735  -4.163  1.00 38.75  ? 415 LEU B CD1 1 
ATOM   6828 C CD2 . LEU B 1 415 ? -1.861  26.524  -4.707  1.00 39.52  ? 415 LEU B CD2 1 
ATOM   6829 N N   . ASN B 1 416 ? 0.123   25.051  0.287   1.00 44.47  ? 416 ASN B N   1 
ATOM   6830 C CA  . ASN B 1 416 ? 1.136   24.379  1.107   1.00 43.43  ? 416 ASN B CA  1 
ATOM   6831 C C   . ASN B 1 416 ? 0.740   22.950  1.434   1.00 45.09  ? 416 ASN B C   1 
ATOM   6832 O O   . ASN B 1 416 ? 1.569   22.159  1.886   1.00 43.29  ? 416 ASN B O   1 
ATOM   6833 C CB  . ASN B 1 416 ? 1.416   25.139  2.404   1.00 42.44  ? 416 ASN B CB  1 
ATOM   6834 C CG  . ASN B 1 416 ? 2.688   24.643  3.106   1.00 48.62  ? 416 ASN B CG  1 
ATOM   6835 O OD1 . ASN B 1 416 ? 3.644   24.179  2.458   1.00 40.91  ? 416 ASN B OD1 1 
ATOM   6836 N ND2 . ASN B 1 416 ? 2.693   24.716  4.438   1.00 47.05  ? 416 ASN B ND2 1 
ATOM   6837 N N   . TYR B 1 417 ? -0.530  22.629  1.200   1.00 44.55  ? 417 TYR B N   1 
ATOM   6838 C CA  . TYR B 1 417 ? -1.017  21.258  1.313   1.00 47.11  ? 417 TYR B CA  1 
ATOM   6839 C C   . TYR B 1 417 ? -0.352  20.333  0.294   1.00 46.45  ? 417 TYR B C   1 
ATOM   6840 O O   . TYR B 1 417 ? -0.269  20.665  -0.892  1.00 51.64  ? 417 TYR B O   1 
ATOM   6841 C CB  . TYR B 1 417 ? -2.530  21.222  1.123   1.00 49.05  ? 417 TYR B CB  1 
ATOM   6842 C CG  . TYR B 1 417 ? -3.321  21.596  2.342   1.00 45.11  ? 417 TYR B CG  1 
ATOM   6843 C CD1 . TYR B 1 417 ? -3.044  21.023  3.571   1.00 49.59  ? 417 TYR B CD1 1 
ATOM   6844 C CD2 . TYR B 1 417 ? -4.348  22.519  2.268   1.00 44.45  ? 417 TYR B CD2 1 
ATOM   6845 C CE1 . TYR B 1 417 ? -3.774  21.363  4.698   1.00 45.15  ? 417 TYR B CE1 1 
ATOM   6846 C CE2 . TYR B 1 417 ? -5.076  22.867  3.384   1.00 42.29  ? 417 TYR B CE2 1 
ATOM   6847 C CZ  . TYR B 1 417 ? -4.787  22.278  4.594   1.00 40.83  ? 417 TYR B CZ  1 
ATOM   6848 O OH  . TYR B 1 417 ? -5.503  22.614  5.716   1.00 49.64  ? 417 TYR B OH  1 
ATOM   6849 N N   . LYS B 1 418 ? 0.107   19.173  0.754   1.00 46.59  ? 418 LYS B N   1 
ATOM   6850 C CA  . LYS B 1 418 ? 0.728   18.208  -0.133  1.00 46.71  ? 418 LYS B CA  1 
ATOM   6851 C C   . LYS B 1 418 ? -0.184  17.818  -1.293  1.00 56.91  ? 418 LYS B C   1 
ATOM   6852 O O   . LYS B 1 418 ? -1.408  18.008  -1.255  1.00 55.64  ? 418 LYS B O   1 
ATOM   6853 C CB  . LYS B 1 418 ? 1.134   16.960  0.630   1.00 48.27  ? 418 LYS B CB  1 
ATOM   6854 C CG  . LYS B 1 418 ? 2.373   17.117  1.460   1.00 44.37  ? 418 LYS B CG  1 
ATOM   6855 C CD  . LYS B 1 418 ? 2.569   15.892  2.321   1.00 47.84  ? 418 LYS B CD  1 
ATOM   6856 C CE  . LYS B 1 418 ? 3.900   15.916  3.031   1.00 52.76  ? 418 LYS B CE  1 
ATOM   6857 N NZ  . LYS B 1 418 ? 4.207   14.629  3.722   1.00 53.69  ? 418 LYS B NZ  1 
ATOM   6858 N N   . ILE B 1 419 ? 0.445   17.283  -2.334  1.00 65.68  ? 419 ILE B N   1 
ATOM   6859 C CA  . ILE B 1 419 ? -0.241  16.795  -3.526  1.00 63.54  ? 419 ILE B CA  1 
ATOM   6860 C C   . ILE B 1 419 ? -0.174  15.271  -3.569  1.00 58.66  ? 419 ILE B C   1 
ATOM   6861 O O   . ILE B 1 419 ? -1.062  14.607  -4.108  1.00 57.29  ? 419 ILE B O   1 
ATOM   6862 C CB  . ILE B 1 419 ? 0.390   17.379  -4.798  1.00 57.81  ? 419 ILE B CB  1 
ATOM   6863 C CG1 . ILE B 1 419 ? 0.105   18.872  -4.873  1.00 58.28  ? 419 ILE B CG1 1 
ATOM   6864 C CG2 . ILE B 1 419 ? -0.145  16.688  -6.039  1.00 69.56  ? 419 ILE B CG2 1 
ATOM   6865 C CD1 . ILE B 1 419 ? -1.353  19.179  -4.889  1.00 58.97  ? 419 ILE B CD1 1 
ATOM   6866 N N   . ASP B 1 420 ? 0.872   14.743  -2.935  1.00 62.81  ? 420 ASP B N   1 
ATOM   6867 C CA  . ASP B 1 420 ? 1.314   13.363  -3.108  1.00 67.56  ? 420 ASP B CA  1 
ATOM   6868 C C   . ASP B 1 420 ? 0.235   12.351  -2.791  1.00 72.09  ? 420 ASP B C   1 
ATOM   6869 O O   . ASP B 1 420 ? -0.653  12.613  -1.974  1.00 69.82  ? 420 ASP B O   1 
ATOM   6870 C CB  . ASP B 1 420 ? 2.550   13.077  -2.248  1.00 65.97  ? 420 ASP B CB  1 
ATOM   6871 C CG  . ASP B 1 420 ? 2.947   14.255  -1.354  1.00 71.56  ? 420 ASP B CG  1 
ATOM   6872 O OD1 . ASP B 1 420 ? 3.082   15.406  -1.842  1.00 63.96  ? 420 ASP B OD1 1 
ATOM   6873 O OD2 . ASP B 1 420 ? 3.135   14.016  -0.140  1.00 80.28  ? 420 ASP B OD2 1 
ATOM   6874 N N   . THR B 1 421 ? 0.323   11.196  -3.451  1.00 69.82  ? 421 THR B N   1 
ATOM   6875 C CA  . THR B 1 421 ? -0.704  10.163  -3.351  1.00 73.08  ? 421 THR B CA  1 
ATOM   6876 C C   . THR B 1 421 ? -0.779  9.596   -1.937  1.00 76.24  ? 421 THR B C   1 
ATOM   6877 O O   . THR B 1 421 ? -1.873  9.348   -1.415  1.00 75.00  ? 421 THR B O   1 
ATOM   6878 C CB  . THR B 1 421 ? -0.453  9.024   -4.366  1.00 62.48  ? 421 THR B CB  1 
ATOM   6879 O OG1 . THR B 1 421 ? -0.773  9.491   -5.678  1.00 68.92  ? 421 THR B OG1 1 
ATOM   6880 C CG2 . THR B 1 421 ? -1.319  7.819   -4.059  1.00 61.38  ? 421 THR B CG2 1 
ATOM   6881 N N   . ASN B 1 422 ? 0.385   9.421   -1.314  1.00 78.20  ? 422 ASN B N   1 
ATOM   6882 C CA  . ASN B 1 422 ? 0.460   8.825   0.016   1.00 82.21  ? 422 ASN B CA  1 
ATOM   6883 C C   . ASN B 1 422 ? -0.393  9.592   1.027   1.00 80.68  ? 422 ASN B C   1 
ATOM   6884 O O   . ASN B 1 422 ? -1.004  8.993   1.913   1.00 81.58  ? 422 ASN B O   1 
ATOM   6885 C CB  . ASN B 1 422 ? 1.922   8.744   0.489   1.00 82.44  ? 422 ASN B CB  1 
ATOM   6886 C CG  . ASN B 1 422 ? 2.497   10.094  0.869   1.00 77.87  ? 422 ASN B CG  1 
ATOM   6887 O OD1 . ASN B 1 422 ? 2.701   10.955  0.013   1.00 83.33  ? 422 ASN B OD1 1 
ATOM   6888 N ND2 . ASN B 1 422 ? 2.774   10.283  2.158   1.00 74.71  ? 422 ASN B ND2 1 
ATOM   6889 N N   . ALA B 1 423 ? -0.451  10.912  0.865   1.00 75.93  ? 423 ALA B N   1 
ATOM   6890 C CA  . ALA B 1 423 ? -1.235  11.767  1.744   1.00 73.74  ? 423 ALA B CA  1 
ATOM   6891 C C   . ALA B 1 423 ? -2.646  11.954  1.184   1.00 70.78  ? 423 ALA B C   1 
ATOM   6892 O O   . ALA B 1 423 ? -3.484  12.641  1.778   1.00 72.70  ? 423 ALA B O   1 
ATOM   6893 C CB  . ALA B 1 423 ? -0.540  13.120  1.936   1.00 65.26  ? 423 ALA B CB  1 
ATOM   6894 N N   . GLY B 1 424 ? -2.904  11.336  0.037   1.00 66.19  ? 424 GLY B N   1 
ATOM   6895 C CA  . GLY B 1 424 ? -4.221  11.389  -0.576  1.00 69.87  ? 424 GLY B CA  1 
ATOM   6896 C C   . GLY B 1 424 ? -4.595  12.745  -1.150  1.00 64.16  ? 424 GLY B C   1 
ATOM   6897 O O   . GLY B 1 424 ? -5.776  13.105  -1.174  1.00 61.15  ? 424 GLY B O   1 
ATOM   6898 N N   . ASN B 1 425 ? -3.588  13.476  -1.627  1.00 60.58  ? 425 ASN B N   1 
ATOM   6899 C CA  . ASN B 1 425 ? -3.740  14.832  -2.174  1.00 55.64  ? 425 ASN B CA  1 
ATOM   6900 C C   . ASN B 1 425 ? -4.679  15.738  -1.374  1.00 56.37  ? 425 ASN B C   1 
ATOM   6901 O O   . ASN B 1 425 ? -5.766  16.097  -1.851  1.00 52.17  ? 425 ASN B O   1 
ATOM   6902 C CB  . ASN B 1 425 ? -4.214  14.777  -3.631  1.00 55.49  ? 425 ASN B CB  1 
ATOM   6903 C CG  . ASN B 1 425 ? -3.966  16.084  -4.375  1.00 61.99  ? 425 ASN B CG  1 
ATOM   6904 O OD1 . ASN B 1 425 ? -3.614  17.098  -3.775  1.00 64.40  ? 425 ASN B OD1 1 
ATOM   6905 N ND2 . ASN B 1 425 ? -4.165  16.067  -5.684  1.00 64.08  ? 425 ASN B ND2 1 
ATOM   6906 N N   . PRO B 1 426 ? -4.251  16.123  -0.156  1.00 58.92  ? 426 PRO B N   1 
ATOM   6907 C CA  . PRO B 1 426 ? -5.015  17.064  0.671   1.00 51.58  ? 426 PRO B CA  1 
ATOM   6908 C C   . PRO B 1 426 ? -5.247  18.396  -0.017  1.00 50.57  ? 426 PRO B C   1 
ATOM   6909 O O   . PRO B 1 426 ? -6.296  19.003  0.193   1.00 45.75  ? 426 PRO B O   1 
ATOM   6910 C CB  . PRO B 1 426 ? -4.133  17.245  1.907   1.00 56.41  ? 426 PRO B CB  1 
ATOM   6911 C CG  . PRO B 1 426 ? -2.764  16.759  1.491   1.00 53.68  ? 426 PRO B CG  1 
ATOM   6912 C CD  . PRO B 1 426 ? -3.028  15.661  0.528   1.00 54.17  ? 426 PRO B CD  1 
ATOM   6913 N N   . CYS B 1 427 ? -4.287  18.845  -0.826  1.00 49.73  ? 427 CYS B N   1 
ATOM   6914 C CA  . CYS B 1 427 ? -4.435  20.123  -1.497  1.00 42.90  ? 427 CYS B CA  1 
ATOM   6915 C C   . CYS B 1 427 ? -5.662  20.124  -2.403  1.00 49.97  ? 427 CYS B C   1 
ATOM   6916 O O   . CYS B 1 427 ? -6.437  21.078  -2.412  1.00 45.07  ? 427 CYS B O   1 
ATOM   6917 C CB  . CYS B 1 427 ? -3.179  20.471  -2.295  1.00 44.96  ? 427 CYS B CB  1 
ATOM   6918 S SG  . CYS B 1 427 ? -3.348  22.062  -3.169  1.00 47.44  ? 427 CYS B SG  1 
ATOM   6919 N N   . ALA B 1 428 ? -5.846  19.040  -3.151  1.00 54.29  ? 428 ALA B N   1 
ATOM   6920 C CA  . ALA B 1 428 ? -6.993  18.922  -4.039  1.00 53.07  ? 428 ALA B CA  1 
ATOM   6921 C C   . ALA B 1 428 ? -8.294  18.804  -3.243  1.00 53.84  ? 428 ALA B C   1 
ATOM   6922 O O   . ALA B 1 428 ? -9.286  19.488  -3.551  1.00 49.51  ? 428 ALA B O   1 
ATOM   6923 C CB  . ALA B 1 428 ? -6.822  17.727  -4.971  1.00 59.03  ? 428 ALA B CB  1 
ATOM   6924 N N   . LYS B 1 429 ? -8.282  17.941  -2.224  1.00 49.22  ? 429 LYS B N   1 
ATOM   6925 C CA  . LYS B 1 429 ? -9.450  17.758  -1.356  1.00 55.17  ? 429 LYS B CA  1 
ATOM   6926 C C   . LYS B 1 429 ? -10.052 19.100  -0.908  1.00 56.28  ? 429 LYS B C   1 
ATOM   6927 O O   . LYS B 1 429 ? -11.250 19.327  -1.111  1.00 57.93  ? 429 LYS B O   1 
ATOM   6928 C CB  . LYS B 1 429 ? -9.096  16.904  -0.132  1.00 57.65  ? 429 LYS B CB  1 
ATOM   6929 C CG  . LYS B 1 429 ? -8.602  15.502  -0.455  1.00 58.77  ? 429 LYS B CG  1 
ATOM   6930 C CD  . LYS B 1 429 ? -9.203  14.482  0.507   1.00 64.37  ? 429 LYS B CD  1 
ATOM   6931 C CE  . LYS B 1 429 ? -8.276  13.301  0.753   1.00 63.09  ? 429 LYS B CE  1 
ATOM   6932 N NZ  . LYS B 1 429 ? -7.135  13.700  1.639   1.00 58.13  ? 429 LYS B NZ  1 
ATOM   6933 N N   . GLU B 1 430 ? -9.223  19.996  -0.354  1.00 47.88  ? 430 GLU B N   1 
ATOM   6934 C CA  . GLU B 1 430 ? -9.693  21.314  0.099   1.00 48.18  ? 430 GLU B CA  1 
ATOM   6935 C C   . GLU B 1 430 ? -10.250 22.200  -1.014  1.00 51.26  ? 430 GLU B C   1 
ATOM   6936 O O   . GLU B 1 430 ? -11.311 22.821  -0.837  1.00 47.80  ? 430 GLU B O   1 
ATOM   6937 C CB  . GLU B 1 430 ? -8.569  22.064  0.810   1.00 51.80  ? 430 GLU B CB  1 
ATOM   6938 C CG  . GLU B 1 430 ? -8.218  21.501  2.189   1.00 54.26  ? 430 GLU B CG  1 
ATOM   6939 C CD  . GLU B 1 430 ? -9.452  21.290  3.061   1.00 49.86  ? 430 GLU B CD  1 
ATOM   6940 O OE1 . GLU B 1 430 ? -10.056 22.275  3.520   1.00 47.01  ? 430 GLU B OE1 1 
ATOM   6941 O OE2 . GLU B 1 430 ? -9.828  20.125  3.272   1.00 57.59  ? 430 GLU B OE2 1 
ATOM   6942 N N   . ILE B 1 431 ? -9.529  22.272  -2.140  1.00 46.60  ? 431 ILE B N   1 
ATOM   6943 C CA  . ILE B 1 431 ? -9.964  23.069  -3.293  1.00 50.95  ? 431 ILE B CA  1 
ATOM   6944 C C   . ILE B 1 431 ? -11.376 22.696  -3.706  1.00 52.00  ? 431 ILE B C   1 
ATOM   6945 O O   . ILE B 1 431 ? -12.205 23.562  -3.990  1.00 52.74  ? 431 ILE B O   1 
ATOM   6946 C CB  . ILE B 1 431 ? -9.042  22.894  -4.536  1.00 55.99  ? 431 ILE B CB  1 
ATOM   6947 C CG1 . ILE B 1 431 ? -7.578  23.174  -4.192  1.00 50.80  ? 431 ILE B CG1 1 
ATOM   6948 C CG2 . ILE B 1 431 ? -9.490  23.826  -5.659  1.00 47.12  ? 431 ILE B CG2 1 
ATOM   6949 C CD1 . ILE B 1 431 ? -6.591  22.615  -5.186  1.00 48.58  ? 431 ILE B CD1 1 
ATOM   6950 N N   . VAL B 1 432 ? -11.639 21.393  -3.730  1.00 54.17  ? 432 VAL B N   1 
ATOM   6951 C CA  . VAL B 1 432 ? -12.963 20.877  -4.053  1.00 55.20  ? 432 VAL B CA  1 
ATOM   6952 C C   . VAL B 1 432 ? -14.035 21.377  -3.066  1.00 51.82  ? 432 VAL B C   1 
ATOM   6953 O O   . VAL B 1 432 ? -15.093 21.856  -3.476  1.00 51.30  ? 432 VAL B O   1 
ATOM   6954 C CB  . VAL B 1 432 ? -12.943 19.318  -4.097  1.00 60.30  ? 432 VAL B CB  1 
ATOM   6955 C CG1 . VAL B 1 432 ? -14.344 18.742  -4.084  1.00 54.96  ? 432 VAL B CG1 1 
ATOM   6956 C CG2 . VAL B 1 432 ? -12.193 18.836  -5.326  1.00 58.35  ? 432 VAL B CG2 1 
ATOM   6957 N N   . GLN B 1 433 ? -13.770 21.282  -1.768  1.00 54.21  ? 433 GLN B N   1 
ATOM   6958 C CA  . GLN B 1 433 ? -14.771 21.706  -0.783  1.00 51.15  ? 433 GLN B CA  1 
ATOM   6959 C C   . GLN B 1 433 ? -15.053 23.192  -0.932  1.00 54.36  ? 433 GLN B C   1 
ATOM   6960 O O   . GLN B 1 433 ? -16.215 23.627  -0.918  1.00 53.16  ? 433 GLN B O   1 
ATOM   6961 C CB  . GLN B 1 433 ? -14.298 21.375  0.622   1.00 42.37  ? 433 GLN B CB  1 
ATOM   6962 C CG  . GLN B 1 433 ? -13.634 20.027  0.668   1.00 43.01  ? 433 GLN B CG  1 
ATOM   6963 C CD  . GLN B 1 433 ? -13.513 19.467  2.045   1.00 45.81  ? 433 GLN B CD  1 
ATOM   6964 O OE1 . GLN B 1 433 ? -14.349 19.730  2.917   1.00 49.33  ? 433 GLN B OE1 1 
ATOM   6965 N NE2 . GLN B 1 433 ? -12.469 18.670  2.262   1.00 47.46  ? 433 GLN B NE2 1 
ATOM   6966 N N   . LEU B 1 434 ? -13.979 23.961  -1.104  1.00 51.39  ? 434 LEU B N   1 
ATOM   6967 C CA  . LEU B 1 434 ? -14.094 25.379  -1.403  1.00 52.65  ? 434 LEU B CA  1 
ATOM   6968 C C   . LEU B 1 434 ? -14.849 25.570  -2.716  1.00 55.79  ? 434 LEU B C   1 
ATOM   6969 O O   . LEU B 1 434 ? -15.583 26.550  -2.897  1.00 55.31  ? 434 LEU B O   1 
ATOM   6970 C CB  . LEU B 1 434 ? -12.708 26.016  -1.457  1.00 48.29  ? 434 LEU B CB  1 
ATOM   6971 C CG  . LEU B 1 434 ? -12.167 26.224  -0.052  1.00 47.51  ? 434 LEU B CG  1 
ATOM   6972 C CD1 . LEU B 1 434 ? -10.654 26.203  -0.008  1.00 39.99  ? 434 LEU B CD1 1 
ATOM   6973 C CD2 . LEU B 1 434 ? -12.732 27.525  0.502   1.00 45.20  ? 434 LEU B CD2 1 
ATOM   6974 N N   . PHE B 1 435 ? -14.684 24.612  -3.622  1.00 53.92  ? 435 PHE B N   1 
ATOM   6975 C CA  . PHE B 1 435 ? -15.403 24.647  -4.884  1.00 55.34  ? 435 PHE B CA  1 
ATOM   6976 C C   . PHE B 1 435 ? -16.884 24.344  -4.669  1.00 52.90  ? 435 PHE B C   1 
ATOM   6977 O O   . PHE B 1 435 ? -17.747 25.060  -5.177  1.00 55.10  ? 435 PHE B O   1 
ATOM   6978 C CB  . PHE B 1 435 ? -14.785 23.666  -5.876  1.00 55.11  ? 435 PHE B CB  1 
ATOM   6979 C CG  . PHE B 1 435 ? -15.516 23.584  -7.180  1.00 61.45  ? 435 PHE B CG  1 
ATOM   6980 C CD1 . PHE B 1 435 ? -15.823 24.738  -7.891  1.00 55.45  ? 435 PHE B CD1 1 
ATOM   6981 C CD2 . PHE B 1 435 ? -15.893 22.348  -7.699  1.00 59.99  ? 435 PHE B CD2 1 
ATOM   6982 C CE1 . PHE B 1 435 ? -16.499 24.670  -9.091  1.00 60.63  ? 435 PHE B CE1 1 
ATOM   6983 C CE2 . PHE B 1 435 ? -16.571 22.270  -8.904  1.00 66.02  ? 435 PHE B CE2 1 
ATOM   6984 C CZ  . PHE B 1 435 ? -16.874 23.435  -9.604  1.00 65.10  ? 435 PHE B CZ  1 
ATOM   6985 N N   . ARG B 1 436 ? -17.177 23.297  -3.905  1.00 47.35  ? 436 ARG B N   1 
ATOM   6986 C CA  . ARG B 1 436 ? -18.562 22.944  -3.621  1.00 52.08  ? 436 ARG B CA  1 
ATOM   6987 C C   . ARG B 1 436 ? -19.284 24.102  -2.959  1.00 55.10  ? 436 ARG B C   1 
ATOM   6988 O O   . ARG B 1 436 ? -20.323 24.559  -3.444  1.00 54.68  ? 436 ARG B O   1 
ATOM   6989 C CB  . ARG B 1 436 ? -18.641 21.704  -2.727  1.00 53.04  ? 436 ARG B CB  1 
ATOM   6990 C CG  . ARG B 1 436 ? -18.113 20.420  -3.352  1.00 53.59  ? 436 ARG B CG  1 
ATOM   6991 C CD  . ARG B 1 436 ? -18.024 19.342  -2.294  1.00 54.86  ? 436 ARG B CD  1 
ATOM   6992 N NE  . ARG B 1 436 ? -17.303 18.158  -2.751  1.00 53.40  ? 436 ARG B NE  1 
ATOM   6993 C CZ  . ARG B 1 436 ? -16.884 17.179  -1.956  1.00 50.76  ? 436 ARG B CZ  1 
ATOM   6994 N NH1 . ARG B 1 436 ? -17.106 17.235  -0.647  1.00 56.68  ? 436 ARG B NH1 1 
ATOM   6995 N NH2 . ARG B 1 436 ? -16.242 16.141  -2.469  1.00 56.00  ? 436 ARG B NH2 1 
ATOM   6996 N N   . ILE B 1 437 ? -18.715 24.579  -1.852  1.00 58.00  ? 437 ILE B N   1 
ATOM   6997 C CA  . ILE B 1 437 ? -19.267 25.718  -1.122  1.00 58.32  ? 437 ILE B CA  1 
ATOM   6998 C C   . ILE B 1 437 ? -19.564 26.878  -2.058  1.00 61.34  ? 437 ILE B C   1 
ATOM   6999 O O   . ILE B 1 437 ? -20.639 27.483  -1.988  1.00 62.34  ? 437 ILE B O   1 
ATOM   7000 C CB  . ILE B 1 437 ? -18.313 26.189  -0.025  1.00 55.75  ? 437 ILE B CB  1 
ATOM   7001 C CG1 . ILE B 1 437 ? -18.195 25.114  1.052   1.00 51.28  ? 437 ILE B CG1 1 
ATOM   7002 C CG2 . ILE B 1 437 ? -18.785 27.503  0.567   1.00 57.56  ? 437 ILE B CG2 1 
ATOM   7003 C CD1 . ILE B 1 437 ? -17.338 25.518  2.200   1.00 51.22  ? 437 ILE B CD1 1 
ATOM   7004 N N   . GLN B 1 438 ? -18.613 27.158  -2.950  1.00 56.69  ? 438 GLN B N   1 
ATOM   7005 C CA  . GLN B 1 438 ? -18.766 28.213  -3.947  1.00 62.01  ? 438 GLN B CA  1 
ATOM   7006 C C   . GLN B 1 438 ? -19.910 27.930  -4.942  1.00 64.14  ? 438 GLN B C   1 
ATOM   7007 O O   . GLN B 1 438 ? -20.663 28.849  -5.288  1.00 64.47  ? 438 GLN B O   1 
ATOM   7008 C CB  . GLN B 1 438 ? -17.441 28.434  -4.694  1.00 60.88  ? 438 GLN B CB  1 
ATOM   7009 C CG  . GLN B 1 438 ? -16.846 29.830  -4.473  1.00 61.19  ? 438 GLN B CG  1 
ATOM   7010 C CD  . GLN B 1 438 ? -15.608 30.110  -5.311  1.00 60.13  ? 438 GLN B CD  1 
ATOM   7011 O OE1 . GLN B 1 438 ? -14.870 29.200  -5.682  1.00 60.64  ? 438 GLN B OE1 1 
ATOM   7012 N NE2 . GLN B 1 438 ? -15.383 31.381  -5.620  1.00 64.81  ? 438 GLN B NE2 1 
ATOM   7013 N N   . LYS B 1 439 ? -20.034 26.675  -5.391  1.00 62.65  ? 439 LYS B N   1 
ATOM   7014 C CA  . LYS B 1 439 ? -21.146 26.246  -6.256  1.00 63.08  ? 439 LYS B CA  1 
ATOM   7015 C C   . LYS B 1 439 ? -22.493 26.487  -5.593  1.00 63.14  ? 439 LYS B C   1 
ATOM   7016 O O   . LYS B 1 439 ? -23.481 26.770  -6.263  1.00 63.06  ? 439 LYS B O   1 
ATOM   7017 C CB  . LYS B 1 439 ? -21.046 24.748  -6.604  1.00 63.14  ? 439 LYS B CB  1 
ATOM   7018 C CG  . LYS B 1 439 ? -20.230 24.389  -7.844  1.00 64.55  ? 439 LYS B CG  1 
ATOM   7019 C CD  . LYS B 1 439 ? -20.489 22.935  -8.305  1.00 60.36  ? 439 LYS B CD  1 
ATOM   7020 C CE  . LYS B 1 439 ? -20.213 21.915  -7.199  1.00 60.22  ? 439 LYS B CE  1 
ATOM   7021 N NZ  . LYS B 1 439 ? -20.055 20.508  -7.695  1.00 57.92  ? 439 LYS B NZ  1 
ATOM   7022 N N   . ALA B 1 440 ? -22.502 26.371  -4.266  1.00 66.12  ? 440 ALA B N   1 
ATOM   7023 C CA  . ALA B 1 440 ? -23.721 26.264  -3.465  1.00 62.78  ? 440 ALA B CA  1 
ATOM   7024 C C   . ALA B 1 440 ? -24.552 27.544  -3.355  1.00 63.32  ? 440 ALA B C   1 
ATOM   7025 O O   . ALA B 1 440 ? -25.777 27.493  -3.232  1.00 60.33  ? 440 ALA B O   1 
ATOM   7026 C CB  . ALA B 1 440 ? -23.356 25.770  -2.070  1.00 57.28  ? 440 ALA B CB  1 
ATOM   7027 N N   . GLY B 1 441 ? -23.887 28.691  -3.383  1.00 67.77  ? 441 GLY B N   1 
ATOM   7028 C CA  . GLY B 1 441 ? -24.571 29.956  -3.185  1.00 70.69  ? 441 GLY B CA  1 
ATOM   7029 C C   . GLY B 1 441 ? -24.286 30.947  -4.296  1.00 72.33  ? 441 GLY B C   1 
ATOM   7030 O O   . GLY B 1 441 ? -24.733 32.098  -4.268  1.00 67.95  ? 441 GLY B O   1 
ATOM   7031 N N   . PHE B 1 442 ? -23.539 30.496  -5.292  1.00 74.24  ? 442 PHE B N   1 
ATOM   7032 C CA  . PHE B 1 442 ? -23.207 31.359  -6.412  1.00 81.23  ? 442 PHE B CA  1 
ATOM   7033 C C   . PHE B 1 442 ? -23.363 30.636  -7.753  1.00 86.53  ? 442 PHE B C   1 
ATOM   7034 O O   . PHE B 1 442 ? -23.089 29.435  -7.871  1.00 84.66  ? 442 PHE B O   1 
ATOM   7035 C CB  . PHE B 1 442 ? -21.776 31.893  -6.263  1.00 81.89  ? 442 PHE B CB  1 
ATOM   7036 C CG  . PHE B 1 442 ? -21.567 32.762  -5.048  1.00 78.42  ? 442 PHE B CG  1 
ATOM   7037 C CD1 . PHE B 1 442 ? -22.100 34.044  -4.993  1.00 70.82  ? 442 PHE B CD1 1 
ATOM   7038 C CD2 . PHE B 1 442 ? -20.819 32.305  -3.972  1.00 78.85  ? 442 PHE B CD2 1 
ATOM   7039 C CE1 . PHE B 1 442 ? -21.903 34.850  -3.885  1.00 71.68  ? 442 PHE B CE1 1 
ATOM   7040 C CE2 . PHE B 1 442 ? -20.617 33.107  -2.860  1.00 76.89  ? 442 PHE B CE2 1 
ATOM   7041 C CZ  . PHE B 1 442 ? -21.162 34.384  -2.817  1.00 70.78  ? 442 PHE B CZ  1 
ATOM   7042 N N   . ASP B 1 443 ? -23.830 31.371  -8.757  1.00 90.31  ? 443 ASP B N   1 
ATOM   7043 C CA  . ASP B 1 443 ? -23.763 30.898  -10.133 1.00 90.25  ? 443 ASP B CA  1 
ATOM   7044 C C   . ASP B 1 443 ? -22.427 31.342  -10.713 1.00 93.91  ? 443 ASP B C   1 
ATOM   7045 O O   . ASP B 1 443 ? -22.299 32.448  -11.262 1.00 92.44  ? 443 ASP B O   1 
ATOM   7046 C CB  . ASP B 1 443 ? -24.917 31.436  -10.974 1.00 92.42  ? 443 ASP B CB  1 
ATOM   7047 C CG  . ASP B 1 443 ? -24.699 31.217  -12.455 1.00 96.90  ? 443 ASP B CG  1 
ATOM   7048 O OD1 . ASP B 1 443 ? -24.479 30.054  -12.856 1.00 98.18  ? 443 ASP B OD1 1 
ATOM   7049 O OD2 . ASP B 1 443 ? -24.707 32.212  -13.211 1.00 98.73  ? 443 ASP B OD2 1 
ATOM   7050 N N   . LEU B 1 444 ? -21.431 30.477  -10.561 1.00 91.28  ? 444 LEU B N   1 
ATOM   7051 C CA  . LEU B 1 444 ? -20.071 30.765  -10.987 1.00 88.89  ? 444 LEU B CA  1 
ATOM   7052 C C   . LEU B 1 444 ? -20.015 31.195  -12.462 1.00 93.22  ? 444 LEU B C   1 
ATOM   7053 O O   . LEU B 1 444 ? -19.589 32.310  -12.793 1.00 89.94  ? 444 LEU B O   1 
ATOM   7054 C CB  . LEU B 1 444 ? -19.198 29.530  -10.741 1.00 84.78  ? 444 LEU B CB  1 
ATOM   7055 C CG  . LEU B 1 444 ? -19.259 28.965  -9.316  1.00 78.07  ? 444 LEU B CG  1 
ATOM   7056 C CD1 . LEU B 1 444 ? -18.493 27.647  -9.188  1.00 67.80  ? 444 LEU B CD1 1 
ATOM   7057 C CD2 . LEU B 1 444 ? -18.728 29.992  -8.328  1.00 76.82  ? 444 LEU B CD2 1 
ATOM   7058 N N   . ASP B 1 445 ? -20.479 30.307  -13.334 1.00 95.79  ? 445 ASP B N   1 
ATOM   7059 C CA  . ASP B 1 445 ? -20.512 30.553  -14.772 1.00 96.83  ? 445 ASP B CA  1 
ATOM   7060 C C   . ASP B 1 445 ? -21.192 31.882  -15.122 1.00 93.04  ? 445 ASP B C   1 
ATOM   7061 O O   . ASP B 1 445 ? -22.028 32.389  -14.365 1.00 92.67  ? 445 ASP B O   1 
ATOM   7062 C CB  . ASP B 1 445 ? -21.224 29.392  -15.478 1.00 95.46  ? 445 ASP B CB  1 
ATOM   7063 C CG  . ASP B 1 445 ? -20.598 28.037  -15.157 1.00 93.20  ? 445 ASP B CG  1 
ATOM   7064 O OD1 . ASP B 1 445 ? -20.927 27.454  -14.101 1.00 90.33  ? 445 ASP B OD1 1 
ATOM   7065 O OD2 . ASP B 1 445 ? -19.785 27.541  -15.965 1.00 89.94  ? 445 ASP B OD2 1 
ATOM   7066 N N   . MET B 1 447 ? -19.411 35.016  -13.207 1.00 80.72  ? 447 MET B N   1 
ATOM   7067 C CA  . MET B 1 447 ? -18.312 35.540  -12.398 1.00 90.36  ? 447 MET B CA  1 
ATOM   7068 C C   . MET B 1 447 ? -17.037 35.826  -13.199 1.00 94.78  ? 447 MET B C   1 
ATOM   7069 O O   . MET B 1 447 ? -16.600 35.000  -14.001 1.00 93.24  ? 447 MET B O   1 
ATOM   7070 C CB  . MET B 1 447 ? -17.967 34.569  -11.265 1.00 93.37  ? 447 MET B CB  1 
ATOM   7071 C CG  . MET B 1 447 ? -18.892 34.617  -10.056 1.00 94.19  ? 447 MET B CG  1 
ATOM   7072 S SD  . MET B 1 447 ? -18.406 33.437  -8.768  1.00 98.74  ? 447 MET B SD  1 
ATOM   7073 C CE  . MET B 1 447 ? -16.998 34.236  -8.013  1.00 83.41  ? 447 MET B CE  1 
ATOM   7074 N N   . ASP B 1 448 ? -16.433 36.987  -12.947 1.00 98.18  ? 448 ASP B N   1 
ATOM   7075 C CA  . ASP B 1 448 ? -15.149 37.362  -13.550 1.00 97.87  ? 448 ASP B CA  1 
ATOM   7076 C C   . ASP B 1 448 ? -14.019 36.397  -13.177 1.00 96.88  ? 448 ASP B C   1 
ATOM   7077 O O   . ASP B 1 448 ? -13.046 36.263  -13.923 1.00 92.92  ? 448 ASP B O   1 
ATOM   7078 C CB  . ASP B 1 448 ? -14.742 38.785  -13.131 1.00 99.92  ? 448 ASP B CB  1 
ATOM   7079 C CG  . ASP B 1 448 ? -15.417 39.870  -13.958 1.00 98.15  ? 448 ASP B CG  1 
ATOM   7080 O OD1 . ASP B 1 448 ? -15.983 39.554  -15.028 1.00 95.98  ? 448 ASP B OD1 1 
ATOM   7081 O OD2 . ASP B 1 448 ? -15.365 41.049  -13.536 1.00 94.89  ? 448 ASP B OD2 1 
ATOM   7082 N N   . ILE B 1 449 ? -14.141 35.749  -12.017 1.00 98.87  ? 449 ILE B N   1 
ATOM   7083 C CA  . ILE B 1 449 ? -13.122 34.808  -11.539 1.00 94.90  ? 449 ILE B CA  1 
ATOM   7084 C C   . ILE B 1 449 ? -13.637 33.908  -10.398 1.00 90.04  ? 449 ILE B C   1 
ATOM   7085 O O   . ILE B 1 449 ? -14.370 34.354  -9.514  1.00 90.69  ? 449 ILE B O   1 
ATOM   7086 C CB  . ILE B 1 449 ? -11.843 35.561  -11.073 1.00 90.84  ? 449 ILE B CB  1 
ATOM   7087 C CG1 . ILE B 1 449 ? -10.689 34.588  -10.814 1.00 85.64  ? 449 ILE B CG1 1 
ATOM   7088 C CG2 . ILE B 1 449 ? -12.127 36.437  -9.858  1.00 88.78  ? 449 ILE B CG2 1 
ATOM   7089 C CD1 . ILE B 1 449 ? -9.399  35.286  -10.461 1.00 88.27  ? 449 ILE B CD1 1 
ATOM   7090 N N   . VAL B 1 450 ? -13.255 32.633  -10.439 1.00 77.55  ? 450 VAL B N   1 
ATOM   7091 C CA  . VAL B 1 450 ? -13.671 31.657  -9.438  1.00 72.82  ? 450 VAL B CA  1 
ATOM   7092 C C   . VAL B 1 450 ? -12.468 31.257  -8.592  1.00 71.48  ? 450 VAL B C   1 
ATOM   7093 O O   . VAL B 1 450 ? -11.556 30.569  -9.073  1.00 68.65  ? 450 VAL B O   1 
ATOM   7094 C CB  . VAL B 1 450 ? -14.310 30.409  -10.094 1.00 72.92  ? 450 VAL B CB  1 
ATOM   7095 C CG1 . VAL B 1 450 ? -14.376 29.240  -9.121  1.00 72.32  ? 450 VAL B CG1 1 
ATOM   7096 C CG2 . VAL B 1 450 ? -15.690 30.748  -10.608 1.00 80.37  ? 450 VAL B CG2 1 
ATOM   7097 N N   . ALA B 1 451 ? -12.480 31.695  -7.333  1.00 60.80  ? 451 ALA B N   1 
ATOM   7098 C CA  . ALA B 1 451 ? -11.302 31.623  -6.473  1.00 60.41  ? 451 ALA B CA  1 
ATOM   7099 C C   . ALA B 1 451 ? -10.726 30.214  -6.381  1.00 56.66  ? 451 ALA B C   1 
ATOM   7100 O O   . ALA B 1 451 ? -9.508  30.044  -6.345  1.00 52.69  ? 451 ALA B O   1 
ATOM   7101 C CB  . ALA B 1 451 ? -11.633 32.155  -5.068  1.00 55.58  ? 451 ALA B CB  1 
ATOM   7102 N N   . SER B 1 452 ? -11.592 29.204  -6.360  1.00 59.36  ? 452 SER B N   1 
ATOM   7103 C CA  . SER B 1 452 ? -11.126 27.836  -6.169  1.00 56.58  ? 452 SER B CA  1 
ATOM   7104 C C   . SER B 1 452 ? -10.477 27.276  -7.436  1.00 52.14  ? 452 SER B C   1 
ATOM   7105 O O   . SER B 1 452 ? -9.545  26.476  -7.357  1.00 50.06  ? 452 SER B O   1 
ATOM   7106 C CB  . SER B 1 452 ? -12.273 26.931  -5.706  1.00 50.87  ? 452 SER B CB  1 
ATOM   7107 O OG  . SER B 1 452 ? -13.421 27.114  -6.506  1.00 55.91  ? 452 SER B OG  1 
ATOM   7108 N N   . GLU B 1 453 ? -10.953 27.697  -8.604  1.00 58.90  ? 453 GLU B N   1 
ATOM   7109 C CA  . GLU B 1 453 ? -10.366 27.207  -9.853  1.00 62.20  ? 453 GLU B CA  1 
ATOM   7110 C C   . GLU B 1 453 ? -8.987  27.819  -10.066 1.00 56.44  ? 453 GLU B C   1 
ATOM   7111 O O   . GLU B 1 453 ? -8.050  27.138  -10.472 1.00 53.77  ? 453 GLU B O   1 
ATOM   7112 C CB  . GLU B 1 453 ? -11.288 27.503  -11.027 1.00 59.83  ? 453 GLU B CB  1 
ATOM   7113 C CG  . GLU B 1 453 ? -12.433 26.531  -11.110 1.00 64.32  ? 453 GLU B CG  1 
ATOM   7114 C CD  . GLU B 1 453 ? -13.539 26.998  -12.031 1.00 77.82  ? 453 GLU B CD  1 
ATOM   7115 O OE1 . GLU B 1 453 ? -13.401 28.078  -12.650 1.00 75.39  ? 453 GLU B OE1 1 
ATOM   7116 O OE2 . GLU B 1 453 ? -14.554 26.278  -12.129 1.00 78.15  ? 453 GLU B OE2 1 
ATOM   7117 N N   . HIS B 1 454 ? -8.884  29.108  -9.750  1.00 60.71  ? 454 HIS B N   1 
ATOM   7118 C CA  . HIS B 1 454 ? -7.616  29.841  -9.688  1.00 59.20  ? 454 HIS B CA  1 
ATOM   7119 C C   . HIS B 1 454 ? -6.566  29.167  -8.796  1.00 50.27  ? 454 HIS B C   1 
ATOM   7120 O O   . HIS B 1 454 ? -5.381  29.171  -9.109  1.00 57.89  ? 454 HIS B O   1 
ATOM   7121 C CB  . HIS B 1 454 ? -7.891  31.270  -9.193  1.00 65.70  ? 454 HIS B CB  1 
ATOM   7122 C CG  . HIS B 1 454 ? -6.838  32.272  -9.565  1.00 67.23  ? 454 HIS B CG  1 
ATOM   7123 N ND1 . HIS B 1 454 ? -5.659  32.416  -8.863  1.00 66.29  ? 454 HIS B ND1 1 
ATOM   7124 C CD2 . HIS B 1 454 ? -6.804  33.203  -10.548 1.00 71.16  ? 454 HIS B CD2 1 
ATOM   7125 C CE1 . HIS B 1 454 ? -4.941  33.384  -9.403  1.00 64.66  ? 454 HIS B CE1 1 
ATOM   7126 N NE2 . HIS B 1 454 ? -5.614  33.877  -10.428 1.00 71.85  ? 454 HIS B NE2 1 
ATOM   7127 N N   . LEU B 1 455 ? -6.999  28.593  -7.684  1.00 47.49  ? 455 LEU B N   1 
ATOM   7128 C CA  . LEU B 1 455 ? -6.085  27.906  -6.777  1.00 51.32  ? 455 LEU B CA  1 
ATOM   7129 C C   . LEU B 1 455 ? -5.639  26.542  -7.334  1.00 54.50  ? 455 LEU B C   1 
ATOM   7130 O O   . LEU B 1 455 ? -4.477  26.132  -7.174  1.00 50.38  ? 455 LEU B O   1 
ATOM   7131 C CB  . LEU B 1 455 ? -6.738  27.740  -5.397  1.00 45.44  ? 455 LEU B CB  1 
ATOM   7132 C CG  . LEU B 1 455 ? -6.453  28.825  -4.358  1.00 47.55  ? 455 LEU B CG  1 
ATOM   7133 C CD1 . LEU B 1 455 ? -7.423  28.751  -3.202  1.00 42.31  ? 455 LEU B CD1 1 
ATOM   7134 C CD2 . LEU B 1 455 ? -5.020  28.711  -3.845  1.00 49.04  ? 455 LEU B CD2 1 
ATOM   7135 N N   . LEU B 1 456 ? -6.577  25.844  -7.972  1.00 56.81  ? 456 LEU B N   1 
ATOM   7136 C CA  . LEU B 1 456 ? -6.311  24.547  -8.592  1.00 55.71  ? 456 LEU B CA  1 
ATOM   7137 C C   . LEU B 1 456 ? -5.288  24.750  -9.709  1.00 54.57  ? 456 LEU B C   1 
ATOM   7138 O O   . LEU B 1 456 ? -4.246  24.081  -9.759  1.00 51.58  ? 456 LEU B O   1 
ATOM   7139 C CB  . LEU B 1 456 ? -7.613  23.933  -9.135  1.00 54.06  ? 456 LEU B CB  1 
ATOM   7140 C CG  . LEU B 1 456 ? -7.519  22.621  -9.922  1.00 51.00  ? 456 LEU B CG  1 
ATOM   7141 C CD1 . LEU B 1 456 ? -6.913  21.526  -9.061  1.00 53.14  ? 456 LEU B CD1 1 
ATOM   7142 C CD2 . LEU B 1 456 ? -8.879  22.190  -10.478 1.00 51.15  ? 456 LEU B CD2 1 
ATOM   7143 N N   . HIS B 1 457 ? -5.626  25.678  -10.600 1.00 48.48  ? 457 HIS B N   1 
ATOM   7144 C CA  . HIS B 1 457 ? -4.716  26.243  -11.588 1.00 52.90  ? 457 HIS B CA  1 
ATOM   7145 C C   . HIS B 1 457 ? -3.279  26.267  -11.073 1.00 55.53  ? 457 HIS B C   1 
ATOM   7146 O O   . HIS B 1 457 ? -2.429  25.514  -11.556 1.00 56.44  ? 457 HIS B O   1 
ATOM   7147 C CB  . HIS B 1 457 ? -5.187  27.655  -11.936 1.00 52.32  ? 457 HIS B CB  1 
ATOM   7148 C CG  . HIS B 1 457 ? -4.384  28.337  -12.998 1.00 63.13  ? 457 HIS B CG  1 
ATOM   7149 N ND1 . HIS B 1 457 ? -3.131  27.904  -13.388 1.00 66.39  ? 457 HIS B ND1 1 
ATOM   7150 C CD2 . HIS B 1 457 ? -4.653  29.427  -13.754 1.00 68.13  ? 457 HIS B CD2 1 
ATOM   7151 C CE1 . HIS B 1 457 ? -2.670  28.694  -14.340 1.00 64.43  ? 457 HIS B CE1 1 
ATOM   7152 N NE2 . HIS B 1 457 ? -3.574  29.628  -14.582 1.00 67.92  ? 457 HIS B NE2 1 
ATOM   7153 N N   . GLN B 1 458 ? -3.027  27.104  -10.065 1.00 55.27  ? 458 GLN B N   1 
ATOM   7154 C CA  . GLN B 1 458 ? -1.688  27.268  -9.509  1.00 53.50  ? 458 GLN B CA  1 
ATOM   7155 C C   . GLN B 1 458 ? -1.045  25.949  -9.075  1.00 51.48  ? 458 GLN B C   1 
ATOM   7156 O O   . GLN B 1 458 ? 0.179   25.796  -9.160  1.00 51.29  ? 458 GLN B O   1 
ATOM   7157 C CB  . GLN B 1 458 ? -1.740  28.246  -8.341  1.00 54.54  ? 458 GLN B CB  1 
ATOM   7158 C CG  . GLN B 1 458 ? -2.225  29.622  -8.771  1.00 60.98  ? 458 GLN B CG  1 
ATOM   7159 C CD  . GLN B 1 458 ? -2.117  30.668  -7.677  1.00 63.91  ? 458 GLN B CD  1 
ATOM   7160 O OE1 . GLN B 1 458 ? -1.375  30.499  -6.712  1.00 59.88  ? 458 GLN B OE1 1 
ATOM   7161 N NE2 . GLN B 1 458 ? -2.861  31.765  -7.829  1.00 58.07  ? 458 GLN B NE2 1 
ATOM   7162 N N   . SER B 1 459 ? -1.862  24.992  -8.633  1.00 53.75  ? 459 SER B N   1 
ATOM   7163 C CA  . SER B 1 459 ? -1.329  23.711  -8.168  1.00 50.14  ? 459 SER B CA  1 
ATOM   7164 C C   . SER B 1 459 ? -0.902  22.821  -9.344  1.00 53.36  ? 459 SER B C   1 
ATOM   7165 O O   . SER B 1 459 ? 0.033   22.031  -9.208  1.00 46.96  ? 459 SER B O   1 
ATOM   7166 C CB  . SER B 1 459 ? -2.351  22.982  -7.287  1.00 45.91  ? 459 SER B CB  1 
ATOM   7167 O OG  . SER B 1 459 ? -1.796  21.786  -6.760  1.00 48.62  ? 459 SER B OG  1 
ATOM   7168 N N   . LEU B 1 460 ? -1.586  22.959  -10.487 1.00 48.43  ? 460 LEU B N   1 
ATOM   7169 C CA  . LEU B 1 460 ? -1.270  22.192  -11.693 1.00 48.10  ? 460 LEU B CA  1 
ATOM   7170 C C   . LEU B 1 460 ? 0.026   22.697  -12.347 1.00 58.67  ? 460 LEU B C   1 
ATOM   7171 O O   . LEU B 1 460 ? 0.850   21.906  -12.844 1.00 50.99  ? 460 LEU B O   1 
ATOM   7172 C CB  . LEU B 1 460 ? -2.420  22.277  -12.708 1.00 54.89  ? 460 LEU B CB  1 
ATOM   7173 C CG  . LEU B 1 460 ? -3.868  22.049  -12.266 1.00 54.97  ? 460 LEU B CG  1 
ATOM   7174 C CD1 . LEU B 1 460 ? -4.868  22.614  -13.278 1.00 43.73  ? 460 LEU B CD1 1 
ATOM   7175 C CD2 . LEU B 1 460 ? -4.109  20.584  -12.038 1.00 50.96  ? 460 LEU B CD2 1 
ATOM   7176 N N   . VAL B 1 461 ? 0.183   24.024  -12.355 1.00 51.66  ? 461 VAL B N   1 
ATOM   7177 C CA  . VAL B 1 461 ? 1.407   24.669  -12.818 1.00 51.08  ? 461 VAL B CA  1 
ATOM   7178 C C   . VAL B 1 461 ? 2.615   24.156  -12.037 1.00 50.63  ? 461 VAL B C   1 
ATOM   7179 O O   . VAL B 1 461 ? 3.744   24.119  -12.547 1.00 51.61  ? 461 VAL B O   1 
ATOM   7180 C CB  . VAL B 1 461 ? 1.329   26.198  -12.664 1.00 56.03  ? 461 VAL B CB  1 
ATOM   7181 C CG1 . VAL B 1 461 ? 2.498   26.858  -13.361 1.00 61.67  ? 461 VAL B CG1 1 
ATOM   7182 C CG2 . VAL B 1 461 ? 0.012   26.731  -13.213 1.00 55.43  ? 461 VAL B CG2 1 
ATOM   7183 N N   . GLY B 1 462 ? 2.360   23.760  -10.792 1.00 46.88  ? 462 GLY B N   1 
ATOM   7184 C CA  . GLY B 1 462 ? 3.388   23.213  -9.928  1.00 47.58  ? 462 GLY B CA  1 
ATOM   7185 C C   . GLY B 1 462 ? 3.799   24.134  -8.793  1.00 43.05  ? 462 GLY B C   1 
ATOM   7186 O O   . GLY B 1 462 ? 4.931   24.057  -8.332  1.00 48.13  ? 462 GLY B O   1 
ATOM   7187 N N   . LYS B 1 463 ? 2.896   25.011  -8.357  1.00 43.34  ? 463 LYS B N   1 
ATOM   7188 C CA  . LYS B 1 463 ? 3.104   25.779  -7.121  1.00 49.32  ? 463 LYS B CA  1 
ATOM   7189 C C   . LYS B 1 463 ? 2.801   24.911  -5.895  1.00 43.85  ? 463 LYS B C   1 
ATOM   7190 O O   . LYS B 1 463 ? 1.643   24.612  -5.618  1.00 41.16  ? 463 LYS B O   1 
ATOM   7191 C CB  . LYS B 1 463 ? 2.223   27.033  -7.090  1.00 48.05  ? 463 LYS B CB  1 
ATOM   7192 C CG  . LYS B 1 463 ? 2.681   28.196  -7.960  1.00 46.53  ? 463 LYS B CG  1 
ATOM   7193 C CD  . LYS B 1 463 ? 1.616   29.286  -7.998  1.00 45.27  ? 463 LYS B CD  1 
ATOM   7194 C CE  . LYS B 1 463 ? 2.224   30.668  -7.857  1.00 54.71  ? 463 LYS B CE  1 
ATOM   7195 N NZ  . LYS B 1 463 ? 1.175   31.738  -7.793  1.00 62.93  ? 463 LYS B NZ  1 
ATOM   7196 N N   . ARG B 1 464 ? 3.848   24.496  -5.192  1.00 43.87  ? 464 ARG B N   1 
ATOM   7197 C CA  . ARG B 1 464 ? 3.718   23.751  -3.943  1.00 48.61  ? 464 ARG B CA  1 
ATOM   7198 C C   . ARG B 1 464 ? 3.746   24.705  -2.735  1.00 54.31  ? 464 ARG B C   1 
ATOM   7199 O O   . ARG B 1 464 ? 3.623   24.262  -1.588  1.00 48.36  ? 464 ARG B O   1 
ATOM   7200 C CB  . ARG B 1 464 ? 4.841   22.712  -3.790  1.00 41.64  ? 464 ARG B CB  1 
ATOM   7201 C CG  . ARG B 1 464 ? 5.101   21.789  -4.980  1.00 45.38  ? 464 ARG B CG  1 
ATOM   7202 C CD  . ARG B 1 464 ? 4.080   20.654  -5.122  1.00 52.18  ? 464 ARG B CD  1 
ATOM   7203 N NE  . ARG B 1 464 ? 3.026   21.023  -6.066  1.00 51.08  ? 464 ARG B NE  1 
ATOM   7204 C CZ  . ARG B 1 464 ? 2.918   20.537  -7.293  1.00 46.59  ? 464 ARG B CZ  1 
ATOM   7205 N NH1 . ARG B 1 464 ? 3.785   19.636  -7.726  1.00 46.00  ? 464 ARG B NH1 1 
ATOM   7206 N NH2 . ARG B 1 464 ? 1.939   20.950  -8.084  1.00 46.86  ? 464 ARG B NH2 1 
ATOM   7207 N N   . CYS B 1 465 ? 3.929   26.003  -3.011  1.00 52.55  ? 465 CYS B N   1 
ATOM   7208 C CA  . CYS B 1 465 ? 4.015   27.062  -1.998  1.00 40.09  ? 465 CYS B CA  1 
ATOM   7209 C C   . CYS B 1 465 ? 3.847   28.424  -2.668  1.00 47.54  ? 465 CYS B C   1 
ATOM   7210 O O   . CYS B 1 465 ? 4.335   28.633  -3.778  1.00 50.15  ? 465 CYS B O   1 
ATOM   7211 C CB  . CYS B 1 465 ? 5.349   27.006  -1.255  1.00 44.02  ? 465 CYS B CB  1 
ATOM   7212 S SG  . CYS B 1 465 ? 5.511   28.188  0.153   1.00 47.67  ? 465 CYS B SG  1 
ATOM   7213 N N   . HIS B 1 466 ? 3.169   29.362  -2.014  1.00 44.24  ? 466 HIS B N   1 
ATOM   7214 C CA  . HIS B 1 466 ? 2.888   30.647  -2.664  1.00 46.25  ? 466 HIS B CA  1 
ATOM   7215 C C   . HIS B 1 466 ? 4.102   31.620  -2.676  1.00 48.32  ? 466 HIS B C   1 
ATOM   7216 O O   . HIS B 1 466 ? 4.044   32.714  -3.256  1.00 49.83  ? 466 HIS B O   1 
ATOM   7217 C CB  . HIS B 1 466 ? 1.697   31.310  -1.987  1.00 41.91  ? 466 HIS B CB  1 
ATOM   7218 C CG  . HIS B 1 466 ? 2.055   31.944  -0.684  1.00 52.06  ? 466 HIS B CG  1 
ATOM   7219 N ND1 . HIS B 1 466 ? 1.680   33.225  -0.352  1.00 48.16  ? 466 HIS B ND1 1 
ATOM   7220 C CD2 . HIS B 1 466 ? 2.804   31.481  0.345   1.00 45.63  ? 466 HIS B CD2 1 
ATOM   7221 C CE1 . HIS B 1 466 ? 2.170   33.522  0.840   1.00 44.68  ? 466 HIS B CE1 1 
ATOM   7222 N NE2 . HIS B 1 466 ? 2.861   32.486  1.278   1.00 46.37  ? 466 HIS B NE2 1 
ATOM   7223 N N   . PHE B 1 467 ? 5.193   31.214  -2.031  1.00 51.46  ? 467 PHE B N   1 
ATOM   7224 C CA  . PHE B 1 467 ? 6.424   32.000  -2.004  1.00 52.30  ? 467 PHE B CA  1 
ATOM   7225 C C   . PHE B 1 467 ? 7.287   31.589  -3.201  1.00 56.98  ? 467 PHE B C   1 
ATOM   7226 O O   . PHE B 1 467 ? 8.444   32.014  -3.346  1.00 54.55  ? 467 PHE B O   1 
ATOM   7227 C CB  . PHE B 1 467 ? 7.177   31.816  -0.659  1.00 51.81  ? 467 PHE B CB  1 
ATOM   7228 C CG  . PHE B 1 467 ? 6.572   32.603  0.502   1.00 49.88  ? 467 PHE B CG  1 
ATOM   7229 C CD1 . PHE B 1 467 ? 6.369   33.984  0.406   1.00 46.87  ? 467 PHE B CD1 1 
ATOM   7230 C CD2 . PHE B 1 467 ? 6.173   31.954  1.675   1.00 52.82  ? 467 PHE B CD2 1 
ATOM   7231 C CE1 . PHE B 1 467 ? 5.791   34.709  1.458   1.00 45.56  ? 467 PHE B CE1 1 
ATOM   7232 C CE2 . PHE B 1 467 ? 5.587   32.671  2.741   1.00 46.41  ? 467 PHE B CE2 1 
ATOM   7233 C CZ  . PHE B 1 467 ? 5.401   34.047  2.631   1.00 46.75  ? 467 PHE B CZ  1 
ATOM   7234 N N   . GLN B 1 468 ? 6.698   30.756  -4.057  1.00 54.11  ? 468 GLN B N   1 
ATOM   7235 C CA  . GLN B 1 468 ? 7.315   30.341  -5.311  1.00 48.29  ? 468 GLN B CA  1 
ATOM   7236 C C   . GLN B 1 468 ? 6.879   31.267  -6.430  1.00 47.47  ? 468 GLN B C   1 
ATOM   7237 O O   . GLN B 1 468 ? 5.718   31.665  -6.483  1.00 45.87  ? 468 GLN B O   1 
ATOM   7238 C CB  . GLN B 1 468 ? 6.939   28.901  -5.665  1.00 43.13  ? 468 GLN B CB  1 
ATOM   7239 C CG  . GLN B 1 468 ? 7.649   27.816  -4.881  1.00 40.13  ? 468 GLN B CG  1 
ATOM   7240 C CD  . GLN B 1 468 ? 7.176   26.440  -5.301  1.00 44.56  ? 468 GLN B CD  1 
ATOM   7241 O OE1 . GLN B 1 468 ? 6.051   26.290  -5.774  1.00 45.50  ? 468 GLN B OE1 1 
ATOM   7242 N NE2 . GLN B 1 468 ? 8.034   25.429  -5.151  1.00 45.28  ? 468 GLN B NE2 1 
ATOM   7243 N N   . ASN B 1 469 ? 7.821   31.620  -7.309  1.00 52.34  ? 469 ASN B N   1 
ATOM   7244 C CA  . ASN B 1 469 ? 7.512   32.356  -8.535  1.00 47.84  ? 469 ASN B CA  1 
ATOM   7245 C C   . ASN B 1 469 ? 7.410   31.379  -9.694  1.00 49.49  ? 469 ASN B C   1 
ATOM   7246 O O   . ASN B 1 469 ? 8.254   30.497  -9.849  1.00 49.39  ? 469 ASN B O   1 
ATOM   7247 C CB  . ASN B 1 469 ? 8.567   33.419  -8.831  1.00 52.27  ? 469 ASN B CB  1 
ATOM   7248 C CG  . ASN B 1 469 ? 8.267   34.203  -10.107 1.00 64.07  ? 469 ASN B CG  1 
ATOM   7249 O OD1 . ASN B 1 469 ? 8.557   33.748  -11.222 1.00 67.31  ? 469 ASN B OD1 1 
ATOM   7250 N ND2 . ASN B 1 469 ? 7.677   35.386  -9.948  1.00 58.04  ? 469 ASN B ND2 1 
ATOM   7251 N N   . ALA B 1 470 ? 6.367   31.524  -10.500 1.00 53.43  ? 470 ALA B N   1 
ATOM   7252 C CA  . ALA B 1 470 ? 6.085   30.532  -11.527 1.00 59.36  ? 470 ALA B CA  1 
ATOM   7253 C C   . ALA B 1 470 ? 6.082   31.137  -12.919 1.00 60.89  ? 470 ALA B C   1 
ATOM   7254 O O   . ALA B 1 470 ? 5.447   30.609  -13.825 1.00 68.63  ? 470 ALA B O   1 
ATOM   7255 C CB  . ALA B 1 470 ? 4.755   29.854  -11.244 1.00 61.58  ? 470 ALA B CB  1 
ATOM   7256 N N   . TYR B 1 471 ? 6.817   32.231  -13.089 1.00 65.11  ? 471 TYR B N   1 
ATOM   7257 C CA  . TYR B 1 471 ? 6.793   32.985  -14.336 1.00 65.93  ? 471 TYR B CA  1 
ATOM   7258 C C   . TYR B 1 471 ? 7.562   32.289  -15.458 1.00 67.87  ? 471 TYR B C   1 
ATOM   7259 O O   . TYR B 1 471 ? 7.110   32.295  -16.603 1.00 65.00  ? 471 TYR B O   1 
ATOM   7260 C CB  . TYR B 1 471 ? 7.347   34.392  -14.113 1.00 66.41  ? 471 TYR B CB  1 
ATOM   7261 C CG  . TYR B 1 471 ? 7.165   35.280  -15.308 1.00 62.95  ? 471 TYR B CG  1 
ATOM   7262 C CD1 . TYR B 1 471 ? 5.915   35.426  -15.894 1.00 68.99  ? 471 TYR B CD1 1 
ATOM   7263 C CD2 . TYR B 1 471 ? 8.238   35.970  -15.860 1.00 59.73  ? 471 TYR B CD2 1 
ATOM   7264 C CE1 . TYR B 1 471 ? 5.732   36.240  -17.004 1.00 68.74  ? 471 TYR B CE1 1 
ATOM   7265 C CE2 . TYR B 1 471 ? 8.070   36.784  -16.970 1.00 60.62  ? 471 TYR B CE2 1 
ATOM   7266 C CZ  . TYR B 1 471 ? 6.812   36.915  -17.537 1.00 66.49  ? 471 TYR B CZ  1 
ATOM   7267 O OH  . TYR B 1 471 ? 6.620   37.724  -18.631 1.00 60.86  ? 471 TYR B OH  1 
ATOM   7268 N N   . LYS B 1 472 ? 8.709   31.692  -15.113 1.00 69.63  ? 472 LYS B N   1 
ATOM   7269 C CA  . LYS B 1 472 ? 9.553   30.932  -16.049 1.00 61.63  ? 472 LYS B CA  1 
ATOM   7270 C C   . LYS B 1 472 ? 9.061   29.496  -16.262 1.00 70.55  ? 472 LYS B C   1 
ATOM   7271 O O   . LYS B 1 472 ? 9.844   28.624  -16.665 1.00 73.63  ? 472 LYS B O   1 
ATOM   7272 C CB  . LYS B 1 472 ? 11.012  30.858  -15.560 1.00 62.64  ? 472 LYS B CB  1 
ATOM   7273 C CG  . LYS B 1 472 ? 11.698  32.170  -15.228 1.00 67.71  ? 472 LYS B CG  1 
ATOM   7274 C CD  . LYS B 1 472 ? 13.038  31.898  -14.533 1.00 72.37  ? 472 LYS B CD  1 
ATOM   7275 C CE  . LYS B 1 472 ? 13.684  33.187  -14.020 1.00 74.01  ? 472 LYS B CE  1 
ATOM   7276 N NZ  . LYS B 1 472 ? 13.707  34.254  -15.072 1.00 64.36  ? 472 LYS B NZ  1 
ATOM   7277 N N   . VAL B 1 473 ? 7.788   29.239  -15.967 1.00 68.61  ? 473 VAL B N   1 
ATOM   7278 C CA  . VAL B 1 473 ? 7.202   27.922  -16.210 1.00 69.23  ? 473 VAL B CA  1 
ATOM   7279 C C   . VAL B 1 473 ? 6.409   27.951  -17.517 1.00 69.79  ? 473 VAL B C   1 
ATOM   7280 O O   . VAL B 1 473 ? 5.290   28.467  -17.583 1.00 70.40  ? 473 VAL B O   1 
ATOM   7281 C CB  . VAL B 1 473 ? 6.295   27.457  -15.027 1.00 68.60  ? 473 VAL B CB  1 
ATOM   7282 C CG1 . VAL B 1 473 ? 5.368   26.328  -15.445 1.00 61.00  ? 473 VAL B CG1 1 
ATOM   7283 C CG2 . VAL B 1 473 ? 7.142   27.007  -13.858 1.00 62.90  ? 473 VAL B CG2 1 
ATOM   7284 N N   . LYS B 1 474 ? 7.016   27.427  -18.574 1.00 76.53  ? 474 LYS B N   1 
ATOM   7285 C CA  . LYS B 1 474 ? 6.320   27.304  -19.845 1.00 71.60  ? 474 LYS B CA  1 
ATOM   7286 C C   . LYS B 1 474 ? 5.320   26.169  -19.691 1.00 71.76  ? 474 LYS B C   1 
ATOM   7287 O O   . LYS B 1 474 ? 5.581   25.190  -18.986 1.00 70.30  ? 474 LYS B O   1 
ATOM   7288 C CB  . LYS B 1 474 ? 7.292   27.027  -21.000 1.00 68.30  ? 474 LYS B CB  1 
ATOM   7289 C CG  . LYS B 1 474 ? 8.394   28.066  -21.209 1.00 66.24  ? 474 LYS B CG  1 
ATOM   7290 C CD  . LYS B 1 474 ? 9.784   27.410  -21.244 1.00 63.86  ? 474 LYS B CD  1 
ATOM   7291 C CE  . LYS B 1 474 ? 10.020  26.536  -20.003 1.00 76.56  ? 474 LYS B CE  1 
ATOM   7292 N NZ  . LYS B 1 474 ? 11.425  26.045  -19.877 1.00 69.70  ? 474 LYS B NZ  1 
ATOM   7293 N N   . GLY B 1 475 ? 4.167   26.295  -20.327 1.00 71.87  ? 475 GLY B N   1 
ATOM   7294 C CA  . GLY B 1 475 ? 3.224   25.204  -20.289 1.00 68.35  ? 475 GLY B CA  1 
ATOM   7295 C C   . GLY B 1 475 ? 1.790   25.641  -20.416 1.00 75.21  ? 475 GLY B C   1 
ATOM   7296 O O   . GLY B 1 475 ? 1.463   26.814  -20.213 1.00 69.83  ? 475 GLY B O   1 
ATOM   7297 N N   . ASN B 1 476 ? 0.948   24.667  -20.762 1.00 86.86  ? 476 ASN B N   1 
ATOM   7298 C CA  . ASN B 1 476 ? -0.496  24.829  -20.917 1.00 86.89  ? 476 ASN B CA  1 
ATOM   7299 C C   . ASN B 1 476 ? -1.228  24.321  -19.675 1.00 84.59  ? 476 ASN B C   1 
ATOM   7300 O O   . ASN B 1 476 ? -0.937  23.230  -19.174 1.00 86.32  ? 476 ASN B O   1 
ATOM   7301 C CB  . ASN B 1 476 ? -0.970  24.086  -22.178 1.00 93.26  ? 476 ASN B CB  1 
ATOM   7302 C CG  . ASN B 1 476 ? -2.475  24.174  -22.399 1.00 97.49  ? 476 ASN B CG  1 
ATOM   7303 O OD1 . ASN B 1 476 ? -3.146  25.079  -21.896 1.00 99.62  ? 476 ASN B OD1 1 
ATOM   7304 N ND2 . ASN B 1 476 ? -3.012  23.224  -23.165 1.00 99.27  ? 476 ASN B ND2 1 
ATOM   7305 N N   . ALA B 1 477 ? -2.175  25.117  -19.188 1.00 88.83  ? 477 ALA B N   1 
ATOM   7306 C CA  . ALA B 1 477 ? -2.871  24.835  -17.934 1.00 87.16  ? 477 ALA B CA  1 
ATOM   7307 C C   . ALA B 1 477 ? -3.642  23.516  -17.947 1.00 82.97  ? 477 ALA B C   1 
ATOM   7308 O O   . ALA B 1 477 ? -3.617  22.769  -16.977 1.00 70.67  ? 477 ALA B O   1 
ATOM   7309 C CB  . ALA B 1 477 ? -3.812  25.979  -17.602 1.00 86.39  ? 477 ALA B CB  1 
ATOM   7310 N N   . THR B 1 478 ? -4.310  23.230  -19.059 1.00 92.03  ? 478 THR B N   1 
ATOM   7311 C CA  . THR B 1 478 ? -5.226  22.094  -19.146 1.00 87.34  ? 478 THR B CA  1 
ATOM   7312 C C   . THR B 1 478 ? -4.568  20.787  -19.616 1.00 84.75  ? 478 THR B C   1 
ATOM   7313 O O   . THR B 1 478 ? -4.067  20.693  -20.747 1.00 83.14  ? 478 THR B O   1 
ATOM   7314 C CB  . THR B 1 478 ? -6.374  22.421  -20.088 1.00 89.20  ? 478 THR B CB  1 
ATOM   7315 O OG1 . THR B 1 478 ? -5.876  22.494  -21.433 1.00 93.62  ? 478 THR B OG1 1 
ATOM   7316 C CG2 . THR B 1 478 ? -7.003  23.771  -19.699 1.00 85.65  ? 478 THR B CG2 1 
ATOM   7317 N N   . ASN B 1 479 ? -4.579  19.790  -18.727 1.00 84.85  ? 479 ASN B N   1 
ATOM   7318 C CA  . ASN B 1 479 ? -4.083  18.441  -19.008 1.00 77.94  ? 479 ASN B CA  1 
ATOM   7319 C C   . ASN B 1 479 ? -4.900  17.415  -18.227 1.00 68.42  ? 479 ASN B C   1 
ATOM   7320 O O   . ASN B 1 479 ? -6.043  17.694  -17.886 1.00 68.06  ? 479 ASN B O   1 
ATOM   7321 C CB  . ASN B 1 479 ? -2.594  18.333  -18.702 1.00 81.58  ? 479 ASN B CB  1 
ATOM   7322 C CG  . ASN B 1 479 ? -1.735  18.961  -19.800 1.00 90.11  ? 479 ASN B CG  1 
ATOM   7323 O OD1 . ASN B 1 479 ? -2.003  18.781  -20.991 1.00 95.70  ? 479 ASN B OD1 1 
ATOM   7324 N ND2 . ASN B 1 479 ? -0.719  19.723  -19.402 1.00 86.29  ? 479 ASN B ND2 1 
ATOM   7325 N N   . VAL B 1 480 ? -4.352  16.233  -17.947 1.00 72.22  ? 480 VAL B N   1 
ATOM   7326 C CA  . VAL B 1 480 ? -5.243  15.100  -17.631 1.00 79.31  ? 480 VAL B CA  1 
ATOM   7327 C C   . VAL B 1 480 ? -5.201  14.484  -16.200 1.00 75.32  ? 480 VAL B C   1 
ATOM   7328 O O   . VAL B 1 480 ? -4.148  14.362  -15.569 1.00 67.79  ? 480 VAL B O   1 
ATOM   7329 C CB  . VAL B 1 480 ? -5.034  13.937  -18.683 1.00 75.71  ? 480 VAL B CB  1 
ATOM   7330 C CG1 . VAL B 1 480 ? -5.738  14.264  -20.008 1.00 70.75  ? 480 VAL B CG1 1 
ATOM   7331 C CG2 . VAL B 1 480 ? -3.562  13.639  -18.925 1.00 76.93  ? 480 VAL B CG2 1 
ATOM   7332 N N   . GLU B 1 481 ? -6.398  14.094  -15.746 1.00 76.77  ? 481 GLU B N   1 
ATOM   7333 C CA  . GLU B 1 481 ? -6.708  13.481  -14.446 1.00 62.04  ? 481 GLU B CA  1 
ATOM   7334 C C   . GLU B 1 481 ? -6.712  14.503  -13.323 1.00 68.42  ? 481 GLU B C   1 
ATOM   7335 O O   . GLU B 1 481 ? -7.613  14.496  -12.482 1.00 64.33  ? 481 GLU B O   1 
ATOM   7336 C CB  . GLU B 1 481 ? -5.753  12.337  -14.089 1.00 57.56  ? 481 GLU B CB  1 
ATOM   7337 C CG  . GLU B 1 481 ? -5.988  11.855  -12.661 1.00 66.04  ? 481 GLU B CG  1 
ATOM   7338 C CD  . GLU B 1 481 ? -5.363  10.516  -12.351 1.00 68.86  ? 481 GLU B CD  1 
ATOM   7339 O OE1 . GLU B 1 481 ? -4.509  10.052  -13.141 1.00 65.20  ? 481 GLU B OE1 1 
ATOM   7340 O OE2 . GLU B 1 481 ? -5.737  9.931   -11.310 1.00 60.76  ? 481 GLU B OE2 1 
HETATM 7341 O O   . HOH C 2 .   ? 12.835  7.650   36.763  1.00 28.78  ? 501 HOH A O   1 
HETATM 7342 O O   . HOH C 2 .   ? -26.572 4.180   31.297  1.00 49.73  ? 502 HOH A O   1 
HETATM 7343 O O   . HOH C 2 .   ? 18.350  17.903  46.741  1.00 48.41  ? 503 HOH A O   1 
HETATM 7344 O O   . HOH C 2 .   ? -28.347 13.326  92.116  1.00 42.02  ? 504 HOH A O   1 
HETATM 7345 O O   . HOH C 2 .   ? 17.277  7.188   57.337  1.00 36.23  ? 505 HOH A O   1 
HETATM 7346 O O   . HOH C 2 .   ? -21.128 -12.685 53.365  1.00 43.12  ? 506 HOH A O   1 
HETATM 7347 O O   . HOH C 2 .   ? 16.843  8.422   60.846  1.00 41.84  ? 507 HOH A O   1 
HETATM 7348 O O   . HOH C 2 .   ? 13.553  13.371  38.130  1.00 35.24  ? 508 HOH A O   1 
HETATM 7349 O O   . HOH C 2 .   ? 14.450  16.994  60.913  1.00 41.80  ? 509 HOH A O   1 
HETATM 7350 O O   . HOH C 2 .   ? -12.266 27.524  46.887  1.00 42.24  ? 510 HOH A O   1 
HETATM 7351 O O   . HOH C 2 .   ? 16.191  19.566  35.907  1.00 45.00  ? 511 HOH A O   1 
HETATM 7352 O O   . HOH C 2 .   ? -3.085  -19.494 40.893  1.00 45.48  ? 512 HOH A O   1 
HETATM 7353 O O   . HOH C 2 .   ? 12.934  3.094   42.964  1.00 40.25  ? 513 HOH A O   1 
HETATM 7354 O O   . HOH C 2 .   ? -4.347  -5.264  24.861  1.00 50.43  ? 514 HOH A O   1 
HETATM 7355 O O   . HOH C 2 .   ? -34.559 30.377  81.565  1.00 50.50  ? 515 HOH A O   1 
HETATM 7356 O O   . HOH C 2 .   ? -11.238 13.498  54.954  1.00 33.25  ? 516 HOH A O   1 
HETATM 7357 O O   . HOH C 2 .   ? -0.463  3.854   44.351  1.00 20.67  ? 517 HOH A O   1 
HETATM 7358 O O   . HOH C 2 .   ? -4.087  6.032   48.318  1.00 24.59  ? 518 HOH A O   1 
HETATM 7359 O O   . HOH C 2 .   ? 14.265  23.614  48.607  1.00 40.08  ? 519 HOH A O   1 
HETATM 7360 O O   . HOH C 2 .   ? -1.192  1.914   46.121  1.00 26.11  ? 520 HOH A O   1 
HETATM 7361 O O   . HOH C 2 .   ? 21.065  23.624  43.513  1.00 47.06  ? 521 HOH A O   1 
HETATM 7362 O O   . HOH C 2 .   ? 0.172   9.754   27.403  1.00 47.42  ? 522 HOH A O   1 
HETATM 7363 O O   . HOH C 2 .   ? 3.908   12.873  36.695  1.00 20.94  ? 523 HOH A O   1 
HETATM 7364 O O   . HOH C 2 .   ? -1.942  0.114   54.936  1.00 41.20  ? 524 HOH A O   1 
HETATM 7365 O O   . HOH C 2 .   ? 0.339   3.056   41.952  1.00 25.50  ? 525 HOH A O   1 
HETATM 7366 O O   . HOH C 2 .   ? -12.054 17.534  57.798  1.00 39.41  ? 526 HOH A O   1 
HETATM 7367 O O   . HOH C 2 .   ? -5.776  3.521   64.889  1.00 37.25  ? 527 HOH A O   1 
HETATM 7368 O O   . HOH C 2 .   ? -15.400 -9.988  48.463  1.00 47.26  ? 528 HOH A O   1 
HETATM 7369 O O   . HOH C 2 .   ? -37.700 27.734  90.068  1.00 45.86  ? 529 HOH A O   1 
HETATM 7370 O O   . HOH C 2 .   ? -1.858  27.891  62.680  1.00 37.50  ? 530 HOH A O   1 
HETATM 7371 O O   . HOH C 2 .   ? -0.271  1.215   48.236  1.00 25.99  ? 531 HOH A O   1 
HETATM 7372 O O   . HOH C 2 .   ? 1.693   11.880  27.487  1.00 40.46  ? 532 HOH A O   1 
HETATM 7373 O O   . HOH C 2 .   ? -6.824  14.641  29.733  1.00 37.12  ? 533 HOH A O   1 
HETATM 7374 O O   . HOH C 2 .   ? -22.675 8.227   60.723  1.00 51.66  ? 534 HOH A O   1 
HETATM 7375 O O   . HOH C 2 .   ? -43.616 15.197  81.644  1.00 58.20  ? 535 HOH A O   1 
HETATM 7376 O O   . HOH C 2 .   ? 3.749   16.280  43.381  1.00 27.33  ? 536 HOH A O   1 
HETATM 7377 O O   . HOH C 2 .   ? 10.772  23.130  49.405  1.00 35.68  ? 537 HOH A O   1 
HETATM 7378 O O   . HOH C 2 .   ? -12.299 13.011  52.535  1.00 36.37  ? 538 HOH A O   1 
HETATM 7379 O O   . HOH C 2 .   ? -17.177 4.913   70.866  1.00 44.76  ? 539 HOH A O   1 
HETATM 7380 O O   . HOH C 2 .   ? 6.207   33.061  40.823  1.00 36.12  ? 540 HOH A O   1 
HETATM 7381 O O   . HOH C 2 .   ? 2.978   3.045   29.999  1.00 43.65  ? 541 HOH A O   1 
HETATM 7382 O O   . HOH C 2 .   ? -6.678  17.102  69.524  1.00 42.46  ? 542 HOH A O   1 
HETATM 7383 O O   . HOH C 2 .   ? -30.760 2.899   46.121  1.00 52.06  ? 543 HOH A O   1 
HETATM 7384 O O   . HOH C 2 .   ? -14.510 4.847   67.023  1.00 43.96  ? 544 HOH A O   1 
HETATM 7385 O O   . HOH C 2 .   ? -7.618  1.970   56.294  1.00 35.97  ? 545 HOH A O   1 
HETATM 7386 O O   . HOH C 2 .   ? -36.654 24.662  89.292  1.00 54.65  ? 546 HOH A O   1 
HETATM 7387 O O   . HOH C 2 .   ? -14.153 9.309   85.591  1.00 55.98  ? 547 HOH A O   1 
HETATM 7388 O O   . HOH C 2 .   ? -17.469 -3.683  62.542  1.00 44.43  ? 548 HOH A O   1 
HETATM 7389 O O   . HOH C 2 .   ? -0.923  13.915  34.695  1.00 32.37  ? 549 HOH A O   1 
HETATM 7390 O O   . HOH C 2 .   ? -14.825 -4.222  54.118  1.00 42.18  ? 550 HOH A O   1 
HETATM 7391 O O   . HOH C 2 .   ? -21.794 -0.777  65.285  1.00 59.10  ? 551 HOH A O   1 
HETATM 7392 O O   . HOH C 2 .   ? 3.422   12.391  29.264  1.00 33.63  ? 552 HOH A O   1 
HETATM 7393 O O   . HOH C 2 .   ? -3.058  1.110   27.433  1.00 46.31  ? 553 HOH A O   1 
HETATM 7394 O O   . HOH C 2 .   ? -1.202  1.476   29.590  1.00 41.79  ? 554 HOH A O   1 
HETATM 7395 O O   . HOH C 2 .   ? -2.657  9.282   28.131  1.00 49.49  ? 555 HOH A O   1 
HETATM 7396 O O   . HOH C 2 .   ? -1.458  7.620   78.423  1.00 56.54  ? 556 HOH A O   1 
HETATM 7397 O O   . HOH C 2 .   ? -14.056 -5.527  55.861  1.00 46.26  ? 557 HOH A O   1 
HETATM 7398 O O   . HOH C 2 .   ? -8.210  12.369  49.617  1.00 32.47  ? 558 HOH A O   1 
HETATM 7399 O O   . HOH C 2 .   ? -22.444 17.351  81.415  1.00 40.96  ? 559 HOH A O   1 
HETATM 7400 O O   . HOH C 2 .   ? -16.186 -8.931  35.372  1.00 45.81  ? 560 HOH A O   1 
HETATM 7401 O O   . HOH C 2 .   ? 0.292   -1.739  54.655  1.00 33.50  ? 561 HOH A O   1 
HETATM 7402 O O   . HOH C 2 .   ? -2.108  -1.164  29.718  1.00 41.29  ? 562 HOH A O   1 
HETATM 7403 O O   . HOH C 2 .   ? -25.097 22.231  85.189  1.00 51.39  ? 563 HOH A O   1 
HETATM 7404 O O   . HOH D 2 .   ? -2.323  37.198  -43.385 1.00 49.54  ? 501 HOH B O   1 
HETATM 7405 O O   . HOH D 2 .   ? 4.911   15.995  -36.370 1.00 40.39  ? 502 HOH B O   1 
HETATM 7406 O O   . HOH D 2 .   ? -9.598  60.388  10.371  1.00 53.25  ? 503 HOH B O   1 
HETATM 7407 O O   . HOH D 2 .   ? 2.254   13.697  -44.981 1.00 34.21  ? 504 HOH B O   1 
HETATM 7408 O O   . HOH D 2 .   ? 3.725   18.688  -48.935 1.00 42.66  ? 505 HOH B O   1 
HETATM 7409 O O   . HOH D 2 .   ? 16.302  23.623  -62.708 1.00 63.73  ? 506 HOH B O   1 
HETATM 7410 O O   . HOH D 2 .   ? -7.333  25.456  -46.338 1.00 49.85  ? 507 HOH B O   1 
HETATM 7411 O O   . HOH D 2 .   ? 18.712  54.557  -10.296 1.00 53.74  ? 508 HOH B O   1 
HETATM 7412 O O   . HOH D 2 .   ? 4.927   11.582  -45.109 1.00 32.77  ? 509 HOH B O   1 
HETATM 7413 O O   . HOH D 2 .   ? 9.634   21.936  6.818   1.00 38.83  ? 510 HOH B O   1 
HETATM 7414 O O   . HOH D 2 .   ? 21.131  30.400  -39.217 1.00 59.23  ? 511 HOH B O   1 
HETATM 7415 O O   . HOH D 2 .   ? -5.816  23.920  8.488   1.00 44.85  ? 512 HOH B O   1 
HETATM 7416 O O   . HOH D 2 .   ? 9.312   24.273  8.285   1.00 42.78  ? 513 HOH B O   1 
HETATM 7417 O O   . HOH D 2 .   ? 7.409   15.446  -15.126 1.00 71.65  ? 514 HOH B O   1 
HETATM 7418 O O   . HOH D 2 .   ? 0.971   18.748  8.240   1.00 48.54  ? 515 HOH B O   1 
HETATM 7419 O O   . HOH D 2 .   ? 1.589   28.529  0.514   1.00 41.89  ? 516 HOH B O   1 
HETATM 7420 O O   . HOH D 2 .   ? -1.932  25.405  16.179  1.00 39.88  ? 517 HOH B O   1 
HETATM 7421 O O   . HOH D 2 .   ? 11.105  24.471  -29.423 1.00 45.44  ? 518 HOH B O   1 
HETATM 7422 O O   . HOH D 2 .   ? 13.869  23.250  15.649  1.00 60.99  ? 519 HOH B O   1 
HETATM 7423 O O   . HOH D 2 .   ? 23.292  39.061  2.733   1.00 59.79  ? 520 HOH B O   1 
HETATM 7424 O O   . HOH D 2 .   ? 6.055   18.020  -29.587 1.00 43.50  ? 521 HOH B O   1 
HETATM 7425 O O   . HOH D 2 .   ? 9.070   17.852  -31.013 1.00 50.68  ? 522 HOH B O   1 
HETATM 7426 O O   . HOH D 2 .   ? 17.008  35.352  -33.404 1.00 57.24  ? 523 HOH B O   1 
HETATM 7427 O O   . HOH D 2 .   ? 15.238  33.388  -16.786 1.00 57.74  ? 524 HOH B O   1 
HETATM 7428 O O   . HOH D 2 .   ? 16.052  27.777  -8.973  1.00 45.12  ? 525 HOH B O   1 
HETATM 7429 O O   . HOH D 2 .   ? 5.431   34.758  -20.326 1.00 50.26  ? 526 HOH B O   1 
HETATM 7430 O O   . HOH D 2 .   ? 22.139  28.821  -37.521 1.00 58.80  ? 527 HOH B O   1 
HETATM 7431 O O   . HOH D 2 .   ? 17.681  28.047  -11.286 1.00 56.62  ? 528 HOH B O   1 
HETATM 7432 O O   . HOH D 2 .   ? 9.353   46.158  23.229  1.00 62.90  ? 529 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   1   MET MET A . n 
A 1 2   GLU 2   2   2   GLU GLU A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   GLN 4   4   4   GLN GLN A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   ALA 7   7   7   ALA ALA A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   THR 9   9   9   THR THR A . n 
A 1 10  LYS 10  10  10  LYS LYS A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  TYR 13  13  13  TYR TYR A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  TRP 16  16  16  TRP TRP A . n 
A 1 17  PHE 17  17  17  PHE PHE A . n 
A 1 18  LYS 18  18  18  LYS LYS A . n 
A 1 19  PRO 19  19  19  PRO PRO A . n 
A 1 20  TYR 20  20  20  TYR TYR A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  GLU 22  22  22  GLU GLU A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  THR 24  24  24  THR THR A . n 
A 1 25  HIS 25  25  25  HIS HIS A . n 
A 1 26  LEU 26  26  26  LEU LEU A . n 
A 1 27  LYS 27  27  27  LYS LYS A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  THR 31  31  31  THR THR A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  SER 33  33  33  SER SER A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  CYS 37  37  37  CYS CYS A . n 
A 1 38  ASP 38  38  38  ASP ASP A . n 
A 1 39  ALA 39  39  39  ALA ALA A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  PRO 41  41  41  PRO PRO A . n 
A 1 42  ASP 42  42  42  ASP ASP A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  GLU 47  47  47  GLU GLU A . n 
A 1 48  VAL 48  48  48  VAL VAL A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  MET 50  50  50  MET MET A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  ASP 55  55  55  ASP ASP A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  ARG 57  57  57  ARG ARG A . n 
A 1 58  GLU 58  58  58  GLU GLU A . n 
A 1 59  LYS 59  59  59  LYS LYS A . n 
A 1 60  ASP 60  60  60  ASP ASP A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  ILE 62  62  62  ILE ILE A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  ALA 64  64  64  ALA ALA A . n 
A 1 65  CYS 65  65  65  CYS CYS A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  MET 67  67  67  MET MET A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  GLU 69  69  69  GLU GLU A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  THR 71  71  71  THR THR A . n 
A 1 72  LYS 72  72  72  LYS LYS A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  CYS 74  74  74  CYS CYS A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  ILE 77  77  77  ILE ILE A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  CYS 80  80  80  CYS CYS A . n 
A 1 81  GLY 81  81  81  GLY GLY A . n 
A 1 82  TRP 82  82  82  TRP TRP A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  CYS 84  84  84  CYS CYS A . n 
A 1 85  CYS 85  85  85  CYS CYS A . n 
A 1 86  THR 86  86  86  THR THR A . n 
A 1 87  GLY 87  87  87  GLY GLY A . n 
A 1 88  MET 88  88  88  MET MET A . n 
A 1 89  VAL 89  89  89  VAL VAL A . n 
A 1 90  GLU 90  90  90  GLU GLU A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  GLY 92  92  92  GLY GLY A . n 
A 1 93  LEU 93  93  93  LEU LEU A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  TRP 95  95  95  TRP TRP A . n 
A 1 96  PHE 96  96  96  PHE PHE A . n 
A 1 97  ASP 97  97  97  ASP ASP A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  ASN 99  99  99  ASN ASN A . n 
A 1 100 LYS 100 100 100 LYS LYS A . n 
A 1 101 ASP 101 101 101 ASP ASP A . n 
A 1 102 VAL 102 102 102 VAL VAL A . n 
A 1 103 ILE 103 103 103 ILE ILE A . n 
A 1 104 LYS 104 104 104 LYS LYS A . n 
A 1 105 LEU 105 105 105 LEU LEU A . n 
A 1 106 TRP 106 106 106 TRP TRP A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 GLY 108 108 108 GLY GLY A . n 
A 1 109 LYS 109 109 109 LYS LYS A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 SER 111 111 111 SER SER A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 MET 114 114 114 MET MET A . n 
A 1 115 LYS 115 115 115 LYS LYS A . n 
A 1 116 ASN 116 116 116 ASN ASN A . n 
A 1 117 VAL 117 117 117 VAL VAL A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 PRO 120 120 120 PRO PRO A . n 
A 1 121 GLU 121 121 121 GLU GLU A . n 
A 1 122 GLN 122 122 122 GLN GLN A . n 
A 1 123 LEU 123 123 123 LEU LEU A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 TYR 126 126 126 TYR TYR A . n 
A 1 127 GLN 127 127 127 GLN GLN A . n 
A 1 128 ARG 128 128 128 ARG ARG A . n 
A 1 129 ALA 129 129 129 ALA ALA A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 GLN 131 131 131 GLN GLN A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 TRP 133 133 133 TRP TRP A . n 
A 1 134 ARG 134 134 134 ARG ARG A . n 
A 1 135 GLN 135 135 135 GLN GLN A . n 
A 1 136 ASP 136 136 136 ASP ASP A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 LYS 138 138 138 LYS LYS A . n 
A 1 139 PHE 139 139 139 PHE PHE A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 ILE 141 141 141 ILE ILE A . n 
A 1 142 ASN 142 142 142 ASN ASN A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 THR 145 145 145 THR THR A . n 
A 1 146 ARG 146 146 146 ARG ARG A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 THR 149 149 149 THR THR A . n 
A 1 150 HIS 150 150 150 HIS HIS A . n 
A 1 151 SER 151 151 151 SER SER A . n 
A 1 152 VAL 152 152 152 VAL VAL A . n 
A 1 153 GLN 153 153 153 GLN GLN A . n 
A 1 154 ALA 154 154 154 ALA ALA A . n 
A 1 155 ASP 155 155 155 ASP ASP A . n 
A 1 156 TYR 156 156 156 TYR TYR A . n 
A 1 157 LYS 157 157 157 LYS LYS A . n 
A 1 158 VAL 158 158 158 VAL VAL A . n 
A 1 159 PRO 159 159 159 PRO PRO A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 GLU 161 161 161 GLU GLU A . n 
A 1 162 TYR 162 162 162 TYR TYR A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 VAL 164 164 164 VAL VAL A . n 
A 1 165 GLU 165 165 165 GLU GLU A . n 
A 1 166 VAL 166 166 166 VAL VAL A . n 
A 1 167 LYS 167 167 167 LYS LYS A . n 
A 1 168 GLU 168 168 168 GLU GLU A . n 
A 1 169 MET 169 169 169 MET MET A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 SER 171 171 171 SER SER A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 MET 173 173 173 MET MET A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 ARG 175 175 175 ARG ARG A . n 
A 1 176 ARG 176 176 176 ARG ARG A . n 
A 1 177 ARG 177 177 177 ARG ARG A . n 
A 1 178 ASN 178 178 178 ASN ASN A . n 
A 1 179 ILE 179 179 179 ILE ILE A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 LEU 181 181 181 LEU LEU A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 GLY 183 183 ?   ?   ?   A . n 
A 1 184 ASN 184 184 ?   ?   ?   A . n 
A 1 185 GLY 185 185 ?   ?   ?   A . n 
A 1 186 ASP 186 186 ?   ?   ?   A . n 
A 1 187 ASP 187 187 ?   ?   ?   A . n 
A 1 188 ALA 188 188 ?   ?   ?   A . n 
A 1 189 GLY 189 189 ?   ?   ?   A . n 
A 1 190 LYS 190 190 ?   ?   ?   A . n 
A 1 191 LYS 191 191 ?   ?   ?   A . n 
A 1 192 GLY 192 192 ?   ?   ?   A . n 
A 1 193 PRO 193 193 ?   ?   ?   A . n 
A 1 194 VAL 194 194 ?   ?   ?   A . n 
A 1 195 SER 195 195 ?   ?   ?   A . n 
A 1 196 ARG 196 196 ?   ?   ?   A . n 
A 1 197 GLU 197 197 ?   ?   ?   A . n 
A 1 198 HIS 198 198 198 HIS HIS A . n 
A 1 199 VAL 199 199 199 VAL VAL A . n 
A 1 200 ASN 200 200 200 ASN ASN A . n 
A 1 201 TRP 201 201 201 TRP TRP A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 ARG 203 203 203 ARG ALA A . n 
A 1 204 GLU 204 204 204 GLU GLU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 ALA 207 207 207 ALA ALA A . n 
A 1 208 GLY 208 208 208 GLY GLY A . n 
A 1 209 LYS 209 209 209 LYS LYS A . n 
A 1 210 PHE 210 210 210 PHE PHE A . n 
A 1 211 GLN 211 211 211 GLN GLN A . n 
A 1 212 VAL 212 212 212 VAL VAL A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 PHE 214 214 214 PHE PHE A . n 
A 1 215 ASN 215 215 215 ASN ASN A . n 
A 1 216 PRO 216 216 216 PRO PRO A . n 
A 1 217 PRO 217 217 217 PRO PRO A . n 
A 1 218 TRP 218 218 218 TRP TRP A . n 
A 1 219 GLY 219 219 219 GLY GLY A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 ILE 221 221 221 ILE ILE A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 THR 224 224 224 THR THR A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 ARG 226 226 226 ARG ARG A . n 
A 1 227 SER 227 227 227 SER SER A . n 
A 1 228 GLY 228 228 228 GLY GLY A . n 
A 1 229 ILE 229 229 229 ILE ILE A . n 
A 1 230 PRO 230 230 230 PRO PRO A . n 
A 1 231 LEU 231 231 231 LEU LEU A . n 
A 1 232 ALA 232 232 232 ALA ALA A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 THR 234 234 234 THR THR A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 MET 236 236 236 MET MET A . n 
A 1 237 VAL 237 237 237 VAL VAL A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 ALA 240 240 240 ALA ALA A . n 
A 1 241 GLU 241 241 241 GLU GLU A . n 
A 1 242 LEU 242 242 242 LEU LEU A . n 
A 1 243 ASP 243 243 243 ASP ASP A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 HIS 245 245 245 HIS HIS A . n 
A 1 246 LYS 246 246 246 LYS LYS A . n 
A 1 247 ARG 247 247 247 ARG ARG A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLU 249 249 249 GLU GLU A . n 
A 1 250 ASP 250 250 250 ASP ASP A . n 
A 1 251 ILE 251 251 251 ILE ILE A . n 
A 1 252 ARG 252 252 252 ARG ARG A . n 
A 1 253 LYS 253 253 253 LYS LYS A . n 
A 1 254 THR 254 254 254 THR THR A . n 
A 1 255 LEU 255 255 255 LEU LEU A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASP 257 257 257 ASP ASP A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 LYS 259 259 259 LYS LYS A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 TRP 261 261 261 TRP TRP A . n 
A 1 262 ILE 262 262 262 ILE ILE A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 ASP 264 264 264 ASP ASP A . n 
A 1 265 ASN 265 265 265 ASN ASN A . n 
A 1 266 LYS 266 266 266 LYS LYS A . n 
A 1 267 ASP 267 267 267 ASP ASP A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 GLU 270 270 270 GLU GLU A . n 
A 1 271 ASP 271 271 271 ASP ALA A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 LYS 273 273 273 LYS LYS A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 ASP 275 275 275 ASP ASP A . n 
A 1 276 GLU 276 276 276 GLU GLU A . n 
A 1 277 LEU 277 277 277 LEU LEU A . n 
A 1 278 VAL 278 278 278 VAL VAL A . n 
A 1 279 LYS 279 279 279 LYS LYS A . n 
A 1 280 THR 280 280 280 THR THR A . n 
A 1 281 LEU 281 281 281 LEU LEU A . n 
A 1 282 THR 282 282 282 THR THR A . n 
A 1 283 LYS 283 283 283 LYS LYS A . n 
A 1 284 GLN 284 284 284 GLN GLN A . n 
A 1 285 LEU 285 285 285 LEU LEU A . n 
A 1 286 ALA 286 286 286 ALA ALA A . n 
A 1 287 ASP 287 287 287 ASP ASP A . n 
A 1 288 ALA 288 288 288 ALA ALA A . n 
A 1 289 ILE 289 289 289 ILE ILE A . n 
A 1 290 GLU 290 290 290 GLU GLU A . n 
A 1 291 LEU 291 291 291 LEU LEU A . n 
A 1 292 ALA 292 292 292 ALA ALA A . n 
A 1 293 LYS 293 293 293 LYS LYS A . n 
A 1 294 LYS 294 294 294 LYS LYS A . n 
A 1 295 SER 295 295 295 SER SER A . n 
A 1 296 SER 296 296 296 SER SER A . n 
A 1 297 ALA 297 297 297 ALA ALA A . n 
A 1 298 LEU 298 298 298 LEU LEU A . n 
A 1 299 ARG 299 299 299 ARG ARG A . n 
A 1 300 ALA 300 300 300 ALA ALA A . n 
A 1 301 GLN 301 301 301 GLN GLN A . n 
A 1 302 GLY 302 302 302 GLY GLY A . n 
A 1 303 ALA 303 303 303 ALA ALA A . n 
A 1 304 GLN 304 304 304 GLN GLN A . n 
A 1 305 ILE 305 305 305 ILE ILE A . n 
A 1 306 ASP 306 306 306 ASP ASP A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 ILE 308 308 308 ILE ILE A . n 
A 1 309 PHE 309 309 309 PHE PHE A . n 
A 1 310 SER 310 310 310 SER SER A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 TYR 312 312 312 TYR TYR A . n 
A 1 313 TYR 313 313 313 TYR TYR A . n 
A 1 314 TRP 314 314 314 TRP TRP A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 TRP 316 316 316 TRP TRP A . n 
A 1 317 LYS 317 317 317 LYS LYS A . n 
A 1 318 ALA 318 318 318 ALA ALA A . n 
A 1 319 GLY 319 319 319 GLY GLY A . n 
A 1 320 ILE 320 320 320 ILE ILE A . n 
A 1 321 THR 321 321 321 THR THR A . n 
A 1 322 PRO 322 322 322 PRO PRO A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 THR 324 324 324 THR THR A . n 
A 1 325 PHE 325 325 325 PHE PHE A . n 
A 1 326 PRO 326 326 326 PRO PRO A . n 
A 1 327 THR 327 327 327 THR THR A . n 
A 1 328 LEU 328 328 328 LEU LEU A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 GLN 330 330 330 GLN GLN A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 PHE 333 333 333 PHE PHE A . n 
A 1 334 GLU 334 334 334 GLU GLU A . n 
A 1 335 MET 335 335 335 MET MET A . n 
A 1 336 GLY 336 336 336 GLY GLY A . n 
A 1 337 GLN 337 337 337 GLN GLN A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PRO 339 339 339 PRO PRO A . n 
A 1 340 ARG 340 340 340 ARG ARG A . n 
A 1 341 GLY 341 341 341 GLY GLY A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 LYS 343 343 343 LYS LYS A . n 
A 1 344 LYS 344 344 344 LYS LYS A . n 
A 1 345 MET 345 345 345 MET MET A . n 
A 1 346 ILE 346 346 346 ILE ILE A . n 
A 1 347 LYS 347 347 347 LYS LYS A . n 
A 1 348 ALA 348 348 348 ALA ALA A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 THR 350 350 350 THR THR A . n 
A 1 351 ASN 351 351 351 ASN ASN A . n 
A 1 352 THR 352 352 352 THR THR A . n 
A 1 353 PRO 353 353 353 PRO PRO A . n 
A 1 354 LEU 354 354 354 LEU LEU A . n 
A 1 355 LYS 355 355 355 LYS LYS A . n 
A 1 356 TRP 356 356 356 TRP TRP A . n 
A 1 357 GLY 357 357 357 GLY GLY A . n 
A 1 358 LYS 358 358 358 LYS LYS A . n 
A 1 359 LYS 359 359 359 LYS LYS A . n 
A 1 360 ILE 360 360 360 ILE ILE A . n 
A 1 361 ILE 361 361 361 ILE ILE A . n 
A 1 362 SER 362 362 362 SER SER A . n 
A 1 363 LEU 363 363 363 LEU LEU A . n 
A 1 364 PHE 364 364 364 PHE PHE A . n 
A 1 365 ALA 365 365 365 ALA ALA A . n 
A 1 366 GLU 366 366 366 GLU GLU A . n 
A 1 367 ASP 367 367 367 ASP ASP A . n 
A 1 368 ASP 368 368 368 ASP ASP A . n 
A 1 369 PHE 369 369 369 PHE PHE A . n 
A 1 370 ASN 370 370 370 ASN ASN A . n 
A 1 371 GLY 371 371 371 GLY GLY A . n 
A 1 372 ASN 372 372 372 ASN ASN A . n 
A 1 373 LYS 373 373 373 LYS LYS A . n 
A 1 374 LEU 374 374 374 LEU LEU A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 MET 376 376 376 MET MET A . n 
A 1 377 HIS 377 377 377 HIS HIS A . n 
A 1 378 PRO 378 378 378 PRO PRO A . n 
A 1 379 GLY 379 379 379 GLY GLY A . n 
A 1 380 VAL 380 380 380 VAL VAL A . n 
A 1 381 LEU 381 381 381 LEU LEU A . n 
A 1 382 THR 382 382 382 THR THR A . n 
A 1 383 ALA 383 383 383 ALA ALA A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ARG 385 385 385 ARG ARG A . n 
A 1 386 MET 386 386 386 MET MET A . n 
A 1 387 SER 387 387 387 SER SER A . n 
A 1 388 GLU 388 388 388 GLU GLU A . n 
A 1 389 MET 389 389 389 MET MET A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 ALA 391 391 391 ALA ALA A . n 
A 1 392 CYS 392 392 392 CYS CYS A . n 
A 1 393 PHE 393 393 393 PHE PHE A . n 
A 1 394 GLY 394 394 394 GLY GLY A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 VAL 396 396 396 VAL VAL A . n 
A 1 397 PRO 397 397 397 PRO PRO A . n 
A 1 398 VAL 398 398 398 VAL VAL A . n 
A 1 399 SER 399 399 399 SER SER A . n 
A 1 400 ASN 400 400 400 ASN ASN A . n 
A 1 401 PRO 401 401 401 PRO PRO A . n 
A 1 402 GLU 402 402 402 GLU GLU A . n 
A 1 403 ASP 403 403 403 ASP ASP A . n 
A 1 404 ALA 404 404 404 ALA ALA A . n 
A 1 405 VAL 405 405 405 VAL VAL A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 GLY 407 407 407 GLY GLY A . n 
A 1 408 SER 408 408 408 SER SER A . n 
A 1 409 GLY 409 409 409 GLY GLY A . n 
A 1 410 HIS 410 410 410 HIS HIS A . n 
A 1 411 SER 411 411 411 SER SER A . n 
A 1 412 LYS 412 412 412 LYS LYS A . n 
A 1 413 SER 413 413 413 SER SER A . n 
A 1 414 LEU 414 414 414 LEU LEU A . n 
A 1 415 LEU 415 415 415 LEU LEU A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 TYR 417 417 417 TYR TYR A . n 
A 1 418 LYS 418 418 418 LYS LYS A . n 
A 1 419 ILE 419 419 419 ILE ILE A . n 
A 1 420 ASP 420 420 420 ASP ASP A . n 
A 1 421 THR 421 421 421 THR THR A . n 
A 1 422 ASN 422 422 422 ASN ASN A . n 
A 1 423 ALA 423 423 423 ALA ALA A . n 
A 1 424 GLY 424 424 424 GLY GLY A . n 
A 1 425 ASN 425 425 425 ASN ASN A . n 
A 1 426 PRO 426 426 426 PRO PRO A . n 
A 1 427 CYS 427 427 427 CYS CYS A . n 
A 1 428 ALA 428 428 428 ALA ALA A . n 
A 1 429 LYS 429 429 429 LYS LYS A . n 
A 1 430 GLU 430 430 430 GLU GLU A . n 
A 1 431 ILE 431 431 431 ILE ILE A . n 
A 1 432 VAL 432 432 432 VAL VAL A . n 
A 1 433 GLN 433 433 433 GLN GLN A . n 
A 1 434 LEU 434 434 434 LEU LEU A . n 
A 1 435 PHE 435 435 435 PHE PHE A . n 
A 1 436 ARG 436 436 436 ARG ARG A . n 
A 1 437 ILE 437 437 437 ILE ILE A . n 
A 1 438 GLN 438 438 438 GLN GLN A . n 
A 1 439 LYS 439 439 439 LYS LYS A . n 
A 1 440 ALA 440 440 440 ALA ALA A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 PHE 442 442 442 PHE PHE A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 LEU 444 444 444 LEU LEU A . n 
A 1 445 ASP 445 445 445 ASP ASP A . n 
A 1 446 SER 446 446 446 SER SER A . n 
A 1 447 MET 447 447 447 MET MET A . n 
A 1 448 ASP 448 448 448 ASP ASP A . n 
A 1 449 ILE 449 449 449 ILE ILE A . n 
A 1 450 VAL 450 450 450 VAL VAL A . n 
A 1 451 ALA 451 451 451 ALA ALA A . n 
A 1 452 SER 452 452 452 SER SER A . n 
A 1 453 GLU 453 453 453 GLU GLU A . n 
A 1 454 HIS 454 454 454 HIS HIS A . n 
A 1 455 LEU 455 455 455 LEU LEU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 HIS 457 457 457 HIS HIS A . n 
A 1 458 GLN 458 458 458 GLN GLN A . n 
A 1 459 SER 459 459 459 SER SER A . n 
A 1 460 LEU 460 460 460 LEU LEU A . n 
A 1 461 VAL 461 461 461 VAL VAL A . n 
A 1 462 GLY 462 462 462 GLY GLY A . n 
A 1 463 LYS 463 463 463 LYS LYS A . n 
A 1 464 ARG 464 464 464 ARG ARG A . n 
A 1 465 CYS 465 465 465 CYS CYS A . n 
A 1 466 HIS 466 466 466 HIS HIS A . n 
A 1 467 PHE 467 467 467 PHE PHE A . n 
A 1 468 GLN 468 468 468 GLN GLN A . n 
A 1 469 ASN 469 469 469 ASN ASN A . n 
A 1 470 ALA 470 470 470 ALA ALA A . n 
A 1 471 TYR 471 471 471 TYR TYR A . n 
A 1 472 LYS 472 472 472 LYS LYS A . n 
A 1 473 VAL 473 473 473 VAL VAL A . n 
A 1 474 LYS 474 474 474 LYS LYS A . n 
A 1 475 GLY 475 475 475 GLY GLY A . n 
A 1 476 ASN 476 476 476 ASN ASN A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 THR 478 478 478 THR THR A . n 
A 1 479 ASN 479 479 479 ASN ASN A . n 
A 1 480 VAL 480 480 480 VAL VAL A . n 
A 1 481 GLU 481 481 481 GLU GLU A . n 
A 1 482 ILE 482 482 482 ILE ILE A . n 
A 1 483 VAL 483 483 483 VAL VAL A . n 
B 1 1   MET 1   1   1   MET MET B . n 
B 1 2   GLU 2   2   2   GLU GLU B . n 
B 1 3   ASN 3   3   3   ASN ASN B . n 
B 1 4   GLN 4   4   4   GLN GLN B . n 
B 1 5   ILE 5   5   5   ILE ILE B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   ALA 7   7   7   ALA ALA B . n 
B 1 8   ASN 8   8   8   ASN ASN B . n 
B 1 9   THR 9   9   9   THR THR B . n 
B 1 10  LYS 10  10  10  LYS LYS B . n 
B 1 11  LYS 11  11  11  LYS LYS B . n 
B 1 12  GLU 12  12  12  GLU GLU B . n 
B 1 13  TYR 13  13  13  TYR TYR B . n 
B 1 14  ASP 14  14  14  ASP ASP B . n 
B 1 15  GLU 15  15  15  GLU GLU B . n 
B 1 16  TRP 16  16  16  TRP TRP B . n 
B 1 17  PHE 17  17  17  PHE PHE B . n 
B 1 18  LYS 18  18  18  LYS LYS B . n 
B 1 19  PRO 19  19  19  PRO PRO B . n 
B 1 20  TYR 20  20  20  TYR TYR B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  GLU 22  22  22  GLU GLU B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  THR 24  24  24  THR THR B . n 
B 1 25  HIS 25  25  25  HIS HIS B . n 
B 1 26  LEU 26  26  26  LEU LEU B . n 
B 1 27  LYS 27  27  27  LYS LYS B . n 
B 1 28  SER 28  28  28  SER SER B . n 
B 1 29  VAL 29  29  29  VAL VAL B . n 
B 1 30  LEU 30  30  30  LEU LEU B . n 
B 1 31  THR 31  31  31  THR THR B . n 
B 1 32  ASN 32  32  32  ASN ASN B . n 
B 1 33  SER 33  33  33  SER SER B . n 
B 1 34  ALA 34  34  34  ALA ALA B . n 
B 1 35  SER 35  35  35  SER SER B . n 
B 1 36  PHE 36  36  36  PHE PHE B . n 
B 1 37  CYS 37  37  37  CYS CYS B . n 
B 1 38  ASP 38  38  38  ASP ASP B . n 
B 1 39  ALA 39  39  39  ALA ALA B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  PRO 41  41  41  PRO PRO B . n 
B 1 42  ASP 42  42  42  ASP ASP B . n 
B 1 43  LEU 43  43  43  LEU LEU B . n 
B 1 44  SER 44  44  44  SER SER B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  PHE 46  46  46  PHE PHE B . n 
B 1 47  GLU 47  47  47  GLU GLU B . n 
B 1 48  VAL 48  48  48  VAL VAL B . n 
B 1 49  LYS 49  49  49  LYS LYS B . n 
B 1 50  MET 50  50  50  MET MET B . n 
B 1 51  GLY 51  51  51  GLY GLY B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  ALA 53  53  53  ALA ALA B . n 
B 1 54  THR 54  54  54  THR THR B . n 
B 1 55  ASP 55  55  55  ASP ASP B . n 
B 1 56  ASP 56  56  56  ASP ASP B . n 
B 1 57  ARG 57  57  57  ARG ARG B . n 
B 1 58  GLU 58  58  58  GLU GLU B . n 
B 1 59  LYS 59  59  59  LYS LYS B . n 
B 1 60  ASP 60  60  60  ASP ASP B . n 
B 1 61  SER 61  61  61  SER SER B . n 
B 1 62  ILE 62  62  62  ILE ILE B . n 
B 1 63  TYR 63  63  63  TYR TYR B . n 
B 1 64  ALA 64  64  64  ALA ALA B . n 
B 1 65  CYS 65  65  65  CYS CYS B . n 
B 1 66  ALA 66  66  66  ALA ALA B . n 
B 1 67  MET 67  67  67  MET MET B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  GLU 69  69  69  GLU GLU B . n 
B 1 70  ALA 70  70  70  ALA ALA B . n 
B 1 71  THR 71  71  71  THR THR B . n 
B 1 72  LYS 72  72  72  LYS LYS B . n 
B 1 73  PHE 73  73  73  PHE PHE B . n 
B 1 74  CYS 74  74  74  CYS CYS B . n 
B 1 75  ALA 75  75  75  ALA ALA B . n 
B 1 76  PRO 76  76  76  PRO PRO B . n 
B 1 77  ILE 77  77  77  ILE ILE B . n 
B 1 78  TYR 78  78  78  TYR TYR B . n 
B 1 79  GLU 79  79  79  GLU GLU B . n 
B 1 80  CYS 80  80  80  CYS CYS B . n 
B 1 81  GLY 81  81  81  GLY GLY B . n 
B 1 82  TRP 82  82  82  TRP TRP B . n 
B 1 83  ALA 83  83  83  ALA ALA B . n 
B 1 84  CYS 84  84  84  CYS CYS B . n 
B 1 85  CYS 85  85  85  CYS CYS B . n 
B 1 86  THR 86  86  86  THR THR B . n 
B 1 87  GLY 87  87  87  GLY GLY B . n 
B 1 88  MET 88  88  88  MET MET B . n 
B 1 89  VAL 89  89  89  VAL VAL B . n 
B 1 90  GLU 90  90  90  GLU GLU B . n 
B 1 91  ASN 91  91  91  ASN ASN B . n 
B 1 92  GLY 92  92  92  GLY GLY B . n 
B 1 93  LEU 93  93  93  LEU LEU B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  TRP 95  95  95  TRP TRP B . n 
B 1 96  PHE 96  96  96  PHE PHE B . n 
B 1 97  ASP 97  97  97  ASP ASP B . n 
B 1 98  LYS 98  98  98  LYS LYS B . n 
B 1 99  ASN 99  99  99  ASN ASN B . n 
B 1 100 LYS 100 100 100 LYS LYS B . n 
B 1 101 ASP 101 101 101 ASP ASP B . n 
B 1 102 VAL 102 102 102 VAL VAL B . n 
B 1 103 ILE 103 103 103 ILE ILE B . n 
B 1 104 LYS 104 104 104 LYS LYS B . n 
B 1 105 LEU 105 105 105 LEU LEU B . n 
B 1 106 TRP 106 106 106 TRP TRP B . n 
B 1 107 ASP 107 107 107 ASP ASP B . n 
B 1 108 GLY 108 108 108 GLY GLY B . n 
B 1 109 LYS 109 109 109 LYS LYS B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 SER 111 111 111 SER SER B . n 
B 1 112 ASP 112 112 112 ASP ASP B . n 
B 1 113 LEU 113 113 113 LEU LEU B . n 
B 1 114 MET 114 114 114 MET MET B . n 
B 1 115 LYS 115 115 115 LYS LYS B . n 
B 1 116 ASN 116 116 116 ASN ASN B . n 
B 1 117 VAL 117 117 117 VAL VAL B . n 
B 1 118 PRO 118 118 118 PRO PRO B . n 
B 1 119 GLU 119 119 119 GLU GLU B . n 
B 1 120 PRO 120 120 120 PRO PRO B . n 
B 1 121 GLU 121 121 121 GLU GLU B . n 
B 1 122 GLN 122 122 122 GLN GLN B . n 
B 1 123 LEU 123 123 123 LEU LEU B . n 
B 1 124 VAL 124 124 124 VAL VAL B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 TYR 126 126 126 TYR TYR B . n 
B 1 127 GLN 127 127 127 GLN GLN B . n 
B 1 128 ARG 128 128 128 ARG ARG B . n 
B 1 129 ALA 129 129 129 ALA ALA B . n 
B 1 130 ALA 130 130 130 ALA ALA B . n 
B 1 131 GLN 131 131 131 GLN GLN B . n 
B 1 132 LYS 132 132 132 LYS LYS B . n 
B 1 133 TRP 133 133 133 TRP TRP B . n 
B 1 134 ARG 134 134 134 ARG ARG B . n 
B 1 135 GLN 135 135 135 GLN GLN B . n 
B 1 136 ASP 136 136 136 ASP ASP B . n 
B 1 137 ASN 137 137 137 ASN ASN B . n 
B 1 138 LYS 138 138 138 LYS LYS B . n 
B 1 139 PHE 139 139 139 PHE PHE B . n 
B 1 140 GLU 140 140 140 GLU GLU B . n 
B 1 141 ILE 141 141 141 ILE ILE B . n 
B 1 142 ASN 142 142 142 ASN ASN B . n 
B 1 143 GLN 143 143 143 GLN GLN B . n 
B 1 144 TYR 144 144 144 TYR TYR B . n 
B 1 145 THR 145 145 145 THR THR B . n 
B 1 146 ARG 146 146 146 ARG ARG B . n 
B 1 147 SER 147 147 147 SER SER B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 THR 149 149 149 THR THR B . n 
B 1 150 HIS 150 150 150 HIS HIS B . n 
B 1 151 SER 151 151 151 SER SER B . n 
B 1 152 VAL 152 152 152 VAL VAL B . n 
B 1 153 GLN 153 153 153 GLN GLN B . n 
B 1 154 ALA 154 154 154 ALA ALA B . n 
B 1 155 ASP 155 155 155 ASP ASP B . n 
B 1 156 TYR 156 156 156 TYR TYR B . n 
B 1 157 LYS 157 157 157 LYS LYS B . n 
B 1 158 VAL 158 158 158 VAL VAL B . n 
B 1 159 PRO 159 159 159 PRO PRO B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 GLU 161 161 161 GLU GLU B . n 
B 1 162 TYR 162 162 162 TYR TYR B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 VAL 164 164 164 VAL VAL B . n 
B 1 165 GLU 165 165 165 GLU GLU B . n 
B 1 166 VAL 166 166 166 VAL VAL B . n 
B 1 167 LYS 167 167 167 LYS LYS B . n 
B 1 168 GLU 168 168 168 GLU GLU B . n 
B 1 169 MET 169 169 169 MET MET B . n 
B 1 170 LEU 170 170 170 LEU LEU B . n 
B 1 171 SER 171 171 171 SER SER B . n 
B 1 172 ASP 172 172 172 ASP ASP B . n 
B 1 173 MET 173 173 173 MET MET B . n 
B 1 174 VAL 174 174 174 VAL VAL B . n 
B 1 175 ARG 175 175 175 ARG ARG B . n 
B 1 176 ARG 176 176 176 ARG ARG B . n 
B 1 177 ARG 177 177 177 ARG ARG B . n 
B 1 178 ASN 178 178 178 ASN ASN B . n 
B 1 179 ILE 179 179 179 ILE ILE B . n 
B 1 180 LEU 180 180 ?   ?   ?   B . n 
B 1 181 LEU 181 181 ?   ?   ?   B . n 
B 1 182 ASN 182 182 ?   ?   ?   B . n 
B 1 183 GLY 183 183 ?   ?   ?   B . n 
B 1 184 ASN 184 184 ?   ?   ?   B . n 
B 1 185 GLY 185 185 ?   ?   ?   B . n 
B 1 186 ASP 186 186 ?   ?   ?   B . n 
B 1 187 ASP 187 187 ?   ?   ?   B . n 
B 1 188 ALA 188 188 ?   ?   ?   B . n 
B 1 189 GLY 189 189 ?   ?   ?   B . n 
B 1 190 LYS 190 190 ?   ?   ?   B . n 
B 1 191 LYS 191 191 ?   ?   ?   B . n 
B 1 192 GLY 192 192 ?   ?   ?   B . n 
B 1 193 PRO 193 193 ?   ?   ?   B . n 
B 1 194 VAL 194 194 ?   ?   ?   B . n 
B 1 195 SER 195 195 195 SER SER B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 GLU 197 197 197 GLU GLU B . n 
B 1 198 HIS 198 198 198 HIS HIS B . n 
B 1 199 VAL 199 199 199 VAL VAL B . n 
B 1 200 ASN 200 200 200 ASN ASN B . n 
B 1 201 TRP 201 201 201 TRP TRP B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 ARG 203 203 203 ARG ARG B . n 
B 1 204 GLU 204 204 204 GLU GLU B . n 
B 1 205 LEU 205 205 205 LEU LEU B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 ALA 207 207 207 ALA ALA B . n 
B 1 208 GLY 208 208 208 GLY GLY B . n 
B 1 209 LYS 209 209 209 LYS LYS B . n 
B 1 210 PHE 210 210 210 PHE PHE B . n 
B 1 211 GLN 211 211 211 GLN GLN B . n 
B 1 212 VAL 212 212 212 VAL VAL B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 PHE 214 214 214 PHE PHE B . n 
B 1 215 ASN 215 215 215 ASN ASN B . n 
B 1 216 PRO 216 216 216 PRO PRO B . n 
B 1 217 PRO 217 217 217 PRO PRO B . n 
B 1 218 TRP 218 218 218 TRP TRP B . n 
B 1 219 GLY 219 219 219 GLY GLY B . n 
B 1 220 ASP 220 220 220 ASP ASP B . n 
B 1 221 ILE 221 221 221 ILE ILE B . n 
B 1 222 ASN 222 222 222 ASN ASN B . n 
B 1 223 LYS 223 223 223 LYS LYS B . n 
B 1 224 THR 224 224 224 THR THR B . n 
B 1 225 GLY 225 225 225 GLY GLY B . n 
B 1 226 ARG 226 226 226 ARG ARG B . n 
B 1 227 SER 227 227 227 SER SER B . n 
B 1 228 GLY 228 228 228 GLY GLY B . n 
B 1 229 ILE 229 229 229 ILE ILE B . n 
B 1 230 PRO 230 230 230 PRO PRO B . n 
B 1 231 LEU 231 231 231 LEU LEU B . n 
B 1 232 ALA 232 232 232 ALA ALA B . n 
B 1 233 VAL 233 233 233 VAL VAL B . n 
B 1 234 THR 234 234 234 THR THR B . n 
B 1 235 SER 235 235 235 SER SER B . n 
B 1 236 MET 236 236 236 MET MET B . n 
B 1 237 VAL 237 237 237 VAL VAL B . n 
B 1 238 LYS 238 238 238 LYS LYS B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 ALA 240 240 240 ALA ALA B . n 
B 1 241 GLU 241 241 241 GLU GLU B . n 
B 1 242 LEU 242 242 242 LEU LEU B . n 
B 1 243 ASP 243 243 243 ASP ASP B . n 
B 1 244 GLY 244 244 244 GLY GLY B . n 
B 1 245 HIS 245 245 245 HIS HIS B . n 
B 1 246 LYS 246 246 246 LYS LYS B . n 
B 1 247 ARG 247 247 247 ARG ARG B . n 
B 1 248 LEU 248 248 248 LEU LEU B . n 
B 1 249 GLU 249 249 249 GLU GLU B . n 
B 1 250 ASP 250 250 250 ASP ASP B . n 
B 1 251 ILE 251 251 251 ILE ILE B . n 
B 1 252 ARG 252 252 252 ARG ARG B . n 
B 1 253 LYS 253 253 253 LYS LYS B . n 
B 1 254 THR 254 254 254 THR THR B . n 
B 1 255 LEU 255 255 255 LEU LEU B . n 
B 1 256 LEU 256 256 256 LEU LEU B . n 
B 1 257 ASP 257 257 257 ASP ASP B . n 
B 1 258 LEU 258 258 258 LEU LEU B . n 
B 1 259 LYS 259 259 259 LYS LYS B . n 
B 1 260 LYS 260 260 260 LYS LYS B . n 
B 1 261 TRP 261 261 261 TRP TRP B . n 
B 1 262 ILE 262 262 262 ILE ILE B . n 
B 1 263 GLU 263 263 263 GLU GLU B . n 
B 1 264 ASP 264 264 264 ASP ASP B . n 
B 1 265 ASN 265 265 265 ASN ASN B . n 
B 1 266 LYS 266 266 266 LYS LYS B . n 
B 1 267 ASP 267 267 267 ASP ASP B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 GLU 270 270 270 GLU GLU B . n 
B 1 271 ASP 271 271 271 ASP ASP B . n 
B 1 272 GLY 272 272 272 GLY GLY B . n 
B 1 273 LYS 273 273 273 LYS LYS B . n 
B 1 274 GLY 274 274 274 GLY GLY B . n 
B 1 275 ASP 275 275 275 ASP ASP B . n 
B 1 276 GLU 276 276 276 GLU GLU B . n 
B 1 277 LEU 277 277 277 LEU LEU B . n 
B 1 278 VAL 278 278 278 VAL VAL B . n 
B 1 279 LYS 279 279 279 LYS LYS B . n 
B 1 280 THR 280 280 280 THR THR B . n 
B 1 281 LEU 281 281 281 LEU LEU B . n 
B 1 282 THR 282 282 282 THR THR B . n 
B 1 283 LYS 283 283 283 LYS LYS B . n 
B 1 284 GLN 284 284 284 GLN GLN B . n 
B 1 285 LEU 285 285 285 LEU LEU B . n 
B 1 286 ALA 286 286 286 ALA ALA B . n 
B 1 287 ASP 287 287 287 ASP ASP B . n 
B 1 288 ALA 288 288 288 ALA ALA B . n 
B 1 289 ILE 289 289 289 ILE ILE B . n 
B 1 290 GLU 290 290 290 GLU GLU B . n 
B 1 291 LEU 291 291 291 LEU LEU B . n 
B 1 292 ALA 292 292 292 ALA ALA B . n 
B 1 293 LYS 293 293 293 LYS LYS B . n 
B 1 294 LYS 294 294 294 LYS ALA B . n 
B 1 295 SER 295 295 295 SER ALA B . n 
B 1 296 SER 296 296 296 SER ALA B . n 
B 1 297 ALA 297 297 297 ALA ALA B . n 
B 1 298 LEU 298 298 298 LEU LEU B . n 
B 1 299 ARG 299 299 299 ARG ARG B . n 
B 1 300 ALA 300 300 300 ALA ALA B . n 
B 1 301 GLN 301 301 301 GLN GLN B . n 
B 1 302 GLY 302 302 302 GLY GLY B . n 
B 1 303 ALA 303 303 303 ALA ALA B . n 
B 1 304 GLN 304 304 304 GLN GLN B . n 
B 1 305 ILE 305 305 305 ILE ILE B . n 
B 1 306 ASP 306 306 306 ASP ASP B . n 
B 1 307 SER 307 307 307 SER SER B . n 
B 1 308 ILE 308 308 308 ILE ILE B . n 
B 1 309 PHE 309 309 309 PHE PHE B . n 
B 1 310 SER 310 310 310 SER SER B . n 
B 1 311 SER 311 311 311 SER SER B . n 
B 1 312 TYR 312 312 312 TYR TYR B . n 
B 1 313 TYR 313 313 313 TYR TYR B . n 
B 1 314 TRP 314 314 314 TRP TRP B . n 
B 1 315 ALA 315 315 315 ALA ALA B . n 
B 1 316 TRP 316 316 316 TRP TRP B . n 
B 1 317 LYS 317 317 317 LYS LYS B . n 
B 1 318 ALA 318 318 318 ALA ALA B . n 
B 1 319 GLY 319 319 319 GLY GLY B . n 
B 1 320 ILE 320 320 320 ILE ILE B . n 
B 1 321 THR 321 321 321 THR THR B . n 
B 1 322 PRO 322 322 322 PRO PRO B . n 
B 1 323 VAL 323 323 323 VAL VAL B . n 
B 1 324 THR 324 324 324 THR THR B . n 
B 1 325 PHE 325 325 325 PHE PHE B . n 
B 1 326 PRO 326 326 326 PRO PRO B . n 
B 1 327 THR 327 327 327 THR THR B . n 
B 1 328 LEU 328 328 328 LEU LEU B . n 
B 1 329 SER 329 329 329 SER SER B . n 
B 1 330 GLN 330 330 330 GLN GLN B . n 
B 1 331 PHE 331 331 331 PHE PHE B . n 
B 1 332 LEU 332 332 332 LEU LEU B . n 
B 1 333 PHE 333 333 333 PHE PHE B . n 
B 1 334 GLU 334 334 334 GLU GLU B . n 
B 1 335 MET 335 335 335 MET MET B . n 
B 1 336 GLY 336 336 336 GLY GLY B . n 
B 1 337 GLN 337 337 337 GLN GLN B . n 
B 1 338 GLY 338 338 338 GLY GLY B . n 
B 1 339 PRO 339 339 339 PRO PRO B . n 
B 1 340 ARG 340 340 340 ARG ARG B . n 
B 1 341 GLY 341 341 341 GLY GLY B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 LYS 343 343 343 LYS LYS B . n 
B 1 344 LYS 344 344 344 LYS LYS B . n 
B 1 345 MET 345 345 345 MET MET B . n 
B 1 346 ILE 346 346 346 ILE ILE B . n 
B 1 347 LYS 347 347 347 LYS LYS B . n 
B 1 348 ALA 348 348 348 ALA ALA B . n 
B 1 349 LEU 349 349 349 LEU LEU B . n 
B 1 350 THR 350 350 350 THR THR B . n 
B 1 351 ASN 351 351 351 ASN ASN B . n 
B 1 352 THR 352 352 352 THR THR B . n 
B 1 353 PRO 353 353 353 PRO PRO B . n 
B 1 354 LEU 354 354 354 LEU LEU B . n 
B 1 355 LYS 355 355 355 LYS LYS B . n 
B 1 356 TRP 356 356 356 TRP TRP B . n 
B 1 357 GLY 357 357 357 GLY GLY B . n 
B 1 358 LYS 358 358 358 LYS LYS B . n 
B 1 359 LYS 359 359 359 LYS LYS B . n 
B 1 360 ILE 360 360 360 ILE ILE B . n 
B 1 361 ILE 361 361 361 ILE ILE B . n 
B 1 362 SER 362 362 362 SER SER B . n 
B 1 363 LEU 363 363 363 LEU LEU B . n 
B 1 364 PHE 364 364 364 PHE PHE B . n 
B 1 365 ALA 365 365 365 ALA ALA B . n 
B 1 366 GLU 366 366 366 GLU GLU B . n 
B 1 367 ASP 367 367 367 ASP ASP B . n 
B 1 368 ASP 368 368 368 ASP ASP B . n 
B 1 369 PHE 369 369 369 PHE PHE B . n 
B 1 370 ASN 370 370 370 ASN ASN B . n 
B 1 371 GLY 371 371 371 GLY GLY B . n 
B 1 372 ASN 372 372 372 ASN ASN B . n 
B 1 373 LYS 373 373 373 LYS LYS B . n 
B 1 374 LEU 374 374 374 LEU LEU B . n 
B 1 375 TYR 375 375 375 TYR TYR B . n 
B 1 376 MET 376 376 376 MET MET B . n 
B 1 377 HIS 377 377 377 HIS HIS B . n 
B 1 378 PRO 378 378 378 PRO PRO B . n 
B 1 379 GLY 379 379 379 GLY GLY B . n 
B 1 380 VAL 380 380 380 VAL VAL B . n 
B 1 381 LEU 381 381 381 LEU LEU B . n 
B 1 382 THR 382 382 382 THR THR B . n 
B 1 383 ALA 383 383 383 ALA ALA B . n 
B 1 384 GLY 384 384 384 GLY GLY B . n 
B 1 385 ARG 385 385 385 ARG ARG B . n 
B 1 386 MET 386 386 386 MET MET B . n 
B 1 387 SER 387 387 387 SER SER B . n 
B 1 388 GLU 388 388 388 GLU GLU B . n 
B 1 389 MET 389 389 389 MET MET B . n 
B 1 390 GLY 390 390 390 GLY GLY B . n 
B 1 391 ALA 391 391 391 ALA ALA B . n 
B 1 392 CYS 392 392 392 CYS CYS B . n 
B 1 393 PHE 393 393 393 PHE PHE B . n 
B 1 394 GLY 394 394 394 GLY GLY B . n 
B 1 395 VAL 395 395 395 VAL VAL B . n 
B 1 396 VAL 396 396 396 VAL VAL B . n 
B 1 397 PRO 397 397 397 PRO PRO B . n 
B 1 398 VAL 398 398 398 VAL VAL B . n 
B 1 399 SER 399 399 399 SER SER B . n 
B 1 400 ASN 400 400 400 ASN ASN B . n 
B 1 401 PRO 401 401 401 PRO PRO B . n 
B 1 402 GLU 402 402 402 GLU GLU B . n 
B 1 403 ASP 403 403 403 ASP ASP B . n 
B 1 404 ALA 404 404 404 ALA ALA B . n 
B 1 405 VAL 405 405 405 VAL VAL B . n 
B 1 406 LEU 406 406 406 LEU LEU B . n 
B 1 407 GLY 407 407 407 GLY GLY B . n 
B 1 408 SER 408 408 408 SER SER B . n 
B 1 409 GLY 409 409 409 GLY GLY B . n 
B 1 410 HIS 410 410 410 HIS HIS B . n 
B 1 411 SER 411 411 411 SER SER B . n 
B 1 412 LYS 412 412 412 LYS LYS B . n 
B 1 413 SER 413 413 413 SER SER B . n 
B 1 414 LEU 414 414 414 LEU LEU B . n 
B 1 415 LEU 415 415 415 LEU LEU B . n 
B 1 416 ASN 416 416 416 ASN ASN B . n 
B 1 417 TYR 417 417 417 TYR TYR B . n 
B 1 418 LYS 418 418 418 LYS LYS B . n 
B 1 419 ILE 419 419 419 ILE ILE B . n 
B 1 420 ASP 420 420 420 ASP ASP B . n 
B 1 421 THR 421 421 421 THR THR B . n 
B 1 422 ASN 422 422 422 ASN ASN B . n 
B 1 423 ALA 423 423 423 ALA ALA B . n 
B 1 424 GLY 424 424 424 GLY GLY B . n 
B 1 425 ASN 425 425 425 ASN ASN B . n 
B 1 426 PRO 426 426 426 PRO PRO B . n 
B 1 427 CYS 427 427 427 CYS CYS B . n 
B 1 428 ALA 428 428 428 ALA ALA B . n 
B 1 429 LYS 429 429 429 LYS LYS B . n 
B 1 430 GLU 430 430 430 GLU GLU B . n 
B 1 431 ILE 431 431 431 ILE ILE B . n 
B 1 432 VAL 432 432 432 VAL VAL B . n 
B 1 433 GLN 433 433 433 GLN GLN B . n 
B 1 434 LEU 434 434 434 LEU LEU B . n 
B 1 435 PHE 435 435 435 PHE PHE B . n 
B 1 436 ARG 436 436 436 ARG ARG B . n 
B 1 437 ILE 437 437 437 ILE ILE B . n 
B 1 438 GLN 438 438 438 GLN GLN B . n 
B 1 439 LYS 439 439 439 LYS LYS B . n 
B 1 440 ALA 440 440 440 ALA ALA B . n 
B 1 441 GLY 441 441 441 GLY GLY B . n 
B 1 442 PHE 442 442 442 PHE PHE B . n 
B 1 443 ASP 443 443 443 ASP ASP B . n 
B 1 444 LEU 444 444 444 LEU LEU B . n 
B 1 445 ASP 445 445 445 ASP ASP B . n 
B 1 446 SER 446 446 ?   ?   ?   B . n 
B 1 447 MET 447 447 447 MET MET B . n 
B 1 448 ASP 448 448 448 ASP ASP B . n 
B 1 449 ILE 449 449 449 ILE ILE B . n 
B 1 450 VAL 450 450 450 VAL VAL B . n 
B 1 451 ALA 451 451 451 ALA ALA B . n 
B 1 452 SER 452 452 452 SER SER B . n 
B 1 453 GLU 453 453 453 GLU GLU B . n 
B 1 454 HIS 454 454 454 HIS HIS B . n 
B 1 455 LEU 455 455 455 LEU LEU B . n 
B 1 456 LEU 456 456 456 LEU LEU B . n 
B 1 457 HIS 457 457 457 HIS HIS B . n 
B 1 458 GLN 458 458 458 GLN GLN B . n 
B 1 459 SER 459 459 459 SER SER B . n 
B 1 460 LEU 460 460 460 LEU LEU B . n 
B 1 461 VAL 461 461 461 VAL VAL B . n 
B 1 462 GLY 462 462 462 GLY GLY B . n 
B 1 463 LYS 463 463 463 LYS LYS B . n 
B 1 464 ARG 464 464 464 ARG ARG B . n 
B 1 465 CYS 465 465 465 CYS CYS B . n 
B 1 466 HIS 466 466 466 HIS HIS B . n 
B 1 467 PHE 467 467 467 PHE PHE B . n 
B 1 468 GLN 468 468 468 GLN GLN B . n 
B 1 469 ASN 469 469 469 ASN ASN B . n 
B 1 470 ALA 470 470 470 ALA ALA B . n 
B 1 471 TYR 471 471 471 TYR TYR B . n 
B 1 472 LYS 472 472 472 LYS LYS B . n 
B 1 473 VAL 473 473 473 VAL VAL B . n 
B 1 474 LYS 474 474 474 LYS LYS B . n 
B 1 475 GLY 475 475 475 GLY GLY B . n 
B 1 476 ASN 476 476 476 ASN ASN B . n 
B 1 477 ALA 477 477 477 ALA ALA B . n 
B 1 478 THR 478 478 478 THR THR B . n 
B 1 479 ASN 479 479 479 ASN ASN B . n 
B 1 480 VAL 480 480 480 VAL VAL B . n 
B 1 481 GLU 481 481 481 GLU GLU B . n 
B 1 482 ILE 482 482 ?   ?   ?   B . n 
B 1 483 VAL 483 483 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  501 12 HOH HOH A . 
C 2 HOH 2  502 51 HOH HOH A . 
C 2 HOH 3  503 88 HOH HOH A . 
C 2 HOH 4  504 70 HOH HOH A . 
C 2 HOH 5  505 30 HOH HOH A . 
C 2 HOH 6  506 19 HOH HOH A . 
C 2 HOH 7  507 64 HOH HOH A . 
C 2 HOH 8  508 33 HOH HOH A . 
C 2 HOH 9  509 63 HOH HOH A . 
C 2 HOH 10 510 16 HOH HOH A . 
C 2 HOH 11 511 72 HOH HOH A . 
C 2 HOH 12 512 62 HOH HOH A . 
C 2 HOH 13 513 20 HOH HOH A . 
C 2 HOH 14 514 90 HOH HOH A . 
C 2 HOH 15 515 87 HOH HOH A . 
C 2 HOH 16 516 1  HOH HOH A . 
C 2 HOH 17 517 4  HOH HOH A . 
C 2 HOH 18 518 5  HOH HOH A . 
C 2 HOH 19 519 7  HOH HOH A . 
C 2 HOH 20 520 8  HOH HOH A . 
C 2 HOH 21 521 11 HOH HOH A . 
C 2 HOH 22 522 13 HOH HOH A . 
C 2 HOH 23 523 15 HOH HOH A . 
C 2 HOH 24 524 17 HOH HOH A . 
C 2 HOH 25 525 22 HOH HOH A . 
C 2 HOH 26 526 23 HOH HOH A . 
C 2 HOH 27 527 25 HOH HOH A . 
C 2 HOH 28 528 26 HOH HOH A . 
C 2 HOH 29 529 27 HOH HOH A . 
C 2 HOH 30 530 28 HOH HOH A . 
C 2 HOH 31 531 29 HOH HOH A . 
C 2 HOH 32 532 31 HOH HOH A . 
C 2 HOH 33 533 32 HOH HOH A . 
C 2 HOH 34 534 34 HOH HOH A . 
C 2 HOH 35 535 35 HOH HOH A . 
C 2 HOH 36 536 36 HOH HOH A . 
C 2 HOH 37 537 37 HOH HOH A . 
C 2 HOH 38 538 38 HOH HOH A . 
C 2 HOH 39 539 39 HOH HOH A . 
C 2 HOH 40 540 40 HOH HOH A . 
C 2 HOH 41 541 41 HOH HOH A . 
C 2 HOH 42 542 43 HOH HOH A . 
C 2 HOH 43 543 44 HOH HOH A . 
C 2 HOH 44 544 46 HOH HOH A . 
C 2 HOH 45 545 47 HOH HOH A . 
C 2 HOH 46 546 48 HOH HOH A . 
C 2 HOH 47 547 50 HOH HOH A . 
C 2 HOH 48 548 54 HOH HOH A . 
C 2 HOH 49 549 55 HOH HOH A . 
C 2 HOH 50 550 57 HOH HOH A . 
C 2 HOH 51 551 60 HOH HOH A . 
C 2 HOH 52 552 61 HOH HOH A . 
C 2 HOH 53 553 65 HOH HOH A . 
C 2 HOH 54 554 71 HOH HOH A . 
C 2 HOH 55 555 73 HOH HOH A . 
C 2 HOH 56 556 75 HOH HOH A . 
C 2 HOH 57 557 76 HOH HOH A . 
C 2 HOH 58 558 78 HOH HOH A . 
C 2 HOH 59 559 79 HOH HOH A . 
C 2 HOH 60 560 85 HOH HOH A . 
C 2 HOH 61 561 89 HOH HOH A . 
C 2 HOH 62 562 91 HOH HOH A . 
C 2 HOH 63 563 92 HOH HOH A . 
D 2 HOH 1  501 81 HOH HOH B . 
D 2 HOH 2  502 24 HOH HOH B . 
D 2 HOH 3  503 42 HOH HOH B . 
D 2 HOH 4  504 9  HOH HOH B . 
D 2 HOH 5  505 18 HOH HOH B . 
D 2 HOH 6  506 52 HOH HOH B . 
D 2 HOH 7  507 82 HOH HOH B . 
D 2 HOH 8  508 59 HOH HOH B . 
D 2 HOH 9  509 2  HOH HOH B . 
D 2 HOH 10 510 6  HOH HOH B . 
D 2 HOH 11 511 10 HOH HOH B . 
D 2 HOH 12 512 14 HOH HOH B . 
D 2 HOH 13 513 21 HOH HOH B . 
D 2 HOH 14 514 45 HOH HOH B . 
D 2 HOH 15 515 49 HOH HOH B . 
D 2 HOH 16 516 53 HOH HOH B . 
D 2 HOH 17 517 56 HOH HOH B . 
D 2 HOH 18 518 58 HOH HOH B . 
D 2 HOH 19 519 66 HOH HOH B . 
D 2 HOH 20 520 67 HOH HOH B . 
D 2 HOH 21 521 68 HOH HOH B . 
D 2 HOH 22 522 69 HOH HOH B . 
D 2 HOH 23 523 74 HOH HOH B . 
D 2 HOH 24 524 77 HOH HOH B . 
D 2 HOH 25 525 80 HOH HOH B . 
D 2 HOH 26 526 83 HOH HOH B . 
D 2 HOH 27 527 86 HOH HOH B . 
D 2 HOH 28 528 93 HOH HOH B . 
D 2 HOH 29 529 94 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C 
2 1 B,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-02 
2 'Structure model' 1 1 2015-11-18 
3 'Structure model' 1 2 2020-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Data collection'      
3 3 'Structure model' 'Database references'  
4 3 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' citation              
2 3 'Structure model' diffrn_source         
3 3 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_citation.journal_id_CSD'                  
2 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX    ? ? ? '(phenix.refine: 1.9_1692)' 1 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? .                           2 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000  ? ? ? .                           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER    ? ? ? .                           4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 B ASP 42  ? ? OG B SER 44  ? ? 2.06 
2 1 NE2 A GLN 284 ? ? O  A HOH 559 ? ? 2.13 
3 1 NE2 A GLN 337 ? ? O  A HOH 501 ? ? 2.16 
4 1 OE2 A GLU 165 ? ? O  A HOH 560 ? ? 2.18 
5 1 O   B GLY 384 ? ? OG B SER 387 ? ? 2.19 
6 1 O   B LYS 18  ? ? O  B HOH 519 ? ? 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 3   ? ? -59.54  107.45  
2  1 HIS A 25  ? ? 53.68   70.35   
3  1 ASN A 32  ? ? -63.56  -72.39  
4  1 SER A 35  ? ? -129.07 -165.69 
5  1 THR A 54  ? ? -106.00 -69.34  
6  1 ASN A 142 ? ? -172.83 -171.25 
7  1 HIS A 150 ? ? -59.14  179.70  
8  1 VAL A 152 ? ? -50.46  107.95  
9  1 ASN A 215 ? ? -153.83 76.19   
10 1 ASN A 265 ? ? -152.00 32.24   
11 1 PRO A 339 ? ? -66.05  76.26   
12 1 ASN A 370 ? ? -62.44  74.07   
13 1 PRO A 401 ? ? -37.70  -36.05  
14 1 ASP A 420 ? ? -25.92  122.36  
15 1 ASN A 425 ? ? 24.31   70.16   
16 1 CYS A 465 ? ? -170.94 136.70  
17 1 ASN A 479 ? ? -105.17 59.95   
18 1 SER B 35  ? ? -125.39 -157.41 
19 1 LYS B 72  ? ? -29.98  -53.81  
20 1 TRP B 95  ? ? -38.00  -39.25  
21 1 ASN B 99  ? ? -152.53 35.29   
22 1 HIS B 150 ? ? -57.81  174.23  
23 1 ASP B 155 ? ? -121.77 -125.86 
24 1 TYR B 156 ? ? 87.71   89.33   
25 1 LYS B 209 ? ? -68.37  70.85   
26 1 HIS B 245 ? ? -68.44  5.92    
27 1 LYS B 294 ? ? -151.58 7.22    
28 1 PRO B 322 ? ? -58.46  -3.44   
29 1 PRO B 339 ? ? -67.96  69.79   
30 1 ASN B 370 ? ? -54.57  93.44   
31 1 VAL B 395 ? ? -120.39 -54.57  
32 1 ASN B 479 ? ? -147.30 -155.94 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 203 ? CG  ? A ARG 203 CG  
2  1 Y 1 A ARG 203 ? CD  ? A ARG 203 CD  
3  1 Y 1 A ARG 203 ? NE  ? A ARG 203 NE  
4  1 Y 1 A ARG 203 ? CZ  ? A ARG 203 CZ  
5  1 Y 1 A ARG 203 ? NH1 ? A ARG 203 NH1 
6  1 Y 1 A ARG 203 ? NH2 ? A ARG 203 NH2 
7  1 Y 1 A LYS 246 ? CG  ? A LYS 246 CG  
8  1 Y 1 A LYS 246 ? CD  ? A LYS 246 CD  
9  1 Y 1 A LYS 246 ? CE  ? A LYS 246 CE  
10 1 Y 1 A LYS 246 ? NZ  ? A LYS 246 NZ  
11 1 Y 1 A LYS 266 ? CG  ? A LYS 266 CG  
12 1 Y 1 A LYS 266 ? CD  ? A LYS 266 CD  
13 1 Y 1 A LYS 266 ? CE  ? A LYS 266 CE  
14 1 Y 1 A LYS 266 ? NZ  ? A LYS 266 NZ  
15 1 Y 1 A ASP 271 ? CG  ? A ASP 271 CG  
16 1 Y 1 A ASP 271 ? OD1 ? A ASP 271 OD1 
17 1 Y 1 A ASP 271 ? OD2 ? A ASP 271 OD2 
18 1 Y 1 B LYS 253 ? CG  ? B LYS 253 CG  
19 1 Y 1 B LYS 253 ? CD  ? B LYS 253 CD  
20 1 Y 1 B LYS 253 ? CE  ? B LYS 253 CE  
21 1 Y 1 B LYS 253 ? NZ  ? B LYS 253 NZ  
22 1 Y 1 B LYS 266 ? CG  ? B LYS 266 CG  
23 1 Y 1 B LYS 266 ? CD  ? B LYS 266 CD  
24 1 Y 1 B LYS 266 ? CE  ? B LYS 266 CE  
25 1 Y 1 B LYS 266 ? NZ  ? B LYS 266 NZ  
26 1 Y 1 B LYS 294 ? CG  ? B LYS 294 CG  
27 1 Y 1 B LYS 294 ? CD  ? B LYS 294 CD  
28 1 Y 1 B LYS 294 ? CE  ? B LYS 294 CE  
29 1 Y 1 B LYS 294 ? NZ  ? B LYS 294 NZ  
30 1 Y 1 B SER 295 ? OG  ? B SER 295 OG  
31 1 Y 1 B SER 296 ? OG  ? B SER 296 OG  
32 1 Y 1 B LYS 343 ? CG  ? B LYS 343 CG  
33 1 Y 1 B LYS 343 ? CD  ? B LYS 343 CD  
34 1 Y 1 B LYS 343 ? CE  ? B LYS 343 CE  
35 1 Y 1 B LYS 343 ? NZ  ? B LYS 343 NZ  
36 1 Y 1 B LYS 344 ? CG  ? B LYS 344 CG  
37 1 Y 1 B LYS 344 ? CD  ? B LYS 344 CD  
38 1 Y 1 B LYS 344 ? CE  ? B LYS 344 CE  
39 1 Y 1 B LYS 344 ? NZ  ? B LYS 344 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 183 ? A GLY 183 
2  1 Y 1 A ASN 184 ? A ASN 184 
3  1 Y 1 A GLY 185 ? A GLY 185 
4  1 Y 1 A ASP 186 ? A ASP 186 
5  1 Y 1 A ASP 187 ? A ASP 187 
6  1 Y 1 A ALA 188 ? A ALA 188 
7  1 Y 1 A GLY 189 ? A GLY 189 
8  1 Y 1 A LYS 190 ? A LYS 190 
9  1 Y 1 A LYS 191 ? A LYS 191 
10 1 Y 1 A GLY 192 ? A GLY 192 
11 1 Y 1 A PRO 193 ? A PRO 193 
12 1 Y 1 A VAL 194 ? A VAL 194 
13 1 Y 1 A SER 195 ? A SER 195 
14 1 Y 1 A ARG 196 ? A ARG 196 
15 1 Y 1 A GLU 197 ? A GLU 197 
16 1 Y 1 B LEU 180 ? B LEU 180 
17 1 Y 1 B LEU 181 ? B LEU 181 
18 1 Y 1 B ASN 182 ? B ASN 182 
19 1 Y 1 B GLY 183 ? B GLY 183 
20 1 Y 1 B ASN 184 ? B ASN 184 
21 1 Y 1 B GLY 185 ? B GLY 185 
22 1 Y 1 B ASP 186 ? B ASP 186 
23 1 Y 1 B ASP 187 ? B ASP 187 
24 1 Y 1 B ALA 188 ? B ALA 188 
25 1 Y 1 B GLY 189 ? B GLY 189 
26 1 Y 1 B LYS 190 ? B LYS 190 
27 1 Y 1 B LYS 191 ? B LYS 191 
28 1 Y 1 B GLY 192 ? B GLY 192 
29 1 Y 1 B PRO 193 ? B PRO 193 
30 1 Y 1 B VAL 194 ? B VAL 194 
31 1 Y 1 B SER 446 ? B SER 446 
32 1 Y 1 B ILE 482 ? B ILE 482 
33 1 Y 1 B VAL 483 ? B VAL 483 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#