data_4Y05
# 
_entry.id   4Y05 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Y05         
WWPDB D_1000206626 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4Y05 
_pdbx_database_status.recvd_initial_deposition_date   2015-02-05 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Wang, W.'    1 
'Knossow, M.' 2 
'Gigant, B.'  3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                18721 
_citation.page_last                 18731 
_citation.title                     
'New Insights into the Coupling between Microtubule Depolymerization and ATP Hydrolysis by Kinesin-13 Protein Kif2C.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M115.646919 
_citation.pdbx_database_id_PubMed   26055718 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Wang, W.'    1 ? 
primary 'Shen, T.'    2 ? 
primary 'Guerois, R.' 3 ? 
primary 'Zhang, F.'   4 ? 
primary 'Kuerban, H.' 5 ? 
primary 'Lv, Y.'      6 ? 
primary 'Gigant, B.'  7 ? 
primary 'Knossow, M.' 8 ? 
primary 'Wang, C.'    9 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4Y05 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     83.889 
_cell.length_a_esd                 ? 
_cell.length_b                     83.889 
_cell.length_b_esd                 ? 
_cell.length_c                     147.872 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4Y05 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Kinesin-like protein KIF2C' 43433.555 1  ? 
'R330A R379A P294deleted K295deleted L296deleted L300deleted T301deleted K302deleted' 'UNP residues 216-599' 
'The construct has a C-terminal His-tag.' 
2 non-polymer syn 'MAGNESIUM ION'              24.305    1  ? ? ?                      ?                                         
3 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"   427.201   1  ? ? ?                      ?                                         
4 non-polymer syn 'SULFATE ION'                96.063    3  ? ? ?                      ?                                         
5 water       nat water                        18.015    52 ? ? ?                      ?                                         
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Kinesin-like protein 6,Mitotic centromere-associated kinesin,MCAK' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTMTDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHE
KVDYLENQAFCFDFAFDETASNEVVYRFTAAPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSGKAQNASKGIYAMASA
DVFLLKNQPCYRKLGLEVYVTFFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSACRTSG
QTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPF
RESKLTQVLRDSFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGRMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTMTDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHE
KVDYLENQAFCFDFAFDETASNEVVYRFTAAPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSGKAQNASKGIYAMASA
DVFLLKNQPCYRKLGLEVYVTFFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSACRTSG
QTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKAHTPF
RESKLTQVLRDSFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ARG n 
1 4   MET n 
1 5   LYS n 
1 6   ARG n 
1 7   ALA n 
1 8   GLN n 
1 9   GLU n 
1 10  TYR n 
1 11  ASP n 
1 12  SER n 
1 13  SER n 
1 14  PHE n 
1 15  PRO n 
1 16  ASN n 
1 17  TRP n 
1 18  GLU n 
1 19  PHE n 
1 20  ALA n 
1 21  ARG n 
1 22  MET n 
1 23  ILE n 
1 24  LYS n 
1 25  GLU n 
1 26  PHE n 
1 27  ARG n 
1 28  ALA n 
1 29  THR n 
1 30  LEU n 
1 31  GLU n 
1 32  CYS n 
1 33  HIS n 
1 34  PRO n 
1 35  LEU n 
1 36  THR n 
1 37  MET n 
1 38  THR n 
1 39  ASP n 
1 40  PRO n 
1 41  ILE n 
1 42  GLU n 
1 43  GLU n 
1 44  HIS n 
1 45  ARG n 
1 46  ILE n 
1 47  CYS n 
1 48  VAL n 
1 49  CYS n 
1 50  VAL n 
1 51  ARG n 
1 52  LYS n 
1 53  ARG n 
1 54  PRO n 
1 55  LEU n 
1 56  ASN n 
1 57  LYS n 
1 58  GLN n 
1 59  GLU n 
1 60  LEU n 
1 61  ALA n 
1 62  LYS n 
1 63  LYS n 
1 64  GLU n 
1 65  ILE n 
1 66  ASP n 
1 67  VAL n 
1 68  ILE n 
1 69  SER n 
1 70  ILE n 
1 71  PRO n 
1 72  SER n 
1 73  LYS n 
1 74  CYS n 
1 75  LEU n 
1 76  LEU n 
1 77  LEU n 
1 78  VAL n 
1 79  HIS n 
1 80  GLU n 
1 81  LYS n 
1 82  VAL n 
1 83  ASP n 
1 84  TYR n 
1 85  LEU n 
1 86  GLU n 
1 87  ASN n 
1 88  GLN n 
1 89  ALA n 
1 90  PHE n 
1 91  CYS n 
1 92  PHE n 
1 93  ASP n 
1 94  PHE n 
1 95  ALA n 
1 96  PHE n 
1 97  ASP n 
1 98  GLU n 
1 99  THR n 
1 100 ALA n 
1 101 SER n 
1 102 ASN n 
1 103 GLU n 
1 104 VAL n 
1 105 VAL n 
1 106 TYR n 
1 107 ARG n 
1 108 PHE n 
1 109 THR n 
1 110 ALA n 
1 111 ALA n 
1 112 PRO n 
1 113 LEU n 
1 114 VAL n 
1 115 GLN n 
1 116 THR n 
1 117 ILE n 
1 118 PHE n 
1 119 GLU n 
1 120 GLY n 
1 121 GLY n 
1 122 LYS n 
1 123 ALA n 
1 124 THR n 
1 125 CYS n 
1 126 PHE n 
1 127 ALA n 
1 128 TYR n 
1 129 GLY n 
1 130 GLN n 
1 131 THR n 
1 132 GLY n 
1 133 SER n 
1 134 GLY n 
1 135 LYS n 
1 136 THR n 
1 137 HIS n 
1 138 THR n 
1 139 MET n 
1 140 GLY n 
1 141 GLY n 
1 142 ASP n 
1 143 LEU n 
1 144 SER n 
1 145 GLY n 
1 146 LYS n 
1 147 ALA n 
1 148 GLN n 
1 149 ASN n 
1 150 ALA n 
1 151 SER n 
1 152 LYS n 
1 153 GLY n 
1 154 ILE n 
1 155 TYR n 
1 156 ALA n 
1 157 MET n 
1 158 ALA n 
1 159 SER n 
1 160 ALA n 
1 161 ASP n 
1 162 VAL n 
1 163 PHE n 
1 164 LEU n 
1 165 LEU n 
1 166 LYS n 
1 167 ASN n 
1 168 GLN n 
1 169 PRO n 
1 170 CYS n 
1 171 TYR n 
1 172 ARG n 
1 173 LYS n 
1 174 LEU n 
1 175 GLY n 
1 176 LEU n 
1 177 GLU n 
1 178 VAL n 
1 179 TYR n 
1 180 VAL n 
1 181 THR n 
1 182 PHE n 
1 183 PHE n 
1 184 GLU n 
1 185 ILE n 
1 186 TYR n 
1 187 ASN n 
1 188 GLY n 
1 189 LYS n 
1 190 LEU n 
1 191 PHE n 
1 192 ASP n 
1 193 LEU n 
1 194 LEU n 
1 195 ASN n 
1 196 LYS n 
1 197 LYS n 
1 198 ALA n 
1 199 LYS n 
1 200 LEU n 
1 201 ARG n 
1 202 VAL n 
1 203 LEU n 
1 204 GLU n 
1 205 ASP n 
1 206 GLY n 
1 207 LYS n 
1 208 GLN n 
1 209 GLN n 
1 210 VAL n 
1 211 GLN n 
1 212 VAL n 
1 213 VAL n 
1 214 GLY n 
1 215 LEU n 
1 216 GLN n 
1 217 GLU n 
1 218 HIS n 
1 219 LEU n 
1 220 VAL n 
1 221 ASN n 
1 222 SER n 
1 223 ALA n 
1 224 ASP n 
1 225 ASP n 
1 226 VAL n 
1 227 ILE n 
1 228 LYS n 
1 229 MET n 
1 230 ILE n 
1 231 ASP n 
1 232 MET n 
1 233 GLY n 
1 234 SER n 
1 235 ALA n 
1 236 CYS n 
1 237 ARG n 
1 238 THR n 
1 239 SER n 
1 240 GLY n 
1 241 GLN n 
1 242 THR n 
1 243 PHE n 
1 244 ALA n 
1 245 ASN n 
1 246 SER n 
1 247 ASN n 
1 248 SER n 
1 249 SER n 
1 250 ARG n 
1 251 SER n 
1 252 HIS n 
1 253 ALA n 
1 254 CYS n 
1 255 PHE n 
1 256 GLN n 
1 257 ILE n 
1 258 ILE n 
1 259 LEU n 
1 260 ARG n 
1 261 ALA n 
1 262 LYS n 
1 263 GLY n 
1 264 ARG n 
1 265 MET n 
1 266 HIS n 
1 267 GLY n 
1 268 LYS n 
1 269 PHE n 
1 270 SER n 
1 271 LEU n 
1 272 VAL n 
1 273 ASP n 
1 274 LEU n 
1 275 ALA n 
1 276 GLY n 
1 277 ASN n 
1 278 GLU n 
1 279 ARG n 
1 280 GLY n 
1 281 ALA n 
1 282 ASP n 
1 283 THR n 
1 284 SER n 
1 285 SER n 
1 286 ALA n 
1 287 ASP n 
1 288 ARG n 
1 289 GLN n 
1 290 THR n 
1 291 ARG n 
1 292 MET n 
1 293 GLU n 
1 294 GLY n 
1 295 ALA n 
1 296 GLU n 
1 297 ILE n 
1 298 ASN n 
1 299 LYS n 
1 300 SER n 
1 301 LEU n 
1 302 LEU n 
1 303 ALA n 
1 304 LEU n 
1 305 LYS n 
1 306 GLU n 
1 307 CYS n 
1 308 ILE n 
1 309 ARG n 
1 310 ALA n 
1 311 LEU n 
1 312 GLY n 
1 313 GLN n 
1 314 ASN n 
1 315 LYS n 
1 316 ALA n 
1 317 HIS n 
1 318 THR n 
1 319 PRO n 
1 320 PHE n 
1 321 ARG n 
1 322 GLU n 
1 323 SER n 
1 324 LYS n 
1 325 LEU n 
1 326 THR n 
1 327 GLN n 
1 328 VAL n 
1 329 LEU n 
1 330 ARG n 
1 331 ASP n 
1 332 SER n 
1 333 PHE n 
1 334 ILE n 
1 335 GLY n 
1 336 GLU n 
1 337 ASN n 
1 338 SER n 
1 339 ARG n 
1 340 THR n 
1 341 CYS n 
1 342 MET n 
1 343 ILE n 
1 344 ALA n 
1 345 THR n 
1 346 ILE n 
1 347 SER n 
1 348 PRO n 
1 349 GLY n 
1 350 ILE n 
1 351 SER n 
1 352 SER n 
1 353 CYS n 
1 354 GLU n 
1 355 TYR n 
1 356 THR n 
1 357 LEU n 
1 358 ASN n 
1 359 THR n 
1 360 LEU n 
1 361 ARG n 
1 362 TYR n 
1 363 ALA n 
1 364 ASP n 
1 365 ARG n 
1 366 VAL n 
1 367 LYS n 
1 368 GLU n 
1 369 LEU n 
1 370 SER n 
1 371 PRO n 
1 372 HIS n 
1 373 SER n 
1 374 GLY n 
1 375 PRO n 
1 376 SER n 
1 377 GLY n 
1 378 GLU n 
1 379 GLN n 
1 380 LEU n 
1 381 GLU n 
1 382 HIS n 
1 383 HIS n 
1 384 HIS n 
1 385 HIS n 
1 386 HIS n 
1 387 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   387 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'KIF2C, KNSL6' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       PET28A 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KIF2C_HUMAN 
_struct_ref.pdbx_db_accession          Q99661 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RMKRAQEYDSSFPNWEFARMIKEFRATLECHPLTMTDPIEEHRICVCVRKRPLNKQELAKKEIDVISIPSKCLLLVHEPK
LKVDLTKYLENQAFCFDFAFDETASNEVVYRFTARPLVQTIFEGGKATCFAYGQTGSGKTHTMGGDLSGKAQNASKGIYA
MASRDVFLLKNQPCYRKLGLEVYVTFFEIYNGKLFDLLNKKAKLRVLEDGKQQVQVVGLQEHLVNSADDVIKMIDMGSAC
RTSGQTFANSNSSRSHACFQIILRAKGRMHGKFSLVDLAGNERGADTSSADRQTRMEGAEINKSLLALKECIRALGQNKA
HTPFRESKLTQVLRDSFIGENSRTCMIATISPGISSCEYTLNTLRYADRVKELSPHSGPSGEQL
;
_struct_ref.pdbx_align_begin           216 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4Y05 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 380 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q99661 
_struct_ref_seq.db_align_beg                  216 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  599 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       216 
_struct_ref_seq.pdbx_auth_seq_align_end       599 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Y05 MET A 1   ? UNP Q99661 ?   ?   'initiating methionine' 214 1  
1 4Y05 GLY A 2   ? UNP Q99661 ?   ?   'expression tag'        215 2  
1 4Y05 ?   A ?   ? UNP Q99661 PRO 294 deletion                ?   3  
1 4Y05 ?   A ?   ? UNP Q99661 LYS 295 deletion                ?   4  
1 4Y05 ?   A ?   ? UNP Q99661 LEU 296 deletion                ?   5  
1 4Y05 ?   A ?   ? UNP Q99661 LEU 300 deletion                ?   6  
1 4Y05 ?   A ?   ? UNP Q99661 THR 301 deletion                ?   7  
1 4Y05 ?   A ?   ? UNP Q99661 LYS 302 deletion                ?   8  
1 4Y05 ALA A 111 ? UNP Q99661 ARG 330 'engineered mutation'   330 9  
1 4Y05 ALA A 160 ? UNP Q99661 ARG 379 'engineered mutation'   379 10 
1 4Y05 GLU A 381 ? UNP Q99661 ?   ?   'expression tag'        600 11 
1 4Y05 HIS A 382 ? UNP Q99661 ?   ?   'expression tag'        601 12 
1 4Y05 HIS A 383 ? UNP Q99661 ?   ?   'expression tag'        602 13 
1 4Y05 HIS A 384 ? UNP Q99661 ?   ?   'expression tag'        603 14 
1 4Y05 HIS A 385 ? UNP Q99661 ?   ?   'expression tag'        604 15 
1 4Y05 HIS A 386 ? UNP Q99661 ?   ?   'expression tag'        605 16 
1 4Y05 HIS A 387 ? UNP Q99661 ?   ?   'expression tag'        606 17 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE" ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'            ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                   ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                  ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                      ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                     ? 'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'              ? 'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                     ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4Y05 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.000 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.000 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M AMMONIUM SULFATE, 10% ETHYLENEGLYCOL, 0.1M TRIS-HCL PH8.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-03-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9790 1.0 
2 0.979  1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SOLEIL BEAMLINE PROXIMA 1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'PROXIMA 1' 
_diffrn_source.pdbx_synchrotron_site       SOLEIL 
# 
_reflns.B_iso_Wilson_estimate            95.270 
_reflns.entry_id                         4Y05 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.590 
_reflns.d_resolution_low                 42.500 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       17175 
_reflns.number_obs                       17174 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.700 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.600 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.053 
_reflns.pdbx_netI_over_av_sigmaI         8.663 
_reflns.pdbx_netI_over_sigmaI            27.600 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.054 
_reflns.pdbx_Rpim_I_all                  0.015 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         234047 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.590 
_reflns_shell.d_res_low                   2.730 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.400 
_reflns_shell.number_measured_all         7349 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           643 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.000 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             11.400 
_reflns_shell.pdbx_Rsym_value             1.220 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   75.800 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.009 
_reflns_shell.pdbx_rejects                0 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -5.1664 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -5.1664 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            10.3329 
_refine.B_iso_max                                218.810 
_refine.B_iso_mean                               103.1100 
_refine.B_iso_min                                55.380 
_refine.correlation_coeff_Fo_to_Fc               0.9542 
_refine.correlation_coeff_Fo_to_Fc_free          0.9524 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4Y05 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.5900 
_refine.ls_d_res_low                             24.7200 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     17069 
_refine.ls_number_reflns_R_free                  871 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9400 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1928 
_refine.ls_R_factor_R_free                       0.2042 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1922 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2HEH 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.2060 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.2080 
_refine.pdbx_overall_SU_R_Blow_DPI               0.3290 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.3130 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        4Y05 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.496 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.5900 
_refine_hist.d_res_low                        24.7200 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             52 
_refine_hist.number_atoms_total               2607 
_refine_hist.pdbx_number_residues_total       330 
_refine_hist.pdbx_B_iso_mean_ligand           130.49 
_refine_hist.pdbx_B_iso_mean_solvent          82.01 
_refine_hist.pdbx_number_atoms_protein        2512 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? ?      ? 906  ? t_dihedral_angle_d        2.000  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?      ? 60   ? t_trig_c_planes           2.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 397  ? t_gen_planes              5.000  HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 2619 ? t_it                      20.000 HARMONIC     
'X-RAY DIFFRACTION' ? ?      ? 0    ? t_nbd                     5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_improper_torsion        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_pseud_angle             ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 354  ? t_chiral_improper_torsion 5.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_sum_occupancies         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_distance        ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_angle           ?      ?            
'X-RAY DIFFRACTION' ? ?      ? ?    ? t_utility_torsion         ?      ?            
'X-RAY DIFFRACTION' ? ?      ? 2933 ? t_ideal_dist_contact      4.000  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? 0.010  ? 2619 ? t_bond_d                  2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 1.150  ? 3549 ? t_angle_deg               2.000  HARMONIC     
'X-RAY DIFFRACTION' ? 3.600  ? ?    ? t_omega_torsion           ?      ?            
'X-RAY DIFFRACTION' ? 18.830 ? ?    ? t_other_torsion           ?      ?            
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.5900 
_refine_ls_shell.d_res_low                        2.7500 
_refine_ls_shell.number_reflns_all                2693 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             162 
_refine_ls_shell.number_reflns_R_work             2531 
_refine_ls_shell.percent_reflns_obs               99.9400 
_refine_ls_shell.percent_reflns_R_free            6.0200 
_refine_ls_shell.R_factor_all                     0.2326 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.2548 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2311 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   9 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     4Y05 
_struct.title                        'KIF2C short Loop2 construct' 
_struct.pdbx_descriptor              KIF2C 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4Y05 
_struct_keywords.text            'KINESIN-13, MICROTUBULE, TUBULIN, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLU A 18  ? LEU A 30  ? GLU A 231 LEU A 243 1 ? 13 
HELX_P HELX_P2  AA2 ASN A 56  ? LYS A 62  ? ASN A 269 LYS A 275 1 ? 7  
HELX_P HELX_P3  AA3 SER A 101 ? THR A 109 ? SER A 320 THR A 328 1 ? 9  
HELX_P HELX_P4  AA4 ALA A 110 ? GLU A 119 ? ALA A 329 GLU A 338 1 ? 10 
HELX_P HELX_P5  AA5 GLY A 134 ? GLY A 140 ? GLY A 353 GLY A 359 1 ? 7  
HELX_P HELX_P6  AA6 GLY A 153 ? ASN A 167 ? GLY A 372 ASN A 386 1 ? 15 
HELX_P HELX_P7  AA7 GLN A 168 ? LYS A 173 ? GLN A 387 LYS A 392 1 ? 6  
HELX_P HELX_P8  AA8 SER A 222 ? ARG A 237 ? SER A 441 ARG A 456 1 ? 16 
HELX_P HELX_P9  AA9 ASN A 247 ? SER A 251 ? ASN A 466 SER A 470 5 ? 5  
HELX_P HELX_P10 AB1 GLY A 294 ? GLN A 313 ? GLY A 513 GLN A 532 1 ? 20 
HELX_P HELX_P11 AB2 PRO A 319 ? GLU A 322 ? PRO A 538 GLU A 541 5 ? 4  
HELX_P HELX_P12 AB3 SER A 323 ? LEU A 329 ? SER A 542 LEU A 548 1 ? 7  
HELX_P HELX_P13 AB4 ARG A 330 ? ILE A 334 ? ARG A 549 ILE A 553 5 ? 5  
HELX_P HELX_P14 AB5 GLY A 349 ? SER A 351 ? GLY A 568 SER A 570 5 ? 3  
HELX_P HELX_P15 AB6 SER A 352 ? LYS A 367 ? SER A 571 LYS A 586 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A THR 136 OG1 ? ? ? 1_555 B MG  . MG  ? ? A THR 355 A MG  701 1_555 ? ? ? ? ? ? ? 1.980 ? 
metalc2 metalc ? ? B MG  .   MG  ? ? ? 1_555 C ADP . O1B ? ? A MG  701 A ADP 702 1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc3 metalc ? ? B MG  .   MG  ? ? ? 1_555 G HOH . O   ? ? A MG  701 A HOH 814 1_555 ? ? ? ? ? ? ? 2.155 ? 
metalc4 metalc ? ? B MG  .   MG  ? ? ? 1_555 G HOH . O   ? ? A MG  701 A HOH 815 1_555 ? ? ? ? ? ? ? 2.153 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 VAL 82  A . ? VAL 298 A ASP 83  A ? ASP 299 A 1 -12.86 
2 LYS 152 A . ? LYS 371 A GLY 153 A ? GLY 372 A 1 7.56   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 10 ? 
AA2 ? 8  ? 
AA3 ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2  ? parallel      
AA1 2 3  ? parallel      
AA1 3 4  ? parallel      
AA1 4 5  ? parallel      
AA1 5 6  ? anti-parallel 
AA1 6 7  ? anti-parallel 
AA1 7 8  ? anti-parallel 
AA1 8 9  ? anti-parallel 
AA1 9 10 ? anti-parallel 
AA2 1 2  ? parallel      
AA2 2 3  ? parallel      
AA2 3 4  ? parallel      
AA2 4 5  ? parallel      
AA2 5 6  ? anti-parallel 
AA2 6 7  ? anti-parallel 
AA2 7 8  ? anti-parallel 
AA3 1 2  ? anti-parallel 
AA3 2 3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  PHE A 94  ? PHE A 96  ? PHE A 313 PHE A 315 
AA1 2  ILE A 46  ? LYS A 52  ? ILE A 259 LYS A 265 
AA1 3  SER A 338 ? ILE A 346 ? SER A 557 ILE A 565 
AA1 4  LYS A 122 ? TYR A 128 ? LYS A 341 TYR A 347 
AA1 5  MET A 265 ? ASP A 273 ? MET A 484 ASP A 492 
AA1 6  HIS A 252 ? ARG A 260 ? HIS A 471 ARG A 479 
AA1 7  GLU A 177 ? TYR A 186 ? GLU A 396 TYR A 405 
AA1 8  LYS A 189 ? ASP A 192 ? LYS A 408 ASP A 411 
AA1 9  ALA A 198 ? GLU A 204 ? ALA A 417 GLU A 423 
AA1 10 VAL A 210 ? VAL A 213 ? VAL A 429 VAL A 432 
AA2 1  PHE A 94  ? PHE A 96  ? PHE A 313 PHE A 315 
AA2 2  ILE A 46  ? LYS A 52  ? ILE A 259 LYS A 265 
AA2 3  SER A 338 ? ILE A 346 ? SER A 557 ILE A 565 
AA2 4  LYS A 122 ? TYR A 128 ? LYS A 341 TYR A 347 
AA2 5  MET A 265 ? ASP A 273 ? MET A 484 ASP A 492 
AA2 6  HIS A 252 ? ARG A 260 ? HIS A 471 ARG A 479 
AA2 7  GLU A 177 ? TYR A 186 ? GLU A 396 TYR A 405 
AA2 8  HIS A 218 ? VAL A 220 ? HIS A 437 VAL A 439 
AA3 1  ILE A 68  ? SER A 69  ? ILE A 281 SER A 282 
AA3 2  LEU A 75  ? LYS A 81  ? LEU A 288 LYS A 297 
AA3 3  LEU A 85  ? CYS A 91  ? LEU A 304 CYS A 310 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2  O PHE A 96  ? O PHE A 315 N VAL A 50  ? N VAL A 263 
AA1 2 3  N CYS A 49  ? N CYS A 262 O MET A 342 ? O MET A 561 
AA1 3 4  O ILE A 343 ? O ILE A 562 N PHE A 126 ? N PHE A 345 
AA1 4 5  N CYS A 125 ? N CYS A 344 O VAL A 272 ? O VAL A 491 
AA1 5 6  O HIS A 266 ? O HIS A 485 N LEU A 259 ? N LEU A 478 
AA1 6 7  O CYS A 254 ? O CYS A 473 N PHE A 183 ? N PHE A 402 
AA1 7 8  N TYR A 186 ? N TYR A 405 O LYS A 189 ? O LYS A 408 
AA1 8 9  N ASP A 192 ? N ASP A 411 O ALA A 198 ? O ALA A 417 
AA1 9 10 N ARG A 201 ? N ARG A 420 O VAL A 213 ? O VAL A 432 
AA2 1 2  O PHE A 96  ? O PHE A 315 N VAL A 50  ? N VAL A 263 
AA2 2 3  N CYS A 49  ? N CYS A 262 O MET A 342 ? O MET A 561 
AA2 3 4  O ILE A 343 ? O ILE A 562 N PHE A 126 ? N PHE A 345 
AA2 4 5  N CYS A 125 ? N CYS A 344 O VAL A 272 ? O VAL A 491 
AA2 5 6  O HIS A 266 ? O HIS A 485 N LEU A 259 ? N LEU A 478 
AA2 6 7  O CYS A 254 ? O CYS A 473 N PHE A 183 ? N PHE A 402 
AA2 7 8  N VAL A 180 ? N VAL A 399 O HIS A 218 ? O HIS A 437 
AA3 1 2  N SER A 69  ? N SER A 282 O LEU A 77  ? O LEU A 290 
AA3 2 3  N VAL A 78  ? N VAL A 291 O GLN A 88  ? O GLN A 307 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  701 ? 4  'binding site for residue MG A 701'  
AC2 Software A ADP 702 ? 14 'binding site for residue ADP A 702' 
AC3 Software A SO4 703 ? 1  'binding site for residue SO4 A 703' 
AC4 Software A SO4 704 ? 6  'binding site for residue SO4 A 704' 
AC5 Software A SO4 705 ? 1  'binding site for residue SO4 A 705' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  THR A 136 ? THR A 355 . ? 1_555 ? 
2  AC1 4  ADP C .   ? ADP A 702 . ? 1_555 ? 
3  AC1 4  HOH G .   ? HOH A 814 . ? 1_555 ? 
4  AC1 4  HOH G .   ? HOH A 815 . ? 1_555 ? 
5  AC2 14 ARG A 51  ? ARG A 264 . ? 1_555 ? 
6  AC2 14 ARG A 53  ? ARG A 266 . ? 1_555 ? 
7  AC2 14 PRO A 54  ? PRO A 267 . ? 1_555 ? 
8  AC2 14 GLN A 130 ? GLN A 349 . ? 1_555 ? 
9  AC2 14 THR A 131 ? THR A 350 . ? 1_555 ? 
10 AC2 14 GLY A 132 ? GLY A 351 . ? 1_555 ? 
11 AC2 14 SER A 133 ? SER A 352 . ? 1_555 ? 
12 AC2 14 GLY A 134 ? GLY A 353 . ? 1_555 ? 
13 AC2 14 LYS A 135 ? LYS A 354 . ? 1_555 ? 
14 AC2 14 THR A 136 ? THR A 355 . ? 1_555 ? 
15 AC2 14 HIS A 137 ? HIS A 356 . ? 1_555 ? 
16 AC2 14 MG  B .   ? MG  A 701 . ? 1_555 ? 
17 AC2 14 HOH G .   ? HOH A 815 . ? 1_555 ? 
18 AC2 14 HOH G .   ? HOH A 847 . ? 1_555 ? 
19 AC3 1  ARG A 260 ? ARG A 479 . ? 1_555 ? 
20 AC4 6  GLY A 188 ? GLY A 407 . ? 1_555 ? 
21 AC4 6  GLU A 296 ? GLU A 515 . ? 1_555 ? 
22 AC4 6  LYS A 299 ? LYS A 518 . ? 1_555 ? 
23 AC4 6  SER A 323 ? SER A 542 . ? 1_555 ? 
24 AC4 6  LYS A 324 ? LYS A 543 . ? 1_555 ? 
25 AC4 6  HOH G .   ? HOH A 821 . ? 1_555 ? 
26 AC5 1  ARG A 107 ? ARG A 326 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4Y05 
_atom_sites.fract_transf_matrix[1][1]   0.011921 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011921 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006763 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . PHE A 1 14  ? 22.056  9.580   27.037  1.00 174.91 ? 227 PHE A N     1 
ATOM   2    C  CA    . PHE A 1 14  ? 21.711  10.890  27.592  1.00 179.31 ? 227 PHE A CA    1 
ATOM   3    C  C     . PHE A 1 14  ? 20.192  11.223  27.668  1.00 182.42 ? 227 PHE A C     1 
ATOM   4    O  O     . PHE A 1 14  ? 19.801  11.830  28.673  1.00 183.22 ? 227 PHE A O     1 
ATOM   5    C  CB    . PHE A 1 14  ? 22.474  12.003  26.873  1.00 187.82 ? 227 PHE A CB    1 
ATOM   6    N  N     . PRO A 1 15  ? 19.317  10.874  26.671  1.00 176.73 ? 228 PRO A N     1 
ATOM   7    C  CA    . PRO A 1 15  ? 17.895  11.267  26.781  1.00 176.10 ? 228 PRO A CA    1 
ATOM   8    C  C     . PRO A 1 15  ? 17.089  10.631  27.927  1.00 172.35 ? 228 PRO A C     1 
ATOM   9    O  O     . PRO A 1 15  ? 16.814  11.334  28.912  1.00 173.43 ? 228 PRO A O     1 
ATOM   10   C  CB    . PRO A 1 15  ? 17.322  10.967  25.382  1.00 178.15 ? 228 PRO A CB    1 
ATOM   11   C  CG    . PRO A 1 15  ? 18.515  10.768  24.496  1.00 184.71 ? 228 PRO A CG    1 
ATOM   12   C  CD    . PRO A 1 15  ? 19.566  10.191  25.385  1.00 177.41 ? 228 PRO A CD    1 
ATOM   13   N  N     . ASN A 1 16  ? 16.717  9.315   27.802  1.00 160.65 ? 229 ASN A N     1 
ATOM   14   C  CA    . ASN A 1 16  ? 15.925  8.532   28.770  1.00 153.96 ? 229 ASN A CA    1 
ATOM   15   C  C     . ASN A 1 16  ? 16.575  8.290   30.121  1.00 152.55 ? 229 ASN A C     1 
ATOM   16   O  O     . ASN A 1 16  ? 17.061  7.199   30.420  1.00 147.18 ? 229 ASN A O     1 
ATOM   17   C  CB    . ASN A 1 16  ? 15.370  7.247   28.166  1.00 149.70 ? 229 ASN A CB    1 
ATOM   18   C  CG    . ASN A 1 16  ? 14.382  7.483   27.058  1.00 177.54 ? 229 ASN A CG    1 
ATOM   19   O  OD1   . ASN A 1 16  ? 13.330  8.104   27.251  1.00 177.49 ? 229 ASN A OD1   1 
ATOM   20   N  ND2   . ASN A 1 16  ? 14.693  6.979   25.872  1.00 167.18 ? 229 ASN A ND2   1 
ATOM   21   N  N     . TRP A 1 17  ? 16.575  9.363   30.921  1.00 152.00 ? 230 TRP A N     1 
ATOM   22   C  CA    . TRP A 1 17  ? 17.048  9.496   32.293  1.00 151.08 ? 230 TRP A CA    1 
ATOM   23   C  C     . TRP A 1 17  ? 18.302  8.665   32.643  1.00 145.26 ? 230 TRP A C     1 
ATOM   24   O  O     . TRP A 1 17  ? 19.174  8.384   31.806  1.00 143.87 ? 230 TRP A O     1 
ATOM   25   C  CB    . TRP A 1 17  ? 15.877  9.191   33.270  1.00 148.47 ? 230 TRP A CB    1 
ATOM   26   C  CG    . TRP A 1 17  ? 14.778  10.214  33.282  1.00 154.36 ? 230 TRP A CG    1 
ATOM   27   C  CD1   . TRP A 1 17  ? 13.833  10.415  32.317  1.00 159.10 ? 230 TRP A CD1   1 
ATOM   28   C  CD2   . TRP A 1 17  ? 14.463  11.118  34.348  1.00 157.69 ? 230 TRP A CD2   1 
ATOM   29   N  NE1   . TRP A 1 17  ? 12.989  11.439  32.687  1.00 163.45 ? 230 TRP A NE1   1 
ATOM   30   C  CE2   . TRP A 1 17  ? 13.343  11.879  33.936  1.00 166.08 ? 230 TRP A CE2   1 
ATOM   31   C  CE3   . TRP A 1 17  ? 15.031  11.380  35.604  1.00 159.67 ? 230 TRP A CE3   1 
ATOM   32   C  CZ2   . TRP A 1 17  ? 12.783  12.888  34.736  1.00 170.08 ? 230 TRP A CZ2   1 
ATOM   33   C  CZ3   . TRP A 1 17  ? 14.471  12.373  36.399  1.00 165.77 ? 230 TRP A CZ3   1 
ATOM   34   C  CH2   . TRP A 1 17  ? 13.361  13.116  35.965  1.00 170.52 ? 230 TRP A CH2   1 
ATOM   35   N  N     . GLU A 1 18  ? 18.372  8.314   33.919  1.00 135.27 ? 231 GLU A N     1 
ATOM   36   C  CA    . GLU A 1 18  ? 19.356  7.451   34.518  1.00 130.22 ? 231 GLU A CA    1 
ATOM   37   C  C     . GLU A 1 18  ? 18.754  6.044   34.414  1.00 124.01 ? 231 GLU A C     1 
ATOM   38   O  O     . GLU A 1 18  ? 19.188  5.138   35.127  1.00 119.88 ? 231 GLU A O     1 
ATOM   39   C  CB    . GLU A 1 18  ? 19.599  7.860   35.994  1.00 132.78 ? 231 GLU A CB    1 
ATOM   40   C  CG    . GLU A 1 18  ? 18.375  7.797   36.905  1.00 142.34 ? 231 GLU A CG    1 
ATOM   41   C  CD    . GLU A 1 18  ? 18.058  9.057   37.691  1.00 164.08 ? 231 GLU A CD    1 
ATOM   42   O  OE1   . GLU A 1 18  ? 16.880  9.480   37.667  1.00 158.12 ? 231 GLU A OE1   1 
ATOM   43   O  OE2   . GLU A 1 18  ? 18.968  9.603   38.356  1.00 157.57 ? 231 GLU A OE2   1 
ATOM   44   N  N     . PHE A 1 19  ? 17.726  5.861   33.533  1.00 116.13 ? 232 PHE A N     1 
ATOM   45   C  CA    . PHE A 1 19  ? 17.085  4.571   33.285  1.00 108.76 ? 232 PHE A CA    1 
ATOM   46   C  C     . PHE A 1 19  ? 18.108  3.565   32.754  1.00 105.63 ? 232 PHE A C     1 
ATOM   47   O  O     . PHE A 1 19  ? 18.170  2.437   33.258  1.00 100.53 ? 232 PHE A O     1 
ATOM   48   C  CB    . PHE A 1 19  ? 15.876  4.733   32.354  1.00 110.59 ? 232 PHE A CB    1 
ATOM   49   C  CG    . PHE A 1 19  ? 15.055  3.490   32.135  1.00 107.40 ? 232 PHE A CG    1 
ATOM   50   C  CD1   . PHE A 1 19  ? 14.599  2.737   33.212  1.00 107.75 ? 232 PHE A CD1   1 
ATOM   51   C  CD2   . PHE A 1 19  ? 14.696  3.097   30.857  1.00 107.58 ? 232 PHE A CD2   1 
ATOM   52   C  CE1   . PHE A 1 19  ? 13.843  1.585   33.005  1.00 104.97 ? 232 PHE A CE1   1 
ATOM   53   C  CE2   . PHE A 1 19  ? 13.911  1.963   30.654  1.00 106.87 ? 232 PHE A CE2   1 
ATOM   54   C  CZ    . PHE A 1 19  ? 13.497  1.210   31.727  1.00 102.43 ? 232 PHE A CZ    1 
ATOM   55   N  N     . ALA A 1 20  ? 18.967  3.999   31.815  1.00 102.98 ? 233 ALA A N     1 
ATOM   56   C  CA    . ALA A 1 20  ? 20.021  3.138   31.290  1.00 102.33 ? 233 ALA A CA    1 
ATOM   57   C  C     . ALA A 1 20  ? 21.019  2.732   32.393  1.00 108.14 ? 233 ALA A C     1 
ATOM   58   O  O     . ALA A 1 20  ? 21.469  1.582   32.420  1.00 105.50 ? 233 ALA A O     1 
ATOM   59   C  CB    . ALA A 1 20  ? 20.731  3.823   30.135  1.00 106.98 ? 233 ALA A CB    1 
ATOM   60   N  N     . ARG A 1 21  ? 21.322  3.661   33.324  1.00 109.12 ? 234 ARG A N     1 
ATOM   61   C  CA    . ARG A 1 21  ? 22.232  3.409   34.449  1.00 109.31 ? 234 ARG A CA    1 
ATOM   62   C  C     . ARG A 1 21  ? 21.639  2.365   35.392  1.00 109.63 ? 234 ARG A C     1 
ATOM   63   O  O     . ARG A 1 21  ? 22.349  1.451   35.810  1.00 106.90 ? 234 ARG A O     1 
ATOM   64   C  CB    . ARG A 1 21  ? 22.535  4.700   35.203  1.00 113.88 ? 234 ARG A CB    1 
ATOM   65   N  N     . MET A 1 22  ? 20.341  2.486   35.710  1.00 106.37 ? 235 MET A N     1 
ATOM   66   C  CA    . MET A 1 22  ? 19.646  1.534   36.576  1.00 103.67 ? 235 MET A CA    1 
ATOM   67   C  C     . MET A 1 22  ? 19.631  0.146   35.946  1.00 101.65 ? 235 MET A C     1 
ATOM   68   O  O     . MET A 1 22  ? 19.864  -0.834  36.651  1.00 100.66 ? 235 MET A O     1 
ATOM   69   C  CB    . MET A 1 22  ? 18.220  1.997   36.867  1.00 107.39 ? 235 MET A CB    1 
ATOM   70   C  CG    . MET A 1 22  ? 18.161  3.239   37.706  1.00 116.78 ? 235 MET A CG    1 
ATOM   71   S  SD    . MET A 1 22  ? 16.465  3.830   37.952  1.00 124.37 ? 235 MET A SD    1 
ATOM   72   C  CE    . MET A 1 22  ? 16.207  3.223   39.577  1.00 120.25 ? 235 MET A CE    1 
ATOM   73   N  N     . ILE A 1 23  ? 19.381  0.063   34.622  1.00 93.83  ? 236 ILE A N     1 
ATOM   74   C  CA    . ILE A 1 23  ? 19.376  -1.198  33.881  1.00 89.06  ? 236 ILE A CA    1 
ATOM   75   C  C     . ILE A 1 23  ? 20.777  -1.872  33.956  1.00 92.72  ? 236 ILE A C     1 
ATOM   76   O  O     . ILE A 1 23  ? 20.879  -3.063  34.280  1.00 90.09  ? 236 ILE A O     1 
ATOM   77   C  CB    . ILE A 1 23  ? 18.825  -1.001  32.441  1.00 91.09  ? 236 ILE A CB    1 
ATOM   78   C  CG1   . ILE A 1 23  ? 17.332  -0.608  32.479  1.00 89.79  ? 236 ILE A CG1   1 
ATOM   79   C  CG2   . ILE A 1 23  ? 19.013  -2.271  31.623  1.00 89.49  ? 236 ILE A CG2   1 
ATOM   80   C  CD1   . ILE A 1 23  ? 16.739  -0.187  31.175  1.00 92.01  ? 236 ILE A CD1   1 
ATOM   81   N  N     . LYS A 1 24  ? 21.845  -1.087  33.712  1.00 91.45  ? 237 LYS A N     1 
ATOM   82   C  CA    . LYS A 1 24  ? 23.229  -1.556  33.811  1.00 92.30  ? 237 LYS A CA    1 
ATOM   83   C  C     . LYS A 1 24  ? 23.552  -2.094  35.221  1.00 95.80  ? 237 LYS A C     1 
ATOM   84   O  O     . LYS A 1 24  ? 24.159  -3.159  35.348  1.00 95.96  ? 237 LYS A O     1 
ATOM   85   C  CB    . LYS A 1 24  ? 24.194  -0.435  33.422  1.00 99.03  ? 237 LYS A CB    1 
ATOM   86   C  CG    . LYS A 1 24  ? 25.525  -0.950  32.879  1.00 114.29 ? 237 LYS A CG    1 
ATOM   87   C  CD    . LYS A 1 24  ? 26.161  0.013   31.874  1.00 125.20 ? 237 LYS A CD    1 
ATOM   88   C  CE    . LYS A 1 24  ? 27.573  -0.384  31.520  1.00 135.77 ? 237 LYS A CE    1 
ATOM   89   N  NZ    . LYS A 1 24  ? 28.571  0.142   32.499  1.00 145.10 ? 237 LYS A NZ    1 
ATOM   90   N  N     . GLU A 1 25  ? 23.128  -1.376  36.273  1.00 91.94  ? 238 GLU A N     1 
ATOM   91   C  CA    . GLU A 1 25  ? 23.363  -1.813  37.651  1.00 90.31  ? 238 GLU A CA    1 
ATOM   92   C  C     . GLU A 1 25  ? 22.609  -3.099  37.937  1.00 88.15  ? 238 GLU A C     1 
ATOM   93   O  O     . GLU A 1 25  ? 23.121  -3.946  38.662  1.00 89.67  ? 238 GLU A O     1 
ATOM   94   C  CB    . GLU A 1 25  ? 22.949  -0.733  38.635  1.00 92.57  ? 238 GLU A CB    1 
ATOM   95   N  N     . PHE A 1 26  ? 21.405  -3.267  37.360  1.00 77.61  ? 239 PHE A N     1 
ATOM   96   C  CA    . PHE A 1 26  ? 20.644  -4.484  37.551  1.00 72.72  ? 239 PHE A CA    1 
ATOM   97   C  C     . PHE A 1 26  ? 21.371  -5.625  36.829  1.00 77.58  ? 239 PHE A C     1 
ATOM   98   O  O     . PHE A 1 26  ? 21.540  -6.690  37.406  1.00 77.81  ? 239 PHE A O     1 
ATOM   99   C  CB    . PHE A 1 26  ? 19.228  -4.308  37.040  1.00 72.15  ? 239 PHE A CB    1 
ATOM   100  C  CG    . PHE A 1 26  ? 18.320  -5.479  37.302  1.00 70.45  ? 239 PHE A CG    1 
ATOM   101  C  CD1   . PHE A 1 26  ? 17.399  -5.440  38.334  1.00 74.32  ? 239 PHE A CD1   1 
ATOM   102  C  CD2   . PHE A 1 26  ? 18.312  -6.578  36.450  1.00 68.74  ? 239 PHE A CD2   1 
ATOM   103  C  CE1   . PHE A 1 26  ? 16.517  -6.499  38.540  1.00 73.86  ? 239 PHE A CE1   1 
ATOM   104  C  CE2   . PHE A 1 26  ? 17.475  -7.652  36.693  1.00 70.47  ? 239 PHE A CE2   1 
ATOM   105  C  CZ    . PHE A 1 26  ? 16.558  -7.597  37.718  1.00 69.54  ? 239 PHE A CZ    1 
ATOM   106  N  N     . ARG A 1 27  ? 21.829  -5.407  35.596  1.00 74.16  ? 240 ARG A N     1 
ATOM   107  C  CA    . ARG A 1 27  ? 22.551  -6.429  34.842  1.00 72.62  ? 240 ARG A CA    1 
ATOM   108  C  C     . ARG A 1 27  ? 23.856  -6.884  35.525  1.00 75.11  ? 240 ARG A C     1 
ATOM   109  O  O     . ARG A 1 27  ? 24.128  -8.078  35.542  1.00 74.37  ? 240 ARG A O     1 
ATOM   110  C  CB    . ARG A 1 27  ? 22.765  -5.969  33.397  1.00 71.65  ? 240 ARG A CB    1 
ATOM   111  C  CG    . ARG A 1 27  ? 21.474  -5.963  32.584  1.00 71.98  ? 240 ARG A CG    1 
ATOM   112  C  CD    . ARG A 1 27  ? 21.683  -5.423  31.184  1.00 71.13  ? 240 ARG A CD    1 
ATOM   113  N  NE    . ARG A 1 27  ? 20.507  -5.669  30.365  1.00 67.68  ? 240 ARG A NE    1 
ATOM   114  C  CZ    . ARG A 1 27  ? 20.024  -4.850  29.429  1.00 81.22  ? 240 ARG A CZ    1 
ATOM   115  N  NH1   . ARG A 1 27  ? 20.647  -3.714  29.142  1.00 75.12  ? 240 ARG A NH1   1 
ATOM   116  N  NH2   . ARG A 1 27  ? 18.920  -5.169  28.767  1.00 69.50  ? 240 ARG A NH2   1 
ATOM   117  N  N     . ALA A 1 28  ? 24.600  -5.965  36.158  1.00 73.15  ? 241 ALA A N     1 
ATOM   118  C  CA    . ALA A 1 28  ? 25.870  -6.276  36.864  1.00 74.45  ? 241 ALA A CA    1 
ATOM   119  C  C     . ALA A 1 28  ? 25.708  -7.198  38.085  1.00 78.52  ? 241 ALA A C     1 
ATOM   120  O  O     . ALA A 1 28  ? 26.601  -7.998  38.376  1.00 80.59  ? 241 ALA A O     1 
ATOM   121  C  CB    . ALA A 1 28  ? 26.614  -5.006  37.239  1.00 76.65  ? 241 ALA A CB    1 
ATOM   122  N  N     . THR A 1 29  ? 24.544  -7.146  38.725  1.00 73.80  ? 242 THR A N     1 
ATOM   123  C  CA    . THR A 1 29  ? 24.176  -7.947  39.899  1.00 74.00  ? 242 THR A CA    1 
ATOM   124  C  C     . THR A 1 29  ? 23.564  -9.272  39.498  1.00 77.53  ? 242 THR A C     1 
ATOM   125  O  O     . THR A 1 29  ? 23.601  -10.216 40.281  1.00 78.03  ? 242 THR A O     1 
ATOM   126  C  CB    . THR A 1 29  ? 23.122  -7.184  40.742  1.00 87.89  ? 242 THR A CB    1 
ATOM   127  O  OG1   . THR A 1 29  ? 23.470  -5.803  40.818  1.00 91.36  ? 242 THR A OG1   1 
ATOM   128  C  CG2   . THR A 1 29  ? 22.928  -7.773  42.150  1.00 86.92  ? 242 THR A CG2   1 
ATOM   129  N  N     . LEU A 1 30  ? 22.923  -9.309  38.339  1.00 74.29  ? 243 LEU A N     1 
ATOM   130  C  CA    . LEU A 1 30  ? 22.244  -10.488 37.839  1.00 74.12  ? 243 LEU A CA    1 
ATOM   131  C  C     . LEU A 1 30  ? 23.264  -11.550 37.424  1.00 83.05  ? 243 LEU A C     1 
ATOM   132  O  O     . LEU A 1 30  ? 24.054  -11.320 36.513  1.00 85.01  ? 243 LEU A O     1 
ATOM   133  C  CB    . LEU A 1 30  ? 21.360  -10.066 36.646  1.00 71.43  ? 243 LEU A CB    1 
ATOM   134  C  CG    . LEU A 1 30  ? 20.361  -11.028 36.083  1.00 71.43  ? 243 LEU A CG    1 
ATOM   135  C  CD1   . LEU A 1 30  ? 19.257  -11.278 37.054  1.00 70.43  ? 243 LEU A CD1   1 
ATOM   136  C  CD2   . LEU A 1 30  ? 19.740  -10.438 34.820  1.00 66.18  ? 243 LEU A CD2   1 
ATOM   137  N  N     . GLU A 1 31  ? 23.276  -12.670 38.138  1.00 79.93  ? 244 GLU A N     1 
ATOM   138  C  CA    . GLU A 1 31  ? 24.075  -13.836 37.813  1.00 82.73  ? 244 GLU A CA    1 
ATOM   139  C  C     . GLU A 1 31  ? 23.193  -14.670 36.872  1.00 87.86  ? 244 GLU A C     1 
ATOM   140  O  O     . GLU A 1 31  ? 22.057  -14.992 37.222  1.00 89.23  ? 244 GLU A O     1 
ATOM   141  C  CB    . GLU A 1 31  ? 24.397  -14.591 39.089  1.00 86.45  ? 244 GLU A CB    1 
ATOM   142  C  CG    . GLU A 1 31  ? 25.137  -15.891 38.896  1.00 104.58 ? 244 GLU A CG    1 
ATOM   143  C  CD    . GLU A 1 31  ? 25.459  -16.582 40.203  1.00 132.63 ? 244 GLU A CD    1 
ATOM   144  O  OE1   . GLU A 1 31  ? 25.758  -15.884 41.204  1.00 109.85 ? 244 GLU A OE1   1 
ATOM   145  O  OE2   . GLU A 1 31  ? 25.462  -17.834 40.206  1.00 132.98 ? 244 GLU A OE2   1 
ATOM   146  N  N     . CYS A 1 32  ? 23.680  -14.966 35.668  1.00 83.65  ? 245 CYS A N     1 
ATOM   147  C  CA    . CYS A 1 32  ? 22.899  -15.648 34.631  1.00 82.14  ? 245 CYS A CA    1 
ATOM   148  C  C     . CYS A 1 32  ? 23.200  -17.119 34.416  1.00 84.01  ? 245 CYS A C     1 
ATOM   149  O  O     . CYS A 1 32  ? 24.303  -17.576 34.655  1.00 87.42  ? 245 CYS A O     1 
ATOM   150  C  CB    . CYS A 1 32  ? 22.930  -14.867 33.327  1.00 82.73  ? 245 CYS A CB    1 
ATOM   151  S  SG    . CYS A 1 32  ? 22.255  -13.198 33.469  1.00 85.15  ? 245 CYS A SG    1 
ATOM   152  N  N     . HIS A 1 33  ? 22.208  -17.877 33.975  1.00 77.40  ? 246 HIS A N     1 
ATOM   153  C  CA    . HIS A 1 33  ? 22.369  -19.325 33.707  1.00 78.51  ? 246 HIS A CA    1 
ATOM   154  C  C     . HIS A 1 33  ? 21.763  -19.594 32.321  1.00 81.92  ? 246 HIS A C     1 
ATOM   155  O  O     . HIS A 1 33  ? 20.645  -20.110 32.178  1.00 78.65  ? 246 HIS A O     1 
ATOM   156  C  CB    . HIS A 1 33  ? 21.716  -20.163 34.801  1.00 79.44  ? 246 HIS A CB    1 
ATOM   157  C  CG    . HIS A 1 33  ? 22.255  -19.870 36.165  1.00 85.14  ? 246 HIS A CG    1 
ATOM   158  N  ND1   . HIS A 1 33  ? 23.336  -20.580 36.680  1.00 90.71  ? 246 HIS A ND1   1 
ATOM   159  C  CD2   . HIS A 1 33  ? 21.848  -18.953 37.084  1.00 84.93  ? 246 HIS A CD2   1 
ATOM   160  C  CE1   . HIS A 1 33  ? 23.544  -20.078 37.885  1.00 90.53  ? 246 HIS A CE1   1 
ATOM   161  N  NE2   . HIS A 1 33  ? 22.666  -19.108 38.177  1.00 87.81  ? 246 HIS A NE2   1 
ATOM   162  N  N     . PRO A 1 34  ? 22.463  -19.153 31.268  1.00 81.95  ? 247 PRO A N     1 
ATOM   163  C  CA    . PRO A 1 34  ? 21.858  -19.244 29.948  1.00 81.57  ? 247 PRO A CA    1 
ATOM   164  C  C     . PRO A 1 34  ? 21.867  -20.646 29.382  1.00 85.64  ? 247 PRO A C     1 
ATOM   165  O  O     . PRO A 1 34  ? 22.471  -21.580 29.903  1.00 87.34  ? 247 PRO A O     1 
ATOM   166  C  CB    . PRO A 1 34  ? 22.661  -18.244 29.103  1.00 84.85  ? 247 PRO A CB    1 
ATOM   167  C  CG    . PRO A 1 34  ? 23.795  -17.721 30.025  1.00 90.85  ? 247 PRO A CG    1 
ATOM   168  C  CD    . PRO A 1 34  ? 23.836  -18.596 31.208  1.00 86.43  ? 247 PRO A CD    1 
ATOM   169  N  N     . LEU A 1 35  ? 21.131  -20.777 28.331  1.00 80.95  ? 248 LEU A N     1 
ATOM   170  C  CA    . LEU A 1 35  ? 21.017  -21.987 27.565  1.00 82.45  ? 248 LEU A CA    1 
ATOM   171  C  C     . LEU A 1 35  ? 22.301  -22.209 26.768  1.00 85.13  ? 248 LEU A C     1 
ATOM   172  O  O     . LEU A 1 35  ? 22.877  -21.259 26.239  1.00 82.57  ? 248 LEU A O     1 
ATOM   173  C  CB    . LEU A 1 35  ? 19.849  -21.757 26.617  1.00 80.62  ? 248 LEU A CB    1 
ATOM   174  C  CG    . LEU A 1 35  ? 19.501  -22.838 25.692  1.00 88.59  ? 248 LEU A CG    1 
ATOM   175  C  CD1   . LEU A 1 35  ? 18.752  -23.949 26.417  1.00 90.48  ? 248 LEU A CD1   1 
ATOM   176  C  CD2   . LEU A 1 35  ? 18.669  -22.282 24.620  1.00 90.34  ? 248 LEU A CD2   1 
ATOM   177  N  N     . THR A 1 36  ? 22.746  -23.466 26.701  1.00 84.41  ? 249 THR A N     1 
ATOM   178  C  CA    . THR A 1 36  ? 23.896  -23.867 25.909  1.00 88.33  ? 249 THR A CA    1 
ATOM   179  C  C     . THR A 1 36  ? 23.443  -24.997 25.003  1.00 95.05  ? 249 THR A C     1 
ATOM   180  O  O     . THR A 1 36  ? 22.395  -25.588 25.236  1.00 91.99  ? 249 THR A O     1 
ATOM   181  C  CB    . THR A 1 36  ? 25.116  -24.253 26.784  1.00 94.80  ? 249 THR A CB    1 
ATOM   182  O  OG1   . THR A 1 36  ? 24.905  -25.514 27.409  1.00 99.32  ? 249 THR A OG1   1 
ATOM   183  C  CG2   . THR A 1 36  ? 25.461  -23.210 27.808  1.00 82.20  ? 249 THR A CG2   1 
ATOM   184  N  N     . MET A 1 37  ? 24.283  -25.343 24.020  1.00 98.31  ? 250 MET A N     1 
ATOM   185  C  CA    . MET A 1 37  ? 24.049  -26.400 23.033  1.00 100.59 ? 250 MET A CA    1 
ATOM   186  C  C     . MET A 1 37  ? 24.086  -27.802 23.603  1.00 107.88 ? 250 MET A C     1 
ATOM   187  O  O     . MET A 1 37  ? 23.670  -28.729 22.932  1.00 109.57 ? 250 MET A O     1 
ATOM   188  C  CB    . MET A 1 37  ? 25.046  -26.271 21.875  1.00 106.60 ? 250 MET A CB    1 
ATOM   189  C  CG    . MET A 1 37  ? 24.711  -25.171 20.917  1.00 108.77 ? 250 MET A CG    1 
ATOM   190  S  SD    . MET A 1 37  ? 23.373  -25.608 19.776  1.00 112.62 ? 250 MET A SD    1 
ATOM   191  C  CE    . MET A 1 37  ? 24.266  -26.417 18.500  1.00 115.37 ? 250 MET A CE    1 
ATOM   192  N  N     . THR A 1 38  ? 24.609  -27.978 24.800  1.00 107.28 ? 251 THR A N     1 
ATOM   193  C  CA    . THR A 1 38  ? 24.683  -29.304 25.396  1.00 111.14 ? 251 THR A CA    1 
ATOM   194  C  C     . THR A 1 38  ? 23.499  -29.571 26.284  1.00 113.25 ? 251 THR A C     1 
ATOM   195  O  O     . THR A 1 38  ? 23.396  -30.675 26.813  1.00 115.13 ? 251 THR A O     1 
ATOM   196  C  CB    . THR A 1 38  ? 26.026  -29.494 26.126  1.00 120.80 ? 251 THR A CB    1 
ATOM   197  O  OG1   . THR A 1 38  ? 26.083  -28.652 27.293  1.00 116.15 ? 251 THR A OG1   1 
ATOM   198  C  CG2   . THR A 1 38  ? 27.210  -29.262 25.206  1.00 120.42 ? 251 THR A CG2   1 
ATOM   199  N  N     . ASP A 1 39  ? 22.626  -28.573 26.478  1.00 107.00 ? 252 ASP A N     1 
ATOM   200  C  CA    . ASP A 1 39  ? 21.467  -28.765 27.327  1.00 106.26 ? 252 ASP A CA    1 
ATOM   201  C  C     . ASP A 1 39  ? 20.578  -29.772 26.680  1.00 118.38 ? 252 ASP A C     1 
ATOM   202  O  O     . ASP A 1 39  ? 20.434  -29.704 25.467  1.00 118.32 ? 252 ASP A O     1 
ATOM   203  C  CB    . ASP A 1 39  ? 20.697  -27.462 27.531  1.00 101.82 ? 252 ASP A CB    1 
ATOM   204  C  CG    . ASP A 1 39  ? 21.299  -26.542 28.544  1.00 99.61  ? 252 ASP A CG    1 
ATOM   205  O  OD1   . ASP A 1 39  ? 22.098  -27.028 29.388  1.00 99.85  ? 252 ASP A OD1   1 
ATOM   206  O  OD2   . ASP A 1 39  ? 20.923  -25.344 28.547  1.00 101.74 ? 252 ASP A OD2   1 
ATOM   207  N  N     . PRO A 1 40  ? 19.971  -30.724 27.418  1.00 121.47 ? 253 PRO A N     1 
ATOM   208  C  CA    . PRO A 1 40  ? 19.096  -31.692 26.756  1.00 123.53 ? 253 PRO A CA    1 
ATOM   209  C  C     . PRO A 1 40  ? 17.864  -31.081 26.119  1.00 124.69 ? 253 PRO A C     1 
ATOM   210  O  O     . PRO A 1 40  ? 17.182  -30.206 26.676  1.00 120.86 ? 253 PRO A O     1 
ATOM   211  C  CB    . PRO A 1 40  ? 18.734  -32.678 27.863  1.00 128.66 ? 253 PRO A CB    1 
ATOM   212  C  CG    . PRO A 1 40  ? 18.834  -31.887 29.083  1.00 131.76 ? 253 PRO A CG    1 
ATOM   213  C  CD    . PRO A 1 40  ? 20.015  -30.970 28.870  1.00 125.62 ? 253 PRO A CD    1 
ATOM   214  N  N     . ILE A 1 41  ? 17.631  -31.552 24.896  1.00 123.61 ? 254 ILE A N     1 
ATOM   215  C  CA    . ILE A 1 41  ? 16.484  -31.243 24.073  1.00 120.74 ? 254 ILE A CA    1 
ATOM   216  C  C     . ILE A 1 41  ? 15.269  -31.716 24.878  1.00 122.01 ? 254 ILE A C     1 
ATOM   217  O  O     . ILE A 1 41  ? 15.303  -32.787 25.509  1.00 124.25 ? 254 ILE A O     1 
ATOM   218  C  CB    . ILE A 1 41  ? 16.640  -32.024 22.740  1.00 127.68 ? 254 ILE A CB    1 
ATOM   219  C  CG1   . ILE A 1 41  ? 17.744  -31.395 21.841  1.00 129.02 ? 254 ILE A CG1   1 
ATOM   220  C  CG2   . ILE A 1 41  ? 15.293  -32.199 22.018  1.00 127.49 ? 254 ILE A CG2   1 
ATOM   221  C  CD1   . ILE A 1 41  ? 17.906  -31.987 20.390  1.00 138.82 ? 254 ILE A CD1   1 
ATOM   222  N  N     . GLU A 1 42  ? 14.209  -30.913 24.872  1.00 114.04 ? 255 GLU A N     1 
ATOM   223  C  CA    . GLU A 1 42  ? 12.997  -31.277 25.594  1.00 113.32 ? 255 GLU A CA    1 
ATOM   224  C  C     . GLU A 1 42  ? 11.885  -31.670 24.644  1.00 115.12 ? 255 GLU A C     1 
ATOM   225  O  O     . GLU A 1 42  ? 11.801  -31.140 23.531  1.00 114.55 ? 255 GLU A O     1 
ATOM   226  C  CB    . GLU A 1 42  ? 12.560  -30.150 26.505  1.00 111.42 ? 255 GLU A CB    1 
ATOM   227  C  CG    . GLU A 1 42  ? 13.578  -29.817 27.572  1.00 118.17 ? 255 GLU A CG    1 
ATOM   228  C  CD    . GLU A 1 42  ? 13.337  -28.475 28.219  1.00 131.78 ? 255 GLU A CD    1 
ATOM   229  O  OE1   . GLU A 1 42  ? 12.186  -27.968 28.195  1.00 129.93 ? 255 GLU A OE1   1 
ATOM   230  O  OE2   . GLU A 1 42  ? 14.330  -27.920 28.739  1.00 127.53 ? 255 GLU A OE2   1 
ATOM   231  N  N     . GLU A 1 43  ? 11.044  -32.614 25.067  1.00 110.18 ? 256 GLU A N     1 
ATOM   232  C  CA    . GLU A 1 43  ? 9.944   -33.076 24.239  1.00 108.66 ? 256 GLU A CA    1 
ATOM   233  C  C     . GLU A 1 43  ? 8.662   -32.486 24.794  1.00 105.83 ? 256 GLU A C     1 
ATOM   234  O  O     . GLU A 1 43  ? 8.224   -32.852 25.889  1.00 108.25 ? 256 GLU A O     1 
ATOM   235  C  CB    . GLU A 1 43  ? 9.898   -34.626 24.158  1.00 115.32 ? 256 GLU A CB    1 
ATOM   236  C  CG    . GLU A 1 43  ? 11.142  -35.296 23.564  1.00 128.98 ? 256 GLU A CG    1 
ATOM   237  C  CD    . GLU A 1 43  ? 11.538  -35.025 22.116  1.00 149.74 ? 256 GLU A CD    1 
ATOM   238  O  OE1   . GLU A 1 43  ? 10.665  -34.637 21.307  1.00 130.14 ? 256 GLU A OE1   1 
ATOM   239  O  OE2   . GLU A 1 43  ? 12.723  -35.256 21.779  1.00 153.33 ? 256 GLU A OE2   1 
ATOM   240  N  N     . HIS A 1 44  ? 8.114   -31.506 24.071  1.00 93.78  ? 257 HIS A N     1 
ATOM   241  C  CA    . HIS A 1 44  ? 6.875   -30.817 24.419  1.00 88.74  ? 257 HIS A CA    1 
ATOM   242  C  C     . HIS A 1 44  ? 5.875   -31.019 23.321  1.00 90.72  ? 257 HIS A C     1 
ATOM   243  O  O     . HIS A 1 44  ? 6.261   -31.055 22.136  1.00 89.84  ? 257 HIS A O     1 
ATOM   244  C  CB    . HIS A 1 44  ? 7.106   -29.305 24.525  1.00 85.03  ? 257 HIS A CB    1 
ATOM   245  C  CG    . HIS A 1 44  ? 8.058   -28.888 25.603  1.00 87.64  ? 257 HIS A CG    1 
ATOM   246  N  ND1   . HIS A 1 44  ? 7.654   -28.786 26.922  1.00 89.33  ? 257 HIS A ND1   1 
ATOM   247  C  CD2   . HIS A 1 44  ? 9.355   -28.521 25.519  1.00 88.25  ? 257 HIS A CD2   1 
ATOM   248  C  CE1   . HIS A 1 44  ? 8.724   -28.412 27.601  1.00 88.21  ? 257 HIS A CE1   1 
ATOM   249  N  NE2   . HIS A 1 44  ? 9.768   -28.232 26.800  1.00 88.08  ? 257 HIS A NE2   1 
ATOM   250  N  N     . ARG A 1 45  ? 4.569   -31.076 23.701  1.00 85.90  ? 258 ARG A N     1 
ATOM   251  C  CA    . ARG A 1 45  ? 3.461   -31.121 22.749  1.00 83.72  ? 258 ARG A CA    1 
ATOM   252  C  C     . ARG A 1 45  ? 3.332   -29.694 22.228  1.00 79.60  ? 258 ARG A C     1 
ATOM   253  O  O     . ARG A 1 45  ? 3.237   -29.489 21.021  1.00 78.38  ? 258 ARG A O     1 
ATOM   254  C  CB    . ARG A 1 45  ? 2.161   -31.578 23.420  1.00 87.07  ? 258 ARG A CB    1 
ATOM   255  C  CG    . ARG A 1 45  ? 0.948   -31.660 22.483  1.00 96.85  ? 258 ARG A CG    1 
ATOM   256  C  CD    . ARG A 1 45  ? -0.193  -32.419 23.148  1.00 107.65 ? 258 ARG A CD    1 
ATOM   257  N  NE    . ARG A 1 45  ? -1.457  -32.382 22.396  1.00 126.34 ? 258 ARG A NE    1 
ATOM   258  C  CZ    . ARG A 1 45  ? -1.789  -33.214 21.408  1.00 145.03 ? 258 ARG A CZ    1 
ATOM   259  N  NH1   . ARG A 1 45  ? -2.974  -33.110 20.811  1.00 132.97 ? 258 ARG A NH1   1 
ATOM   260  N  NH2   . ARG A 1 45  ? -0.932  -34.141 20.993  1.00 135.00 ? 258 ARG A NH2   1 
ATOM   261  N  N     . ILE A 1 46  ? 3.376   -28.713 23.152  1.00 72.33  ? 259 ILE A N     1 
ATOM   262  C  CA    . ILE A 1 46  ? 3.341   -27.260 22.874  1.00 68.88  ? 259 ILE A CA    1 
ATOM   263  C  C     . ILE A 1 46  ? 4.606   -26.666 23.436  1.00 72.69  ? 259 ILE A C     1 
ATOM   264  O  O     . ILE A 1 46  ? 4.794   -26.680 24.648  1.00 73.32  ? 259 ILE A O     1 
ATOM   265  C  CB    . ILE A 1 46  ? 2.105   -26.523 23.485  1.00 70.22  ? 259 ILE A CB    1 
ATOM   266  C  CG1   . ILE A 1 46  ? 0.746   -27.288 23.281  1.00 72.28  ? 259 ILE A CG1   1 
ATOM   267  C  CG2   . ILE A 1 46  ? 2.065   -25.044 23.060  1.00 65.49  ? 259 ILE A CG2   1 
ATOM   268  C  CD1   . ILE A 1 46  ? 0.416   -27.500 21.932  1.00 83.91  ? 259 ILE A CD1   1 
ATOM   269  N  N     . CYS A 1 47  ? 5.476   -26.174 22.572  1.00 69.54  ? 260 CYS A N     1 
ATOM   270  C  CA    . CYS A 1 47  ? 6.722   -25.548 22.984  1.00 69.85  ? 260 CYS A CA    1 
ATOM   271  C  C     . CYS A 1 47  ? 6.612   -24.039 22.688  1.00 70.07  ? 260 CYS A C     1 
ATOM   272  O  O     . CYS A 1 47  ? 6.408   -23.655 21.535  1.00 69.58  ? 260 CYS A O     1 
ATOM   273  C  CB    . CYS A 1 47  ? 7.887   -26.182 22.241  1.00 72.91  ? 260 CYS A CB    1 
ATOM   274  S  SG    . CYS A 1 47  ? 9.494   -25.473 22.642  1.00 78.44  ? 260 CYS A SG    1 
ATOM   275  N  N     . VAL A 1 48  ? 6.695   -23.190 23.715  1.00 64.03  ? 261 VAL A N     1 
ATOM   276  C  CA    . VAL A 1 48  ? 6.655   -21.732 23.507  1.00 62.43  ? 261 VAL A CA    1 
ATOM   277  C  C     . VAL A 1 48  ? 7.985   -21.113 23.919  1.00 67.89  ? 261 VAL A C     1 
ATOM   278  O  O     . VAL A 1 48  ? 8.445   -21.305 25.042  1.00 67.86  ? 261 VAL A O     1 
ATOM   279  C  CB    . VAL A 1 48  ? 5.439   -21.052 24.187  1.00 65.20  ? 261 VAL A CB    1 
ATOM   280  C  CG1   . VAL A 1 48  ? 5.380   -19.567 23.846  1.00 63.32  ? 261 VAL A CG1   1 
ATOM   281  C  CG2   . VAL A 1 48  ? 4.148   -21.735 23.773  1.00 65.47  ? 261 VAL A CG2   1 
ATOM   282  N  N     . CYS A 1 49  ? 8.603   -20.403 22.986  1.00 66.95  ? 262 CYS A N     1 
ATOM   283  C  CA    . CYS A 1 49  ? 9.910   -19.752 23.109  1.00 67.17  ? 262 CYS A CA    1 
ATOM   284  C  C     . CYS A 1 49  ? 9.823   -18.280 22.844  1.00 67.89  ? 262 CYS A C     1 
ATOM   285  O  O     . CYS A 1 49  ? 8.908   -17.810 22.153  1.00 66.32  ? 262 CYS A O     1 
ATOM   286  C  CB    . CYS A 1 49  ? 10.892  -20.391 22.145  1.00 69.66  ? 262 CYS A CB    1 
ATOM   287  S  SG    . CYS A 1 49  ? 10.911  -22.188 22.230  1.00 77.07  ? 262 CYS A SG    1 
ATOM   288  N  N     . VAL A 1 50  ? 10.845  -17.578 23.301  1.00 63.33  ? 263 VAL A N     1 
ATOM   289  C  CA    . VAL A 1 50  ? 11.074  -16.164 23.030  1.00 62.74  ? 263 VAL A CA    1 
ATOM   290  C  C     . VAL A 1 50  ? 12.496  -15.986 22.526  1.00 64.67  ? 263 VAL A C     1 
ATOM   291  O  O     . VAL A 1 50  ? 13.419  -16.605 23.049  1.00 64.81  ? 263 VAL A O     1 
ATOM   292  C  CB    . VAL A 1 50  ? 10.795  -15.200 24.196  1.00 65.43  ? 263 VAL A CB    1 
ATOM   293  C  CG1   . VAL A 1 50  ? 9.323   -15.166 24.548  1.00 64.85  ? 263 VAL A CG1   1 
ATOM   294  C  CG2   . VAL A 1 50  ? 11.681  -15.518 25.400  1.00 65.35  ? 263 VAL A CG2   1 
ATOM   295  N  N     . ARG A 1 51  ? 12.668  -15.114 21.550  1.00 61.89  ? 264 ARG A N     1 
ATOM   296  C  CA    . ARG A 1 51  ? 13.971  -14.816 20.990  1.00 65.44  ? 264 ARG A CA    1 
ATOM   297  C  C     . ARG A 1 51  ? 14.189  -13.326 20.932  1.00 70.90  ? 264 ARG A C     1 
ATOM   298  O  O     . ARG A 1 51  ? 13.461  -12.606 20.249  1.00 71.74  ? 264 ARG A O     1 
ATOM   299  C  CB    . ARG A 1 51  ? 14.123  -15.425 19.582  1.00 68.47  ? 264 ARG A CB    1 
ATOM   300  C  CG    . ARG A 1 51  ? 15.550  -15.348 19.120  1.00 69.73  ? 264 ARG A CG    1 
ATOM   301  C  CD    . ARG A 1 51  ? 15.706  -15.753 17.697  1.00 72.21  ? 264 ARG A CD    1 
ATOM   302  N  NE    . ARG A 1 51  ? 17.120  -15.760 17.381  1.00 74.27  ? 264 ARG A NE    1 
ATOM   303  C  CZ    . ARG A 1 51  ? 17.650  -16.176 16.240  1.00 90.98  ? 264 ARG A CZ    1 
ATOM   304  N  NH1   . ARG A 1 51  ? 16.879  -16.637 15.272  1.00 90.36  ? 264 ARG A NH1   1 
ATOM   305  N  NH2   . ARG A 1 51  ? 18.957  -16.180 16.076  1.00 77.76  ? 264 ARG A NH2   1 
ATOM   306  N  N     . LYS A 1 52  ? 15.191  -12.861 21.638  1.00 67.79  ? 265 LYS A N     1 
ATOM   307  C  CA    . LYS A 1 52  ? 15.567  -11.455 21.604  1.00 68.57  ? 265 LYS A CA    1 
ATOM   308  C  C     . LYS A 1 52  ? 16.647  -11.277 20.555  1.00 75.09  ? 265 LYS A C     1 
ATOM   309  O  O     . LYS A 1 52  ? 17.680  -11.950 20.605  1.00 76.75  ? 265 LYS A O     1 
ATOM   310  C  CB    . LYS A 1 52  ? 16.109  -11.032 22.973  1.00 69.37  ? 265 LYS A CB    1 
ATOM   311  C  CG    . LYS A 1 52  ? 16.733  -9.651  23.015  1.00 65.13  ? 265 LYS A CG    1 
ATOM   312  C  CD    . LYS A 1 52  ? 17.605  -9.517  24.244  1.00 62.55  ? 265 LYS A CD    1 
ATOM   313  C  CE    . LYS A 1 52  ? 18.237  -8.155  24.299  1.00 66.07  ? 265 LYS A CE    1 
ATOM   314  N  NZ    . LYS A 1 52  ? 19.171  -8.026  25.434  1.00 80.40  ? 265 LYS A NZ    1 
ATOM   315  N  N     . ARG A 1 53  ? 16.425  -10.374 19.619  1.00 72.07  ? 266 ARG A N     1 
ATOM   316  C  CA    . ARG A 1 53  ? 17.472  -10.022 18.659  1.00 74.32  ? 266 ARG A CA    1 
ATOM   317  C  C     . ARG A 1 53  ? 18.356  -8.879  19.246  1.00 78.36  ? 266 ARG A C     1 
ATOM   318  O  O     . ARG A 1 53  ? 17.894  -8.146  20.116  1.00 77.44  ? 266 ARG A O     1 
ATOM   319  C  CB    . ARG A 1 53  ? 16.872  -9.602  17.306  1.00 72.74  ? 266 ARG A CB    1 
ATOM   320  C  CG    . ARG A 1 53  ? 16.120  -8.287  17.297  1.00 73.02  ? 266 ARG A CG    1 
ATOM   321  C  CD    . ARG A 1 53  ? 16.201  -7.668  15.917  1.00 72.18  ? 266 ARG A CD    1 
ATOM   322  N  NE    . ARG A 1 53  ? 15.387  -6.455  15.807  1.00 77.53  ? 266 ARG A NE    1 
ATOM   323  C  CZ    . ARG A 1 53  ? 15.762  -5.246  16.209  1.00 91.06  ? 266 ARG A CZ    1 
ATOM   324  N  NH1   . ARG A 1 53  ? 16.949  -5.063  16.771  1.00 87.12  ? 266 ARG A NH1   1 
ATOM   325  N  NH2   . ARG A 1 53  ? 14.950  -4.211  16.057  1.00 82.97  ? 266 ARG A NH2   1 
ATOM   326  N  N     . PRO A 1 54  ? 19.616  -8.700  18.809  1.00 76.58  ? 267 PRO A N     1 
ATOM   327  C  CA    . PRO A 1 54  ? 20.401  -7.563  19.315  1.00 77.85  ? 267 PRO A CA    1 
ATOM   328  C  C     . PRO A 1 54  ? 19.964  -6.229  18.707  1.00 87.06  ? 267 PRO A C     1 
ATOM   329  O  O     . PRO A 1 54  ? 19.363  -6.182  17.640  1.00 89.08  ? 267 PRO A O     1 
ATOM   330  C  CB    . PRO A 1 54  ? 21.830  -7.878  18.841  1.00 82.31  ? 267 PRO A CB    1 
ATOM   331  C  CG    . PRO A 1 54  ? 21.695  -8.796  17.722  1.00 87.20  ? 267 PRO A CG    1 
ATOM   332  C  CD    . PRO A 1 54  ? 20.391  -9.511  17.842  1.00 79.36  ? 267 PRO A CD    1 
ATOM   333  N  N     . LEU A 1 55  ? 20.343  -5.139  19.357  1.00 87.08  ? 268 LEU A N     1 
ATOM   334  C  CA    . LEU A 1 55  ? 20.130  -3.814  18.819  1.00 90.71  ? 268 LEU A CA    1 
ATOM   335  C  C     . LEU A 1 55  ? 20.963  -3.691  17.525  1.00 101.54 ? 268 LEU A C     1 
ATOM   336  O  O     . LEU A 1 55  ? 22.115  -4.129  17.488  1.00 103.92 ? 268 LEU A O     1 
ATOM   337  C  CB    . LEU A 1 55  ? 20.574  -2.743  19.842  1.00 91.81  ? 268 LEU A CB    1 
ATOM   338  C  CG    . LEU A 1 55  ? 19.665  -2.464  21.064  1.00 92.18  ? 268 LEU A CG    1 
ATOM   339  C  CD1   . LEU A 1 55  ? 20.329  -1.497  22.001  1.00 94.56  ? 268 LEU A CD1   1 
ATOM   340  C  CD2   . LEU A 1 55  ? 18.300  -1.899  20.657  1.00 94.27  ? 268 LEU A CD2   1 
ATOM   341  N  N     . ASN A 1 56  ? 20.368  -3.150  16.460  1.00 100.20 ? 269 ASN A N     1 
ATOM   342  C  CA    . ASN A 1 56  ? 21.094  -2.925  15.213  1.00 105.52 ? 269 ASN A CA    1 
ATOM   343  C  C     . ASN A 1 56  ? 21.905  -1.604  15.296  1.00 117.69 ? 269 ASN A C     1 
ATOM   344  O  O     . ASN A 1 56  ? 21.765  -0.851  16.274  1.00 115.97 ? 269 ASN A O     1 
ATOM   345  C  CB    . ASN A 1 56  ? 20.149  -2.939  14.005  1.00 103.70 ? 269 ASN A CB    1 
ATOM   346  C  CG    . ASN A 1 56  ? 19.049  -1.904  14.042  1.00 111.32 ? 269 ASN A CG    1 
ATOM   347  O  OD1   . ASN A 1 56  ? 19.287  -0.716  14.264  1.00 115.55 ? 269 ASN A OD1   1 
ATOM   348  N  ND2   . ASN A 1 56  ? 17.821  -2.318  13.765  1.00 89.53  ? 269 ASN A ND2   1 
ATOM   349  N  N     . LYS A 1 57  ? 22.753  -1.330  14.268  1.00 121.98 ? 270 LYS A N     1 
ATOM   350  C  CA    . LYS A 1 57  ? 23.623  -0.141  14.207  1.00 128.56 ? 270 LYS A CA    1 
ATOM   351  C  C     . LYS A 1 57  ? 22.850  1.183   14.271  1.00 134.89 ? 270 LYS A C     1 
ATOM   352  O  O     . LYS A 1 57  ? 23.303  2.135   14.920  1.00 135.83 ? 270 LYS A O     1 
ATOM   353  C  CB    . LYS A 1 57  ? 24.494  -0.188  12.957  1.00 135.55 ? 270 LYS A CB    1 
ATOM   354  N  N     . GLN A 1 58  ? 21.671  1.221   13.614  1.00 131.80 ? 271 GLN A N     1 
ATOM   355  C  CA    . GLN A 1 58  ? 20.764  2.372   13.602  1.00 134.39 ? 271 GLN A CA    1 
ATOM   356  C  C     . GLN A 1 58  ? 20.185  2.622   14.987  1.00 135.95 ? 271 GLN A C     1 
ATOM   357  O  O     . GLN A 1 58  ? 20.013  3.786   15.367  1.00 138.68 ? 271 GLN A O     1 
ATOM   358  C  CB    . GLN A 1 58  ? 19.613  2.164   12.605  1.00 135.32 ? 271 GLN A CB    1 
ATOM   359  C  CG    . GLN A 1 58  ? 20.025  2.234   11.128  1.00 160.62 ? 271 GLN A CG    1 
ATOM   360  C  CD    . GLN A 1 58  ? 20.682  0.950   10.664  1.00 175.94 ? 271 GLN A CD    1 
ATOM   361  O  OE1   . GLN A 1 58  ? 20.293  -0.166  11.060  1.00 162.85 ? 271 GLN A OE1   1 
ATOM   362  N  NE2   . GLN A 1 58  ? 21.719  1.087   9.842   1.00 169.10 ? 271 GLN A NE2   1 
ATOM   363  N  N     . GLU A 1 59  ? 19.864  1.535   15.735  1.00 125.71 ? 272 GLU A N     1 
ATOM   364  C  CA    . GLU A 1 59  ? 19.320  1.641   17.085  1.00 120.89 ? 272 GLU A CA    1 
ATOM   365  C  C     . GLU A 1 59  ? 20.390  2.125   18.036  1.00 128.27 ? 272 GLU A C     1 
ATOM   366  O  O     . GLU A 1 59  ? 20.121  3.002   18.851  1.00 129.15 ? 272 GLU A O     1 
ATOM   367  C  CB    . GLU A 1 59  ? 18.741  0.308   17.550  1.00 115.25 ? 272 GLU A CB    1 
ATOM   368  C  CG    . GLU A 1 59  ? 17.401  -0.024  16.924  1.00 117.24 ? 272 GLU A CG    1 
ATOM   369  C  CD    . GLU A 1 59  ? 16.951  -1.464  17.083  1.00 124.85 ? 272 GLU A CD    1 
ATOM   370  O  OE1   . GLU A 1 59  ? 17.819  -2.348  17.252  1.00 97.11  ? 272 GLU A OE1   1 
ATOM   371  O  OE2   . GLU A 1 59  ? 15.729  -1.718  16.985  1.00 125.15 ? 272 GLU A OE2   1 
ATOM   372  N  N     . LEU A 1 60  ? 21.611  1.586   17.909  1.00 126.94 ? 273 LEU A N     1 
ATOM   373  C  CA    . LEU A 1 60  ? 22.745  2.019   18.717  1.00 129.99 ? 273 LEU A CA    1 
ATOM   374  C  C     . LEU A 1 60  ? 23.116  3.484   18.427  1.00 142.16 ? 273 LEU A C     1 
ATOM   375  O  O     . LEU A 1 60  ? 23.511  4.213   19.345  1.00 142.42 ? 273 LEU A O     1 
ATOM   376  C  CB    . LEU A 1 60  ? 23.945  1.093   18.498  1.00 130.80 ? 273 LEU A CB    1 
ATOM   377  C  CG    . LEU A 1 60  ? 23.814  -0.312  19.083  1.00 129.47 ? 273 LEU A CG    1 
ATOM   378  C  CD1   . LEU A 1 60  ? 24.988  -1.182  18.670  1.00 130.97 ? 273 LEU A CD1   1 
ATOM   379  C  CD2   . LEU A 1 60  ? 23.662  -0.278  20.617  1.00 128.87 ? 273 LEU A CD2   1 
ATOM   380  N  N     . ALA A 1 61  ? 22.946  3.915   17.154  1.00 144.66 ? 274 ALA A N     1 
ATOM   381  C  CA    . ALA A 1 61  ? 23.201  5.292   16.720  1.00 151.64 ? 274 ALA A CA    1 
ATOM   382  C  C     . ALA A 1 61  ? 22.203  6.256   17.369  1.00 155.92 ? 274 ALA A C     1 
ATOM   383  O  O     . ALA A 1 61  ? 22.610  7.318   17.843  1.00 160.67 ? 274 ALA A O     1 
ATOM   384  C  CB    . ALA A 1 61  ? 23.127  5.396   15.203  1.00 156.87 ? 274 ALA A CB    1 
ATOM   385  N  N     . LYS A 1 62  ? 20.910  5.872   17.428  1.00 147.59 ? 275 LYS A N     1 
ATOM   386  C  CA    . LYS A 1 62  ? 19.856  6.684   18.051  1.00 147.11 ? 275 LYS A CA    1 
ATOM   387  C  C     . LYS A 1 62  ? 19.824  6.516   19.592  1.00 146.72 ? 275 LYS A C     1 
ATOM   388  O  O     . LYS A 1 62  ? 18.881  6.985   20.238  1.00 146.81 ? 275 LYS A O     1 
ATOM   389  C  CB    . LYS A 1 62  ? 18.474  6.360   17.439  1.00 147.19 ? 275 LYS A CB    1 
ATOM   390  C  CG    . LYS A 1 62  ? 18.302  6.740   15.968  1.00 167.23 ? 275 LYS A CG    1 
ATOM   391  C  CD    . LYS A 1 62  ? 16.890  6.362   15.485  1.00 174.69 ? 275 LYS A CD    1 
ATOM   392  C  CE    . LYS A 1 62  ? 16.734  6.312   13.986  1.00 188.58 ? 275 LYS A CE    1 
ATOM   393  N  NZ    . LYS A 1 62  ? 15.417  5.734   13.602  1.00 192.29 ? 275 LYS A NZ    1 
ATOM   394  N  N     . LYS A 1 63  ? 20.851  5.860   20.177  1.00 138.85 ? 276 LYS A N     1 
ATOM   395  C  CA    . LYS A 1 63  ? 20.948  5.599   21.611  1.00 133.82 ? 276 LYS A CA    1 
ATOM   396  C  C     . LYS A 1 63  ? 19.681  4.901   22.202  1.00 130.04 ? 276 LYS A C     1 
ATOM   397  O  O     . LYS A 1 63  ? 19.121  5.347   23.212  1.00 129.34 ? 276 LYS A O     1 
ATOM   398  C  CB    . LYS A 1 63  ? 21.303  6.875   22.363  1.00 138.81 ? 276 LYS A CB    1 
ATOM   399  N  N     . GLU A 1 64  ? 19.221  3.814   21.543  1.00 120.49 ? 277 GLU A N     1 
ATOM   400  C  CA    . GLU A 1 64  ? 18.106  3.019   22.059  1.00 113.59 ? 277 GLU A CA    1 
ATOM   401  C  C     . GLU A 1 64  ? 18.655  2.269   23.249  1.00 111.80 ? 277 GLU A C     1 
ATOM   402  O  O     . GLU A 1 64  ? 19.792  1.771   23.185  1.00 113.30 ? 277 GLU A O     1 
ATOM   403  C  CB    . GLU A 1 64  ? 17.618  1.983   21.035  1.00 112.34 ? 277 GLU A CB    1 
ATOM   404  C  CG    . GLU A 1 64  ? 16.520  2.474   20.117  1.00 124.11 ? 277 GLU A CG    1 
ATOM   405  C  CD    . GLU A 1 64  ? 15.181  2.710   20.788  1.00 131.62 ? 277 GLU A CD    1 
ATOM   406  O  OE1   . GLU A 1 64  ? 14.485  1.717   21.103  1.00 99.89  ? 277 GLU A OE1   1 
ATOM   407  O  OE2   . GLU A 1 64  ? 14.813  3.894   20.962  1.00 133.77 ? 277 GLU A OE2   1 
ATOM   408  N  N     . ILE A 1 65  ? 17.870  2.227   24.340  1.00 100.93 ? 278 ILE A N     1 
ATOM   409  C  CA    . ILE A 1 65  ? 18.177  1.480   25.543  1.00 94.79  ? 278 ILE A CA    1 
ATOM   410  C  C     . ILE A 1 65  ? 17.672  0.058   25.271  1.00 92.71  ? 278 ILE A C     1 
ATOM   411  O  O     . ILE A 1 65  ? 16.593  -0.130  24.702  1.00 89.98  ? 278 ILE A O     1 
ATOM   412  C  CB    . ILE A 1 65  ? 17.488  2.056   26.833  1.00 96.19  ? 278 ILE A CB    1 
ATOM   413  C  CG1   . ILE A 1 65  ? 17.693  3.585   27.001  1.00 100.40 ? 278 ILE A CG1   1 
ATOM   414  C  CG2   . ILE A 1 65  ? 17.979  1.308   28.087  1.00 93.31  ? 278 ILE A CG2   1 
ATOM   415  C  CD1   . ILE A 1 65  ? 17.232  4.178   28.402  1.00 100.90 ? 278 ILE A CD1   1 
ATOM   416  N  N     . ASP A 1 66  ? 18.436  -0.937  25.701  1.00 86.96  ? 279 ASP A N     1 
ATOM   417  C  CA    . ASP A 1 66  ? 18.046  -2.339  25.630  1.00 82.00  ? 279 ASP A CA    1 
ATOM   418  C  C     . ASP A 1 66  ? 17.262  -2.598  26.923  1.00 82.18  ? 279 ASP A C     1 
ATOM   419  O  O     . ASP A 1 66  ? 17.816  -2.464  28.030  1.00 83.33  ? 279 ASP A O     1 
ATOM   420  C  CB    . ASP A 1 66  ? 19.295  -3.223  25.523  1.00 83.53  ? 279 ASP A CB    1 
ATOM   421  C  CG    . ASP A 1 66  ? 19.029  -4.698  25.396  1.00 91.11  ? 279 ASP A CG    1 
ATOM   422  O  OD1   . ASP A 1 66  ? 17.872  -5.124  25.639  1.00 87.47  ? 279 ASP A OD1   1 
ATOM   423  O  OD2   . ASP A 1 66  ? 19.975  -5.433  25.070  1.00 102.95 ? 279 ASP A OD2   1 
ATOM   424  N  N     . VAL A 1 67  ? 15.965  -2.904  26.791  1.00 73.81  ? 280 VAL A N     1 
ATOM   425  C  CA    . VAL A 1 67  ? 15.116  -3.098  27.972  1.00 70.67  ? 280 VAL A CA    1 
ATOM   426  C  C     . VAL A 1 67  ? 14.811  -4.568  28.282  1.00 71.01  ? 280 VAL A C     1 
ATOM   427  O  O     . VAL A 1 67  ? 13.888  -4.837  29.050  1.00 70.57  ? 280 VAL A O     1 
ATOM   428  C  CB    . VAL A 1 67  ? 13.817  -2.227  27.909  1.00 74.54  ? 280 VAL A CB    1 
ATOM   429  C  CG1   . VAL A 1 67  ? 14.134  -0.740  27.809  1.00 77.92  ? 280 VAL A CG1   1 
ATOM   430  C  CG2   . VAL A 1 67  ? 12.887  -2.662  26.787  1.00 73.26  ? 280 VAL A CG2   1 
ATOM   431  N  N     . ILE A 1 68  ? 15.554  -5.515  27.671  1.00 66.06  ? 281 ILE A N     1 
ATOM   432  C  CA    . ILE A 1 68  ? 15.301  -6.955  27.836  1.00 63.50  ? 281 ILE A CA    1 
ATOM   433  C  C     . ILE A 1 68  ? 16.498  -7.692  28.416  1.00 69.86  ? 281 ILE A C     1 
ATOM   434  O  O     . ILE A 1 68  ? 17.592  -7.578  27.880  1.00 72.29  ? 281 ILE A O     1 
ATOM   435  C  CB    . ILE A 1 68  ? 14.909  -7.634  26.490  1.00 65.66  ? 281 ILE A CB    1 
ATOM   436  C  CG1   . ILE A 1 68  ? 13.826  -6.866  25.710  1.00 65.96  ? 281 ILE A CG1   1 
ATOM   437  C  CG2   . ILE A 1 68  ? 14.527  -9.116  26.683  1.00 62.24  ? 281 ILE A CG2   1 
ATOM   438  C  CD1   . ILE A 1 68  ? 12.430  -6.738  26.429  1.00 56.39  ? 281 ILE A CD1   1 
ATOM   439  N  N     . SER A 1 69  ? 16.286  -8.499  29.457  1.00 63.89  ? 282 SER A N     1 
ATOM   440  C  CA    . SER A 1 69  ? 17.350  -9.344  30.012  1.00 62.66  ? 282 SER A CA    1 
ATOM   441  C  C     . SER A 1 69  ? 16.856  -10.753 30.099  1.00 66.19  ? 282 SER A C     1 
ATOM   442  O  O     . SER A 1 69  ? 15.668  -11.008 30.329  1.00 65.50  ? 282 SER A O     1 
ATOM   443  C  CB    . SER A 1 69  ? 17.808  -8.872  31.389  1.00 63.51  ? 282 SER A CB    1 
ATOM   444  O  OG    . SER A 1 69  ? 18.410  -7.593  31.293  1.00 68.39  ? 282 SER A OG    1 
ATOM   445  N  N     . ILE A 1 70  ? 17.768  -11.681 29.933  1.00 65.50  ? 283 ILE A N     1 
ATOM   446  C  CA    . ILE A 1 70  ? 17.485  -13.115 29.971  1.00 64.66  ? 283 ILE A CA    1 
ATOM   447  C  C     . ILE A 1 70  ? 18.419  -13.831 30.947  1.00 72.30  ? 283 ILE A C     1 
ATOM   448  O  O     . ILE A 1 70  ? 19.531  -14.237 30.599  1.00 76.65  ? 283 ILE A O     1 
ATOM   449  C  CB    . ILE A 1 70  ? 17.499  -13.700 28.536  1.00 67.05  ? 283 ILE A CB    1 
ATOM   450  C  CG1   . ILE A 1 70  ? 16.383  -12.980 27.697  1.00 67.01  ? 283 ILE A CG1   1 
ATOM   451  C  CG2   . ILE A 1 70  ? 17.313  -15.221 28.587  1.00 63.31  ? 283 ILE A CG2   1 
ATOM   452  C  CD1   . ILE A 1 70  ? 16.292  -13.268 26.352  1.00 78.84  ? 283 ILE A CD1   1 
ATOM   453  N  N     . PRO A 1 71  ? 17.988  -13.948 32.211  1.00 67.48  ? 284 PRO A N     1 
ATOM   454  C  CA    . PRO A 1 71  ? 18.876  -14.556 33.232  1.00 67.42  ? 284 PRO A CA    1 
ATOM   455  C  C     . PRO A 1 71  ? 18.927  -16.061 33.237  1.00 70.25  ? 284 PRO A C     1 
ATOM   456  O  O     . PRO A 1 71  ? 19.806  -16.637 33.895  1.00 72.66  ? 284 PRO A O     1 
ATOM   457  C  CB    . PRO A 1 71  ? 18.302  -14.030 34.535  1.00 68.35  ? 284 PRO A CB    1 
ATOM   458  C  CG    . PRO A 1 71  ? 16.852  -13.746 34.236  1.00 69.51  ? 284 PRO A CG    1 
ATOM   459  C  CD    . PRO A 1 71  ? 16.752  -13.387 32.808  1.00 64.86  ? 284 PRO A CD    1 
ATOM   460  N  N     . SER A 1 72  ? 18.010  -16.713 32.527  1.00 63.37  ? 285 SER A N     1 
ATOM   461  C  CA    . SER A 1 72  ? 18.056  -18.167 32.507  1.00 64.11  ? 285 SER A CA    1 
ATOM   462  C  C     . SER A 1 72  ? 17.559  -18.703 31.188  1.00 71.10  ? 285 SER A C     1 
ATOM   463  O  O     . SER A 1 72  ? 17.131  -17.946 30.319  1.00 67.25  ? 285 SER A O     1 
ATOM   464  C  CB    . SER A 1 72  ? 17.262  -18.745 33.678  1.00 65.62  ? 285 SER A CB    1 
ATOM   465  O  OG    . SER A 1 72  ? 15.862  -18.636 33.479  1.00 69.20  ? 285 SER A OG    1 
ATOM   466  N  N     . LYS A 1 73  ? 17.629  -20.026 31.039  1.00 72.60  ? 286 LYS A N     1 
ATOM   467  C  CA    . LYS A 1 73  ? 17.110  -20.722 29.888  1.00 71.87  ? 286 LYS A CA    1 
ATOM   468  C  C     . LYS A 1 73  ? 15.560  -20.483 29.745  1.00 76.91  ? 286 LYS A C     1 
ATOM   469  O  O     . LYS A 1 73  ? 15.052  -20.619 28.647  1.00 77.61  ? 286 LYS A O     1 
ATOM   470  C  CB    . LYS A 1 73  ? 17.493  -22.228 29.963  1.00 74.39  ? 286 LYS A CB    1 
ATOM   471  C  CG    . LYS A 1 73  ? 16.468  -23.251 30.466  1.00 92.55  ? 286 LYS A CG    1 
ATOM   472  C  CD    . LYS A 1 73  ? 15.588  -23.851 29.365  1.00 102.00 ? 286 LYS A CD    1 
ATOM   473  C  CE    . LYS A 1 73  ? 15.040  -25.210 29.723  1.00 106.46 ? 286 LYS A CE    1 
ATOM   474  N  NZ    . LYS A 1 73  ? 13.569  -25.295 29.537  1.00 116.89 ? 286 LYS A NZ    1 
ATOM   475  N  N     . CYS A 1 74  ? 14.827  -20.112 30.804  1.00 71.75  ? 287 CYS A N     1 
ATOM   476  C  CA    . CYS A 1 74  ? 13.364  -19.992 30.721  1.00 70.06  ? 287 CYS A CA    1 
ATOM   477  C  C     . CYS A 1 74  ? 12.787  -18.614 31.029  1.00 68.06  ? 287 CYS A C     1 
ATOM   478  O  O     . CYS A 1 74  ? 11.617  -18.369 30.787  1.00 65.12  ? 287 CYS A O     1 
ATOM   479  C  CB    . CYS A 1 74  ? 12.725  -21.048 31.616  1.00 72.95  ? 287 CYS A CB    1 
ATOM   480  S  SG    . CYS A 1 74  ? 13.218  -20.955 33.351  1.00 79.48  ? 287 CYS A SG    1 
ATOM   481  N  N     . LEU A 1 75  ? 13.585  -17.735 31.579  1.00 64.04  ? 288 LEU A N     1 
ATOM   482  C  CA    . LEU A 1 75  ? 13.125  -16.468 32.108  1.00 61.41  ? 288 LEU A CA    1 
ATOM   483  C  C     . LEU A 1 75  ? 13.532  -15.272 31.289  1.00 64.24  ? 288 LEU A C     1 
ATOM   484  O  O     . LEU A 1 75  ? 14.680  -15.153 30.883  1.00 64.32  ? 288 LEU A O     1 
ATOM   485  C  CB    . LEU A 1 75  ? 13.683  -16.367 33.522  1.00 61.45  ? 288 LEU A CB    1 
ATOM   486  C  CG    . LEU A 1 75  ? 12.988  -15.657 34.638  1.00 66.02  ? 288 LEU A CG    1 
ATOM   487  C  CD1   . LEU A 1 75  ? 11.509  -16.079 34.786  1.00 65.59  ? 288 LEU A CD1   1 
ATOM   488  C  CD2   . LEU A 1 75  ? 13.733  -15.951 35.916  1.00 69.88  ? 288 LEU A CD2   1 
ATOM   489  N  N     . LEU A 1 76  ? 12.564  -14.397 31.024  1.00 58.84  ? 289 LEU A N     1 
ATOM   490  C  CA    . LEU A 1 76  ? 12.785  -13.164 30.315  1.00 56.73  ? 289 LEU A CA    1 
ATOM   491  C  C     . LEU A 1 76  ? 12.316  -12.027 31.208  1.00 60.26  ? 289 LEU A C     1 
ATOM   492  O  O     . LEU A 1 76  ? 11.236  -12.098 31.782  1.00 59.95  ? 289 LEU A O     1 
ATOM   493  C  CB    . LEU A 1 76  ? 12.077  -13.159 28.945  1.00 55.38  ? 289 LEU A CB    1 
ATOM   494  C  CG    . LEU A 1 76  ? 12.294  -11.876 28.100  1.00 60.92  ? 289 LEU A CG    1 
ATOM   495  C  CD1   . LEU A 1 76  ? 12.351  -12.188 26.655  1.00 61.19  ? 289 LEU A CD1   1 
ATOM   496  C  CD2   . LEU A 1 76  ? 11.213  -10.792 28.352  1.00 61.40  ? 289 LEU A CD2   1 
ATOM   497  N  N     . LEU A 1 77  ? 13.112  -10.971 31.302  1.00 58.45  ? 290 LEU A N     1 
ATOM   498  C  CA    . LEU A 1 77  ? 12.756  -9.776  32.050  1.00 59.15  ? 290 LEU A CA    1 
ATOM   499  C  C     . LEU A 1 77  ? 12.587  -8.586  31.134  1.00 63.86  ? 290 LEU A C     1 
ATOM   500  O  O     . LEU A 1 77  ? 13.409  -8.367  30.246  1.00 65.30  ? 290 LEU A O     1 
ATOM   501  C  CB    . LEU A 1 77  ? 13.832  -9.444  33.101  1.00 59.99  ? 290 LEU A CB    1 
ATOM   502  C  CG    . LEU A 1 77  ? 14.238  -10.555 34.090  1.00 62.18  ? 290 LEU A CG    1 
ATOM   503  C  CD1   . LEU A 1 77  ? 15.358  -10.059 34.965  1.00 61.65  ? 290 LEU A CD1   1 
ATOM   504  C  CD2   . LEU A 1 77  ? 13.030  -11.103 34.898  1.00 58.50  ? 290 LEU A CD2   1 
ATOM   505  N  N     . VAL A 1 78  ? 11.541  -7.797  31.361  1.00 61.89  ? 291 VAL A N     1 
ATOM   506  C  CA    . VAL A 1 78  ? 11.287  -6.498  30.674  1.00 61.14  ? 291 VAL A CA    1 
ATOM   507  C  C     . VAL A 1 78  ? 11.554  -5.392  31.720  1.00 65.91  ? 291 VAL A C     1 
ATOM   508  O  O     . VAL A 1 78  ? 10.951  -5.385  32.787  1.00 63.78  ? 291 VAL A O     1 
ATOM   509  C  CB    . VAL A 1 78  ? 9.872   -6.322  30.020  1.00 62.52  ? 291 VAL A CB    1 
ATOM   510  C  CG1   . VAL A 1 78  ? 9.770   -4.989  29.251  1.00 64.02  ? 291 VAL A CG1   1 
ATOM   511  C  CG2   . VAL A 1 78  ? 9.551   -7.475  29.095  1.00 59.70  ? 291 VAL A CG2   1 
ATOM   512  N  N     . HIS A 1 79  ? 12.449  -4.471  31.383  1.00 65.67  ? 292 HIS A N     1 
ATOM   513  C  CA    . HIS A 1 79  ? 12.800  -3.322  32.215  1.00 67.34  ? 292 HIS A CA    1 
ATOM   514  C  C     . HIS A 1 79  ? 11.931  -2.115  31.824  1.00 74.36  ? 292 HIS A C     1 
ATOM   515  O  O     . HIS A 1 79  ? 11.998  -1.659  30.697  1.00 76.03  ? 292 HIS A O     1 
ATOM   516  C  CB    . HIS A 1 79  ? 14.297  -3.005  32.059  1.00 68.31  ? 292 HIS A CB    1 
ATOM   517  C  CG    . HIS A 1 79  ? 15.196  -4.169  32.350  1.00 69.23  ? 292 HIS A CG    1 
ATOM   518  N  ND1   . HIS A 1 79  ? 15.177  -4.814  33.583  1.00 69.08  ? 292 HIS A ND1   1 
ATOM   519  C  CD2   . HIS A 1 79  ? 16.149  -4.739  31.574  1.00 70.43  ? 292 HIS A CD2   1 
ATOM   520  C  CE1   . HIS A 1 79  ? 16.100  -5.756  33.510  1.00 67.61  ? 292 HIS A CE1   1 
ATOM   521  N  NE2   . HIS A 1 79  ? 16.727  -5.738  32.326  1.00 68.61  ? 292 HIS A NE2   1 
ATOM   522  N  N     . GLU A 1 80  ? 11.091  -1.633  32.741  1.00 73.00  ? 293 GLU A N     1 
ATOM   523  C  CA    . GLU A 1 80  ? 10.187  -0.481  32.542  1.00 74.87  ? 293 GLU A CA    1 
ATOM   524  C  C     . GLU A 1 80  ? 10.544  0.698   33.426  1.00 84.35  ? 293 GLU A C     1 
ATOM   525  O  O     . GLU A 1 80  ? 10.949  0.518   34.582  1.00 81.06  ? 293 GLU A O     1 
ATOM   526  C  CB    . GLU A 1 80  ? 8.726   -0.865  32.760  1.00 75.19  ? 293 GLU A CB    1 
ATOM   527  C  CG    . GLU A 1 80  ? 8.188   -1.809  31.704  1.00 82.83  ? 293 GLU A CG    1 
ATOM   528  C  CD    . GLU A 1 80  ? 6.924   -2.540  32.108  1.00 106.35 ? 293 GLU A CD    1 
ATOM   529  O  OE1   . GLU A 1 80  ? 7.027   -3.527  32.872  1.00 115.10 ? 293 GLU A OE1   1 
ATOM   530  O  OE2   . GLU A 1 80  ? 5.831   -2.129  31.655  1.00 97.70  ? 293 GLU A OE2   1 
ATOM   531  N  N     . LYS A 1 81  ? 10.437  1.913   32.856  1.00 90.53  ? 297 LYS A N     1 
ATOM   532  C  CA    . LYS A 1 81  ? 10.715  3.175   33.553  1.00 96.41  ? 297 LYS A CA    1 
ATOM   533  C  C     . LYS A 1 81  ? 9.401   3.639   34.159  1.00 106.70 ? 297 LYS A C     1 
ATOM   534  O  O     . LYS A 1 81  ? 8.402   3.713   33.426  1.00 106.10 ? 297 LYS A O     1 
ATOM   535  C  CB    . LYS A 1 81  ? 11.244  4.220   32.545  1.00 103.11 ? 297 LYS A CB    1 
ATOM   536  C  CG    . LYS A 1 81  ? 11.612  5.583   33.141  1.00 125.83 ? 297 LYS A CG    1 
ATOM   537  C  CD    . LYS A 1 81  ? 11.446  6.739   32.125  1.00 145.32 ? 297 LYS A CD    1 
ATOM   538  C  CE    . LYS A 1 81  ? 10.003  7.166   31.899  1.00 159.29 ? 297 LYS A CE    1 
ATOM   539  N  NZ    . LYS A 1 81  ? 9.884   8.261   30.898  1.00 171.22 ? 297 LYS A NZ    1 
ATOM   540  N  N     . VAL A 1 82  ? 9.384   3.919   35.494  1.00 109.46 ? 298 VAL A N     1 
ATOM   541  C  CA    . VAL A 1 82  ? 8.187   4.428   36.216  1.00 114.44 ? 298 VAL A CA    1 
ATOM   542  C  C     . VAL A 1 82  ? 8.419   5.131   37.630  1.00 125.35 ? 298 VAL A C     1 
ATOM   543  O  O     . VAL A 1 82  ? 7.707   4.816   38.582  1.00 125.92 ? 298 VAL A O     1 
ATOM   544  C  CB    . VAL A 1 82  ? 6.969   3.435   36.137  1.00 116.59 ? 298 VAL A CB    1 
ATOM   545  C  CG1   . VAL A 1 82  ? 7.317   2.051   36.643  1.00 112.03 ? 298 VAL A CG1   1 
ATOM   546  C  CG2   . VAL A 1 82  ? 5.695   3.980   36.784  1.00 120.20 ? 298 VAL A CG2   1 
ATOM   547  N  N     . ASP A 1 83  ? 9.323   6.146   37.771  1.00 127.65 ? 299 ASP A N     1 
ATOM   548  C  CA    . ASP A 1 83  ? 10.380  6.613   36.861  1.00 129.45 ? 299 ASP A CA    1 
ATOM   549  C  C     . ASP A 1 83  ? 11.556  5.706   37.225  1.00 129.72 ? 299 ASP A C     1 
ATOM   550  O  O     . ASP A 1 83  ? 12.510  5.558   36.439  1.00 129.81 ? 299 ASP A O     1 
ATOM   551  C  CB    . ASP A 1 83  ? 10.732  8.105   37.064  1.00 137.72 ? 299 ASP A CB    1 
ATOM   552  C  CG    . ASP A 1 83  ? 10.102  9.066   36.050  1.00 156.20 ? 299 ASP A CG    1 
ATOM   553  O  OD1   . ASP A 1 83  ? 9.761   8.612   34.917  1.00 156.05 ? 299 ASP A OD1   1 
ATOM   554  O  OD2   . ASP A 1 83  ? 9.980   10.275  36.371  1.00 164.68 ? 299 ASP A OD2   1 
ATOM   555  N  N     . TYR A 1 84  ? 11.435  5.076   38.444  1.00 120.37 ? 303 TYR A N     1 
ATOM   556  C  CA    A TYR A 1 84  ? 12.386  4.089   38.942  0.50 115.52 ? 303 TYR A CA    1 
ATOM   557  C  CA    B TYR A 1 84  ? 12.346  4.074   39.004  0.50 114.51 ? 303 TYR A CA    1 
ATOM   558  C  C     . TYR A 1 84  ? 12.108  2.759   38.226  1.00 109.17 ? 303 TYR A C     1 
ATOM   559  O  O     . TYR A 1 84  ? 10.990  2.543   37.736  1.00 107.26 ? 303 TYR A O     1 
ATOM   560  C  CB    A TYR A 1 84  ? 12.308  3.958   40.482  0.50 117.90 ? 303 TYR A CB    1 
ATOM   561  C  CB    B TYR A 1 84  ? 12.012  3.858   40.503  0.50 115.34 ? 303 TYR A CB    1 
ATOM   562  C  CG    A TYR A 1 84  ? 11.042  3.330   41.032  0.50 120.06 ? 303 TYR A CG    1 
ATOM   563  C  CG    B TYR A 1 84  ? 13.127  3.252   41.330  0.50 114.07 ? 303 TYR A CG    1 
ATOM   564  C  CD1   A TYR A 1 84  ? 9.841   4.036   41.055  0.50 125.84 ? 303 TYR A CD1   1 
ATOM   565  C  CD1   B TYR A 1 84  ? 13.888  4.037   42.190  0.50 118.18 ? 303 TYR A CD1   1 
ATOM   566  C  CD2   A TYR A 1 84  ? 11.064  2.066   41.614  0.50 117.87 ? 303 TYR A CD2   1 
ATOM   567  C  CD2   B TYR A 1 84  ? 13.385  1.882   41.296  0.50 110.81 ? 303 TYR A CD2   1 
ATOM   568  C  CE1   A TYR A 1 84  ? 8.686   3.482   41.604  0.50 127.65 ? 303 TYR A CE1   1 
ATOM   569  C  CE1   B TYR A 1 84  ? 14.908  3.482   42.962  0.50 117.41 ? 303 TYR A CE1   1 
ATOM   570  C  CE2   A TYR A 1 84  ? 9.915   1.501   42.163  0.50 118.86 ? 303 TYR A CE2   1 
ATOM   571  C  CE2   B TYR A 1 84  ? 14.417  1.321   42.044  0.50 110.33 ? 303 TYR A CE2   1 
ATOM   572  C  CZ    A TYR A 1 84  ? 8.731   2.217   42.166  0.50 131.02 ? 303 TYR A CZ    1 
ATOM   573  C  CZ    B TYR A 1 84  ? 15.173  2.125   42.879  0.50 118.22 ? 303 TYR A CZ    1 
ATOM   574  O  OH    A TYR A 1 84  ? 7.599   1.667   42.715  0.50 134.43 ? 303 TYR A OH    1 
ATOM   575  O  OH    B TYR A 1 84  ? 16.183  1.573   43.622  0.50 115.84 ? 303 TYR A OH    1 
ATOM   576  N  N     . LEU A 1 85  ? 13.144  1.881   38.133  1.00 95.75  ? 304 LEU A N     1 
ATOM   577  C  CA    . LEU A 1 85  ? 13.124  0.563   37.472  1.00 87.82  ? 304 LEU A CA    1 
ATOM   578  C  C     . LEU A 1 85  ? 12.078  -0.389  38.032  1.00 85.96  ? 304 LEU A C     1 
ATOM   579  O  O     . LEU A 1 85  ? 12.048  -0.679  39.224  1.00 85.15  ? 304 LEU A O     1 
ATOM   580  C  CB    . LEU A 1 85  ? 14.496  -0.131  37.607  1.00 84.83  ? 304 LEU A CB    1 
ATOM   581  C  CG    . LEU A 1 85  ? 15.190  -0.751  36.385  1.00 85.40  ? 304 LEU A CG    1 
ATOM   582  C  CD1   . LEU A 1 85  ? 16.213  -1.757  36.826  1.00 82.77  ? 304 LEU A CD1   1 
ATOM   583  C  CD2   . LEU A 1 85  ? 14.229  -1.363  35.384  1.00 82.17  ? 304 LEU A CD2   1 
ATOM   584  N  N     . GLU A 1 86  ? 11.282  -0.942  37.143  1.00 79.83  ? 305 GLU A N     1 
ATOM   585  C  CA    . GLU A 1 86  ? 10.313  -1.957  37.476  1.00 77.23  ? 305 GLU A CA    1 
ATOM   586  C  C     . GLU A 1 86  ? 10.548  -3.062  36.472  1.00 77.62  ? 305 GLU A C     1 
ATOM   587  O  O     . GLU A 1 86  ? 10.550  -2.796  35.274  1.00 78.71  ? 305 GLU A O     1 
ATOM   588  C  CB    . GLU A 1 86  ? 8.891   -1.404  37.467  1.00 80.61  ? 305 GLU A CB    1 
ATOM   589  C  CG    . GLU A 1 86  ? 8.595   -0.579  38.713  1.00 90.06  ? 305 GLU A CG    1 
ATOM   590  C  CD    . GLU A 1 86  ? 7.129   -0.357  39.032  1.00 116.84 ? 305 GLU A CD    1 
ATOM   591  O  OE1   . GLU A 1 86  ? 6.838   0.533   39.865  1.00 125.23 ? 305 GLU A OE1   1 
ATOM   592  O  OE2   . GLU A 1 86  ? 6.271   -1.045  38.431  1.00 107.33 ? 305 GLU A OE2   1 
ATOM   593  N  N     . ASN A 1 87  ? 10.884  -4.270  36.956  1.00 70.45  ? 306 ASN A N     1 
ATOM   594  C  CA    . ASN A 1 87  ? 11.197  -5.409  36.099  1.00 66.64  ? 306 ASN A CA    1 
ATOM   595  C  C     . ASN A 1 87  ? 10.033  -6.375  36.017  1.00 69.37  ? 306 ASN A C     1 
ATOM   596  O  O     . ASN A 1 87  ? 9.574   -6.852  37.040  1.00 69.58  ? 306 ASN A O     1 
ATOM   597  C  CB    . ASN A 1 87  ? 12.441  -6.103  36.618  1.00 63.55  ? 306 ASN A CB    1 
ATOM   598  C  CG    . ASN A 1 87  ? 13.573  -5.158  36.843  1.00 77.16  ? 306 ASN A CG    1 
ATOM   599  O  OD1   . ASN A 1 87  ? 14.149  -4.650  35.900  1.00 70.23  ? 306 ASN A OD1   1 
ATOM   600  N  ND2   . ASN A 1 87  ? 13.880  -4.871  38.086  1.00 69.33  ? 306 ASN A ND2   1 
ATOM   601  N  N     . GLN A 1 88  ? 9.545   -6.672  34.826  1.00 66.33  ? 307 GLN A N     1 
ATOM   602  C  CA    . GLN A 1 88  ? 8.461   -7.642  34.649  1.00 65.66  ? 307 GLN A CA    1 
ATOM   603  C  C     . GLN A 1 88  ? 9.032   -8.992  34.133  1.00 67.05  ? 307 GLN A C     1 
ATOM   604  O  O     . GLN A 1 88  ? 9.830   -9.015  33.195  1.00 64.83  ? 307 GLN A O     1 
ATOM   605  C  CB    . GLN A 1 88  ? 7.376   -7.079  33.725  1.00 68.12  ? 307 GLN A CB    1 
ATOM   606  C  CG    . GLN A 1 88  ? 6.114   -7.917  33.717  1.00 90.33  ? 307 GLN A CG    1 
ATOM   607  C  CD    . GLN A 1 88  ? 4.938   -7.280  33.027  1.00 104.73 ? 307 GLN A CD    1 
ATOM   608  O  OE1   . GLN A 1 88  ? 4.963   -6.116  32.560  1.00 98.49  ? 307 GLN A OE1   1 
ATOM   609  N  NE2   . GLN A 1 88  ? 3.863   -8.056  32.983  1.00 88.08  ? 307 GLN A NE2   1 
ATOM   610  N  N     . ALA A 1 89  ? 8.648   -10.098 34.775  1.00 62.52  ? 308 ALA A N     1 
ATOM   611  C  CA    . ALA A 1 89  ? 9.183   -11.394 34.414  1.00 61.27  ? 308 ALA A CA    1 
ATOM   612  C  C     . ALA A 1 89  ? 8.193   -12.272 33.666  1.00 63.89  ? 308 ALA A C     1 
ATOM   613  O  O     . ALA A 1 89  ? 7.012   -12.302 33.992  1.00 64.46  ? 308 ALA A O     1 
ATOM   614  C  CB    . ALA A 1 89  ? 9.703   -12.107 35.651  1.00 62.52  ? 308 ALA A CB    1 
ATOM   615  N  N     . PHE A 1 90  ? 8.691   -12.994 32.664  1.00 58.09  ? 309 PHE A N     1 
ATOM   616  C  CA    . PHE A 1 90  ? 7.910   -13.944 31.869  1.00 57.30  ? 309 PHE A CA    1 
ATOM   617  C  C     . PHE A 1 90  ? 8.702   -15.245 31.849  1.00 63.78  ? 309 PHE A C     1 
ATOM   618  O  O     . PHE A 1 90  ? 9.937   -15.215 31.817  1.00 62.51  ? 309 PHE A O     1 
ATOM   619  C  CB    . PHE A 1 90  ? 7.712   -13.416 30.435  1.00 57.50  ? 309 PHE A CB    1 
ATOM   620  C  CG    . PHE A 1 90  ? 6.920   -12.139 30.384  1.00 59.95  ? 309 PHE A CG    1 
ATOM   621  C  CD1   . PHE A 1 90  ? 5.539   -12.162 30.168  1.00 62.56  ? 309 PHE A CD1   1 
ATOM   622  C  CD2   . PHE A 1 90  ? 7.541   -10.912 30.571  1.00 61.11  ? 309 PHE A CD2   1 
ATOM   623  C  CE1   . PHE A 1 90  ? 4.808   -10.986 30.153  1.00 62.59  ? 309 PHE A CE1   1 
ATOM   624  C  CE2   . PHE A 1 90  ? 6.793   -9.738  30.590  1.00 63.75  ? 309 PHE A CE2   1 
ATOM   625  C  CZ    . PHE A 1 90  ? 5.443   -9.783  30.340  1.00 60.73  ? 309 PHE A CZ    1 
ATOM   626  N  N     . CYS A 1 91  ? 8.014   -16.374 31.841  1.00 63.74  ? 310 CYS A N     1 
ATOM   627  C  CA    . CYS A 1 91  ? 8.634   -17.706 31.844  1.00 65.39  ? 310 CYS A CA    1 
ATOM   628  C  C     . CYS A 1 91  ? 8.180   -18.495 30.645  1.00 66.60  ? 310 CYS A C     1 
ATOM   629  O  O     . CYS A 1 91  ? 6.994   -18.664 30.460  1.00 65.15  ? 310 CYS A O     1 
ATOM   630  C  CB    . CYS A 1 91  ? 8.301   -18.442 33.135  1.00 69.34  ? 310 CYS A CB    1 
ATOM   631  S  SG    . CYS A 1 91  ? 9.303   -19.904 33.415  1.00 75.92  ? 310 CYS A SG    1 
ATOM   632  N  N     . PHE A 1 92  ? 9.112   -19.016 29.855  1.00 65.16  ? 311 PHE A N     1 
ATOM   633  C  CA    . PHE A 1 92  ? 8.839   -19.759 28.625  1.00 63.81  ? 311 PHE A CA    1 
ATOM   634  C  C     . PHE A 1 92  ? 9.592   -21.069 28.648  1.00 67.87  ? 311 PHE A C     1 
ATOM   635  O  O     . PHE A 1 92  ? 10.396  -21.259 29.526  1.00 67.36  ? 311 PHE A O     1 
ATOM   636  C  CB    . PHE A 1 92  ? 9.245   -18.907 27.391  1.00 64.05  ? 311 PHE A CB    1 
ATOM   637  C  CG    . PHE A 1 92  ? 8.480   -17.612 27.313  1.00 63.72  ? 311 PHE A CG    1 
ATOM   638  C  CD1   . PHE A 1 92  ? 7.145   -17.596 26.909  1.00 66.36  ? 311 PHE A CD1   1 
ATOM   639  C  CD2   . PHE A 1 92  ? 9.067   -16.416 27.707  1.00 64.72  ? 311 PHE A CD2   1 
ATOM   640  C  CE1   . PHE A 1 92  ? 6.407   -16.408 26.920  1.00 67.39  ? 311 PHE A CE1   1 
ATOM   641  C  CE2   . PHE A 1 92  ? 8.350   -15.221 27.665  1.00 68.30  ? 311 PHE A CE2   1 
ATOM   642  C  CZ    . PHE A 1 92  ? 7.011   -15.222 27.296  1.00 66.76  ? 311 PHE A CZ    1 
ATOM   643  N  N     . ASP A 1 93  ? 9.360   -21.970 27.679  1.00 64.41  ? 312 ASP A N     1 
ATOM   644  C  CA    . ASP A 1 93  ? 10.083  -23.245 27.635  1.00 64.58  ? 312 ASP A CA    1 
ATOM   645  C  C     . ASP A 1 93  ? 11.548  -22.988 27.349  1.00 68.47  ? 312 ASP A C     1 
ATOM   646  O  O     . ASP A 1 93  ? 12.421  -23.622 27.943  1.00 70.21  ? 312 ASP A O     1 
ATOM   647  C  CB    . ASP A 1 93  ? 9.462   -24.197 26.609  1.00 66.55  ? 312 ASP A CB    1 
ATOM   648  C  CG    . ASP A 1 93  ? 8.063   -24.602 27.004  1.00 70.85  ? 312 ASP A CG    1 
ATOM   649  O  OD1   . ASP A 1 93  ? 7.874   -25.038 28.168  1.00 71.32  ? 312 ASP A OD1   1 
ATOM   650  O  OD2   . ASP A 1 93  ? 7.132   -24.381 26.197  1.00 72.82  ? 312 ASP A OD2   1 
ATOM   651  N  N     . PHE A 1 94  ? 11.818  -22.024 26.464  1.00 63.43  ? 313 PHE A N     1 
ATOM   652  C  CA    . PHE A 1 94  ? 13.172  -21.595 26.128  1.00 63.64  ? 313 PHE A CA    1 
ATOM   653  C  C     . PHE A 1 94  ? 13.183  -20.101 25.889  1.00 66.67  ? 313 PHE A C     1 
ATOM   654  O  O     . PHE A 1 94  ? 12.247  -19.553 25.309  1.00 63.22  ? 313 PHE A O     1 
ATOM   655  C  CB    . PHE A 1 94  ? 13.736  -22.333 24.895  1.00 66.20  ? 313 PHE A CB    1 
ATOM   656  C  CG    . PHE A 1 94  ? 13.808  -23.831 25.073  1.00 69.82  ? 313 PHE A CG    1 
ATOM   657  C  CD1   . PHE A 1 94  ? 14.882  -24.426 25.752  1.00 74.15  ? 313 PHE A CD1   1 
ATOM   658  C  CD2   . PHE A 1 94  ? 12.792  -24.658 24.585  1.00 68.58  ? 313 PHE A CD2   1 
ATOM   659  C  CE1   . PHE A 1 94  ? 14.931  -25.823 25.926  1.00 76.81  ? 313 PHE A CE1   1 
ATOM   660  C  CE2   . PHE A 1 94  ? 12.847  -26.051 24.765  1.00 72.36  ? 313 PHE A CE2   1 
ATOM   661  C  CZ    . PHE A 1 94  ? 13.923  -26.625 25.410  1.00 73.68  ? 313 PHE A CZ    1 
ATOM   662  N  N     . ALA A 1 95  ? 14.228  -19.428 26.382  1.00 65.35  ? 314 ALA A N     1 
ATOM   663  C  CA    . ALA A 1 95  ? 14.412  -17.999 26.116  1.00 64.26  ? 314 ALA A CA    1 
ATOM   664  C  C     . ALA A 1 95  ? 15.783  -17.837 25.463  1.00 69.86  ? 314 ALA A C     1 
ATOM   665  O  O     . ALA A 1 95  ? 16.804  -18.307 25.992  1.00 69.68  ? 314 ALA A O     1 
ATOM   666  C  CB    . ALA A 1 95  ? 14.286  -17.181 27.385  1.00 63.40  ? 314 ALA A CB    1 
ATOM   667  N  N     . PHE A 1 96  ? 15.791  -17.282 24.258  1.00 66.94  ? 315 PHE A N     1 
ATOM   668  C  CA    . PHE A 1 96  ? 17.042  -17.130 23.519  1.00 68.24  ? 315 PHE A CA    1 
ATOM   669  C  C     . PHE A 1 96  ? 17.469  -15.687 23.547  1.00 74.29  ? 315 PHE A C     1 
ATOM   670  O  O     . PHE A 1 96  ? 16.706  -14.795 23.160  1.00 73.87  ? 315 PHE A O     1 
ATOM   671  C  CB    . PHE A 1 96  ? 16.911  -17.625 22.071  1.00 69.82  ? 315 PHE A CB    1 
ATOM   672  C  CG    . PHE A 1 96  ? 16.450  -19.054 21.972  1.00 70.82  ? 315 PHE A CG    1 
ATOM   673  C  CD1   . PHE A 1 96  ? 17.336  -20.100 22.163  1.00 73.95  ? 315 PHE A CD1   1 
ATOM   674  C  CD2   . PHE A 1 96  ? 15.114  -19.358 21.706  1.00 69.49  ? 315 PHE A CD2   1 
ATOM   675  C  CE1   . PHE A 1 96  ? 16.902  -21.425 22.071  1.00 74.70  ? 315 PHE A CE1   1 
ATOM   676  C  CE2   . PHE A 1 96  ? 14.693  -20.687 21.608  1.00 71.42  ? 315 PHE A CE2   1 
ATOM   677  C  CZ    . PHE A 1 96  ? 15.592  -21.709 21.808  1.00 70.87  ? 315 PHE A CZ    1 
ATOM   678  N  N     . ASP A 1 97  ? 18.694  -15.446 23.993  1.00 73.02  ? 316 ASP A N     1 
ATOM   679  C  CA    . ASP A 1 97  ? 19.183  -14.087 24.029  1.00 73.53  ? 316 ASP A CA    1 
ATOM   680  C  C     . ASP A 1 97  ? 19.827  -13.715 22.729  1.00 80.28  ? 316 ASP A C     1 
ATOM   681  O  O     . ASP A 1 97  ? 19.858  -14.517 21.785  1.00 80.84  ? 316 ASP A O     1 
ATOM   682  C  CB    . ASP A 1 97  ? 20.088  -13.850 25.244  1.00 75.79  ? 316 ASP A CB    1 
ATOM   683  C  CG    . ASP A 1 97  ? 21.456  -14.496 25.249  1.00 88.53  ? 316 ASP A CG    1 
ATOM   684  O  OD1   . ASP A 1 97  ? 21.861  -15.070 24.217  1.00 91.08  ? 316 ASP A OD1   1 
ATOM   685  O  OD2   . ASP A 1 97  ? 22.132  -14.400 26.265  1.00 99.19  ? 316 ASP A OD2   1 
ATOM   686  N  N     . GLU A 1 98  ? 20.364  -12.504 22.686  1.00 79.11  ? 317 GLU A N     1 
ATOM   687  C  CA    . GLU A 1 98  ? 20.988  -11.972 21.485  1.00 82.21  ? 317 GLU A CA    1 
ATOM   688  C  C     . GLU A 1 98  ? 22.235  -12.720 21.045  1.00 90.72  ? 317 GLU A C     1 
ATOM   689  O  O     . GLU A 1 98  ? 22.679  -12.518 19.931  1.00 95.10  ? 317 GLU A O     1 
ATOM   690  C  CB    . GLU A 1 98  ? 21.222  -10.459 21.624  1.00 84.57  ? 317 GLU A CB    1 
ATOM   691  C  CG    . GLU A 1 98  ? 22.189  -10.079 22.723  1.00 87.63  ? 317 GLU A CG    1 
ATOM   692  C  CD    . GLU A 1 98  ? 21.637  -9.703  24.088  1.00 106.78 ? 317 GLU A CD    1 
ATOM   693  O  OE1   . GLU A 1 98  ? 20.926  -10.527 24.707  1.00 103.27 ? 317 GLU A OE1   1 
ATOM   694  O  OE2   . GLU A 1 98  ? 22.141  -8.700  24.643  1.00 90.88  ? 317 GLU A OE2   1 
ATOM   695  N  N     . THR A 1 99  ? 22.785  -13.600 21.883  1.00 86.57  ? 318 THR A N     1 
ATOM   696  C  CA    . THR A 1 99  ? 23.971  -14.369 21.488  1.00 88.77  ? 318 THR A CA    1 
ATOM   697  C  C     . THR A 1 99  ? 23.583  -15.672 20.788  1.00 92.36  ? 318 THR A C     1 
ATOM   698  O  O     . THR A 1 99  ? 24.457  -16.324 20.226  1.00 95.44  ? 318 THR A O     1 
ATOM   699  C  CB    . THR A 1 99  ? 24.886  -14.627 22.705  1.00 89.31  ? 318 THR A CB    1 
ATOM   700  O  OG1   . THR A 1 99  ? 24.240  -15.569 23.569  1.00 96.50  ? 318 THR A OG1   1 
ATOM   701  C  CG2   . THR A 1 99  ? 25.213  -13.342 23.486  1.00 67.68  ? 318 THR A CG2   1 
ATOM   702  N  N     . ALA A 1 100 ? 22.291  -16.077 20.865  1.00 85.67  ? 319 ALA A N     1 
ATOM   703  C  CA    . ALA A 1 100 ? 21.804  -17.317 20.272  1.00 84.91  ? 319 ALA A CA    1 
ATOM   704  C  C     . ALA A 1 100 ? 21.734  -17.251 18.755  1.00 90.79  ? 319 ALA A C     1 
ATOM   705  O  O     . ALA A 1 100 ? 21.074  -16.372 18.197  1.00 90.63  ? 319 ALA A O     1 
ATOM   706  C  CB    . ALA A 1 100 ? 20.456  -17.701 20.856  1.00 81.63  ? 319 ALA A CB    1 
ATOM   707  N  N     . SER A 1 101 ? 22.438  -18.174 18.087  1.00 89.07  ? 320 SER A N     1 
ATOM   708  C  CA    . SER A 1 101 ? 22.448  -18.291 16.629  1.00 90.36  ? 320 SER A CA    1 
ATOM   709  C  C     . SER A 1 101 ? 21.192  -19.047 16.179  1.00 89.58  ? 320 SER A C     1 
ATOM   710  O  O     . SER A 1 101 ? 20.526  -19.667 16.999  1.00 84.92  ? 320 SER A O     1 
ATOM   711  C  CB    . SER A 1 101 ? 23.679  -19.072 16.183  1.00 96.19  ? 320 SER A CB    1 
ATOM   712  O  OG    . SER A 1 101 ? 23.632  -20.388 16.715  1.00 101.92 ? 320 SER A OG    1 
ATOM   713  N  N     . ASN A 1 102 ? 20.898  -19.040 14.876  1.00 87.95  ? 321 ASN A N     1 
ATOM   714  C  CA    . ASN A 1 102 ? 19.779  -19.804 14.318  1.00 85.77  ? 321 ASN A CA    1 
ATOM   715  C  C     . ASN A 1 102 ? 19.905  -21.284 14.658  1.00 91.53  ? 321 ASN A C     1 
ATOM   716  O  O     . ASN A 1 102 ? 18.901  -21.918 14.968  1.00 89.82  ? 321 ASN A O     1 
ATOM   717  C  CB    . ASN A 1 102 ? 19.676  -19.610 12.808  1.00 87.01  ? 321 ASN A CB    1 
ATOM   718  C  CG    . ASN A 1 102 ? 19.062  -18.288 12.439  1.00 108.83 ? 321 ASN A CG    1 
ATOM   719  O  OD1   . ASN A 1 102 ? 18.660  -17.500 13.311  1.00 100.07 ? 321 ASN A OD1   1 
ATOM   720  N  ND2   . ASN A 1 102 ? 19.008  -17.996 11.151  1.00 101.74 ? 321 ASN A ND2   1 
ATOM   721  N  N     . GLU A 1 103 ? 21.138  -21.805 14.657  1.00 92.36  ? 322 GLU A N     1 
ATOM   722  C  CA    . GLU A 1 103 ? 21.518  -23.181 14.980  1.00 94.50  ? 322 GLU A CA    1 
ATOM   723  C  C     . GLU A 1 103 ? 21.082  -23.568 16.396  1.00 96.57  ? 322 GLU A C     1 
ATOM   724  O  O     . GLU A 1 103 ? 20.554  -24.657 16.595  1.00 98.91  ? 322 GLU A O     1 
ATOM   725  C  CB    . GLU A 1 103 ? 23.045  -23.334 14.782  1.00 100.64 ? 322 GLU A CB    1 
ATOM   726  C  CG    . GLU A 1 103 ? 23.650  -24.638 15.267  1.00 117.32 ? 322 GLU A CG    1 
ATOM   727  C  CD    . GLU A 1 103 ? 25.167  -24.699 15.408  1.00 149.98 ? 322 GLU A CD    1 
ATOM   728  O  OE1   . GLU A 1 103 ? 25.801  -23.701 15.838  1.00 126.49 ? 322 GLU A OE1   1 
ATOM   729  O  OE2   . GLU A 1 103 ? 25.707  -25.803 15.173  1.00 153.57 ? 322 GLU A OE2   1 
ATOM   730  N  N     . VAL A 1 104 ? 21.294  -22.674 17.362  1.00 88.36  ? 323 VAL A N     1 
ATOM   731  C  CA    . VAL A 1 104 ? 20.937  -22.883 18.758  1.00 85.33  ? 323 VAL A CA    1 
ATOM   732  C  C     . VAL A 1 104 ? 19.415  -22.869 18.905  1.00 88.11  ? 323 VAL A C     1 
ATOM   733  O  O     . VAL A 1 104 ? 18.848  -23.715 19.596  1.00 89.04  ? 323 VAL A O     1 
ATOM   734  C  CB    . VAL A 1 104 ? 21.618  -21.789 19.621  1.00 88.43  ? 323 VAL A CB    1 
ATOM   735  C  CG1   . VAL A 1 104 ? 20.991  -21.672 21.007  1.00 84.50  ? 323 VAL A CG1   1 
ATOM   736  C  CG2   . VAL A 1 104 ? 23.128  -21.998 19.710  1.00 92.49  ? 323 VAL A CG2   1 
ATOM   737  N  N     . VAL A 1 105 ? 18.753  -21.886 18.273  1.00 81.41  ? 324 VAL A N     1 
ATOM   738  C  CA    . VAL A 1 105 ? 17.300  -21.769 18.287  1.00 77.08  ? 324 VAL A CA    1 
ATOM   739  C  C     . VAL A 1 105 ? 16.675  -23.056 17.702  1.00 81.22  ? 324 VAL A C     1 
ATOM   740  O  O     . VAL A 1 105 ? 15.797  -23.670 18.320  1.00 79.74  ? 324 VAL A O     1 
ATOM   741  C  CB    . VAL A 1 105 ? 16.833  -20.499 17.515  1.00 78.82  ? 324 VAL A CB    1 
ATOM   742  C  CG1   . VAL A 1 105 ? 15.307  -20.435 17.399  1.00 74.85  ? 324 VAL A CG1   1 
ATOM   743  C  CG2   . VAL A 1 105 ? 17.391  -19.222 18.151  1.00 77.64  ? 324 VAL A CG2   1 
ATOM   744  N  N     . TYR A 1 106 ? 17.153  -23.456 16.529  1.00 79.70  ? 325 TYR A N     1 
ATOM   745  C  CA    . TYR A 1 106 ? 16.673  -24.639 15.815  1.00 81.87  ? 325 TYR A CA    1 
ATOM   746  C  C     . TYR A 1 106 ? 16.691  -25.906 16.656  1.00 88.37  ? 325 TYR A C     1 
ATOM   747  O  O     . TYR A 1 106 ? 15.688  -26.644 16.721  1.00 87.30  ? 325 TYR A O     1 
ATOM   748  C  CB    . TYR A 1 106 ? 17.492  -24.838 14.527  1.00 85.95  ? 325 TYR A CB    1 
ATOM   749  C  CG    . TYR A 1 106 ? 17.157  -26.123 13.811  1.00 86.73  ? 325 TYR A CG    1 
ATOM   750  C  CD1   . TYR A 1 106 ? 15.878  -26.347 13.297  1.00 85.81  ? 325 TYR A CD1   1 
ATOM   751  C  CD2   . TYR A 1 106 ? 18.103  -27.132 13.676  1.00 90.11  ? 325 TYR A CD2   1 
ATOM   752  C  CE1   . TYR A 1 106 ? 15.554  -27.548 12.674  1.00 87.37  ? 325 TYR A CE1   1 
ATOM   753  C  CE2   . TYR A 1 106 ? 17.792  -28.330 13.045  1.00 92.71  ? 325 TYR A CE2   1 
ATOM   754  C  CZ    . TYR A 1 106 ? 16.512  -28.535 12.552  1.00 97.13  ? 325 TYR A CZ    1 
ATOM   755  O  OH    . TYR A 1 106 ? 16.188  -29.706 11.931  1.00 102.93 ? 325 TYR A OH    1 
ATOM   756  N  N     . ARG A 1 107 ? 17.829  -26.128 17.320  1.00 87.12  ? 326 ARG A N     1 
ATOM   757  C  CA    . ARG A 1 107 ? 18.034  -27.280 18.183  1.00 89.00  ? 326 ARG A CA    1 
ATOM   758  C  C     . ARG A 1 107 ? 16.877  -27.545 19.162  1.00 92.09  ? 326 ARG A C     1 
ATOM   759  O  O     . ARG A 1 107 ? 16.513  -28.692 19.412  1.00 94.65  ? 326 ARG A O     1 
ATOM   760  C  CB    . ARG A 1 107 ? 19.369  -27.139 18.947  1.00 88.97  ? 326 ARG A CB    1 
ATOM   761  C  CG    . ARG A 1 107 ? 19.557  -28.265 19.965  1.00 99.47  ? 326 ARG A CG    1 
ATOM   762  C  CD    . ARG A 1 107 ? 20.900  -28.323 20.640  1.00 111.29 ? 326 ARG A CD    1 
ATOM   763  N  NE    . ARG A 1 107 ? 21.258  -29.725 20.864  1.00 124.63 ? 326 ARG A NE    1 
ATOM   764  C  CZ    . ARG A 1 107 ? 21.219  -30.325 22.045  1.00 131.32 ? 326 ARG A CZ    1 
ATOM   765  N  NH1   . ARG A 1 107 ? 20.926  -29.637 23.132  1.00 115.74 ? 326 ARG A NH1   1 
ATOM   766  N  NH2   . ARG A 1 107 ? 21.536  -31.605 22.155  1.00 122.25 ? 326 ARG A NH2   1 
ATOM   767  N  N     . PHE A 1 108 ? 16.348  -26.496 19.745  1.00 85.59  ? 327 PHE A N     1 
ATOM   768  C  CA    . PHE A 1 108 ? 15.381  -26.621 20.820  1.00 82.74  ? 327 PHE A CA    1 
ATOM   769  C  C     . PHE A 1 108 ? 13.948  -26.445 20.387  1.00 86.28  ? 327 PHE A C     1 
ATOM   770  O  O     . PHE A 1 108 ? 13.022  -26.677 21.177  1.00 86.01  ? 327 PHE A O     1 
ATOM   771  C  CB    . PHE A 1 108 ? 15.764  -25.625 21.931  1.00 81.39  ? 327 PHE A CB    1 
ATOM   772  C  CG    . PHE A 1 108 ? 17.066  -25.983 22.621  1.00 84.71  ? 327 PHE A CG    1 
ATOM   773  C  CD1   . PHE A 1 108 ? 17.123  -27.032 23.546  1.00 89.98  ? 327 PHE A CD1   1 
ATOM   774  C  CD2   . PHE A 1 108 ? 18.235  -25.272 22.352  1.00 87.26  ? 327 PHE A CD2   1 
ATOM   775  C  CE1   . PHE A 1 108 ? 18.337  -27.377 24.171  1.00 94.61  ? 327 PHE A CE1   1 
ATOM   776  C  CE2   . PHE A 1 108 ? 19.452  -25.635 22.956  1.00 93.27  ? 327 PHE A CE2   1 
ATOM   777  C  CZ    . PHE A 1 108 ? 19.493  -26.683 23.862  1.00 93.75  ? 327 PHE A CZ    1 
ATOM   778  N  N     . THR A 1 109 ? 13.756  -26.044 19.127  1.00 80.99  ? 328 THR A N     1 
ATOM   779  C  CA    . THR A 1 109 ? 12.442  -25.742 18.604  1.00 76.33  ? 328 THR A CA    1 
ATOM   780  C  C     . THR A 1 109 ? 12.004  -26.723 17.574  1.00 81.53  ? 328 THR A C     1 
ATOM   781  O  O     . THR A 1 109 ? 11.318  -27.691 17.912  1.00 82.17  ? 328 THR A O     1 
ATOM   782  C  CB    . THR A 1 109 ? 12.396  -24.304 18.114  1.00 79.56  ? 328 THR A CB    1 
ATOM   783  O  OG1   . THR A 1 109 ? 13.349  -24.121 17.061  1.00 84.80  ? 328 THR A OG1   1 
ATOM   784  C  CG2   . THR A 1 109 ? 12.623  -23.318 19.234  1.00 77.98  ? 328 THR A CG2   1 
ATOM   785  N  N     . ALA A 1 110 ? 12.395  -26.485 16.311  1.00 79.26  ? 329 ALA A N     1 
ATOM   786  C  CA    . ALA A 1 110 ? 12.007  -27.305 15.161  1.00 79.23  ? 329 ALA A CA    1 
ATOM   787  C  C     . ALA A 1 110 ? 12.686  -28.660 15.114  1.00 88.47  ? 329 ALA A C     1 
ATOM   788  O  O     . ALA A 1 110 ? 12.065  -29.635 14.676  1.00 91.47  ? 329 ALA A O     1 
ATOM   789  C  CB    . ALA A 1 110 ? 12.266  -26.548 13.865  1.00 79.44  ? 329 ALA A CB    1 
ATOM   790  N  N     . ALA A 1 111 ? 13.957  -28.744 15.529  1.00 85.84  ? 330 ALA A N     1 
ATOM   791  C  CA    . ALA A 1 111 ? 14.724  -29.996 15.400  1.00 89.26  ? 330 ALA A CA    1 
ATOM   792  C  C     . ALA A 1 111 ? 14.065  -31.213 16.042  1.00 94.22  ? 330 ALA A C     1 
ATOM   793  O  O     . ALA A 1 111 ? 13.886  -32.196 15.343  1.00 97.36  ? 330 ALA A O     1 
ATOM   794  C  CB    . ALA A 1 111 ? 16.140  -29.821 15.887  1.00 91.61  ? 330 ALA A CB    1 
ATOM   795  N  N     . PRO A 1 112 ? 13.588  -31.158 17.307  1.00 87.34  ? 331 PRO A N     1 
ATOM   796  C  CA    . PRO A 1 112 ? 12.898  -32.335 17.862  1.00 88.64  ? 331 PRO A CA    1 
ATOM   797  C  C     . PRO A 1 112 ? 11.587  -32.673 17.154  1.00 92.92  ? 331 PRO A C     1 
ATOM   798  O  O     . PRO A 1 112 ? 11.078  -33.772 17.356  1.00 95.24  ? 331 PRO A O     1 
ATOM   799  C  CB    . PRO A 1 112 ? 12.625  -31.950 19.320  1.00 87.31  ? 331 PRO A CB    1 
ATOM   800  C  CG    . PRO A 1 112 ? 12.916  -30.574 19.434  1.00 86.62  ? 331 PRO A CG    1 
ATOM   801  C  CD    . PRO A 1 112 ? 13.713  -30.086 18.314  1.00 83.29  ? 331 PRO A CD    1 
ATOM   802  N  N     . LEU A 1 113 ? 11.039  -31.764 16.338  1.00 86.51  ? 332 LEU A N     1 
ATOM   803  C  CA    . LEU A 1 113 ? 9.770   -32.022 15.657  1.00 86.02  ? 332 LEU A CA    1 
ATOM   804  C  C     . LEU A 1 113 ? 9.964   -32.759 14.336  1.00 95.47  ? 332 LEU A C     1 
ATOM   805  O  O     . LEU A 1 113 ? 8.986   -33.250 13.773  1.00 95.10  ? 332 LEU A O     1 
ATOM   806  C  CB    . LEU A 1 113 ? 8.938   -30.744 15.449  1.00 81.33  ? 332 LEU A CB    1 
ATOM   807  C  CG    . LEU A 1 113 ? 8.576   -29.904 16.691  1.00 83.42  ? 332 LEU A CG    1 
ATOM   808  C  CD1   . LEU A 1 113 ? 7.561   -28.851 16.358  1.00 79.06  ? 332 LEU A CD1   1 
ATOM   809  C  CD2   . LEU A 1 113 ? 8.008   -30.759 17.787  1.00 89.73  ? 332 LEU A CD2   1 
ATOM   810  N  N     . VAL A 1 114 ? 11.216  -32.823 13.833  1.00 94.38  ? 333 VAL A N     1 
ATOM   811  C  CA    . VAL A 1 114 ? 11.554  -33.507 12.593  1.00 96.54  ? 333 VAL A CA    1 
ATOM   812  C  C     . VAL A 1 114 ? 11.305  -35.012 12.754  1.00 106.21 ? 333 VAL A C     1 
ATOM   813  O  O     . VAL A 1 114 ? 10.758  -35.621 11.843  1.00 108.54 ? 333 VAL A O     1 
ATOM   814  C  CB    . VAL A 1 114 ? 12.980  -33.191 12.085  1.00 102.25 ? 333 VAL A CB    1 
ATOM   815  C  CG1   . VAL A 1 114 ? 13.316  -34.013 10.856  1.00 106.64 ? 333 VAL A CG1   1 
ATOM   816  C  CG2   . VAL A 1 114 ? 13.154  -31.710 11.775  1.00 98.81  ? 333 VAL A CG2   1 
ATOM   817  N  N     . GLN A 1 115 ? 11.663  -35.604 13.901  1.00 104.54 ? 334 GLN A N     1 
ATOM   818  C  CA    . GLN A 1 115 ? 11.417  -37.020 14.167  1.00 108.93 ? 334 GLN A CA    1 
ATOM   819  C  C     . GLN A 1 115 ? 9.919   -37.314 14.173  1.00 112.38 ? 334 GLN A C     1 
ATOM   820  O  O     . GLN A 1 115 ? 9.527   -38.367 13.681  1.00 117.23 ? 334 GLN A O     1 
ATOM   821  C  CB    . GLN A 1 115 ? 12.026  -37.426 15.498  1.00 112.11 ? 334 GLN A CB    1 
ATOM   822  N  N     . THR A 1 116 ? 9.081   -36.385 14.706  1.00 103.18 ? 335 THR A N     1 
ATOM   823  C  CA    . THR A 1 116 ? 7.612   -36.502 14.768  1.00 100.97 ? 335 THR A CA    1 
ATOM   824  C  C     . THR A 1 116 ? 7.030   -36.885 13.426  1.00 105.07 ? 335 THR A C     1 
ATOM   825  O  O     . THR A 1 116 ? 6.186   -37.782 13.367  1.00 108.38 ? 335 THR A O     1 
ATOM   826  C  CB    . THR A 1 116 ? 6.962   -35.178 15.248  1.00 101.78 ? 335 THR A CB    1 
ATOM   827  O  OG1   . THR A 1 116 ? 7.407   -34.931 16.569  1.00 99.93  ? 335 THR A OG1   1 
ATOM   828  C  CG2   . THR A 1 116 ? 5.409   -35.201 15.225  1.00 100.02 ? 335 THR A CG2   1 
ATOM   829  N  N     . ILE A 1 117 ? 7.466   -36.202 12.353  1.00 98.60  ? 336 ILE A N     1 
ATOM   830  C  CA    . ILE A 1 117 ? 6.961   -36.452 11.006  1.00 98.39  ? 336 ILE A CA    1 
ATOM   831  C  C     . ILE A 1 117 ? 7.345   -37.849 10.487  1.00 106.90 ? 336 ILE A C     1 
ATOM   832  O  O     . ILE A 1 117 ? 6.604   -38.432 9.707   1.00 107.91 ? 336 ILE A O     1 
ATOM   833  C  CB    . ILE A 1 117 ? 7.176   -35.258 10.032  1.00 97.85  ? 336 ILE A CB    1 
ATOM   834  C  CG1   . ILE A 1 117 ? 8.570   -35.214 9.430   1.00 99.57  ? 336 ILE A CG1   1 
ATOM   835  C  CG2   . ILE A 1 117 ? 6.838   -33.922 10.723  1.00 94.09  ? 336 ILE A CG2   1 
ATOM   836  C  CD1   . ILE A 1 117 ? 8.666   -34.375 8.197   1.00 100.17 ? 336 ILE A CD1   1 
ATOM   837  N  N     . PHE A 1 118 ? 8.466   -38.407 10.980  1.00 107.75 ? 337 PHE A N     1 
ATOM   838  C  CA    . PHE A 1 118 ? 8.901   -39.767 10.641  1.00 114.32 ? 337 PHE A CA    1 
ATOM   839  C  C     . PHE A 1 118 ? 8.136   -40.846 11.415  1.00 123.80 ? 337 PHE A C     1 
ATOM   840  O  O     . PHE A 1 118 ? 8.009   -41.965 10.928  1.00 129.05 ? 337 PHE A O     1 
ATOM   841  C  CB    . PHE A 1 118 ? 10.413  -39.921 10.812  1.00 118.80 ? 337 PHE A CB    1 
ATOM   842  C  CG    . PHE A 1 118 ? 11.172  -39.340 9.647   1.00 119.82 ? 337 PHE A CG    1 
ATOM   843  C  CD1   . PHE A 1 118 ? 11.463  -40.117 8.531   1.00 126.62 ? 337 PHE A CD1   1 
ATOM   844  C  CD2   . PHE A 1 118 ? 11.542  -38.001 9.636   1.00 116.76 ? 337 PHE A CD2   1 
ATOM   845  C  CE1   . PHE A 1 118 ? 12.131  -39.572 7.434   1.00 127.37 ? 337 PHE A CE1   1 
ATOM   846  C  CE2   . PHE A 1 118 ? 12.218  -37.457 8.543   1.00 119.96 ? 337 PHE A CE2   1 
ATOM   847  C  CZ    . PHE A 1 118 ? 12.511  -38.247 7.448   1.00 122.48 ? 337 PHE A CZ    1 
ATOM   848  N  N     . GLU A 1 119 ? 7.610   -40.508 12.603  1.00 118.93 ? 338 GLU A N     1 
ATOM   849  C  CA    . GLU A 1 119 ? 6.780   -41.417 13.392  1.00 121.82 ? 338 GLU A CA    1 
ATOM   850  C  C     . GLU A 1 119 ? 5.336   -41.355 12.882  1.00 124.32 ? 338 GLU A C     1 
ATOM   851  O  O     . GLU A 1 119 ? 4.458   -41.961 13.491  1.00 126.49 ? 338 GLU A O     1 
ATOM   852  C  CB    . GLU A 1 119 ? 6.769   -41.024 14.872  1.00 121.99 ? 338 GLU A CB    1 
ATOM   853  C  CG    . GLU A 1 119 ? 8.110   -40.895 15.575  1.00 137.20 ? 338 GLU A CG    1 
ATOM   854  C  CD    . GLU A 1 119 ? 8.060   -40.128 16.891  1.00 162.18 ? 338 GLU A CD    1 
ATOM   855  O  OE1   . GLU A 1 119 ? 7.013   -39.511 17.205  1.00 141.66 ? 338 GLU A OE1   1 
ATOM   856  O  OE2   . GLU A 1 119 ? 9.089   -40.131 17.605  1.00 168.85 ? 338 GLU A OE2   1 
ATOM   857  N  N     . GLY A 1 120 ? 5.089   -40.592 11.820  1.00 117.16 ? 339 GLY A N     1 
ATOM   858  C  CA    . GLY A 1 120 ? 3.753   -40.447 11.259  1.00 114.95 ? 339 GLY A CA    1 
ATOM   859  C  C     . GLY A 1 120 ? 2.921   -39.328 11.854  1.00 112.71 ? 339 GLY A C     1 
ATOM   860  O  O     . GLY A 1 120 ? 1.692   -39.322 11.726  1.00 112.19 ? 339 GLY A O     1 
ATOM   861  N  N     . GLY A 1 121 ? 3.579   -38.356 12.466  1.00 104.80 ? 340 GLY A N     1 
ATOM   862  C  CA    . GLY A 1 121 ? 2.881   -37.229 13.076  1.00 99.51  ? 340 GLY A CA    1 
ATOM   863  C  C     . GLY A 1 121 ? 2.819   -35.954 12.264  1.00 97.28  ? 340 GLY A C     1 
ATOM   864  O  O     . GLY A 1 121 ? 3.247   -35.896 11.108  1.00 96.07  ? 340 GLY A O     1 
ATOM   865  N  N     . LYS A 1 122 ? 2.260   -34.927 12.883  1.00 91.07  ? 341 LYS A N     1 
ATOM   866  C  CA    . LYS A 1 122 ? 2.125   -33.603 12.289  1.00 87.18  ? 341 LYS A CA    1 
ATOM   867  C  C     . LYS A 1 122 ? 2.860   -32.629 13.168  1.00 88.27  ? 341 LYS A C     1 
ATOM   868  O  O     . LYS A 1 122 ? 2.743   -32.687 14.392  1.00 89.43  ? 341 LYS A O     1 
ATOM   869  C  CB    . LYS A 1 122 ? 0.654   -33.182 12.159  1.00 88.18  ? 341 LYS A CB    1 
ATOM   870  C  CG    . LYS A 1 122 ? -0.217  -34.101 11.312  1.00 93.50  ? 341 LYS A CG    1 
ATOM   871  C  CD    . LYS A 1 122 ? -0.078  -33.846 9.835   1.00 98.71  ? 341 LYS A CD    1 
ATOM   872  C  CE    . LYS A 1 122 ? -1.061  -34.681 9.060   1.00 110.02 ? 341 LYS A CE    1 
ATOM   873  N  NZ    . LYS A 1 122 ? -0.781  -36.145 9.209   1.00 127.94 ? 341 LYS A NZ    1 
ATOM   874  N  N     . ALA A 1 123 ? 3.637   -31.754 12.553  1.00 81.48  ? 342 ALA A N     1 
ATOM   875  C  CA    . ALA A 1 123 ? 4.398   -30.774 13.289  1.00 78.74  ? 342 ALA A CA    1 
ATOM   876  C  C     . ALA A 1 123 ? 4.157   -29.415 12.662  1.00 79.16  ? 342 ALA A C     1 
ATOM   877  O  O     . ALA A 1 123 ? 3.903   -29.312 11.452  1.00 76.69  ? 342 ALA A O     1 
ATOM   878  C  CB    . ALA A 1 123 ? 5.890   -31.127 13.270  1.00 80.96  ? 342 ALA A CB    1 
ATOM   879  N  N     . THR A 1 124 ? 4.199   -28.372 13.511  1.00 73.48  ? 343 THR A N     1 
ATOM   880  C  CA    . THR A 1 124 ? 4.118   -26.980 13.099  1.00 70.63  ? 343 THR A CA    1 
ATOM   881  C  C     . THR A 1 124 ? 5.115   -26.162 13.880  1.00 72.86  ? 343 THR A C     1 
ATOM   882  O  O     . THR A 1 124 ? 5.359   -26.408 15.070  1.00 70.08  ? 343 THR A O     1 
ATOM   883  C  CB    . THR A 1 124 ? 2.711   -26.378 13.252  1.00 77.00  ? 343 THR A CB    1 
ATOM   884  O  OG1   . THR A 1 124 ? 2.218   -26.590 14.576  1.00 73.00  ? 343 THR A OG1   1 
ATOM   885  C  CG2   . THR A 1 124 ? 1.718   -26.896 12.211  1.00 69.90  ? 343 THR A CG2   1 
ATOM   886  N  N     . CYS A 1 125 ? 5.659   -25.153 13.204  1.00 69.90  ? 344 CYS A N     1 
ATOM   887  C  CA    . CYS A 1 125 ? 6.597   -24.227 13.789  1.00 68.71  ? 344 CYS A CA    1 
ATOM   888  C  C     . CYS A 1 125 ? 6.285   -22.856 13.284  1.00 69.45  ? 344 CYS A C     1 
ATOM   889  O  O     . CYS A 1 125 ? 6.273   -22.642 12.082  1.00 70.69  ? 344 CYS A O     1 
ATOM   890  C  CB    . CYS A 1 125 ? 8.032   -24.630 13.477  1.00 71.76  ? 344 CYS A CB    1 
ATOM   891  S  SG    . CYS A 1 125 ? 9.260   -23.606 14.311  1.00 75.76  ? 344 CYS A SG    1 
ATOM   892  N  N     . PHE A 1 126 ? 6.050   -21.928 14.196  1.00 65.47  ? 345 PHE A N     1 
ATOM   893  C  CA    . PHE A 1 126 ? 5.682   -20.544 13.892  1.00 65.02  ? 345 PHE A CA    1 
ATOM   894  C  C     . PHE A 1 126 ? 6.660   -19.555 14.457  1.00 67.82  ? 345 PHE A C     1 
ATOM   895  O  O     . PHE A 1 126 ? 7.066   -19.695 15.597  1.00 64.66  ? 345 PHE A O     1 
ATOM   896  C  CB    . PHE A 1 126 ? 4.285   -20.186 14.504  1.00 64.30  ? 345 PHE A CB    1 
ATOM   897  C  CG    . PHE A 1 126 ? 3.181   -21.111 14.101  1.00 65.22  ? 345 PHE A CG    1 
ATOM   898  C  CD1   . PHE A 1 126 ? 2.464   -20.892 12.932  1.00 68.83  ? 345 PHE A CD1   1 
ATOM   899  C  CD2   . PHE A 1 126 ? 2.852   -22.206 14.886  1.00 66.79  ? 345 PHE A CD2   1 
ATOM   900  C  CE1   . PHE A 1 126 ? 1.444   -21.761 12.545  1.00 69.63  ? 345 PHE A CE1   1 
ATOM   901  C  CE2   . PHE A 1 126 ? 1.854   -23.096 14.483  1.00 70.61  ? 345 PHE A CE2   1 
ATOM   902  C  CZ    . PHE A 1 126 ? 1.153   -22.860 13.317  1.00 68.90  ? 345 PHE A CZ    1 
ATOM   903  N  N     . ALA A 1 127 ? 6.956   -18.501 13.689  1.00 67.45  ? 346 ALA A N     1 
ATOM   904  C  CA    . ALA A 1 127 ? 7.694   -17.346 14.171  1.00 67.45  ? 346 ALA A CA    1 
ATOM   905  C  C     . ALA A 1 127 ? 6.655   -16.232 14.217  1.00 71.08  ? 346 ALA A C     1 
ATOM   906  O  O     . ALA A 1 127 ? 5.987   -15.967 13.212  1.00 72.66  ? 346 ALA A O     1 
ATOM   907  C  CB    . ALA A 1 127 ? 8.846   -16.994 13.261  1.00 69.93  ? 346 ALA A CB    1 
ATOM   908  N  N     . TYR A 1 128 ? 6.499   -15.624 15.399  1.00 64.72  ? 347 TYR A N     1 
ATOM   909  C  CA    . TYR A 1 128 ? 5.489   -14.636 15.736  1.00 63.72  ? 347 TYR A CA    1 
ATOM   910  C  C     . TYR A 1 128 ? 6.146   -13.402 16.411  1.00 68.70  ? 347 TYR A C     1 
ATOM   911  O  O     . TYR A 1 128 ? 6.993   -13.563 17.275  1.00 67.79  ? 347 TYR A O     1 
ATOM   912  C  CB    . TYR A 1 128 ? 4.504   -15.334 16.707  1.00 62.23  ? 347 TYR A CB    1 
ATOM   913  C  CG    . TYR A 1 128 ? 3.506   -14.389 17.337  1.00 63.31  ? 347 TYR A CG    1 
ATOM   914  C  CD1   . TYR A 1 128 ? 2.248   -14.189 16.765  1.00 65.88  ? 347 TYR A CD1   1 
ATOM   915  C  CD2   . TYR A 1 128 ? 3.824   -13.674 18.491  1.00 63.20  ? 347 TYR A CD2   1 
ATOM   916  C  CE1   . TYR A 1 128 ? 1.338   -13.288 17.319  1.00 67.74  ? 347 TYR A CE1   1 
ATOM   917  C  CE2   . TYR A 1 128 ? 2.927   -12.767 19.050  1.00 65.09  ? 347 TYR A CE2   1 
ATOM   918  C  CZ    . TYR A 1 128 ? 1.686   -12.574 18.457  1.00 72.79  ? 347 TYR A CZ    1 
ATOM   919  O  OH    . TYR A 1 128 ? 0.787   -11.686 19.000  1.00 74.10  ? 347 TYR A OH    1 
ATOM   920  N  N     . GLY A 1 129 ? 5.720   -12.197 16.071  1.00 66.70  ? 348 GLY A N     1 
ATOM   921  C  CA    . GLY A 1 129 ? 6.247   -10.987 16.713  1.00 66.88  ? 348 GLY A CA    1 
ATOM   922  C  C     . GLY A 1 129 ? 6.143   -9.776  15.826  1.00 74.84  ? 348 GLY A C     1 
ATOM   923  O  O     . GLY A 1 129 ? 5.695   -9.893  14.678  1.00 76.47  ? 348 GLY A O     1 
ATOM   924  N  N     . GLN A 1 130 ? 6.581   -8.606  16.316  1.00 72.25  ? 349 GLN A N     1 
ATOM   925  C  CA    . GLN A 1 130 ? 6.449   -7.393  15.508  1.00 74.03  ? 349 GLN A CA    1 
ATOM   926  C  C     . GLN A 1 130 ? 7.336   -7.377  14.276  1.00 79.25  ? 349 GLN A C     1 
ATOM   927  O  O     . GLN A 1 130 ? 8.366   -8.050  14.251  1.00 78.79  ? 349 GLN A O     1 
ATOM   928  C  CB    . GLN A 1 130 ? 6.643   -6.115  16.346  1.00 76.42  ? 349 GLN A CB    1 
ATOM   929  C  CG    . GLN A 1 130 ? 8.085   -5.871  16.740  1.00 91.70  ? 349 GLN A CG    1 
ATOM   930  C  CD    . GLN A 1 130 ? 8.317   -4.547  17.383  1.00 95.41  ? 349 GLN A CD    1 
ATOM   931  O  OE1   . GLN A 1 130 ? 8.782   -4.477  18.509  1.00 88.20  ? 349 GLN A OE1   1 
ATOM   932  N  NE2   . GLN A 1 130 ? 8.011   -3.481  16.686  1.00 86.68  ? 349 GLN A NE2   1 
ATOM   933  N  N     . THR A 1 131 ? 6.959   -6.578  13.265  1.00 77.30  ? 350 THR A N     1 
ATOM   934  C  CA    . THR A 1 131 ? 7.810   -6.389  12.099  1.00 79.46  ? 350 THR A CA    1 
ATOM   935  C  C     . THR A 1 131 ? 9.161   -5.860  12.592  1.00 83.75  ? 350 THR A C     1 
ATOM   936  O  O     . THR A 1 131 ? 9.199   -4.959  13.439  1.00 84.39  ? 350 THR A O     1 
ATOM   937  C  CB    . THR A 1 131 ? 7.173   -5.402  11.127  1.00 86.28  ? 350 THR A CB    1 
ATOM   938  O  OG1   . THR A 1 131 ? 5.938   -5.963  10.686  1.00 88.43  ? 350 THR A OG1   1 
ATOM   939  C  CG2   . THR A 1 131 ? 8.063   -5.104  9.927   1.00 81.55  ? 350 THR A CG2   1 
ATOM   940  N  N     . GLY A 1 132 ? 10.238  -6.439  12.075  1.00 79.16  ? 351 GLY A N     1 
ATOM   941  C  CA    . GLY A 1 132 ? 11.600  -6.078  12.440  1.00 80.12  ? 351 GLY A CA    1 
ATOM   942  C  C     . GLY A 1 132 ? 12.190  -6.860  13.595  1.00 83.53  ? 351 GLY A C     1 
ATOM   943  O  O     . GLY A 1 132 ? 13.347  -6.647  13.932  1.00 87.06  ? 351 GLY A O     1 
ATOM   944  N  N     . SER A 1 133 ? 11.420  -7.796  14.195  1.00 76.47  ? 352 SER A N     1 
ATOM   945  C  CA    . SER A 1 133 ? 11.818  -8.577  15.380  1.00 71.39  ? 352 SER A CA    1 
ATOM   946  C  C     . SER A 1 133 ? 12.745  -9.781  15.126  1.00 75.62  ? 352 SER A C     1 
ATOM   947  O  O     . SER A 1 133 ? 13.454  -10.225 16.037  1.00 73.11  ? 352 SER A O     1 
ATOM   948  C  CB    . SER A 1 133 ? 10.622  -8.909  16.276  1.00 66.32  ? 352 SER A CB    1 
ATOM   949  O  OG    . SER A 1 133 ? 9.639   -9.724  15.669  1.00 71.23  ? 352 SER A OG    1 
ATOM   950  N  N     . GLY A 1 134 ? 12.697  -10.323 13.914  1.00 74.65  ? 353 GLY A N     1 
ATOM   951  C  CA    . GLY A 1 134 ? 13.554  -11.433 13.531  1.00 75.37  ? 353 GLY A CA    1 
ATOM   952  C  C     . GLY A 1 134 ? 12.877  -12.695 13.064  1.00 79.61  ? 353 GLY A C     1 
ATOM   953  O  O     . GLY A 1 134 ? 13.522  -13.744 13.046  1.00 81.28  ? 353 GLY A O     1 
ATOM   954  N  N     . LYS A 1 135 ? 11.603  -12.615 12.640  1.00 74.22  ? 354 LYS A N     1 
ATOM   955  C  CA    . LYS A 1 135 ? 10.880  -13.800 12.173  1.00 71.12  ? 354 LYS A CA    1 
ATOM   956  C  C     . LYS A 1 135 ? 11.494  -14.361 10.914  1.00 75.14  ? 354 LYS A C     1 
ATOM   957  O  O     . LYS A 1 135 ? 11.702  -15.568 10.844  1.00 75.16  ? 354 LYS A O     1 
ATOM   958  C  CB    . LYS A 1 135 ? 9.392   -13.508 11.920  1.00 71.73  ? 354 LYS A CB    1 
ATOM   959  C  CG    . LYS A 1 135 ? 8.600   -12.964 13.110  1.00 67.63  ? 354 LYS A CG    1 
ATOM   960  C  CD    . LYS A 1 135 ? 7.154   -12.627 12.689  1.00 68.81  ? 354 LYS A CD    1 
ATOM   961  C  CE    . LYS A 1 135 ? 7.034   -11.411 11.761  1.00 71.31  ? 354 LYS A CE    1 
ATOM   962  N  NZ    . LYS A 1 135 ? 7.553   -10.140 12.335  1.00 78.29  ? 354 LYS A NZ    1 
ATOM   963  N  N     . THR A 1 136 ? 11.732  -13.520 9.896   1.00 73.69  ? 355 THR A N     1 
ATOM   964  C  CA    . THR A 1 136 ? 12.277  -13.990 8.623   1.00 77.29  ? 355 THR A CA    1 
ATOM   965  C  C     . THR A 1 136 ? 13.721  -14.453 8.781   1.00 85.70  ? 355 THR A C     1 
ATOM   966  O  O     . THR A 1 136 ? 14.136  -15.452 8.185   1.00 87.53  ? 355 THR A O     1 
ATOM   967  C  CB    . THR A 1 136 ? 12.092  -12.930 7.517   1.00 90.85  ? 355 THR A CB    1 
ATOM   968  O  OG1   . THR A 1 136 ? 10.695  -12.589 7.428   1.00 95.58  ? 355 THR A OG1   1 
ATOM   969  C  CG2   . THR A 1 136 ? 12.612  -13.412 6.135   1.00 79.59  ? 355 THR A CG2   1 
ATOM   970  N  N     . HIS A 1 137 ? 14.479  -13.729 9.601   1.00 83.42  ? 356 HIS A N     1 
ATOM   971  C  CA    . HIS A 1 137 ? 15.849  -14.075 9.919   1.00 85.12  ? 356 HIS A CA    1 
ATOM   972  C  C     . HIS A 1 137 ? 15.889  -15.491 10.539  1.00 90.19  ? 356 HIS A C     1 
ATOM   973  O  O     . HIS A 1 137 ? 16.753  -16.297 10.186  1.00 92.55  ? 356 HIS A O     1 
ATOM   974  C  CB    . HIS A 1 137 ? 16.426  -13.035 10.868  1.00 85.30  ? 356 HIS A CB    1 
ATOM   975  C  CG    . HIS A 1 137 ? 17.780  -13.391 11.384  1.00 90.61  ? 356 HIS A CG    1 
ATOM   976  N  ND1   . HIS A 1 137 ? 17.931  -14.205 12.487  1.00 89.63  ? 356 HIS A ND1   1 
ATOM   977  C  CD2   . HIS A 1 137 ? 19.008  -13.029 10.934  1.00 97.06  ? 356 HIS A CD2   1 
ATOM   978  C  CE1   . HIS A 1 137 ? 19.236  -14.330 12.670  1.00 92.33  ? 356 HIS A CE1   1 
ATOM   979  N  NE2   . HIS A 1 137 ? 19.926  -13.638 11.762  1.00 96.98  ? 356 HIS A NE2   1 
ATOM   980  N  N     . THR A 1 138 ? 14.937  -15.790 11.452  1.00 84.23  ? 357 THR A N     1 
ATOM   981  C  CA    . THR A 1 138 ? 14.828  -17.101 12.109  1.00 82.22  ? 357 THR A CA    1 
ATOM   982  C  C     . THR A 1 138 ? 14.448  -18.209 11.115  1.00 87.78  ? 357 THR A C     1 
ATOM   983  O  O     . THR A 1 138 ? 15.075  -19.273 11.107  1.00 88.15  ? 357 THR A O     1 
ATOM   984  C  CB    . THR A 1 138 ? 13.840  -17.032 13.296  1.00 81.89  ? 357 THR A CB    1 
ATOM   985  O  OG1   . THR A 1 138 ? 14.262  -16.012 14.203  1.00 80.08  ? 357 THR A OG1   1 
ATOM   986  C  CG2   . THR A 1 138 ? 13.703  -18.348 14.034  1.00 81.33  ? 357 THR A CG2   1 
ATOM   987  N  N     . MET A 1 139 ? 13.401  -17.973 10.307  1.00 85.64  ? 358 MET A N     1 
ATOM   988  C  CA    . MET A 1 139 ? 12.877  -19.001 9.407   1.00 86.35  ? 358 MET A CA    1 
ATOM   989  C  C     . MET A 1 139 ? 13.639  -19.169 8.117   1.00 96.52  ? 358 MET A C     1 
ATOM   990  O  O     . MET A 1 139 ? 13.971  -20.299 7.779   1.00 98.35  ? 358 MET A O     1 
ATOM   991  C  CB    . MET A 1 139 ? 11.376  -18.798 9.122   1.00 86.07  ? 358 MET A CB    1 
ATOM   992  C  CG    . MET A 1 139 ? 10.498  -18.715 10.356  1.00 85.84  ? 358 MET A CG    1 
ATOM   993  S  SD    . MET A 1 139 ? 10.597  -20.095 11.534  1.00 88.27  ? 358 MET A SD    1 
ATOM   994  C  CE    . MET A 1 139 ? 9.945   -21.338 10.641  1.00 85.53  ? 358 MET A CE    1 
ATOM   995  N  N     . GLY A 1 140 ? 13.883  -18.059 7.410   1.00 97.96  ? 359 GLY A N     1 
ATOM   996  C  CA    . GLY A 1 140 ? 14.518  -18.033 6.094   1.00 104.64 ? 359 GLY A CA    1 
ATOM   997  C  C     . GLY A 1 140 ? 16.025  -17.863 6.085   1.00 119.12 ? 359 GLY A C     1 
ATOM   998  O  O     . GLY A 1 140 ? 16.716  -18.552 5.335   1.00 124.23 ? 359 GLY A O     1 
ATOM   999  N  N     . GLY A 1 141 ? 16.534  -17.002 6.964   1.00 117.95 ? 360 GLY A N     1 
ATOM   1000 C  CA    . GLY A 1 141 ? 17.962  -16.745 7.113   1.00 122.32 ? 360 GLY A CA    1 
ATOM   1001 C  C     . GLY A 1 141 ? 18.324  -15.277 7.027   1.00 131.61 ? 360 GLY A C     1 
ATOM   1002 O  O     . GLY A 1 141 ? 17.485  -14.449 6.655   1.00 131.18 ? 360 GLY A O     1 
ATOM   1003 N  N     . ASP A 1 142 ? 19.582  -14.949 7.380   1.00 132.73 ? 361 ASP A N     1 
ATOM   1004 C  CA    . ASP A 1 142 ? 20.139  -13.591 7.312   1.00 136.21 ? 361 ASP A CA    1 
ATOM   1005 C  C     . ASP A 1 142 ? 20.526  -13.270 5.840   1.00 146.29 ? 361 ASP A C     1 
ATOM   1006 O  O     . ASP A 1 142 ? 20.179  -12.198 5.333   1.00 147.97 ? 361 ASP A O     1 
ATOM   1007 C  CB    . ASP A 1 142 ? 21.381  -13.479 8.245   1.00 139.38 ? 361 ASP A CB    1 
ATOM   1008 C  CG    . ASP A 1 142 ? 21.995  -12.092 8.475   1.00 150.62 ? 361 ASP A CG    1 
ATOM   1009 O  OD1   . ASP A 1 142 ? 21.887  -11.225 7.570   1.00 154.71 ? 361 ASP A OD1   1 
ATOM   1010 O  OD2   . ASP A 1 142 ? 22.650  -11.897 9.531   1.00 153.64 ? 361 ASP A OD2   1 
ATOM   1011 N  N     . LEU A 1 143 ? 21.221  -14.219 5.167   1.00 145.66 ? 362 LEU A N     1 
ATOM   1012 C  CA    . LEU A 1 143 ? 21.761  -14.131 3.797   1.00 183.06 ? 362 LEU A CA    1 
ATOM   1013 C  C     . LEU A 1 143 ? 23.036  -13.274 3.755   1.00 184.06 ? 362 LEU A C     1 
ATOM   1014 O  O     . LEU A 1 143 ? 23.813  -13.258 4.715   1.00 161.52 ? 362 LEU A O     1 
ATOM   1015 C  CB    . LEU A 1 143 ? 20.734  -13.639 2.746   1.00 183.66 ? 362 LEU A CB    1 
ATOM   1016 C  CG    . LEU A 1 143 ? 19.648  -14.620 2.314   1.00 184.77 ? 362 LEU A CG    1 
ATOM   1017 C  CD1   . LEU A 1 143 ? 18.397  -14.459 3.148   1.00 179.39 ? 362 LEU A CD1   1 
ATOM   1018 C  CD2   . LEU A 1 143 ? 19.324  -14.441 0.844   1.00 189.14 ? 362 LEU A CD2   1 
ATOM   1019 N  N     . SER A 1 151 ? 24.407  -18.565 5.791   1.00 154.66 ? 370 SER A N     1 
ATOM   1020 C  CA    . SER A 1 151 ? 23.572  -18.630 6.994   1.00 147.73 ? 370 SER A CA    1 
ATOM   1021 C  C     . SER A 1 151 ? 22.090  -19.025 6.756   1.00 145.50 ? 370 SER A C     1 
ATOM   1022 O  O     . SER A 1 151 ? 21.363  -18.355 6.013   1.00 144.74 ? 370 SER A O     1 
ATOM   1023 C  CB    . SER A 1 151 ? 23.654  -17.322 7.769   1.00 146.82 ? 370 SER A CB    1 
ATOM   1024 N  N     . LYS A 1 152 ? 21.676  -20.137 7.385   1.00 137.42 ? 371 LYS A N     1 
ATOM   1025 C  CA    . LYS A 1 152 ? 20.317  -20.683 7.421   1.00 132.11 ? 371 LYS A CA    1 
ATOM   1026 C  C     . LYS A 1 152 ? 19.767  -20.202 8.795   1.00 126.07 ? 371 LYS A C     1 
ATOM   1027 O  O     . LYS A 1 152 ? 20.586  -19.807 9.623   1.00 127.15 ? 371 LYS A O     1 
ATOM   1028 C  CB    . LYS A 1 152 ? 20.404  -22.204 7.391   1.00 133.90 ? 371 LYS A CB    1 
ATOM   1029 N  N     . GLY A 1 153 ? 18.468  -20.101 9.074   1.00 113.76 ? 372 GLY A N     1 
ATOM   1030 C  CA    . GLY A 1 153 ? 17.264  -20.488 8.373   1.00 109.99 ? 372 GLY A CA    1 
ATOM   1031 C  C     . GLY A 1 153 ? 16.723  -21.807 8.901   1.00 106.49 ? 372 GLY A C     1 
ATOM   1032 O  O     . GLY A 1 153 ? 17.320  -22.850 8.620   1.00 107.89 ? 372 GLY A O     1 
ATOM   1033 N  N     . ILE A 1 154 ? 15.585  -21.795 9.650   1.00 94.86  ? 373 ILE A N     1 
ATOM   1034 C  CA    . ILE A 1 154 ? 14.963  -23.040 10.139  1.00 91.93  ? 373 ILE A CA    1 
ATOM   1035 C  C     . ILE A 1 154 ? 14.426  -23.918 8.999   1.00 95.85  ? 373 ILE A C     1 
ATOM   1036 O  O     . ILE A 1 154 ? 14.491  -25.139 9.100   1.00 97.59  ? 373 ILE A O     1 
ATOM   1037 C  CB    . ILE A 1 154 ? 13.918  -22.782 11.240  1.00 90.26  ? 373 ILE A CB    1 
ATOM   1038 C  CG1   . ILE A 1 154 ? 14.630  -22.412 12.552  1.00 89.10  ? 373 ILE A CG1   1 
ATOM   1039 C  CG2   . ILE A 1 154 ? 13.003  -24.000 11.450  1.00 88.90  ? 373 ILE A CG2   1 
ATOM   1040 C  CD1   . ILE A 1 154 ? 13.667  -22.009 13.664  1.00 80.86  ? 373 ILE A CD1   1 
ATOM   1041 N  N     . TYR A 1 155 ? 13.925  -23.315 7.910   1.00 90.21  ? 374 TYR A N     1 
ATOM   1042 C  CA    . TYR A 1 155 ? 13.444  -24.108 6.774   1.00 90.21  ? 374 TYR A CA    1 
ATOM   1043 C  C     . TYR A 1 155 ? 14.559  -25.005 6.247   1.00 98.55  ? 374 TYR A C     1 
ATOM   1044 O  O     . TYR A 1 155 ? 14.314  -26.176 5.984   1.00 99.73  ? 374 TYR A O     1 
ATOM   1045 C  CB    . TYR A 1 155 ? 13.009  -23.227 5.600   1.00 90.58  ? 374 TYR A CB    1 
ATOM   1046 C  CG    . TYR A 1 155 ? 11.960  -22.162 5.810   1.00 87.15  ? 374 TYR A CG    1 
ATOM   1047 C  CD1   . TYR A 1 155 ? 10.865  -22.384 6.648   1.00 85.34  ? 374 TYR A CD1   1 
ATOM   1048 C  CD2   . TYR A 1 155 ? 11.976  -20.995 5.058   1.00 88.76  ? 374 TYR A CD2   1 
ATOM   1049 C  CE1   . TYR A 1 155 ? 9.867   -21.419 6.808   1.00 83.25  ? 374 TYR A CE1   1 
ATOM   1050 C  CE2   . TYR A 1 155 ? 10.972  -20.039 5.186   1.00 87.77  ? 374 TYR A CE2   1 
ATOM   1051 C  CZ    . TYR A 1 155 ? 9.916   -20.257 6.058   1.00 88.17  ? 374 TYR A CZ    1 
ATOM   1052 O  OH    . TYR A 1 155 ? 8.938   -19.306 6.169   1.00 85.54  ? 374 TYR A OH    1 
ATOM   1053 N  N     . ALA A 1 156 ? 15.784  -24.442 6.085   1.00 97.65  ? 375 ALA A N     1 
ATOM   1054 C  CA    . ALA A 1 156 ? 16.929  -25.147 5.508   1.00 101.76 ? 375 ALA A CA    1 
ATOM   1055 C  C     . ALA A 1 156 ? 17.463  -26.211 6.444   1.00 105.82 ? 375 ALA A C     1 
ATOM   1056 O  O     . ALA A 1 156 ? 17.784  -27.322 6.017   1.00 107.68 ? 375 ALA A O     1 
ATOM   1057 C  CB    . ALA A 1 156 ? 18.021  -24.155 5.137   1.00 105.48 ? 375 ALA A CB    1 
ATOM   1058 N  N     . MET A 1 157 ? 17.497  -25.893 7.736   1.00 100.80 ? 376 MET A N     1 
ATOM   1059 C  CA    . MET A 1 157 ? 17.998  -26.809 8.742   1.00 101.76 ? 376 MET A CA    1 
ATOM   1060 C  C     . MET A 1 157 ? 17.069  -28.006 8.928   1.00 106.43 ? 376 MET A C     1 
ATOM   1061 O  O     . MET A 1 157 ? 17.556  -29.133 9.086   1.00 111.42 ? 376 MET A O     1 
ATOM   1062 C  CB    . MET A 1 157 ? 18.253  -26.065 10.053  1.00 101.24 ? 376 MET A CB    1 
ATOM   1063 C  CG    . MET A 1 157 ? 19.384  -25.054 9.971   1.00 107.03 ? 376 MET A CG    1 
ATOM   1064 S  SD    . MET A 1 157 ? 19.613  -24.082 11.492  1.00 108.52 ? 376 MET A SD    1 
ATOM   1065 C  CE    . MET A 1 157 ? 21.253  -24.500 11.810  1.00 110.82 ? 376 MET A CE    1 
ATOM   1066 N  N     . ALA A 1 158 ? 15.736  -27.768 8.890   1.00 97.34  ? 377 ALA A N     1 
ATOM   1067 C  CA    . ALA A 1 158 ? 14.752  -28.843 8.978   1.00 95.90  ? 377 ALA A CA    1 
ATOM   1068 C  C     . ALA A 1 158 ? 14.867  -29.726 7.740   1.00 104.17 ? 377 ALA A C     1 
ATOM   1069 O  O     . ALA A 1 158 ? 14.904  -30.943 7.870   1.00 107.20 ? 377 ALA A O     1 
ATOM   1070 C  CB    . ALA A 1 158 ? 13.343  -28.281 9.108   1.00 91.97  ? 377 ALA A CB    1 
ATOM   1071 N  N     . SER A 1 159 ? 14.978  -29.117 6.550   1.00 101.22 ? 378 SER A N     1 
ATOM   1072 C  CA    . SER A 1 159 ? 15.096  -29.844 5.289   1.00 104.54 ? 378 SER A CA    1 
ATOM   1073 C  C     . SER A 1 159 ? 16.295  -30.763 5.306   1.00 117.17 ? 378 SER A C     1 
ATOM   1074 O  O     . SER A 1 159 ? 16.159  -31.964 5.034   1.00 120.58 ? 378 SER A O     1 
ATOM   1075 C  CB    . SER A 1 159 ? 15.196  -28.866 4.131   1.00 106.35 ? 378 SER A CB    1 
ATOM   1076 O  OG    . SER A 1 159 ? 14.029  -28.065 4.090   1.00 104.58 ? 378 SER A OG    1 
ATOM   1077 N  N     . ALA A 1 160 ? 17.463  -30.207 5.699   1.00 116.49 ? 379 ALA A N     1 
ATOM   1078 C  CA    . ALA A 1 160 ? 18.708  -30.958 5.848   1.00 121.12 ? 379 ALA A CA    1 
ATOM   1079 C  C     . ALA A 1 160 ? 18.498  -32.179 6.740   1.00 126.50 ? 379 ALA A C     1 
ATOM   1080 O  O     . ALA A 1 160 ? 18.827  -33.284 6.317   1.00 131.39 ? 379 ALA A O     1 
ATOM   1081 C  CB    . ALA A 1 160 ? 19.797  -30.069 6.423   1.00 121.60 ? 379 ALA A CB    1 
ATOM   1082 N  N     . ASP A 1 161 ? 17.913  -31.994 7.944   1.00 118.15 ? 380 ASP A N     1 
ATOM   1083 C  CA    . ASP A 1 161 ? 17.674  -33.105 8.869   1.00 118.82 ? 380 ASP A CA    1 
ATOM   1084 C  C     . ASP A 1 161 ? 16.654  -34.128 8.372   1.00 124.66 ? 380 ASP A C     1 
ATOM   1085 O  O     . ASP A 1 161 ? 16.761  -35.307 8.730   1.00 128.44 ? 380 ASP A O     1 
ATOM   1086 C  CB    . ASP A 1 161 ? 17.294  -32.599 10.253  1.00 115.88 ? 380 ASP A CB    1 
ATOM   1087 C  CG    . ASP A 1 161 ? 18.449  -32.090 11.087  1.00 127.38 ? 380 ASP A CG    1 
ATOM   1088 O  OD1   . ASP A 1 161 ? 19.636  -32.465 10.791  1.00 133.65 ? 380 ASP A OD1   1 
ATOM   1089 O  OD2   . ASP A 1 161 ? 18.184  -31.379 12.067  1.00 126.42 ? 380 ASP A OD2   1 
ATOM   1090 N  N     . VAL A 1 162 ? 15.668  -33.694 7.562   1.00 117.66 ? 381 VAL A N     1 
ATOM   1091 C  CA    . VAL A 1 162 ? 14.697  -34.623 6.987   1.00 118.50 ? 381 VAL A CA    1 
ATOM   1092 C  C     . VAL A 1 162 ? 15.466  -35.608 6.108   1.00 129.32 ? 381 VAL A C     1 
ATOM   1093 O  O     . VAL A 1 162 ? 15.292  -36.816 6.247   1.00 133.48 ? 381 VAL A O     1 
ATOM   1094 C  CB    . VAL A 1 162 ? 13.562  -33.915 6.204   1.00 119.07 ? 381 VAL A CB    1 
ATOM   1095 C  CG1   . VAL A 1 162 ? 12.762  -34.914 5.360   1.00 121.52 ? 381 VAL A CG1   1 
ATOM   1096 C  CG2   . VAL A 1 162 ? 12.632  -33.174 7.152   1.00 113.19 ? 381 VAL A CG2   1 
ATOM   1097 N  N     . PHE A 1 163 ? 16.360  -35.092 5.254   1.00 127.34 ? 382 PHE A N     1 
ATOM   1098 C  CA    . PHE A 1 163 ? 17.166  -35.926 4.372   1.00 133.11 ? 382 PHE A CA    1 
ATOM   1099 C  C     . PHE A 1 163 ? 18.185  -36.808 5.086   1.00 142.16 ? 382 PHE A C     1 
ATOM   1100 O  O     . PHE A 1 163 ? 18.519  -37.868 4.572   1.00 148.72 ? 382 PHE A O     1 
ATOM   1101 C  CB    . PHE A 1 163 ? 17.762  -35.112 3.233   1.00 136.62 ? 382 PHE A CB    1 
ATOM   1102 C  CG    . PHE A 1 163 ? 16.723  -34.691 2.214   1.00 136.14 ? 382 PHE A CG    1 
ATOM   1103 C  CD1   . PHE A 1 163 ? 16.140  -35.625 1.355   1.00 142.24 ? 382 PHE A CD1   1 
ATOM   1104 C  CD2   . PHE A 1 163 ? 16.330  -33.360 2.103   1.00 134.31 ? 382 PHE A CD2   1 
ATOM   1105 C  CE1   . PHE A 1 163 ? 15.162  -35.236 0.422   1.00 141.30 ? 382 PHE A CE1   1 
ATOM   1106 C  CE2   . PHE A 1 163 ? 15.362  -32.970 1.159   1.00 135.26 ? 382 PHE A CE2   1 
ATOM   1107 C  CZ    . PHE A 1 163 ? 14.789  -33.909 0.324   1.00 135.88 ? 382 PHE A CZ    1 
ATOM   1108 N  N     . LEU A 1 164 ? 18.641  -36.416 6.278   1.00 137.38 ? 383 LEU A N     1 
ATOM   1109 C  CA    . LEU A 1 164 ? 19.533  -37.254 7.089   1.00 142.41 ? 383 LEU A CA    1 
ATOM   1110 C  C     . LEU A 1 164 ? 18.733  -38.386 7.736   1.00 147.27 ? 383 LEU A C     1 
ATOM   1111 O  O     . LEU A 1 164 ? 19.206  -39.523 7.797   1.00 153.78 ? 383 LEU A O     1 
ATOM   1112 C  CB    . LEU A 1 164 ? 20.225  -36.422 8.181   1.00 140.66 ? 383 LEU A CB    1 
ATOM   1113 C  CG    . LEU A 1 164 ? 21.573  -35.773 7.841   1.00 149.29 ? 383 LEU A CG    1 
ATOM   1114 C  CD1   . LEU A 1 164 ? 21.589  -35.191 6.430   1.00 150.68 ? 383 LEU A CD1   1 
ATOM   1115 C  CD2   . LEU A 1 164 ? 21.927  -34.699 8.864   1.00 145.44 ? 383 LEU A CD2   1 
ATOM   1116 N  N     . LEU A 1 165 ? 17.525  -38.075 8.218   1.00 138.01 ? 384 LEU A N     1 
ATOM   1117 C  CA    . LEU A 1 165 ? 16.674  -39.060 8.870   1.00 137.93 ? 384 LEU A CA    1 
ATOM   1118 C  C     . LEU A 1 165 ? 16.172  -40.111 7.901   1.00 145.53 ? 384 LEU A C     1 
ATOM   1119 O  O     . LEU A 1 165 ? 16.148  -41.283 8.263   1.00 150.44 ? 384 LEU A O     1 
ATOM   1120 C  CB    . LEU A 1 165 ? 15.518  -38.389 9.624   1.00 131.30 ? 384 LEU A CB    1 
ATOM   1121 C  CG    . LEU A 1 165 ? 15.542  -38.444 11.163  1.00 135.10 ? 384 LEU A CG    1 
ATOM   1122 C  CD1   . LEU A 1 165 ? 16.952  -38.408 11.736  1.00 138.51 ? 384 LEU A CD1   1 
ATOM   1123 C  CD2   . LEU A 1 165 ? 14.762  -37.292 11.753  1.00 132.03 ? 384 LEU A CD2   1 
ATOM   1124 N  N     . LYS A 1 166 ? 15.818  -39.722 6.667   1.00 139.92 ? 385 LYS A N     1 
ATOM   1125 C  CA    . LYS A 1 166 ? 15.325  -40.690 5.685   1.00 143.18 ? 385 LYS A CA    1 
ATOM   1126 C  C     . LYS A 1 166 ? 16.402  -41.580 5.059   1.00 155.50 ? 385 LYS A C     1 
ATOM   1127 O  O     . LYS A 1 166 ? 16.064  -42.584 4.437   1.00 156.60 ? 385 LYS A O     1 
ATOM   1128 C  CB    . LYS A 1 166 ? 14.435  -40.030 4.637   1.00 141.48 ? 385 LYS A CB    1 
ATOM   1129 C  CG    . LYS A 1 166 ? 15.170  -39.439 3.451   1.00 143.29 ? 385 LYS A CG    1 
ATOM   1130 C  CD    . LYS A 1 166 ? 14.179  -38.886 2.450   1.00 140.56 ? 385 LYS A CD    1 
ATOM   1131 C  CE    . LYS A 1 166 ? 13.420  -39.928 1.664   1.00 142.97 ? 385 LYS A CE    1 
ATOM   1132 N  NZ    . LYS A 1 166 ? 14.172  -40.331 0.462   1.00 151.86 ? 385 LYS A NZ    1 
ATOM   1133 N  N     . ASN A 1 167 ? 17.687  -41.216 5.217   1.00 154.13 ? 386 ASN A N     1 
ATOM   1134 C  CA    . ASN A 1 167 ? 18.803  -42.042 4.750   1.00 155.39 ? 386 ASN A CA    1 
ATOM   1135 C  C     . ASN A 1 167 ? 19.221  -43.029 5.855   1.00 159.98 ? 386 ASN A C     1 
ATOM   1136 O  O     . ASN A 1 167 ? 20.116  -43.842 5.627   1.00 160.55 ? 386 ASN A O     1 
ATOM   1137 C  CB    . ASN A 1 167 ? 19.988  -41.170 4.343   1.00 155.36 ? 386 ASN A CB    1 
ATOM   1138 N  N     . GLN A 1 168 ? 18.585  -42.957 7.051   1.00 159.08 ? 387 GLN A N     1 
ATOM   1139 C  CA    . GLN A 1 168 ? 18.874  -43.884 8.151   1.00 160.20 ? 387 GLN A CA    1 
ATOM   1140 C  C     . GLN A 1 168 ? 18.222  -45.243 7.877   1.00 165.96 ? 387 GLN A C     1 
ATOM   1141 O  O     . GLN A 1 168 ? 17.206  -45.284 7.184   1.00 165.70 ? 387 GLN A O     1 
ATOM   1142 C  CB    . GLN A 1 168 ? 18.454  -43.320 9.511   1.00 160.42 ? 387 GLN A CB    1 
ATOM   1143 C  CG    . GLN A 1 168 ? 19.495  -42.378 10.103  1.00 163.25 ? 387 GLN A CG    1 
ATOM   1144 C  CD    . GLN A 1 168 ? 19.194  -42.006 11.540  1.00 173.73 ? 387 GLN A CD    1 
ATOM   1145 O  OE1   . GLN A 1 168 ? 18.961  -42.869 12.394  1.00 174.81 ? 387 GLN A OE1   1 
ATOM   1146 N  NE2   . GLN A 1 168 ? 19.248  -40.712 11.857  1.00 164.83 ? 387 GLN A NE2   1 
ATOM   1147 N  N     . PRO A 1 169 ? 18.811  -46.356 8.391   1.00 166.79 ? 388 PRO A N     1 
ATOM   1148 C  CA    . PRO A 1 169 ? 18.279  -47.708 8.088   1.00 168.57 ? 388 PRO A CA    1 
ATOM   1149 C  C     . PRO A 1 169 ? 16.811  -47.950 8.445   1.00 172.82 ? 388 PRO A C     1 
ATOM   1150 O  O     . PRO A 1 169 ? 16.082  -48.574 7.661   1.00 173.56 ? 388 PRO A O     1 
ATOM   1151 C  CB    . PRO A 1 169 ? 19.225  -48.641 8.858   1.00 170.38 ? 388 PRO A CB    1 
ATOM   1152 C  CG    . PRO A 1 169 ? 19.869  -47.759 9.904   1.00 172.32 ? 388 PRO A CG    1 
ATOM   1153 C  CD    . PRO A 1 169 ? 20.030  -46.445 9.222   1.00 168.04 ? 388 PRO A CD    1 
ATOM   1154 N  N     . CYS A 1 170 ? 16.383  -47.442 9.615   1.00 170.00 ? 389 CYS A N     1 
ATOM   1155 C  CA    . CYS A 1 170 ? 15.014  -47.544 10.114  1.00 170.25 ? 389 CYS A CA    1 
ATOM   1156 C  C     . CYS A 1 170 ? 14.025  -46.998 9.107   1.00 171.33 ? 389 CYS A C     1 
ATOM   1157 O  O     . CYS A 1 170 ? 13.104  -47.703 8.697   1.00 172.51 ? 389 CYS A O     1 
ATOM   1158 C  CB    . CYS A 1 170 ? 14.888  -46.818 11.450  1.00 170.36 ? 389 CYS A CB    1 
ATOM   1159 S  SG    . CYS A 1 170 ? 16.142  -47.311 12.668  1.00 173.54 ? 389 CYS A SG    1 
ATOM   1160 N  N     . TYR A 1 171 ? 14.237  -45.747 8.694   1.00 166.04 ? 390 TYR A N     1 
ATOM   1161 C  CA    . TYR A 1 171 ? 13.347  -45.013 7.803   1.00 164.48 ? 390 TYR A CA    1 
ATOM   1162 C  C     . TYR A 1 171 ? 13.618  -45.184 6.323   1.00 166.25 ? 390 TYR A C     1 
ATOM   1163 O  O     . TYR A 1 171 ? 12.724  -44.901 5.511   1.00 165.90 ? 390 TYR A O     1 
ATOM   1164 C  CB    . TYR A 1 171 ? 13.333  -43.533 8.176   1.00 160.62 ? 390 TYR A CB    1 
ATOM   1165 C  CG    . TYR A 1 171 ? 12.989  -43.262 9.626   1.00 157.99 ? 390 TYR A CG    1 
ATOM   1166 C  CD1   . TYR A 1 171 ? 13.855  -42.549 10.447  1.00 157.98 ? 390 TYR A CD1   1 
ATOM   1167 C  CD2   . TYR A 1 171 ? 11.792  -43.709 10.175  1.00 157.23 ? 390 TYR A CD2   1 
ATOM   1168 C  CE1   . TYR A 1 171 ? 13.535  -42.276 11.776  1.00 155.40 ? 390 TYR A CE1   1 
ATOM   1169 C  CE2   . TYR A 1 171 ? 11.466  -43.452 11.505  1.00 155.15 ? 390 TYR A CE2   1 
ATOM   1170 C  CZ    . TYR A 1 171 ? 12.340  -42.733 12.301  1.00 158.95 ? 390 TYR A CZ    1 
ATOM   1171 O  OH    . TYR A 1 171 ? 12.030  -42.472 13.611  1.00 153.73 ? 390 TYR A OH    1 
ATOM   1172 N  N     . ARG A 1 172 ? 14.845  -45.647 5.960   1.00 164.33 ? 391 ARG A N     1 
ATOM   1173 C  CA    . ARG A 1 172 ? 15.215  -45.925 4.565   1.00 164.14 ? 391 ARG A CA    1 
ATOM   1174 C  C     . ARG A 1 172 ? 14.389  -47.098 4.074   1.00 168.70 ? 391 ARG A C     1 
ATOM   1175 O  O     . ARG A 1 172 ? 14.131  -47.209 2.872   1.00 169.27 ? 391 ARG A O     1 
ATOM   1176 C  CB    . ARG A 1 172 ? 16.705  -46.237 4.441   1.00 164.50 ? 391 ARG A CB    1 
ATOM   1177 N  N     . LYS A 1 173 ? 13.953  -47.959 5.013   1.00 167.77 ? 392 LYS A N     1 
ATOM   1178 C  CA    . LYS A 1 173 ? 13.099  -49.108 4.723   1.00 168.95 ? 392 LYS A CA    1 
ATOM   1179 C  C     . LYS A 1 173 ? 11.713  -48.664 4.218   1.00 170.14 ? 392 LYS A C     1 
ATOM   1180 O  O     . LYS A 1 173 ? 11.236  -49.219 3.223   1.00 170.49 ? 392 LYS A O     1 
ATOM   1181 C  CB    . LYS A 1 173 ? 12.946  -49.987 5.976   1.00 171.81 ? 392 LYS A CB    1 
ATOM   1182 N  N     . LEU A 1 174 ? 11.093  -47.648 4.883   1.00 165.30 ? 393 LEU A N     1 
ATOM   1183 C  CA    . LEU A 1 174 ? 9.733   -47.161 4.612   1.00 164.33 ? 393 LEU A CA    1 
ATOM   1184 C  C     . LEU A 1 174 ? 9.348   -46.771 3.163   1.00 165.56 ? 393 LEU A C     1 
ATOM   1185 O  O     . LEU A 1 174 ? 8.157   -46.781 2.824   1.00 165.45 ? 393 LEU A O     1 
ATOM   1186 C  CB    . LEU A 1 174 ? 9.339   -46.080 5.605   1.00 160.06 ? 393 LEU A CB    1 
ATOM   1187 N  N     . GLY A 1 175 ? 10.345  -46.471 2.326   1.00 161.34 ? 394 GLY A N     1 
ATOM   1188 C  CA    . GLY A 1 175 ? 10.134  -46.098 0.925   1.00 160.49 ? 394 GLY A CA    1 
ATOM   1189 C  C     . GLY A 1 175 ? 9.549   -44.711 0.767   1.00 159.10 ? 394 GLY A C     1 
ATOM   1190 O  O     . GLY A 1 175 ? 8.730   -44.454 -0.124  1.00 156.60 ? 394 GLY A O     1 
ATOM   1191 N  N     . LEU A 1 176 ? 9.998   -43.808 1.635   1.00 151.25 ? 395 LEU A N     1 
ATOM   1192 C  CA    . LEU A 1 176 ? 9.515   -42.446 1.728   1.00 143.82 ? 395 LEU A CA    1 
ATOM   1193 C  C     . LEU A 1 176 ? 10.048  -41.522 0.662   1.00 146.85 ? 395 LEU A C     1 
ATOM   1194 O  O     . LEU A 1 176 ? 11.236  -41.557 0.334   1.00 151.02 ? 395 LEU A O     1 
ATOM   1195 C  CB    . LEU A 1 176 ? 9.844   -41.879 3.117   1.00 140.17 ? 395 LEU A CB    1 
ATOM   1196 C  CG    . LEU A 1 176 ? 9.295   -42.657 4.311   1.00 144.82 ? 395 LEU A CG    1 
ATOM   1197 C  CD1   . LEU A 1 176 ? 9.710   -42.020 5.590   1.00 144.50 ? 395 LEU A CD1   1 
ATOM   1198 C  CD2   . LEU A 1 176 ? 7.772   -42.680 4.311   1.00 141.25 ? 395 LEU A CD2   1 
ATOM   1199 N  N     . GLU A 1 177 ? 9.161   -40.679 0.130   1.00 137.20 ? 396 GLU A N     1 
ATOM   1200 C  CA    . GLU A 1 177 ? 9.524   -39.610 -0.801  1.00 135.04 ? 396 GLU A CA    1 
ATOM   1201 C  C     . GLU A 1 177 ? 9.259   -38.297 -0.053  1.00 130.50 ? 396 GLU A C     1 
ATOM   1202 O  O     . GLU A 1 177 ? 8.395   -38.252 0.830   1.00 126.12 ? 396 GLU A O     1 
ATOM   1203 C  CB    . GLU A 1 177 ? 8.713   -39.647 -2.116  1.00 137.17 ? 396 GLU A CB    1 
ATOM   1204 C  CG    . GLU A 1 177 ? 8.804   -40.932 -2.928  1.00 152.50 ? 396 GLU A CG    1 
ATOM   1205 C  CD    . GLU A 1 177 ? 7.471   -41.540 -3.341  1.00 172.03 ? 396 GLU A CD    1 
ATOM   1206 O  OE1   . GLU A 1 177 ? 6.409   -41.027 -2.915  1.00 155.61 ? 396 GLU A OE1   1 
ATOM   1207 O  OE2   . GLU A 1 177 ? 7.494   -42.544 -4.090  1.00 171.13 ? 396 GLU A OE2   1 
ATOM   1208 N  N     . VAL A 1 178 ? 10.011  -37.239 -0.385  1.00 125.49 ? 397 VAL A N     1 
ATOM   1209 C  CA    . VAL A 1 178 ? 9.886   -35.916 0.250   1.00 118.55 ? 397 VAL A CA    1 
ATOM   1210 C  C     . VAL A 1 178 ? 9.321   -34.932 -0.753  1.00 121.16 ? 397 VAL A C     1 
ATOM   1211 O  O     . VAL A 1 178 ? 9.873   -34.781 -1.845  1.00 124.75 ? 397 VAL A O     1 
ATOM   1212 C  CB    . VAL A 1 178 ? 11.224  -35.388 0.832   1.00 120.98 ? 397 VAL A CB    1 
ATOM   1213 C  CG1   . VAL A 1 178 ? 11.044  -34.022 1.508   1.00 115.45 ? 397 VAL A CG1   1 
ATOM   1214 C  CG2   . VAL A 1 178 ? 11.831  -36.383 1.796   1.00 122.70 ? 397 VAL A CG2   1 
ATOM   1215 N  N     . TYR A 1 179 ? 8.254   -34.226 -0.360  1.00 111.83 ? 398 TYR A N     1 
ATOM   1216 C  CA    . TYR A 1 179 ? 7.618   -33.195 -1.172  1.00 108.69 ? 398 TYR A CA    1 
ATOM   1217 C  C     . TYR A 1 179 ? 7.646   -31.890 -0.426  1.00 107.71 ? 398 TYR A C     1 
ATOM   1218 O  O     . TYR A 1 179 ? 7.694   -31.858 0.808   1.00 104.72 ? 398 TYR A O     1 
ATOM   1219 C  CB    . TYR A 1 179 ? 6.166   -33.564 -1.548  1.00 107.21 ? 398 TYR A CB    1 
ATOM   1220 C  CG    . TYR A 1 179 ? 6.059   -34.800 -2.404  1.00 111.99 ? 398 TYR A CG    1 
ATOM   1221 C  CD1   . TYR A 1 179 ? 5.930   -34.705 -3.787  1.00 116.17 ? 398 TYR A CD1   1 
ATOM   1222 C  CD2   . TYR A 1 179 ? 6.102   -36.070 -1.837  1.00 114.32 ? 398 TYR A CD2   1 
ATOM   1223 C  CE1   . TYR A 1 179 ? 5.851   -35.844 -4.585  1.00 119.62 ? 398 TYR A CE1   1 
ATOM   1224 C  CE2   . TYR A 1 179 ? 6.017   -37.215 -2.624  1.00 119.10 ? 398 TYR A CE2   1 
ATOM   1225 C  CZ    . TYR A 1 179 ? 5.890   -37.098 -3.998  1.00 129.20 ? 398 TYR A CZ    1 
ATOM   1226 O  OH    . TYR A 1 179 ? 5.790   -38.228 -4.777  1.00 137.76 ? 398 TYR A OH    1 
ATOM   1227 N  N     . VAL A 1 180 ? 7.581   -30.803 -1.165  1.00 104.37 ? 399 VAL A N     1 
ATOM   1228 C  CA    . VAL A 1 180 ? 7.597   -29.492 -0.549  1.00 101.02 ? 399 VAL A CA    1 
ATOM   1229 C  C     . VAL A 1 180 ? 6.522   -28.588 -1.186  1.00 102.73 ? 399 VAL A C     1 
ATOM   1230 O  O     . VAL A 1 180 ? 6.120   -28.793 -2.336  1.00 103.26 ? 399 VAL A O     1 
ATOM   1231 C  CB    . VAL A 1 180 ? 9.039   -28.915 -0.650  1.00 107.23 ? 399 VAL A CB    1 
ATOM   1232 C  CG1   . VAL A 1 180 ? 9.046   -27.405 -0.596  1.00 106.05 ? 399 VAL A CG1   1 
ATOM   1233 C  CG2   . VAL A 1 180 ? 9.955   -29.499 0.432   1.00 106.98 ? 399 VAL A CG2   1 
ATOM   1234 N  N     . THR A 1 181 ? 6.035   -27.621 -0.400  1.00 96.03  ? 400 THR A N     1 
ATOM   1235 C  CA    . THR A 1 181 ? 5.140   -26.543 -0.831  1.00 93.82  ? 400 THR A CA    1 
ATOM   1236 C  C     . THR A 1 181 ? 5.659   -25.267 -0.186  1.00 94.19  ? 400 THR A C     1 
ATOM   1237 O  O     . THR A 1 181 ? 6.355   -25.309 0.835   1.00 91.43  ? 400 THR A O     1 
ATOM   1238 C  CB    . THR A 1 181 ? 3.661   -26.746 -0.455  1.00 97.59  ? 400 THR A CB    1 
ATOM   1239 O  OG1   . THR A 1 181 ? 3.524   -26.708 0.954   1.00 97.58  ? 400 THR A OG1   1 
ATOM   1240 C  CG2   . THR A 1 181 ? 3.049   -28.023 -1.025  1.00 96.51  ? 400 THR A CG2   1 
ATOM   1241 N  N     . PHE A 1 182 ? 5.302   -24.133 -0.765  1.00 91.42  ? 401 PHE A N     1 
ATOM   1242 C  CA    . PHE A 1 182 ? 5.682   -22.834 -0.238  1.00 90.11  ? 401 PHE A CA    1 
ATOM   1243 C  C     . PHE A 1 182 ? 4.681   -21.827 -0.754  1.00 92.81  ? 401 PHE A C     1 
ATOM   1244 O  O     . PHE A 1 182 ? 4.606   -21.582 -1.954  1.00 95.17  ? 401 PHE A O     1 
ATOM   1245 C  CB    . PHE A 1 182 ? 7.122   -22.483 -0.622  1.00 95.81  ? 401 PHE A CB    1 
ATOM   1246 C  CG    . PHE A 1 182 ? 7.783   -21.377 0.168   1.00 97.57  ? 401 PHE A CG    1 
ATOM   1247 C  CD1   . PHE A 1 182 ? 7.311   -21.016 1.431   1.00 96.16  ? 401 PHE A CD1   1 
ATOM   1248 C  CD2   . PHE A 1 182 ? 8.917   -20.733 -0.326  1.00 103.01 ? 401 PHE A CD2   1 
ATOM   1249 C  CE1   . PHE A 1 182 ? 7.925   -19.995 2.157   1.00 96.35  ? 401 PHE A CE1   1 
ATOM   1250 C  CE2   . PHE A 1 182 ? 9.535   -19.716 0.406   1.00 105.15 ? 401 PHE A CE2   1 
ATOM   1251 C  CZ    . PHE A 1 182 ? 9.041   -19.363 1.650   1.00 99.23  ? 401 PHE A CZ    1 
ATOM   1252 N  N     . PHE A 1 183 ? 3.844   -21.306 0.140   1.00 86.33  ? 402 PHE A N     1 
ATOM   1253 C  CA    . PHE A 1 183 ? 2.815   -20.341 -0.238  1.00 85.17  ? 402 PHE A CA    1 
ATOM   1254 C  C     . PHE A 1 183 ? 2.717   -19.233 0.759   1.00 85.18  ? 402 PHE A C     1 
ATOM   1255 O  O     . PHE A 1 183 ? 3.196   -19.374 1.877   1.00 81.05  ? 402 PHE A O     1 
ATOM   1256 C  CB    . PHE A 1 183 ? 1.437   -21.024 -0.434  1.00 85.35  ? 402 PHE A CB    1 
ATOM   1257 C  CG    . PHE A 1 183 ? 0.960   -21.845 0.726   1.00 83.65  ? 402 PHE A CG    1 
ATOM   1258 C  CD1   . PHE A 1 183 ? 0.111   -21.298 1.684   1.00 84.83  ? 402 PHE A CD1   1 
ATOM   1259 C  CD2   . PHE A 1 183 ? 1.368   -23.163 0.876   1.00 85.52  ? 402 PHE A CD2   1 
ATOM   1260 C  CE1   . PHE A 1 183 ? -0.291  -22.045 2.791   1.00 82.94  ? 402 PHE A CE1   1 
ATOM   1261 C  CE2   . PHE A 1 183 ? 0.952   -23.916 1.974   1.00 86.64  ? 402 PHE A CE2   1 
ATOM   1262 C  CZ    . PHE A 1 183 ? 0.116   -23.357 2.917   1.00 82.13  ? 402 PHE A CZ    1 
ATOM   1263 N  N     . GLU A 1 184 ? 2.125   -18.120 0.348   1.00 84.73  ? 403 GLU A N     1 
ATOM   1264 C  CA    . GLU A 1 184 ? 1.848   -17.028 1.251   1.00 83.64  ? 403 GLU A CA    1 
ATOM   1265 C  C     . GLU A 1 184 ? 0.367   -16.746 1.346   1.00 87.98  ? 403 GLU A C     1 
ATOM   1266 O  O     . GLU A 1 184 ? -0.391  -17.110 0.449   1.00 90.08  ? 403 GLU A O     1 
ATOM   1267 C  CB    . GLU A 1 184 ? 2.682   -15.781 0.976   1.00 87.82  ? 403 GLU A CB    1 
ATOM   1268 C  CG    . GLU A 1 184 ? 2.370   -15.015 -0.286  1.00 105.95 ? 403 GLU A CG    1 
ATOM   1269 C  CD    . GLU A 1 184 ? 2.895   -13.591 -0.244  1.00 131.00 ? 403 GLU A CD    1 
ATOM   1270 O  OE1   . GLU A 1 184 ? 3.934   -13.342 0.412   1.00 127.33 ? 403 GLU A OE1   1 
ATOM   1271 O  OE2   . GLU A 1 184 ? 2.253   -12.714 -0.860  1.00 130.37 ? 403 GLU A OE2   1 
ATOM   1272 N  N     . ILE A 1 185 ? -0.049  -16.144 2.464   1.00 82.59  ? 404 ILE A N     1 
ATOM   1273 C  CA    . ILE A 1 185 ? -1.429  -15.749 2.724   1.00 81.89  ? 404 ILE A CA    1 
ATOM   1274 C  C     . ILE A 1 185 ? -1.418  -14.249 2.928   1.00 90.12  ? 404 ILE A C     1 
ATOM   1275 O  O     . ILE A 1 185 ? -0.770  -13.773 3.858   1.00 89.61  ? 404 ILE A O     1 
ATOM   1276 C  CB    . ILE A 1 185 ? -2.076  -16.519 3.909   1.00 80.80  ? 404 ILE A CB    1 
ATOM   1277 C  CG1   . ILE A 1 185 ? -2.063  -18.042 3.642   1.00 79.95  ? 404 ILE A CG1   1 
ATOM   1278 C  CG2   . ILE A 1 185 ? -3.503  -16.007 4.208   1.00 79.92  ? 404 ILE A CG2   1 
ATOM   1279 C  CD1   . ILE A 1 185 ? -2.140  -18.947 4.903   1.00 71.76  ? 404 ILE A CD1   1 
ATOM   1280 N  N     . TYR A 1 186 ? -2.117  -13.518 2.046   1.00 91.50  ? 405 TYR A N     1 
ATOM   1281 C  CA    . TYR A 1 186 ? -2.244  -12.077 2.088   1.00 95.37  ? 405 TYR A CA    1 
ATOM   1282 C  C     . TYR A 1 186 ? -3.678  -11.654 1.824   1.00 103.02 ? 405 TYR A C     1 
ATOM   1283 O  O     . TYR A 1 186 ? -4.236  -11.972 0.767   1.00 103.69 ? 405 TYR A O     1 
ATOM   1284 C  CB    . TYR A 1 186 ? -1.292  -11.425 1.081   1.00 101.91 ? 405 TYR A CB    1 
ATOM   1285 C  CG    . TYR A 1 186 ? -1.443  -9.921  1.039   1.00 110.13 ? 405 TYR A CG    1 
ATOM   1286 C  CD1   . TYR A 1 186 ? -1.053  -9.133  2.117   1.00 112.36 ? 405 TYR A CD1   1 
ATOM   1287 C  CD2   . TYR A 1 186 ? -2.029  -9.289  -0.054  1.00 115.68 ? 405 TYR A CD2   1 
ATOM   1288 C  CE1   . TYR A 1 186 ? -1.226  -7.750  2.104   1.00 118.36 ? 405 TYR A CE1   1 
ATOM   1289 C  CE2   . TYR A 1 186 ? -2.194  -7.905  -0.085  1.00 120.96 ? 405 TYR A CE2   1 
ATOM   1290 C  CZ    . TYR A 1 186 ? -1.783  -7.138  0.995   1.00 130.71 ? 405 TYR A CZ    1 
ATOM   1291 O  OH    . TYR A 1 186 ? -1.941  -5.774  0.986   1.00 138.12 ? 405 TYR A OH    1 
ATOM   1292 N  N     . ASN A 1 187 ? -4.273  -10.928 2.779   1.00 102.84 ? 406 ASN A N     1 
ATOM   1293 C  CA    . ASN A 1 187 ? -5.650  -10.427 2.671   1.00 106.63 ? 406 ASN A CA    1 
ATOM   1294 C  C     . ASN A 1 187 ? -6.648  -11.552 2.354   1.00 110.67 ? 406 ASN A C     1 
ATOM   1295 O  O     . ASN A 1 187 ? -7.455  -11.415 1.432   1.00 113.82 ? 406 ASN A O     1 
ATOM   1296 C  CB    . ASN A 1 187 ? -5.735  -9.274  1.626   1.00 117.64 ? 406 ASN A CB    1 
ATOM   1297 C  CG    . ASN A 1 187 ? -5.829  -7.894  2.239   1.00 158.17 ? 406 ASN A CG    1 
ATOM   1298 O  OD1   . ASN A 1 187 ? -6.675  -7.624  3.107   1.00 155.34 ? 406 ASN A OD1   1 
ATOM   1299 N  ND2   . ASN A 1 187 ? -4.975  -6.982  1.788   1.00 153.81 ? 406 ASN A ND2   1 
ATOM   1300 N  N     . GLY A 1 188 ? -6.530  -12.675 3.071   1.00 103.52 ? 407 GLY A N     1 
ATOM   1301 C  CA    . GLY A 1 188 ? -7.394  -13.846 2.897   1.00 101.78 ? 407 GLY A CA    1 
ATOM   1302 C  C     . GLY A 1 188 ? -7.233  -14.627 1.605   1.00 103.77 ? 407 GLY A C     1 
ATOM   1303 O  O     . GLY A 1 188 ? -8.063  -15.489 1.299   1.00 104.74 ? 407 GLY A O     1 
ATOM   1304 N  N     . LYS A 1 189 ? -6.161  -14.347 0.850   1.00 97.75  ? 408 LYS A N     1 
ATOM   1305 C  CA    . LYS A 1 189 ? -5.876  -15.009 -0.418  1.00 97.74  ? 408 LYS A CA    1 
ATOM   1306 C  C     . LYS A 1 189 ? -4.550  -15.736 -0.339  1.00 98.04  ? 408 LYS A C     1 
ATOM   1307 O  O     . LYS A 1 189 ? -3.582  -15.220 0.221   1.00 97.65  ? 408 LYS A O     1 
ATOM   1308 C  CB    . LYS A 1 189 ? -5.843  -14.004 -1.576  1.00 104.24 ? 408 LYS A CB    1 
ATOM   1309 C  CG    . LYS A 1 189 ? -7.000  -13.012 -1.642  1.00 127.46 ? 408 LYS A CG    1 
ATOM   1310 C  CD    . LYS A 1 189 ? -8.220  -13.558 -2.368  1.00 144.07 ? 408 LYS A CD    1 
ATOM   1311 C  CE    . LYS A 1 189 ? -8.728  -12.620 -3.450  1.00 163.35 ? 408 LYS A CE    1 
ATOM   1312 N  NZ    . LYS A 1 189 ? -9.149  -11.302 -2.902  1.00 175.90 ? 408 LYS A NZ    1 
ATOM   1313 N  N     . LEU A 1 190 ? -4.500  -16.919 -0.923  1.00 92.52  ? 409 LEU A N     1 
ATOM   1314 C  CA    . LEU A 1 190 ? -3.307  -17.749 -0.939  1.00 90.87  ? 409 LEU A CA    1 
ATOM   1315 C  C     . LEU A 1 190 ? -2.633  -17.601 -2.258  1.00 95.96  ? 409 LEU A C     1 
ATOM   1316 O  O     . LEU A 1 190 ? -3.295  -17.619 -3.287  1.00 98.63  ? 409 LEU A O     1 
ATOM   1317 C  CB    . LEU A 1 190 ? -3.657  -19.230 -0.712  1.00 89.43  ? 409 LEU A CB    1 
ATOM   1318 C  CG    . LEU A 1 190 ? -3.718  -19.693 0.710   1.00 92.42  ? 409 LEU A CG    1 
ATOM   1319 C  CD1   . LEU A 1 190 ? -4.947  -19.173 1.388   1.00 92.82  ? 409 LEU A CD1   1 
ATOM   1320 C  CD2   . LEU A 1 190 ? -3.620  -21.196 0.799   1.00 96.41  ? 409 LEU A CD2   1 
ATOM   1321 N  N     . PHE A 1 191 ? -1.318  -17.492 -2.240  1.00 91.52  ? 410 PHE A N     1 
ATOM   1322 C  CA    . PHE A 1 191 ? -0.510  -17.381 -3.440  1.00 94.15  ? 410 PHE A CA    1 
ATOM   1323 C  C     . PHE A 1 191 ? 0.601   -18.392 -3.399  1.00 97.89  ? 410 PHE A C     1 
ATOM   1324 O  O     . PHE A 1 191 ? 1.339   -18.453 -2.417  1.00 97.27  ? 410 PHE A O     1 
ATOM   1325 C  CB    . PHE A 1 191 ? 0.096   -15.988 -3.564  1.00 98.38  ? 410 PHE A CB    1 
ATOM   1326 C  CG    . PHE A 1 191 ? -0.933  -14.906 -3.546  1.00 101.11 ? 410 PHE A CG    1 
ATOM   1327 C  CD1   . PHE A 1 191 ? -1.528  -14.470 -4.728  1.00 108.93 ? 410 PHE A CD1   1 
ATOM   1328 C  CD2   . PHE A 1 191 ? -1.329  -14.337 -2.352  1.00 100.90 ? 410 PHE A CD2   1 
ATOM   1329 C  CE1   . PHE A 1 191 ? -2.496  -13.471 -4.709  1.00 111.49 ? 410 PHE A CE1   1 
ATOM   1330 C  CE2   . PHE A 1 191 ? -2.300  -13.350 -2.328  1.00 105.87 ? 410 PHE A CE2   1 
ATOM   1331 C  CZ    . PHE A 1 191 ? -2.871  -12.913 -3.507  1.00 108.43 ? 410 PHE A CZ    1 
ATOM   1332 N  N     . ASP A 1 192 ? 0.742   -19.163 -4.476  1.00 95.35  ? 411 ASP A N     1 
ATOM   1333 C  CA    . ASP A 1 192 ? 1.765   -20.196 -4.610  1.00 94.76  ? 411 ASP A CA    1 
ATOM   1334 C  C     . ASP A 1 192 ? 3.093   -19.542 -5.018  1.00 100.06 ? 411 ASP A C     1 
ATOM   1335 O  O     . ASP A 1 192 ? 3.211   -18.961 -6.086  1.00 101.65 ? 411 ASP A O     1 
ATOM   1336 C  CB    . ASP A 1 192 ? 1.309   -21.288 -5.607  1.00 97.93  ? 411 ASP A CB    1 
ATOM   1337 C  CG    . ASP A 1 192 ? 2.151   -22.558 -5.581  1.00 106.41 ? 411 ASP A CG    1 
ATOM   1338 O  OD1   . ASP A 1 192 ? 3.324   -22.494 -5.130  1.00 104.43 ? 411 ASP A OD1   1 
ATOM   1339 O  OD2   . ASP A 1 192 ? 1.653   -23.609 -6.041  1.00 114.50 ? 411 ASP A OD2   1 
ATOM   1340 N  N     . LEU A 1 193 ? 4.078   -19.609 -4.133  1.00 97.13  ? 412 LEU A N     1 
ATOM   1341 C  CA    . LEU A 1 193 ? 5.374   -18.955 -4.330  1.00 100.06 ? 412 LEU A CA    1 
ATOM   1342 C  C     . LEU A 1 193 ? 6.289   -19.742 -5.240  1.00 111.31 ? 412 LEU A C     1 
ATOM   1343 O  O     . LEU A 1 193 ? 7.224   -19.169 -5.802  1.00 115.92 ? 412 LEU A O     1 
ATOM   1344 C  CB    . LEU A 1 193 ? 6.053   -18.645 -2.988  1.00 96.49  ? 412 LEU A CB    1 
ATOM   1345 C  CG    . LEU A 1 193 ? 5.314   -17.680 -2.038  1.00 97.22  ? 412 LEU A CG    1 
ATOM   1346 C  CD1   . LEU A 1 193 ? 5.938   -17.677 -0.625  1.00 92.73  ? 412 LEU A CD1   1 
ATOM   1347 C  CD2   . LEU A 1 193 ? 5.234   -16.285 -2.616  1.00 101.65 ? 412 LEU A CD2   1 
ATOM   1348 N  N     . LEU A 1 194 ? 6.008   -21.057 -5.384  1.00 107.04 ? 413 LEU A N     1 
ATOM   1349 C  CA    . LEU A 1 194 ? 6.721   -21.986 -6.263  1.00 109.98 ? 413 LEU A CA    1 
ATOM   1350 C  C     . LEU A 1 194 ? 6.092   -22.069 -7.660  1.00 121.68 ? 413 LEU A C     1 
ATOM   1351 O  O     . LEU A 1 194 ? 6.731   -22.591 -8.575  1.00 127.12 ? 413 LEU A O     1 
ATOM   1352 C  CB    . LEU A 1 194 ? 6.791   -23.385 -5.653  1.00 106.72 ? 413 LEU A CB    1 
ATOM   1353 C  CG    . LEU A 1 194 ? 7.372   -23.508 -4.265  1.00 106.34 ? 413 LEU A CG    1 
ATOM   1354 C  CD1   . LEU A 1 194 ? 7.524   -24.965 -3.890  1.00 105.17 ? 413 LEU A CD1   1 
ATOM   1355 C  CD2   . LEU A 1 194 ? 8.685   -22.769 -4.159  1.00 108.56 ? 413 LEU A CD2   1 
ATOM   1356 N  N     . ASN A 1 195 ? 4.843   -21.587 -7.819  1.00 117.96 ? 414 ASN A N     1 
ATOM   1357 C  CA    . ASN A 1 195 ? 4.156   -21.528 -9.097  1.00 121.38 ? 414 ASN A CA    1 
ATOM   1358 C  C     . ASN A 1 195 ? 3.679   -20.111 -9.437  1.00 129.43 ? 414 ASN A C     1 
ATOM   1359 O  O     . ASN A 1 195 ? 2.498   -19.885 -9.671  1.00 127.41 ? 414 ASN A O     1 
ATOM   1360 C  CB    . ASN A 1 195 ? 3.070   -22.601 -9.254  1.00 122.70 ? 414 ASN A CB    1 
ATOM   1361 C  CG    . ASN A 1 195 ? 3.556   -23.999 -9.628  1.00 149.89 ? 414 ASN A CG    1 
ATOM   1362 O  OD1   . ASN A 1 195 ? 3.027   -25.019 -9.164  1.00 146.19 ? 414 ASN A OD1   1 
ATOM   1363 N  ND2   . ASN A 1 195 ? 4.533   -24.095 -10.513 1.00 146.96 ? 414 ASN A ND2   1 
ATOM   1364 N  N     . LYS A 1 196 ? 4.629   -19.156 -9.458  1.00 133.29 ? 415 LYS A N     1 
ATOM   1365 C  CA    . LYS A 1 196 ? 4.483   -17.773 -9.930  1.00 138.46 ? 415 LYS A CA    1 
ATOM   1366 C  C     . LYS A 1 196 ? 3.377   -16.929 -9.293  1.00 143.31 ? 415 LYS A C     1 
ATOM   1367 O  O     . LYS A 1 196 ? 2.717   -16.131 -9.981  1.00 145.28 ? 415 LYS A O     1 
ATOM   1368 C  CB    . LYS A 1 196 ? 4.367   -17.780 -11.464 1.00 147.25 ? 415 LYS A CB    1 
ATOM   1369 N  N     . LYS A 1 197 ? 3.211   -17.081 -7.960  1.00 138.00 ? 416 LYS A N     1 
ATOM   1370 C  CA    . LYS A 1 197 ? 2.204   -16.384 -7.148  1.00 135.40 ? 416 LYS A CA    1 
ATOM   1371 C  C     . LYS A 1 197 ? 0.746   -16.614 -7.648  1.00 141.86 ? 416 LYS A C     1 
ATOM   1372 O  O     . LYS A 1 197 ? -0.059  -15.674 -7.659  1.00 142.99 ? 416 LYS A O     1 
ATOM   1373 C  CB    . LYS A 1 197 ? 2.562   -14.888 -6.953  1.00 139.22 ? 416 LYS A CB    1 
ATOM   1374 C  CG    . LYS A 1 197 ? 3.111   -14.564 -5.567  1.00 141.40 ? 416 LYS A CG    1 
ATOM   1375 C  CD    . LYS A 1 197 ? 3.334   -13.073 -5.339  1.00 149.45 ? 416 LYS A CD    1 
ATOM   1376 C  CE    . LYS A 1 197 ? 3.354   -12.754 -3.855  1.00 156.29 ? 416 LYS A CE    1 
ATOM   1377 N  NZ    . LYS A 1 197 ? 3.952   -11.428 -3.545  1.00 168.94 ? 416 LYS A NZ    1 
ATOM   1378 N  N     . ALA A 1 198 ? 0.407   -17.871 -8.054  1.00 138.69 ? 417 ALA A N     1 
ATOM   1379 C  CA    . ALA A 1 198 ? -0.952  -18.216 -8.526  1.00 138.64 ? 417 ALA A CA    1 
ATOM   1380 C  C     . ALA A 1 198 ? -1.916  -18.188 -7.359  1.00 139.75 ? 417 ALA A C     1 
ATOM   1381 O  O     . ALA A 1 198 ? -1.633  -18.774 -6.307  1.00 136.03 ? 417 ALA A O     1 
ATOM   1382 C  CB    . ALA A 1 198 ? -0.986  -19.593 -9.201  1.00 139.46 ? 417 ALA A CB    1 
ATOM   1383 N  N     . LYS A 1 199 ? -3.046  -17.486 -7.536  1.00 137.32 ? 418 LYS A N     1 
ATOM   1384 C  CA    . LYS A 1 199 ? -4.069  -17.389 -6.497  1.00 133.61 ? 418 LYS A CA    1 
ATOM   1385 C  C     . LYS A 1 199 ? -4.856  -18.715 -6.410  1.00 131.60 ? 418 LYS A C     1 
ATOM   1386 O  O     . LYS A 1 199 ? -5.757  -18.983 -7.217  1.00 134.22 ? 418 LYS A O     1 
ATOM   1387 C  CB    . LYS A 1 199 ? -4.995  -16.199 -6.756  1.00 137.13 ? 418 LYS A CB    1 
ATOM   1388 N  N     . LEU A 1 200 ? -4.449  -19.568 -5.452  1.00 119.34 ? 419 LEU A N     1 
ATOM   1389 C  CA    . LEU A 1 200 ? -5.064  -20.872 -5.160  1.00 113.85 ? 419 LEU A CA    1 
ATOM   1390 C  C     . LEU A 1 200 ? -6.388  -20.638 -4.416  1.00 110.25 ? 419 LEU A C     1 
ATOM   1391 O  O     . LEU A 1 200 ? -6.710  -19.494 -4.081  1.00 111.10 ? 419 LEU A O     1 
ATOM   1392 C  CB    . LEU A 1 200 ? -4.129  -21.722 -4.269  1.00 110.42 ? 419 LEU A CB    1 
ATOM   1393 C  CG    . LEU A 1 200 ? -2.656  -21.816 -4.669  1.00 114.80 ? 419 LEU A CG    1 
ATOM   1394 C  CD1   . LEU A 1 200 ? -1.754  -21.726 -3.477  1.00 111.37 ? 419 LEU A CD1   1 
ATOM   1395 C  CD2   . LEU A 1 200 ? -2.381  -23.063 -5.374  1.00 118.24 ? 419 LEU A CD2   1 
ATOM   1396 N  N     . ARG A 1 201 ? -7.138  -21.708 -4.133  1.00 100.23 ? 420 ARG A N     1 
ATOM   1397 C  CA    . ARG A 1 201 ? -8.401  -21.603 -3.384  1.00 96.64  ? 420 ARG A CA    1 
ATOM   1398 C  C     . ARG A 1 201 ? -8.488  -22.685 -2.300  1.00 94.76  ? 420 ARG A C     1 
ATOM   1399 O  O     . ARG A 1 201 ? -8.059  -23.818 -2.503  1.00 94.37  ? 420 ARG A O     1 
ATOM   1400 C  CB    . ARG A 1 201 ? -9.606  -21.647 -4.321  1.00 99.09  ? 420 ARG A CB    1 
ATOM   1401 N  N     . VAL A 1 202 ? -8.992  -22.309 -1.137  1.00 87.21  ? 421 VAL A N     1 
ATOM   1402 C  CA    . VAL A 1 202 ? -9.132  -23.186 0.015   1.00 84.19  ? 421 VAL A CA    1 
ATOM   1403 C  C     . VAL A 1 202 ? -10.606 -23.626 0.136   1.00 89.80  ? 421 VAL A C     1 
ATOM   1404 O  O     . VAL A 1 202 ? -11.526 -22.797 0.166   1.00 90.81  ? 421 VAL A O     1 
ATOM   1405 C  CB    . VAL A 1 202 ? -8.611  -22.460 1.276   1.00 85.53  ? 421 VAL A CB    1 
ATOM   1406 C  CG1   . VAL A 1 202 ? -8.719  -23.333 2.509   1.00 83.06  ? 421 VAL A CG1   1 
ATOM   1407 C  CG2   . VAL A 1 202 ? -7.169  -22.021 1.079   1.00 84.87  ? 421 VAL A CG2   1 
ATOM   1408 N  N     . LEU A 1 203 ? -10.820 -24.937 0.145   1.00 85.74  ? 422 LEU A N     1 
ATOM   1409 C  CA    . LEU A 1 203 ? -12.147 -25.537 0.225   1.00 85.60  ? 422 LEU A CA    1 
ATOM   1410 C  C     . LEU A 1 203 ? -12.236 -26.416 1.456   1.00 83.78  ? 422 LEU A C     1 
ATOM   1411 O  O     . LEU A 1 203 ? -11.245 -27.006 1.890   1.00 82.72  ? 422 LEU A O     1 
ATOM   1412 C  CB    . LEU A 1 203 ? -12.457 -26.394 -1.032  1.00 88.15  ? 422 LEU A CB    1 
ATOM   1413 C  CG    . LEU A 1 203 ? -12.425 -25.744 -2.423  1.00 95.90  ? 422 LEU A CG    1 
ATOM   1414 C  CD1   . LEU A 1 203 ? -12.947 -26.694 -3.441  1.00 97.20  ? 422 LEU A CD1   1 
ATOM   1415 C  CD2   . LEU A 1 203 ? -13.232 -24.436 -2.482  1.00 103.82 ? 422 LEU A CD2   1 
ATOM   1416 N  N     . GLU A 1 204 ? -13.427 -26.531 1.986   1.00 77.81  ? 423 GLU A N     1 
ATOM   1417 C  CA    . GLU A 1 204 ? -13.714 -27.367 3.130   1.00 76.21  ? 423 GLU A CA    1 
ATOM   1418 C  C     . GLU A 1 204 ? -14.832 -28.315 2.706   1.00 80.78  ? 423 GLU A C     1 
ATOM   1419 O  O     . GLU A 1 204 ? -15.792 -27.867 2.072   1.00 79.70  ? 423 GLU A O     1 
ATOM   1420 C  CB    . GLU A 1 204 ? -14.184 -26.484 4.272   1.00 76.46  ? 423 GLU A CB    1 
ATOM   1421 C  CG    . GLU A 1 204 ? -14.274 -27.197 5.596   1.00 84.61  ? 423 GLU A CG    1 
ATOM   1422 C  CD    . GLU A 1 204 ? -15.001 -26.414 6.679   1.00 103.54 ? 423 GLU A CD    1 
ATOM   1423 O  OE1   . GLU A 1 204 ? -14.717 -25.207 6.865   1.00 87.96  ? 423 GLU A OE1   1 
ATOM   1424 O  OE2   . GLU A 1 204 ? -15.807 -27.045 7.400   1.00 95.26  ? 423 GLU A OE2   1 
ATOM   1425 N  N     . ASP A 1 205 ? -14.691 -29.620 3.002   1.00 78.44  ? 424 ASP A N     1 
ATOM   1426 C  CA    . ASP A 1 205 ? -15.720 -30.594 2.638   1.00 80.99  ? 424 ASP A CA    1 
ATOM   1427 C  C     . ASP A 1 205 ? -16.721 -30.884 3.779   1.00 87.15  ? 424 ASP A C     1 
ATOM   1428 O  O     . ASP A 1 205 ? -16.604 -30.309 4.867   1.00 87.42  ? 424 ASP A O     1 
ATOM   1429 C  CB    . ASP A 1 205 ? -15.103 -31.880 2.058   1.00 82.69  ? 424 ASP A CB    1 
ATOM   1430 C  CG    . ASP A 1 205 ? -14.367 -32.776 3.037   1.00 93.67  ? 424 ASP A CG    1 
ATOM   1431 O  OD1   . ASP A 1 205 ? -14.580 -32.635 4.269   1.00 94.95  ? 424 ASP A OD1   1 
ATOM   1432 O  OD2   . ASP A 1 205 ? -13.609 -33.637 2.578   1.00 101.85 ? 424 ASP A OD2   1 
ATOM   1433 N  N     . GLY A 1 206 ? -17.639 -31.816 3.532   1.00 86.54  ? 425 GLY A N     1 
ATOM   1434 C  CA    . GLY A 1 206 ? -18.666 -32.229 4.486   1.00 89.96  ? 425 GLY A CA    1 
ATOM   1435 C  C     . GLY A 1 206 ? -18.175 -32.851 5.780   1.00 96.41  ? 425 GLY A C     1 
ATOM   1436 O  O     . GLY A 1 206 ? -18.970 -33.003 6.703   1.00 101.12 ? 425 GLY A O     1 
ATOM   1437 N  N     . LYS A 1 207 ? -16.891 -33.261 5.842   1.00 90.15  ? 426 LYS A N     1 
ATOM   1438 C  CA    . LYS A 1 207 ? -16.250 -33.887 7.004   1.00 89.84  ? 426 LYS A CA    1 
ATOM   1439 C  C     . LYS A 1 207 ? -15.272 -32.906 7.640   1.00 92.40  ? 426 LYS A C     1 
ATOM   1440 O  O     . LYS A 1 207 ? -14.408 -33.318 8.421   1.00 92.25  ? 426 LYS A O     1 
ATOM   1441 C  CB    . LYS A 1 207 ? -15.461 -35.168 6.614   1.00 93.68  ? 426 LYS A CB    1 
ATOM   1442 C  CG    . LYS A 1 207 ? -15.792 -35.835 5.268   1.00 118.61 ? 426 LYS A CG    1 
ATOM   1443 C  CD    . LYS A 1 207 ? -14.783 -36.923 4.937   1.00 132.74 ? 426 LYS A CD    1 
ATOM   1444 C  CE    . LYS A 1 207 ? -14.254 -36.830 3.534   1.00 143.90 ? 426 LYS A CE    1 
ATOM   1445 N  NZ    . LYS A 1 207 ? -12.943 -36.140 3.497   1.00 149.35 ? 426 LYS A NZ    1 
ATOM   1446 N  N     . GLN A 1 208 ? -15.378 -31.615 7.299   1.00 87.17  ? 427 GLN A N     1 
ATOM   1447 C  CA    . GLN A 1 208 ? -14.500 -30.558 7.813   1.00 83.41  ? 427 GLN A CA    1 
ATOM   1448 C  C     . GLN A 1 208 ? -13.045 -30.670 7.389   1.00 89.17  ? 427 GLN A C     1 
ATOM   1449 O  O     . GLN A 1 208 ? -12.207 -29.984 7.948   1.00 87.09  ? 427 GLN A O     1 
ATOM   1450 C  CB    . GLN A 1 208 ? -14.604 -30.383 9.342   1.00 84.04  ? 427 GLN A CB    1 
ATOM   1451 C  CG    . GLN A 1 208 ? -15.979 -29.979 9.853   1.00 83.78  ? 427 GLN A CG    1 
ATOM   1452 C  CD    . GLN A 1 208 ? -16.921 -31.130 10.028  1.00 107.05 ? 427 GLN A CD    1 
ATOM   1453 O  OE1   . GLN A 1 208 ? -16.613 -32.096 10.728  1.00 109.78 ? 427 GLN A OE1   1 
ATOM   1454 N  NE2   . GLN A 1 208 ? -18.073 -31.079 9.353   1.00 91.94  ? 427 GLN A NE2   1 
ATOM   1455 N  N     . GLN A 1 209 ? -12.740 -31.481 6.374   1.00 89.72  ? 428 GLN A N     1 
ATOM   1456 C  CA    . GLN A 1 209 ? -11.373 -31.581 5.856   1.00 87.57  ? 428 GLN A CA    1 
ATOM   1457 C  C     . GLN A 1 209 ? -11.134 -30.442 4.855   1.00 87.21  ? 428 GLN A C     1 
ATOM   1458 O  O     . GLN A 1 209 ? -12.011 -30.080 4.065   1.00 87.57  ? 428 GLN A O     1 
ATOM   1459 C  CB    . GLN A 1 209 ? -11.128 -32.937 5.194   1.00 91.85  ? 428 GLN A CB    1 
ATOM   1460 C  CG    . GLN A 1 209 ? -11.249 -34.107 6.170   1.00 113.87 ? 428 GLN A CG    1 
ATOM   1461 C  CD    . GLN A 1 209 ? -10.627 -35.381 5.644   1.00 144.73 ? 428 GLN A CD    1 
ATOM   1462 O  OE1   . GLN A 1 209 ? -9.778  -35.378 4.740   1.00 140.65 ? 428 GLN A OE1   1 
ATOM   1463 N  NE2   . GLN A 1 209 ? -11.055 -36.511 6.189   1.00 144.38 ? 428 GLN A NE2   1 
ATOM   1464 N  N     . VAL A 1 210 ? -9.954  -29.882 4.909   1.00 81.07  ? 429 VAL A N     1 
ATOM   1465 C  CA    . VAL A 1 210 ? -9.568  -28.762 4.079   1.00 79.77  ? 429 VAL A CA    1 
ATOM   1466 C  C     . VAL A 1 210 ? -8.596  -29.182 2.976   1.00 85.08  ? 429 VAL A C     1 
ATOM   1467 O  O     . VAL A 1 210 ? -7.715  -30.020 3.189   1.00 85.59  ? 429 VAL A O     1 
ATOM   1468 C  CB    . VAL A 1 210 ? -8.991  -27.640 4.974   1.00 80.52  ? 429 VAL A CB    1 
ATOM   1469 C  CG1   . VAL A 1 210 ? -8.632  -26.401 4.165   1.00 79.30  ? 429 VAL A CG1   1 
ATOM   1470 C  CG2   . VAL A 1 210 ? -9.987  -27.273 6.067   1.00 80.16  ? 429 VAL A CG2   1 
ATOM   1471 N  N     . GLN A 1 211 ? -8.768  -28.591 1.801   1.00 80.95  ? 430 GLN A N     1 
ATOM   1472 C  CA    . GLN A 1 211 ? -7.900  -28.830 0.666   1.00 81.47  ? 430 GLN A CA    1 
ATOM   1473 C  C     . GLN A 1 211 ? -7.564  -27.475 0.057   1.00 85.12  ? 430 GLN A C     1 
ATOM   1474 O  O     . GLN A 1 211 ? -8.430  -26.604 -0.043  1.00 84.37  ? 430 GLN A O     1 
ATOM   1475 C  CB    . GLN A 1 211 ? -8.619  -29.743 -0.361  1.00 85.64  ? 430 GLN A CB    1 
ATOM   1476 C  CG    . GLN A 1 211 ? -8.031  -29.702 -1.751  1.00 113.50 ? 430 GLN A CG    1 
ATOM   1477 C  CD    . GLN A 1 211 ? -8.732  -30.617 -2.703  1.00 144.22 ? 430 GLN A CD    1 
ATOM   1478 O  OE1   . GLN A 1 211 ? -9.672  -30.222 -3.393  1.00 142.60 ? 430 GLN A OE1   1 
ATOM   1479 N  NE2   . GLN A 1 211 ? -8.232  -31.835 -2.822  1.00 142.36 ? 430 GLN A NE2   1 
ATOM   1480 N  N     . VAL A 1 212 ? -6.308  -27.300 -0.340  1.00 83.05  ? 431 VAL A N     1 
ATOM   1481 C  CA    . VAL A 1 212 ? -5.891  -26.104 -1.057  1.00 83.18  ? 431 VAL A CA    1 
ATOM   1482 C  C     . VAL A 1 212 ? -5.902  -26.561 -2.510  1.00 89.82  ? 431 VAL A C     1 
ATOM   1483 O  O     . VAL A 1 212 ? -5.044  -27.334 -2.950  1.00 92.36  ? 431 VAL A O     1 
ATOM   1484 C  CB    . VAL A 1 212 ? -4.529  -25.508 -0.610  1.00 84.37  ? 431 VAL A CB    1 
ATOM   1485 C  CG1   . VAL A 1 212 ? -4.228  -24.219 -1.373  1.00 84.91  ? 431 VAL A CG1   1 
ATOM   1486 C  CG2   . VAL A 1 212 ? -4.526  -25.229 0.890   1.00 81.16  ? 431 VAL A CG2   1 
ATOM   1487 N  N     . VAL A 1 213 ? -6.930  -26.155 -3.233  1.00 85.99  ? 432 VAL A N     1 
ATOM   1488 C  CA    . VAL A 1 213 ? -7.097  -26.550 -4.632  1.00 87.14  ? 432 VAL A CA    1 
ATOM   1489 C  C     . VAL A 1 213 ? -6.052  -25.823 -5.474  1.00 92.47  ? 432 VAL A C     1 
ATOM   1490 O  O     . VAL A 1 213 ? -5.909  -24.612 -5.343  1.00 91.55  ? 432 VAL A O     1 
ATOM   1491 C  CB    . VAL A 1 213 ? -8.522  -26.256 -5.127  1.00 90.70  ? 432 VAL A CB    1 
ATOM   1492 C  CG1   . VAL A 1 213 ? -8.727  -26.717 -6.562  1.00 93.28  ? 432 VAL A CG1   1 
ATOM   1493 C  CG2   . VAL A 1 213 ? -9.557  -26.875 -4.215  1.00 89.33  ? 432 VAL A CG2   1 
ATOM   1494 N  N     . GLY A 1 214 ? -5.324  -26.564 -6.301  1.00 90.73  ? 433 GLY A N     1 
ATOM   1495 C  CA    . GLY A 1 214 ? -4.306  -25.986 -7.162  1.00 92.61  ? 433 GLY A CA    1 
ATOM   1496 C  C     . GLY A 1 214 ? -2.902  -25.974 -6.593  1.00 97.64  ? 433 GLY A C     1 
ATOM   1497 O  O     . GLY A 1 214 ? -1.964  -25.583 -7.296  1.00 100.32 ? 433 GLY A O     1 
ATOM   1498 N  N     . LEU A 1 215 ? -2.739  -26.362 -5.312  1.00 92.20  ? 434 LEU A N     1 
ATOM   1499 C  CA    . LEU A 1 215 ? -1.430  -26.381 -4.674  1.00 91.85  ? 434 LEU A CA    1 
ATOM   1500 C  C     . LEU A 1 215 ? -0.643  -27.605 -5.107  1.00 102.54 ? 434 LEU A C     1 
ATOM   1501 O  O     . LEU A 1 215 ? -1.013  -28.737 -4.782  1.00 102.25 ? 434 LEU A O     1 
ATOM   1502 C  CB    . LEU A 1 215 ? -1.536  -26.276 -3.134  1.00 87.65  ? 434 LEU A CB    1 
ATOM   1503 C  CG    . LEU A 1 215 ? -0.221  -26.067 -2.347  1.00 89.91  ? 434 LEU A CG    1 
ATOM   1504 C  CD1   . LEU A 1 215 ? 0.470   -24.756 -2.739  1.00 89.83  ? 434 LEU A CD1   1 
ATOM   1505 C  CD2   . LEU A 1 215 ? -0.468  -26.135 -0.832  1.00 86.69  ? 434 LEU A CD2   1 
ATOM   1506 N  N     . GLN A 1 216 ? 0.426   -27.376 -5.871  1.00 104.96 ? 435 GLN A N     1 
ATOM   1507 C  CA    . GLN A 1 216 ? 1.258   -28.476 -6.309  1.00 108.51 ? 435 GLN A CA    1 
ATOM   1508 C  C     . GLN A 1 216 ? 2.363   -28.734 -5.295  1.00 111.25 ? 435 GLN A C     1 
ATOM   1509 O  O     . GLN A 1 216 ? 3.042   -27.798 -4.833  1.00 109.28 ? 435 GLN A O     1 
ATOM   1510 C  CB    . GLN A 1 216 ? 1.859   -28.228 -7.702  1.00 114.37 ? 435 GLN A CB    1 
ATOM   1511 C  CG    . GLN A 1 216 ? 1.897   -29.522 -8.535  1.00 136.52 ? 435 GLN A CG    1 
ATOM   1512 C  CD    . GLN A 1 216 ? 3.111   -29.706 -9.433  1.00 142.58 ? 435 GLN A CD    1 
ATOM   1513 O  OE1   . GLN A 1 216 ? 3.066   -30.459 -10.412 1.00 141.40 ? 435 GLN A OE1   1 
ATOM   1514 N  NE2   . GLN A 1 216 ? 4.219   -29.054 -9.123  1.00 122.05 ? 435 GLN A NE2   1 
ATOM   1515 N  N     . GLU A 1 217 ? 2.544   -30.019 -4.976  1.00 107.65 ? 436 GLU A N     1 
ATOM   1516 C  CA    . GLU A 1 217 ? 3.618   -30.488 -4.124  1.00 106.96 ? 436 GLU A CA    1 
ATOM   1517 C  C     . GLU A 1 217 ? 4.781   -30.811 -5.035  1.00 115.21 ? 436 GLU A C     1 
ATOM   1518 O  O     . GLU A 1 217 ? 4.592   -31.470 -6.050  1.00 118.70 ? 436 GLU A O     1 
ATOM   1519 C  CB    . GLU A 1 217 ? 3.196   -31.747 -3.393  1.00 107.58 ? 436 GLU A CB    1 
ATOM   1520 C  CG    . GLU A 1 217 ? 2.086   -31.537 -2.385  1.00 108.88 ? 436 GLU A CG    1 
ATOM   1521 C  CD    . GLU A 1 217 ? 1.835   -32.773 -1.551  1.00 116.56 ? 436 GLU A CD    1 
ATOM   1522 O  OE1   . GLU A 1 217 ? 2.652   -33.718 -1.635  1.00 116.05 ? 436 GLU A OE1   1 
ATOM   1523 O  OE2   . GLU A 1 217 ? 0.849   -32.785 -0.781  1.00 103.27 ? 436 GLU A OE2   1 
ATOM   1524 N  N     . HIS A 1 218 ? 5.981   -30.357 -4.682  1.00 113.15 ? 437 HIS A N     1 
ATOM   1525 C  CA    . HIS A 1 218 ? 7.188   -30.579 -5.473  1.00 117.56 ? 437 HIS A CA    1 
ATOM   1526 C  C     . HIS A 1 218 ? 8.073   -31.625 -4.867  1.00 121.22 ? 437 HIS A C     1 
ATOM   1527 O  O     . HIS A 1 218 ? 8.514   -31.471 -3.741  1.00 117.62 ? 437 HIS A O     1 
ATOM   1528 C  CB    . HIS A 1 218 ? 7.976   -29.280 -5.616  1.00 119.35 ? 437 HIS A CB    1 
ATOM   1529 C  CG    . HIS A 1 218 ? 7.292   -28.255 -6.457  1.00 123.42 ? 437 HIS A CG    1 
ATOM   1530 N  ND1   . HIS A 1 218 ? 6.081   -27.699 -6.078  1.00 121.16 ? 437 HIS A ND1   1 
ATOM   1531 C  CD2   . HIS A 1 218 ? 7.670   -27.715 -7.640  1.00 130.02 ? 437 HIS A CD2   1 
ATOM   1532 C  CE1   . HIS A 1 218 ? 5.763   -26.848 -7.037  1.00 122.66 ? 437 HIS A CE1   1 
ATOM   1533 N  NE2   . HIS A 1 218 ? 6.687   -26.825 -7.999  1.00 128.14 ? 437 HIS A NE2   1 
ATOM   1534 N  N     . LEU A 1 219 ? 8.363   -32.676 -5.631  1.00 123.34 ? 438 LEU A N     1 
ATOM   1535 C  CA    . LEU A 1 219 ? 9.253   -33.760 -5.223  1.00 125.62 ? 438 LEU A CA    1 
ATOM   1536 C  C     . LEU A 1 219 ? 10.674  -33.229 -5.187  1.00 131.71 ? 438 LEU A C     1 
ATOM   1537 O  O     . LEU A 1 219 ? 11.070  -32.445 -6.053  1.00 132.71 ? 438 LEU A O     1 
ATOM   1538 C  CB    . LEU A 1 219 ? 9.117   -34.938 -6.197  1.00 129.73 ? 438 LEU A CB    1 
ATOM   1539 C  CG    . LEU A 1 219 ? 9.879   -36.244 -5.936  1.00 138.27 ? 438 LEU A CG    1 
ATOM   1540 C  CD1   . LEU A 1 219 ? 9.636   -36.801 -4.548  1.00 134.76 ? 438 LEU A CD1   1 
ATOM   1541 C  CD2   . LEU A 1 219 ? 9.485   -37.297 -6.971  1.00 146.14 ? 438 LEU A CD2   1 
ATOM   1542 N  N     . VAL A 1 220 ? 11.403  -33.597 -4.132  1.00 128.58 ? 439 VAL A N     1 
ATOM   1543 C  CA    . VAL A 1 220 ? 12.770  -33.162 -3.870  1.00 131.40 ? 439 VAL A CA    1 
ATOM   1544 C  C     . VAL A 1 220 ? 13.572  -34.360 -3.367  1.00 140.53 ? 439 VAL A C     1 
ATOM   1545 O  O     . VAL A 1 220 ? 13.032  -35.184 -2.624  1.00 138.06 ? 439 VAL A O     1 
ATOM   1546 C  CB    . VAL A 1 220 ? 12.831  -31.944 -2.894  1.00 130.88 ? 439 VAL A CB    1 
ATOM   1547 C  CG1   . VAL A 1 220 ? 12.229  -30.694 -3.522  1.00 128.70 ? 439 VAL A CG1   1 
ATOM   1548 C  CG2   . VAL A 1 220 ? 12.138  -32.241 -1.567  1.00 125.57 ? 439 VAL A CG2   1 
ATOM   1549 N  N     . ASN A 1 221 ? 14.839  -34.490 -3.804  1.00 143.40 ? 440 ASN A N     1 
ATOM   1550 C  CA    . ASN A 1 221 ? 15.697  -35.616 -3.403  1.00 147.20 ? 440 ASN A CA    1 
ATOM   1551 C  C     . ASN A 1 221 ? 16.896  -35.174 -2.569  1.00 151.25 ? 440 ASN A C     1 
ATOM   1552 O  O     . ASN A 1 221 ? 17.694  -36.017 -2.142  1.00 151.29 ? 440 ASN A O     1 
ATOM   1553 C  CB    . ASN A 1 221 ? 16.155  -36.423 -4.611  1.00 150.43 ? 440 ASN A CB    1 
ATOM   1554 C  CG    . ASN A 1 221 ? 15.159  -36.451 -5.730  1.00 161.47 ? 440 ASN A CG    1 
ATOM   1555 O  OD1   . ASN A 1 221 ? 14.304  -37.342 -5.818  1.00 158.31 ? 440 ASN A OD1   1 
ATOM   1556 N  ND2   . ASN A 1 221 ? 15.239  -35.448 -6.595  1.00 159.10 ? 440 ASN A ND2   1 
ATOM   1557 N  N     . SER A 1 222 ? 17.029  -33.861 -2.335  1.00 144.24 ? 441 SER A N     1 
ATOM   1558 C  CA    . SER A 1 222 ? 18.143  -33.340 -1.555  1.00 145.34 ? 441 SER A CA    1 
ATOM   1559 C  C     . SER A 1 222 ? 17.780  -32.040 -0.912  1.00 145.87 ? 441 SER A C     1 
ATOM   1560 O  O     . SER A 1 222 ? 16.842  -31.377 -1.357  1.00 143.36 ? 441 SER A O     1 
ATOM   1561 C  CB    . SER A 1 222 ? 19.388  -33.154 -2.425  1.00 150.67 ? 441 SER A CB    1 
ATOM   1562 O  OG    . SER A 1 222 ? 19.325  -31.963 -3.195  1.00 155.21 ? 441 SER A OG    1 
ATOM   1563 N  N     . ALA A 1 223 ? 18.534  -31.657 0.135   1.00 142.24 ? 442 ALA A N     1 
ATOM   1564 C  CA    . ALA A 1 223 ? 18.309  -30.394 0.837   1.00 137.17 ? 442 ALA A CA    1 
ATOM   1565 C  C     . ALA A 1 223 ? 18.718  -29.230 -0.055  1.00 142.10 ? 442 ALA A C     1 
ATOM   1566 O  O     . ALA A 1 223 ? 18.228  -28.119 0.136   1.00 138.22 ? 442 ALA A O     1 
ATOM   1567 C  CB    . ALA A 1 223 ? 19.085  -30.361 2.143   1.00 137.34 ? 442 ALA A CB    1 
ATOM   1568 N  N     . ASP A 1 224 ? 19.606  -29.489 -1.037  1.00 143.84 ? 443 ASP A N     1 
ATOM   1569 C  CA    . ASP A 1 224 ? 20.054  -28.485 -2.008  1.00 145.95 ? 443 ASP A CA    1 
ATOM   1570 C  C     . ASP A 1 224 ? 18.925  -28.128 -2.990  1.00 149.44 ? 443 ASP A C     1 
ATOM   1571 O  O     . ASP A 1 224 ? 18.783  -26.961 -3.371  1.00 149.80 ? 443 ASP A O     1 
ATOM   1572 C  CB    . ASP A 1 224 ? 21.325  -28.956 -2.731  1.00 149.95 ? 443 ASP A CB    1 
ATOM   1573 C  CG    . ASP A 1 224 ? 22.575  -28.893 -1.865  1.00 155.52 ? 443 ASP A CG    1 
ATOM   1574 O  OD1   . ASP A 1 224 ? 22.635  -28.021 -0.958  1.00 154.61 ? 443 ASP A OD1   1 
ATOM   1575 O  OD2   . ASP A 1 224 ? 23.516  -29.682 -2.120  1.00 161.20 ? 443 ASP A OD2   1 
ATOM   1576 N  N     . ASP A 1 225 ? 18.110  -29.128 -3.371  1.00 144.37 ? 444 ASP A N     1 
ATOM   1577 C  CA    . ASP A 1 225 ? 16.921  -28.910 -4.192  1.00 142.24 ? 444 ASP A CA    1 
ATOM   1578 C  C     . ASP A 1 225 ? 15.937  -27.995 -3.425  1.00 142.00 ? 444 ASP A C     1 
ATOM   1579 O  O     . ASP A 1 225 ? 15.449  -27.017 -3.993  1.00 141.60 ? 444 ASP A O     1 
ATOM   1580 C  CB    . ASP A 1 225 ? 16.245  -30.247 -4.514  1.00 143.56 ? 444 ASP A CB    1 
ATOM   1581 C  CG    . ASP A 1 225 ? 17.042  -31.144 -5.448  1.00 153.58 ? 444 ASP A CG    1 
ATOM   1582 O  OD1   . ASP A 1 225 ? 17.814  -30.606 -6.282  1.00 154.17 ? 444 ASP A OD1   1 
ATOM   1583 O  OD2   . ASP A 1 225 ? 16.852  -32.382 -5.388  1.00 156.57 ? 444 ASP A OD2   1 
ATOM   1584 N  N     . VAL A 1 226 ? 15.697  -28.291 -2.119  1.00 134.16 ? 445 VAL A N     1 
ATOM   1585 C  CA    . VAL A 1 226 ? 14.811  -27.500 -1.252  1.00 127.62 ? 445 VAL A CA    1 
ATOM   1586 C  C     . VAL A 1 226 ? 15.297  -26.058 -1.129  1.00 132.86 ? 445 VAL A C     1 
ATOM   1587 O  O     . VAL A 1 226 ? 14.480  -25.139 -1.216  1.00 130.30 ? 445 VAL A O     1 
ATOM   1588 C  CB    . VAL A 1 226 ? 14.609  -28.124 0.149   1.00 126.84 ? 445 VAL A CB    1 
ATOM   1589 C  CG1   . VAL A 1 226 ? 13.703  -27.256 1.007   1.00 120.67 ? 445 VAL A CG1   1 
ATOM   1590 C  CG2   . VAL A 1 226 ? 14.044  -29.521 0.059   1.00 127.06 ? 445 VAL A CG2   1 
ATOM   1591 N  N     . ILE A 1 227 ? 16.613  -25.858 -0.910  1.00 132.69 ? 446 ILE A N     1 
ATOM   1592 C  CA    . ILE A 1 227 ? 17.181  -24.513 -0.769  1.00 133.62 ? 446 ILE A CA    1 
ATOM   1593 C  C     . ILE A 1 227 ? 16.944  -23.705 -2.026  1.00 141.63 ? 446 ILE A C     1 
ATOM   1594 O  O     . ILE A 1 227 ? 16.665  -22.510 -1.933  1.00 140.09 ? 446 ILE A O     1 
ATOM   1595 C  CB    . ILE A 1 227 ? 18.669  -24.536 -0.324  1.00 140.54 ? 446 ILE A CB    1 
ATOM   1596 C  CG1   . ILE A 1 227 ? 18.768  -24.979 1.149   1.00 137.25 ? 446 ILE A CG1   1 
ATOM   1597 C  CG2   . ILE A 1 227 ? 19.378  -23.178 -0.559  1.00 143.54 ? 446 ILE A CG2   1 
ATOM   1598 C  CD1   . ILE A 1 227 ? 20.175  -24.931 1.781   1.00 155.58 ? 446 ILE A CD1   1 
ATOM   1599 N  N     . LYS A 1 228 ? 17.021  -24.360 -3.195  1.00 142.97 ? 447 LYS A N     1 
ATOM   1600 C  CA    . LYS A 1 228 ? 16.737  -23.700 -4.465  1.00 146.31 ? 447 LYS A CA    1 
ATOM   1601 C  C     . LYS A 1 228 ? 15.260  -23.300 -4.484  1.00 145.35 ? 447 LYS A C     1 
ATOM   1602 O  O     . LYS A 1 228 ? 14.961  -22.183 -4.898  1.00 145.74 ? 447 LYS A O     1 
ATOM   1603 C  CB    . LYS A 1 228 ? 17.089  -24.602 -5.651  1.00 152.75 ? 447 LYS A CB    1 
ATOM   1604 N  N     . MET A 1 229 ? 14.354  -24.172 -3.966  1.00 137.56 ? 448 MET A N     1 
ATOM   1605 C  CA    . MET A 1 229 ? 12.910  -23.881 -3.853  1.00 132.26 ? 448 MET A CA    1 
ATOM   1606 C  C     . MET A 1 229 ? 12.667  -22.673 -2.920  1.00 130.22 ? 448 MET A C     1 
ATOM   1607 O  O     . MET A 1 229 ? 11.972  -21.741 -3.310  1.00 128.55 ? 448 MET A O     1 
ATOM   1608 C  CB    . MET A 1 229 ? 12.120  -25.083 -3.293  1.00 131.43 ? 448 MET A CB    1 
ATOM   1609 C  CG    . MET A 1 229 ? 12.268  -26.383 -4.053  1.00 139.04 ? 448 MET A CG    1 
ATOM   1610 S  SD    . MET A 1 229 ? 11.369  -26.405 -5.602  1.00 146.12 ? 448 MET A SD    1 
ATOM   1611 C  CE    . MET A 1 229 ? 11.092  -28.142 -5.770  1.00 144.28 ? 448 MET A CE    1 
ATOM   1612 N  N     . ILE A 1 230 ? 13.227  -22.692 -1.693  1.00 124.10 ? 449 ILE A N     1 
ATOM   1613 C  CA    . ILE A 1 230 ? 13.061  -21.598 -0.720  1.00 120.69 ? 449 ILE A CA    1 
ATOM   1614 C  C     . ILE A 1 230 ? 13.516  -20.273 -1.302  1.00 132.14 ? 449 ILE A C     1 
ATOM   1615 O  O     . ILE A 1 230 ? 12.807  -19.271 -1.162  1.00 130.27 ? 449 ILE A O     1 
ATOM   1616 C  CB    . ILE A 1 230 ? 13.820  -21.880 0.580   1.00 121.34 ? 449 ILE A CB    1 
ATOM   1617 C  CG1   . ILE A 1 230 ? 13.322  -23.157 1.213   1.00 118.08 ? 449 ILE A CG1   1 
ATOM   1618 C  CG2   . ILE A 1 230 ? 13.719  -20.683 1.556   1.00 120.16 ? 449 ILE A CG2   1 
ATOM   1619 C  CD1   . ILE A 1 230 ? 13.958  -23.459 2.478   1.00 121.98 ? 449 ILE A CD1   1 
ATOM   1620 N  N     . ASP A 1 231 ? 14.710  -20.273 -1.944  1.00 136.58 ? 450 ASP A N     1 
ATOM   1621 C  CA    . ASP A 1 231 ? 15.275  -19.099 -2.596  1.00 142.05 ? 450 ASP A CA    1 
ATOM   1622 C  C     . ASP A 1 231 ? 14.390  -18.631 -3.724  1.00 150.89 ? 450 ASP A C     1 
ATOM   1623 O  O     . ASP A 1 231 ? 14.156  -17.427 -3.829  1.00 151.03 ? 450 ASP A O     1 
ATOM   1624 C  CB    . ASP A 1 231 ? 16.689  -19.380 -3.103  1.00 150.47 ? 450 ASP A CB    1 
ATOM   1625 C  CG    . ASP A 1 231 ? 17.736  -19.403 -2.010  1.00 161.94 ? 450 ASP A CG    1 
ATOM   1626 O  OD1   . ASP A 1 231 ? 17.418  -18.983 -0.869  1.00 156.76 ? 450 ASP A OD1   1 
ATOM   1627 O  OD2   . ASP A 1 231 ? 18.882  -19.821 -2.296  1.00 174.99 ? 450 ASP A OD2   1 
ATOM   1628 N  N     . MET A 1 232 ? 13.873  -19.578 -4.549  1.00 151.40 ? 451 MET A N     1 
ATOM   1629 C  CA    . MET A 1 232 ? 12.923  -19.285 -5.632  1.00 154.15 ? 451 MET A CA    1 
ATOM   1630 C  C     . MET A 1 232 ? 11.705  -18.612 -5.005  1.00 156.47 ? 451 MET A C     1 
ATOM   1631 O  O     . MET A 1 232 ? 11.273  -17.560 -5.479  1.00 158.58 ? 451 MET A O     1 
ATOM   1632 C  CB    . MET A 1 232 ? 12.478  -20.575 -6.363  1.00 157.42 ? 451 MET A CB    1 
ATOM   1633 C  CG    . MET A 1 232 ? 11.932  -20.330 -7.773  1.00 165.39 ? 451 MET A CG    1 
ATOM   1634 S  SD    . MET A 1 232 ? 10.568  -21.424 -8.284  1.00 167.63 ? 451 MET A SD    1 
ATOM   1635 C  CE    . MET A 1 232 ? 10.444  -20.989 -10.031 1.00 170.60 ? 451 MET A CE    1 
ATOM   1636 N  N     . GLY A 1 233 ? 11.204  -19.203 -3.921  1.00 148.81 ? 452 GLY A N     1 
ATOM   1637 C  CA    . GLY A 1 233 ? 10.025  -18.727 -3.219  1.00 144.70 ? 452 GLY A CA    1 
ATOM   1638 C  C     . GLY A 1 233 ? 10.182  -17.379 -2.550  1.00 150.10 ? 452 GLY A C     1 
ATOM   1639 O  O     . GLY A 1 233 ? 9.337   -16.500 -2.740  1.00 149.42 ? 452 GLY A O     1 
ATOM   1640 N  N     . SER A 1 234 ? 11.259  -17.209 -1.752  1.00 148.00 ? 453 SER A N     1 
ATOM   1641 C  CA    . SER A 1 234 ? 11.548  -15.970 -1.017  1.00 147.59 ? 453 SER A CA    1 
ATOM   1642 C  C     . SER A 1 234 ? 11.659  -14.746 -1.923  1.00 160.34 ? 453 SER A C     1 
ATOM   1643 O  O     . SER A 1 234 ? 11.252  -13.652 -1.520  1.00 159.55 ? 453 SER A O     1 
ATOM   1644 C  CB    . SER A 1 234 ? 12.808  -16.122 -0.180  1.00 148.37 ? 453 SER A CB    1 
ATOM   1645 O  OG    . SER A 1 234 ? 12.641  -17.148 0.782   1.00 145.50 ? 453 SER A OG    1 
ATOM   1646 N  N     . ALA A 1 235 ? 12.188  -14.940 -3.150  1.00 164.84 ? 454 ALA A N     1 
ATOM   1647 C  CA    . ALA A 1 235 ? 12.319  -13.886 -4.159  1.00 171.47 ? 454 ALA A CA    1 
ATOM   1648 C  C     . ALA A 1 235 ? 10.948  -13.318 -4.527  1.00 177.79 ? 454 ALA A C     1 
ATOM   1649 O  O     . ALA A 1 235 ? 10.823  -12.103 -4.687  1.00 180.22 ? 454 ALA A O     1 
ATOM   1650 C  CB    . ALA A 1 235 ? 13.014  -14.422 -5.398  1.00 177.66 ? 454 ALA A CB    1 
ATOM   1651 N  N     . CYS A 1 236 ? 9.915   -14.192 -4.621  1.00 173.30 ? 455 CYS A N     1 
ATOM   1652 C  CA    . CYS A 1 236 ? 8.537   -13.789 -4.915  1.00 173.11 ? 455 CYS A CA    1 
ATOM   1653 C  C     . CYS A 1 236 ? 7.999   -12.902 -3.807  1.00 176.15 ? 455 CYS A C     1 
ATOM   1654 O  O     . CYS A 1 236 ? 7.710   -11.730 -4.058  1.00 178.85 ? 455 CYS A O     1 
ATOM   1655 C  CB    . CYS A 1 236 ? 7.626   -15.000 -5.115  1.00 170.38 ? 455 CYS A CB    1 
ATOM   1656 S  SG    . CYS A 1 236 ? 7.895   -15.919 -6.647  1.00 178.87 ? 455 CYS A SG    1 
ATOM   1657 N  N     . ARG A 1 237 ? 7.849   -13.479 -2.589  1.00 168.54 ? 456 ARG A N     1 
ATOM   1658 C  CA    . ARG A 1 237 ? 7.268   -12.822 -1.422  1.00 165.44 ? 456 ARG A CA    1 
ATOM   1659 C  C     . ARG A 1 237 ? 7.599   -11.367 -1.160  1.00 174.07 ? 456 ARG A C     1 
ATOM   1660 O  O     . ARG A 1 237 ? 8.731   -10.998 -0.832  1.00 175.55 ? 456 ARG A O     1 
ATOM   1661 C  CB    . ARG A 1 237 ? 7.385   -13.672 -0.170  1.00 161.02 ? 456 ARG A CB    1 
ATOM   1662 N  N     . THR A 1 238 ? 6.541   -10.537 -1.309  1.00 172.21 ? 457 THR A N     1 
ATOM   1663 C  CA    . THR A 1 238 ? 6.501   -9.081  -1.125  1.00 204.43 ? 457 THR A CA    1 
ATOM   1664 C  C     . THR A 1 238 ? 5.231   -8.675  -0.347  1.00 211.38 ? 457 THR A C     1 
ATOM   1665 O  O     . THR A 1 238 ? 4.258   -9.435  -0.262  1.00 155.37 ? 457 THR A O     1 
ATOM   1666 C  CB    . THR A 1 238 ? 6.596   -8.332  -2.483  1.00 217.96 ? 457 THR A CB    1 
ATOM   1667 O  OG1   . THR A 1 238 ? 5.690   -8.906  -3.432  1.00 218.21 ? 457 THR A OG1   1 
ATOM   1668 C  CG2   . THR A 1 238 ? 8.016   -8.301  -3.054  1.00 218.81 ? 457 THR A CG2   1 
ATOM   1669 N  N     . ASN A 1 247 ? 3.979   -5.326  1.100   1.00 138.38 ? 466 ASN A N     1 
ATOM   1670 C  CA    . ASN A 1 247 ? 4.872   -5.656  2.215   1.00 134.78 ? 466 ASN A CA    1 
ATOM   1671 C  C     . ASN A 1 247 ? 4.725   -7.103  2.694   1.00 131.97 ? 466 ASN A C     1 
ATOM   1672 O  O     . ASN A 1 247 ? 3.614   -7.581  2.959   1.00 127.91 ? 466 ASN A O     1 
ATOM   1673 C  CB    . ASN A 1 247 ? 4.674   -4.687  3.382   1.00 134.98 ? 466 ASN A CB    1 
ATOM   1674 N  N     . SER A 1 248 ? 5.872   -7.789  2.809   1.00 126.31 ? 467 SER A N     1 
ATOM   1675 C  CA    . SER A 1 248 ? 5.979   -9.161  3.309   1.00 120.35 ? 467 SER A CA    1 
ATOM   1676 C  C     . SER A 1 248 ? 5.786   -9.187  4.835   1.00 114.19 ? 467 SER A C     1 
ATOM   1677 O  O     . SER A 1 248 ? 5.679   -10.262 5.435   1.00 107.71 ? 467 SER A O     1 
ATOM   1678 C  CB    . SER A 1 248 ? 7.338   -9.737  2.934   1.00 126.98 ? 467 SER A CB    1 
ATOM   1679 O  OG    . SER A 1 248 ? 8.360   -8.858  3.378   1.00 141.08 ? 467 SER A OG    1 
ATOM   1680 N  N     . SER A 1 249 ? 5.725   -7.997  5.453   1.00 109.77 ? 468 SER A N     1 
ATOM   1681 C  CA    . SER A 1 249 ? 5.427   -7.861  6.871   1.00 105.42 ? 468 SER A CA    1 
ATOM   1682 C  C     . SER A 1 249 ? 3.900   -7.993  7.104   1.00 105.44 ? 468 SER A C     1 
ATOM   1683 O  O     . SER A 1 249 ? 3.450   -8.112  8.251   1.00 102.70 ? 468 SER A O     1 
ATOM   1684 C  CB    . SER A 1 249 ? 5.961   -6.533  7.410   1.00 109.68 ? 468 SER A CB    1 
ATOM   1685 O  OG    . SER A 1 249 ? 5.211   -5.403  7.001   1.00 116.86 ? 468 SER A OG    1 
ATOM   1686 N  N     . ARG A 1 250 ? 3.115   -7.984  6.017   1.00 101.58 ? 469 ARG A N     1 
ATOM   1687 C  CA    . ARG A 1 250 ? 1.659   -8.049  6.092   1.00 99.89  ? 469 ARG A CA    1 
ATOM   1688 C  C     . ARG A 1 250 ? 1.097   -9.388  5.637   1.00 99.12  ? 469 ARG A C     1 
ATOM   1689 O  O     . ARG A 1 250 ? -0.119  -9.537  5.506   1.00 99.58  ? 469 ARG A O     1 
ATOM   1690 C  CB    . ARG A 1 250 ? 1.034   -6.886  5.310   1.00 105.82 ? 469 ARG A CB    1 
ATOM   1691 C  CG    . ARG A 1 250 ? 1.349   -5.507  5.901   1.00 120.14 ? 469 ARG A CG    1 
ATOM   1692 C  CD    . ARG A 1 250 ? 0.075   -4.746  6.253   1.00 135.95 ? 469 ARG A CD    1 
ATOM   1693 N  NE    . ARG A 1 250 ? -0.487  -4.028  5.100   1.00 154.35 ? 469 ARG A NE    1 
ATOM   1694 C  CZ    . ARG A 1 250 ? -1.516  -4.449  4.365   1.00 165.66 ? 469 ARG A CZ    1 
ATOM   1695 N  NH1   . ARG A 1 250 ? -2.127  -5.593  4.655   1.00 152.78 ? 469 ARG A NH1   1 
ATOM   1696 N  NH2   . ARG A 1 250 ? -1.947  -3.726  3.341   1.00 146.46 ? 469 ARG A NH2   1 
ATOM   1697 N  N     . SER A 1 251 ? 1.977   -10.372 5.419   1.00 90.91  ? 470 SER A N     1 
ATOM   1698 C  CA    . SER A 1 251 ? 1.564   -11.695 4.977   1.00 86.89  ? 470 SER A CA    1 
ATOM   1699 C  C     . SER A 1 251 ? 2.204   -12.836 5.761   1.00 83.35  ? 470 SER A C     1 
ATOM   1700 O  O     . SER A 1 251 ? 3.261   -12.669 6.378   1.00 81.81  ? 470 SER A O     1 
ATOM   1701 C  CB    . SER A 1 251 ? 1.848   -11.862 3.489   1.00 93.40  ? 470 SER A CB    1 
ATOM   1702 O  OG    . SER A 1 251 ? 3.207   -11.611 3.187   1.00 106.65 ? 470 SER A OG    1 
ATOM   1703 N  N     . HIS A 1 252 ? 1.540   -13.999 5.734   1.00 75.86  ? 471 HIS A N     1 
ATOM   1704 C  CA    . HIS A 1 252 ? 2.053   -15.224 6.327   1.00 72.91  ? 471 HIS A CA    1 
ATOM   1705 C  C     . HIS A 1 252 ? 2.707   -16.025 5.225   1.00 80.24  ? 471 HIS A C     1 
ATOM   1706 O  O     . HIS A 1 252 ? 2.167   -16.075 4.136   1.00 81.06  ? 471 HIS A O     1 
ATOM   1707 C  CB    . HIS A 1 252 ? 0.937   -16.086 6.912   1.00 70.67  ? 471 HIS A CB    1 
ATOM   1708 C  CG    . HIS A 1 252 ? -0.018  -15.379 7.810   1.00 73.07  ? 471 HIS A CG    1 
ATOM   1709 N  ND1   . HIS A 1 252 ? 0.409   -14.679 8.932   1.00 74.06  ? 471 HIS A ND1   1 
ATOM   1710 C  CD2   . HIS A 1 252 ? -1.367  -15.366 7.779   1.00 75.05  ? 471 HIS A CD2   1 
ATOM   1711 C  CE1   . HIS A 1 252 ? -0.690  -14.249 9.527   1.00 73.15  ? 471 HIS A CE1   1 
ATOM   1712 N  NE2   . HIS A 1 252 ? -1.780  -14.628 8.866   1.00 74.36  ? 471 HIS A NE2   1 
ATOM   1713 N  N     . ALA A 1 253 ? 3.873   -16.625 5.481   1.00 77.98  ? 472 ALA A N     1 
ATOM   1714 C  CA    . ALA A 1 253 ? 4.522   -17.484 4.495   1.00 79.82  ? 472 ALA A CA    1 
ATOM   1715 C  C     . ALA A 1 253 ? 4.606   -18.862 5.136   1.00 82.11  ? 472 ALA A C     1 
ATOM   1716 O  O     . ALA A 1 253 ? 5.029   -18.960 6.286   1.00 81.35  ? 472 ALA A O     1 
ATOM   1717 C  CB    . ALA A 1 253 ? 5.894   -16.953 4.136   1.00 82.63  ? 472 ALA A CB    1 
ATOM   1718 N  N     . CYS A 1 254 ? 4.153   -19.911 4.419   1.00 77.41  ? 473 CYS A N     1 
ATOM   1719 C  CA    A CYS A 1 254 ? 4.112   -21.276 4.938   0.50 74.76  ? 473 CYS A CA    1 
ATOM   1720 C  CA    B CYS A 1 254 ? 4.116   -21.276 4.934   0.50 76.30  ? 473 CYS A CA    1 
ATOM   1721 C  C     . CYS A 1 254 ? 4.892   -22.194 4.028   1.00 81.83  ? 473 CYS A C     1 
ATOM   1722 O  O     . CYS A 1 254 ? 4.558   -22.320 2.853   1.00 83.80  ? 473 CYS A O     1 
ATOM   1723 C  CB    A CYS A 1 254 ? 2.668   -21.748 5.119   0.50 72.66  ? 473 CYS A CB    1 
ATOM   1724 C  CB    B CYS A 1 254 ? 2.679   -21.766 5.116   0.50 75.67  ? 473 CYS A CB    1 
ATOM   1725 S  SG    A CYS A 1 254 ? 2.496   -23.424 5.800   0.50 75.15  ? 473 CYS A SG    1 
ATOM   1726 S  SG    B CYS A 1 254 ? 1.511   -20.490 5.650   0.50 78.58  ? 473 CYS A SG    1 
ATOM   1727 N  N     . PHE A 1 255 ? 5.919   -22.835 4.584   1.00 79.11  ? 474 PHE A N     1 
ATOM   1728 C  CA    . PHE A 1 255 ? 6.771   -23.781 3.894   1.00 82.49  ? 474 PHE A CA    1 
ATOM   1729 C  C     . PHE A 1 255 ? 6.474   -25.125 4.515   1.00 85.94  ? 474 PHE A C     1 
ATOM   1730 O  O     . PHE A 1 255 ? 6.516   -25.259 5.737   1.00 84.59  ? 474 PHE A O     1 
ATOM   1731 C  CB    . PHE A 1 255 ? 8.255   -23.388 4.047   1.00 86.35  ? 474 PHE A CB    1 
ATOM   1732 C  CG    . PHE A 1 255 ? 9.208   -24.498 3.707   1.00 91.27  ? 474 PHE A CG    1 
ATOM   1733 C  CD1   . PHE A 1 255 ? 9.483   -24.822 2.385   1.00 98.12  ? 474 PHE A CD1   1 
ATOM   1734 C  CD2   . PHE A 1 255 ? 9.796   -25.253 4.705   1.00 94.68  ? 474 PHE A CD2   1 
ATOM   1735 C  CE1   . PHE A 1 255 ? 10.343  -25.881 2.069   1.00 102.62 ? 474 PHE A CE1   1 
ATOM   1736 C  CE2   . PHE A 1 255 ? 10.671  -26.299 4.391   1.00 100.79 ? 474 PHE A CE2   1 
ATOM   1737 C  CZ    . PHE A 1 255 ? 10.920  -26.619 3.075   1.00 102.18 ? 474 PHE A CZ    1 
ATOM   1738 N  N     . GLN A 1 256 ? 6.141   -26.109 3.682   1.00 83.27  ? 475 GLN A N     1 
ATOM   1739 C  CA    . GLN A 1 256 ? 5.769   -27.426 4.175   1.00 82.60  ? 475 GLN A CA    1 
ATOM   1740 C  C     . GLN A 1 256 ? 6.684   -28.508 3.696   1.00 89.51  ? 475 GLN A C     1 
ATOM   1741 O  O     . GLN A 1 256 ? 7.058   -28.519 2.539   1.00 91.88  ? 475 GLN A O     1 
ATOM   1742 C  CB    . GLN A 1 256 ? 4.313   -27.784 3.789   1.00 82.30  ? 475 GLN A CB    1 
ATOM   1743 C  CG    . GLN A 1 256 ? 3.282   -26.757 4.231   1.00 80.05  ? 475 GLN A CG    1 
ATOM   1744 C  CD    . GLN A 1 256 ? 1.871   -27.123 3.900   1.00 104.65 ? 475 GLN A CD    1 
ATOM   1745 O  OE1   . GLN A 1 256 ? 1.518   -27.360 2.743   1.00 107.02 ? 475 GLN A OE1   1 
ATOM   1746 N  NE2   . GLN A 1 256 ? 1.007   -27.107 4.905   1.00 98.61  ? 475 GLN A NE2   1 
ATOM   1747 N  N     . ILE A 1 257 ? 7.024   -29.432 4.591   1.00 87.01  ? 476 ILE A N     1 
ATOM   1748 C  CA    . ILE A 1 257 ? 7.756   -30.652 4.270   1.00 90.47  ? 476 ILE A CA    1 
ATOM   1749 C  C     . ILE A 1 257 ? 6.744   -31.753 4.468   1.00 94.58  ? 476 ILE A C     1 
ATOM   1750 O  O     . ILE A 1 257 ? 6.201   -31.911 5.564   1.00 93.95  ? 476 ILE A O     1 
ATOM   1751 C  CB    . ILE A 1 257 ? 8.980   -30.920 5.140   1.00 94.13  ? 476 ILE A CB    1 
ATOM   1752 C  CG1   . ILE A 1 257 ? 9.989   -29.778 5.057   1.00 94.01  ? 476 ILE A CG1   1 
ATOM   1753 C  CG2   . ILE A 1 257 ? 9.604   -32.256 4.718   1.00 99.01  ? 476 ILE A CG2   1 
ATOM   1754 C  CD1   . ILE A 1 257 ? 11.011  -29.778 6.180   1.00 97.99  ? 476 ILE A CD1   1 
ATOM   1755 N  N     . ILE A 1 258 ? 6.489   -32.500 3.408   1.00 92.03  ? 477 ILE A N     1 
ATOM   1756 C  CA    . ILE A 1 258 ? 5.515   -33.582 3.399   1.00 92.14  ? 477 ILE A CA    1 
ATOM   1757 C  C     . ILE A 1 258 ? 6.212   -34.918 3.114   1.00 102.45 ? 477 ILE A C     1 
ATOM   1758 O  O     . ILE A 1 258 ? 6.862   -35.055 2.082   1.00 104.66 ? 477 ILE A O     1 
ATOM   1759 C  CB    . ILE A 1 258 ? 4.391   -33.288 2.360   1.00 93.17  ? 477 ILE A CB    1 
ATOM   1760 C  CG1   . ILE A 1 258 ? 3.728   -31.914 2.598   1.00 88.14  ? 477 ILE A CG1   1 
ATOM   1761 C  CG2   . ILE A 1 258 ? 3.363   -34.406 2.360   1.00 94.46  ? 477 ILE A CG2   1 
ATOM   1762 C  CD1   . ILE A 1 258 ? 3.099   -31.293 1.403   1.00 92.33  ? 477 ILE A CD1   1 
ATOM   1763 N  N     . LEU A 1 259 ? 6.083   -35.894 4.021   1.00 101.05 ? 478 LEU A N     1 
ATOM   1764 C  CA    . LEU A 1 259 ? 6.605   -37.243 3.798   1.00 105.62 ? 478 LEU A CA    1 
ATOM   1765 C  C     . LEU A 1 259 ? 5.459   -38.124 3.275   1.00 112.12 ? 478 LEU A C     1 
ATOM   1766 O  O     . LEU A 1 259 ? 4.399   -38.194 3.900   1.00 108.76 ? 478 LEU A O     1 
ATOM   1767 C  CB    . LEU A 1 259 ? 7.183   -37.856 5.087   1.00 106.36 ? 478 LEU A CB    1 
ATOM   1768 C  CG    . LEU A 1 259 ? 8.450   -37.242 5.661   1.00 110.03 ? 478 LEU A CG    1 
ATOM   1769 C  CD1   . LEU A 1 259 ? 8.800   -37.899 6.977   1.00 110.81 ? 478 LEU A CD1   1 
ATOM   1770 C  CD2   . LEU A 1 259 ? 9.620   -37.362 4.683   1.00 118.00 ? 478 LEU A CD2   1 
ATOM   1771 N  N     . ARG A 1 260 ? 5.662   -38.777 2.125   1.00 114.57 ? 479 ARG A N     1 
ATOM   1772 C  CA    . ARG A 1 260 ? 4.680   -39.713 1.545   1.00 117.45 ? 479 ARG A CA    1 
ATOM   1773 C  C     . ARG A 1 260 ? 5.319   -41.095 1.397   1.00 130.57 ? 479 ARG A C     1 
ATOM   1774 O  O     . ARG A 1 260 ? 6.460   -41.194 0.938   1.00 133.90 ? 479 ARG A O     1 
ATOM   1775 C  CB    . ARG A 1 260 ? 4.127   -39.212 0.210   1.00 115.48 ? 479 ARG A CB    1 
ATOM   1776 C  CG    . ARG A 1 260 ? 3.365   -37.913 0.338   1.00 112.11 ? 479 ARG A CG    1 
ATOM   1777 C  CD    . ARG A 1 260 ? 2.642   -37.573 -0.943  1.00 111.32 ? 479 ARG A CD    1 
ATOM   1778 N  NE    . ARG A 1 260 ? 1.728   -36.445 -0.766  1.00 109.09 ? 479 ARG A NE    1 
ATOM   1779 C  CZ    . ARG A 1 260 ? 0.531   -36.517 -0.183  1.00 121.04 ? 479 ARG A CZ    1 
ATOM   1780 N  NH1   . ARG A 1 260 ? 0.096   -37.668 0.325   1.00 112.02 ? 479 ARG A NH1   1 
ATOM   1781 N  NH2   . ARG A 1 260 ? -0.229  -35.436 -0.079  1.00 101.07 ? 479 ARG A NH2   1 
ATOM   1782 N  N     . ALA A 1 261 ? 4.591   -42.154 1.800   1.00 131.04 ? 480 ALA A N     1 
ATOM   1783 C  CA    . ALA A 1 261 ? 5.084   -43.538 1.843   1.00 137.48 ? 480 ALA A CA    1 
ATOM   1784 C  C     . ALA A 1 261 ? 5.014   -44.278 0.512   1.00 146.98 ? 480 ALA A C     1 
ATOM   1785 O  O     . ALA A 1 261 ? 5.970   -44.980 0.143   1.00 152.84 ? 480 ALA A O     1 
ATOM   1786 C  CB    . ALA A 1 261 ? 4.363   -44.314 2.938   1.00 139.11 ? 480 ALA A CB    1 
ATOM   1787 N  N     . LYS A 1 262 ? 3.875   -44.145 -0.187  1.00 140.70 ? 481 LYS A N     1 
ATOM   1788 C  CA    . LYS A 1 262 ? 3.633   -44.706 -1.517  1.00 144.10 ? 481 LYS A CA    1 
ATOM   1789 C  C     . LYS A 1 262 ? 2.603   -43.799 -2.188  1.00 143.99 ? 481 LYS A C     1 
ATOM   1790 O  O     . LYS A 1 262 ? 1.702   -44.271 -2.891  1.00 144.50 ? 481 LYS A O     1 
ATOM   1791 C  CB    . LYS A 1 262 ? 3.126   -46.164 -1.429  1.00 151.10 ? 481 LYS A CB    1 
ATOM   1792 C  CG    . LYS A 1 262 ? 4.218   -47.199 -1.200  1.00 163.28 ? 481 LYS A CG    1 
ATOM   1793 C  CD    . LYS A 1 262 ? 4.194   -48.242 -2.312  1.00 169.99 ? 481 LYS A CD    1 
ATOM   1794 C  CE    . LYS A 1 262 ? 4.040   -49.656 -1.805  1.00 174.84 ? 481 LYS A CE    1 
ATOM   1795 N  NZ    . LYS A 1 262 ? 2.654   -49.941 -1.347  1.00 180.23 ? 481 LYS A NZ    1 
ATOM   1796 N  N     . GLY A 1 263 ? 2.751   -42.495 -1.948  1.00 135.96 ? 482 GLY A N     1 
ATOM   1797 C  CA    . GLY A 1 263 ? 1.796   -41.483 -2.381  1.00 131.94 ? 482 GLY A CA    1 
ATOM   1798 C  C     . GLY A 1 263 ? 0.836   -41.176 -1.241  1.00 133.00 ? 482 GLY A C     1 
ATOM   1799 O  O     . GLY A 1 263 ? 0.157   -40.142 -1.250  1.00 128.04 ? 482 GLY A O     1 
ATOM   1800 N  N     . ARG A 1 264 ? 0.769   -42.092 -0.243  1.00 132.09 ? 483 ARG A N     1 
ATOM   1801 C  CA    . ARG A 1 264 ? -0.039  -41.941 0.965   1.00 128.73 ? 483 ARG A CA    1 
ATOM   1802 C  C     . ARG A 1 264 ? 0.765   -41.111 1.937   1.00 128.48 ? 483 ARG A C     1 
ATOM   1803 O  O     . ARG A 1 264 ? 1.956   -41.377 2.145   1.00 129.80 ? 483 ARG A O     1 
ATOM   1804 C  CB    . ARG A 1 264 ? -0.353  -43.303 1.573   1.00 133.82 ? 483 ARG A CB    1 
ATOM   1805 N  N     . MET A 1 265 ? 0.127   -40.091 2.525   1.00 120.02 ? 484 MET A N     1 
ATOM   1806 C  CA    . MET A 1 265 ? 0.829   -39.230 3.461   1.00 115.86 ? 484 MET A CA    1 
ATOM   1807 C  C     . MET A 1 265 ? 1.276   -39.954 4.713   1.00 118.46 ? 484 MET A C     1 
ATOM   1808 O  O     . MET A 1 265 ? 0.475   -40.636 5.354   1.00 120.24 ? 484 MET A O     1 
ATOM   1809 C  CB    . MET A 1 265 ? 0.011   -38.025 3.864   1.00 113.78 ? 484 MET A CB    1 
ATOM   1810 C  CG    . MET A 1 265 ? 0.773   -37.194 4.883   1.00 114.99 ? 484 MET A CG    1 
ATOM   1811 S  SD    . MET A 1 265 ? 0.368   -35.487 4.833   1.00 114.42 ? 484 MET A SD    1 
ATOM   1812 C  CE    . MET A 1 265 ? 0.535   -35.127 3.130   1.00 111.84 ? 484 MET A CE    1 
ATOM   1813 N  N     . HIS A 1 266 ? 2.542   -39.757 5.079   1.00 111.19 ? 485 HIS A N     1 
ATOM   1814 C  CA    . HIS A 1 266 ? 3.111   -40.354 6.262   1.00 111.71 ? 485 HIS A CA    1 
ATOM   1815 C  C     . HIS A 1 266 ? 3.226   -39.308 7.357   1.00 112.22 ? 485 HIS A C     1 
ATOM   1816 O  O     . HIS A 1 266 ? 2.881   -39.595 8.492   1.00 113.47 ? 485 HIS A O     1 
ATOM   1817 C  CB    . HIS A 1 266 ? 4.478   -40.998 5.955   1.00 116.12 ? 485 HIS A CB    1 
ATOM   1818 C  CG    . HIS A 1 266 ? 5.156   -41.577 7.160   1.00 121.73 ? 485 HIS A CG    1 
ATOM   1819 N  ND1   . HIS A 1 266 ? 4.717   -42.752 7.742   1.00 127.29 ? 485 HIS A ND1   1 
ATOM   1820 C  CD2   . HIS A 1 266 ? 6.214   -41.113 7.866   1.00 123.42 ? 485 HIS A CD2   1 
ATOM   1821 C  CE1   . HIS A 1 266 ? 5.523   -42.972 8.770   1.00 128.59 ? 485 HIS A CE1   1 
ATOM   1822 N  NE2   . HIS A 1 266 ? 6.428   -42.004 8.895   1.00 126.43 ? 485 HIS A NE2   1 
ATOM   1823 N  N     . GLY A 1 267 ? 3.720   -38.118 7.019   1.00 102.44 ? 486 GLY A N     1 
ATOM   1824 C  CA    . GLY A 1 267 ? 3.926   -37.043 7.975   1.00 95.83  ? 486 GLY A CA    1 
ATOM   1825 C  C     . GLY A 1 267 ? 4.062   -35.700 7.301   1.00 94.05  ? 486 GLY A C     1 
ATOM   1826 O  O     . GLY A 1 267 ? 4.345   -35.624 6.110   1.00 92.56  ? 486 GLY A O     1 
ATOM   1827 N  N     . LYS A 1 268 ? 3.846   -34.630 8.052   1.00 89.18  ? 487 LYS A N     1 
ATOM   1828 C  CA    . LYS A 1 268 ? 3.911   -33.276 7.515   1.00 86.31  ? 487 LYS A CA    1 
ATOM   1829 C  C     . LYS A 1 268 ? 4.424   -32.274 8.551   1.00 88.26  ? 487 LYS A C     1 
ATOM   1830 O  O     . LYS A 1 268 ? 3.998   -32.281 9.709   1.00 85.95  ? 487 LYS A O     1 
ATOM   1831 C  CB    . LYS A 1 268 ? 2.534   -32.842 6.972   1.00 86.04  ? 487 LYS A CB    1 
ATOM   1832 C  CG    . LYS A 1 268 ? 2.547   -31.453 6.331   1.00 89.08  ? 487 LYS A CG    1 
ATOM   1833 C  CD    . LYS A 1 268 ? 1.353   -31.108 5.481   1.00 85.77  ? 487 LYS A CD    1 
ATOM   1834 C  CE    . LYS A 1 268 ? 0.025   -31.278 6.138   1.00 93.73  ? 487 LYS A CE    1 
ATOM   1835 N  NZ    . LYS A 1 268 ? -1.069  -30.798 5.237   1.00 96.61  ? 487 LYS A NZ    1 
ATOM   1836 N  N     . PHE A 1 269 ? 5.327   -31.402 8.110   1.00 84.63  ? 488 PHE A N     1 
ATOM   1837 C  CA    . PHE A 1 269 ? 5.844   -30.329 8.927   1.00 81.43  ? 488 PHE A CA    1 
ATOM   1838 C  C     . PHE A 1 269 ? 5.515   -29.031 8.232   1.00 81.35  ? 488 PHE A C     1 
ATOM   1839 O  O     . PHE A 1 269 ? 5.914   -28.845 7.084   1.00 82.02  ? 488 PHE A O     1 
ATOM   1840 C  CB    . PHE A 1 269 ? 7.357   -30.449 9.063   1.00 85.04  ? 488 PHE A CB    1 
ATOM   1841 C  CG    . PHE A 1 269 ? 7.954   -29.771 10.264  1.00 84.68  ? 488 PHE A CG    1 
ATOM   1842 C  CD1   . PHE A 1 269 ? 9.185   -30.160 10.748  1.00 90.07  ? 488 PHE A CD1   1 
ATOM   1843 C  CD2   . PHE A 1 269 ? 7.287   -28.731 10.909  1.00 83.75  ? 488 PHE A CD2   1 
ATOM   1844 C  CE1   . PHE A 1 269 ? 9.741   -29.530 11.866  1.00 90.18  ? 488 PHE A CE1   1 
ATOM   1845 C  CE2   . PHE A 1 269 ? 7.844   -28.100 12.020  1.00 85.37  ? 488 PHE A CE2   1 
ATOM   1846 C  CZ    . PHE A 1 269 ? 9.071   -28.493 12.486  1.00 85.07  ? 488 PHE A CZ    1 
ATOM   1847 N  N     . SER A 1 270 ? 4.814   -28.128 8.910   1.00 73.93  ? 489 SER A N     1 
ATOM   1848 C  CA    . SER A 1 270 ? 4.548   -26.810 8.334   1.00 72.12  ? 489 SER A CA    1 
ATOM   1849 C  C     . SER A 1 270 ? 5.309   -25.753 9.130   1.00 75.30  ? 489 SER A C     1 
ATOM   1850 O  O     . SER A 1 270 ? 5.226   -25.719 10.363  1.00 73.63  ? 489 SER A O     1 
ATOM   1851 C  CB    . SER A 1 270 ? 3.060   -26.506 8.280   1.00 70.47  ? 489 SER A CB    1 
ATOM   1852 O  OG    . SER A 1 270 ? 2.362   -27.603 7.713   1.00 81.89  ? 489 SER A OG    1 
ATOM   1853 N  N     . LEU A 1 271 ? 6.090   -24.921 8.431   1.00 72.65  ? 490 LEU A N     1 
ATOM   1854 C  CA    . LEU A 1 271 ? 6.930   -23.904 9.068   1.00 72.00  ? 490 LEU A CA    1 
ATOM   1855 C  C     . LEU A 1 271 ? 6.472   -22.571 8.559   1.00 76.70  ? 490 LEU A C     1 
ATOM   1856 O  O     . LEU A 1 271 ? 6.387   -22.368 7.344   1.00 77.65  ? 490 LEU A O     1 
ATOM   1857 C  CB    . LEU A 1 271 ? 8.408   -24.166 8.780   1.00 73.84  ? 490 LEU A CB    1 
ATOM   1858 C  CG    . LEU A 1 271 ? 8.935   -25.510 9.254   1.00 78.95  ? 490 LEU A CG    1 
ATOM   1859 C  CD1   . LEU A 1 271 ? 9.008   -26.515 8.096   1.00 82.04  ? 490 LEU A CD1   1 
ATOM   1860 C  CD2   . LEU A 1 271 ? 10.258  -25.342 9.897   1.00 79.59  ? 490 LEU A CD2   1 
ATOM   1861 N  N     . VAL A 1 272 ? 6.070   -21.701 9.492   1.00 70.42  ? 491 VAL A N     1 
ATOM   1862 C  CA    . VAL A 1 272 ? 5.387   -20.464 9.156   1.00 69.56  ? 491 VAL A CA    1 
ATOM   1863 C  C     . VAL A 1 272 ? 6.061   -19.250 9.704   1.00 72.40  ? 491 VAL A C     1 
ATOM   1864 O  O     . VAL A 1 272 ? 6.257   -19.146 10.917  1.00 70.83  ? 491 VAL A O     1 
ATOM   1865 C  CB    . VAL A 1 272 ? 3.900   -20.526 9.649   1.00 71.36  ? 491 VAL A CB    1 
ATOM   1866 C  CG1   . VAL A 1 272 ? 3.106   -19.290 9.247   1.00 71.54  ? 491 VAL A CG1   1 
ATOM   1867 C  CG2   . VAL A 1 272 ? 3.193   -21.772 9.164   1.00 71.21  ? 491 VAL A CG2   1 
ATOM   1868 N  N     . ASP A 1 273 ? 6.309   -18.287 8.814   1.00 70.47  ? 492 ASP A N     1 
ATOM   1869 C  CA    . ASP A 1 273 ? 6.828   -16.955 9.098   1.00 70.58  ? 492 ASP A CA    1 
ATOM   1870 C  C     . ASP A 1 273 ? 5.589   -16.076 9.052   1.00 73.67  ? 492 ASP A C     1 
ATOM   1871 O  O     . ASP A 1 273 ? 5.104   -15.744 7.976   1.00 76.46  ? 492 ASP A O     1 
ATOM   1872 C  CB    . ASP A 1 273 ? 7.852   -16.569 8.028   1.00 75.17  ? 492 ASP A CB    1 
ATOM   1873 C  CG    . ASP A 1 273 ? 8.421   -15.160 8.084   1.00 85.95  ? 492 ASP A CG    1 
ATOM   1874 O  OD1   . ASP A 1 273 ? 8.019   -14.391 8.974   1.00 84.03  ? 492 ASP A OD1   1 
ATOM   1875 O  OD2   . ASP A 1 273 ? 9.295   -14.833 7.234   1.00 95.30  ? 492 ASP A OD2   1 
ATOM   1876 N  N     . LEU A 1 274 ? 5.040   -15.756 10.214  1.00 68.15  ? 493 LEU A N     1 
ATOM   1877 C  CA    . LEU A 1 274 ? 3.773   -15.032 10.296  1.00 67.80  ? 493 LEU A CA    1 
ATOM   1878 C  C     . LEU A 1 274 ? 3.874   -13.555 9.948   1.00 75.83  ? 493 LEU A C     1 
ATOM   1879 O  O     . LEU A 1 274 ? 4.961   -12.982 9.942   1.00 76.51  ? 493 LEU A O     1 
ATOM   1880 C  CB    . LEU A 1 274 ? 3.155   -15.194 11.709  1.00 64.78  ? 493 LEU A CB    1 
ATOM   1881 C  CG    . LEU A 1 274 ? 2.769   -16.587 12.166  1.00 66.12  ? 493 LEU A CG    1 
ATOM   1882 C  CD1   . LEU A 1 274 ? 2.624   -16.631 13.681  1.00 63.13  ? 493 LEU A CD1   1 
ATOM   1883 C  CD2   . LEU A 1 274 ? 1.466   -17.039 11.525  1.00 70.46  ? 493 LEU A CD2   1 
ATOM   1884 N  N     . ALA A 1 275 ? 2.722   -12.944 9.647   1.00 75.14  ? 494 ALA A N     1 
ATOM   1885 C  CA    . ALA A 1 275 ? 2.604   -11.499 9.449   1.00 77.50  ? 494 ALA A CA    1 
ATOM   1886 C  C     . ALA A 1 275 ? 2.892   -10.828 10.815  1.00 81.43  ? 494 ALA A C     1 
ATOM   1887 O  O     . ALA A 1 275 ? 2.626   -11.411 11.878  1.00 77.76  ? 494 ALA A O     1 
ATOM   1888 C  CB    . ALA A 1 275 ? 1.183   -11.159 9.020   1.00 79.24  ? 494 ALA A CB    1 
ATOM   1889 N  N     . GLY A 1 276 ? 3.436   -9.622  10.767  1.00 81.00  ? 495 GLY A N     1 
ATOM   1890 C  CA    . GLY A 1 276 ? 3.717   -8.834  11.958  1.00 80.23  ? 495 GLY A CA    1 
ATOM   1891 C  C     . GLY A 1 276 ? 2.479   -8.600  12.803  1.00 84.46  ? 495 GLY A C     1 
ATOM   1892 O  O     . GLY A 1 276 ? 1.397   -8.314  12.280  1.00 86.48  ? 495 GLY A O     1 
ATOM   1893 N  N     . ASN A 1 277 ? 2.628   -8.749  14.116  1.00 80.08  ? 496 ASN A N     1 
ATOM   1894 C  CA    . ASN A 1 277 ? 1.520   -8.636  15.068  1.00 79.03  ? 496 ASN A CA    1 
ATOM   1895 C  C     . ASN A 1 277 ? 1.223   -7.229  15.516  1.00 88.01  ? 496 ASN A C     1 
ATOM   1896 O  O     . ASN A 1 277 ? 0.231   -7.026  16.211  1.00 88.71  ? 496 ASN A O     1 
ATOM   1897 C  CB    . ASN A 1 277 ? 1.749   -9.542  16.282  1.00 71.94  ? 496 ASN A CB    1 
ATOM   1898 C  CG    . ASN A 1 277 ? 2.742   -9.012  17.283  1.00 83.91  ? 496 ASN A CG    1 
ATOM   1899 O  OD1   . ASN A 1 277 ? 3.648   -8.270  16.937  1.00 84.19  ? 496 ASN A OD1   1 
ATOM   1900 N  ND2   . ASN A 1 277 ? 2.600   -9.380  18.560  1.00 70.10  ? 496 ASN A ND2   1 
ATOM   1901 N  N     . GLU A 1 278 ? 2.076   -6.253  15.161  1.00 88.62  ? 497 GLU A N     1 
ATOM   1902 C  CA    . GLU A 1 278 ? 1.844   -4.860  15.556  1.00 91.40  ? 497 GLU A CA    1 
ATOM   1903 C  C     . GLU A 1 278 ? 0.574   -4.340  14.878  1.00 101.76 ? 497 GLU A C     1 
ATOM   1904 O  O     . GLU A 1 278 ? 0.491   -4.326  13.649  1.00 105.41 ? 497 GLU A O     1 
ATOM   1905 C  CB    . GLU A 1 278 ? 3.086   -3.983  15.316  1.00 94.37  ? 497 GLU A CB    1 
ATOM   1906 C  CG    . GLU A 1 278 ? 3.436   -3.688  13.867  1.00 104.53 ? 497 GLU A CG    1 
ATOM   1907 C  CD    . GLU A 1 278 ? 3.992   -4.843  13.063  1.00 116.02 ? 497 GLU A CD    1 
ATOM   1908 O  OE1   . GLU A 1 278 ? 4.280   -5.912  13.647  1.00 103.59 ? 497 GLU A OE1   1 
ATOM   1909 O  OE2   . GLU A 1 278 ? 4.144   -4.675  11.835  1.00 112.13 ? 497 GLU A OE2   1 
ATOM   1910 N  N     . ARG A 1 279 ? -0.475  -4.045  15.698  1.00 99.01  ? 498 ARG A N     1 
ATOM   1911 C  CA    . ARG A 1 279 ? -1.809  -3.562  15.282  1.00 134.92 ? 498 ARG A CA    1 
ATOM   1912 C  C     . ARG A 1 279 ? -2.427  -4.319  14.093  1.00 170.50 ? 498 ARG A C     1 
ATOM   1913 O  O     . ARG A 1 279 ? -3.052  -5.365  14.263  1.00 135.86 ? 498 ARG A O     1 
ATOM   1914 C  CB    . ARG A 1 279 ? -1.769  -2.067  14.988  1.00 140.69 ? 498 ARG A CB    1 
ATOM   1915 N  N     . ARG A 1 291 ? -5.996  5.212   5.431   1.00 193.30 ? 510 ARG A N     1 
ATOM   1916 C  CA    . ARG A 1 291 ? -5.872  4.197   6.472   1.00 190.49 ? 510 ARG A CA    1 
ATOM   1917 C  C     . ARG A 1 291 ? -5.464  2.833   5.897   1.00 189.68 ? 510 ARG A C     1 
ATOM   1918 O  O     . ARG A 1 291 ? -5.691  2.563   4.715   1.00 190.47 ? 510 ARG A O     1 
ATOM   1919 C  CB    . ARG A 1 291 ? -7.179  4.079   7.243   1.00 191.02 ? 510 ARG A CB    1 
ATOM   1920 N  N     . MET A 1 292 ? -4.854  1.982   6.744   1.00 181.08 ? 511 MET A N     1 
ATOM   1921 C  CA    . MET A 1 292 ? -4.384  0.638   6.384   1.00 175.75 ? 511 MET A CA    1 
ATOM   1922 C  C     . MET A 1 292 ? -5.243  -0.494  7.005   1.00 172.85 ? 511 MET A C     1 
ATOM   1923 O  O     . MET A 1 292 ? -6.240  -0.222  7.683   1.00 173.60 ? 511 MET A O     1 
ATOM   1924 C  CB    . MET A 1 292 ? -2.875  0.474   6.706   1.00 175.86 ? 511 MET A CB    1 
ATOM   1925 C  CG    . MET A 1 292 ? -2.549  0.532   8.196   1.00 177.23 ? 511 MET A CG    1 
ATOM   1926 S  SD    . MET A 1 292 ? -0.821  0.171   8.611   1.00 178.82 ? 511 MET A SD    1 
ATOM   1927 C  CE    . MET A 1 292 ? -0.085  1.794   8.365   1.00 182.48 ? 511 MET A CE    1 
ATOM   1928 N  N     . GLU A 1 293 ? -4.841  -1.756  6.764   1.00 162.57 ? 512 GLU A N     1 
ATOM   1929 C  CA    . GLU A 1 293 ? -5.520  -2.958  7.247   1.00 156.81 ? 512 GLU A CA    1 
ATOM   1930 C  C     . GLU A 1 293 ? -4.596  -3.811  8.151   1.00 153.14 ? 512 GLU A C     1 
ATOM   1931 O  O     . GLU A 1 293 ? -3.430  -4.038  7.816   1.00 152.52 ? 512 GLU A O     1 
ATOM   1932 C  CB    . GLU A 1 293 ? -6.067  -3.768  6.039   1.00 157.93 ? 512 GLU A CB    1 
ATOM   1933 C  CG    . GLU A 1 293 ? -6.541  -5.192  6.321   1.00 160.17 ? 512 GLU A CG    1 
ATOM   1934 C  CD    . GLU A 1 293 ? -5.436  -6.228  6.431   1.00 170.22 ? 512 GLU A CD    1 
ATOM   1935 O  OE1   . GLU A 1 293 ? -4.645  -6.367  5.470   1.00 169.17 ? 512 GLU A OE1   1 
ATOM   1936 O  OE2   . GLU A 1 293 ? -5.326  -6.862  7.504   1.00 154.52 ? 512 GLU A OE2   1 
ATOM   1937 N  N     . GLY A 1 294 ? -5.169  -4.318  9.245   1.00 143.07 ? 513 GLY A N     1 
ATOM   1938 C  CA    . GLY A 1 294 ? -4.530  -5.200  10.217  1.00 135.61 ? 513 GLY A CA    1 
ATOM   1939 C  C     . GLY A 1 294 ? -5.552  -6.024  10.973  1.00 131.78 ? 513 GLY A C     1 
ATOM   1940 O  O     . GLY A 1 294 ? -5.219  -6.669  11.966  1.00 127.63 ? 513 GLY A O     1 
ATOM   1941 N  N     . ALA A 1 295 ? -6.813  -5.977  10.519  1.00 127.43 ? 514 ALA A N     1 
ATOM   1942 C  CA    . ALA A 1 295 ? -7.943  -6.689  11.103  1.00 124.69 ? 514 ALA A CA    1 
ATOM   1943 C  C     . ALA A 1 295 ? -7.892  -8.140  10.687  1.00 120.60 ? 514 ALA A C     1 
ATOM   1944 O  O     . ALA A 1 295 ? -8.192  -8.996  11.515  1.00 117.01 ? 514 ALA A O     1 
ATOM   1945 C  CB    . ALA A 1 295 ? -9.250  -6.053  10.651  1.00 129.91 ? 514 ALA A CB    1 
ATOM   1946 N  N     . GLU A 1 296 ? -7.522  -8.419  9.410   1.00 114.03 ? 515 GLU A N     1 
ATOM   1947 C  CA    . GLU A 1 296 ? -7.365  -9.782  8.883   1.00 109.44 ? 515 GLU A CA    1 
ATOM   1948 C  C     . GLU A 1 296 ? -6.197  -10.468 9.639   1.00 104.45 ? 515 GLU A C     1 
ATOM   1949 O  O     . GLU A 1 296 ? -6.340  -11.607 10.094  1.00 100.86 ? 515 GLU A O     1 
ATOM   1950 C  CB    . GLU A 1 296 ? -7.068  -9.748  7.367   1.00 112.45 ? 515 GLU A CB    1 
ATOM   1951 C  CG    . GLU A 1 296 ? -7.605  -10.931 6.582   1.00 123.65 ? 515 GLU A CG    1 
ATOM   1952 C  CD    . GLU A 1 296 ? -8.924  -10.642 5.890   1.00 156.91 ? 515 GLU A CD    1 
ATOM   1953 O  OE1   . GLU A 1 296 ? -8.898  -10.193 4.720   1.00 151.43 ? 515 GLU A OE1   1 
ATOM   1954 O  OE2   . GLU A 1 296 ? -9.984  -10.868 6.517   1.00 157.79 ? 515 GLU A OE2   1 
ATOM   1955 N  N     . ILE A 1 297 ? -5.056  -9.758  9.786   1.00 96.90  ? 516 ILE A N     1 
ATOM   1956 C  CA    . ILE A 1 297 ? -3.890  -10.286 10.490  1.00 91.54  ? 516 ILE A CA    1 
ATOM   1957 C  C     . ILE A 1 297 ? -4.236  -10.621 11.933  1.00 90.65  ? 516 ILE A C     1 
ATOM   1958 O  O     . ILE A 1 297 ? -3.980  -11.738 12.374  1.00 86.57  ? 516 ILE A O     1 
ATOM   1959 C  CB    . ILE A 1 297 ? -2.669  -9.345  10.405  1.00 95.04  ? 516 ILE A CB    1 
ATOM   1960 C  CG1   . ILE A 1 297 ? -2.134  -9.255  8.968   1.00 96.81  ? 516 ILE A CG1   1 
ATOM   1961 C  CG2   . ILE A 1 297 ? -1.577  -9.795  11.383  1.00 92.48  ? 516 ILE A CG2   1 
ATOM   1962 C  CD1   . ILE A 1 297 ? -1.379  -8.006  8.666   1.00 109.05 ? 516 ILE A CD1   1 
ATOM   1963 N  N     . ASN A 1 298 ? -4.850  -9.666  12.650  1.00 87.64  ? 517 ASN A N     1 
ATOM   1964 C  CA    . ASN A 1 298 ? -5.192  -9.856  14.056  1.00 86.22  ? 517 ASN A CA    1 
ATOM   1965 C  C     . ASN A 1 298 ? -6.148  -11.017 14.312  1.00 87.27  ? 517 ASN A C     1 
ATOM   1966 O  O     . ASN A 1 298 ? -5.963  -11.751 15.283  1.00 85.24  ? 517 ASN A O     1 
ATOM   1967 C  CB    . ASN A 1 298 ? -5.666  -8.560  14.689  1.00 89.73  ? 517 ASN A CB    1 
ATOM   1968 C  CG    . ASN A 1 298 ? -5.831  -8.659  16.182  1.00 118.41 ? 517 ASN A CG    1 
ATOM   1969 O  OD1   . ASN A 1 298 ? -6.956  -8.737  16.686  1.00 114.86 ? 517 ASN A OD1   1 
ATOM   1970 N  ND2   . ASN A 1 298 ? -4.718  -8.713  16.917  1.00 108.64 ? 517 ASN A ND2   1 
ATOM   1971 N  N     . LYS A 1 299 ? -7.142  -11.201 13.441  1.00 84.98  ? 518 LYS A N     1 
ATOM   1972 C  CA    . LYS A 1 299 ? -8.091  -12.313 13.584  1.00 84.26  ? 518 LYS A CA    1 
ATOM   1973 C  C     . LYS A 1 299 ? -7.422  -13.639 13.266  1.00 82.54  ? 518 LYS A C     1 
ATOM   1974 O  O     . LYS A 1 299 ? -7.686  -14.657 13.897  1.00 80.74  ? 518 LYS A O     1 
ATOM   1975 C  CB    . LYS A 1 299 ? -9.378  -12.106 12.771  1.00 89.88  ? 518 LYS A CB    1 
ATOM   1976 C  CG    . LYS A 1 299 ? -9.231  -12.030 11.269  1.00 103.15 ? 518 LYS A CG    1 
ATOM   1977 C  CD    . LYS A 1 299 ? -10.609 -11.959 10.622  1.00 114.07 ? 518 LYS A CD    1 
ATOM   1978 C  CE    . LYS A 1 299 ? -11.216 -13.293 10.327  1.00 106.52 ? 518 LYS A CE    1 
ATOM   1979 N  NZ    . LYS A 1 299 ? -11.119 -13.640 8.884   1.00 98.80  ? 518 LYS A NZ    1 
ATOM   1980 N  N     . SER A 1 300 ? -6.517  -13.601 12.321  1.00 76.96  ? 519 SER A N     1 
ATOM   1981 C  CA    . SER A 1 300 ? -5.688  -14.735 11.949  1.00 74.34  ? 519 SER A CA    1 
ATOM   1982 C  C     . SER A 1 300 ? -4.827  -15.207 13.175  1.00 76.75  ? 519 SER A C     1 
ATOM   1983 O  O     . SER A 1 300 ? -4.819  -16.393 13.515  1.00 75.17  ? 519 SER A O     1 
ATOM   1984 C  CB    . SER A 1 300 ? -4.799  -14.317 10.785  1.00 75.62  ? 519 SER A CB    1 
ATOM   1985 O  OG    . SER A 1 300 ? -4.009  -15.399 10.369  1.00 89.27  ? 519 SER A OG    1 
ATOM   1986 N  N     . LEU A 1 301 ? -4.149  -14.262 13.850  1.00 72.71  ? 520 LEU A N     1 
ATOM   1987 C  CA    . LEU A 1 301 ? -3.292  -14.520 15.017  1.00 69.45  ? 520 LEU A CA    1 
ATOM   1988 C  C     . LEU A 1 301 ? -4.095  -14.987 16.220  1.00 70.57  ? 520 LEU A C     1 
ATOM   1989 O  O     . LEU A 1 301 ? -3.725  -15.961 16.876  1.00 68.16  ? 520 LEU A O     1 
ATOM   1990 C  CB    . LEU A 1 301 ? -2.395  -13.319 15.327  1.00 69.11  ? 520 LEU A CB    1 
ATOM   1991 C  CG    . LEU A 1 301 ? -1.432  -12.976 14.164  1.00 72.45  ? 520 LEU A CG    1 
ATOM   1992 C  CD1   . LEU A 1 301 ? -0.687  -11.706 14.406  1.00 73.80  ? 520 LEU A CD1   1 
ATOM   1993 C  CD2   . LEU A 1 301 ? -0.486  -14.108 13.877  1.00 68.98  ? 520 LEU A CD2   1 
ATOM   1994 N  N     . LEU A 1 302 ? -5.251  -14.383 16.434  1.00 68.35  ? 521 LEU A N     1 
ATOM   1995 C  CA    . LEU A 1 302 ? -6.175  -14.813 17.483  1.00 69.52  ? 521 LEU A CA    1 
ATOM   1996 C  C     . LEU A 1 302 ? -6.697  -16.218 17.252  1.00 71.93  ? 521 LEU A C     1 
ATOM   1997 O  O     . LEU A 1 302 ? -6.753  -17.023 18.190  1.00 73.17  ? 521 LEU A O     1 
ATOM   1998 C  CB    . LEU A 1 302 ? -7.343  -13.839 17.587  1.00 73.39  ? 521 LEU A CB    1 
ATOM   1999 C  CG    . LEU A 1 302 ? -7.154  -12.787 18.685  1.00 82.11  ? 521 LEU A CG    1 
ATOM   2000 C  CD1   . LEU A 1 302 ? -5.802  -12.010 18.515  1.00 83.48  ? 521 LEU A CD1   1 
ATOM   2001 C  CD2   . LEU A 1 302 ? -8.299  -11.858 18.713  1.00 87.42  ? 521 LEU A CD2   1 
ATOM   2002 N  N     . ALA A 1 303 ? -7.028  -16.530 15.997  1.00 66.08  ? 522 ALA A N     1 
ATOM   2003 C  CA    . ALA A 1 303 ? -7.508  -17.845 15.596  1.00 65.33  ? 522 ALA A CA    1 
ATOM   2004 C  C     . ALA A 1 303 ? -6.393  -18.888 15.856  1.00 69.10  ? 522 ALA A C     1 
ATOM   2005 O  O     . ALA A 1 303 ? -6.655  -19.936 16.442  1.00 68.50  ? 522 ALA A O     1 
ATOM   2006 C  CB    . ALA A 1 303 ? -7.926  -17.822 14.131  1.00 66.43  ? 522 ALA A CB    1 
ATOM   2007 N  N     . LEU A 1 304 ? -5.148  -18.572 15.464  1.00 65.47  ? 523 LEU A N     1 
ATOM   2008 C  CA    . LEU A 1 304 ? -4.008  -19.457 15.683  1.00 64.95  ? 523 LEU A CA    1 
ATOM   2009 C  C     . LEU A 1 304 ? -3.819  -19.811 17.152  1.00 69.87  ? 523 LEU A C     1 
ATOM   2010 O  O     . LEU A 1 304 ? -3.608  -20.981 17.471  1.00 70.40  ? 523 LEU A O     1 
ATOM   2011 C  CB    . LEU A 1 304 ? -2.730  -18.819 15.140  1.00 63.91  ? 523 LEU A CB    1 
ATOM   2012 C  CG    . LEU A 1 304 ? -1.457  -19.627 15.299  1.00 67.85  ? 523 LEU A CG    1 
ATOM   2013 C  CD1   . LEU A 1 304 ? -1.581  -20.999 14.638  1.00 69.05  ? 523 LEU A CD1   1 
ATOM   2014 C  CD2   . LEU A 1 304 ? -0.292  -18.876 14.759  1.00 68.63  ? 523 LEU A CD2   1 
ATOM   2015 N  N     . LYS A 1 305 ? -3.882  -18.793 18.039  1.00 66.18  ? 524 LYS A N     1 
ATOM   2016 C  CA    . LYS A 1 305 ? -3.754  -18.990 19.480  1.00 66.03  ? 524 LYS A CA    1 
ATOM   2017 C  C     . LYS A 1 305 ? -4.767  -19.971 19.980  1.00 70.89  ? 524 LYS A C     1 
ATOM   2018 O  O     . LYS A 1 305 ? -4.395  -20.887 20.721  1.00 69.38  ? 524 LYS A O     1 
ATOM   2019 C  CB    . LYS A 1 305 ? -3.894  -17.675 20.238  1.00 68.80  ? 524 LYS A CB    1 
ATOM   2020 C  CG    . LYS A 1 305 ? -3.816  -17.828 21.769  1.00 73.08  ? 524 LYS A CG    1 
ATOM   2021 C  CD    . LYS A 1 305 ? -3.235  -16.598 22.454  1.00 78.76  ? 524 LYS A CD    1 
ATOM   2022 C  CE    . LYS A 1 305 ? -4.127  -15.379 22.317  1.00 84.05  ? 524 LYS A CE    1 
ATOM   2023 N  NZ    . LYS A 1 305 ? -5.324  -15.474 23.192  1.00 97.34  ? 524 LYS A NZ    1 
ATOM   2024 N  N     . GLU A 1 306 ? -6.038  -19.800 19.552  1.00 69.48  ? 525 GLU A N     1 
ATOM   2025 C  CA    . GLU A 1 306 ? -7.103  -20.713 19.945  1.00 72.49  ? 525 GLU A CA    1 
ATOM   2026 C  C     . GLU A 1 306 ? -6.892  -22.119 19.462  1.00 78.49  ? 525 GLU A C     1 
ATOM   2027 O  O     . GLU A 1 306 ? -7.203  -23.048 20.199  1.00 79.70  ? 525 GLU A O     1 
ATOM   2028 C  CB    . GLU A 1 306 ? -8.477  -20.202 19.531  1.00 76.12  ? 525 GLU A CB    1 
ATOM   2029 C  CG    . GLU A 1 306 ? -8.949  -18.999 20.333  1.00 90.94  ? 525 GLU A CG    1 
ATOM   2030 C  CD    . GLU A 1 306 ? -8.798  -19.135 21.841  1.00 121.57 ? 525 GLU A CD    1 
ATOM   2031 O  OE1   . GLU A 1 306 ? -9.188  -20.192 22.392  1.00 118.04 ? 525 GLU A OE1   1 
ATOM   2032 O  OE2   . GLU A 1 306 ? -8.256  -18.195 22.468  1.00 120.00 ? 525 GLU A OE2   1 
ATOM   2033 N  N     . CYS A 1 307 ? -6.345  -22.284 18.242  1.00 73.81  ? 526 CYS A N     1 
ATOM   2034 C  CA    . CYS A 1 307 ? -6.067  -23.603 17.691  1.00 73.59  ? 526 CYS A CA    1 
ATOM   2035 C  C     . CYS A 1 307 ? -4.926  -24.265 18.425  1.00 77.20  ? 526 CYS A C     1 
ATOM   2036 O  O     . CYS A 1 307 ? -5.013  -25.453 18.705  1.00 78.15  ? 526 CYS A O     1 
ATOM   2037 C  CB    . CYS A 1 307 ? -5.825  -23.540 16.185  1.00 73.19  ? 526 CYS A CB    1 
ATOM   2038 S  SG    . CYS A 1 307 ? -7.294  -23.078 15.235  1.00 79.24  ? 526 CYS A SG    1 
ATOM   2039 N  N     . ILE A 1 308 ? -3.853  -23.509 18.737  1.00 72.70  ? 527 ILE A N     1 
ATOM   2040 C  CA    . ILE A 1 308 ? -2.741  -24.044 19.514  1.00 71.75  ? 527 ILE A CA    1 
ATOM   2041 C  C     . ILE A 1 308 ? -3.237  -24.417 20.917  1.00 78.93  ? 527 ILE A C     1 
ATOM   2042 O  O     . ILE A 1 308 ? -2.977  -25.520 21.400  1.00 79.03  ? 527 ILE A O     1 
ATOM   2043 C  CB    . ILE A 1 308 ? -1.563  -23.057 19.585  1.00 72.61  ? 527 ILE A CB    1 
ATOM   2044 C  CG1   . ILE A 1 308 ? -0.885  -22.897 18.217  1.00 71.08  ? 527 ILE A CG1   1 
ATOM   2045 C  CG2   . ILE A 1 308 ? -0.532  -23.541 20.631  1.00 73.33  ? 527 ILE A CG2   1 
ATOM   2046 C  CD1   . ILE A 1 308 ? -0.045  -21.656 18.094  1.00 65.94  ? 527 ILE A CD1   1 
ATOM   2047 N  N     . ARG A 1 309 ? -3.993  -23.511 21.553  1.00 78.27  ? 528 ARG A N     1 
ATOM   2048 C  CA    . ARG A 1 309 ? -4.550  -23.790 22.873  1.00 80.98  ? 528 ARG A CA    1 
ATOM   2049 C  C     . ARG A 1 309 ? -5.373  -25.054 22.879  1.00 88.85  ? 528 ARG A C     1 
ATOM   2050 O  O     . ARG A 1 309 ? -5.269  -25.813 23.833  1.00 91.09  ? 528 ARG A O     1 
ATOM   2051 C  CB    . ARG A 1 309 ? -5.390  -22.621 23.405  1.00 81.71  ? 528 ARG A CB    1 
ATOM   2052 C  CG    . ARG A 1 309 ? -4.570  -21.419 23.846  1.00 81.45  ? 528 ARG A CG    1 
ATOM   2053 C  CD    . ARG A 1 309 ? -5.485  -20.273 24.271  1.00 96.29  ? 528 ARG A CD    1 
ATOM   2054 N  NE    . ARG A 1 309 ? -6.277  -20.613 25.454  1.00 111.16 ? 528 ARG A NE    1 
ATOM   2055 C  CZ    . ARG A 1 309 ? -6.043  -20.158 26.679  1.00 132.66 ? 528 ARG A CZ    1 
ATOM   2056 N  NH1   . ARG A 1 309 ? -5.050  -19.306 26.901  1.00 126.64 ? 528 ARG A NH1   1 
ATOM   2057 N  NH2   . ARG A 1 309 ? -6.816  -20.532 27.690  1.00 121.75 ? 528 ARG A NH2   1 
ATOM   2058 N  N     . ALA A 1 310 ? -6.169  -25.284 21.819  1.00 87.22  ? 529 ALA A N     1 
ATOM   2059 C  CA    . ALA A 1 310 ? -7.049  -26.440 21.705  1.00 89.71  ? 529 ALA A CA    1 
ATOM   2060 C  C     . ALA A 1 310 ? -6.290  -27.730 21.521  1.00 95.94  ? 529 ALA A C     1 
ATOM   2061 O  O     . ALA A 1 310 ? -6.639  -28.701 22.173  1.00 98.76  ? 529 ALA A O     1 
ATOM   2062 C  CB    . ALA A 1 310 ? -8.052  -26.232 20.615  1.00 90.26  ? 529 ALA A CB    1 
ATOM   2063 N  N     . LEU A 1 311 ? -5.220  -27.732 20.712  1.00 92.54  ? 530 LEU A N     1 
ATOM   2064 C  CA    . LEU A 1 311 ? -4.304  -28.861 20.569  1.00 94.31  ? 530 LEU A CA    1 
ATOM   2065 C  C     . LEU A 1 311 ? -3.794  -29.206 21.955  1.00 103.33 ? 530 LEU A C     1 
ATOM   2066 O  O     . LEU A 1 311 ? -3.797  -30.378 22.320  1.00 104.30 ? 530 LEU A O     1 
ATOM   2067 C  CB    . LEU A 1 311 ? -3.122  -28.458 19.642  1.00 91.81  ? 530 LEU A CB    1 
ATOM   2068 C  CG    . LEU A 1 311 ? -1.843  -29.315 19.652  1.00 97.58  ? 530 LEU A CG    1 
ATOM   2069 C  CD1   . LEU A 1 311 ? -2.114  -30.645 19.075  1.00 101.74 ? 530 LEU A CD1   1 
ATOM   2070 C  CD2   . LEU A 1 311 ? -0.725  -28.673 18.822  1.00 95.45  ? 530 LEU A CD2   1 
ATOM   2071 N  N     . GLY A 1 312 ? -3.403  -28.175 22.719  1.00 104.09 ? 531 GLY A N     1 
ATOM   2072 C  CA    . GLY A 1 312 ? -2.880  -28.307 24.078  1.00 107.04 ? 531 GLY A CA    1 
ATOM   2073 C  C     . GLY A 1 312 ? -3.796  -29.105 24.977  1.00 119.68 ? 531 GLY A C     1 
ATOM   2074 O  O     . GLY A 1 312 ? -3.349  -30.022 25.674  1.00 124.03 ? 531 GLY A O     1 
ATOM   2075 N  N     . GLN A 1 313 ? -5.101  -28.789 24.913  1.00 118.44 ? 532 GLN A N     1 
ATOM   2076 C  CA    . GLN A 1 313 ? -6.165  -29.438 25.679  1.00 122.85 ? 532 GLN A CA    1 
ATOM   2077 C  C     . GLN A 1 313 ? -6.738  -30.686 24.980  1.00 132.14 ? 532 GLN A C     1 
ATOM   2078 O  O     . GLN A 1 313 ? -7.768  -31.192 25.425  1.00 136.13 ? 532 GLN A O     1 
ATOM   2079 C  CB    . GLN A 1 313 ? -7.288  -28.432 25.981  1.00 124.14 ? 532 GLN A CB    1 
ATOM   2080 C  CG    . GLN A 1 313 ? -6.826  -27.117 26.596  1.00 133.88 ? 532 GLN A CG    1 
ATOM   2081 N  N     . ASN A 1 314 ? -6.078  -31.187 23.902  1.00 129.20 ? 533 ASN A N     1 
ATOM   2082 C  CA    . ASN A 1 314 ? -6.503  -32.359 23.130  1.00 132.73 ? 533 ASN A CA    1 
ATOM   2083 C  C     . ASN A 1 314 ? -8.043  -32.334 22.839  1.00 141.77 ? 533 ASN A C     1 
ATOM   2084 O  O     . ASN A 1 314 ? -8.748  -33.336 23.030  1.00 146.30 ? 533 ASN A O     1 
ATOM   2085 C  CB    . ASN A 1 314 ? -6.036  -33.644 23.846  1.00 139.12 ? 533 ASN A CB    1 
ATOM   2086 C  CG    . ASN A 1 314 ? -5.680  -34.795 22.935  1.00 172.79 ? 533 ASN A CG    1 
ATOM   2087 O  OD1   . ASN A 1 314 ? -4.747  -34.715 22.123  1.00 166.01 ? 533 ASN A OD1   1 
ATOM   2088 N  ND2   . ASN A 1 314 ? -6.377  -35.923 23.098  1.00 169.06 ? 533 ASN A ND2   1 
ATOM   2089 N  N     . LYS A 1 315 ? -8.560  -31.158 22.413  1.00 137.14 ? 534 LYS A N     1 
ATOM   2090 C  CA    . LYS A 1 315 ? -9.994  -30.953 22.110  1.00 139.06 ? 534 LYS A CA    1 
ATOM   2091 C  C     . LYS A 1 315 ? -10.380 -31.528 20.766  1.00 143.74 ? 534 LYS A C     1 
ATOM   2092 O  O     . LYS A 1 315 ? -9.566  -31.530 19.837  1.00 141.37 ? 534 LYS A O     1 
ATOM   2093 C  CB    . LYS A 1 315 ? -10.363 -29.467 22.128  1.00 138.66 ? 534 LYS A CB    1 
ATOM   2094 C  CG    . LYS A 1 315 ? -10.373 -28.855 23.506  1.00 156.06 ? 534 LYS A CG    1 
ATOM   2095 C  CD    . LYS A 1 315 ? -10.385 -27.337 23.433  1.00 163.50 ? 534 LYS A CD    1 
ATOM   2096 C  CE    . LYS A 1 315 ? -11.758 -26.727 23.599  1.00 172.66 ? 534 LYS A CE    1 
ATOM   2097 N  NZ    . LYS A 1 315 ? -11.672 -25.282 23.942  1.00 175.48 ? 534 LYS A NZ    1 
ATOM   2098 N  N     . ALA A 1 316 ? -11.638 -31.966 20.644  1.00 143.15 ? 535 ALA A N     1 
ATOM   2099 C  CA    . ALA A 1 316 ? -12.145 -32.546 19.408  1.00 143.73 ? 535 ALA A CA    1 
ATOM   2100 C  C     . ALA A 1 316 ? -12.393 -31.486 18.331  1.00 143.92 ? 535 ALA A C     1 
ATOM   2101 O  O     . ALA A 1 316 ? -12.383 -31.801 17.135  1.00 143.84 ? 535 ALA A O     1 
ATOM   2102 C  CB    . ALA A 1 316 ? -13.419 -33.329 19.686  1.00 149.69 ? 535 ALA A CB    1 
ATOM   2103 N  N     . HIS A 1 317 ? -12.631 -30.233 18.758  1.00 136.55 ? 536 HIS A N     1 
ATOM   2104 C  CA    . HIS A 1 317 ? -12.923 -29.124 17.850  1.00 132.61 ? 536 HIS A CA    1 
ATOM   2105 C  C     . HIS A 1 317 ? -12.134 -27.897 18.243  1.00 127.68 ? 536 HIS A C     1 
ATOM   2106 O  O     . HIS A 1 317 ? -11.878 -27.675 19.422  1.00 129.02 ? 536 HIS A O     1 
ATOM   2107 C  CB    . HIS A 1 317 ? -14.433 -28.801 17.849  1.00 136.83 ? 536 HIS A CB    1 
ATOM   2108 C  CG    . HIS A 1 317 ? -15.296 -30.015 17.748  1.00 145.02 ? 536 HIS A CG    1 
ATOM   2109 N  ND1   . HIS A 1 317 ? -15.586 -30.776 18.862  1.00 150.77 ? 536 HIS A ND1   1 
ATOM   2110 C  CD2   . HIS A 1 317 ? -15.861 -30.594 16.659  1.00 148.92 ? 536 HIS A CD2   1 
ATOM   2111 C  CE1   . HIS A 1 317 ? -16.345 -31.774 18.429  1.00 154.30 ? 536 HIS A CE1   1 
ATOM   2112 N  NE2   . HIS A 1 317 ? -16.540 -31.707 17.109  1.00 153.38 ? 536 HIS A NE2   1 
ATOM   2113 N  N     . THR A 1 318 ? -11.695 -27.139 17.246  1.00 114.90 ? 537 THR A N     1 
ATOM   2114 C  CA    . THR A 1 318 ? -10.989 -25.881 17.412  1.00 107.99 ? 537 THR A CA    1 
ATOM   2115 C  C     . THR A 1 318 ? -11.592 -24.931 16.358  1.00 101.30 ? 537 THR A C     1 
ATOM   2116 O  O     . THR A 1 318 ? -12.153 -25.379 15.345  1.00 100.33 ? 537 THR A O     1 
ATOM   2117 C  CB    . THR A 1 318 ? -9.455  -26.018 17.298  1.00 115.92 ? 537 THR A CB    1 
ATOM   2118 O  OG1   . THR A 1 318 ? -9.037  -25.625 16.008  1.00 120.29 ? 537 THR A OG1   1 
ATOM   2119 C  CG2   . THR A 1 318 ? -8.923  -27.428 17.608  1.00 116.20 ? 537 THR A CG2   1 
ATOM   2120 N  N     . PRO A 1 319 ? -11.451 -23.616 16.558  1.00 88.36  ? 538 PRO A N     1 
ATOM   2121 C  CA    . PRO A 1 319 ? -12.038 -22.673 15.600  1.00 85.35  ? 538 PRO A CA    1 
ATOM   2122 C  C     . PRO A 1 319 ? -11.187 -22.453 14.320  1.00 83.69  ? 538 PRO A C     1 
ATOM   2123 O  O     . PRO A 1 319 ? -10.934 -21.298 13.937  1.00 81.42  ? 538 PRO A O     1 
ATOM   2124 C  CB    . PRO A 1 319 ? -12.169 -21.411 16.442  1.00 86.73  ? 538 PRO A CB    1 
ATOM   2125 C  CG    . PRO A 1 319 ? -11.008 -21.477 17.386  1.00 88.82  ? 538 PRO A CG    1 
ATOM   2126 C  CD    . PRO A 1 319 ? -10.809 -22.921 17.699  1.00 85.89  ? 538 PRO A CD    1 
ATOM   2127 N  N     . PHE A 1 320 ? -10.788 -23.550 13.636  1.00 76.52  ? 539 PHE A N     1 
ATOM   2128 C  CA    A PHE A 1 320 ? -9.964  -23.540 12.409  0.50 73.84  ? 539 PHE A CA    1 
ATOM   2129 C  CA    B PHE A 1 320 ? -9.939  -23.490 12.434  0.50 74.27  ? 539 PHE A CA    1 
ATOM   2130 C  C     . PHE A 1 320 ? -10.473 -22.612 11.301  1.00 79.18  ? 539 PHE A C     1 
ATOM   2131 O  O     . PHE A 1 320 ? -9.702  -22.102 10.497  1.00 77.65  ? 539 PHE A O     1 
ATOM   2132 C  CB    A PHE A 1 320 ? -9.840  -24.976 11.837  0.50 75.09  ? 539 PHE A CB    1 
ATOM   2133 C  CB    B PHE A 1 320 ? -9.714  -24.892 11.865  0.50 75.83  ? 539 PHE A CB    1 
ATOM   2134 C  CG    A PHE A 1 320 ? -11.039 -25.499 11.065  0.50 77.94  ? 539 PHE A CG    1 
ATOM   2135 C  CG    B PHE A 1 320 ? -9.415  -25.997 12.841  0.50 77.35  ? 539 PHE A CG    1 
ATOM   2136 C  CD1   A PHE A 1 320 ? -11.059 -25.471 9.669   0.50 79.53  ? 539 PHE A CD1   1 
ATOM   2137 C  CD1   B PHE A 1 320 ? -8.114  -26.237 13.265  0.50 78.16  ? 539 PHE A CD1   1 
ATOM   2138 C  CD2   A PHE A 1 320 ? -12.150 -26.013 11.733  0.50 81.80  ? 539 PHE A CD2   1 
ATOM   2139 C  CD2   B PHE A 1 320 ? -10.410 -26.880 13.240  0.50 82.00  ? 539 PHE A CD2   1 
ATOM   2140 C  CE1   A PHE A 1 320 ? -12.152 -25.975 8.958   0.50 81.95  ? 539 PHE A CE1   1 
ATOM   2141 C  CE1   B PHE A 1 320 ? -7.820  -27.334 14.079  0.50 79.61  ? 539 PHE A CE1   1 
ATOM   2142 C  CE2   A PHE A 1 320 ? -13.250 -26.503 11.021  0.50 86.46  ? 539 PHE A CE2   1 
ATOM   2143 C  CE2   B PHE A 1 320 ? -10.114 -27.969 14.068  0.50 85.67  ? 539 PHE A CE2   1 
ATOM   2144 C  CZ    A PHE A 1 320 ? -13.242 -26.479 9.640   0.50 84.25  ? 539 PHE A CZ    1 
ATOM   2145 C  CZ    B PHE A 1 320 ? -8.815  -28.204 14.452  0.50 81.66  ? 539 PHE A CZ    1 
ATOM   2146 N  N     . ARG A 1 321 ? -11.764 -22.477 11.209  1.00 79.18  ? 540 ARG A N     1 
ATOM   2147 C  CA    . ARG A 1 321 ? -12.469 -21.769 10.158  1.00 79.77  ? 540 ARG A CA    1 
ATOM   2148 C  C     . ARG A 1 321 ? -12.341 -20.252 10.178  1.00 82.84  ? 540 ARG A C     1 
ATOM   2149 O  O     . ARG A 1 321 ? -12.622 -19.590 9.185   1.00 83.18  ? 540 ARG A O     1 
ATOM   2150 C  CB    . ARG A 1 321 ? -13.920 -22.190 10.287  1.00 83.83  ? 540 ARG A CB    1 
ATOM   2151 C  CG    . ARG A 1 321 ? -14.698 -22.309 9.043   1.00 103.04 ? 540 ARG A CG    1 
ATOM   2152 C  CD    . ARG A 1 321 ? -16.059 -22.793 9.486   1.00 114.04 ? 540 ARG A CD    1 
ATOM   2153 N  NE    . ARG A 1 321 ? -16.150 -24.252 9.485   1.00 116.61 ? 540 ARG A NE    1 
ATOM   2154 C  CZ    . ARG A 1 321 ? -17.061 -24.940 10.161  1.00 121.76 ? 540 ARG A CZ    1 
ATOM   2155 N  NH1   . ARG A 1 321 ? -17.937 -24.315 10.937  1.00 110.62 ? 540 ARG A NH1   1 
ATOM   2156 N  NH2   . ARG A 1 321 ? -17.122 -26.257 10.047  1.00 102.03 ? 540 ARG A NH2   1 
ATOM   2157 N  N     . GLU A 1 322 ? -11.904 -19.702 11.301  1.00 78.94  ? 541 GLU A N     1 
ATOM   2158 C  CA    . GLU A 1 322 ? -11.792 -18.263 11.514  1.00 77.75  ? 541 GLU A CA    1 
ATOM   2159 C  C     . GLU A 1 322 ? -10.741 -17.523 10.690  1.00 79.66  ? 541 GLU A C     1 
ATOM   2160 O  O     . GLU A 1 322 ? -10.740 -16.304 10.686  1.00 80.07  ? 541 GLU A O     1 
ATOM   2161 C  CB    . GLU A 1 322 ? -11.714 -17.925 13.016  1.00 77.64  ? 541 GLU A CB    1 
ATOM   2162 C  CG    . GLU A 1 322 ? -13.008 -18.169 13.790  1.00 76.70  ? 541 GLU A CG    1 
ATOM   2163 C  CD    . GLU A 1 322 ? -14.305 -17.641 13.200  1.00 100.42 ? 541 GLU A CD    1 
ATOM   2164 O  OE1   . GLU A 1 322 ? -14.297 -16.546 12.587  1.00 93.01  ? 541 GLU A OE1   1 
ATOM   2165 O  OE2   . GLU A 1 322 ? -15.324 -18.365 13.306  1.00 94.49  ? 541 GLU A OE2   1 
ATOM   2166 N  N     . SER A 1 323 ? -9.827  -18.249 10.032  1.00 73.08  ? 542 SER A N     1 
ATOM   2167 C  CA    . SER A 1 323 ? -8.815  -17.629 9.186   1.00 70.97  ? 542 SER A CA    1 
ATOM   2168 C  C     . SER A 1 323 ? -8.363  -18.631 8.166   1.00 74.14  ? 542 SER A C     1 
ATOM   2169 O  O     . SER A 1 323 ? -8.505  -19.832 8.385   1.00 73.38  ? 542 SER A O     1 
ATOM   2170 C  CB    . SER A 1 323 ? -7.620  -17.147 10.004  1.00 71.74  ? 542 SER A CB    1 
ATOM   2171 O  OG    . SER A 1 323 ? -6.873  -18.224 10.556  1.00 77.33  ? 542 SER A OG    1 
ATOM   2172 N  N     . LYS A 1 324 ? -7.779  -18.155 7.063   1.00 71.77  ? 543 LYS A N     1 
ATOM   2173 C  CA    . LYS A 1 324 ? -7.243  -19.040 6.029   1.00 71.19  ? 543 LYS A CA    1 
ATOM   2174 C  C     . LYS A 1 324 ? -6.058  -19.826 6.583   1.00 73.81  ? 543 LYS A C     1 
ATOM   2175 O  O     . LYS A 1 324 ? -5.903  -20.995 6.250   1.00 71.56  ? 543 LYS A O     1 
ATOM   2176 C  CB    . LYS A 1 324 ? -6.818  -18.256 4.763   1.00 74.30  ? 543 LYS A CB    1 
ATOM   2177 C  CG    . LYS A 1 324 ? -7.936  -17.814 3.852   1.00 86.42  ? 543 LYS A CG    1 
ATOM   2178 C  CD    . LYS A 1 324 ? -8.579  -19.006 3.204   1.00 96.18  ? 543 LYS A CD    1 
ATOM   2179 C  CE    . LYS A 1 324 ? -9.839  -18.658 2.459   1.00 91.80  ? 543 LYS A CE    1 
ATOM   2180 N  NZ    . LYS A 1 324 ? -11.050 -18.821 3.310   1.00 113.17 ? 543 LYS A NZ    1 
ATOM   2181 N  N     . LEU A 1 325 ? -5.222  -19.181 7.430   1.00 70.22  ? 544 LEU A N     1 
ATOM   2182 C  CA    . LEU A 1 325 ? -4.068  -19.818 8.039   1.00 67.41  ? 544 LEU A CA    1 
ATOM   2183 C  C     . LEU A 1 325 ? -4.455  -21.054 8.836   1.00 68.64  ? 544 LEU A C     1 
ATOM   2184 O  O     . LEU A 1 325 ? -3.905  -22.121 8.599   1.00 68.32  ? 544 LEU A O     1 
ATOM   2185 C  CB    . LEU A 1 325 ? -3.338  -18.823 8.946   1.00 66.88  ? 544 LEU A CB    1 
ATOM   2186 C  CG    . LEU A 1 325 ? -2.097  -19.353 9.712   1.00 69.75  ? 544 LEU A CG    1 
ATOM   2187 C  CD1   . LEU A 1 325 ? -0.975  -19.781 8.751   1.00 69.45  ? 544 LEU A CD1   1 
ATOM   2188 C  CD2   . LEU A 1 325 ? -1.623  -18.322 10.668  1.00 72.06  ? 544 LEU A CD2   1 
ATOM   2189 N  N     . THR A 1 326 ? -5.412  -20.922 9.765   1.00 66.09  ? 545 THR A N     1 
ATOM   2190 C  CA    . THR A 1 326 ? -5.838  -22.045 10.605  1.00 66.12  ? 545 THR A CA    1 
ATOM   2191 C  C     . THR A 1 326 ? -6.612  -23.100 9.837   1.00 73.44  ? 545 THR A C     1 
ATOM   2192 O  O     . THR A 1 326 ? -6.528  -24.286 10.154  1.00 75.40  ? 545 THR A O     1 
ATOM   2193 C  CB    . THR A 1 326 ? -6.539  -21.566 11.862  1.00 71.39  ? 545 THR A CB    1 
ATOM   2194 O  OG1   . THR A 1 326 ? -7.595  -20.679 11.518  1.00 72.27  ? 545 THR A OG1   1 
ATOM   2195 C  CG2   . THR A 1 326 ? -5.568  -20.915 12.862  1.00 66.39  ? 545 THR A CG2   1 
ATOM   2196 N  N     . GLN A 1 327 ? -7.328  -22.676 8.799   1.00 71.37  ? 546 GLN A N     1 
ATOM   2197 C  CA    . GLN A 1 327 ? -8.070  -23.576 7.921   1.00 73.32  ? 546 GLN A CA    1 
ATOM   2198 C  C     . GLN A 1 327 ? -7.088  -24.512 7.173   1.00 78.03  ? 546 GLN A C     1 
ATOM   2199 O  O     . GLN A 1 327 ? -7.209  -25.730 7.220   1.00 80.43  ? 546 GLN A O     1 
ATOM   2200 C  CB    . GLN A 1 327 ? -8.942  -22.744 6.954   1.00 76.03  ? 546 GLN A CB    1 
ATOM   2201 C  CG    . GLN A 1 327 ? -10.168 -23.476 6.447   1.00 111.83 ? 546 GLN A CG    1 
ATOM   2202 C  CD    . GLN A 1 327 ? -11.049 -22.647 5.529   1.00 130.41 ? 546 GLN A CD    1 
ATOM   2203 O  OE1   . GLN A 1 327 ? -10.651 -21.591 4.987   1.00 120.37 ? 546 GLN A OE1   1 
ATOM   2204 N  NE2   . GLN A 1 327 ? -12.284 -23.127 5.348   1.00 124.60 ? 546 GLN A NE2   1 
ATOM   2205 N  N     . VAL A 1 328 ? -6.083  -23.940 6.553   1.00 73.46  ? 547 VAL A N     1 
ATOM   2206 C  CA    . VAL A 1 328 ? -5.051  -24.661 5.833   1.00 73.74  ? 547 VAL A CA    1 
ATOM   2207 C  C     . VAL A 1 328 ? -4.256  -25.594 6.760   1.00 80.26  ? 547 VAL A C     1 
ATOM   2208 O  O     . VAL A 1 328 ? -3.923  -26.698 6.353   1.00 84.75  ? 547 VAL A O     1 
ATOM   2209 C  CB    . VAL A 1 328 ? -4.154  -23.647 5.107   1.00 77.46  ? 547 VAL A CB    1 
ATOM   2210 C  CG1   . VAL A 1 328 ? -2.840  -24.267 4.676   1.00 78.22  ? 547 VAL A CG1   1 
ATOM   2211 C  CG2   . VAL A 1 328 ? -4.889  -23.046 3.920   1.00 78.35  ? 547 VAL A CG2   1 
ATOM   2212 N  N     . LEU A 1 329 ? -3.974  -25.174 7.989   1.00 73.04  ? 548 LEU A N     1 
ATOM   2213 C  CA    . LEU A 1 329 ? -3.265  -26.007 8.958   1.00 71.31  ? 548 LEU A CA    1 
ATOM   2214 C  C     . LEU A 1 329 ? -4.143  -26.858 9.881   1.00 76.63  ? 548 LEU A C     1 
ATOM   2215 O  O     . LEU A 1 329 ? -3.595  -27.511 10.768  1.00 76.73  ? 548 LEU A O     1 
ATOM   2216 C  CB    . LEU A 1 329 ? -2.359  -25.130 9.790   1.00 69.01  ? 548 LEU A CB    1 
ATOM   2217 C  CG    . LEU A 1 329 ? -1.348  -24.348 8.957   1.00 73.21  ? 548 LEU A CG    1 
ATOM   2218 C  CD1   . LEU A 1 329 ? -0.559  -23.439 9.804   1.00 70.17  ? 548 LEU A CD1   1 
ATOM   2219 C  CD2   . LEU A 1 329 ? -0.445  -25.281 8.140   1.00 75.71  ? 548 LEU A CD2   1 
ATOM   2220 N  N     . ARG A 1 330 ? -5.476  -26.890 9.649   1.00 73.70  ? 549 ARG A N     1 
ATOM   2221 C  CA    . ARG A 1 330 ? -6.448  -27.605 10.469  1.00 75.61  ? 549 ARG A CA    1 
ATOM   2222 C  C     . ARG A 1 330 ? -5.967  -28.956 10.939  1.00 86.29  ? 549 ARG A C     1 
ATOM   2223 O  O     . ARG A 1 330 ? -6.072  -29.274 12.120  1.00 87.77  ? 549 ARG A O     1 
ATOM   2224 C  CB    . ARG A 1 330 ? -7.796  -27.783 9.747   1.00 73.49  ? 549 ARG A CB    1 
ATOM   2225 C  CG    . ARG A 1 330 ? -8.826  -28.359 10.675  1.00 78.89  ? 549 ARG A CG    1 
ATOM   2226 C  CD    . ARG A 1 330 ? -10.123 -28.717 10.029  1.00 77.62  ? 549 ARG A CD    1 
ATOM   2227 N  NE    . ARG A 1 330 ? -10.155 -30.155 9.855   1.00 89.86  ? 549 ARG A NE    1 
ATOM   2228 C  CZ    . ARG A 1 330 ? -10.794 -30.976 10.674  1.00 102.92 ? 549 ARG A CZ    1 
ATOM   2229 N  NH1   . ARG A 1 330 ? -11.520 -30.495 11.671  1.00 103.23 ? 549 ARG A NH1   1 
ATOM   2230 N  NH2   . ARG A 1 330 ? -10.779 -32.280 10.456  1.00 93.72  ? 549 ARG A NH2   1 
ATOM   2231 N  N     . ASP A 1 331 ? -5.457  -29.753 9.998   1.00 86.88  ? 550 ASP A N     1 
ATOM   2232 C  CA    . ASP A 1 331 ? -4.994  -31.117 10.218  1.00 90.62  ? 550 ASP A CA    1 
ATOM   2233 C  C     . ASP A 1 331 ? -3.875  -31.251 11.274  1.00 98.00  ? 550 ASP A C     1 
ATOM   2234 O  O     . ASP A 1 331 ? -3.738  -32.297 11.920  1.00 101.55 ? 550 ASP A O     1 
ATOM   2235 C  CB    . ASP A 1 331 ? -4.586  -31.751 8.869   1.00 94.43  ? 550 ASP A CB    1 
ATOM   2236 C  CG    . ASP A 1 331 ? -3.221  -31.371 8.293   1.00 121.53 ? 550 ASP A CG    1 
ATOM   2237 O  OD1   . ASP A 1 331 ? -2.804  -30.181 8.433   1.00 122.68 ? 550 ASP A OD1   1 
ATOM   2238 O  OD2   . ASP A 1 331 ? -2.590  -32.241 7.661   1.00 135.58 ? 550 ASP A OD2   1 
ATOM   2239 N  N     . SER A 1 332 ? -3.098  -30.184 11.457  1.00 92.80  ? 551 SER A N     1 
ATOM   2240 C  CA    . SER A 1 332 ? -1.967  -30.147 12.372  1.00 91.37  ? 551 SER A CA    1 
ATOM   2241 C  C     . SER A 1 332 ? -2.326  -29.806 13.805  1.00 94.76  ? 551 SER A C     1 
ATOM   2242 O  O     . SER A 1 332 ? -1.464  -29.900 14.676  1.00 95.86  ? 551 SER A O     1 
ATOM   2243 C  CB    . SER A 1 332 ? -0.924  -29.189 11.822  1.00 92.92  ? 551 SER A CB    1 
ATOM   2244 O  OG    . SER A 1 332 ? -0.502  -29.603 10.531  1.00 99.38  ? 551 SER A OG    1 
ATOM   2245 N  N     . PHE A 1 333 ? -3.588  -29.443 14.072  1.00 91.32  ? 552 PHE A N     1 
ATOM   2246 C  CA    . PHE A 1 333 ? -4.024  -29.081 15.429  1.00 91.29  ? 552 PHE A CA    1 
ATOM   2247 C  C     . PHE A 1 333 ? -4.845  -30.154 16.125  1.00 96.79  ? 552 PHE A C     1 
ATOM   2248 O  O     . PHE A 1 333 ? -5.386  -29.930 17.232  1.00 95.70  ? 552 PHE A O     1 
ATOM   2249 C  CB    . PHE A 1 333 ? -4.786  -27.761 15.416  1.00 92.06  ? 552 PHE A CB    1 
ATOM   2250 C  CG    . PHE A 1 333 ? -4.051  -26.609 14.782  1.00 91.01  ? 552 PHE A CG    1 
ATOM   2251 C  CD1   . PHE A 1 333 ? -2.834  -26.173 15.294  1.00 91.12  ? 552 PHE A CD1   1 
ATOM   2252 C  CD2   . PHE A 1 333 ? -4.611  -25.916 13.715  1.00 93.66  ? 552 PHE A CD2   1 
ATOM   2253 C  CE1   . PHE A 1 333 ? -2.185  -25.084 14.739  1.00 90.03  ? 552 PHE A CE1   1 
ATOM   2254 C  CE2   . PHE A 1 333 ? -3.967  -24.818 13.164  1.00 94.73  ? 552 PHE A CE2   1 
ATOM   2255 C  CZ    . PHE A 1 333 ? -2.744  -24.425 13.666  1.00 90.39  ? 552 PHE A CZ    1 
ATOM   2256 N  N     . ILE A 1 334 ? -4.938  -31.318 15.457  1.00 95.89  ? 553 ILE A N     1 
ATOM   2257 C  CA    . ILE A 1 334 ? -5.658  -32.511 15.908  1.00 99.51  ? 553 ILE A CA    1 
ATOM   2258 C  C     . ILE A 1 334 ? -4.794  -33.769 15.754  1.00 106.01 ? 553 ILE A C     1 
ATOM   2259 O  O     . ILE A 1 334 ? -3.945  -33.852 14.858  1.00 104.23 ? 553 ILE A O     1 
ATOM   2260 C  CB    . ILE A 1 334 ? -7.058  -32.656 15.223  1.00 103.78 ? 553 ILE A CB    1 
ATOM   2261 C  CG1   . ILE A 1 334 ? -6.946  -32.786 13.691  1.00 102.04 ? 553 ILE A CG1   1 
ATOM   2262 C  CG2   . ILE A 1 334 ? -8.029  -31.527 15.645  1.00 104.59 ? 553 ILE A CG2   1 
ATOM   2263 C  CD1   . ILE A 1 334 ? -8.236  -32.968 12.950  1.00 101.88 ? 553 ILE A CD1   1 
ATOM   2264 N  N     . GLY A 1 335 ? -5.036  -34.730 16.624  1.00 106.97 ? 554 GLY A N     1 
ATOM   2265 C  CA    . GLY A 1 335 ? -4.307  -35.985 16.619  1.00 111.00 ? 554 GLY A CA    1 
ATOM   2266 C  C     . GLY A 1 335 ? -3.470  -36.164 17.863  1.00 119.28 ? 554 GLY A C     1 
ATOM   2267 O  O     . GLY A 1 335 ? -3.055  -35.191 18.497  1.00 116.01 ? 554 GLY A O     1 
ATOM   2268 N  N     . GLU A 1 336 ? -3.227  -37.416 18.210  1.00 123.00 ? 555 GLU A N     1 
ATOM   2269 C  CA    . GLU A 1 336 ? -2.443  -37.849 19.375  1.00 125.94 ? 555 GLU A CA    1 
ATOM   2270 C  C     . GLU A 1 336 ? -0.979  -37.412 19.286  1.00 126.40 ? 555 GLU A C     1 
ATOM   2271 O  O     . GLU A 1 336 ? -0.386  -37.003 20.281  1.00 125.35 ? 555 GLU A O     1 
ATOM   2272 C  CB    . GLU A 1 336 ? -2.542  -39.391 19.545  1.00 133.88 ? 555 GLU A CB    1 
ATOM   2273 C  CG    . GLU A 1 336 ? -2.530  -40.218 18.252  1.00 147.36 ? 555 GLU A CG    1 
ATOM   2274 C  CD    . GLU A 1 336 ? -3.768  -40.146 17.369  1.00 162.80 ? 555 GLU A CD    1 
ATOM   2275 O  OE1   . GLU A 1 336 ? -4.774  -40.810 17.710  1.00 170.66 ? 555 GLU A OE1   1 
ATOM   2276 O  OE2   . GLU A 1 336 ? -3.739  -39.417 16.348  1.00 139.21 ? 555 GLU A OE2   1 
ATOM   2277 N  N     . ASN A 1 337 ? -0.416  -37.500 18.083  1.00 121.23 ? 556 ASN A N     1 
ATOM   2278 C  CA    . ASN A 1 337 ? 0.974   -37.203 17.765  1.00 118.79 ? 556 ASN A CA    1 
ATOM   2279 C  C     . ASN A 1 337 ? 1.147   -35.925 16.934  1.00 114.61 ? 556 ASN A C     1 
ATOM   2280 O  O     . ASN A 1 337 ? 1.953   -35.883 15.991  1.00 115.71 ? 556 ASN A O     1 
ATOM   2281 C  CB    . ASN A 1 337 ? 1.644   -38.426 17.110  1.00 126.60 ? 556 ASN A CB    1 
ATOM   2282 C  CG    . ASN A 1 337 ? 0.738   -39.254 16.195  1.00 168.16 ? 556 ASN A CG    1 
ATOM   2283 O  OD1   . ASN A 1 337 ? 0.763   -40.495 16.228  1.00 172.86 ? 556 ASN A OD1   1 
ATOM   2284 N  ND2   . ASN A 1 337 ? -0.071  -38.615 15.341  1.00 158.13 ? 556 ASN A ND2   1 
ATOM   2285 N  N     . SER A 1 338 ? 0.383   -34.874 17.296  1.00 102.37 ? 557 SER A N     1 
ATOM   2286 C  CA    . SER A 1 338 ? 0.514   -33.543 16.708  1.00 94.39  ? 557 SER A CA    1 
ATOM   2287 C  C     . SER A 1 338 ? 1.203   -32.630 17.740  1.00 91.35  ? 557 SER A C     1 
ATOM   2288 O  O     . SER A 1 338 ? 0.840   -32.599 18.916  1.00 90.91  ? 557 SER A O     1 
ATOM   2289 C  CB    . SER A 1 338 ? -0.831  -32.984 16.269  1.00 93.25  ? 557 SER A CB    1 
ATOM   2290 O  OG    . SER A 1 338 ? -1.265  -33.661 15.105  1.00 101.63 ? 557 SER A OG    1 
ATOM   2291 N  N     . ARG A 1 339 ? 2.244   -31.948 17.296  1.00 83.00  ? 558 ARG A N     1 
ATOM   2292 C  CA    . ARG A 1 339 ? 3.067   -31.097 18.125  1.00 79.43  ? 558 ARG A CA    1 
ATOM   2293 C  C     . ARG A 1 339 ? 3.314   -29.782 17.445  1.00 79.24  ? 558 ARG A C     1 
ATOM   2294 O  O     . ARG A 1 339 ? 3.337   -29.711 16.219  1.00 79.11  ? 558 ARG A O     1 
ATOM   2295 C  CB    . ARG A 1 339 ? 4.387   -31.819 18.434  1.00 80.15  ? 558 ARG A CB    1 
ATOM   2296 C  CG    . ARG A 1 339 ? 4.171   -33.065 19.271  1.00 87.79  ? 558 ARG A CG    1 
ATOM   2297 C  CD    . ARG A 1 339 ? 5.408   -33.894 19.291  1.00 99.11  ? 558 ARG A CD    1 
ATOM   2298 N  NE    . ARG A 1 339 ? 6.150   -33.718 20.521  1.00 120.13 ? 558 ARG A NE    1 
ATOM   2299 C  CZ    . ARG A 1 339 ? 5.961   -34.443 21.623  1.00 140.82 ? 558 ARG A CZ    1 
ATOM   2300 N  NH1   . ARG A 1 339 ? 5.025   -35.387 21.655  1.00 131.11 ? 558 ARG A NH1   1 
ATOM   2301 N  NH2   . ARG A 1 339 ? 6.693   -34.218 22.706  1.00 130.17 ? 558 ARG A NH2   1 
ATOM   2302 N  N     . THR A 1 340 ? 3.445   -28.729 18.246  1.00 74.38  ? 559 THR A N     1 
ATOM   2303 C  CA    . THR A 1 340 ? 3.713   -27.381 17.761  1.00 72.49  ? 559 THR A CA    1 
ATOM   2304 C  C     . THR A 1 340 ? 4.804   -26.669 18.577  1.00 76.26  ? 559 THR A C     1 
ATOM   2305 O  O     . THR A 1 340 ? 5.041   -26.954 19.771  1.00 74.35  ? 559 THR A O     1 
ATOM   2306 C  CB    . THR A 1 340 ? 2.422   -26.560 17.704  1.00 77.16  ? 559 THR A CB    1 
ATOM   2307 O  OG1   . THR A 1 340 ? 2.663   -25.393 16.936  1.00 75.56  ? 559 THR A OG1   1 
ATOM   2308 C  CG2   . THR A 1 340 ? 1.941   -26.141 19.051  1.00 76.87  ? 559 THR A CG2   1 
ATOM   2309 N  N     . CYS A 1 341 ? 5.446   -25.733 17.906  1.00 73.43  ? 560 CYS A N     1 
ATOM   2310 C  CA    . CYS A 1 341 ? 6.420   -24.864 18.507  1.00 73.29  ? 560 CYS A CA    1 
ATOM   2311 C  C     . CYS A 1 341 ? 6.134   -23.460 18.054  1.00 72.99  ? 560 CYS A C     1 
ATOM   2312 O  O     . CYS A 1 341 ? 5.836   -23.248 16.875  1.00 72.87  ? 560 CYS A O     1 
ATOM   2313 C  CB    . CYS A 1 341 ? 7.851   -25.271 18.156  1.00 76.71  ? 560 CYS A CB    1 
ATOM   2314 S  SG    . CYS A 1 341 ? 9.083   -24.140 18.855  1.00 81.29  ? 560 CYS A SG    1 
ATOM   2315 N  N     . MET A 1 342 ? 6.232   -22.502 18.955  1.00 67.07  ? 561 MET A N     1 
ATOM   2316 C  CA    . MET A 1 342 ? 6.128   -21.105 18.599  1.00 64.57  ? 561 MET A CA    1 
ATOM   2317 C  C     . MET A 1 342 ? 7.321   -20.350 19.149  1.00 64.77  ? 561 MET A C     1 
ATOM   2318 O  O     . MET A 1 342 ? 7.603   -20.420 20.364  1.00 63.14  ? 561 MET A O     1 
ATOM   2319 C  CB    . MET A 1 342 ? 4.868   -20.466 19.124  1.00 67.06  ? 561 MET A CB    1 
ATOM   2320 C  CG    . MET A 1 342 ? 4.833   -18.995 18.773  1.00 72.26  ? 561 MET A CG    1 
ATOM   2321 S  SD    . MET A 1 342 ? 3.277   -18.239 19.107  1.00 78.97  ? 561 MET A SD    1 
ATOM   2322 C  CE    . MET A 1 342 ? 2.347   -18.832 17.751  1.00 75.01  ? 561 MET A CE    1 
ATOM   2323 N  N     . ILE A 1 343 ? 7.978   -19.587 18.259  1.00 60.68  ? 562 ILE A N     1 
ATOM   2324 C  CA    . ILE A 1 343 ? 9.094   -18.701 18.572  1.00 60.65  ? 562 ILE A CA    1 
ATOM   2325 C  C     . ILE A 1 343 ? 8.577   -17.280 18.515  1.00 64.78  ? 562 ILE A C     1 
ATOM   2326 O  O     . ILE A 1 343 ? 8.307   -16.773 17.436  1.00 64.72  ? 562 ILE A O     1 
ATOM   2327 C  CB    . ILE A 1 343 ? 10.310  -18.878 17.629  1.00 64.32  ? 562 ILE A CB    1 
ATOM   2328 C  CG1   . ILE A 1 343 ? 10.730  -20.363 17.568  1.00 66.21  ? 562 ILE A CG1   1 
ATOM   2329 C  CG2   . ILE A 1 343 ? 11.463  -17.968 18.085  1.00 63.77  ? 562 ILE A CG2   1 
ATOM   2330 C  CD1   . ILE A 1 343 ? 11.414  -20.846 16.260  1.00 70.08  ? 562 ILE A CD1   1 
ATOM   2331 N  N     . ALA A 1 344 ? 8.445   -16.639 19.675  1.00 61.69  ? 563 ALA A N     1 
ATOM   2332 C  CA    . ALA A 1 344 ? 8.031   -15.245 19.778  1.00 60.30  ? 563 ALA A CA    1 
ATOM   2333 C  C     . ALA A 1 344 ? 9.308   -14.402 19.716  1.00 64.70  ? 563 ALA A C     1 
ATOM   2334 O  O     . ALA A 1 344 ? 10.131  -14.427 20.632  1.00 61.94  ? 563 ALA A O     1 
ATOM   2335 C  CB    . ALA A 1 344 ? 7.280   -15.005 21.081  1.00 59.79  ? 563 ALA A CB    1 
ATOM   2336 N  N     . THR A 1 345 ? 9.476   -13.686 18.603  1.00 64.25  ? 564 THR A N     1 
ATOM   2337 C  CA    . THR A 1 345 ? 10.623  -12.829 18.349  1.00 65.93  ? 564 THR A CA    1 
ATOM   2338 C  C     . THR A 1 345 ? 10.331  -11.438 18.903  1.00 71.55  ? 564 THR A C     1 
ATOM   2339 O  O     . THR A 1 345 ? 9.219   -10.922 18.733  1.00 71.98  ? 564 THR A O     1 
ATOM   2340 C  CB    . THR A 1 345 ? 10.974  -12.832 16.850  1.00 67.68  ? 564 THR A CB    1 
ATOM   2341 O  OG1   . THR A 1 345 ? 9.841   -12.384 16.106  1.00 71.93  ? 564 THR A OG1   1 
ATOM   2342 C  CG2   . THR A 1 345 ? 11.419  -14.202 16.365  1.00 57.76  ? 564 THR A CG2   1 
ATOM   2343 N  N     . ILE A 1 346 ? 11.323  -10.832 19.574  1.00 67.90  ? 565 ILE A N     1 
ATOM   2344 C  CA    . ILE A 1 346 ? 11.158  -9.504  20.171  1.00 67.25  ? 565 ILE A CA    1 
ATOM   2345 C  C     . ILE A 1 346 ? 12.304  -8.548  19.814  1.00 71.34  ? 565 ILE A C     1 
ATOM   2346 O  O     . ILE A 1 346 ? 13.461  -8.964  19.678  1.00 71.32  ? 565 ILE A O     1 
ATOM   2347 C  CB    . ILE A 1 346 ? 10.867  -9.576  21.728  1.00 68.06  ? 565 ILE A CB    1 
ATOM   2348 C  CG1   . ILE A 1 346 ? 12.034  -10.083 22.518  1.00 67.66  ? 565 ILE A CG1   1 
ATOM   2349 C  CG2   . ILE A 1 346 ? 9.564   -10.367 22.111  1.00 64.12  ? 565 ILE A CG2   1 
ATOM   2350 C  CD1   . ILE A 1 346 ? 11.803  -9.997  23.970  1.00 83.62  ? 565 ILE A CD1   1 
ATOM   2351 N  N     . SER A 1 347 ? 11.966  -7.271  19.633  1.00 69.75  ? 566 SER A N     1 
ATOM   2352 C  CA    . SER A 1 347 ? 12.923  -6.187  19.392  1.00 72.72  ? 566 SER A CA    1 
ATOM   2353 C  C     . SER A 1 347 ? 13.222  -5.622  20.785  1.00 78.03  ? 566 SER A C     1 
ATOM   2354 O  O     . SER A 1 347 ? 12.293  -5.366  21.562  1.00 77.51  ? 566 SER A O     1 
ATOM   2355 C  CB    . SER A 1 347 ? 12.328  -5.127  18.484  1.00 78.79  ? 566 SER A CB    1 
ATOM   2356 O  OG    . SER A 1 347 ? 12.185  -5.609  17.155  1.00 91.20  ? 566 SER A OG    1 
ATOM   2357 N  N     . PRO A 1 348 ? 14.499  -5.478  21.158  1.00 74.51  ? 567 PRO A N     1 
ATOM   2358 C  CA    . PRO A 1 348 ? 14.815  -5.133  22.549  1.00 74.73  ? 567 PRO A CA    1 
ATOM   2359 C  C     . PRO A 1 348 ? 14.802  -3.675  22.976  1.00 80.53  ? 567 PRO A C     1 
ATOM   2360 O  O     . PRO A 1 348 ? 14.995  -3.383  24.171  1.00 79.71  ? 567 PRO A O     1 
ATOM   2361 C  CB    . PRO A 1 348 ? 16.221  -5.699  22.701  1.00 76.79  ? 567 PRO A CB    1 
ATOM   2362 C  CG    . PRO A 1 348 ? 16.825  -5.463  21.373  1.00 82.72  ? 567 PRO A CG    1 
ATOM   2363 C  CD    . PRO A 1 348 ? 15.728  -5.750  20.388  1.00 77.39  ? 567 PRO A CD    1 
ATOM   2364 N  N     . GLY A 1 349 ? 14.653  -2.788  22.010  1.00 78.34  ? 568 GLY A N     1 
ATOM   2365 C  CA    . GLY A 1 349 ? 14.716  -1.356  22.241  1.00 80.60  ? 568 GLY A CA    1 
ATOM   2366 C  C     . GLY A 1 349 ? 13.565  -0.798  23.039  1.00 82.53  ? 568 GLY A C     1 
ATOM   2367 O  O     . GLY A 1 349 ? 12.425  -1.249  22.903  1.00 80.35  ? 568 GLY A O     1 
ATOM   2368 N  N     . ILE A 1 350 ? 13.864  0.194   23.877  1.00 81.54  ? 569 ILE A N     1 
ATOM   2369 C  CA    . ILE A 1 350 ? 12.877  0.908   24.699  1.00 81.45  ? 569 ILE A CA    1 
ATOM   2370 C  C     . ILE A 1 350 ? 11.656  1.377   23.863  1.00 90.99  ? 569 ILE A C     1 
ATOM   2371 O  O     . ILE A 1 350 ? 10.532  1.315   24.344  1.00 91.21  ? 569 ILE A O     1 
ATOM   2372 C  CB    . ILE A 1 350 ? 13.537  2.080   25.495  1.00 85.68  ? 569 ILE A CB    1 
ATOM   2373 C  CG1   . ILE A 1 350 ? 12.543  2.707   26.490  1.00 85.20  ? 569 ILE A CG1   1 
ATOM   2374 C  CG2   . ILE A 1 350 ? 14.207  3.132   24.571  1.00 89.16  ? 569 ILE A CG2   1 
ATOM   2375 C  CD1   . ILE A 1 350 ? 13.197  3.553   27.564  1.00 95.36  ? 569 ILE A CD1   1 
ATOM   2376 N  N     . SER A 1 351 ? 11.881  1.808   22.622  1.00 91.47  ? 570 SER A N     1 
ATOM   2377 C  CA    . SER A 1 351 ? 10.834  2.315   21.733  1.00 94.96  ? 570 SER A CA    1 
ATOM   2378 C  C     . SER A 1 351 ? 9.839   1.245   21.290  1.00 97.64  ? 570 SER A C     1 
ATOM   2379 O  O     . SER A 1 351 ? 8.723   1.566   20.883  1.00 99.10  ? 570 SER A O     1 
ATOM   2380 C  CB    . SER A 1 351 ? 11.456  3.011   20.532  1.00 102.50 ? 570 SER A CB    1 
ATOM   2381 O  OG    . SER A 1 351 ? 12.225  4.112   20.997  1.00 122.65 ? 570 SER A OG    1 
ATOM   2382 N  N     . SER A 1 352 ? 10.235  -0.023  21.384  1.00 90.19  ? 571 SER A N     1 
ATOM   2383 C  CA    . SER A 1 352 ? 9.386   -1.132  20.991  1.00 86.72  ? 571 SER A CA    1 
ATOM   2384 C  C     . SER A 1 352 ? 8.725   -1.802  22.169  1.00 88.08  ? 571 SER A C     1 
ATOM   2385 O  O     . SER A 1 352 ? 7.953   -2.727  21.977  1.00 84.66  ? 571 SER A O     1 
ATOM   2386 C  CB    . SER A 1 352 ? 10.201  -2.144  20.202  1.00 87.37  ? 571 SER A CB    1 
ATOM   2387 O  OG    . SER A 1 352 ? 10.678  -1.589  18.987  1.00 96.98  ? 571 SER A OG    1 
ATOM   2388 N  N     . CYS A 1 353 ? 8.990   -1.313  23.380  1.00 87.65  ? 572 CYS A N     1 
ATOM   2389 C  CA    . CYS A 1 353 ? 8.492   -1.902  24.609  1.00 85.85  ? 572 CYS A CA    1 
ATOM   2390 C  C     . CYS A 1 353 ? 7.036   -2.318  24.624  1.00 85.83  ? 572 CYS A C     1 
ATOM   2391 O  O     . CYS A 1 353 ? 6.738   -3.412  25.072  1.00 82.84  ? 572 CYS A O     1 
ATOM   2392 C  CB    . CYS A 1 353 ? 8.839   -1.073  25.830  1.00 89.16  ? 572 CYS A CB    1 
ATOM   2393 S  SG    . CYS A 1 353 ? 8.583   -1.968  27.375  1.00 91.24  ? 572 CYS A SG    1 
ATOM   2394 N  N     . GLU A 1 354 ? 6.130   -1.458  24.189  1.00 84.38  ? 573 GLU A N     1 
ATOM   2395 C  CA    . GLU A 1 354 ? 4.712   -1.800  24.184  1.00 83.73  ? 573 GLU A CA    1 
ATOM   2396 C  C     . GLU A 1 354 ? 4.381   -2.926  23.233  1.00 83.17  ? 573 GLU A C     1 
ATOM   2397 O  O     . GLU A 1 354 ? 3.555   -3.771  23.567  1.00 81.32  ? 573 GLU A O     1 
ATOM   2398 C  CB    . GLU A 1 354 ? 3.822   -0.581  23.928  1.00 89.57  ? 573 GLU A CB    1 
ATOM   2399 C  CG    . GLU A 1 354 ? 3.275   0.046   25.213  1.00 108.21 ? 573 GLU A CG    1 
ATOM   2400 C  CD    . GLU A 1 354 ? 3.150   -0.827  26.456  1.00 126.26 ? 573 GLU A CD    1 
ATOM   2401 O  OE1   . GLU A 1 354 ? 2.437   -1.859  26.401  1.00 129.02 ? 573 GLU A OE1   1 
ATOM   2402 O  OE2   . GLU A 1 354 ? 3.787   -0.486  27.481  1.00 105.87 ? 573 GLU A OE2   1 
ATOM   2403 N  N     . TYR A 1 355 ? 5.043   -2.958  22.064  1.00 77.39  ? 574 TYR A N     1 
ATOM   2404 C  CA    . TYR A 1 355 ? 4.866   -4.039  21.107  1.00 75.06  ? 574 TYR A CA    1 
ATOM   2405 C  C     . TYR A 1 355 ? 5.454   -5.348  21.661  1.00 74.58  ? 574 TYR A C     1 
ATOM   2406 O  O     . TYR A 1 355 ? 4.871   -6.411  21.483  1.00 73.04  ? 574 TYR A O     1 
ATOM   2407 C  CB    . TYR A 1 355 ? 5.505   -3.675  19.775  1.00 79.14  ? 574 TYR A CB    1 
ATOM   2408 C  CG    . TYR A 1 355 ? 4.971   -2.393  19.181  1.00 87.70  ? 574 TYR A CG    1 
ATOM   2409 C  CD1   . TYR A 1 355 ? 5.670   -1.196  19.310  1.00 94.63  ? 574 TYR A CD1   1 
ATOM   2410 C  CD2   . TYR A 1 355 ? 3.740   -2.362  18.539  1.00 89.93  ? 574 TYR A CD2   1 
ATOM   2411 C  CE1   . TYR A 1 355 ? 5.166   0.000   18.792  1.00 100.05 ? 574 TYR A CE1   1 
ATOM   2412 C  CE2   . TYR A 1 355 ? 3.249   -1.187  17.969  1.00 95.69  ? 574 TYR A CE2   1 
ATOM   2413 C  CZ    . TYR A 1 355 ? 3.963   -0.005  18.105  1.00 111.42 ? 574 TYR A CZ    1 
ATOM   2414 O  OH    . TYR A 1 355 ? 3.476   1.165   17.568  1.00 122.17 ? 574 TYR A OH    1 
ATOM   2415 N  N     . THR A 1 356 ? 6.605   -5.258  22.344  1.00 70.14  ? 575 THR A N     1 
ATOM   2416 C  CA    . THR A 1 356 ? 7.254   -6.388  22.997  1.00 67.03  ? 575 THR A CA    1 
ATOM   2417 C  C     . THR A 1 356 ? 6.313   -6.986  24.034  1.00 69.28  ? 575 THR A C     1 
ATOM   2418 O  O     . THR A 1 356 ? 6.102   -8.195  24.034  1.00 67.11  ? 575 THR A O     1 
ATOM   2419 C  CB    . THR A 1 356 ? 8.590   -5.965  23.590  1.00 69.78  ? 575 THR A CB    1 
ATOM   2420 O  OG1   . THR A 1 356 ? 9.494   -5.735  22.507  1.00 68.34  ? 575 THR A OG1   1 
ATOM   2421 C  CG2   . THR A 1 356 ? 9.174   -7.007  24.539  1.00 63.94  ? 575 THR A CG2   1 
ATOM   2422 N  N     . LEU A 1 357 ? 5.733   -6.157  24.891  1.00 67.60  ? 576 LEU A N     1 
ATOM   2423 C  CA    . LEU A 1 357 ? 4.808   -6.643  25.912  1.00 66.59  ? 576 LEU A CA    1 
ATOM   2424 C  C     . LEU A 1 357 ? 3.590   -7.311  25.313  1.00 71.37  ? 576 LEU A C     1 
ATOM   2425 O  O     . LEU A 1 357 ? 3.168   -8.341  25.829  1.00 71.70  ? 576 LEU A O     1 
ATOM   2426 C  CB    . LEU A 1 357 ? 4.416   -5.564  26.923  1.00 67.72  ? 576 LEU A CB    1 
ATOM   2427 C  CG    . LEU A 1 357 ? 5.521   -5.103  27.879  1.00 68.76  ? 576 LEU A CG    1 
ATOM   2428 C  CD1   . LEU A 1 357 ? 5.195   -3.731  28.406  1.00 68.11  ? 576 LEU A CD1   1 
ATOM   2429 C  CD2   . LEU A 1 357 ? 5.816   -6.157  29.011  1.00 64.59  ? 576 LEU A CD2   1 
ATOM   2430 N  N     . ASN A 1 358 ? 3.073   -6.785  24.197  1.00 68.08  ? 577 ASN A N     1 
ATOM   2431 C  CA    . ASN A 1 358 ? 1.964   -7.435  23.506  1.00 67.63  ? 577 ASN A CA    1 
ATOM   2432 C  C     . ASN A 1 358 ? 2.372   -8.821  23.017  1.00 71.90  ? 577 ASN A C     1 
ATOM   2433 O  O     . ASN A 1 358 ? 1.613   -9.766  23.184  1.00 72.21  ? 577 ASN A O     1 
ATOM   2434 C  CB    . ASN A 1 358 ? 1.514   -6.632  22.331  1.00 63.27  ? 577 ASN A CB    1 
ATOM   2435 C  CG    . ASN A 1 358 ? 0.782   -5.383  22.679  1.00 81.25  ? 577 ASN A CG    1 
ATOM   2436 O  OD1   . ASN A 1 358 ? 0.322   -5.189  23.807  1.00 82.04  ? 577 ASN A OD1   1 
ATOM   2437 N  ND2   . ASN A 1 358 ? 0.699   -4.493  21.699  1.00 75.42  ? 577 ASN A ND2   1 
ATOM   2438 N  N     . THR A 1 359 ? 3.568   -8.951  22.427  1.00 66.64  ? 578 THR A N     1 
ATOM   2439 C  CA    . THR A 1 359 ? 4.056   -10.229 21.936  1.00 63.89  ? 578 THR A CA    1 
ATOM   2440 C  C     . THR A 1 359 ? 4.171   -11.231 23.094  1.00 67.82  ? 578 THR A C     1 
ATOM   2441 O  O     . THR A 1 359 ? 3.785   -12.395 22.950  1.00 67.71  ? 578 THR A O     1 
ATOM   2442 C  CB    . THR A 1 359 ? 5.380   -10.041 21.219  1.00 66.09  ? 578 THR A CB    1 
ATOM   2443 O  OG1   . THR A 1 359 ? 5.201   -9.264  20.035  1.00 65.43  ? 578 THR A OG1   1 
ATOM   2444 C  CG2   . THR A 1 359 ? 6.026   -11.354 20.867  1.00 59.87  ? 578 THR A CG2   1 
ATOM   2445 N  N     . LEU A 1 360 ? 4.724   -10.779 24.239  1.00 63.98  ? 579 LEU A N     1 
ATOM   2446 C  CA    . LEU A 1 360 ? 4.945   -11.614 25.432  1.00 60.47  ? 579 LEU A CA    1 
ATOM   2447 C  C     . LEU A 1 360 ? 3.631   -12.025 26.088  1.00 61.79  ? 579 LEU A C     1 
ATOM   2448 O  O     . LEU A 1 360 ? 3.468   -13.162 26.494  1.00 60.74  ? 579 LEU A O     1 
ATOM   2449 C  CB    . LEU A 1 360 ? 5.866   -10.918 26.443  1.00 59.88  ? 579 LEU A CB    1 
ATOM   2450 C  CG    . LEU A 1 360 ? 7.304   -10.650 25.977  1.00 61.76  ? 579 LEU A CG    1 
ATOM   2451 C  CD1   . LEU A 1 360 ? 7.972   -9.643  26.881  1.00 60.66  ? 579 LEU A CD1   1 
ATOM   2452 C  CD2   . LEU A 1 360 ? 8.113   -11.953 25.862  1.00 57.76  ? 579 LEU A CD2   1 
ATOM   2453 N  N     . ARG A 1 361 ? 2.699   -11.112 26.187  1.00 59.44  ? 580 ARG A N     1 
ATOM   2454 C  CA    . ARG A 1 361 ? 1.370   -11.422 26.708  1.00 60.48  ? 580 ARG A CA    1 
ATOM   2455 C  C     . ARG A 1 361 ? 0.680   -12.487 25.843  1.00 65.99  ? 580 ARG A C     1 
ATOM   2456 O  O     . ARG A 1 361 ? 0.103   -13.414 26.384  1.00 67.08  ? 580 ARG A O     1 
ATOM   2457 C  CB    . ARG A 1 361 ? 0.518   -10.167 26.804  1.00 60.36  ? 580 ARG A CB    1 
ATOM   2458 C  CG    . ARG A 1 361 ? 1.010   -9.276  27.989  1.00 77.17  ? 580 ARG A CG    1 
ATOM   2459 C  CD    . ARG A 1 361 ? 0.132   -8.048  28.300  1.00 87.41  ? 580 ARG A CD    1 
ATOM   2460 N  NE    . ARG A 1 361 ? 0.312   -6.916  27.371  1.00 93.17  ? 580 ARG A NE    1 
ATOM   2461 C  CZ    . ARG A 1 361 ? 0.965   -5.785  27.655  1.00 111.75 ? 580 ARG A CZ    1 
ATOM   2462 N  NH1   . ARG A 1 361 ? 1.537   -5.615  28.850  1.00 89.44  ? 580 ARG A NH1   1 
ATOM   2463 N  NH2   . ARG A 1 361 ? 1.056   -4.817  26.745  1.00 105.30 ? 580 ARG A NH2   1 
ATOM   2464 N  N     . TYR A 1 362 ? 0.793   -12.393 24.514  1.00 61.57  ? 581 TYR A N     1 
ATOM   2465 C  CA    . TYR A 1 362 ? 0.212   -13.354 23.605  1.00 60.14  ? 581 TYR A CA    1 
ATOM   2466 C  C     . TYR A 1 362 ? 0.886   -14.709 23.798  1.00 64.44  ? 581 TYR A C     1 
ATOM   2467 O  O     . TYR A 1 362 ? 0.189   -15.701 23.967  1.00 63.56  ? 581 TYR A O     1 
ATOM   2468 C  CB    . TYR A 1 362 ? 0.359   -12.876 22.157  1.00 60.18  ? 581 TYR A CB    1 
ATOM   2469 C  CG    . TYR A 1 362 ? -0.083  -13.855 21.085  1.00 59.86  ? 581 TYR A CG    1 
ATOM   2470 C  CD1   . TYR A 1 362 ? -1.296  -13.685 20.411  1.00 62.00  ? 581 TYR A CD1   1 
ATOM   2471 C  CD2   . TYR A 1 362 ? 0.740   -14.908 20.687  1.00 59.67  ? 581 TYR A CD2   1 
ATOM   2472 C  CE1   . TYR A 1 362 ? -1.675  -14.530 19.361  1.00 58.89  ? 581 TYR A CE1   1 
ATOM   2473 C  CE2   . TYR A 1 362 ? 0.357   -15.780 19.664  1.00 61.12  ? 581 TYR A CE2   1 
ATOM   2474 C  CZ    . TYR A 1 362 ? -0.857  -15.587 19.007  1.00 67.27  ? 581 TYR A CZ    1 
ATOM   2475 O  OH    . TYR A 1 362 ? -1.232  -16.421 17.983  1.00 70.23  ? 581 TYR A OH    1 
ATOM   2476 N  N     . ALA A 1 363 ? 2.225   -14.770 23.722  1.00 63.22  ? 582 ALA A N     1 
ATOM   2477 C  CA    . ALA A 1 363 ? 2.973   -16.019 23.882  1.00 64.04  ? 582 ALA A CA    1 
ATOM   2478 C  C     . ALA A 1 363 ? 2.708   -16.658 25.238  1.00 71.11  ? 582 ALA A C     1 
ATOM   2479 O  O     . ALA A 1 363 ? 2.604   -17.863 25.341  1.00 72.39  ? 582 ALA A O     1 
ATOM   2480 C  CB    . ALA A 1 363 ? 4.459   -15.787 23.678  1.00 64.48  ? 582 ALA A CB    1 
ATOM   2481 N  N     . ASP A 1 364 ? 2.523   -15.865 26.252  1.00 70.91  ? 583 ASP A N     1 
ATOM   2482 C  CA    . ASP A 1 364 ? 2.153   -16.326 27.577  1.00 73.11  ? 583 ASP A CA    1 
ATOM   2483 C  C     . ASP A 1 364 ? 0.807   -17.103 27.588  1.00 78.72  ? 583 ASP A C     1 
ATOM   2484 O  O     . ASP A 1 364 ? 0.661   -18.039 28.356  1.00 81.26  ? 583 ASP A O     1 
ATOM   2485 C  CB    . ASP A 1 364 ? 2.022   -15.088 28.472  1.00 76.86  ? 583 ASP A CB    1 
ATOM   2486 C  CG    . ASP A 1 364 ? 2.478   -15.254 29.894  1.00 98.05  ? 583 ASP A CG    1 
ATOM   2487 O  OD1   . ASP A 1 364 ? 2.716   -16.413 30.309  1.00 100.99 ? 583 ASP A OD1   1 
ATOM   2488 O  OD2   . ASP A 1 364 ? 2.600   -14.222 30.599  1.00 109.71 ? 583 ASP A OD2   1 
ATOM   2489 N  N     . ARG A 1 365 ? -0.175  -16.694 26.780  1.00 75.58  ? 584 ARG A N     1 
ATOM   2490 C  CA    . ARG A 1 365 ? -1.505  -17.316 26.713  1.00 77.54  ? 584 ARG A CA    1 
ATOM   2491 C  C     . ARG A 1 365 ? -1.578  -18.502 25.744  1.00 82.49  ? 584 ARG A C     1 
ATOM   2492 O  O     . ARG A 1 365 ? -2.583  -19.195 25.735  1.00 83.51  ? 584 ARG A O     1 
ATOM   2493 C  CB    . ARG A 1 365 ? -2.550  -16.282 26.310  1.00 80.67  ? 584 ARG A CB    1 
ATOM   2494 C  CG    . ARG A 1 365 ? -2.710  -15.116 27.271  1.00 102.03 ? 584 ARG A CG    1 
ATOM   2495 C  CD    . ARG A 1 365 ? -3.821  -14.173 26.829  1.00 127.95 ? 584 ARG A CD    1 
ATOM   2496 N  NE    . ARG A 1 365 ? -5.133  -14.827 26.699  1.00 148.26 ? 584 ARG A NE    1 
ATOM   2497 C  CZ    . ARG A 1 365 ? -6.279  -14.188 26.459  1.00 164.42 ? 584 ARG A CZ    1 
ATOM   2498 N  NH1   . ARG A 1 365 ? -6.301  -12.864 26.347  1.00 147.24 ? 584 ARG A NH1   1 
ATOM   2499 N  NH2   . ARG A 1 365 ? -7.412  -14.868 26.342  1.00 154.05 ? 584 ARG A NH2   1 
ATOM   2500 N  N     . VAL A 1 366 ? -0.528  -18.742 24.950  1.00 79.25  ? 585 VAL A N     1 
ATOM   2501 C  CA    . VAL A 1 366 ? -0.480  -19.835 23.980  1.00 81.42  ? 585 VAL A CA    1 
ATOM   2502 C  C     . VAL A 1 366 ? -0.389  -21.206 24.659  1.00 96.99  ? 585 VAL A C     1 
ATOM   2503 O  O     . VAL A 1 366 ? -1.054  -22.149 24.222  1.00 99.72  ? 585 VAL A O     1 
ATOM   2504 C  CB    . VAL A 1 366 ? 0.617   -19.587 22.914  1.00 81.41  ? 585 VAL A CB    1 
ATOM   2505 C  CG1   . VAL A 1 366 ? 0.991   -20.844 22.181  1.00 80.75  ? 585 VAL A CG1   1 
ATOM   2506 C  CG2   . VAL A 1 366 ? 0.163   -18.526 21.931  1.00 80.75  ? 585 VAL A CG2   1 
ATOM   2507 N  N     . LYS A 1 367 ? 0.426   -21.324 25.706  1.00 99.24  ? 586 LYS A N     1 
ATOM   2508 C  CA    . LYS A 1 367 ? 0.574   -22.585 26.422  1.00 103.87 ? 586 LYS A CA    1 
ATOM   2509 C  C     . LYS A 1 367 ? 0.031   -22.298 27.793  1.00 116.06 ? 586 LYS A C     1 
ATOM   2510 O  O     . LYS A 1 367 ? 0.674   -21.639 28.609  1.00 115.64 ? 586 LYS A O     1 
ATOM   2511 C  CB    . LYS A 1 367 ? 2.032   -23.060 26.431  1.00 105.78 ? 586 LYS A CB    1 
ATOM   2512 C  CG    . LYS A 1 367 ? 2.280   -24.414 27.086  1.00 111.31 ? 586 LYS A CG    1 
ATOM   2513 C  CD    . LYS A 1 367 ? 3.744   -24.815 26.939  1.00 109.26 ? 586 LYS A CD    1 
ATOM   2514 C  CE    . LYS A 1 367 ? 4.049   -26.034 27.765  1.00 120.80 ? 586 LYS A CE    1 
ATOM   2515 N  NZ    . LYS A 1 367 ? 5.440   -26.512 27.575  1.00 125.55 ? 586 LYS A NZ    1 
ATOM   2516 N  N     . GLU A 1 368 ? -1.274  -22.497 27.880  1.00 118.61 ? 587 GLU A N     1 
ATOM   2517 C  CA    . GLU A 1 368 ? -2.085  -22.284 29.062  1.00 122.89 ? 587 GLU A CA    1 
ATOM   2518 C  C     . GLU A 1 368 ? -3.015  -23.494 29.078  1.00 132.93 ? 587 GLU A C     1 
ATOM   2519 O  O     . GLU A 1 368 ? -3.658  -23.811 28.058  1.00 133.28 ? 587 GLU A O     1 
ATOM   2520 C  CB    . GLU A 1 368 ? -2.865  -20.947 28.975  1.00 124.23 ? 587 GLU A CB    1 
ATOM   2521 C  CG    . GLU A 1 368 ? -3.386  -20.418 30.306  1.00 135.43 ? 587 GLU A CG    1 
ATOM   2522 C  CD    . GLU A 1 368 ? -4.259  -19.180 30.204  1.00 152.29 ? 587 GLU A CD    1 
ATOM   2523 O  OE1   . GLU A 1 368 ? -3.710  -18.075 29.986  1.00 138.39 ? 587 GLU A OE1   1 
ATOM   2524 O  OE2   . GLU A 1 368 ? -5.496  -19.313 30.353  1.00 151.04 ? 587 GLU A OE2   1 
ATOM   2525 N  N     . LEU A 1 369 ? -3.000  -24.210 30.214  1.00 132.59 ? 588 LEU A N     1 
ATOM   2526 C  CA    . LEU A 1 369 ? -3.744  -25.445 30.470  1.00 168.62 ? 588 LEU A CA    1 
ATOM   2527 C  C     . LEU A 1 369 ? -5.262  -25.261 30.383  1.00 203.96 ? 588 LEU A C     1 
ATOM   2528 O  O     . LEU A 1 369 ? -5.833  -25.360 29.295  1.00 161.76 ? 588 LEU A O     1 
ATOM   2529 C  CB    . LEU A 1 369 ? -3.334  -26.024 31.835  1.00 171.43 ? 588 LEU A CB    1 
ATOM   2530 C  CG    . LEU A 1 369 ? -1.829  -26.014 32.119  1.00 173.81 ? 588 LEU A CG    1 
ATOM   2531 C  CD1   . LEU A 1 369 ? -1.496  -25.051 33.233  1.00 173.61 ? 588 LEU A CD1   1 
ATOM   2532 C  CD2   . LEU A 1 369 ? -1.314  -27.402 32.410  1.00 178.65 ? 588 LEU A CD2   1 
HETATM 2533 MG MG    . MG  B 2 .   ? 9.801   -10.846 7.715   1.00 106.30 2 701 MG  A MG    1 
HETATM 2534 P  PB    . ADP C 3 .   ? 10.796  -9.659  10.716  1.00 87.94  ? 702 ADP A PB    1 
HETATM 2535 O  O1B   . ADP C 3 .   ? 10.691  -10.748 9.704   1.00 92.17  ? 702 ADP A O1B   1 
HETATM 2536 O  O2B   . ADP C 3 .   ? 10.277  -10.097 12.013  1.00 81.91  ? 702 ADP A O2B   1 
HETATM 2537 O  O3B   . ADP C 3 .   ? 10.079  -8.396  10.232  1.00 91.35  ? 702 ADP A O3B   1 
HETATM 2538 P  PA    . ADP C 3 .   ? 13.675  -9.642  10.083  1.00 100.80 ? 702 ADP A PA    1 
HETATM 2539 O  O1A   . ADP C 3 .   ? 13.496  -9.189  8.678   1.00 107.47 ? 702 ADP A O1A   1 
HETATM 2540 O  O2A   . ADP C 3 .   ? 14.007  -11.135 10.136  1.00 96.54  ? 702 ADP A O2A   1 
HETATM 2541 O  O3A   . ADP C 3 .   ? 12.345  -9.316  10.912  1.00 95.33  ? 702 ADP A O3A   1 
HETATM 2542 O  "O5'" . ADP C 3 .   ? 14.821  -8.814  10.793  1.00 104.78 ? 702 ADP A "O5'" 1 
HETATM 2543 C  "C5'" . ADP C 3 .   ? 15.117  -7.426  10.519  1.00 110.03 ? 702 ADP A "C5'" 1 
HETATM 2544 C  "C4'" . ADP C 3 .   ? 16.618  -7.246  10.473  1.00 116.89 ? 702 ADP A "C4'" 1 
HETATM 2545 O  "O4'" . ADP C 3 .   ? 17.192  -7.638  11.743  1.00 115.17 ? 702 ADP A "O4'" 1 
HETATM 2546 C  "C3'" . ADP C 3 .   ? 17.386  -8.023  9.400   1.00 120.70 ? 702 ADP A "C3'" 1 
HETATM 2547 O  "O3'" . ADP C 3 .   ? 18.438  -7.252  8.822   1.00 126.50 ? 702 ADP A "O3'" 1 
HETATM 2548 C  "C2'" . ADP C 3 .   ? 17.872  -9.257  10.167  1.00 118.04 ? 702 ADP A "C2'" 1 
HETATM 2549 O  "O2'" . ADP C 3 .   ? 19.006  -9.916  9.618   1.00 123.21 ? 702 ADP A "O2'" 1 
HETATM 2550 C  "C1'" . ADP C 3 .   ? 18.153  -8.659  11.545  1.00 114.68 ? 702 ADP A "C1'" 1 
HETATM 2551 N  N9    . ADP C 3 .   ? 18.056  -9.613  12.647  1.00 106.27 ? 702 ADP A N9    1 
HETATM 2552 C  C8    . ADP C 3 .   ? 16.924  -10.210 13.143  1.00 100.68 ? 702 ADP A C8    1 
HETATM 2553 N  N7    . ADP C 3 .   ? 17.155  -11.097 14.081  1.00 97.72  ? 702 ADP A N7    1 
HETATM 2554 C  C5    . ADP C 3 .   ? 18.537  -11.069 14.228  1.00 101.39 ? 702 ADP A C5    1 
HETATM 2555 C  C6    . ADP C 3 .   ? 19.425  -11.768 15.083  1.00 99.83  ? 702 ADP A C6    1 
HETATM 2556 N  N6    . ADP C 3 .   ? 19.028  -12.645 16.013  1.00 93.71  ? 702 ADP A N6    1 
HETATM 2557 N  N1    . ADP C 3 .   ? 20.750  -11.502 14.971  1.00 103.87 ? 702 ADP A N1    1 
HETATM 2558 C  C2    . ADP C 3 .   ? 21.153  -10.586 14.080  1.00 107.11 ? 702 ADP A C2    1 
HETATM 2559 N  N3    . ADP C 3 .   ? 20.410  -9.861  13.235  1.00 107.89 ? 702 ADP A N3    1 
HETATM 2560 C  C4    . ADP C 3 .   ? 19.103  -10.155 13.353  1.00 104.49 ? 702 ADP A C4    1 
HETATM 2561 S  S     . SO4 D 4 .   ? -3.611  -36.803 1.523   1.00 171.22 ? 703 SO4 A S     1 
HETATM 2562 O  O1    . SO4 D 4 .   ? -2.982  -35.749 0.717   1.00 169.57 ? 703 SO4 A O1    1 
HETATM 2563 O  O2    . SO4 D 4 .   ? -4.971  -37.020 1.038   1.00 172.97 ? 703 SO4 A O2    1 
HETATM 2564 O  O3    . SO4 D 4 .   ? -2.869  -38.073 1.414   1.00 170.45 ? 703 SO4 A O3    1 
HETATM 2565 O  O4    . SO4 D 4 .   ? -3.663  -36.371 2.925   1.00 171.00 ? 703 SO4 A O4    1 
HETATM 2566 S  S     . SO4 E 4 .   ? -8.804  -14.783 6.458   1.00 168.54 ? 704 SO4 A S     1 
HETATM 2567 O  O1    . SO4 E 4 .   ? -9.357  -13.700 5.655   1.00 168.96 ? 704 SO4 A O1    1 
HETATM 2568 O  O2    . SO4 E 4 .   ? -7.493  -15.173 5.938   1.00 167.83 ? 704 SO4 A O2    1 
HETATM 2569 O  O3    . SO4 E 4 .   ? -9.743  -15.908 6.395   1.00 168.02 ? 704 SO4 A O3    1 
HETATM 2570 O  O4    . SO4 E 4 .   ? -8.631  -14.333 7.845   1.00 169.58 ? 704 SO4 A O4    1 
HETATM 2571 S  S     . SO4 F 4 .   ? 22.185  -34.416 21.044  1.00 196.15 ? 705 SO4 A S     1 
HETATM 2572 O  O1    . SO4 F 4 .   ? 21.977  -33.529 19.898  1.00 196.30 ? 705 SO4 A O1    1 
HETATM 2573 O  O2    . SO4 F 4 .   ? 22.388  -35.786 20.570  1.00 196.15 ? 705 SO4 A O2    1 
HETATM 2574 O  O3    . SO4 F 4 .   ? 21.005  -34.370 21.912  1.00 195.74 ? 705 SO4 A O3    1 
HETATM 2575 O  O4    . SO4 F 4 .   ? 23.367  -33.971 21.791  1.00 195.69 ? 705 SO4 A O4    1 
HETATM 2576 O  O     . HOH G 5 .   ? 12.832  -2.844  40.658  1.00 73.46  ? 801 HOH A O     1 
HETATM 2577 O  O     . HOH G 5 .   ? 4.611   -10.913 33.915  1.00 66.42  ? 802 HOH A O     1 
HETATM 2578 O  O     . HOH G 5 .   ? -18.027 -28.594 6.530   1.00 77.56  ? 803 HOH A O     1 
HETATM 2579 O  O     . HOH G 5 .   ? 20.185  -17.690 24.921  1.00 65.65  ? 804 HOH A O     1 
HETATM 2580 O  O     . HOH G 5 .   ? 5.014   -19.671 32.274  1.00 90.67  ? 805 HOH A O     1 
HETATM 2581 O  O     . HOH G 5 .   ? 5.151   -16.032 31.970  1.00 68.98  ? 806 HOH A O     1 
HETATM 2582 O  O     . HOH G 5 .   ? 2.797   -4.568  31.328  1.00 104.04 ? 807 HOH A O     1 
HETATM 2583 O  O     . HOH G 5 .   ? -20.071 -29.200 8.265   1.00 73.45  ? 808 HOH A O     1 
HETATM 2584 O  O     . HOH G 5 .   ? 15.191  -3.318  40.283  1.00 71.03  ? 809 HOH A O     1 
HETATM 2585 O  O     . HOH G 5 .   ? 19.443  -18.165 27.455  1.00 76.33  ? 810 HOH A O     1 
HETATM 2586 O  O     . HOH G 5 .   ? 20.258  -10.533 28.535  1.00 89.49  ? 811 HOH A O     1 
HETATM 2587 O  O     . HOH G 5 .   ? 25.326  -15.667 17.253  1.00 90.36  ? 812 HOH A O     1 
HETATM 2588 O  O     . HOH G 5 .   ? -10.952 -31.652 1.284   1.00 88.81  ? 813 HOH A O     1 
HETATM 2589 O  O     . HOH G 5 .   ? 8.052   -11.915 8.380   1.00 74.59  ? 814 HOH A O     1 
HETATM 2590 O  O     . HOH G 5 .   ? 11.399  -9.603  6.981   1.00 102.12 ? 815 HOH A O     1 
HETATM 2591 O  O     . HOH G 5 .   ? 9.004   -6.504  19.863  1.00 57.83  ? 816 HOH A O     1 
HETATM 2592 O  O     . HOH G 5 .   ? 3.205   -12.282 14.372  1.00 65.44  ? 817 HOH A O     1 
HETATM 2593 O  O     . HOH G 5 .   ? 11.357  -4.002  23.494  1.00 74.49  ? 818 HOH A O     1 
HETATM 2594 O  O     . HOH G 5 .   ? 6.961   -28.968 20.292  1.00 74.66  ? 819 HOH A O     1 
HETATM 2595 O  O     . HOH G 5 .   ? 1.663   -29.782 9.423   1.00 81.40  ? 820 HOH A O     1 
HETATM 2596 O  O     . HOH G 5 .   ? -4.955  -16.024 7.411   1.00 67.01  ? 821 HOH A O     1 
HETATM 2597 O  O     . HOH G 5 .   ? 3.954   -6.535  18.720  1.00 64.94  ? 822 HOH A O     1 
HETATM 2598 O  O     . HOH G 5 .   ? 7.719   -8.569  19.017  1.00 73.05  ? 823 HOH A O     1 
HETATM 2599 O  O     . HOH G 5 .   ? 23.189  -4.118  11.852  1.00 93.00  ? 824 HOH A O     1 
HETATM 2600 O  O     . HOH G 5 .   ? 5.868   -11.040 8.354   1.00 78.21  ? 825 HOH A O     1 
HETATM 2601 O  O     . HOH G 5 .   ? 6.625   -8.810  9.891   1.00 80.63  ? 826 HOH A O     1 
HETATM 2602 O  O     . HOH G 5 .   ? 14.389  -12.359 17.599  1.00 81.14  ? 827 HOH A O     1 
HETATM 2603 O  O     . HOH G 5 .   ? -5.768  -28.822 6.974   1.00 73.77  ? 828 HOH A O     1 
HETATM 2604 O  O     . HOH G 5 .   ? -1.770  -11.152 17.853  1.00 74.04  ? 829 HOH A O     1 
HETATM 2605 O  O     . HOH G 5 .   ? 24.414  -22.265 31.513  1.00 85.92  ? 830 HOH A O     1 
HETATM 2606 O  O     . HOH G 5 .   ? 7.019   -23.388 -11.444 1.00 103.70 ? 831 HOH A O     1 
HETATM 2607 O  O     . HOH G 5 .   ? -7.833  -30.675 7.499   1.00 76.13  ? 832 HOH A O     1 
HETATM 2608 O  O     . HOH G 5 .   ? 9.578   -28.423 20.077  1.00 76.03  ? 833 HOH A O     1 
HETATM 2609 O  O     . HOH G 5 .   ? -1.721  -7.708  25.386  1.00 85.80  ? 834 HOH A O     1 
HETATM 2610 O  O     . HOH G 5 .   ? -1.257  -9.997  23.332  1.00 81.99  ? 835 HOH A O     1 
HETATM 2611 O  O     . HOH G 5 .   ? -2.042  -28.498 6.732   1.00 96.99  ? 836 HOH A O     1 
HETATM 2612 O  O     . HOH G 5 .   ? 21.586  -2.500  10.956  1.00 100.68 ? 837 HOH A O     1 
HETATM 2613 O  O     . HOH G 5 .   ? 4.408   -18.478 29.614  1.00 82.55  ? 838 HOH A O     1 
HETATM 2614 O  O     . HOH G 5 .   ? 0.981   -28.914 15.048  1.00 68.25  ? 839 HOH A O     1 
HETATM 2615 O  O     . HOH G 5 .   ? 10.076  -16.955 5.596   1.00 78.84  ? 840 HOH A O     1 
HETATM 2616 O  O     . HOH G 5 .   ? -1.237  -8.732  20.449  1.00 97.86  ? 841 HOH A O     1 
HETATM 2617 O  O     . HOH G 5 .   ? -9.170  -23.058 22.094  1.00 92.02  ? 842 HOH A O     1 
HETATM 2618 O  O     . HOH G 5 .   ? 5.849   -13.519 6.178   1.00 89.25  ? 843 HOH A O     1 
HETATM 2619 O  O     . HOH G 5 .   ? 4.054   -24.372 -3.470  1.00 84.82  ? 844 HOH A O     1 
HETATM 2620 O  O     . HOH G 5 .   ? 20.879  -0.677  27.301  1.00 90.45  ? 845 HOH A O     1 
HETATM 2621 O  O     . HOH G 5 .   ? -7.640  -5.276  14.216  1.00 114.29 ? 846 HOH A O     1 
HETATM 2622 O  O     . HOH G 5 .   ? 16.236  -13.069 15.658  1.00 98.10  ? 847 HOH A O     1 
HETATM 2623 O  O     . HOH G 5 .   ? 18.824  -13.999 18.918  1.00 77.78  ? 848 HOH A O     1 
HETATM 2624 O  O     . HOH G 5 .   ? -4.920  -29.494 4.303   1.00 75.97  ? 849 HOH A O     1 
HETATM 2625 O  O     . HOH G 5 .   ? 15.805  -21.464 5.578   1.00 92.23  ? 850 HOH A O     1 
HETATM 2626 O  O     . HOH G 5 .   ? 22.428  -17.010 13.199  1.00 74.81  ? 851 HOH A O     1 
HETATM 2627 O  O     . HOH G 5 .   ? 3.467   -29.308 26.561  1.00 87.39  ? 852 HOH A O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N     . PHE A 14  ? 2.8043 1.7431 2.0983 -0.6556 -0.3793 0.0830  227 PHE A N     
2    C  CA    . PHE A 14  ? 2.9360 1.7098 2.1671 -0.6442 -0.4450 0.0859  227 PHE A CA    
3    C  C     . PHE A 14  ? 3.0206 1.6848 2.2257 -0.5573 -0.4897 0.0846  227 PHE A C     
4    O  O     . PHE A 14  ? 3.0535 1.6479 2.2602 -0.5024 -0.5278 0.0590  227 PHE A O     
5    C  CB    . PHE A 14  ? 3.1112 1.7790 2.2461 -0.7529 -0.4786 0.1224  227 PHE A CB    
6    N  N     . PRO A 15  ? 2.9605 1.6112 2.1432 -0.5406 -0.4889 0.1065  228 PRO A N     
7    C  CA    . PRO A 15  ? 2.9939 1.5434 2.1536 -0.4571 -0.5367 0.0994  228 PRO A CA    
8    C  C     . PRO A 15  ? 2.8949 1.5172 2.1366 -0.3511 -0.5230 0.0532  228 PRO A C     
9    O  O     . PRO A 15  ? 2.9321 1.4873 2.1703 -0.3063 -0.5627 0.0257  228 PRO A O     
10   C  CB    . PRO A 15  ? 3.0363 1.5753 2.1572 -0.4750 -0.5322 0.1339  228 PRO A CB    
11   C  CG    . PRO A 15  ? 3.1098 1.7027 2.2055 -0.5834 -0.4973 0.1651  228 PRO A CG    
12   C  CD    . PRO A 15  ? 2.9483 1.6710 2.1214 -0.5971 -0.4497 0.1358  228 PRO A CD    
13   N  N     . ASN A 16  ? 2.6783 1.4362 1.9894 -0.3143 -0.4689 0.0441  229 ASN A N     
14   C  CA    . ASN A 16  ? 2.5402 1.3836 1.9259 -0.2248 -0.4485 0.0062  229 ASN A CA    
15   C  C     . ASN A 16  ? 2.4795 1.3951 1.9215 -0.2092 -0.4280 -0.0259 229 ASN A C     
16   O  O     . ASN A 16  ? 2.3477 1.3913 1.8531 -0.2112 -0.3764 -0.0345 229 ASN A O     
17   C  CB    . ASN A 16  ? 2.4350 1.3864 1.8665 -0.2027 -0.4020 0.0114  229 ASN A CB    
18   C  CG    . ASN A 16  ? 2.8273 1.7091 2.2094 -0.1949 -0.4278 0.0343  229 ASN A CG    
19   O  OD1   . ASN A 16  ? 2.8611 1.6633 2.2194 -0.1380 -0.4732 0.0218  229 ASN A OD1   
20   N  ND2   . ASN A 16  ? 2.6889 1.6066 2.0567 -0.2488 -0.4002 0.0646  229 ASN A ND2   
21   N  N     . TRP A 17  ? 2.5132 1.3358 1.9263 -0.1931 -0.4751 -0.0444 230 TRP A N     
22   C  CA    . TRP A 17  ? 2.4795 1.3331 1.9278 -0.1722 -0.4748 -0.0783 230 TRP A CA    
23   C  C     . TRP A 17  ? 2.3471 1.3232 1.8488 -0.2147 -0.4223 -0.0800 230 TRP A C     
24   O  O     . TRP A 17  ? 2.3198 1.3306 1.8160 -0.2842 -0.3968 -0.0548 230 TRP A O     
25   C  CB    . TRP A 17  ? 2.4197 1.3121 1.9092 -0.0763 -0.4792 -0.1181 230 TRP A CB    
26   C  CG    . TRP A 17  ? 2.5490 1.3227 1.9931 -0.0245 -0.5415 -0.1342 230 TRP A CG    
27   C  CD1   . TRP A 17  ? 2.6425 1.3521 2.0503 -0.0072 -0.5676 -0.1189 230 TRP A CD1   
28   C  CD2   . TRP A 17  ? 2.6136 1.3284 2.0496 0.0252  -0.5873 -0.1754 230 TRP A CD2   
29   N  NE1   . TRP A 17  ? 2.7427 1.3494 2.1183 0.0498  -0.6314 -0.1481 230 TRP A NE1   
30   C  CE2   . TRP A 17  ? 2.7688 1.3790 2.1624 0.0720  -0.6440 -0.1850 230 TRP A CE2   
31   C  CE3   . TRP A 17  ? 2.6228 1.3620 2.0819 0.0360  -0.5891 -0.2077 230 TRP A CE3   
32   C  CZ2   . TRP A 17  ? 2.8512 1.3832 2.2280 0.1317  -0.7030 -0.2297 230 TRP A CZ2   
33   C  CZ3   . TRP A 17  ? 2.7313 1.3951 2.1721 0.0918  -0.6442 -0.2499 230 TRP A CZ3   
34   C  CH2   . TRP A 17  ? 2.8385 1.4007 2.2399 0.1403  -0.7009 -0.2625 230 TRP A CH2   
35   N  N     . GLU A 18  ? 2.1817 1.2243 1.7338 -0.1703 -0.4099 -0.1136 231 GLU A N     
36   C  CA    . GLU A 18  ? 2.0589 1.2200 1.6688 -0.1865 -0.3672 -0.1246 231 GLU A CA    
37   C  C     . GLU A 18  ? 1.9262 1.1964 1.5892 -0.1461 -0.3240 -0.1251 231 GLU A C     
38   O  O     . GLU A 18  ? 1.8231 1.1927 1.5390 -0.1327 -0.2932 -0.1396 231 GLU A O     
39   C  CB    . GLU A 18  ? 2.0861 1.2468 1.7120 -0.1551 -0.3848 -0.1599 231 GLU A CB    
40   C  CG    . GLU A 18  ? 2.2007 1.3667 1.8409 -0.0707 -0.3974 -0.1895 231 GLU A CG    
41   C  CD    . GLU A 18  ? 2.5205 1.5884 2.1255 -0.0412 -0.4507 -0.2178 231 GLU A CD    
42   O  OE1   . GLU A 18  ? 2.4685 1.4851 2.0544 0.0119  -0.4798 -0.2318 231 GLU A OE1   
43   O  OE2   . GLU A 18  ? 2.4466 1.4940 2.0463 -0.0676 -0.4649 -0.2306 231 GLU A OE2   
44   N  N     . PHE A 19  ? 1.8400 1.0864 1.4859 -0.1266 -0.3256 -0.1089 232 PHE A N     
45   C  CA    . PHE A 19  ? 1.7019 1.0397 1.3909 -0.0945 -0.2883 -0.1063 232 PHE A CA    
46   C  C     . PHE A 19  ? 1.6193 1.0497 1.3444 -0.1400 -0.2457 -0.0939 232 PHE A C     
47   O  O     . PHE A 19  ? 1.5061 1.0301 1.2833 -0.1151 -0.2157 -0.1051 232 PHE A O     
48   C  CB    . PHE A 19  ? 1.7528 1.0381 1.4110 -0.0718 -0.3039 -0.0922 232 PHE A CB    
49   C  CG    . PHE A 19  ? 1.6702 1.0414 1.3691 -0.0365 -0.2705 -0.0916 232 PHE A CG    
50   C  CD1   . PHE A 19  ? 1.6341 1.0820 1.3780 0.0115  -0.2524 -0.1147 232 PHE A CD1   
51   C  CD2   . PHE A 19  ? 1.6763 1.0480 1.3632 -0.0538 -0.2595 -0.0674 232 PHE A CD2   
52   C  CE1   . PHE A 19  ? 1.5635 1.0849 1.3398 0.0368  -0.2238 -0.1118 232 PHE A CE1   
53   C  CE2   . PHE A 19  ? 1.6303 1.0768 1.3536 -0.0224 -0.2313 -0.0679 232 PHE A CE2   
54   C  CZ    . PHE A 19  ? 1.5351 1.0540 1.3027 0.0209  -0.2140 -0.0894 232 PHE A CZ    
55   N  N     . ALA A 20  ? 1.6036 1.0094 1.2999 -0.2080 -0.2462 -0.0741 233 ALA A N     
56   C  CA    . ALA A 20  ? 1.5504 1.0544 1.2833 -0.2526 -0.2080 -0.0709 233 ALA A CA    
57   C  C     . ALA A 20  ? 1.5822 1.1616 1.3651 -0.2499 -0.1947 -0.0972 233 ALA A C     
58   O  O     . ALA A 20  ? 1.4974 1.1777 1.3334 -0.2436 -0.1639 -0.1073 233 ALA A O     
59   C  CB    . ALA A 20  ? 1.6372 1.1046 1.3230 -0.3318 -0.2129 -0.0475 233 ALA A CB    
60   N  N     . ARG A 21  ? 1.6181 1.1446 1.3834 -0.2498 -0.2221 -0.1103 234 ARG A N     
61   C  CA    . ARG A 21  ? 1.5859 1.1746 1.3927 -0.2452 -0.2156 -0.1363 234 ARG A CA    
62   C  C     . ARG A 21  ? 1.5551 1.2046 1.4059 -0.1777 -0.2020 -0.1521 234 ARG A C     
63   O  O     . ARG A 21  ? 1.4753 1.2125 1.3738 -0.1739 -0.1819 -0.1655 234 ARG A O     
64   C  CB    . ARG A 21  ? 1.6824 1.1903 1.4541 -0.2578 -0.2518 -0.1468 234 ARG A CB    
65   N  N     . MET A 22  ? 1.5344 1.1396 1.3675 -0.1263 -0.2149 -0.1517 235 MET A N     
66   C  CA    . MET A 22  ? 1.4710 1.1322 1.3358 -0.0697 -0.2022 -0.1634 235 MET A CA    
67   C  C     . MET A 22  ? 1.4079 1.1455 1.3090 -0.0687 -0.1697 -0.1520 235 MET A C     
68   O  O     . MET A 22  ? 1.3617 1.1647 1.2983 -0.0478 -0.1566 -0.1614 235 MET A O     
69   C  CB    . MET A 22  ? 1.5441 1.1539 1.3822 -0.0218 -0.2210 -0.1679 235 MET A CB    
70   C  CG    . MET A 22  ? 1.6954 1.2377 1.5041 -0.0082 -0.2565 -0.1886 235 MET A CG    
71   S  SD    . MET A 22  ? 1.8161 1.3101 1.5992 0.0543  -0.2823 -0.2044 235 MET A SD    
72   C  CE    . MET A 22  ? 1.7271 1.3023 1.5397 0.0985  -0.2715 -0.2340 235 MET A CE    
73   N  N     . ILE A 23  ? 1.3172 1.0419 1.2061 -0.0918 -0.1606 -0.1323 236 ILE A N     
74   C  CA    . ILE A 23  ? 1.2235 1.0157 1.1448 -0.0930 -0.1323 -0.1240 236 ILE A CA    
75   C  C     . ILE A 23  ? 1.2293 1.0999 1.1936 -0.1189 -0.1168 -0.1376 236 ILE A C     
76   O  O     . ILE A 23  ? 1.1622 1.0951 1.1656 -0.0945 -0.1038 -0.1455 236 ILE A O     
77   C  CB    . ILE A 23  ? 1.2695 1.0284 1.1630 -0.1145 -0.1288 -0.1021 236 ILE A CB    
78   C  CG1   . ILE A 23  ? 1.2829 0.9823 1.1464 -0.0737 -0.1453 -0.0955 236 ILE A CG1   
79   C  CG2   . ILE A 23  ? 1.2123 1.0463 1.1415 -0.1214 -0.1001 -0.0985 236 ILE A CG2   
80   C  CD1   . ILE A 23  ? 1.3406 0.9887 1.1668 -0.0909 -0.1522 -0.0745 236 ILE A CD1   
81   N  N     . LYS A 24  ? 1.2177 1.0835 1.1734 -0.1678 -0.1220 -0.1426 237 LYS A N     
82   C  CA    . LYS A 24  ? 1.1868 1.1348 1.1853 -0.1938 -0.1104 -0.1628 237 LYS A CA    
83   C  C     . LYS A 24  ? 1.2083 1.1919 1.2399 -0.1543 -0.1175 -0.1839 237 LYS A C     
84   O  O     . LYS A 24  ? 1.1698 1.2289 1.2473 -0.1422 -0.1077 -0.1992 237 LYS A O     
85   C  CB    . LYS A 24  ? 1.2854 1.2165 1.2606 -0.2580 -0.1175 -0.1642 237 LYS A CB    
86   C  CG    . LYS A 24  ? 1.4297 1.4649 1.4478 -0.2997 -0.0974 -0.1837 237 LYS A CG    
87   C  CD    . LYS A 24  ? 1.5838 1.6073 1.5658 -0.3788 -0.0950 -0.1734 237 LYS A CD    
88   C  CE    . LYS A 24  ? 1.6619 1.8063 1.6906 -0.4227 -0.0755 -0.2018 237 LYS A CE    
89   N  NZ    . LYS A 24  ? 1.7674 1.9330 1.8127 -0.4398 -0.0884 -0.2253 237 LYS A NZ    
90   N  N     . GLU A 25  ? 1.1862 1.1145 1.1925 -0.1321 -0.1378 -0.1862 238 GLU A N     
91   C  CA    . GLU A 25  ? 1.1488 1.1062 1.1764 -0.0969 -0.1464 -0.2037 238 GLU A CA    
92   C  C     . GLU A 25  ? 1.1059 1.0931 1.1503 -0.0525 -0.1372 -0.1974 238 GLU A C     
93   O  O     . GLU A 25  ? 1.1000 1.1345 1.1725 -0.0338 -0.1396 -0.2091 238 GLU A O     
94   C  CB    . GLU A 25  ? 1.2103 1.1039 1.2029 -0.0825 -0.1693 -0.2094 238 GLU A CB    
95   N  N     . PHE A 26  ? 0.9888 0.9464 1.0136 -0.0376 -0.1296 -0.1785 239 PHE A N     
96   C  CA    . PHE A 26  ? 0.9142 0.8980 0.9509 -0.0040 -0.1208 -0.1703 239 PHE A CA    
97   C  C     . PHE A 26  ? 0.9431 0.9846 1.0198 -0.0136 -0.1083 -0.1733 239 PHE A C     
98   O  O     . PHE A 26  ? 0.9283 1.0022 1.0261 0.0091  -0.1119 -0.1779 239 PHE A O     
99   C  CB    . PHE A 26  ? 0.9289 0.8745 0.9381 0.0104  -0.1162 -0.1534 239 PHE A CB    
100  C  CG    . PHE A 26  ? 0.8968 0.8675 0.9124 0.0397  -0.1076 -0.1440 239 PHE A CG    
101  C  CD1   . PHE A 26  ? 0.9542 0.9196 0.9500 0.0677  -0.1136 -0.1453 239 PHE A CD1   
102  C  CD2   . PHE A 26  ? 0.8579 0.8581 0.8959 0.0358  -0.0940 -0.1349 239 PHE A CD2   
103  C  CE1   . PHE A 26  ? 0.9402 0.9302 0.9359 0.0852  -0.1051 -0.1341 239 PHE A CE1   
104  C  CE2   . PHE A 26  ? 0.8744 0.8897 0.9135 0.0572  -0.0892 -0.1243 239 PHE A CE2   
105  C  CZ    . PHE A 26  ? 0.8722 0.8817 0.8882 0.0785  -0.0941 -0.1218 239 PHE A CZ    
106  N  N     . ARG A 27  ? 0.8929 0.9472 0.9776 -0.0474 -0.0969 -0.1729 240 ARG A N     
107  C  CA    . ARG A 27  ? 0.8378 0.9574 0.9640 -0.0553 -0.0854 -0.1842 240 ARG A CA    
108  C  C     . ARG A 27  ? 0.8361 1.0145 1.0031 -0.0518 -0.0953 -0.2125 240 ARG A C     
109  O  O     . ARG A 27  ? 0.8019 1.0217 1.0021 -0.0291 -0.0982 -0.2237 240 ARG A O     
110  C  CB    . ARG A 27  ? 0.8245 0.9530 0.9448 -0.0979 -0.0700 -0.1799 240 ARG A CB    
111  C  CG    . ARG A 27  ? 0.8536 0.9377 0.9436 -0.0919 -0.0620 -0.1544 240 ARG A CG    
112  C  CD    . ARG A 27  ? 0.8479 0.9334 0.9212 -0.1381 -0.0500 -0.1468 240 ARG A CD    
113  N  NE    . ARG A 27  ? 0.8211 0.8769 0.8734 -0.1271 -0.0432 -0.1260 240 ARG A NE    
114  C  CZ    . ARG A 27  ? 1.0223 1.0312 1.0323 -0.1544 -0.0435 -0.1066 240 ARG A CZ    
115  N  NH1   . ARG A 27  ? 0.9651 0.9453 0.9440 -0.2005 -0.0506 -0.1023 240 ARG A NH1   
116  N  NH2   . ARG A 27  ? 0.8862 0.8733 0.8813 -0.1379 -0.0394 -0.0905 240 ARG A NH2   
117  N  N     . ALA A 28  ? 0.8135 0.9898 0.9761 -0.0701 -0.1051 -0.2250 241 ALA A N     
118  C  CA    . ALA A 28  ? 0.7971 1.0325 0.9990 -0.0668 -0.1172 -0.2552 241 ALA A CA    
119  C  C     . ALA A 28  ? 0.8473 1.0802 1.0559 -0.0191 -0.1364 -0.2575 241 ALA A C     
120  O  O     . ALA A 28  ? 0.8429 1.1288 1.0905 -0.0039 -0.1489 -0.2813 241 ALA A O     
121  C  CB    . ALA A 28  ? 0.8306 1.0600 1.0219 -0.1020 -0.1237 -0.2665 241 ALA A CB    
122  N  N     . THR A 29  ? 0.8198 0.9949 0.9893 0.0038  -0.1401 -0.2338 242 THR A N     
123  C  CA    . THR A 29  ? 0.8294 0.9935 0.9888 0.0406  -0.1571 -0.2280 242 THR A CA    
124  C  C     . THR A 29  ? 0.8721 1.0369 1.0369 0.0611  -0.1553 -0.2139 242 THR A C     
125  O  O     . THR A 29  ? 0.8791 1.0431 1.0426 0.0857  -0.1743 -0.2117 242 THR A O     
126  C  CB    . THR A 29  ? 1.0385 1.1510 1.1501 0.0496  -0.1589 -0.2122 242 THR A CB    
127  O  OG1   . THR A 29  ? 1.0919 1.1867 1.1926 0.0274  -0.1604 -0.2231 242 THR A OG1   
128  C  CG2   . THR A 29  ? 1.0332 1.1429 1.1266 0.0773  -0.1771 -0.2089 242 THR A CG2   
129  N  N     . LEU A 30  ? 0.8340 0.9915 0.9972 0.0497  -0.1357 -0.2017 243 LEU A N     
130  C  CA    . LEU A 30  ? 0.8320 0.9858 0.9983 0.0653  -0.1329 -0.1881 243 LEU A CA    
131  C  C     . LEU A 30  ? 0.9142 1.1144 1.1269 0.0748  -0.1444 -0.2116 243 LEU A C     
132  O  O     . LEU A 30  ? 0.9127 1.1590 1.1584 0.0563  -0.1340 -0.2333 243 LEU A O     
133  C  CB    . LEU A 30  ? 0.8080 0.9451 0.9609 0.0486  -0.1094 -0.1726 243 LEU A CB    
134  C  CG    . LEU A 30  ? 0.8134 0.9395 0.9613 0.0602  -0.1028 -0.1551 243 LEU A CG    
135  C  CD1   . LEU A 30  ? 0.8234 0.9167 0.9358 0.0772  -0.1086 -0.1341 243 LEU A CD1   
136  C  CD2   . LEU A 30  ? 0.7529 0.8702 0.8916 0.0408  -0.0816 -0.1456 243 LEU A CD2   
137  N  N     . GLU A 31  ? 0.8784 1.0675 1.0910 0.1025  -0.1689 -0.2093 244 GLU A N     
138  C  CA    . GLU A 31  ? 0.8902 1.1098 1.1432 0.1222  -0.1894 -0.2328 244 GLU A CA    
139  C  C     . GLU A 31  ? 0.9621 1.1639 1.2121 0.1255  -0.1802 -0.2179 244 GLU A C     
140  O  O     . GLU A 31  ? 1.0092 1.1616 1.2195 0.1285  -0.1799 -0.1859 244 GLU A O     
141  C  CB    . GLU A 31  ? 0.9496 1.1447 1.1905 0.1498  -0.2273 -0.2319 244 GLU A CB    
142  C  CG    . GLU A 31  ? 1.1618 1.3726 1.4392 0.1789  -0.2602 -0.2570 244 GLU A CG    
143  C  CD    . GLU A 31  ? 1.5366 1.7102 1.7927 0.2053  -0.3048 -0.2526 244 GLU A CD    
144  O  OE1   . GLU A 31  ? 1.2537 1.4277 1.4925 0.2018  -0.3106 -0.2515 244 GLU A OE1   
145  O  OE2   . GLU A 31  ? 1.5517 1.6935 1.8075 0.2297  -0.3380 -0.2523 244 GLU A OE2   
146  N  N     . CYS A 32  ? 0.8796 1.1282 1.1705 0.1216  -0.1709 -0.2424 245 CYS A N     
147  C  CA    . CYS A 32  ? 0.8636 1.1024 1.1548 0.1219  -0.1597 -0.2327 245 CYS A CA    
148  C  C     . CYS A 32  ? 0.8778 1.1180 1.1962 0.1523  -0.1891 -0.2514 245 CYS A C     
149  O  O     . CYS A 32  ? 0.8974 1.1717 1.2526 0.1735  -0.2152 -0.2862 245 CYS A O     
150  C  CB    . CYS A 32  ? 0.8527 1.1334 1.1572 0.0915  -0.1258 -0.2408 245 CYS A CB    
151  S  SG    . CYS A 32  ? 0.9094 1.1577 1.1682 0.0582  -0.0998 -0.2118 245 CYS A SG    
152  N  N     . HIS A 33  ? 0.8132 1.0142 1.1134 0.1562  -0.1887 -0.2305 246 HIS A N     
153  C  CA    . HIS A 33  ? 0.8257 1.0119 1.1455 0.1849  -0.2213 -0.2463 246 HIS A CA    
154  C  C     . HIS A 33  ? 0.8597 1.0620 1.1908 0.1749  -0.1980 -0.2482 246 HIS A C     
155  O  O     . HIS A 33  ? 0.8453 0.9972 1.1460 0.1714  -0.1973 -0.2188 246 HIS A O     
156  C  CB    . HIS A 33  ? 0.8805 0.9840 1.1539 0.1972  -0.2543 -0.2130 246 HIS A CB    
157  C  CG    . HIS A 33  ? 0.9640 1.0517 1.2193 0.2047  -0.2768 -0.2088 246 HIS A CG    
158  N  ND1   . HIS A 33  ? 1.0267 1.1142 1.3055 0.2364  -0.3222 -0.2375 246 HIS A ND1   
159  C  CD2   . HIS A 33  ? 0.9788 1.0527 1.1956 0.1869  -0.2620 -0.1826 246 HIS A CD2   
160  C  CE1   . HIS A 33  ? 1.0388 1.1109 1.2900 0.2340  -0.3322 -0.2243 246 HIS A CE1   
161  N  NE2   . HIS A 33  ? 1.0195 1.0839 1.2329 0.2043  -0.2963 -0.1919 246 HIS A NE2   
162  N  N     . PRO A 34  ? 0.8209 1.0999 1.1930 0.1645  -0.1760 -0.2821 247 PRO A N     
163  C  CA    . PRO A 34  ? 0.8084 1.1062 1.1847 0.1502  -0.1507 -0.2817 247 PRO A CA    
164  C  C     . PRO A 34  ? 0.8531 1.1462 1.2546 0.1788  -0.1766 -0.3049 247 PRO A C     
165  O  O     . PRO A 34  ? 0.8732 1.1512 1.2941 0.2126  -0.2182 -0.3276 247 PRO A O     
166  C  CB    . PRO A 34  ? 0.8123 1.1956 1.2160 0.1228  -0.1201 -0.3089 247 PRO A CB    
167  C  CG    . PRO A 34  ? 0.8733 1.2856 1.2931 0.1244  -0.1315 -0.3274 247 PRO A CG    
168  C  CD    . PRO A 34  ? 0.8370 1.1953 1.2515 0.1613  -0.1731 -0.3235 247 PRO A CD    
169  N  N     . LEU A 35  ? 0.7938 1.0915 1.1904 0.1660  -0.1556 -0.2980 248 LEU A N     
170  C  CA    . LEU A 35  ? 0.8056 1.1025 1.2247 0.1878  -0.1743 -0.3210 248 LEU A CA    
171  C  C     . LEU A 35  ? 0.7865 1.1805 1.2677 0.2029  -0.1780 -0.3853 248 LEU A C     
172  O  O     . LEU A 35  ? 0.7223 1.1949 1.2199 0.1767  -0.1459 -0.4018 248 LEU A O     
173  C  CB    . LEU A 35  ? 0.7941 1.0812 1.1878 0.1623  -0.1423 -0.2941 248 LEU A CB    
174  C  CG    . LEU A 35  ? 0.8902 1.1756 1.3001 0.1767  -0.1537 -0.3123 248 LEU A CG    
175  C  CD1   . LEU A 35  ? 0.9548 1.1456 1.3373 0.1941  -0.1910 -0.2872 248 LEU A CD1   
176  C  CD2   . LEU A 35  ? 0.9110 1.2172 1.3044 0.1476  -0.1153 -0.2957 248 LEU A CD2   
177  N  N     . THR A 36  ? 0.7682 1.1572 1.2819 0.2438  -0.2199 -0.4231 249 THR A N     
178  C  CA    . THR A 36  ? 0.7626 1.2522 1.3415 0.2663  -0.2284 -0.4940 249 THR A CA    
179  C  C     . THR A 36  ? 0.8479 1.3236 1.4400 0.2882  -0.2455 -0.5151 249 THR A C     
180  O  O     . THR A 36  ? 0.8553 1.2327 1.4071 0.2899  -0.2607 -0.4750 249 THR A O     
181  C  CB    . THR A 36  ? 0.8249 1.3351 1.4418 0.3055  -0.2718 -0.5359 249 THR A CB    
182  O  OG1   . THR A 36  ? 0.9171 1.3325 1.5241 0.3488  -0.3308 -0.5346 249 THR A OG1   
183  C  CG2   . THR A 36  ? 0.6719 1.1812 1.2700 0.2849  -0.2597 -0.5110 249 THR A CG2   
184  N  N     . MET A 37  ? 0.8355 1.4141 1.4856 0.3054  -0.2459 -0.5824 250 MET A N     
185  C  CA    . MET A 37  ? 0.8539 1.4408 1.5271 0.3301  -0.2626 -0.6179 250 MET A CA    
186  C  C     . MET A 37  ? 0.9735 1.4715 1.6538 0.3848  -0.3320 -0.6354 250 MET A C     
187  O  O     . MET A 37  ? 1.0017 1.4734 1.6881 0.4038  -0.3520 -0.6531 250 MET A O     
188  C  CB    . MET A 37  ? 0.8580 1.5993 1.5932 0.3311  -0.2412 -0.6919 250 MET A CB    
189  C  CG    . MET A 37  ? 0.8693 1.6795 1.5839 0.2717  -0.1770 -0.6706 250 MET A CG    
190  S  SD    . MET A 37  ? 0.9425 1.7114 1.6253 0.2577  -0.1602 -0.6458 250 MET A SD    
191  C  CE    . MET A 37  ? 0.9083 1.8131 1.6621 0.2865  -0.1679 -0.7426 250 MET A CE    
192  N  N     . THR A 38  ? 0.9834 1.4321 1.6606 0.4100  -0.3723 -0.6322 251 THR A N     
193  C  CA    . THR A 38  ? 1.0664 1.4157 1.7409 0.4607  -0.4467 -0.6453 251 THR A CA    
194  C  C     . THR A 38  ? 1.1687 1.3689 1.7653 0.4398  -0.4621 -0.5656 251 THR A C     
195  O  O     . THR A 38  ? 1.2338 1.3297 1.8108 0.4709  -0.5254 -0.5628 251 THR A O     
196  C  CB    . THR A 38  ? 1.1627 1.5466 1.8807 0.5067  -0.4926 -0.6970 251 THR A CB    
197  O  OG1   . THR A 38  ? 1.1258 1.4793 1.8081 0.4829  -0.4814 -0.6493 251 THR A OG1   
198  C  CG2   . THR A 38  ? 1.0743 1.6265 1.8747 0.5244  -0.4753 -0.7834 251 THR A CG2   
199  N  N     . ASP A 39  ? 1.1085 1.2981 1.6589 0.3871  -0.4084 -0.5028 252 ASP A N     
200  C  CA    . ASP A 39  ? 1.1638 1.2316 1.6420 0.3628  -0.4178 -0.4308 252 ASP A CA    
201  C  C     . ASP A 39  ? 1.3439 1.3484 1.8055 0.3642  -0.4366 -0.4237 252 ASP A C     
202  O  O     . ASP A 39  ? 1.3113 1.3816 1.8029 0.3599  -0.4076 -0.4507 252 ASP A O     
203  C  CB    . ASP A 39  ? 1.1145 1.1994 1.5547 0.3114  -0.3563 -0.3762 252 ASP A CB    
204  C  CG    . ASP A 39  ? 1.0824 1.1864 1.5160 0.3047  -0.3477 -0.3647 252 ASP A CG    
205  O  OD1   . ASP A 39  ? 1.0919 1.1684 1.5334 0.3362  -0.3951 -0.3825 252 ASP A OD1   
206  O  OD2   . ASP A 39  ? 1.1037 1.2419 1.5200 0.2689  -0.2979 -0.3365 252 ASP A OD2   
207  N  N     . PRO A 40  ? 1.4419 1.3200 1.8533 0.3664  -0.4856 -0.3880 253 PRO A N     
208  C  CA    . PRO A 40  ? 1.4944 1.3104 1.8886 0.3622  -0.5040 -0.3811 253 PRO A CA    
209  C  C     . PRO A 40  ? 1.5093 1.3492 1.8791 0.3138  -0.4433 -0.3408 253 PRO A C     
210  O  O     . PRO A 40  ? 1.4743 1.3128 1.8052 0.2751  -0.4047 -0.2894 253 PRO A O     
211  C  CB    . PRO A 40  ? 1.6275 1.2994 1.9615 0.3633  -0.5686 -0.3426 253 PRO A CB    
212  C  CG    . PRO A 40  ? 1.6807 1.3450 1.9805 0.3437  -0.5558 -0.3025 253 PRO A CG    
213  C  CD    . PRO A 40  ? 1.5423 1.3266 1.9040 0.3664  -0.5268 -0.3497 253 PRO A CD    
214  N  N     . ILE A 41  ? 1.4765 1.3458 1.8743 0.3211  -0.4377 -0.3722 254 ILE A N     
215  C  CA    . ILE A 41  ? 1.4392 1.3279 1.8204 0.2844  -0.3921 -0.3459 254 ILE A CA    
216  C  C     . ILE A 41  ? 1.5146 1.2933 1.8279 0.2510  -0.4085 -0.2818 254 ILE A C     
217  O  O     . ILE A 41  ? 1.5855 1.2633 1.8723 0.2626  -0.4683 -0.2745 254 ILE A O     
218  C  CB    . ILE A 41  ? 1.5020 1.4233 1.9258 0.3097  -0.4054 -0.4011 254 ILE A CB    
219  C  CG1   . ILE A 41  ? 1.4522 1.5089 1.9409 0.3313  -0.3771 -0.4646 254 ILE A CG1   
220  C  CG2   . ILE A 41  ? 1.5155 1.4166 1.9121 0.2761  -0.3814 -0.3713 254 ILE A CG2   
221  C  CD1   . ILE A 41  ? 1.5401 1.6616 2.0730 0.3505  -0.3760 -0.5239 254 ILE A CD1   
222  N  N     . GLU A 42  ? 1.4169 1.2161 1.6999 0.2083  -0.3583 -0.2368 255 GLU A N     
223  C  CA    . GLU A 42  ? 1.4550 1.1744 1.6763 0.1702  -0.3658 -0.1795 255 GLU A CA    
224  C  C     . GLU A 42  ? 1.4803 1.1985 1.6953 0.1478  -0.3509 -0.1720 255 GLU A C     
225  O  O     . GLU A 42  ? 1.4358 1.2322 1.6843 0.1507  -0.3128 -0.1953 255 GLU A O     
226  C  CB    . GLU A 42  ? 1.4337 1.1766 1.6231 0.1404  -0.3270 -0.1363 255 GLU A CB    
227  C  CG    . GLU A 42  ? 1.5222 1.2573 1.7106 0.1586  -0.3452 -0.1391 255 GLU A CG    
228  C  CD    . GLU A 42  ? 1.6846 1.4663 1.8561 0.1368  -0.3003 -0.1113 255 GLU A CD    
229  O  OE1   . GLU A 42  ? 1.6651 1.4617 1.8099 0.1039  -0.2652 -0.0790 255 GLU A OE1   
230  O  OE2   . GLU A 42  ? 1.6168 1.4237 1.8049 0.1552  -0.3026 -0.1264 255 GLU A OE2   
231  N  N     . GLU A 43  ? 1.4627 1.0919 1.6316 0.1223  -0.3827 -0.1393 256 GLU A N     
232  C  CA    . GLU A 43  ? 1.4482 1.0716 1.6087 0.0974  -0.3729 -0.1314 256 GLU A CA    
233  C  C     . GLU A 43  ? 1.4231 1.0586 1.5395 0.0468  -0.3353 -0.0780 256 GLU A C     
234  O  O     . GLU A 43  ? 1.4922 1.0642 1.5565 0.0163  -0.3561 -0.0377 256 GLU A O     
235  C  CB    . GLU A 43  ? 1.5736 1.0912 1.7169 0.1025  -0.4386 -0.1395 256 GLU A CB    
236  C  CG    . GLU A 43  ? 1.7332 1.2418 1.9255 0.1604  -0.4829 -0.2028 256 GLU A CG    
237  C  CD    . GLU A 43  ? 1.9418 1.5496 2.1981 0.1903  -0.4542 -0.2601 256 GLU A CD    
238  O  OE1   . GLU A 43  ? 1.6753 1.3356 1.9339 0.1650  -0.4103 -0.2510 256 GLU A OE1   
239  O  OE2   . GLU A 43  ? 1.9623 1.5977 2.2657 0.2391  -0.4788 -0.3169 256 GLU A OE2   
240  N  N     . HIS A 44  ? 1.2346 0.9576 1.3710 0.0388  -0.2808 -0.0801 257 HIS A N     
241  C  CA    . HIS A 44  ? 1.1696 0.9259 1.2761 -0.0006 -0.2421 -0.0416 257 HIS A CA    
242  C  C     . HIS A 44  ? 1.1820 0.9674 1.2975 -0.0161 -0.2242 -0.0463 257 HIS A C     
243  O  O     . HIS A 44  ? 1.1473 0.9648 1.3013 0.0087  -0.2193 -0.0826 257 HIS A O     
244  C  CB    . HIS A 44  ? 1.0917 0.9256 1.2136 0.0091  -0.1967 -0.0426 257 HIS A CB    
245  C  CG    . HIS A 44  ? 1.1316 0.9516 1.2469 0.0229  -0.2071 -0.0388 257 HIS A CG    
246  N  ND1   . HIS A 44  ? 1.1768 0.9693 1.2480 -0.0019 -0.2113 -0.0025 257 HIS A ND1   
247  C  CD2   . HIS A 44  ? 1.1219 0.9614 1.2698 0.0565  -0.2119 -0.0687 257 HIS A CD2   
248  C  CE1   . HIS A 44  ? 1.1625 0.9495 1.2397 0.0199  -0.2219 -0.0105 257 HIS A CE1   
249  N  NE2   . HIS A 44  ? 1.1354 0.9514 1.2598 0.0551  -0.2224 -0.0503 257 HIS A NE2   
250  N  N     . ARG A 45  ? 1.1320 0.9189 1.2129 -0.0587 -0.2112 -0.0120 258 ARG A N     
251  C  CA    . ARG A 45  ? 1.0883 0.9158 1.1768 -0.0767 -0.1897 -0.0142 258 ARG A CA    
252  C  C     . ARG A 45  ? 0.9982 0.9154 1.1110 -0.0605 -0.1421 -0.0237 258 ARG A C     
253  O  O     . ARG A 45  ? 0.9603 0.9175 1.1002 -0.0466 -0.1271 -0.0468 258 ARG A O     
254  C  CB    . ARG A 45  ? 1.1499 0.9629 1.1953 -0.1293 -0.1909 0.0224  258 ARG A CB    
255  C  CG    . ARG A 45  ? 1.2546 1.1155 1.3096 -0.1499 -0.1705 0.0185  258 ARG A CG    
256  C  CD    . ARG A 45  ? 1.4137 1.2512 1.4254 -0.2080 -0.1815 0.0508  258 ARG A CD    
257  N  NE    . ARG A 45  ? 1.6264 1.5259 1.6479 -0.2315 -0.1584 0.0474  258 ARG A NE    
258  C  CZ    . ARG A 45  ? 1.8663 1.7449 1.8991 -0.2378 -0.1744 0.0326  258 ARG A CZ    
259  N  NH1   . ARG A 45  ? 1.6894 1.6321 1.7306 -0.2604 -0.1524 0.0299  258 ARG A NH1   
260  N  NH2   . ARG A 45  ? 1.7644 1.5620 1.8029 -0.2182 -0.2144 0.0159  258 ARG A NH2   
261  N  N     . ILE A 46  ? 0.9021 0.8447 1.0016 -0.0621 -0.1225 -0.0066 259 ILE A N     
262  C  CA    . ILE A 46  ? 0.8308 0.8413 0.9449 -0.0461 -0.0851 -0.0127 259 ILE A CA    
263  C  C     . ILE A 46  ? 0.8794 0.8815 1.0010 -0.0223 -0.0879 -0.0199 259 ILE A C     
264  O  O     . ILE A 46  ? 0.9038 0.8796 1.0026 -0.0302 -0.0983 -0.0020 259 ILE A O     
265  C  CB    . ILE A 46  ? 0.8399 0.8957 0.9326 -0.0682 -0.0603 0.0090  259 ILE A CB    
266  C  CG1   . ILE A 46  ? 0.8666 0.9334 0.9464 -0.1026 -0.0614 0.0199  259 ILE A CG1   
267  C  CG2   . ILE A 46  ? 0.7566 0.8683 0.8633 -0.0462 -0.0309 -0.0011 259 ILE A CG2   
268  C  CD1   . ILE A 46  ? 0.9999 1.0858 1.1025 -0.0952 -0.0569 0.0015  259 ILE A CD1   
269  N  N     . CYS A 47  ? 0.8212 0.8488 0.9722 0.0029  -0.0791 -0.0463 260 CYS A N     
270  C  CA    . CYS A 47  ? 0.8200 0.8514 0.9826 0.0228  -0.0794 -0.0576 260 CYS A CA    
271  C  C     . CYS A 47  ? 0.8063 0.8871 0.9691 0.0256  -0.0464 -0.0560 260 CYS A C     
272  O  O     . CYS A 47  ? 0.7855 0.8993 0.9588 0.0273  -0.0305 -0.0675 260 CYS A O     
273  C  CB    . CYS A 47  ? 0.8487 0.8773 1.0444 0.0454  -0.0978 -0.0932 260 CYS A CB    
274  S  SG    . CYS A 47  ? 0.9048 0.9537 1.1219 0.0677  -0.0986 -0.1145 260 CYS A SG    
275  N  N     . VAL A 48  ? 0.7350 0.8161 0.8817 0.0249  -0.0393 -0.0413 261 VAL A N     
276  C  CA    . VAL A 48  ? 0.7054 0.8186 0.8479 0.0291  -0.0157 -0.0405 261 VAL A CA    
277  C  C     . VAL A 48  ? 0.7722 0.8841 0.9234 0.0396  -0.0177 -0.0509 261 VAL A C     
278  O  O     . VAL A 48  ? 0.7811 0.8709 0.9265 0.0424  -0.0310 -0.0453 261 VAL A O     
279  C  CB    . VAL A 48  ? 0.7445 0.8701 0.8626 0.0213  -0.0042 -0.0210 261 VAL A CB    
280  C  CG1   . VAL A 48  ? 0.7160 0.8616 0.8282 0.0305  0.0114  -0.0236 261 VAL A CG1   
281  C  CG2   . VAL A 48  ? 0.7452 0.8834 0.8589 0.0078  -0.0025 -0.0145 261 VAL A CG2   
282  N  N     . CYS A 49  ? 0.7478 0.8855 0.9106 0.0419  -0.0052 -0.0660 262 CYS A N     
283  C  CA    . CYS A 49  ? 0.7429 0.8924 0.9168 0.0453  -0.0038 -0.0801 262 CYS A CA    
284  C  C     . CYS A 49  ? 0.7555 0.9142 0.9099 0.0368  0.0130  -0.0719 262 CYS A C     
285  O  O     . CYS A 49  ? 0.7405 0.9016 0.8778 0.0317  0.0225  -0.0621 262 CYS A O     
286  C  CB    . CYS A 49  ? 0.7542 0.9327 0.9597 0.0492  -0.0075 -0.1110 262 CYS A CB    
287  S  SG    . CYS A 49  ? 0.8488 1.0038 1.0758 0.0641  -0.0364 -0.1258 262 CYS A SG    
288  N  N     . VAL A 50  ? 0.6961 0.8577 0.8526 0.0349  0.0130  -0.0782 263 VAL A N     
289  C  CA    . VAL A 50  ? 0.6955 0.8570 0.8314 0.0222  0.0233  -0.0727 263 VAL A CA    
290  C  C     . VAL A 50  ? 0.7026 0.8979 0.8568 0.0087  0.0276  -0.0945 263 VAL A C     
291  O  O     . VAL A 50  ? 0.6895 0.9011 0.8719 0.0174  0.0188  -0.1130 263 VAL A O     
292  C  CB    . VAL A 50  ? 0.7472 0.8787 0.8600 0.0274  0.0190  -0.0580 263 VAL A CB    
293  C  CG1   . VAL A 50  ? 0.7511 0.8675 0.8453 0.0380  0.0180  -0.0422 263 VAL A CG1   
294  C  CG2   . VAL A 50  ? 0.7421 0.8712 0.8697 0.0352  0.0085  -0.0653 263 VAL A CG2   
295  N  N     . ARG A 51  ? 0.6698 0.8766 0.8052 -0.0140 0.0391  -0.0925 264 ARG A N     
296  C  CA    . ARG A 51  ? 0.6961 0.9471 0.8433 -0.0372 0.0471  -0.1127 264 ARG A CA    
297  C  C     . ARG A 51  ? 0.7862 1.0132 0.8944 -0.0648 0.0506  -0.0961 264 ARG A C     
298  O  O     . ARG A 51  ? 0.8197 1.0172 0.8888 -0.0782 0.0520  -0.0759 264 ARG A O     
299  C  CB    . ARG A 51  ? 0.7134 1.0150 0.8732 -0.0491 0.0579  -0.1312 264 ARG A CB    
300  C  CG    . ARG A 51  ? 0.6994 1.0687 0.8815 -0.0715 0.0669  -0.1616 264 ARG A CG    
301  C  CD    . ARG A 51  ? 0.7090 1.1374 0.8972 -0.0884 0.0800  -0.1815 264 ARG A CD    
302  N  NE    . ARG A 51  ? 0.6981 1.2089 0.9151 -0.1085 0.0891  -0.2183 264 ARG A NE    
303  C  CZ    . ARG A 51  ? 0.8767 1.4692 1.1110 -0.1249 0.1020  -0.2505 264 ARG A CZ    
304  N  NH1   . ARG A 51  ? 0.8714 1.4671 1.0948 -0.1232 0.1066  -0.2485 264 ARG A NH1   
305  N  NH2   . ARG A 51  ? 0.6696 1.3496 0.9354 -0.1420 0.1102  -0.2895 264 ARG A NH2   
306  N  N     . LYS A 52  ? 0.7415 0.9764 0.8578 -0.0738 0.0481  -0.1049 265 LYS A N     
307  C  CA    . LYS A 52  ? 0.7728 0.9816 0.8511 -0.1058 0.0481  -0.0911 265 LYS A CA    
308  C  C     . LYS A 52  ? 0.8341 1.1042 0.9148 -0.1485 0.0625  -0.1076 265 LYS A C     
309  O  O     . LYS A 52  ? 0.8171 1.1567 0.9425 -0.1487 0.0684  -0.1400 265 LYS A O     
310  C  CB    . LYS A 52  ? 0.7867 0.9762 0.8728 -0.0962 0.0375  -0.0938 265 LYS A CB    
311  C  CG    . LYS A 52  ? 0.7525 0.9177 0.8045 -0.1327 0.0347  -0.0851 265 LYS A CG    
312  C  CD    . LYS A 52  ? 0.7094 0.8830 0.7842 -0.1257 0.0272  -0.0994 265 LYS A CD    
313  C  CE    . LYS A 52  ? 0.7749 0.9207 0.8149 -0.1653 0.0224  -0.0913 265 LYS A CE    
314  N  NZ    . LYS A 52  ? 0.9425 1.1053 1.0072 -0.1619 0.0157  -0.1086 265 LYS A NZ    
315  N  N     . ARG A 53  ? 0.8198 1.0674 0.8510 -0.1855 0.0659  -0.0875 266 ARG A N     
316  C  CA    . ARG A 53  ? 0.8318 1.1392 0.8530 -0.2390 0.0807  -0.0991 266 ARG A CA    
317  C  C     . ARG A 53  ? 0.8967 1.1849 0.8958 -0.2748 0.0754  -0.0931 266 ARG A C     
318  O  O     . ARG A 53  ? 0.9200 1.1283 0.8942 -0.2602 0.0575  -0.0722 266 ARG A O     
319  C  CB    . ARG A 53  ? 0.8352 1.1253 0.8033 -0.2710 0.0848  -0.0769 266 ARG A CB    
320  C  CG    . ARG A 53  ? 0.8976 1.0828 0.7940 -0.2862 0.0649  -0.0356 266 ARG A CG    
321  C  CD    . ARG A 53  ? 0.9072 1.0916 0.7438 -0.3426 0.0687  -0.0173 266 ARG A CD    
322  N  NE    . ARG A 53  ? 1.0377 1.1081 0.7998 -0.3523 0.0410  0.0227  266 ARG A NE    
323  C  CZ    . ARG A 53  ? 1.2474 1.2496 0.9630 -0.3830 0.0224  0.0420  266 ARG A CZ    
324  N  NH1   . ARG A 53  ? 1.1768 1.2193 0.9140 -0.4108 0.0321  0.0263  266 ARG A NH1   
325  N  NH2   . ARG A 53  ? 1.2046 1.0957 0.8523 -0.3842 -0.0098 0.0750  266 ARG A NH2   
326  N  N     . PRO A 54  ? 0.8456 1.2101 0.8540 -0.3224 0.0898  -0.1141 267 PRO A N     
327  C  CA    . PRO A 54  ? 0.8782 1.2200 0.8599 -0.3635 0.0835  -0.1058 267 PRO A CA    
328  C  C     . PRO A 54  ? 1.0529 1.3068 0.9482 -0.4121 0.0716  -0.0633 267 PRO A C     
329  O  O     . PRO A 54  ? 1.0965 1.3352 0.9528 -0.4289 0.0739  -0.0450 267 PRO A O     
330  C  CB    . PRO A 54  ? 0.8799 1.3485 0.8991 -0.4050 0.1052  -0.1451 267 PRO A CB    
331  C  CG    . PRO A 54  ? 0.9108 1.4534 0.9491 -0.4033 0.1225  -0.1642 267 PRO A CG    
332  C  CD    . PRO A 54  ? 0.8295 1.3117 0.8741 -0.3425 0.1120  -0.1504 267 PRO A CD    
333  N  N     . LEU A 55  ? 1.0833 1.2790 0.9463 -0.4377 0.0559  -0.0488 268 LEU A N     
334  C  CA    . LEU A 55  ? 1.1886 1.2933 0.9648 -0.4906 0.0377  -0.0101 268 LEU A CA    
335  C  C     . LEU A 55  ? 1.3099 1.4901 1.0581 -0.5699 0.0590  -0.0113 268 LEU A C     
336  O  O     . LEU A 55  ? 1.2854 1.5826 1.0804 -0.5968 0.0831  -0.0461 268 LEU A O     
337  C  CB    . LEU A 55  ? 1.2329 1.2689 0.9866 -0.5055 0.0156  -0.0017 268 LEU A CB    
338  C  CG    . LEU A 55  ? 1.2683 1.2096 1.0247 -0.4392 -0.0119 0.0056  268 LEU A CG    
339  C  CD1   . LEU A 55  ? 1.3187 1.2141 1.0599 -0.4596 -0.0301 0.0054  268 LEU A CD1   
340  C  CD2   . LEU A 55  ? 1.3515 1.1820 1.0482 -0.4178 -0.0389 0.0379  268 LEU A CD2   
341  N  N     . ASN A 56  ? 1.3370 1.4592 1.0110 -0.6055 0.0496  0.0233  269 ASN A N     
342  C  CA    . ASN A 56  ? 1.3965 1.5840 1.0288 -0.6897 0.0681  0.0277  269 ASN A CA    
343  C  C     . ASN A 56  ? 1.5887 1.7278 1.1552 -0.7716 0.0541  0.0509  269 ASN A C     
344  O  O     . ASN A 56  ? 1.6053 1.6451 1.1559 -0.7549 0.0258  0.0649  269 ASN A O     
345  C  CB    . ASN A 56  ? 1.4060 1.5537 0.9805 -0.6980 0.0625  0.0562  269 ASN A CB    
346  C  CG    . ASN A 56  ? 1.5858 1.5653 1.0787 -0.6873 0.0185  0.1048  269 ASN A CG    
347  O  OD1   . ASN A 56  ? 1.6922 1.5779 1.1201 -0.7305 -0.0088 0.1329  269 ASN A OD1   
348  N  ND2   . ASN A 56  ? 1.3239 1.2618 0.8162 -0.6312 0.0075  0.1136  269 ASN A ND2   
349  N  N     . LYS A 57  ? 1.6321 1.8443 1.1584 -0.8631 0.0735  0.0535  270 LYS A N     
350  C  CA    . LYS A 57  ? 1.7483 1.9294 1.2071 -0.9576 0.0636  0.0757  270 LYS A CA    
351  C  C     . LYS A 57  ? 1.9299 1.9127 1.2827 -0.9756 0.0125  0.1344  270 LYS A C     
352  O  O     . LYS A 57  ? 1.9769 1.8875 1.2965 -1.0097 -0.0106 0.1480  270 LYS A O     
353  C  CB    . LYS A 57  ? 1.8059 2.1095 1.2347 -1.0545 0.0955  0.0693  270 LYS A CB    
354  N  N     . GLN A 58  ? 1.9369 1.8315 1.2394 -0.9478 -0.0086 0.1653  271 GLN A N     
355  C  CA    . GLN A 58  ? 2.0661 1.7686 1.2714 -0.9478 -0.0643 0.2159  271 GLN A CA    
356  C  C     . GLN A 58  ? 2.1046 1.7145 1.3465 -0.8638 -0.0944 0.2073  271 GLN A C     
357  O  O     . GLN A 58  ? 2.2091 1.6767 1.3833 -0.8790 -0.1406 0.2356  271 GLN A O     
358  C  CB    . GLN A 58  ? 2.1093 1.7629 1.2693 -0.9246 -0.0778 0.2408  271 GLN A CB    
359  C  CG    . GLN A 58  ? 2.4367 2.1411 1.5251 -1.0187 -0.0615 0.2628  271 GLN A CG    
360  C  CD    . GLN A 58  ? 2.5355 2.4423 1.7070 -1.0236 -0.0010 0.2160  271 GLN A CD    
361  O  OE1   . GLN A 58  ? 2.3136 2.2934 1.5806 -0.9393 0.0203  0.1778  271 GLN A OE1   
362  N  NE2   . GLN A 58  ? 2.4286 2.4318 1.5647 -1.1242 0.0259  0.2156  271 GLN A NE2   
363  N  N     . GLU A 59  ? 1.9147 1.6023 1.2593 -0.7763 -0.0712 0.1679  272 GLU A N     
364  C  CA    . GLU A 59  ? 1.8617 1.4851 1.2465 -0.6968 -0.0935 0.1551  272 GLU A CA    
365  C  C     . GLU A 59  ? 1.9448 1.5805 1.3483 -0.7254 -0.0934 0.1401  272 GLU A C     
366  O  O     . GLU A 59  ? 2.0029 1.5261 1.3780 -0.7069 -0.1312 0.1502  272 GLU A O     
367  C  CB    . GLU A 59  ? 1.7309 1.4378 1.2101 -0.6094 -0.0679 0.1213  272 GLU A CB    
368  C  CG    . GLU A 59  ? 1.7758 1.4411 1.2377 -0.5633 -0.0793 0.1357  272 GLU A CG    
369  C  CD    . GLU A 59  ? 1.8106 1.5745 1.3587 -0.4981 -0.0488 0.1048  272 GLU A CD    
370  O  OE1   . GLU A 59  ? 1.3978 1.2798 1.0120 -0.5029 -0.0139 0.0732  272 GLU A OE1   
371  O  OE2   . GLU A 59  ? 1.8283 1.5513 1.3757 -0.4440 -0.0622 0.1111  272 GLU A OE2   
372  N  N     . LEU A 60  ? 1.8659 1.6404 1.3167 -0.7709 -0.0534 0.1129  273 LEU A N     
373  C  CA    . LEU A 60  ? 1.8880 1.6924 1.3588 -0.8068 -0.0506 0.0956  273 LEU A CA    
374  C  C     . LEU A 60  ? 2.1141 1.8057 1.4817 -0.8942 -0.0843 0.1346  273 LEU A C     
375  O  O     . LEU A 60  ? 2.1389 1.7727 1.4997 -0.9014 -0.1065 0.1326  273 LEU A O     
376  C  CB    . LEU A 60  ? 1.8120 1.8017 1.3562 -0.8368 -0.0022 0.0534  273 LEU A CB    
377  C  CG    . LEU A 60  ? 1.7256 1.8171 1.3764 -0.7501 0.0225  0.0094  273 LEU A CG    
378  C  CD1   . LEU A 60  ? 1.6629 1.9341 1.3794 -0.7807 0.0634  -0.0354 273 LEU A CD1   
379  C  CD2   . LEU A 60  ? 1.7196 1.7636 1.4133 -0.6830 0.0040  -0.0045 273 LEU A CD2   
380  N  N     . ALA A 61  ? 2.1874 1.8395 1.4695 -0.9607 -0.0916 0.1715  274 ALA A N     
381  C  CA    . ALA A 61  ? 2.3561 1.8832 1.5225 -1.0512 -0.1298 0.2169  274 ALA A CA    
382  C  C     . ALA A 61  ? 2.4945 1.8237 1.6061 -1.0004 -0.1931 0.2430  274 ALA A C     
383  O  O     . ALA A 61  ? 2.6050 1.8351 1.6646 -1.0422 -0.2282 0.2582  274 ALA A O     
384  C  CB    . ALA A 61  ? 2.4476 1.9792 1.5334 -1.1264 -0.1244 0.2510  274 ALA A CB    
385  N  N     . LYS A 62  ? 2.4004 1.6789 1.5283 -0.9085 -0.2085 0.2429  275 LYS A N     
386  C  CA    . LYS A 62  ? 2.4636 1.5737 1.5523 -0.8457 -0.2682 0.2566  275 LYS A CA    
387  C  C     . LYS A 62  ? 2.4268 1.5517 1.5962 -0.7685 -0.2685 0.2175  275 LYS A C     
388  O  O     . LYS A 62  ? 2.4674 1.4845 1.6263 -0.6994 -0.3107 0.2155  275 LYS A O     
389  C  CB    . LYS A 62  ? 2.4853 1.5486 1.5587 -0.7825 -0.2847 0.2688  275 LYS A CB    
390  C  CG    . LYS A 62  ? 2.7903 1.7991 1.7644 -0.8514 -0.3007 0.3132  275 LYS A CG    
391  C  CD    . LYS A 62  ? 2.8988 1.8687 1.8701 -0.7766 -0.3183 0.3184  275 LYS A CD    
392  C  CE    . LYS A 62  ? 3.1006 2.0664 1.9982 -0.8346 -0.3178 0.3534  275 LYS A CE    
393  N  NZ    . LYS A 62  ? 3.1433 2.1032 2.0598 -0.7552 -0.3258 0.3490  275 LYS A NZ    
394  N  N     . LYS A 63  ? 2.2553 1.5167 1.5037 -0.7793 -0.2237 0.1840  276 LYS A N     
395  C  CA    . LYS A 63  ? 2.1563 1.4476 1.4805 -0.7139 -0.2199 0.1473  276 LYS A CA    
396  C  C     . LYS A 63  ? 2.0905 1.3817 1.4686 -0.6029 -0.2216 0.1286  276 LYS A C     
397  O  O     . LYS A 63  ? 2.1039 1.3229 1.4877 -0.5451 -0.2521 0.1171  276 LYS A O     
398  C  CB    . LYS A 63  ? 2.2759 1.4482 1.5502 -0.7393 -0.2649 0.1548  276 LYS A CB    
399  N  N     . GLU A 64  ? 1.9287 1.3049 1.3444 -0.5768 -0.1892 0.1241  277 GLU A N     
400  C  CA    . GLU A 64  ? 1.8162 1.2128 1.2868 -0.4828 -0.1844 0.1056  277 GLU A CA    
401  C  C     . GLU A 64  ? 1.7336 1.2251 1.2893 -0.4469 -0.1574 0.0691  277 GLU A C     
402  O  O     . GLU A 64  ? 1.7063 1.2989 1.2998 -0.4869 -0.1253 0.0541  277 GLU A O     
403  C  CB    . GLU A 64  ? 1.7692 1.2394 1.2598 -0.4730 -0.1551 0.1086  277 GLU A CB    
404  C  CG    . GLU A 64  ? 1.9734 1.3468 1.3953 -0.4668 -0.1868 0.1385  277 GLU A CG    
405  C  CD    . GLU A 64  ? 2.0932 1.3899 1.5180 -0.3836 -0.2207 0.1319  277 GLU A CD    
406  O  OE1   . GLU A 64  ? 1.6476 1.0129 1.1348 -0.3225 -0.1993 0.1113  277 GLU A OE1   
407  O  OE2   . GLU A 64  ? 2.1841 1.3523 1.5463 -0.3815 -0.2711 0.1459  277 GLU A OE2   
408  N  N     . ILE A 65  ? 1.5968 1.0580 1.1801 -0.3733 -0.1730 0.0531  278 ILE A N     
409  C  CA    . ILE A 65  ? 1.4685 1.0080 1.1252 -0.3310 -0.1527 0.0216  278 ILE A CA    
410  C  C     . ILE A 65  ? 1.3929 1.0243 1.1053 -0.2915 -0.1200 0.0115  278 ILE A C     
411  O  O     . ILE A 65  ? 1.3721 0.9776 1.0691 -0.2644 -0.1254 0.0231  278 ILE A O     
412  C  CB    . ILE A 65  ? 1.5090 0.9809 1.1649 -0.2721 -0.1837 0.0081  278 ILE A CB    
413  C  CG1   . ILE A 65  ? 1.6253 0.9753 1.2142 -0.3018 -0.2286 0.0191  278 ILE A CG1   
414  C  CG2   . ILE A 65  ? 1.4223 0.9773 1.1458 -0.2403 -0.1629 -0.0213 278 ILE A CG2   
415  C  CD1   . ILE A 65  ? 1.6472 0.9443 1.2422 -0.2446 -0.2592 -0.0045 278 ILE A CD1   
416  N  N     . ASP A 66  ? 1.2644 0.9989 1.0407 -0.2865 -0.0903 -0.0116 279 ASP A N     
417  C  CA    . ASP A 66  ? 1.1569 0.9710 0.9877 -0.2471 -0.0648 -0.0243 279 ASP A CA    
418  C  C     . ASP A 66  ? 1.1565 0.9547 1.0112 -0.1826 -0.0750 -0.0353 279 ASP A C     
419  O  O     . ASP A 66  ? 1.1615 0.9688 1.0358 -0.1732 -0.0798 -0.0507 279 ASP A O     
420  C  CB    . ASP A 66  ? 1.1220 1.0456 1.0062 -0.2707 -0.0368 -0.0473 279 ASP A CB    
421  C  CG    . ASP A 66  ? 1.1750 1.1737 1.1132 -0.2334 -0.0162 -0.0623 279 ASP A CG    
422  O  OD1   . ASP A 66  ? 1.1374 1.1085 1.0775 -0.1871 -0.0211 -0.0551 279 ASP A OD1   
423  O  OD2   . ASP A 66  ? 1.2821 1.3686 1.2611 -0.2505 0.0027  -0.0840 279 ASP A OD2   
424  N  N     . VAL A 67  ? 1.0593 0.8363 0.9089 -0.1418 -0.0793 -0.0283 280 VAL A N     
425  C  CA    . VAL A 67  ? 1.0162 0.7863 0.8825 -0.0863 -0.0878 -0.0392 280 VAL A CA    
426  C  C     . VAL A 67  ? 0.9794 0.8236 0.8951 -0.0564 -0.0654 -0.0483 280 VAL A C     
427  O  O     . VAL A 67  ? 0.9711 0.8160 0.8942 -0.0163 -0.0695 -0.0531 280 VAL A O     
428  C  CB    . VAL A 67  ? 1.1046 0.7982 0.9295 -0.0574 -0.1153 -0.0319 280 VAL A CB    
429  C  CG1   . VAL A 67  ? 1.1958 0.7977 0.9670 -0.0826 -0.1477 -0.0243 280 VAL A CG1   
430  C  CG2   . VAL A 67  ? 1.0899 0.7873 0.9064 -0.0507 -0.1097 -0.0190 280 VAL A CG2   
431  N  N     . ILE A 68  ? 0.8853 0.7920 0.8325 -0.0769 -0.0441 -0.0524 281 ILE A N     
432  C  CA    . ILE A 68  ? 0.8199 0.7839 0.8089 -0.0513 -0.0291 -0.0600 281 ILE A CA    
433  C  C     . ILE A 68  ? 0.8683 0.8872 0.8987 -0.0546 -0.0226 -0.0789 281 ILE A C     
434  O  O     . ILE A 68  ? 0.8846 0.9360 0.9261 -0.0870 -0.0159 -0.0888 281 ILE A O     
435  C  CB    . ILE A 68  ? 0.8378 0.8264 0.8307 -0.0606 -0.0152 -0.0534 281 ILE A CB    
436  C  CG1   . ILE A 68  ? 0.8740 0.8088 0.8232 -0.0610 -0.0246 -0.0350 281 ILE A CG1   
437  C  CG2   . ILE A 68  ? 0.7668 0.8001 0.7980 -0.0332 -0.0056 -0.0606 281 ILE A CG2   
438  C  CD1   . ILE A 68  ? 0.7659 0.6707 0.7059 -0.0176 -0.0371 -0.0324 281 ILE A CD1   
439  N  N     . SER A 69  ? 0.7804 0.8145 0.8326 -0.0228 -0.0259 -0.0850 282 SER A N     
440  C  CA    . SER A 69  ? 0.7364 0.8171 0.8272 -0.0187 -0.0266 -0.1035 282 SER A CA    
441  C  C     . SER A 69  ? 0.7675 0.8679 0.8796 0.0063  -0.0257 -0.1031 282 SER A C     
442  O  O     . SER A 69  ? 0.7718 0.8495 0.8673 0.0237  -0.0262 -0.0882 282 SER A O     
443  C  CB    . SER A 69  ? 0.7524 0.8204 0.8403 -0.0091 -0.0403 -0.1104 282 SER A CB    
444  O  OG    . SER A 69  ? 0.8274 0.8747 0.8965 -0.0366 -0.0440 -0.1129 282 SER A OG    
445  N  N     . ILE A 70  ? 0.7319 0.8758 0.8809 0.0079  -0.0272 -0.1219 283 ILE A N     
446  C  CA    . ILE A 70  ? 0.7110 0.8655 0.8802 0.0303  -0.0336 -0.1244 283 ILE A CA    
447  C  C     . ILE A 70  ? 0.7943 0.9639 0.9887 0.0479  -0.0536 -0.1417 283 ILE A C     
448  O  O     . ILE A 70  ? 0.8223 1.0367 1.0533 0.0477  -0.0584 -0.1697 283 ILE A O     
449  C  CB    . ILE A 70  ? 0.7243 0.9108 0.9125 0.0213  -0.0220 -0.1338 283 ILE A CB    
450  C  CG1   . ILE A 70  ? 0.7438 0.9040 0.8981 0.0072  -0.0072 -0.1115 283 ILE A CG1   
451  C  CG2   . ILE A 70  ? 0.6684 0.8585 0.8786 0.0456  -0.0350 -0.1403 283 ILE A CG2   
452  C  CD1   . ILE A 70  ? 0.8826 1.0687 1.0441 -0.0056 0.0049  -0.1163 283 ILE A CD1   
453  N  N     . PRO A 71  ? 0.7513 0.8879 0.9247 0.0633  -0.0672 -0.1277 284 PRO A N     
454  C  CA    . PRO A 71  ? 0.7437 0.8856 0.9324 0.0801  -0.0914 -0.1411 284 PRO A CA    
455  C  C     . PRO A 71  ? 0.7766 0.9122 0.9805 0.1000  -0.1126 -0.1454 284 PRO A C     
456  O  O     . PRO A 71  ? 0.8005 0.9397 1.0207 0.1169  -0.1388 -0.1613 284 PRO A O     
457  C  CB    . PRO A 71  ? 0.7790 0.8875 0.9303 0.0840  -0.0970 -0.1221 284 PRO A CB    
458  C  CG    . PRO A 71  ? 0.8112 0.8976 0.9323 0.0788  -0.0806 -0.0987 284 PRO A CG    
459  C  CD    . PRO A 71  ? 0.7437 0.8438 0.8770 0.0649  -0.0621 -0.1028 284 PRO A CD    
460  N  N     . SER A 72  ? 0.6965 0.8177 0.8935 0.0993  -0.1061 -0.1324 285 SER A N     
461  C  CA    . SER A 72  ? 0.7082 0.8119 0.9159 0.1170  -0.1316 -0.1367 285 SER A CA    
462  C  C     . SER A 72  ? 0.7885 0.9029 1.0102 0.1134  -0.1198 -0.1408 285 SER A C     
463  O  O     . SER A 72  ? 0.7332 0.8689 0.9531 0.0965  -0.0915 -0.1375 285 SER A O     
464  C  CB    . SER A 72  ? 0.7593 0.8095 0.9244 0.1196  -0.1503 -0.1061 285 SER A CB    
465  O  OG    . SER A 72  ? 0.8200 0.8548 0.9544 0.1042  -0.1308 -0.0786 285 SER A OG    
466  N  N     . LYS A 73  ? 0.8102 0.9048 1.0434 0.1301  -0.1460 -0.1488 286 LYS A N     
467  C  CA    . LYS A 73  ? 0.7959 0.8940 1.0410 0.1298  -0.1410 -0.1541 286 LYS A CA    
468  C  C     . LYS A 73  ? 0.8812 0.9533 1.0876 0.1096  -0.1193 -0.1171 286 LYS A C     
469  O  O     . LYS A 73  ? 0.8822 0.9697 1.0968 0.1031  -0.1040 -0.1202 286 LYS A O     
470  C  CB    . LYS A 73  ? 0.8332 0.8998 1.0934 0.1551  -0.1835 -0.1709 286 LYS A CB    
471  C  CG    . LYS A 73  ? 1.1012 1.0939 1.3215 0.1514  -0.2068 -0.1385 286 LYS A CG    
472  C  CD    . LYS A 73  ? 1.2215 1.2096 1.4444 0.1439  -0.1979 -0.1365 286 LYS A CD    
473  C  CE    . LYS A 73  ? 1.3122 1.2253 1.5076 0.1450  -0.2362 -0.1191 286 LYS A CE    
474  N  NZ    . LYS A 73  ? 1.4621 1.3565 1.6225 0.1153  -0.2164 -0.0840 286 LYS A NZ    
475  N  N     . CYS A 74  ? 0.8387 0.8817 1.0059 0.1002  -0.1175 -0.0870 287 CYS A N     
476  C  CA    . CYS A 74  ? 0.8315 0.8630 0.9676 0.0837  -0.0999 -0.0593 287 CYS A CA    
477  C  C     . CYS A 74  ? 0.8071 0.8556 0.9234 0.0744  -0.0747 -0.0481 287 CYS A C     
478  O  O     . CYS A 74  ? 0.7742 0.8270 0.8732 0.0653  -0.0590 -0.0338 287 CYS A O     
479  C  CB    . CYS A 74  ? 0.8939 0.8804 0.9973 0.0775  -0.1231 -0.0354 287 CYS A CB    
480  S  SG    . CYS A 74  ? 0.9953 0.9562 1.0683 0.0792  -0.1456 -0.0230 287 CYS A SG    
481  N  N     . LEU A 75  ? 0.7520 0.8099 0.8715 0.0783  -0.0741 -0.0573 288 LEU A N     
482  C  CA    . LEU A 75  ? 0.7244 0.7871 0.8219 0.0738  -0.0596 -0.0495 288 LEU A CA    
483  C  C     . LEU A 75  ? 0.7514 0.8299 0.8596 0.0686  -0.0439 -0.0618 288 LEU A C     
484  O  O     . LEU A 75  ? 0.7388 0.8336 0.8714 0.0663  -0.0459 -0.0799 288 LEU A O     
485  C  CB    . LEU A 75  ? 0.7330 0.7849 0.8170 0.0792  -0.0758 -0.0484 288 LEU A CB    
486  C  CG    . LEU A 75  ? 0.8022 0.8531 0.8530 0.0775  -0.0717 -0.0372 288 LEU A CG    
487  C  CD1   . LEU A 75  ? 0.8041 0.8593 0.8289 0.0687  -0.0634 -0.0186 288 LEU A CD1   
488  C  CD2   . LEU A 75  ? 0.8590 0.8980 0.8983 0.0819  -0.0932 -0.0367 288 LEU A CD2   
489  N  N     . LEU A 76  ? 0.6909 0.7658 0.7790 0.0653  -0.0305 -0.0528 289 LEU A N     
490  C  CA    . LEU A 76  ? 0.6663 0.7389 0.7503 0.0572  -0.0215 -0.0583 289 LEU A CA    
491  C  C     . LEU A 76  ? 0.7256 0.7806 0.7834 0.0641  -0.0247 -0.0555 289 LEU A C     
492  O  O     . LEU A 76  ? 0.7263 0.7833 0.7682 0.0746  -0.0244 -0.0487 289 LEU A O     
493  C  CB    . LEU A 76  ? 0.6487 0.7246 0.7309 0.0505  -0.0101 -0.0535 289 LEU A CB    
494  C  CG    . LEU A 76  ? 0.7283 0.7909 0.7954 0.0362  -0.0054 -0.0543 289 LEU A CG    
495  C  CD1   . LEU A 76  ? 0.7240 0.8025 0.7985 0.0218  0.0043  -0.0554 289 LEU A CD1   
496  C  CD2   . LEU A 76  ? 0.7552 0.7875 0.7904 0.0467  -0.0103 -0.0461 289 LEU A CD2   
497  N  N     . LEU A 77  ? 0.7085 0.7504 0.7618 0.0569  -0.0285 -0.0636 290 LEU A N     
498  C  CA    . LEU A 77  ? 0.7337 0.7518 0.7621 0.0653  -0.0361 -0.0659 290 LEU A CA    
499  C  C     . LEU A 77  ? 0.8107 0.7961 0.8194 0.0560  -0.0382 -0.0645 290 LEU A C     
500  O  O     . LEU A 77  ? 0.8290 0.8107 0.8414 0.0322  -0.0350 -0.0642 290 LEU A O     
501  C  CB    . LEU A 77  ? 0.7435 0.7605 0.7755 0.0638  -0.0460 -0.0765 290 LEU A CB    
502  C  CG    . LEU A 77  ? 0.7592 0.7987 0.8047 0.0717  -0.0515 -0.0774 290 LEU A CG    
503  C  CD1   . LEU A 77  ? 0.7516 0.7901 0.8008 0.0699  -0.0629 -0.0902 290 LEU A CD1   
504  C  CD2   . LEU A 77  ? 0.7162 0.7635 0.7432 0.0851  -0.0512 -0.0672 290 LEU A CD2   
505  N  N     . VAL A 78  ? 0.8012 0.7638 0.7864 0.0737  -0.0466 -0.0653 291 VAL A N     
506  C  CA    . VAL A 78  ? 0.8182 0.7303 0.7744 0.0707  -0.0601 -0.0642 291 VAL A CA    
507  C  C     . VAL A 78  ? 0.8952 0.7749 0.8340 0.0807  -0.0788 -0.0773 291 VAL A C     
508  O  O     . VAL A 78  ? 0.8623 0.7594 0.8016 0.1069  -0.0829 -0.0894 291 VAL A O     
509  C  CB    . VAL A 78  ? 0.8434 0.7467 0.7855 0.0900  -0.0643 -0.0614 291 VAL A CB    
510  C  CG1   . VAL A 78  ? 0.8971 0.7327 0.8025 0.0853  -0.0865 -0.0580 291 VAL A CG1   
511  C  CG2   . VAL A 78  ? 0.7898 0.7284 0.7501 0.0813  -0.0462 -0.0507 291 VAL A CG2   
512  N  N     . HIS A 79  ? 0.9125 0.7484 0.8341 0.0563  -0.0902 -0.0756 292 HIS A N     
513  C  CA    . HIS A 79  ? 0.9548 0.7477 0.8563 0.0604  -0.1120 -0.0880 292 HIS A CA    
514  C  C     . HIS A 79  ? 1.0795 0.8032 0.9426 0.0759  -0.1397 -0.0899 292 HIS A C     
515  O  O     . HIS A 79  ? 1.1242 0.8025 0.9620 0.0528  -0.1480 -0.0745 292 HIS A O     
516  C  CB    . HIS A 79  ? 0.9698 0.7531 0.8724 0.0195  -0.1115 -0.0856 292 HIS A CB    
517  C  CG    . HIS A 79  ? 0.9455 0.7966 0.8885 0.0092  -0.0905 -0.0890 292 HIS A CG    
518  N  ND1   . HIS A 79  ? 0.9246 0.8124 0.8879 0.0338  -0.0880 -0.0996 292 HIS A ND1   
519  C  CD2   . HIS A 79  ? 0.9418 0.8285 0.9057 -0.0218 -0.0754 -0.0859 292 HIS A CD2   
520  C  CE1   . HIS A 79  ? 0.8801 0.8140 0.8748 0.0203  -0.0759 -0.1012 292 HIS A CE1   
521  N  NE2   . HIS A 79  ? 0.8889 0.8291 0.8890 -0.0111 -0.0675 -0.0968 292 HIS A NE2   
522  N  N     . GLU A 80  ? 1.0661 0.7841 0.9234 0.1159  -0.1563 -0.1107 293 GLU A N     
523  C  CA    . GLU A 80  ? 1.1220 0.7758 0.9468 0.1436  -0.1905 -0.1223 293 GLU A CA    
524  C  C     . GLU A 80  ? 1.2674 0.8666 1.0711 0.1545  -0.2216 -0.1429 293 GLU A C     
525  O  O     . GLU A 80  ? 1.2067 0.8451 1.0282 0.1620  -0.2138 -0.1587 293 GLU A O     
526  C  CB    . GLU A 80  ? 1.1049 0.8077 0.9442 0.1883  -0.1880 -0.1393 293 GLU A CB    
527  C  CG    . GLU A 80  ? 1.1857 0.9237 1.0378 0.1798  -0.1666 -0.1202 293 GLU A CG    
528  C  CD    . GLU A 80  ? 1.4498 1.2647 1.3263 0.2124  -0.1530 -0.1359 293 GLU A CD    
529  O  OE1   . GLU A 80  ? 1.5296 1.4125 1.4312 0.2063  -0.1269 -0.1355 293 GLU A OE1   
530  O  OE2   . GLU A 80  ? 1.3453 1.1528 1.2140 0.2418  -0.1705 -0.1486 293 GLU A OE2   
531  N  N     . LYS A 81  ? 1.3924 0.8938 1.1534 0.1532  -0.2603 -0.1416 297 LYS A N     
532  C  CA    . LYS A 81  ? 1.5007 0.9286 1.2340 0.1639  -0.2995 -0.1620 297 LYS A CA    
533  C  C     . LYS A 81  ? 1.6295 1.0608 1.3640 0.2293  -0.3258 -0.1995 297 LYS A C     
534  O  O     . LYS A 81  ? 1.6297 1.0463 1.3552 0.2539  -0.3396 -0.2003 297 LYS A O     
535  C  CB    . LYS A 81  ? 1.6431 0.9530 1.3218 0.1246  -0.3337 -0.1388 297 LYS A CB    
536  C  CG    . LYS A 81  ? 1.9756 1.1882 1.6172 0.1282  -0.3813 -0.1563 297 LYS A CG    
537  C  CD    . LYS A 81  ? 2.2907 1.3656 1.8653 0.1117  -0.4328 -0.1385 297 LYS A CD    
538  C  CE    . LYS A 81  ? 2.4854 1.5213 2.0457 0.1744  -0.4704 -0.1585 297 LYS A CE    
539  N  NZ    . LYS A 81  ? 2.7092 1.5993 2.1971 0.1567  -0.5265 -0.1373 297 LYS A NZ    
540  N  N     . VAL A 82  ? 1.6501 1.1107 1.3980 0.2587  -0.3324 -0.2342 298 VAL A N     
541  C  CA    . VAL A 82  ? 1.7050 1.1852 1.4581 0.3234  -0.3580 -0.2811 298 VAL A CA    
542  C  C     . VAL A 82  ? 1.8425 1.3245 1.5959 0.3496  -0.3781 -0.3223 298 VAL A C     
543  O  O     . VAL A 82  ? 1.8109 1.3834 1.5900 0.3875  -0.3665 -0.3574 298 VAL A O     
544  C  CB    . VAL A 82  ? 1.6854 1.2721 1.4722 0.3521  -0.3290 -0.2901 298 VAL A CB    
545  C  CG1   . VAL A 82  ? 1.5816 1.2728 1.4022 0.3254  -0.2758 -0.2733 298 VAL A CG1   
546  C  CG2   . VAL A 82  ? 1.7161 1.3392 1.5117 0.4180  -0.3550 -0.3444 298 VAL A CG2   
547  N  N     . ASP A 83  ? 1.9149 1.2985 1.6369 0.3306  -0.4115 -0.3223 299 ASP A N     
548  C  CA    . ASP A 83  ? 1.9836 1.2651 1.6699 0.2732  -0.4250 -0.2828 299 ASP A CA    
549  C  C     . ASP A 83  ? 1.9546 1.3059 1.6682 0.2252  -0.3782 -0.2603 299 ASP A C     
550  O  O     . ASP A 83  ? 1.9687 1.2918 1.6716 0.1687  -0.3661 -0.2244 299 ASP A O     
551  C  CB    . ASP A 83  ? 2.1459 1.2998 1.7870 0.2763  -0.4846 -0.3001 299 ASP A CB    
552  C  CG    . ASP A 83  ? 2.4383 1.4670 2.0296 0.2897  -0.5396 -0.2950 299 ASP A CG    
553  O  OD1   . ASP A 83  ? 2.4401 1.4656 2.0234 0.2730  -0.5275 -0.2629 299 ASP A OD1   
554  O  OD2   . ASP A 83  ? 2.5906 1.5187 2.1478 0.3161  -0.5981 -0.3229 299 ASP A OD2   
555  N  N     . TYR A 84  ? 1.7918 1.2413 1.5403 0.2499  -0.3536 -0.2847 303 TYR A N     
556  C  CA    A TYR A 84  ? 1.6961 1.2202 1.4730 0.2172  -0.3137 -0.2690 303 TYR A CA    
557  C  CA    B TYR A 84  ? 1.6816 1.2097 1.4596 0.2197  -0.3133 -0.2708 303 TYR A CA    
558  C  C     . TYR A 84  ? 1.5842 1.1772 1.3864 0.2034  -0.2730 -0.2401 303 TYR A C     
559  O  O     . TYR A 84  ? 1.5541 1.1631 1.3582 0.2294  -0.2715 -0.2419 303 TYR A O     
560  C  CB    A TYR A 84  ? 1.6983 1.2896 1.4917 0.2468  -0.3091 -0.3030 303 TYR A CB    
561  C  CB    B TYR A 84  ? 1.6605 1.2654 1.4566 0.2562  -0.3068 -0.3064 303 TYR A CB    
562  C  CG    A TYR A 84  ? 1.6894 1.3712 1.5012 0.2898  -0.2927 -0.3246 303 TYR A CG    
563  C  CG    B TYR A 84  ? 1.6223 1.2766 1.4354 0.2292  -0.2847 -0.2998 303 TYR A CG    
564  C  CD1   A TYR A 84  ? 1.7688 1.4401 1.5723 0.3384  -0.3192 -0.3588 303 TYR A CD1   
565  C  CD1   B TYR A 84  ? 1.6879 1.3118 1.4906 0.2264  -0.3066 -0.3211 303 TYR A CD1   
566  C  CD2   A TYR A 84  ? 1.6211 1.4009 1.4564 0.2812  -0.2546 -0.3148 303 TYR A CD2   
567  C  CD2   B TYR A 84  ? 1.5472 1.2771 1.3861 0.2099  -0.2461 -0.2750 303 TYR A CD2   
568  C  CE1   A TYR A 84  ? 1.7520 1.5234 1.5747 0.3736  -0.3022 -0.3839 303 TYR A CE1   
569  C  CE1   B TYR A 84  ? 1.6570 1.3285 1.4757 0.2045  -0.2895 -0.3171 303 TYR A CE1   
570  C  CE2   A TYR A 84  ? 1.6008 1.4681 1.4472 0.3109  -0.2390 -0.3335 303 TYR A CE2   
571  C  CE2   B TYR A 84  ? 1.5232 1.2928 1.3762 0.1895  -0.2326 -0.2705 303 TYR A CE2   
572  C  CZ    A TYR A 84  ? 1.7551 1.6257 1.5972 0.3555  -0.2603 -0.3694 303 TYR A CZ    
573  C  CZ    B TYR A 84  ? 1.6349 1.3783 1.4785 0.1873  -0.2537 -0.2917 303 TYR A CZ    
574  O  OH    A TYR A 84  ? 1.7600 1.7327 1.6152 0.3804  -0.2427 -0.3919 303 TYR A OH    
575  O  OH    B TYR A 84  ? 1.5862 1.3710 1.4442 0.1698  -0.2432 -0.2891 303 TYR A OH    
576  N  N     . LEU A 85  ? 1.3944 1.0268 1.2168 0.1635  -0.2434 -0.2163 304 LEU A N     
577  C  CA    . LEU A 85  ? 1.2658 0.9577 1.1132 0.1465  -0.2080 -0.1903 304 LEU A CA    
578  C  C     . LEU A 85  ? 1.2095 0.9803 1.0762 0.1785  -0.1882 -0.1981 304 LEU A C     
579  O  O     . LEU A 85  ? 1.1805 1.0001 1.0549 0.1938  -0.1832 -0.2145 304 LEU A O     
580  C  CB    . LEU A 85  ? 1.2093 0.9351 1.0787 0.1089  -0.1881 -0.1769 304 LEU A CB    
581  C  CG    . LEU A 85  ? 1.2094 0.9440 1.0914 0.0689  -0.1688 -0.1508 304 LEU A CG    
582  C  CD1   . LEU A 85  ? 1.1437 0.9416 1.0594 0.0535  -0.1492 -0.1494 304 LEU A CD1   
583  C  CD2   . LEU A 85  ? 1.1638 0.9103 1.0478 0.0771  -0.1556 -0.1352 304 LEU A CD2   
584  N  N     . GLU A 86  ? 1.1248 0.9113 0.9970 0.1819  -0.1758 -0.1842 305 GLU A N     
585  C  CA    . GLU A 86  ? 1.0608 0.9233 0.9501 0.2005  -0.1545 -0.1861 305 GLU A CA    
586  C  C     . GLU A 86  ? 1.0543 0.9350 0.9599 0.1733  -0.1305 -0.1557 305 GLU A C     
587  O  O     . GLU A 86  ? 1.0838 0.9247 0.9821 0.1612  -0.1343 -0.1422 305 GLU A O     
588  C  CB    . GLU A 86  ? 1.1039 0.9737 0.9851 0.2407  -0.1691 -0.2106 305 GLU A CB    
589  C  CG    . GLU A 86  ? 1.2220 1.1047 1.0952 0.2734  -0.1881 -0.2493 305 GLU A CG    
590  C  CD    . GLU A 86  ? 1.5432 1.4763 1.4199 0.3172  -0.1955 -0.2838 305 GLU A CD    
591  O  OE1   . GLU A 86  ? 1.6528 1.5840 1.5215 0.3504  -0.2197 -0.3231 305 GLU A OE1   
592  O  OE2   . GLU A 86  ? 1.4039 1.3815 1.2928 0.3195  -0.1791 -0.2754 305 GLU A OE2   
593  N  N     . ASN A 87  ? 0.9395 0.8737 0.8637 0.1612  -0.1096 -0.1451 306 ASN A N     
594  C  CA    . ASN A 87  ? 0.8793 0.8310 0.8217 0.1386  -0.0907 -0.1214 306 ASN A CA    
595  C  C     . ASN A 87  ? 0.8959 0.8951 0.8447 0.1482  -0.0759 -0.1153 306 ASN A C     
596  O  O     . ASN A 87  ? 0.8850 0.9276 0.8313 0.1565  -0.0711 -0.1210 306 ASN A O     
597  C  CB    . ASN A 87  ? 0.8298 0.7974 0.7875 0.1201  -0.0857 -0.1156 306 ASN A CB    
598  C  CG    . ASN A 87  ? 1.0149 0.9482 0.9685 0.1081  -0.0995 -0.1252 306 ASN A CG    
599  O  OD1   . ASN A 87  ? 0.9386 0.8391 0.8906 0.0871  -0.1023 -0.1201 306 ASN A OD1   
600  N  ND2   . ASN A 87  ? 0.9148 0.8564 0.8629 0.1176  -0.1088 -0.1393 306 ASN A ND2   
601  N  N     . GLN A 88  ? 0.8573 0.8517 0.8113 0.1433  -0.0689 -0.1038 307 GLN A N     
602  C  CA    . GLN A 88  ? 0.8310 0.8713 0.7926 0.1474  -0.0548 -0.0975 307 GLN A CA    
603  C  C     . GLN A 88  ? 0.8391 0.8903 0.8183 0.1237  -0.0412 -0.0767 307 GLN A C     
604  O  O     . GLN A 88  ? 0.8162 0.8425 0.8046 0.1089  -0.0403 -0.0694 307 GLN A O     
605  C  CB    . GLN A 88  ? 0.8669 0.8984 0.8229 0.1633  -0.0598 -0.1033 307 GLN A CB    
606  C  CG    . GLN A 88  ? 1.1258 1.2162 1.0901 0.1695  -0.0467 -0.1040 307 GLN A CG    
607  C  CD    . GLN A 88  ? 1.3080 1.4016 1.2695 0.1929  -0.0555 -0.1176 307 GLN A CD    
608  O  OE1   . GLN A 88  ? 1.2509 1.2927 1.1984 0.2095  -0.0770 -0.1273 307 GLN A OE1   
609  N  NE2   . GLN A 88  ? 1.0736 1.2271 1.0459 0.1936  -0.0422 -0.1192 307 GLN A NE2   
610  N  N     . ALA A 89  ? 0.7685 0.8570 0.7498 0.1186  -0.0334 -0.0691 308 ALA A N     
611  C  CA    . ALA A 89  ? 0.7479 0.8371 0.7431 0.1009  -0.0288 -0.0528 308 ALA A CA    
612  C  C     . ALA A 89  ? 0.7729 0.8818 0.7729 0.0949  -0.0189 -0.0426 308 ALA A C     
613  O  O     . ALA A 89  ? 0.7724 0.9143 0.7623 0.0990  -0.0134 -0.0450 308 ALA A O     
614  C  CB    . ALA A 89  ? 0.7635 0.8608 0.7511 0.0947  -0.0355 -0.0474 308 ALA A CB    
615  N  N     . PHE A 90  ? 0.6982 0.7937 0.7154 0.0845  -0.0168 -0.0349 309 PHE A N     
616  C  CA    . PHE A 90  ? 0.6814 0.7902 0.7054 0.0767  -0.0097 -0.0258 309 PHE A CA    
617  C  C     . PHE A 90  ? 0.7638 0.8597 0.7997 0.0654  -0.0174 -0.0179 309 PHE A C     
618  O  O     . PHE A 90  ? 0.7483 0.8289 0.7978 0.0670  -0.0250 -0.0249 309 PHE A O     
619  C  CB    . PHE A 90  ? 0.6838 0.7849 0.7162 0.0794  -0.0040 -0.0296 309 PHE A CB    
620  C  CG    . PHE A 90  ? 0.7197 0.8207 0.7374 0.0951  -0.0054 -0.0386 309 PHE A CG    
621  C  CD1   . PHE A 90  ? 0.7442 0.8743 0.7585 0.1039  -0.0014 -0.0417 309 PHE A CD1   
622  C  CD2   . PHE A 90  ? 0.7477 0.8191 0.7551 0.1023  -0.0146 -0.0468 309 PHE A CD2   
623  C  CE1   . PHE A 90  ? 0.7484 0.8783 0.7515 0.1258  -0.0093 -0.0561 309 PHE A CE1   
624  C  CE2   . PHE A 90  ? 0.7902 0.8509 0.7812 0.1216  -0.0241 -0.0580 309 PHE A CE2   
625  C  CZ    . PHE A 90  ? 0.7425 0.8322 0.7328 0.1361  -0.0227 -0.0640 309 PHE A CZ    
626  N  N     . CYS A 91  ? 0.7629 0.8649 0.7942 0.0543  -0.0184 -0.0062 310 CYS A N     
627  C  CA    . CYS A 91  ? 0.7896 0.8676 0.8274 0.0462  -0.0338 0.0007  310 CYS A CA    
628  C  C     . CYS A 91  ? 0.8002 0.8780 0.8523 0.0405  -0.0308 0.0016  310 CYS A C     
629  O  O     . CYS A 91  ? 0.7790 0.8754 0.8211 0.0309  -0.0216 0.0094  310 CYS A O     
630  C  CB    . CYS A 91  ? 0.8524 0.9224 0.8599 0.0322  -0.0461 0.0177  310 CYS A CB    
631  S  SG    . CYS A 91  ? 0.9531 0.9719 0.9596 0.0285  -0.0789 0.0253  310 CYS A SG    
632  N  N     . PHE A 92  ? 0.7783 0.8421 0.8555 0.0463  -0.0393 -0.0099 311 PHE A N     
633  C  CA    . PHE A 92  ? 0.7549 0.8204 0.8491 0.0435  -0.0380 -0.0151 311 PHE A CA    
634  C  C     . PHE A 92  ? 0.8123 0.8478 0.9185 0.0469  -0.0640 -0.0210 311 PHE A C     
635  O  O     . PHE A 92  ? 0.8138 0.8289 0.9165 0.0533  -0.0825 -0.0219 311 PHE A O     
636  C  CB    . PHE A 92  ? 0.7437 0.8320 0.8579 0.0495  -0.0222 -0.0315 311 PHE A CB    
637  C  CG    . PHE A 92  ? 0.7404 0.8428 0.8377 0.0494  -0.0055 -0.0257 311 PHE A CG    
638  C  CD1   . PHE A 92  ? 0.7726 0.8889 0.8598 0.0462  0.0032  -0.0181 311 PHE A CD1   
639  C  CD2   . PHE A 92  ? 0.7562 0.8558 0.8472 0.0540  -0.0030 -0.0300 311 PHE A CD2   
640  C  CE1   . PHE A 92  ? 0.7870 0.9141 0.8594 0.0532  0.0114  -0.0175 311 PHE A CE1   
641  C  CE2   . PHE A 92  ? 0.8070 0.9081 0.8798 0.0582  0.0043  -0.0272 311 PHE A CE2   
642  C  CZ    . PHE A 92  ? 0.7859 0.9006 0.8499 0.0607  0.0100  -0.0222 311 PHE A CZ    
643  N  N     . ASP A 93  ? 0.7655 0.7959 0.8858 0.0456  -0.0695 -0.0280 312 ASP A N     
644  C  CA    . ASP A 93  ? 0.7750 0.7705 0.9083 0.0547  -0.1014 -0.0397 312 ASP A CA    
645  C  C     . ASP A 93  ? 0.8063 0.8210 0.9742 0.0765  -0.1076 -0.0710 312 ASP A C     
646  O  O     . ASP A 93  ? 0.8348 0.8231 1.0099 0.0910  -0.1378 -0.0815 312 ASP A O     
647  C  CB    . ASP A 93  ? 0.7998 0.7875 0.9413 0.0496  -0.1063 -0.0445 312 ASP A CB    
648  C  CG    . ASP A 93  ? 0.8712 0.8423 0.9786 0.0232  -0.1043 -0.0148 312 ASP A CG    
649  O  OD1   . ASP A 93  ? 0.8999 0.8350 0.9750 0.0090  -0.1220 0.0074  312 ASP A OD1   
650  O  OD2   . ASP A 93  ? 0.8853 0.8863 0.9954 0.0138  -0.0833 -0.0132 312 ASP A OD2   
651  N  N     . PHE A 94  ? 0.7202 0.7829 0.9071 0.0766  -0.0807 -0.0861 313 PHE A N     
652  C  CA    . PHE A 94  ? 0.7002 0.7991 0.9187 0.0879  -0.0794 -0.1166 313 PHE A CA    
653  C  C     . PHE A 94  ? 0.7311 0.8611 0.9409 0.0743  -0.0499 -0.1111 313 PHE A C     
654  O  O     . PHE A 94  ? 0.6917 0.8262 0.8840 0.0622  -0.0304 -0.0963 313 PHE A O     
655  C  CB    . PHE A 94  ? 0.7100 0.8400 0.9653 0.0983  -0.0848 -0.1518 313 PHE A CB    
656  C  CG    . PHE A 94  ? 0.7664 0.8554 1.0309 0.1162  -0.1223 -0.1626 313 PHE A CG    
657  C  CD1   . PHE A 94  ? 0.8204 0.8938 1.1031 0.1398  -0.1567 -0.1842 313 PHE A CD1   
658  C  CD2   . PHE A 94  ? 0.7645 0.8244 1.0170 0.1098  -0.1282 -0.1515 313 PHE A CD2   
659  C  CE1   . PHE A 94  ? 0.8715 0.8908 1.1563 0.1583  -0.2003 -0.1934 313 PHE A CE1   
660  C  CE2   . PHE A 94  ? 0.8291 0.8366 1.0838 0.1236  -0.1691 -0.1598 313 PHE A CE2   
661  C  CZ    . PHE A 94  ? 0.8488 0.8323 1.1184 0.1489  -0.2067 -0.1808 313 PHE A CZ    
662  N  N     . ALA A 95  ? 0.7056 0.8522 0.9251 0.0763  -0.0506 -0.1231 314 ALA A N     
663  C  CA    . ALA A 95  ? 0.6883 0.8563 0.8971 0.0598  -0.0280 -0.1198 314 ALA A CA    
664  C  C     . ALA A 95  ? 0.7305 0.9513 0.9724 0.0550  -0.0245 -0.1534 314 ALA A C     
665  O  O     . ALA A 95  ? 0.7140 0.9505 0.9831 0.0692  -0.0420 -0.1765 314 ALA A O     
666  C  CB    . ALA A 95  ? 0.6945 0.8359 0.8785 0.0596  -0.0305 -0.1019 314 ALA A CB    
667  N  N     . PHE A 96  ? 0.6833 0.9370 0.9232 0.0345  -0.0039 -0.1587 315 PHE A N     
668  C  CA    . PHE A 96  ? 0.6680 0.9880 0.9369 0.0214  0.0039  -0.1925 315 PHE A CA    
669  C  C     . PHE A 96  ? 0.7502 1.0766 0.9960 -0.0092 0.0185  -0.1826 315 PHE A C     
670  O  O     . PHE A 96  ? 0.7685 1.0636 0.9747 -0.0282 0.0299  -0.1554 315 PHE A O     
671  C  CB    . PHE A 96  ? 0.6698 1.0325 0.9507 0.0135  0.0155  -0.2097 315 PHE A CB    
672  C  CG    . PHE A 96  ? 0.6802 1.0289 0.9816 0.0423  -0.0023 -0.2206 315 PHE A CG    
673  C  CD1   . PHE A 96  ? 0.6966 1.0718 1.0412 0.0684  -0.0248 -0.2590 315 PHE A CD1   
674  C  CD2   . PHE A 96  ? 0.6860 0.9917 0.9626 0.0439  -0.0007 -0.1940 315 PHE A CD2   
675  C  CE1   . PHE A 96  ? 0.7109 1.0584 1.0688 0.0942  -0.0479 -0.2684 315 PHE A CE1   
676  C  CE2   . PHE A 96  ? 0.7116 0.9986 1.0035 0.0649  -0.0195 -0.2030 315 PHE A CE2   
677  C  CZ    . PHE A 96  ? 0.6872 0.9885 1.0170 0.0894  -0.0446 -0.2385 315 PHE A CZ    
678  N  N     . ASP A 97  ? 0.7136 1.0781 0.9829 -0.0142 0.0147  -0.2060 316 ASP A N     
679  C  CA    . ASP A 97  ? 0.7266 1.0948 0.9725 -0.0489 0.0260  -0.1975 316 ASP A CA    
680  C  C     . ASP A 97  ? 0.7893 1.2234 1.0374 -0.0881 0.0457  -0.2148 316 ASP A C     
681  O  O     . ASP A 97  ? 0.7729 1.2554 1.0431 -0.0846 0.0522  -0.2359 316 ASP A O     
682  C  CB    . ASP A 97  ? 0.7480 1.1207 1.0109 -0.0408 0.0126  -0.2099 316 ASP A CB    
683  C  CG    . ASP A 97  ? 0.8643 1.3178 1.1817 -0.0336 0.0060  -0.2568 316 ASP A CG    
684  O  OD1   . ASP A 97  ? 0.8649 1.3845 1.2111 -0.0376 0.0140  -0.2863 316 ASP A OD1   
685  O  OD2   . ASP A 97  ? 0.9933 1.4498 1.3256 -0.0229 -0.0082 -0.2677 316 ASP A OD2   
686  N  N     . GLU A 98  ? 0.7819 1.2194 1.0045 -0.1286 0.0542  -0.2068 317 GLU A N     
687  C  CA    . GLU A 98  ? 0.8048 1.3029 1.0160 -0.1799 0.0737  -0.2170 317 GLU A CA    
688  C  C     . GLU A 98  ? 0.8539 1.4702 1.1229 -0.1840 0.0816  -0.2702 317 GLU A C     
689  O  O     . GLU A 98  ? 0.8883 1.5732 1.1520 -0.2253 0.1006  -0.2843 317 GLU A O     
690  C  CB    . GLU A 98  ? 0.8647 1.3228 1.0257 -0.2275 0.0755  -0.1911 317 GLU A CB    
691  C  CG    . GLU A 98  ? 0.8918 1.3637 1.0741 -0.2294 0.0668  -0.2066 317 GLU A CG    
692  C  CD    . GLU A 98  ? 1.1689 1.5531 1.3353 -0.1973 0.0470  -0.1840 317 GLU A CD    
693  O  OE1   . GLU A 98  ? 1.1283 1.4840 1.3115 -0.1476 0.0363  -0.1812 317 GLU A OE1   
694  O  OE2   . GLU A 98  ? 0.9828 1.3423 1.1279 -0.2230 0.0413  -0.1769 317 GLU A OE2   
695  N  N     . THR A 99  ? 0.7745 1.4178 1.0968 -0.1410 0.0650  -0.3021 318 THR A N     
696  C  CA    . THR A 99  ? 0.7425 1.5033 1.1269 -0.1349 0.0665  -0.3617 318 THR A CA    
697  C  C     . THR A 99  ? 0.7699 1.5552 1.1842 -0.0988 0.0612  -0.3859 318 THR A C     
698  O  O     . THR A 99  ? 0.7575 1.6464 1.2223 -0.0923 0.0627  -0.4405 318 THR A O     
699  C  CB    . THR A 99  ? 0.7284 1.5089 1.1561 -0.1054 0.0448  -0.3898 318 THR A CB    
700  O  OG1   . THR A 99  ? 0.8409 1.5481 1.2775 -0.0477 0.0167  -0.3801 318 THR A OG1   
701  C  CG2   . THR A 99  ? 0.4756 1.2237 0.8724 -0.1392 0.0474  -0.3655 318 THR A CG2   
702  N  N     . ALA A 100 ? 0.7247 1.4192 1.1111 -0.0736 0.0528  -0.3499 319 ALA A N     
703  C  CA    . ALA A 100 ? 0.7051 1.4065 1.1146 -0.0403 0.0440  -0.3684 319 ALA A CA    
704  C  C     . ALA A 100 ? 0.7606 1.5269 1.1621 -0.0723 0.0687  -0.3812 319 ALA A C     
705  O  O     . ALA A 100 ? 0.7873 1.5205 1.1356 -0.1100 0.0871  -0.3422 319 ALA A O     
706  C  CB    . ALA A 100 ? 0.7099 1.3017 1.0900 -0.0121 0.0288  -0.3257 319 ALA A CB    
707  N  N     . SER A 101 ? 0.6902 1.5505 1.1437 -0.0557 0.0662  -0.4388 320 SER A N     
708  C  CA    . SER A 101 ? 0.6808 1.6196 1.1330 -0.0821 0.0885  -0.4612 320 SER A CA    
709  C  C     . SER A 101 ? 0.6981 1.5716 1.1341 -0.0564 0.0803  -0.4417 320 SER A C     
710  O  O     . SER A 101 ? 0.6671 1.4540 1.1054 -0.0161 0.0553  -0.4232 320 SER A O     
711  C  CB    . SER A 101 ? 0.6870 1.7591 1.2086 -0.0655 0.0851  -0.5399 320 SER A CB    
712  O  OG    . SER A 101 ? 0.7537 1.7969 1.3219 0.0016  0.0481  -0.5703 320 SER A OG    
713  N  N     . ASN A 102 ? 0.6675 1.5876 1.0867 -0.0822 0.1004  -0.4476 321 ASN A N     
714  C  CA    . ASN A 102 ? 0.6587 1.5328 1.0675 -0.0599 0.0932  -0.4368 321 ASN A CA    
715  C  C     . ASN A 102 ? 0.7134 1.5858 1.1787 -0.0004 0.0612  -0.4800 321 ASN A C     
716  O  O     . ASN A 102 ? 0.7242 1.5095 1.1789 0.0269  0.0422  -0.4556 321 ASN A O     
717  C  CB    . ASN A 102 ? 0.6577 1.6031 1.0450 -0.0977 0.1190  -0.4475 321 ASN A CB    
718  C  CG    . ASN A 102 ? 0.9746 1.8729 1.2877 -0.1499 0.1390  -0.3887 321 ASN A CG    
719  O  OD1   . ASN A 102 ? 0.9034 1.7151 1.1837 -0.1548 0.1332  -0.3423 321 ASN A OD1   
720  N  ND2   . ASN A 102 ? 0.8766 1.8299 1.1590 -0.1899 0.1598  -0.3910 321 ASN A ND2   
721  N  N     . GLU A 103 ? 0.6736 1.6388 1.1970 0.0189  0.0517  -0.5441 322 GLU A N     
722  C  CA    . GLU A 103 ? 0.6799 1.6496 1.2611 0.0792  0.0129  -0.5963 322 GLU A CA    
723  C  C     . GLU A 103 ? 0.7498 1.5962 1.3233 0.1145  -0.0224 -0.5618 322 GLU A C     
724  O  O     . GLU A 103 ? 0.7986 1.5792 1.3805 0.1526  -0.0551 -0.5656 322 GLU A O     
725  C  CB    . GLU A 103 ? 0.6913 1.7980 1.3346 0.0879  0.0118  -0.6725 322 GLU A CB    
726  C  CG    . GLU A 103 ? 0.8799 1.9914 1.5863 0.1562  -0.0368 -0.7329 322 GLU A CG    
727  C  CD    . GLU A 103 ? 1.2304 2.4671 2.0011 0.1724  -0.0449 -0.8058 322 GLU A CD    
728  O  OE1   . GLU A 103 ? 0.9208 2.1997 1.6854 0.1370  -0.0232 -0.7940 322 GLU A OE1   
729  O  OE2   . GLU A 103 ? 1.2400 2.5257 2.0693 0.2257  -0.0792 -0.8772 322 GLU A OE2   
730  N  N     . VAL A 104 ? 0.6631 1.4778 1.2163 0.0977  -0.0167 -0.5278 323 VAL A N     
731  C  CA    . VAL A 104 ? 0.6649 1.3732 1.2039 0.1230  -0.0458 -0.4929 323 VAL A CA    
732  C  C     . VAL A 104 ? 0.7529 1.3557 1.2391 0.1145  -0.0431 -0.4312 323 VAL A C     
733  O  O     . VAL A 104 ? 0.7940 1.3149 1.2743 0.1425  -0.0741 -0.4161 323 VAL A O     
734  C  CB    . VAL A 104 ? 0.7032 1.4228 1.2339 0.1017  -0.0349 -0.4777 323 VAL A CB    
735  C  CG1   . VAL A 104 ? 0.7019 1.3093 1.1995 0.1140  -0.0542 -0.4275 323 VAL A CG1   
736  C  CG2   . VAL A 104 ? 0.7009 1.5222 1.2912 0.1181  -0.0462 -0.5429 323 VAL A CG2   
737  N  N     . VAL A 105 ? 0.6809 1.2862 1.1260 0.0738  -0.0082 -0.3958 324 VAL A N     
738  C  CA    . VAL A 105 ? 0.6685 1.1927 1.0676 0.0652  -0.0033 -0.3439 324 VAL A CA    
739  C  C     . VAL A 105 ? 0.7220 1.2287 1.1352 0.0892  -0.0213 -0.3602 324 VAL A C     
740  O  O     . VAL A 105 ? 0.7352 1.1618 1.1328 0.1041  -0.0417 -0.3336 324 VAL A O     
741  C  CB    . VAL A 105 ? 0.7000 1.2391 1.0558 0.0211  0.0316  -0.3132 324 VAL A CB    
742  C  CG1   . VAL A 105 ? 0.6865 1.1556 1.0018 0.0179  0.0341  -0.2690 324 VAL A CG1   
743  C  CG2   . VAL A 105 ? 0.6918 1.2307 1.0276 -0.0042 0.0435  -0.2943 324 VAL A CG2   
744  N  N     . TYR A 106 ? 0.6672 1.2523 1.1086 0.0898  -0.0144 -0.4055 325 TYR A N     
745  C  CA    . TYR A 106 ? 0.6912 1.2705 1.1490 0.1118  -0.0315 -0.4298 325 TYR A CA    
746  C  C     . TYR A 106 ? 0.7886 1.3004 1.2685 0.1544  -0.0785 -0.4433 325 TYR A C     
747  O  O     . TYR A 106 ? 0.8054 1.2442 1.2675 0.1618  -0.0964 -0.4220 325 TYR A O     
748  C  CB    . TYR A 106 ? 0.6927 1.3875 1.1855 0.1092  -0.0183 -0.4898 325 TYR A CB    
749  C  CG    . TYR A 106 ? 0.6947 1.3891 1.2117 0.1382  -0.0411 -0.5263 325 TYR A CG    
750  C  CD1   . TYR A 106 ? 0.7107 1.3542 1.1955 0.1278  -0.0366 -0.4946 325 TYR A CD1   
751  C  CD2   . TYR A 106 ? 0.7025 1.4455 1.2759 0.1789  -0.0711 -0.5956 325 TYR A CD2   
752  C  CE1   . TYR A 106 ? 0.7258 1.3622 1.2316 0.1533  -0.0605 -0.5283 325 TYR A CE1   
753  C  CE2   . TYR A 106 ? 0.7315 1.4649 1.3263 0.2086  -0.0979 -0.6322 325 TYR A CE2   
754  C  CZ    . TYR A 106 ? 0.8180 1.4950 1.3774 0.1936  -0.0919 -0.5965 325 TYR A CZ    
755  O  OH    . TYR A 106 ? 0.8896 1.5528 1.4683 0.2205  -0.1197 -0.6322 325 TYR A OH    
756  N  N     . ARG A 107 ? 0.7541 1.2873 1.2687 0.1794  -0.1008 -0.4771 326 ARG A N     
757  C  CA    . ARG A 107 ? 0.7953 1.2593 1.3271 0.2214  -0.1533 -0.4918 326 ARG A CA    
758  C  C     . ARG A 107 ? 0.8920 1.2321 1.3750 0.2148  -0.1705 -0.4294 326 ARG A C     
759  O  O     . ARG A 107 ? 0.9497 1.2167 1.4297 0.2365  -0.2114 -0.4315 326 ARG A O     
760  C  CB    . ARG A 107 ? 0.7708 1.2725 1.3372 0.2436  -0.1711 -0.5252 326 ARG A CB    
761  C  CG    . ARG A 107 ? 0.9311 1.3438 1.5044 0.2867  -0.2321 -0.5328 326 ARG A CG    
762  C  CD    . ARG A 107 ? 1.0547 1.5059 1.6680 0.3182  -0.2591 -0.5754 326 ARG A CD    
763  N  NE    . ARG A 107 ? 1.2323 1.6315 1.8715 0.3720  -0.3250 -0.6167 326 ARG A NE    
764  C  CZ    . ARG A 107 ? 1.3611 1.6519 1.9767 0.3937  -0.3752 -0.5935 326 ARG A CZ    
765  N  NH1   . ARG A 107 ? 1.1955 1.4346 1.7675 0.3680  -0.3633 -0.5352 326 ARG A NH1   
766  N  NH2   . ARG A 107 ? 1.2587 1.4932 1.8929 0.4425  -0.4410 -0.6320 326 ARG A NH2   
767  N  N     . PHE A 108 ? 0.8297 1.1485 1.2740 0.1842  -0.1422 -0.3773 327 PHE A N     
768  C  CA    . PHE A 108 ? 0.8406 1.0626 1.2407 0.1753  -0.1551 -0.3229 327 PHE A CA    
769  C  C     . PHE A 108 ? 0.9063 1.1017 1.2703 0.1481  -0.1326 -0.2830 327 PHE A C     
770  O  O     . PHE A 108 ? 0.9377 1.0637 1.2665 0.1375  -0.1427 -0.2421 327 PHE A O     
771  C  CB    . PHE A 108 ? 0.8305 1.0476 1.2145 0.1657  -0.1448 -0.2976 327 PHE A CB    
772  C  CG    . PHE A 108 ? 0.8589 1.0849 1.2747 0.1958  -0.1772 -0.3325 327 PHE A CG    
773  C  CD1   . PHE A 108 ? 0.9549 1.1012 1.3629 0.2206  -0.2273 -0.3291 327 PHE A CD1   
774  C  CD2   . PHE A 108 ? 0.8503 1.1641 1.3009 0.1971  -0.1604 -0.3685 327 PHE A CD2   
775  C  CE1   . PHE A 108 ? 1.0016 1.1540 1.4390 0.2534  -0.2632 -0.3641 327 PHE A CE1   
776  C  CE2   . PHE A 108 ? 0.9084 1.2411 1.3945 0.2282  -0.1925 -0.4073 327 PHE A CE2   
777  C  CZ    . PHE A 108 ? 0.9437 1.1943 1.4241 0.2597  -0.2451 -0.4057 327 PHE A CZ    
778  N  N     . THR A 109 ? 0.8165 1.0726 1.1881 0.1351  -0.1030 -0.2965 328 THR A N     
779  C  CA    . THR A 109 ? 0.7723 1.0154 1.1125 0.1112  -0.0806 -0.2632 328 THR A CA    
780  C  C     . THR A 109 ? 0.8324 1.0797 1.1856 0.1179  -0.0911 -0.2861 328 THR A C     
781  O  O     . THR A 109 ? 0.8651 1.0485 1.2083 0.1224  -0.1179 -0.2746 328 THR A O     
782  C  CB    . THR A 109 ? 0.8024 1.0950 1.1256 0.0862  -0.0407 -0.2482 328 THR A CB    
783  O  OG1   . THR A 109 ? 0.8334 1.2055 1.1833 0.0847  -0.0274 -0.2894 328 THR A OG1   
784  C  CG2   . THR A 109 ? 0.7951 1.0684 1.0995 0.0787  -0.0337 -0.2210 328 THR A CG2   
785  N  N     . ALA A 110 ? 0.7722 1.0950 1.1443 0.1148  -0.0711 -0.3187 329 ALA A N     
786  C  CA    . ALA A 110 ? 0.7610 1.1030 1.1462 0.1202  -0.0766 -0.3460 329 ALA A CA    
787  C  C     . ALA A 110 ? 0.8689 1.1999 1.2927 0.1557  -0.1181 -0.3959 329 ALA A C     
788  O  O     . ALA A 110 ? 0.9177 1.2147 1.3430 0.1633  -0.1392 -0.4053 329 ALA A O     
789  C  CB    . ALA A 110 ? 0.7332 1.1650 1.1203 0.1023  -0.0416 -0.3648 329 ALA A CB    
790  N  N     . ALA A 111 ? 0.8152 1.1749 1.2716 0.1793  -0.1337 -0.4317 330 ALA A N     
791  C  CA    . ALA A 111 ? 0.8449 1.2026 1.3438 0.2214  -0.1788 -0.4904 330 ALA A CA    
792  C  C     . ALA A 111 ? 0.9524 1.1924 1.4351 0.2367  -0.2287 -0.4743 330 ALA A C     
793  O  O     . ALA A 111 ? 0.9909 1.2188 1.4894 0.2544  -0.2543 -0.5077 330 ALA A O     
794  C  CB    . ALA A 111 ? 0.8457 1.2531 1.3818 0.2457  -0.1902 -0.5297 330 ALA A CB    
795  N  N     . PRO A 112 ? 0.9074 1.0588 1.3525 0.2243  -0.2421 -0.4209 331 PRO A N     
796  C  CA    . PRO A 112 ? 0.9704 1.0077 1.3899 0.2276  -0.2897 -0.4010 331 PRO A CA    
797  C  C     . PRO A 112 ? 1.0396 1.0549 1.4360 0.2012  -0.2788 -0.3794 331 PRO A C     
798  O  O     . PRO A 112 ? 1.1037 1.0321 1.4830 0.2018  -0.3206 -0.3727 331 PRO A O     
799  C  CB    . PRO A 112 ? 0.9895 0.9606 1.3674 0.2085  -0.2935 -0.3444 331 PRO A CB    
800  C  CG    . PRO A 112 ? 0.9557 0.9996 1.3358 0.1945  -0.2457 -0.3315 331 PRO A CG    
801  C  CD    . PRO A 112 ? 0.8639 1.0144 1.2864 0.2059  -0.2187 -0.3799 331 PRO A CD    
802  N  N     . LEU A 113 ? 0.9356 1.0232 1.3282 0.1769  -0.2274 -0.3681 332 LEU A N     
803  C  CA    . LEU A 113 ? 0.9403 1.0153 1.3128 0.1528  -0.2164 -0.3491 332 LEU A CA    
804  C  C     . LEU A 113 ? 1.0363 1.1499 1.4411 0.1725  -0.2276 -0.4041 332 LEU A C     
805  O  O     . LEU A 113 ? 1.0431 1.1351 1.4350 0.1577  -0.2303 -0.3964 332 LEU A O     
806  C  CB    . LEU A 113 ? 0.8738 0.9954 1.2209 0.1196  -0.1637 -0.3084 332 LEU A CB    
807  C  CG    . LEU A 113 ? 0.9205 1.0139 1.2351 0.0997  -0.1489 -0.2566 332 LEU A CG    
808  C  CD1   . LEU A 113 ? 0.8611 0.9907 1.1520 0.0732  -0.1081 -0.2241 332 LEU A CD1   
809  C  CD2   . LEU A 113 ? 1.0401 1.0421 1.3272 0.0892  -0.1829 -0.2263 332 LEU A CD2   
810  N  N     . VAL A 114 ? 0.9861 1.1657 1.4343 0.2049  -0.2332 -0.4630 333 VAL A N     
811  C  CA    . VAL A 114 ? 0.9838 1.2164 1.4679 0.2284  -0.2443 -0.5261 333 VAL A CA    
812  C  C     . VAL A 114 ? 1.1380 1.2726 1.6249 0.2513  -0.3063 -0.5454 333 VAL A C     
813  O  O     . VAL A 114 ? 1.1653 1.3022 1.6564 0.2510  -0.3134 -0.5664 333 VAL A O     
814  C  CB    . VAL A 114 ? 1.0038 1.3457 1.5356 0.2555  -0.2347 -0.5894 333 VAL A CB    
815  C  CG1   . VAL A 114 ? 1.0267 1.4278 1.5973 0.2828  -0.2503 -0.6617 333 VAL A CG1   
816  C  CG2   . VAL A 114 ? 0.9337 1.3670 1.4538 0.2228  -0.1746 -0.5677 333 VAL A CG2   
817  N  N     . GLN A 115 ? 1.1503 1.1925 1.6294 0.2684  -0.3537 -0.5359 334 GLN A N     
818  C  CA    . GLN A 115 ? 1.2475 1.1741 1.7173 0.2853  -0.4206 -0.5463 334 GLN A CA    
819  C  C     . GLN A 115 ? 1.3301 1.1872 1.7527 0.2397  -0.4165 -0.4921 334 GLN A C     
820  O  O     . GLN A 115 ? 1.4098 1.2125 1.8320 0.2460  -0.4547 -0.5136 334 GLN A O     
821  C  CB    . GLN A 115 ? 1.3229 1.1574 1.7795 0.3040  -0.4703 -0.5338 334 GLN A CB    
822  N  N     . THR A 116 ? 1.2236 1.0878 1.6089 0.1947  -0.3717 -0.4266 335 THR A N     
823  C  CA    . THR A 116 ? 1.2239 1.0452 1.5673 0.1476  -0.3603 -0.3754 335 THR A CA    
824  C  C     . THR A 116 ? 1.2580 1.1172 1.6170 0.1455  -0.3526 -0.4048 335 THR A C     
825  O  O     . THR A 116 ? 1.3306 1.1191 1.6681 0.1255  -0.3814 -0.3929 335 THR A O     
826  C  CB    . THR A 116 ? 1.2268 1.0959 1.5446 0.1116  -0.3033 -0.3206 335 THR A CB    
827  O  OG1   . THR A 116 ? 1.2243 1.0498 1.5229 0.1105  -0.3143 -0.2917 335 THR A OG1   
828  C  CG2   . THR A 116 ? 1.2221 1.0736 1.5047 0.0650  -0.2867 -0.2759 335 THR A CG2   
829  N  N     . ILE A 117 ? 1.1278 1.0987 1.5199 0.1613  -0.3144 -0.4417 336 ILE A N     
830  C  CA    . ILE A 117 ? 1.1040 1.1247 1.5095 0.1594  -0.3028 -0.4715 336 ILE A CA    
831  C  C     . ILE A 117 ? 1.2185 1.1941 1.6491 0.1928  -0.3596 -0.5302 336 ILE A C     
832  O  O     . ILE A 117 ? 1.2351 1.2019 1.6630 0.1831  -0.3680 -0.5420 336 ILE A O     
833  C  CB    . ILE A 117 ? 1.0502 1.1982 1.4695 0.1561  -0.2449 -0.4842 336 ILE A CB    
834  C  CG1   . ILE A 117 ? 1.0305 1.2590 1.4936 0.1936  -0.2453 -0.5500 336 ILE A CG1   
835  C  CG2   . ILE A 117 ? 1.0057 1.1731 1.3962 0.1276  -0.2015 -0.4259 336 ILE A CG2   
836  C  CD1   . ILE A 117 ? 0.9963 1.3432 1.4664 0.1835  -0.1979 -0.5697 336 ILE A CD1   
837  N  N     . PHE A 118 ? 1.2336 1.1734 1.6871 0.2335  -0.4038 -0.5672 337 PHE A N     
838  C  CA    . PHE A 118 ? 1.3286 1.2095 1.8054 0.2732  -0.4697 -0.6265 337 PHE A CA    
839  C  C     . PHE A 118 ? 1.5157 1.2390 1.9490 0.2528  -0.5276 -0.5891 337 PHE A C     
840  O  O     . PHE A 118 ? 1.6007 1.2630 2.0397 0.2693  -0.5782 -0.6257 337 PHE A O     
841  C  CB    . PHE A 118 ? 1.3597 1.2726 1.8817 0.3299  -0.4981 -0.6882 337 PHE A CB    
842  C  CG    . PHE A 118 ? 1.3033 1.3743 1.8749 0.3526  -0.4571 -0.7512 337 PHE A CG    
843  C  CD1   . PHE A 118 ? 1.3621 1.4770 1.9720 0.3873  -0.4808 -0.8282 337 PHE A CD1   
844  C  CD2   . PHE A 118 ? 1.2280 1.4053 1.8031 0.3340  -0.3943 -0.7327 337 PHE A CD2   
845  C  CE1   . PHE A 118 ? 1.3056 1.5779 1.9560 0.4008  -0.4396 -0.8860 337 PHE A CE1   
846  C  CE2   . PHE A 118 ? 1.2074 1.5314 1.8191 0.3442  -0.3558 -0.7865 337 PHE A CE2   
847  C  CZ    . PHE A 118 ? 1.2096 1.5857 1.8585 0.3761  -0.3768 -0.8629 337 PHE A CZ    
848  N  N     . GLU A 119 ? 1.4912 1.1501 1.8776 0.2133  -0.5207 -0.5166 338 GLU A N     
849  C  CA    . GLU A 119 ? 1.5926 1.1101 1.9260 0.1775  -0.5679 -0.4702 338 GLU A CA    
850  C  C     . GLU A 119 ? 1.6276 1.1597 1.9362 0.1244  -0.5359 -0.4352 338 GLU A C     
851  O  O     . GLU A 119 ? 1.7032 1.1388 1.9641 0.0797  -0.5622 -0.3900 338 GLU A O     
852  C  CB    . GLU A 119 ? 1.6280 1.0885 1.9185 0.1510  -0.5679 -0.4075 338 GLU A CB    
853  C  CG    . GLU A 119 ? 1.8176 1.2685 2.1267 0.1965  -0.5931 -0.4300 338 GLU A CG    
854  C  CD    . GLU A 119 ? 2.1512 1.5875 2.4234 0.1678  -0.5713 -0.3684 338 GLU A CD    
855  O  OE1   . GLU A 119 ? 1.8960 1.3524 2.1340 0.1150  -0.5266 -0.3116 338 GLU A OE1   
856  O  OE2   . GLU A 119 ? 2.2414 1.6528 2.5213 0.2011  -0.5998 -0.3813 338 GLU A OE2   
857  N  N     . GLY A 120 ? 1.4868 1.1407 1.8239 0.1255  -0.4799 -0.4539 339 GLY A N     
858  C  CA    . GLY A 120 ? 1.4552 1.1378 1.7745 0.0812  -0.4485 -0.4267 339 GLY A CA    
859  C  C     . GLY A 120 ? 1.4210 1.1492 1.7124 0.0376  -0.3933 -0.3635 339 GLY A C     
860  O  O     . GLY A 120 ? 1.4201 1.1533 1.6894 -0.0050 -0.3766 -0.3325 339 GLY A O     
861  N  N     . GLY A 121 ? 1.3059 1.0747 1.6015 0.0498  -0.3652 -0.3492 340 GLY A N     
862  C  CA    . GLY A 121 ? 1.2322 1.0447 1.5039 0.0159  -0.3164 -0.2954 340 GLY A CA    
863  C  C     . GLY A 121 ? 1.1589 1.0882 1.4492 0.0227  -0.2586 -0.3018 340 GLY A C     
864  O  O     . GLY A 121 ? 1.1140 1.1030 1.4333 0.0472  -0.2494 -0.3458 340 GLY A O     
865  N  N     . LYS A 122 ? 1.0769 1.0369 1.3464 -0.0007 -0.2221 -0.2578 341 LYS A N     
866  C  CA    . LYS A 122 ? 0.9945 1.0475 1.2705 0.0022  -0.1726 -0.2543 341 LYS A CA    
867  C  C     . LYS A 122 ? 1.0059 1.0705 1.2776 0.0114  -0.1551 -0.2364 341 LYS A C     
868  O  O     . LYS A 122 ? 1.0439 1.0593 1.2946 -0.0025 -0.1655 -0.2045 341 LYS A O     
869  C  CB    . LYS A 122 ? 1.0039 1.0866 1.2600 -0.0307 -0.1483 -0.2228 341 LYS A CB    
870  C  CG    . LYS A 122 ? 1.0725 1.1486 1.3313 -0.0457 -0.1637 -0.2375 341 LYS A CG    
871  C  CD    . LYS A 122 ? 1.1094 1.2525 1.3885 -0.0264 -0.1480 -0.2740 341 LYS A CD    
872  C  CE    . LYS A 122 ? 1.2535 1.3932 1.5334 -0.0438 -0.1619 -0.2859 341 LYS A CE    
873  N  NZ    . LYS A 122 ? 1.5060 1.5639 1.7912 -0.0429 -0.2104 -0.3075 341 LYS A NZ    
874  N  N     . ALA A 123 ? 0.8927 1.0220 1.1811 0.0313  -0.1299 -0.2569 342 ALA A N     
875  C  CA    . ALA A 123 ? 0.8541 0.9982 1.1396 0.0387  -0.1131 -0.2434 342 ALA A CA    
876  C  C     . ALA A 123 ? 0.8396 1.0522 1.1158 0.0320  -0.0723 -0.2328 342 ALA A C     
877  O  O     . ALA A 123 ? 0.7916 1.0502 1.0719 0.0312  -0.0600 -0.2507 342 ALA A O     
878  C  CB    . ALA A 123 ? 0.8712 1.0187 1.1862 0.0695  -0.1318 -0.2842 342 ALA A CB    
879  N  N     . THR A 124 ? 0.7731 0.9864 1.0325 0.0263  -0.0549 -0.2025 343 THR A N     
880  C  CA    . THR A 124 ? 0.7263 0.9866 0.9707 0.0215  -0.0238 -0.1899 343 THR A CA    
881  C  C     . THR A 124 ? 0.7553 1.0150 0.9982 0.0277  -0.0164 -0.1833 343 THR A C     
882  O  O     . THR A 124 ? 0.7336 0.9529 0.9764 0.0309  -0.0300 -0.1713 343 THR A O     
883  C  CB    . THR A 124 ? 0.8144 1.0771 1.0341 0.0063  -0.0112 -0.1573 343 THR A CB    
884  O  OG1   . THR A 124 ? 0.7796 1.0042 0.9898 -0.0024 -0.0199 -0.1319 343 THR A OG1   
885  C  CG2   . THR A 124 ? 0.7176 1.0000 0.9381 -0.0012 -0.0126 -0.1662 343 THR A CG2   
886  N  N     . CYS A 125 ? 0.7052 1.0087 0.9418 0.0255  0.0043  -0.1892 344 CYS A N     
887  C  CA    . CYS A 125 ? 0.6895 0.9991 0.9219 0.0259  0.0138  -0.1837 344 CYS A CA    
888  C  C     . CYS A 125 ? 0.7030 1.0321 0.9036 0.0116  0.0349  -0.1634 344 CYS A C     
889  O  O     . CYS A 125 ? 0.7097 1.0749 0.9013 0.0026  0.0447  -0.1742 344 CYS A O     
890  C  CB    . CYS A 125 ? 0.7065 1.0508 0.9693 0.0362  0.0091  -0.2238 344 CYS A CB    
891  S  SG    . CYS A 125 ? 0.7537 1.1083 1.0165 0.0343  0.0179  -0.2203 344 CYS A SG    
892  N  N     . PHE A 126 ? 0.6684 0.9707 0.8486 0.0097  0.0386  -0.1353 345 PHE A N     
893  C  CA    . PHE A 126 ? 0.6747 0.9764 0.8192 -0.0002 0.0499  -0.1135 345 PHE A CA    
894  C  C     . PHE A 126 ? 0.7162 1.0106 0.8499 -0.0062 0.0550  -0.1071 345 PHE A C     
895  O  O     . PHE A 126 ? 0.6781 0.9533 0.8253 0.0024  0.0492  -0.1052 345 PHE A O     
896  C  CB    . PHE A 126 ? 0.6800 0.9554 0.8077 0.0064  0.0455  -0.0883 345 PHE A CB    
897  C  CG    . PHE A 126 ? 0.6853 0.9699 0.8229 0.0081  0.0403  -0.0920 345 PHE A CG    
898  C  CD1   . PHE A 126 ? 0.7292 1.0338 0.8523 0.0047  0.0427  -0.0931 345 PHE A CD1   
899  C  CD2   . PHE A 126 ? 0.7034 0.9736 0.8607 0.0097  0.0305  -0.0932 345 PHE A CD2   
900  C  CE1   . PHE A 126 ? 0.7314 1.0486 0.8657 0.0047  0.0375  -0.0987 345 PHE A CE1   
901  C  CE2   . PHE A 126 ? 0.7467 1.0246 0.9114 0.0049  0.0246  -0.0968 345 PHE A CE2   
902  C  CZ    . PHE A 126 ? 0.7190 1.0237 0.8750 0.0033  0.0292  -0.1009 345 PHE A CZ    
903  N  N     . ALA A 127 ? 0.7186 1.0227 0.8216 -0.0239 0.0636  -0.1003 346 ALA A N     
904  C  CA    . ALA A 127 ? 0.7312 1.0187 0.8130 -0.0357 0.0663  -0.0883 346 ALA A CA    
905  C  C     . ALA A 127 ? 0.8057 1.0496 0.8454 -0.0337 0.0588  -0.0594 346 ALA A C     
906  O  O     . ALA A 127 ? 0.8343 1.0787 0.8479 -0.0398 0.0568  -0.0524 346 ALA A O     
907  C  CB    . ALA A 127 ? 0.7520 1.0804 0.8247 -0.0639 0.0779  -0.1023 346 ALA A CB    
908  N  N     . TYR A 128 ? 0.7389 0.9469 0.7734 -0.0218 0.0516  -0.0463 347 TYR A N     
909  C  CA    . TYR A 128 ? 0.7497 0.9177 0.7536 -0.0090 0.0391  -0.0272 347 TYR A CA    
910  C  C     . TYR A 128 ? 0.8341 0.9632 0.8130 -0.0152 0.0323  -0.0164 347 TYR A C     
911  O  O     . TYR A 128 ? 0.8141 0.9481 0.8134 -0.0165 0.0370  -0.0231 347 TYR A O     
912  C  CB    . TYR A 128 ? 0.7200 0.8939 0.7504 0.0154  0.0360  -0.0295 347 TYR A CB    
913  C  CG    . TYR A 128 ? 0.7486 0.8977 0.7592 0.0349  0.0233  -0.0198 347 TYR A CG    
914  C  CD1   . TYR A 128 ? 0.7835 0.9375 0.7822 0.0480  0.0143  -0.0185 347 TYR A CD1   
915  C  CD2   . TYR A 128 ? 0.7571 0.8821 0.7623 0.0431  0.0180  -0.0166 347 TYR A CD2   
916  C  CE1   . TYR A 128 ? 0.8168 0.9556 0.8014 0.0718  -0.0011 -0.0177 347 TYR A CE1   
917  C  CE2   . TYR A 128 ? 0.7923 0.8995 0.7813 0.0654  0.0037  -0.0150 347 TYR A CE2   
918  C  CZ    . TYR A 128 ? 0.8899 1.0056 0.8700 0.0813  -0.0066 -0.0172 347 TYR A CZ    
919  O  OH    . TYR A 128 ? 0.9134 1.0195 0.8824 0.1093  -0.0243 -0.0235 347 TYR A OH    
920  N  N     . GLY A 129 ? 0.8383 0.9238 0.7723 -0.0169 0.0172  -0.0008 348 GLY A N     
921  C  CA    . GLY A 129 ? 0.8661 0.9031 0.7718 -0.0225 0.0051  0.0093  348 GLY A CA    
922  C  C     . GLY A 129 ? 1.0050 0.9885 0.8500 -0.0403 -0.0140 0.0280  348 GLY A C     
923  O  O     . GLY A 129 ? 1.0308 1.0198 0.8548 -0.0492 -0.0163 0.0336  348 GLY A O     
924  N  N     . GLN A 130 ? 1.0025 0.9288 0.8140 -0.0483 -0.0309 0.0386  349 GLN A N     
925  C  CA    . GLN A 130 ? 1.0711 0.9274 0.8142 -0.0675 -0.0575 0.0602  349 GLN A CA    
926  C  C     . GLN A 130 ? 1.1435 1.0143 0.8533 -0.1219 -0.0458 0.0719  349 GLN A C     
927  O  O     . GLN A 130 ? 1.1064 1.0395 0.8478 -0.1471 -0.0177 0.0593  349 GLN A O     
928  C  CB    . GLN A 130 ? 1.1378 0.9175 0.8484 -0.0627 -0.0848 0.0681  349 GLN A CB    
929  C  CG    . GLN A 130 ? 1.3303 1.1137 1.0403 -0.1023 -0.0716 0.0696  349 GLN A CG    
930  C  CD    . GLN A 130 ? 1.4187 1.1182 1.0882 -0.1051 -0.1018 0.0792  349 GLN A CD    
931  O  OE1   . GLN A 130 ? 1.3159 1.0219 1.0133 -0.0945 -0.0974 0.0670  349 GLN A OE1   
932  N  NE2   . GLN A 130 ? 1.3597 0.9742 0.9596 -0.1199 -0.1361 0.1010  349 GLN A NE2   
933  N  N     . THR A 131 ? 1.1597 0.9743 0.8029 -0.1408 -0.0698 0.0944  350 THR A N     
934  C  CA    . THR A 131 ? 1.1989 1.0240 0.7963 -0.2018 -0.0609 0.1092  350 THR A CA    
935  C  C     . THR A 131 ? 1.2575 1.0787 0.8461 -0.2440 -0.0523 0.1118  350 THR A C     
936  O  O     . THR A 131 ? 1.2949 1.0463 0.8652 -0.2348 -0.0756 0.1199  350 THR A O     
937  C  CB    . THR A 131 ? 1.3416 1.0825 0.8542 -0.2167 -0.0979 0.1391  350 THR A CB    
938  O  OG1   . THR A 131 ? 1.3579 1.1153 0.8866 -0.1753 -0.1045 0.1318  350 THR A OG1   
939  C  CG2   . THR A 131 ? 1.2996 1.0481 0.7509 -0.2902 -0.0901 0.1592  350 THR A CG2   
940  N  N     . GLY A 132 ? 1.1665 1.0690 0.7721 -0.2875 -0.0201 0.1001  351 GLY A N     
941  C  CA    . GLY A 132 ? 1.1711 1.0961 0.7771 -0.3323 -0.0069 0.0961  351 GLY A CA    
942  C  C     . GLY A 132 ? 1.1665 1.1534 0.8538 -0.3030 0.0144  0.0643  351 GLY A C     
943  O  O     . GLY A 132 ? 1.1979 1.2154 0.8944 -0.3362 0.0259  0.0554  351 GLY A O     
944  N  N     . SER A 133 ? 1.0509 1.0591 0.7954 -0.2442 0.0185  0.0470  352 SER A N     
945  C  CA    . SER A 133 ? 0.9489 1.0004 0.7632 -0.2119 0.0315  0.0211  352 SER A CA    
946  C  C     . SER A 133 ? 0.9492 1.1036 0.8205 -0.2202 0.0596  -0.0116 352 SER A C     
947  O  O     . SER A 133 ? 0.8908 1.0780 0.8092 -0.2069 0.0663  -0.0323 352 SER A O     
948  C  CB    . SER A 133 ? 0.8864 0.9072 0.7262 -0.1534 0.0193  0.0202  352 SER A CB    
949  O  OG    . SER A 133 ? 0.9365 0.9797 0.7902 -0.1305 0.0228  0.0167  352 SER A OG    
950  N  N     . GLY A 134 ? 0.9215 1.1255 0.7894 -0.2371 0.0722  -0.0191 353 GLY A N     
951  C  CA    . GLY A 134 ? 0.8795 1.1843 0.8000 -0.2424 0.0948  -0.0566 353 GLY A CA    
952  C  C     . GLY A 134 ? 0.9089 1.2501 0.8660 -0.2094 0.0997  -0.0751 353 GLY A C     
953  O  O     . GLY A 134 ? 0.8880 1.3008 0.8995 -0.1979 0.1108  -0.1117 353 GLY A O     
954  N  N     . LYS A 135 ? 0.8659 1.1600 0.7943 -0.1938 0.0888  -0.0535 354 LYS A N     
955  C  CA    . LYS A 135 ? 0.8055 1.1307 0.7660 -0.1658 0.0920  -0.0701 354 LYS A CA    
956  C  C     . LYS A 135 ? 0.8273 1.2337 0.7941 -0.1923 0.1089  -0.0960 354 LYS A C     
957  O  O     . LYS A 135 ? 0.7918 1.2523 0.8115 -0.1707 0.1150  -0.1303 354 LYS A O     
958  C  CB    . LYS A 135 ? 0.8436 1.1107 0.7712 -0.1469 0.0765  -0.0440 354 LYS A CB    
959  C  CG    . LYS A 135 ? 0.8161 1.0147 0.7390 -0.1162 0.0589  -0.0245 354 LYS A CG    
960  C  CD    . LYS A 135 ? 0.8551 1.0124 0.7469 -0.0980 0.0422  -0.0061 354 LYS A CD    
961  C  CE    . LYS A 135 ? 0.9258 1.0373 0.7463 -0.1263 0.0274  0.0190  354 LYS A CE    
962  N  NZ    . LYS A 135 ? 1.0474 1.0980 0.8292 -0.1422 0.0130  0.0375  354 LYS A NZ    
963  N  N     . THR A 136 ? 0.8257 1.2387 0.7353 -0.2393 0.1137  -0.0805 355 THR A N     
964  C  CA    . THR A 136 ? 0.8425 1.3432 0.7510 -0.2701 0.1318  -0.1060 355 THR A CA    
965  C  C     . THR A 136 ? 0.9015 1.4962 0.8586 -0.2841 0.1500  -0.1489 355 THR A C     
966  O  O     . THR A 136 ? 0.8813 1.5638 0.8805 -0.2774 0.1620  -0.1921 355 THR A O     
967  C  CB    . THR A 136 ? 1.0504 1.5277 0.8738 -0.3222 0.1294  -0.0730 355 THR A CB    
968  O  OG1   . THR A 136 ? 1.1512 1.5424 0.9379 -0.2977 0.1067  -0.0397 355 THR A OG1   
969  C  CG2   . THR A 136 ? 0.8765 1.4550 0.6927 -0.3589 0.1502  -0.1000 355 THR A CG2   
970  N  N     . HIS A 137 ? 0.8790 1.4575 0.8331 -0.3003 0.1494  -0.1409 356 HIS A N     
971  C  CA    . HIS A 137 ? 0.8547 1.5211 0.8585 -0.3100 0.1632  -0.1825 356 HIS A CA    
972  C  C     . HIS A 137 ? 0.8816 1.5784 0.9667 -0.2493 0.1572  -0.2240 356 HIS A C     
973  O  O     . HIS A 137 ? 0.8623 1.6575 0.9967 -0.2452 0.1667  -0.2752 356 HIS A O     
974  C  CB    . HIS A 137 ? 0.8777 1.5006 0.8628 -0.3309 0.1580  -0.1612 356 HIS A CB    
975  C  CG    . HIS A 137 ? 0.8969 1.6064 0.9395 -0.3334 0.1684  -0.2049 356 HIS A CG    
976  N  ND1   . HIS A 137 ? 0.8645 1.5699 0.9712 -0.2785 0.1571  -0.2286 356 HIS A ND1   
977  C  CD2   . HIS A 137 ? 0.9471 1.7509 0.9897 -0.3855 0.1869  -0.2294 356 HIS A CD2   
978  C  CE1   . HIS A 137 ? 0.8555 1.6500 1.0027 -0.2923 0.1664  -0.2687 356 HIS A CE1   
979  N  NE2   . HIS A 137 ? 0.9026 1.7656 1.0167 -0.3567 0.1863  -0.2729 356 HIS A NE2   
980  N  N     . THR A 138 ? 0.8311 1.4428 0.9266 -0.2034 0.1386  -0.2029 357 THR A N     
981  C  CA    . THR A 138 ? 0.7835 1.3992 0.9413 -0.1508 0.1263  -0.2317 357 THR A CA    
982  C  C     . THR A 138 ? 0.8317 1.4918 1.0116 -0.1354 0.1274  -0.2607 357 THR A C     
983  O  O     . THR A 138 ? 0.7991 1.5162 1.0340 -0.1109 0.1227  -0.3084 357 THR A O     
984  C  CB    . THR A 138 ? 0.8142 1.3316 0.9655 -0.1180 0.1083  -0.1969 357 THR A CB    
985  O  OG1   . THR A 138 ? 0.8093 1.2910 0.9423 -0.1304 0.1062  -0.1761 357 THR A OG1   
986  C  CG2   . THR A 138 ? 0.7928 1.3017 0.9956 -0.0726 0.0921  -0.2189 357 THR A CG2   
987  N  N     . MET A 139 ? 0.8285 1.4592 0.9663 -0.1460 0.1294  -0.2344 358 MET A N     
988  C  CA    . MET A 139 ? 0.8209 1.4837 0.9762 -0.1301 0.1282  -0.2586 358 MET A CA    
989  C  C     . MET A 139 ? 0.9145 1.6810 1.0719 -0.1587 0.1459  -0.2967 358 MET A C     
990  O  O     . MET A 139 ? 0.9016 1.7269 1.1082 -0.1346 0.1427  -0.3458 358 MET A O     
991  C  CB    . MET A 139 ? 0.8531 1.4478 0.9692 -0.1245 0.1205  -0.2197 358 MET A CB    
992  C  CG    . MET A 139 ? 0.8787 1.3870 0.9957 -0.0960 0.1043  -0.1881 358 MET A CG    
993  S  SD    . MET A 139 ? 0.8939 1.3859 1.0739 -0.0517 0.0869  -0.2122 358 MET A SD    
994  C  CE    . MET A 139 ? 0.8456 1.3585 1.0458 -0.0367 0.0804  -0.2365 358 MET A CE    
995  N  N     . GLY A 140 ? 0.9453 1.7310 1.0459 -0.2107 0.1617  -0.2746 359 GLY A N     
996  C  CA    . GLY A 140 ? 1.0007 1.8889 1.0863 -0.2513 0.1819  -0.3032 359 GLY A CA    
997  C  C     . GLY A 140 ? 1.1417 2.1322 1.2523 -0.2805 0.1991  -0.3421 359 GLY A C     
998  O  O     . GLY A 140 ? 1.1564 2.2606 1.3031 -0.2829 0.2110  -0.3983 359 GLY A O     
999  N  N     . GLY A 141 ? 1.1431 2.0990 1.2395 -0.2996 0.1990  -0.3177 360 GLY A N     
1000 C  CA    . GLY A 141 ? 1.1586 2.2092 1.2797 -0.3299 0.2142  -0.3521 360 GLY A CA    
1001 C  C     . GLY A 141 ? 1.3069 2.3360 1.3575 -0.3986 0.2245  -0.3091 360 GLY A C     
1002 O  O     . GLY A 141 ? 1.3556 2.2975 1.3312 -0.4249 0.2181  -0.2538 360 GLY A O     
1003 N  N     . ASP A 142 ? 1.2880 2.3938 1.3615 -0.4279 0.2367  -0.3358 361 ASP A N     
1004 C  CA    . ASP A 142 ? 1.3560 2.4539 1.3653 -0.5024 0.2465  -0.3015 361 ASP A CA    
1005 C  C     . ASP A 142 ? 1.4683 2.6642 1.4260 -0.5771 0.2710  -0.3088 361 ASP A C     
1006 O  O     . ASP A 142 ? 1.5418 2.6729 1.4074 -0.6363 0.2692  -0.2540 361 ASP A O     
1007 C  CB    . ASP A 142 ? 1.3596 2.5154 1.4207 -0.5053 0.2505  -0.3334 361 ASP A CB    
1008 C  CG    . ASP A 142 ? 1.5303 2.6605 1.5321 -0.5773 0.2551  -0.2970 361 ASP A CG    
1009 O  OD1   . ASP A 142 ? 1.6155 2.7298 1.5331 -0.6476 0.2627  -0.2597 361 ASP A OD1   
1010 O  OD2   . ASP A 142 ? 1.5568 2.6861 1.5947 -0.5665 0.2495  -0.3079 361 ASP A OD2   
1011 N  N     . LEU A 143 ? 1.3901 2.7393 1.4051 -0.5724 0.2906  -0.3780 362 LEU A N     
1012 C  CA    . LEU A 143 ? 1.8300 3.3122 1.8131 -0.6395 0.3185  -0.4036 362 LEU A CA    
1013 C  C     . LEU A 143 ? 1.8213 3.3837 1.7886 -0.7110 0.3384  -0.4091 362 LEU A C     
1014 O  O     . LEU A 143 ? 1.5029 3.1102 1.5239 -0.7032 0.3388  -0.4403 362 LEU A O     
1015 C  CB    . LEU A 143 ? 1.8930 3.3060 1.7794 -0.6781 0.3163  -0.3490 362 LEU A CB    
1016 C  CG    . LEU A 143 ? 1.9105 3.2929 1.8171 -0.6162 0.3047  -0.3582 362 LEU A CG    
1017 C  CD1   . LEU A 143 ? 1.9053 3.1126 1.7981 -0.5619 0.2735  -0.3035 362 LEU A CD1   
1018 C  CD2   . LEU A 143 ? 1.9741 3.4030 1.8095 -0.6708 0.3181  -0.3477 362 LEU A CD2   
1019 N  N     . SER A 151 ? 1.2204 3.0397 1.6161 -0.3799 0.2868  -0.7051 370 SER A N     
1020 C  CA    . SER A 151 ? 1.1910 2.8375 1.5847 -0.3277 0.2560  -0.6533 370 SER A CA    
1021 C  C     . SER A 151 ? 1.2166 2.7349 1.5769 -0.2941 0.2398  -0.6088 370 SER A C     
1022 O  O     . SER A 151 ? 1.2443 2.7232 1.5320 -0.3379 0.2530  -0.5611 370 SER A O     
1023 C  CB    . SER A 151 ? 1.2237 2.7912 1.5636 -0.3750 0.2608  -0.5898 370 SER A CB    
1024 N  N     . LYS A 152 ? 1.1180 2.5730 1.5305 -0.2179 0.2087  -0.6261 371 LYS A N     
1025 C  CA    . LYS A 152 ? 1.0976 2.4306 1.4914 -0.1796 0.1887  -0.5892 371 LYS A CA    
1026 C  C     . LYS A 152 ? 1.0773 2.2688 1.4440 -0.1691 0.1733  -0.5241 371 LYS A C     
1027 O  O     . LYS A 152 ? 1.0819 2.2852 1.4639 -0.1760 0.1730  -0.5270 371 LYS A O     
1028 C  CB    . LYS A 152 ? 1.0899 2.4409 1.5567 -0.1088 0.1601  -0.6501 371 LYS A CB    
1029 N  N     . GLY A 153 ? 0.9752 2.0435 1.3036 -0.1549 0.1615  -0.4688 372 GLY A N     
1030 C  CA    . GLY A 153 ? 0.9502 1.9740 1.2548 -0.1441 0.1572  -0.4512 372 GLY A CA    
1031 C  C     . GLY A 153 ? 0.9083 1.8791 1.2589 -0.0815 0.1273  -0.4696 372 GLY A C     
1032 O  O     . GLY A 153 ? 0.8852 1.9234 1.2906 -0.0511 0.1163  -0.5315 372 GLY A O     
1033 N  N     . ILE A 154 ? 0.8084 1.6605 1.1355 -0.0631 0.1117  -0.4189 373 ILE A N     
1034 C  CA    . ILE A 154 ? 0.7804 1.5731 1.1396 -0.0144 0.0821  -0.4287 373 ILE A CA    
1035 C  C     . ILE A 154 ? 0.8175 1.6393 1.1850 -0.0046 0.0789  -0.4565 373 ILE A C     
1036 O  O     . ILE A 154 ? 0.8273 1.6433 1.2374 0.0343  0.0530  -0.4944 373 ILE A O     
1037 C  CB    . ILE A 154 ? 0.8074 1.4835 1.1387 -0.0048 0.0695  -0.3706 373 ILE A CB    
1038 C  CG1   . ILE A 154 ? 0.7972 1.4476 1.1407 0.0032  0.0614  -0.3625 373 ILE A CG1   
1039 C  CG2   . ILE A 154 ? 0.8051 1.4209 1.1519 0.0284  0.0433  -0.3716 373 ILE A CG2   
1040 C  CD1   . ILE A 154 ? 0.7365 1.2868 1.0491 0.0076  0.0529  -0.3076 373 ILE A CD1   
1041 N  N     . TYR A 155 ? 0.7513 1.6002 1.0759 -0.0394 0.1012  -0.4390 374 TYR A N     
1042 C  CA    . TYR A 155 ? 0.7376 1.6216 1.0685 -0.0321 0.0992  -0.4676 374 TYR A CA    
1043 C  C     . TYR A 155 ? 0.7895 1.7777 1.1773 -0.0123 0.0946  -0.5462 374 TYR A C     
1044 O  O     . TYR A 155 ? 0.7943 1.7792 1.2156 0.0227  0.0723  -0.5832 374 TYR A O     
1045 C  CB    . TYR A 155 ? 0.7505 1.6674 1.0238 -0.0776 0.1248  -0.4431 374 TYR A CB    
1046 C  CG    . TYR A 155 ? 0.7563 1.5880 0.9669 -0.1002 0.1290  -0.3728 374 TYR A CG    
1047 C  CD1   . TYR A 155 ? 0.7665 1.5006 0.9755 -0.0740 0.1105  -0.3377 374 TYR A CD1   
1048 C  CD2   . TYR A 155 ? 0.7904 1.6417 0.9402 -0.1482 0.1483  -0.3443 374 TYR A CD2   
1049 C  CE1   . TYR A 155 ? 0.7798 1.4465 0.9368 -0.0886 0.1116  -0.2820 374 TYR A CE1   
1050 C  CE2   . TYR A 155 ? 0.8250 1.5929 0.9169 -0.1622 0.1444  -0.2847 374 TYR A CE2   
1051 C  CZ    . TYR A 155 ? 0.8566 1.5371 0.9563 -0.1288 0.1261  -0.2571 374 TYR A CZ    
1052 O  OH    . TYR A 155 ? 0.8641 1.4740 0.9122 -0.1375 0.1201  -0.2071 374 TYR A OH    
1053 N  N     . ALA A 156 ? 0.7424 1.8265 1.1413 -0.0354 0.1140  -0.5749 375 ALA A N     
1054 C  CA    . ALA A 156 ? 0.7338 1.9438 1.1888 -0.0197 0.1134  -0.6577 375 ALA A CA    
1055 C  C     . ALA A 156 ? 0.7712 1.9572 1.2922 0.0403  0.0755  -0.7011 375 ALA A C     
1056 O  O     . ALA A 156 ? 0.7624 1.9961 1.3328 0.0794  0.0538  -0.7674 375 ALA A O     
1057 C  CB    . ALA A 156 ? 0.7470 2.0703 1.1906 -0.0695 0.1467  -0.6717 375 ALA A CB    
1058 N  N     . MET A 157 ? 0.7361 1.8394 1.2543 0.0496  0.0628  -0.6629 376 MET A N     
1059 C  CA    . MET A 157 ? 0.7436 1.8090 1.3138 0.1033  0.0225  -0.6949 376 MET A CA    
1060 C  C     . MET A 157 ? 0.8341 1.7988 1.4109 0.1437  -0.0162 -0.6920 376 MET A C     
1061 O  O     . MET A 157 ? 0.8803 1.8467 1.5065 0.1922  -0.0550 -0.7480 376 MET A O     
1062 C  CB    . MET A 157 ? 0.7611 1.7673 1.3183 0.0962  0.0214  -0.6513 376 MET A CB    
1063 C  CG    . MET A 157 ? 0.7993 1.9076 1.3597 0.0598  0.0518  -0.6654 376 MET A CG    
1064 S  SD    . MET A 157 ? 0.8496 1.8832 1.3903 0.0490  0.0502  -0.6121 376 MET A SD    
1065 C  CE    . MET A 157 ? 0.8171 1.9628 1.4306 0.0762  0.0362  -0.6917 376 MET A CE    
1066 N  N     . ALA A 158 ? 0.7646 1.6426 1.2912 0.1232  -0.0086 -0.6293 377 ALA A N     
1067 C  CA    . ALA A 158 ? 0.7768 1.5643 1.3028 0.1494  -0.0412 -0.6218 377 ALA A CA    
1068 C  C     . ALA A 158 ? 0.8488 1.7050 1.4041 0.1669  -0.0494 -0.6857 377 ALA A C     
1069 O  O     . ALA A 158 ? 0.8891 1.7068 1.4774 0.2086  -0.0918 -0.7241 377 ALA A O     
1070 C  CB    . ALA A 158 ? 0.7724 1.4798 1.2421 0.1193  -0.0259 -0.5475 377 ALA A CB    
1071 N  N     . SER A 159 ? 0.7825 1.7398 1.3235 0.1347  -0.0119 -0.6993 378 SER A N     
1072 C  CA    . SER A 159 ? 0.7892 1.8287 1.3542 0.1464  -0.0141 -0.7620 378 SER A CA    
1073 C  C     . SER A 159 ? 0.9035 2.0113 1.5373 0.1942  -0.0436 -0.8497 378 SER A C     
1074 O  O     . SER A 159 ? 0.9432 2.0294 1.6089 0.2358  -0.0815 -0.8967 378 SER A O     
1075 C  CB    . SER A 159 ? 0.7879 1.9340 1.3188 0.0959  0.0337  -0.7586 378 SER A CB    
1076 O  OG    . SER A 159 ? 0.8109 1.8848 1.2778 0.0591  0.0525  -0.6810 378 SER A OG    
1077 N  N     . ALA A 160 ? 0.8615 2.0452 1.5192 0.1904  -0.0311 -0.8723 379 ALA A N     
1078 C  CA    . ALA A 160 ? 0.8717 2.1306 1.5998 0.2389  -0.0604 -0.9588 379 ALA A CA    
1079 C  C     . ALA A 160 ? 0.9728 2.1061 1.7276 0.2990  -0.1245 -0.9698 379 ALA A C     
1080 O  O     . ALA A 160 ? 1.0110 2.1692 1.8119 0.3471  -0.1624 -1.0434 379 ALA A O     
1081 C  CB    . ALA A 160 ? 0.8496 2.1800 1.5908 0.2208  -0.0392 -0.9619 379 ALA A CB    
1082 N  N     . ASP A 161 ? 0.9239 1.9200 1.6454 0.2946  -0.1391 -0.8973 380 ASP A N     
1083 C  CA    . ASP A 161 ? 0.9727 1.8366 1.7052 0.3410  -0.2014 -0.8964 380 ASP A CA    
1084 C  C     . ASP A 161 ? 1.0774 1.8617 1.7975 0.3539  -0.2308 -0.8968 380 ASP A C     
1085 O  O     . ASP A 161 ? 1.1427 1.8512 1.8861 0.4007  -0.2913 -0.9305 380 ASP A O     
1086 C  CB    . ASP A 161 ? 0.9863 1.7368 1.6800 0.3247  -0.2049 -0.8180 380 ASP A CB    
1087 C  CG    . ASP A 161 ? 1.1097 1.9017 1.8285 0.3352  -0.2056 -0.8320 380 ASP A CG    
1088 O  OD1   . ASP A 161 ? 1.1366 2.0273 1.9142 0.3713  -0.2221 -0.9134 380 ASP A OD1   
1089 O  OD2   . ASP A 161 ? 1.1304 1.8590 1.8138 0.3114  -0.1938 -0.7676 380 ASP A OD2   
1090 N  N     . VAL A 162 ? 0.9979 1.7933 1.6793 0.3127  -0.1930 -0.8599 381 VAL A N     
1091 C  CA    . VAL A 162 ? 1.0323 1.7663 1.7037 0.3207  -0.2174 -0.8639 381 VAL A CA    
1092 C  C     . VAL A 162 ? 1.1243 1.9369 1.8524 0.3676  -0.2475 -0.9648 381 VAL A C     
1093 O  O     . VAL A 162 ? 1.1992 1.9286 1.9438 0.4071  -0.3048 -0.9945 381 VAL A O     
1094 C  CB    . VAL A 162 ? 1.0510 1.7991 1.6741 0.2702  -0.1710 -0.8124 381 VAL A CB    
1095 C  CG1   . VAL A 162 ? 1.0910 1.8109 1.7152 0.2811  -0.1943 -0.8369 381 VAL A CG1   
1096 C  CG2   . VAL A 162 ? 1.0257 1.6783 1.5968 0.2346  -0.1548 -0.7196 381 VAL A CG2   
1097 N  N     . PHE A 163 ? 1.0362 2.0090 1.7931 0.3627  -0.2120 -1.0196 382 PHE A N     
1098 C  CA    . PHE A 163 ? 1.0550 2.1318 1.8707 0.4073  -0.2349 -1.1250 382 PHE A CA    
1099 C  C     . PHE A 163 ? 1.1565 2.2147 2.0304 0.4742  -0.2961 -1.1916 382 PHE A C     
1100 O  O     . PHE A 163 ? 1.2172 2.2977 2.1357 0.5256  -0.3401 -1.2738 382 PHE A O     
1101 C  CB    . PHE A 163 ? 1.0347 2.2976 1.8585 0.3745  -0.1767 -1.1630 382 PHE A CB    
1102 C  CG    . PHE A 163 ? 1.0407 2.3184 1.8135 0.3260  -0.1369 -1.1235 382 PHE A CG    
1103 C  CD1   . PHE A 163 ? 1.1182 2.3875 1.8987 0.3465  -0.1596 -1.1621 382 PHE A CD1   
1104 C  CD2   . PHE A 163 ? 1.0300 2.3273 1.7458 0.2615  -0.0810 -1.0500 382 PHE A CD2   
1105 C  CE1   . PHE A 163 ? 1.1177 2.4008 1.8501 0.3028  -0.1252 -1.1256 382 PHE A CE1   
1106 C  CE2   . PHE A 163 ? 1.0556 2.3620 1.7218 0.2202  -0.0502 -1.0144 382 PHE A CE2   
1107 C  CZ    . PHE A 163 ? 1.0614 2.3644 1.7370 0.2410  -0.0713 -1.0524 382 PHE A CZ    
1108 N  N     . LEU A 164 ? 1.1128 2.1222 1.9850 0.4772  -0.3047 -1.1580 383 LEU A N     
1109 C  CA    . LEU A 164 ? 1.1740 2.1431 2.0939 0.5424  -0.3707 -1.2122 383 LEU A CA    
1110 C  C     . LEU A 164 ? 1.3081 2.0837 2.2037 0.5704  -0.4397 -1.1840 383 LEU A C     
1111 O  O     . LEU A 164 ? 1.3906 2.1272 2.3252 0.6333  -0.5090 -1.2523 383 LEU A O     
1112 C  CB    . LEU A 164 ? 1.1498 2.1256 2.0692 0.5318  -0.3569 -1.1796 383 LEU A CB    
1113 C  CG    . LEU A 164 ? 1.1787 2.3432 2.1505 0.5344  -0.3243 -1.2464 383 LEU A CG    
1114 C  CD1   . LEU A 164 ? 1.1426 2.4676 2.1151 0.4928  -0.2623 -1.2743 383 LEU A CD1   
1115 C  CD2   . LEU A 164 ? 1.1395 2.2961 2.0905 0.5016  -0.2962 -1.1876 383 LEU A CD2   
1116 N  N     . LEU A 165 ? 1.2530 1.9083 2.0825 0.5226  -0.4236 -1.0855 384 LEU A N     
1117 C  CA    . LEU A 165 ? 1.3241 1.7972 2.1193 0.5327  -0.4828 -1.0474 384 LEU A CA    
1118 C  C     . LEU A 165 ? 1.4243 1.8752 2.2298 0.5534  -0.5157 -1.0941 384 LEU A C     
1119 O  O     . LEU A 165 ? 1.5248 1.8571 2.3340 0.5934  -0.5907 -1.1177 384 LEU A O     
1120 C  CB    . LEU A 165 ? 1.2961 1.6713 2.0214 0.4718  -0.4512 -0.9351 384 LEU A CB    
1121 C  CG    . LEU A 165 ? 1.3966 1.6450 2.0917 0.4719  -0.4852 -0.8796 384 LEU A CG    
1122 C  CD1   . LEU A 165 ? 1.4096 1.7034 2.1496 0.5177  -0.5107 -0.9302 384 LEU A CD1   
1123 C  CD2   . LEU A 165 ? 1.3806 1.6127 2.0231 0.4113  -0.4289 -0.7865 384 LEU A CD2   
1124 N  N     . LYS A 166 ? 1.3157 1.8767 2.1241 0.5277  -0.4650 -1.1106 385 LYS A N     
1125 C  CA    . LYS A 166 ? 1.3575 1.9065 2.1760 0.5461  -0.4935 -1.1580 385 LYS A CA    
1126 C  C     . LYS A 166 ? 1.4684 2.0897 2.3502 0.6132  -0.5362 -1.2711 385 LYS A C     
1127 O  O     . LYS A 166 ? 1.5193 2.0658 2.3651 0.6129  -0.5485 -1.2612 385 LYS A O     
1128 C  CB    . LYS A 166 ? 1.3215 1.9436 2.1106 0.4930  -0.4291 -1.1272 385 LYS A CB    
1129 C  CG    . LYS A 166 ? 1.2674 2.0859 2.0909 0.4914  -0.3792 -1.1912 385 LYS A CG    
1130 C  CD    . LYS A 166 ? 1.2310 2.0953 2.0145 0.4392  -0.3262 -1.1542 385 LYS A CD    
1131 C  CE    . LYS A 166 ? 1.2757 2.0966 2.0598 0.4540  -0.3595 -1.1860 385 LYS A CE    
1132 N  NZ    . LYS A 166 ? 1.3236 2.2893 2.1571 0.4875  -0.3603 -1.2911 385 LYS A NZ    
1133 N  N     . ASN A 167 ? 1.4172 2.1234 2.3155 0.6249  -0.5105 -1.2866 386 ASN A N     
1134 C  CA    . ASN A 167 ? 1.4480 2.1418 2.3144 0.6359  -0.4936 -1.2767 386 ASN A CA    
1135 C  C     . ASN A 167 ? 1.5848 2.0952 2.3987 0.6489  -0.5298 -1.2133 386 ASN A C     
1136 O  O     . ASN A 167 ? 1.6089 2.0923 2.3989 0.6614  -0.5222 -1.2055 386 ASN A O     
1137 C  CB    . ASN A 167 ? 1.3878 2.2420 2.2730 0.6220  -0.4324 -1.2911 386 ASN A CB    
1138 N  N     . GLN A 168 ? 1.6071 2.0125 2.4247 0.6579  -0.5835 -1.1961 387 GLN A N     
1139 C  CA    . GLN A 168 ? 1.6902 1.9312 2.4656 0.6732  -0.6294 -1.1520 387 GLN A CA    
1140 C  C     . GLN A 168 ? 1.8417 1.9278 2.5362 0.6479  -0.6337 -1.0934 387 GLN A C     
1141 O  O     . GLN A 168 ? 1.8387 1.9243 2.5329 0.6324  -0.6370 -1.1040 387 GLN A O     
1142 C  CB    . GLN A 168 ? 1.7166 1.8837 2.4950 0.6721  -0.6685 -1.1231 387 GLN A CB    
1143 C  CG    . GLN A 168 ? 1.7190 1.9729 2.5109 0.6679  -0.6280 -1.1087 387 GLN A CG    
1144 C  CD    . GLN A 168 ? 1.9161 2.0483 2.6367 0.6240  -0.6137 -0.9973 387 GLN A CD    
1145 O  OE1   . GLN A 168 ? 1.9974 1.9758 2.6686 0.6237  -0.6546 -0.9522 387 GLN A OE1   
1146 N  NE2   . GLN A 168 ? 1.7319 1.9851 2.5457 0.6542  -0.6403 -1.0746 387 GLN A NE2   
1147 N  N     . PRO A 169 ? 1.9033 1.8785 2.5556 0.6587  -0.6514 -1.0643 388 PRO A N     
1148 C  CA    . PRO A 169 ? 1.9870 1.8362 2.5818 0.6446  -0.6642 -1.0371 388 PRO A CA    
1149 C  C     . PRO A 169 ? 2.0981 1.8256 2.6428 0.6018  -0.6826 -0.9832 388 PRO A C     
1150 O  O     . PRO A 169 ? 2.1264 1.8205 2.6477 0.5845  -0.6810 -0.9847 388 PRO A O     
1151 C  CB    . PRO A 169 ? 2.0518 1.8140 2.6080 0.6536  -0.6653 -1.0011 388 PRO A CB    
1152 C  CG    . PRO A 169 ? 2.0601 1.8559 2.6312 0.6568  -0.6574 -0.9788 388 PRO A CG    
1153 C  CD    . PRO A 169 ? 1.9238 1.8910 2.5699 0.6737  -0.6435 -1.0437 388 PRO A CD    
1154 N  N     . CYS A 170 ? 2.0796 1.7451 2.6345 0.6050  -0.7322 -0.9690 389 CYS A N     
1155 C  CA    . CYS A 170 ? 2.1321 1.6807 2.6561 0.5729  -0.7731 -0.9312 389 CYS A CA    
1156 C  C     . CYS A 170 ? 2.1130 1.7348 2.6619 0.5537  -0.7554 -0.9526 389 CYS A C     
1157 O  O     . CYS A 170 ? 2.1646 1.7129 2.6772 0.5257  -0.7644 -0.9342 389 CYS A O     
1158 C  CB    . CYS A 170 ? 2.1502 1.6504 2.6723 0.5670  -0.8021 -0.8953 389 CYS A CB    
1159 S  SG    . CYS A 170 ? 2.2248 1.6656 2.7034 0.5739  -0.7896 -0.8479 389 CYS A SG    
1160 N  N     . TYR A 171 ? 1.9645 1.7424 2.6018 0.5850  -0.7531 -1.0223 390 TYR A N     
1161 C  CA    . TYR A 171 ? 1.8953 1.7732 2.5810 0.5761  -0.7411 -1.0618 390 TYR A CA    
1162 C  C     . TYR A 171 ? 1.8783 1.8725 2.5660 0.5728  -0.6828 -1.0939 390 TYR A C     
1163 O  O     . TYR A 171 ? 1.8492 1.8981 2.5560 0.5569  -0.6720 -1.1145 390 TYR A O     
1164 C  CB    . TYR A 171 ? 1.8053 1.7855 2.5122 0.5536  -0.6902 -1.0383 390 TYR A CB    
1165 C  CG    . TYR A 171 ? 1.8303 1.6891 2.4834 0.5198  -0.6985 -0.9483 390 TYR A CG    
1166 C  CD1   . TYR A 171 ? 1.8139 1.7107 2.4781 0.5305  -0.6837 -0.9380 390 TYR A CD1   
1167 C  CD2   . TYR A 171 ? 1.8902 1.6040 2.4800 0.4735  -0.7197 -0.8747 390 TYR A CD2   
1168 C  CE1   . TYR A 171 ? 1.8331 1.6255 2.4460 0.4986  -0.6897 -0.8571 390 TYR A CE1   
1169 C  CE2   . TYR A 171 ? 1.9143 1.5289 2.4519 0.4383  -0.7248 -0.7941 390 TYR A CE2   
1170 C  CZ    . TYR A 171 ? 1.9456 1.5992 2.4945 0.4525  -0.7098 -0.7857 390 TYR A CZ    
1171 O  OH    . TYR A 171 ? 1.9276 1.4895 2.4239 0.4183  -0.7145 -0.7091 390 TYR A OH    
1172 N  N     . ARG A 172 ? 1.8387 1.8775 2.5275 0.6001  -0.6651 -1.1207 391 ARG A N     
1173 C  CA    . ARG A 172 ? 1.8035 1.9393 2.4936 0.6014  -0.6219 -1.1548 391 ARG A CA    
1174 C  C     . ARG A 172 ? 1.9246 1.9383 2.5470 0.5723  -0.6260 -1.1145 391 ARG A C     
1175 O  O     . ARG A 172 ? 1.9115 1.9892 2.5306 0.5616  -0.5965 -1.1345 391 ARG A O     
1176 C  CB    . ARG A 172 ? 1.7964 1.9746 2.4794 0.6209  -0.5918 -1.1596 391 ARG A CB    
1177 N  N     . LYS A 173 ? 1.9795 1.8273 2.5676 0.5707  -0.6818 -1.0830 392 LYS A N     
1178 C  CA    . LYS A 173 ? 2.0528 1.7784 2.5883 0.5462  -0.7024 -1.0592 392 LYS A CA    
1179 C  C     . LYS A 173 ? 2.0591 1.8014 2.6042 0.5162  -0.7066 -1.0591 392 LYS A C     
1180 O  O     . LYS A 173 ? 2.0685 1.8144 2.5951 0.5024  -0.6945 -1.0703 392 LYS A O     
1181 C  CB    . LYS A 173 ? 2.1692 1.7191 2.6396 0.5240  -0.7302 -0.9917 392 LYS A CB    
1182 N  N     . LEU A 174 ? 1.9708 1.7324 2.5774 0.5268  -0.7523 -1.0808 393 LEU A N     
1183 C  CA    . LEU A 174 ? 1.9456 1.7178 2.5803 0.5040  -0.7715 -1.0876 393 LEU A CA    
1184 C  C     . LEU A 174 ? 1.9054 1.8217 2.5633 0.4941  -0.7184 -1.1247 393 LEU A C     
1185 O  O     . LEU A 174 ? 1.9132 1.8085 2.5648 0.4623  -0.7233 -1.1101 393 LEU A O     
1186 C  CB    . LEU A 174 ? 1.8958 1.6665 2.5194 0.4684  -0.7455 -1.0205 393 LEU A CB    
1187 N  N     . GLY A 175 ? 1.7885 1.8535 2.4881 0.5291  -0.6855 -1.1903 394 GLY A N     
1188 C  CA    . GLY A 175 ? 1.7208 1.9337 2.4432 0.5234  -0.6395 -1.2350 394 GLY A CA    
1189 C  C     . GLY A 175 ? 1.6637 1.9889 2.3923 0.4825  -0.5765 -1.2033 394 GLY A C     
1190 O  O     . GLY A 175 ? 1.6206 1.9982 2.3312 0.4491  -0.5396 -1.1906 394 GLY A O     
1191 N  N     . LEU A 176 ? 1.5616 1.9037 2.2816 0.4687  -0.5444 -1.1559 395 LEU A N     
1192 C  CA    . LEU A 176 ? 1.4586 1.8627 2.1433 0.4122  -0.4678 -1.0789 395 LEU A CA    
1193 C  C     . LEU A 176 ? 1.4298 2.0172 2.1325 0.4056  -0.4049 -1.1145 395 LEU A C     
1194 O  O     . LEU A 176 ? 1.4332 2.1228 2.1819 0.4441  -0.4074 -1.1891 395 LEU A O     
1195 C  CB    . LEU A 176 ? 1.4376 1.7822 2.1060 0.4026  -0.4640 -1.0193 395 LEU A CB    
1196 C  CG    . LEU A 176 ? 1.5679 1.7298 2.2047 0.3966  -0.5212 -0.9695 395 LEU A CG    
1197 C  CD1   . LEU A 176 ? 1.5809 1.7062 2.2032 0.3889  -0.5133 -0.9183 395 LEU A CD1   
1198 C  CD2   . LEU A 176 ? 1.5627 1.6549 2.1492 0.3401  -0.5068 -0.8983 395 LEU A CD2   
1199 N  N     . GLU A 177 ? 1.3062 1.9371 1.9696 0.3544  -0.3499 -1.0608 396 GLU A N     
1200 C  CA    . GLU A 177 ? 1.2271 2.0164 1.8873 0.3322  -0.2862 -1.0723 396 GLU A CA    
1201 C  C     . GLU A 177 ? 1.1874 1.9648 1.8063 0.2875  -0.2393 -0.9828 396 GLU A C     
1202 O  O     . GLU A 177 ? 1.1807 1.8428 1.7684 0.2666  -0.2483 -0.9125 396 GLU A O     
1203 C  CB    . GLU A 177 ? 1.2409 2.0882 1.8826 0.3105  -0.2656 -1.0843 396 GLU A CB    
1204 C  CG    . GLU A 177 ? 1.4203 2.2758 2.0982 0.3515  -0.3117 -1.1712 396 GLU A CG    
1205 C  CD    . GLU A 177 ? 1.7021 2.4798 2.3543 0.3334  -0.3306 -1.1494 396 GLU A CD    
1206 O  OE1   . GLU A 177 ? 1.5315 2.2414 2.1396 0.2898  -0.3113 -1.0648 396 GLU A OE1   
1207 O  OE2   . GLU A 177 ? 1.6784 2.4665 2.3571 0.3642  -0.3668 -1.2214 396 GLU A OE2   
1208 N  N     . VAL A 178 ? 1.0846 1.9816 1.7020 0.2711  -0.1913 -0.9875 397 VAL A N     
1209 C  CA    . VAL A 178 ? 1.0113 1.9034 1.5895 0.2307  -0.1486 -0.9100 397 VAL A CA    
1210 C  C     . VAL A 178 ? 1.0339 2.0018 1.5679 0.1853  -0.0987 -0.8797 397 VAL A C     
1211 O  O     . VAL A 178 ? 1.0362 2.1266 1.5772 0.1809  -0.0772 -0.9301 397 VAL A O     
1212 C  CB    . VAL A 178 ? 1.0139 1.9650 1.6178 0.2419  -0.1376 -0.9298 397 VAL A CB    
1213 C  CG1   . VAL A 178 ? 0.9640 1.8983 1.5244 0.1996  -0.0975 -0.8491 397 VAL A CG1   
1214 C  CG2   . VAL A 178 ? 1.0466 1.9223 1.6933 0.2918  -0.1932 -0.9639 397 VAL A CG2   
1215 N  N     . TYR A 179 ? 0.9545 1.8534 1.4410 0.1512  -0.0816 -0.7987 398 TYR A N     
1216 C  CA    . TYR A 179 ? 0.9151 1.8631 1.3514 0.1094  -0.0413 -0.7593 398 TYR A CA    
1217 C  C     . TYR A 179 ? 0.9217 1.8485 1.3223 0.0806  -0.0131 -0.6925 398 TYR A C     
1218 O  O     . TYR A 179 ? 0.9067 1.7567 1.3153 0.0898  -0.0260 -0.6617 398 TYR A O     
1219 C  CB    . TYR A 179 ? 0.9236 1.8138 1.3361 0.0992  -0.0522 -0.7314 398 TYR A CB    
1220 C  CG    . TYR A 179 ? 0.9673 1.8783 1.4094 0.1234  -0.0799 -0.7970 398 TYR A CG    
1221 C  CD1   . TYR A 179 ? 0.9942 1.9982 1.4217 0.1112  -0.0619 -0.8283 398 TYR A CD1   
1222 C  CD2   . TYR A 179 ? 1.0097 1.8435 1.4906 0.1580  -0.1278 -0.8290 398 TYR A CD2   
1223 C  CE1   . TYR A 179 ? 1.0208 2.0473 1.4768 0.1355  -0.0887 -0.8937 398 TYR A CE1   
1224 C  CE2   . TYR A 179 ? 1.0576 1.9024 1.5652 0.1825  -0.1588 -0.8928 398 TYR A CE2   
1225 C  CZ    . TYR A 179 ? 1.1555 2.1004 1.6532 0.1725  -0.1380 -0.9272 398 TYR A CZ    
1226 O  OH    . TYR A 179 ? 1.2506 2.2084 1.7752 0.1981  -0.1695 -0.9938 398 TYR A OH    
1227 N  N     . VAL A 180 ? 0.8736 1.8622 1.2298 0.0445  0.0223  -0.6684 399 VAL A N     
1228 C  CA    . VAL A 180 ? 0.8524 1.8169 1.1690 0.0160  0.0457  -0.6063 399 VAL A CA    
1229 C  C     . VAL A 180 ? 0.8987 1.8516 1.1531 -0.0173 0.0627  -0.5536 399 VAL A C     
1230 O  O     . VAL A 180 ? 0.8952 1.8949 1.1332 -0.0262 0.0662  -0.5726 399 VAL A O     
1231 C  CB    . VAL A 180 ? 0.8982 1.9534 1.2226 0.0035  0.0679  -0.6347 399 VAL A CB    
1232 C  CG1   . VAL A 180 ? 0.9029 1.9579 1.1685 -0.0403 0.0968  -0.5758 399 VAL A CG1   
1233 C  CG2   . VAL A 180 ? 0.8831 1.9188 1.2627 0.0380  0.0476  -0.6646 399 VAL A CG2   
1234 N  N     . THR A 181 ? 0.8468 1.7340 1.0679 -0.0316 0.0688  -0.4902 400 THR A N     
1235 C  CA    . THR A 181 ? 0.8458 1.7137 1.0053 -0.0592 0.0801  -0.4376 400 THR A CA    
1236 C  C     . THR A 181 ? 0.8677 1.7159 0.9952 -0.0802 0.0947  -0.3965 400 THR A C     
1237 O  O     . THR A 181 ? 0.8295 1.6579 0.9867 -0.0684 0.0931  -0.3989 400 THR A O     
1238 C  CB    . THR A 181 ? 0.9204 1.7129 1.0747 -0.0476 0.0628  -0.4032 400 THR A CB    
1239 O  OG1   . THR A 181 ? 0.9375 1.6598 1.1103 -0.0342 0.0539  -0.3758 400 THR A OG1   
1240 C  CG2   . THR A 181 ? 0.8941 1.6948 1.0781 -0.0307 0.0451  -0.4401 400 THR A CG2   
1241 N  N     . PHE A 182 ? 0.8544 1.7006 0.9185 -0.1107 0.1048  -0.3580 401 PHE A N     
1242 C  CA    . PHE A 182 ? 0.8618 1.6765 0.8853 -0.1339 0.1136  -0.3152 401 PHE A CA    
1243 C  C     . PHE A 182 ? 0.9332 1.7050 0.8883 -0.1521 0.1074  -0.2670 401 PHE A C     
1244 O  O     . PHE A 182 ? 0.9642 1.7768 0.8752 -0.1775 0.1122  -0.2690 401 PHE A O     
1245 C  CB    . PHE A 182 ? 0.9103 1.8031 0.9271 -0.1644 0.1347  -0.3398 401 PHE A CB    
1246 C  CG    . PHE A 182 ? 0.9507 1.8131 0.9435 -0.1858 0.1421  -0.3065 401 PHE A CG    
1247 C  CD1   . PHE A 182 ? 0.9603 1.7331 0.9603 -0.1646 0.1293  -0.2703 401 PHE A CD1   
1248 C  CD2   . PHE A 182 ? 1.0064 1.9367 0.9710 -0.2295 0.1623  -0.3153 401 PHE A CD2   
1249 C  CE1   . PHE A 182 ? 0.9798 1.7231 0.9578 -0.1833 0.1342  -0.2424 401 PHE A CE1   
1250 C  CE2   . PHE A 182 ? 1.0514 1.9508 0.9930 -0.2526 0.1674  -0.2850 401 PHE A CE2   
1251 C  CZ    . PHE A 182 ? 1.0059 1.8088 0.9556 -0.2269 0.1523  -0.2496 401 PHE A CZ    
1252 N  N     . PHE A 183 ? 0.8807 1.5720 0.8276 -0.1360 0.0935  -0.2269 402 PHE A N     
1253 C  CA    . PHE A 183 ? 0.9020 1.5451 0.7888 -0.1432 0.0797  -0.1847 402 PHE A CA    
1254 C  C     . PHE A 183 ? 0.9342 1.5054 0.7970 -0.1412 0.0713  -0.1438 402 PHE A C     
1255 O  O     . PHE A 183 ? 0.8745 1.4294 0.7756 -0.1285 0.0758  -0.1469 402 PHE A O     
1256 C  CB    . PHE A 183 ? 0.9018 1.5331 0.8079 -0.1160 0.0639  -0.1892 402 PHE A CB    
1257 C  CG    . PHE A 183 ? 0.8688 1.4731 0.8364 -0.0843 0.0576  -0.1975 402 PHE A CG    
1258 C  CD1   . PHE A 183 ? 0.9032 1.4513 0.8686 -0.0676 0.0456  -0.1668 402 PHE A CD1   
1259 C  CD2   . PHE A 183 ? 0.8634 1.4980 0.8878 -0.0725 0.0610  -0.2374 402 PHE A CD2   
1260 C  CE1   . PHE A 183 ? 0.8690 1.3979 0.8846 -0.0468 0.0416  -0.1725 402 PHE A CE1   
1261 C  CE2   . PHE A 183 ? 0.8739 1.4736 0.9445 -0.0506 0.0516  -0.2397 402 PHE A CE2   
1262 C  CZ    . PHE A 183 ? 0.8354 1.3859 0.8994 -0.0414 0.0441  -0.2056 402 PHE A CZ    
1263 N  N     . GLU A 184 ? 0.9656 1.4911 0.7626 -0.1526 0.0556  -0.1070 403 GLU A N     
1264 C  CA    . GLU A 184 ? 0.9855 1.4349 0.7576 -0.1440 0.0400  -0.0710 403 GLU A CA    
1265 C  C     . GLU A 184 ? 1.0585 1.4637 0.8208 -0.1127 0.0139  -0.0545 403 GLU A C     
1266 O  O     . GLU A 184 ? 1.0807 1.5083 0.8335 -0.1084 0.0058  -0.0619 403 GLU A O     
1267 C  CB    . GLU A 184 ? 1.0715 1.4913 0.7738 -0.1846 0.0384  -0.0424 403 GLU A CB    
1268 C  CG    . GLU A 184 ? 1.3354 1.7370 0.9534 -0.2143 0.0221  -0.0178 403 GLU A CG    
1269 C  CD    . GLU A 184 ? 1.7011 2.0351 1.2413 -0.2501 0.0077  0.0224  403 GLU A CD    
1270 O  OE1   . GLU A 184 ? 1.6496 1.9877 1.2007 -0.2701 0.0233  0.0219  403 GLU A OE1   
1271 O  OE2   . GLU A 184 ? 1.7385 2.0103 1.2047 -0.2580 -0.0231 0.0545  403 GLU A OE2   
1272 N  N     . ILE A 185 ? 1.0057 1.3569 0.7755 -0.0888 0.0006  -0.0373 404 ILE A N     
1273 C  CA    . ILE A 185 ? 1.0098 1.3265 0.7753 -0.0550 -0.0258 -0.0268 404 ILE A CA    
1274 C  C     . ILE A 185 ? 1.1599 1.4005 0.8639 -0.0561 -0.0514 0.0053  404 ILE A C     
1275 O  O     . ILE A 185 ? 1.1621 1.3722 0.8703 -0.0586 -0.0471 0.0137  404 ILE A O     
1276 C  CB    . ILE A 185 ? 0.9668 1.3004 0.8028 -0.0226 -0.0204 -0.0438 404 ILE A CB    
1277 C  CG1   . ILE A 185 ? 0.9181 1.3126 0.8072 -0.0257 -0.0015 -0.0740 404 ILE A CG1   
1278 C  CG2   . ILE A 185 ? 0.9631 1.2769 0.7966 0.0118  -0.0471 -0.0384 404 ILE A CG2   
1279 C  CD1   . ILE A 185 ? 0.7897 1.1949 0.7419 -0.0113 0.0088  -0.0878 404 ILE A CD1   
1280 N  N     . TYR A 186 ? 1.2089 1.4143 0.8534 -0.0540 -0.0817 0.0223  405 TYR A N     
1281 C  CA    . TYR A 186 ? 1.3100 1.4278 0.8859 -0.0523 -0.1177 0.0530  405 TYR A CA    
1282 C  C     . TYR A 186 ? 1.4216 1.5115 0.9811 -0.0114 -0.1581 0.0539  405 TYR A C     
1283 O  O     . TYR A 186 ? 1.4280 1.5428 0.9691 -0.0134 -0.1668 0.0502  405 TYR A O     
1284 C  CB    . TYR A 186 ? 1.4300 1.5185 0.9238 -0.1068 -0.1202 0.0794  405 TYR A CB    
1285 C  CG    . TYR A 186 ? 1.5981 1.5783 1.0080 -0.1100 -0.1656 0.1154  405 TYR A CG    
1286 C  CD1   . TYR A 186 ? 1.6472 1.5668 1.0550 -0.1026 -0.1758 0.1264  405 TYR A CD1   
1287 C  CD2   . TYR A 186 ? 1.7111 1.6425 1.0417 -0.1177 -0.2038 0.1376  405 TYR A CD2   
1288 C  CE1   . TYR A 186 ? 1.7862 1.5950 1.1159 -0.1022 -0.2244 0.1571  405 TYR A CE1   
1289 C  CE2   . TYR A 186 ? 1.8440 1.6601 1.0920 -0.1181 -0.2547 0.1711  405 TYR A CE2   
1290 C  CZ    . TYR A 186 ? 1.9886 1.7413 1.2365 -0.1104 -0.2656 0.1802  405 TYR A CZ    
1291 O  OH    . TYR A 186 ? 2.1515 1.7802 1.3163 -0.1092 -0.3214 0.2113  405 TYR A OH    
1292 N  N     . ASN A 187 ? 1.4320 1.4758 0.9996 0.0278  -0.1844 0.0547  406 ASN A N     
1293 C  CA    . ASN A 187 ? 1.4902 1.5124 1.0490 0.0752  -0.2277 0.0480  406 ASN A CA    
1294 C  C     . ASN A 187 ? 1.4922 1.6030 1.1096 0.0955  -0.2151 0.0182  406 ASN A C     
1295 O  O     . ASN A 187 ? 1.5421 1.6520 1.1307 0.1086  -0.2433 0.0172  406 ASN A O     
1296 C  CB    . ASN A 187 ? 1.6932 1.6259 1.1508 0.0647  -0.2763 0.0789  406 ASN A CB    
1297 C  CG    . ASN A 187 ? 2.2557 2.0855 1.6684 0.0887  -0.3227 0.0946  406 ASN A CG    
1298 O  OD1   . ASN A 187 ? 2.2061 2.0366 1.6595 0.1429  -0.3437 0.0719  406 ASN A OD1   
1299 N  ND2   . ASN A 187 ? 2.2589 2.0000 1.5850 0.0472  -0.3418 0.1317  406 ASN A ND2   
1300 N  N     . GLY A 188 ? 1.3527 1.5347 1.0460 0.0934  -0.1750 -0.0041 407 GLY A N     
1301 C  CA    . GLY A 188 ? 1.2837 1.5479 1.0355 0.1045  -0.1602 -0.0321 407 GLY A CA    
1302 C  C     . GLY A 188 ? 1.3010 1.6017 1.0401 0.0765  -0.1480 -0.0355 407 GLY A C     
1303 O  O     . GLY A 188 ? 1.2804 1.6406 1.0585 0.0862  -0.1441 -0.0579 407 GLY A O     
1304 N  N     . LYS A 189 ? 1.2525 1.5240 0.9375 0.0390  -0.1413 -0.0157 408 LYS A N     
1305 C  CA    . LYS A 189 ? 1.2456 1.5564 0.9118 0.0093  -0.1289 -0.0212 408 LYS A CA    
1306 C  C     . LYS A 189 ? 1.2311 1.5749 0.9192 -0.0263 -0.0890 -0.0293 408 LYS A C     
1307 O  O     . LYS A 189 ? 1.2415 1.5531 0.9155 -0.0428 -0.0796 -0.0149 408 LYS A O     
1308 C  CB    . LYS A 189 ? 1.3767 1.6354 0.9487 -0.0080 -0.1601 0.0065  408 LYS A CB    
1309 C  CG    . LYS A 189 ? 1.7014 1.9047 1.2369 0.0308  -0.2113 0.0177  408 LYS A CG    
1310 C  CD    . LYS A 189 ? 1.8898 2.1419 1.4422 0.0548  -0.2274 -0.0031 408 LYS A CD    
1311 C  CE    . LYS A 189 ? 2.1829 2.3764 1.6474 0.0588  -0.2770 0.0194  408 LYS A CE    
1312 N  NZ    . LYS A 189 ? 2.3833 2.4888 1.8114 0.0939  -0.3253 0.0358  408 LYS A NZ    
1313 N  N     . LEU A 190 ? 1.1280 1.5369 0.8503 -0.0365 -0.0687 -0.0554 409 LEU A N     
1314 C  CA    . LEU A 190 ? 1.0837 1.5345 0.8345 -0.0627 -0.0354 -0.0739 409 LEU A CA    
1315 C  C     . LEU A 190 ? 1.1590 1.6331 0.8540 -0.0995 -0.0301 -0.0721 409 LEU A C     
1316 O  O     . LEU A 190 ? 1.1989 1.6866 0.8620 -0.1010 -0.0448 -0.0726 409 LEU A O     
1317 C  CB    . LEU A 190 ? 1.0224 1.5273 0.8482 -0.0489 -0.0208 -0.1094 409 LEU A CB    
1318 C  CG    . LEU A 190 ? 1.0436 1.5389 0.9290 -0.0306 -0.0127 -0.1153 409 LEU A CG    
1319 C  CD1   . LEU A 190 ? 1.0545 1.5264 0.9459 -0.0024 -0.0326 -0.1032 409 LEU A CD1   
1320 C  CD2   . LEU A 190 ? 1.0602 1.5975 1.0053 -0.0308 0.0012  -0.1482 409 LEU A CD2   
1321 N  N     . PHE A 191 ? 1.1018 1.5895 0.7859 -0.1311 -0.0086 -0.0727 410 PHE A N     
1322 C  CA    . PHE A 191 ? 1.1390 1.6669 0.7715 -0.1747 0.0026  -0.0751 410 PHE A CA    
1323 C  C     . PHE A 191 ? 1.1432 1.7471 0.8292 -0.1873 0.0355  -0.1154 410 PHE A C     
1324 O  O     . PHE A 191 ? 1.1246 1.7230 0.8484 -0.1835 0.0485  -0.1206 410 PHE A O     
1325 C  CB    . PHE A 191 ? 1.2387 1.7110 0.7884 -0.2108 -0.0075 -0.0341 410 PHE A CB    
1326 C  CG    . PHE A 191 ? 1.3216 1.7053 0.8150 -0.1934 -0.0484 0.0040  410 PHE A CG    
1327 C  CD1   . PHE A 191 ? 1.4504 1.8174 0.8710 -0.2066 -0.0738 0.0217  410 PHE A CD1   
1328 C  CD2   . PHE A 191 ? 1.3338 1.6526 0.8472 -0.1602 -0.0649 0.0186  410 PHE A CD2   
1329 C  CE1   . PHE A 191 ? 1.5288 1.8092 0.8981 -0.1836 -0.1192 0.0529  410 PHE A CE1   
1330 C  CE2   . PHE A 191 ? 1.4383 1.6793 0.9049 -0.1365 -0.1075 0.0455  410 PHE A CE2   
1331 C  CZ    . PHE A 191 ? 1.5020 1.7210 0.8970 -0.1467 -0.1365 0.0624  410 PHE A CZ    
1332 N  N     . ASP A 192 ? 1.0860 1.7624 0.7745 -0.2002 0.0462  -0.1470 411 ASP A N     
1333 C  CA    . ASP A 192 ? 1.0336 1.7924 0.7746 -0.2068 0.0724  -0.1960 411 ASP A CA    
1334 C  C     . ASP A 192 ? 1.1016 1.9017 0.7985 -0.2557 0.0921  -0.1936 411 ASP A C     
1335 O  O     . ASP A 192 ? 1.1387 1.9604 0.7633 -0.2956 0.0924  -0.1794 411 ASP A O     
1336 C  CB    . ASP A 192 ? 1.0452 1.8673 0.8083 -0.1976 0.0726  -0.2364 411 ASP A CB    
1337 C  CG    . ASP A 192 ? 1.1044 2.0005 0.9383 -0.1870 0.0900  -0.2962 411 ASP A CG    
1338 O  OD1   . ASP A 192 ? 1.0639 1.9872 0.9168 -0.1979 0.1066  -0.3102 411 ASP A OD1   
1339 O  OD2   . ASP A 192 ? 1.1845 2.1118 1.0540 -0.1672 0.0840  -0.3319 411 ASP A OD2   
1340 N  N     . LEU A 193 ? 1.0476 1.8582 0.7848 -0.2556 0.1073  -0.2058 412 LEU A N     
1341 C  CA    . LEU A 193 ? 1.0818 1.9352 0.7848 -0.3037 0.1270  -0.2045 412 LEU A CA    
1342 C  C     . LEU A 193 ? 1.1755 2.1538 0.8998 -0.3244 0.1513  -0.2608 412 LEU A C     
1343 O  O     . LEU A 193 ? 1.2299 2.2658 0.9088 -0.3769 0.1690  -0.2607 412 LEU A O     
1344 C  CB    . LEU A 193 ? 1.0368 1.8546 0.7749 -0.2946 0.1316  -0.1964 412 LEU A CB    
1345 C  CG    . LEU A 193 ? 1.0939 1.7948 0.8053 -0.2790 0.1089  -0.1429 412 LEU A CG    
1346 C  CD1   . LEU A 193 ? 1.0279 1.7046 0.7909 -0.2605 0.1143  -0.1460 412 LEU A CD1   
1347 C  CD2   . LEU A 193 ? 1.2009 1.8499 0.8114 -0.3236 0.0959  -0.0931 412 LEU A CD2   
1348 N  N     . LEU A 194 ? 1.0843 2.1064 0.8765 -0.2848 0.1504  -0.3107 413 LEU A N     
1349 C  CA    . LEU A 194 ? 1.0708 2.2135 0.8945 -0.2907 0.1674  -0.3760 413 LEU A CA    
1350 C  C     . LEU A 194 ? 1.2226 2.4050 0.9955 -0.3101 0.1650  -0.3800 413 LEU A C     
1351 O  O     . LEU A 194 ? 1.2521 2.5458 1.0320 -0.3268 0.1815  -0.4311 413 LEU A O     
1352 C  CB    . LEU A 194 ? 0.9920 2.1493 0.9137 -0.2353 0.1603  -0.4307 413 LEU A CB    
1353 C  CG    . LEU A 194 ? 0.9815 2.1005 0.9583 -0.2100 0.1580  -0.4328 413 LEU A CG    
1354 C  CD1   . LEU A 194 ? 0.9320 2.0696 0.9944 -0.1605 0.1456  -0.4916 413 LEU A CD1   
1355 C  CD2   . LEU A 194 ? 0.9957 2.1719 0.9571 -0.2479 0.1801  -0.4363 413 LEU A CD2   
1356 N  N     . ASN A 195 ? 1.2196 2.3177 0.9448 -0.3048 0.1430  -0.3315 414 ASN A N     
1357 C  CA    . ASN A 195 ? 1.2742 2.3959 0.9418 -0.3233 0.1357  -0.3268 414 ASN A CA    
1358 C  C     . ASN A 195 ? 1.4357 2.4832 0.9987 -0.3606 0.1201  -0.2570 414 ASN A C     
1359 O  O     . ASN A 195 ? 1.4413 2.4254 0.9743 -0.3433 0.0941  -0.2279 414 ASN A O     
1360 C  CB    . ASN A 195 ? 1.2774 2.3902 0.9946 -0.2761 0.1185  -0.3534 414 ASN A CB    
1361 C  CG    . ASN A 195 ? 1.5667 2.7730 1.3556 -0.2547 0.1290  -0.4299 414 ASN A CG    
1362 O  OD1   . ASN A 195 ? 1.5054 2.6874 1.3616 -0.2102 0.1151  -0.4562 414 ASN A OD1   
1363 N  ND2   . ASN A 195 ? 1.4980 2.8143 1.2714 -0.2871 0.1508  -0.4695 414 ASN A ND2   
1364 N  N     . LYS A 196 ? 1.5008 2.5558 1.0077 -0.4127 0.1330  -0.2321 415 LYS A N     
1365 C  CA    . LYS A 196 ? 1.6261 2.6164 1.0184 -0.4632 0.1171  -0.1683 415 LYS A CA    
1366 C  C     . LYS A 196 ? 1.7457 2.5939 1.1057 -0.4350 0.0790  -0.1102 415 LYS A C     
1367 O  O     . LYS A 196 ? 1.8202 2.6091 1.0905 -0.4553 0.0514  -0.0671 415 LYS A O     
1368 C  CB    . LYS A 196 ? 1.7402 2.7952 1.0593 -0.5054 0.1186  -0.1732 415 LYS A CB    
1369 N  N     . LYS A 197 ? 1.6723 2.4680 1.1032 -0.3884 0.0753  -0.1109 416 LYS A N     
1370 C  CA    . LYS A 197 ? 1.6825 2.3592 1.1030 -0.3527 0.0419  -0.0683 416 LYS A CA    
1371 C  C     . LYS A 197 ? 1.7767 2.4239 1.1894 -0.3169 0.0129  -0.0634 416 LYS A C     
1372 O  O     . LYS A 197 ? 1.8398 2.3988 1.1942 -0.3092 -0.0224 -0.0213 416 LYS A O     
1373 C  CB    . LYS A 197 ? 1.7888 2.3795 1.1215 -0.3920 0.0245  -0.0125 416 LYS A CB    
1374 C  CG    . LYS A 197 ? 1.8158 2.3651 1.1915 -0.3784 0.0310  -0.0060 416 LYS A CG    
1375 C  CD    . LYS A 197 ? 1.9800 2.4296 1.2687 -0.4126 0.0068  0.0488  416 LYS A CD    
1376 C  CE    . LYS A 197 ? 2.0718 2.4578 1.4088 -0.3768 0.0006  0.0564  416 LYS A CE    
1377 N  NZ    . LYS A 197 ? 2.2831 2.5888 1.5470 -0.4177 -0.0152 0.0994  416 LYS A NZ    
1378 N  N     . ALA A 198 ? 1.6919 2.4127 1.1650 -0.2930 0.0246  -0.1098 417 ALA A N     
1379 C  CA    . ALA A 198 ? 1.6950 2.4022 1.1704 -0.2603 -0.0003 -0.1121 417 ALA A CA    
1380 C  C     . ALA A 198 ? 1.7140 2.3551 1.2406 -0.2089 -0.0194 -0.1015 417 ALA A C     
1381 O  O     . ALA A 198 ? 1.6398 2.2876 1.2410 -0.1870 -0.0036 -0.1207 417 ALA A O     
1382 C  CB    . ALA A 198 ? 1.6561 2.4576 1.1852 -0.2512 0.0169  -0.1672 417 ALA A CB    
1383 N  N     . LYS A 199 ? 1.7178 2.2980 1.2019 -0.1900 -0.0555 -0.0722 418 LYS A N     
1384 C  CA    . LYS A 199 ? 1.6717 2.2034 1.2016 -0.1413 -0.0755 -0.0664 418 LYS A CA    
1385 C  C     . LYS A 199 ? 1.6001 2.1887 1.2113 -0.1104 -0.0681 -0.1070 418 LYS A C     
1386 O  O     . LYS A 199 ? 1.6298 2.2395 1.2306 -0.1003 -0.0852 -0.1161 418 LYS A O     
1387 C  CB    . LYS A 199 ? 1.7650 2.2205 1.2250 -0.1275 -0.1208 -0.0294 418 LYS A CB    
1388 N  N     . LEU A 200 ? 1.4115 2.0229 1.1001 -0.0994 -0.0441 -0.1313 419 LEU A N     
1389 C  CA    . LEU A 200 ? 1.3026 1.9548 1.0685 -0.0766 -0.0379 -0.1671 419 LEU A CA    
1390 C  C     . LEU A 200 ? 1.2589 1.8813 1.0489 -0.0428 -0.0599 -0.1564 419 LEU A C     
1391 O  O     . LEU A 200 ? 1.2990 1.8708 1.0514 -0.0317 -0.0797 -0.1264 419 LEU A O     
1392 C  CB    . LEU A 200 ? 1.2330 1.9008 1.0618 -0.0777 -0.0124 -0.1899 419 LEU A CB    
1393 C  CG    . LEU A 200 ? 1.2814 1.9831 1.0975 -0.1063 0.0107  -0.2042 419 LEU A CG    
1394 C  CD1   . LEU A 200 ? 1.2353 1.9137 1.0827 -0.1047 0.0247  -0.2001 419 LEU A CD1   
1395 C  CD2   . LEU A 200 ? 1.2910 2.0588 1.1426 -0.1090 0.0211  -0.2514 419 LEU A CD2   
1396 N  N     . ARG A 201 ? 1.1001 1.7556 0.9524 -0.0277 -0.0582 -0.1830 420 ARG A N     
1397 C  CA    . ARG A 201 ? 1.0468 1.6952 0.9298 -0.0005 -0.0748 -0.1796 420 ARG A CA    
1398 C  C     . ARG A 201 ? 0.9939 1.6571 0.9493 0.0017  -0.0593 -0.1981 420 ARG A C     
1399 O  O     . ARG A 201 ? 0.9708 1.6576 0.9572 -0.0114 -0.0466 -0.2230 420 ARG A O     
1400 C  CB    . ARG A 201 ? 1.0720 1.7505 0.9423 0.0110  -0.0981 -0.1893 420 ARG A CB    
1401 N  N     . VAL A 202 ? 0.8969 1.5425 0.8743 0.0173  -0.0630 -0.1862 421 VAL A N     
1402 C  CA    . VAL A 202 ? 0.8371 1.4901 0.8715 0.0145  -0.0511 -0.1961 421 VAL A CA    
1403 C  C     . VAL A 202 ? 0.8830 1.5792 0.9498 0.0221  -0.0629 -0.2102 421 VAL A C     
1404 O  O     . VAL A 202 ? 0.8951 1.6040 0.9511 0.0431  -0.0799 -0.2049 421 VAL A O     
1405 C  CB    . VAL A 202 ? 0.8674 1.4809 0.9013 0.0214  -0.0444 -0.1746 421 VAL A CB    
1406 C  CG1   . VAL A 202 ? 0.8183 1.4358 0.9019 0.0143  -0.0334 -0.1808 421 VAL A CG1   
1407 C  CG2   . VAL A 202 ? 0.8810 1.4605 0.8830 0.0100  -0.0331 -0.1630 421 VAL A CG2   
1408 N  N     . LEU A 203 ? 0.8107 1.5307 0.9164 0.0046  -0.0571 -0.2311 422 LEU A N     
1409 C  CA    . LEU A 203 ? 0.7821 1.5497 0.9207 0.0009  -0.0657 -0.2470 422 LEU A CA    
1410 C  C     . LEU A 203 ? 0.7469 1.5108 0.9255 -0.0196 -0.0557 -0.2479 422 LEU A C     
1411 O  O     . LEU A 203 ? 0.7451 1.4681 0.9297 -0.0326 -0.0462 -0.2450 422 LEU A O     
1412 C  CB    . LEU A 203 ? 0.8035 1.6012 0.9447 -0.0094 -0.0734 -0.2719 422 LEU A CB    
1413 C  CG    . LEU A 203 ? 0.9134 1.7207 1.0097 0.0035  -0.0851 -0.2734 422 LEU A CG    
1414 C  CD1   . LEU A 203 ? 0.9128 1.7593 1.0209 -0.0072 -0.0929 -0.3016 422 LEU A CD1   
1415 C  CD2   . LEU A 203 ? 1.0201 1.8352 1.0894 0.0306  -0.1040 -0.2586 422 LEU A CD2   
1416 N  N     . GLU A 204 ? 0.6476 1.4574 0.8515 -0.0242 -0.0599 -0.2534 423 GLU A N     
1417 C  CA    . GLU A 204 ? 0.6154 1.4303 0.8501 -0.0526 -0.0522 -0.2522 423 GLU A CA    
1418 C  C     . GLU A 204 ? 0.6473 1.5147 0.9073 -0.0764 -0.0604 -0.2738 423 GLU A C     
1419 O  O     . GLU A 204 ? 0.6134 1.5385 0.8765 -0.0612 -0.0703 -0.2874 423 GLU A O     
1420 C  CB    . GLU A 204 ? 0.6088 1.4476 0.8489 -0.0409 -0.0473 -0.2406 423 GLU A CB    
1421 C  CG    . GLU A 204 ? 0.7053 1.5437 0.9658 -0.0739 -0.0366 -0.2328 423 GLU A CG    
1422 C  CD    . GLU A 204 ? 0.9244 1.8142 1.1956 -0.0655 -0.0313 -0.2305 423 GLU A CD    
1423 O  OE1   . GLU A 204 ? 0.7358 1.6147 0.9915 -0.0293 -0.0329 -0.2238 423 GLU A OE1   
1424 O  OE2   . GLU A 204 ? 0.7956 1.7352 1.0888 -0.0987 -0.0260 -0.2360 423 GLU A OE2   
1425 N  N     . ASP A 205 ? 0.6204 1.4636 0.8962 -0.1132 -0.0605 -0.2778 424 ASP A N     
1426 C  CA    . ASP A 205 ? 0.6312 1.5173 0.9288 -0.1439 -0.0699 -0.2972 424 ASP A CA    
1427 C  C     . ASP A 205 ? 0.6861 1.6202 1.0050 -0.1792 -0.0647 -0.2926 424 ASP A C     
1428 O  O     . ASP A 205 ? 0.6896 1.6256 1.0062 -0.1763 -0.0533 -0.2755 424 ASP A O     
1429 C  CB    . ASP A 205 ? 0.6709 1.5022 0.9689 -0.1647 -0.0807 -0.3099 424 ASP A CB    
1430 C  CG    . ASP A 205 ? 0.8345 1.5920 1.1324 -0.1925 -0.0830 -0.2967 424 ASP A CG    
1431 O  OD1   . ASP A 205 ? 0.8503 1.6082 1.1493 -0.2111 -0.0749 -0.2757 424 ASP A OD1   
1432 O  OD2   . ASP A 205 ? 0.9576 1.6588 1.2533 -0.1954 -0.0956 -0.3094 424 ASP A OD2   
1433 N  N     . GLY A 206 ? 0.6593 1.6322 0.9965 -0.2165 -0.0728 -0.3086 425 GLY A N     
1434 C  CA    . GLY A 206 ? 0.6770 1.7086 1.0326 -0.2624 -0.0676 -0.3073 425 GLY A CA    
1435 C  C     . GLY A 206 ? 0.7818 1.7558 1.1255 -0.3035 -0.0623 -0.2813 425 GLY A C     
1436 O  O     . GLY A 206 ? 0.8201 1.8500 1.1721 -0.3430 -0.0540 -0.2763 425 GLY A O     
1437 N  N     . LYS A 207 ? 0.7448 1.6123 1.0681 -0.2972 -0.0688 -0.2668 426 LYS A N     
1438 C  CA    . LYS A 207 ? 0.7717 1.5645 1.0775 -0.3304 -0.0710 -0.2411 426 LYS A CA    
1439 C  C     . LYS A 207 ? 0.8186 1.5801 1.1119 -0.2916 -0.0579 -0.2232 426 LYS A C     
1440 O  O     . LYS A 207 ? 0.8482 1.5322 1.1246 -0.3035 -0.0627 -0.2037 426 LYS A O     
1441 C  CB    . LYS A 207 ? 0.8588 1.5477 1.1529 -0.3475 -0.0960 -0.2437 426 LYS A CB    
1442 C  CG    . LYS A 207 ? 1.1683 1.8639 1.4745 -0.3470 -0.1127 -0.2738 426 LYS A CG    
1443 C  CD    . LYS A 207 ? 1.3867 1.9744 1.6824 -0.3486 -0.1395 -0.2818 426 LYS A CD    
1444 C  CE    . LYS A 207 ? 1.5248 2.1138 1.8290 -0.3045 -0.1451 -0.3135 426 LYS A CE    
1445 N  NZ    . LYS A 207 ? 1.6070 2.1638 1.9037 -0.2566 -0.1358 -0.3115 426 LYS A NZ    
1446 N  N     . GLN A 208 ? 0.7328 1.5473 1.0319 -0.2447 -0.0455 -0.2300 427 GLN A N     
1447 C  CA    . GLN A 208 ? 0.6986 1.4859 0.9847 -0.2070 -0.0346 -0.2148 427 GLN A CA    
1448 C  C     . GLN A 208 ? 0.8055 1.5060 1.0765 -0.1836 -0.0400 -0.2105 427 GLN A C     
1449 O  O     . GLN A 208 ? 0.7935 1.4625 1.0529 -0.1623 -0.0320 -0.1960 427 GLN A O     
1450 C  CB    . GLN A 208 ? 0.7051 1.5016 0.9866 -0.2293 -0.0233 -0.1946 427 GLN A CB    
1451 C  CG    . GLN A 208 ? 0.6595 1.5653 0.9586 -0.2444 -0.0134 -0.2048 427 GLN A CG    
1452 C  CD    . GLN A 208 ? 0.9390 1.8819 1.2466 -0.3061 -0.0175 -0.2092 427 GLN A CD    
1453 O  OE1   . GLN A 208 ? 0.9978 1.8853 1.2879 -0.3544 -0.0225 -0.1894 427 GLN A OE1   
1454 N  NE2   . GLN A 208 ? 0.7100 1.7420 1.0414 -0.3077 -0.0191 -0.2351 427 GLN A NE2   
1455 N  N     . GLN A 209 ? 0.8218 1.4923 1.0948 -0.1858 -0.0534 -0.2274 428 GLN A N     
1456 C  CA    . GLN A 209 ? 0.8185 1.4266 1.0822 -0.1612 -0.0581 -0.2329 428 GLN A CA    
1457 C  C     . GLN A 209 ? 0.8062 1.4471 1.0601 -0.1215 -0.0493 -0.2405 428 GLN A C     
1458 O  O     . GLN A 209 ? 0.7918 1.4880 1.0473 -0.1139 -0.0506 -0.2515 428 GLN A O     
1459 C  CB    . GLN A 209 ? 0.8842 1.4509 1.1547 -0.1775 -0.0789 -0.2542 428 GLN A CB    
1460 C  CG    . GLN A 209 ? 1.1816 1.6936 1.4513 -0.2203 -0.0957 -0.2431 428 GLN A CG    
1461 C  CD    . GLN A 209 ? 1.5952 2.0367 1.8672 -0.2253 -0.1238 -0.2646 428 GLN A CD    
1462 O  OE1   . GLN A 209 ? 1.5455 1.9759 1.8225 -0.1917 -0.1276 -0.2891 428 GLN A OE1   
1463 N  NE2   . GLN A 209 ? 1.6084 2.0021 1.8751 -0.2692 -0.1466 -0.2581 428 GLN A NE2   
1464 N  N     . VAL A 210 ? 0.7448 1.3502 0.9852 -0.0990 -0.0427 -0.2338 429 VAL A N     
1465 C  CA    . VAL A 210 ? 0.7291 1.3524 0.9494 -0.0696 -0.0355 -0.2343 429 VAL A CA    
1466 C  C     . VAL A 210 ? 0.8031 1.4120 1.0174 -0.0622 -0.0386 -0.2558 429 VAL A C     
1467 O  O     . VAL A 210 ? 0.8186 1.3890 1.0445 -0.0672 -0.0434 -0.2670 429 VAL A O     
1468 C  CB    . VAL A 210 ? 0.7500 1.3539 0.9554 -0.0540 -0.0243 -0.2104 429 VAL A CB    
1469 C  CG1   . VAL A 210 ? 0.7419 1.3538 0.9173 -0.0299 -0.0210 -0.2056 429 VAL A CG1   
1470 C  CG2   . VAL A 210 ? 0.7339 1.3637 0.9481 -0.0600 -0.0215 -0.1964 429 VAL A CG2   
1471 N  N     . GLN A 211 ? 0.7460 1.3891 0.9408 -0.0496 -0.0380 -0.2638 430 GLN A N     
1472 C  CA    . GLN A 211 ? 0.7545 1.4023 0.9385 -0.0446 -0.0377 -0.2861 430 GLN A CA    
1473 C  C     . GLN A 211 ? 0.8097 1.4717 0.9529 -0.0318 -0.0296 -0.2712 430 GLN A C     
1474 O  O     . GLN A 211 ? 0.8014 1.4786 0.9256 -0.0237 -0.0343 -0.2547 430 GLN A O     
1475 C  CB    . GLN A 211 ? 0.7934 1.4717 0.9888 -0.0526 -0.0503 -0.3149 430 GLN A CB    
1476 C  CG    . GLN A 211 ? 1.1435 1.8493 1.3196 -0.0460 -0.0490 -0.3392 430 GLN A CG    
1477 C  CD    . GLN A 211 ? 1.5187 2.2541 1.7068 -0.0527 -0.0627 -0.3693 430 GLN A CD    
1478 O  OE1   . GLN A 211 ? 1.4909 2.2626 1.6647 -0.0519 -0.0678 -0.3666 430 GLN A OE1   
1479 N  NE2   . GLN A 211 ? 1.4922 2.2118 1.7052 -0.0567 -0.0721 -0.4019 430 GLN A NE2   
1480 N  N     . VAL A 212 ? 0.7901 1.4470 0.9183 -0.0311 -0.0204 -0.2784 431 VAL A N     
1481 C  CA    . VAL A 212 ? 0.8042 1.4719 0.8845 -0.0295 -0.0143 -0.2639 431 VAL A CA    
1482 C  C     . VAL A 212 ? 0.8783 1.5890 0.9454 -0.0357 -0.0175 -0.2917 431 VAL A C     
1483 O  O     . VAL A 212 ? 0.8991 1.6289 0.9814 -0.0403 -0.0120 -0.3231 431 VAL A O     
1484 C  CB    . VAL A 212 ? 0.8308 1.4778 0.8972 -0.0326 -0.0002 -0.2533 431 VAL A CB    
1485 C  CG1   . VAL A 212 ? 0.8561 1.5074 0.8626 -0.0400 0.0025  -0.2325 431 VAL A CG1   
1486 C  CG2   . VAL A 212 ? 0.7980 1.4033 0.8824 -0.0258 0.0016  -0.2304 431 VAL A CG2   
1487 N  N     . VAL A 213 ? 0.8315 1.5616 0.8742 -0.0331 -0.0290 -0.2851 432 VAL A N     
1488 C  CA    . VAL A 213 ? 0.8371 1.6108 0.8632 -0.0393 -0.0341 -0.3103 432 VAL A CA    
1489 C  C     . VAL A 213 ? 0.9167 1.7057 0.8910 -0.0521 -0.0234 -0.3062 432 VAL A C     
1490 O  O     . VAL A 213 ? 0.9289 1.6917 0.8580 -0.0549 -0.0240 -0.2716 432 VAL A O     
1491 C  CB    . VAL A 213 ? 0.8810 1.6715 0.8935 -0.0317 -0.0526 -0.3033 432 VAL A CB    
1492 C  CG1   . VAL A 213 ? 0.9043 1.7408 0.8993 -0.0385 -0.0592 -0.3305 432 VAL A CG1   
1493 C  CG2   . VAL A 213 ? 0.8483 1.6353 0.9106 -0.0261 -0.0602 -0.3063 432 VAL A CG2   
1494 N  N     . GLY A 214 ? 0.8784 1.7107 0.8584 -0.0617 -0.0153 -0.3429 433 GLY A N     
1495 C  CA    . GLY A 214 ? 0.9072 1.7729 0.8387 -0.0815 -0.0020 -0.3450 433 GLY A CA    
1496 C  C     . GLY A 214 ? 0.9647 1.8338 0.9113 -0.0886 0.0172  -0.3536 433 GLY A C     
1497 O  O     . GLY A 214 ? 0.9962 1.9080 0.9075 -0.1105 0.0315  -0.3615 433 GLY A O     
1498 N  N     . LEU A 215 ? 0.8929 1.7214 0.8890 -0.0731 0.0174  -0.3516 434 LEU A N     
1499 C  CA    . LEU A 215 ? 0.8814 1.7112 0.8972 -0.0754 0.0320  -0.3615 434 LEU A CA    
1500 C  C     . LEU A 215 ? 0.9854 1.8659 1.0447 -0.0687 0.0343  -0.4209 434 LEU A C     
1501 O  O     . LEU A 215 ? 0.9719 1.8341 1.0791 -0.0503 0.0192  -0.4465 434 LEU A O     
1502 C  CB    . LEU A 215 ? 0.8399 1.6051 0.8854 -0.0614 0.0285  -0.3354 434 LEU A CB    
1503 C  CG    . LEU A 215 ? 0.8657 1.6248 0.9258 -0.0631 0.0415  -0.3376 434 LEU A CG    
1504 C  CD1   . LEU A 215 ? 0.8786 1.6525 0.8820 -0.0878 0.0563  -0.3127 434 LEU A CD1   
1505 C  CD2   . LEU A 215 ? 0.8359 1.5317 0.9263 -0.0481 0.0347  -0.3149 434 LEU A CD2   
1506 N  N     . GLN A 216 ? 1.0006 1.9468 1.0406 -0.0852 0.0509  -0.4451 435 GLN A N     
1507 C  CA    . GLN A 216 ? 1.0108 2.0175 1.0947 -0.0741 0.0518  -0.5103 435 GLN A CA    
1508 C  C     . GLN A 216 ? 1.0339 2.0311 1.1619 -0.0604 0.0550  -0.5271 435 GLN A C     
1509 O  O     . GLN A 216 ? 1.0168 2.0123 1.1232 -0.0760 0.0709  -0.5002 435 GLN A O     
1510 C  CB    . GLN A 216 ? 1.0649 2.1693 1.1114 -0.0989 0.0685  -0.5397 435 GLN A CB    
1511 C  CG    . GLN A 216 ? 1.3130 2.4759 1.3983 -0.0810 0.0582  -0.6084 435 GLN A CG    
1512 C  CD    . GLN A 216 ? 1.3505 2.6286 1.4383 -0.0921 0.0761  -0.6672 435 GLN A CD    
1513 O  OE1   . GLN A 216 ? 1.3104 2.6532 1.4090 -0.0857 0.0714  -0.7200 435 GLN A OE1   
1514 N  NE2   . GLN A 216 ? 1.0812 2.3952 1.1611 -0.1095 0.0969  -0.6640 435 GLN A NE2   
1515 N  N     . GLU A 217 ? 0.9719 1.9591 1.1593 -0.0311 0.0360  -0.5730 436 GLU A N     
1516 C  CA    . GLU A 217 ? 0.9495 1.9307 1.1838 -0.0107 0.0307  -0.6014 436 GLU A CA    
1517 C  C     . GLU A 217 ? 1.0124 2.1015 1.2635 -0.0088 0.0410  -0.6682 436 GLU A C     
1518 O  O     . GLU A 217 ? 1.0375 2.1775 1.2949 -0.0035 0.0347  -0.7123 436 GLU A O     
1519 C  CB    . GLU A 217 ? 0.9654 1.8740 1.2480 0.0194  -0.0029 -0.6188 436 GLU A CB    
1520 C  CG    . GLU A 217 ? 1.0173 1.8311 1.2885 0.0144  -0.0123 -0.5586 436 GLU A CG    
1521 C  CD    . GLU A 217 ? 1.1260 1.8648 1.4378 0.0351  -0.0462 -0.5726 436 GLU A CD    
1522 O  OE1   . GLU A 217 ? 1.1039 1.8519 1.4534 0.0590  -0.0660 -0.6274 436 GLU A OE1   
1523 O  OE2   . GLU A 217 ? 0.9830 1.6537 1.2871 0.0265  -0.0551 -0.5297 436 GLU A OE2   
1524 N  N     . HIS A 218 ? 0.9689 2.1013 1.2291 -0.0135 0.0567  -0.6799 437 HIS A N     
1525 C  CA    . HIS A 218 ? 0.9775 2.2320 1.2574 -0.0143 0.0700  -0.7479 437 HIS A CA    
1526 C  C     . HIS A 218 ? 0.9977 2.2580 1.3500 0.0297  0.0464  -0.8100 437 HIS A C     
1527 O  O     . HIS A 218 ? 0.9624 2.1726 1.3342 0.0411  0.0403  -0.7915 437 HIS A O     
1528 C  CB    . HIS A 218 ? 0.9939 2.3105 1.2303 -0.0574 0.1049  -0.7223 437 HIS A CB    
1529 C  CG    . HIS A 218 ? 1.0693 2.3936 1.2264 -0.1030 0.1238  -0.6719 437 HIS A CG    
1530 N  ND1   . HIS A 218 ? 1.0882 2.3093 1.2060 -0.1087 0.1147  -0.6023 437 HIS A ND1   
1531 C  CD2   . HIS A 218 ? 1.1359 2.5593 1.2448 -0.1443 0.1477  -0.6835 437 HIS A CD2   
1532 C  CE1   . HIS A 218 ? 1.1205 2.3718 1.1682 -0.1483 0.1289  -0.5740 437 HIS A CE1   
1533 N  NE2   . HIS A 218 ? 1.1549 2.5235 1.1905 -0.1741 0.1493  -0.6177 437 HIS A NE2   
1534 N  N     . LEU A 219 ? 0.9908 2.3138 1.3817 0.0566  0.0302  -0.8869 438 LEU A N     
1535 C  CA    . LEU A 219 ? 0.9920 2.3275 1.4535 0.1058  -0.0004 -0.9600 438 LEU A CA    
1536 C  C     . LEU A 219 ? 1.0261 2.4723 1.5058 0.0992  0.0236  -0.9956 438 LEU A C     
1537 O  O     . LEU A 219 ? 1.0127 2.5710 1.4586 0.0588  0.0616  -1.0003 438 LEU A O     
1538 C  CB    . LEU A 219 ? 1.0189 2.3986 1.5115 0.1353  -0.0250 -1.0365 438 LEU A CB    
1539 C  CG    . LEU A 219 ? 1.1021 2.4834 1.6680 0.1955  -0.0699 -1.1231 438 LEU A CG    
1540 C  CD1   . LEU A 219 ? 1.1011 2.3306 1.6884 0.2244  -0.1118 -1.0919 438 LEU A CD1   
1541 C  CD2   . LEU A 219 ? 1.1860 2.5960 1.7705 0.2192  -0.0949 -1.1887 438 LEU A CD2   
1542 N  N     . VAL A 220 ? 0.9828 2.3928 1.5098 0.1336  0.0009  -1.0142 439 VAL A N     
1543 C  CA    . VAL A 220 ? 0.9773 2.4839 1.5313 0.1327  0.0181  -1.0493 439 VAL A CA    
1544 C  C     . VAL A 220 ? 1.0675 2.5728 1.6992 0.1984  -0.0278 -1.1290 439 VAL A C     
1545 O  O     . VAL A 220 ? 1.0744 2.4484 1.7230 0.2343  -0.0725 -1.1169 439 VAL A O     
1546 C  CB    . VAL A 220 ? 1.0013 2.4533 1.5182 0.0975  0.0417  -0.9679 439 VAL A CB    
1547 C  CG1   . VAL A 220 ? 0.9944 2.4623 1.4332 0.0343  0.0829  -0.9011 439 VAL A CG1   
1548 C  CG2   . VAL A 220 ? 0.9874 2.2756 1.5079 0.1215  0.0093  -0.9134 439 VAL A CG2   
1549 N  N     . ASN A 221 ? 1.0396 2.6922 1.7169 0.2136  -0.0202 -1.2131 440 ASN A N     
1550 C  CA    . ASN A 221 ? 1.0575 2.7224 1.8130 0.2832  -0.0688 -1.3011 440 ASN A CA    
1551 C  C     . ASN A 221 ? 1.0812 2.7954 1.8703 0.2914  -0.0638 -1.3165 440 ASN A C     
1552 O  O     . ASN A 221 ? 1.0868 2.7511 1.9104 0.3423  -0.1002 -1.3439 440 ASN A O     
1553 C  CB    . ASN A 221 ? 1.0805 2.7974 1.8379 0.3012  -0.0699 -1.3495 440 ASN A CB    
1554 C  CG    . ASN A 221 ? 1.2909 2.8954 1.9487 0.2586  -0.0441 -1.2510 440 ASN A CG    
1555 O  OD1   . ASN A 221 ? 1.2530 2.8224 1.9398 0.2910  -0.0853 -1.2950 440 ASN A OD1   
1556 N  ND2   . ASN A 221 ? 1.2303 2.9605 1.8542 0.2056  0.0061  -1.2461 440 ASN A ND2   
1557 N  N     . SER A 222 ? 0.9986 2.7396 1.7424 0.2324  -0.0154 -1.2512 441 SER A N     
1558 C  CA    . SER A 222 ? 0.9866 2.7778 1.7578 0.2322  -0.0068 -1.2610 441 SER A CA    
1559 C  C     . SER A 222 ? 1.0370 2.7601 1.7452 0.1747  0.0278  -1.1573 441 SER A C     
1560 O  O     . SER A 222 ? 1.0407 2.7237 1.6826 0.1271  0.0548  -1.0897 441 SER A O     
1561 C  CB    . SER A 222 ? 1.0114 2.9311 1.7822 0.2143  0.0268  -1.2922 441 SER A CB    
1562 O  OG    . SER A 222 ? 1.0847 3.0371 1.7755 0.1355  0.0854  -1.2199 441 SER A OG    
1563 N  N     . ALA A 223 ? 0.9880 2.6994 1.7171 0.1810  0.0242  -1.1477 442 ALA A N     
1564 C  CA    . ALA A 223 ? 0.9629 2.6122 1.6368 0.1301  0.0536  -1.0561 442 ALA A CA    
1565 C  C     . ALA A 223 ? 0.9967 2.7754 1.6271 0.0581  0.1093  -1.0463 442 ALA A C     
1566 O  O     . ALA A 223 ? 0.9890 2.7094 1.5534 0.0059  0.1353  -0.9637 442 ALA A O     
1567 C  CB    . ALA A 223 ? 0.9645 2.5779 1.6758 0.1579  0.0326  -1.0582 442 ALA A CB    
1568 N  N     . ASP A 224 ? 0.9491 2.9028 1.6132 0.0539  0.1252  -1.1316 443 ASP A N     
1569 C  CA    . ASP A 224 ? 0.9445 3.0376 1.5632 -0.0218 0.1775  -1.1297 443 ASP A CA    
1570 C  C     . ASP A 224 ? 1.0262 3.0839 1.5680 -0.0650 0.1967  -1.0769 443 ASP A C     
1571 O  O     . ASP A 224 ? 1.0516 3.1215 1.5188 -0.1371 0.2321  -1.0175 443 ASP A O     
1572 C  CB    . ASP A 224 ? 0.9561 3.1391 1.6024 -0.0074 0.1852  -1.1782 443 ASP A CB    
1573 C  CG    . ASP A 224 ? 1.0478 3.1511 1.7102 0.0161  0.1768  -1.1405 443 ASP A CG    
1574 O  OD1   . ASP A 224 ? 1.0225 3.1606 1.6912 -0.0138 0.1863  -1.1348 443 ASP A OD1   
1575 O  OD2   . ASP A 224 ? 1.1539 3.1563 1.8147 0.0584  0.1635  -1.1097 443 ASP A OD2   
1576 N  N     . ASP A 225 ? 0.9747 2.9791 1.5316 -0.0208 0.1688  -1.0970 444 ASP A N     
1577 C  CA    . ASP A 225 ? 0.9871 2.9405 1.4770 -0.0510 0.1789  -1.0469 444 ASP A CA    
1578 C  C     . ASP A 225 ? 1.0598 2.8506 1.4850 -0.0778 0.1803  -0.9346 444 ASP A C     
1579 O  O     . ASP A 225 ? 1.0825 2.8667 1.4308 -0.1358 0.2064  -0.8766 444 ASP A O     
1580 C  CB    . ASP A 225 ? 1.0051 2.9159 1.5335 0.0084  0.1415  -1.0911 444 ASP A CB    
1581 C  CG    . ASP A 225 ? 1.0711 3.1159 1.6485 0.0368  0.1373  -1.1906 444 ASP A CG    
1582 O  OD1   . ASP A 225 ? 1.0847 3.1618 1.6112 -0.0039 0.1730  -1.1561 444 ASP A OD1   
1583 O  OD2   . ASP A 225 ? 1.1353 3.0718 1.7419 0.0999  0.0957  -1.2027 444 ASP A OD2   
1584 N  N     . VAL A 226 ? 0.9929 2.6567 1.4477 -0.0356 0.1503  -0.9070 445 VAL A N     
1585 C  CA    . VAL A 226 ? 0.9756 2.4931 1.3801 -0.0526 0.1487  -0.8108 445 VAL A CA    
1586 C  C     . VAL A 226 ? 1.0508 2.5943 1.4031 -0.1134 0.1820  -0.7630 445 VAL A C     
1587 O  O     . VAL A 226 ? 1.0661 2.5365 1.3482 -0.1508 0.1924  -0.6894 445 VAL A O     
1588 C  CB    . VAL A 226 ? 0.9922 2.3881 1.4392 0.0002  0.1116  -0.7981 445 VAL A CB    
1589 C  CG1   . VAL A 226 ? 0.9749 2.2399 1.3702 -0.0198 0.1137  -0.7049 445 VAL A CG1   
1590 C  CG2   . VAL A 226 ? 0.9974 2.3459 1.4845 0.0530  0.0735  -0.8363 445 VAL A CG2   
1591 N  N     . ILE A 227 ? 1.0039 2.6478 1.3898 -0.1229 0.1949  -0.8056 446 ILE A N     
1592 C  CA    . ILE A 227 ? 1.0228 2.6943 1.3600 -0.1857 0.2247  -0.7640 446 ILE A CA    
1593 C  C     . ILE A 227 ? 1.1314 2.8603 1.3897 -0.2552 0.2549  -0.7383 446 ILE A C     
1594 O  O     . ILE A 227 ? 1.1565 2.8250 1.3414 -0.3069 0.2672  -0.6666 446 ILE A O     
1595 C  CB    . ILE A 227 ? 1.0540 2.8371 1.4487 -0.1834 0.2323  -0.8227 446 ILE A CB    
1596 C  CG1   . ILE A 227 ? 1.0273 2.7120 1.4756 -0.1247 0.1994  -0.8189 446 ILE A CG1   
1597 C  CG2   . ILE A 227 ? 1.0884 2.9383 1.4271 -0.2648 0.2689  -0.7921 446 ILE A CG2   
1598 C  CD1   . ILE A 227 ? 1.2100 2.9866 1.7149 -0.1174 0.2012  -0.8698 446 ILE A CD1   
1599 N  N     . LYS A 228 ? 1.1084 2.9463 1.3775 -0.2553 0.2627  -0.7961 447 LYS A N     
1600 C  CA    . LYS A 228 ? 1.1591 3.0520 1.3480 -0.3211 0.2883  -0.7731 447 LYS A CA    
1601 C  C     . LYS A 228 ? 1.2200 2.9595 1.3432 -0.3227 0.2732  -0.6913 447 LYS A C     
1602 O  O     . LYS A 228 ? 1.2643 2.9730 1.3000 -0.3832 0.2864  -0.6293 447 LYS A O     
1603 C  CB    . LYS A 228 ? 1.1797 3.2236 1.4006 -0.3129 0.2971  -0.8590 447 LYS A CB    
1604 N  N     . MET A 229 ? 1.1412 2.7804 1.3050 -0.2580 0.2426  -0.6897 448 MET A N     
1605 C  CA    . MET A 229 ? 1.1368 2.6371 1.2514 -0.2522 0.2260  -0.6188 448 MET A CA    
1606 C  C     . MET A 229 ? 1.1636 2.5533 1.2309 -0.2753 0.2249  -0.5397 448 MET A C     
1607 O  O     . MET A 229 ? 1.1874 2.5201 1.1767 -0.3122 0.2266  -0.4795 448 MET A O     
1608 C  CB    . MET A 229 ? 1.1327 2.5543 1.3066 -0.1831 0.1939  -0.6359 448 MET A CB    
1609 C  CG    . MET A 229 ? 1.1840 2.6881 1.4107 -0.1490 0.1846  -0.7156 448 MET A CG    
1610 S  SD    . MET A 229 ? 1.2803 2.8214 1.4501 -0.1757 0.1922  -0.7128 448 MET A SD    
1611 C  CE    . MET A 229 ? 1.2277 2.7775 1.4769 -0.1081 0.1609  -0.7890 448 MET A CE    
1612 N  N     . ILE A 230 ? 1.0819 2.4383 1.1951 -0.2511 0.2181  -0.5416 449 ILE A N     
1613 C  CA    . ILE A 230 ? 1.0849 2.3403 1.1606 -0.2678 0.2152  -0.4743 449 ILE A CA    
1614 C  C     . ILE A 230 ? 1.2461 2.5322 1.2426 -0.3417 0.2369  -0.4388 449 ILE A C     
1615 O  O     . ILE A 230 ? 1.2781 2.4648 1.2068 -0.3645 0.2290  -0.3713 449 ILE A O     
1616 C  CB    . ILE A 230 ? 1.0762 2.3184 1.2157 -0.2346 0.2071  -0.4938 449 ILE A CB    
1617 C  CG1   . ILE A 230 ? 1.0299 2.2215 1.2350 -0.1671 0.1797  -0.5200 449 ILE A CG1   
1618 C  CG2   . ILE A 230 ? 1.1065 2.2540 1.2050 -0.2555 0.2057  -0.4282 449 ILE A CG2   
1619 C  CD1   . ILE A 230 ? 1.0704 2.2358 1.3286 -0.1341 0.1662  -0.5338 449 ILE A CD1   
1620 N  N     . ASP A 231 ? 1.2534 2.6785 1.2576 -0.3800 0.2616  -0.4867 450 ASP A N     
1621 C  CA    . ASP A 231 ? 1.3334 2.8053 1.2587 -0.4623 0.2839  -0.4584 450 ASP A CA    
1622 C  C     . ASP A 231 ? 1.4843 2.9272 1.3216 -0.4999 0.2827  -0.4175 450 ASP A C     
1623 O  O     . ASP A 231 ? 1.5392 2.9103 1.2889 -0.5513 0.2795  -0.3524 450 ASP A O     
1624 C  CB    . ASP A 231 ? 1.3689 3.0186 1.3297 -0.4939 0.3121  -0.5292 450 ASP A CB    
1625 C  CG    . ASP A 231 ? 1.4828 3.1622 1.5078 -0.4780 0.3144  -0.5571 450 ASP A CG    
1626 O  OD1   . ASP A 231 ? 1.4585 3.0138 1.4837 -0.4563 0.2970  -0.5103 450 ASP A OD1   
1627 O  OD2   . ASP A 231 ? 1.5802 3.4132 1.6555 -0.4871 0.3330  -0.6285 450 ASP A OD2   
1628 N  N     . MET A 232 ? 1.4681 2.9580 1.3263 -0.4723 0.2804  -0.4551 451 MET A N     
1629 C  CA    . MET A 232 ? 1.5382 2.9998 1.3189 -0.4982 0.2750  -0.4210 451 MET A CA    
1630 C  C     . MET A 232 ? 1.6390 2.9297 1.3765 -0.4789 0.2462  -0.3450 451 MET A C     
1631 O  O     . MET A 232 ? 1.7173 2.9476 1.3603 -0.5250 0.2388  -0.2867 451 MET A O     
1632 C  CB    . MET A 232 ? 1.5418 3.0683 1.3712 -0.4552 0.2719  -0.4795 451 MET A CB    
1633 C  CG    . MET A 232 ? 1.6585 3.2169 1.4086 -0.4971 0.2760  -0.4652 451 MET A CG    
1634 S  SD    . MET A 232 ? 1.6884 3.2121 1.4685 -0.4358 0.2529  -0.4852 451 MET A SD    
1635 C  CE    . MET A 232 ? 1.7339 3.3352 1.4129 -0.5036 0.2657  -0.4766 451 MET A CE    
1636 N  N     . GLY A 233 ? 1.5442 2.7607 1.3493 -0.4125 0.2283  -0.3481 452 GLY A N     
1637 C  CA    . GLY A 233 ? 1.5478 2.6205 1.3296 -0.3847 0.2018  -0.2892 452 GLY A CA    
1638 C  C     . GLY A 233 ? 1.6629 2.6508 1.3893 -0.4158 0.1954  -0.2308 452 GLY A C     
1639 O  O     . GLY A 233 ? 1.7089 2.6050 1.3634 -0.4294 0.1760  -0.1757 452 GLY A O     
1640 N  N     . SER A 234 ? 1.6158 2.6316 1.3760 -0.4245 0.2080  -0.2452 453 SER A N     
1641 C  CA    . SER A 234 ? 1.6513 2.5902 1.3662 -0.4540 0.2017  -0.1961 453 SER A CA    
1642 C  C     . SER A 234 ? 1.8552 2.7768 1.4602 -0.5292 0.2014  -0.1507 453 SER A C     
1643 O  O     . SER A 234 ? 1.9035 2.7110 1.4477 -0.5429 0.1794  -0.0942 453 SER A O     
1644 C  CB    . SER A 234 ? 1.6220 2.6199 1.3956 -0.4554 0.2180  -0.2297 453 SER A CB    
1645 O  OG    . SER A 234 ? 1.5597 2.5456 1.4229 -0.3860 0.2098  -0.2613 453 SER A OG    
1646 N  N     . ALA A 235 ? 1.8850 2.9173 1.4608 -0.5781 0.2225  -0.1763 454 ALA A N     
1647 C  CA    . ALA A 235 ? 2.0092 3.0349 1.4708 -0.6592 0.2223  -0.1339 454 ALA A CA    
1648 C  C     . ALA A 235 ? 2.1572 3.0539 1.5441 -0.6482 0.1867  -0.0765 454 ALA A C     
1649 O  O     . ALA A 235 ? 2.2504 3.0564 1.5406 -0.6954 0.1661  -0.0182 454 ALA A O     
1650 C  CB    . ALA A 235 ? 2.0374 3.2208 1.4922 -0.7047 0.2528  -0.1810 454 ALA A CB    
1651 N  N     . CYS A 236 ? 2.0897 2.9734 1.5217 -0.5844 0.1754  -0.0942 455 CYS A N     
1652 C  CA    . CYS A 236 ? 2.1419 2.9159 1.5195 -0.5621 0.1402  -0.0498 455 CYS A CA    
1653 C  C     . CYS A 236 ? 2.2318 2.8662 1.5950 -0.5354 0.1096  -0.0031 455 CYS A C     
1654 O  O     . CYS A 236 ? 2.3289 2.8691 1.5975 -0.5691 0.0820  0.0503  455 CYS A O     
1655 C  CB    . CYS A 236 ? 2.0758 2.8787 1.5192 -0.4996 0.1376  -0.0859 455 CYS A CB    
1656 S  SG    . CYS A 236 ? 2.1371 3.0824 1.5768 -0.5263 0.1614  -0.1354 455 CYS A SG    
1657 N  N     . ARG A 237 ? 2.1099 2.7295 1.5643 -0.4744 0.1114  -0.0249 456 ARG A N     
1658 C  CA    . ARG A 237 ? 2.1081 2.6118 1.5660 -0.4381 0.0849  0.0079  456 ARG A CA    
1659 C  C     . ARG A 237 ? 2.2750 2.6871 1.6518 -0.4801 0.0648  0.0576  456 ARG A C     
1660 O  O     . ARG A 237 ? 2.2866 2.7243 1.6592 -0.5211 0.0816  0.0562  456 ARG A O     
1661 C  CB    . ARG A 237 ? 2.0113 2.5335 1.5731 -0.3829 0.0965  -0.0255 456 ARG A CB    
1662 N  N     . THR A 238 ? 2.3103 2.6108 1.6221 -0.4668 0.0239  0.0999  457 THR A N     
1663 C  CA    . THR A 238 ? 2.7889 2.9673 2.0112 -0.4948 -0.0124 0.1520  457 THR A CA    
1664 C  C     . THR A 238 ? 2.9091 2.9802 2.1421 -0.4261 -0.0533 0.1679  457 THR A C     
1665 O  O     . THR A 238 ? 2.1743 2.2669 1.4621 -0.3695 -0.0556 0.1463  457 THR A O     
1666 C  CB    . THR A 238 ? 3.0088 3.1613 2.1112 -0.5639 -0.0296 0.1889  457 THR A CB    
1667 O  OG1   . THR A 238 ? 3.0049 3.1855 2.1007 -0.5425 -0.0365 0.1802  457 THR A OG1   
1668 C  CG2   . THR A 238 ? 2.9990 3.2433 2.0713 -0.6484 0.0067  0.1821  457 THR A CG2   
1669 N  N     . ASN A 247 ? 2.1566 1.8622 1.2391 -0.3854 -0.1875 0.2614  466 ASN A N     
1670 C  CA    . ASN A 247 ? 2.0699 1.8255 1.2256 -0.3848 -0.1508 0.2386  466 ASN A CA    
1671 C  C     . ASN A 247 ? 1.9564 1.8288 1.2292 -0.3391 -0.1075 0.1909  466 ASN A C     
1672 O  O     . ASN A 247 ? 1.8884 1.7642 1.2074 -0.2780 -0.1177 0.1748  466 ASN A O     
1673 C  CB    . ASN A 247 ? 2.1095 1.7597 1.2594 -0.3531 -0.1860 0.2508  466 ASN A CB    
1674 N  N     . SER A 248 ? 1.8374 1.8053 1.1564 -0.3710 -0.0617 0.1674  467 SER A N     
1675 C  CA    . SER A 248 ? 1.6927 1.7626 1.1175 -0.3347 -0.0240 0.1223  467 SER A CA    
1676 C  C     . SER A 248 ? 1.6036 1.6440 1.0910 -0.2843 -0.0274 0.1118  467 SER A C     
1677 O  O     . SER A 248 ? 1.4738 1.5750 1.0436 -0.2477 -0.0057 0.0800  467 SER A O     
1678 C  CB    . SER A 248 ? 1.7346 1.9088 1.1812 -0.3838 0.0174  0.0983  467 SER A CB    
1679 O  OG    . SER A 248 ? 1.9329 2.0795 1.3480 -0.4275 0.0184  0.1145  467 SER A OG    
1680 N  N     . SER A 249 ? 1.5947 1.5378 1.0381 -0.2838 -0.0579 0.1386  468 SER A N     
1681 C  CA    . SER A 249 ? 1.5348 1.4442 1.0264 -0.2356 -0.0662 0.1299  468 SER A CA    
1682 C  C     . SER A 249 ? 1.5376 1.4197 1.0491 -0.1723 -0.0913 0.1243  468 SER A C     
1683 O  O     . SER A 249 ? 1.4877 1.3652 1.0492 -0.1272 -0.0940 0.1100  468 SER A O     
1684 C  CB    . SER A 249 ? 1.6372 1.4560 1.0743 -0.2589 -0.0912 0.1556  468 SER A CB    
1685 O  OG    . SER A 249 ? 1.7911 1.5008 1.1481 -0.2552 -0.1409 0.1862  468 SER A OG    
1686 N  N     . ARG A 250 ? 1.5048 1.3775 0.9774 -0.1711 -0.1091 0.1335  469 ARG A N     
1687 C  CA    . ARG A 250 ? 1.4842 1.3393 0.9719 -0.1146 -0.1355 0.1258  469 ARG A CA    
1688 C  C     . ARG A 250 ? 1.4251 1.3714 0.9697 -0.0977 -0.1102 0.0999  469 ARG A C     
1689 O  O     . ARG A 250 ? 1.4264 1.3740 0.9832 -0.0582 -0.1293 0.0916  469 ARG A O     
1690 C  CB    . ARG A 250 ? 1.6213 1.3805 1.0188 -0.1165 -0.1872 0.1551  469 ARG A CB    
1691 C  CG    . ARG A 250 ? 1.8582 1.5072 1.1994 -0.1220 -0.2244 0.1786  469 ARG A CG    
1692 C  CD    . ARG A 250 ? 2.0881 1.6624 1.4149 -0.0604 -0.2785 0.1757  469 ARG A CD    
1693 N  NE    . ARG A 250 ? 2.3758 1.8737 1.6151 -0.0678 -0.3269 0.2013  469 ARG A NE    
1694 C  CZ    . ARG A 250 ? 2.5074 2.0351 1.7517 -0.0392 -0.3395 0.1917  469 ARG A CZ    
1695 N  NH1   . ARG A 250 ? 2.2796 1.9127 1.6128 -0.0041 -0.3062 0.1569  469 ARG A NH1   
1696 N  NH2   . ARG A 250 ? 2.3198 1.7685 1.4765 -0.0478 -0.3882 0.2176  469 ARG A NH2   
1697 N  N     . SER A 251 ? 1.2825 1.3070 0.8646 -0.1260 -0.0698 0.0833  470 SER A N     
1698 C  CA    . SER A 251 ? 1.1872 1.2924 0.8220 -0.1132 -0.0480 0.0565  470 SER A CA    
1699 C  C     . SER A 251 ? 1.0945 1.2649 0.8077 -0.1074 -0.0137 0.0278  470 SER A C     
1700 O  O     . SER A 251 ? 1.0715 1.2425 0.7945 -0.1247 0.0000  0.0272  470 SER A O     
1701 C  CB    . SER A 251 ? 1.2741 1.4107 0.8638 -0.1525 -0.0422 0.0602  470 SER A CB    
1702 O  OG    . SER A 251 ? 1.4452 1.6000 1.0070 -0.2048 -0.0230 0.0656  470 SER A OG    
1703 N  N     . HIS A 252 ? 0.9646 1.1861 0.7316 -0.0831 -0.0039 0.0041  471 HIS A N     
1704 C  CA    . HIS A 252 ? 0.8866 1.1617 0.7220 -0.0771 0.0211  -0.0234 471 HIS A CA    
1705 C  C     . HIS A 252 ? 0.9567 1.2944 0.7975 -0.1027 0.0392  -0.0446 471 HIS A C     
1706 O  O     . HIS A 252 ? 0.9718 1.3233 0.7848 -0.1095 0.0330  -0.0439 471 HIS A O     
1707 C  CB    . HIS A 252 ? 0.8366 1.1265 0.7222 -0.0418 0.0177  -0.0369 471 HIS A CB    
1708 C  CG    . HIS A 252 ? 0.8817 1.1307 0.7638 -0.0129 -0.0013 -0.0237 471 HIS A CG    
1709 N  ND1   . HIS A 252 ? 0.9069 1.1192 0.7879 -0.0068 -0.0040 -0.0138 471 HIS A ND1   
1710 C  CD2   . HIS A 252 ? 0.9045 1.1562 0.7910 0.0131  -0.0175 -0.0256 471 HIS A CD2   
1711 C  CE1   . HIS A 252 ? 0.9002 1.0952 0.7840 0.0237  -0.0218 -0.0115 471 HIS A CE1   
1712 N  NE2   . HIS A 252 ? 0.9054 1.1262 0.7937 0.0366  -0.0304 -0.0192 471 HIS A NE2   
1713 N  N     . ALA A 253 ? 0.9024 1.2821 0.7784 -0.1150 0.0595  -0.0669 472 ALA A N     
1714 C  CA    . ALA A 253 ? 0.8963 1.3487 0.7877 -0.1329 0.0760  -0.0981 472 ALA A CA    
1715 C  C     . ALA A 253 ? 0.8914 1.3722 0.8561 -0.1050 0.0812  -0.1312 472 ALA A C     
1716 O  O     . ALA A 253 ? 0.8781 1.3396 0.8733 -0.0922 0.0817  -0.1320 472 ALA A O     
1717 C  CB    . ALA A 253 ? 0.9290 1.4149 0.7957 -0.1733 0.0914  -0.1019 472 ALA A CB    
1718 N  N     . CYS A 254 ? 0.8115 1.3298 0.7998 -0.0957 0.0808  -0.1568 473 CYS A N     
1719 C  CA    A CYS A 254 ? 0.7534 1.2838 0.8032 -0.0707 0.0778  -0.1866 473 CYS A CA    
1720 C  CA    B CYS A 254 ? 0.7728 1.3034 0.8227 -0.0707 0.0778  -0.1866 473 CYS A CA    
1721 C  C     . CYS A 254 ? 0.8117 1.4108 0.8866 -0.0760 0.0856  -0.2320 473 CYS A C     
1722 O  O     . CYS A 254 ? 0.8314 1.4661 0.8866 -0.0867 0.0877  -0.2425 473 CYS A O     
1723 C  CB    A CYS A 254 ? 0.7333 1.2346 0.7928 -0.0512 0.0638  -0.1766 473 CYS A CB    
1724 C  CB    B CYS A 254 ? 0.7711 1.2731 0.8309 -0.0512 0.0638  -0.1772 473 CYS A CB    
1725 S  SG    A CYS A 254 ? 0.7455 1.2422 0.8676 -0.0295 0.0535  -0.2049 473 CYS A SG    
1726 S  SG    B CYS A 254 ? 0.8398 1.2865 0.8593 -0.0448 0.0528  -0.1322 473 CYS A SG    
1727 N  N     . PHE A 255 ? 0.7558 1.3755 0.8746 -0.0658 0.0872  -0.2621 474 PHE A N     
1728 C  CA    . PHE A 255 ? 0.7636 1.4532 0.9175 -0.0619 0.0903  -0.3158 474 PHE A CA    
1729 C  C     . PHE A 255 ? 0.8008 1.4592 1.0055 -0.0285 0.0688  -0.3387 474 PHE A C     
1730 O  O     . PHE A 255 ? 0.7952 1.4011 1.0177 -0.0140 0.0581  -0.3243 474 PHE A O     
1731 C  CB    . PHE A 255 ? 0.7920 1.5330 0.9560 -0.0753 0.1041  -0.3367 474 PHE A CB    
1732 C  CG    . PHE A 255 ? 0.8126 1.6250 1.0303 -0.0578 0.1010  -0.4017 474 PHE A CG    
1733 C  CD1   . PHE A 255 ? 0.8712 1.7694 1.0874 -0.0698 0.1112  -0.4416 474 PHE A CD1   
1734 C  CD2   . PHE A 255 ? 0.8450 1.6382 1.1141 -0.0262 0.0840  -0.4261 474 PHE A CD2   
1735 C  CE1   . PHE A 255 ? 0.8860 1.8561 1.1571 -0.0470 0.1046  -0.5106 474 PHE A CE1   
1736 C  CE2   . PHE A 255 ? 0.8841 1.7398 1.2055 -0.0025 0.0737  -0.4923 474 PHE A CE2   
1737 C  CZ    . PHE A 255 ? 0.8707 1.8161 1.1955 -0.0108 0.0838  -0.5366 474 PHE A CZ    
1738 N  N     . GLN A 256 ? 0.7520 1.4372 0.9747 -0.0188 0.0599  -0.3725 475 GLN A N     
1739 C  CA    . GLN A 256 ? 0.7441 1.3876 1.0068 0.0080  0.0337  -0.3923 475 GLN A CA    
1740 C  C     . GLN A 256 ? 0.8012 1.4921 1.1076 0.0284  0.0210  -0.4566 475 GLN A C     
1741 O  O     . GLN A 256 ? 0.8061 1.5742 1.1108 0.0210  0.0329  -0.4912 475 GLN A O     
1742 C  CB    . GLN A 256 ? 0.7552 1.3682 1.0036 0.0053  0.0247  -0.3745 475 GLN A CB    
1743 C  CG    . GLN A 256 ? 0.7526 1.3264 0.9627 -0.0084 0.0328  -0.3184 475 GLN A CG    
1744 C  CD    . GLN A 256 ? 1.0725 1.6289 1.2748 -0.0101 0.0233  -0.3064 475 GLN A CD    
1745 O  OE1   . GLN A 256 ? 1.0925 1.6868 1.2869 -0.0146 0.0241  -0.3249 475 GLN A OE1   
1746 N  NE2   . GLN A 256 ? 1.0125 1.5191 1.2151 -0.0089 0.0155  -0.2755 475 GLN A NE2   
1747 N  N     . ILE A 257 ? 0.7729 1.4168 1.1164 0.0548  -0.0062 -0.4743 476 ILE A N     
1748 C  CA    . ILE A 257 ? 0.7932 1.4614 1.1827 0.0846  -0.0316 -0.5396 476 ILE A CA    
1749 C  C     . ILE A 257 ? 0.8696 1.4593 1.2648 0.0954  -0.0639 -0.5352 476 ILE A C     
1750 O  O     . ILE A 257 ? 0.8928 1.3976 1.2792 0.0933  -0.0793 -0.4957 476 ILE A O     
1751 C  CB    . ILE A 257 ? 0.8288 1.4938 1.2540 0.1095  -0.0478 -0.5667 476 ILE A CB    
1752 C  CG1   . ILE A 257 ? 0.8031 1.5467 1.2223 0.0924  -0.0150 -0.5682 476 ILE A CG1   
1753 C  CG2   . ILE A 257 ? 0.8681 1.5520 1.3418 0.1476  -0.0829 -0.6403 476 ILE A CG2   
1754 C  CD1   . ILE A 257 ? 0.8492 1.5778 1.2960 0.1115  -0.0280 -0.5775 476 ILE A CD1   
1755 N  N     . ILE A 258 ? 0.8229 1.4438 1.2300 0.1028  -0.0740 -0.5760 477 ILE A N     
1756 C  CA    . ILE A 258 ? 0.8460 1.3983 1.2566 0.1079  -0.1057 -0.5769 477 ILE A CA    
1757 C  C     . ILE A 258 ? 0.9638 1.5114 1.4175 0.1444  -0.1464 -0.6469 477 ILE A C     
1758 O  O     . ILE A 258 ? 0.9554 1.5912 1.4300 0.1582  -0.1398 -0.7042 477 ILE A O     
1759 C  CB    . ILE A 258 ? 0.8577 1.4419 1.2404 0.0841  -0.0866 -0.5615 477 ILE A CB    
1760 C  CG1   . ILE A 258 ? 0.8069 1.3950 1.1470 0.0547  -0.0528 -0.4979 477 ILE A CG1   
1761 C  CG2   . ILE A 258 ? 0.8948 1.4124 1.2819 0.0841  -0.1189 -0.5628 477 ILE A CG2   
1762 C  CD1   . ILE A 258 ? 0.8507 1.4971 1.1605 0.0356  -0.0301 -0.4915 477 ILE A CD1   
1763 N  N     . LEU A 259 ? 0.9766 1.4220 1.4407 0.1594  -0.1907 -0.6440 478 LEU A N     
1764 C  CA    . LEU A 259 ? 1.0323 1.4484 1.5323 0.1972  -0.2413 -0.7089 478 LEU A CA    
1765 C  C     . LEU A 259 ? 1.1355 1.4999 1.6245 0.1856  -0.2649 -0.7093 478 LEU A C     
1766 O  O     . LEU A 259 ? 1.1291 1.4153 1.5878 0.1556  -0.2699 -0.6529 478 LEU A O     
1767 C  CB    . LEU A 259 ? 1.0704 1.3894 1.5813 0.2201  -0.2863 -0.7060 478 LEU A CB    
1768 C  CG    . LEU A 259 ? 1.0954 1.4589 1.6265 0.2400  -0.2756 -0.7187 478 LEU A CG    
1769 C  CD1   . LEU A 259 ? 1.1425 1.3932 1.6746 0.2593  -0.3252 -0.7068 478 LEU A CD1   
1770 C  CD2   . LEU A 259 ? 1.1418 1.6226 1.7191 0.2746  -0.2724 -0.8030 478 LEU A CD2   
1771 N  N     . ARG A 260 ? 1.1412 1.5571 1.6549 0.2071  -0.2782 -0.7750 479 ARG A N     
1772 C  CA    . ARG A 260 ? 1.1951 1.5645 1.7030 0.1997  -0.3058 -0.7864 479 ARG A CA    
1773 C  C     . ARG A 260 ? 1.3653 1.6868 1.9090 0.2448  -0.3686 -0.8592 479 ARG A C     
1774 O  O     . ARG A 260 ? 1.3696 1.7667 1.9514 0.2846  -0.3733 -0.9270 479 ARG A O     
1775 C  CB    . ARG A 260 ? 1.1400 1.6101 1.6376 0.1815  -0.2668 -0.7964 479 ARG A CB    
1776 C  CG    . ARG A 260 ? 1.1008 1.6000 1.5587 0.1403  -0.2161 -0.7248 479 ARG A CG    
1777 C  CD    . ARG A 260 ? 1.0714 1.6460 1.5121 0.1219  -0.1897 -0.7304 479 ARG A CD    
1778 N  NE    . ARG A 260 ? 1.0539 1.6359 1.4550 0.0863  -0.1533 -0.6616 479 ARG A NE    
1779 C  CZ    . ARG A 260 ? 1.2336 1.7493 1.6161 0.0625  -0.1600 -0.6123 479 ARG A CZ    
1780 N  NH1   . ARG A 260 ? 1.1445 1.5736 1.5380 0.0621  -0.2005 -0.6168 479 ARG A NH1   
1781 N  NH2   . ARG A 260 ? 0.9844 1.5201 1.3356 0.0377  -0.1287 -0.5597 479 ARG A NH2   
1782 N  N     . ALA A 261 ? 1.4172 1.6140 1.9479 0.2377  -0.4191 -0.8470 480 ALA A N     
1783 C  CA    . ALA A 261 ? 1.5184 1.6317 2.0736 0.2791  -0.4924 -0.9073 480 ALA A CA    
1784 C  C     . ALA A 261 ? 1.6146 1.7750 2.1951 0.3023  -0.5113 -0.9821 480 ALA A C     
1785 O  O     . ALA A 261 ? 1.6698 1.8466 2.2910 0.3562  -0.5512 -1.0638 480 ALA A O     
1786 C  CB    . ALA A 261 ? 1.6066 1.5529 2.1260 0.2533  -0.5420 -0.8548 480 ALA A CB    
1787 N  N     . LYS A 262 ? 1.5350 1.7182 2.0929 0.2642  -0.4860 -0.9579 481 LYS A N     
1788 C  CA    . LYS A 262 ? 1.5539 1.7922 2.1291 0.2774  -0.4951 -1.0206 481 LYS A CA    
1789 C  C     . LYS A 262 ? 1.5355 1.8536 2.0818 0.2304  -0.4347 -0.9749 481 LYS A C     
1790 O  O     . LYS A 262 ? 1.5479 1.8574 2.0851 0.2132  -0.4442 -0.9823 481 LYS A O     
1791 C  CB    . LYS A 262 ? 1.6893 1.7904 2.2616 0.2831  -0.5697 -1.0424 481 LYS A CB    
1792 C  CG    . LYS A 262 ? 1.8533 1.8902 2.4603 0.3443  -0.6407 -1.1155 481 LYS A CG    
1793 C  CD    . LYS A 262 ? 1.9496 1.9739 2.5352 0.3519  -0.6512 -1.1526 481 LYS A CD    
1794 C  CE    . LYS A 262 ? 2.1048 1.9357 2.6028 0.3223  -0.6764 -1.0912 481 LYS A CE    
1795 N  NZ    . LYS A 262 ? 2.2214 1.9480 2.6786 0.2630  -0.6919 -1.0294 481 LYS A NZ    
1796 N  N     . GLY A 263 ? 1.4150 1.8051 1.9459 0.2111  -0.3771 -0.9284 482 GLY A N     
1797 C  CA    . GLY A 263 ? 1.3548 1.8058 1.8525 0.1686  -0.3240 -0.8754 482 GLY A CA    
1798 C  C     . GLY A 263 ? 1.4085 1.7711 1.8738 0.1289  -0.3196 -0.7912 482 GLY A C     
1799 O  O     . GLY A 263 ? 1.3405 1.7455 1.7790 0.0982  -0.2760 -0.7387 482 GLY A O     
1800 N  N     . ARG A 264 ? 1.4386 1.6764 1.9037 0.1292  -0.3684 -0.7796 483 ARG A N     
1801 C  CA    . ARG A 264 ? 1.4350 1.5876 1.8687 0.0894  -0.3693 -0.7046 483 ARG A CA    
1802 C  C     . ARG A 264 ? 1.4311 1.5881 1.8625 0.0980  -0.3483 -0.6745 483 ARG A C     
1803 O  O     . ARG A 264 ? 1.4421 1.5920 1.8976 0.1366  -0.3696 -0.7137 483 ARG A O     
1804 C  CB    . ARG A 264 ? 1.5477 1.5629 1.9740 0.0810  -0.4340 -0.7062 483 ARG A CB    
1805 N  N     . MET A 265 ? 1.3272 1.5011 1.7318 0.0647  -0.3081 -0.6092 484 MET A N     
1806 C  CA    . MET A 265 ? 1.2744 1.4534 1.6744 0.0703  -0.2868 -0.5787 484 MET A CA    
1807 C  C     . MET A 265 ? 1.3453 1.4134 1.7421 0.0761  -0.3307 -0.5669 484 MET A C     
1808 O  O     . MET A 265 ? 1.4056 1.3836 1.7792 0.0461  -0.3592 -0.5351 484 MET A O     
1809 C  CB    . MET A 265 ? 1.2459 1.4594 1.6177 0.0369  -0.2409 -0.5156 484 MET A CB    
1810 C  CG    . MET A 265 ? 1.2639 1.4742 1.6310 0.0437  -0.2236 -0.4871 484 MET A CG    
1811 S  SD    . MET A 265 ? 1.2376 1.5275 1.5822 0.0260  -0.1655 -0.4422 484 MET A SD    
1812 C  CE    . MET A 265 ? 1.1688 1.5602 1.5204 0.0372  -0.1429 -0.4844 484 MET A CE    
1813 N  N     . HIS A 266 ? 1.2435 1.3216 1.6598 0.1107  -0.3357 -0.5902 485 HIS A N     
1814 C  CA    . HIS A 266 ? 1.2851 1.2619 1.6973 0.1222  -0.3793 -0.5812 485 HIS A CA    
1815 C  C     . HIS A 266 ? 1.2963 1.2787 1.6888 0.1054  -0.3467 -0.5249 485 HIS A C     
1816 O  O     . HIS A 266 ? 1.3514 1.2444 1.7156 0.0828  -0.3682 -0.4809 485 HIS A O     
1817 C  CB    . HIS A 266 ? 1.3261 1.3071 1.7790 0.1791  -0.4175 -0.6552 485 HIS A CB    
1818 C  CG    . HIS A 266 ? 1.4339 1.3092 1.8821 0.1974  -0.4679 -0.6491 485 HIS A CG    
1819 N  ND1   . HIS A 266 ? 1.5600 1.2945 1.9821 0.1859  -0.5301 -0.6349 485 HIS A ND1   
1820 C  CD2   . HIS A 266 ? 1.4461 1.3356 1.9078 0.2231  -0.4661 -0.6531 485 HIS A CD2   
1821 C  CE1   . HIS A 266 ? 1.6011 1.2654 2.0194 0.2072  -0.5663 -0.6305 485 HIS A CE1   
1822 N  NE2   . HIS A 266 ? 1.5344 1.2910 1.9784 0.2312  -0.5287 -0.6417 485 HIS A NE2   
1823 N  N     . GLY A 267 ? 1.1349 1.2191 1.5384 0.1137  -0.2975 -0.5269 486 GLY A N     
1824 C  CA    . GLY A 267 ? 1.0527 1.1482 1.4402 0.1019  -0.2666 -0.4803 486 GLY A CA    
1825 C  C     . GLY A 267 ? 0.9931 1.1986 1.3816 0.0977  -0.2107 -0.4764 486 GLY A C     
1826 O  O     . GLY A 267 ? 0.9434 1.2246 1.3490 0.1098  -0.1973 -0.5180 486 GLY A O     
1827 N  N     . LYS A 268 ? 0.9366 1.1492 1.3026 0.0786  -0.1801 -0.4264 487 LYS A N     
1828 C  CA    . LYS A 268 ? 0.8751 1.1727 1.2317 0.0704  -0.1326 -0.4143 487 LYS A CA    
1829 C  C     . LYS A 268 ? 0.9046 1.1988 1.2501 0.0676  -0.1144 -0.3810 487 LYS A C     
1830 O  O     . LYS A 268 ? 0.9012 1.1343 1.2302 0.0559  -0.1232 -0.3421 487 LYS A O     
1831 C  CB    . LYS A 268 ? 0.8734 1.1911 1.2048 0.0431  -0.1111 -0.3841 487 LYS A CB    
1832 C  CG    . LYS A 268 ? 0.8929 1.2852 1.2064 0.0351  -0.0704 -0.3709 487 LYS A CG    
1833 C  CD    . LYS A 268 ? 0.8479 1.2704 1.1407 0.0178  -0.0561 -0.3566 487 LYS A CD    
1834 C  CE    . LYS A 268 ? 0.9670 1.3473 1.2469 -0.0008 -0.0627 -0.3198 487 LYS A CE    
1835 N  NZ    . LYS A 268 ? 0.9950 1.4182 1.2577 -0.0128 -0.0485 -0.3107 487 LYS A NZ    
1836 N  N     . PHE A 269 ? 0.8334 1.1971 1.1851 0.0745  -0.0886 -0.3969 488 PHE A N     
1837 C  CA    . PHE A 269 ? 0.7950 1.1638 1.1351 0.0695  -0.0689 -0.3684 488 PHE A CA    
1838 C  C     . PHE A 269 ? 0.7844 1.2095 1.0969 0.0492  -0.0314 -0.3470 488 PHE A C     
1839 O  O     . PHE A 269 ? 0.7698 1.2616 1.0851 0.0475  -0.0175 -0.3761 488 PHE A O     
1840 C  CB    . PHE A 269 ? 0.8202 1.2196 1.1913 0.0930  -0.0768 -0.4094 488 PHE A CB    
1841 C  CG    . PHE A 269 ? 0.8247 1.2019 1.1907 0.0932  -0.0724 -0.3838 488 PHE A CG    
1842 C  CD1   . PHE A 269 ? 0.8816 1.2621 1.2785 0.1185  -0.0925 -0.4179 488 PHE A CD1   
1843 C  CD2   . PHE A 269 ? 0.8315 1.1875 1.1632 0.0710  -0.0507 -0.3298 488 PHE A CD2   
1844 C  CE1   . PHE A 269 ? 0.8911 1.2526 1.2829 0.1184  -0.0894 -0.3949 488 PHE A CE1   
1845 C  CE2   . PHE A 269 ? 0.8601 1.1967 1.1867 0.0718  -0.0476 -0.3089 488 PHE A CE2   
1846 C  CZ    . PHE A 269 ? 0.8457 1.1851 1.2013 0.0937  -0.0658 -0.3400 488 PHE A CZ    
1847 N  N     . SER A 270 ? 0.7089 1.1079 0.9923 0.0338  -0.0176 -0.2984 489 SER A N     
1848 C  CA    . SER A 270 ? 0.6839 1.1207 0.9356 0.0175  0.0103  -0.2762 489 SER A CA    
1849 C  C     . SER A 270 ? 0.7293 1.1619 0.9698 0.0141  0.0227  -0.2565 489 SER A C     
1850 O  O     . SER A 270 ? 0.7232 1.1095 0.9650 0.0188  0.0147  -0.2348 489 SER A O     
1851 C  CB    . SER A 270 ? 0.6775 1.0957 0.9044 0.0065  0.0129  -0.2433 489 SER A CB    
1852 O  OG    . SER A 270 ? 0.8183 1.2340 1.0590 0.0077  -0.0019 -0.2616 489 SER A OG    
1853 N  N     . LEU A 271 ? 0.6834 1.1661 0.9108 0.0027  0.0413  -0.2652 490 LEU A N     
1854 C  CA    . LEU A 271 ? 0.6788 1.1618 0.8949 -0.0052 0.0526  -0.2506 490 LEU A CA    
1855 C  C     . LEU A 271 ? 0.7540 1.2392 0.9212 -0.0276 0.0681  -0.2183 490 LEU A C     
1856 O  O     . LEU A 271 ? 0.7597 1.2845 0.9063 -0.0430 0.0769  -0.2263 490 LEU A O     
1857 C  CB    . LEU A 271 ? 0.6732 1.2144 0.9180 -0.0031 0.0564  -0.2937 490 LEU A CB    
1858 C  CG    . LEU A 271 ? 0.7241 1.2577 1.0179 0.0263  0.0322  -0.3319 490 LEU A CG    
1859 C  CD1   . LEU A 271 ? 0.7393 1.3208 1.0572 0.0363  0.0248  -0.3800 490 LEU A CD1   
1860 C  CD2   . LEU A 271 ? 0.7167 1.2730 1.0343 0.0338  0.0312  -0.3519 490 LEU A CD2   
1861 N  N     . VAL A 272 ? 0.6975 1.1350 0.8431 -0.0281 0.0673  -0.1818 491 VAL A N     
1862 C  CA    . VAL A 272 ? 0.7091 1.1275 0.8063 -0.0414 0.0714  -0.1491 491 VAL A CA    
1863 C  C     . VAL A 272 ? 0.7605 1.1583 0.8320 -0.0540 0.0762  -0.1293 491 VAL A C     
1864 O  O     . VAL A 272 ? 0.7456 1.1140 0.8316 -0.0425 0.0720  -0.1214 491 VAL A O     
1865 C  CB    . VAL A 272 ? 0.7460 1.1263 0.8389 -0.0257 0.0602  -0.1273 491 VAL A CB    
1866 C  CG1   . VAL A 272 ? 0.7710 1.1307 0.8165 -0.0307 0.0568  -0.0999 491 VAL A CG1   
1867 C  CG2   . VAL A 272 ? 0.7302 1.1275 0.8481 -0.0180 0.0538  -0.1459 491 VAL A CG2   
1868 N  N     . ASP A 273 ? 0.7479 1.1552 0.7744 -0.0804 0.0823  -0.1180 492 ASP A N     
1869 C  CA    . ASP A 273 ? 0.7726 1.1502 0.7590 -0.1009 0.0829  -0.0939 492 ASP A CA    
1870 C  C     . ASP A 273 ? 0.8456 1.1652 0.7882 -0.0930 0.0666  -0.0612 492 ASP A C     
1871 O  O     . ASP A 273 ? 0.8938 1.2138 0.7975 -0.1058 0.0618  -0.0521 492 ASP A O     
1872 C  CB    . ASP A 273 ? 0.8237 1.2500 0.7826 -0.1415 0.0966  -0.1033 492 ASP A CB    
1873 C  CG    . ASP A 273 ? 0.9890 1.3827 0.8940 -0.1759 0.0955  -0.0758 492 ASP A CG    
1874 O  OD1   . ASP A 273 ? 0.9930 1.3186 0.8812 -0.1633 0.0812  -0.0500 492 ASP A OD1   
1875 O  OD2   . ASP A 273 ? 1.1011 1.5406 0.9791 -0.2183 0.1082  -0.0821 492 ASP A OD2   
1876 N  N     . LEU A 274 ? 0.7878 1.0630 0.7386 -0.0690 0.0559  -0.0476 493 LEU A N     
1877 C  CA    . LEU A 274 ? 0.8080 1.0385 0.7295 -0.0511 0.0371  -0.0267 493 LEU A CA    
1878 C  C     . LEU A 274 ? 0.9486 1.1262 0.8063 -0.0674 0.0215  -0.0012 493 LEU A C     
1879 O  O     . LEU A 274 ? 0.9675 1.1361 0.8034 -0.0959 0.0268  0.0051  493 LEU A O     
1880 C  CB    . LEU A 274 ? 0.7650 0.9782 0.7182 -0.0205 0.0315  -0.0264 493 LEU A CB    
1881 C  CG    . LEU A 274 ? 0.7535 1.0009 0.7578 -0.0065 0.0390  -0.0440 493 LEU A CG    
1882 C  CD1   . LEU A 274 ? 0.7136 0.9455 0.7397 0.0097  0.0369  -0.0410 493 LEU A CD1   
1883 C  CD2   . LEU A 274 ? 0.8017 1.0670 0.8086 0.0041  0.0327  -0.0472 493 LEU A CD2   
1884 N  N     . ALA A 275 ? 0.9625 1.1038 0.7887 -0.0498 -0.0013 0.0125  494 ALA A N     
1885 C  CA    . ALA A 275 ? 1.0378 1.1077 0.7990 -0.0563 -0.0282 0.0377  494 ALA A CA    
1886 C  C     . ALA A 275 ? 1.0984 1.1278 0.8678 -0.0417 -0.0355 0.0414  494 ALA A C     
1887 O  O     . ALA A 275 ? 1.0265 1.0808 0.8472 -0.0151 -0.0264 0.0265  494 ALA A O     
1888 C  CB    . ALA A 275 ? 1.0752 1.1206 0.8150 -0.0266 -0.0561 0.0426  494 ALA A CB    
1889 N  N     . GLY A 276 ? 1.1323 1.0983 0.8470 -0.0626 -0.0531 0.0618  495 GLY A N     
1890 C  CA    . GLY A 276 ? 1.1389 1.0575 0.8521 -0.0506 -0.0651 0.0654  495 GLY A CA    
1891 C  C     . GLY A 276 ? 1.1919 1.0927 0.9245 0.0024  -0.0862 0.0555  495 GLY A C     
1892 O  O     . GLY A 276 ? 1.2301 1.1129 0.9429 0.0261  -0.1104 0.0565  495 GLY A O     
1893 N  N     . ASN A 277 ? 1.1185 1.0329 0.8911 0.0214  -0.0774 0.0428  496 ASN A N     
1894 C  CA    . ASN A 277 ? 1.0946 1.0149 0.8932 0.0686  -0.0910 0.0270  496 ASN A CA    
1895 C  C     . ASN A 277 ? 1.2462 1.0918 1.0061 0.0917  -0.1291 0.0299  496 ASN A C     
1896 O  O     . ASN A 277 ? 1.2447 1.1017 1.0242 0.1344  -0.1441 0.0110  496 ASN A O     
1897 C  CB    . ASN A 277 ? 0.9672 0.9429 0.8234 0.0760  -0.0640 0.0115  496 ASN A CB    
1898 C  CG    . ASN A 277 ? 1.1290 1.0764 0.9829 0.0677  -0.0625 0.0137  496 ASN A CG    
1899 O  OD1   . ASN A 277 ? 1.1604 1.0608 0.9775 0.0411  -0.0699 0.0278  496 ASN A OD1   
1900 N  ND2   . ASN A 277 ? 0.9320 0.9091 0.8222 0.0866  -0.0534 0.0002  496 ASN A ND2   
1901 N  N     . GLU A 278 ? 1.2969 1.0686 1.0017 0.0626  -0.1465 0.0507  497 GLU A N     
1902 C  CA    . GLU A 278 ? 1.3764 1.0593 1.0371 0.0834  -0.1905 0.0540  497 GLU A CA    
1903 C  C     . GLU A 278 ? 1.5293 1.1766 1.1606 0.1194  -0.2313 0.0509  497 GLU A C     
1904 O  O     . GLU A 278 ? 1.5963 1.2218 1.1871 0.0979  -0.2409 0.0695  497 GLU A O     
1905 C  CB    . GLU A 278 ? 1.4578 1.0659 1.0619 0.0351  -0.2008 0.0795  497 GLU A CB    
1906 C  CG    . GLU A 278 ? 1.6217 1.1890 1.1608 -0.0116 -0.2110 0.1089  497 GLU A CG    
1907 C  CD    . GLU A 278 ? 1.7309 1.3831 1.2942 -0.0498 -0.1666 0.1110  497 GLU A CD    
1908 O  OE1   . GLU A 278 ? 1.5232 1.2586 1.1540 -0.0435 -0.1284 0.0912  497 GLU A OE1   
1909 O  OE2   . GLU A 278 ? 1.7053 1.3385 1.2165 -0.0862 -0.1731 0.1315  497 GLU A OE2   
1910 N  N     . ARG A 279 ? 1.4816 1.1402 1.1403 0.1766  -0.2526 0.0223  498 ARG A N     
1911 C  CA    . ARG A 279 ? 1.9463 1.5878 1.5923 0.2253  -0.2949 0.0063  498 ARG A CA    
1912 C  C     . ARG A 279 ? 2.3814 2.0670 2.0298 0.2189  -0.2864 0.0116  498 ARG A C     
1913 O  O     . ARG A 279 ? 1.8910 1.6736 1.5974 0.2327  -0.2576 -0.0087 498 ARG A O     
1914 C  CB    . ARG A 279 ? 2.0873 1.5993 1.6590 0.2363  -0.3565 0.0186  498 ARG A CB    
1915 N  N     . ARG A 291 ? 3.2801 1.9088 2.1555 0.2775  -0.8964 0.2245  510 ARG A N     
1916 C  CA    . ARG A 291 ? 3.2192 1.8871 2.1313 0.3038  -0.8822 0.1770  510 ARG A CA    
1917 C  C     . ARG A 291 ? 3.1472 1.9568 2.1029 0.2469  -0.7944 0.1898  510 ARG A C     
1918 O  O     . ARG A 291 ? 3.1731 1.9815 2.0824 0.2218  -0.8012 0.2134  510 ARG A O     
1919 C  CB    . ARG A 291 ? 3.1698 1.9147 2.1733 0.4079  -0.9025 0.1087  510 ARG A CB    
1920 N  N     . MET A 292 ? 2.9700 1.8974 2.0127 0.2283  -0.7160 0.1725  511 MET A N     
1921 C  CA    . MET A 292 ? 2.8398 1.9028 1.9350 0.1800  -0.6330 0.1770  511 MET A CA    
1922 C  C     . MET A 292 ? 2.7111 1.9293 1.9270 0.2333  -0.5881 0.1255  511 MET A C     
1923 O  O     . MET A 292 ? 2.7013 1.9339 1.9607 0.3061  -0.6190 0.0849  511 MET A O     
1924 C  CB    . MET A 292 ? 2.8411 1.9114 1.9295 0.1047  -0.5807 0.2030  511 MET A CB    
1925 C  CG    . MET A 292 ? 2.8265 1.9248 1.9828 0.1303  -0.5589 0.1750  511 MET A CG    
1926 S  SD    . MET A 292 ? 2.8324 1.9645 1.9975 0.0485  -0.4938 0.1971  511 MET A SD    
1927 C  CE    . MET A 292 ? 2.9822 1.9297 2.0215 0.0032  -0.5587 0.2417  511 MET A CE    
1928 N  N     . GLU A 293 ? 2.5252 1.8596 1.7921 0.1945  -0.5176 0.1257  512 GLU A N     
1929 C  CA    . GLU A 293 ? 2.3702 1.8467 1.7413 0.2272  -0.4714 0.0852  512 GLU A CA    
1930 C  C     . GLU A 293 ? 2.2754 1.8315 1.7119 0.1962  -0.4031 0.0789  512 GLU A C     
1931 O  O     . GLU A 293 ? 2.2780 1.8275 1.6896 0.1351  -0.3713 0.1061  512 GLU A O     
1932 C  CB    . GLU A 293 ? 2.3644 1.9007 1.7354 0.2171  -0.4605 0.0872  512 GLU A CB    
1933 C  CG    . GLU A 293 ? 2.3123 1.9931 1.7805 0.2277  -0.4054 0.0545  512 GLU A CG    
1934 C  CD    . GLU A 293 ? 2.4071 2.1521 1.9083 0.1718  -0.3384 0.0641  512 GLU A CD    
1935 O  OE1   . GLU A 293 ? 2.4157 2.1435 1.8684 0.1189  -0.3256 0.0920  512 GLU A OE1   
1936 O  OE2   . GLU A 293 ? 2.1621 1.9739 1.7350 0.1807  -0.3013 0.0425  512 GLU A OE2   
1937 N  N     . GLY A 294 ? 2.0931 1.7308 1.6121 0.2380  -0.3825 0.0409  513 GLY A N     
1938 C  CA    . GLY A 294 ? 1.9500 1.6667 1.5357 0.2195  -0.3245 0.0301  513 GLY A CA    
1939 C  C     . GLY A 294 ? 1.8376 1.6631 1.5065 0.2602  -0.3039 -0.0099 513 GLY A C     
1940 O  O     . GLY A 294 ? 1.7475 1.6321 1.4696 0.2535  -0.2651 -0.0217 513 GLY A O     
1941 N  N     . ALA A 295 ? 1.7707 1.6233 1.4478 0.3010  -0.3327 -0.0311 514 ALA A N     
1942 C  CA    . ALA A 295 ? 1.6741 1.6382 1.4255 0.3367  -0.3178 -0.0714 514 ALA A CA    
1943 C  C     . ALA A 295 ? 1.5804 1.6304 1.3715 0.3002  -0.2683 -0.0684 514 ALA A C     
1944 O  O     . ALA A 295 ? 1.4851 1.6224 1.3383 0.3007  -0.2347 -0.0892 514 ALA A O     
1945 C  CB    . ALA A 295 ? 1.7433 1.7058 1.4867 0.3928  -0.3709 -0.0977 514 ALA A CB    
1946 N  N     . GLU A 296 ? 1.5187 1.5430 1.2710 0.2668  -0.2659 -0.0432 515 GLU A N     
1947 C  CA    . GLU A 296 ? 1.4262 1.5215 1.2106 0.2314  -0.2231 -0.0414 515 GLU A CA    
1948 C  C     . GLU A 296 ? 1.3485 1.4597 1.1603 0.1946  -0.1776 -0.0325 515 GLU A C     
1949 O  O     . GLU A 296 ? 1.2602 1.4446 1.1273 0.1855  -0.1443 -0.0467 515 GLU A O     
1950 C  CB    . GLU A 296 ? 1.4956 1.5535 1.2234 0.2034  -0.2338 -0.0177 515 GLU A CB    
1951 C  CG    . GLU A 296 ? 1.6006 1.7370 1.3606 0.1926  -0.2127 -0.0302 515 GLU A CG    
1952 C  CD    . GLU A 296 ? 2.0204 2.1702 1.7714 0.2295  -0.2511 -0.0455 515 GLU A CD    
1953 O  OE1   . GLU A 296 ? 1.9883 2.0880 1.6774 0.2212  -0.2783 -0.0269 515 GLU A OE1   
1954 O  OE2   . GLU A 296 ? 1.9921 2.2068 1.7964 0.2651  -0.2549 -0.0771 515 GLU A OE2   
1955 N  N     . ILE A 297 ? 1.2903 1.3302 1.0613 0.1730  -0.1802 -0.0096 516 ILE A N     
1956 C  CA    . ILE A 297 ? 1.2106 1.2624 1.0051 0.1419  -0.1431 -0.0033 516 ILE A CA    
1957 C  C     . ILE A 297 ? 1.1657 1.2627 1.0158 0.1647  -0.1290 -0.0243 516 ILE A C     
1958 O  O     . ILE A 297 ? 1.0814 1.2325 0.9754 0.1478  -0.0956 -0.0307 516 ILE A O     
1959 C  CB    . ILE A 297 ? 1.3000 1.2716 1.0395 0.1143  -0.1519 0.0225  516 ILE A CB    
1960 C  CG1   . ILE A 297 ? 1.3496 1.2947 1.0339 0.0752  -0.1549 0.0449  516 ILE A CG1   
1961 C  CG2   . ILE A 297 ? 1.2504 1.2404 1.0231 0.0934  -0.1186 0.0217  516 ILE A CG2   
1962 C  CD1   . ILE A 297 ? 1.5607 1.4127 1.1700 0.0503  -0.1810 0.0732  516 ILE A CD1   
1963 N  N     . ASN A 298 ? 1.1367 1.2114 0.9819 0.2032  -0.1576 -0.0367 517 ASN A N     
1964 C  CA    . ASN A 298 ? 1.0871 1.2100 0.9788 0.2235  -0.1455 -0.0585 517 ASN A CA    
1965 C  C     . ASN A 298 ? 1.0489 1.2711 0.9957 0.2269  -0.1232 -0.0802 517 ASN A C     
1966 O  O     . ASN A 298 ? 0.9966 1.2631 0.9789 0.2134  -0.0954 -0.0852 517 ASN A O     
1967 C  CB    . ASN A 298 ? 1.1501 1.2343 1.0250 0.2669  -0.1837 -0.0738 517 ASN A CB    
1968 C  CG    . ASN A 298 ? 1.4830 1.6168 1.3992 0.2829  -0.1693 -0.0962 517 ASN A CG    
1969 O  OD1   . ASN A 298 ? 1.4030 1.6075 1.3537 0.3146  -0.1745 -0.1281 517 ASN A OD1   
1970 N  ND2   . ASN A 298 ? 1.3685 1.4764 1.2829 0.2586  -0.1496 -0.0820 517 ASN A ND2   
1971 N  N     . LYS A 299 ? 1.0082 1.2626 0.9581 0.2406  -0.1366 -0.0912 518 LYS A N     
1972 C  CA    . LYS A 299 ? 0.9505 1.3010 0.9501 0.2373  -0.1167 -0.1115 518 LYS A CA    
1973 C  C     . LYS A 299 ? 0.9184 1.2846 0.9331 0.1924  -0.0823 -0.0961 518 LYS A C     
1974 O  O     . LYS A 299 ? 0.8637 1.2876 0.9164 0.1757  -0.0590 -0.1043 518 LYS A O     
1975 C  CB    . LYS A 299 ? 1.0089 1.3954 1.0109 0.2667  -0.1434 -0.1319 518 LYS A CB    
1976 C  CG    . LYS A 299 ? 1.2048 1.5468 1.1677 0.2570  -0.1584 -0.1143 518 LYS A CG    
1977 C  CD    . LYS A 299 ? 1.3232 1.7142 1.2967 0.2888  -0.1848 -0.1391 518 LYS A CD    
1978 C  CE    . LYS A 299 ? 1.1837 1.6628 1.2009 0.2672  -0.1587 -0.1520 518 LYS A CE    
1979 N  NZ    . LYS A 299 ? 1.1019 1.5602 1.0920 0.2492  -0.1630 -0.1378 518 LYS A NZ    
1980 N  N     . SER A 300 ? 0.8766 1.1893 0.8584 0.1715  -0.0818 -0.0750 519 SER A N     
1981 C  CA    . SER A 300 ? 0.8368 1.1572 0.8304 0.1340  -0.0541 -0.0652 519 SER A CA    
1982 C  C     . SER A 300 ? 0.8606 1.1790 0.8765 0.1182  -0.0318 -0.0611 519 SER A C     
1983 O  O     . SER A 300 ? 0.8184 1.1715 0.8661 0.0998  -0.0130 -0.0655 519 SER A O     
1984 C  CB    . SER A 300 ? 0.8854 1.1539 0.8339 0.1167  -0.0600 -0.0473 519 SER A CB    
1985 O  OG    . SER A 300 ? 1.0471 1.3335 1.0112 0.0859  -0.0355 -0.0463 519 SER A OG    
1986 N  N     . LEU A 301 ? 0.8311 1.1041 0.8273 0.1259  -0.0383 -0.0526 520 LEU A N     
1987 C  CA    . LEU A 301 ? 0.7870 1.0531 0.7988 0.1143  -0.0219 -0.0486 520 LEU A CA    
1988 C  C     . LEU A 301 ? 0.7729 1.0908 0.8177 0.1225  -0.0144 -0.0619 520 LEU A C     
1989 O  O     . LEU A 301 ? 0.7298 1.0640 0.7958 0.1019  0.0030  -0.0593 520 LEU A O     
1990 C  CB    . LEU A 301 ? 0.8142 1.0185 0.7933 0.1185  -0.0331 -0.0372 520 LEU A CB    
1991 C  CG    . LEU A 301 ? 0.8834 1.0437 0.8257 0.0956  -0.0356 -0.0212 520 LEU A CG    
1992 C  CD1   . LEU A 301 ? 0.9348 1.0310 0.8381 0.0945  -0.0509 -0.0084 520 LEU A CD1   
1993 C  CD2   . LEU A 301 ? 0.8247 1.0081 0.7883 0.0661  -0.0105 -0.0211 520 LEU A CD2   
1994 N  N     . LEU A 302 ? 0.7332 1.0824 0.7815 0.1505  -0.0294 -0.0782 521 LEU A N     
1995 C  CA    . LEU A 302 ? 0.7143 1.1336 0.7934 0.1541  -0.0208 -0.0956 521 LEU A CA    
1996 C  C     . LEU A 302 ? 0.7190 1.1904 0.8238 0.1256  -0.0040 -0.0971 521 LEU A C     
1997 O  O     . LEU A 302 ? 0.7187 1.2214 0.8400 0.1030  0.0115  -0.0958 521 LEU A O     
1998 C  CB    . LEU A 302 ? 0.7507 1.2055 0.8321 0.1943  -0.0432 -0.1213 521 LEU A CB    
1999 C  CG    . LEU A 302 ? 0.8689 1.3083 0.9427 0.2202  -0.0543 -0.1317 521 LEU A CG    
2000 C  CD1   . LEU A 302 ? 0.9319 1.2714 0.9686 0.2177  -0.0638 -0.1084 521 LEU A CD1   
2001 C  CD2   . LEU A 302 ? 0.9226 1.3974 1.0015 0.2660  -0.0820 -0.1640 521 LEU A CD2   
2002 N  N     . ALA A 303 ? 0.6444 1.1186 0.7476 0.1232  -0.0093 -0.0980 522 ALA A N     
2003 C  CA    . ALA A 303 ? 0.6143 1.1289 0.7391 0.0959  0.0023  -0.1005 522 ALA A CA    
2004 C  C     . ALA A 303 ? 0.6737 1.1509 0.8009 0.0636  0.0170  -0.0838 522 ALA A C     
2005 O  O     . ALA A 303 ? 0.6525 1.1544 0.7957 0.0376  0.0262  -0.0828 522 ALA A O     
2006 C  CB    . ALA A 303 ? 0.6302 1.1463 0.7477 0.1035  -0.0093 -0.1054 522 ALA A CB    
2007 N  N     . LEU A 304 ? 0.6533 1.0716 0.7625 0.0646  0.0164  -0.0721 523 LEU A N     
2008 C  CA    . LEU A 304 ? 0.6558 1.0417 0.7704 0.0426  0.0255  -0.0632 523 LEU A CA    
2009 C  C     . LEU A 304 ? 0.7158 1.1011 0.8380 0.0320  0.0312  -0.0570 523 LEU A C     
2010 O  O     . LEU A 304 ? 0.7212 1.0999 0.8537 0.0091  0.0335  -0.0532 523 LEU A O     
2011 C  CB    . LEU A 304 ? 0.6646 1.0040 0.7598 0.0469  0.0245  -0.0568 523 LEU A CB    
2012 C  CG    . LEU A 304 ? 0.7193 1.0339 0.8247 0.0309  0.0311  -0.0554 523 LEU A CG    
2013 C  CD1   . LEU A 304 ? 0.7238 1.0514 0.8483 0.0161  0.0312  -0.0654 523 LEU A CD1   
2014 C  CD2   . LEU A 304 ? 0.7442 1.0318 0.8316 0.0318  0.0323  -0.0528 523 LEU A CD2   
2015 N  N     . LYS A 305 ? 0.6712 1.0587 0.7845 0.0487  0.0299  -0.0565 524 LYS A N     
2016 C  CA    . LYS A 305 ? 0.6667 1.0601 0.7821 0.0392  0.0352  -0.0514 524 LYS A CA    
2017 C  C     . LYS A 305 ? 0.7077 1.1508 0.8349 0.0147  0.0404  -0.0534 524 LYS A C     
2018 O  O     . LYS A 305 ? 0.6947 1.1217 0.8196 -0.0116 0.0425  -0.0415 524 LYS A O     
2019 C  CB    . LYS A 305 ? 0.7030 1.1028 0.8084 0.0648  0.0312  -0.0575 524 LYS A CB    
2020 C  CG    . LYS A 305 ? 0.7522 1.1676 0.8570 0.0544  0.0375  -0.0545 524 LYS A CG    
2021 C  CD    . LYS A 305 ? 0.8369 1.2270 0.9286 0.0784  0.0319  -0.0574 524 LYS A CD    
2022 C  CE    . LYS A 305 ? 0.8954 1.3129 0.9852 0.1130  0.0202  -0.0781 524 LYS A CE    
2023 N  NZ    . LYS A 305 ? 1.0313 1.5320 1.1350 0.1145  0.0255  -0.0976 524 LYS A NZ    
2024 N  N     . GLU A 306 ? 0.6669 1.1691 0.8041 0.0210  0.0399  -0.0685 525 GLU A N     
2025 C  CA    . GLU A 306 ? 0.6810 1.2436 0.8296 -0.0089 0.0462  -0.0726 525 GLU A CA    
2026 C  C     . GLU A 306 ? 0.7658 1.2999 0.9165 -0.0430 0.0448  -0.0611 525 GLU A C     
2027 O  O     . GLU A 306 ? 0.7785 1.3247 0.9252 -0.0801 0.0473  -0.0519 525 GLU A O     
2028 C  CB    . GLU A 306 ? 0.6956 1.3369 0.8596 0.0078  0.0444  -0.0968 525 GLU A CB    
2029 C  CG    . GLU A 306 ? 0.8676 1.5542 1.0334 0.0388  0.0425  -0.1157 525 GLU A CG    
2030 C  CD    . GLU A 306 ? 1.2506 1.9588 1.4098 0.0187  0.0536  -0.1106 525 GLU A CD    
2031 O  OE1   . GLU A 306 ? 1.1942 1.9373 1.3534 -0.0261 0.0642  -0.1024 525 GLU A OE1   
2032 O  OE2   . GLU A 306 ? 1.2416 1.9268 1.3911 0.0445  0.0498  -0.1133 525 GLU A OE2   
2033 N  N     . CYS A 307 ? 0.7191 1.2132 0.8722 -0.0326 0.0386  -0.0622 526 CYS A N     
2034 C  CA    . CYS A 307 ? 0.7255 1.1880 0.8827 -0.0582 0.0329  -0.0579 526 CYS A CA    
2035 C  C     . CYS A 307 ? 0.7953 1.1949 0.9431 -0.0718 0.0270  -0.0432 526 CYS A C     
2036 O  O     . CYS A 307 ? 0.8155 1.1938 0.9602 -0.1028 0.0182  -0.0356 526 CYS A O     
2037 C  CB    . CYS A 307 ? 0.7226 1.1728 0.8854 -0.0414 0.0285  -0.0688 526 CYS A CB    
2038 S  SG    . CYS A 307 ? 0.7729 1.2930 0.9450 -0.0298 0.0280  -0.0861 526 CYS A SG    
2039 N  N     . ILE A 308 ? 0.7515 1.1178 0.8930 -0.0495 0.0281  -0.0397 527 ILE A N     
2040 C  CA    . ILE A 308 ? 0.7600 1.0718 0.8945 -0.0573 0.0200  -0.0289 527 ILE A CA    
2041 C  C     . ILE A 308 ? 0.8530 1.1738 0.9721 -0.0844 0.0195  -0.0135 527 ILE A C     
2042 O  O     . ILE A 308 ? 0.8715 1.1513 0.9799 -0.1104 0.0055  -0.0015 527 ILE A O     
2043 C  CB    . ILE A 308 ? 0.7798 1.0670 0.9120 -0.0305 0.0229  -0.0305 527 ILE A CB    
2044 C  CG1   . ILE A 308 ? 0.7608 1.0378 0.9022 -0.0153 0.0226  -0.0440 527 ILE A CG1   
2045 C  CG2   . ILE A 308 ? 0.8064 1.0476 0.9323 -0.0370 0.0131  -0.0208 527 ILE A CG2   
2046 C  CD1   . ILE A 308 ? 0.7009 0.9698 0.8346 0.0044  0.0285  -0.0451 527 ILE A CD1   
2047 N  N     . ARG A 309 ? 0.8277 1.2032 0.9430 -0.0793 0.0321  -0.0154 528 ARG A N     
2048 C  CA    . ARG A 309 ? 0.8585 1.2614 0.9571 -0.1089 0.0354  -0.0040 528 ARG A CA    
2049 C  C     . ARG A 309 ? 0.9568 1.3708 1.0484 -0.1546 0.0303  0.0045  528 ARG A C     
2050 O  O     . ARG A 309 ? 1.0020 1.3903 1.0687 -0.1902 0.0223  0.0240  528 ARG A O     
2051 C  CB    . ARG A 309 ? 0.8411 1.3203 0.9432 -0.0928 0.0496  -0.0179 528 ARG A CB    
2052 C  CG    . ARG A 309 ? 0.8459 1.3044 0.9444 -0.0569 0.0505  -0.0217 528 ARG A CG    
2053 C  CD    . ARG A 309 ? 1.0075 1.5395 1.1117 -0.0349 0.0584  -0.0425 528 ARG A CD    
2054 N  NE    . ARG A 309 ? 1.1772 1.7742 1.2723 -0.0656 0.0675  -0.0429 528 ARG A NE    
2055 C  CZ    . ARG A 309 ? 1.4495 2.0606 1.5302 -0.0652 0.0712  -0.0428 528 ARG A CZ    
2056 N  NH1   . ARG A 309 ? 1.3913 1.9526 1.4677 -0.0330 0.0654  -0.0431 528 ARG A NH1   
2057 N  NH2   . ARG A 309 ? 1.2923 1.9725 1.3611 -0.1000 0.0811  -0.0435 528 ARG A NH2   
2058 N  N     . ALA A 310 ? 0.9192 1.3663 1.0285 -0.1563 0.0323  -0.0086 529 ALA A N     
2059 C  CA    . ALA A 310 ? 0.9472 1.4097 1.0515 -0.2026 0.0270  -0.0031 529 ALA A CA    
2060 C  C     . ALA A 310 ? 1.0615 1.4315 1.1522 -0.2237 0.0033  0.0116  529 ALA A C     
2061 O  O     . ALA A 310 ? 1.1121 1.4625 1.1777 -0.2720 -0.0078 0.0299  529 ALA A O     
2062 C  CB    . ALA A 310 ? 0.9250 1.4502 1.0542 -0.1934 0.0341  -0.0245 529 ALA A CB    
2063 N  N     . LEU A 311 ? 1.0331 1.3460 1.1370 -0.1894 -0.0071 0.0028  530 LEU A N     
2064 C  CA    . LEU A 311 ? 1.0878 1.3117 1.1839 -0.1963 -0.0346 0.0082  530 LEU A CA    
2065 C  C     . LEU A 311 ? 1.2288 1.4038 1.2933 -0.2172 -0.0481 0.0323  530 LEU A C     
2066 O  O     . LEU A 311 ? 1.2695 1.3842 1.3093 -0.2522 -0.0741 0.0480  530 LEU A O     
2067 C  CB    . LEU A 311 ? 1.0574 1.2545 1.1766 -0.1493 -0.0369 -0.0120 530 LEU A CB    
2068 C  CG    . LEU A 311 ? 1.1578 1.2731 1.2767 -0.1391 -0.0654 -0.0162 530 LEU A CG    
2069 C  CD1   . LEU A 311 ? 1.2247 1.2981 1.3429 -0.1591 -0.0911 -0.0222 530 LEU A CD1   
2070 C  CD2   . LEU A 311 ? 1.1208 1.2410 1.2648 -0.0958 -0.0592 -0.0400 530 LEU A CD2   
2071 N  N     . GLY A 312 ? 1.2319 1.4297 1.2934 -0.1974 -0.0332 0.0357  531 GLY A N     
2072 C  CA    . GLY A 312 ? 1.2922 1.4521 1.3226 -0.2128 -0.0437 0.0573  531 GLY A CA    
2073 C  C     . GLY A 312 ? 1.4634 1.6281 1.4558 -0.2727 -0.0502 0.0819  531 GLY A C     
2074 O  O     . GLY A 312 ? 1.5555 1.6443 1.5128 -0.3001 -0.0784 0.1043  531 GLY A O     
2075 N  N     . GLN A 313 ? 1.4158 1.6708 1.4136 -0.2952 -0.0266 0.0766  532 GLN A N     
2076 C  CA    . GLN A 313 ? 1.4713 1.7610 1.4356 -0.3601 -0.0252 0.0956  532 GLN A CA    
2077 C  C     . GLN A 313 ? 1.6020 1.8595 1.5593 -0.4010 -0.0437 0.1013  532 GLN A C     
2078 O  O     . GLN A 313 ? 1.6458 1.9473 1.5792 -0.4604 -0.0391 0.1139  532 GLN A O     
2079 C  CB    . GLN A 313 ? 1.4388 1.8595 1.4184 -0.3615 0.0096  0.0787  532 GLN A CB    
2080 C  CG    . GLN A 313 ? 1.5477 2.0027 1.5366 -0.3175 0.0258  0.0673  532 GLN A CG    
2081 N  N     . ASN A 314 ? 1.5817 1.7681 1.5592 -0.3722 -0.0649 0.0898  533 ASN A N     
2082 C  CA    . ASN A 314 ? 1.6409 1.7869 1.6152 -0.4028 -0.0869 0.0898  533 ASN A CA    
2083 C  C     . ASN A 314 ? 1.7180 1.9670 1.7015 -0.4415 -0.0637 0.0825  533 ASN A C     
2084 O  O     . ASN A 314 ? 1.7897 2.0244 1.7447 -0.5040 -0.0779 0.0990  533 ASN A O     
2085 C  CB    . ASN A 314 ? 1.7780 1.8073 1.7008 -0.4464 -0.1300 0.1202  533 ASN A CB    
2086 C  CG    . ASN A 314 ? 2.2346 2.1699 2.1606 -0.4437 -0.1691 0.1116  533 ASN A CG    
2087 O  OD1   . ASN A 314 ? 2.1495 2.0492 2.1089 -0.3871 -0.1797 0.0859  533 ASN A OD1   
2088 N  ND2   . ASN A 314 ? 2.2145 2.1060 2.1030 -0.5079 -0.1940 0.1317  533 ASN A ND2   
2089 N  N     . LYS A 315 ? 1.6121 1.9649 1.6338 -0.4051 -0.0308 0.0572  534 LYS A N     
2090 C  CA    . LYS A 315 ? 1.5923 2.0591 1.6322 -0.4289 -0.0088 0.0416  534 LYS A CA    
2091 C  C     . LYS A 315 ? 1.6460 2.1058 1.7095 -0.4267 -0.0186 0.0246  534 LYS A C     
2092 O  O     . LYS A 315 ? 1.6295 2.0307 1.7111 -0.3824 -0.0305 0.0125  534 LYS A O     
2093 C  CB    . LYS A 315 ? 1.5425 2.1125 1.6135 -0.3824 0.0211  0.0169  534 LYS A CB    
2094 C  CG    . LYS A 315 ? 1.7555 2.3678 1.8062 -0.3925 0.0353  0.0261  534 LYS A CG    
2095 C  CD    . LYS A 315 ? 1.8174 2.4963 1.8987 -0.3306 0.0545  -0.0007 534 LYS A CD    
2096 C  CE    . LYS A 315 ? 1.8795 2.6986 1.9822 -0.3361 0.0756  -0.0282 534 LYS A CE    
2097 N  NZ    . LYS A 315 ? 1.8930 2.7613 2.0131 -0.2798 0.0869  -0.0511 534 LYS A NZ    
2098 N  N     . ALA A 316 ? 1.6141 2.1455 1.6793 -0.4749 -0.0119 0.0201  535 ALA A N     
2099 C  CA    . ALA A 316 ? 1.6130 2.1482 1.6998 -0.4795 -0.0211 0.0027  535 ALA A CA    
2100 C  C     . ALA A 316 ? 1.5760 2.1836 1.7088 -0.4172 -0.0035 -0.0313 535 ALA A C     
2101 O  O     . ALA A 316 ? 1.5749 2.1638 1.7264 -0.4002 -0.0137 -0.0474 535 ALA A O     
2102 C  CB    . ALA A 316 ? 1.6733 2.2683 1.7458 -0.5564 -0.0195 0.0089  535 ALA A CB    
2103 N  N     . HIS A 317 ? 1.4513 2.1383 1.5987 -0.3840 0.0195  -0.0427 536 HIS A N     
2104 C  CA    . HIS A 317 ? 1.3689 2.1182 1.5513 -0.3256 0.0305  -0.0723 536 HIS A CA    
2105 C  C     . HIS A 317 ? 1.3108 2.0472 1.4933 -0.2724 0.0385  -0.0728 536 HIS A C     
2106 O  O     . HIS A 317 ? 1.3337 2.0701 1.4984 -0.2840 0.0450  -0.0591 536 HIS A O     
2107 C  CB    . HIS A 317 ? 1.3696 2.2542 1.5752 -0.3410 0.0452  -0.0966 536 HIS A CB    
2108 C  CG    . HIS A 317 ? 1.4661 2.3767 1.6672 -0.4084 0.0402  -0.0934 536 HIS A CG    
2109 N  ND1   . HIS A 317 ? 1.5471 2.4638 1.7178 -0.4785 0.0422  -0.0709 536 HIS A ND1   
2110 C  CD2   . HIS A 317 ? 1.5054 2.4293 1.7235 -0.4189 0.0312  -0.1081 536 HIS A CD2   
2111 C  CE1   . HIS A 317 ? 1.5866 2.5198 1.7564 -0.5319 0.0342  -0.0720 536 HIS A CE1   
2112 N  NE2   . HIS A 317 ? 1.5625 2.5021 1.7631 -0.4967 0.0276  -0.0957 536 HIS A NE2   
2113 N  N     . THR A 318 ? 1.1497 1.8687 1.3471 -0.2181 0.0360  -0.0868 537 THR A N     
2114 C  CA    . THR A 318 ? 1.0676 1.7717 1.2637 -0.1677 0.0405  -0.0889 537 THR A CA    
2115 C  C     . THR A 318 ? 0.9595 1.7147 1.1749 -0.1244 0.0396  -0.1138 537 THR A C     
2116 O  O     . THR A 318 ? 0.9362 1.7121 1.1638 -0.1294 0.0339  -0.1257 537 THR A O     
2117 C  CB    . THR A 318 ? 1.2077 1.8075 1.3891 -0.1520 0.0320  -0.0727 537 THR A CB    
2118 O  OG1   . THR A 318 ? 1.2679 1.8454 1.4571 -0.1165 0.0272  -0.0841 537 THR A OG1   
2119 C  CG2   . THR A 318 ? 1.2396 1.7694 1.4062 -0.1925 0.0187  -0.0548 537 THR A CG2   
2120 N  N     . PRO A 319 ? 0.7916 1.5593 1.0064 -0.0809 0.0409  -0.1218 538 PRO A N     
2121 C  CA    . PRO A 319 ? 0.7380 1.5418 0.9633 -0.0383 0.0321  -0.1436 538 PRO A CA    
2122 C  C     . PRO A 319 ? 0.7455 1.4771 0.9572 -0.0145 0.0217  -0.1371 538 PRO A C     
2123 O  O     . PRO A 319 ? 0.7276 1.4390 0.9270 0.0249  0.0125  -0.1401 538 PRO A O     
2124 C  CB    . PRO A 319 ? 0.7462 1.5787 0.9704 -0.0044 0.0320  -0.1540 538 PRO A CB    
2125 C  CG    . PRO A 319 ? 0.8010 1.5676 1.0061 -0.0157 0.0392  -0.1302 538 PRO A CG    
2126 C  CD    . PRO A 319 ? 0.7717 1.5186 0.9733 -0.0686 0.0461  -0.1122 538 PRO A CD    
2127 N  N     . PHE A 320 ? 0.6671 1.3621 0.8784 -0.0398 0.0208  -0.1302 539 PHE A N     
2128 C  CA    A PHE A 320 ? 0.6550 1.2958 0.8546 -0.0254 0.0138  -0.1282 539 PHE A CA    
2129 C  CA    B PHE A 320 ? 0.6611 1.3009 0.8601 -0.0242 0.0139  -0.1278 539 PHE A CA    
2130 C  C     . PHE A 320 ? 0.7174 1.3807 0.9103 0.0076  0.0029  -0.1407 539 PHE A C     
2131 O  O     . PHE A 320 ? 0.7201 1.3388 0.8916 0.0243  -0.0023 -0.1351 539 PHE A O     
2132 C  CB    A PHE A 320 ? 0.6744 1.2964 0.8822 -0.0572 0.0113  -0.1300 539 PHE A CB    
2133 C  CB    B PHE A 320 ? 0.6862 1.3027 0.8922 -0.0548 0.0116  -0.1288 539 PHE A CB    
2134 C  CG    A PHE A 320 ? 0.6863 1.3651 0.9098 -0.0695 0.0060  -0.1472 539 PHE A CG    
2135 C  CG    B PHE A 320 ? 0.7145 1.3017 0.9226 -0.0915 0.0129  -0.1168 539 PHE A CG    
2136 C  CD1   A PHE A 320 ? 0.7074 1.3860 0.9282 -0.0546 -0.0020 -0.1593 539 PHE A CD1   
2137 C  CD1   B PHE A 320 ? 0.7512 1.2693 0.9492 -0.0911 0.0111  -0.1046 539 PHE A CD1   
2138 C  CD2   A PHE A 320 ? 0.7099 1.4488 0.9493 -0.0994 0.0094  -0.1523 539 PHE A CD2   
2139 C  CD2   B PHE A 320 ? 0.7576 1.3828 0.9751 -0.1297 0.0121  -0.1184 539 PHE A CD2   
2140 C  CE1   A PHE A 320 ? 0.7153 1.4473 0.9513 -0.0657 -0.0083 -0.1767 539 PHE A CE1   
2141 C  CE1   B PHE A 320 ? 0.7842 1.2621 0.9786 -0.1235 0.0041  -0.0931 539 PHE A CE1   
2142 C  CE2   A PHE A 320 ? 0.7438 1.5412 1.0000 -0.1134 0.0044  -0.1704 539 PHE A CE2   
2143 C  CE2   B PHE A 320 ? 0.8213 1.4038 1.0301 -0.1694 0.0070  -0.1031 539 PHE A CE2   
2144 C  CZ    A PHE A 320 ? 0.7181 1.5095 0.9736 -0.0943 -0.0052 -0.1828 539 PHE A CZ    
2145 C  CZ    B PHE A 320 ? 0.8010 1.3044 0.9972 -0.1636 0.0005  -0.0904 539 PHE A CZ    
2146 N  N     . ARG A 321 ? 0.6883 1.4227 0.8975 0.0132  -0.0023 -0.1584 540 ARG A N     
2147 C  CA    . ARG A 321 ? 0.6882 1.4500 0.8928 0.0435  -0.0187 -0.1735 540 ARG A CA    
2148 C  C     . ARG A 321 ? 0.7422 1.4812 0.9240 0.0874  -0.0340 -0.1726 540 ARG A C     
2149 O  O     . ARG A 321 ? 0.7554 1.4863 0.9187 0.1134  -0.0538 -0.1777 540 ARG A O     
2150 C  CB    . ARG A 321 ? 0.6974 1.5539 0.9337 0.0338  -0.0199 -0.1973 540 ARG A CB    
2151 C  CG    . ARG A 321 ? 0.9271 1.8194 1.1687 0.0439  -0.0344 -0.2148 540 ARG A CG    
2152 C  CD    . ARG A 321 ? 1.0195 2.0156 1.2980 0.0264  -0.0309 -0.2392 540 ARG A CD    
2153 N  NE    . ARG A 321 ? 1.0450 2.0489 1.3368 -0.0268 -0.0190 -0.2354 540 ARG A NE    
2154 C  CZ    . ARG A 321 ? 1.0774 2.1551 1.3940 -0.0652 -0.0091 -0.2459 540 ARG A CZ    
2155 N  NH1   . ARG A 321 ? 0.9011 2.0651 1.2369 -0.0551 -0.0054 -0.2644 540 ARG A NH1   
2156 N  NH2   . ARG A 321 ? 0.8287 1.8979 1.1500 -0.1154 -0.0047 -0.2403 540 ARG A NH2   
2157 N  N     . GLU A 322 ? 0.6998 1.4213 0.8784 0.0947  -0.0284 -0.1653 541 GLU A N     
2158 C  CA    . GLU A 322 ? 0.7011 1.3948 0.8583 0.1353  -0.0460 -0.1661 541 GLU A CA    
2159 C  C     . GLU A 322 ? 0.7695 1.3746 0.8825 0.1464  -0.0581 -0.1453 541 GLU A C     
2160 O  O     . GLU A 322 ? 0.7943 1.3660 0.8820 0.1785  -0.0801 -0.1449 541 GLU A O     
2161 C  CB    . GLU A 322 ? 0.6904 1.4004 0.8593 0.1384  -0.0365 -0.1688 541 GLU A CB    
2162 C  CG    . GLU A 322 ? 0.6309 1.4468 0.8367 0.1371  -0.0315 -0.1970 541 GLU A CG    
2163 C  CD    . GLU A 322 ? 0.9025 1.7883 1.1247 0.1713  -0.0537 -0.2298 541 GLU A CD    
2164 O  OE1   . GLU A 322 ? 0.8299 1.6747 1.0295 0.2150  -0.0827 -0.2343 541 GLU A OE1   
2165 O  OE2   . GLU A 322 ? 0.7853 1.7644 1.0406 0.1518  -0.0447 -0.2504 541 GLU A OE2   
2166 N  N     . SER A 323 ? 0.7022 1.2704 0.8042 0.1181  -0.0453 -0.1299 542 SER A N     
2167 C  CA    . SER A 323 ? 0.7125 1.2126 0.7715 0.1190  -0.0528 -0.1119 542 SER A CA    
2168 C  C     . SER A 323 ? 0.7521 1.2536 0.8111 0.0921  -0.0417 -0.1110 542 SER A C     
2169 O  O     . SER A 323 ? 0.7208 1.2542 0.8130 0.0715  -0.0271 -0.1199 542 SER A O     
2170 C  CB    . SER A 323 ? 0.7447 1.1916 0.7896 0.1139  -0.0440 -0.0951 542 SER A CB    
2171 O  OG    . SER A 323 ? 0.8065 1.2559 0.8757 0.0861  -0.0202 -0.0920 542 SER A OG    
2172 N  N     . LYS A 324 ? 0.7477 1.2132 0.7662 0.0896  -0.0501 -0.1009 543 LYS A N     
2173 C  CA    . LYS A 324 ? 0.7385 1.2117 0.7548 0.0653  -0.0392 -0.1048 543 LYS A CA    
2174 C  C     . LYS A 324 ? 0.7690 1.2296 0.8058 0.0434  -0.0168 -0.1043 543 LYS A C     
2175 O  O     . LYS A 324 ? 0.7254 1.2074 0.7863 0.0277  -0.0076 -0.1184 543 LYS A O     
2176 C  CB    . LYS A 324 ? 0.8066 1.2495 0.7671 0.0622  -0.0522 -0.0931 543 LYS A CB    
2177 C  CG    . LYS A 324 ? 0.9631 1.4195 0.9010 0.0803  -0.0781 -0.0971 543 LYS A CG    
2178 C  CD    . LYS A 324 ? 1.0571 1.5705 1.0268 0.0714  -0.0715 -0.1187 543 LYS A CD    
2179 C  CE    . LYS A 324 ? 0.9973 1.5359 0.9549 0.0926  -0.0981 -0.1275 543 LYS A CE    
2180 N  NZ    . LYS A 324 ? 1.2362 1.8235 1.2403 0.1134  -0.1037 -0.1454 543 LYS A NZ    
2181 N  N     . LEU A 325 ? 0.7392 1.1628 0.7662 0.0446  -0.0119 -0.0906 544 LEU A N     
2182 C  CA    . LEU A 325 ? 0.7014 1.1123 0.7477 0.0289  0.0050  -0.0915 544 LEU A CA    
2183 C  C     . LEU A 325 ? 0.6955 1.1272 0.7852 0.0224  0.0113  -0.1022 544 LEU A C     
2184 O  O     . LEU A 325 ? 0.6845 1.1186 0.7929 0.0087  0.0168  -0.1141 544 LEU A O     
2185 C  CB    . LEU A 325 ? 0.7132 1.0850 0.7431 0.0342  0.0057  -0.0755 544 LEU A CB    
2186 C  CG    . LEU A 325 ? 0.7472 1.1057 0.7971 0.0218  0.0201  -0.0770 544 LEU A CG    
2187 C  CD1   . LEU A 325 ? 0.7423 1.1088 0.7877 0.0041  0.0290  -0.0876 544 LEU A CD1   
2188 C  CD2   . LEU A 325 ? 0.7929 1.1173 0.8276 0.0288  0.0186  -0.0623 544 LEU A CD2   
2189 N  N     . THR A 326 ? 0.6535 1.1011 0.7567 0.0307  0.0080  -0.0997 545 THR A N     
2190 C  CA    . THR A 326 ? 0.6372 1.1030 0.7721 0.0154  0.0129  -0.1048 545 THR A CA    
2191 C  C     . THR A 326 ? 0.7137 1.2114 0.8654 0.0018  0.0092  -0.1194 545 THR A C     
2192 O  O     . THR A 326 ? 0.7343 1.2260 0.9047 -0.0189 0.0099  -0.1237 545 THR A O     
2193 C  CB    . THR A 326 ? 0.6955 1.1801 0.8368 0.0221  0.0135  -0.0995 545 THR A CB    
2194 O  OG1   . THR A 326 ? 0.6973 1.2164 0.8321 0.0441  0.0034  -0.1067 545 THR A OG1   
2195 C  CG2   . THR A 326 ? 0.6486 1.0947 0.7792 0.0286  0.0180  -0.0865 545 THR A CG2   
2196 N  N     . GLN A 327 ? 0.6818 1.2067 0.8233 0.0131  0.0016  -0.1270 546 GLN A N     
2197 C  CA    . GLN A 327 ? 0.6907 1.2489 0.8461 0.0018  -0.0033 -0.1431 546 GLN A CA    
2198 C  C     . GLN A 327 ? 0.7575 1.2918 0.9156 -0.0116 -0.0011 -0.1530 546 GLN A C     
2199 O  O     . GLN A 327 ? 0.7808 1.3150 0.9603 -0.0297 -0.0038 -0.1639 546 GLN A O     
2200 C  CB    . GLN A 327 ? 0.7206 1.3093 0.8590 0.0218  -0.0155 -0.1487 546 GLN A CB    
2201 C  CG    . GLN A 327 ? 1.1490 1.7912 1.3089 0.0135  -0.0220 -0.1668 546 GLN A CG    
2202 C  CD    . GLN A 327 ? 1.3795 2.0525 1.5231 0.0374  -0.0387 -0.1743 546 GLN A CD    
2203 O  OE1   . GLN A 327 ? 1.2750 1.9171 1.3816 0.0573  -0.0487 -0.1641 546 GLN A OE1   
2204 N  NE2   . GLN A 327 ? 1.2775 2.0107 1.4461 0.0336  -0.0450 -0.1923 546 GLN A NE2   
2205 N  N     . VAL A 328 ? 0.7141 1.2279 0.8493 -0.0040 0.0020  -0.1510 547 VAL A N     
2206 C  CA    . VAL A 328 ? 0.7192 1.2247 0.8579 -0.0123 0.0051  -0.1671 547 VAL A CA    
2207 C  C     . VAL A 328 ? 0.8033 1.2786 0.9678 -0.0202 0.0061  -0.1720 547 VAL A C     
2208 O  O     . VAL A 328 ? 0.8551 1.3273 1.0377 -0.0266 -0.0003 -0.1936 547 VAL A O     
2209 C  CB    . VAL A 328 ? 0.7796 1.2800 0.8834 -0.0081 0.0107  -0.1616 547 VAL A CB    
2210 C  CG1   . VAL A 328 ? 0.7855 1.2883 0.8981 -0.0161 0.0179  -0.1818 547 VAL A CG1   
2211 C  CG2   . VAL A 328 ? 0.7936 1.3169 0.8664 -0.0043 0.0027  -0.1603 547 VAL A CG2   
2212 N  N     . LEU A 329 ? 0.7201 1.1704 0.8847 -0.0180 0.0099  -0.1539 548 LEU A N     
2213 C  CA    . LEU A 329 ? 0.7038 1.1190 0.8868 -0.0247 0.0061  -0.1550 548 LEU A CA    
2214 C  C     . LEU A 329 ? 0.7702 1.1752 0.9662 -0.0418 -0.0024 -0.1472 548 LEU A C     
2215 O  O     . LEU A 329 ? 0.7822 1.1483 0.9850 -0.0495 -0.0100 -0.1431 548 LEU A O     
2216 C  CB    . LEU A 329 ? 0.6853 1.0785 0.8581 -0.0161 0.0139  -0.1402 548 LEU A CB    
2217 C  CG    . LEU A 329 ? 0.7411 1.1430 0.8977 -0.0091 0.0223  -0.1465 548 LEU A CG    
2218 C  CD1   . LEU A 329 ? 0.7134 1.0939 0.8588 -0.0045 0.0288  -0.1310 548 LEU A CD1   
2219 C  CD2   . LEU A 329 ? 0.7634 1.1761 0.9372 -0.0106 0.0195  -0.1771 548 LEU A CD2   
2220 N  N     . ARG A 330 ? 0.7205 1.1618 0.9179 -0.0507 -0.0031 -0.1463 549 ARG A N     
2221 C  CA    . ARG A 330 ? 0.7398 1.1875 0.9457 -0.0758 -0.0083 -0.1387 549 ARG A CA    
2222 C  C     . ARG A 330 ? 0.8905 1.2853 1.1028 -0.0972 -0.0240 -0.1400 549 ARG A C     
2223 O  O     . ARG A 330 ? 0.9188 1.2908 1.1251 -0.1168 -0.0276 -0.1225 549 ARG A O     
2224 C  CB    . ARG A 330 ? 0.6927 1.1935 0.9059 -0.0852 -0.0103 -0.1492 549 ARG A CB    
2225 C  CG    . ARG A 330 ? 0.7518 1.2738 0.9717 -0.1175 -0.0118 -0.1408 549 ARG A CG    
2226 C  CD    . ARG A 330 ? 0.7127 1.2920 0.9444 -0.1325 -0.0149 -0.1545 549 ARG A CD    
2227 N  NE    . ARG A 330 ? 0.8774 1.4227 1.1140 -0.1657 -0.0300 -0.1599 549 ARG A NE    
2228 C  CZ    . ARG A 330 ? 1.0438 1.5878 1.2788 -0.2091 -0.0354 -0.1495 549 ARG A CZ    
2229 N  NH1   . ARG A 330 ? 1.0318 1.6257 1.2648 -0.2244 -0.0226 -0.1371 549 ARG A NH1   
2230 N  NH2   . ARG A 330 ? 0.9431 1.4410 1.1768 -0.2397 -0.0553 -0.1536 549 ARG A NH2   
2231 N  N     . ASP A 331 ? 0.9018 1.2761 1.1231 -0.0930 -0.0366 -0.1623 550 ASP A N     
2232 C  CA    . ASP A 331 ? 0.9669 1.2818 1.1943 -0.1068 -0.0611 -0.1712 550 ASP A CA    
2233 C  C     . ASP A 331 ? 1.0811 1.3386 1.3037 -0.1005 -0.0702 -0.1610 550 ASP A C     
2234 O  O     . ASP A 331 ? 1.1478 1.3451 1.3656 -0.1184 -0.0952 -0.1563 550 ASP A O     
2235 C  CB    . ASP A 331 ? 1.0102 1.3261 1.2515 -0.0929 -0.0726 -0.2064 550 ASP A CB    
2236 C  CG    . ASP A 331 ? 1.3498 1.6698 1.5980 -0.0615 -0.0676 -0.2282 550 ASP A CG    
2237 O  OD1   . ASP A 331 ? 1.3592 1.7044 1.5978 -0.0483 -0.0465 -0.2157 550 ASP A OD1   
2238 O  OD2   . ASP A 331 ? 1.5283 1.8317 1.7913 -0.0513 -0.0854 -0.2608 550 ASP A OD2   
2239 N  N     . SER A 332 ? 1.0111 1.2834 1.2316 -0.0771 -0.0532 -0.1567 551 SER A N     
2240 C  CA    . SER A 332 ? 1.0079 1.2372 1.2266 -0.0667 -0.0597 -0.1506 551 SER A CA    
2241 C  C     . SER A 332 ? 1.0614 1.2766 1.2626 -0.0834 -0.0554 -0.1181 551 SER A C     
2242 O  O     . SER A 332 ? 1.0907 1.2644 1.2872 -0.0782 -0.0649 -0.1108 551 SER A O     
2243 C  CB    . SER A 332 ? 1.0164 1.2734 1.2407 -0.0389 -0.0437 -0.1641 551 SER A CB    
2244 O  OG    . SER A 332 ? 1.0868 1.3635 1.3257 -0.0269 -0.0480 -0.1976 551 SER A OG    
2245 N  N     . PHE A 333 ? 1.0074 1.2627 1.1998 -0.1030 -0.0425 -0.1020 552 PHE A N     
2246 C  CA    . PHE A 333 ? 1.0110 1.2707 1.1869 -0.1208 -0.0356 -0.0758 552 PHE A CA    
2247 C  C     . PHE A 333 ? 1.0921 1.3317 1.2537 -0.1653 -0.0503 -0.0606 552 PHE A C     
2248 O  O     . PHE A 333 ? 1.0777 1.3357 1.2227 -0.1888 -0.0427 -0.0400 552 PHE A O     
2249 C  CB    . PHE A 333 ? 0.9978 1.3263 1.1736 -0.1091 -0.0114 -0.0725 552 PHE A CB    
2250 C  CG    . PHE A 333 ? 0.9801 1.3190 1.1587 -0.0730 -0.0001 -0.0813 552 PHE A CG    
2251 C  CD1   . PHE A 333 ? 0.9943 1.2994 1.1686 -0.0574 0.0006  -0.0770 552 PHE A CD1   
2252 C  CD2   . PHE A 333 ? 0.9986 1.3805 1.1796 -0.0581 0.0079  -0.0921 552 PHE A CD2   
2253 C  CE1   . PHE A 333 ? 0.9782 1.2930 1.1495 -0.0331 0.0107  -0.0824 552 PHE A CE1   
2254 C  CE2   . PHE A 333 ? 1.0143 1.3978 1.1871 -0.0328 0.0151  -0.0948 552 PHE A CE2   
2255 C  CZ    . PHE A 333 ? 0.9723 1.3223 1.1398 -0.0232 0.0172  -0.0896 552 PHE A CZ    
2256 N  N     . ILE A 334 ? 1.0912 1.2952 1.2569 -0.1794 -0.0724 -0.0722 553 ILE A N     
2257 C  CA    . ILE A 334 ? 1.1548 1.3239 1.3021 -0.2279 -0.0936 -0.0585 553 ILE A CA    
2258 C  C     . ILE A 334 ? 1.2715 1.3428 1.4137 -0.2274 -0.1336 -0.0671 553 ILE A C     
2259 O  O     . ILE A 334 ? 1.2464 1.3033 1.4107 -0.1895 -0.1416 -0.0958 553 ILE A O     
2260 C  CB    . ILE A 334 ? 1.1842 1.4186 1.3403 -0.2535 -0.0836 -0.0659 553 ILE A CB    
2261 C  CG1   . ILE A 334 ? 1.1497 1.3965 1.3308 -0.2256 -0.0867 -0.0975 553 ILE A CG1   
2262 C  CG2   . ILE A 334 ? 1.1614 1.4920 1.3205 -0.2569 -0.0517 -0.0588 553 ILE A CG2   
2263 C  CD1   . ILE A 334 ? 1.1239 1.4320 1.3152 -0.2468 -0.0807 -0.1080 553 ILE A CD1   
2264 N  N     . GLY A 335 ? 1.3155 1.3226 1.4262 -0.2707 -0.1605 -0.0441 554 GLY A N     
2265 C  CA    . GLY A 335 ? 1.4068 1.3053 1.5053 -0.2721 -0.2085 -0.0502 554 GLY A CA    
2266 C  C     . GLY A 335 ? 1.5462 1.3704 1.6155 -0.2740 -0.2311 -0.0272 554 GLY A C     
2267 O  O     . GLY A 335 ? 1.4925 1.3521 1.5633 -0.2556 -0.2069 -0.0175 554 GLY A O     
2268 N  N     . GLU A 336 ? 1.6394 1.3548 1.6793 -0.2961 -0.2816 -0.0188 555 GLU A N     
2269 C  CA    . GLU A 336 ? 1.7203 1.3416 1.7234 -0.3014 -0.3174 0.0041  555 GLU A CA    
2270 C  C     . GLU A 336 ? 1.7194 1.3299 1.7532 -0.2348 -0.3234 -0.0236 555 GLU A C     
2271 O  O     . GLU A 336 ? 1.7170 1.3115 1.7343 -0.2281 -0.3237 -0.0054 555 GLU A O     
2272 C  CB    . GLU A 336 ? 1.8777 1.3696 1.8396 -0.3378 -0.3808 0.0152  555 GLU A CB    
2273 C  CG    . GLU A 336 ? 2.0499 1.5097 2.0395 -0.3178 -0.4090 -0.0250 555 GLU A CG    
2274 C  CD    . GLU A 336 ? 2.2136 1.7523 2.2196 -0.3469 -0.3786 -0.0321 555 GLU A CD    
2275 O  OE1   . GLU A 336 ? 2.3354 1.8463 2.3025 -0.4136 -0.3912 -0.0034 555 GLU A OE1   
2276 O  OE2   . GLU A 336 ? 1.8679 1.4988 1.9227 -0.3065 -0.3425 -0.0652 555 GLU A OE2   
2277 N  N     . ASN A 337 ? 1.6333 1.2611 1.7116 -0.1883 -0.3270 -0.0697 556 ASN A N     
2278 C  CA    . ASN A 337 ? 1.5888 1.2214 1.7032 -0.1270 -0.3333 -0.1066 556 ASN A CA    
2279 C  C     . ASN A 337 ? 1.4831 1.2329 1.6388 -0.0958 -0.2789 -0.1289 556 ASN A C     
2280 O  O     . ASN A 337 ? 1.4748 1.2534 1.6683 -0.0540 -0.2796 -0.1729 556 ASN A O     
2281 C  CB    . ASN A 337 ? 1.7085 1.2639 1.8377 -0.0982 -0.3891 -0.1476 556 ASN A CB    
2282 C  CG    . ASN A 337 ? 2.2401 1.7806 2.3688 -0.1218 -0.4031 -0.1596 556 ASN A CG    
2283 O  OD1   . ASN A 337 ? 2.3411 1.7771 2.4498 -0.1308 -0.4606 -0.1657 556 ASN A OD1   
2284 N  ND2   . ASN A 337 ? 2.0740 1.7118 2.2226 -0.1314 -0.3561 -0.1645 556 ASN A ND2   
2285 N  N     . SER A 338 ? 1.3087 1.1269 1.4541 -0.1177 -0.2339 -0.0996 557 SER A N     
2286 C  CA    . SER A 338 ? 1.1670 1.0804 1.3389 -0.0926 -0.1874 -0.1116 557 SER A CA    
2287 C  C     . SER A 338 ? 1.1286 1.0494 1.2930 -0.0807 -0.1733 -0.0945 557 SER A C     
2288 O  O     . SER A 338 ? 1.1416 1.0376 1.2750 -0.1074 -0.1758 -0.0608 557 SER A O     
2289 C  CB    . SER A 338 ? 1.1305 1.1132 1.2993 -0.1172 -0.1538 -0.0989 557 SER A CB    
2290 O  OG    . SER A 338 ? 1.2297 1.2187 1.4132 -0.1188 -0.1633 -0.1232 557 SER A OG    
2291 N  N     . ARG A 339 ? 1.0023 0.9578 1.1936 -0.0434 -0.1604 -0.1198 558 ARG A N     
2292 C  CA    . ARG A 339 ? 0.9549 0.9183 1.1446 -0.0284 -0.1496 -0.1112 558 ARG A CA    
2293 C  C     . ARG A 339 ? 0.9211 0.9613 1.1282 -0.0113 -0.1108 -0.1222 558 ARG A C     
2294 O  O     . ARG A 339 ? 0.8999 0.9799 1.1259 -0.0009 -0.1006 -0.1473 558 ARG A O     
2295 C  CB    . ARG A 339 ? 0.9780 0.8871 1.1804 -0.0013 -0.1875 -0.1343 558 ARG A CB    
2296 C  CG    . ARG A 339 ? 1.1167 0.9296 1.2892 -0.0206 -0.2339 -0.1159 558 ARG A CG    
2297 C  CD    . ARG A 339 ? 1.2730 1.0298 1.4629 0.0146  -0.2801 -0.1489 558 ARG A CD    
2298 N  NE    . ARG A 339 ? 1.5573 1.2759 1.7312 0.0222  -0.2969 -0.1332 558 ARG A NE    
2299 C  CZ    . ARG A 339 ? 1.8640 1.4926 1.9941 -0.0004 -0.3349 -0.1012 558 ARG A CZ    
2300 N  NH1   . ARG A 339 ? 1.7727 1.3399 1.8688 -0.0373 -0.3588 -0.0794 558 ARG A NH1   
2301 N  NH2   . ARG A 339 ? 1.7437 1.3430 1.8592 0.0093  -0.3499 -0.0891 558 ARG A NH2   
2302 N  N     . THR A 340 ? 0.8576 0.9153 1.0531 -0.0115 -0.0911 -0.1020 559 THR A N     
2303 C  CA    . THR A 340 ? 0.8124 0.9272 1.0147 0.0008  -0.0595 -0.1068 559 THR A CA    
2304 C  C     . THR A 340 ? 0.8612 0.9719 1.0644 0.0143  -0.0568 -0.1050 559 THR A C     
2305 O  O     . THR A 340 ? 0.8545 0.9249 1.0456 0.0111  -0.0728 -0.0899 559 THR A O     
2306 C  CB    . THR A 340 ? 0.8654 1.0159 1.0504 -0.0143 -0.0356 -0.0851 559 THR A CB    
2307 O  OG1   . THR A 340 ? 0.8303 1.0228 1.0177 -0.0021 -0.0136 -0.0926 559 THR A OG1   
2308 C  CG2   . THR A 340 ? 0.8718 1.0136 1.0352 -0.0267 -0.0317 -0.0574 559 THR A CG2   
2309 N  N     . CYS A 341 ? 0.8078 0.9609 1.0214 0.0253  -0.0373 -0.1193 560 CYS A N     
2310 C  CA    . CYS A 341 ? 0.8035 0.9634 1.0177 0.0337  -0.0301 -0.1187 560 CYS A CA    
2311 C  C     . CYS A 341 ? 0.7932 0.9880 0.9922 0.0281  -0.0031 -0.1082 560 CYS A C     
2312 O  O     . CYS A 341 ? 0.7818 1.0065 0.9803 0.0245  0.0080  -0.1169 560 CYS A O     
2313 C  CB    . CYS A 341 ? 0.8326 1.0055 1.0766 0.0512  -0.0418 -0.1544 560 CYS A CB    
2314 S  SG    . CYS A 341 ? 0.8834 1.0750 1.1302 0.0564  -0.0313 -0.1558 560 CYS A SG    
2315 N  N     . MET A 342 ? 0.7260 0.9130 0.9095 0.0276  0.0039  -0.0904 561 MET A N     
2316 C  CA    . MET A 342 ? 0.6942 0.8996 0.8595 0.0244  0.0217  -0.0817 561 MET A CA    
2317 C  C     . MET A 342 ? 0.6971 0.9007 0.8630 0.0265  0.0239  -0.0850 561 MET A C     
2318 O  O     . MET A 342 ? 0.6838 0.8652 0.8501 0.0317  0.0153  -0.0779 561 MET A O     
2319 C  CB    . MET A 342 ? 0.7354 0.9345 0.8780 0.0231  0.0261  -0.0592 561 MET A CB    
2320 C  CG    . MET A 342 ? 0.8073 1.0104 0.9277 0.0244  0.0354  -0.0522 561 MET A CG    
2321 S  SD    . MET A 342 ? 0.8982 1.1043 0.9981 0.0322  0.0353  -0.0377 561 MET A SD    
2322 C  CE    . MET A 342 ? 0.8387 1.0692 0.9422 0.0283  0.0365  -0.0438 561 MET A CE    
2323 N  N     . ILE A 343 ? 0.6386 0.8669 0.8002 0.0182  0.0352  -0.0942 562 ILE A N     
2324 C  CA    . ILE A 343 ? 0.6375 0.8712 0.7958 0.0119  0.0399  -0.0976 562 ILE A CA    
2325 C  C     . ILE A 343 ? 0.7087 0.9232 0.8293 0.0029  0.0463  -0.0750 562 ILE A C     
2326 O  O     . ILE A 343 ? 0.7120 0.9352 0.8119 -0.0096 0.0526  -0.0715 562 ILE A O     
2327 C  CB    . ILE A 343 ? 0.6614 0.9430 0.8393 0.0016  0.0466  -0.1268 562 ILE A CB    
2328 C  CG1   . ILE A 343 ? 0.6663 0.9650 0.8845 0.0187  0.0333  -0.1567 562 ILE A CG1   
2329 C  CG2   . ILE A 343 ? 0.6518 0.9437 0.8273 -0.0100 0.0512  -0.1302 562 ILE A CG2   
2330 C  CD1   . ILE A 343 ? 0.6874 1.0473 0.9281 0.0138  0.0395  -0.1934 562 ILE A CD1   
2331 N  N     . ALA A 344 ? 0.6832 0.8686 0.7921 0.0101  0.0412  -0.0612 563 ALA A N     
2332 C  CA    . ALA A 344 ? 0.6865 0.8444 0.7603 0.0075  0.0399  -0.0444 563 ALA A CA    
2333 C  C     . ALA A 344 ? 0.7458 0.9022 0.8104 -0.0113 0.0426  -0.0480 563 ALA A C     
2334 O  O     . ALA A 344 ? 0.7055 0.8627 0.7853 -0.0091 0.0404  -0.0548 563 ALA A O     
2335 C  CB    . ALA A 344 ? 0.6889 0.8251 0.7576 0.0255  0.0324  -0.0345 563 ALA A CB    
2336 N  N     . THR A 345 ? 0.7493 0.9056 0.7863 -0.0337 0.0464  -0.0431 564 THR A N     
2337 C  CA    . THR A 345 ? 0.7758 0.9341 0.7953 -0.0633 0.0498  -0.0440 564 THR A CA    
2338 C  C     . THR A 345 ? 0.8812 0.9779 0.8596 -0.0647 0.0356  -0.0235 564 THR A C     
2339 O  O     . THR A 345 ? 0.9089 0.9669 0.8590 -0.0511 0.0235  -0.0089 564 THR A O     
2340 C  CB    . THR A 345 ? 0.7919 0.9841 0.7957 -0.0944 0.0603  -0.0483 564 THR A CB    
2341 O  OG1   . THR A 345 ? 0.8698 1.0282 0.8350 -0.0932 0.0525  -0.0287 564 THR A OG1   
2342 C  CG2   . THR A 345 ? 0.6285 0.8874 0.6786 -0.0894 0.0719  -0.0778 564 THR A CG2   
2343 N  N     . ILE A 346 ? 0.8383 0.9265 0.8150 -0.0784 0.0339  -0.0261 565 ILE A N     
2344 C  CA    . ILE A 346 ? 0.8640 0.8886 0.8025 -0.0793 0.0165  -0.0106 565 ILE A CA    
2345 C  C     . ILE A 346 ? 0.9298 0.9423 0.8385 -0.1241 0.0157  -0.0058 565 ILE A C     
2346 O  O     . ILE A 346 ? 0.9024 0.9708 0.8368 -0.1480 0.0311  -0.0220 565 ILE A O     
2347 C  CB    . ILE A 346 ? 0.8719 0.8827 0.8315 -0.0447 0.0088  -0.0160 565 ILE A CB    
2348 C  CG1   . ILE A 346 ? 0.8431 0.8894 0.8383 -0.0489 0.0166  -0.0321 565 ILE A CG1   
2349 C  CG2   . ILE A 346 ? 0.8125 0.8337 0.7902 -0.0085 0.0082  -0.0171 565 ILE A CG2   
2350 C  CD1   . ILE A 346 ? 1.0480 1.0769 1.0521 -0.0220 0.0074  -0.0343 565 ILE A CD1   
2351 N  N     . SER A 347 ? 0.9524 0.8923 0.8053 -0.1367 -0.0051 0.0149  566 SER A N     
2352 C  CA    . SER A 347 ? 1.0146 0.9227 0.8257 -0.1849 -0.0126 0.0256  566 SER A CA    
2353 C  C     . SER A 347 ? 1.0902 0.9649 0.9098 -0.1680 -0.0255 0.0197  566 SER A C     
2354 O  O     . SER A 347 ? 1.0982 0.9305 0.9162 -0.1256 -0.0427 0.0203  566 SER A O     
2355 C  CB    . SER A 347 ? 1.1418 0.9716 0.8803 -0.2058 -0.0367 0.0532  566 SER A CB    
2356 O  OG    . SER A 347 ? 1.2912 1.1569 1.0170 -0.2284 -0.0239 0.0588  566 SER A OG    
2357 N  N     . PRO A 348 ? 1.0312 0.9355 0.8645 -0.1986 -0.0166 0.0094  567 PRO A N     
2358 C  CA    . PRO A 348 ? 1.0347 0.9200 0.8846 -0.1787 -0.0266 -0.0006 567 PRO A CA    
2359 C  C     . PRO A 348 ? 1.1558 0.9502 0.9539 -0.1907 -0.0561 0.0130  567 PRO A C     
2360 O  O     . PRO A 348 ? 1.1458 0.9252 0.9577 -0.1705 -0.0656 0.0021  567 PRO A O     
2361 C  CB    . PRO A 348 ? 1.0199 0.9856 0.9120 -0.2048 -0.0057 -0.0220 567 PRO A CB    
2362 C  CG    . PRO A 348 ? 1.0954 1.0871 0.9604 -0.2618 0.0055  -0.0154 567 PRO A CG    
2363 C  CD    . PRO A 348 ? 1.0411 1.0152 0.8841 -0.2498 0.0051  -0.0002 567 PRO A CD    
2364 N  N     . GLY A 349 ? 1.1690 0.9019 0.9056 -0.2259 -0.0727 0.0359  568 GLY A N     
2365 C  CA    . GLY A 349 ? 1.2514 0.8829 0.9283 -0.2452 -0.1076 0.0511  568 GLY A CA    
2366 C  C     . GLY A 349 ? 1.3044 0.8622 0.9692 -0.1871 -0.1399 0.0479  568 GLY A C     
2367 O  O     . GLY A 349 ? 1.2708 0.8347 0.9473 -0.1427 -0.1417 0.0453  568 GLY A O     
2368 N  N     . ILE A 350 ? 1.3206 0.8142 0.9634 -0.1876 -0.1663 0.0444  569 ILE A N     
2369 C  CA    . ILE A 350 ? 1.3480 0.7703 0.9766 -0.1328 -0.2024 0.0342  569 ILE A CA    
2370 C  C     . ILE A 350 ? 1.5074 0.8592 1.0906 -0.1098 -0.2339 0.0474  569 ILE A C     
2371 O  O     . ILE A 350 ? 1.5049 0.8555 1.1052 -0.0492 -0.2472 0.0301  569 ILE A O     
2372 C  CB    . ILE A 350 ? 1.4362 0.7848 1.0346 -0.1491 -0.2324 0.0301  569 ILE A CB    
2373 C  CG1   . ILE A 350 ? 1.4493 0.7431 1.0448 -0.0837 -0.2678 0.0084  569 ILE A CG1   
2374 C  CG2   . ILE A 350 ? 1.5349 0.7945 1.0582 -0.2184 -0.2578 0.0595  569 ILE A CG2   
2375 C  CD1   . ILE A 350 ? 1.5948 0.8460 1.1826 -0.0875 -0.2887 -0.0063 569 ILE A CD1   
2376 N  N     . SER A 351 ? 1.5494 0.8509 1.0753 -0.1594 -0.2455 0.0764  570 SER A N     
2377 C  CA    . SER A 351 ? 1.6367 0.8613 1.1100 -0.1436 -0.2812 0.0924  570 SER A CA    
2378 C  C     . SER A 351 ? 1.6321 0.9318 1.1460 -0.1041 -0.2581 0.0846  570 SER A C     
2379 O  O     . SER A 351 ? 1.6747 0.9267 1.1638 -0.0678 -0.2889 0.0858  570 SER A O     
2380 C  CB    . SER A 351 ? 1.7827 0.9355 1.1765 -0.2175 -0.2987 0.1293  570 SER A CB    
2381 O  OG    . SER A 351 ? 2.0807 1.1490 1.4306 -0.2524 -0.3282 0.1366  570 SER A OG    
2382 N  N     . SER A 352 ? 1.4784 0.8932 1.0551 -0.1092 -0.2079 0.0742  571 SER A N     
2383 C  CA    . SER A 352 ? 1.3968 0.8844 1.0136 -0.0780 -0.1847 0.0666  571 SER A CA    
2384 C  C     . SER A 352 ? 1.3740 0.9205 1.0522 -0.0207 -0.1720 0.0383  571 SER A C     
2385 O  O     . SER A 352 ? 1.2993 0.9058 1.0116 0.0047  -0.1543 0.0308  571 SER A O     
2386 C  CB    . SER A 352 ? 1.3697 0.9400 1.0101 -0.1221 -0.1427 0.0728  571 SER A CB    
2387 O  OG    . SER A 352 ? 1.5252 1.0549 1.1046 -0.1791 -0.1515 0.0989  571 SER A OG    
2388 N  N     . CYS A 353 ? 1.3711 0.9001 1.0590 -0.0036 -0.1826 0.0231  572 CYS A N     
2389 C  CA    . CYS A 353 ? 1.3110 0.9001 1.0507 0.0421  -0.1695 -0.0029 572 CYS A CA    
2390 C  C     . CYS A 353 ? 1.2933 0.9154 1.0523 0.0909  -0.1726 -0.0168 572 CYS A C     
2391 O  O     . CYS A 353 ? 1.2132 0.9160 1.0185 0.1045  -0.1438 -0.0269 572 CYS A O     
2392 C  CB    . CYS A 353 ? 1.3668 0.9194 1.1014 0.0562  -0.1893 -0.0186 572 CYS A CB    
2393 S  SG    . CYS A 353 ? 1.3432 0.9856 1.1379 0.0946  -0.1647 -0.0463 572 CYS A SG    
2394 N  N     . GLU A 354 ? 1.3073 0.8680 1.0308 0.1171  -0.2101 -0.0191 573 GLU A N     
2395 C  CA    . GLU A 354 ? 1.2780 0.8803 1.0231 0.1650  -0.2150 -0.0379 573 GLU A CA    
2396 C  C     . GLU A 354 ? 1.2444 0.9062 1.0094 0.1506  -0.1864 -0.0255 573 GLU A C     
2397 O  O     . GLU A 354 ? 1.1821 0.9198 0.9877 0.1756  -0.1682 -0.0413 573 GLU A O     
2398 C  CB    . GLU A 354 ? 1.3923 0.9144 1.0966 0.2030  -0.2688 -0.0491 573 GLU A CB    
2399 C  CG    . GLU A 354 ? 1.6218 1.1479 1.3416 0.2550  -0.2918 -0.0875 573 GLU A CG    
2400 C  CD    . GLU A 354 ? 1.7959 1.4288 1.5727 0.2696  -0.2545 -0.1107 573 GLU A CD    
2401 O  OE1   . GLU A 354 ? 1.7886 1.5108 1.6028 0.2789  -0.2265 -0.1174 573 GLU A OE1   
2402 O  OE2   . GLU A 354 ? 1.5393 1.1641 1.3193 0.2677  -0.2545 -0.1206 573 GLU A OE2   
2403 N  N     . TYR A 355 ? 1.1912 0.8230 0.9264 0.1066  -0.1819 0.0017  574 TYR A N     
2404 C  CA    . TYR A 355 ? 1.1368 0.8253 0.8900 0.0898  -0.1545 0.0114  574 TYR A CA    
2405 C  C     . TYR A 355 ? 1.0839 0.8577 0.8921 0.0767  -0.1115 0.0051  574 TYR A C     
2406 O  O     . TYR A 355 ? 1.0325 0.8684 0.8741 0.0861  -0.0915 -0.0005 574 TYR A O     
2407 C  CB    . TYR A 355 ? 1.2210 0.8615 0.9245 0.0432  -0.1609 0.0388  574 TYR A CB    
2408 C  CG    . TYR A 355 ? 1.3847 0.9246 1.0228 0.0516  -0.2103 0.0504  574 TYR A CG    
2409 C  CD1   . TYR A 355 ? 1.5212 0.9681 1.1062 0.0281  -0.2407 0.0638  574 TYR A CD1   
2410 C  CD2   . TYR A 355 ? 1.4190 0.9515 1.0464 0.0845  -0.2319 0.0467  574 TYR A CD2   
2411 C  CE1   . TYR A 355 ? 1.6489 0.9863 1.1664 0.0369  -0.2949 0.0756  574 TYR A CE1   
2412 C  CE2   . TYR A 355 ? 1.5473 0.9781 1.1103 0.0957  -0.2850 0.0571  574 TYR A CE2   
2413 C  CZ    . TYR A 355 ? 1.8001 1.1277 1.3058 0.0722  -0.3184 0.0725  574 TYR A CZ    
2414 O  OH    . TYR A 355 ? 1.9984 1.2097 1.4337 0.0838  -0.3789 0.0839  574 TYR A OH    
2415 N  N     . THR A 356 ? 1.0260 0.7977 0.8413 0.0553  -0.1016 0.0054  575 THR A N     
2416 C  CA    . THR A 356 ? 0.9483 0.7874 0.8110 0.0474  -0.0702 -0.0023 575 THR A CA    
2417 C  C     . THR A 356 ? 0.9506 0.8351 0.8468 0.0850  -0.0648 -0.0187 575 THR A C     
2418 O  O     . THR A 356 ? 0.8937 0.8340 0.8221 0.0845  -0.0437 -0.0207 575 THR A O     
2419 C  CB    . THR A 356 ? 0.9893 0.8124 0.8495 0.0226  -0.0685 -0.0022 575 THR A CB    
2420 O  OG1   . THR A 356 ? 0.9839 0.7928 0.8200 -0.0226 -0.0644 0.0119  575 THR A OG1   
2421 C  CG2   . THR A 356 ? 0.8797 0.7628 0.7869 0.0257  -0.0460 -0.0139 575 THR A CG2   
2422 N  N     . LEU A 357 ? 0.9401 0.8022 0.8261 0.1152  -0.0852 -0.0318 576 LEU A N     
2423 C  CA    . LEU A 357 ? 0.8998 0.8168 0.8136 0.1462  -0.0790 -0.0502 576 LEU A CA    
2424 C  C     . LEU A 357 ? 0.9410 0.9021 0.8686 0.1598  -0.0729 -0.0536 576 LEU A C     
2425 O  O     . LEU A 357 ? 0.9148 0.9382 0.8711 0.1608  -0.0534 -0.0585 576 LEU A O     
2426 C  CB    . LEU A 357 ? 0.9255 0.8203 0.8271 0.1782  -0.1030 -0.0711 576 LEU A CB    
2427 C  CG    . LEU A 357 ? 0.9487 0.8183 0.8455 0.1674  -0.1053 -0.0730 576 LEU A CG    
2428 C  CD1   . LEU A 357 ? 0.9660 0.7840 0.8378 0.1967  -0.1398 -0.0922 576 LEU A CD1   
2429 C  CD2   . LEU A 357 ? 0.8633 0.7986 0.7922 0.1626  -0.0798 -0.0773 576 LEU A CD2   
2430 N  N     . ASN A 358 ? 0.9185 0.8457 0.8226 0.1658  -0.0907 -0.0490 577 ASN A N     
2431 C  CA    . ASN A 358 ? 0.8935 0.8645 0.8115 0.1767  -0.0856 -0.0526 577 ASN A CA    
2432 C  C     . ASN A 358 ? 0.9256 0.9384 0.8677 0.1460  -0.0553 -0.0393 577 ASN A C     
2433 O  O     . ASN A 358 ? 0.9012 0.9724 0.8700 0.1504  -0.0412 -0.0460 577 ASN A O     
2434 C  CB    . ASN A 358 ? 0.8675 0.7861 0.7505 0.1851  -0.1131 -0.0469 577 ASN A CB    
2435 C  CG    . ASN A 358 ? 1.1152 0.9946 0.9773 0.2263  -0.1516 -0.0664 577 ASN A CG    
2436 O  OD1   . ASN A 358 ? 1.1070 1.0210 0.9893 0.2554  -0.1548 -0.0919 577 ASN A OD1   
2437 N  ND2   . ASN A 358 ? 1.0815 0.8851 0.8989 0.2288  -0.1848 -0.0557 577 ASN A ND2   
2438 N  N     . THR A 359 ? 0.8711 0.8572 0.8039 0.1140  -0.0468 -0.0234 578 THR A N     
2439 C  CA    . THR A 359 ? 0.8154 0.8392 0.7728 0.0897  -0.0229 -0.0175 578 THR A CA    
2440 C  C     . THR A 359 ? 0.8402 0.9057 0.8308 0.0913  -0.0078 -0.0238 578 THR A C     
2441 O  O     . THR A 359 ? 0.8189 0.9222 0.8317 0.0863  0.0042  -0.0243 578 THR A O     
2442 C  CB    . THR A 359 ? 0.8562 0.8553 0.7996 0.0575  -0.0182 -0.0074 578 THR A CB    
2443 O  OG1   . THR A 359 ? 0.8733 0.8349 0.7780 0.0478  -0.0321 0.0033  578 THR A OG1   
2444 C  CG2   . THR A 359 ? 0.7522 0.7955 0.7272 0.0389  0.0032  -0.0104 578 THR A CG2   
2445 N  N     . LEU A 360 ? 0.7963 0.8491 0.7855 0.0958  -0.0114 -0.0275 579 LEU A N     
2446 C  CA    . LEU A 360 ? 0.7348 0.8174 0.7452 0.0947  -0.0017 -0.0306 579 LEU A CA    
2447 C  C     . LEU A 360 ? 0.7345 0.8607 0.7526 0.1091  0.0008  -0.0376 579 LEU A C     
2448 O  O     . LEU A 360 ? 0.7064 0.8627 0.7389 0.0977  0.0107  -0.0336 579 LEU A O     
2449 C  CB    . LEU A 360 ? 0.7378 0.7965 0.7408 0.0957  -0.0081 -0.0338 579 LEU A CB    
2450 C  CG    . LEU A 360 ? 0.7715 0.8028 0.7722 0.0740  -0.0076 -0.0294 579 LEU A CG    
2451 C  CD1   . LEU A 360 ? 0.7717 0.7741 0.7591 0.0768  -0.0184 -0.0342 579 LEU A CD1   
2452 C  CD2   . LEU A 360 ? 0.7024 0.7611 0.7312 0.0587  0.0045  -0.0293 579 LEU A CD2   
2453 N  N     . ARG A 361 ? 0.7068 0.8376 0.7140 0.1328  -0.0105 -0.0498 580 ARG A N     
2454 C  CA    . ARG A 361 ? 0.6969 0.8869 0.7142 0.1458  -0.0071 -0.0631 580 ARG A CA    
2455 C  C     . ARG A 361 ? 0.7510 0.9738 0.7825 0.1323  0.0035  -0.0570 580 ARG A C     
2456 O  O     . ARG A 361 ? 0.7450 1.0158 0.7881 0.1198  0.0147  -0.0571 580 ARG A O     
2457 C  CB    . ARG A 361 ? 0.6982 0.8898 0.7053 0.1809  -0.0266 -0.0853 580 ARG A CB    
2458 C  CG    . ARG A 361 ? 0.9206 1.0944 0.9172 0.1952  -0.0367 -0.0974 580 ARG A CG    
2459 C  CD    . ARG A 361 ? 1.0512 1.2298 1.0402 0.2370  -0.0612 -0.1282 580 ARG A CD    
2460 N  NE    . ARG A 361 ? 1.1589 1.2583 1.1227 0.2532  -0.0904 -0.1267 580 ARG A NE    
2461 C  CZ    . ARG A 361 ? 1.4248 1.4566 1.3646 0.2638  -0.1138 -0.1307 580 ARG A CZ    
2462 N  NH1   . ARG A 361 ? 1.1391 1.1778 1.0815 0.2632  -0.1096 -0.1390 580 ARG A NH1   
2463 N  NH2   . ARG A 361 ? 1.3799 1.3324 1.2885 0.2722  -0.1439 -0.1250 580 ARG A NH2   
2464 N  N     . TYR A 362 ? 0.7059 0.9009 0.7327 0.1300  -0.0007 -0.0504 581 TYR A N     
2465 C  CA    . TYR A 362 ? 0.6745 0.8966 0.7141 0.1180  0.0075  -0.0465 581 TYR A CA    
2466 C  C     . TYR A 362 ? 0.7229 0.9486 0.7769 0.0905  0.0208  -0.0348 581 TYR A C     
2467 O  O     . TYR A 362 ? 0.6958 0.9578 0.7614 0.0782  0.0276  -0.0341 581 TYR A O     
2468 C  CB    . TYR A 362 ? 0.6912 0.8788 0.7164 0.1198  -0.0013 -0.0417 581 TYR A CB    
2469 C  CG    . TYR A 362 ? 0.6752 0.8870 0.7123 0.1067  0.0064  -0.0389 581 TYR A CG    
2470 C  CD1   . TYR A 362 ? 0.6936 0.9316 0.7304 0.1215  -0.0016 -0.0478 581 TYR A CD1   
2471 C  CD2   . TYR A 362 ? 0.6702 0.8777 0.7194 0.0826  0.0182  -0.0310 581 TYR A CD2   
2472 C  CE1   . TYR A 362 ? 0.6446 0.9026 0.6905 0.1091  0.0040  -0.0463 581 TYR A CE1   
2473 C  CE2   . TYR A 362 ? 0.6787 0.9056 0.7381 0.0722  0.0227  -0.0320 581 TYR A CE2   
2474 C  CZ    . TYR A 362 ? 0.7490 1.0009 0.8059 0.0838  0.0167  -0.0382 581 TYR A CZ    
2475 O  OH    . TYR A 362 ? 0.7769 1.0483 0.8431 0.0732  0.0203  -0.0403 581 TYR A OH    
2476 N  N     . ALA A 363 ? 0.7204 0.9084 0.7731 0.0802  0.0214  -0.0274 582 ALA A N     
2477 C  CA    . ALA A 363 ? 0.7269 0.9118 0.7944 0.0614  0.0264  -0.0216 582 ALA A CA    
2478 C  C     . ALA A 363 ? 0.8112 1.0116 0.8790 0.0544  0.0267  -0.0173 582 ALA A C     
2479 O  O     . ALA A 363 ? 0.8241 1.0280 0.8984 0.0380  0.0262  -0.0111 582 ALA A O     
2480 C  CB    . ALA A 363 ? 0.7421 0.8965 0.8113 0.0566  0.0249  -0.0220 582 ALA A CB    
2481 N  N     . ASP A 364 ? 0.8096 1.0182 0.8663 0.0648  0.0252  -0.0208 583 ASP A N     
2482 C  CA    . ASP A 364 ? 0.8318 1.0647 0.8814 0.0552  0.0267  -0.0171 583 ASP A CA    
2483 C  C     . ASP A 364 ? 0.8860 1.1681 0.9370 0.0397  0.0332  -0.0161 583 ASP A C     
2484 O  O     . ASP A 364 ? 0.9182 1.2092 0.9601 0.0153  0.0334  -0.0047 583 ASP A O     
2485 C  CB    . ASP A 364 ? 0.8789 1.1239 0.9174 0.0748  0.0244  -0.0291 583 ASP A CB    
2486 C  CG    . ASP A 364 ? 1.1506 1.3977 1.1771 0.0666  0.0230  -0.0248 583 ASP A CG    
2487 O  OD1   . ASP A 364 ? 1.1914 1.4322 1.2134 0.0430  0.0221  -0.0096 583 ASP A OD1   
2488 O  OD2   . ASP A 364 ? 1.3000 1.5499 1.3184 0.0840  0.0193  -0.0369 583 ASP A OD2   
2489 N  N     . ARG A 365 ? 0.8331 1.1467 0.8920 0.0515  0.0362  -0.0278 584 ARG A N     
2490 C  CA    . ARG A 365 ? 0.8365 1.2089 0.9009 0.0370  0.0430  -0.0319 584 ARG A CA    
2491 C  C     . ARG A 365 ? 0.9010 1.2591 0.9741 0.0155  0.0431  -0.0214 584 ARG A C     
2492 O  O     . ARG A 365 ? 0.8985 1.3002 0.9744 -0.0051 0.0478  -0.0217 584 ARG A O     
2493 C  CB    . ARG A 365 ? 0.8584 1.2763 0.9305 0.0656  0.0417  -0.0552 584 ARG A CB    
2494 C  CG    . ARG A 365 ? 1.1235 1.5637 1.1893 0.0916  0.0375  -0.0739 584 ARG A CG    
2495 C  CD    . ARG A 365 ? 1.4340 1.9179 1.5096 0.1257  0.0288  -0.1025 584 ARG A CD    
2496 N  NE    . ARG A 365 ? 1.6581 2.2254 1.7498 0.1130  0.0378  -0.1149 584 ARG A NE    
2497 C  CZ    . ARG A 365 ? 1.8369 2.4673 1.9432 0.1417  0.0305  -0.1465 584 ARG A CZ    
2498 N  NH1   . ARG A 365 ? 1.6271 2.2368 1.7306 0.1878  0.0098  -0.1685 584 ARG A NH1   
2499 N  NH2   . ARG A 365 ? 1.6719 2.3859 1.7953 0.1245  0.0405  -0.1584 584 ARG A NH2   
2500 N  N     . VAL A 366 ? 0.8765 1.1802 0.9546 0.0186  0.0375  -0.0153 585 VAL A N     
2501 C  CA    . VAL A 366 ? 0.9059 1.1938 0.9940 0.0034  0.0347  -0.0112 585 VAL A CA    
2502 C  C     . VAL A 366 ? 1.1113 1.3814 1.1923 -0.0272 0.0275  0.0029  585 VAL A C     
2503 O  O     . VAL A 366 ? 1.1420 1.4211 1.2257 -0.0480 0.0251  0.0057  585 VAL A O     
2504 C  CB    . VAL A 366 ? 0.9159 1.1652 1.0122 0.0171  0.0314  -0.0158 585 VAL A CB    
2505 C  CG1   . VAL A 366 ? 0.9102 1.1394 1.0184 0.0036  0.0252  -0.0163 585 VAL A CG1   
2506 C  CG2   . VAL A 366 ? 0.9034 1.1671 0.9978 0.0359  0.0343  -0.0248 585 VAL A CG2   
2507 N  N     . LYS A 367 ? 1.1544 1.3937 1.2227 -0.0312 0.0203  0.0125  586 LYS A N     
2508 C  CA    . LYS A 367 ? 1.2291 1.4365 1.2809 -0.0604 0.0060  0.0294  586 LYS A CA    
2509 C  C     . LYS A 367 ? 1.3807 1.6211 1.4079 -0.0767 0.0120  0.0388  586 LYS A C     
2510 O  O     . LYS A 367 ? 1.3808 1.6133 1.3997 -0.0638 0.0114  0.0389  586 LYS A O     
2511 C  CB    . LYS A 367 ? 1.2731 1.4167 1.3293 -0.0499 -0.0129 0.0300  586 LYS A CB    
2512 C  CG    . LYS A 367 ? 1.3675 1.4588 1.4028 -0.0751 -0.0383 0.0469  586 LYS A CG    
2513 C  CD    . LYS A 367 ? 1.3557 1.3914 1.4044 -0.0539 -0.0610 0.0375  586 LYS A CD    
2514 C  CE    . LYS A 367 ? 1.5325 1.5040 1.5535 -0.0736 -0.0946 0.0549  586 LYS A CE    
2515 N  NZ    . LYS A 367 ? 1.6033 1.5246 1.6425 -0.0468 -0.1225 0.0386  586 LYS A NZ    
2516 N  N     . GLU A 368 ? 1.3960 1.6931 1.4176 -0.0996 0.0224  0.0390  587 GLU A N     
2517 C  CA    . GLU A 368 ? 1.4376 1.7939 1.4377 -0.1220 0.0327  0.0421  587 GLU A CA    
2518 C  C     . GLU A 368 ? 1.5647 1.9375 1.5485 -0.1719 0.0303  0.0567  587 GLU A C     
2519 O  O     . GLU A 368 ? 1.5565 1.9482 1.5594 -0.1749 0.0335  0.0485  587 GLU A O     
2520 C  CB    . GLU A 368 ? 1.4223 1.8567 1.4411 -0.0922 0.0502  0.0148  587 GLU A CB    
2521 C  CG    . GLU A 368 ? 1.5479 2.0483 1.5495 -0.1012 0.0603  0.0077  587 GLU A CG    
2522 C  CD    . GLU A 368 ? 1.7273 2.3085 1.7504 -0.0674 0.0715  -0.0267 587 GLU A CD    
2523 O  OE1   . GLU A 368 ? 1.5559 2.1122 1.5899 -0.0238 0.0664  -0.0413 587 GLU A OE1   
2524 O  OE2   . GLU A 368 ? 1.6802 2.3503 1.7082 -0.0854 0.0828  -0.0410 587 GLU A OE2   
2525 N  N     . LEU A 369 ? 1.5792 1.9355 1.5231 -0.2138 0.0213  0.0804  588 LEU A N     
2526 C  CA    . LEU A 369 ? 2.0462 2.4014 1.9591 -0.2740 0.0136  0.1024  588 LEU A CA    
2527 C  C     . LEU A 369 ? 2.4531 2.9213 2.3750 -0.2990 0.0378  0.0874  588 LEU A C     
2528 O  O     . LEU A 369 ? 1.9005 2.3928 1.8529 -0.2892 0.0430  0.0722  588 LEU A O     
2529 C  CB    . LEU A 369 ? 2.1133 2.4282 1.9721 -0.3134 -0.0022 0.1325  588 LEU A CB    
2530 C  CG    . LEU A 369 ? 2.1772 2.3972 2.0296 -0.2824 -0.0264 0.1412  588 LEU A CG    
2531 C  CD1   . LEU A 369 ? 2.1672 2.4220 2.0073 -0.2679 -0.0157 0.1369  588 LEU A CD1   
2532 C  CD2   . LEU A 369 ? 2.2869 2.4035 2.0974 -0.3178 -0.0649 0.1728  588 LEU A CD2   
2533 MG MG    . MG  B .   ? 1.3658 1.6113 1.0619 -0.3054 0.0695  0.0211  701 MG  A MG    
2534 P  PB    . ADP C .   ? 1.1511 1.3050 0.8851 -0.2804 0.0546  0.0298  702 ADP A PB    
2535 O  O1B   . ADP C .   ? 1.1700 1.4033 0.9286 -0.2809 0.0733  0.0073  702 ADP A O1B   
2536 O  O2B   . ADP C .   ? 1.0636 1.1979 0.8506 -0.2243 0.0488  0.0198  702 ADP A O2B   
2537 O  O3B   . ADP C .   ? 1.2554 1.3110 0.9045 -0.2965 0.0235  0.0698  702 ADP A O3B   
2538 P  PA    . ADP C .   ? 1.2596 1.5663 1.0039 -0.3840 0.1002  -0.0060 702 ADP A PA    
2539 O  O1A   . ADP C .   ? 1.3682 1.6746 1.0407 -0.4336 0.0995  0.0150  702 ADP A O1A   
2540 O  O2A   . ADP C .   ? 1.1436 1.5517 0.9727 -0.3501 0.1217  -0.0544 702 ADP A O2A   
2541 O  O3A   . ADP C .   ? 1.2292 1.4272 0.9655 -0.3288 0.0710  0.0193  702 ADP A O3A   
2542 O  "O5'" . ADP C .   ? 1.3141 1.6168 1.0501 -0.4213 0.1017  -0.0037 702 ADP A "O5'" 
2543 C  "C5'" . ADP C .   ? 1.4310 1.6662 1.0836 -0.4804 0.0866  0.0335  702 ADP A "C5'" 
2544 C  "C4'" . ADP C .   ? 1.4870 1.8065 1.1479 -0.5401 0.1090  0.0138  702 ADP A "C4'" 
2545 O  "O4'" . ADP C .   ? 1.4314 1.7793 1.1653 -0.5037 0.1143  -0.0149 702 ADP A "O4'" 
2546 C  "C3'" . ADP C .   ? 1.4807 1.9410 1.1645 -0.5765 0.1422  -0.0217 702 ADP A "C3'" 
2547 O  "O3'" . ADP C .   ? 1.5554 2.0613 1.1895 -0.6635 0.1544  -0.0157 702 ADP A "O3'" 
2548 C  "C2'" . ADP C .   ? 1.3815 1.9311 1.1722 -0.5209 0.1584  -0.0756 702 ADP A "C2'" 
2549 O  "O2'" . ADP C .   ? 1.3832 2.0802 1.2180 -0.5488 0.1873  -0.1250 702 ADP A "O2'" 
2550 C  "C1'" . ADP C .   ? 1.3562 1.8420 1.1590 -0.5057 0.1434  -0.0655 702 ADP A "C1'" 
2551 N  N9    . ADP C .   ? 1.2185 1.7167 1.1028 -0.4342 0.1409  -0.0945 702 ADP A N9    
2552 C  C8    . ADP C .   ? 1.1595 1.5996 1.0664 -0.3691 0.1269  -0.0877 702 ADP A C8    
2553 N  N7    . ADP C .   ? 1.0893 1.5579 1.0657 -0.3210 0.1268  -0.1171 702 ADP A N7    
2554 C  C5    . ADP C .   ? 1.0984 1.6496 1.1043 -0.3501 0.1399  -0.1481 702 ADP A C5    
2555 C  C6    . ADP C .   ? 1.0350 1.6469 1.1111 -0.3221 0.1413  -0.1887 702 ADP A C6    
2556 N  N6    . ADP C .   ? 0.9508 1.5363 1.0735 -0.2600 0.1275  -0.1994 702 ADP A N6    
2557 N  N1    . ADP C .   ? 1.0510 1.7515 1.1440 -0.3633 0.1550  -0.2174 702 ADP A N1    
2558 C  C2    . ADP C .   ? 1.1023 1.8271 1.1405 -0.4350 0.1684  -0.2027 702 ADP A C2    
2559 N  N3    . ADP C .   ? 1.1582 1.8209 1.1203 -0.4711 0.1666  -0.1602 702 ADP A N3    
2560 C  C4    . ADP C .   ? 1.1473 1.7237 1.0991 -0.4218 0.1510  -0.1358 702 ADP A C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   214 ?   ?   ?   A . n 
A 1 2   GLY 2   215 ?   ?   ?   A . n 
A 1 3   ARG 3   216 ?   ?   ?   A . n 
A 1 4   MET 4   217 ?   ?   ?   A . n 
A 1 5   LYS 5   218 ?   ?   ?   A . n 
A 1 6   ARG 6   219 ?   ?   ?   A . n 
A 1 7   ALA 7   220 ?   ?   ?   A . n 
A 1 8   GLN 8   221 ?   ?   ?   A . n 
A 1 9   GLU 9   222 ?   ?   ?   A . n 
A 1 10  TYR 10  223 ?   ?   ?   A . n 
A 1 11  ASP 11  224 ?   ?   ?   A . n 
A 1 12  SER 12  225 ?   ?   ?   A . n 
A 1 13  SER 13  226 ?   ?   ?   A . n 
A 1 14  PHE 14  227 227 PHE PHE A . n 
A 1 15  PRO 15  228 228 PRO PRO A . n 
A 1 16  ASN 16  229 229 ASN ASN A . n 
A 1 17  TRP 17  230 230 TRP TRP A . n 
A 1 18  GLU 18  231 231 GLU GLU A . n 
A 1 19  PHE 19  232 232 PHE PHE A . n 
A 1 20  ALA 20  233 233 ALA ALA A . n 
A 1 21  ARG 21  234 234 ARG ARG A . n 
A 1 22  MET 22  235 235 MET MET A . n 
A 1 23  ILE 23  236 236 ILE ILE A . n 
A 1 24  LYS 24  237 237 LYS LYS A . n 
A 1 25  GLU 25  238 238 GLU GLU A . n 
A 1 26  PHE 26  239 239 PHE PHE A . n 
A 1 27  ARG 27  240 240 ARG ARG A . n 
A 1 28  ALA 28  241 241 ALA ALA A . n 
A 1 29  THR 29  242 242 THR THR A . n 
A 1 30  LEU 30  243 243 LEU LEU A . n 
A 1 31  GLU 31  244 244 GLU GLU A . n 
A 1 32  CYS 32  245 245 CYS CYS A . n 
A 1 33  HIS 33  246 246 HIS HIS A . n 
A 1 34  PRO 34  247 247 PRO PRO A . n 
A 1 35  LEU 35  248 248 LEU LEU A . n 
A 1 36  THR 36  249 249 THR THR A . n 
A 1 37  MET 37  250 250 MET MET A . n 
A 1 38  THR 38  251 251 THR THR A . n 
A 1 39  ASP 39  252 252 ASP ASP A . n 
A 1 40  PRO 40  253 253 PRO PRO A . n 
A 1 41  ILE 41  254 254 ILE ILE A . n 
A 1 42  GLU 42  255 255 GLU GLU A . n 
A 1 43  GLU 43  256 256 GLU GLU A . n 
A 1 44  HIS 44  257 257 HIS HIS A . n 
A 1 45  ARG 45  258 258 ARG ARG A . n 
A 1 46  ILE 46  259 259 ILE ILE A . n 
A 1 47  CYS 47  260 260 CYS CYS A . n 
A 1 48  VAL 48  261 261 VAL VAL A . n 
A 1 49  CYS 49  262 262 CYS CYS A . n 
A 1 50  VAL 50  263 263 VAL VAL A . n 
A 1 51  ARG 51  264 264 ARG ARG A . n 
A 1 52  LYS 52  265 265 LYS LYS A . n 
A 1 53  ARG 53  266 266 ARG ARG A . n 
A 1 54  PRO 54  267 267 PRO PRO A . n 
A 1 55  LEU 55  268 268 LEU LEU A . n 
A 1 56  ASN 56  269 269 ASN ASN A . n 
A 1 57  LYS 57  270 270 LYS LYS A . n 
A 1 58  GLN 58  271 271 GLN GLN A . n 
A 1 59  GLU 59  272 272 GLU GLU A . n 
A 1 60  LEU 60  273 273 LEU LEU A . n 
A 1 61  ALA 61  274 274 ALA ALA A . n 
A 1 62  LYS 62  275 275 LYS LYS A . n 
A 1 63  LYS 63  276 276 LYS LYS A . n 
A 1 64  GLU 64  277 277 GLU GLU A . n 
A 1 65  ILE 65  278 278 ILE ILE A . n 
A 1 66  ASP 66  279 279 ASP ASP A . n 
A 1 67  VAL 67  280 280 VAL VAL A . n 
A 1 68  ILE 68  281 281 ILE ILE A . n 
A 1 69  SER 69  282 282 SER SER A . n 
A 1 70  ILE 70  283 283 ILE ILE A . n 
A 1 71  PRO 71  284 284 PRO PRO A . n 
A 1 72  SER 72  285 285 SER SER A . n 
A 1 73  LYS 73  286 286 LYS LYS A . n 
A 1 74  CYS 74  287 287 CYS CYS A . n 
A 1 75  LEU 75  288 288 LEU LEU A . n 
A 1 76  LEU 76  289 289 LEU LEU A . n 
A 1 77  LEU 77  290 290 LEU LEU A . n 
A 1 78  VAL 78  291 291 VAL VAL A . n 
A 1 79  HIS 79  292 292 HIS HIS A . n 
A 1 80  GLU 80  293 293 GLU GLU A . n 
A 1 81  LYS 81  297 297 LYS LYS A . n 
A 1 82  VAL 82  298 298 VAL VAL A . n 
A 1 83  ASP 83  299 299 ASP ASP A . n 
A 1 84  TYR 84  303 303 TYR TYR A . n 
A 1 85  LEU 85  304 304 LEU LEU A . n 
A 1 86  GLU 86  305 305 GLU GLU A . n 
A 1 87  ASN 87  306 306 ASN ASN A . n 
A 1 88  GLN 88  307 307 GLN GLN A . n 
A 1 89  ALA 89  308 308 ALA ALA A . n 
A 1 90  PHE 90  309 309 PHE PHE A . n 
A 1 91  CYS 91  310 310 CYS CYS A . n 
A 1 92  PHE 92  311 311 PHE PHE A . n 
A 1 93  ASP 93  312 312 ASP ASP A . n 
A 1 94  PHE 94  313 313 PHE PHE A . n 
A 1 95  ALA 95  314 314 ALA ALA A . n 
A 1 96  PHE 96  315 315 PHE PHE A . n 
A 1 97  ASP 97  316 316 ASP ASP A . n 
A 1 98  GLU 98  317 317 GLU GLU A . n 
A 1 99  THR 99  318 318 THR THR A . n 
A 1 100 ALA 100 319 319 ALA ALA A . n 
A 1 101 SER 101 320 320 SER SER A . n 
A 1 102 ASN 102 321 321 ASN ASN A . n 
A 1 103 GLU 103 322 322 GLU GLU A . n 
A 1 104 VAL 104 323 323 VAL VAL A . n 
A 1 105 VAL 105 324 324 VAL VAL A . n 
A 1 106 TYR 106 325 325 TYR TYR A . n 
A 1 107 ARG 107 326 326 ARG ARG A . n 
A 1 108 PHE 108 327 327 PHE PHE A . n 
A 1 109 THR 109 328 328 THR THR A . n 
A 1 110 ALA 110 329 329 ALA ALA A . n 
A 1 111 ALA 111 330 330 ALA ALA A . n 
A 1 112 PRO 112 331 331 PRO PRO A . n 
A 1 113 LEU 113 332 332 LEU LEU A . n 
A 1 114 VAL 114 333 333 VAL VAL A . n 
A 1 115 GLN 115 334 334 GLN GLN A . n 
A 1 116 THR 116 335 335 THR THR A . n 
A 1 117 ILE 117 336 336 ILE ILE A . n 
A 1 118 PHE 118 337 337 PHE PHE A . n 
A 1 119 GLU 119 338 338 GLU GLU A . n 
A 1 120 GLY 120 339 339 GLY GLY A . n 
A 1 121 GLY 121 340 340 GLY GLY A . n 
A 1 122 LYS 122 341 341 LYS LYS A . n 
A 1 123 ALA 123 342 342 ALA ALA A . n 
A 1 124 THR 124 343 343 THR THR A . n 
A 1 125 CYS 125 344 344 CYS CYS A . n 
A 1 126 PHE 126 345 345 PHE PHE A . n 
A 1 127 ALA 127 346 346 ALA ALA A . n 
A 1 128 TYR 128 347 347 TYR TYR A . n 
A 1 129 GLY 129 348 348 GLY GLY A . n 
A 1 130 GLN 130 349 349 GLN GLN A . n 
A 1 131 THR 131 350 350 THR THR A . n 
A 1 132 GLY 132 351 351 GLY GLY A . n 
A 1 133 SER 133 352 352 SER SER A . n 
A 1 134 GLY 134 353 353 GLY GLY A . n 
A 1 135 LYS 135 354 354 LYS LYS A . n 
A 1 136 THR 136 355 355 THR THR A . n 
A 1 137 HIS 137 356 356 HIS HIS A . n 
A 1 138 THR 138 357 357 THR THR A . n 
A 1 139 MET 139 358 358 MET MET A . n 
A 1 140 GLY 140 359 359 GLY GLY A . n 
A 1 141 GLY 141 360 360 GLY GLY A . n 
A 1 142 ASP 142 361 361 ASP ASP A . n 
A 1 143 LEU 143 362 362 LEU LEU A . n 
A 1 144 SER 144 363 ?   ?   ?   A . n 
A 1 145 GLY 145 364 ?   ?   ?   A . n 
A 1 146 LYS 146 365 ?   ?   ?   A . n 
A 1 147 ALA 147 366 ?   ?   ?   A . n 
A 1 148 GLN 148 367 ?   ?   ?   A . n 
A 1 149 ASN 149 368 ?   ?   ?   A . n 
A 1 150 ALA 150 369 ?   ?   ?   A . n 
A 1 151 SER 151 370 370 SER SER A . n 
A 1 152 LYS 152 371 371 LYS LYS A . n 
A 1 153 GLY 153 372 372 GLY GLY A . n 
A 1 154 ILE 154 373 373 ILE ILE A . n 
A 1 155 TYR 155 374 374 TYR TYR A . n 
A 1 156 ALA 156 375 375 ALA ALA A . n 
A 1 157 MET 157 376 376 MET MET A . n 
A 1 158 ALA 158 377 377 ALA ALA A . n 
A 1 159 SER 159 378 378 SER SER A . n 
A 1 160 ALA 160 379 379 ALA ALA A . n 
A 1 161 ASP 161 380 380 ASP ASP A . n 
A 1 162 VAL 162 381 381 VAL VAL A . n 
A 1 163 PHE 163 382 382 PHE PHE A . n 
A 1 164 LEU 164 383 383 LEU LEU A . n 
A 1 165 LEU 165 384 384 LEU LEU A . n 
A 1 166 LYS 166 385 385 LYS LYS A . n 
A 1 167 ASN 167 386 386 ASN ASN A . n 
A 1 168 GLN 168 387 387 GLN GLN A . n 
A 1 169 PRO 169 388 388 PRO PRO A . n 
A 1 170 CYS 170 389 389 CYS CYS A . n 
A 1 171 TYR 171 390 390 TYR TYR A . n 
A 1 172 ARG 172 391 391 ARG ARG A . n 
A 1 173 LYS 173 392 392 LYS LYS A . n 
A 1 174 LEU 174 393 393 LEU LEU A . n 
A 1 175 GLY 175 394 394 GLY GLY A . n 
A 1 176 LEU 176 395 395 LEU LEU A . n 
A 1 177 GLU 177 396 396 GLU GLU A . n 
A 1 178 VAL 178 397 397 VAL VAL A . n 
A 1 179 TYR 179 398 398 TYR TYR A . n 
A 1 180 VAL 180 399 399 VAL VAL A . n 
A 1 181 THR 181 400 400 THR THR A . n 
A 1 182 PHE 182 401 401 PHE PHE A . n 
A 1 183 PHE 183 402 402 PHE PHE A . n 
A 1 184 GLU 184 403 403 GLU GLU A . n 
A 1 185 ILE 185 404 404 ILE ILE A . n 
A 1 186 TYR 186 405 405 TYR TYR A . n 
A 1 187 ASN 187 406 406 ASN ASN A . n 
A 1 188 GLY 188 407 407 GLY GLY A . n 
A 1 189 LYS 189 408 408 LYS LYS A . n 
A 1 190 LEU 190 409 409 LEU LEU A . n 
A 1 191 PHE 191 410 410 PHE PHE A . n 
A 1 192 ASP 192 411 411 ASP ASP A . n 
A 1 193 LEU 193 412 412 LEU LEU A . n 
A 1 194 LEU 194 413 413 LEU LEU A . n 
A 1 195 ASN 195 414 414 ASN ASN A . n 
A 1 196 LYS 196 415 415 LYS LYS A . n 
A 1 197 LYS 197 416 416 LYS LYS A . n 
A 1 198 ALA 198 417 417 ALA ALA A . n 
A 1 199 LYS 199 418 418 LYS LYS A . n 
A 1 200 LEU 200 419 419 LEU LEU A . n 
A 1 201 ARG 201 420 420 ARG ARG A . n 
A 1 202 VAL 202 421 421 VAL VAL A . n 
A 1 203 LEU 203 422 422 LEU LEU A . n 
A 1 204 GLU 204 423 423 GLU GLU A . n 
A 1 205 ASP 205 424 424 ASP ASP A . n 
A 1 206 GLY 206 425 425 GLY GLY A . n 
A 1 207 LYS 207 426 426 LYS LYS A . n 
A 1 208 GLN 208 427 427 GLN GLN A . n 
A 1 209 GLN 209 428 428 GLN GLN A . n 
A 1 210 VAL 210 429 429 VAL VAL A . n 
A 1 211 GLN 211 430 430 GLN GLN A . n 
A 1 212 VAL 212 431 431 VAL VAL A . n 
A 1 213 VAL 213 432 432 VAL VAL A . n 
A 1 214 GLY 214 433 433 GLY GLY A . n 
A 1 215 LEU 215 434 434 LEU LEU A . n 
A 1 216 GLN 216 435 435 GLN GLN A . n 
A 1 217 GLU 217 436 436 GLU GLU A . n 
A 1 218 HIS 218 437 437 HIS HIS A . n 
A 1 219 LEU 219 438 438 LEU LEU A . n 
A 1 220 VAL 220 439 439 VAL VAL A . n 
A 1 221 ASN 221 440 440 ASN ASN A . n 
A 1 222 SER 222 441 441 SER SER A . n 
A 1 223 ALA 223 442 442 ALA ALA A . n 
A 1 224 ASP 224 443 443 ASP ASP A . n 
A 1 225 ASP 225 444 444 ASP ASP A . n 
A 1 226 VAL 226 445 445 VAL VAL A . n 
A 1 227 ILE 227 446 446 ILE ILE A . n 
A 1 228 LYS 228 447 447 LYS LYS A . n 
A 1 229 MET 229 448 448 MET MET A . n 
A 1 230 ILE 230 449 449 ILE ILE A . n 
A 1 231 ASP 231 450 450 ASP ASP A . n 
A 1 232 MET 232 451 451 MET MET A . n 
A 1 233 GLY 233 452 452 GLY GLY A . n 
A 1 234 SER 234 453 453 SER SER A . n 
A 1 235 ALA 235 454 454 ALA ALA A . n 
A 1 236 CYS 236 455 455 CYS CYS A . n 
A 1 237 ARG 237 456 456 ARG ARG A . n 
A 1 238 THR 238 457 457 THR THR A . n 
A 1 239 SER 239 458 ?   ?   ?   A . n 
A 1 240 GLY 240 459 ?   ?   ?   A . n 
A 1 241 GLN 241 460 ?   ?   ?   A . n 
A 1 242 THR 242 461 ?   ?   ?   A . n 
A 1 243 PHE 243 462 ?   ?   ?   A . n 
A 1 244 ALA 244 463 ?   ?   ?   A . n 
A 1 245 ASN 245 464 ?   ?   ?   A . n 
A 1 246 SER 246 465 ?   ?   ?   A . n 
A 1 247 ASN 247 466 466 ASN ASN A . n 
A 1 248 SER 248 467 467 SER SER A . n 
A 1 249 SER 249 468 468 SER SER A . n 
A 1 250 ARG 250 469 469 ARG ARG A . n 
A 1 251 SER 251 470 470 SER SER A . n 
A 1 252 HIS 252 471 471 HIS HIS A . n 
A 1 253 ALA 253 472 472 ALA ALA A . n 
A 1 254 CYS 254 473 473 CYS CYS A . n 
A 1 255 PHE 255 474 474 PHE PHE A . n 
A 1 256 GLN 256 475 475 GLN GLN A . n 
A 1 257 ILE 257 476 476 ILE ILE A . n 
A 1 258 ILE 258 477 477 ILE ILE A . n 
A 1 259 LEU 259 478 478 LEU LEU A . n 
A 1 260 ARG 260 479 479 ARG ARG A . n 
A 1 261 ALA 261 480 480 ALA ALA A . n 
A 1 262 LYS 262 481 481 LYS LYS A . n 
A 1 263 GLY 263 482 482 GLY GLY A . n 
A 1 264 ARG 264 483 483 ARG ARG A . n 
A 1 265 MET 265 484 484 MET MET A . n 
A 1 266 HIS 266 485 485 HIS HIS A . n 
A 1 267 GLY 267 486 486 GLY GLY A . n 
A 1 268 LYS 268 487 487 LYS LYS A . n 
A 1 269 PHE 269 488 488 PHE PHE A . n 
A 1 270 SER 270 489 489 SER SER A . n 
A 1 271 LEU 271 490 490 LEU LEU A . n 
A 1 272 VAL 272 491 491 VAL VAL A . n 
A 1 273 ASP 273 492 492 ASP ASP A . n 
A 1 274 LEU 274 493 493 LEU LEU A . n 
A 1 275 ALA 275 494 494 ALA ALA A . n 
A 1 276 GLY 276 495 495 GLY GLY A . n 
A 1 277 ASN 277 496 496 ASN ASN A . n 
A 1 278 GLU 278 497 497 GLU GLU A . n 
A 1 279 ARG 279 498 498 ARG ARG A . n 
A 1 280 GLY 280 499 ?   ?   ?   A . n 
A 1 281 ALA 281 500 ?   ?   ?   A . n 
A 1 282 ASP 282 501 ?   ?   ?   A . n 
A 1 283 THR 283 502 ?   ?   ?   A . n 
A 1 284 SER 284 503 ?   ?   ?   A . n 
A 1 285 SER 285 504 ?   ?   ?   A . n 
A 1 286 ALA 286 505 ?   ?   ?   A . n 
A 1 287 ASP 287 506 ?   ?   ?   A . n 
A 1 288 ARG 288 507 ?   ?   ?   A . n 
A 1 289 GLN 289 508 ?   ?   ?   A . n 
A 1 290 THR 290 509 ?   ?   ?   A . n 
A 1 291 ARG 291 510 510 ARG ARG A . n 
A 1 292 MET 292 511 511 MET MET A . n 
A 1 293 GLU 293 512 512 GLU GLU A . n 
A 1 294 GLY 294 513 513 GLY GLY A . n 
A 1 295 ALA 295 514 514 ALA ALA A . n 
A 1 296 GLU 296 515 515 GLU GLU A . n 
A 1 297 ILE 297 516 516 ILE ILE A . n 
A 1 298 ASN 298 517 517 ASN ASN A . n 
A 1 299 LYS 299 518 518 LYS LYS A . n 
A 1 300 SER 300 519 519 SER SER A . n 
A 1 301 LEU 301 520 520 LEU LEU A . n 
A 1 302 LEU 302 521 521 LEU LEU A . n 
A 1 303 ALA 303 522 522 ALA ALA A . n 
A 1 304 LEU 304 523 523 LEU LEU A . n 
A 1 305 LYS 305 524 524 LYS LYS A . n 
A 1 306 GLU 306 525 525 GLU GLU A . n 
A 1 307 CYS 307 526 526 CYS CYS A . n 
A 1 308 ILE 308 527 527 ILE ILE A . n 
A 1 309 ARG 309 528 528 ARG ARG A . n 
A 1 310 ALA 310 529 529 ALA ALA A . n 
A 1 311 LEU 311 530 530 LEU LEU A . n 
A 1 312 GLY 312 531 531 GLY GLY A . n 
A 1 313 GLN 313 532 532 GLN GLN A . n 
A 1 314 ASN 314 533 533 ASN ASN A . n 
A 1 315 LYS 315 534 534 LYS LYS A . n 
A 1 316 ALA 316 535 535 ALA ALA A . n 
A 1 317 HIS 317 536 536 HIS HIS A . n 
A 1 318 THR 318 537 537 THR THR A . n 
A 1 319 PRO 319 538 538 PRO PRO A . n 
A 1 320 PHE 320 539 539 PHE PHE A . n 
A 1 321 ARG 321 540 540 ARG ARG A . n 
A 1 322 GLU 322 541 541 GLU GLU A . n 
A 1 323 SER 323 542 542 SER SER A . n 
A 1 324 LYS 324 543 543 LYS LYS A . n 
A 1 325 LEU 325 544 544 LEU LEU A . n 
A 1 326 THR 326 545 545 THR THR A . n 
A 1 327 GLN 327 546 546 GLN GLN A . n 
A 1 328 VAL 328 547 547 VAL VAL A . n 
A 1 329 LEU 329 548 548 LEU LEU A . n 
A 1 330 ARG 330 549 549 ARG ARG A . n 
A 1 331 ASP 331 550 550 ASP ASP A . n 
A 1 332 SER 332 551 551 SER SER A . n 
A 1 333 PHE 333 552 552 PHE PHE A . n 
A 1 334 ILE 334 553 553 ILE ILE A . n 
A 1 335 GLY 335 554 554 GLY GLY A . n 
A 1 336 GLU 336 555 555 GLU GLU A . n 
A 1 337 ASN 337 556 556 ASN ASN A . n 
A 1 338 SER 338 557 557 SER SER A . n 
A 1 339 ARG 339 558 558 ARG ARG A . n 
A 1 340 THR 340 559 559 THR THR A . n 
A 1 341 CYS 341 560 560 CYS CYS A . n 
A 1 342 MET 342 561 561 MET MET A . n 
A 1 343 ILE 343 562 562 ILE ILE A . n 
A 1 344 ALA 344 563 563 ALA ALA A . n 
A 1 345 THR 345 564 564 THR THR A . n 
A 1 346 ILE 346 565 565 ILE ILE A . n 
A 1 347 SER 347 566 566 SER SER A . n 
A 1 348 PRO 348 567 567 PRO PRO A . n 
A 1 349 GLY 349 568 568 GLY GLY A . n 
A 1 350 ILE 350 569 569 ILE ILE A . n 
A 1 351 SER 351 570 570 SER SER A . n 
A 1 352 SER 352 571 571 SER SER A . n 
A 1 353 CYS 353 572 572 CYS CYS A . n 
A 1 354 GLU 354 573 573 GLU GLU A . n 
A 1 355 TYR 355 574 574 TYR TYR A . n 
A 1 356 THR 356 575 575 THR THR A . n 
A 1 357 LEU 357 576 576 LEU LEU A . n 
A 1 358 ASN 358 577 577 ASN ASN A . n 
A 1 359 THR 359 578 578 THR THR A . n 
A 1 360 LEU 360 579 579 LEU LEU A . n 
A 1 361 ARG 361 580 580 ARG ARG A . n 
A 1 362 TYR 362 581 581 TYR TYR A . n 
A 1 363 ALA 363 582 582 ALA ALA A . n 
A 1 364 ASP 364 583 583 ASP ASP A . n 
A 1 365 ARG 365 584 584 ARG ARG A . n 
A 1 366 VAL 366 585 585 VAL VAL A . n 
A 1 367 LYS 367 586 586 LYS LYS A . n 
A 1 368 GLU 368 587 587 GLU GLU A . n 
A 1 369 LEU 369 588 588 LEU LEU A . n 
A 1 370 SER 370 589 ?   ?   ?   A . n 
A 1 371 PRO 371 590 ?   ?   ?   A . n 
A 1 372 HIS 372 591 ?   ?   ?   A . n 
A 1 373 SER 373 592 ?   ?   ?   A . n 
A 1 374 GLY 374 593 ?   ?   ?   A . n 
A 1 375 PRO 375 594 ?   ?   ?   A . n 
A 1 376 SER 376 595 ?   ?   ?   A . n 
A 1 377 GLY 377 596 ?   ?   ?   A . n 
A 1 378 GLU 378 597 ?   ?   ?   A . n 
A 1 379 GLN 379 598 ?   ?   ?   A . n 
A 1 380 LEU 380 599 ?   ?   ?   A . n 
A 1 381 GLU 381 600 ?   ?   ?   A . n 
A 1 382 HIS 382 601 ?   ?   ?   A . n 
A 1 383 HIS 383 602 ?   ?   ?   A . n 
A 1 384 HIS 384 603 ?   ?   ?   A . n 
A 1 385 HIS 385 604 ?   ?   ?   A . n 
A 1 386 HIS 386 605 ?   ?   ?   A . n 
A 1 387 HIS 387 606 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 MG  1  701 602 MG  MG  A . 
C 3 ADP 1  702 601 ADP ADP A . 
D 4 SO4 1  703 1   SO4 SO4 A . 
E 4 SO4 1  704 2   SO4 SO4 A . 
F 4 SO4 1  705 3   SO4 SO4 A . 
G 5 HOH 1  801 27  HOH HOH A . 
G 5 HOH 2  802 3   HOH HOH A . 
G 5 HOH 3  803 26  HOH HOH A . 
G 5 HOH 4  804 15  HOH HOH A . 
G 5 HOH 5  805 41  HOH HOH A . 
G 5 HOH 6  806 19  HOH HOH A . 
G 5 HOH 7  807 52  HOH HOH A . 
G 5 HOH 8  808 28  HOH HOH A . 
G 5 HOH 9  809 32  HOH HOH A . 
G 5 HOH 10 810 8   HOH HOH A . 
G 5 HOH 11 811 47  HOH HOH A . 
G 5 HOH 12 812 37  HOH HOH A . 
G 5 HOH 13 813 12  HOH HOH A . 
G 5 HOH 14 814 1   HOH HOH A . 
G 5 HOH 15 815 2   HOH HOH A . 
G 5 HOH 16 816 4   HOH HOH A . 
G 5 HOH 17 817 5   HOH HOH A . 
G 5 HOH 18 818 6   HOH HOH A . 
G 5 HOH 19 819 7   HOH HOH A . 
G 5 HOH 20 820 9   HOH HOH A . 
G 5 HOH 21 821 10  HOH HOH A . 
G 5 HOH 22 822 11  HOH HOH A . 
G 5 HOH 23 823 13  HOH HOH A . 
G 5 HOH 24 824 14  HOH HOH A . 
G 5 HOH 25 825 16  HOH HOH A . 
G 5 HOH 26 826 17  HOH HOH A . 
G 5 HOH 27 827 18  HOH HOH A . 
G 5 HOH 28 828 20  HOH HOH A . 
G 5 HOH 29 829 21  HOH HOH A . 
G 5 HOH 30 830 22  HOH HOH A . 
G 5 HOH 31 831 23  HOH HOH A . 
G 5 HOH 32 832 24  HOH HOH A . 
G 5 HOH 33 833 25  HOH HOH A . 
G 5 HOH 34 834 29  HOH HOH A . 
G 5 HOH 35 835 30  HOH HOH A . 
G 5 HOH 36 836 31  HOH HOH A . 
G 5 HOH 37 837 33  HOH HOH A . 
G 5 HOH 38 838 34  HOH HOH A . 
G 5 HOH 39 839 35  HOH HOH A . 
G 5 HOH 40 840 36  HOH HOH A . 
G 5 HOH 41 841 38  HOH HOH A . 
G 5 HOH 42 842 39  HOH HOH A . 
G 5 HOH 43 843 40  HOH HOH A . 
G 5 HOH 44 844 42  HOH HOH A . 
G 5 HOH 45 845 43  HOH HOH A . 
G 5 HOH 46 846 44  HOH HOH A . 
G 5 HOH 47 847 45  HOH HOH A . 
G 5 HOH 48 848 46  HOH HOH A . 
G 5 HOH 49 849 48  HOH HOH A . 
G 5 HOH 50 850 49  HOH HOH A . 
G 5 HOH 51 851 50  HOH HOH A . 
G 5 HOH 52 852 51  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1230  ? 
1 MORE         -50   ? 
1 'SSA (A^2)'  15030 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 OG1 ? A THR 136 ? A THR 355 ? 1_555 MG ? B MG . ? A MG 701 ? 1_555 O1B ? C ADP . ? A ADP 702 ? 1_555 89.3  ? 
2 OG1 ? A THR 136 ? A THR 355 ? 1_555 MG ? B MG . ? A MG 701 ? 1_555 O   ? G HOH . ? A HOH 814 ? 1_555 88.5  ? 
3 O1B ? C ADP .   ? A ADP 702 ? 1_555 MG ? B MG . ? A MG 701 ? 1_555 O   ? G HOH . ? A HOH 814 ? 1_555 94.1  ? 
4 OG1 ? A THR 136 ? A THR 355 ? 1_555 MG ? B MG . ? A MG 701 ? 1_555 O   ? G HOH . ? A HOH 815 ? 1_555 97.1  ? 
5 O1B ? C ADP .   ? A ADP 702 ? 1_555 MG ? B MG . ? A MG 701 ? 1_555 O   ? G HOH . ? A HOH 815 ? 1_555 89.0  ? 
6 O   ? G HOH .   ? A HOH 814 ? 1_555 MG ? B MG . ? A MG 701 ? 1_555 O   ? G HOH . ? A HOH 815 ? 1_555 173.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-06-17 
2 'Structure model' 1 1 2015-06-24 
3 'Structure model' 1 2 2015-08-05 
4 'Structure model' 1 3 2019-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 4 'Structure model' 'Data collection'     
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            reflns_shell 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    4 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_reflns_shell.Rmerge_I_obs' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         7.5833 
_pdbx_refine_tls.origin_y         -19.2571 
_pdbx_refine_tls.origin_z         15.2363 
_pdbx_refine_tls.T[1][1]          -1.0823 
_pdbx_refine_tls.T[1][1]_esd      ? 
_pdbx_refine_tls.T[1][2]          -0.0060 
_pdbx_refine_tls.T[1][2]_esd      ? 
_pdbx_refine_tls.T[1][3]          0.0548 
_pdbx_refine_tls.T[1][3]_esd      ? 
_pdbx_refine_tls.T[2][2]          -0.7940 
_pdbx_refine_tls.T[2][2]_esd      ? 
_pdbx_refine_tls.T[2][3]          -0.1091 
_pdbx_refine_tls.T[2][3]_esd      ? 
_pdbx_refine_tls.T[3][3]          -0.9413 
_pdbx_refine_tls.T[3][3]_esd      ? 
_pdbx_refine_tls.L[1][1]          4.5735 
_pdbx_refine_tls.L[1][1]_esd      ? 
_pdbx_refine_tls.L[1][2]          1.4028 
_pdbx_refine_tls.L[1][2]_esd      ? 
_pdbx_refine_tls.L[1][3]          3.6805 
_pdbx_refine_tls.L[1][3]_esd      ? 
_pdbx_refine_tls.L[2][2]          2.5009 
_pdbx_refine_tls.L[2][2]_esd      ? 
_pdbx_refine_tls.L[2][3]          2.8629 
_pdbx_refine_tls.L[2][3]_esd      ? 
_pdbx_refine_tls.L[3][3]          7.1725 
_pdbx_refine_tls.L[3][3]_esd      ? 
_pdbx_refine_tls.S[1][1]          -0.0728 
_pdbx_refine_tls.S[1][1]_esd      ? 
_pdbx_refine_tls.S[1][2]          0.8316 
_pdbx_refine_tls.S[1][2]_esd      ? 
_pdbx_refine_tls.S[1][3]          -0.4469 
_pdbx_refine_tls.S[1][3]_esd      ? 
_pdbx_refine_tls.S[2][1]          -0.1564 
_pdbx_refine_tls.S[2][1]_esd      ? 
_pdbx_refine_tls.S[2][2]          0.4367 
_pdbx_refine_tls.S[2][2]_esd      ? 
_pdbx_refine_tls.S[2][3]          -0.3306 
_pdbx_refine_tls.S[2][3]_esd      ? 
_pdbx_refine_tls.S[3][1]          -0.2602 
_pdbx_refine_tls.S[3][1]_esd      ? 
_pdbx_refine_tls.S[3][2]          0.4913 
_pdbx_refine_tls.S[3][2]_esd      ? 
_pdbx_refine_tls.S[3][3]          -0.3639 
_pdbx_refine_tls.S[3][3]_esd      ? 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     227 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     588 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   '{ A|* }' 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALA       ? ? ? 3.3.20          1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .               2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? BUSTER-TNT  ? ? ? 'BUSTER 2.10.0' 3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15            4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .               5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 228 ? ? -65.49  -74.39  
2 1 ASN A 229 ? ? -65.07  75.17   
3 1 TRP A 230 ? ? 35.51   -151.50 
4 1 VAL A 298 ? ? -161.34 52.09   
5 1 THR A 328 ? ? -112.09 -85.99  
6 1 ARG A 456 ? ? -39.67  112.43  
7 1 LYS A 481 ? ? -152.58 38.69   
8 1 ASN A 556 ? ? -109.63 41.85   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A PHE 227 ? CG  ? A PHE 14  CG  
2  1 Y 1 A PHE 227 ? CD1 ? A PHE 14  CD1 
3  1 Y 1 A PHE 227 ? CD2 ? A PHE 14  CD2 
4  1 Y 1 A PHE 227 ? CE1 ? A PHE 14  CE1 
5  1 Y 1 A PHE 227 ? CE2 ? A PHE 14  CE2 
6  1 Y 1 A PHE 227 ? CZ  ? A PHE 14  CZ  
7  1 Y 1 A ARG 234 ? CG  ? A ARG 21  CG  
8  1 Y 1 A ARG 234 ? CD  ? A ARG 21  CD  
9  1 Y 1 A ARG 234 ? NE  ? A ARG 21  NE  
10 1 Y 1 A ARG 234 ? CZ  ? A ARG 21  CZ  
11 1 Y 1 A ARG 234 ? NH1 ? A ARG 21  NH1 
12 1 Y 1 A ARG 234 ? NH2 ? A ARG 21  NH2 
13 1 Y 1 A GLU 238 ? CG  ? A GLU 25  CG  
14 1 Y 1 A GLU 238 ? CD  ? A GLU 25  CD  
15 1 Y 1 A GLU 238 ? OE1 ? A GLU 25  OE1 
16 1 Y 1 A GLU 238 ? OE2 ? A GLU 25  OE2 
17 1 Y 1 A LYS 270 ? CG  ? A LYS 57  CG  
18 1 Y 1 A LYS 270 ? CD  ? A LYS 57  CD  
19 1 Y 1 A LYS 270 ? CE  ? A LYS 57  CE  
20 1 Y 1 A LYS 270 ? NZ  ? A LYS 57  NZ  
21 1 Y 1 A LYS 276 ? CG  ? A LYS 63  CG  
22 1 Y 1 A LYS 276 ? CD  ? A LYS 63  CD  
23 1 Y 1 A LYS 276 ? CE  ? A LYS 63  CE  
24 1 Y 1 A LYS 276 ? NZ  ? A LYS 63  NZ  
25 1 Y 1 A GLN 334 ? CG  ? A GLN 115 CG  
26 1 Y 1 A GLN 334 ? CD  ? A GLN 115 CD  
27 1 Y 1 A GLN 334 ? OE1 ? A GLN 115 OE1 
28 1 Y 1 A GLN 334 ? NE2 ? A GLN 115 NE2 
29 1 Y 1 A SER 370 ? OG  ? A SER 151 OG  
30 1 Y 1 A LYS 371 ? CG  ? A LYS 152 CG  
31 1 Y 1 A LYS 371 ? CD  ? A LYS 152 CD  
32 1 Y 1 A LYS 371 ? CE  ? A LYS 152 CE  
33 1 Y 1 A LYS 371 ? NZ  ? A LYS 152 NZ  
34 1 Y 1 A ASN 386 ? CG  ? A ASN 167 CG  
35 1 Y 1 A ASN 386 ? OD1 ? A ASN 167 OD1 
36 1 Y 1 A ASN 386 ? ND2 ? A ASN 167 ND2 
37 1 Y 1 A ARG 391 ? CG  ? A ARG 172 CG  
38 1 Y 1 A ARG 391 ? CD  ? A ARG 172 CD  
39 1 Y 1 A ARG 391 ? NE  ? A ARG 172 NE  
40 1 Y 1 A ARG 391 ? CZ  ? A ARG 172 CZ  
41 1 Y 1 A ARG 391 ? NH1 ? A ARG 172 NH1 
42 1 Y 1 A ARG 391 ? NH2 ? A ARG 172 NH2 
43 1 Y 1 A LYS 392 ? CG  ? A LYS 173 CG  
44 1 Y 1 A LYS 392 ? CD  ? A LYS 173 CD  
45 1 Y 1 A LYS 392 ? CE  ? A LYS 173 CE  
46 1 Y 1 A LYS 392 ? NZ  ? A LYS 173 NZ  
47 1 Y 1 A LEU 393 ? CG  ? A LEU 174 CG  
48 1 Y 1 A LEU 393 ? CD1 ? A LEU 174 CD1 
49 1 Y 1 A LEU 393 ? CD2 ? A LEU 174 CD2 
50 1 Y 1 A LYS 415 ? CG  ? A LYS 196 CG  
51 1 Y 1 A LYS 415 ? CD  ? A LYS 196 CD  
52 1 Y 1 A LYS 415 ? CE  ? A LYS 196 CE  
53 1 Y 1 A LYS 415 ? NZ  ? A LYS 196 NZ  
54 1 Y 1 A LYS 418 ? CG  ? A LYS 199 CG  
55 1 Y 1 A LYS 418 ? CD  ? A LYS 199 CD  
56 1 Y 1 A LYS 418 ? CE  ? A LYS 199 CE  
57 1 Y 1 A LYS 418 ? NZ  ? A LYS 199 NZ  
58 1 Y 1 A ARG 420 ? CG  ? A ARG 201 CG  
59 1 Y 1 A ARG 420 ? CD  ? A ARG 201 CD  
60 1 Y 1 A ARG 420 ? NE  ? A ARG 201 NE  
61 1 Y 1 A ARG 420 ? CZ  ? A ARG 201 CZ  
62 1 Y 1 A ARG 420 ? NH1 ? A ARG 201 NH1 
63 1 Y 1 A ARG 420 ? NH2 ? A ARG 201 NH2 
64 1 Y 1 A LYS 447 ? CG  ? A LYS 228 CG  
65 1 Y 1 A LYS 447 ? CD  ? A LYS 228 CD  
66 1 Y 1 A LYS 447 ? CE  ? A LYS 228 CE  
67 1 Y 1 A LYS 447 ? NZ  ? A LYS 228 NZ  
68 1 Y 1 A ARG 456 ? CG  ? A ARG 237 CG  
69 1 Y 1 A ARG 456 ? CD  ? A ARG 237 CD  
70 1 Y 1 A ARG 456 ? NE  ? A ARG 237 NE  
71 1 Y 1 A ARG 456 ? CZ  ? A ARG 237 CZ  
72 1 Y 1 A ARG 456 ? NH1 ? A ARG 237 NH1 
73 1 Y 1 A ARG 456 ? NH2 ? A ARG 237 NH2 
74 1 Y 1 A ASN 466 ? CG  ? A ASN 247 CG  
75 1 Y 1 A ASN 466 ? OD1 ? A ASN 247 OD1 
76 1 Y 1 A ASN 466 ? ND2 ? A ASN 247 ND2 
77 1 Y 1 A ARG 483 ? CG  ? A ARG 264 CG  
78 1 Y 1 A ARG 483 ? CD  ? A ARG 264 CD  
79 1 Y 1 A ARG 483 ? NE  ? A ARG 264 NE  
80 1 Y 1 A ARG 483 ? CZ  ? A ARG 264 CZ  
81 1 Y 1 A ARG 483 ? NH1 ? A ARG 264 NH1 
82 1 Y 1 A ARG 483 ? NH2 ? A ARG 264 NH2 
83 1 Y 1 A ARG 498 ? CG  ? A ARG 279 CG  
84 1 Y 1 A ARG 498 ? CD  ? A ARG 279 CD  
85 1 Y 1 A ARG 498 ? NE  ? A ARG 279 NE  
86 1 Y 1 A ARG 498 ? CZ  ? A ARG 279 CZ  
87 1 Y 1 A ARG 498 ? NH1 ? A ARG 279 NH1 
88 1 Y 1 A ARG 498 ? NH2 ? A ARG 279 NH2 
89 1 Y 1 A ARG 510 ? CG  ? A ARG 291 CG  
90 1 Y 1 A ARG 510 ? CD  ? A ARG 291 CD  
91 1 Y 1 A ARG 510 ? NE  ? A ARG 291 NE  
92 1 Y 1 A ARG 510 ? CZ  ? A ARG 291 CZ  
93 1 Y 1 A ARG 510 ? NH1 ? A ARG 291 NH1 
94 1 Y 1 A ARG 510 ? NH2 ? A ARG 291 NH2 
95 1 Y 1 A GLN 532 ? CD  ? A GLN 313 CD  
96 1 Y 1 A GLN 532 ? OE1 ? A GLN 313 OE1 
97 1 Y 1 A GLN 532 ? NE2 ? A GLN 313 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 214 ? A MET 1   
2  1 Y 1 A GLY 215 ? A GLY 2   
3  1 Y 1 A ARG 216 ? A ARG 3   
4  1 Y 1 A MET 217 ? A MET 4   
5  1 Y 1 A LYS 218 ? A LYS 5   
6  1 Y 1 A ARG 219 ? A ARG 6   
7  1 Y 1 A ALA 220 ? A ALA 7   
8  1 Y 1 A GLN 221 ? A GLN 8   
9  1 Y 1 A GLU 222 ? A GLU 9   
10 1 Y 1 A TYR 223 ? A TYR 10  
11 1 Y 1 A ASP 224 ? A ASP 11  
12 1 Y 1 A SER 225 ? A SER 12  
13 1 Y 1 A SER 226 ? A SER 13  
14 1 Y 1 A SER 363 ? A SER 144 
15 1 Y 1 A GLY 364 ? A GLY 145 
16 1 Y 1 A LYS 365 ? A LYS 146 
17 1 Y 1 A ALA 366 ? A ALA 147 
18 1 Y 1 A GLN 367 ? A GLN 148 
19 1 Y 1 A ASN 368 ? A ASN 149 
20 1 Y 1 A ALA 369 ? A ALA 150 
21 1 Y 1 A SER 458 ? A SER 239 
22 1 Y 1 A GLY 459 ? A GLY 240 
23 1 Y 1 A GLN 460 ? A GLN 241 
24 1 Y 1 A THR 461 ? A THR 242 
25 1 Y 1 A PHE 462 ? A PHE 243 
26 1 Y 1 A ALA 463 ? A ALA 244 
27 1 Y 1 A ASN 464 ? A ASN 245 
28 1 Y 1 A SER 465 ? A SER 246 
29 1 Y 1 A GLY 499 ? A GLY 280 
30 1 Y 1 A ALA 500 ? A ALA 281 
31 1 Y 1 A ASP 501 ? A ASP 282 
32 1 Y 1 A THR 502 ? A THR 283 
33 1 Y 1 A SER 503 ? A SER 284 
34 1 Y 1 A SER 504 ? A SER 285 
35 1 Y 1 A ALA 505 ? A ALA 286 
36 1 Y 1 A ASP 506 ? A ASP 287 
37 1 Y 1 A ARG 507 ? A ARG 288 
38 1 Y 1 A GLN 508 ? A GLN 289 
39 1 Y 1 A THR 509 ? A THR 290 
40 1 Y 1 A SER 589 ? A SER 370 
41 1 Y 1 A PRO 590 ? A PRO 371 
42 1 Y 1 A HIS 591 ? A HIS 372 
43 1 Y 1 A SER 592 ? A SER 373 
44 1 Y 1 A GLY 593 ? A GLY 374 
45 1 Y 1 A PRO 594 ? A PRO 375 
46 1 Y 1 A SER 595 ? A SER 376 
47 1 Y 1 A GLY 596 ? A GLY 377 
48 1 Y 1 A GLU 597 ? A GLU 378 
49 1 Y 1 A GLN 598 ? A GLN 379 
50 1 Y 1 A LEU 599 ? A LEU 380 
51 1 Y 1 A GLU 600 ? A GLU 381 
52 1 Y 1 A HIS 601 ? A HIS 382 
53 1 Y 1 A HIS 602 ? A HIS 383 
54 1 Y 1 A HIS 603 ? A HIS 384 
55 1 Y 1 A HIS 604 ? A HIS 385 
56 1 Y 1 A HIS 605 ? A HIS 386 
57 1 Y 1 A HIS 606 ? A HIS 387 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MAGNESIUM ION'            MG  
3 "ADENOSINE-5'-DIPHOSPHATE" ADP 
4 'SULFATE ION'              SO4 
5 water                      HOH 
#