data_4Y0F
# 
_entry.id   4Y0F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Y0F         
WWPDB D_1000206625 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          4Y00 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4Y0F 
_pdbx_database_status.recvd_initial_deposition_date   2015-02-06 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Chiang, C.H.'  1 
'Kuo, P.H.'     2 
'Doudeva, L.G.' 3 
'Wang, Y.T.'    4 
'Yuan, H.S.'    5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Sci Rep' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2045-2322 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                21581 
_citation.page_last                 21581 
_citation.title                     
;Structural analysis of disease-related TDP-43 D169G mutation: linking enhanced stability and caspase cleavage efficiency to protein accumulation
;
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/srep21581 
_citation.pdbx_database_id_PubMed   26883171 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Chiang, C.H.'  1 
primary 'Grauffel, C.'  2 
primary 'Wu, L.S.'      3 
primary 'Kuo, P.H.'     4 
primary 'Doudeva, L.G.' 5 
primary 'Lim, C.'       6 
primary 'Shen, C.K.'    7 
primary 'Yuan, H.S.'    8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4Y0F 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     100.027 
_cell.length_a_esd                 ? 
_cell.length_b                     100.027 
_cell.length_b_esd                 ? 
_cell.length_c                     98.144 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4Y0F 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                179 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 65 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'TAR DNA-binding protein 43'                   12064.745 2  ? ? 'UNP residues 101-191' ? 
2 polymer syn 
;DNA (5'-D(*GP*TP*TP*GP*AP*GP*CP*GP*TP*T)-3')
;
3091.026  2  ? ? ?                      ? 
3 water   nat water                                          18.015    37 ? ? ?                      ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        TDP-43 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MRGSHHHHHHGSQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMI
DGRWCDCKLPNSKQSQDEPLRSR
;
;MRGSHHHHHHGSQKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMI
DGRWCDCKLPNSKQSQDEPLRSR
;
A,B ? 
2 polydeoxyribonucleotide no no '(DG)(DT)(DT)(DG)(DA)(DG)(DC)(DG)(DT)(DT)' GTTGAGCGTT C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  GLY n 
1 12  SER n 
1 13  GLN n 
1 14  LYS n 
1 15  THR n 
1 16  SER n 
1 17  ASP n 
1 18  LEU n 
1 19  ILE n 
1 20  VAL n 
1 21  LEU n 
1 22  GLY n 
1 23  LEU n 
1 24  PRO n 
1 25  TRP n 
1 26  LYS n 
1 27  THR n 
1 28  THR n 
1 29  GLU n 
1 30  GLN n 
1 31  ASP n 
1 32  LEU n 
1 33  LYS n 
1 34  GLU n 
1 35  TYR n 
1 36  PHE n 
1 37  SER n 
1 38  THR n 
1 39  PHE n 
1 40  GLY n 
1 41  GLU n 
1 42  VAL n 
1 43  LEU n 
1 44  MET n 
1 45  VAL n 
1 46  GLN n 
1 47  VAL n 
1 48  LYS n 
1 49  LYS n 
1 50  ASP n 
1 51  LEU n 
1 52  LYS n 
1 53  THR n 
1 54  GLY n 
1 55  HIS n 
1 56  SER n 
1 57  LYS n 
1 58  GLY n 
1 59  PHE n 
1 60  GLY n 
1 61  PHE n 
1 62  VAL n 
1 63  ARG n 
1 64  PHE n 
1 65  THR n 
1 66  GLU n 
1 67  TYR n 
1 68  GLU n 
1 69  THR n 
1 70  GLN n 
1 71  VAL n 
1 72  LYS n 
1 73  VAL n 
1 74  MET n 
1 75  SER n 
1 76  GLN n 
1 77  ARG n 
1 78  HIS n 
1 79  MET n 
1 80  ILE n 
1 81  ASP n 
1 82  GLY n 
1 83  ARG n 
1 84  TRP n 
1 85  CYS n 
1 86  ASP n 
1 87  CYS n 
1 88  LYS n 
1 89  LEU n 
1 90  PRO n 
1 91  ASN n 
1 92  SER n 
1 93  LYS n 
1 94  GLN n 
1 95  SER n 
1 96  GLN n 
1 97  ASP n 
1 98  GLU n 
1 99  PRO n 
1 100 LEU n 
1 101 ARG n 
1 102 SER n 
1 103 ARG n 
2 1   DG  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DA  n 
2 6   DG  n 
2 7   DC  n 
2 8   DG  n 
2 9   DT  n 
2 10  DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   103 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'TARDBP, TDP43' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pQE30 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       10 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP TADBP_HUMAN Q13148 ? 1 
;QKTSDLIVLGLPWKTTEQDLKEYFSTFGEVLMVQVKKDLKTGHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNS
KQSQDEPLRSR
;
101 
2 PDB 4Y0F        4Y0F   ? 2 ?                                                                                              1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4Y0F A 13 ? 103 ? Q13148 101 ? 191 ? 101 191 
2 1 4Y0F B 13 ? 103 ? Q13148 101 ? 191 ? 101 191 
3 2 4Y0F C 1  ? 10  ? 4Y0F   1   ? 10  ? 1   10  
4 2 4Y0F D 1  ? 10  ? 4Y0F   1   ? 10  ? 1   10  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Y0F MET A 1  ? UNP Q13148 ? ? 'expression tag' 89  1  
1 4Y0F ARG A 2  ? UNP Q13148 ? ? 'expression tag' 90  2  
1 4Y0F GLY A 3  ? UNP Q13148 ? ? 'expression tag' 91  3  
1 4Y0F SER A 4  ? UNP Q13148 ? ? 'expression tag' 92  4  
1 4Y0F HIS A 5  ? UNP Q13148 ? ? 'expression tag' 93  5  
1 4Y0F HIS A 6  ? UNP Q13148 ? ? 'expression tag' 94  6  
1 4Y0F HIS A 7  ? UNP Q13148 ? ? 'expression tag' 95  7  
1 4Y0F HIS A 8  ? UNP Q13148 ? ? 'expression tag' 96  8  
1 4Y0F HIS A 9  ? UNP Q13148 ? ? 'expression tag' 97  9  
1 4Y0F HIS A 10 ? UNP Q13148 ? ? 'expression tag' 98  10 
1 4Y0F GLY A 11 ? UNP Q13148 ? ? 'expression tag' 99  11 
1 4Y0F SER A 12 ? UNP Q13148 ? ? 'expression tag' 100 12 
2 4Y0F MET B 1  ? UNP Q13148 ? ? 'expression tag' 89  13 
2 4Y0F ARG B 2  ? UNP Q13148 ? ? 'expression tag' 90  14 
2 4Y0F GLY B 3  ? UNP Q13148 ? ? 'expression tag' 91  15 
2 4Y0F SER B 4  ? UNP Q13148 ? ? 'expression tag' 92  16 
2 4Y0F HIS B 5  ? UNP Q13148 ? ? 'expression tag' 93  17 
2 4Y0F HIS B 6  ? UNP Q13148 ? ? 'expression tag' 94  18 
2 4Y0F HIS B 7  ? UNP Q13148 ? ? 'expression tag' 95  19 
2 4Y0F HIS B 8  ? UNP Q13148 ? ? 'expression tag' 96  20 
2 4Y0F HIS B 9  ? UNP Q13148 ? ? 'expression tag' 97  21 
2 4Y0F HIS B 10 ? UNP Q13148 ? ? 'expression tag' 98  22 
2 4Y0F GLY B 11 ? UNP Q13148 ? ? 'expression tag' 99  23 
2 4Y0F SER B 12 ? UNP Q13148 ? ? 'expression tag' 100 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4Y0F 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.34 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.39 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    'room temperature' 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.12M ammonium acetate, 0.08M BIS-TRIS, pH 5.5, 20% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   5.5-7.5 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           110 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU SATURN 944+' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-02-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    Cu 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU FR-E+ SUPERBRIGHT' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4Y0F 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.648 
_reflns.d_resolution_low                 27.701 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       8322 
_reflns.number_obs                       7991 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             93.63 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  9.7 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            44.43 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4Y0F 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.648 
_refine.ls_d_res_low                             27.701 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     7991 
_refine.ls_number_reflns_R_free                  797 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    89.94 
_refine.ls_percent_reflns_R_free                 9.97 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2451 
_refine.ls_R_factor_R_free                       0.2883 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2404 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4IUF 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.60 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.35 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1264 
_refine_hist.pdbx_number_atoms_nucleic_acid   289 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             37 
_refine_hist.number_atoms_total               1590 
_refine_hist.d_res_high                       2.648 
_refine_hist.d_res_low                        27.701 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 1615 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.664  ? 2232 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 20.486 ? 613  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.039  ? 244  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.002  ? 229  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.6479 2.8137  . . 110 955  74.00 . . . 0.3999 . 0.2957 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8137 3.0306  . . 114 1070 82.00 . . . 0.3334 . 0.3052 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0306 3.3352  . . 128 1187 90.00 . . . 0.3647 . 0.2757 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3352 3.8167  . . 140 1244 95.00 . . . 0.3165 . 0.2307 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8167 4.8046  . . 146 1313 98.00 . . . 0.2413 . 0.2090 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8046 27.7028 . . 159 1425 99.00 . . . 0.2484 . 0.2330 . . . . . . . . . . 
# 
_struct.entry_id                     4Y0F 
_struct.title                        
'Crystal Structure of Human TDP-43 RRM1 Domain in Complex with an Unmodified Single-stranded DNA' 
_struct.pdbx_descriptor              'TAR DNA-binding protein 43/DNA' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4Y0F 
_struct_keywords.text            'RNA recognition motif 1 Complex, DNA BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 28 ? SER A 37 ? THR A 116 SER A 125 1 ? 10 
HELX_P HELX_P2 AA2 GLU A 66 ? SER A 75 ? GLU A 154 SER A 163 1 ? 10 
HELX_P HELX_P3 AA3 THR B 28 ? SER B 37 ? THR B 116 SER B 125 1 ? 10 
HELX_P HELX_P4 AA4 GLU B 66 ? SER B 75 ? GLU B 154 SER B 163 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1 hydrog ? ? C DG 1 N2 ? ? ? 1_555 C DT 3 O2 ? ? C DG 1 C DT 3 12_554 ? ? ? ? ? ? 'DG-DT MISPAIR' ? ? 
hydrog2 hydrog ? ? C DG 1 N1 ? ? ? 1_555 C DA 5 N1 ? ? C DG 1 C DA 5 12_554 ? ? ? ? ? ? 'DG-DA MISPAIR' ? ? 
hydrog3 hydrog ? ? C DT 3 O2 ? ? ? 1_555 C DG 1 N2 ? ? C DT 3 C DG 1 12_554 ? ? ? ? ? ? 'DT-DG MISPAIR' ? ? 
hydrog4 hydrog ? ? C DA 5 N1 ? ? ? 1_555 C DG 1 N1 ? ? C DA 5 C DG 1 12_554 ? ? ? ? ? ? 'DA-DG MISPAIR' ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 42 ? LYS A 49 ? VAL A 130 LYS A 137 
AA1 2 SER A 56 ? PHE A 64 ? SER A 144 PHE A 152 
AA1 3 LEU A 18 ? LEU A 21 ? LEU A 106 LEU A 109 
AA1 4 ARG A 83 ? LYS A 88 ? ARG A 171 LYS A 176 
AA1 5 HIS A 78 ? ILE A 80 ? HIS A 166 ILE A 168 
AA2 1 VAL B 42 ? LYS B 49 ? VAL B 130 LYS B 137 
AA2 2 SER B 56 ? PHE B 64 ? SER B 144 PHE B 152 
AA2 3 LEU B 18 ? LEU B 21 ? LEU B 106 LEU B 109 
AA2 4 ARG B 83 ? LYS B 88 ? ARG B 171 LYS B 176 
AA2 5 HIS B 78 ? ILE B 80 ? HIS B 166 ILE B 168 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 48 ? N LYS A 136 O LYS A 57 ? O LYS A 145 
AA1 2 3 O GLY A 60 ? O GLY A 148 N VAL A 20 ? N VAL A 108 
AA1 3 4 N LEU A 21 ? N LEU A 109 O ASP A 86 ? O ASP A 174 
AA1 4 5 O CYS A 85 ? O CYS A 173 N HIS A 78 ? N HIS A 166 
AA2 1 2 N LEU B 43 ? N LEU B 131 O ARG B 63 ? O ARG B 151 
AA2 2 3 O VAL B 62 ? O VAL B 150 N LEU B 18 ? N LEU B 106 
AA2 3 4 N LEU B 21 ? N LEU B 109 O ASP B 86 ? O ASP B 174 
AA2 4 5 O CYS B 85 ? O CYS B 173 N HIS B 78 ? N HIS B 166 
# 
_atom_sites.entry_id                    4Y0F 
_atom_sites.fract_transf_matrix[1][1]   0.009997 
_atom_sites.fract_transf_matrix[1][2]   0.005772 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011544 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010189 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . THR A 1 15 ? 2.199   -22.854 8.400   1.00 42.77  ?  103 THR A N     1 
ATOM   2    C CA    . THR A 1 15 ? 2.817   -23.931 7.636   1.00 40.76  ?  103 THR A CA    1 
ATOM   3    C C     . THR A 1 15 ? 1.765   -24.825 6.987   1.00 47.34  ?  103 THR A C     1 
ATOM   4    O O     . THR A 1 15 ? 2.093   -25.865 6.416   1.00 56.37  ?  103 THR A O     1 
ATOM   5    C CB    . THR A 1 15 ? 3.720   -24.805 8.525   1.00 45.77  ?  103 THR A CB    1 
ATOM   6    O OG1   . THR A 1 15 ? 2.928   -25.458 9.525   1.00 44.31  ?  103 THR A OG1   1 
ATOM   7    C CG2   . THR A 1 15 ? 4.796   -23.960 9.194   1.00 47.35  ?  103 THR A CG2   1 
ATOM   8    H HA    . THR A 1 15 ? 3.370   -23.544 6.925   1.00 48.91  ?  103 THR A HA    1 
ATOM   9    H HB    . THR A 1 15 ? 4.158   -25.474 7.976   1.00 54.92  ?  103 THR A HB    1 
ATOM   10   H HG1   . THR A 1 15 ? 2.551   -24.900 9.993   1.00 53.17  ?  103 THR A HG1   1 
ATOM   11   H HG21  . THR A 1 15 ? 5.352   -24.514 9.745   1.00 56.81  ?  103 THR A HG21  1 
ATOM   12   H HG22  . THR A 1 15 ? 5.340   -23.535 8.527   1.00 56.81  ?  103 THR A HG22  1 
ATOM   13   H HG23  . THR A 1 15 ? 4.388   -23.284 9.741   1.00 56.81  ?  103 THR A HG23  1 
ATOM   14   N N     . SER A 1 16 ? 0.503   -24.419 7.075   1.00 44.18  ?  104 SER A N     1 
ATOM   15   C CA    . SER A 1 16 ? -0.582  -25.176 6.464   1.00 39.99  ?  104 SER A CA    1 
ATOM   16   C C     . SER A 1 16 ? -1.738  -24.258 6.094   1.00 33.64  ?  104 SER A C     1 
ATOM   17   O O     . SER A 1 16 ? -1.984  -23.254 6.760   1.00 34.08  ?  104 SER A O     1 
ATOM   18   C CB    . SER A 1 16 ? -1.070  -26.270 7.413   1.00 36.75  ?  104 SER A CB    1 
ATOM   19   O OG    . SER A 1 16 ? -2.184  -26.955 6.868   1.00 38.66  ?  104 SER A OG    1 
ATOM   20   H H     . SER A 1 16 ? 0.249   -23.707 7.485   1.00 53.01  ?  104 SER A H     1 
ATOM   21   H HA    . SER A 1 16 ? -0.255  -25.604 5.645   1.00 47.99  ?  104 SER A HA    1 
ATOM   22   H HB2   . SER A 1 16 ? -0.351  -26.905 7.560   1.00 44.09  ?  104 SER A HB2   1 
ATOM   23   H HB3   . SER A 1 16 ? -1.331  -25.865 8.255   1.00 44.09  ?  104 SER A HB3   1 
ATOM   24   H HG    . SER A 1 16 ? -2.436  -27.538 7.386   1.00 46.39  ?  104 SER A HG    1 
ATOM   25   N N     . ASP A 1 17 ? -2.444  -24.606 5.024   1.00 38.68  ?  105 ASP A N     1 
ATOM   26   C CA    . ASP A 1 17 ? -3.598  -23.830 4.593   1.00 35.70  ?  105 ASP A CA    1 
ATOM   27   C C     . ASP A 1 17 ? -4.715  -23.927 5.618   1.00 33.83  ?  105 ASP A C     1 
ATOM   28   O O     . ASP A 1 17 ? -4.957  -24.988 6.191   1.00 38.34  ?  105 ASP A O     1 
ATOM   29   C CB    . ASP A 1 17 ? -4.121  -24.325 3.242   1.00 32.85  ?  105 ASP A CB    1 
ATOM   30   C CG    . ASP A 1 17 ? -3.232  -23.923 2.086   1.00 38.64  ?  105 ASP A CG    1 
ATOM   31   O OD1   . ASP A 1 17 ? -2.413  -22.999 2.260   1.00 41.08  ?  105 ASP A OD1   1 
ATOM   32   O OD2   . ASP A 1 17 ? -3.363  -24.525 0.999   1.00 35.11  -1 105 ASP A OD2   1 
ATOM   33   H H     . ASP A 1 17 ? -2.275  -25.289 4.529   1.00 46.42  ?  105 ASP A H     1 
ATOM   34   H HA    . ASP A 1 17 ? -3.342  -22.888 4.501   1.00 42.84  ?  105 ASP A HA    1 
ATOM   35   H HB2   . ASP A 1 17 ? -4.171  -25.294 3.259   1.00 39.42  ?  105 ASP A HB2   1 
ATOM   36   H HB3   . ASP A 1 17 ? -5.002  -23.950 3.087   1.00 39.42  ?  105 ASP A HB3   1 
ATOM   37   N N     . LEU A 1 18 ? -5.390  -22.808 5.844   1.00 34.99  ?  106 LEU A N     1 
ATOM   38   C CA    . LEU A 1 18 ? -6.615  -22.800 6.624   1.00 29.65  ?  106 LEU A CA    1 
ATOM   39   C C     . LEU A 1 18 ? -7.761  -22.470 5.690   1.00 34.89  ?  106 LEU A C     1 
ATOM   40   O O     . LEU A 1 18 ? -7.667  -21.542 4.887   1.00 34.57  ?  106 LEU A O     1 
ATOM   41   C CB    . LEU A 1 18 ? -6.549  -21.760 7.740   1.00 32.52  ?  106 LEU A CB    1 
ATOM   42   C CG    . LEU A 1 18 ? -5.448  -21.954 8.779   1.00 39.36  ?  106 LEU A CG    1 
ATOM   43   C CD1   . LEU A 1 18 ? -5.510  -20.826 9.792   1.00 32.26  ?  106 LEU A CD1   1 
ATOM   44   C CD2   . LEU A 1 18 ? -5.578  -23.313 9.455   1.00 33.50  ?  106 LEU A CD2   1 
ATOM   45   H H     . LEU A 1 18 ? -5.156  -22.033 5.554   1.00 41.99  ?  106 LEU A H     1 
ATOM   46   H HA    . LEU A 1 18 ? -6.768  -23.684 7.019   1.00 35.58  ?  106 LEU A HA    1 
ATOM   47   H HB2   . LEU A 1 18 ? -6.414  -20.889 7.336   1.00 39.03  ?  106 LEU A HB2   1 
ATOM   48   H HB3   . LEU A 1 18 ? -7.396  -21.767 8.212   1.00 39.03  ?  106 LEU A HB3   1 
ATOM   49   H HG    . LEU A 1 18 ? -4.585  -21.917 8.339   1.00 47.23  ?  106 LEU A HG    1 
ATOM   50   H HD11  . LEU A 1 18 ? -4.816  -20.952 10.443  1.00 38.72  ?  106 LEU A HD11  1 
ATOM   51   H HD12  . LEU A 1 18 ? -5.384  -19.990 9.337   1.00 38.72  ?  106 LEU A HD12  1 
ATOM   52   H HD13  . LEU A 1 18 ? -6.369  -20.839 10.222  1.00 38.72  ?  106 LEU A HD13  1 
ATOM   53   H HD21  . LEU A 1 18 ? -4.875  -23.409 10.102  1.00 40.20  ?  106 LEU A HD21  1 
ATOM   54   H HD22  . LEU A 1 18 ? -6.432  -23.366 9.889   1.00 40.20  ?  106 LEU A HD22  1 
ATOM   55   H HD23  . LEU A 1 18 ? -5.505  -24.001 8.789   1.00 40.20  ?  106 LEU A HD23  1 
ATOM   56   N N     . ILE A 1 19 ? -8.837  -23.238 5.784   1.00 33.51  ?  107 ILE A N     1 
ATOM   57   C CA    . ILE A 1 19 ? -10.027 -22.958 5.002   1.00 29.99  ?  107 ILE A CA    1 
ATOM   58   C C     . ILE A 1 19 ? -10.893 -21.967 5.766   1.00 32.71  ?  107 ILE A C     1 
ATOM   59   O O     . ILE A 1 19 ? -11.030 -22.066 6.984   1.00 33.16  ?  107 ILE A O     1 
ATOM   60   C CB    . ILE A 1 19 ? -10.838 -24.233 4.707   1.00 32.71  ?  107 ILE A CB    1 
ATOM   61   C CG1   . ILE A 1 19 ? -11.996 -23.906 3.764   1.00 28.92  ?  107 ILE A CG1   1 
ATOM   62   C CG2   . ILE A 1 19 ? -11.360 -24.857 5.998   1.00 32.62  ?  107 ILE A CG2   1 
ATOM   63   C CD1   . ILE A 1 19 ? -12.821 -25.111 3.359   1.00 27.55  ?  107 ILE A CD1   1 
ATOM   64   H H     . ILE A 1 19 ? -8.902  -23.928 6.294   1.00 40.21  ?  107 ILE A H     1 
ATOM   65   H HA    . ILE A 1 19 ? -9.768  -22.550 4.149   1.00 35.99  ?  107 ILE A HA    1 
ATOM   66   H HB    . ILE A 1 19 ? -10.256 -24.874 4.269   1.00 39.26  ?  107 ILE A HB    1 
ATOM   67   H HG12  . ILE A 1 19 ? -12.588 -23.276 4.204   1.00 34.70  ?  107 ILE A HG12  1 
ATOM   68   H HG13  . ILE A 1 19 ? -11.637 -23.508 2.955   1.00 34.70  ?  107 ILE A HG13  1 
ATOM   69   H HG21  . ILE A 1 19 ? -11.860 -25.648 5.782   1.00 39.14  ?  107 ILE A HG21  1 
ATOM   70   H HG22  . ILE A 1 19 ? -10.615 -25.084 6.558   1.00 39.14  ?  107 ILE A HG22  1 
ATOM   71   H HG23  . ILE A 1 19 ? -11.926 -24.223 6.444   1.00 39.14  ?  107 ILE A HG23  1 
ATOM   72   H HD11  . ILE A 1 19 ? -13.524 -24.824 2.770   1.00 33.06  ?  107 ILE A HD11  1 
ATOM   73   H HD12  . ILE A 1 19 ? -12.254 -25.741 2.910   1.00 33.06  ?  107 ILE A HD12  1 
ATOM   74   H HD13  . ILE A 1 19 ? -13.197 -25.511 4.147   1.00 33.06  ?  107 ILE A HD13  1 
ATOM   75   N N     . VAL A 1 20 ? -11.464 -21.006 5.048   1.00 33.43  ?  108 VAL A N     1 
ATOM   76   C CA    . VAL A 1 20 ? -12.313 -19.997 5.668   1.00 22.68  ?  108 VAL A CA    1 
ATOM   77   C C     . VAL A 1 20 ? -13.760 -20.172 5.221   1.00 25.43  ?  108 VAL A C     1 
ATOM   78   O O     . VAL A 1 20 ? -14.065 -20.105 4.031   1.00 29.47  ?  108 VAL A O     1 
ATOM   79   C CB    . VAL A 1 20 ? -11.844 -18.577 5.321   1.00 30.75  ?  108 VAL A CB    1 
ATOM   80   C CG1   . VAL A 1 20 ? -12.551 -17.562 6.208   1.00 30.77  ?  108 VAL A CG1   1 
ATOM   81   C CG2   . VAL A 1 20 ? -10.329 -18.470 5.466   1.00 35.39  ?  108 VAL A CG2   1 
ATOM   82   H H     . VAL A 1 20 ? -11.376 -20.917 4.197   1.00 40.12  ?  108 VAL A H     1 
ATOM   83   H HA    . VAL A 1 20 ? -12.279 -20.102 6.642   1.00 27.21  ?  108 VAL A HA    1 
ATOM   84   H HB    . VAL A 1 20 ? -12.075 -18.380 4.389   1.00 36.90  ?  108 VAL A HB    1 
ATOM   85   H HG11  . VAL A 1 20 ? -12.246 -16.681 5.978   1.00 36.93  ?  108 VAL A HG11  1 
ATOM   86   H HG12  . VAL A 1 20 ? -13.498 -17.629 6.065   1.00 36.93  ?  108 VAL A HG12  1 
ATOM   87   H HG13  . VAL A 1 20 ? -12.344 -17.752 7.126   1.00 36.93  ?  108 VAL A HG13  1 
ATOM   88   H HG21  . VAL A 1 20 ? -10.056 -17.577 5.246   1.00 42.46  ?  108 VAL A HG21  1 
ATOM   89   H HG22  . VAL A 1 20 ? -10.087 -18.672 6.373   1.00 42.46  ?  108 VAL A HG22  1 
ATOM   90   H HG23  . VAL A 1 20 ? -9.913  -19.097 4.869   1.00 42.46  ?  108 VAL A HG23  1 
ATOM   91   N N     . LEU A 1 21 ? -14.645 -20.401 6.185   1.00 27.57  ?  109 LEU A N     1 
ATOM   92   C CA    . LEU A 1 21 ? -16.050 -20.659 5.896   1.00 31.47  ?  109 LEU A CA    1 
ATOM   93   C C     . LEU A 1 21 ? -16.939 -19.504 6.333   1.00 31.87  ?  109 LEU A C     1 
ATOM   94   O O     . LEU A 1 21 ? -16.656 -18.829 7.324   1.00 31.38  ?  109 LEU A O     1 
ATOM   95   C CB    . LEU A 1 21 ? -16.498 -21.937 6.605   1.00 35.55  ?  109 LEU A CB    1 
ATOM   96   C CG    . LEU A 1 21 ? -16.178 -23.253 5.894   1.00 36.10  ?  109 LEU A CG    1 
ATOM   97   C CD1   . LEU A 1 21 ? -14.706 -23.346 5.553   1.00 29.48  ?  109 LEU A CD1   1 
ATOM   98   C CD2   . LEU A 1 21 ? -16.607 -24.425 6.759   1.00 38.80  ?  109 LEU A CD2   1 
ATOM   99   H H     . LEU A 1 21 ? -14.455 -20.411 7.023   1.00 33.08  ?  109 LEU A H     1 
ATOM   100  H HA    . LEU A 1 21 ? -16.164 -20.786 4.931   1.00 37.76  ?  109 LEU A HA    1 
ATOM   101  H HB2   . LEU A 1 21 ? -16.071 -21.968 7.475   1.00 42.66  ?  109 LEU A HB2   1 
ATOM   102  H HB3   . LEU A 1 21 ? -17.461 -21.898 6.721   1.00 42.66  ?  109 LEU A HB3   1 
ATOM   103  H HG    . LEU A 1 21 ? -16.680 -23.293 5.066   1.00 43.32  ?  109 LEU A HG    1 
ATOM   104  H HD11  . LEU A 1 21 ? -14.540 -24.181 5.110   1.00 35.37  ?  109 LEU A HD11  1 
ATOM   105  H HD12  . LEU A 1 21 ? -14.473 -22.616 4.975   1.00 35.37  ?  109 LEU A HD12  1 
ATOM   106  H HD13  . LEU A 1 21 ? -14.194 -23.298 6.364   1.00 35.37  ?  109 LEU A HD13  1 
ATOM   107  H HD21  . LEU A 1 21 ? -16.400 -25.243 6.301   1.00 46.56  ?  109 LEU A HD21  1 
ATOM   108  H HD22  . LEU A 1 21 ? -16.132 -24.387 7.593   1.00 46.56  ?  109 LEU A HD22  1 
ATOM   109  H HD23  . LEU A 1 21 ? -17.552 -24.367 6.917   1.00 46.56  ?  109 LEU A HD23  1 
ATOM   110  N N     . GLY A 1 22 ? -18.011 -19.278 5.581   1.00 23.06  ?  110 GLY A N     1 
ATOM   111  C CA    . GLY A 1 22 ? -19.026 -18.314 5.967   1.00 29.42  ?  110 GLY A CA    1 
ATOM   112  C C     . GLY A 1 22 ? -18.880 -16.978 5.266   1.00 29.10  ?  110 GLY A C     1 
ATOM   113  O O     . GLY A 1 22 ? -19.680 -16.068 5.484   1.00 30.49  ?  110 GLY A O     1 
ATOM   114  H H     . GLY A 1 22 ? -18.173 -19.676 4.836   1.00 27.67  ?  110 GLY A H     1 
ATOM   115  H HA2   . GLY A 1 22 ? -19.903 -18.673 5.759   1.00 35.31  ?  110 GLY A HA2   1 
ATOM   116  H HA3   . GLY A 1 22 ? -18.977 -18.163 6.923   1.00 35.31  ?  110 GLY A HA3   1 
ATOM   117  N N     . LEU A 1 23 ? -17.864 -16.862 4.418   1.00 23.38  ?  111 LEU A N     1 
ATOM   118  C CA    . LEU A 1 23 ? -17.573 -15.604 3.739   1.00 27.98  ?  111 LEU A CA    1 
ATOM   119  C C     . LEU A 1 23 ? -18.803 -15.025 3.046   1.00 26.32  ?  111 LEU A C     1 
ATOM   120  O O     . LEU A 1 23 ? -19.518 -15.737 2.343   1.00 27.21  ?  111 LEU A O     1 
ATOM   121  C CB    . LEU A 1 23 ? -16.458 -15.800 2.710   1.00 27.89  ?  111 LEU A CB    1 
ATOM   122  C CG    . LEU A 1 23 ? -15.076 -16.097 3.287   1.00 26.72  ?  111 LEU A CG    1 
ATOM   123  C CD1   . LEU A 1 23 ? -14.138 -16.585 2.194   1.00 25.14  ?  111 LEU A CD1   1 
ATOM   124  C CD2   . LEU A 1 23 ? -14.517 -14.858 3.973   1.00 26.61  ?  111 LEU A CD2   1 
ATOM   125  H H     . LEU A 1 23 ? -17.323 -17.500 4.219   1.00 28.05  ?  111 LEU A H     1 
ATOM   126  H HA    . LEU A 1 23 ? -17.263 -14.950 4.400   1.00 33.58  ?  111 LEU A HA    1 
ATOM   127  H HB2   . LEU A 1 23 ? -16.699 -16.542 2.134   1.00 33.47  ?  111 LEU A HB2   1 
ATOM   128  H HB3   . LEU A 1 23 ? -16.384 -14.990 2.180   1.00 33.47  ?  111 LEU A HB3   1 
ATOM   129  H HG    . LEU A 1 23 ? -15.154 -16.799 3.952   1.00 32.07  ?  111 LEU A HG    1 
ATOM   130  H HD11  . LEU A 1 23 ? -13.278 -16.765 2.579   1.00 30.17  ?  111 LEU A HD11  1 
ATOM   131  H HD12  . LEU A 1 23 ? -14.499 -17.386 1.809   1.00 30.17  ?  111 LEU A HD12  1 
ATOM   132  H HD13  . LEU A 1 23 ? -14.061 -15.904 1.522   1.00 30.17  ?  111 LEU A HD13  1 
ATOM   133  H HD21  . LEU A 1 23 ? -13.649 -15.063 4.329   1.00 31.93  ?  111 LEU A HD21  1 
ATOM   134  H HD22  . LEU A 1 23 ? -14.448 -14.149 3.330   1.00 31.93  ?  111 LEU A HD22  1 
ATOM   135  H HD23  . LEU A 1 23 ? -15.110 -14.600 4.683   1.00 31.93  ?  111 LEU A HD23  1 
ATOM   136  N N     . PRO A 1 24 ? -19.058 -13.724 3.255   1.00 30.14  ?  112 PRO A N     1 
ATOM   137  C CA    . PRO A 1 24 ? -20.100 -13.014 2.508   1.00 33.52  ?  112 PRO A CA    1 
ATOM   138  C C     . PRO A 1 24 ? -19.887 -13.153 1.004   1.00 30.65  ?  112 PRO A C     1 
ATOM   139  O O     . PRO A 1 24 ? -18.765 -13.418 0.574   1.00 30.34  ?  112 PRO A O     1 
ATOM   140  C CB    . PRO A 1 24 ? -19.910 -11.560 2.943   1.00 25.97  ?  112 PRO A CB    1 
ATOM   141  C CG    . PRO A 1 24 ? -19.306 -11.647 4.294   1.00 31.83  ?  112 PRO A CG    1 
ATOM   142  C CD    . PRO A 1 24 ? -18.441 -12.873 4.286   1.00 28.27  ?  112 PRO A CD    1 
ATOM   143  H HA    . PRO A 1 24 ? -20.994 -13.330 2.757   1.00 40.22  ?  112 PRO A HA    1 
ATOM   144  H HB2   . PRO A 1 24 ? -19.312 -11.109 2.327   1.00 31.17  ?  112 PRO A HB2   1 
ATOM   145  H HB3   . PRO A 1 24 ? -20.770 -11.113 2.978   1.00 31.17  ?  112 PRO A HB3   1 
ATOM   146  H HG2   . PRO A 1 24 ? -18.772 -10.855 4.461   1.00 38.19  ?  112 PRO A HG2   1 
ATOM   147  H HG3   . PRO A 1 24 ? -20.008 -11.731 4.958   1.00 38.19  ?  112 PRO A HG3   1 
ATOM   148  H HD2   . PRO A 1 24 ? -17.532 -12.643 4.035   1.00 33.92  ?  112 PRO A HD2   1 
ATOM   149  H HD3   . PRO A 1 24 ? -18.471 -13.313 5.150   1.00 33.92  ?  112 PRO A HD3   1 
ATOM   150  N N     . TRP A 1 25 ? -20.944 -12.976 0.219   1.00 28.48  ?  113 TRP A N     1 
ATOM   151  C CA    . TRP A 1 25 ? -20.859 -13.159 -1.225  1.00 27.94  ?  113 TRP A CA    1 
ATOM   152  C C     . TRP A 1 25 ? -19.943 -12.126 -1.884  1.00 29.84  ?  113 TRP A C     1 
ATOM   153  O O     . TRP A 1 25 ? -19.221 -12.443 -2.829  1.00 28.47  ?  113 TRP A O     1 
ATOM   154  C CB    . TRP A 1 25 ? -22.250 -13.078 -1.862  1.00 33.63  ?  113 TRP A CB    1 
ATOM   155  C CG    . TRP A 1 25 ? -23.297 -13.945 -1.207  1.00 30.53  ?  113 TRP A CG    1 
ATOM   156  C CD1   . TRP A 1 25 ? -24.447 -13.524 -0.606  1.00 27.72  ?  113 TRP A CD1   1 
ATOM   157  C CD2   . TRP A 1 25 ? -23.289 -15.374 -1.093  1.00 26.60  ?  113 TRP A CD2   1 
ATOM   158  N NE1   . TRP A 1 25 ? -25.155 -14.597 -0.127  1.00 27.19  ?  113 TRP A NE1   1 
ATOM   159  C CE2   . TRP A 1 25 ? -24.465 -15.746 -0.413  1.00 28.11  ?  113 TRP A CE2   1 
ATOM   160  C CE3   . TRP A 1 25 ? -22.401 -16.374 -1.500  1.00 25.90  ?  113 TRP A CE3   1 
ATOM   161  C CZ2   . TRP A 1 25 ? -24.778 -17.071 -0.130  1.00 28.57  ?  113 TRP A CZ2   1 
ATOM   162  C CZ3   . TRP A 1 25 ? -22.715 -17.692 -1.217  1.00 33.25  ?  113 TRP A CZ3   1 
ATOM   163  C CH2   . TRP A 1 25 ? -23.892 -18.027 -0.539  1.00 27.77  ?  113 TRP A CH2   1 
ATOM   164  H H     . TRP A 1 25 ? -21.725 -12.749 0.499   1.00 34.18  ?  113 TRP A H     1 
ATOM   165  H HA    . TRP A 1 25 ? -20.493 -14.049 -1.411  1.00 33.53  ?  113 TRP A HA    1 
ATOM   166  H HB2   . TRP A 1 25 ? -22.558 -12.160 -1.815  1.00 40.35  ?  113 TRP A HB2   1 
ATOM   167  H HB3   . TRP A 1 25 ? -22.181 -13.351 -2.790  1.00 40.35  ?  113 TRP A HB3   1 
ATOM   168  H HD1   . TRP A 1 25 ? -24.714 -12.636 -0.534  1.00 33.27  ?  113 TRP A HD1   1 
ATOM   169  H HE1   . TRP A 1 25 ? -25.908 -14.556 0.286   1.00 32.63  ?  113 TRP A HE1   1 
ATOM   170  H HE3   . TRP A 1 25 ? -21.618 -16.159 -1.952  1.00 31.08  ?  113 TRP A HE3   1 
ATOM   171  H HZ2   . TRP A 1 25 ? -25.559 -17.298 0.322   1.00 34.29  ?  113 TRP A HZ2   1 
ATOM   172  H HZ3   . TRP A 1 25 ? -22.134 -18.367 -1.483  1.00 39.90  ?  113 TRP A HZ3   1 
ATOM   173  H HH2   . TRP A 1 25 ? -24.076 -18.922 -0.363  1.00 33.32  ?  113 TRP A HH2   1 
ATOM   174  N N     . LYS A 1 26 ? -19.969 -10.894 -1.384  1.00 25.27  ?  114 LYS A N     1 
ATOM   175  C CA    . LYS A 1 26 ? -19.281 -9.792  -2.052  1.00 33.49  ?  114 LYS A CA    1 
ATOM   176  C C     . LYS A 1 26 ? -17.789 -9.770  -1.744  1.00 33.88  ?  114 LYS A C     1 
ATOM   177  O O     . LYS A 1 26 ? -17.021 -9.069  -2.407  1.00 35.76  ?  114 LYS A O     1 
ATOM   178  C CB    . LYS A 1 26 ? -19.898 -8.451  -1.655  1.00 30.18  ?  114 LYS A CB    1 
ATOM   179  C CG    . LYS A 1 26 ? -19.541 -7.986  -0.254  1.00 37.76  ?  114 LYS A CG    1 
ATOM   180  C CD    . LYS A 1 26 ? -19.947 -6.535  -0.055  1.00 38.84  ?  114 LYS A CD    1 
ATOM   181  C CE    . LYS A 1 26 ? -19.406 -5.966  1.244   1.00 42.89  ?  114 LYS A CE    1 
ATOM   182  N NZ    . LYS A 1 26 ? -19.731 -4.519  1.380   1.00 50.93  1  114 LYS A NZ    1 
ATOM   183  H H     . LYS A 1 26 ? -20.377 -10.669 -0.661  1.00 30.33  ?  114 LYS A H     1 
ATOM   184  H HA    . LYS A 1 26 ? -19.386 -9.895  -3.021  1.00 40.19  ?  114 LYS A HA    1 
ATOM   185  H HB2   . LYS A 1 26 ? -19.593 -7.772  -2.277  1.00 36.22  ?  114 LYS A HB2   1 
ATOM   186  H HB3   . LYS A 1 26 ? -20.864 -8.527  -1.702  1.00 36.22  ?  114 LYS A HB3   1 
ATOM   187  H HG2   . LYS A 1 26 ? -20.012 -8.530  0.397   1.00 45.31  ?  114 LYS A HG2   1 
ATOM   188  H HG3   . LYS A 1 26 ? -18.582 -8.058  -0.125  1.00 45.31  ?  114 LYS A HG3   1 
ATOM   189  H HD2   . LYS A 1 26 ? -19.598 -6.003  -0.787  1.00 46.60  ?  114 LYS A HD2   1 
ATOM   190  H HD3   . LYS A 1 26 ? -20.915 -6.476  -0.031  1.00 46.60  ?  114 LYS A HD3   1 
ATOM   191  H HE2   . LYS A 1 26 ? -19.804 -6.439  1.991   1.00 51.47  ?  114 LYS A HE2   1 
ATOM   192  H HE3   . LYS A 1 26 ? -18.441 -6.065  1.259   1.00 51.47  ?  114 LYS A HE3   1 
ATOM   193  H HZ1   . LYS A 1 26 ? -19.405 -4.205  2.146   1.00 61.12  ?  114 LYS A HZ1   1 
ATOM   194  H HZ2   . LYS A 1 26 ? -19.372 -4.062  0.705   1.00 61.12  ?  114 LYS A HZ2   1 
ATOM   195  H HZ3   . LYS A 1 26 ? -20.613 -4.403  1.371   1.00 61.12  ?  114 LYS A HZ3   1 
ATOM   196  N N     . THR A 1 27 ? -17.380 -10.538 -0.740  1.00 29.57  ?  115 THR A N     1 
ATOM   197  C CA    . THR A 1 27 ? -15.993 -10.532 -0.288  1.00 24.54  ?  115 THR A CA    1 
ATOM   198  C C     . THR A 1 27 ? -15.050 -11.024 -1.379  1.00 26.91  ?  115 THR A C     1 
ATOM   199  O O     . THR A 1 27 ? -15.244 -12.097 -1.949  1.00 34.64  ?  115 THR A O     1 
ATOM   200  C CB    . THR A 1 27 ? -15.812 -11.399 0.971   1.00 27.70  ?  115 THR A CB    1 
ATOM   201  O OG1   . THR A 1 27 ? -16.763 -11.000 1.963   1.00 34.20  ?  115 THR A OG1   1 
ATOM   202  C CG2   . THR A 1 27 ? -14.401 -11.257 1.533   1.00 35.81  ?  115 THR A CG2   1 
ATOM   203  H H     . THR A 1 27 ? -17.889 -11.075 -0.301  1.00 35.48  ?  115 THR A H     1 
ATOM   204  H HA    . THR A 1 27 ? -15.738 -9.614  -0.061  1.00 29.45  ?  115 THR A HA    1 
ATOM   205  H HB    . THR A 1 27 ? -15.957 -12.331 0.743   1.00 33.24  ?  115 THR A HB    1 
ATOM   206  H HG1   . THR A 1 27 ? -16.673 -11.457 2.638   1.00 41.04  ?  115 THR A HG1   1 
ATOM   207  H HG21  . THR A 1 27 ? -14.304 -11.803 2.316   1.00 42.97  ?  115 THR A HG21  1 
ATOM   208  H HG22  . THR A 1 27 ? -13.758 -11.535 0.877   1.00 42.97  ?  115 THR A HG22  1 
ATOM   209  H HG23  . THR A 1 27 ? -14.232 -10.341 1.767   1.00 42.97  ?  115 THR A HG23  1 
ATOM   210  N N     . THR A 1 28 ? -14.021 -10.229 -1.654  1.00 33.50  ?  116 THR A N     1 
ATOM   211  C CA    . THR A 1 28 ? -13.057 -10.539 -2.701  1.00 33.08  ?  116 THR A CA    1 
ATOM   212  C C     . THR A 1 28 ? -11.720 -10.954 -2.098  1.00 37.82  ?  116 THR A C     1 
ATOM   213  O O     . THR A 1 28 ? -11.491 -10.791 -0.900  1.00 39.38  ?  116 THR A O     1 
ATOM   214  C CB    . THR A 1 28 ? -12.831 -9.333  -3.634  1.00 31.48  ?  116 THR A CB    1 
ATOM   215  O OG1   . THR A 1 28 ? -12.379 -8.206  -2.871  1.00 41.87  ?  116 THR A OG1   1 
ATOM   216  C CG2   . THR A 1 28 ? -14.114 -8.972  -4.368  1.00 28.29  ?  116 THR A CG2   1 
ATOM   217  H H     . THR A 1 28 ? -13.859 -9.492  -1.241  1.00 40.20  ?  116 THR A H     1 
ATOM   218  H HA    . THR A 1 28 ? -13.395 -11.285 -3.240  1.00 39.70  ?  116 THR A HA    1 
ATOM   219  H HB    . THR A 1 28 ? -12.158 -9.562  -4.294  1.00 37.78  ?  116 THR A HB    1 
ATOM   220  H HG1   . THR A 1 28 ? -12.939 -8.006  -2.307  1.00 50.25  ?  116 THR A HG1   1 
ATOM   221  H HG21  . THR A 1 28 ? -13.962 -8.220  -4.945  1.00 33.95  ?  116 THR A HG21  1 
ATOM   222  H HG22  . THR A 1 28 ? -14.410 -9.717  -4.897  1.00 33.95  ?  116 THR A HG22  1 
ATOM   223  H HG23  . THR A 1 28 ? -14.801 -8.746  -3.736  1.00 33.95  ?  116 THR A HG23  1 
ATOM   224  N N     . GLU A 1 29 ? -10.839 -11.488 -2.938  1.00 35.91  ?  117 GLU A N     1 
ATOM   225  C CA    . GLU A 1 29 ? -9.543  -11.977 -2.483  1.00 35.87  ?  117 GLU A CA    1 
ATOM   226  C C     . GLU A 1 29 ? -8.761  -10.923 -1.704  1.00 35.87  ?  117 GLU A C     1 
ATOM   227  O O     . GLU A 1 29 ? -8.297  -11.183 -0.595  1.00 38.34  ?  117 GLU A O     1 
ATOM   228  C CB    . GLU A 1 29 ? -8.709  -12.466 -3.669  1.00 36.31  ?  117 GLU A CB    1 
ATOM   229  C CG    . GLU A 1 29 ? -9.163  -13.803 -4.230  1.00 46.43  ?  117 GLU A CG    1 
ATOM   230  C CD    . GLU A 1 29 ? -8.141  -14.425 -5.162  1.00 56.51  ?  117 GLU A CD    1 
ATOM   231  O OE1   . GLU A 1 29 ? -8.253  -15.636 -5.445  1.00 49.65  ?  117 GLU A OE1   1 
ATOM   232  O OE2   . GLU A 1 29 ? -7.224  -13.704 -5.610  1.00 53.90  -1 117 GLU A OE2   1 
ATOM   233  H H     . GLU A 1 29 ? -10.969 -11.578 -3.783  1.00 43.10  ?  117 GLU A H     1 
ATOM   234  H HA    . GLU A 1 29 ? -9.688  -12.741 -1.886  1.00 43.04  ?  117 GLU A HA    1 
ATOM   235  H HB2   . GLU A 1 29 ? -8.767  -11.811 -4.382  1.00 43.57  ?  117 GLU A HB2   1 
ATOM   236  H HB3   . GLU A 1 29 ? -7.787  -12.561 -3.385  1.00 43.57  ?  117 GLU A HB3   1 
ATOM   237  H HG2   . GLU A 1 29 ? -9.313  -14.419 -3.495  1.00 55.72  ?  117 GLU A HG2   1 
ATOM   238  H HG3   . GLU A 1 29 ? -9.985  -13.674 -4.729  1.00 55.72  ?  117 GLU A HG3   1 
ATOM   239  N N     . GLN A 1 30 ? -8.612  -9.735  -2.281  1.00 32.62  ?  118 GLN A N     1 
ATOM   240  C CA    . GLN A 1 30 ? -7.779  -8.707  -1.667  1.00 38.60  ?  118 GLN A CA    1 
ATOM   241  C C     . GLN A 1 30 ? -8.382  -8.211  -0.355  1.00 41.41  ?  118 GLN A C     1 
ATOM   242  O O     . GLN A 1 30 ? -7.657  -7.781  0.542   1.00 51.63  ?  118 GLN A O     1 
ATOM   243  C CB    . GLN A 1 30 ? -7.532  -7.542  -2.634  1.00 48.95  ?  118 GLN A CB    1 
ATOM   244  C CG    . GLN A 1 30 ? -8.507  -6.376  -2.523  1.00 48.87  ?  118 GLN A CG    1 
ATOM   245  C CD    . GLN A 1 30 ? -7.801  -5.031  -2.525  1.00 58.64  ?  118 GLN A CD    1 
ATOM   246  O OE1   . GLN A 1 30 ? -6.747  -4.871  -1.909  1.00 62.09  ?  118 GLN A OE1   1 
ATOM   247  N NE2   . GLN A 1 30 ? -8.378  -4.058  -3.220  1.00 61.46  ?  118 GLN A NE2   1 
ATOM   248  H H     . GLN A 1 30 ? -8.979  -9.500  -3.023  1.00 39.14  ?  118 GLN A H     1 
ATOM   249  H HA    . GLN A 1 30 ? -6.907  -9.101  -1.457  1.00 46.33  ?  118 GLN A HA    1 
ATOM   250  H HB2   . GLN A 1 30 ? -6.642  -7.192  -2.471  1.00 58.73  ?  118 GLN A HB2   1 
ATOM   251  H HB3   . GLN A 1 30 ? -7.586  -7.880  -3.541  1.00 58.73  ?  118 GLN A HB3   1 
ATOM   252  H HG2   . GLN A 1 30 ? -9.115  -6.398  -3.278  1.00 58.65  ?  118 GLN A HG2   1 
ATOM   253  H HG3   . GLN A 1 30 ? -9.003  -6.455  -1.693  1.00 58.65  ?  118 GLN A HG3   1 
ATOM   254  H HE21  . GLN A 1 30 ? -9.113  -4.207  -3.640  1.00 73.76  ?  118 GLN A HE21  1 
ATOM   255  H HE22  . GLN A 1 30 ? -8.015  -3.278  -3.251  1.00 73.76  ?  118 GLN A HE22  1 
ATOM   256  N N     . ASP A 1 31 ? -9.705  -8.272  -0.244  1.00 38.48  ?  119 ASP A N     1 
ATOM   257  C CA    . ASP A 1 31 ? -10.374 -7.939  1.009   1.00 40.93  ?  119 ASP A CA    1 
ATOM   258  C C     . ASP A 1 31 ? -9.952  -8.930  2.081   1.00 35.05  ?  119 ASP A C     1 
ATOM   259  O O     . ASP A 1 31 ? -9.481  -8.542  3.149   1.00 39.69  ?  119 ASP A O     1 
ATOM   260  C CB    . ASP A 1 31 ? -11.894 -7.981  0.848   1.00 42.75  ?  119 ASP A CB    1 
ATOM   261  C CG    . ASP A 1 31 ? -12.444 -6.759  0.147   1.00 45.69  ?  119 ASP A CG    1 
ATOM   262  O OD1   . ASP A 1 31 ? -11.864 -5.666  0.310   1.00 52.30  ?  119 ASP A OD1   1 
ATOM   263  O OD2   . ASP A 1 31 ? -13.462 -6.894  -0.563  1.00 55.12  -1 119 ASP A OD2   1 
ATOM   264  H H     . ASP A 1 31 ? -10.238 -8.502  -0.879  1.00 46.18  ?  119 ASP A H     1 
ATOM   265  H HA    . ASP A 1 31 ? -10.113 -7.038  1.293   1.00 49.11  ?  119 ASP A HA    1 
ATOM   266  H HB2   . ASP A 1 31 ? -12.135 -8.761  0.324   1.00 51.30  ?  119 ASP A HB2   1 
ATOM   267  H HB3   . ASP A 1 31 ? -12.303 -8.032  1.726   1.00 51.30  ?  119 ASP A HB3   1 
ATOM   268  N N     . LEU A 1 32 ? -10.127 -10.214 1.786   1.00 32.20  ?  120 LEU A N     1 
ATOM   269  C CA    . LEU A 1 32 ? -9.723  -11.274 2.698   1.00 31.83  ?  120 LEU A CA    1 
ATOM   270  C C     . LEU A 1 32 ? -8.275  -11.065 3.120   1.00 32.51  ?  120 LEU A C     1 
ATOM   271  O O     . LEU A 1 32 ? -7.944  -11.122 4.304   1.00 36.19  ?  120 LEU A O     1 
ATOM   272  C CB    . LEU A 1 32 ? -9.859  -12.642 2.024   1.00 28.48  ?  120 LEU A CB    1 
ATOM   273  C CG    . LEU A 1 32 ? -10.771 -13.682 2.677   1.00 27.85  ?  120 LEU A CG    1 
ATOM   274  C CD1   . LEU A 1 32 ? -10.382 -15.071 2.190   1.00 25.86  ?  120 LEU A CD1   1 
ATOM   275  C CD2   . LEU A 1 32 ? -10.707 -13.603 4.192   1.00 33.93  ?  120 LEU A CD2   1 
ATOM   276  H H     . LEU A 1 32 ? -10.482 -10.498 1.056   1.00 38.64  ?  120 LEU A H     1 
ATOM   277  H HA    . LEU A 1 32 ? -10.290 -11.259 3.497   1.00 38.19  ?  120 LEU A HA    1 
ATOM   278  H HB2   . LEU A 1 32 ? -10.193 -12.498 1.125   1.00 34.17  ?  120 LEU A HB2   1 
ATOM   279  H HB3   . LEU A 1 32 ? -8.974  -13.037 1.972   1.00 34.17  ?  120 LEU A HB3   1 
ATOM   280  H HG    . LEU A 1 32 ? -11.688 -13.514 2.406   1.00 33.42  ?  120 LEU A HG    1 
ATOM   281  H HD11  . LEU A 1 32 ? -10.957 -15.720 2.602   1.00 31.03  ?  120 LEU A HD11  1 
ATOM   282  H HD12  . LEU A 1 32 ? -10.479 -15.106 1.235   1.00 31.03  ?  120 LEU A HD12  1 
ATOM   283  H HD13  . LEU A 1 32 ? -9.469  -15.242 2.432   1.00 31.03  ?  120 LEU A HD13  1 
ATOM   284  H HD21  . LEU A 1 32 ? -11.290 -14.268 4.565   1.00 40.72  ?  120 LEU A HD21  1 
ATOM   285  H HD22  . LEU A 1 32 ? -9.803  -13.764 4.475   1.00 40.72  ?  120 LEU A HD22  1 
ATOM   286  H HD23  . LEU A 1 32 ? -10.986 -12.728 4.472   1.00 40.72  ?  120 LEU A HD23  1 
ATOM   287  N N     . LYS A 1 33 ? -7.416  -10.831 2.135   1.00 32.24  ?  121 LYS A N     1 
ATOM   288  C CA    . LYS A 1 33 ? -6.010  -10.541 2.381   1.00 34.18  ?  121 LYS A CA    1 
ATOM   289  C C     . LYS A 1 33 ? -5.872  -9.374  3.348   1.00 31.79  ?  121 LYS A C     1 
ATOM   290  O O     . LYS A 1 33 ? -5.253  -9.491  4.406   1.00 33.29  ?  121 LYS A O     1 
ATOM   291  C CB    . LYS A 1 33 ? -5.315  -10.193 1.065   1.00 34.91  ?  121 LYS A CB    1 
ATOM   292  C CG    . LYS A 1 33 ? -4.017  -9.421  1.232   1.00 42.33  ?  121 LYS A CG    1 
ATOM   293  C CD    . LYS A 1 33 ? -2.914  -10.298 1.795   1.00 37.58  ?  121 LYS A CD    1 
ATOM   294  C CE    . LYS A 1 33 ? -2.406  -11.282 0.754   1.00 40.77  ?  121 LYS A CE    1 
ATOM   295  N NZ    . LYS A 1 33 ? -1.807  -10.593 -0.424  1.00 37.90  1  121 LYS A NZ    1 
ATOM   296  H H     . LYS A 1 33 ? -7.627  -10.834 1.301   1.00 38.69  ?  121 LYS A H     1 
ATOM   297  H HA    . LYS A 1 33 ? -5.572  -11.327 2.770   1.00 41.01  ?  121 LYS A HA    1 
ATOM   298  H HB2   . LYS A 1 33 ? -5.111  -11.015 0.593   1.00 41.89  ?  121 LYS A HB2   1 
ATOM   299  H HB3   . LYS A 1 33 ? -5.915  -9.649  0.531   1.00 41.89  ?  121 LYS A HB3   1 
ATOM   300  H HG2   . LYS A 1 33 ? -3.729  -9.089  0.367   1.00 50.80  ?  121 LYS A HG2   1 
ATOM   301  H HG3   . LYS A 1 33 ? -4.160  -8.683  1.844   1.00 50.80  ?  121 LYS A HG3   1 
ATOM   302  H HD2   . LYS A 1 33 ? -2.172  -9.740  2.074   1.00 45.10  ?  121 LYS A HD2   1 
ATOM   303  H HD3   . LYS A 1 33 ? -3.259  -10.802 2.548   1.00 45.10  ?  121 LYS A HD3   1 
ATOM   304  H HE2   . LYS A 1 33 ? -1.724  -11.844 1.154   1.00 48.93  ?  121 LYS A HE2   1 
ATOM   305  H HE3   . LYS A 1 33 ? -3.146  -11.826 0.442   1.00 48.93  ?  121 LYS A HE3   1 
ATOM   306  H HZ1   . LYS A 1 33 ? -1.520  -11.193 -1.014  1.00 45.48  ?  121 LYS A HZ1   1 
ATOM   307  H HZ2   . LYS A 1 33 ? -2.416  -10.073 -0.814  1.00 45.48  ?  121 LYS A HZ2   1 
ATOM   308  H HZ3   . LYS A 1 33 ? -1.120  -10.089 -0.165  1.00 45.48  ?  121 LYS A HZ3   1 
ATOM   309  N N     . GLU A 1 34 ? -6.450  -8.243  2.961   1.00 29.45  ?  122 GLU A N     1 
ATOM   310  C CA    . GLU A 1 34 ? -6.396  -7.026  3.759   1.00 35.32  ?  122 GLU A CA    1 
ATOM   311  C C     . GLU A 1 34 ? -6.736  -7.330  5.211   1.00 32.80  ?  122 GLU A C     1 
ATOM   312  O O     . GLU A 1 34 ? -6.010  -6.941  6.126   1.00 35.75  ?  122 GLU A O     1 
ATOM   313  C CB    . GLU A 1 34 ? -7.376  -5.996  3.197   1.00 39.25  ?  122 GLU A CB    1 
ATOM   314  C CG    . GLU A 1 34 ? -7.307  -4.630  3.856   1.00 43.26  ?  122 GLU A CG    1 
ATOM   315  C CD    . GLU A 1 34 ? -8.220  -3.619  3.188   1.00 49.89  ?  122 GLU A CD    1 
ATOM   316  O OE1   . GLU A 1 34 ? -8.809  -2.784  3.905   1.00 49.62  ?  122 GLU A OE1   1 
ATOM   317  O OE2   . GLU A 1 34 ? -8.345  -3.658  1.946   1.00 52.25  -1 122 GLU A OE2   1 
ATOM   318  H H     . GLU A 1 34 ? -6.888  -8.154  2.227   1.00 35.34  ?  122 GLU A H     1 
ATOM   319  H HA    . GLU A 1 34 ? -5.492  -6.649  3.722   1.00 42.39  ?  122 GLU A HA    1 
ATOM   320  H HB2   . GLU A 1 34 ? -7.191  -5.876  2.252   1.00 47.10  ?  122 GLU A HB2   1 
ATOM   321  H HB3   . GLU A 1 34 ? -8.278  -6.333  3.312   1.00 47.10  ?  122 GLU A HB3   1 
ATOM   322  H HG2   . GLU A 1 34 ? -7.576  -4.712  4.784   1.00 51.91  ?  122 GLU A HG2   1 
ATOM   323  H HG3   . GLU A 1 34 ? -6.397  -4.297  3.801   1.00 51.91  ?  122 GLU A HG3   1 
ATOM   324  N N     . TYR A 1 35 ? -7.841  -8.038  5.412   1.00 34.58  ?  123 TYR A N     1 
ATOM   325  C CA    . TYR A 1 35 ? -8.289  -8.393  6.752   1.00 35.62  ?  123 TYR A CA    1 
ATOM   326  C C     . TYR A 1 35 ? -7.262  -9.256  7.478   1.00 35.89  ?  123 TYR A C     1 
ATOM   327  O O     . TYR A 1 35 ? -6.810  -8.910  8.568   1.00 42.40  ?  123 TYR A O     1 
ATOM   328  C CB    . TYR A 1 35 ? -9.625  -9.138  6.695   1.00 33.57  ?  123 TYR A CB    1 
ATOM   329  C CG    . TYR A 1 35 ? -10.051 -9.686  8.037   1.00 36.13  ?  123 TYR A CG    1 
ATOM   330  C CD1   . TYR A 1 35 ? -10.751 -8.897  8.941   1.00 29.74  ?  123 TYR A CD1   1 
ATOM   331  C CD2   . TYR A 1 35 ? -9.742  -10.987 8.408   1.00 38.11  ?  123 TYR A CD2   1 
ATOM   332  C CE1   . TYR A 1 35 ? -11.136 -9.391  10.171  1.00 26.95  ?  123 TYR A CE1   1 
ATOM   333  C CE2   . TYR A 1 35 ? -10.124 -11.488 9.638   1.00 34.65  ?  123 TYR A CE2   1 
ATOM   334  C CZ    . TYR A 1 35 ? -10.821 -10.684 10.514  1.00 32.31  ?  123 TYR A CZ    1 
ATOM   335  O OH    . TYR A 1 35 ? -11.205 -11.172 11.741  1.00 34.82  ?  123 TYR A OH    1 
ATOM   336  H H     . TYR A 1 35 ? -8.353  -8.327  4.784   1.00 41.50  ?  123 TYR A H     1 
ATOM   337  H HA    . TYR A 1 35 ? -8.421  -7.573  7.273   1.00 42.75  ?  123 TYR A HA    1 
ATOM   338  H HB2   . TYR A 1 35 ? -10.313 -8.528  6.388   1.00 40.28  ?  123 TYR A HB2   1 
ATOM   339  H HB3   . TYR A 1 35 ? -9.544  -9.883  6.079   1.00 40.28  ?  123 TYR A HB3   1 
ATOM   340  H HD1   . TYR A 1 35 ? -10.965 -8.022  8.712   1.00 35.69  ?  123 TYR A HD1   1 
ATOM   341  H HD2   . TYR A 1 35 ? -9.272  -11.531 7.818   1.00 45.73  ?  123 TYR A HD2   1 
ATOM   342  H HE1   . TYR A 1 35 ? -11.606 -8.851  10.765  1.00 32.33  ?  123 TYR A HE1   1 
ATOM   343  H HE2   . TYR A 1 35 ? -9.912  -12.363 9.873   1.00 41.58  ?  123 TYR A HE2   1 
ATOM   344  H HH    . TYR A 1 35 ? -12.022 -11.142 11.811  1.00 41.79  ?  123 TYR A HH    1 
ATOM   345  N N     . PHE A 1 36 ? -6.895  -10.377 6.867   1.00 22.42  ?  124 PHE A N     1 
ATOM   346  C CA    . PHE A 1 36 ? -6.004  -11.343 7.504   1.00 29.15  ?  124 PHE A CA    1 
ATOM   347  C C     . PHE A 1 36 ? -4.597  -10.795 7.742   1.00 30.02  ?  124 PHE A C     1 
ATOM   348  O O     . PHE A 1 36 ? -3.841  -11.350 8.539   1.00 33.23  ?  124 PHE A O     1 
ATOM   349  C CB    . PHE A 1 36 ? -5.929  -12.629 6.672   1.00 31.20  ?  124 PHE A CB    1 
ATOM   350  C CG    . PHE A 1 36 ? -7.071  -13.582 6.915   1.00 31.37  ?  124 PHE A CG    1 
ATOM   351  C CD1   . PHE A 1 36 ? -7.563  -13.790 8.193   1.00 32.09  ?  124 PHE A CD1   1 
ATOM   352  C CD2   . PHE A 1 36 ? -7.654  -14.269 5.863   1.00 30.86  ?  124 PHE A CD2   1 
ATOM   353  C CE1   . PHE A 1 36 ? -8.612  -14.667 8.416   1.00 28.29  ?  124 PHE A CE1   1 
ATOM   354  C CE2   . PHE A 1 36 ? -8.702  -15.145 6.082   1.00 33.44  ?  124 PHE A CE2   1 
ATOM   355  C CZ    . PHE A 1 36 ? -9.181  -15.342 7.359   1.00 31.94  ?  124 PHE A CZ    1 
ATOM   356  H H     . PHE A 1 36 ? -7.150  -10.605 6.078   1.00 26.90  ?  124 PHE A H     1 
ATOM   357  H HA    . PHE A 1 36 ? -6.379  -11.580 8.378   1.00 34.98  ?  124 PHE A HA    1 
ATOM   358  H HB2   . PHE A 1 36 ? -5.936  -12.392 5.731   1.00 37.44  ?  124 PHE A HB2   1 
ATOM   359  H HB3   . PHE A 1 36 ? -5.105  -13.093 6.888   1.00 37.44  ?  124 PHE A HB3   1 
ATOM   360  H HD1   . PHE A 1 36 ? -7.183  -13.337 8.911   1.00 38.51  ?  124 PHE A HD1   1 
ATOM   361  H HD2   . PHE A 1 36 ? -7.336  -14.141 4.998   1.00 37.04  ?  124 PHE A HD2   1 
ATOM   362  H HE1   . PHE A 1 36 ? -8.933  -14.798 9.279   1.00 33.95  ?  124 PHE A HE1   1 
ATOM   363  H HE2   . PHE A 1 36 ? -9.085  -15.600 5.367   1.00 40.13  ?  124 PHE A HE2   1 
ATOM   364  H HZ    . PHE A 1 36 ? -9.886  -15.931 7.507   1.00 38.33  ?  124 PHE A HZ    1 
ATOM   365  N N     . SER A 1 37 ? -4.244  -9.710  7.060   1.00 33.23  ?  125 SER A N     1 
ATOM   366  C CA    . SER A 1 37 ? -2.925  -9.107  7.230   1.00 34.71  ?  125 SER A CA    1 
ATOM   367  C C     . SER A 1 37 ? -2.793  -8.419  8.589   1.00 36.32  ?  125 SER A C     1 
ATOM   368  O O     . SER A 1 37 ? -1.683  -8.199  9.075   1.00 34.43  ?  125 SER A O     1 
ATOM   369  C CB    . SER A 1 37 ? -2.643  -8.109  6.106   1.00 32.20  ?  125 SER A CB    1 
ATOM   370  O OG    . SER A 1 37 ? -2.289  -8.777  4.906   1.00 33.30  ?  125 SER A OG    1 
ATOM   371  H H     . SER A 1 37 ? -4.748  -9.304  6.494   1.00 39.88  ?  125 SER A H     1 
ATOM   372  H HA    . SER A 1 37 ? -2.246  -9.813  7.183   1.00 41.65  ?  125 SER A HA    1 
ATOM   373  H HB2   . SER A 1 37 ? -3.439  -7.579  5.949   1.00 38.64  ?  125 SER A HB2   1 
ATOM   374  H HB3   . SER A 1 37 ? -1.909  -7.533  6.374   1.00 38.64  ?  125 SER A HB3   1 
ATOM   375  H HG    . SER A 1 37 ? -2.297  -9.589  5.025   1.00 39.96  ?  125 SER A HG    1 
ATOM   376  N N     . THR A 1 38 ? -3.928  -8.088  9.200   1.00 37.09  ?  126 THR A N     1 
ATOM   377  C CA    . THR A 1 38 ? -3.938  -7.420  10.499  1.00 35.01  ?  126 THR A CA    1 
ATOM   378  C C     . THR A 1 38 ? -3.464  -8.352  11.613  1.00 35.64  ?  126 THR A C     1 
ATOM   379  O O     . THR A 1 38 ? -3.217  -7.915  12.737  1.00 41.74  ?  126 THR A O     1 
ATOM   380  C CB    . THR A 1 38 ? -5.346  -6.890  10.860  1.00 30.42  ?  126 THR A CB    1 
ATOM   381  O OG1   . THR A 1 38 ? -6.251  -7.989  11.035  1.00 38.56  ?  126 THR A OG1   1 
ATOM   382  C CG2   . THR A 1 38 ? -5.870  -5.950  9.779   1.00 31.18  ?  126 THR A CG2   1 
ATOM   383  H H     . THR A 1 38 ? -4.711  -8.241  8.880   1.00 44.51  ?  126 THR A H     1 
ATOM   384  H HA    . THR A 1 38 ? -3.327  -6.654  10.467  1.00 42.02  ?  126 THR A HA    1 
ATOM   385  H HB    . THR A 1 38 ? -5.292  -6.391  11.690  1.00 36.51  ?  126 THR A HB    1 
ATOM   386  H HG1   . THR A 1 38 ? -6.299  -8.425  10.342  1.00 46.28  ?  126 THR A HG1   1 
ATOM   387  H HG21  . THR A 1 38 ? -6.744  -5.631  10.017  1.00 37.42  ?  126 THR A HG21  1 
ATOM   388  H HG22  . THR A 1 38 ? -5.279  -5.200  9.682   1.00 37.42  ?  126 THR A HG22  1 
ATOM   389  H HG23  . THR A 1 38 ? -5.926  -6.414  8.940   1.00 37.42  ?  126 THR A HG23  1 
ATOM   390  N N     . PHE A 1 39 ? -3.341  -9.637  11.296  1.00 36.10  ?  127 PHE A N     1 
ATOM   391  C CA    . PHE A 1 39 ? -2.864  -10.626 12.254  1.00 34.88  ?  127 PHE A CA    1 
ATOM   392  C C     . PHE A 1 39 ? -1.397  -10.949 12.004  1.00 36.56  ?  127 PHE A C     1 
ATOM   393  O O     . PHE A 1 39 ? -0.660  -11.295 12.927  1.00 40.02  ?  127 PHE A O     1 
ATOM   394  C CB    . PHE A 1 39 ? -3.705  -11.898 12.153  1.00 30.77  ?  127 PHE A CB    1 
ATOM   395  C CG    . PHE A 1 39 ? -5.133  -11.716 12.587  1.00 31.25  ?  127 PHE A CG    1 
ATOM   396  C CD1   . PHE A 1 39 ? -6.071  -11.169 11.729  1.00 33.86  ?  127 PHE A CD1   1 
ATOM   397  C CD2   . PHE A 1 39 ? -5.537  -12.092 13.856  1.00 27.52  ?  127 PHE A CD2   1 
ATOM   398  C CE1   . PHE A 1 39 ? -7.385  -11.001 12.131  1.00 32.23  ?  127 PHE A CE1   1 
ATOM   399  C CE2   . PHE A 1 39 ? -6.848  -11.927 14.260  1.00 26.86  ?  127 PHE A CE2   1 
ATOM   400  C CZ    . PHE A 1 39 ? -7.771  -11.382 13.397  1.00 22.54  ?  127 PHE A CZ    1 
ATOM   401  H H     . PHE A 1 39 ? -3.530  -9.963  10.523  1.00 43.32  ?  127 PHE A H     1 
ATOM   402  H HA    . PHE A 1 39 ? -2.952  -10.269 13.163  1.00 41.86  ?  127 PHE A HA    1 
ATOM   403  H HB2   . PHE A 1 39 ? -3.711  -12.196 11.230  1.00 36.93  ?  127 PHE A HB2   1 
ATOM   404  H HB3   . PHE A 1 39 ? -3.308  -12.581 12.717  1.00 36.93  ?  127 PHE A HB3   1 
ATOM   405  H HD1   . PHE A 1 39 ? -5.816  -10.910 10.873  1.00 40.63  ?  127 PHE A HD1   1 
ATOM   406  H HD2   . PHE A 1 39 ? -4.918  -12.461 14.444  1.00 33.02  ?  127 PHE A HD2   1 
ATOM   407  H HE1   . PHE A 1 39 ? -8.007  -10.633 11.546  1.00 38.68  ?  127 PHE A HE1   1 
ATOM   408  H HE2   . PHE A 1 39 ? -7.107  -12.184 15.116  1.00 32.24  ?  127 PHE A HE2   1 
ATOM   409  H HZ    . PHE A 1 39 ? -8.654  -11.270 13.668  1.00 27.05  ?  127 PHE A HZ    1 
ATOM   410  N N     . GLY A 1 40 ? -0.975  -10.829 10.750  1.00 39.60  ?  128 GLY A N     1 
ATOM   411  C CA    . GLY A 1 40 ? 0.393   -11.131 10.375  1.00 39.39  ?  128 GLY A CA    1 
ATOM   412  C C     . GLY A 1 40 ? 0.557   -11.220 8.873   1.00 36.11  ?  128 GLY A C     1 
ATOM   413  O O     . GLY A 1 40 ? -0.395  -11.018 8.123   1.00 42.48  ?  128 GLY A O     1 
ATOM   414  H H     . GLY A 1 40 ? -1.469  -10.571 10.094  1.00 47.52  ?  128 GLY A H     1 
ATOM   415  H HA2   . GLY A 1 40 ? 0.983   -10.437 10.710  1.00 47.27  ?  128 GLY A HA2   1 
ATOM   416  H HA3   . GLY A 1 40 ? 0.658   -11.978 10.767  1.00 47.27  ?  128 GLY A HA3   1 
ATOM   417  N N     . GLU A 1 41 ? 1.770   -11.529 8.434   1.00 34.78  ?  129 GLU A N     1 
ATOM   418  C CA    . GLU A 1 41 ? 2.064   -11.619 7.013   1.00 32.84  ?  129 GLU A CA    1 
ATOM   419  C C     . GLU A 1 41 ? 1.331   -12.803 6.391   1.00 35.27  ?  129 GLU A C     1 
ATOM   420  O O     . GLU A 1 41 ? 1.356   -13.911 6.923   1.00 43.54  ?  129 GLU A O     1 
ATOM   421  C CB    . GLU A 1 41 ? 3.566   -11.763 6.793   1.00 40.52  ?  129 GLU A CB    1 
ATOM   422  C CG    . GLU A 1 41 ? 3.973   -11.730 5.337   1.00 47.58  ?  129 GLU A CG    1 
ATOM   423  C CD    . GLU A 1 41 ? 5.459   -11.943 5.150   1.00 59.76  ?  129 GLU A CD    1 
ATOM   424  O OE1   . GLU A 1 41 ? 6.192   -11.953 6.162   1.00 59.92  ?  129 GLU A OE1   1 
ATOM   425  O OE2   . GLU A 1 41 ? 5.897   -12.106 3.992   1.00 61.27  -1 129 GLU A OE2   1 
ATOM   426  H H     . GLU A 1 41 ? 2.445   -11.692 8.943   1.00 41.74  ?  129 GLU A H     1 
ATOM   427  H HA    . GLU A 1 41 ? 1.763   -10.801 6.567   1.00 39.41  ?  129 GLU A HA    1 
ATOM   428  H HB2   . GLU A 1 41 ? 4.019   -11.034 7.245   1.00 48.62  ?  129 GLU A HB2   1 
ATOM   429  H HB3   . GLU A 1 41 ? 3.857   -12.611 7.163   1.00 48.62  ?  129 GLU A HB3   1 
ATOM   430  H HG2   . GLU A 1 41 ? 3.505   -12.433 4.861   1.00 57.09  ?  129 GLU A HG2   1 
ATOM   431  H HG3   . GLU A 1 41 ? 3.744   -10.865 4.963   1.00 57.09  ?  129 GLU A HG3   1 
ATOM   432  N N     . VAL A 1 42 ? 0.685   -12.559 5.256   1.00 27.66  ?  130 VAL A N     1 
ATOM   433  C CA    . VAL A 1 42 ? -0.096  -13.584 4.577   1.00 26.60  ?  130 VAL A CA    1 
ATOM   434  C C     . VAL A 1 42 ? 0.571   -13.984 3.267   1.00 32.92  ?  130 VAL A C     1 
ATOM   435  O O     . VAL A 1 42 ? 0.715   -13.163 2.360   1.00 34.26  ?  130 VAL A O     1 
ATOM   436  C CB    . VAL A 1 42 ? -1.527  -13.087 4.285   1.00 29.38  ?  130 VAL A CB    1 
ATOM   437  C CG1   . VAL A 1 42 ? -2.311  -14.132 3.502   1.00 34.09  ?  130 VAL A CG1   1 
ATOM   438  C CG2   . VAL A 1 42 ? -2.237  -12.737 5.583   1.00 31.21  ?  130 VAL A CG2   1 
ATOM   439  H H     . VAL A 1 42 ? 0.683   -11.798 4.855   1.00 33.20  ?  130 VAL A H     1 
ATOM   440  H HA    . VAL A 1 42 ? -0.155  -14.378 5.148   1.00 31.92  ?  130 VAL A HA    1 
ATOM   441  H HB    . VAL A 1 42 ? -1.477  -12.275 3.739   1.00 35.26  ?  130 VAL A HB    1 
ATOM   442  H HG11  . VAL A 1 42 ? -3.195  -13.798 3.334   1.00 40.91  ?  130 VAL A HG11  1 
ATOM   443  H HG12  . VAL A 1 42 ? -1.862  -14.302 2.671   1.00 40.91  ?  130 VAL A HG12  1 
ATOM   444  H HG13  . VAL A 1 42 ? -2.359  -14.939 4.019   1.00 40.91  ?  130 VAL A HG13  1 
ATOM   445  H HG21  . VAL A 1 42 ? -3.124  -12.431 5.381   1.00 37.45  ?  130 VAL A HG21  1 
ATOM   446  H HG22  . VAL A 1 42 ? -2.278  -13.520 6.137   1.00 37.45  ?  130 VAL A HG22  1 
ATOM   447  H HG23  . VAL A 1 42 ? -1.745  -12.045 6.031   1.00 37.45  ?  130 VAL A HG23  1 
ATOM   448  N N     . LEU A 1 43 ? 0.982   -15.244 3.174   1.00 33.78  ?  131 LEU A N     1 
ATOM   449  C CA    . LEU A 1 43 ? 1.622   -15.747 1.964   1.00 29.62  ?  131 LEU A CA    1 
ATOM   450  C C     . LEU A 1 43 ? 0.650   -15.733 0.795   1.00 29.00  ?  131 LEU A C     1 
ATOM   451  O O     . LEU A 1 43 ? 0.938   -15.155 -0.253  1.00 33.48  ?  131 LEU A O     1 
ATOM   452  C CB    . LEU A 1 43 ? 2.154   -17.164 2.181   1.00 27.97  ?  131 LEU A CB    1 
ATOM   453  C CG    . LEU A 1 43 ? 3.387   -17.281 3.080   1.00 32.98  ?  131 LEU A CG    1 
ATOM   454  C CD1   . LEU A 1 43 ? 3.836   -18.730 3.163   1.00 25.22  ?  131 LEU A CD1   1 
ATOM   455  C CD2   . LEU A 1 43 ? 4.518   -16.384 2.582   1.00 31.95  ?  131 LEU A CD2   1 
ATOM   456  H H     . LEU A 1 43 ? 0.902   -15.829 3.799   1.00 40.54  ?  131 LEU A H     1 
ATOM   457  H HA    . LEU A 1 43 ? 2.380   -15.168 1.738   1.00 35.55  ?  131 LEU A HA    1 
ATOM   458  H HB2   . LEU A 1 43 ? 1.451   -17.697 2.584   1.00 33.57  ?  131 LEU A HB2   1 
ATOM   459  H HB3   . LEU A 1 43 ? 2.389   -17.538 1.318   1.00 33.57  ?  131 LEU A HB3   1 
ATOM   460  H HG    . LEU A 1 43 ? 3.151   -16.991 3.975   1.00 39.57  ?  131 LEU A HG    1 
ATOM   461  H HD11  . LEU A 1 43 ? 4.609   -18.786 3.729   1.00 30.27  ?  131 LEU A HD11  1 
ATOM   462  H HD12  . LEU A 1 43 ? 3.122   -19.257 3.530   1.00 30.27  ?  131 LEU A HD12  1 
ATOM   463  H HD13  . LEU A 1 43 ? 4.052   -19.041 2.281   1.00 30.27  ?  131 LEU A HD13  1 
ATOM   464  H HD21  . LEU A 1 43 ? 5.274   -16.482 3.167   1.00 38.34  ?  131 LEU A HD21  1 
ATOM   465  H HD22  . LEU A 1 43 ? 4.757   -16.649 1.691   1.00 38.34  ?  131 LEU A HD22  1 
ATOM   466  H HD23  . LEU A 1 43 ? 4.218   -15.473 2.584   1.00 38.34  ?  131 LEU A HD23  1 
ATOM   467  N N     . MET A 1 44 ? -0.502  -16.370 0.973   1.00 30.59  ?  132 MET A N     1 
ATOM   468  C CA    . MET A 1 44 ? -1.495  -16.423 -0.089  1.00 33.87  ?  132 MET A CA    1 
ATOM   469  C C     . MET A 1 44 ? -2.916  -16.437 0.456   1.00 32.66  ?  132 MET A C     1 
ATOM   470  O O     . MET A 1 44 ? -3.146  -16.668 1.643   1.00 29.37  ?  132 MET A O     1 
ATOM   471  C CB    . MET A 1 44 ? -1.270  -17.658 -0.963  1.00 33.26  ?  132 MET A CB    1 
ATOM   472  C CG    . MET A 1 44 ? -1.826  -18.943 -0.373  1.00 33.08  ?  132 MET A CG    1 
ATOM   473  S SD    . MET A 1 44 ? -3.579  -19.176 -0.719  1.00 31.19  ?  132 MET A SD    1 
ATOM   474  C CE    . MET A 1 44 ? -3.918  -20.662 0.221   1.00 28.05  ?  132 MET A CE    1 
ATOM   475  H H     . MET A 1 44 ? -0.731  -16.777 1.695   1.00 36.71  ?  132 MET A H     1 
ATOM   476  H HA    . MET A 1 44 ? -1.387  -15.633 -0.658  1.00 40.65  ?  132 MET A HA    1 
ATOM   477  H HB2   . MET A 1 44 ? -1.701  -17.516 -1.820  1.00 39.91  ?  132 MET A HB2   1 
ATOM   478  H HB3   . MET A 1 44 ? -0.317  -17.780 -1.091  1.00 39.91  ?  132 MET A HB3   1 
ATOM   479  H HG2   . MET A 1 44 ? -1.344  -19.696 -0.748  1.00 39.70  ?  132 MET A HG2   1 
ATOM   480  H HG3   . MET A 1 44 ? -1.711  -18.923 0.590   1.00 39.70  ?  132 MET A HG3   1 
ATOM   481  H HE1   . MET A 1 44 ? -4.843  -20.894 0.115   1.00 33.66  ?  132 MET A HE1   1 
ATOM   482  H HE2   . MET A 1 44 ? -3.362  -21.372 -0.107  1.00 33.66  ?  132 MET A HE2   1 
ATOM   483  H HE3   . MET A 1 44 ? -3.726  -20.496 1.147   1.00 33.66  ?  132 MET A HE3   1 
ATOM   484  N N     . VAL A 1 45 ? -3.864  -16.194 -0.440  1.00 34.84  ?  133 VAL A N     1 
ATOM   485  C CA    . VAL A 1 45 ? -5.277  -16.174 -0.099  1.00 30.75  ?  133 VAL A CA    1 
ATOM   486  C C     . VAL A 1 45 ? -6.074  -16.621 -1.315  1.00 31.09  ?  133 VAL A C     1 
ATOM   487  O O     . VAL A 1 45 ? -5.662  -16.396 -2.452  1.00 30.56  ?  133 VAL A O     1 
ATOM   488  C CB    . VAL A 1 45 ? -5.732  -14.761 0.320   1.00 35.01  ?  133 VAL A CB    1 
ATOM   489  C CG1   . VAL A 1 45 ? -7.243  -14.711 0.496   1.00 39.37  ?  133 VAL A CG1   1 
ATOM   490  C CG2   . VAL A 1 45 ? -5.024  -14.331 1.596   1.00 44.37  ?  133 VAL A CG2   1 
ATOM   491  H H     . VAL A 1 45 ? -3.709  -16.035 -1.270  1.00 41.80  ?  133 VAL A H     1 
ATOM   492  H HA    . VAL A 1 45 ? -5.450  -16.794 0.640   1.00 36.90  ?  133 VAL A HA    1 
ATOM   493  H HB    . VAL A 1 45 ? -5.490  -14.127 -0.387  1.00 42.01  ?  133 VAL A HB    1 
ATOM   494  H HG11  . VAL A 1 45 ? -7.497  -13.822 0.755   1.00 47.24  ?  133 VAL A HG11  1 
ATOM   495  H HG12  . VAL A 1 45 ? -7.662  -14.942 -0.337  1.00 47.24  ?  133 VAL A HG12  1 
ATOM   496  H HG13  . VAL A 1 45 ? -7.499  -15.337 1.176   1.00 47.24  ?  133 VAL A HG13  1 
ATOM   497  H HG21  . VAL A 1 45 ? -5.323  -13.451 1.838   1.00 53.24  ?  133 VAL A HG21  1 
ATOM   498  H HG22  . VAL A 1 45 ? -5.237  -14.953 2.296   1.00 53.24  ?  133 VAL A HG22  1 
ATOM   499  H HG23  . VAL A 1 45 ? -4.077  -14.325 1.441   1.00 53.24  ?  133 VAL A HG23  1 
ATOM   500  N N     . GLN A 1 46 ? -7.211  -17.260 -1.074  1.00 29.84  ?  134 GLN A N     1 
ATOM   501  C CA    . GLN A 1 46 ? -8.058  -17.731 -2.159  1.00 31.89  ?  134 GLN A CA    1 
ATOM   502  C C     . GLN A 1 46 ? -9.529  -17.583 -1.808  1.00 32.50  ?  134 GLN A C     1 
ATOM   503  O O     . GLN A 1 46 ? -9.943  -17.889 -0.693  1.00 30.96  ?  134 GLN A O     1 
ATOM   504  C CB    . GLN A 1 46 ? -7.763  -19.199 -2.468  1.00 32.78  ?  134 GLN A CB    1 
ATOM   505  C CG    . GLN A 1 46 ? -6.433  -19.447 -3.162  1.00 27.99  ?  134 GLN A CG    1 
ATOM   506  C CD    . GLN A 1 46 ? -6.134  -20.924 -3.326  1.00 27.50  ?  134 GLN A CD    1 
ATOM   507  O OE1   . GLN A 1 46 ? -6.744  -21.766 -2.670  1.00 35.78  ?  134 GLN A OE1   1 
ATOM   508  N NE2   . GLN A 1 46 ? -5.194  -21.246 -4.205  1.00 26.61  ?  134 GLN A NE2   1 
ATOM   509  H H     . GLN A 1 46 ? -7.515  -17.435 -0.289  1.00 35.81  ?  134 GLN A H     1 
ATOM   510  H HA    . GLN A 1 46 ? -7.878  -17.203 -2.964  1.00 38.26  ?  134 GLN A HA    1 
ATOM   511  H HB2   . GLN A 1 46 ? -7.756  -19.696 -1.635  1.00 39.33  ?  134 GLN A HB2   1 
ATOM   512  H HB3   . GLN A 1 46 ? -8.463  -19.541 -3.046  1.00 39.33  ?  134 GLN A HB3   1 
ATOM   513  H HG2   . GLN A 1 46 ? -6.455  -19.044 -4.044  1.00 33.58  ?  134 GLN A HG2   1 
ATOM   514  H HG3   . GLN A 1 46 ? -5.721  -19.053 -2.634  1.00 33.58  ?  134 GLN A HG3   1 
ATOM   515  H HE21  . GLN A 1 46 ? -4.789  -20.629 -4.647  1.00 31.93  ?  134 GLN A HE21  1 
ATOM   516  H HE22  . GLN A 1 46 ? -4.990  -22.071 -4.333  1.00 31.93  ?  134 GLN A HE22  1 
ATOM   517  N N     . VAL A 1 47 ? -10.310 -17.106 -2.769  1.00 27.85  ?  135 VAL A N     1 
ATOM   518  C CA    . VAL A 1 47 ? -11.759 -17.101 -2.651  1.00 26.35  ?  135 VAL A CA    1 
ATOM   519  C C     . VAL A 1 47 ? -12.324 -17.942 -3.787  1.00 33.13  ?  135 VAL A C     1 
ATOM   520  O O     . VAL A 1 47 ? -12.093 -17.647 -4.961  1.00 33.20  ?  135 VAL A O     1 
ATOM   521  C CB    . VAL A 1 47 ? -12.333 -15.677 -2.725  1.00 28.44  ?  135 VAL A CB    1 
ATOM   522  C CG1   . VAL A 1 47 ? -13.852 -15.713 -2.615  1.00 20.65  ?  135 VAL A CG1   1 
ATOM   523  C CG2   . VAL A 1 47 ? -11.727 -14.807 -1.631  1.00 31.69  ?  135 VAL A CG2   1 
ATOM   524  H H     . VAL A 1 47 ? -10.020 -16.775 -3.508  1.00 33.42  ?  135 VAL A H     1 
ATOM   525  H HA    . VAL A 1 47 ? -12.024 -17.505 -1.798  1.00 31.62  ?  135 VAL A HA    1 
ATOM   526  H HB    . VAL A 1 47 ? -12.100 -15.283 -3.591  1.00 34.13  ?  135 VAL A HB    1 
ATOM   527  H HG11  . VAL A 1 47 ? -14.190 -14.816 -2.664  1.00 24.78  ?  135 VAL A HG11  1 
ATOM   528  H HG12  . VAL A 1 47 ? -14.205 -16.235 -3.340  1.00 24.78  ?  135 VAL A HG12  1 
ATOM   529  H HG13  . VAL A 1 47 ? -14.095 -16.110 -1.776  1.00 24.78  ?  135 VAL A HG13  1 
ATOM   530  H HG21  . VAL A 1 47 ? -12.098 -13.923 -1.695  1.00 38.03  ?  135 VAL A HG21  1 
ATOM   531  H HG22  . VAL A 1 47 ? -11.936 -15.189 -0.776  1.00 38.03  ?  135 VAL A HG22  1 
ATOM   532  H HG23  . VAL A 1 47 ? -10.775 -14.772 -1.751  1.00 38.03  ?  135 VAL A HG23  1 
ATOM   533  N N     . LYS A 1 48 ? -13.056 -18.994 -3.440  1.00 25.99  ?  136 LYS A N     1 
ATOM   534  C CA    . LYS A 1 48 ? -13.548 -19.931 -4.439  1.00 24.67  ?  136 LYS A CA    1 
ATOM   535  C C     . LYS A 1 48 ? -14.824 -19.424 -5.092  1.00 30.82  ?  136 LYS A C     1 
ATOM   536  O O     . LYS A 1 48 ? -15.774 -19.040 -4.414  1.00 30.59  ?  136 LYS A O     1 
ATOM   537  C CB    . LYS A 1 48 ? -13.763 -21.312 -3.819  1.00 28.56  ?  136 LYS A CB    1 
ATOM   538  C CG    . LYS A 1 48 ? -12.466 -21.986 -3.394  1.00 33.00  ?  136 LYS A CG    1 
ATOM   539  C CD    . LYS A 1 48 ? -11.442 -21.954 -4.522  1.00 31.68  ?  136 LYS A CD    1 
ATOM   540  C CE    . LYS A 1 48 ? -10.170 -22.690 -4.151  1.00 35.69  ?  136 LYS A CE    1 
ATOM   541  N NZ    . LYS A 1 48 ? -9.295  -22.910 -5.334  1.00 29.20  1  136 LYS A NZ    1 
ATOM   542  H H     . LYS A 1 48 ? -13.281 -19.186 -2.632  1.00 31.18  ?  136 LYS A H     1 
ATOM   543  H HA    . LYS A 1 48 ? -12.872 -20.023 -5.142  1.00 29.60  ?  136 LYS A HA    1 
ATOM   544  H HB2   . LYS A 1 48 ? -14.323 -21.220 -3.032  1.00 34.28  ?  136 LYS A HB2   1 
ATOM   545  H HB3   . LYS A 1 48 ? -14.198 -21.885 -4.469  1.00 34.28  ?  136 LYS A HB3   1 
ATOM   546  H HG2   . LYS A 1 48 ? -12.095 -21.517 -2.630  1.00 39.60  ?  136 LYS A HG2   1 
ATOM   547  H HG3   . LYS A 1 48 ? -12.644 -22.913 -3.168  1.00 39.60  ?  136 LYS A HG3   1 
ATOM   548  H HD2   . LYS A 1 48 ? -11.820 -22.379 -5.308  1.00 38.02  ?  136 LYS A HD2   1 
ATOM   549  H HD3   . LYS A 1 48 ? -11.213 -21.032 -4.718  1.00 38.02  ?  136 LYS A HD3   1 
ATOM   550  H HE2   . LYS A 1 48 ? -9.675  -22.165 -3.502  1.00 42.82  ?  136 LYS A HE2   1 
ATOM   551  H HE3   . LYS A 1 48 ? -10.399 -23.555 -3.778  1.00 42.82  ?  136 LYS A HE3   1 
ATOM   552  H HZ1   . LYS A 1 48 ? -8.556  -23.342 -5.090  1.00 35.04  ?  136 LYS A HZ1   1 
ATOM   553  H HZ2   . LYS A 1 48 ? -9.725  -23.394 -5.945  1.00 35.04  ?  136 LYS A HZ2   1 
ATOM   554  H HZ3   . LYS A 1 48 ? -9.067  -22.128 -5.693  1.00 35.04  ?  136 LYS A HZ3   1 
ATOM   555  N N     . LYS A 1 49 ? -14.828 -19.424 -6.420  1.00 31.22  ?  137 LYS A N     1 
ATOM   556  C CA    . LYS A 1 49 ? -15.935 -18.882 -7.188  1.00 28.54  ?  137 LYS A CA    1 
ATOM   557  C C     . LYS A 1 49 ? -16.238 -19.784 -8.373  1.00 25.71  ?  137 LYS A C     1 
ATOM   558  O O     . LYS A 1 49 ? -15.459 -20.676 -8.702  1.00 29.67  ?  137 LYS A O     1 
ATOM   559  C CB    . LYS A 1 49 ? -15.583 -17.484 -7.701  1.00 31.91  ?  137 LYS A CB    1 
ATOM   560  C CG    . LYS A 1 49 ? -14.256 -16.947 -7.181  1.00 38.39  ?  137 LYS A CG    1 
ATOM   561  C CD    . LYS A 1 49 ? -13.795 -15.740 -7.983  1.00 50.06  ?  137 LYS A CD    1 
ATOM   562  C CE    . LYS A 1 49 ? -12.356 -15.370 -7.657  1.00 55.36  ?  137 LYS A CE    1 
ATOM   563  N NZ    . LYS A 1 49 ? -11.825 -14.336 -8.589  1.00 63.50  1  137 LYS A NZ    1 
ATOM   564  H H     . LYS A 1 49 ? -14.189 -19.737 -6.904  1.00 37.46  ?  137 LYS A H     1 
ATOM   565  H HA    . LYS A 1 49 ? -16.734 -18.821 -6.624  1.00 34.24  ?  137 LYS A HA    1 
ATOM   566  H HB2   . LYS A 1 49 ? -15.532 -17.510 -8.669  1.00 38.29  ?  137 LYS A HB2   1 
ATOM   567  H HB3   . LYS A 1 49 ? -16.279 -16.867 -7.425  1.00 38.29  ?  137 LYS A HB3   1 
ATOM   568  H HG2   . LYS A 1 49 ? -14.359 -16.677 -6.256  1.00 46.07  ?  137 LYS A HG2   1 
ATOM   569  H HG3   . LYS A 1 49 ? -13.579 -17.638 -7.256  1.00 46.07  ?  137 LYS A HG3   1 
ATOM   570  H HD2   . LYS A 1 49 ? -13.850 -15.945 -8.929  1.00 60.07  ?  137 LYS A HD2   1 
ATOM   571  H HD3   . LYS A 1 49 ? -14.360 -14.981 -7.771  1.00 60.07  ?  137 LYS A HD3   1 
ATOM   572  H HE2   . LYS A 1 49 ? -12.315 -15.015 -6.755  1.00 66.43  ?  137 LYS A HE2   1 
ATOM   573  H HE3   . LYS A 1 49 ? -11.799 -16.160 -7.732  1.00 66.43  ?  137 LYS A HE3   1 
ATOM   574  H HZ1   . LYS A 1 49 ? -10.984 -14.138 -8.376  1.00 76.20  ?  137 LYS A HZ1   1 
ATOM   575  H HZ2   . LYS A 1 49 ? -11.848 -14.640 -9.425  1.00 76.20  ?  137 LYS A HZ2   1 
ATOM   576  H HZ3   . LYS A 1 49 ? -12.318 -13.597 -8.536  1.00 76.20  ?  137 LYS A HZ3   1 
ATOM   577  N N     . ASP A 1 50 ? -17.375 -19.543 -9.014  1.00 28.71  ?  138 ASP A N     1 
ATOM   578  C CA    . ASP A 1 50 ? -17.688 -20.200 -10.272 1.00 25.63  ?  138 ASP A CA    1 
ATOM   579  C C     . ASP A 1 50 ? -16.954 -19.463 -11.387 1.00 26.77  ?  138 ASP A C     1 
ATOM   580  O O     . ASP A 1 50 ? -17.170 -18.274 -11.600 1.00 25.03  ?  138 ASP A O     1 
ATOM   581  C CB    . ASP A 1 50 ? -19.195 -20.191 -10.520 1.00 26.92  ?  138 ASP A CB    1 
ATOM   582  C CG    . ASP A 1 50 ? -19.550 -20.543 -11.948 1.00 31.07  ?  138 ASP A CG    1 
ATOM   583  O OD1   . ASP A 1 50 ? -19.620 -19.618 -12.781 1.00 33.59  ?  138 ASP A OD1   1 
ATOM   584  O OD2   . ASP A 1 50 ? -19.756 -21.740 -12.239 1.00 35.40  -1 138 ASP A OD2   1 
ATOM   585  H H     . ASP A 1 50 ? -17.983 -19.002 -8.738  1.00 34.45  ?  138 ASP A H     1 
ATOM   586  H HA    . ASP A 1 50 ? -17.377 -21.129 -10.248 1.00 30.76  ?  138 ASP A HA    1 
ATOM   587  H HB2   . ASP A 1 50 ? -19.616 -20.841 -9.936  1.00 32.31  ?  138 ASP A HB2   1 
ATOM   588  H HB3   . ASP A 1 50 ? -19.541 -19.304 -10.335 1.00 32.31  ?  138 ASP A HB3   1 
ATOM   589  N N     . LEU A 1 51 ? -16.074 -20.173 -12.084 1.00 27.94  ?  139 LEU A N     1 
ATOM   590  C CA    . LEU A 1 51 ? -15.220 -19.564 -13.098 1.00 25.04  ?  139 LEU A CA    1 
ATOM   591  C C     . LEU A 1 51 ? -16.008 -18.851 -14.187 1.00 30.34  ?  139 LEU A C     1 
ATOM   592  O O     . LEU A 1 51 ? -15.492 -17.956 -14.856 1.00 40.03  ?  139 LEU A O     1 
ATOM   593  C CB    . LEU A 1 51 ? -14.341 -20.629 -13.747 1.00 29.19  ?  139 LEU A CB    1 
ATOM   594  C CG    . LEU A 1 51 ? -12.864 -20.573 -13.370 1.00 44.54  ?  139 LEU A CG    1 
ATOM   595  C CD1   . LEU A 1 51 ? -12.668 -20.831 -11.881 1.00 41.92  ?  139 LEU A CD1   1 
ATOM   596  C CD2   . LEU A 1 51 ? -12.099 -21.571 -14.204 1.00 46.53  ?  139 LEU A CD2   1 
ATOM   597  H H     . LEU A 1 51 ? -15.952 -21.019 -11.988 1.00 33.53  ?  139 LEU A H     1 
ATOM   598  H HA    . LEU A 1 51 ? -14.633 -18.907 -12.669 1.00 30.05  ?  139 LEU A HA    1 
ATOM   599  H HB2   . LEU A 1 51 ? -14.675 -21.502 -13.488 1.00 35.03  ?  139 LEU A HB2   1 
ATOM   600  H HB3   . LEU A 1 51 ? -14.400 -20.532 -14.710 1.00 35.03  ?  139 LEU A HB3   1 
ATOM   601  H HG    . LEU A 1 51 ? -12.520 -19.688 -13.569 1.00 53.45  ?  139 LEU A HG    1 
ATOM   602  H HD11  . LEU A 1 51 ? -11.731 -20.788 -11.678 1.00 50.30  ?  139 LEU A HD11  1 
ATOM   603  H HD12  . LEU A 1 51 ? -13.142 -20.161 -11.383 1.00 50.30  ?  139 LEU A HD12  1 
ATOM   604  H HD13  . LEU A 1 51 ? -13.010 -21.702 -11.668 1.00 50.30  ?  139 LEU A HD13  1 
ATOM   605  H HD21  . LEU A 1 51 ? -11.170 -21.532 -13.963 1.00 55.84  ?  139 LEU A HD21  1 
ATOM   606  H HD22  . LEU A 1 51 ? -12.445 -22.451 -14.034 1.00 55.84  ?  139 LEU A HD22  1 
ATOM   607  H HD23  . LEU A 1 51 ? -12.206 -21.351 -15.132 1.00 55.84  ?  139 LEU A HD23  1 
ATOM   608  N N     . LYS A 1 52 ? -17.259 -19.255 -14.367 1.00 28.93  ?  140 LYS A N     1 
ATOM   609  C CA    . LYS A 1 52 ? -18.075 -18.749 -15.459 1.00 29.64  ?  140 LYS A CA    1 
ATOM   610  C C     . LYS A 1 52 ? -18.717 -17.402 -15.124 1.00 36.42  ?  140 LYS A C     1 
ATOM   611  O O     . LYS A 1 52 ? -18.968 -16.587 -16.013 1.00 36.26  ?  140 LYS A O     1 
ATOM   612  C CB    . LYS A 1 52 ? -19.149 -19.778 -15.807 1.00 28.47  ?  140 LYS A CB    1 
ATOM   613  C CG    . LYS A 1 52 ? -19.982 -19.420 -17.011 1.00 42.14  ?  140 LYS A CG    1 
ATOM   614  C CD    . LYS A 1 52 ? -20.893 -20.572 -17.406 1.00 48.32  ?  140 LYS A CD    1 
ATOM   615  C CE    . LYS A 1 52 ? -21.926 -20.135 -18.429 1.00 57.75  ?  140 LYS A CE    1 
ATOM   616  N NZ    . LYS A 1 52 ? -21.298 -19.361 -19.522 1.00 58.22  1  140 LYS A NZ    1 
ATOM   617  H H     . LYS A 1 52 ? -17.660 -19.826 -13.865 1.00 34.71  ?  140 LYS A H     1 
ATOM   618  H HA    . LYS A 1 52 ? -17.509 -18.625 -16.249 1.00 35.57  ?  140 LYS A HA    1 
ATOM   619  H HB2   . LYS A 1 52 ? -18.719 -20.628 -15.988 1.00 34.16  ?  140 LYS A HB2   1 
ATOM   620  H HB3   . LYS A 1 52 ? -19.749 -19.869 -15.050 1.00 34.16  ?  140 LYS A HB3   1 
ATOM   621  H HG2   . LYS A 1 52 ? -20.535 -18.651 -16.803 1.00 50.57  ?  140 LYS A HG2   1 
ATOM   622  H HG3   . LYS A 1 52 ? -19.397 -19.223 -17.759 1.00 50.57  ?  140 LYS A HG3   1 
ATOM   623  H HD2   . LYS A 1 52 ? -20.360 -21.283 -17.796 1.00 57.99  ?  140 LYS A HD2   1 
ATOM   624  H HD3   . LYS A 1 52 ? -21.361 -20.895 -16.620 1.00 57.99  ?  140 LYS A HD3   1 
ATOM   625  H HE2   . LYS A 1 52 ? -22.348 -20.919 -18.814 1.00 69.31  ?  140 LYS A HE2   1 
ATOM   626  H HE3   . LYS A 1 52 ? -22.588 -19.573 -17.997 1.00 69.31  ?  140 LYS A HE3   1 
ATOM   627  H HZ1   . LYS A 1 52 ? -21.916 -19.113 -20.113 1.00 69.86  ?  140 LYS A HZ1   1 
ATOM   628  H HZ2   . LYS A 1 52 ? -20.905 -18.634 -19.193 1.00 69.86  ?  140 LYS A HZ2   1 
ATOM   629  H HZ3   . LYS A 1 52 ? -20.687 -19.858 -19.935 1.00 69.86  ?  140 LYS A HZ3   1 
ATOM   630  N N     . THR A 1 53 ? -18.971 -17.169 -13.840 1.00 28.64  ?  141 THR A N     1 
ATOM   631  C CA    . THR A 1 53 ? -19.632 -15.944 -13.396 1.00 28.70  ?  141 THR A CA    1 
ATOM   632  C C     . THR A 1 53 ? -18.774 -15.116 -12.438 1.00 28.22  ?  141 THR A C     1 
ATOM   633  O O     . THR A 1 53 ? -18.994 -13.916 -12.282 1.00 32.72  ?  141 THR A O     1 
ATOM   634  C CB    . THR A 1 53 ? -20.976 -16.259 -12.704 1.00 32.54  ?  141 THR A CB    1 
ATOM   635  O OG1   . THR A 1 53 ? -20.770 -17.220 -11.660 1.00 29.61  ?  141 THR A OG1   1 
ATOM   636  C CG2   . THR A 1 53 ? -21.974 -16.810 -13.712 1.00 29.74  ?  141 THR A CG2   1 
ATOM   637  H H     . THR A 1 53 ? -18.769 -17.707 -13.201 1.00 34.37  ?  141 THR A H     1 
ATOM   638  H HA    . THR A 1 53 ? -19.824 -15.388 -14.180 1.00 34.44  ?  141 THR A HA    1 
ATOM   639  H HB    . THR A 1 53 ? -21.342 -15.445 -12.325 1.00 39.05  ?  141 THR A HB    1 
ATOM   640  H HG1   . THR A 1 53 ? -20.460 -17.912 -11.973 1.00 35.54  ?  141 THR A HG1   1 
ATOM   641  H HG21  . THR A 1 53 ? -22.807 -17.004 -13.275 1.00 35.69  ?  141 THR A HG21  1 
ATOM   642  H HG22  . THR A 1 53 ? -22.129 -16.166 -14.406 1.00 35.69  ?  141 THR A HG22  1 
ATOM   643  H HG23  . THR A 1 53 ? -21.633 -17.617 -14.105 1.00 35.69  ?  141 THR A HG23  1 
ATOM   644  N N     . GLY A 1 54 ? -17.800 -15.754 -11.798 1.00 24.12  ?  142 GLY A N     1 
ATOM   645  C CA    . GLY A 1 54 ? -16.959 -15.076 -10.827 1.00 28.11  ?  142 GLY A CA    1 
ATOM   646  C C     . GLY A 1 54 ? -17.642 -14.907 -9.482  1.00 31.97  ?  142 GLY A C     1 
ATOM   647  O O     . GLY A 1 54 ? -17.045 -14.390 -8.538  1.00 27.55  ?  142 GLY A O     1 
ATOM   648  H H     . GLY A 1 54 ? -17.606 -16.584 -11.911 1.00 28.95  ?  142 GLY A H     1 
ATOM   649  H HA2   . GLY A 1 54 ? -16.144 -15.586 -10.695 1.00 33.73  ?  142 GLY A HA2   1 
ATOM   650  H HA3   . GLY A 1 54 ? -16.722 -14.198 -11.163 1.00 33.73  ?  142 GLY A HA3   1 
ATOM   651  N N     . HIS A 1 55 ? -18.894 -15.346 -9.388  1.00 30.67  ?  143 HIS A N     1 
ATOM   652  C CA    . HIS A 1 55 ? -19.639 -15.252 -8.138  1.00 27.24  ?  143 HIS A CA    1 
ATOM   653  C C     . HIS A 1 55 ? -19.019 -16.153 -7.082  1.00 23.20  ?  143 HIS A C     1 
ATOM   654  O O     . HIS A 1 55 ? -18.776 -17.335 -7.322  1.00 23.34  ?  143 HIS A O     1 
ATOM   655  C CB    . HIS A 1 55 ? -21.103 -15.630 -8.352  1.00 26.92  ?  143 HIS A CB    1 
ATOM   656  C CG    . HIS A 1 55 ? -21.832 -14.711 -9.281  1.00 25.40  ?  143 HIS A CG    1 
ATOM   657  N ND1   . HIS A 1 55 ? -22.925 -15.108 -10.014 1.00 23.69  ?  143 HIS A ND1   1 
ATOM   658  C CD2   . HIS A 1 55 ? -21.617 -13.410 -9.591  1.00 26.70  ?  143 HIS A CD2   1 
ATOM   659  C CE1   . HIS A 1 55 ? -23.356 -14.090 -10.742 1.00 30.43  ?  143 HIS A CE1   1 
ATOM   660  N NE2   . HIS A 1 55 ? -22.580 -13.051 -10.503 1.00 29.78  ?  143 HIS A NE2   1 
ATOM   661  H H     . HIS A 1 55 ? -19.335 -15.702 -10.035 1.00 36.80  ?  143 HIS A H     1 
ATOM   662  H HA    . HIS A 1 55 ? -19.606 -14.329 -7.811  1.00 32.69  ?  143 HIS A HA    1 
ATOM   663  H HB2   . HIS A 1 55 ? -21.144 -16.524 -8.726  1.00 32.30  ?  143 HIS A HB2   1 
ATOM   664  H HB3   . HIS A 1 55 ? -21.560 -15.611 -7.496  1.00 32.30  ?  143 HIS A HB3   1 
ATOM   665  H HD1   . HIS A 1 55 ? -23.273 -15.894 -10.003 1.00 28.43  ?  143 HIS A HD1   1 
ATOM   666  H HD2   . HIS A 1 55 ? -20.945 -12.864 -9.253  1.00 32.04  ?  143 HIS A HD2   1 
ATOM   667  H HE1   . HIS A 1 55 ? -24.083 -14.105 -11.322 1.00 36.51  ?  143 HIS A HE1   1 
ATOM   668  H HE2   . HIS A 1 55 ? -22.664 -12.273 -10.860 1.00 35.73  ?  143 HIS A HE2   1 
ATOM   669  N N     . SER A 1 56 ? -18.765 -15.584 -5.909  1.00 23.88  ?  144 SER A N     1 
ATOM   670  C CA    . SER A 1 56 ? -18.136 -16.316 -4.821  1.00 25.84  ?  144 SER A CA    1 
ATOM   671  C C     . SER A 1 56 ? -19.000 -17.491 -4.387  1.00 31.60  ?  144 SER A C     1 
ATOM   672  O O     . SER A 1 56 ? -20.228 -17.420 -4.420  1.00 25.18  ?  144 SER A O     1 
ATOM   673  C CB    . SER A 1 56 ? -17.890 -15.383 -3.635  1.00 29.66  ?  144 SER A CB    1 
ATOM   674  O OG    . SER A 1 56 ? -17.367 -16.093 -2.527  1.00 31.03  ?  144 SER A OG    1 
ATOM   675  H H     . SER A 1 56 ? -18.951 -14.766 -5.718  1.00 28.65  ?  144 SER A H     1 
ATOM   676  H HA    . SER A 1 56 ? -17.271 -16.664 -5.122  1.00 31.01  ?  144 SER A HA    1 
ATOM   677  H HB2   . SER A 1 56 ? -17.255 -14.699 -3.898  1.00 35.59  ?  144 SER A HB2   1 
ATOM   678  H HB3   . SER A 1 56 ? -18.731 -14.973 -3.377  1.00 35.59  ?  144 SER A HB3   1 
ATOM   679  H HG    . SER A 1 56 ? -17.241 -15.580 -1.900  1.00 37.24  ?  144 SER A HG    1 
ATOM   680  N N     . LYS A 1 57 ? -18.348 -18.575 -3.983  1.00 31.99  ?  145 LYS A N     1 
ATOM   681  C CA    . LYS A 1 57 ? -19.050 -19.754 -3.497  1.00 34.46  ?  145 LYS A CA    1 
ATOM   682  C C     . LYS A 1 57 ? -19.193 -19.700 -1.981  1.00 26.92  ?  145 LYS A C     1 
ATOM   683  O O     . LYS A 1 57 ? -19.850 -20.550 -1.382  1.00 27.25  ?  145 LYS A O     1 
ATOM   684  C CB    . LYS A 1 57 ? -18.330 -21.031 -3.936  1.00 28.21  ?  145 LYS A CB    1 
ATOM   685  C CG    . LYS A 1 57 ? -18.589 -21.386 -5.390  1.00 31.49  ?  145 LYS A CG    1 
ATOM   686  C CD    . LYS A 1 57 ? -18.168 -22.806 -5.716  1.00 29.89  ?  145 LYS A CD    1 
ATOM   687  C CE    . LYS A 1 57 ? -16.690 -22.896 -6.032  1.00 34.19  ?  145 LYS A CE    1 
ATOM   688  N NZ    . LYS A 1 57 ? -16.346 -24.226 -6.601  1.00 41.37  1  145 LYS A NZ    1 
ATOM   689  H H     . LYS A 1 57 ? -17.491 -18.653 -3.982  1.00 38.39  ?  145 LYS A H     1 
ATOM   690  H HA    . LYS A 1 57 ? -19.950 -19.768 -3.883  1.00 41.35  ?  145 LYS A HA    1 
ATOM   691  H HB2   . LYS A 1 57 ? -17.375 -20.909 -3.823  1.00 33.85  ?  145 LYS A HB2   1 
ATOM   692  H HB3   . LYS A 1 57 ? -18.637 -21.770 -3.388  1.00 33.85  ?  145 LYS A HB3   1 
ATOM   693  H HG2   . LYS A 1 57 ? -19.538 -21.303 -5.573  1.00 37.78  ?  145 LYS A HG2   1 
ATOM   694  H HG3   . LYS A 1 57 ? -18.085 -20.783 -5.959  1.00 37.78  ?  145 LYS A HG3   1 
ATOM   695  H HD2   . LYS A 1 57 ? -18.349 -23.376 -4.953  1.00 35.87  ?  145 LYS A HD2   1 
ATOM   696  H HD3   . LYS A 1 57 ? -18.663 -23.116 -6.491  1.00 35.87  ?  145 LYS A HD3   1 
ATOM   697  H HE2   . LYS A 1 57 ? -16.459 -22.216 -6.684  1.00 41.02  ?  145 LYS A HE2   1 
ATOM   698  H HE3   . LYS A 1 57 ? -16.179 -22.770 -5.217  1.00 41.02  ?  145 LYS A HE3   1 
ATOM   699  H HZ1   . LYS A 1 57 ? -15.475 -24.264 -6.781  1.00 49.65  ?  145 LYS A HZ1   1 
ATOM   700  H HZ2   . LYS A 1 57 ? -16.548 -24.868 -6.018  1.00 49.65  ?  145 LYS A HZ2   1 
ATOM   701  H HZ3   . LYS A 1 57 ? -16.803 -24.363 -7.352  1.00 49.65  ?  145 LYS A HZ3   1 
ATOM   702  N N     . GLY A 1 58 ? -18.577 -18.694 -1.367  1.00 25.69  ?  146 GLY A N     1 
ATOM   703  C CA    . GLY A 1 58 ? -18.791 -18.417 0.041   1.00 30.36  ?  146 GLY A CA    1 
ATOM   704  C C     . GLY A 1 58 ? -17.669 -18.865 0.961   1.00 30.73  ?  146 GLY A C     1 
ATOM   705  O O     . GLY A 1 58 ? -17.752 -18.670 2.173   1.00 35.19  ?  146 GLY A O     1 
ATOM   706  H H     . GLY A 1 58 ? -18.026 -18.156 -1.750  1.00 30.83  ?  146 GLY A H     1 
ATOM   707  H HA2   . GLY A 1 58 ? -18.910 -17.461 0.159   1.00 36.44  ?  146 GLY A HA2   1 
ATOM   708  H HA3   . GLY A 1 58 ? -19.606 -18.858 0.328   1.00 36.44  ?  146 GLY A HA3   1 
ATOM   709  N N     . PHE A 1 59 ? -16.624 -19.465 0.397   1.00 28.78  ?  147 PHE A N     1 
ATOM   710  C CA    . PHE A 1 59 ? -15.499 -19.940 1.199   1.00 30.83  ?  147 PHE A CA    1 
ATOM   711  C C     . PHE A 1 59 ? -14.169 -19.696 0.497   1.00 24.54  ?  147 PHE A C     1 
ATOM   712  O O     . PHE A 1 59 ? -14.126 -19.482 -0.713  1.00 31.19  ?  147 PHE A O     1 
ATOM   713  C CB    . PHE A 1 59 ? -15.653 -21.430 1.510   1.00 29.69  ?  147 PHE A CB    1 
ATOM   714  C CG    . PHE A 1 59 ? -15.493 -22.323 0.309   1.00 26.48  ?  147 PHE A CG    1 
ATOM   715  C CD1   . PHE A 1 59 ? -16.546 -22.527 -0.565  1.00 27.98  ?  147 PHE A CD1   1 
ATOM   716  C CD2   . PHE A 1 59 ? -14.292 -22.965 0.058   1.00 30.37  ?  147 PHE A CD2   1 
ATOM   717  C CE1   . PHE A 1 59 ? -16.401 -23.350 -1.668  1.00 29.16  ?  147 PHE A CE1   1 
ATOM   718  C CE2   . PHE A 1 59 ? -14.146 -23.789 -1.044  1.00 28.47  ?  147 PHE A CE2   1 
ATOM   719  C CZ    . PHE A 1 59 ? -15.201 -23.980 -1.905  1.00 27.33  ?  147 PHE A CZ    1 
ATOM   720  H H     . PHE A 1 59 ? -16.542 -19.610 -0.446  1.00 34.53  ?  147 PHE A H     1 
ATOM   721  H HA    . PHE A 1 59 ? -15.486 -19.453 2.049   1.00 37.00  ?  147 PHE A HA    1 
ATOM   722  H HB2   . PHE A 1 59 ? -14.980 -21.685 2.160   1.00 35.62  ?  147 PHE A HB2   1 
ATOM   723  H HB3   . PHE A 1 59 ? -16.538 -21.583 1.877   1.00 35.62  ?  147 PHE A HB3   1 
ATOM   724  H HD1   . PHE A 1 59 ? -17.360 -22.104 -0.411  1.00 33.58  ?  147 PHE A HD1   1 
ATOM   725  H HD2   . PHE A 1 59 ? -13.575 -22.840 0.636   1.00 36.45  ?  147 PHE A HD2   1 
ATOM   726  H HE1   . PHE A 1 59 ? -17.115 -23.478 -2.249  1.00 34.99  ?  147 PHE A HE1   1 
ATOM   727  H HE2   . PHE A 1 59 ? -13.334 -24.213 -1.203  1.00 34.16  ?  147 PHE A HE2   1 
ATOM   728  H HZ    . PHE A 1 59 ? -15.103 -24.533 -2.646  1.00 32.80  ?  147 PHE A HZ    1 
ATOM   729  N N     . GLY A 1 60 ? -13.084 -19.733 1.264   1.00 21.33  ?  148 GLY A N     1 
ATOM   730  C CA    . GLY A 1 60 ? -11.761 -19.485 0.724   1.00 26.81  ?  148 GLY A CA    1 
ATOM   731  C C     . GLY A 1 60 ? -10.664 -20.177 1.510   1.00 30.66  ?  148 GLY A C     1 
ATOM   732  O O     . GLY A 1 60 ? -10.933 -21.008 2.375   1.00 27.79  ?  148 GLY A O     1 
ATOM   733  H H     . GLY A 1 60 ? -13.092 -19.901 2.108   1.00 25.60  ?  148 GLY A H     1 
ATOM   734  H HA2   . GLY A 1 60 ? -11.724 -19.799 -0.193  1.00 32.17  ?  148 GLY A HA2   1 
ATOM   735  H HA3   . GLY A 1 60 ? -11.585 -18.531 0.729   1.00 32.17  ?  148 GLY A HA3   1 
ATOM   736  N N     . PHE A 1 61 ? -9.419  -19.832 1.201   1.00 27.43  ?  149 PHE A N     1 
ATOM   737  C CA    . PHE A 1 61 ? -8.271  -20.407 1.883   1.00 32.78  ?  149 PHE A CA    1 
ATOM   738  C C     . PHE A 1 61 ? -7.244  -19.325 2.179   1.00 30.31  ?  149 PHE A C     1 
ATOM   739  O O     . PHE A 1 61 ? -7.255  -18.263 1.558   1.00 32.42  ?  149 PHE A O     1 
ATOM   740  C CB    . PHE A 1 61 ? -7.642  -21.508 1.030   1.00 23.00  ?  149 PHE A CB    1 
ATOM   741  C CG    . PHE A 1 61 ? -8.515  -22.715 0.863   1.00 26.95  ?  149 PHE A CG    1 
ATOM   742  C CD1   . PHE A 1 61 ? -8.468  -23.752 1.780   1.00 32.64  ?  149 PHE A CD1   1 
ATOM   743  C CD2   . PHE A 1 61 ? -9.387  -22.814 -0.207  1.00 31.84  ?  149 PHE A CD2   1 
ATOM   744  C CE1   . PHE A 1 61 ? -9.272  -24.866 1.631   1.00 27.10  ?  149 PHE A CE1   1 
ATOM   745  C CE2   . PHE A 1 61 ? -10.194 -23.927 -0.361  1.00 29.96  ?  149 PHE A CE2   1 
ATOM   746  C CZ    . PHE A 1 61 ? -10.136 -24.952 0.560   1.00 25.22  ?  149 PHE A CZ    1 
ATOM   747  H H     . PHE A 1 61 ? -9.213  -19.260 0.592   1.00 32.92  ?  149 PHE A H     1 
ATOM   748  H HA    . PHE A 1 61 ? -8.560  -20.801 2.733   1.00 39.34  ?  149 PHE A HA    1 
ATOM   749  H HB2   . PHE A 1 61 ? -7.456  -21.151 0.147   1.00 27.60  ?  149 PHE A HB2   1 
ATOM   750  H HB3   . PHE A 1 61 ? -6.815  -21.795 1.449   1.00 27.60  ?  149 PHE A HB3   1 
ATOM   751  H HD1   . PHE A 1 61 ? -7.887  -23.698 2.504   1.00 39.17  ?  149 PHE A HD1   1 
ATOM   752  H HD2   . PHE A 1 61 ? -9.430  -22.126 -0.831  1.00 38.21  ?  149 PHE A HD2   1 
ATOM   753  H HE1   . PHE A 1 61 ? -9.231  -25.556 2.252   1.00 32.52  ?  149 PHE A HE1   1 
ATOM   754  H HE2   . PHE A 1 61 ? -10.776 -23.983 -1.084  1.00 35.96  ?  149 PHE A HE2   1 
ATOM   755  H HZ    . PHE A 1 61 ? -10.678 -25.701 0.457   1.00 30.26  ?  149 PHE A HZ    1 
ATOM   756  N N     . VAL A 1 62 ? -6.359  -19.594 3.132   1.00 26.13  ?  150 VAL A N     1 
ATOM   757  C CA    . VAL A 1 62 ? -5.321  -18.639 3.487   1.00 28.06  ?  150 VAL A CA    1 
ATOM   758  C C     . VAL A 1 62 ? -4.130  -19.330 4.135   1.00 30.29  ?  150 VAL A C     1 
ATOM   759  O O     . VAL A 1 62 ? -4.288  -20.202 4.988   1.00 32.69  ?  150 VAL A O     1 
ATOM   760  C CB    . VAL A 1 62 ? -5.855  -17.550 4.440   1.00 24.37  ?  150 VAL A CB    1 
ATOM   761  C CG1   . VAL A 1 62 ? -6.500  -18.181 5.668   1.00 26.04  ?  150 VAL A CG1   1 
ATOM   762  C CG2   . VAL A 1 62 ? -4.736  -16.594 4.830   1.00 32.33  ?  150 VAL A CG2   1 
ATOM   763  H H     . VAL A 1 62 ? -6.340  -20.323 3.587   1.00 31.35  ?  150 VAL A H     1 
ATOM   764  H HA    . VAL A 1 62 ? -5.005  -18.197 2.671   1.00 33.67  ?  150 VAL A HA    1 
ATOM   765  H HB    . VAL A 1 62 ? -6.543  -17.031 3.973   1.00 29.24  ?  150 VAL A HB    1 
ATOM   766  H HG11  . VAL A 1 62 ? -6.823  -17.484 6.243   1.00 31.25  ?  150 VAL A HG11  1 
ATOM   767  H HG12  . VAL A 1 62 ? -7.229  -18.738 5.386   1.00 31.25  ?  150 VAL A HG12  1 
ATOM   768  H HG13  . VAL A 1 62 ? -5.844  -18.708 6.129   1.00 31.25  ?  150 VAL A HG13  1 
ATOM   769  H HG21  . VAL A 1 62 ? -5.088  -15.926 5.422   1.00 38.79  ?  150 VAL A HG21  1 
ATOM   770  H HG22  . VAL A 1 62 ? -4.042  -17.090 5.271   1.00 38.79  ?  150 VAL A HG22  1 
ATOM   771  H HG23  . VAL A 1 62 ? -4.389  -16.179 4.037   1.00 38.79  ?  150 VAL A HG23  1 
ATOM   772  N N     . ARG A 1 63 ? -2.936  -18.929 3.714   1.00 27.09  ?  151 ARG A N     1 
ATOM   773  C CA    . ARG A 1 63 ? -1.701  -19.460 4.265   1.00 24.80  ?  151 ARG A CA    1 
ATOM   774  C C     . ARG A 1 63 ? -0.925  -18.325 4.918   1.00 33.61  ?  151 ARG A C     1 
ATOM   775  O O     . ARG A 1 63 ? -0.705  -17.282 4.302   1.00 29.18  ?  151 ARG A O     1 
ATOM   776  C CB    . ARG A 1 63 ? -0.860  -20.095 3.157   1.00 31.93  ?  151 ARG A CB    1 
ATOM   777  C CG    . ARG A 1 63 ? 0.354   -20.867 3.649   1.00 34.08  ?  151 ARG A CG    1 
ATOM   778  C CD    . ARG A 1 63 ? -0.040  -22.187 4.298   1.00 38.91  ?  151 ARG A CD    1 
ATOM   779  N NE    . ARG A 1 63 ? 0.938   -23.241 4.034   1.00 44.78  ?  151 ARG A NE    1 
ATOM   780  C CZ    . ARG A 1 63 ? 0.897   -24.071 2.994   1.00 43.12  ?  151 ARG A CZ    1 
ATOM   781  N NH1   . ARG A 1 63 ? -0.075  -23.986 2.097   1.00 38.13  1  151 ARG A NH1   1 
ATOM   782  N NH2   . ARG A 1 63 ? 1.837   -24.995 2.849   1.00 42.53  ?  151 ARG A NH2   1 
ATOM   783  H H     . ARG A 1 63 ? -2.816  -18.340 3.100   1.00 32.51  ?  151 ARG A H     1 
ATOM   784  H HA    . ARG A 1 63 ? -1.901  -20.140 4.942   1.00 29.76  ?  151 ARG A HA    1 
ATOM   785  H HB2   . ARG A 1 63 ? -1.418  -20.711 2.658   1.00 38.32  ?  151 ARG A HB2   1 
ATOM   786  H HB3   . ARG A 1 63 ? -0.542  -19.392 2.568   1.00 38.32  ?  151 ARG A HB3   1 
ATOM   787  H HG2   . ARG A 1 63 ? 0.935   -21.061 2.896   1.00 40.90  ?  151 ARG A HG2   1 
ATOM   788  H HG3   . ARG A 1 63 ? 0.826   -20.334 4.307   1.00 40.90  ?  151 ARG A HG3   1 
ATOM   789  H HD2   . ARG A 1 63 ? -0.099  -22.063 5.259   1.00 46.69  ?  151 ARG A HD2   1 
ATOM   790  H HD3   . ARG A 1 63 ? -0.896  -22.473 3.944   1.00 46.69  ?  151 ARG A HD3   1 
ATOM   791  H HE    . ARG A 1 63 ? 1.587   -23.332 4.591   1.00 53.73  ?  151 ARG A HE    1 
ATOM   792  H HH11  . ARG A 1 63 ? -0.689  -23.389 2.183   1.00 45.76  ?  151 ARG A HH11  1 
ATOM   793  H HH12  . ARG A 1 63 ? -0.092  -24.527 1.428   1.00 45.76  ?  151 ARG A HH12  1 
ATOM   794  H HH21  . ARG A 1 63 ? 2.471   -25.058 3.426   1.00 51.04  ?  151 ARG A HH21  1 
ATOM   795  H HH22  . ARG A 1 63 ? 1.812   -25.532 2.178   1.00 51.04  ?  151 ARG A HH22  1 
ATOM   796  N N     . PHE A 1 64 ? -0.521  -18.525 6.169   1.00 33.27  ?  152 PHE A N     1 
ATOM   797  C CA    . PHE A 1 64 ? 0.261   -17.525 6.884   1.00 29.87  ?  152 PHE A CA    1 
ATOM   798  C C     . PHE A 1 64 ? 1.731   -17.918 6.924   1.00 38.46  ?  152 PHE A C     1 
ATOM   799  O O     . PHE A 1 64 ? 2.070   -19.099 6.861   1.00 41.38  ?  152 PHE A O     1 
ATOM   800  C CB    . PHE A 1 64 ? -0.265  -17.345 8.307   1.00 31.92  ?  152 PHE A CB    1 
ATOM   801  C CG    . PHE A 1 64 ? -1.632  -16.729 8.375   1.00 30.07  ?  152 PHE A CG    1 
ATOM   802  C CD1   . PHE A 1 64 ? -1.802  -15.367 8.199   1.00 32.69  ?  152 PHE A CD1   1 
ATOM   803  C CD2   . PHE A 1 64 ? -2.748  -17.510 8.622   1.00 36.71  ?  152 PHE A CD2   1 
ATOM   804  C CE1   . PHE A 1 64 ? -3.059  -14.798 8.262   1.00 32.00  ?  152 PHE A CE1   1 
ATOM   805  C CE2   . PHE A 1 64 ? -4.007  -16.944 8.685   1.00 32.15  ?  152 PHE A CE2   1 
ATOM   806  C CZ    . PHE A 1 64 ? -4.161  -15.587 8.505   1.00 31.75  ?  152 PHE A CZ    1 
ATOM   807  H H     . PHE A 1 64 ? -0.688  -19.234 6.626   1.00 39.92  ?  152 PHE A H     1 
ATOM   808  H HA    . PHE A 1 64 ? 0.187   -16.665 6.419   1.00 35.84  ?  152 PHE A HA    1 
ATOM   809  H HB2   . PHE A 1 64 ? -0.309  -18.214 8.736   1.00 38.30  ?  152 PHE A HB2   1 
ATOM   810  H HB3   . PHE A 1 64 ? 0.345   -16.769 8.795   1.00 38.30  ?  152 PHE A HB3   1 
ATOM   811  H HD1   . PHE A 1 64 ? -1.062  -14.829 8.033   1.00 39.23  ?  152 PHE A HD1   1 
ATOM   812  H HD2   . PHE A 1 64 ? -2.649  -18.427 8.743   1.00 44.05  ?  152 PHE A HD2   1 
ATOM   813  H HE1   . PHE A 1 64 ? -3.161  -13.882 8.140   1.00 38.40  ?  152 PHE A HE1   1 
ATOM   814  H HE2   . PHE A 1 64 ? -4.750  -17.479 8.850   1.00 38.58  ?  152 PHE A HE2   1 
ATOM   815  H HZ    . PHE A 1 64 ? -5.008  -15.204 8.548   1.00 38.10  ?  152 PHE A HZ    1 
ATOM   816  N N     . THR A 1 65 ? 2.602   -16.919 7.027   1.00 34.87  ?  153 THR A N     1 
ATOM   817  C CA    . THR A 1 65 ? 4.034   -17.163 7.121   1.00 37.90  ?  153 THR A CA    1 
ATOM   818  C C     . THR A 1 65 ? 4.377   -17.733 8.488   1.00 43.32  ?  153 THR A C     1 
ATOM   819  O O     . THR A 1 65 ? 4.895   -18.844 8.596   1.00 48.53  ?  153 THR A O     1 
ATOM   820  C CB    . THR A 1 65 ? 4.838   -15.871 6.911   1.00 45.05  ?  153 THR A CB    1 
ATOM   821  O OG1   . THR A 1 65 ? 4.590   -15.361 5.596   1.00 49.25  ?  153 THR A OG1   1 
ATOM   822  C CG2   . THR A 1 65 ? 6.326   -16.135 7.082   1.00 44.04  ?  153 THR A CG2   1 
ATOM   823  H H     . THR A 1 65 ? 2.386   -16.087 7.044   1.00 41.84  ?  153 THR A H     1 
ATOM   824  H HA    . THR A 1 65 ? 4.302   -17.811 6.436   1.00 45.48  ?  153 THR A HA    1 
ATOM   825  H HB    . THR A 1 65 ? 4.566   -15.212 7.569   1.00 54.06  ?  153 THR A HB    1 
ATOM   826  H HG1   . THR A 1 65 ? 5.017   -14.671 5.478   1.00 59.10  ?  153 THR A HG1   1 
ATOM   827  H HG21  . THR A 1 65 ? 6.821   -15.323 6.950   1.00 52.85  ?  153 THR A HG21  1 
ATOM   828  H HG22  . THR A 1 65 ? 6.501   -16.466 7.967   1.00 52.85  ?  153 THR A HG22  1 
ATOM   829  H HG23  . THR A 1 65 ? 6.619   -16.788 6.442   1.00 52.85  ?  153 THR A HG23  1 
ATOM   830  N N     . GLU A 1 66 ? 4.082   -16.965 9.532   1.00 47.77  ?  154 GLU A N     1 
ATOM   831  C CA    . GLU A 1 66 ? 4.338   -17.408 10.895  1.00 43.98  ?  154 GLU A CA    1 
ATOM   832  C C     . GLU A 1 66 ? 3.289   -18.432 11.297  1.00 48.27  ?  154 GLU A C     1 
ATOM   833  O O     . GLU A 1 66 ? 2.158   -18.400 10.813  1.00 48.45  ?  154 GLU A O     1 
ATOM   834  C CB    . GLU A 1 66 ? 4.306   -16.228 11.869  1.00 50.11  ?  154 GLU A CB    1 
ATOM   835  C CG    . GLU A 1 66 ? 5.201   -15.056 11.485  1.00 57.63  ?  154 GLU A CG    1 
ATOM   836  C CD    . GLU A 1 66 ? 6.679   -15.370 11.619  1.00 62.63  ?  154 GLU A CD    1 
ATOM   837  O OE1   . GLU A 1 66 ? 7.032   -16.562 11.737  1.00 51.24  ?  154 GLU A OE1   1 
ATOM   838  O OE2   . GLU A 1 66 ? 7.489   -14.418 11.610  1.00 64.05  -1 154 GLU A OE2   1 
ATOM   839  H H     . GLU A 1 66 ? 3.733   -16.181 9.477   1.00 57.32  ?  154 GLU A H     1 
ATOM   840  H HA    . GLU A 1 66 ? 5.221   -17.830 10.943  1.00 52.77  ?  154 GLU A HA    1 
ATOM   841  H HB2   . GLU A 1 66 ? 3.396   -15.896 11.923  1.00 60.13  ?  154 GLU A HB2   1 
ATOM   842  H HB3   . GLU A 1 66 ? 4.591   -16.540 12.742  1.00 60.13  ?  154 GLU A HB3   1 
ATOM   843  H HG2   . GLU A 1 66 ? 5.029   -14.818 10.560  1.00 69.16  ?  154 GLU A HG2   1 
ATOM   844  H HG3   . GLU A 1 66 ? 5.002   -14.304 12.063  1.00 69.16  ?  154 GLU A HG3   1 
ATOM   845  N N     . TYR A 1 67 ? 3.669   -19.342 12.185  1.00 52.75  ?  155 TYR A N     1 
ATOM   846  C CA    . TYR A 1 67 ? 2.750   -20.363 12.665  1.00 43.31  ?  155 TYR A CA    1 
ATOM   847  C C     . TYR A 1 67 ? 1.922   -19.831 13.827  1.00 45.91  ?  155 TYR A C     1 
ATOM   848  O O     . TYR A 1 67 ? 0.747   -20.166 13.966  1.00 47.15  ?  155 TYR A O     1 
ATOM   849  C CB    . TYR A 1 67 ? 3.517   -21.610 13.102  1.00 43.49  ?  155 TYR A CB    1 
ATOM   850  C CG    . TYR A 1 67 ? 2.626   -22.681 13.683  1.00 43.34  ?  155 TYR A CG    1 
ATOM   851  C CD1   . TYR A 1 67 ? 1.882   -23.513 12.861  1.00 49.26  ?  155 TYR A CD1   1 
ATOM   852  C CD2   . TYR A 1 67 ? 2.524   -22.855 15.055  1.00 37.35  ?  155 TYR A CD2   1 
ATOM   853  C CE1   . TYR A 1 67 ? 1.063   -24.491 13.390  1.00 47.48  ?  155 TYR A CE1   1 
ATOM   854  C CE2   . TYR A 1 67 ? 1.709   -23.830 15.591  1.00 39.52  ?  155 TYR A CE2   1 
ATOM   855  C CZ    . TYR A 1 67 ? 0.980   -24.645 14.755  1.00 40.84  ?  155 TYR A CZ    1 
ATOM   856  O OH    . TYR A 1 67 ? 0.166   -25.620 15.285  1.00 42.12  ?  155 TYR A OH    1 
ATOM   857  H H     . TYR A 1 67 ? 4.457   -19.389 12.526  1.00 63.30  ?  155 TYR A H     1 
ATOM   858  H HA    . TYR A 1 67 ? 2.139   -20.615 11.941  1.00 51.97  ?  155 TYR A HA    1 
ATOM   859  H HB2   . TYR A 1 67 ? 3.972   -21.985 12.332  1.00 52.19  ?  155 TYR A HB2   1 
ATOM   860  H HB3   . TYR A 1 67 ? 4.164   -21.359 13.780  1.00 52.19  ?  155 TYR A HB3   1 
ATOM   861  H HD1   . TYR A 1 67 ? 1.935   -23.411 11.938  1.00 59.11  ?  155 TYR A HD1   1 
ATOM   862  H HD2   . TYR A 1 67 ? 3.014   -22.306 15.623  1.00 44.82  ?  155 TYR A HD2   1 
ATOM   863  H HE1   . TYR A 1 67 ? 0.570   -25.043 12.826  1.00 56.98  ?  155 TYR A HE1   1 
ATOM   864  H HE2   . TYR A 1 67 ? 1.652   -23.935 16.513  1.00 47.43  ?  155 TYR A HE2   1 
ATOM   865  H HH    . TYR A 1 67 ? -0.404  -25.278 15.767  1.00 50.54  ?  155 TYR A HH    1 
ATOM   866  N N     . GLU A 1 68 ? 2.538   -18.999 14.660  1.00 46.95  ?  156 GLU A N     1 
ATOM   867  C CA    . GLU A 1 68 ? 1.844   -18.431 15.808  1.00 50.38  ?  156 GLU A CA    1 
ATOM   868  C C     . GLU A 1 68 ? 0.668   -17.584 15.330  1.00 52.62  ?  156 GLU A C     1 
ATOM   869  O O     . GLU A 1 68 ? -0.378  -17.527 15.978  1.00 50.04  ?  156 GLU A O     1 
ATOM   870  C CB    . GLU A 1 68 ? 2.794   -17.580 16.650  1.00 50.53  ?  156 GLU A CB    1 
ATOM   871  C CG    . GLU A 1 68 ? 2.259   -17.257 18.036  1.00 66.29  ?  156 GLU A CG    1 
ATOM   872  C CD    . GLU A 1 68 ? 3.224   -16.422 18.855  1.00 75.64  ?  156 GLU A CD    1 
ATOM   873  O OE1   . GLU A 1 68 ? 3.353   -15.212 18.572  1.00 73.29  ?  156 GLU A OE1   1 
ATOM   874  O OE2   . GLU A 1 68 ? 3.857   -16.977 19.779  1.00 69.92  -1 156 GLU A OE2   1 
ATOM   875  H H     . GLU A 1 68 ? 3.357   -18.747 14.582  1.00 56.34  ?  156 GLU A H     1 
ATOM   876  H HA    . GLU A 1 68 ? 1.496   -19.155 16.369  1.00 60.46  ?  156 GLU A HA    1 
ATOM   877  H HB2   . GLU A 1 68 ? 3.630   -18.060 16.758  1.00 60.64  ?  156 GLU A HB2   1 
ATOM   878  H HB3   . GLU A 1 68 ? 2.953   -16.741 16.190  1.00 60.64  ?  156 GLU A HB3   1 
ATOM   879  H HG2   . GLU A 1 68 ? 1.432   -16.759 17.948  1.00 79.54  ?  156 GLU A HG2   1 
ATOM   880  H HG3   . GLU A 1 68 ? 2.098   -18.086 18.514  1.00 79.54  ?  156 GLU A HG3   1 
ATOM   881  N N     . THR A 1 69 ? 0.848   -16.931 14.186  1.00 39.12  ?  157 THR A N     1 
ATOM   882  C CA    . THR A 1 69 ? -0.211  -16.131 13.585  1.00 41.35  ?  157 THR A CA    1 
ATOM   883  C C     . THR A 1 69 ? -1.350  -17.032 13.121  1.00 41.51  ?  157 THR A C     1 
ATOM   884  O O     . THR A 1 69 ? -2.517  -16.647 13.159  1.00 41.93  ?  157 THR A O     1 
ATOM   885  C CB    . THR A 1 69 ? 0.309   -15.320 12.381  1.00 46.03  ?  157 THR A CB    1 
ATOM   886  O OG1   . THR A 1 69 ? 1.299   -14.383 12.822  1.00 41.78  ?  157 THR A OG1   1 
ATOM   887  C CG2   . THR A 1 69 ? -0.831  -14.570 11.699  1.00 43.64  ?  157 THR A CG2   1 
ATOM   888  H H     . THR A 1 69 ? 1.581   -16.937 13.735  1.00 46.94  ?  157 THR A H     1 
ATOM   889  H HA    . THR A 1 69 ? -0.564  -15.504 14.252  1.00 49.62  ?  157 THR A HA    1 
ATOM   890  H HB    . THR A 1 69 ? 0.705   -15.925 11.735  1.00 55.24  ?  157 THR A HB    1 
ATOM   891  H HG1   . THR A 1 69 ? 1.579   -13.950 12.185  1.00 50.14  ?  157 THR A HG1   1 
ATOM   892  H HG21  . THR A 1 69 ? -0.494  -14.070 10.952  1.00 52.37  ?  157 THR A HG21  1 
ATOM   893  H HG22  . THR A 1 69 ? -1.492  -15.191 11.386  1.00 52.37  ?  157 THR A HG22  1 
ATOM   894  H HG23  . THR A 1 69 ? -1.242  -13.964 12.320  1.00 52.37  ?  157 THR A HG23  1 
ATOM   895  N N     . GLN A 1 70 ? -1.000  -18.237 12.685  1.00 44.38  ?  158 GLN A N     1 
ATOM   896  C CA    . GLN A 1 70 ? -1.985  -19.207 12.217  1.00 40.42  ?  158 GLN A CA    1 
ATOM   897  C C     . GLN A 1 70 ? -2.825  -19.738 13.376  1.00 45.57  ?  158 GLN A C     1 
ATOM   898  O O     . GLN A 1 70 ? -4.046  -19.860 13.265  1.00 44.14  ?  158 GLN A O     1 
ATOM   899  C CB    . GLN A 1 70 ? -1.284  -20.365 11.501  1.00 39.49  ?  158 GLN A CB    1 
ATOM   900  C CG    . GLN A 1 70 ? -2.202  -21.525 11.149  1.00 37.65  ?  158 GLN A CG    1 
ATOM   901  C CD    . GLN A 1 70 ? -1.465  -22.693 10.519  1.00 40.51  ?  158 GLN A CD    1 
ATOM   902  O OE1   . GLN A 1 70 ? -0.447  -22.514 9.850   1.00 36.17  ?  158 GLN A OE1   1 
ATOM   903  N NE2   . GLN A 1 70 ? -1.978  -23.899 10.733  1.00 39.32  ?  158 GLN A NE2   1 
ATOM   904  H H     . GLN A 1 70 ? -0.189  -18.521 12.649  1.00 53.26  ?  158 GLN A H     1 
ATOM   905  H HA    . GLN A 1 70 ? -2.586  -18.771 11.578  1.00 48.51  ?  158 GLN A HA    1 
ATOM   906  H HB2   . GLN A 1 70 ? -0.898  -20.033 10.676  1.00 47.39  ?  158 GLN A HB2   1 
ATOM   907  H HB3   . GLN A 1 70 ? -0.583  -20.708 12.077  1.00 47.39  ?  158 GLN A HB3   1 
ATOM   908  H HG2   . GLN A 1 70 ? -2.632  -21.844 11.958  1.00 45.18  ?  158 GLN A HG2   1 
ATOM   909  H HG3   . GLN A 1 70 ? -2.870  -21.218 10.517  1.00 45.18  ?  158 GLN A HG3   1 
ATOM   910  H HE21  . GLN A 1 70 ? -2.691  -23.985 11.207  1.00 47.18  ?  158 GLN A HE21  1 
ATOM   911  H HE22  . GLN A 1 70 ? -1.598  -24.594 10.398  1.00 47.18  ?  158 GLN A HE22  1 
ATOM   912  N N     . VAL A 1 71 ? -2.165  -20.054 14.487  1.00 43.83  ?  159 VAL A N     1 
ATOM   913  C CA    . VAL A 1 71 ? -2.849  -20.575 15.667  1.00 46.25  ?  159 VAL A CA    1 
ATOM   914  C C     . VAL A 1 71 ? -3.821  -19.539 16.214  1.00 40.72  ?  159 VAL A C     1 
ATOM   915  O O     . VAL A 1 71 ? -4.950  -19.861 16.585  1.00 46.07  ?  159 VAL A O     1 
ATOM   916  C CB    . VAL A 1 71 ? -1.849  -20.944 16.783  1.00 43.55  ?  159 VAL A CB    1 
ATOM   917  C CG1   . VAL A 1 71 ? -2.587  -21.327 18.060  1.00 30.74  ?  159 VAL A CG1   1 
ATOM   918  C CG2   . VAL A 1 71 ? -0.931  -22.073 16.331  1.00 39.26  ?  159 VAL A CG2   1 
ATOM   919  H H     . VAL A 1 71 ? -1.314  -19.974 14.583  1.00 52.59  ?  159 VAL A H     1 
ATOM   920  H HA    . VAL A 1 71 ? -3.354  -21.379 15.423  1.00 55.50  ?  159 VAL A HA    1 
ATOM   921  H HB    . VAL A 1 71 ? -1.291  -20.163 16.980  1.00 52.26  ?  159 VAL A HB    1 
ATOM   922  H HG11  . VAL A 1 71 ? -1.944  -21.552 18.737  1.00 36.89  ?  159 VAL A HG11  1 
ATOM   923  H HG12  . VAL A 1 71 ? -3.120  -20.582 18.348  1.00 36.89  ?  159 VAL A HG12  1 
ATOM   924  H HG13  . VAL A 1 71 ? -3.151  -22.083 17.879  1.00 36.89  ?  159 VAL A HG13  1 
ATOM   925  H HG21  . VAL A 1 71 ? -0.321  -22.282 17.042  1.00 47.11  ?  159 VAL A HG21  1 
ATOM   926  H HG22  . VAL A 1 71 ? -1.465  -22.843 16.120  1.00 47.11  ?  159 VAL A HG22  1 
ATOM   927  H HG23  . VAL A 1 71 ? -0.445  -21.788 15.554  1.00 47.11  ?  159 VAL A HG23  1 
ATOM   928  N N     . LYS A 1 72 ? -3.367  -18.292 16.262  1.00 35.50  ?  160 LYS A N     1 
ATOM   929  C CA    . LYS A 1 72 ? -4.168  -17.191 16.778  1.00 41.01  ?  160 LYS A CA    1 
ATOM   930  C C     . LYS A 1 72 ? -5.471  -17.047 16.001  1.00 45.68  ?  160 LYS A C     1 
ATOM   931  O O     . LYS A 1 72 ? -6.541  -16.867 16.584  1.00 46.13  ?  160 LYS A O     1 
ATOM   932  C CB    . LYS A 1 72 ? -3.375  -15.886 16.685  1.00 40.42  ?  160 LYS A CB    1 
ATOM   933  C CG    . LYS A 1 72 ? -4.197  -14.637 16.944  1.00 40.14  ?  160 LYS A CG    1 
ATOM   934  C CD    . LYS A 1 72 ? -4.679  -14.576 18.379  1.00 49.63  ?  160 LYS A CD    1 
ATOM   935  C CE    . LYS A 1 72 ? -5.404  -13.272 18.653  1.00 47.24  ?  160 LYS A CE    1 
ATOM   936  N NZ    . LYS A 1 72 ? -5.969  -13.231 20.026  1.00 47.93  1  160 LYS A NZ    1 
ATOM   937  H H     . LYS A 1 72 ? -2.584  -18.055 15.996  1.00 42.60  ?  160 LYS A H     1 
ATOM   938  H HA    . LYS A 1 72 ? -4.384  -17.357 17.720  1.00 49.21  ?  160 LYS A HA    1 
ATOM   939  H HB2   . LYS A 1 72 ? -2.660  -15.910 17.340  1.00 48.50  ?  160 LYS A HB2   1 
ATOM   940  H HB3   . LYS A 1 72 ? -3.000  -15.813 15.794  1.00 48.50  ?  160 LYS A HB3   1 
ATOM   941  H HG2   . LYS A 1 72 ? -3.651  -13.854 16.774  1.00 48.17  ?  160 LYS A HG2   1 
ATOM   942  H HG3   . LYS A 1 72 ? -4.973  -14.639 16.363  1.00 48.17  ?  160 LYS A HG3   1 
ATOM   943  H HD2   . LYS A 1 72 ? -5.293  -15.309 18.544  1.00 59.56  ?  160 LYS A HD2   1 
ATOM   944  H HD3   . LYS A 1 72 ? -3.917  -14.634 18.977  1.00 59.56  ?  160 LYS A HD3   1 
ATOM   945  H HE2   . LYS A 1 72 ? -4.781  -12.535 18.560  1.00 56.69  ?  160 LYS A HE2   1 
ATOM   946  H HE3   . LYS A 1 72 ? -6.135  -13.175 18.022  1.00 56.69  ?  160 LYS A HE3   1 
ATOM   947  H HZ1   . LYS A 1 72 ? -6.388  -12.457 20.159  1.00 57.51  ?  160 LYS A HZ1   1 
ATOM   948  H HZ2   . LYS A 1 72 ? -6.549  -13.897 20.136  1.00 57.51  ?  160 LYS A HZ2   1 
ATOM   949  H HZ3   . LYS A 1 72 ? -5.317  -13.314 20.625  1.00 57.51  ?  160 LYS A HZ3   1 
ATOM   950  N N     . VAL A 1 73 ? -5.370  -17.128 14.678  1.00 41.93  ?  161 VAL A N     1 
ATOM   951  C CA    . VAL A 1 73 ? -6.512  -16.903 13.799  1.00 45.15  ?  161 VAL A CA    1 
ATOM   952  C C     . VAL A 1 73 ? -7.575  -17.983 13.969  1.00 41.28  ?  161 VAL A C     1 
ATOM   953  O O     . VAL A 1 73 ? -8.761  -17.731 13.766  1.00 37.13  ?  161 VAL A O     1 
ATOM   954  C CB    . VAL A 1 73 ? -6.071  -16.836 12.317  1.00 41.78  ?  161 VAL A CB    1 
ATOM   955  C CG1   . VAL A 1 73 ? -7.274  -16.916 11.382  1.00 36.61  ?  161 VAL A CG1   1 
ATOM   956  C CG2   . VAL A 1 73 ? -5.273  -15.564 12.064  1.00 35.57  ?  161 VAL A CG2   1 
ATOM   957  H H     . VAL A 1 73 ? -4.641  -17.315 14.261  1.00 50.31  ?  161 VAL A H     1 
ATOM   958  H HA    . VAL A 1 73 ? -6.921  -16.042 14.029  1.00 54.19  ?  161 VAL A HA    1 
ATOM   959  H HB    . VAL A 1 73 ? -5.489  -17.600 12.124  1.00 50.14  ?  161 VAL A HB    1 
ATOM   960  H HG11  . VAL A 1 73 ? -6.967  -16.871 10.474  1.00 43.93  ?  161 VAL A HG11  1 
ATOM   961  H HG12  . VAL A 1 73 ? -7.732  -17.746 11.533  1.00 43.93  ?  161 VAL A HG12  1 
ATOM   962  H HG13  . VAL A 1 73 ? -7.862  -16.179 11.566  1.00 43.93  ?  161 VAL A HG13  1 
ATOM   963  H HG21  . VAL A 1 73 ? -5.009  -15.540 11.141  1.00 42.69  ?  161 VAL A HG21  1 
ATOM   964  H HG22  . VAL A 1 73 ? -5.823  -14.804 12.267  1.00 42.69  ?  161 VAL A HG22  1 
ATOM   965  H HG23  . VAL A 1 73 ? -4.495  -15.567 12.627  1.00 42.69  ?  161 VAL A HG23  1 
ATOM   966  N N     . MET A 1 74 ? -7.151  -19.181 14.350  1.00 39.36  ?  162 MET A N     1 
ATOM   967  C CA    . MET A 1 74 ? -8.077  -20.294 14.517  1.00 42.54  ?  162 MET A CA    1 
ATOM   968  C C     . MET A 1 74 ? -8.782  -20.231 15.866  1.00 42.10  ?  162 MET A C     1 
ATOM   969  O O     . MET A 1 74 ? -9.903  -20.719 16.013  1.00 42.23  ?  162 MET A O     1 
ATOM   970  C CB    . MET A 1 74 ? -7.334  -21.621 14.397  1.00 51.15  ?  162 MET A CB    1 
ATOM   971  C CG    . MET A 1 74 ? -6.921  -21.976 12.982  1.00 50.03  ?  162 MET A CG    1 
ATOM   972  S SD    . MET A 1 74 ? -6.091  -23.574 12.913  1.00 75.46  ?  162 MET A SD    1 
ATOM   973  C CE    . MET A 1 74 ? -7.364  -24.644 13.573  1.00 42.81  ?  162 MET A CE    1 
ATOM   974  H H     . MET A 1 74 ? -6.331  -19.377 14.519  1.00 47.23  ?  162 MET A H     1 
ATOM   975  H HA    . MET A 1 74 ? -8.749  -20.258 13.805  1.00 51.05  ?  162 MET A HA    1 
ATOM   976  H HB2   . MET A 1 74 ? -6.529  -21.577 14.937  1.00 61.38  ?  162 MET A HB2   1 
ATOM   977  H HB3   . MET A 1 74 ? -7.909  -22.330 14.724  1.00 61.38  ?  162 MET A HB3   1 
ATOM   978  H HG2   . MET A 1 74 ? -7.711  -22.020 12.420  1.00 60.04  ?  162 MET A HG2   1 
ATOM   979  H HG3   . MET A 1 74 ? -6.309  -21.302 12.648  1.00 60.04  ?  162 MET A HG3   1 
ATOM   980  H HE1   . MET A 1 74 ? -7.037  -25.546 13.589  1.00 51.37  ?  162 MET A HE1   1 
ATOM   981  H HE2   . MET A 1 74 ? -7.581  -24.358 14.464  1.00 51.37  ?  162 MET A HE2   1 
ATOM   982  H HE3   . MET A 1 74 ? -8.141  -24.587 13.012  1.00 51.37  ?  162 MET A HE3   1 
ATOM   983  N N     . SER A 1 75 ? -8.121  -19.623 16.847  1.00 44.21  ?  163 SER A N     1 
ATOM   984  C CA    . SER A 1 75 ? -8.643  -19.565 18.208  1.00 43.43  ?  163 SER A CA    1 
ATOM   985  C C     . SER A 1 75 ? -9.881  -18.678 18.320  1.00 48.37  ?  163 SER A C     1 
ATOM   986  O O     . SER A 1 75 ? -10.527 -18.639 19.368  1.00 49.54  ?  163 SER A O     1 
ATOM   987  C CB    . SER A 1 75 ? -7.563  -19.053 19.164  1.00 42.48  ?  163 SER A CB    1 
ATOM   988  O OG    . SER A 1 75 ? -7.267  -17.686 18.924  1.00 40.54  ?  163 SER A OG    1 
ATOM   989  H H     . SER A 1 75 ? -7.361  -19.232 16.748  1.00 53.06  ?  163 SER A H     1 
ATOM   990  H HA    . SER A 1 75 ? -8.893  -20.469 18.491  1.00 52.12  ?  163 SER A HA    1 
ATOM   991  H HB2   . SER A 1 75 ? -7.879  -19.150 20.076  1.00 50.98  ?  163 SER A HB2   1 
ATOM   992  H HB3   . SER A 1 75 ? -6.756  -19.576 19.037  1.00 50.98  ?  163 SER A HB3   1 
ATOM   993  H HG    . SER A 1 75 ? -7.729  -17.403 18.309  1.00 48.64  ?  163 SER A HG    1 
ATOM   994  N N     . GLN A 1 76 ? -10.210 -17.968 17.245  1.00 46.33  ?  164 GLN A N     1 
ATOM   995  C CA    . GLN A 1 76 ? -11.312 -17.015 17.274  1.00 33.02  ?  164 GLN A CA    1 
ATOM   996  C C     . GLN A 1 76 ? -12.110 -17.032 15.979  1.00 35.04  ?  164 GLN A C     1 
ATOM   997  O O     . GLN A 1 76 ? -11.627 -17.486 14.942  1.00 38.44  ?  164 GLN A O     1 
ATOM   998  C CB    . GLN A 1 76 ? -10.774 -15.602 17.504  1.00 32.89  ?  164 GLN A CB    1 
ATOM   999  C CG    . GLN A 1 76 ? -10.146 -14.976 16.264  1.00 37.47  ?  164 GLN A CG    1 
ATOM   1000 C CD    . GLN A 1 76 ? -9.713  -13.541 16.485  1.00 36.00  ?  164 GLN A CD    1 
ATOM   1001 O OE1   . GLN A 1 76 ? -10.176 -12.629 15.801  1.00 38.63  ?  164 GLN A OE1   1 
ATOM   1002 N NE2   . GLN A 1 76 ? -8.813  -13.335 17.438  1.00 42.14  ?  164 GLN A NE2   1 
ATOM   1003 H H     . GLN A 1 76 ? -9.810  -18.021 16.485  1.00 55.60  ?  164 GLN A H     1 
ATOM   1004 H HA    . GLN A 1 76 ? -11.916 -17.239 18.012  1.00 39.62  ?  164 GLN A HA    1 
ATOM   1005 H HB2   . GLN A 1 76 ? -11.506 -15.031 17.786  1.00 39.47  ?  164 GLN A HB2   1 
ATOM   1006 H HB3   . GLN A 1 76 ? -10.096 -15.634 18.197  1.00 39.47  ?  164 GLN A HB3   1 
ATOM   1007 H HG2   . GLN A 1 76 ? -9.362  -15.491 16.014  1.00 44.97  ?  164 GLN A HG2   1 
ATOM   1008 H HG3   . GLN A 1 76 ? -10.794 -14.986 15.542  1.00 44.97  ?  164 GLN A HG3   1 
ATOM   1009 H HE21  . GLN A 1 76 ? -8.507  -13.999 17.892  1.00 50.57  ?  164 GLN A HE21  1 
ATOM   1010 H HE22  . GLN A 1 76 ? -8.535  -12.538 17.602  1.00 50.57  ?  164 GLN A HE22  1 
ATOM   1011 N N     . ARG A 1 77 ? -13.336 -16.525 16.052  1.00 34.64  ?  165 ARG A N     1 
ATOM   1012 C CA    . ARG A 1 77 ? -14.158 -16.315 14.871  1.00 29.65  ?  165 ARG A CA    1 
ATOM   1013 C C     . ARG A 1 77 ? -13.732 -15.010 14.212  1.00 33.93  ?  165 ARG A C     1 
ATOM   1014 O O     . ARG A 1 77 ? -12.866 -14.307 14.727  1.00 38.55  ?  165 ARG A O     1 
ATOM   1015 C CB    . ARG A 1 77 ? -15.633 -16.255 15.262  1.00 34.59  ?  165 ARG A CB    1 
ATOM   1016 C CG    . ARG A 1 77 ? -16.124 -17.501 15.977  1.00 32.29  ?  165 ARG A CG    1 
ATOM   1017 C CD    . ARG A 1 77 ? -17.172 -18.214 15.145  1.00 28.19  ?  165 ARG A CD    1 
ATOM   1018 N NE    . ARG A 1 77 ? -18.463 -17.532 15.160  1.00 35.12  ?  165 ARG A NE    1 
ATOM   1019 C CZ    . ARG A 1 77 ? -19.471 -17.828 14.346  1.00 36.97  ?  165 ARG A CZ    1 
ATOM   1020 N NH1   . ARG A 1 77 ? -19.342 -18.791 13.444  1.00 34.79  1  165 ARG A NH1   1 
ATOM   1021 N NH2   . ARG A 1 77 ? -20.611 -17.158 14.427  1.00 44.20  ?  165 ARG A NH2   1 
ATOM   1022 H H     . ARG A 1 77 ? -13.718 -16.293 16.786  1.00 41.56  ?  165 ARG A H     1 
ATOM   1023 H HA    . ARG A 1 77 ? -14.027 -17.050 14.236  1.00 35.58  ?  165 ARG A HA    1 
ATOM   1024 H HB2   . ARG A 1 77 ? -15.769 -15.500 15.855  1.00 41.50  ?  165 ARG A HB2   1 
ATOM   1025 H HB3   . ARG A 1 77 ? -16.166 -16.144 14.459  1.00 41.50  ?  165 ARG A HB3   1 
ATOM   1026 H HG2   . ARG A 1 77 ? -15.379 -18.107 16.118  1.00 38.75  ?  165 ARG A HG2   1 
ATOM   1027 H HG3   . ARG A 1 77 ? -16.523 -17.251 16.825  1.00 38.75  ?  165 ARG A HG3   1 
ATOM   1028 H HD2   . ARG A 1 77 ? -16.868 -18.260 14.225  1.00 33.82  ?  165 ARG A HD2   1 
ATOM   1029 H HD3   . ARG A 1 77 ? -17.301 -19.109 15.497  1.00 33.82  ?  165 ARG A HD3   1 
ATOM   1030 H HE    . ARG A 1 77 ? -18.558 -16.864 15.692  1.00 42.15  ?  165 ARG A HE    1 
ATOM   1031 H HH11  . ARG A 1 77 ? -18.605 -19.230 13.386  1.00 41.75  ?  165 ARG A HH11  1 
ATOM   1032 H HH12  . ARG A 1 77 ? -19.997 -18.979 12.919  1.00 41.75  ?  165 ARG A HH12  1 
ATOM   1033 H HH21  . ARG A 1 77 ? -20.701 -16.531 15.010  1.00 53.04  ?  165 ARG A HH21  1 
ATOM   1034 H HH22  . ARG A 1 77 ? -21.261 -17.350 13.899  1.00 53.04  ?  165 ARG A HH22  1 
ATOM   1035 N N     . HIS A 1 78 ? -14.341 -14.677 13.080  1.00 34.02  ?  166 HIS A N     1 
ATOM   1036 C CA    . HIS A 1 78 ? -13.941 -13.486 12.341  1.00 31.06  ?  166 HIS A CA    1 
ATOM   1037 C C     . HIS A 1 78 ? -15.129 -12.779 11.708  1.00 32.44  ?  166 HIS A C     1 
ATOM   1038 O O     . HIS A 1 78 ? -15.846 -13.354 10.891  1.00 33.80  ?  166 HIS A O     1 
ATOM   1039 C CB    . HIS A 1 78 ? -12.919 -13.859 11.267  1.00 28.06  ?  166 HIS A CB    1 
ATOM   1040 C CG    . HIS A 1 78 ? -11.652 -14.430 11.821  1.00 34.90  ?  166 HIS A CG    1 
ATOM   1041 N ND1   . HIS A 1 78 ? -10.600 -13.644 12.240  1.00 33.63  ?  166 HIS A ND1   1 
ATOM   1042 C CD2   . HIS A 1 78 ? -11.272 -15.711 12.036  1.00 27.14  ?  166 HIS A CD2   1 
ATOM   1043 C CE1   . HIS A 1 78 ? -9.626  -14.416 12.685  1.00 33.97  ?  166 HIS A CE1   1 
ATOM   1044 N NE2   . HIS A 1 78 ? -10.008 -15.676 12.572  1.00 27.90  ?  166 HIS A NE2   1 
ATOM   1045 H H     . HIS A 1 78 ? -14.984 -15.121 12.720  1.00 40.83  ?  166 HIS A H     1 
ATOM   1046 H HA    . HIS A 1 78 ? -13.513 -12.859 12.960  1.00 37.27  ?  166 HIS A HA    1 
ATOM   1047 H HB2   . HIS A 1 78 ? -13.312 -14.522 10.678  1.00 33.68  ?  166 HIS A HB2   1 
ATOM   1048 H HB3   . HIS A 1 78 ? -12.691 -13.063 10.762  1.00 33.68  ?  166 HIS A HB3   1 
ATOM   1049 H HD1   . HIS A 1 78 ? -10.581 -12.785 12.215  1.00 40.35  ?  166 HIS A HD1   1 
ATOM   1050 H HD2   . HIS A 1 78 ? -11.772 -16.473 11.853  1.00 32.57  ?  166 HIS A HD2   1 
ATOM   1051 H HE1   . HIS A 1 78 ? -8.809  -14.123 13.020  1.00 40.77  ?  166 HIS A HE1   1 
ATOM   1052 H HE2   . HIS A 1 78 ? -9.541  -16.362 12.796  1.00 33.48  ?  166 HIS A HE2   1 
ATOM   1053 N N     . MET A 1 79 ? -15.331 -11.523 12.091  1.00 36.46  ?  167 MET A N     1 
ATOM   1054 C CA    . MET A 1 79 ? -16.376 -10.705 11.495  1.00 35.28  ?  167 MET A CA    1 
ATOM   1055 C C     . MET A 1 79 ? -15.838 -10.092 10.213  1.00 27.90  ?  167 MET A C     1 
ATOM   1056 O O     . MET A 1 79 ? -15.123 -9.091  10.248  1.00 34.65  ?  167 MET A O     1 
ATOM   1057 C CB    . MET A 1 79 ? -16.813 -9.597  12.452  1.00 29.95  ?  167 MET A CB    1 
ATOM   1058 C CG    . MET A 1 79 ? -17.830 -8.641  11.850  1.00 27.74  ?  167 MET A CG    1 
ATOM   1059 S SD    . MET A 1 79 ? -19.425 -9.423  11.547  1.00 34.68  ?  167 MET A SD    1 
ATOM   1060 C CE    . MET A 1 79 ? -20.007 -9.657  13.219  1.00 37.88  ?  167 MET A CE    1 
ATOM   1061 H H     . MET A 1 79 ? -14.873 -11.121 12.697  1.00 43.75  ?  167 MET A H     1 
ATOM   1062 H HA    . MET A 1 79 ? -17.154 -11.265 11.290  1.00 42.34  ?  167 MET A HA    1 
ATOM   1063 H HB2   . MET A 1 79 ? -17.214 -10.001 13.238  1.00 35.94  ?  167 MET A HB2   1 
ATOM   1064 H HB3   . MET A 1 79 ? -16.034 -9.079  12.709  1.00 35.94  ?  167 MET A HB3   1 
ATOM   1065 H HG2   . MET A 1 79 ? -17.970 -7.901  12.462  1.00 33.29  ?  167 MET A HG2   1 
ATOM   1066 H HG3   . MET A 1 79 ? -17.492 -8.312  11.003  1.00 33.29  ?  167 MET A HG3   1 
ATOM   1067 H HE1   . MET A 1 79 ? -20.870 -10.077 13.193  1.00 45.45  ?  167 MET A HE1   1 
ATOM   1068 H HE2   . MET A 1 79 ? -19.385 -10.216 13.691  1.00 45.45  ?  167 MET A HE2   1 
ATOM   1069 H HE3   . MET A 1 79 ? -20.071 -8.802  13.650  1.00 45.45  ?  167 MET A HE3   1 
ATOM   1070 N N     . ILE A 1 80 ? -16.177 -10.701 9.083   1.00 31.02  ?  168 ILE A N     1 
ATOM   1071 C CA    . ILE A 1 80 ? -15.699 -10.227 7.792   1.00 27.69  ?  168 ILE A CA    1 
ATOM   1072 C C     . ILE A 1 80 ? -16.855 -9.689  6.961   1.00 30.08  ?  168 ILE A C     1 
ATOM   1073 O O     . ILE A 1 80 ? -17.758 -10.431 6.576   1.00 35.90  ?  168 ILE A O     1 
ATOM   1074 C CB    . ILE A 1 80 ? -14.983 -11.347 7.017   1.00 25.69  ?  168 ILE A CB    1 
ATOM   1075 C CG1   . ILE A 1 80 ? -13.825 -11.901 7.851   1.00 27.64  ?  168 ILE A CG1   1 
ATOM   1076 C CG2   . ILE A 1 80 ? -14.476 -10.828 5.679   1.00 28.54  ?  168 ILE A CG2   1 
ATOM   1077 C CD1   . ILE A 1 80 ? -13.174 -13.135 7.261   1.00 24.57  ?  168 ILE A CD1   1 
ATOM   1078 H H     . ILE A 1 80 ? -16.684 -11.394 9.038   1.00 37.23  ?  168 ILE A H     1 
ATOM   1079 H HA    . ILE A 1 80 ? -15.060 -9.498  7.934   1.00 33.23  ?  168 ILE A HA    1 
ATOM   1080 H HB    . ILE A 1 80 ? -15.616 -12.063 6.851   1.00 30.83  ?  168 ILE A HB    1 
ATOM   1081 H HG12  . ILE A 1 80 ? -13.143 -11.216 7.930   1.00 33.16  ?  168 ILE A HG12  1 
ATOM   1082 H HG13  . ILE A 1 80 ? -14.159 -12.134 8.731   1.00 33.16  ?  168 ILE A HG13  1 
ATOM   1083 H HG21  . ILE A 1 80 ? -14.034 -11.542 5.215   1.00 34.25  ?  168 ILE A HG21  1 
ATOM   1084 H HG22  . ILE A 1 80 ? -15.223 -10.513 5.164   1.00 34.25  ?  168 ILE A HG22  1 
ATOM   1085 H HG23  . ILE A 1 80 ? -13.861 -10.108 5.837   1.00 34.25  ?  168 ILE A HG23  1 
ATOM   1086 H HD11  . ILE A 1 80 ? -12.462 -13.419 7.840   1.00 29.48  ?  168 ILE A HD11  1 
ATOM   1087 H HD12  . ILE A 1 80 ? -13.832 -13.830 7.187   1.00 29.48  ?  168 ILE A HD12  1 
ATOM   1088 H HD13  . ILE A 1 80 ? -12.825 -12.920 6.393   1.00 29.48  ?  168 ILE A HD13  1 
ATOM   1089 N N     . ASP A 1 81 ? -16.824 -8.386  6.703   1.00 36.80  ?  169 ASP A N     1 
ATOM   1090 C CA    . ASP A 1 81 ? -17.860 -7.726  5.919   1.00 34.65  ?  169 ASP A CA    1 
ATOM   1091 C C     . ASP A 1 81 ? -19.264 -8.043  6.435   1.00 34.30  ?  169 ASP A C     1 
ATOM   1092 O O     . ASP A 1 81 ? -20.203 -8.179  5.652   1.00 36.40  ?  169 ASP A O     1 
ATOM   1093 C CB    . ASP A 1 81 ? -17.730 -8.100  4.439   1.00 32.62  ?  169 ASP A CB    1 
ATOM   1094 C CG    . ASP A 1 81 ? -16.562 -7.407  3.763   1.00 34.56  ?  169 ASP A CG    1 
ATOM   1095 O OD1   . ASP A 1 81 ? -16.679 -6.202  3.457   1.00 36.19  ?  169 ASP A OD1   1 
ATOM   1096 O OD2   . ASP A 1 81 ? -15.529 -8.067  3.531   1.00 40.93  -1 169 ASP A OD2   1 
ATOM   1097 H H     . ASP A 1 81 ? -16.204 -7.856  6.974   1.00 44.15  ?  169 ASP A H     1 
ATOM   1098 H HA    . ASP A 1 81 ? -17.733 -6.756  5.990   1.00 41.58  ?  169 ASP A HA    1 
ATOM   1099 H HB2   . ASP A 1 81 ? -17.595 -9.058  4.366   1.00 39.15  ?  169 ASP A HB2   1 
ATOM   1100 H HB3   . ASP A 1 81 ? -18.542 -7.843  3.975   1.00 39.15  ?  169 ASP A HB3   1 
ATOM   1101 N N     . GLY A 1 82 ? -19.400 -8.169  7.754   1.00 34.30  ?  170 GLY A N     1 
ATOM   1102 C CA    . GLY A 1 82 ? -20.709 -8.243  8.380   1.00 28.55  ?  170 GLY A CA    1 
ATOM   1103 C C     . GLY A 1 82 ? -21.152 -9.621  8.831   1.00 32.41  ?  170 GLY A C     1 
ATOM   1104 O O     . GLY A 1 82 ? -22.221 -9.760  9.426   1.00 34.36  ?  170 GLY A O     1 
ATOM   1105 H H     . GLY A 1 82 ? -18.743 -8.214  8.307   1.00 41.17  ?  170 GLY A H     1 
ATOM   1106 H HA2   . GLY A 1 82 ? -20.715 -7.662  9.157   1.00 34.26  ?  170 GLY A HA2   1 
ATOM   1107 H HA3   . GLY A 1 82 ? -21.372 -7.910  7.755   1.00 34.26  ?  170 GLY A HA3   1 
ATOM   1108 N N     . ARG A 1 83 ? -20.347 -10.642 8.552   1.00 31.54  ?  171 ARG A N     1 
ATOM   1109 C CA    . ARG A 1 83 ? -20.700 -12.006 8.937   1.00 32.04  ?  171 ARG A CA    1 
ATOM   1110 C C     . ARG A 1 83 ? -19.560 -12.735 9.635   1.00 35.79  ?  171 ARG A C     1 
ATOM   1111 O O     . ARG A 1 83 ? -18.392 -12.574 9.282   1.00 35.08  ?  171 ARG A O     1 
ATOM   1112 C CB    . ARG A 1 83 ? -21.148 -12.810 7.716   1.00 29.81  ?  171 ARG A CB    1 
ATOM   1113 C CG    . ARG A 1 83 ? -22.657 -12.872 7.538   1.00 36.47  ?  171 ARG A CG    1 
ATOM   1114 C CD    . ARG A 1 83 ? -23.031 -13.600 6.257   1.00 28.81  ?  171 ARG A CD    1 
ATOM   1115 N NE    . ARG A 1 83 ? -22.491 -14.958 6.228   1.00 36.64  ?  171 ARG A NE    1 
ATOM   1116 C CZ    . ARG A 1 83 ? -23.214 -16.074 6.294   1.00 26.39  ?  171 ARG A CZ    1 
ATOM   1117 N NH1   . ARG A 1 83 ? -24.537 -16.038 6.388   1.00 23.46  1  171 ARG A NH1   1 
ATOM   1118 N NH2   . ARG A 1 83 ? -22.601 -17.248 6.257   1.00 26.98  ?  171 ARG A NH2   1 
ATOM   1119 H H     . ARG A 1 83 ? -19.594 -10.572 8.143   1.00 37.85  ?  171 ARG A H     1 
ATOM   1120 H HA    . ARG A 1 83 ? -21.454 -11.969 9.562   1.00 38.45  ?  171 ARG A HA    1 
ATOM   1121 H HB2   . ARG A 1 83 ? -20.773 -12.403 6.920   1.00 35.78  ?  171 ARG A HB2   1 
ATOM   1122 H HB3   . ARG A 1 83 ? -20.823 -13.719 7.804   1.00 35.78  ?  171 ARG A HB3   1 
ATOM   1123 H HG2   . ARG A 1 83 ? -23.048 -13.349 8.286   1.00 43.76  ?  171 ARG A HG2   1 
ATOM   1124 H HG3   . ARG A 1 83 ? -23.011 -11.970 7.491   1.00 43.76  ?  171 ARG A HG3   1 
ATOM   1125 H HD2   . ARG A 1 83 ? -23.998 -13.657 6.193   1.00 34.58  ?  171 ARG A HD2   1 
ATOM   1126 H HD3   . ARG A 1 83 ? -22.673 -13.115 5.497   1.00 34.58  ?  171 ARG A HD3   1 
ATOM   1127 H HE    . ARG A 1 83 ? -21.638 -15.043 6.163   1.00 43.97  ?  171 ARG A HE    1 
ATOM   1128 H HH11  . ARG A 1 83 ? -24.945 -15.281 6.412   1.00 28.15  ?  171 ARG A HH11  1 
ATOM   1129 H HH12  . ARG A 1 83 ? -24.985 -16.770 6.428   1.00 28.15  ?  171 ARG A HH12  1 
ATOM   1130 H HH21  . ARG A 1 83 ? -21.744 -17.284 6.195   1.00 32.37  ?  171 ARG A HH21  1 
ATOM   1131 H HH22  . ARG A 1 83 ? -23.060 -17.974 6.298   1.00 32.37  ?  171 ARG A HH22  1 
ATOM   1132 N N     . TRP A 1 84 ? -19.916 -13.546 10.626  1.00 32.76  ?  172 TRP A N     1 
ATOM   1133 C CA    . TRP A 1 84 ? -18.938 -14.330 11.367  1.00 31.03  ?  172 TRP A CA    1 
ATOM   1134 C C     . TRP A 1 84 ? -18.433 -15.491 10.522  1.00 33.67  ?  172 TRP A C     1 
ATOM   1135 O O     . TRP A 1 84 ? -19.218 -16.279 9.998   1.00 40.92  ?  172 TRP A O     1 
ATOM   1136 C CB    . TRP A 1 84 ? -19.547 -14.843 12.672  1.00 27.09  ?  172 TRP A CB    1 
ATOM   1137 C CG    . TRP A 1 84 ? -19.774 -13.754 13.675  1.00 33.25  ?  172 TRP A CG    1 
ATOM   1138 C CD1   . TRP A 1 84 ? -20.965 -13.184 14.014  1.00 32.07  ?  172 TRP A CD1   1 
ATOM   1139 C CD2   . TRP A 1 84 ? -18.775 -13.093 14.459  1.00 33.01  ?  172 TRP A CD2   1 
ATOM   1140 N NE1   . TRP A 1 84 ? -20.771 -12.212 14.966  1.00 38.46  ?  172 TRP A NE1   1 
ATOM   1141 C CE2   . TRP A 1 84 ? -19.435 -12.138 15.257  1.00 33.53  ?  172 TRP A CE2   1 
ATOM   1142 C CE3   . TRP A 1 84 ? -17.388 -13.220 14.566  1.00 33.31  ?  172 TRP A CE3   1 
ATOM   1143 C CZ2   . TRP A 1 84 ? -18.754 -11.314 16.148  1.00 34.80  ?  172 TRP A CZ2   1 
ATOM   1144 C CZ3   . TRP A 1 84 ? -16.715 -12.401 15.452  1.00 34.10  ?  172 TRP A CZ3   1 
ATOM   1145 C CH2   . TRP A 1 84 ? -17.398 -11.461 16.231  1.00 34.34  ?  172 TRP A CH2   1 
ATOM   1146 H H     . TRP A 1 84 ? -20.726 -13.661 10.889  1.00 39.31  ?  172 TRP A H     1 
ATOM   1147 H HA    . TRP A 1 84 ? -18.173 -13.760 11.591  1.00 37.24  ?  172 TRP A HA    1 
ATOM   1148 H HB2   . TRP A 1 84 ? -20.403 -15.257 12.480  1.00 32.51  ?  172 TRP A HB2   1 
ATOM   1149 H HB3   . TRP A 1 84 ? -18.945 -15.493 13.067  1.00 32.51  ?  172 TRP A HB3   1 
ATOM   1150 H HD1   . TRP A 1 84 ? -21.790 -13.420 13.655  1.00 38.49  ?  172 TRP A HD1   1 
ATOM   1151 H HE1   . TRP A 1 84 ? -21.388 -11.730 15.323  1.00 46.15  ?  172 TRP A HE1   1 
ATOM   1152 H HE3   . TRP A 1 84 ? -16.927 -13.843 14.052  1.00 39.98  ?  172 TRP A HE3   1 
ATOM   1153 H HZ2   . TRP A 1 84 ? -19.205 -10.688 16.668  1.00 41.75  ?  172 TRP A HZ2   1 
ATOM   1154 H HZ3   . TRP A 1 84 ? -15.792 -12.476 15.532  1.00 40.92  ?  172 TRP A HZ3   1 
ATOM   1155 H HH2   . TRP A 1 84 ? -16.918 -10.924 16.819  1.00 41.20  ?  172 TRP A HH2   1 
ATOM   1156 N N     . CYS A 1 85 ? -17.115 -15.588 10.397  1.00 32.25  ?  173 CYS A N     1 
ATOM   1157 C CA    . CYS A 1 85 ? -16.491 -16.611 9.572   1.00 35.78  ?  173 CYS A CA    1 
ATOM   1158 C C     . CYS A 1 85 ? -15.581 -17.488 10.422  1.00 33.49  ?  173 CYS A C     1 
ATOM   1159 O O     . CYS A 1 85 ? -15.044 -17.041 11.435  1.00 32.99  ?  173 CYS A O     1 
ATOM   1160 C CB    . CYS A 1 85 ? -15.696 -15.958 8.439   1.00 30.82  ?  173 CYS A CB    1 
ATOM   1161 S SG    . CYS A 1 85 ? -16.722 -15.069 7.242   1.00 31.97  ?  173 CYS A SG    1 
ATOM   1162 H H     . CYS A 1 85 ? -16.554 -15.065 10.785  1.00 38.71  ?  173 CYS A H     1 
ATOM   1163 H HA    . CYS A 1 85 ? -17.185 -17.178 9.176   1.00 42.94  ?  173 CYS A HA    1 
ATOM   1164 H HB2   . CYS A 1 85 ? -15.070 -15.323 8.823   1.00 36.99  ?  173 CYS A HB2   1 
ATOM   1165 H HB3   . CYS A 1 85 ? -15.211 -16.648 7.960   1.00 36.99  ?  173 CYS A HB3   1 
ATOM   1166 H HG    . CYS A 1 85 ? -17.321 -14.198 7.811   1.00 38.36  ?  173 CYS A HG    1 
ATOM   1167 N N     . ASP A 1 86 ? -15.409 -18.737 10.004  1.00 30.52  ?  174 ASP A N     1 
ATOM   1168 C CA    . ASP A 1 86 ? -14.618 -19.699 10.763  1.00 29.92  ?  174 ASP A CA    1 
ATOM   1169 C C     . ASP A 1 86 ? -13.391 -20.149 9.981   1.00 26.66  ?  174 ASP A C     1 
ATOM   1170 O O     . ASP A 1 86 ? -13.480 -20.473 8.799   1.00 36.02  ?  174 ASP A O     1 
ATOM   1171 C CB    . ASP A 1 86 ? -15.474 -20.913 11.120  1.00 30.47  ?  174 ASP A CB    1 
ATOM   1172 C CG    . ASP A 1 86 ? -16.617 -20.562 12.044  1.00 33.04  ?  174 ASP A CG    1 
ATOM   1173 O OD1   . ASP A 1 86 ? -16.350 -20.002 13.127  1.00 30.08  ?  174 ASP A OD1   1 
ATOM   1174 O OD2   . ASP A 1 86 ? -17.782 -20.835 11.686  1.00 34.94  -1 174 ASP A OD2   1 
ATOM   1175 H H     . ASP A 1 86 ? -15.743 -19.055 9.278   1.00 36.62  ?  174 ASP A H     1 
ATOM   1176 H HA    . ASP A 1 86 ? -14.314 -19.281 11.596  1.00 35.90  ?  174 ASP A HA    1 
ATOM   1177 H HB2   . ASP A 1 86 ? -15.848 -21.287 10.308  1.00 36.56  ?  174 ASP A HB2   1 
ATOM   1178 H HB3   . ASP A 1 86 ? -14.918 -21.572 11.566  1.00 36.56  ?  174 ASP A HB3   1 
ATOM   1179 N N     . CYS A 1 87 ? -12.247 -20.171 10.653  1.00 32.84  ?  175 CYS A N     1 
ATOM   1180 C CA    . CYS A 1 87 ? -11.010 -20.635 10.043  1.00 32.76  ?  175 CYS A CA    1 
ATOM   1181 C C     . CYS A 1 87 ? -10.642 -21.995 10.617  1.00 37.45  ?  175 CYS A C     1 
ATOM   1182 O O     . CYS A 1 87 ? -10.191 -22.099 11.756  1.00 47.96  ?  175 CYS A O     1 
ATOM   1183 C CB    . CYS A 1 87 ? -9.883  -19.631 10.282  1.00 33.30  ?  175 CYS A CB    1 
ATOM   1184 S SG    . CYS A 1 87 ? -10.063 -18.098 9.345   1.00 41.77  ?  175 CYS A SG    1 
ATOM   1185 H H     . CYS A 1 87 ? -12.160 -19.921 11.472  1.00 39.41  ?  175 CYS A H     1 
ATOM   1186 H HA    . CYS A 1 87 ? -11.140 -20.731 9.076   1.00 39.32  ?  175 CYS A HA    1 
ATOM   1187 H HB2   . CYS A 1 87 ? -9.863  -19.402 11.225  1.00 39.96  ?  175 CYS A HB2   1 
ATOM   1188 H HB3   . CYS A 1 87 ? -9.041  -20.038 10.025  1.00 39.96  ?  175 CYS A HB3   1 
ATOM   1189 H HG    . CYS A 1 87 ? -9.138  -17.376 9.595   1.00 50.12  ?  175 CYS A HG    1 
ATOM   1190 N N     . LYS A 1 88 ? -10.850 -23.038 9.822   1.00 34.73  ?  176 LYS A N     1 
ATOM   1191 C CA    . LYS A 1 88 ? -10.596 -24.401 10.264  1.00 34.70  ?  176 LYS A CA    1 
ATOM   1192 C C     . LYS A 1 88 ? -9.530  -25.054 9.401   1.00 37.58  ?  176 LYS A C     1 
ATOM   1193 O O     . LYS A 1 88 ? -9.226  -24.579 8.309   1.00 41.59  ?  176 LYS A O     1 
ATOM   1194 C CB    . LYS A 1 88 ? -11.881 -25.224 10.184  1.00 34.34  ?  176 LYS A CB    1 
ATOM   1195 C CG    . LYS A 1 88 ? -13.018 -24.674 11.021  1.00 38.17  ?  176 LYS A CG    1 
ATOM   1196 C CD    . LYS A 1 88 ? -14.253 -25.551 10.906  1.00 37.82  ?  176 LYS A CD    1 
ATOM   1197 C CE    . LYS A 1 88 ? -15.370 -25.067 11.815  1.00 48.34  ?  176 LYS A CE    1 
ATOM   1198 N NZ    . LYS A 1 88 ? -16.516 -26.016 11.831  1.00 52.95  1  176 LYS A NZ    1 
ATOM   1199 H H     . LYS A 1 88 ? -11.141 -22.981 9.015   1.00 41.68  ?  176 LYS A H     1 
ATOM   1200 H HA    . LYS A 1 88 ? -10.285 -24.393 11.193  1.00 41.64  ?  176 LYS A HA    1 
ATOM   1201 H HB2   . LYS A 1 88 ? -12.178 -25.250 9.261   1.00 41.21  ?  176 LYS A HB2   1 
ATOM   1202 H HB3   . LYS A 1 88 ? -11.694 -26.124 10.494  1.00 41.21  ?  176 LYS A HB3   1 
ATOM   1203 H HG2   . LYS A 1 88 ? -12.748 -24.647 11.952  1.00 45.80  ?  176 LYS A HG2   1 
ATOM   1204 H HG3   . LYS A 1 88 ? -13.245 -23.784 10.709  1.00 45.80  ?  176 LYS A HG3   1 
ATOM   1205 H HD2   . LYS A 1 88 ? -14.576 -25.531 9.992   1.00 45.38  ?  176 LYS A HD2   1 
ATOM   1206 H HD3   . LYS A 1 88 ? -14.025 -26.459 11.162  1.00 45.38  ?  176 LYS A HD3   1 
ATOM   1207 H HE2   . LYS A 1 88 ? -15.031 -24.985 12.721  1.00 58.01  ?  176 LYS A HE2   1 
ATOM   1208 H HE3   . LYS A 1 88 ? -15.690 -24.209 11.498  1.00 58.01  ?  176 LYS A HE3   1 
ATOM   1209 H HZ1   . LYS A 1 88 ? -17.156 -25.710 12.370  1.00 63.54  ?  176 LYS A HZ1   1 
ATOM   1210 H HZ2   . LYS A 1 88 ? -16.848 -26.105 11.010  1.00 63.54  ?  176 LYS A HZ2   1 
ATOM   1211 H HZ3   . LYS A 1 88 ? -16.248 -26.812 12.124  1.00 63.54  ?  176 LYS A HZ3   1 
ATOM   1212 N N     . LEU A 1 89 ? -8.955  -26.142 9.902   1.00 47.26  ?  177 LEU A N     1 
ATOM   1213 C CA    . LEU A 1 89 ? -8.105  -26.993 9.085   1.00 37.04  ?  177 LEU A CA    1 
ATOM   1214 C C     . LEU A 1 89 ? -8.994  -27.744 8.102   1.00 32.22  ?  177 LEU A C     1 
ATOM   1215 O O     . LEU A 1 89 ? -10.081 -28.190 8.466   1.00 45.46  ?  177 LEU A O     1 
ATOM   1216 C CB    . LEU A 1 89 ? -7.334  -27.980 9.959   1.00 43.52  ?  177 LEU A CB    1 
ATOM   1217 C CG    . LEU A 1 89 ? -6.250  -27.376 10.852  1.00 39.35  ?  177 LEU A CG    1 
ATOM   1218 C CD1   . LEU A 1 89 ? -5.737  -28.431 11.814  1.00 43.32  ?  177 LEU A CD1   1 
ATOM   1219 C CD2   . LEU A 1 89 ? -5.113  -26.807 10.015  1.00 39.85  ?  177 LEU A CD2   1 
ATOM   1220 H H     . LEU A 1 89 ? -9.042  -26.407 10.716  1.00 56.72  ?  177 LEU A H     1 
ATOM   1221 H HA    . LEU A 1 89 ? -7.466  -26.446 8.583   1.00 44.45  ?  177 LEU A HA    1 
ATOM   1222 H HB2   . LEU A 1 89 ? -7.966  -28.434 10.538  1.00 52.22  ?  177 LEU A HB2   1 
ATOM   1223 H HB3   . LEU A 1 89 ? -6.904  -28.629 9.381   1.00 52.22  ?  177 LEU A HB3   1 
ATOM   1224 H HG    . LEU A 1 89 ? -6.633  -26.653 11.373  1.00 47.22  ?  177 LEU A HG    1 
ATOM   1225 H HD11  . LEU A 1 89 ? -5.058  -28.042 12.370  1.00 51.99  ?  177 LEU A HD11  1 
ATOM   1226 H HD12  . LEU A 1 89 ? -6.467  -28.740 12.356  1.00 51.99  ?  177 LEU A HD12  1 
ATOM   1227 H HD13  . LEU A 1 89 ? -5.371  -29.161 11.310  1.00 51.99  ?  177 LEU A HD13  1 
ATOM   1228 H HD21  . LEU A 1 89 ? -4.449  -26.436 10.601  1.00 47.82  ?  177 LEU A HD21  1 
ATOM   1229 H HD22  . LEU A 1 89 ? -4.728  -27.512 9.490   1.00 47.82  ?  177 LEU A HD22  1 
ATOM   1230 H HD23  . LEU A 1 89 ? -5.461  -26.122 9.440   1.00 47.82  ?  177 LEU A HD23  1 
ATOM   1231 N N     . PRO A 1 90 ? -8.541  -27.880 6.848   1.00 37.84  ?  178 PRO A N     1 
ATOM   1232 C CA    . PRO A 1 90 ? -9.367  -28.512 5.816   1.00 42.44  ?  178 PRO A CA    1 
ATOM   1233 C C     . PRO A 1 90 ? -9.282  -30.039 5.807   1.00 48.26  ?  178 PRO A C     1 
ATOM   1234 O O     . PRO A 1 90 ? -8.426  -30.622 6.472   1.00 40.63  ?  178 PRO A O     1 
ATOM   1235 C CB    . PRO A 1 90 ? -8.787  -27.942 4.523   1.00 40.15  ?  178 PRO A CB    1 
ATOM   1236 C CG    . PRO A 1 90 ? -7.340  -27.729 4.838   1.00 41.72  ?  178 PRO A CG    1 
ATOM   1237 C CD    . PRO A 1 90 ? -7.278  -27.354 6.299   1.00 40.87  ?  178 PRO A CD    1 
ATOM   1238 H HA    . PRO A 1 90 ? -10.303 -28.235 5.906   1.00 50.93  ?  178 PRO A HA    1 
ATOM   1239 H HB2   . PRO A 1 90 ? -8.894  -28.582 3.803   1.00 48.18  ?  178 PRO A HB2   1 
ATOM   1240 H HB3   . PRO A 1 90 ? -9.222  -27.102 4.308   1.00 48.18  ?  178 PRO A HB3   1 
ATOM   1241 H HG2   . PRO A 1 90 ? -6.850  -28.550 4.677   1.00 50.07  ?  178 PRO A HG2   1 
ATOM   1242 H HG3   . PRO A 1 90 ? -6.992  -27.010 4.288   1.00 50.07  ?  178 PRO A HG3   1 
ATOM   1243 H HD2   . PRO A 1 90 ? -6.520  -27.782 6.726   1.00 49.05  ?  178 PRO A HD2   1 
ATOM   1244 H HD3   . PRO A 1 90 ? -7.243  -26.389 6.399   1.00 49.05  ?  178 PRO A HD3   1 
ATOM   1245 N N     . ASN A 1 91 ? -10.178 -30.667 5.049   1.00 52.41  ?  179 ASN A N     1 
ATOM   1246 C CA    . ASN A 1 91 ? -10.202 -32.114 4.884   1.00 55.89  ?  179 ASN A CA    1 
ATOM   1247 C C     . ASN A 1 91 ? -9.584  -32.485 3.540   1.00 65.16  ?  179 ASN A C     1 
ATOM   1248 O O     . ASN A 1 91 ? -10.147 -32.176 2.491   1.00 62.81  ?  179 ASN A O     1 
ATOM   1249 C CB    . ASN A 1 91 ? -11.645 -32.624 4.941   1.00 57.36  ?  179 ASN A CB    1 
ATOM   1250 C CG    . ASN A 1 91 ? -12.407 -32.091 6.141   1.00 54.14  ?  179 ASN A CG    1 
ATOM   1251 O OD1   . ASN A 1 91 ? -11.868 -32.001 7.242   1.00 60.02  ?  179 ASN A OD1   1 
ATOM   1252 N ND2   . ASN A 1 91 ? -13.670 -31.731 5.929   1.00 44.05  ?  179 ASN A ND2   1 
ATOM   1253 H H     . ASN A 1 91 ? -10.797 -30.263 4.610   1.00 62.89  ?  179 ASN A H     1 
ATOM   1254 H HA    . ASN A 1 91 ? -9.686  -32.541 5.600   1.00 67.06  ?  179 ASN A HA    1 
ATOM   1255 H HB2   . ASN A 1 91 ? -12.112 -32.341 4.139   1.00 68.83  ?  179 ASN A HB2   1 
ATOM   1256 H HB3   . ASN A 1 91 ? -11.636 -33.592 4.997   1.00 68.83  ?  179 ASN A HB3   1 
ATOM   1257 H HD21  . ASN A 1 91 ? -14.012 -31.806 5.144   1.00 52.86  ?  179 ASN A HD21  1 
ATOM   1258 H HD22  . ASN A 1 91 ? -14.143 -31.424 6.578   1.00 52.86  ?  179 ASN A HD22  1 
ATOM   1259 N N     . SER A 1 92 ? -8.426  -33.137 3.576   1.00 74.65  ?  180 SER A N     1 
ATOM   1260 C CA    . SER A 1 92 ? -7.696  -33.513 2.365   1.00 79.92  ?  180 SER A CA    1 
ATOM   1261 C C     . SER A 1 92 ? -6.987  -32.307 1.755   1.00 75.46  ?  180 SER A C     1 
ATOM   1262 O O     . SER A 1 92 ? -5.844  -32.006 2.101   1.00 64.39  ?  180 SER A O     1 
ATOM   1263 C CB    . SER A 1 92 ? -8.627  -34.164 1.332   1.00 76.37  ?  180 SER A CB    1 
ATOM   1264 O OG    . SER A 1 92 ? -9.578  -33.248 0.810   1.00 73.79  ?  180 SER A OG    1 
ATOM   1265 H H     . SER A 1 92 ? -8.033  -33.378 4.303   1.00 89.59  ?  180 SER A H     1 
ATOM   1266 H HA    . SER A 1 92 ? -7.011  -34.171 2.603   1.00 95.90  ?  180 SER A HA    1 
ATOM   1267 H HB2   . SER A 1 92 ? -8.089  -34.504 0.600   1.00 91.64  ?  180 SER A HB2   1 
ATOM   1268 H HB3   . SER A 1 92 ? -9.101  -34.895 1.757   1.00 91.64  ?  180 SER A HB3   1 
ATOM   1269 H HG    . SER A 1 92 ? -9.472  -32.510 1.151   1.00 88.54  ?  180 SER A HG    1 
ATOM   1270 N N     . THR B 1 15 ? -47.198 -39.091 -2.826  1.00 50.28  ?  103 THR B N     1 
ATOM   1271 C CA    . THR B 1 15 ? -47.800 -40.219 -3.526  1.00 57.67  ?  103 THR B CA    1 
ATOM   1272 C C     . THR B 1 15 ? -47.729 -40.048 -5.042  1.00 56.58  ?  103 THR B C     1 
ATOM   1273 O O     . THR B 1 15 ? -48.201 -40.905 -5.788  1.00 61.10  ?  103 THR B O     1 
ATOM   1274 C CB    . THR B 1 15 ? -49.275 -40.413 -3.120  1.00 68.70  ?  103 THR B CB    1 
ATOM   1275 O OG1   . THR B 1 15 ? -49.984 -39.175 -3.264  1.00 58.51  ?  103 THR B OG1   1 
ATOM   1276 C CG2   . THR B 1 15 ? -49.378 -40.892 -1.679  1.00 71.16  ?  103 THR B CG2   1 
ATOM   1277 H HA    . THR B 1 15 ? -47.312 -41.035 -3.291  1.00 69.20  ?  103 THR B HA    1 
ATOM   1278 H HB    . THR B 1 15 ? -49.679 -41.082 -3.693  1.00 82.44  ?  103 THR B HB    1 
ATOM   1279 H HG1   . THR B 1 15 ? -49.648 -38.601 -2.785  1.00 70.21  ?  103 THR B HG1   1 
ATOM   1280 H HG21  . THR B 1 15 ? -50.300 -41.010 -1.438  1.00 85.39  ?  103 THR B HG21  1 
ATOM   1281 H HG22  . THR B 1 15 ? -48.920 -41.730 -1.579  1.00 85.39  ?  103 THR B HG22  1 
ATOM   1282 H HG23  . THR B 1 15 ? -48.980 -40.247 -1.090  1.00 85.39  ?  103 THR B HG23  1 
ATOM   1283 N N     . SER B 1 16 ? -47.140 -38.945 -5.495  1.00 56.59  ?  104 SER B N     1 
ATOM   1284 C CA    . SER B 1 16 ? -46.991 -38.694 -6.925  1.00 57.05  ?  104 SER B CA    1 
ATOM   1285 C C     . SER B 1 16 ? -45.568 -38.264 -7.271  1.00 59.83  ?  104 SER B C     1 
ATOM   1286 O O     . SER B 1 16 ? -44.857 -37.705 -6.435  1.00 49.20  ?  104 SER B O     1 
ATOM   1287 C CB    . SER B 1 16 ? -47.985 -37.630 -7.393  1.00 54.85  ?  104 SER B CB    1 
ATOM   1288 O OG    . SER B 1 16 ? -47.773 -37.306 -8.756  1.00 53.31  ?  104 SER B OG    1 
ATOM   1289 H H     . SER B 1 16 ? -46.818 -38.324 -4.994  1.00 67.90  ?  104 SER B H     1 
ATOM   1290 H HA    . SER B 1 16 ? -47.182 -39.522 -7.414  1.00 68.46  ?  104 SER B HA    1 
ATOM   1291 H HB2   . SER B 1 16 ? -48.887 -37.972 -7.286  1.00 65.82  ?  104 SER B HB2   1 
ATOM   1292 H HB3   . SER B 1 16 ? -47.868 -36.831 -6.856  1.00 65.82  ?  104 SER B HB3   1 
ATOM   1293 H HG    . SER B 1 16 ? -48.311 -36.735 -8.995  1.00 63.98  ?  104 SER B HG    1 
ATOM   1294 N N     . ASP B 1 17 ? -45.166 -38.525 -8.511  1.00 60.08  ?  105 ASP B N     1 
ATOM   1295 C CA    . ASP B 1 17 ? -43.824 -38.194 -8.978  1.00 47.49  ?  105 ASP B CA    1 
ATOM   1296 C C     . ASP B 1 17 ? -43.617 -36.686 -9.063  1.00 46.52  ?  105 ASP B C     1 
ATOM   1297 O O     . ASP B 1 17 ? -44.532 -35.940 -9.411  1.00 43.20  ?  105 ASP B O     1 
ATOM   1298 C CB    . ASP B 1 17 ? -43.569 -38.809 -10.358 1.00 52.72  ?  105 ASP B CB    1 
ATOM   1299 C CG    . ASP B 1 17 ? -43.396 -40.315 -10.309 1.00 56.89  ?  105 ASP B CG    1 
ATOM   1300 O OD1   . ASP B 1 17 ? -42.959 -40.835 -9.264  1.00 60.83  ?  105 ASP B OD1   1 
ATOM   1301 O OD2   . ASP B 1 17 ? -43.687 -40.977 -11.327 1.00 59.02  -1 105 ASP B OD2   1 
ATOM   1302 H H     . ASP B 1 17 ? -45.659 -38.899 -9.109  1.00 72.10  ?  105 ASP B H     1 
ATOM   1303 H HA    . ASP B 1 17 ? -43.165 -38.560 -8.352  1.00 56.99  ?  105 ASP B HA    1 
ATOM   1304 H HB2   . ASP B 1 17 ? -44.324 -38.613 -10.935 1.00 63.26  ?  105 ASP B HB2   1 
ATOM   1305 H HB3   . ASP B 1 17 ? -42.759 -38.426 -10.729 1.00 63.26  ?  105 ASP B HB3   1 
ATOM   1306 N N     . LEU B 1 18 ? -42.404 -36.249 -8.744  1.00 47.51  ?  106 LEU B N     1 
ATOM   1307 C CA    . LEU B 1 18 ? -42.020 -34.852 -8.893  1.00 46.95  ?  106 LEU B CA    1 
ATOM   1308 C C     . LEU B 1 18 ? -40.889 -34.748 -9.898  1.00 40.35  ?  106 LEU B C     1 
ATOM   1309 O O     . LEU B 1 18 ? -39.990 -35.583 -9.908  1.00 35.29  ?  106 LEU B O     1 
ATOM   1310 C CB    . LEU B 1 18 ? -41.550 -34.279 -7.559  1.00 43.30  ?  106 LEU B CB    1 
ATOM   1311 C CG    . LEU B 1 18 ? -42.590 -34.237 -6.444  1.00 39.76  ?  106 LEU B CG    1 
ATOM   1312 C CD1   . LEU B 1 18 ? -41.942 -33.763 -5.156  1.00 44.53  ?  106 LEU B CD1   1 
ATOM   1313 C CD2   . LEU B 1 18 ? -43.747 -33.339 -6.847  1.00 47.29  ?  106 LEU B CD2   1 
ATOM   1314 H H     . LEU B 1 18 ? -41.777 -36.750 -8.435  1.00 57.01  ?  106 LEU B H     1 
ATOM   1315 H HA    . LEU B 1 18 ? -42.782 -34.327 -9.215  1.00 56.34  ?  106 LEU B HA    1 
ATOM   1316 H HB2   . LEU B 1 18 ? -40.807 -34.816 -7.241  1.00 51.95  ?  106 LEU B HB2   1 
ATOM   1317 H HB3   . LEU B 1 18 ? -41.249 -33.369 -7.707  1.00 51.95  ?  106 LEU B HB3   1 
ATOM   1318 H HG    . LEU B 1 18 ? -42.937 -35.131 -6.298  1.00 47.71  ?  106 LEU B HG    1 
ATOM   1319 H HD11  . LEU B 1 18 ? -42.605 -33.741 -4.462  1.00 53.43  ?  106 LEU B HD11  1 
ATOM   1320 H HD12  . LEU B 1 18 ? -41.238 -34.372 -4.918  1.00 53.43  ?  106 LEU B HD12  1 
ATOM   1321 H HD13  . LEU B 1 18 ? -41.581 -32.884 -5.293  1.00 53.43  ?  106 LEU B HD13  1 
ATOM   1322 H HD21  . LEU B 1 18 ? -44.392 -33.323 -6.136  1.00 56.74  ?  106 LEU B HD21  1 
ATOM   1323 H HD22  . LEU B 1 18 ? -43.413 -32.453 -7.006  1.00 56.74  ?  106 LEU B HD22  1 
ATOM   1324 H HD23  . LEU B 1 18 ? -44.148 -33.686 -7.646  1.00 56.74  ?  106 LEU B HD23  1 
ATOM   1325 N N     . ILE B 1 19 ? -40.937 -33.725 -10.742 1.00 38.20  ?  107 ILE B N     1 
ATOM   1326 C CA    . ILE B 1 19 ? -39.851 -33.475 -11.676 1.00 37.17  ?  107 ILE B CA    1 
ATOM   1327 C C     . ILE B 1 19 ? -38.840 -32.530 -11.032 1.00 36.16  ?  107 ILE B C     1 
ATOM   1328 O O     . ILE B 1 19 ? -39.201 -31.466 -10.531 1.00 36.03  ?  107 ILE B O     1 
ATOM   1329 C CB    . ILE B 1 19 ? -40.361 -32.888 -13.014 1.00 37.32  ?  107 ILE B CB    1 
ATOM   1330 C CG1   . ILE B 1 19 ? -39.239 -32.903 -14.055 1.00 37.28  ?  107 ILE B CG1   1 
ATOM   1331 C CG2   . ILE B 1 19 ? -40.916 -31.476 -12.818 1.00 37.53  ?  107 ILE B CG2   1 
ATOM   1332 C CD1   . ILE B 1 19 ? -39.641 -32.338 -15.401 1.00 36.24  ?  107 ILE B CD1   1 
ATOM   1333 H H     . ILE B 1 19 ? -41.586 -33.163 -10.793 1.00 45.84  ?  107 ILE B H     1 
ATOM   1334 H HA    . ILE B 1 19 ? -39.396 -34.321 -11.871 1.00 44.60  ?  107 ILE B HA    1 
ATOM   1335 H HB    . ILE B 1 19 ? -41.080 -33.453 -13.337 1.00 44.79  ?  107 ILE B HB    1 
ATOM   1336 H HG12  . ILE B 1 19 ? -38.497 -32.374 -13.722 1.00 44.73  ?  107 ILE B HG12  1 
ATOM   1337 H HG13  . ILE B 1 19 ? -38.953 -33.820 -14.192 1.00 44.73  ?  107 ILE B HG13  1 
ATOM   1338 H HG21  . ILE B 1 19 ? -41.223 -31.142 -13.664 1.00 45.03  ?  107 ILE B HG21  1 
ATOM   1339 H HG22  . ILE B 1 19 ? -41.646 -31.512 -12.196 1.00 45.03  ?  107 ILE B HG22  1 
ATOM   1340 H HG23  . ILE B 1 19 ? -40.220 -30.912 -12.476 1.00 45.03  ?  107 ILE B HG23  1 
ATOM   1341 H HD11  . ILE B 1 19 ? -38.888 -32.382 -15.996 1.00 43.49  ?  107 ILE B HD11  1 
ATOM   1342 H HD12  . ILE B 1 19 ? -40.367 -32.857 -15.753 1.00 43.49  ?  107 ILE B HD12  1 
ATOM   1343 H HD13  . ILE B 1 19 ? -39.915 -31.425 -15.287 1.00 43.49  ?  107 ILE B HD13  1 
ATOM   1344 N N     . VAL B 1 20 ? -37.575 -32.939 -11.026 1.00 33.91  ?  108 VAL B N     1 
ATOM   1345 C CA    . VAL B 1 20 ? -36.511 -32.130 -10.444 1.00 30.16  ?  108 VAL B CA    1 
ATOM   1346 C C     . VAL B 1 20 ? -35.752 -31.404 -11.553 1.00 34.02  ?  108 VAL B C     1 
ATOM   1347 O O     . VAL B 1 20 ? -35.038 -32.029 -12.337 1.00 36.49  ?  108 VAL B O     1 
ATOM   1348 C CB    . VAL B 1 20 ? -35.530 -32.999 -9.628  1.00 35.11  ?  108 VAL B CB    1 
ATOM   1349 C CG1   . VAL B 1 20 ? -34.517 -32.123 -8.898  1.00 28.27  ?  108 VAL B CG1   1 
ATOM   1350 C CG2   . VAL B 1 20 ? -36.291 -33.888 -8.650  1.00 33.14  ?  108 VAL B CG2   1 
ATOM   1351 H H     . VAL B 1 20 ? -37.306 -33.686 -11.356 1.00 40.69  ?  108 VAL B H     1 
ATOM   1352 H HA    . VAL B 1 20 ? -36.902 -31.460 -9.845  1.00 36.19  ?  108 VAL B HA    1 
ATOM   1353 H HB    . VAL B 1 20 ? -35.036 -33.582 -10.243 1.00 42.14  ?  108 VAL B HB    1 
ATOM   1354 H HG11  . VAL B 1 20 ? -33.920 -32.686 -8.400  1.00 33.92  ?  108 VAL B HG11  1 
ATOM   1355 H HG12  . VAL B 1 20 ? -34.024 -31.612 -9.544  1.00 33.92  ?  108 VAL B HG12  1 
ATOM   1356 H HG13  . VAL B 1 20 ? -34.986 -31.534 -8.303  1.00 33.92  ?  108 VAL B HG13  1 
ATOM   1357 H HG21  . VAL B 1 20 ? -35.662 -34.418 -8.155  1.00 39.77  ?  108 VAL B HG21  1 
ATOM   1358 H HG22  . VAL B 1 20 ? -36.795 -33.332 -8.050  1.00 39.77  ?  108 VAL B HG22  1 
ATOM   1359 H HG23  . VAL B 1 20 ? -36.884 -34.459 -9.144  1.00 39.77  ?  108 VAL B HG23  1 
ATOM   1360 N N     . LEU B 1 21 ? -35.915 -30.086 -11.618 1.00 30.03  ?  109 LEU B N     1 
ATOM   1361 C CA    . LEU B 1 21 ? -35.316 -29.290 -12.685 1.00 31.63  ?  109 LEU B CA    1 
ATOM   1362 C C     . LEU B 1 21 ? -33.958 -28.712 -12.306 1.00 28.57  ?  109 LEU B C     1 
ATOM   1363 O O     . LEU B 1 21 ? -33.688 -28.436 -11.138 1.00 29.54  ?  109 LEU B O     1 
ATOM   1364 C CB    . LEU B 1 21 ? -36.252 -28.142 -13.073 1.00 31.01  ?  109 LEU B CB    1 
ATOM   1365 C CG    . LEU B 1 21 ? -37.335 -28.416 -14.123 1.00 35.95  ?  109 LEU B CG    1 
ATOM   1366 C CD1   . LEU B 1 21 ? -37.311 -29.861 -14.611 1.00 38.82  ?  109 LEU B CD1   1 
ATOM   1367 C CD2   . LEU B 1 21 ? -38.705 -28.055 -13.567 1.00 34.38  ?  109 LEU B CD2   1 
ATOM   1368 H H     . LEU B 1 21 ? -36.370 -29.625 -11.052 1.00 36.04  ?  109 LEU B H     1 
ATOM   1369 H HA    . LEU B 1 21 ? -35.192 -29.858 -13.473 1.00 37.95  ?  109 LEU B HA    1 
ATOM   1370 H HB2   . LEU B 1 21 ? -36.708 -27.845 -12.270 1.00 37.21  ?  109 LEU B HB2   1 
ATOM   1371 H HB3   . LEU B 1 21 ? -35.707 -27.416 -13.414 1.00 37.21  ?  109 LEU B HB3   1 
ATOM   1372 H HG    . LEU B 1 21 ? -37.171 -27.846 -14.891 1.00 43.14  ?  109 LEU B HG    1 
ATOM   1373 H HD11  . LEU B 1 21 ? -38.004 -29.981 -15.264 1.00 46.59  ?  109 LEU B HD11  1 
ATOM   1374 H HD12  . LEU B 1 21 ? -36.455 -30.044 -15.005 1.00 46.59  ?  109 LEU B HD12  1 
ATOM   1375 H HD13  . LEU B 1 21 ? -37.460 -30.445 -13.864 1.00 46.59  ?  109 LEU B HD13  1 
ATOM   1376 H HD21  . LEU B 1 21 ? -39.370 -28.232 -14.236 1.00 41.26  ?  109 LEU B HD21  1 
ATOM   1377 H HD22  . LEU B 1 21 ? -38.875 -28.588 -12.786 1.00 41.26  ?  109 LEU B HD22  1 
ATOM   1378 H HD23  . LEU B 1 21 ? -38.712 -27.123 -13.336 1.00 41.26  ?  109 LEU B HD23  1 
ATOM   1379 N N     . GLY B 1 22 ? -33.107 -28.535 -13.311 1.00 31.87  ?  110 GLY B N     1 
ATOM   1380 C CA    . GLY B 1 22 ? -31.857 -27.820 -13.141 1.00 30.55  ?  110 GLY B CA    1 
ATOM   1381 C C     . GLY B 1 22 ? -30.726 -28.663 -12.586 1.00 31.36  ?  110 GLY B C     1 
ATOM   1382 O O     . GLY B 1 22 ? -29.768 -28.124 -12.034 1.00 40.77  ?  110 GLY B O     1 
ATOM   1383 H H     . GLY B 1 22 ? -33.236 -28.825 -14.110 1.00 38.25  ?  110 GLY B H     1 
ATOM   1384 H HA2   . GLY B 1 22 ? -31.575 -27.467 -13.999 1.00 36.66  ?  110 GLY B HA2   1 
ATOM   1385 H HA3   . GLY B 1 22 ? -31.998 -27.073 -12.538 1.00 36.66  ?  110 GLY B HA3   1 
ATOM   1386 N N     . LEU B 1 23 ? -30.826 -29.982 -12.725 1.00 31.29  ?  111 LEU B N     1 
ATOM   1387 C CA    . LEU B 1 23 ? -29.760 -30.862 -12.259 1.00 27.76  ?  111 LEU B CA    1 
ATOM   1388 C C     . LEU B 1 23 ? -28.490 -30.641 -13.072 1.00 30.82  ?  111 LEU B C     1 
ATOM   1389 O O     . LEU B 1 23 ? -28.547 -30.516 -14.295 1.00 30.75  ?  111 LEU B O     1 
ATOM   1390 C CB    . LEU B 1 23 ? -30.158 -32.333 -12.379 1.00 21.72  ?  111 LEU B CB    1 
ATOM   1391 C CG    . LEU B 1 23 ? -31.414 -32.807 -11.653 1.00 37.80  ?  111 LEU B CG    1 
ATOM   1392 C CD1   . LEU B 1 23 ? -31.602 -34.296 -11.897 1.00 34.15  ?  111 LEU B CD1   1 
ATOM   1393 C CD2   . LEU B 1 23 ? -31.337 -32.505 -10.163 1.00 36.11  ?  111 LEU B CD2   1 
ATOM   1394 H H     . LEU B 1 23 ? -31.494 -30.389 -13.082 1.00 37.54  ?  111 LEU B H     1 
ATOM   1395 H HA    . LEU B 1 23 ? -29.564 -30.668 -11.319 1.00 33.32  ?  111 LEU B HA    1 
ATOM   1396 H HB2   . LEU B 1 23 ? -30.286 -32.530 -13.320 1.00 26.06  ?  111 LEU B HB2   1 
ATOM   1397 H HB3   . LEU B 1 23 ? -29.422 -32.868 -12.043 1.00 26.06  ?  111 LEU B HB3   1 
ATOM   1398 H HG    . LEU B 1 23 ? -32.185 -32.343 -12.016 1.00 45.36  ?  111 LEU B HG    1 
ATOM   1399 H HD11  . LEU B 1 23 ? -32.393 -34.590 -11.439 1.00 40.98  ?  111 LEU B HD11  1 
ATOM   1400 H HD12  . LEU B 1 23 ? -31.694 -34.449 -12.840 1.00 40.98  ?  111 LEU B HD12  1 
ATOM   1401 H HD13  . LEU B 1 23 ? -30.836 -34.767 -11.561 1.00 40.98  ?  111 LEU B HD13  1 
ATOM   1402 H HD21  . LEU B 1 23 ? -32.141 -32.815 -9.740  1.00 43.33  ?  111 LEU B HD21  1 
ATOM   1403 H HD22  . LEU B 1 23 ? -30.576 -32.956 -9.792  1.00 43.33  ?  111 LEU B HD22  1 
ATOM   1404 H HD23  . LEU B 1 23 ? -31.248 -31.557 -10.042 1.00 43.33  ?  111 LEU B HD23  1 
ATOM   1405 N N     . PRO B 1 24 ? -27.337 -30.586 -12.392 1.00 36.70  ?  112 PRO B N     1 
ATOM   1406 C CA    . PRO B 1 24 ? -26.052 -30.624 -13.098 1.00 31.21  ?  112 PRO B CA    1 
ATOM   1407 C C     . PRO B 1 24 ? -25.962 -31.861 -13.989 1.00 25.54  ?  112 PRO B C     1 
ATOM   1408 O O     . PRO B 1 24 ? -26.618 -32.860 -13.701 1.00 29.40  ?  112 PRO B O     1 
ATOM   1409 C CB    . PRO B 1 24 ? -25.031 -30.700 -11.962 1.00 26.00  ?  112 PRO B CB    1 
ATOM   1410 C CG    . PRO B 1 24 ? -25.712 -30.075 -10.792 1.00 32.60  ?  112 PRO B CG    1 
ATOM   1411 C CD    . PRO B 1 24 ? -27.174 -30.369 -10.944 1.00 32.73  ?  112 PRO B CD    1 
ATOM   1412 H HA    . PRO B 1 24 ? -25.913 -29.811 -13.627 1.00 37.45  ?  112 PRO B HA    1 
ATOM   1413 H HB2   . PRO B 1 24 ? -24.813 -31.627 -11.779 1.00 31.20  ?  112 PRO B HB2   1 
ATOM   1414 H HB3   . PRO B 1 24 ? -24.235 -30.200 -12.204 1.00 31.20  ?  112 PRO B HB3   1 
ATOM   1415 H HG2   . PRO B 1 24 ? -25.371 -30.468 -9.973  1.00 39.12  ?  112 PRO B HG2   1 
ATOM   1416 H HG3   . PRO B 1 24 ? -25.556 -29.118 -10.800 1.00 39.12  ?  112 PRO B HG3   1 
ATOM   1417 H HD2   . PRO B 1 24 ? -27.409 -31.172 -10.454 1.00 39.28  ?  112 PRO B HD2   1 
ATOM   1418 H HD3   . PRO B 1 24 ? -27.702 -29.608 -10.655 1.00 39.28  ?  112 PRO B HD3   1 
ATOM   1419 N N     . TRP B 1 25 ? -25.162 -31.795 -15.048 1.00 31.34  ?  113 TRP B N     1 
ATOM   1420 C CA    . TRP B 1 25 ? -25.086 -32.876 -16.028 1.00 33.24  ?  113 TRP B CA    1 
ATOM   1421 C C     . TRP B 1 25 ? -24.590 -34.180 -15.407 1.00 24.99  ?  113 TRP B C     1 
ATOM   1422 O O     . TRP B 1 25 ? -24.994 -35.266 -15.822 1.00 30.24  ?  113 TRP B O     1 
ATOM   1423 C CB    . TRP B 1 25 ? -24.161 -32.480 -17.182 1.00 33.58  ?  113 TRP B CB    1 
ATOM   1424 C CG    . TRP B 1 25 ? -24.468 -31.132 -17.769 1.00 32.05  ?  113 TRP B CG    1 
ATOM   1425 C CD1   . TRP B 1 25 ? -23.607 -30.083 -17.900 1.00 36.34  ?  113 TRP B CD1   1 
ATOM   1426 C CD2   . TRP B 1 25 ? -25.725 -30.686 -18.293 1.00 34.92  ?  113 TRP B CD2   1 
ATOM   1427 N NE1   . TRP B 1 25 ? -24.246 -29.013 -18.477 1.00 42.68  ?  113 TRP B NE1   1 
ATOM   1428 C CE2   . TRP B 1 25 ? -25.548 -29.357 -18.727 1.00 37.27  ?  113 TRP B CE2   1 
ATOM   1429 C CE3   . TRP B 1 25 ? -26.982 -31.280 -18.437 1.00 37.06  ?  113 TRP B CE3   1 
ATOM   1430 C CZ2   . TRP B 1 25 ? -26.579 -28.613 -19.296 1.00 33.85  ?  113 TRP B CZ2   1 
ATOM   1431 C CZ3   . TRP B 1 25 ? -28.005 -30.539 -19.003 1.00 41.30  ?  113 TRP B CZ3   1 
ATOM   1432 C CH2   . TRP B 1 25 ? -27.796 -29.221 -19.425 1.00 42.33  ?  113 TRP B CH2   1 
ATOM   1433 H H     . TRP B 1 25 ? -24.647 -31.129 -15.224 1.00 37.61  ?  113 TRP B H     1 
ATOM   1434 H HA    . TRP B 1 25 ? -25.980 -33.036 -16.397 1.00 39.88  ?  113 TRP B HA    1 
ATOM   1435 H HB2   . TRP B 1 25 ? -23.247 -32.461 -16.857 1.00 40.29  ?  113 TRP B HB2   1 
ATOM   1436 H HB3   . TRP B 1 25 ? -24.244 -33.138 -17.890 1.00 40.29  ?  113 TRP B HB3   1 
ATOM   1437 H HD1   . TRP B 1 25 ? -22.714 -30.091 -17.639 1.00 43.60  ?  113 TRP B HD1   1 
ATOM   1438 H HE1   . TRP B 1 25 ? -23.888 -28.251 -18.652 1.00 51.22  ?  113 TRP B HE1   1 
ATOM   1439 H HE3   . TRP B 1 25 ? -27.128 -32.156 -18.159 1.00 44.47  ?  113 TRP B HE3   1 
ATOM   1440 H HZ2   . TRP B 1 25 ? -26.444 -27.737 -19.577 1.00 40.62  ?  113 TRP B HZ2   1 
ATOM   1441 H HZ3   . TRP B 1 25 ? -28.845 -30.924 -19.106 1.00 49.56  ?  113 TRP B HZ3   1 
ATOM   1442 H HH2   . TRP B 1 25 ? -28.502 -28.747 -19.802 1.00 50.79  ?  113 TRP B HH2   1 
ATOM   1443 N N     . LYS B 1 26 ? -23.719 -34.063 -14.411 1.00 27.11  ?  114 LYS B N     1 
ATOM   1444 C CA    . LYS B 1 26 ? -23.049 -35.224 -13.826 1.00 28.94  ?  114 LYS B CA    1 
ATOM   1445 C C     . LYS B 1 26 ? -23.871 -35.903 -12.730 1.00 32.30  ?  114 LYS B C     1 
ATOM   1446 O O     . LYS B 1 26 ? -23.530 -36.998 -12.283 1.00 34.61  ?  114 LYS B O     1 
ATOM   1447 C CB    . LYS B 1 26 ? -21.682 -34.821 -13.266 1.00 17.99  ?  114 LYS B CB    1 
ATOM   1448 C CG    . LYS B 1 26 ? -21.722 -33.695 -12.243 1.00 25.06  ?  114 LYS B CG    1 
ATOM   1449 C CD    . LYS B 1 26 ? -20.323 -33.285 -11.818 1.00 31.91  ?  114 LYS B CD    1 
ATOM   1450 C CE    . LYS B 1 26 ? -20.360 -32.156 -10.805 1.00 36.60  ?  114 LYS B CE    1 
ATOM   1451 N NZ    . LYS B 1 26 ? -19.003 -31.876 -10.265 1.00 51.68  1  114 LYS B NZ    1 
ATOM   1452 H H     . LYS B 1 26 ? -23.495 -33.315 -14.050 1.00 32.53  ?  114 LYS B H     1 
ATOM   1453 H HA    . LYS B 1 26 ? -22.897 -35.885 -14.533 1.00 34.73  ?  114 LYS B HA    1 
ATOM   1454 H HB2   . LYS B 1 26 ? -21.283 -35.594 -12.836 1.00 21.59  ?  114 LYS B HB2   1 
ATOM   1455 H HB3   . LYS B 1 26 ? -21.120 -34.530 -14.001 1.00 21.59  ?  114 LYS B HB3   1 
ATOM   1456 H HG2   . LYS B 1 26 ? -22.159 -32.922 -12.634 1.00 30.07  ?  114 LYS B HG2   1 
ATOM   1457 H HG3   . LYS B 1 26 ? -22.204 -33.993 -11.456 1.00 30.07  ?  114 LYS B HG3   1 
ATOM   1458 H HD2   . LYS B 1 26 ? -19.877 -34.044 -11.412 1.00 38.29  ?  114 LYS B HD2   1 
ATOM   1459 H HD3   . LYS B 1 26 ? -19.828 -32.981 -12.595 1.00 38.29  ?  114 LYS B HD3   1 
ATOM   1460 H HE2   . LYS B 1 26 ? -20.690 -31.350 -11.233 1.00 43.92  ?  114 LYS B HE2   1 
ATOM   1461 H HE3   . LYS B 1 26 ? -20.936 -32.405 -10.066 1.00 43.92  ?  114 LYS B HE3   1 
ATOM   1462 H HZ1   . LYS B 1 26 ? -19.041 -31.212 -9.674  1.00 62.01  ?  114 LYS B HZ1   1 
ATOM   1463 H HZ2   . LYS B 1 26 ? -18.679 -32.602 -9.865  1.00 62.01  ?  114 LYS B HZ2   1 
ATOM   1464 H HZ3   . LYS B 1 26 ? -18.455 -31.642 -10.927 1.00 62.01  ?  114 LYS B HZ3   1 
ATOM   1465 N N     . THR B 1 27 ? -24.951 -35.258 -12.303 1.00 30.77  ?  115 THR B N     1 
ATOM   1466 C CA    . THR B 1 27 ? -25.779 -35.787 -11.222 1.00 33.03  ?  115 THR B CA    1 
ATOM   1467 C C     . THR B 1 27 ? -26.409 -37.122 -11.608 1.00 29.96  ?  115 THR B C     1 
ATOM   1468 O O     . THR B 1 27 ? -26.908 -37.282 -12.720 1.00 35.53  ?  115 THR B O     1 
ATOM   1469 C CB    . THR B 1 27 ? -26.893 -34.796 -10.840 1.00 36.78  ?  115 THR B CB    1 
ATOM   1470 O OG1   . THR B 1 27 ? -26.308 -33.576 -10.371 1.00 38.73  ?  115 THR B OG1   1 
ATOM   1471 C CG2   . THR B 1 27 ? -27.787 -35.374 -9.751  1.00 34.10  ?  115 THR B CG2   1 
ATOM   1472 H H     . THR B 1 27 ? -25.228 -34.509 -12.622 1.00 36.93  ?  115 THR B H     1 
ATOM   1473 H HA    . THR B 1 27 ? -25.218 -35.933 -10.432 1.00 39.64  ?  115 THR B HA    1 
ATOM   1474 H HB    . THR B 1 27 ? -27.441 -34.611 -11.619 1.00 44.14  ?  115 THR B HB    1 
ATOM   1475 H HG1   . THR B 1 27 ? -26.897 -33.043 -10.165 1.00 46.47  ?  115 THR B HG1   1 
ATOM   1476 H HG21  . THR B 1 27 ? -28.476 -34.745 -9.524  1.00 40.92  ?  115 THR B HG21  1 
ATOM   1477 H HG22  . THR B 1 27 ? -28.195 -36.186 -10.059 1.00 40.92  ?  115 THR B HG22  1 
ATOM   1478 H HG23  . THR B 1 27 ? -27.267 -35.565 -8.967  1.00 40.92  ?  115 THR B HG23  1 
ATOM   1479 N N     . THR B 1 28 ? -26.384 -38.073 -10.679 1.00 33.12  ?  116 THR B N     1 
ATOM   1480 C CA    . THR B 1 28 ? -26.888 -39.418 -10.933 1.00 31.18  ?  116 THR B CA    1 
ATOM   1481 C C     . THR B 1 28 ? -28.095 -39.751 -10.063 1.00 32.49  ?  116 THR B C     1 
ATOM   1482 O O     . THR B 1 28 ? -28.438 -39.007 -9.145  1.00 36.18  ?  116 THR B O     1 
ATOM   1483 C CB    . THR B 1 28 ? -25.810 -40.469 -10.641 1.00 34.80  ?  116 THR B CB    1 
ATOM   1484 O OG1   . THR B 1 28 ? -25.507 -40.463 -9.240  1.00 34.28  ?  116 THR B OG1   1 
ATOM   1485 C CG2   . THR B 1 28 ? -24.543 -40.181 -11.438 1.00 29.59  ?  116 THR B CG2   1 
ATOM   1486 H H     . THR B 1 28 ? -26.077 -37.962 -9.883  1.00 39.75  ?  116 THR B H     1 
ATOM   1487 H HA    . THR B 1 28 ? -27.152 -39.495 -11.874 1.00 37.41  ?  116 THR B HA    1 
ATOM   1488 H HB    . THR B 1 28 ? -26.138 -41.346 -10.895 1.00 41.76  ?  116 THR B HB    1 
ATOM   1489 H HG1   . THR B 1 28 ? -24.931 -41.022 -9.075  1.00 41.14  ?  116 THR B HG1   1 
ATOM   1490 H HG21  . THR B 1 28 ? -23.877 -40.845 -11.247 1.00 35.51  ?  116 THR B HG21  1 
ATOM   1491 H HG22  . THR B 1 28 ? -24.737 -40.195 -12.378 1.00 35.51  ?  116 THR B HG22  1 
ATOM   1492 H HG23  . THR B 1 28 ? -24.198 -39.316 -11.204 1.00 35.51  ?  116 THR B HG23  1 
ATOM   1493 N N     . GLU B 1 29 ? -28.729 -40.881 -10.359 1.00 36.36  ?  117 GLU B N     1 
ATOM   1494 C CA    . GLU B 1 29 ? -29.845 -41.377 -9.565  1.00 36.09  ?  117 GLU B CA    1 
ATOM   1495 C C     . GLU B 1 29 ? -29.448 -41.448 -8.101  1.00 33.28  ?  117 GLU B C     1 
ATOM   1496 O O     . GLU B 1 29 ? -30.108 -40.879 -7.234  1.00 35.44  ?  117 GLU B O     1 
ATOM   1497 C CB    . GLU B 1 29 ? -30.255 -42.770 -10.043 1.00 43.31  ?  117 GLU B CB    1 
ATOM   1498 C CG    . GLU B 1 29 ? -30.807 -42.809 -11.457 1.00 54.74  ?  117 GLU B CG    1 
ATOM   1499 C CD    . GLU B 1 29 ? -31.229 -44.204 -11.876 1.00 65.72  ?  117 GLU B CD    1 
ATOM   1500 O OE1   . GLU B 1 29 ? -31.923 -44.334 -12.907 1.00 62.63  ?  117 GLU B OE1   1 
ATOM   1501 O OE2   . GLU B 1 29 ? -30.865 -45.171 -11.174 1.00 62.76  -1 117 GLU B OE2   1 
ATOM   1502 H H     . GLU B 1 29 ? -28.527 -41.386 -11.026 1.00 43.63  ?  117 GLU B H     1 
ATOM   1503 H HA    . GLU B 1 29 ? -30.612 -40.773 -9.656  1.00 43.30  ?  117 GLU B HA    1 
ATOM   1504 H HB2   . GLU B 1 29 ? -29.478 -43.350 -10.014 1.00 51.98  ?  117 GLU B HB2   1 
ATOM   1505 H HB3   . GLU B 1 29 ? -30.942 -43.113 -9.450  1.00 51.98  ?  117 GLU B HB3   1 
ATOM   1506 H HG2   . GLU B 1 29 ? -31.583 -42.231 -11.511 1.00 65.69  ?  117 GLU B HG2   1 
ATOM   1507 H HG3   . GLU B 1 29 ? -30.122 -42.504 -12.073 1.00 65.69  ?  117 GLU B HG3   1 
ATOM   1508 N N     . GLN B 1 30 ? -28.361 -42.161 -7.836  1.00 37.72  ?  118 GLN B N     1 
ATOM   1509 C CA    . GLN B 1 30 ? -27.858 -42.320 -6.479  1.00 41.12  ?  118 GLN B CA    1 
ATOM   1510 C C     . GLN B 1 30 ? -27.705 -40.973 -5.780  1.00 38.21  ?  118 GLN B C     1 
ATOM   1511 O O     . GLN B 1 30 ? -28.105 -40.820 -4.627  1.00 43.83  ?  118 GLN B O     1 
ATOM   1512 C CB    . GLN B 1 30 ? -26.518 -43.052 -6.501  1.00 45.75  ?  118 GLN B CB    1 
ATOM   1513 C CG    . GLN B 1 30 ? -25.391 -42.320 -5.805  1.00 65.96  ?  118 GLN B CG    1 
ATOM   1514 C CD    . GLN B 1 30 ? -25.550 -42.250 -4.300  1.00 75.91  ?  118 GLN B CD    1 
ATOM   1515 O OE1   . GLN B 1 30 ? -26.511 -42.774 -3.735  1.00 80.71  ?  118 GLN B OE1   1 
ATOM   1516 N NE2   . GLN B 1 30 ? -24.596 -41.603 -3.639  1.00 65.40  ?  118 GLN B NE2   1 
ATOM   1517 H H     . GLN B 1 30 ? -27.892 -42.567 -8.431  1.00 45.27  ?  118 GLN B H     1 
ATOM   1518 H HA    . GLN B 1 30 ? -28.492 -42.861 -5.964  1.00 49.35  ?  118 GLN B HA    1 
ATOM   1519 H HB2   . GLN B 1 30 ? -26.627 -43.910 -6.063  1.00 54.90  ?  118 GLN B HB2   1 
ATOM   1520 H HB3   . GLN B 1 30 ? -26.254 -43.188 -7.425  1.00 54.90  ?  118 GLN B HB3   1 
ATOM   1521 H HG2   . GLN B 1 30 ? -24.557 -42.777 -5.995  1.00 79.16  ?  118 GLN B HG2   1 
ATOM   1522 H HG3   . GLN B 1 30 ? -25.352 -41.411 -6.142  1.00 79.16  ?  118 GLN B HG3   1 
ATOM   1523 H HE21  . GLN B 1 30 ? -23.937 -41.254 -4.067  1.00 78.48  ?  118 GLN B HE21  1 
ATOM   1524 H HE22  . GLN B 1 30 ? -24.637 -41.534 -2.782  1.00 78.48  ?  118 GLN B HE22  1 
ATOM   1525 N N     . ASP B 1 31 ? -27.121 -40.002 -6.474  1.00 39.88  ?  119 ASP B N     1 
ATOM   1526 C CA    . ASP B 1 31 ? -26.932 -38.673 -5.906  1.00 38.29  ?  119 ASP B CA    1 
ATOM   1527 C C     . ASP B 1 31 ? -28.258 -38.118 -5.413  1.00 39.85  ?  119 ASP B C     1 
ATOM   1528 O O     . ASP B 1 31 ? -28.361 -37.626 -4.288  1.00 31.36  ?  119 ASP B O     1 
ATOM   1529 C CB    . ASP B 1 31 ? -26.347 -37.717 -6.943  1.00 39.61  ?  119 ASP B CB    1 
ATOM   1530 C CG    . ASP B 1 31 ? -24.915 -38.043 -7.300  1.00 38.60  ?  119 ASP B CG    1 
ATOM   1531 O OD1   . ASP B 1 31 ? -24.273 -38.828 -6.572  1.00 37.01  ?  119 ASP B OD1   1 
ATOM   1532 O OD2   . ASP B 1 31 ? -24.433 -37.497 -8.310  1.00 37.94  -1 119 ASP B OD2   1 
ATOM   1533 H H     . ASP B 1 31 ? -26.825 -40.088 -7.277  1.00 47.86  ?  119 ASP B H     1 
ATOM   1534 H HA    . ASP B 1 31 ? -26.314 -38.726 -5.147  1.00 45.95  ?  119 ASP B HA    1 
ATOM   1535 H HB2   . ASP B 1 31 ? -26.877 -37.768 -7.754  1.00 47.54  ?  119 ASP B HB2   1 
ATOM   1536 H HB3   . ASP B 1 31 ? -26.369 -36.815 -6.588  1.00 47.54  ?  119 ASP B HB3   1 
ATOM   1537 N N     . LEU B 1 32 ? -29.270 -38.192 -6.271  1.00 33.29  ?  120 LEU B N     1 
ATOM   1538 C CA    . LEU B 1 32 ? -30.604 -37.732 -5.923  1.00 33.37  ?  120 LEU B CA    1 
ATOM   1539 C C     . LEU B 1 32 ? -31.127 -38.512 -4.725  1.00 39.16  ?  120 LEU B C     1 
ATOM   1540 O O     . LEU B 1 32 ? -31.626 -37.931 -3.762  1.00 38.35  ?  120 LEU B O     1 
ATOM   1541 C CB    . LEU B 1 32 ? -31.546 -37.908 -7.112  1.00 34.48  ?  120 LEU B CB    1 
ATOM   1542 C CG    . LEU B 1 32 ? -31.324 -36.988 -8.315  1.00 30.40  ?  120 LEU B CG    1 
ATOM   1543 C CD1   . LEU B 1 32 ? -32.456 -37.154 -9.324  1.00 20.90  ?  120 LEU B CD1   1 
ATOM   1544 C CD2   . LEU B 1 32 ? -31.192 -35.540 -7.868  1.00 28.32  ?  120 LEU B CD2   1 
ATOM   1545 H H     . LEU B 1 32 ? -29.207 -38.509 -7.068  1.00 39.94  ?  120 LEU B H     1 
ATOM   1546 H HA    . LEU B 1 32 ? -30.573 -36.781 -5.687  1.00 40.05  ?  120 LEU B HA    1 
ATOM   1547 H HB2   . LEU B 1 32 ? -31.462 -38.820 -7.431  1.00 41.38  ?  120 LEU B HB2   1 
ATOM   1548 H HB3   . LEU B 1 32 ? -32.453 -37.759 -6.803  1.00 41.38  ?  120 LEU B HB3   1 
ATOM   1549 H HG    . LEU B 1 32 ? -30.496 -37.240 -8.753  1.00 36.48  ?  120 LEU B HG    1 
ATOM   1550 H HD11  . LEU B 1 32 ? -32.298 -36.570 -10.069 1.00 25.08  ?  120 LEU B HD11  1 
ATOM   1551 H HD12  . LEU B 1 32 ? -32.478 -38.066 -9.622  1.00 25.08  ?  120 LEU B HD12  1 
ATOM   1552 H HD13  . LEU B 1 32 ? -33.287 -36.927 -8.900  1.00 25.08  ?  120 LEU B HD13  1 
ATOM   1553 H HD21  . LEU B 1 32 ? -31.053 -34.987 -8.640  1.00 33.98  ?  120 LEU B HD21  1 
ATOM   1554 H HD22  . LEU B 1 32 ? -31.998 -35.278 -7.417  1.00 33.98  ?  120 LEU B HD22  1 
ATOM   1555 H HD23  . LEU B 1 32 ? -30.443 -35.464 -7.272  1.00 33.98  ?  120 LEU B HD23  1 
ATOM   1556 N N     . LYS B 1 33 ? -31.006 -39.834 -4.792  1.00 38.84  ?  121 LYS B N     1 
ATOM   1557 C CA    . LYS B 1 33 ? -31.406 -40.702 -3.692  1.00 39.54  ?  121 LYS B CA    1 
ATOM   1558 C C     . LYS B 1 33 ? -30.782 -40.224 -2.385  1.00 34.96  ?  121 LYS B C     1 
ATOM   1559 O O     . LYS B 1 33 ? -31.481 -39.983 -1.402  1.00 33.98  ?  121 LYS B O     1 
ATOM   1560 C CB    . LYS B 1 33 ? -30.975 -42.144 -3.976  1.00 44.09  ?  121 LYS B CB    1 
ATOM   1561 C CG    . LYS B 1 33 ? -31.068 -43.081 -2.779  1.00 46.01  ?  121 LYS B CG    1 
ATOM   1562 C CD    . LYS B 1 33 ? -32.503 -43.488 -2.484  1.00 51.30  ?  121 LYS B CD    1 
ATOM   1563 C CE    . LYS B 1 33 ? -33.020 -44.501 -3.499  1.00 61.24  ?  121 LYS B CE    1 
ATOM   1564 N NZ    . LYS B 1 33 ? -32.323 -45.816 -3.404  1.00 62.37  1  121 LYS B NZ    1 
ATOM   1565 H H     . LYS B 1 33 ? -30.691 -40.257 -5.471  1.00 46.61  ?  121 LYS B H     1 
ATOM   1566 H HA    . LYS B 1 33 ? -32.381 -40.682 -3.596  1.00 47.45  ?  121 LYS B HA    1 
ATOM   1567 H HB2   . LYS B 1 33 ? -31.542 -42.504 -4.675  1.00 52.91  ?  121 LYS B HB2   1 
ATOM   1568 H HB3   . LYS B 1 33 ? -30.052 -42.138 -4.274  1.00 52.91  ?  121 LYS B HB3   1 
ATOM   1569 H HG2   . LYS B 1 33 ? -30.557 -43.885 -2.963  1.00 55.21  ?  121 LYS B HG2   1 
ATOM   1570 H HG3   . LYS B 1 33 ? -30.714 -42.633 -1.995  1.00 55.21  ?  121 LYS B HG3   1 
ATOM   1571 H HD2   . LYS B 1 33 ? -32.546 -43.892 -1.603  1.00 61.56  ?  121 LYS B HD2   1 
ATOM   1572 H HD3   . LYS B 1 33 ? -33.072 -42.703 -2.522  1.00 61.56  ?  121 LYS B HD3   1 
ATOM   1573 H HE2   . LYS B 1 33 ? -33.966 -44.650 -3.343  1.00 73.49  ?  121 LYS B HE2   1 
ATOM   1574 H HE3   . LYS B 1 33 ? -32.882 -44.151 -4.393  1.00 73.49  ?  121 LYS B HE3   1 
ATOM   1575 H HZ1   . LYS B 1 33 ? -32.652 -46.379 -4.010  1.00 74.85  ?  121 LYS B HZ1   1 
ATOM   1576 H HZ2   . LYS B 1 33 ? -31.452 -45.710 -3.550  1.00 74.85  ?  121 LYS B HZ2   1 
ATOM   1577 H HZ3   . LYS B 1 33 ? -32.440 -46.164 -2.593  1.00 74.85  ?  121 LYS B HZ3   1 
ATOM   1578 N N     . GLU B 1 34 ? -29.461 -40.084 -2.386  1.00 35.53  ?  122 GLU B N     1 
ATOM   1579 C CA    . GLU B 1 34 ? -28.731 -39.681 -1.189  1.00 44.09  ?  122 GLU B CA    1 
ATOM   1580 C C     . GLU B 1 34 ? -29.201 -38.325 -0.677  1.00 42.69  ?  122 GLU B C     1 
ATOM   1581 O O     . GLU B 1 34 ? -29.399 -38.141 0.524   1.00 47.18  ?  122 GLU B O     1 
ATOM   1582 C CB    . GLU B 1 34 ? -27.227 -39.631 -1.468  1.00 39.12  ?  122 GLU B CB    1 
ATOM   1583 C CG    . GLU B 1 34 ? -26.416 -39.040 -0.325  1.00 42.99  ?  122 GLU B CG    1 
ATOM   1584 C CD    . GLU B 1 34 ? -24.951 -39.425 -0.382  1.00 61.57  ?  122 GLU B CD    1 
ATOM   1585 O OE1   . GLU B 1 34 ? -24.124 -38.573 -0.768  1.00 69.12  ?  122 GLU B OE1   1 
ATOM   1586 O OE2   . GLU B 1 34 ? -24.625 -40.579 -0.031  1.00 74.30  -1 122 GLU B OE2   1 
ATOM   1587 H H     . GLU B 1 34 ? -28.960 -40.217 -3.072  1.00 42.64  ?  122 GLU B H     1 
ATOM   1588 H HA    . GLU B 1 34 ? -28.886 -40.342 -0.483  1.00 52.91  ?  122 GLU B HA    1 
ATOM   1589 H HB2   . GLU B 1 34 ? -26.908 -40.533 -1.625  1.00 46.95  ?  122 GLU B HB2   1 
ATOM   1590 H HB3   . GLU B 1 34 ? -27.073 -39.086 -2.255  1.00 46.95  ?  122 GLU B HB3   1 
ATOM   1591 H HG2   . GLU B 1 34 ? -26.473 -38.073 -0.364  1.00 51.58  ?  122 GLU B HG2   1 
ATOM   1592 H HG3   . GLU B 1 34 ? -26.777 -39.360 0.517   1.00 51.58  ?  122 GLU B HG3   1 
ATOM   1593 N N     . TYR B 1 35 ? -29.377 -37.377 -1.591  1.00 36.25  ?  123 TYR B N     1 
ATOM   1594 C CA    . TYR B 1 35 ? -29.765 -36.023 -1.213  1.00 30.36  ?  123 TYR B CA    1 
ATOM   1595 C C     . TYR B 1 35 ? -31.203 -35.960 -0.709  1.00 38.33  ?  123 TYR B C     1 
ATOM   1596 O O     . TYR B 1 35 ? -31.474 -35.390 0.346   1.00 35.40  ?  123 TYR B O     1 
ATOM   1597 C CB    . TYR B 1 35 ? -29.602 -35.058 -2.388  1.00 31.92  ?  123 TYR B CB    1 
ATOM   1598 C CG    . TYR B 1 35 ? -30.152 -33.683 -2.091  1.00 26.47  ?  123 TYR B CG    1 
ATOM   1599 C CD1   . TYR B 1 35 ? -29.382 -32.730 -1.438  1.00 25.89  ?  123 TYR B CD1   1 
ATOM   1600 C CD2   . TYR B 1 35 ? -31.449 -33.343 -2.446  1.00 28.09  ?  123 TYR B CD2   1 
ATOM   1601 C CE1   . TYR B 1 35 ? -29.887 -31.475 -1.156  1.00 24.94  ?  123 TYR B CE1   1 
ATOM   1602 C CE2   . TYR B 1 35 ? -31.960 -32.095 -2.168  1.00 29.51  ?  123 TYR B CE2   1 
ATOM   1603 C CZ    . TYR B 1 35 ? -31.175 -31.164 -1.524  1.00 30.23  ?  123 TYR B CZ    1 
ATOM   1604 O OH    . TYR B 1 35 ? -31.685 -29.915 -1.243  1.00 30.76  ?  123 TYR B OH    1 
ATOM   1605 H H     . TYR B 1 35 ? -29.277 -37.492 -2.438  1.00 43.50  ?  123 TYR B H     1 
ATOM   1606 H HA    . TYR B 1 35 ? -29.179 -35.717 -0.489  1.00 36.43  ?  123 TYR B HA    1 
ATOM   1607 H HB2   . TYR B 1 35 ? -28.659 -34.966 -2.594  1.00 38.30  ?  123 TYR B HB2   1 
ATOM   1608 H HB3   . TYR B 1 35 ? -30.077 -35.412 -3.156  1.00 38.30  ?  123 TYR B HB3   1 
ATOM   1609 H HD1   . TYR B 1 35 ? -28.511 -32.939 -1.188  1.00 31.07  ?  123 TYR B HD1   1 
ATOM   1610 H HD2   . TYR B 1 35 ? -31.983 -33.969 -2.881  1.00 33.71  ?  123 TYR B HD2   1 
ATOM   1611 H HE1   . TYR B 1 35 ? -29.359 -30.846 -0.720  1.00 29.93  ?  123 TYR B HE1   1 
ATOM   1612 H HE2   . TYR B 1 35 ? -32.831 -31.881 -2.415  1.00 35.41  ?  123 TYR B HE2   1 
ATOM   1613 H HH    . TYR B 1 35 ? -31.233 -29.338 -1.611  1.00 36.91  ?  123 TYR B HH    1 
ATOM   1614 N N     . PHE B 1 36 ? -32.122 -36.547 -1.470  1.00 34.48  ?  124 PHE B N     1 
ATOM   1615 C CA    . PHE B 1 36 ? -33.544 -36.463 -1.156  1.00 33.18  ?  124 PHE B CA    1 
ATOM   1616 C C     . PHE B 1 36 ? -33.954 -37.371 0.003   1.00 31.67  ?  124 PHE B C     1 
ATOM   1617 O O     . PHE B 1 36 ? -35.042 -37.222 0.556   1.00 29.84  ?  124 PHE B O     1 
ATOM   1618 C CB    . PHE B 1 36 ? -34.382 -36.776 -2.398  1.00 29.31  ?  124 PHE B CB    1 
ATOM   1619 C CG    . PHE B 1 36 ? -34.529 -35.609 -3.338  1.00 29.72  ?  124 PHE B CG    1 
ATOM   1620 C CD1   . PHE B 1 36 ? -35.153 -34.446 -2.921  1.00 37.17  ?  124 PHE B CD1   1 
ATOM   1621 C CD2   . PHE B 1 36 ? -34.052 -35.674 -4.637  1.00 29.83  ?  124 PHE B CD2   1 
ATOM   1622 C CE1   . PHE B 1 36 ? -35.295 -33.370 -3.777  1.00 37.14  ?  124 PHE B CE1   1 
ATOM   1623 C CE2   . PHE B 1 36 ? -34.194 -34.598 -5.496  1.00 28.72  ?  124 PHE B CE2   1 
ATOM   1624 C CZ    . PHE B 1 36 ? -34.816 -33.447 -5.064  1.00 31.50  ?  124 PHE B CZ    1 
ATOM   1625 H H     . PHE B 1 36 ? -31.946 -37.002 -2.178  1.00 41.38  ?  124 PHE B H     1 
ATOM   1626 H HA    . PHE B 1 36 ? -33.747 -35.541 -0.890  1.00 39.82  ?  124 PHE B HA    1 
ATOM   1627 H HB2   . PHE B 1 36 ? -33.959 -37.499 -2.887  1.00 35.18  ?  124 PHE B HB2   1 
ATOM   1628 H HB3   . PHE B 1 36 ? -35.271 -37.044 -2.117  1.00 35.18  ?  124 PHE B HB3   1 
ATOM   1629 H HD1   . PHE B 1 36 ? -35.479 -34.387 -2.052  1.00 44.60  ?  124 PHE B HD1   1 
ATOM   1630 H HD2   . PHE B 1 36 ? -33.631 -36.449 -4.935  1.00 35.79  ?  124 PHE B HD2   1 
ATOM   1631 H HE1   . PHE B 1 36 ? -35.716 -32.594 -3.483  1.00 44.57  ?  124 PHE B HE1   1 
ATOM   1632 H HE2   . PHE B 1 36 ? -33.869 -34.652 -6.366  1.00 34.47  ?  124 PHE B HE2   1 
ATOM   1633 H HZ    . PHE B 1 36 ? -34.911 -32.724 -5.641  1.00 37.79  ?  124 PHE B HZ    1 
ATOM   1634 N N     . SER B 1 37 ? -33.082 -38.301 0.378   1.00 37.35  ?  125 SER B N     1 
ATOM   1635 C CA    . SER B 1 37 ? -33.366 -39.198 1.494   1.00 42.64  ?  125 SER B CA    1 
ATOM   1636 C C     . SER B 1 37 ? -33.291 -38.463 2.829   1.00 39.90  ?  125 SER B C     1 
ATOM   1637 O O     . SER B 1 37 ? -33.741 -38.977 3.854   1.00 31.58  ?  125 SER B O     1 
ATOM   1638 C CB    . SER B 1 37 ? -32.394 -40.379 1.493   1.00 34.74  ?  125 SER B CB    1 
ATOM   1639 O OG    . SER B 1 37 ? -32.765 -41.344 0.522   1.00 45.62  ?  125 SER B OG    1 
ATOM   1640 H H     . SER B 1 37 ? -32.318 -38.433 0.005   1.00 44.82  ?  125 SER B H     1 
ATOM   1641 H HA    . SER B 1 37 ? -34.274 -39.553 1.394   1.00 51.17  ?  125 SER B HA    1 
ATOM   1642 H HB2   . SER B 1 37 ? -31.503 -40.054 1.288   1.00 41.68  ?  125 SER B HB2   1 
ATOM   1643 H HB3   . SER B 1 37 ? -32.401 -40.794 2.369   1.00 41.68  ?  125 SER B HB3   1 
ATOM   1644 H HG    . SER B 1 37 ? -33.441 -41.099 0.128   1.00 54.75  ?  125 SER B HG    1 
ATOM   1645 N N     . THR B 1 38 ? -32.724 -37.259 2.810   1.00 37.36  ?  126 THR B N     1 
ATOM   1646 C CA    . THR B 1 38 ? -32.556 -36.463 4.023   1.00 33.26  ?  126 THR B CA    1 
ATOM   1647 C C     . THR B 1 38 ? -33.872 -35.829 4.466   1.00 36.24  ?  126 THR B C     1 
ATOM   1648 O O     . THR B 1 38 ? -34.018 -35.420 5.618   1.00 41.90  ?  126 THR B O     1 
ATOM   1649 C CB    . THR B 1 38 ? -31.508 -35.344 3.826   1.00 37.50  ?  126 THR B CB    1 
ATOM   1650 O OG1   . THR B 1 38 ? -31.930 -34.455 2.783   1.00 39.46  ?  126 THR B OG1   1 
ATOM   1651 C CG2   . THR B 1 38 ? -30.143 -35.936 3.488   1.00 34.90  ?  126 THR B CG2   1 
ATOM   1652 H H     . THR B 1 38 ? -32.426 -36.878 2.100   1.00 44.84  ?  126 THR B H     1 
ATOM   1653 H HA    . THR B 1 38 ? -32.244 -37.046 4.745   1.00 39.91  ?  126 THR B HA    1 
ATOM   1654 H HB    . THR B 1 38 ? -31.422 -34.844 4.653   1.00 45.00  ?  126 THR B HB    1 
ATOM   1655 H HG1   . THR B 1 38 ? -32.014 -34.868 2.079   1.00 47.35  ?  126 THR B HG1   1 
ATOM   1656 H HG21  . THR B 1 38 ? -29.501 -35.232 3.369   1.00 41.88  ?  126 THR B HG21  1 
ATOM   1657 H HG22  . THR B 1 38 ? -29.849 -36.509 4.200   1.00 41.88  ?  126 THR B HG22  1 
ATOM   1658 H HG23  . THR B 1 38 ? -30.199 -36.447 2.678   1.00 41.88  ?  126 THR B HG23  1 
ATOM   1659 N N     . PHE B 1 39 ? -34.826 -35.750 3.546   1.00 32.65  ?  127 PHE B N     1 
ATOM   1660 C CA    . PHE B 1 39 ? -36.129 -35.166 3.837   1.00 36.11  ?  127 PHE B CA    1 
ATOM   1661 C C     . PHE B 1 39 ? -37.120 -36.243 4.265   1.00 46.02  ?  127 PHE B C     1 
ATOM   1662 O O     . PHE B 1 39 ? -38.014 -35.991 5.075   1.00 47.70  ?  127 PHE B O     1 
ATOM   1663 C CB    . PHE B 1 39 ? -36.650 -34.415 2.613   1.00 35.54  ?  127 PHE B CB    1 
ATOM   1664 C CG    . PHE B 1 39 ? -35.877 -33.164 2.299   1.00 41.76  ?  127 PHE B CG    1 
ATOM   1665 C CD1   . PHE B 1 39 ? -34.701 -33.221 1.571   1.00 37.42  ?  127 PHE B CD1   1 
ATOM   1666 C CD2   . PHE B 1 39 ? -36.323 -31.930 2.738   1.00 40.49  ?  127 PHE B CD2   1 
ATOM   1667 C CE1   . PHE B 1 39 ? -33.989 -32.071 1.287   1.00 28.26  ?  127 PHE B CE1   1 
ATOM   1668 C CE2   . PHE B 1 39 ? -35.614 -30.778 2.454   1.00 34.86  ?  127 PHE B CE2   1 
ATOM   1669 C CZ    . PHE B 1 39 ? -34.447 -30.851 1.729   1.00 33.65  ?  127 PHE B CZ    1 
ATOM   1670 H H     . PHE B 1 39 ? -34.743 -36.031 2.737   1.00 39.18  ?  127 PHE B H     1 
ATOM   1671 H HA    . PHE B 1 39 ? -36.037 -34.525 4.573   1.00 43.33  ?  127 PHE B HA    1 
ATOM   1672 H HB2   . PHE B 1 39 ? -36.595 -35.000 1.840   1.00 42.65  ?  127 PHE B HB2   1 
ATOM   1673 H HB3   . PHE B 1 39 ? -37.573 -34.162 2.769   1.00 42.65  ?  127 PHE B HB3   1 
ATOM   1674 H HD1   . PHE B 1 39 ? -34.386 -34.043 1.270   1.00 44.91  ?  127 PHE B HD1   1 
ATOM   1675 H HD2   . PHE B 1 39 ? -37.111 -31.875 3.229   1.00 48.58  ?  127 PHE B HD2   1 
ATOM   1676 H HE1   . PHE B 1 39 ? -33.201 -32.122 0.796   1.00 33.92  ?  127 PHE B HE1   1 
ATOM   1677 H HE2   . PHE B 1 39 ? -35.924 -29.955 2.754   1.00 41.84  ?  127 PHE B HE2   1 
ATOM   1678 H HZ    . PHE B 1 39 ? -33.968 -30.077 1.537   1.00 40.38  ?  127 PHE B HZ    1 
ATOM   1679 N N     . GLY B 1 40 ? -36.953 -37.445 3.725   1.00 41.93  ?  128 GLY B N     1 
ATOM   1680 C CA    . GLY B 1 40 ? -37.817 -38.558 4.068   1.00 42.57  ?  128 GLY B CA    1 
ATOM   1681 C C     . GLY B 1 40 ? -37.446 -39.818 3.316   1.00 44.59  ?  128 GLY B C     1 
ATOM   1682 O O     . GLY B 1 40 ? -36.312 -39.971 2.863   1.00 46.24  ?  128 GLY B O     1 
ATOM   1683 H H     . GLY B 1 40 ? -36.340 -37.640 3.153   1.00 50.32  ?  128 GLY B H     1 
ATOM   1684 H HA2   . GLY B 1 40 ? -37.755 -38.736 5.019   1.00 51.09  ?  128 GLY B HA2   1 
ATOM   1685 H HA3   . GLY B 1 40 ? -38.737 -38.331 3.856   1.00 51.09  ?  128 GLY B HA3   1 
ATOM   1686 N N     . GLU B 1 41 ? -38.408 -40.723 3.181   1.00 46.30  ?  129 GLU B N     1 
ATOM   1687 C CA    . GLU B 1 41 ? -38.168 -41.989 2.505   1.00 49.36  ?  129 GLU B CA    1 
ATOM   1688 C C     . GLU B 1 41 ? -38.496 -41.873 1.020   1.00 47.28  ?  129 GLU B C     1 
ATOM   1689 O O     . GLU B 1 41 ? -39.553 -41.370 0.641   1.00 43.60  ?  129 GLU B O     1 
ATOM   1690 C CB    . GLU B 1 41 ? -38.998 -43.099 3.149   1.00 48.94  ?  129 GLU B CB    1 
ATOM   1691 C CG    . GLU B 1 41 ? -38.622 -44.494 2.687   1.00 65.14  ?  129 GLU B CG    1 
ATOM   1692 C CD    . GLU B 1 41 ? -39.366 -45.579 3.442   1.00 76.32  ?  129 GLU B CD    1 
ATOM   1693 O OE1   . GLU B 1 41 ? -40.137 -45.243 4.366   1.00 68.95  ?  129 GLU B OE1   1 
ATOM   1694 O OE2   . GLU B 1 41 ? -39.179 -46.769 3.112   1.00 76.69  -1 129 GLU B OE2   1 
ATOM   1695 H H     . GLU B 1 41 ? -39.211 -40.627 3.473   1.00 55.56  ?  129 GLU B H     1 
ATOM   1696 H HA    . GLU B 1 41 ? -37.221 -42.226 2.592   1.00 59.23  ?  129 GLU B HA    1 
ATOM   1697 H HB2   . GLU B 1 41 ? -38.875 -43.063 4.111   1.00 58.73  ?  129 GLU B HB2   1 
ATOM   1698 H HB3   . GLU B 1 41 ? -39.932 -42.957 2.932   1.00 58.73  ?  129 GLU B HB3   1 
ATOM   1699 H HG2   . GLU B 1 41 ? -38.836 -44.584 1.745   1.00 78.17  ?  129 GLU B HG2   1 
ATOM   1700 H HG3   . GLU B 1 41 ? -37.672 -44.629 2.826   1.00 78.17  ?  129 GLU B HG3   1 
ATOM   1701 N N     . VAL B 1 42 ? -37.577 -42.342 0.183   1.00 39.47  ?  130 VAL B N     1 
ATOM   1702 C CA    . VAL B 1 42 ? -37.739 -42.267 -1.261  1.00 42.00  ?  130 VAL B CA    1 
ATOM   1703 C C     . VAL B 1 42 ? -38.109 -43.634 -1.826  1.00 47.62  ?  130 VAL B C     1 
ATOM   1704 O O     . VAL B 1 42 ? -37.494 -44.642 -1.481  1.00 48.72  ?  130 VAL B O     1 
ATOM   1705 C CB    . VAL B 1 42 ? -36.439 -41.787 -1.935  1.00 47.95  ?  130 VAL B CB    1 
ATOM   1706 C CG1   . VAL B 1 42 ? -36.629 -41.665 -3.438  1.00 46.30  ?  130 VAL B CG1   1 
ATOM   1707 C CG2   . VAL B 1 42 ? -35.989 -40.460 -1.336  1.00 44.78  ?  130 VAL B CG2   1 
ATOM   1708 H H     . VAL B 1 42 ? -36.843 -42.714 0.432   1.00 47.37  ?  130 VAL B H     1 
ATOM   1709 H HA    . VAL B 1 42 ? -38.455 -41.635 -1.479  1.00 50.40  ?  130 VAL B HA    1 
ATOM   1710 H HB    . VAL B 1 42 ? -35.734 -42.447 -1.772  1.00 57.54  ?  130 VAL B HB    1 
ATOM   1711 H HG11  . VAL B 1 42 ? -35.807 -41.365 -3.832  1.00 55.56  ?  130 VAL B HG11  1 
ATOM   1712 H HG12  . VAL B 1 42 ? -36.868 -42.525 -3.793  1.00 55.56  ?  130 VAL B HG12  1 
ATOM   1713 H HG13  . VAL B 1 42 ? -37.328 -41.031 -3.614  1.00 55.56  ?  130 VAL B HG13  1 
ATOM   1714 H HG21  . VAL B 1 42 ? -35.179 -40.181 -1.770  1.00 53.74  ?  130 VAL B HG21  1 
ATOM   1715 H HG22  . VAL B 1 42 ? -36.677 -39.805 -1.475  1.00 53.74  ?  130 VAL B HG22  1 
ATOM   1716 H HG23  . VAL B 1 42 ? -35.833 -40.578 -0.397  1.00 53.74  ?  130 VAL B HG23  1 
ATOM   1717 N N     . LEU B 1 43 ? -39.117 -43.664 -2.692  1.00 41.71  ?  131 LEU B N     1 
ATOM   1718 C CA    . LEU B 1 43 ? -39.549 -44.910 -3.316  1.00 45.88  ?  131 LEU B CA    1 
ATOM   1719 C C     . LEU B 1 43 ? -38.944 -45.090 -4.703  1.00 45.15  ?  131 LEU B C     1 
ATOM   1720 O O     . LEU B 1 43 ? -38.894 -46.207 -5.218  1.00 45.57  ?  131 LEU B O     1 
ATOM   1721 C CB    . LEU B 1 43 ? -41.076 -44.969 -3.397  1.00 48.98  ?  131 LEU B CB    1 
ATOM   1722 C CG    . LEU B 1 43 ? -41.790 -45.149 -2.055  1.00 60.00  ?  131 LEU B CG    1 
ATOM   1723 C CD1   . LEU B 1 43 ? -43.293 -45.256 -2.266  1.00 63.84  ?  131 LEU B CD1   1 
ATOM   1724 C CD2   . LEU B 1 43 ? -41.259 -46.367 -1.305  1.00 57.36  ?  131 LEU B CD2   1 
ATOM   1725 H H     . LEU B 1 43 ? -39.568 -42.974 -2.937  1.00 50.05  ?  131 LEU B H     1 
ATOM   1726 H HA    . LEU B 1 43 ? -39.250 -45.659 -2.760  1.00 55.06  ?  131 LEU B HA    1 
ATOM   1727 H HB2   . LEU B 1 43 ? -41.396 -44.142 -3.790  1.00 58.77  ?  131 LEU B HB2   1 
ATOM   1728 H HB3   . LEU B 1 43 ? -41.325 -45.716 -3.963  1.00 58.77  ?  131 LEU B HB3   1 
ATOM   1729 H HG    . LEU B 1 43 ? -41.624 -44.367 -1.506  1.00 72.00  ?  131 LEU B HG    1 
ATOM   1730 H HD11  . LEU B 1 43 ? -43.720 -45.367 -1.413  1.00 76.61  ?  131 LEU B HD11  1 
ATOM   1731 H HD12  . LEU B 1 43 ? -43.607 -44.452 -2.687  1.00 76.61  ?  131 LEU B HD12  1 
ATOM   1732 H HD13  . LEU B 1 43 ? -43.476 -46.013 -2.826  1.00 76.61  ?  131 LEU B HD13  1 
ATOM   1733 H HD21  . LEU B 1 43 ? -41.728 -46.449 -0.471  1.00 68.83  ?  131 LEU B HD21  1 
ATOM   1734 H HD22  . LEU B 1 43 ? -41.403 -47.151 -1.840  1.00 68.83  ?  131 LEU B HD22  1 
ATOM   1735 H HD23  . LEU B 1 43 ? -40.320 -46.249 -1.142  1.00 68.83  ?  131 LEU B HD23  1 
ATOM   1736 N N     . MET B 1 44 ? -38.486 -44.000 -5.310  1.00 49.00  ?  132 MET B N     1 
ATOM   1737 C CA    . MET B 1 44 ? -37.810 -44.096 -6.599  1.00 49.51  ?  132 MET B CA    1 
ATOM   1738 C C     . MET B 1 44 ? -37.177 -42.776 -7.022  1.00 48.04  ?  132 MET B C     1 
ATOM   1739 O O     . MET B 1 44 ? -37.635 -41.696 -6.646  1.00 47.03  ?  132 MET B O     1 
ATOM   1740 C CB    . MET B 1 44 ? -38.788 -44.566 -7.677  1.00 46.54  ?  132 MET B CB    1 
ATOM   1741 C CG    . MET B 1 44 ? -39.562 -43.445 -8.346  1.00 48.94  ?  132 MET B CG    1 
ATOM   1742 S SD    . MET B 1 44 ? -38.671 -42.666 -9.706  1.00 63.30  ?  132 MET B SD    1 
ATOM   1743 C CE    . MET B 1 44 ? -39.863 -41.434 -10.218 1.00 46.97  ?  132 MET B CE    1 
ATOM   1744 H H     . MET B 1 44 ? -38.553 -43.200 -5.000  1.00 58.81  ?  132 MET B H     1 
ATOM   1745 H HA    . MET B 1 44 ? -37.103 -44.770 -6.528  1.00 59.41  ?  132 MET B HA    1 
ATOM   1746 H HB2   . MET B 1 44 ? -38.290 -45.033 -8.366  1.00 55.85  ?  132 MET B HB2   1 
ATOM   1747 H HB3   . MET B 1 44 ? -39.431 -45.169 -7.272  1.00 55.85  ?  132 MET B HB3   1 
ATOM   1748 H HG2   . MET B 1 44 ? -40.391 -43.804 -8.700  1.00 58.73  ?  132 MET B HG2   1 
ATOM   1749 H HG3   . MET B 1 44 ? -39.755 -42.760 -7.686  1.00 58.73  ?  132 MET B HG3   1 
ATOM   1750 H HE1   . MET B 1 44 ? -39.501 -40.938 -10.955 1.00 56.36  ?  132 MET B HE1   1 
ATOM   1751 H HE2   . MET B 1 44 ? -40.672 -41.876 -10.486 1.00 56.36  ?  132 MET B HE2   1 
ATOM   1752 H HE3   . MET B 1 44 ? -40.039 -40.845 -9.481  1.00 56.36  ?  132 MET B HE3   1 
ATOM   1753 N N     . VAL B 1 45 ? -36.120 -42.886 -7.817  1.00 43.25  ?  133 VAL B N     1 
ATOM   1754 C CA    . VAL B 1 45 ? -35.416 -41.731 -8.352  1.00 41.82  ?  133 VAL B CA    1 
ATOM   1755 C C     . VAL B 1 45 ? -35.080 -41.999 -9.810  1.00 48.88  ?  133 VAL B C     1 
ATOM   1756 O O     . VAL B 1 45 ? -34.889 -43.148 -10.207 1.00 53.19  ?  133 VAL B O     1 
ATOM   1757 C CB    . VAL B 1 45 ? -34.115 -41.467 -7.579  1.00 40.82  ?  133 VAL B CB    1 
ATOM   1758 C CG1   . VAL B 1 45 ? -33.214 -40.516 -8.347  1.00 53.23  ?  133 VAL B CG1   1 
ATOM   1759 C CG2   . VAL B 1 45 ? -34.427 -40.927 -6.194  1.00 39.92  ?  133 VAL B CG2   1 
ATOM   1760 H H     . VAL B 1 45 ? -35.784 -43.638 -8.065  1.00 51.90  ?  133 VAL B H     1 
ATOM   1761 H HA    . VAL B 1 45 ? -35.987 -40.937 -8.298  1.00 50.19  ?  133 VAL B HA    1 
ATOM   1762 H HB    . VAL B 1 45 ? -33.635 -42.314 -7.469  1.00 48.98  ?  133 VAL B HB    1 
ATOM   1763 H HG11  . VAL B 1 45 ? -32.411 -40.370 -7.841  1.00 63.88  ?  133 VAL B HG11  1 
ATOM   1764 H HG12  . VAL B 1 45 ? -32.999 -40.908 -9.197  1.00 63.88  ?  133 VAL B HG12  1 
ATOM   1765 H HG13  . VAL B 1 45 ? -33.676 -39.685 -8.477  1.00 63.88  ?  133 VAL B HG13  1 
ATOM   1766 H HG21  . VAL B 1 45 ? -33.603 -40.769 -5.728  1.00 47.91  ?  133 VAL B HG21  1 
ATOM   1767 H HG22  . VAL B 1 45 ? -34.917 -40.106 -6.282  1.00 47.91  ?  133 VAL B HG22  1 
ATOM   1768 H HG23  . VAL B 1 45 ? -34.954 -41.573 -5.718  1.00 47.91  ?  133 VAL B HG23  1 
ATOM   1769 N N     . GLN B 1 46 ? -34.999 -40.941 -10.606 1.00 45.46  ?  134 GLN B N     1 
ATOM   1770 C CA    . GLN B 1 46 ? -34.742 -41.100 -12.028 1.00 48.76  ?  134 GLN B CA    1 
ATOM   1771 C C     . GLN B 1 46 ? -34.057 -39.873 -12.612 1.00 41.41  ?  134 GLN B C     1 
ATOM   1772 O O     . GLN B 1 46 ? -34.503 -38.747 -12.410 1.00 33.88  ?  134 GLN B O     1 
ATOM   1773 C CB    . GLN B 1 46 ? -36.057 -41.365 -12.762 1.00 50.00  ?  134 GLN B CB    1 
ATOM   1774 C CG    . GLN B 1 46 ? -35.887 -41.893 -14.174 1.00 53.81  ?  134 GLN B CG    1 
ATOM   1775 C CD    . GLN B 1 46 ? -37.209 -42.263 -14.817 1.00 64.44  ?  134 GLN B CD    1 
ATOM   1776 O OE1   . GLN B 1 46 ? -38.089 -41.418 -14.985 1.00 57.64  ?  134 GLN B OE1   1 
ATOM   1777 N NE2   . GLN B 1 46 ? -37.358 -43.534 -15.172 1.00 63.62  ?  134 GLN B NE2   1 
ATOM   1778 H H     . GLN B 1 46 ? -35.088 -40.125 -10.350 1.00 54.55  ?  134 GLN B H     1 
ATOM   1779 H HA    . GLN B 1 46 ? -34.155 -41.872 -12.165 1.00 58.52  ?  134 GLN B HA    1 
ATOM   1780 H HB2   . GLN B 1 46 ? -36.567 -42.021 -12.262 1.00 60.00  ?  134 GLN B HB2   1 
ATOM   1781 H HB3   . GLN B 1 46 ? -36.556 -40.534 -12.816 1.00 60.00  ?  134 GLN B HB3   1 
ATOM   1782 H HG2   . GLN B 1 46 ? -35.468 -41.209 -14.720 1.00 64.57  ?  134 GLN B HG2   1 
ATOM   1783 H HG3   . GLN B 1 46 ? -35.330 -42.687 -14.151 1.00 64.57  ?  134 GLN B HG3   1 
ATOM   1784 H HE21  . GLN B 1 46 ? -36.723 -44.097 -15.033 1.00 76.34  ?  134 GLN B HE21  1 
ATOM   1785 H HE22  . GLN B 1 46 ? -38.091 -43.794 -15.541 1.00 76.34  ?  134 GLN B HE22  1 
ATOM   1786 N N     . VAL B 1 47 ? -32.964 -40.102 -13.331 1.00 40.18  ?  135 VAL B N     1 
ATOM   1787 C CA    . VAL B 1 47 ? -32.287 -39.042 -14.061 1.00 33.33  ?  135 VAL B CA    1 
ATOM   1788 C C     . VAL B 1 47 ? -32.454 -39.308 -15.547 1.00 34.23  ?  135 VAL B C     1 
ATOM   1789 O O     . VAL B 1 47 ? -31.902 -40.272 -16.075 1.00 39.51  ?  135 VAL B O     1 
ATOM   1790 C CB    . VAL B 1 47 ? -30.784 -38.983 -13.726 1.00 37.79  ?  135 VAL B CB    1 
ATOM   1791 C CG1   . VAL B 1 47 ? -30.098 -37.887 -14.537 1.00 33.72  ?  135 VAL B CG1   1 
ATOM   1792 C CG2   . VAL B 1 47 ? -30.581 -38.766 -12.233 1.00 34.31  ?  135 VAL B CG2   1 
ATOM   1793 H H     . VAL B 1 47 ? -32.592 -40.873 -13.411 1.00 48.22  ?  135 VAL B H     1 
ATOM   1794 H HA    . VAL B 1 47 ? -32.694 -38.177 -13.846 1.00 39.99  ?  135 VAL B HA    1 
ATOM   1795 H HB    . VAL B 1 47 ? -30.371 -39.839 -13.965 1.00 45.35  ?  135 VAL B HB    1 
ATOM   1796 H HG11  . VAL B 1 47 ? -29.165 -37.869 -14.311 1.00 40.46  ?  135 VAL B HG11  1 
ATOM   1797 H HG12  . VAL B 1 47 ? -30.206 -38.076 -15.472 1.00 40.46  ?  135 VAL B HG12  1 
ATOM   1798 H HG13  . VAL B 1 47 ? -30.503 -37.042 -14.324 1.00 40.46  ?  135 VAL B HG13  1 
ATOM   1799 H HG21  . VAL B 1 47 ? -29.640 -38.733 -12.047 1.00 41.17  ?  135 VAL B HG21  1 
ATOM   1800 H HG22  . VAL B 1 47 ? -30.995 -37.938 -11.979 1.00 41.17  ?  135 VAL B HG22  1 
ATOM   1801 H HG23  . VAL B 1 47 ? -30.984 -39.494 -11.754 1.00 41.17  ?  135 VAL B HG23  1 
ATOM   1802 N N     . LYS B 1 48 ? -33.227 -38.462 -16.220 1.00 32.55  ?  136 LYS B N     1 
ATOM   1803 C CA    . LYS B 1 48 ? -33.501 -38.658 -17.637 1.00 36.40  ?  136 LYS B CA    1 
ATOM   1804 C C     . LYS B 1 48 ? -32.236 -38.535 -18.473 1.00 40.59  ?  136 LYS B C     1 
ATOM   1805 O O     . LYS B 1 48 ? -31.343 -37.750 -18.157 1.00 43.43  ?  136 LYS B O     1 
ATOM   1806 C CB    . LYS B 1 48 ? -34.563 -37.672 -18.125 1.00 44.77  ?  136 LYS B CB    1 
ATOM   1807 C CG    . LYS B 1 48 ? -35.981 -38.161 -17.903 1.00 48.70  ?  136 LYS B CG    1 
ATOM   1808 C CD    . LYS B 1 48 ? -36.264 -39.403 -18.738 1.00 52.69  ?  136 LYS B CD    1 
ATOM   1809 C CE    . LYS B 1 48 ? -37.574 -40.053 -18.344 1.00 56.32  ?  136 LYS B CE    1 
ATOM   1810 N NZ    . LYS B 1 48 ? -37.921 -41.183 -19.247 1.00 58.79  1  136 LYS B NZ    1 
ATOM   1811 H H     . LYS B 1 48 ? -33.603 -37.768 -15.879 1.00 39.06  ?  136 LYS B H     1 
ATOM   1812 H HA    . LYS B 1 48 ? -33.855 -39.563 -17.766 1.00 43.68  ?  136 LYS B HA    1 
ATOM   1813 H HB2   . LYS B 1 48 ? -34.458 -36.835 -17.647 1.00 53.73  ?  136 LYS B HB2   1 
ATOM   1814 H HB3   . LYS B 1 48 ? -34.443 -37.526 -19.077 1.00 53.73  ?  136 LYS B HB3   1 
ATOM   1815 H HG2   . LYS B 1 48 ? -36.100 -38.388 -16.967 1.00 58.44  ?  136 LYS B HG2   1 
ATOM   1816 H HG3   . LYS B 1 48 ? -36.606 -37.468 -18.165 1.00 58.44  ?  136 LYS B HG3   1 
ATOM   1817 H HD2   . LYS B 1 48 ? -36.317 -39.154 -19.674 1.00 63.23  ?  136 LYS B HD2   1 
ATOM   1818 H HD3   . LYS B 1 48 ? -35.552 -40.049 -18.603 1.00 63.23  ?  136 LYS B HD3   1 
ATOM   1819 H HE2   . LYS B 1 48 ? -37.500 -40.398 -17.441 1.00 67.59  ?  136 LYS B HE2   1 
ATOM   1820 H HE3   . LYS B 1 48 ? -38.284 -39.395 -18.395 1.00 67.59  ?  136 LYS B HE3   1 
ATOM   1821 H HZ1   . LYS B 1 48 ? -38.693 -41.547 -18.995 1.00 70.55  ?  136 LYS B HZ1   1 
ATOM   1822 H HZ2   . LYS B 1 48 ? -37.998 -40.891 -20.084 1.00 70.55  ?  136 LYS B HZ2   1 
ATOM   1823 H HZ3   . LYS B 1 48 ? -37.285 -41.804 -19.215 1.00 70.55  ?  136 LYS B HZ3   1 
ATOM   1824 N N     . LYS B 1 49 ? -32.169 -39.319 -19.542 1.00 43.22  ?  137 LYS B N     1 
ATOM   1825 C CA    . LYS B 1 49 ? -30.979 -39.373 -20.376 1.00 43.62  ?  137 LYS B CA    1 
ATOM   1826 C C     . LYS B 1 49 ? -31.349 -39.449 -21.848 1.00 43.01  ?  137 LYS B C     1 
ATOM   1827 O O     . LYS B 1 49 ? -32.427 -39.921 -22.205 1.00 50.63  ?  137 LYS B O     1 
ATOM   1828 C CB    . LYS B 1 49 ? -30.133 -40.589 -20.002 1.00 42.01  ?  137 LYS B CB    1 
ATOM   1829 C CG    . LYS B 1 49 ? -29.775 -40.652 -18.530 1.00 42.55  ?  137 LYS B CG    1 
ATOM   1830 C CD    . LYS B 1 49 ? -29.079 -41.954 -18.175 1.00 52.74  ?  137 LYS B CD    1 
ATOM   1831 C CE    . LYS B 1 49 ? -28.819 -42.047 -16.679 1.00 60.56  ?  137 LYS B CE    1 
ATOM   1832 N NZ    . LYS B 1 49 ? -28.296 -43.383 -16.282 1.00 66.74  1  137 LYS B NZ    1 
ATOM   1833 H H     . LYS B 1 49 ? -32.806 -39.834 -19.807 1.00 51.87  ?  137 LYS B H     1 
ATOM   1834 H HA    . LYS B 1 49 ? -30.443 -38.565 -20.232 1.00 52.34  ?  137 LYS B HA    1 
ATOM   1835 H HB2   . LYS B 1 49 ? -30.627 -41.394 -20.222 1.00 50.41  ?  137 LYS B HB2   1 
ATOM   1836 H HB3   . LYS B 1 49 ? -29.306 -40.563 -20.508 1.00 50.41  ?  137 LYS B HB3   1 
ATOM   1837 H HG2   . LYS B 1 49 ? -29.176 -39.920 -18.316 1.00 51.06  ?  137 LYS B HG2   1 
ATOM   1838 H HG3   . LYS B 1 49 ? -30.585 -40.587 -18.002 1.00 51.06  ?  137 LYS B HG3   1 
ATOM   1839 H HD2   . LYS B 1 49 ? -29.643 -42.700 -18.434 1.00 63.29  ?  137 LYS B HD2   1 
ATOM   1840 H HD3   . LYS B 1 49 ? -28.227 -42.000 -18.636 1.00 63.29  ?  137 LYS B HD3   1 
ATOM   1841 H HE2   . LYS B 1 49 ? -28.162 -41.379 -16.428 1.00 72.68  ?  137 LYS B HE2   1 
ATOM   1842 H HE3   . LYS B 1 49 ? -29.649 -41.894 -16.201 1.00 72.68  ?  137 LYS B HE3   1 
ATOM   1843 H HZ1   . LYS B 1 49 ? -28.154 -43.406 -15.403 1.00 80.09  ?  137 LYS B HZ1   1 
ATOM   1844 H HZ2   . LYS B 1 49 ? -28.884 -44.016 -16.496 1.00 80.09  ?  137 LYS B HZ2   1 
ATOM   1845 H HZ3   . LYS B 1 49 ? -27.529 -43.547 -16.703 1.00 80.09  ?  137 LYS B HZ3   1 
ATOM   1846 N N     . ASP B 1 50 ? -30.444 -38.982 -22.698 1.00 45.58  ?  138 ASP B N     1 
ATOM   1847 C CA    . ASP B 1 50 ? -30.617 -39.102 -24.135 1.00 53.86  ?  138 ASP B CA    1 
ATOM   1848 C C     . ASP B 1 50 ? -30.553 -40.579 -24.495 1.00 57.96  ?  138 ASP B C     1 
ATOM   1849 O O     . ASP B 1 50 ? -29.654 -41.294 -24.051 1.00 57.39  ?  138 ASP B O     1 
ATOM   1850 C CB    . ASP B 1 50 ? -29.524 -38.327 -24.862 1.00 53.77  ?  138 ASP B CB    1 
ATOM   1851 C CG    . ASP B 1 50 ? -29.649 -38.415 -26.369 1.00 59.71  ?  138 ASP B CG    1 
ATOM   1852 O OD1   . ASP B 1 50 ? -29.188 -39.421 -26.949 1.00 65.78  ?  138 ASP B OD1   1 
ATOM   1853 O OD2   . ASP B 1 50 ? -30.205 -37.475 -26.974 1.00 59.66  -1 138 ASP B OD2   1 
ATOM   1854 H H     . ASP B 1 50 ? -29.716 -38.588 -22.465 1.00 54.69  ?  138 ASP B H     1 
ATOM   1855 H HA    . ASP B 1 50 ? -31.492 -38.747 -24.398 1.00 64.63  ?  138 ASP B HA    1 
ATOM   1856 H HB2   . ASP B 1 50 ? -29.579 -37.392 -24.611 1.00 64.52  ?  138 ASP B HB2   1 
ATOM   1857 H HB3   . ASP B 1 50 ? -28.660 -38.688 -24.611 1.00 64.52  ?  138 ASP B HB3   1 
ATOM   1858 N N     . LEU B 1 51 ? -31.507 -41.034 -25.299 1.00 58.61  ?  139 LEU B N     1 
ATOM   1859 C CA    . LEU B 1 51 ? -31.672 -42.461 -25.554 1.00 69.22  ?  139 LEU B CA    1 
ATOM   1860 C C     . LEU B 1 51 ? -30.388 -43.119 -26.038 1.00 62.22  ?  139 LEU B C     1 
ATOM   1861 O O     . LEU B 1 51 ? -30.058 -44.226 -25.614 1.00 64.62  ?  139 LEU B O     1 
ATOM   1862 C CB    . LEU B 1 51 ? -32.793 -42.709 -26.563 1.00 76.99  ?  139 LEU B CB    1 
ATOM   1863 C CG    . LEU B 1 51 ? -33.874 -43.659 -26.050 1.00 80.04  ?  139 LEU B CG    1 
ATOM   1864 C CD1   . LEU B 1 51 ? -34.603 -43.043 -24.862 1.00 78.35  ?  139 LEU B CD1   1 
ATOM   1865 C CD2   . LEU B 1 51 ? -34.847 -44.013 -27.161 1.00 78.42  ?  139 LEU B CD2   1 
ATOM   1866 H H     . LEU B 1 51 ? -32.075 -40.536 -25.711 1.00 70.34  ?  139 LEU B H     1 
ATOM   1867 H HA    . LEU B 1 51 ? -31.928 -42.898 -24.716 1.00 83.07  ?  139 LEU B HA    1 
ATOM   1868 H HB2   . LEU B 1 51 ? -33.216 -41.863 -26.776 1.00 92.38  ?  139 LEU B HB2   1 
ATOM   1869 H HB3   . LEU B 1 51 ? -32.411 -43.098 -27.366 1.00 92.38  ?  139 LEU B HB3   1 
ATOM   1870 H HG    . LEU B 1 51 ? -33.454 -44.480 -25.749 1.00 96.04  ?  139 LEU B HG    1 
ATOM   1871 H HD11  . LEU B 1 51 ? -35.276 -43.656 -24.557 1.00 94.02  ?  139 LEU B HD11  1 
ATOM   1872 H HD12  . LEU B 1 51 ? -33.969 -42.876 -24.160 1.00 94.02  ?  139 LEU B HD12  1 
ATOM   1873 H HD13  . LEU B 1 51 ? -35.010 -42.219 -25.139 1.00 94.02  ?  139 LEU B HD13  1 
ATOM   1874 H HD21  . LEU B 1 51 ? -35.515 -44.609 -26.813 1.00 94.11  ?  139 LEU B HD21  1 
ATOM   1875 H HD22  . LEU B 1 51 ? -35.261 -43.208 -27.481 1.00 94.11  ?  139 LEU B HD22  1 
ATOM   1876 H HD23  . LEU B 1 51 ? -34.366 -44.440 -27.874 1.00 94.11  ?  139 LEU B HD23  1 
ATOM   1877 N N     . LYS B 1 52 ? -29.661 -42.444 -26.921 1.00 64.96  ?  140 LYS B N     1 
ATOM   1878 C CA    . LYS B 1 52 ? -28.415 -43.002 -27.426 1.00 75.66  ?  140 LYS B CA    1 
ATOM   1879 C C     . LYS B 1 52 ? -27.226 -42.474 -26.630 1.00 71.95  ?  140 LYS B C     1 
ATOM   1880 O O     . LYS B 1 52 ? -26.621 -43.220 -25.857 1.00 80.31  ?  140 LYS B O     1 
ATOM   1881 C CB    . LYS B 1 52 ? -28.234 -42.716 -28.919 1.00 82.83  ?  140 LYS B CB    1 
ATOM   1882 C CG    . LYS B 1 52 ? -27.259 -43.676 -29.579 1.00 102.44 ?  140 LYS B CG    1 
ATOM   1883 C CD    . LYS B 1 52 ? -27.321 -43.622 -31.092 1.00 115.42 ?  140 LYS B CD    1 
ATOM   1884 C CE    . LYS B 1 52 ? -26.608 -44.822 -31.702 1.00 123.76 ?  140 LYS B CE    1 
ATOM   1885 N NZ    . LYS B 1 52 ? -25.222 -44.991 -31.177 1.00 127.29 1  140 LYS B NZ    1 
ATOM   1886 H H     . LYS B 1 52 ? -29.864 -41.672 -27.240 1.00 77.95  ?  140 LYS B H     1 
ATOM   1887 H HA    . LYS B 1 52 ? -28.440 -43.975 -27.312 1.00 90.79  ?  140 LYS B HA    1 
ATOM   1888 H HB2   . LYS B 1 52 ? -29.092 -42.804 -29.364 1.00 99.40  ?  140 LYS B HB2   1 
ATOM   1889 H HB3   . LYS B 1 52 ? -27.892 -41.815 -29.030 1.00 99.40  ?  140 LYS B HB3   1 
ATOM   1890 H HG2   . LYS B 1 52 ? -26.357 -43.446 -29.307 1.00 122.93 ?  140 LYS B HG2   1 
ATOM   1891 H HG3   . LYS B 1 52 ? -27.470 -44.581 -29.301 1.00 122.93 ?  140 LYS B HG3   1 
ATOM   1892 H HD2   . LYS B 1 52 ? -28.248 -43.638 -31.378 1.00 138.51 ?  140 LYS B HD2   1 
ATOM   1893 H HD3   . LYS B 1 52 ? -26.884 -42.815 -31.405 1.00 138.51 ?  140 LYS B HD3   1 
ATOM   1894 H HE2   . LYS B 1 52 ? -27.109 -45.626 -31.495 1.00 148.51 ?  140 LYS B HE2   1 
ATOM   1895 H HE3   . LYS B 1 52 ? -26.553 -44.702 -32.663 1.00 148.51 ?  140 LYS B HE3   1 
ATOM   1896 H HZ1   . LYS B 1 52 ? -24.839 -45.700 -31.554 1.00 152.75 ?  140 LYS B HZ1   1 
ATOM   1897 H HZ2   . LYS B 1 52 ? -24.737 -44.268 -31.359 1.00 152.75 ?  140 LYS B HZ2   1 
ATOM   1898 H HZ3   . LYS B 1 52 ? -25.244 -45.110 -30.295 1.00 152.75 ?  140 LYS B HZ3   1 
ATOM   1899 N N     . THR B 1 53 ? -26.913 -41.190 -26.797 1.00 54.36  ?  141 THR B N     1 
ATOM   1900 C CA    . THR B 1 53 ? -25.714 -40.603 -26.194 1.00 48.01  ?  141 THR B CA    1 
ATOM   1901 C C     . THR B 1 53 ? -25.566 -41.040 -24.741 1.00 48.45  ?  141 THR B C     1 
ATOM   1902 O O     . THR B 1 53 ? -24.454 -41.196 -24.243 1.00 44.06  ?  141 THR B O     1 
ATOM   1903 C CB    . THR B 1 53 ? -25.705 -39.062 -26.264 1.00 35.66  ?  141 THR B CB    1 
ATOM   1904 O OG1   . THR B 1 53 ? -26.756 -38.533 -25.452 1.00 51.79  ?  141 THR B OG1   1 
ATOM   1905 C CG2   . THR B 1 53 ? -25.868 -38.576 -27.703 1.00 44.99  ?  141 THR B CG2   1 
ATOM   1906 H H     . THR B 1 53 ? -27.380 -40.633 -27.257 1.00 65.23  ?  141 THR B H     1 
ATOM   1907 H HA    . THR B 1 53 ? -24.929 -40.927 -26.683 1.00 57.61  ?  141 THR B HA    1 
ATOM   1908 H HB    . THR B 1 53 ? -24.854 -38.735 -25.932 1.00 42.80  ?  141 THR B HB    1 
ATOM   1909 H HG1   . THR B 1 53 ? -26.753 -37.714 -25.488 1.00 62.15  ?  141 THR B HG1   1 
ATOM   1910 H HG21  . THR B 1 53 ? -25.860 -37.616 -27.728 1.00 53.99  ?  141 THR B HG21  1 
ATOM   1911 H HG22  . THR B 1 53 ? -25.148 -38.908 -28.244 1.00 53.99  ?  141 THR B HG22  1 
ATOM   1912 H HG23  . THR B 1 53 ? -26.700 -38.891 -28.063 1.00 53.99  ?  141 THR B HG23  1 
ATOM   1913 N N     . GLY B 1 54 ? -26.694 -41.244 -24.068 1.00 45.47  ?  142 GLY B N     1 
ATOM   1914 C CA    . GLY B 1 54 ? -26.690 -41.716 -22.695 1.00 35.14  ?  142 GLY B CA    1 
ATOM   1915 C C     . GLY B 1 54 ? -26.374 -40.609 -21.709 1.00 34.50  ?  142 GLY B C     1 
ATOM   1916 O O     . GLY B 1 54 ? -26.166 -40.865 -20.525 1.00 34.78  ?  142 GLY B O     1 
ATOM   1917 H H     . GLY B 1 54 ? -27.481 -41.115 -24.390 1.00 54.57  ?  142 GLY B H     1 
ATOM   1918 H HA2   . GLY B 1 54 ? -27.561 -42.083 -22.477 1.00 42.17  ?  142 GLY B HA2   1 
ATOM   1919 H HA3   . GLY B 1 54 ? -26.026 -42.416 -22.596 1.00 42.17  ?  142 GLY B HA3   1 
ATOM   1920 N N     . HIS B 1 55 ? -26.342 -39.373 -22.199 1.00 40.33  ?  143 HIS B N     1 
ATOM   1921 C CA    . HIS B 1 55 ? -26.053 -38.221 -21.352 1.00 35.58  ?  143 HIS B CA    1 
ATOM   1922 C C     . HIS B 1 55 ? -27.305 -37.728 -20.644 1.00 40.48  ?  143 HIS B C     1 
ATOM   1923 O O     . HIS B 1 55 ? -28.416 -37.885 -21.146 1.00 43.64  ?  143 HIS B O     1 
ATOM   1924 C CB    . HIS B 1 55 ? -25.453 -37.078 -22.173 1.00 33.43  ?  143 HIS B CB    1 
ATOM   1925 C CG    . HIS B 1 55 ? -23.990 -37.233 -22.439 1.00 30.96  ?  143 HIS B CG    1 
ATOM   1926 N ND1   . HIS B 1 55 ? -23.463 -38.342 -23.065 1.00 33.60  ?  143 HIS B ND1   1 
ATOM   1927 C CD2   . HIS B 1 55 ? -22.940 -36.425 -22.160 1.00 34.13  ?  143 HIS B CD2   1 
ATOM   1928 C CE1   . HIS B 1 55 ? -22.154 -38.209 -23.163 1.00 33.74  ?  143 HIS B CE1   1 
ATOM   1929 N NE2   . HIS B 1 55 ? -21.810 -37.054 -22.621 1.00 30.70  ?  143 HIS B NE2   1 
ATOM   1930 H H     . HIS B 1 55 ? -26.485 -39.174 -23.023 1.00 48.39  ?  143 HIS B H     1 
ATOM   1931 H HA    . HIS B 1 55 ? -25.400 -38.481 -20.669 1.00 42.70  ?  143 HIS B HA    1 
ATOM   1932 H HB2   . HIS B 1 55 ? -25.908 -37.035 -23.028 1.00 40.12  ?  143 HIS B HB2   1 
ATOM   1933 H HB3   . HIS B 1 55 ? -25.580 -36.246 -21.691 1.00 40.12  ?  143 HIS B HB3   1 
ATOM   1934 H HD1   . HIS B 1 55 ? -23.917 -39.015 -23.349 1.00 40.32  ?  143 HIS B HD1   1 
ATOM   1935 H HD2   . HIS B 1 55 ? -22.978 -35.598 -21.736 1.00 40.96  ?  143 HIS B HD2   1 
ATOM   1936 H HE1   . HIS B 1 55 ? -21.572 -38.823 -23.548 1.00 40.49  ?  143 HIS B HE1   1 
ATOM   1937 H HE2   . HIS B 1 55 ? -21.009 -36.746 -22.566 1.00 36.84  ?  143 HIS B HE2   1 
ATOM   1938 N N     . SER B 1 56 ? -27.115 -37.125 -19.476 1.00 34.49  ?  144 SER B N     1 
ATOM   1939 C CA    . SER B 1 56 ? -28.221 -36.565 -18.712 1.00 35.10  ?  144 SER B CA    1 
ATOM   1940 C C     . SER B 1 56 ? -28.804 -35.355 -19.432 1.00 38.62  ?  144 SER B C     1 
ATOM   1941 O O     . SER B 1 56 ? -28.082 -34.604 -20.087 1.00 41.82  ?  144 SER B O     1 
ATOM   1942 C CB    . SER B 1 56 ? -27.749 -36.159 -17.317 1.00 35.94  ?  144 SER B CB    1 
ATOM   1943 O OG    . SER B 1 56 ? -28.803 -35.571 -16.577 1.00 41.81  ?  144 SER B OG    1 
ATOM   1944 H H     . SER B 1 56 ? -26.347 -37.026 -19.101 1.00 41.39  ?  144 SER B H     1 
ATOM   1945 H HA    . SER B 1 56 ? -28.926 -37.239 -18.617 1.00 42.12  ?  144 SER B HA    1 
ATOM   1946 H HB2   . SER B 1 56 ? -27.436 -36.948 -16.847 1.00 43.13  ?  144 SER B HB2   1 
ATOM   1947 H HB3   . SER B 1 56 ? -27.027 -35.516 -17.402 1.00 43.13  ?  144 SER B HB3   1 
ATOM   1948 H HG    . SER B 1 56 ? -28.538 -35.358 -15.831 1.00 50.17  ?  144 SER B HG    1 
ATOM   1949 N N     . LYS B 1 57 ? -30.113 -35.168 -19.302 1.00 36.19  ?  145 LYS B N     1 
ATOM   1950 C CA    . LYS B 1 57 ? -30.791 -34.049 -19.944 1.00 39.07  ?  145 LYS B CA    1 
ATOM   1951 C C     . LYS B 1 57 ? -31.060 -32.918 -18.951 1.00 39.86  ?  145 LYS B C     1 
ATOM   1952 O O     . LYS B 1 57 ? -31.770 -31.963 -19.262 1.00 37.58  ?  145 LYS B O     1 
ATOM   1953 C CB    . LYS B 1 57 ? -32.092 -34.524 -20.594 1.00 32.23  ?  145 LYS B CB    1 
ATOM   1954 C CG    . LYS B 1 57 ? -31.873 -35.617 -21.628 1.00 41.27  ?  145 LYS B CG    1 
ATOM   1955 C CD    . LYS B 1 57 ? -32.888 -35.548 -22.756 1.00 47.87  ?  145 LYS B CD    1 
ATOM   1956 C CE    . LYS B 1 57 ? -34.257 -36.036 -22.320 1.00 52.70  ?  145 LYS B CE    1 
ATOM   1957 N NZ    . LYS B 1 57 ? -35.216 -36.035 -23.459 1.00 46.47  1  145 LYS B NZ    1 
ATOM   1958 H H     . LYS B 1 57 ? -30.634 -35.678 -18.845 1.00 43.42  ?  145 LYS B H     1 
ATOM   1959 H HA    . LYS B 1 57 ? -30.214 -33.694 -20.652 1.00 46.88  ?  145 LYS B HA    1 
ATOM   1960 H HB2   . LYS B 1 57 ? -32.678 -34.875 -19.906 1.00 38.68  ?  145 LYS B HB2   1 
ATOM   1961 H HB3   . LYS B 1 57 ? -32.515 -33.772 -21.038 1.00 38.68  ?  145 LYS B HB3   1 
ATOM   1962 H HG2   . LYS B 1 57 ? -30.987 -35.520 -22.012 1.00 49.53  ?  145 LYS B HG2   1 
ATOM   1963 H HG3   . LYS B 1 57 ? -31.957 -36.483 -21.198 1.00 49.53  ?  145 LYS B HG3   1 
ATOM   1964 H HD2   . LYS B 1 57 ? -32.975 -34.628 -23.050 1.00 57.44  ?  145 LYS B HD2   1 
ATOM   1965 H HD3   . LYS B 1 57 ? -32.587 -36.107 -23.490 1.00 57.44  ?  145 LYS B HD3   1 
ATOM   1966 H HE2   . LYS B 1 57 ? -34.183 -36.943 -21.985 1.00 63.24  ?  145 LYS B HE2   1 
ATOM   1967 H HE3   . LYS B 1 57 ? -34.603 -35.449 -21.630 1.00 63.24  ?  145 LYS B HE3   1 
ATOM   1968 H HZ1   . LYS B 1 57 ? -36.012 -36.323 -23.186 1.00 55.76  ?  145 LYS B HZ1   1 
ATOM   1969 H HZ2   . LYS B 1 57 ? -35.302 -35.210 -23.782 1.00 55.76  ?  145 LYS B HZ2   1 
ATOM   1970 H HZ3   . LYS B 1 57 ? -34.920 -36.570 -24.106 1.00 55.76  ?  145 LYS B HZ3   1 
ATOM   1971 N N     . GLY B 1 58 ? -30.485 -33.033 -17.757 1.00 36.54  ?  146 GLY B N     1 
ATOM   1972 C CA    . GLY B 1 58 ? -30.532 -31.961 -16.779 1.00 35.55  ?  146 GLY B CA    1 
ATOM   1973 C C     . GLY B 1 58 ? -31.706 -32.027 -15.819 1.00 35.64  ?  146 GLY B C     1 
ATOM   1974 O O     . GLY B 1 58 ? -31.823 -31.191 -14.923 1.00 32.64  ?  146 GLY B O     1 
ATOM   1975 H H     . GLY B 1 58 ? -30.058 -33.730 -17.490 1.00 43.84  ?  146 GLY B H     1 
ATOM   1976 H HA2   . GLY B 1 58 ? -29.716 -31.976 -16.254 1.00 42.66  ?  146 GLY B HA2   1 
ATOM   1977 H HA3   . GLY B 1 58 ? -30.573 -31.111 -17.244 1.00 42.66  ?  146 GLY B HA3   1 
ATOM   1978 N N     . PHE B 1 59 ? -32.579 -33.015 -15.998 1.00 33.66  ?  147 PHE B N     1 
ATOM   1979 C CA    . PHE B 1 59 ? -33.736 -33.168 -15.122 1.00 37.95  ?  147 PHE B CA    1 
ATOM   1980 C C     . PHE B 1 59 ? -34.038 -34.632 -14.828 1.00 36.76  ?  147 PHE B C     1 
ATOM   1981 O O     . PHE B 1 59 ? -33.502 -35.530 -15.472 1.00 39.98  ?  147 PHE B O     1 
ATOM   1982 C CB    . PHE B 1 59 ? -34.969 -32.497 -15.735 1.00 34.99  ?  147 PHE B CB    1 
ATOM   1983 C CG    . PHE B 1 59 ? -35.469 -33.165 -16.987 1.00 37.89  ?  147 PHE B CG    1 
ATOM   1984 C CD1   . PHE B 1 59 ? -34.961 -32.814 -18.226 1.00 39.93  ?  147 PHE B CD1   1 
ATOM   1985 C CD2   . PHE B 1 59 ? -36.453 -34.139 -16.926 1.00 37.81  ?  147 PHE B CD2   1 
ATOM   1986 C CE1   . PHE B 1 59 ? -35.421 -33.425 -19.380 1.00 38.12  ?  147 PHE B CE1   1 
ATOM   1987 C CE2   . PHE B 1 59 ? -36.915 -34.752 -18.079 1.00 37.80  ?  147 PHE B CE2   1 
ATOM   1988 C CZ    . PHE B 1 59 ? -36.398 -34.394 -19.304 1.00 31.88  ?  147 PHE B CZ    1 
ATOM   1989 H H     . PHE B 1 59 ? -32.524 -33.609 -16.618 1.00 40.39  ?  147 PHE B H     1 
ATOM   1990 H HA    . PHE B 1 59 ? -33.546 -32.724 -14.269 1.00 45.54  ?  147 PHE B HA    1 
ATOM   1991 H HB2   . PHE B 1 59 ? -35.688 -32.512 -15.084 1.00 41.99  ?  147 PHE B HB2   1 
ATOM   1992 H HB3   . PHE B 1 59 ? -34.747 -31.580 -15.957 1.00 41.99  ?  147 PHE B HB3   1 
ATOM   1993 H HD1   . PHE B 1 59 ? -34.302 -32.161 -18.284 1.00 47.92  ?  147 PHE B HD1   1 
ATOM   1994 H HD2   . PHE B 1 59 ? -36.805 -34.386 -16.102 1.00 45.37  ?  147 PHE B HD2   1 
ATOM   1995 H HE1   . PHE B 1 59 ? -35.072 -33.182 -20.207 1.00 45.74  ?  147 PHE B HE1   1 
ATOM   1996 H HE2   . PHE B 1 59 ? -37.574 -35.406 -18.026 1.00 45.36  ?  147 PHE B HE2   1 
ATOM   1997 H HZ    . PHE B 1 59 ? -36.708 -34.805 -20.079 1.00 38.25  ?  147 PHE B HZ    1 
ATOM   1998 N N     . GLY B 1 60 ? -34.904 -34.860 -13.847 1.00 35.62  ?  148 GLY B N     1 
ATOM   1999 C CA    . GLY B 1 60 ? -35.265 -36.203 -13.440 1.00 34.77  ?  148 GLY B CA    1 
ATOM   2000 C C     . GLY B 1 60 ? -36.562 -36.216 -12.656 1.00 39.08  ?  148 GLY B C     1 
ATOM   2001 O O     . GLY B 1 60 ? -37.316 -35.246 -12.680 1.00 38.00  ?  148 GLY B O     1 
ATOM   2002 H H     . GLY B 1 60 ? -35.300 -34.242 -13.398 1.00 42.75  ?  148 GLY B H     1 
ATOM   2003 H HA2   . GLY B 1 60 ? -35.371 -36.765 -14.224 1.00 41.72  ?  148 GLY B HA2   1 
ATOM   2004 H HA3   . GLY B 1 60 ? -34.563 -36.575 -12.884 1.00 41.72  ?  148 GLY B HA3   1 
ATOM   2005 N N     . PHE B 1 61 ? -36.821 -37.316 -11.958 1.00 37.27  ?  149 PHE B N     1 
ATOM   2006 C CA    . PHE B 1 61 ? -38.045 -37.448 -11.182 1.00 36.84  ?  149 PHE B CA    1 
ATOM   2007 C C     . PHE B 1 61 ? -37.773 -38.111 -9.838  1.00 35.50  ?  149 PHE B C     1 
ATOM   2008 O O     . PHE B 1 61 ? -36.872 -38.940 -9.715  1.00 38.68  ?  149 PHE B O     1 
ATOM   2009 C CB    . PHE B 1 61 ? -39.087 -38.247 -11.965 1.00 42.63  ?  149 PHE B CB    1 
ATOM   2010 C CG    . PHE B 1 61 ? -39.443 -37.637 -13.290 1.00 41.76  ?  149 PHE B CG    1 
ATOM   2011 C CD1   . PHE B 1 61 ? -38.679 -37.900 -14.413 1.00 36.99  ?  149 PHE B CD1   1 
ATOM   2012 C CD2   . PHE B 1 61 ? -40.537 -36.798 -13.413 1.00 39.93  ?  149 PHE B CD2   1 
ATOM   2013 C CE1   . PHE B 1 61 ? -39.001 -37.340 -15.633 1.00 42.63  ?  149 PHE B CE1   1 
ATOM   2014 C CE2   . PHE B 1 61 ? -40.862 -36.236 -14.633 1.00 40.07  ?  149 PHE B CE2   1 
ATOM   2015 C CZ    . PHE B 1 61 ? -40.093 -36.508 -15.742 1.00 41.21  ?  149 PHE B CZ    1 
ATOM   2016 H H     . PHE B 1 61 ? -36.303 -38.002 -11.918 1.00 44.73  ?  149 PHE B H     1 
ATOM   2017 H HA    . PHE B 1 61 ? -38.412 -36.555 -11.011 1.00 44.21  ?  149 PHE B HA    1 
ATOM   2018 H HB2   . PHE B 1 61 ? -38.738 -39.137 -12.131 1.00 51.16  ?  149 PHE B HB2   1 
ATOM   2019 H HB3   . PHE B 1 61 ? -39.898 -38.305 -11.437 1.00 51.16  ?  149 PHE B HB3   1 
ATOM   2020 H HD1   . PHE B 1 61 ? -37.941 -38.461 -14.346 1.00 44.39  ?  149 PHE B HD1   1 
ATOM   2021 H HD2   . PHE B 1 61 ? -41.060 -36.611 -12.667 1.00 47.92  ?  149 PHE B HD2   1 
ATOM   2022 H HE1   . PHE B 1 61 ? -38.480 -37.525 -16.382 1.00 51.16  ?  149 PHE B HE1   1 
ATOM   2023 H HE2   . PHE B 1 61 ? -41.600 -35.674 -14.705 1.00 48.09  ?  149 PHE B HE2   1 
ATOM   2024 H HZ    . PHE B 1 61 ? -40.311 -36.131 -16.564 1.00 49.45  ?  149 PHE B HZ    1 
ATOM   2025 N N     . VAL B 1 62 ? -38.557 -37.736 -8.833  1.00 37.84  ?  150 VAL B N     1 
ATOM   2026 C CA    . VAL B 1 62 ? -38.392 -38.273 -7.490  1.00 41.02  ?  150 VAL B CA    1 
ATOM   2027 C C     . VAL B 1 62 ? -39.750 -38.600 -6.882  1.00 43.74  ?  150 VAL B C     1 
ATOM   2028 O O     . VAL B 1 62 ? -40.717 -37.865 -7.071  1.00 45.28  ?  150 VAL B O     1 
ATOM   2029 C CB    . VAL B 1 62 ? -37.650 -37.278 -6.575  1.00 31.82  ?  150 VAL B CB    1 
ATOM   2030 C CG1   . VAL B 1 62 ? -38.484 -36.019 -6.363  1.00 38.67  ?  150 VAL B CG1   1 
ATOM   2031 C CG2   . VAL B 1 62 ? -37.301 -37.937 -5.249  1.00 34.06  ?  150 VAL B CG2   1 
ATOM   2032 H H     . VAL B 1 62 ? -39.198 -37.167 -8.905  1.00 45.41  ?  150 VAL B H     1 
ATOM   2033 H HA    . VAL B 1 62 ? -37.867 -39.100 -7.534  1.00 49.22  ?  150 VAL B HA    1 
ATOM   2034 H HB    . VAL B 1 62 ? -36.811 -37.014 -7.009  1.00 38.18  ?  150 VAL B HB    1 
ATOM   2035 H HG11  . VAL B 1 62 ? -38.001 -35.417 -5.792  1.00 46.40  ?  150 VAL B HG11  1 
ATOM   2036 H HG12  . VAL B 1 62 ? -38.645 -35.604 -7.214  1.00 46.40  ?  150 VAL B HG12  1 
ATOM   2037 H HG13  . VAL B 1 62 ? -39.317 -36.262 -5.953  1.00 46.40  ?  150 VAL B HG13  1 
ATOM   2038 H HG21  . VAL B 1 62 ? -36.841 -37.301 -4.696  1.00 40.88  ?  150 VAL B HG21  1 
ATOM   2039 H HG22  . VAL B 1 62 ? -38.112 -38.219 -4.819  1.00 40.88  ?  150 VAL B HG22  1 
ATOM   2040 H HG23  . VAL B 1 62 ? -36.737 -38.695 -5.416  1.00 40.88  ?  150 VAL B HG23  1 
ATOM   2041 N N     . ARG B 1 63 ? -39.814 -39.711 -6.156  1.00 47.95  ?  151 ARG B N     1 
ATOM   2042 C CA    . ARG B 1 63 ? -41.056 -40.162 -5.543  1.00 46.30  ?  151 ARG B CA    1 
ATOM   2043 C C     . ARG B 1 63 ? -40.827 -40.452 -4.067  1.00 49.55  ?  151 ARG B C     1 
ATOM   2044 O O     . ARG B 1 63 ? -39.975 -41.265 -3.713  1.00 50.63  ?  151 ARG B O     1 
ATOM   2045 C CB    . ARG B 1 63 ? -41.562 -41.423 -6.242  1.00 53.97  ?  151 ARG B CB    1 
ATOM   2046 C CG    . ARG B 1 63 ? -42.907 -41.926 -5.744  1.00 55.93  ?  151 ARG B CG    1 
ATOM   2047 C CD    . ARG B 1 63 ? -44.062 -41.100 -6.287  1.00 55.44  ?  151 ARG B CD    1 
ATOM   2048 N NE    . ARG B 1 63 ? -45.325 -41.833 -6.229  1.00 61.44  ?  151 ARG B NE    1 
ATOM   2049 C CZ    . ARG B 1 63 ? -45.765 -42.660 -7.175  1.00 68.82  ?  151 ARG B CZ    1 
ATOM   2050 N NH1   . ARG B 1 63 ? -45.052 -42.876 -8.273  1.00 70.21  1  151 ARG B NH1   1 
ATOM   2051 N NH2   . ARG B 1 63 ? -46.928 -43.277 -7.021  1.00 64.57  ?  151 ARG B NH2   1 
ATOM   2052 H H     . ARG B 1 63 ? -39.143 -40.226 -6.002  1.00 57.54  ?  151 ARG B H     1 
ATOM   2053 H HA    . ARG B 1 63 ? -41.737 -39.462 -5.624  1.00 55.56  ?  151 ARG B HA    1 
ATOM   2054 H HB2   . ARG B 1 63 ? -41.651 -41.237 -7.190  1.00 64.77  ?  151 ARG B HB2   1 
ATOM   2055 H HB3   . ARG B 1 63 ? -40.915 -42.133 -6.108  1.00 64.77  ?  151 ARG B HB3   1 
ATOM   2056 H HG2   . ARG B 1 63 ? -43.030 -42.844 -6.032  1.00 67.12  ?  151 ARG B HG2   1 
ATOM   2057 H HG3   . ARG B 1 63 ? -42.927 -41.873 -4.776  1.00 67.12  ?  151 ARG B HG3   1 
ATOM   2058 H HD2   . ARG B 1 63 ? -44.155 -40.293 -5.757  1.00 66.53  ?  151 ARG B HD2   1 
ATOM   2059 H HD3   . ARG B 1 63 ? -43.885 -40.874 -7.214  1.00 66.53  ?  151 ARG B HD3   1 
ATOM   2060 H HE    . ARG B 1 63 ? -45.819 -41.723 -5.534  1.00 73.72  ?  151 ARG B HE    1 
ATOM   2061 H HH11  . ARG B 1 63 ? -44.296 -42.480 -8.380  1.00 84.25  ?  151 ARG B HH11  1 
ATOM   2062 H HH12  . ARG B 1 63 ? -45.346 -43.412 -8.878  1.00 84.25  ?  151 ARG B HH12  1 
ATOM   2063 H HH21  . ARG B 1 63 ? -47.396 -43.142 -6.312  1.00 77.49  ?  151 ARG B HH21  1 
ATOM   2064 H HH22  . ARG B 1 63 ? -47.216 -43.811 -7.630  1.00 77.49  ?  151 ARG B HH22  1 
ATOM   2065 N N     . PHE B 1 64 ? -41.587 -39.783 -3.208  1.00 47.04  ?  152 PHE B N     1 
ATOM   2066 C CA    . PHE B 1 64 ? -41.452 -39.971 -1.771  1.00 43.99  ?  152 PHE B CA    1 
ATOM   2067 C C     . PHE B 1 64 ? -42.542 -40.877 -1.216  1.00 55.91  ?  152 PHE B C     1 
ATOM   2068 O O     . PHE B 1 64 ? -43.632 -40.980 -1.779  1.00 57.94  ?  152 PHE B O     1 
ATOM   2069 C CB    . PHE B 1 64 ? -41.474 -38.622 -1.054  1.00 47.65  ?  152 PHE B CB    1 
ATOM   2070 C CG    . PHE B 1 64 ? -40.282 -37.765 -1.355  1.00 48.20  ?  152 PHE B CG    1 
ATOM   2071 C CD1   . PHE B 1 64 ? -39.088 -37.959 -0.683  1.00 46.97  ?  152 PHE B CD1   1 
ATOM   2072 C CD2   . PHE B 1 64 ? -40.350 -36.773 -2.315  1.00 44.48  ?  152 PHE B CD2   1 
ATOM   2073 C CE1   . PHE B 1 64 ? -37.987 -37.178 -0.961  1.00 34.92  ?  152 PHE B CE1   1 
ATOM   2074 C CE2   . PHE B 1 64 ? -39.251 -35.989 -2.596  1.00 42.63  ?  152 PHE B CE2   1 
ATOM   2075 C CZ    . PHE B 1 64 ? -38.069 -36.194 -1.918  1.00 35.94  ?  152 PHE B CZ    1 
ATOM   2076 H H     . PHE B 1 64 ? -42.190 -39.212 -3.433  1.00 56.45  ?  152 PHE B H     1 
ATOM   2077 H HA    . PHE B 1 64 ? -40.587 -40.395 -1.587  1.00 52.78  ?  152 PHE B HA    1 
ATOM   2078 H HB2   . PHE B 1 64 ? -42.267 -38.135 -1.327  1.00 57.18  ?  152 PHE B HB2   1 
ATOM   2079 H HB3   . PHE B 1 64 ? -41.495 -38.776 -0.096  1.00 57.18  ?  152 PHE B HB3   1 
ATOM   2080 H HD1   . PHE B 1 64 ? -39.028 -38.625 -0.036  1.00 56.36  ?  152 PHE B HD1   1 
ATOM   2081 H HD2   . PHE B 1 64 ? -41.145 -36.632 -2.776  1.00 53.38  ?  152 PHE B HD2   1 
ATOM   2082 H HE1   . PHE B 1 64 ? -37.190 -37.316 -0.502  1.00 41.91  ?  152 PHE B HE1   1 
ATOM   2083 H HE2   . PHE B 1 64 ? -39.307 -35.323 -3.243  1.00 51.16  ?  152 PHE B HE2   1 
ATOM   2084 H HZ    . PHE B 1 64 ? -37.327 -35.664 -2.106  1.00 43.12  ?  152 PHE B HZ    1 
ATOM   2085 N N     . THR B 1 65 ? -42.230 -41.538 -0.108  1.00 58.84  ?  153 THR B N     1 
ATOM   2086 C CA    . THR B 1 65 ? -43.169 -42.433 0.550   1.00 57.41  ?  153 THR B CA    1 
ATOM   2087 C C     . THR B 1 65 ? -44.274 -41.635 1.227   1.00 60.62  ?  153 THR B C     1 
ATOM   2088 O O     . THR B 1 65 ? -45.458 -41.902 1.025   1.00 63.49  ?  153 THR B O     1 
ATOM   2089 C CB    . THR B 1 65 ? -42.453 -43.300 1.600   1.00 58.56  ?  153 THR B CB    1 
ATOM   2090 O OG1   . THR B 1 65 ? -41.519 -44.168 0.946   1.00 55.55  ?  153 THR B OG1   1 
ATOM   2091 C CG2   . THR B 1 65 ? -43.450 -44.133 2.390   1.00 60.05  ?  153 THR B CG2   1 
ATOM   2092 H H     . THR B 1 65 ? -41.468 -41.483 0.288   1.00 70.60  ?  153 THR B H     1 
ATOM   2093 H HA    . THR B 1 65 ? -43.577 -43.026 -0.116  1.00 68.89  ?  153 THR B HA    1 
ATOM   2094 H HB    . THR B 1 65 ? -41.977 -42.726 2.219   1.00 70.27  ?  153 THR B HB    1 
ATOM   2095 H HG1   . THR B 1 65 ? -41.133 -44.634 1.500   1.00 66.67  ?  153 THR B HG1   1 
ATOM   2096 H HG21  . THR B 1 65 ? -42.988 -44.668 3.040   1.00 72.07  ?  153 THR B HG21  1 
ATOM   2097 H HG22  . THR B 1 65 ? -44.071 -43.558 2.843   1.00 72.07  ?  153 THR B HG22  1 
ATOM   2098 H HG23  . THR B 1 65 ? -43.936 -44.712 1.798   1.00 72.07  ?  153 THR B HG23  1 
ATOM   2099 N N     . GLU B 1 66 ? -43.880 -40.650 2.028   1.00 56.95  ?  154 GLU B N     1 
ATOM   2100 C CA    . GLU B 1 66 ? -44.838 -39.810 2.736   1.00 63.19  ?  154 GLU B CA    1 
ATOM   2101 C C     . GLU B 1 66 ? -45.197 -38.570 1.925   1.00 61.84  ?  154 GLU B C     1 
ATOM   2102 O O     . GLU B 1 66 ? -44.357 -38.005 1.225   1.00 61.35  ?  154 GLU B O     1 
ATOM   2103 C CB    . GLU B 1 66 ? -44.280 -39.393 4.100   1.00 68.25  ?  154 GLU B CB    1 
ATOM   2104 C CG    . GLU B 1 66 ? -44.089 -40.544 5.076   1.00 74.87  ?  154 GLU B CG    1 
ATOM   2105 C CD    . GLU B 1 66 ? -45.403 -41.089 5.606   1.00 74.83  ?  154 GLU B CD    1 
ATOM   2106 O OE1   . GLU B 1 66 ? -46.471 -40.597 5.183   1.00 73.63  ?  154 GLU B OE1   1 
ATOM   2107 O OE2   . GLU B 1 66 ? -45.367 -42.009 6.450   1.00 73.23  -1 154 GLU B OE2   1 
ATOM   2108 H H     . GLU B 1 66 ? -43.058 -40.447 2.179   1.00 68.34  ?  154 GLU B H     1 
ATOM   2109 H HA    . GLU B 1 66 ? -45.660 -40.322 2.888   1.00 75.82  ?  154 GLU B HA    1 
ATOM   2110 H HB2   . GLU B 1 66 ? -43.417 -38.973 3.967   1.00 81.90  ?  154 GLU B HB2   1 
ATOM   2111 H HB3   . GLU B 1 66 ? -44.893 -38.760 4.506   1.00 81.90  ?  154 GLU B HB3   1 
ATOM   2112 H HG2   . GLU B 1 66 ? -43.625 -41.266 4.626   1.00 89.85  ?  154 GLU B HG2   1 
ATOM   2113 H HG3   . GLU B 1 66 ? -43.567 -40.233 5.832   1.00 89.85  ?  154 GLU B HG3   1 
ATOM   2114 N N     . TYR B 1 67 ? -46.456 -38.157 2.025   1.00 56.07  ?  155 TYR B N     1 
ATOM   2115 C CA    . TYR B 1 67 ? -46.938 -36.960 1.347   1.00 54.14  ?  155 TYR B CA    1 
ATOM   2116 C C     . TYR B 1 67 ? -46.440 -35.716 2.069   1.00 59.20  ?  155 TYR B C     1 
ATOM   2117 O O     . TYR B 1 67 ? -46.144 -34.698 1.445   1.00 57.98  ?  155 TYR B O     1 
ATOM   2118 C CB    . TYR B 1 67 ? -48.465 -36.961 1.302   1.00 59.93  ?  155 TYR B CB    1 
ATOM   2119 C CG    . TYR B 1 67 ? -49.063 -35.722 0.679   1.00 51.16  ?  155 TYR B CG    1 
ATOM   2120 C CD1   . TYR B 1 67 ? -49.221 -35.619 -0.697  1.00 49.06  ?  155 TYR B CD1   1 
ATOM   2121 C CD2   . TYR B 1 67 ? -49.471 -34.655 1.465   1.00 55.57  ?  155 TYR B CD2   1 
ATOM   2122 C CE1   . TYR B 1 67 ? -49.769 -34.487 -1.269  1.00 44.19  ?  155 TYR B CE1   1 
ATOM   2123 C CE2   . TYR B 1 67 ? -50.019 -33.520 0.901   1.00 58.66  ?  155 TYR B CE2   1 
ATOM   2124 C CZ    . TYR B 1 67 ? -50.166 -33.441 -0.465  1.00 53.76  ?  155 TYR B CZ    1 
ATOM   2125 O OH    . TYR B 1 67 ? -50.713 -32.310 -1.029  1.00 57.72  ?  155 TYR B OH    1 
ATOM   2126 H H     . TYR B 1 67 ? -47.060 -38.560 2.486   1.00 67.29  ?  155 TYR B H     1 
ATOM   2127 H HA    . TYR B 1 67 ? -46.599 -36.945 0.428   1.00 64.97  ?  155 TYR B HA    1 
ATOM   2128 H HB2   . TYR B 1 67 ? -48.761 -37.726 0.784   1.00 71.92  ?  155 TYR B HB2   1 
ATOM   2129 H HB3   . TYR B 1 67 ? -48.804 -37.029 2.209   1.00 71.92  ?  155 TYR B HB3   1 
ATOM   2130 H HD1   . TYR B 1 67 ? -48.955 -36.323 -1.242  1.00 58.88  ?  155 TYR B HD1   1 
ATOM   2131 H HD2   . TYR B 1 67 ? -49.374 -34.705 2.389   1.00 66.69  ?  155 TYR B HD2   1 
ATOM   2132 H HE1   . TYR B 1 67 ? -49.869 -34.432 -2.192  1.00 53.03  ?  155 TYR B HE1   1 
ATOM   2133 H HE2   . TYR B 1 67 ? -50.288 -32.813 1.442   1.00 70.39  ?  155 TYR B HE2   1 
ATOM   2134 H HH    . TYR B 1 67 ? -50.255 -31.655 -0.844  1.00 69.26  ?  155 TYR B HH    1 
ATOM   2135 N N     . GLU B 1 68 ? -46.355 -35.806 3.391   1.00 60.02  ?  156 GLU B N     1 
ATOM   2136 C CA    . GLU B 1 68 ? -45.791 -34.735 4.199   1.00 60.69  ?  156 GLU B CA    1 
ATOM   2137 C C     . GLU B 1 68 ? -44.372 -34.437 3.725   1.00 64.97  ?  156 GLU B C     1 
ATOM   2138 O O     . GLU B 1 68 ? -43.928 -33.288 3.726   1.00 61.59  ?  156 GLU B O     1 
ATOM   2139 C CB    . GLU B 1 68 ? -45.774 -35.147 5.670   1.00 60.73  ?  156 GLU B CB    1 
ATOM   2140 C CG    . GLU B 1 68 ? -45.253 -34.080 6.613   1.00 78.40  ?  156 GLU B CG    1 
ATOM   2141 C CD    . GLU B 1 68 ? -45.408 -34.469 8.070   1.00 86.69  ?  156 GLU B CD    1 
ATOM   2142 O OE1   . GLU B 1 68 ? -45.989 -35.542 8.341   1.00 79.73  ?  156 GLU B OE1   1 
ATOM   2143 O OE2   . GLU B 1 68 ? -44.950 -33.704 8.944   1.00 89.29  -1 156 GLU B OE2   1 
ATOM   2144 H H     . GLU B 1 68 ? -46.621 -36.484 3.848   1.00 72.03  ?  156 GLU B H     1 
ATOM   2145 H HA    . GLU B 1 68 ? -46.333 -33.924 4.104   1.00 72.82  ?  156 GLU B HA    1 
ATOM   2146 H HB2   . GLU B 1 68 ? -46.679 -35.364 5.942   1.00 72.87  ?  156 GLU B HB2   1 
ATOM   2147 H HB3   . GLU B 1 68 ? -45.206 -35.928 5.767   1.00 72.87  ?  156 GLU B HB3   1 
ATOM   2148 H HG2   . GLU B 1 68 ? -44.310 -33.935 6.439   1.00 94.08  ?  156 GLU B HG2   1 
ATOM   2149 H HG3   . GLU B 1 68 ? -45.748 -33.258 6.467   1.00 94.08  ?  156 GLU B HG3   1 
ATOM   2150 N N     . THR B 1 69 ? -43.670 -35.488 3.315   1.00 55.95  ?  157 THR B N     1 
ATOM   2151 C CA    . THR B 1 69 ? -42.305 -35.366 2.817   1.00 54.48  ?  157 THR B CA    1 
ATOM   2152 C C     . THR B 1 69 ? -42.299 -34.699 1.447   1.00 55.15  ?  157 THR B C     1 
ATOM   2153 O O     . THR B 1 69 ? -41.373 -33.964 1.104   1.00 53.17  ?  157 THR B O     1 
ATOM   2154 C CB    . THR B 1 69 ? -41.633 -36.749 2.701   1.00 56.28  ?  157 THR B CB    1 
ATOM   2155 O OG1   . THR B 1 69 ? -41.636 -37.394 3.980   1.00 60.11  ?  157 THR B OG1   1 
ATOM   2156 C CG2   . THR B 1 69 ? -40.201 -36.618 2.206   1.00 47.48  ?  157 THR B CG2   1 
ATOM   2157 H H     . THR B 1 69 ? -43.967 -36.295 3.315   1.00 67.14  ?  157 THR B H     1 
ATOM   2158 H HA    . THR B 1 69 ? -41.780 -34.815 3.434   1.00 65.38  ?  157 THR B HA    1 
ATOM   2159 H HB    . THR B 1 69 ? -42.126 -37.293 2.067   1.00 67.54  ?  157 THR B HB    1 
ATOM   2160 H HG1   . THR B 1 69 ? -41.280 -38.130 3.924   1.00 72.13  ?  157 THR B HG1   1 
ATOM   2161 H HG21  . THR B 1 69 ? -39.796 -37.486 2.139   1.00 56.98  ?  157 THR B HG21  1 
ATOM   2162 H HG22  . THR B 1 69 ? -40.190 -36.201 1.341   1.00 56.98  ?  157 THR B HG22  1 
ATOM   2163 H HG23  . THR B 1 69 ? -39.690 -36.082 2.817   1.00 56.98  ?  157 THR B HG23  1 
ATOM   2164 N N     . GLN B 1 70 ? -43.341 -34.964 0.668   1.00 55.41  ?  158 GLN B N     1 
ATOM   2165 C CA    . GLN B 1 70 ? -43.480 -34.397 -0.668  1.00 46.15  ?  158 GLN B CA    1 
ATOM   2166 C C     . GLN B 1 70 ? -43.716 -32.892 -0.590  1.00 47.05  ?  158 GLN B C     1 
ATOM   2167 O O     . GLN B 1 70 ? -43.050 -32.110 -1.268  1.00 45.97  ?  158 GLN B O     1 
ATOM   2168 C CB    . GLN B 1 70 ? -44.642 -35.076 -1.398  1.00 40.81  ?  158 GLN B CB    1 
ATOM   2169 C CG    . GLN B 1 70 ? -44.960 -34.497 -2.765  1.00 45.96  ?  158 GLN B CG    1 
ATOM   2170 C CD    . GLN B 1 70 ? -46.100 -35.226 -3.455  1.00 52.44  ?  158 GLN B CD    1 
ATOM   2171 O OE1   . GLN B 1 70 ? -46.222 -36.446 -3.354  1.00 44.86  ?  158 GLN B OE1   1 
ATOM   2172 N NE2   . GLN B 1 70 ? -46.944 -34.478 -4.158  1.00 31.90  ?  158 GLN B NE2   1 
ATOM   2173 H H     . GLN B 1 70 ? -43.992 -35.479 0.894   1.00 66.49  ?  158 GLN B H     1 
ATOM   2174 H HA    . GLN B 1 70 ? -42.658 -34.556 -1.178  1.00 55.38  ?  158 GLN B HA    1 
ATOM   2175 H HB2   . GLN B 1 70 ? -44.425 -36.014 -1.520  1.00 48.97  ?  158 GLN B HB2   1 
ATOM   2176 H HB3   . GLN B 1 70 ? -45.440 -34.995 -0.853  1.00 48.97  ?  158 GLN B HB3   1 
ATOM   2177 H HG2   . GLN B 1 70 ? -45.215 -33.567 -2.664  1.00 55.15  ?  158 GLN B HG2   1 
ATOM   2178 H HG3   . GLN B 1 70 ? -44.173 -34.567 -3.329  1.00 55.15  ?  158 GLN B HG3   1 
ATOM   2179 H HE21  . GLN B 1 70 ? -46.828 -33.627 -4.204  1.00 38.28  ?  158 GLN B HE21  1 
ATOM   2180 H HE22  . GLN B 1 70 ? -47.605 -34.845 -4.567  1.00 38.28  ?  158 GLN B HE22  1 
ATOM   2181 N N     . VAL B 1 71 ? -44.671 -32.497 0.247   1.00 55.08  ?  159 VAL B N     1 
ATOM   2182 C CA    . VAL B 1 71 ? -45.009 -31.091 0.442   1.00 48.80  ?  159 VAL B CA    1 
ATOM   2183 C C     . VAL B 1 71 ? -43.777 -30.255 0.771   1.00 41.73  ?  159 VAL B C     1 
ATOM   2184 O O     . VAL B 1 71 ? -43.580 -29.175 0.212   1.00 39.83  ?  159 VAL B O     1 
ATOM   2185 C CB    . VAL B 1 71 ? -46.044 -30.932 1.579   1.00 47.83  ?  159 VAL B CB    1 
ATOM   2186 C CG1   . VAL B 1 71 ? -45.992 -29.528 2.178   1.00 41.83  ?  159 VAL B CG1   1 
ATOM   2187 C CG2   . VAL B 1 71 ? -47.441 -31.261 1.071   1.00 50.68  ?  159 VAL B CG2   1 
ATOM   2188 H H     . VAL B 1 71 ? -45.145 -33.035 0.721   1.00 66.10  ?  159 VAL B H     1 
ATOM   2189 H HA    . VAL B 1 71 ? -45.405 -30.739 -0.382  1.00 58.56  ?  159 VAL B HA    1 
ATOM   2190 H HB    . VAL B 1 71 ? -45.828 -31.569 2.292   1.00 57.40  ?  159 VAL B HB    1 
ATOM   2191 H HG11  . VAL B 1 71 ? -46.645 -29.464 2.879   1.00 50.20  ?  159 VAL B HG11  1 
ATOM   2192 H HG12  . VAL B 1 71 ? -45.113 -29.374 2.534   1.00 50.20  ?  159 VAL B HG12  1 
ATOM   2193 H HG13  . VAL B 1 71 ? -46.184 -28.888 1.490   1.00 50.20  ?  159 VAL B HG13  1 
ATOM   2194 H HG21  . VAL B 1 71 ? -48.067 -31.156 1.791   1.00 60.82  ?  159 VAL B HG21  1 
ATOM   2195 H HG22  . VAL B 1 71 ? -47.661 -30.661 0.354   1.00 60.82  ?  159 VAL B HG22  1 
ATOM   2196 H HG23  . VAL B 1 71 ? -47.453 -32.167 0.756   1.00 60.82  ?  159 VAL B HG23  1 
ATOM   2197 N N     . LYS B 1 72 ? -42.951 -30.759 1.681   1.00 44.24  ?  160 LYS B N     1 
ATOM   2198 C CA    . LYS B 1 72 ? -41.776 -30.028 2.140   1.00 42.96  ?  160 LYS B CA    1 
ATOM   2199 C C     . LYS B 1 72 ? -40.792 -29.767 1.004   1.00 42.76  ?  160 LYS B C     1 
ATOM   2200 O O     . LYS B 1 72 ? -40.244 -28.671 0.885   1.00 41.06  ?  160 LYS B O     1 
ATOM   2201 C CB    . LYS B 1 72 ? -41.073 -30.805 3.253   1.00 41.08  ?  160 LYS B CB    1 
ATOM   2202 C CG    . LYS B 1 72 ? -39.943 -30.040 3.921   1.00 48.80  ?  160 LYS B CG    1 
ATOM   2203 C CD    . LYS B 1 72 ? -40.461 -28.820 4.670   1.00 58.59  ?  160 LYS B CD    1 
ATOM   2204 C CE    . LYS B 1 72 ? -39.328 -28.022 5.296   1.00 60.45  ?  160 LYS B CE    1 
ATOM   2205 N NZ    . LYS B 1 72 ? -38.577 -28.816 6.306   1.00 64.56  1  160 LYS B NZ    1 
ATOM   2206 H H     . LYS B 1 72 ? -43.049 -31.529 2.050   1.00 53.09  ?  160 LYS B H     1 
ATOM   2207 H HA    . LYS B 1 72 ? -42.058 -29.163 2.504   1.00 51.55  ?  160 LYS B HA    1 
ATOM   2208 H HB2   . LYS B 1 72 ? -41.724 -31.028 3.937   1.00 49.29  ?  160 LYS B HB2   1 
ATOM   2209 H HB3   . LYS B 1 72 ? -40.699 -31.618 2.878   1.00 49.29  ?  160 LYS B HB3   1 
ATOM   2210 H HG2   . LYS B 1 72 ? -39.495 -30.620 4.557   1.00 58.56  ?  160 LYS B HG2   1 
ATOM   2211 H HG3   . LYS B 1 72 ? -39.317 -29.738 3.244   1.00 58.56  ?  160 LYS B HG3   1 
ATOM   2212 H HD2   . LYS B 1 72 ? -40.934 -28.242 4.051   1.00 70.31  ?  160 LYS B HD2   1 
ATOM   2213 H HD3   . LYS B 1 72 ? -41.056 -29.109 5.379   1.00 70.31  ?  160 LYS B HD3   1 
ATOM   2214 H HE2   . LYS B 1 72 ? -38.707 -27.752 4.601   1.00 72.54  ?  160 LYS B HE2   1 
ATOM   2215 H HE3   . LYS B 1 72 ? -39.695 -27.240 5.738   1.00 72.54  ?  160 LYS B HE3   1 
ATOM   2216 H HZ1   . LYS B 1 72 ? -37.922 -28.324 6.654   1.00 77.48  ?  160 LYS B HZ1   1 
ATOM   2217 H HZ2   . LYS B 1 72 ? -39.124 -29.072 6.960   1.00 77.48  ?  160 LYS B HZ2   1 
ATOM   2218 H HZ3   . LYS B 1 72 ? -38.224 -29.538 5.924   1.00 77.48  ?  160 LYS B HZ3   1 
ATOM   2219 N N     . VAL B 1 73 ? -40.572 -30.778 0.171   1.00 45.80  ?  161 VAL B N     1 
ATOM   2220 C CA    . VAL B 1 73 ? -39.596 -30.687 -0.911  1.00 40.85  ?  161 VAL B CA    1 
ATOM   2221 C C     . VAL B 1 73 ? -40.053 -29.730 -2.005  1.00 38.37  ?  161 VAL B C     1 
ATOM   2222 O O     . VAL B 1 73 ? -39.237 -29.041 -2.617  1.00 41.90  ?  161 VAL B O     1 
ATOM   2223 C CB    . VAL B 1 73 ? -39.321 -32.073 -1.530  1.00 33.92  ?  161 VAL B CB    1 
ATOM   2224 C CG1   . VAL B 1 73 ? -38.550 -31.938 -2.840  1.00 35.82  ?  161 VAL B CG1   1 
ATOM   2225 C CG2   . VAL B 1 73 ? -38.568 -32.947 -0.538  1.00 35.64  ?  161 VAL B CG2   1 
ATOM   2226 H H     . VAL B 1 73 ? -40.978 -31.535 0.211   1.00 54.96  ?  161 VAL B H     1 
ATOM   2227 H HA    . VAL B 1 73 ? -38.752 -30.347 -0.548  1.00 49.02  ?  161 VAL B HA    1 
ATOM   2228 H HB    . VAL B 1 73 ? -40.176 -32.509 -1.727  1.00 40.70  ?  161 VAL B HB    1 
ATOM   2229 H HG11  . VAL B 1 73 ? -38.393 -32.814 -3.201  1.00 42.98  ?  161 VAL B HG11  1 
ATOM   2230 H HG12  . VAL B 1 73 ? -39.070 -31.418 -3.456  1.00 42.98  ?  161 VAL B HG12  1 
ATOM   2231 H HG13  . VAL B 1 73 ? -37.713 -31.501 -2.666  1.00 42.98  ?  161 VAL B HG13  1 
ATOM   2232 H HG21  . VAL B 1 73 ? -38.405 -33.804 -0.939  1.00 42.76  ?  161 VAL B HG21  1 
ATOM   2233 H HG22  . VAL B 1 73 ? -37.735 -32.524 -0.319  1.00 42.76  ?  161 VAL B HG22  1 
ATOM   2234 H HG23  . VAL B 1 73 ? -39.101 -33.051 0.253   1.00 42.76  ?  161 VAL B HG23  1 
ATOM   2235 N N     . MET B 1 74 ? -41.358 -29.685 -2.248  1.00 41.15  ?  162 MET B N     1 
ATOM   2236 C CA    . MET B 1 74 ? -41.909 -28.803 -3.268  1.00 40.83  ?  162 MET B CA    1 
ATOM   2237 C C     . MET B 1 74 ? -41.880 -27.353 -2.803  1.00 37.09  ?  162 MET B C     1 
ATOM   2238 O O     . MET B 1 74 ? -41.972 -26.433 -3.615  1.00 36.39  ?  162 MET B O     1 
ATOM   2239 C CB    . MET B 1 74 ? -43.349 -29.199 -3.592  1.00 37.91  ?  162 MET B CB    1 
ATOM   2240 C CG    . MET B 1 74 ? -43.492 -30.558 -4.249  1.00 42.75  ?  162 MET B CG    1 
ATOM   2241 S SD    . MET B 1 74 ? -45.215 -30.984 -4.566  1.00 54.69  ?  162 MET B SD    1 
ATOM   2242 C CE    . MET B 1 74 ? -45.697 -29.674 -5.687  1.00 48.33  ?  162 MET B CE    1 
ATOM   2243 H H     . MET B 1 74 ? -41.946 -30.157 -1.836  1.00 49.37  ?  162 MET B H     1 
ATOM   2244 H HA    . MET B 1 74 ? -41.378 -28.889 -4.087  1.00 49.00  ?  162 MET B HA    1 
ATOM   2245 H HB2   . MET B 1 74 ? -43.860 -29.216 -2.767  1.00 45.49  ?  162 MET B HB2   1 
ATOM   2246 H HB3   . MET B 1 74 ? -43.724 -28.539 -4.195  1.00 45.49  ?  162 MET B HB3   1 
ATOM   2247 H HG2   . MET B 1 74 ? -43.021 -30.552 -5.098  1.00 51.30  ?  162 MET B HG2   1 
ATOM   2248 H HG3   . MET B 1 74 ? -43.116 -31.235 -3.665  1.00 51.30  ?  162 MET B HG3   1 
ATOM   2249 H HE1   . MET B 1 74 ? -46.617 -29.796 -5.932  1.00 58.00  ?  162 MET B HE1   1 
ATOM   2250 H HE2   . MET B 1 74 ? -45.584 -28.829 -5.245  1.00 58.00  ?  162 MET B HE2   1 
ATOM   2251 H HE3   . MET B 1 74 ? -45.141 -29.712 -6.468  1.00 58.00  ?  162 MET B HE3   1 
ATOM   2252 N N     . SER B 1 75 ? -41.743 -27.154 -1.495  1.00 39.68  ?  163 SER B N     1 
ATOM   2253 C CA    . SER B 1 75 ? -41.870 -25.826 -0.902  1.00 46.36  ?  163 SER B CA    1 
ATOM   2254 C C     . SER B 1 75 ? -40.520 -25.162 -0.637  1.00 39.69  ?  163 SER B C     1 
ATOM   2255 O O     . SER B 1 75 ? -40.425 -24.253 0.188   1.00 37.82  ?  163 SER B O     1 
ATOM   2256 C CB    . SER B 1 75 ? -42.671 -25.907 0.401   1.00 44.88  ?  163 SER B CB    1 
ATOM   2257 O OG    . SER B 1 75 ? -41.980 -26.655 1.388   1.00 45.63  ?  163 SER B OG    1 
ATOM   2258 H H     . SER B 1 75 ? -41.576 -27.776 -0.926  1.00 47.62  ?  163 SER B H     1 
ATOM   2259 H HA    . SER B 1 75 ? -42.367 -25.253 -1.522  1.00 55.64  ?  163 SER B HA    1 
ATOM   2260 H HB2   . SER B 1 75 ? -42.819 -25.008 0.734   1.00 53.85  ?  163 SER B HB2   1 
ATOM   2261 H HB3   . SER B 1 75 ? -43.522 -26.336 0.220   1.00 53.85  ?  163 SER B HB3   1 
ATOM   2262 H HG    . SER B 1 75 ? -41.263 -26.918 1.089   1.00 54.76  ?  163 SER B HG    1 
ATOM   2263 N N     . GLN B 1 76 ? -39.480 -25.610 -1.332  1.00 40.21  ?  164 GLN B N     1 
ATOM   2264 C CA    . GLN B 1 76 ? -38.171 -24.974 -1.221  1.00 38.13  ?  164 GLN B CA    1 
ATOM   2265 C C     . GLN B 1 76 ? -37.257 -25.362 -2.376  1.00 35.97  ?  164 GLN B C     1 
ATOM   2266 O O     . GLN B 1 76 ? -37.381 -26.446 -2.946  1.00 31.62  ?  164 GLN B O     1 
ATOM   2267 C CB    . GLN B 1 76 ? -37.501 -25.332 0.108   1.00 40.05  ?  164 GLN B CB    1 
ATOM   2268 C CG    . GLN B 1 76 ? -37.045 -26.780 0.212   1.00 43.23  ?  164 GLN B CG    1 
ATOM   2269 C CD    . GLN B 1 76 ? -36.134 -27.020 1.401   1.00 33.37  ?  164 GLN B CD    1 
ATOM   2270 O OE1   . GLN B 1 76 ? -34.977 -27.408 1.242   1.00 37.88  ?  164 GLN B OE1   1 
ATOM   2271 N NE2   . GLN B 1 76 ? -36.652 -26.791 2.602   1.00 31.69  ?  164 GLN B NE2   1 
ATOM   2272 H H     . GLN B 1 76 ? -39.504 -26.279 -1.872  1.00 48.25  ?  164 GLN B H     1 
ATOM   2273 H HA    . GLN B 1 76 ? -38.290 -24.001 -1.245  1.00 45.75  ?  164 GLN B HA    1 
ATOM   2274 H HB2   . GLN B 1 76 ? -36.720 -24.768 0.224   1.00 48.06  ?  164 GLN B HB2   1 
ATOM   2275 H HB3   . GLN B 1 76 ? -38.131 -25.169 0.828   1.00 48.06  ?  164 GLN B HB3   1 
ATOM   2276 H HG2   . GLN B 1 76 ? -37.823 -27.351 0.311   1.00 51.88  ?  164 GLN B HG2   1 
ATOM   2277 H HG3   . GLN B 1 76 ? -36.558 -27.018 -0.592  1.00 51.88  ?  164 GLN B HG3   1 
ATOM   2278 H HE21  . GLN B 1 76 ? -37.466 -26.522 2.674   1.00 38.03  ?  164 GLN B HE21  1 
ATOM   2279 H HE22  . GLN B 1 76 ? -36.175 -26.913 3.307   1.00 38.03  ?  164 GLN B HE22  1 
ATOM   2280 N N     . ARG B 1 77 ? -36.339 -24.463 -2.715  1.00 35.22  ?  165 ARG B N     1 
ATOM   2281 C CA    . ARG B 1 77 ? -35.338 -24.731 -3.735  1.00 30.59  ?  165 ARG B CA    1 
ATOM   2282 C C     . ARG B 1 77 ? -34.317 -25.712 -3.170  1.00 34.36  ?  165 ARG B C     1 
ATOM   2283 O O     . ARG B 1 77 ? -34.299 -25.964 -1.966  1.00 36.47  ?  165 ARG B O     1 
ATOM   2284 C CB    . ARG B 1 77 ? -34.655 -23.428 -4.152  1.00 31.39  ?  165 ARG B CB    1 
ATOM   2285 C CG    . ARG B 1 77 ? -35.627 -22.343 -4.594  1.00 34.65  ?  165 ARG B CG    1 
ATOM   2286 C CD    . ARG B 1 77 ? -35.534 -22.118 -6.091  1.00 31.84  ?  165 ARG B CD    1 
ATOM   2287 N NE    . ARG B 1 77 ? -34.341 -21.364 -6.462  1.00 35.43  ?  165 ARG B NE    1 
ATOM   2288 C CZ    . ARG B 1 77 ? -33.788 -21.380 -7.672  1.00 34.82  ?  165 ARG B CZ    1 
ATOM   2289 N NH1   . ARG B 1 77 ? -34.311 -22.119 -8.642  1.00 28.98  1  165 ARG B NH1   1 
ATOM   2290 N NH2   . ARG B 1 77 ? -32.703 -20.661 -7.915  1.00 39.56  ?  165 ARG B NH2   1 
ATOM   2291 H H     . ARG B 1 77 ? -36.276 -23.681 -2.362  1.00 42.27  ?  165 ARG B H     1 
ATOM   2292 H HA    . ARG B 1 77 ? -35.762 -25.133 -4.522  1.00 36.71  ?  165 ARG B HA    1 
ATOM   2293 H HB2   . ARG B 1 77 ? -34.150 -23.085 -3.399  1.00 37.67  ?  165 ARG B HB2   1 
ATOM   2294 H HB3   . ARG B 1 77 ? -34.057 -23.612 -4.893  1.00 37.67  ?  165 ARG B HB3   1 
ATOM   2295 H HG2   . ARG B 1 77 ? -36.533 -22.615 -4.381  1.00 41.59  ?  165 ARG B HG2   1 
ATOM   2296 H HG3   . ARG B 1 77 ? -35.408 -21.512 -4.145  1.00 41.59  ?  165 ARG B HG3   1 
ATOM   2297 H HD2   . ARG B 1 77 ? -35.500 -22.977 -6.541  1.00 38.21  ?  165 ARG B HD2   1 
ATOM   2298 H HD3   . ARG B 1 77 ? -36.311 -21.618 -6.386  1.00 38.21  ?  165 ARG B HD3   1 
ATOM   2299 H HE    . ARG B 1 77 ? -33.970 -20.876 -5.859  1.00 42.52  ?  165 ARG B HE    1 
ATOM   2300 H HH11  . ARG B 1 77 ? -35.016 -22.589 -8.492  1.00 34.78  ?  165 ARG B HH11  1 
ATOM   2301 H HH12  . ARG B 1 77 ? -33.948 -22.125 -9.421  1.00 34.78  ?  165 ARG B HH12  1 
ATOM   2302 H HH21  . ARG B 1 77 ? -32.357 -20.180 -7.291  1.00 47.47  ?  165 ARG B HH21  1 
ATOM   2303 H HH22  . ARG B 1 77 ? -32.345 -20.673 -8.697  1.00 47.47  ?  165 ARG B HH22  1 
ATOM   2304 N N     . HIS B 1 78 ? -33.470 -26.266 -4.031  1.00 30.71  ?  166 HIS B N     1 
ATOM   2305 C CA    . HIS B 1 78 ? -32.513 -27.277 -3.594  1.00 28.43  ?  166 HIS B CA    1 
ATOM   2306 C C     . HIS B 1 78 ? -31.132 -27.079 -4.204  1.00 31.22  ?  166 HIS B C     1 
ATOM   2307 O O     . HIS B 1 78 ? -30.996 -26.856 -5.404  1.00 31.80  ?  166 HIS B O     1 
ATOM   2308 C CB    . HIS B 1 78 ? -33.041 -28.672 -3.926  1.00 24.43  ?  166 HIS B CB    1 
ATOM   2309 C CG    . HIS B 1 78 ? -34.293 -29.027 -3.190  1.00 29.14  ?  166 HIS B CG    1 
ATOM   2310 N ND1   . HIS B 1 78 ? -34.289 -29.747 -2.015  1.00 31.55  ?  166 HIS B ND1   1 
ATOM   2311 C CD2   . HIS B 1 78 ? -35.592 -28.746 -3.453  1.00 32.82  ?  166 HIS B CD2   1 
ATOM   2312 C CE1   . HIS B 1 78 ? -35.530 -29.902 -1.591  1.00 35.50  ?  166 HIS B CE1   1 
ATOM   2313 N NE2   . HIS B 1 78 ? -36.340 -29.303 -2.446  1.00 33.70  ?  166 HIS B NE2   1 
ATOM   2314 H H     . HIS B 1 78 ? -33.428 -26.076 -4.868  1.00 36.85  ?  166 HIS B H     1 
ATOM   2315 H HA    . HIS B 1 78 ? -32.418 -27.219 -2.620  1.00 34.12  ?  166 HIS B HA    1 
ATOM   2316 H HB2   . HIS B 1 78 ? -33.231 -28.717 -4.876  1.00 29.31  ?  166 HIS B HB2   1 
ATOM   2317 H HB3   . HIS B 1 78 ? -32.364 -29.327 -3.695  1.00 29.31  ?  166 HIS B HB3   1 
ATOM   2318 H HD1   . HIS B 1 78 ? -33.588 -30.051 -1.622  1.00 37.86  ?  166 HIS B HD1   1 
ATOM   2319 H HD2   . HIS B 1 78 ? -35.916 -28.268 -4.182  1.00 39.39  ?  166 HIS B HD2   1 
ATOM   2320 H HE1   . HIS B 1 78 ? -35.789 -30.355 -0.821  1.00 42.60  ?  166 HIS B HE1   1 
ATOM   2321 H HE2   . HIS B 1 78 ? -37.197 -29.269 -2.382  1.00 40.44  ?  166 HIS B HE2   1 
ATOM   2322 N N     . MET B 1 79 ? -30.111 -27.164 -3.358  1.00 36.57  ?  167 MET B N     1 
ATOM   2323 C CA    . MET B 1 79 ? -28.727 -27.031 -3.789  1.00 31.05  ?  167 MET B CA    1 
ATOM   2324 C C     . MET B 1 79 ? -28.124 -28.411 -4.019  1.00 34.95  ?  167 MET B C     1 
ATOM   2325 O O     . MET B 1 79 ? -27.697 -29.076 -3.076  1.00 33.99  ?  167 MET B O     1 
ATOM   2326 C CB    . MET B 1 79 ? -27.917 -26.281 -2.729  1.00 29.82  ?  167 MET B CB    1 
ATOM   2327 C CG    . MET B 1 79 ? -26.409 -26.358 -2.922  1.00 38.23  ?  167 MET B CG    1 
ATOM   2328 S SD    . MET B 1 79 ? -25.840 -25.421 -4.348  1.00 41.38  ?  167 MET B SD    1 
ATOM   2329 C CE    . MET B 1 79 ? -25.977 -23.750 -3.731  1.00 31.96  ?  167 MET B CE    1 
ATOM   2330 H H     . MET B 1 79 ? -30.198 -27.302 -2.513  1.00 43.88  ?  167 MET B H     1 
ATOM   2331 H HA    . MET B 1 79 ? -28.694 -26.518 -4.623  1.00 37.26  ?  167 MET B HA    1 
ATOM   2332 H HB2   . MET B 1 79 ? -28.170 -25.345 -2.749  1.00 35.78  ?  167 MET B HB2   1 
ATOM   2333 H HB3   . MET B 1 79 ? -28.123 -26.656 -1.858  1.00 35.78  ?  167 MET B HB3   1 
ATOM   2334 H HG2   . MET B 1 79 ? -25.971 -26.000 -2.134  1.00 45.87  ?  167 MET B HG2   1 
ATOM   2335 H HG3   . MET B 1 79 ? -26.154 -27.285 -3.051  1.00 45.87  ?  167 MET B HG3   1 
ATOM   2336 H HE1   . MET B 1 79 ? -25.695 -23.140 -4.417  1.00 38.35  ?  167 MET B HE1   1 
ATOM   2337 H HE2   . MET B 1 79 ? -26.891 -23.578 -3.495  1.00 38.35  ?  167 MET B HE2   1 
ATOM   2338 H HE3   . MET B 1 79 ? -25.415 -23.656 -2.958  1.00 38.35  ?  167 MET B HE3   1 
ATOM   2339 N N     . ILE B 1 80 ? -28.100 -28.844 -5.276  1.00 37.96  ?  168 ILE B N     1 
ATOM   2340 C CA    . ILE B 1 80 ? -27.510 -30.130 -5.627  1.00 36.47  ?  168 ILE B CA    1 
ATOM   2341 C C     . ILE B 1 80 ? -26.307 -29.939 -6.547  1.00 32.79  ?  168 ILE B C     1 
ATOM   2342 O O     . ILE B 1 80 ? -26.435 -29.413 -7.652  1.00 31.75  ?  168 ILE B O     1 
ATOM   2343 C CB    . ILE B 1 80 ? -28.542 -31.055 -6.303  1.00 36.63  ?  168 ILE B CB    1 
ATOM   2344 C CG1   . ILE B 1 80 ? -29.755 -31.246 -5.387  1.00 34.41  ?  168 ILE B CG1   1 
ATOM   2345 C CG2   . ILE B 1 80 ? -27.912 -32.399 -6.648  1.00 41.48  ?  168 ILE B CG2   1 
ATOM   2346 C CD1   . ILE B 1 80 ? -30.867 -32.076 -5.994  1.00 31.17  ?  168 ILE B CD1   1 
ATOM   2347 H H     . ILE B 1 80 ? -28.421 -28.410 -5.945  1.00 45.56  ?  168 ILE B H     1 
ATOM   2348 H HA    . ILE B 1 80 ? -27.198 -30.571 -4.809  1.00 43.77  ?  168 ILE B HA    1 
ATOM   2349 H HB    . ILE B 1 80 ? -28.841 -30.635 -7.125  1.00 43.96  ?  168 ILE B HB    1 
ATOM   2350 H HG12  . ILE B 1 80 ? -29.465 -31.690 -4.575  1.00 41.29  ?  168 ILE B HG12  1 
ATOM   2351 H HG13  . ILE B 1 80 ? -30.122 -30.375 -5.170  1.00 41.29  ?  168 ILE B HG13  1 
ATOM   2352 H HG21  . ILE B 1 80 ? -28.573 -32.956 -7.067  1.00 49.77  ?  168 ILE B HG21  1 
ATOM   2353 H HG22  . ILE B 1 80 ? -27.177 -32.255 -7.249  1.00 49.77  ?  168 ILE B HG22  1 
ATOM   2354 H HG23  . ILE B 1 80 ? -27.598 -32.813 -5.841  1.00 49.77  ?  168 ILE B HG23  1 
ATOM   2355 H HD11  . ILE B 1 80 ? -31.584 -32.147 -5.360  1.00 37.41  ?  168 ILE B HD11  1 
ATOM   2356 H HD12  . ILE B 1 80 ? -31.177 -31.644 -6.793  1.00 37.41  ?  168 ILE B HD12  1 
ATOM   2357 H HD13  . ILE B 1 80 ? -30.526 -32.948 -6.203  1.00 37.41  ?  168 ILE B HD13  1 
ATOM   2358 N N     . ASP B 1 81 ? -25.137 -30.358 -6.073  1.00 32.40  ?  169 ASP B N     1 
ATOM   2359 C CA    . ASP B 1 81 ? -23.895 -30.240 -6.836  1.00 43.94  ?  169 ASP B CA    1 
ATOM   2360 C C     . ASP B 1 81 ? -23.662 -28.825 -7.371  1.00 44.50  ?  169 ASP B C     1 
ATOM   2361 O O     . ASP B 1 81 ? -23.294 -28.644 -8.532  1.00 41.98  ?  169 ASP B O     1 
ATOM   2362 C CB    . ASP B 1 81 ? -23.874 -31.255 -7.984  1.00 43.23  ?  169 ASP B CB    1 
ATOM   2363 C CG    . ASP B 1 81 ? -23.248 -32.578 -7.583  1.00 61.49  ?  169 ASP B CG    1 
ATOM   2364 O OD1   . ASP B 1 81 ? -22.003 -32.682 -7.613  1.00 58.55  ?  169 ASP B OD1   1 
ATOM   2365 O OD2   . ASP B 1 81 ? -24.001 -33.516 -7.245  1.00 59.55  -1 169 ASP B OD2   1 
ATOM   2366 H H     . ASP B 1 81 ? -25.034 -30.720 -5.300  1.00 38.89  ?  169 ASP B H     1 
ATOM   2367 H HA    . ASP B 1 81 ? -23.146 -30.454 -6.241  1.00 52.72  ?  169 ASP B HA    1 
ATOM   2368 H HB2   . ASP B 1 81 ? -24.785 -31.429 -8.270  1.00 51.88  ?  169 ASP B HB2   1 
ATOM   2369 H HB3   . ASP B 1 81 ? -23.359 -30.890 -8.720  1.00 51.88  ?  169 ASP B HB3   1 
ATOM   2370 N N     . GLY B 1 82 ? -23.876 -27.824 -6.522  1.00 37.75  ?  170 GLY B N     1 
ATOM   2371 C CA    . GLY B 1 82 ? -23.550 -26.450 -6.863  1.00 30.88  ?  170 GLY B CA    1 
ATOM   2372 C C     . GLY B 1 82 ? -24.500 -25.812 -7.860  1.00 36.20  ?  170 GLY B C     1 
ATOM   2373 O O     . GLY B 1 82 ? -24.120 -24.892 -8.584  1.00 38.14  ?  170 GLY B O     1 
ATOM   2374 H H     . GLY B 1 82 ? -24.212 -27.919 -5.736  1.00 45.30  ?  170 GLY B H     1 
ATOM   2375 H HA2   . GLY B 1 82 ? -23.556 -25.913 -6.055  1.00 37.06  ?  170 GLY B HA2   1 
ATOM   2376 H HA3   . GLY B 1 82 ? -22.656 -26.420 -7.238  1.00 37.06  ?  170 GLY B HA3   1 
ATOM   2377 N N     . ARG B 1 83 ? -25.733 -26.303 -7.904  1.00 30.96  ?  171 ARG B N     1 
ATOM   2378 C CA    . ARG B 1 83 ? -26.770 -25.691 -8.728  1.00 36.39  ?  171 ARG B CA    1 
ATOM   2379 C C     . ARG B 1 83 ? -28.111 -25.734 -8.012  1.00 36.54  ?  171 ARG B C     1 
ATOM   2380 O O     . ARG B 1 83 ? -28.441 -26.718 -7.351  1.00 41.08  ?  171 ARG B O     1 
ATOM   2381 C CB    . ARG B 1 83 ? -26.890 -26.393 -10.083 1.00 39.15  ?  171 ARG B CB    1 
ATOM   2382 C CG    . ARG B 1 83 ? -25.784 -26.053 -11.071 1.00 34.99  ?  171 ARG B CG    1 
ATOM   2383 C CD    . ARG B 1 83 ? -26.089 -26.621 -12.452 1.00 34.76  ?  171 ARG B CD    1 
ATOM   2384 N NE    . ARG B 1 83 ? -27.308 -26.044 -13.015 1.00 32.18  ?  171 ARG B NE    1 
ATOM   2385 C CZ    . ARG B 1 83 ? -27.354 -24.928 -13.738 1.00 37.93  ?  171 ARG B CZ    1 
ATOM   2386 N NH1   . ARG B 1 83 ? -26.247 -24.245 -14.004 1.00 37.82  1  171 ARG B NH1   1 
ATOM   2387 N NH2   . ARG B 1 83 ? -28.515 -24.490 -14.203 1.00 42.32  ?  171 ARG B NH2   1 
ATOM   2388 H H     . ARG B 1 83 ? -25.997 -26.993 -7.465  1.00 37.15  ?  171 ARG B H     1 
ATOM   2389 H HA    . ARG B 1 83 ? -26.540 -24.752 -8.889  1.00 43.66  ?  171 ARG B HA    1 
ATOM   2390 H HB2   . ARG B 1 83 ? -26.870 -27.352 -9.938  1.00 46.97  ?  171 ARG B HB2   1 
ATOM   2391 H HB3   . ARG B 1 83 ? -27.734 -26.142 -10.489 1.00 46.97  ?  171 ARG B HB3   1 
ATOM   2392 H HG2   . ARG B 1 83 ? -25.706 -25.089 -11.148 1.00 41.99  ?  171 ARG B HG2   1 
ATOM   2393 H HG3   . ARG B 1 83 ? -24.948 -26.436 -10.762 1.00 41.99  ?  171 ARG B HG3   1 
ATOM   2394 H HD2   . ARG B 1 83 ? -25.353 -26.418 -13.051 1.00 41.71  ?  171 ARG B HD2   1 
ATOM   2395 H HD3   . ARG B 1 83 ? -26.211 -27.581 -12.383 1.00 41.71  ?  171 ARG B HD3   1 
ATOM   2396 H HE    . ARG B 1 83 ? -28.049 -26.455 -12.868 1.00 38.61  ?  171 ARG B HE    1 
ATOM   2397 H HH11  . ARG B 1 83 ? -25.489 -24.522 -13.706 1.00 45.38  ?  171 ARG B HH11  1 
ATOM   2398 H HH12  . ARG B 1 83 ? -26.288 -23.526 -14.472 1.00 45.38  ?  171 ARG B HH12  1 
ATOM   2399 H HH21  . ARG B 1 83 ? -29.237 -24.926 -14.036 1.00 50.79  ?  171 ARG B HH21  1 
ATOM   2400 H HH22  . ARG B 1 83 ? -28.547 -23.769 -14.671 1.00 50.79  ?  171 ARG B HH22  1 
ATOM   2401 N N     . TRP B 1 84 ? -28.884 -24.663 -8.146  1.00 34.06  ?  172 TRP B N     1 
ATOM   2402 C CA    . TRP B 1 84 ? -30.205 -24.607 -7.540  1.00 28.22  ?  172 TRP B CA    1 
ATOM   2403 C C     . TRP B 1 84 ? -31.209 -25.345 -8.412  1.00 34.40  ?  172 TRP B C     1 
ATOM   2404 O O     . TRP B 1 84 ? -31.373 -25.035 -9.592  1.00 27.56  ?  172 TRP B O     1 
ATOM   2405 C CB    . TRP B 1 84 ? -30.634 -23.159 -7.312  1.00 31.45  ?  172 TRP B CB    1 
ATOM   2406 C CG    . TRP B 1 84 ? -29.816 -22.491 -6.253  1.00 28.28  ?  172 TRP B CG    1 
ATOM   2407 C CD1   . TRP B 1 84 ? -28.787 -21.618 -6.439  1.00 30.22  ?  172 TRP B CD1   1 
ATOM   2408 C CD2   . TRP B 1 84 ? -29.946 -22.664 -4.839  1.00 29.97  ?  172 TRP B CD2   1 
ATOM   2409 N NE1   . TRP B 1 84 ? -28.272 -21.227 -5.227  1.00 33.35  ?  172 TRP B NE1   1 
ATOM   2410 C CE2   . TRP B 1 84 ? -28.968 -21.856 -4.228  1.00 26.77  ?  172 TRP B CE2   1 
ATOM   2411 C CE3   . TRP B 1 84 ? -30.798 -23.420 -4.029  1.00 33.81  ?  172 TRP B CE3   1 
ATOM   2412 C CZ2   . TRP B 1 84 ? -28.818 -21.782 -2.847  1.00 33.23  ?  172 TRP B CZ2   1 
ATOM   2413 C CZ3   . TRP B 1 84 ? -30.648 -23.345 -2.656  1.00 28.67  ?  172 TRP B CZ3   1 
ATOM   2414 C CH2   . TRP B 1 84 ? -29.665 -22.533 -2.080  1.00 36.45  ?  172 TRP B CH2   1 
ATOM   2415 H H     . TRP B 1 84 ? -28.666 -23.956 -8.584  1.00 40.88  ?  172 TRP B H     1 
ATOM   2416 H HA    . TRP B 1 84 ? -30.175 -25.055 -6.669  1.00 33.87  ?  172 TRP B HA    1 
ATOM   2417 H HB2   . TRP B 1 84 ? -30.525 -22.661 -8.137  1.00 37.74  ?  172 TRP B HB2   1 
ATOM   2418 H HB3   . TRP B 1 84 ? -31.563 -23.143 -7.032  1.00 37.74  ?  172 TRP B HB3   1 
ATOM   2419 H HD1   . TRP B 1 84 ? -28.480 -21.326 -7.266  1.00 36.26  ?  172 TRP B HD1   1 
ATOM   2420 H HE1   . TRP B 1 84 ? -27.621 -20.677 -5.113  1.00 40.02  ?  172 TRP B HE1   1 
ATOM   2421 H HE3   . TRP B 1 84 ? -31.453 -23.962 -4.406  1.00 40.57  ?  172 TRP B HE3   1 
ATOM   2422 H HZ2   . TRP B 1 84 ? -28.166 -21.243 -2.460  1.00 39.88  ?  172 TRP B HZ2   1 
ATOM   2423 H HZ3   . TRP B 1 84 ? -31.209 -23.843 -2.107  1.00 34.40  ?  172 TRP B HZ3   1 
ATOM   2424 H HH2   . TRP B 1 84 ? -29.588 -22.502 -1.154  1.00 43.74  ?  172 TRP B HH2   1 
ATOM   2425 N N     . CYS B 1 85 ? -31.871 -26.330 -7.816  1.00 32.42  ?  173 CYS B N     1 
ATOM   2426 C CA    . CYS B 1 85 ? -32.811 -27.173 -8.532  1.00 31.99  ?  173 CYS B CA    1 
ATOM   2427 C C     . CYS B 1 85 ? -34.209 -27.001 -7.958  1.00 32.63  ?  173 CYS B C     1 
ATOM   2428 O O     . CYS B 1 85 ? -34.372 -26.642 -6.793  1.00 32.16  ?  173 CYS B O     1 
ATOM   2429 C CB    . CYS B 1 85 ? -32.370 -28.633 -8.442  1.00 31.36  ?  173 CYS B CB    1 
ATOM   2430 S SG    . CYS B 1 85 ? -30.759 -28.943 -9.193  1.00 34.11  ?  173 CYS B SG    1 
ATOM   2431 H H     . CYS B 1 85 ? -31.789 -26.531 -6.984  1.00 38.91  ?  173 CYS B H     1 
ATOM   2432 H HA    . CYS B 1 85 ? -32.829 -26.912 -9.477  1.00 38.39  ?  173 CYS B HA    1 
ATOM   2433 H HB2   . CYS B 1 85 ? -32.317 -28.888 -7.508  1.00 37.63  ?  173 CYS B HB2   1 
ATOM   2434 H HB3   . CYS B 1 85 ? -33.023 -29.187 -8.898  1.00 37.63  ?  173 CYS B HB3   1 
ATOM   2435 H HG    . CYS B 1 85 ? -29.933 -28.277 -8.634  1.00 40.93  ?  173 CYS B HG    1 
ATOM   2436 N N     . ASP B 1 86 ? -35.215 -27.262 -8.785  1.00 26.08  ?  174 ASP B N     1 
ATOM   2437 C CA    . ASP B 1 86 ? -36.600 -27.017 -8.413  1.00 26.37  ?  174 ASP B CA    1 
ATOM   2438 C C     . ASP B 1 86 ? -37.428 -28.288 -8.521  1.00 30.46  ?  174 ASP B C     1 
ATOM   2439 O O     . ASP B 1 86 ? -37.184 -29.124 -9.388  1.00 41.31  ?  174 ASP B O     1 
ATOM   2440 C CB    . ASP B 1 86 ? -37.192 -25.934 -9.314  1.00 33.80  ?  174 ASP B CB    1 
ATOM   2441 C CG    . ASP B 1 86 ? -36.683 -24.554 -8.970  1.00 31.21  ?  174 ASP B CG    1 
ATOM   2442 O OD1   . ASP B 1 86 ? -36.820 -24.153 -7.798  1.00 30.76  ?  174 ASP B OD1   1 
ATOM   2443 O OD2   . ASP B 1 86 ? -36.138 -23.875 -9.865  1.00 38.82  -1 174 ASP B OD2   1 
ATOM   2444 H H     . ASP B 1 86 ? -35.119 -27.586 -9.576  1.00 31.29  ?  174 ASP B H     1 
ATOM   2445 H HA    . ASP B 1 86 ? -36.637 -26.702 -7.485  1.00 31.65  ?  174 ASP B HA    1 
ATOM   2446 H HB2   . ASP B 1 86 ? -36.952 -26.122 -10.234 1.00 40.55  ?  174 ASP B HB2   1 
ATOM   2447 H HB3   . ASP B 1 86 ? -38.156 -25.932 -9.215  1.00 40.55  ?  174 ASP B HB3   1 
ATOM   2448 N N     . CYS B 1 87 ? -38.409 -28.427 -7.637  1.00 31.81  ?  175 CYS B N     1 
ATOM   2449 C CA    . CYS B 1 87 ? -39.281 -29.593 -7.644  1.00 39.60  ?  175 CYS B CA    1 
ATOM   2450 C C     . CYS B 1 87 ? -40.737 -29.176 -7.822  1.00 46.83  ?  175 CYS B C     1 
ATOM   2451 O O     . CYS B 1 87 ? -41.263 -28.369 -7.055  1.00 41.16  ?  175 CYS B O     1 
ATOM   2452 C CB    . CYS B 1 87 ? -39.110 -30.397 -6.353  1.00 35.88  ?  175 CYS B CB    1 
ATOM   2453 S SG    . CYS B 1 87 ? -37.453 -31.095 -6.147  1.00 45.30  ?  175 CYS B SG    1 
ATOM   2454 H H     . CYS B 1 87 ? -38.591 -27.857 -7.020  1.00 38.18  ?  175 CYS B H     1 
ATOM   2455 H HA    . CYS B 1 87 ? -39.037 -30.171 -8.397  1.00 47.52  ?  175 CYS B HA    1 
ATOM   2456 H HB2   . CYS B 1 87 ? -39.283 -29.815 -5.596  1.00 43.06  ?  175 CYS B HB2   1 
ATOM   2457 H HB3   . CYS B 1 87 ? -39.743 -31.132 -6.355  1.00 43.06  ?  175 CYS B HB3   1 
ATOM   2458 H HG    . CYS B 1 87 ? -37.411 -31.705 -5.115  1.00 54.36  ?  175 CYS B HG    1 
ATOM   2459 N N     . LYS B 1 88 ? -41.378 -29.731 -8.846  1.00 51.66  ?  176 LYS B N     1 
ATOM   2460 C CA    . LYS B 1 88 ? -42.769 -29.421 -9.147  1.00 46.14  ?  176 LYS B CA    1 
ATOM   2461 C C     . LYS B 1 88 ? -43.518 -30.678 -9.554  1.00 44.64  ?  176 LYS B C     1 
ATOM   2462 O O     . LYS B 1 88 ? -42.939 -31.760 -9.647  1.00 44.61  ?  176 LYS B O     1 
ATOM   2463 C CB    . LYS B 1 88 ? -42.853 -28.429 -10.303 1.00 43.98  ?  176 LYS B CB    1 
ATOM   2464 C CG    . LYS B 1 88 ? -41.991 -27.197 -10.151 1.00 40.50  ?  176 LYS B CG    1 
ATOM   2465 C CD    . LYS B 1 88 ? -42.162 -26.292 -11.358 1.00 38.99  ?  176 LYS B CD    1 
ATOM   2466 C CE    . LYS B 1 88 ? -41.427 -24.978 -11.192 1.00 37.08  ?  176 LYS B CE    1 
ATOM   2467 N NZ    . LYS B 1 88 ? -41.467 -24.178 -12.444 1.00 46.92  1  176 LYS B NZ    1 
ATOM   2468 H H     . LYS B 1 88 ? -41.023 -30.297 -9.388  1.00 61.99  ?  176 LYS B H     1 
ATOM   2469 H HA    . LYS B 1 88 ? -43.204 -29.032 -8.360  1.00 55.37  ?  176 LYS B HA    1 
ATOM   2470 H HB2   . LYS B 1 88 ? -42.579 -28.879 -11.117 1.00 52.78  ?  176 LYS B HB2   1 
ATOM   2471 H HB3   . LYS B 1 88 ? -43.773 -28.133 -10.389 1.00 52.78  ?  176 LYS B HB3   1 
ATOM   2472 H HG2   . LYS B 1 88 ? -42.259 -26.708 -9.358  1.00 48.60  ?  176 LYS B HG2   1 
ATOM   2473 H HG3   . LYS B 1 88 ? -41.058 -27.458 -10.091 1.00 48.60  ?  176 LYS B HG3   1 
ATOM   2474 H HD2   . LYS B 1 88 ? -41.809 -26.739 -12.144 1.00 46.79  ?  176 LYS B HD2   1 
ATOM   2475 H HD3   . LYS B 1 88 ? -43.105 -26.098 -11.479 1.00 46.79  ?  176 LYS B HD3   1 
ATOM   2476 H HE2   . LYS B 1 88 ? -41.847 -24.462 -10.486 1.00 44.50  ?  176 LYS B HE2   1 
ATOM   2477 H HE3   . LYS B 1 88 ? -40.498 -25.155 -10.973 1.00 44.50  ?  176 LYS B HE3   1 
ATOM   2478 H HZ1   . LYS B 1 88 ? -41.031 -23.410 -12.329 1.00 56.31  ?  176 LYS B HZ1   1 
ATOM   2479 H HZ2   . LYS B 1 88 ? -41.084 -24.631 -13.107 1.00 56.31  ?  176 LYS B HZ2   1 
ATOM   2480 H HZ3   . LYS B 1 88 ? -42.311 -24.001 -12.665 1.00 56.31  ?  176 LYS B HZ3   1 
ATOM   2481 N N     . LEU B 1 89 ? -44.812 -30.523 -9.807  1.00 41.73  ?  177 LEU B N     1 
ATOM   2482 C CA    . LEU B 1 89 ? -45.589 -31.574 -10.440 1.00 41.10  ?  177 LEU B CA    1 
ATOM   2483 C C     . LEU B 1 89 ? -45.370 -31.479 -11.944 1.00 46.98  ?  177 LEU B C     1 
ATOM   2484 O O     . LEU B 1 89 ? -45.579 -30.419 -12.533 1.00 53.85  ?  177 LEU B O     1 
ATOM   2485 C CB    . LEU B 1 89 ? -47.075 -31.414 -10.123 1.00 43.81  ?  177 LEU B CB    1 
ATOM   2486 C CG    . LEU B 1 89 ? -47.458 -31.388 -8.643  1.00 53.55  ?  177 LEU B CG    1 
ATOM   2487 C CD1   . LEU B 1 89 ? -48.929 -31.040 -8.503  1.00 53.06  ?  177 LEU B CD1   1 
ATOM   2488 C CD2   . LEU B 1 89 ? -47.151 -32.724 -7.984  1.00 43.16  ?  177 LEU B CD2   1 
ATOM   2489 H H     . LEU B 1 89 ? -45.264 -29.815 -9.621  1.00 50.08  ?  177 LEU B H     1 
ATOM   2490 H HA    . LEU B 1 89 ? -45.286 -32.452 -10.127 1.00 49.32  ?  177 LEU B HA    1 
ATOM   2491 H HB2   . LEU B 1 89 ? -47.380 -30.581 -10.513 1.00 52.57  ?  177 LEU B HB2   1 
ATOM   2492 H HB3   . LEU B 1 89 ? -47.553 -32.153 -10.530 1.00 52.57  ?  177 LEU B HB3   1 
ATOM   2493 H HG    . LEU B 1 89 ? -46.940 -30.703 -8.192  1.00 64.25  ?  177 LEU B HG    1 
ATOM   2494 H HD11  . LEU B 1 89 ? -49.159 -31.026 -7.571  1.00 63.68  ?  177 LEU B HD11  1 
ATOM   2495 H HD12  . LEU B 1 89 ? -49.084 -30.175 -8.891  1.00 63.68  ?  177 LEU B HD12  1 
ATOM   2496 H HD13  . LEU B 1 89 ? -49.452 -31.702 -8.960  1.00 63.68  ?  177 LEU B HD13  1 
ATOM   2497 H HD21  . LEU B 1 89 ? -47.401 -32.680 -7.058  1.00 51.79  ?  177 LEU B HD21  1 
ATOM   2498 H HD22  . LEU B 1 89 ? -47.653 -33.413 -8.426  1.00 51.79  ?  177 LEU B HD22  1 
ATOM   2499 H HD23  . LEU B 1 89 ? -46.211 -32.902 -8.061  1.00 51.79  ?  177 LEU B HD23  1 
ATOM   2500 N N     . PRO B 1 90 ? -44.941 -32.581 -12.574 1.00 47.73  ?  178 PRO B N     1 
ATOM   2501 C CA    . PRO B 1 90 ? -44.724 -32.564 -14.025 1.00 56.54  ?  178 PRO B CA    1 
ATOM   2502 C C     . PRO B 1 90 ? -45.976 -32.142 -14.790 1.00 62.06  ?  178 PRO B C     1 
ATOM   2503 O O     . PRO B 1 90 ? -47.060 -32.080 -14.212 1.00 66.12  ?  178 PRO B O     1 
ATOM   2504 C CB    . PRO B 1 90 ? -44.359 -34.018 -14.348 1.00 53.35  ?  178 PRO B CB    1 
ATOM   2505 C CG    . PRO B 1 90 ? -44.830 -34.817 -13.174 1.00 54.35  ?  178 PRO B CG    1 
ATOM   2506 C CD    . PRO B 1 90 ? -44.703 -33.913 -11.995 1.00 47.41  ?  178 PRO B CD    1 
ATOM   2507 H HA    . PRO B 1 90 ? -43.977 -31.974 -14.258 1.00 67.85  ?  178 PRO B HA    1 
ATOM   2508 H HB2   . PRO B 1 90 ? -44.815 -34.297 -15.157 1.00 64.02  ?  178 PRO B HB2   1 
ATOM   2509 H HB3   . PRO B 1 90 ? -43.398 -34.097 -14.452 1.00 64.02  ?  178 PRO B HB3   1 
ATOM   2510 H HG2   . PRO B 1 90 ? -45.756 -35.077 -13.307 1.00 65.21  ?  178 PRO B HG2   1 
ATOM   2511 H HG3   . PRO B 1 90 ? -44.268 -35.600 -13.066 1.00 65.21  ?  178 PRO B HG3   1 
ATOM   2512 H HD2   . PRO B 1 90 ? -45.381 -34.121 -11.333 1.00 56.89  ?  178 PRO B HD2   1 
ATOM   2513 H HD3   . PRO B 1 90 ? -43.810 -33.966 -11.621 1.00 56.89  ?  178 PRO B HD3   1 
ATOM   2514 N N     . ASN B 1 91 ? -45.819 -31.857 -16.078 1.00 64.67  ?  179 ASN B N     1 
ATOM   2515 C CA    . ASN B 1 91 ? -46.928 -31.406 -16.909 1.00 65.71  ?  179 ASN B CA    1 
ATOM   2516 C C     . ASN B 1 91 ? -47.595 -32.567 -17.637 1.00 71.15  ?  179 ASN B C     1 
ATOM   2517 O O     . ASN B 1 91 ? -47.006 -33.168 -18.534 1.00 71.10  ?  179 ASN B O     1 
ATOM   2518 C CB    . ASN B 1 91 ? -46.433 -30.373 -17.922 1.00 71.59  ?  179 ASN B CB    1 
ATOM   2519 C CG    . ASN B 1 91 ? -45.606 -29.277 -17.278 1.00 73.33  ?  179 ASN B CG    1 
ATOM   2520 O OD1   . ASN B 1 91 ? -45.722 -29.020 -16.080 1.00 73.66  ?  179 ASN B OD1   1 
ATOM   2521 N ND2   . ASN B 1 91 ? -44.763 -28.625 -18.071 1.00 59.43  ?  179 ASN B ND2   1 
ATOM   2522 H H     . ASN B 1 91 ? -45.071 -31.917 -16.499 1.00 77.60  ?  179 ASN B H     1 
ATOM   2523 H HA    . ASN B 1 91 ? -47.601 -30.976 -16.340 1.00 78.85  ?  179 ASN B HA    1 
ATOM   2524 H HB2   . ASN B 1 91 ? -45.880 -30.818 -18.583 1.00 85.91  ?  179 ASN B HB2   1 
ATOM   2525 H HB3   . ASN B 1 91 ? -47.197 -29.959 -18.352 1.00 85.91  ?  179 ASN B HB3   1 
ATOM   2526 H HD21  . ASN B 1 91 ? -44.708 -28.833 -18.904 1.00 71.32  ?  179 ASN B HD21  1 
ATOM   2527 H HD22  . ASN B 1 91 ? -44.272 -27.995 -17.752 1.00 71.32  ?  179 ASN B HD22  1 
ATOM   2528 O "O5'" . DG  C 2 1  ? -28.378 -10.782 -11.069 1.00 30.90  ?  1   DG  C "O5'" 1 
ATOM   2529 C "C5'" . DG  C 2 1  ? -27.385 -10.254 -10.198 1.00 33.69  ?  1   DG  C "C5'" 1 
ATOM   2530 C "C4'" . DG  C 2 1  ? -28.024 -9.546  -9.017  1.00 39.88  ?  1   DG  C "C4'" 1 
ATOM   2531 O "O4'" . DG  C 2 1  ? -28.589 -8.279  -9.443  1.00 37.39  ?  1   DG  C "O4'" 1 
ATOM   2532 C "C3'" . DG  C 2 1  ? -29.159 -10.308 -8.348  1.00 30.71  ?  1   DG  C "C3'" 1 
ATOM   2533 O "O3'" . DG  C 2 1  ? -29.099 -10.063 -6.956  1.00 22.73  ?  1   DG  C "O3'" 1 
ATOM   2534 C "C2'" . DG  C 2 1  ? -30.405 -9.691  -8.976  1.00 23.75  ?  1   DG  C "C2'" 1 
ATOM   2535 C "C1'" . DG  C 2 1  ? -29.968 -8.238  -9.128  1.00 28.90  ?  1   DG  C "C1'" 1 
ATOM   2536 N N9    . DG  C 2 1  ? -30.661 -7.503  -10.185 1.00 26.56  ?  1   DG  C N9    1 
ATOM   2537 C C8    . DG  C 2 1  ? -31.300 -6.293  -10.066 1.00 28.25  ?  1   DG  C C8    1 
ATOM   2538 N N7    . DG  C 2 1  ? -31.831 -5.873  -11.180 1.00 31.39  ?  1   DG  C N7    1 
ATOM   2539 C C5    . DG  C 2 1  ? -31.529 -6.868  -12.098 1.00 31.93  ?  1   DG  C C5    1 
ATOM   2540 C C6    . DG  C 2 1  ? -31.849 -6.962  -13.473 1.00 39.59  ?  1   DG  C C6    1 
ATOM   2541 O O6    . DG  C 2 1  ? -32.482 -6.156  -14.169 1.00 41.49  ?  1   DG  C O6    1 
ATOM   2542 N N1    . DG  C 2 1  ? -31.353 -8.134  -14.039 1.00 32.35  ?  1   DG  C N1    1 
ATOM   2543 C C2    . DG  C 2 1  ? -30.639 -9.092  -13.359 1.00 33.53  ?  1   DG  C C2    1 
ATOM   2544 N N2    . DG  C 2 1  ? -30.245 -10.156 -14.076 1.00 36.68  ?  1   DG  C N2    1 
ATOM   2545 N N3    . DG  C 2 1  ? -30.332 -9.015  -12.068 1.00 35.03  ?  1   DG  C N3    1 
ATOM   2546 C C4    . DG  C 2 1  ? -30.808 -7.879  -11.503 1.00 30.11  ?  1   DG  C C4    1 
ATOM   2547 P P     . DT  C 2 2  ? -28.219 -11.019 -6.010  1.00 37.86  ?  2   DT  C P     1 
ATOM   2548 O OP1   . DT  C 2 2  ? -27.716 -10.201 -4.878  1.00 34.23  ?  2   DT  C OP1   1 
ATOM   2549 O OP2   . DT  C 2 2  ? -27.260 -11.743 -6.879  1.00 35.22  -1 2   DT  C OP2   1 
ATOM   2550 O "O5'" . DT  C 2 2  ? -29.277 -12.086 -5.458  1.00 29.15  ?  2   DT  C "O5'" 1 
ATOM   2551 C "C5'" . DT  C 2 2  ? -30.502 -11.627 -4.907  1.00 21.94  ?  2   DT  C "C5'" 1 
ATOM   2552 C "C4'" . DT  C 2 2  ? -31.429 -12.799 -4.655  1.00 29.92  ?  2   DT  C "C4'" 1 
ATOM   2553 O "O4'" . DT  C 2 2  ? -31.766 -13.426 -5.917  1.00 27.26  ?  2   DT  C "O4'" 1 
ATOM   2554 C "C3'" . DT  C 2 2  ? -30.844 -13.889 -3.764  1.00 32.61  ?  2   DT  C "C3'" 1 
ATOM   2555 O "O3'" . DT  C 2 2  ? -31.812 -14.271 -2.796  1.00 37.15  ?  2   DT  C "O3'" 1 
ATOM   2556 C "C2'" . DT  C 2 2  ? -30.509 -15.029 -4.723  1.00 23.58  ?  2   DT  C "C2'" 1 
ATOM   2557 C "C1'" . DT  C 2 2  ? -31.484 -14.810 -5.875  1.00 21.48  ?  2   DT  C "C1'" 1 
ATOM   2558 N N1    . DT  C 2 2  ? -30.925 -15.202 -7.200  1.00 28.20  ?  2   DT  C N1    1 
ATOM   2559 C C2    . DT  C 2 2  ? -31.636 -16.057 -8.013  1.00 26.97  ?  2   DT  C C2    1 
ATOM   2560 O O2    . DT  C 2 2  ? -32.718 -16.519 -7.709  1.00 33.69  ?  2   DT  C O2    1 
ATOM   2561 N N3    . DT  C 2 2  ? -31.030 -16.349 -9.207  1.00 26.75  ?  2   DT  C N3    1 
ATOM   2562 C C4    . DT  C 2 2  ? -29.809 -15.882 -9.656  1.00 30.47  ?  2   DT  C C4    1 
ATOM   2563 O O4    . DT  C 2 2  ? -29.345 -16.202 -10.747 1.00 36.61  ?  2   DT  C O4    1 
ATOM   2564 C C5    . DT  C 2 2  ? -29.118 -14.993 -8.754  1.00 35.09  ?  2   DT  C C5    1 
ATOM   2565 C C7    . DT  C 2 2  ? -27.784 -14.424 -9.136  1.00 37.89  ?  2   DT  C C7    1 
ATOM   2566 C C6    . DT  C 2 2  ? -29.699 -14.698 -7.584  1.00 26.85  ?  2   DT  C C6    1 
ATOM   2567 P P     . DT  C 2 3  ? -31.383 -14.465 -1.259  1.00 33.07  ?  3   DT  C P     1 
ATOM   2568 O OP1   . DT  C 2 3  ? -32.414 -13.812 -0.418  1.00 48.07  ?  3   DT  C OP1   1 
ATOM   2569 O OP2   . DT  C 2 3  ? -29.966 -14.045 -1.140  1.00 29.92  -1 3   DT  C OP2   1 
ATOM   2570 O "O5'" . DT  C 2 3  ? -31.447 -16.050 -1.042  1.00 25.28  ?  3   DT  C "O5'" 1 
ATOM   2571 C "C5'" . DT  C 2 3  ? -30.738 -16.877 -1.949  1.00 32.14  ?  3   DT  C "C5'" 1 
ATOM   2572 C "C4'" . DT  C 2 3  ? -30.645 -18.310 -1.468  1.00 30.51  ?  3   DT  C "C4'" 1 
ATOM   2573 O "O4'" . DT  C 2 3  ? -29.557 -18.938 -2.183  1.00 30.02  ?  3   DT  C "O4'" 1 
ATOM   2574 C "C3'" . DT  C 2 3  ? -30.220 -18.497 -0.027  1.00 26.51  ?  3   DT  C "C3'" 1 
ATOM   2575 O "O3'" . DT  C 2 3  ? -30.297 -19.877 0.292   1.00 44.48  ?  3   DT  C "O3'" 1 
ATOM   2576 C "C2'" . DT  C 2 3  ? -28.768 -18.058 -0.132  1.00 34.67  ?  3   DT  C "C2'" 1 
ATOM   2577 C "C1'" . DT  C 2 3  ? -28.367 -18.742 -1.439  1.00 31.62  ?  3   DT  C "C1'" 1 
ATOM   2578 N N1    . DT  C 2 3  ? -27.430 -17.937 -2.266  1.00 31.12  ?  3   DT  C N1    1 
ATOM   2579 C C2    . DT  C 2 3  ? -26.420 -18.577 -2.951  1.00 35.19  ?  3   DT  C C2    1 
ATOM   2580 O O2    . DT  C 2 3  ? -26.245 -19.782 -2.923  1.00 33.32  ?  3   DT  C O2    1 
ATOM   2581 N N3    . DT  C 2 3  ? -25.612 -17.747 -3.682  1.00 27.09  ?  3   DT  C N3    1 
ATOM   2582 C C4    . DT  C 2 3  ? -25.717 -16.376 -3.788  1.00 26.56  ?  3   DT  C C4    1 
ATOM   2583 O O4    . DT  C 2 3  ? -24.939 -15.727 -4.472  1.00 35.36  ?  3   DT  C O4    1 
ATOM   2584 C C5    . DT  C 2 3  ? -26.792 -15.768 -3.046  1.00 25.83  ?  3   DT  C C5    1 
ATOM   2585 C C7    . DT  C 2 3  ? -26.995 -14.283 -3.092  1.00 26.22  ?  3   DT  C C7    1 
ATOM   2586 C C6    . DT  C 2 3  ? -27.590 -16.568 -2.327  1.00 29.47  ?  3   DT  C C6    1 
ATOM   2587 P P     . DG  C 2 4  ? -30.618 -20.348 1.795   1.00 42.69  ?  4   DG  C P     1 
ATOM   2588 O OP1   . DG  C 2 4  ? -31.154 -21.726 1.718   1.00 33.42  ?  4   DG  C OP1   1 
ATOM   2589 O OP2   . DG  C 2 4  ? -31.412 -19.280 2.442   1.00 39.15  -1 4   DG  C OP2   1 
ATOM   2590 O "O5'" . DG  C 2 4  ? -29.184 -20.394 2.503   1.00 27.39  ?  4   DG  C "O5'" 1 
ATOM   2591 C "C5'" . DG  C 2 4  ? -28.304 -21.483 2.263   1.00 30.18  ?  4   DG  C "C5'" 1 
ATOM   2592 C "C4'" . DG  C 2 4  ? -27.152 -21.428 3.245   1.00 32.55  ?  4   DG  C "C4'" 1 
ATOM   2593 O "O4'" . DG  C 2 4  ? -26.162 -20.485 2.772   1.00 35.68  ?  4   DG  C "O4'" 1 
ATOM   2594 C "C3'" . DG  C 2 4  ? -27.568 -20.959 4.635   1.00 43.47  ?  4   DG  C "C3'" 1 
ATOM   2595 O "O3'" . DG  C 2 4  ? -27.686 -22.087 5.504   1.00 48.99  ?  4   DG  C "O3'" 1 
ATOM   2596 C "C2'" . DG  C 2 4  ? -26.481 -19.979 5.079   1.00 37.89  ?  4   DG  C "C2'" 1 
ATOM   2597 C "C1'" . DG  C 2 4  ? -25.552 -19.846 3.873   1.00 38.47  ?  4   DG  C "C1'" 1 
ATOM   2598 N N9    . DG  C 2 4  ? -25.304 -18.452 3.519   1.00 36.64  ?  4   DG  C N9    1 
ATOM   2599 C C8    . DG  C 2 4  ? -26.225 -17.434 3.465   1.00 28.18  ?  4   DG  C C8    1 
ATOM   2600 N N7    . DG  C 2 4  ? -25.709 -16.287 3.122   1.00 31.17  ?  4   DG  C N7    1 
ATOM   2601 C C5    . DG  C 2 4  ? -24.360 -16.561 2.936   1.00 30.13  ?  4   DG  C C5    1 
ATOM   2602 C C6    . DG  C 2 4  ? -23.301 -15.706 2.557   1.00 28.65  ?  4   DG  C C6    1 
ATOM   2603 O O6    . DG  C 2 4  ? -23.348 -14.494 2.302   1.00 27.74  ?  4   DG  C O6    1 
ATOM   2604 N N1    . DG  C 2 4  ? -22.089 -16.391 2.486   1.00 29.92  ?  4   DG  C N1    1 
ATOM   2605 C C2    . DG  C 2 4  ? -21.925 -17.732 2.748   1.00 28.42  ?  4   DG  C C2    1 
ATOM   2606 N N2    . DG  C 2 4  ? -20.680 -18.220 2.628   1.00 26.88  ?  4   DG  C N2    1 
ATOM   2607 N N3    . DG  C 2 4  ? -22.912 -18.542 3.106   1.00 33.37  ?  4   DG  C N3    1 
ATOM   2608 C C4    . DG  C 2 4  ? -24.096 -17.890 3.178   1.00 35.15  ?  4   DG  C C4    1 
ATOM   2609 P P     . DA  C 2 5  ? -26.465 -22.509 6.459   1.00 48.58  ?  5   DA  C P     1 
ATOM   2610 O OP1   . DA  C 2 5  ? -26.723 -21.961 7.809   1.00 49.82  -1 5   DA  C OP1   1 
ATOM   2611 O OP2   . DA  C 2 5  ? -25.206 -22.163 5.765   1.00 48.06  ?  5   DA  C OP2   1 
ATOM   2612 O "O5'" . DA  C 2 5  ? -26.578 -24.102 6.542   1.00 40.67  ?  5   DA  C "O5'" 1 
ATOM   2613 C "C5'" . DA  C 2 5  ? -25.585 -24.827 7.249   1.00 38.73  ?  5   DA  C "C5'" 1 
ATOM   2614 C "C4'" . DA  C 2 5  ? -25.066 -26.004 6.443   1.00 41.72  ?  5   DA  C "C4'" 1 
ATOM   2615 O "O4'" . DA  C 2 5  ? -24.816 -25.608 5.070   1.00 46.28  ?  5   DA  C "O4'" 1 
ATOM   2616 C "C3'" . DA  C 2 5  ? -23.744 -26.569 6.937   1.00 48.30  ?  5   DA  C "C3'" 1 
ATOM   2617 O "O3'" . DA  C 2 5  ? -23.657 -27.950 6.601   1.00 39.55  ?  5   DA  C "O3'" 1 
ATOM   2618 C "C2'" . DA  C 2 5  ? -22.727 -25.726 6.171   1.00 49.76  ?  5   DA  C "C2'" 1 
ATOM   2619 C "C1'" . DA  C 2 5  ? -23.422 -25.509 4.829   1.00 43.56  ?  5   DA  C "C1'" 1 
ATOM   2620 N N9    . DA  C 2 5  ? -23.160 -24.197 4.238   1.00 42.70  ?  5   DA  C N9    1 
ATOM   2621 C C8    . DA  C 2 5  ? -22.961 -23.022 4.906   1.00 43.65  ?  5   DA  C C8    1 
ATOM   2622 N N7    . DA  C 2 5  ? -22.756 -21.991 4.122   1.00 43.69  ?  5   DA  C N7    1 
ATOM   2623 C C5    . DA  C 2 5  ? -22.822 -22.524 2.847   1.00 38.37  ?  5   DA  C C5    1 
ATOM   2624 C C6    . DA  C 2 5  ? -22.684 -21.943 1.571   1.00 41.06  ?  5   DA  C C6    1 
ATOM   2625 N N6    . DA  C 2 5  ? -22.440 -20.642 1.376   1.00 38.21  ?  5   DA  C N6    1 
ATOM   2626 N N1    . DA  C 2 5  ? -22.806 -22.757 0.500   1.00 43.55  ?  5   DA  C N1    1 
ATOM   2627 C C2    . DA  C 2 5  ? -23.048 -24.059 0.703   1.00 39.36  ?  5   DA  C C2    1 
ATOM   2628 N N3    . DA  C 2 5  ? -23.197 -24.715 1.853   1.00 40.06  ?  5   DA  C N3    1 
ATOM   2629 C C4    . DA  C 2 5  ? -23.071 -23.883 2.899   1.00 40.00  ?  5   DA  C C4    1 
ATOM   2630 P P     . DG  C 2 6  ? -22.737 -28.938 7.475   1.00 59.34  ?  6   DG  C P     1 
ATOM   2631 O OP1   . DG  C 2 6  ? -23.528 -30.160 7.748   1.00 62.82  ?  6   DG  C OP1   1 
ATOM   2632 O OP2   . DG  C 2 6  ? -22.172 -28.161 8.603   1.00 45.58  -1 6   DG  C OP2   1 
ATOM   2633 O "O5'" . DG  C 2 6  ? -21.531 -29.300 6.490   1.00 50.21  ?  6   DG  C "O5'" 1 
ATOM   2634 C "C5'" . DG  C 2 6  ? -20.845 -28.237 5.855   1.00 46.95  ?  6   DG  C "C5'" 1 
ATOM   2635 C "C4'" . DG  C 2 6  ? -20.557 -28.552 4.401   1.00 43.92  ?  6   DG  C "C4'" 1 
ATOM   2636 O "O4'" . DG  C 2 6  ? -20.767 -27.353 3.618   1.00 43.49  ?  6   DG  C "O4'" 1 
ATOM   2637 C "C3'" . DG  C 2 6  ? -19.115 -28.927 4.111   1.00 43.07  ?  6   DG  C "C3'" 1 
ATOM   2638 O "O3'" . DG  C 2 6  ? -19.036 -29.498 2.820   1.00 43.57  ?  6   DG  C "O3'" 1 
ATOM   2639 C "C2'" . DG  C 2 6  ? -18.477 -27.546 4.147   1.00 41.57  ?  6   DG  C "C2'" 1 
ATOM   2640 C "C1'" . DG  C 2 6  ? -19.510 -26.759 3.344   1.00 43.16  ?  6   DG  C "C1'" 1 
ATOM   2641 N N9    . DG  C 2 6  ? -19.572 -25.340 3.683   1.00 40.94  ?  6   DG  C N9    1 
ATOM   2642 C C8    . DG  C 2 6  ? -19.586 -24.770 4.934   1.00 37.97  ?  6   DG  C C8    1 
ATOM   2643 N N7    . DG  C 2 6  ? -19.647 -23.466 4.905   1.00 38.88  ?  6   DG  C N7    1 
ATOM   2644 C C5    . DG  C 2 6  ? -19.676 -23.150 3.551   1.00 37.98  ?  6   DG  C C5    1 
ATOM   2645 C C6    . DG  C 2 6  ? -19.740 -21.894 2.898   1.00 36.92  ?  6   DG  C C6    1 
ATOM   2646 O O6    . DG  C 2 6  ? -19.788 -20.763 3.399   1.00 41.10  ?  6   DG  C O6    1 
ATOM   2647 N N1    . DG  C 2 6  ? -19.747 -22.033 1.512   1.00 34.61  ?  6   DG  C N1    1 
ATOM   2648 C C2    . DG  C 2 6  ? -19.698 -23.233 0.841   1.00 36.76  ?  6   DG  C C2    1 
ATOM   2649 N N2    . DG  C 2 6  ? -19.715 -23.172 -0.500  1.00 38.68  ?  6   DG  C N2    1 
ATOM   2650 N N3    . DG  C 2 6  ? -19.638 -24.414 1.441   1.00 39.28  ?  6   DG  C N3    1 
ATOM   2651 C C4    . DG  C 2 6  ? -19.630 -24.296 2.790   1.00 39.93  ?  6   DG  C C4    1 
ATOM   2652 P P     . DC  C 2 7  ? -17.999 -30.691 2.527   1.00 44.05  ?  7   DC  C P     1 
ATOM   2653 O OP1   . DC  C 2 7  ? -18.625 -31.598 1.535   1.00 55.36  ?  7   DC  C OP1   1 
ATOM   2654 O OP2   . DC  C 2 7  ? -17.548 -31.226 3.833   1.00 43.64  -1 7   DC  C OP2   1 
ATOM   2655 O "O5'" . DC  C 2 7  ? -16.746 -29.958 1.849   1.00 41.77  ?  7   DC  C "O5'" 1 
ATOM   2656 C "C5'" . DC  C 2 7  ? -16.917 -29.245 0.631   1.00 39.58  ?  7   DC  C "C5'" 1 
ATOM   2657 C "C4'" . DC  C 2 7  ? -15.596 -28.666 0.163   1.00 41.91  ?  7   DC  C "C4'" 1 
ATOM   2658 O "O4'" . DC  C 2 7  ? -14.977 -27.930 1.250   1.00 34.84  ?  7   DC  C "O4'" 1 
ATOM   2659 C "C3'" . DC  C 2 7  ? -14.550 -29.690 -0.250  1.00 34.95  ?  7   DC  C "C3'" 1 
ATOM   2660 O "O3'" . DC  C 2 7  ? -13.608 -29.071 -1.109  1.00 41.64  ?  7   DC  C "O3'" 1 
ATOM   2661 C "C2'" . DC  C 2 7  ? -13.917 -30.018 1.093   1.00 32.58  ?  7   DC  C "C2'" 1 
ATOM   2662 C "C1'" . DC  C 2 7  ? -13.815 -28.614 1.679   1.00 35.04  ?  7   DC  C "C1'" 1 
ATOM   2663 N N1    . DC  C 2 7  ? -13.754 -28.594 3.165   1.00 30.60  ?  7   DC  C N1    1 
ATOM   2664 C C2    . DC  C 2 7  ? -12.507 -28.634 3.793   1.00 36.54  ?  7   DC  C C2    1 
ATOM   2665 O O2    . DC  C 2 7  ? -11.482 -28.687 3.102   1.00 33.89  ?  7   DC  C O2    1 
ATOM   2666 N N3    . DC  C 2 7  ? -12.453 -28.620 5.147   1.00 39.17  ?  7   DC  C N3    1 
ATOM   2667 C C4    . DC  C 2 7  ? -13.576 -28.564 5.862   1.00 35.56  ?  7   DC  C C4    1 
ATOM   2668 N N4    . DC  C 2 7  ? -13.467 -28.550 7.195   1.00 35.76  ?  7   DC  C N4    1 
ATOM   2669 C C5    . DC  C 2 7  ? -14.858 -28.520 5.236   1.00 32.09  ?  7   DC  C C5    1 
ATOM   2670 C C6    . DC  C 2 7  ? -14.902 -28.537 3.899   1.00 34.45  ?  7   DC  C C6    1 
ATOM   2671 P P     . DG  C 2 8  ? -13.137 -29.801 -2.461  1.00 42.23  ?  8   DG  C P     1 
ATOM   2672 O OP1   . DG  C 2 8  ? -14.354 -30.240 -3.187  1.00 42.68  ?  8   DG  C OP1   1 
ATOM   2673 O OP2   . DG  C 2 8  ? -12.097 -30.793 -2.095  1.00 43.28  -1 8   DG  C OP2   1 
ATOM   2674 O "O5'" . DG  C 2 8  ? -12.413 -28.635 -3.286  1.00 39.23  ?  8   DG  C "O5'" 1 
ATOM   2675 C "C5'" . DG  C 2 8  ? -12.798 -27.279 -3.078  1.00 35.54  ?  8   DG  C "C5'" 1 
ATOM   2676 C "C4'" . DG  C 2 8  ? -11.688 -26.339 -3.514  1.00 34.68  ?  8   DG  C "C4'" 1 
ATOM   2677 O "O4'" . DG  C 2 8  ? -10.754 -26.097 -2.427  1.00 39.78  ?  8   DG  C "O4'" 1 
ATOM   2678 C "C3'" . DG  C 2 8  ? -10.830 -26.837 -4.675  1.00 33.64  ?  8   DG  C "C3'" 1 
ATOM   2679 O "O3'" . DG  C 2 8  ? -10.555 -25.739 -5.518  1.00 37.23  ?  8   DG  C "O3'" 1 
ATOM   2680 C "C2'" . DG  C 2 8  ? -9.558  -27.285 -3.963  1.00 30.72  ?  8   DG  C "C2'" 1 
ATOM   2681 C "C1'" . DG  C 2 8  ? -9.471  -26.096 -3.017  1.00 39.70  ?  8   DG  C "C1'" 1 
ATOM   2682 N N9    . DG  C 2 8  ? -8.418  -26.121 -2.002  1.00 35.30  ?  8   DG  C N9    1 
ATOM   2683 C C8    . DG  C 2 8  ? -7.424  -25.184 -1.837  1.00 35.44  ?  8   DG  C C8    1 
ATOM   2684 N N7    . DG  C 2 8  ? -6.613  -25.446 -0.852  1.00 29.14  ?  8   DG  C N7    1 
ATOM   2685 C C5    . DG  C 2 8  ? -7.099  -26.636 -0.328  1.00 34.75  ?  8   DG  C C5    1 
ATOM   2686 C C6    . DG  C 2 8  ? -6.624  -27.405 0.757   1.00 37.33  ?  8   DG  C C6    1 
ATOM   2687 O O6    . DG  C 2 8  ? -5.652  -27.180 1.491   1.00 35.13  ?  8   DG  C O6    1 
ATOM   2688 N N1    . DG  C 2 8  ? -7.406  -28.539 0.957   1.00 45.03  ?  8   DG  C N1    1 
ATOM   2689 C C2    . DG  C 2 8  ? -8.504  -28.884 0.204   1.00 40.52  ?  8   DG  C C2    1 
ATOM   2690 N N2    . DG  C 2 8  ? -9.128  -30.019 0.553   1.00 45.97  ?  8   DG  C N2    1 
ATOM   2691 N N3    . DG  C 2 8  ? -8.959  -28.170 -0.818  1.00 28.43  ?  8   DG  C N3    1 
ATOM   2692 C C4    . DG  C 2 8  ? -8.209  -27.065 -1.024  1.00 25.32  ?  8   DG  C C4    1 
ATOM   2693 P P     . DT  C 2 9  ? -11.537 -25.395 -6.743  1.00 47.61  ?  9   DT  C P     1 
ATOM   2694 O OP1   . DT  C 2 9  ? -11.127 -24.077 -7.291  1.00 38.87  ?  9   DT  C OP1   1 
ATOM   2695 O OP2   . DT  C 2 9  ? -12.928 -25.605 -6.275  1.00 53.18  -1 9   DT  C OP2   1 
ATOM   2696 O "O5'" . DT  C 2 9  ? -11.208 -26.526 -7.824  1.00 53.37  ?  9   DT  C "O5'" 1 
ATOM   2697 C "C5'" . DT  C 2 9  ? -9.863  -26.698 -8.220  1.00 49.46  ?  9   DT  C "C5'" 1 
ATOM   2698 C "C4'" . DT  C 2 9  ? -9.785  -27.138 -9.666  1.00 53.30  ?  9   DT  C "C4'" 1 
ATOM   2699 O "O4'" . DT  C 2 9  ? -10.579 -26.248 -10.494 1.00 53.28  ?  9   DT  C "O4'" 1 
ATOM   2700 C "C3'" . DT  C 2 9  ? -8.384  -27.079 -10.248 1.00 55.78  ?  9   DT  C "C3'" 1 
ATOM   2701 O "O3'" . DT  C 2 9  ? -7.679  -28.285 -9.958  1.00 52.26  ?  9   DT  C "O3'" 1 
ATOM   2702 C "C2'" . DT  C 2 9  ? -8.685  -26.916 -11.735 1.00 53.98  ?  9   DT  C "C2'" 1 
ATOM   2703 C "C1'" . DT  C 2 9  ? -9.929  -26.035 -11.736 1.00 44.64  ?  9   DT  C "C1'" 1 
ATOM   2704 N N1    . DT  C 2 9  ? -9.617  -24.582 -11.934 1.00 51.11  ?  9   DT  C N1    1 
ATOM   2705 C C2    . DT  C 2 9  ? -9.483  -23.739 -10.848 1.00 58.53  ?  9   DT  C C2    1 
ATOM   2706 O O2    . DT  C 2 9  ? -9.608  -24.099 -9.692  1.00 64.64  ?  9   DT  C O2    1 
ATOM   2707 N N3    . DT  C 2 9  ? -9.194  -22.435 -11.167 1.00 50.08  ?  9   DT  C N3    1 
ATOM   2708 C C4    . DT  C 2 9  ? -9.026  -21.899 -12.430 1.00 46.89  ?  9   DT  C C4    1 
ATOM   2709 O O4    . DT  C 2 9  ? -8.767  -20.712 -12.611 1.00 43.46  ?  9   DT  C O4    1 
ATOM   2710 C C5    . DT  C 2 9  ? -9.175  -22.835 -13.517 1.00 51.32  ?  9   DT  C C5    1 
ATOM   2711 C C7    . DT  C 2 9  ? -9.016  -22.371 -14.936 1.00 52.09  ?  9   DT  C C7    1 
ATOM   2712 C C6    . DT  C 2 9  ? -9.459  -24.110 -13.222 1.00 47.46  ?  9   DT  C C6    1 
ATOM   2713 P P     . DT  C 2 10 ? -6.081  -28.266 -9.777  1.00 52.38  ?  10  DT  C P     1 
ATOM   2714 O OP1   . DT  C 2 10 ? -5.599  -29.660 -9.907  1.00 47.96  ?  10  DT  C OP1   1 
ATOM   2715 O OP2   . DT  C 2 10 ? -5.764  -27.496 -8.553  1.00 56.21  -1 10  DT  C OP2   1 
ATOM   2716 O "O5'" . DT  C 2 10 ? -5.572  -27.424 -11.037 1.00 46.81  ?  10  DT  C "O5'" 1 
ATOM   2717 C "C5'" . DT  C 2 10 ? -4.253  -26.909 -11.111 1.00 51.74  ?  10  DT  C "C5'" 1 
ATOM   2718 C "C4'" . DT  C 2 10 ? -4.145  -26.051 -12.357 1.00 48.69  ?  10  DT  C "C4'" 1 
ATOM   2719 O "O4'" . DT  C 2 10 ? -5.388  -25.320 -12.522 1.00 48.43  ?  10  DT  C "O4'" 1 
ATOM   2720 C "C3'" . DT  C 2 10 ? -3.028  -25.018 -12.346 1.00 41.05  ?  10  DT  C "C3'" 1 
ATOM   2721 O "O3'" . DT  C 2 10 ? -1.899  -25.547 -13.032 1.00 49.67  ?  10  DT  C "O3'" 1 
ATOM   2722 C "C2'" . DT  C 2 10 ? -3.640  -23.833 -13.090 1.00 39.73  ?  10  DT  C "C2'" 1 
ATOM   2723 C "C1'" . DT  C 2 10 ? -5.126  -23.950 -12.752 1.00 46.09  ?  10  DT  C "C1'" 1 
ATOM   2724 N N1    . DT  C 2 10 ? -5.551  -23.161 -11.548 1.00 40.01  ?  10  DT  C N1    1 
ATOM   2725 C C2    . DT  C 2 10 ? -5.698  -21.795 -11.657 1.00 39.03  ?  10  DT  C C2    1 
ATOM   2726 O O2    . DT  C 2 10 ? -5.497  -21.184 -12.687 1.00 45.83  ?  10  DT  C O2    1 
ATOM   2727 N N3    . DT  C 2 10 ? -6.090  -21.158 -10.508 1.00 39.56  ?  10  DT  C N3    1 
ATOM   2728 C C4    . DT  C 2 10 ? -6.348  -21.742 -9.282  1.00 44.44  ?  10  DT  C C4    1 
ATOM   2729 O O4    . DT  C 2 10 ? -6.696  -21.084 -8.306  1.00 44.04  ?  10  DT  C O4    1 
ATOM   2730 C C5    . DT  C 2 10 ? -6.180  -23.173 -9.235  1.00 47.49  ?  10  DT  C C5    1 
ATOM   2731 C C7    . DT  C 2 10 ? -6.432  -23.910 -7.952  1.00 44.16  ?  10  DT  C C7    1 
ATOM   2732 C C6    . DT  C 2 10 ? -5.795  -23.809 -10.352 1.00 45.69  ?  10  DT  C C6    1 
ATOM   2733 P P     . DG  D 2 4  ? -32.993 -26.703 -23.623 1.00 117.89 ?  4   DG  D P     1 
ATOM   2734 O OP1   . DG  D 2 4  ? -33.048 -28.181 -23.578 1.00 117.57 ?  4   DG  D OP1   1 
ATOM   2735 O OP2   . DG  D 2 4  ? -34.242 -25.918 -23.744 1.00 115.90 -1 4   DG  D OP2   1 
ATOM   2736 O "O5'" . DG  D 2 4  ? -32.201 -26.171 -22.338 1.00 93.01  ?  4   DG  D "O5'" 1 
ATOM   2737 C "C5'" . DG  D 2 4  ? -31.655 -27.090 -21.401 1.00 80.54  ?  4   DG  D "C5'" 1 
ATOM   2738 C "C4'" . DG  D 2 4  ? -32.719 -27.596 -20.446 1.00 82.91  ?  4   DG  D "C4'" 1 
ATOM   2739 O "O4'" . DG  D 2 4  ? -32.167 -27.611 -19.112 1.00 81.51  ?  4   DG  D "O4'" 1 
ATOM   2740 C "C3'" . DG  D 2 4  ? -33.919 -26.681 -20.288 1.00 89.50  ?  4   DG  D "C3'" 1 
ATOM   2741 O "O3'" . DG  D 2 4  ? -34.984 -27.378 -19.632 1.00 89.64  ?  4   DG  D "O3'" 1 
ATOM   2742 C "C2'" . DG  D 2 4  ? -33.318 -25.567 -19.429 1.00 83.26  ?  4   DG  D "C2'" 1 
ATOM   2743 C "C1'" . DG  D 2 4  ? -32.267 -26.299 -18.589 1.00 81.30  ?  4   DG  D "C1'" 1 
ATOM   2744 N N9    . DG  D 2 4  ? -30.924 -25.712 -18.615 1.00 77.52  ?  4   DG  D N9    1 
ATOM   2745 C C8    . DG  D 2 4  ? -30.476 -24.625 -19.331 1.00 56.91  ?  4   DG  D C8    1 
ATOM   2746 N N7    . DG  D 2 4  ? -29.212 -24.360 -19.133 1.00 46.91  ?  4   DG  D N7    1 
ATOM   2747 C C5    . DG  D 2 4  ? -28.790 -25.331 -18.232 1.00 52.01  ?  4   DG  D C5    1 
ATOM   2748 C C6    . DG  D 2 4  ? -27.519 -25.556 -17.647 1.00 45.44  ?  4   DG  D C6    1 
ATOM   2749 O O6    . DG  D 2 4  ? -26.470 -24.919 -17.812 1.00 40.67  ?  4   DG  D O6    1 
ATOM   2750 N N1    . DG  D 2 4  ? -27.532 -26.653 -16.787 1.00 43.86  ?  4   DG  D N1    1 
ATOM   2751 C C2    . DG  D 2 4  ? -28.633 -27.433 -16.525 1.00 45.10  ?  4   DG  D C2    1 
ATOM   2752 N N2    . DG  D 2 4  ? -28.455 -28.448 -15.667 1.00 39.78  ?  4   DG  D N2    1 
ATOM   2753 N N3    . DG  D 2 4  ? -29.828 -27.232 -17.067 1.00 53.91  ?  4   DG  D N3    1 
ATOM   2754 C C4    . DG  D 2 4  ? -29.833 -26.168 -17.907 1.00 64.33  ?  4   DG  D C4    1 
ATOM   2755 P P     . DA  D 2 5  ? -36.446 -27.441 -20.301 1.00 92.73  ?  5   DA  D P     1 
ATOM   2756 O OP1   . DA  D 2 5  ? -36.275 -27.322 -21.765 1.00 99.83  -1 5   DA  D OP1   1 
ATOM   2757 O OP2   . DA  D 2 5  ? -37.303 -26.468 -19.587 1.00 85.88  ?  5   DA  D OP2   1 
ATOM   2758 O "O5'" . DA  D 2 5  ? -36.966 -28.923 -19.975 1.00 76.09  ?  5   DA  D "O5'" 1 
ATOM   2759 C "C5'" . DA  D 2 5  ? -38.131 -29.430 -20.630 1.00 54.40  ?  5   DA  D "C5'" 1 
ATOM   2760 C "C4'" . DA  D 2 5  ? -38.545 -30.798 -20.110 1.00 58.89  ?  5   DA  D "C4'" 1 
ATOM   2761 O "O4'" . DA  D 2 5  ? -39.000 -30.678 -18.734 1.00 60.24  ?  5   DA  D "O4'" 1 
ATOM   2762 C "C3'" . DA  D 2 5  ? -39.705 -31.457 -20.853 1.00 63.41  ?  5   DA  D "C3'" 1 
ATOM   2763 O "O3'" . DA  D 2 5  ? -39.564 -32.876 -20.827 1.00 71.76  ?  5   DA  D "O3'" 1 
ATOM   2764 C "C2'" . DA  D 2 5  ? -40.910 -31.022 -20.030 1.00 48.49  ?  5   DA  D "C2'" 1 
ATOM   2765 C "C1'" . DA  D 2 5  ? -40.323 -31.174 -18.634 1.00 55.20  ?  5   DA  D "C1'" 1 
ATOM   2766 N N9    . DA  D 2 5  ? -41.067 -30.427 -17.625 1.00 50.57  ?  5   DA  D N9    1 
ATOM   2767 C C8    . DA  D 2 5  ? -42.083 -30.895 -16.838 1.00 51.08  ?  5   DA  D C8    1 
ATOM   2768 N N7    . DA  D 2 5  ? -42.573 -29.995 -16.018 1.00 51.20  ?  5   DA  D N7    1 
ATOM   2769 C C5    . DA  D 2 5  ? -41.829 -28.858 -16.289 1.00 44.31  ?  5   DA  D C5    1 
ATOM   2770 C C6    . DA  D 2 5  ? -41.856 -27.555 -15.755 1.00 43.68  ?  5   DA  D C6    1 
ATOM   2771 N N6    . DA  D 2 5  ? -42.703 -27.169 -14.794 1.00 56.68  ?  5   DA  D N6    1 
ATOM   2772 N N1    . DA  D 2 5  ? -40.975 -26.661 -16.251 1.00 48.52  ?  5   DA  D N1    1 
ATOM   2773 C C2    . DA  D 2 5  ? -40.127 -27.046 -17.213 1.00 43.48  ?  5   DA  D C2    1 
ATOM   2774 N N3    . DA  D 2 5  ? -40.008 -28.240 -17.791 1.00 47.44  ?  5   DA  D N3    1 
ATOM   2775 C C4    . DA  D 2 5  ? -40.896 -29.107 -17.279 1.00 47.86  ?  5   DA  D C4    1 
ATOM   2776 P P     . DG  D 2 6  ? -40.867 -33.812 -20.706 1.00 71.41  ?  6   DG  D P     1 
ATOM   2777 O OP1   . DG  D 2 6  ? -41.810 -33.411 -21.776 1.00 54.27  ?  6   DG  D OP1   1 
ATOM   2778 O OP2   . DG  D 2 6  ? -41.307 -33.785 -19.291 1.00 70.05  -1 6   DG  D OP2   1 
ATOM   2779 O "O5'" . DG  D 2 6  ? -40.317 -35.281 -21.019 1.00 65.89  ?  6   DG  D "O5'" 1 
ATOM   2780 C "C5'" . DG  D 2 6  ? -41.124 -36.423 -20.771 1.00 67.08  ?  6   DG  D "C5'" 1 
ATOM   2781 C "C4'" . DG  D 2 6  ? -40.321 -37.469 -20.021 1.00 59.47  ?  6   DG  D "C4'" 1 
ATOM   2782 O "O4'" . DG  D 2 6  ? -40.707 -37.489 -18.623 1.00 58.87  ?  6   DG  D "O4'" 1 
ATOM   2783 C "C3'" . DG  D 2 6  ? -40.500 -38.896 -20.535 1.00 70.79  ?  6   DG  D "C3'" 1 
ATOM   2784 O "O3'" . DG  D 2 6  ? -39.230 -39.442 -20.866 1.00 76.25  ?  6   DG  D "O3'" 1 
ATOM   2785 C "C2'" . DG  D 2 6  ? -41.160 -39.642 -19.376 1.00 63.21  ?  6   DG  D "C2'" 1 
ATOM   2786 C "C1'" . DG  D 2 6  ? -40.681 -38.830 -18.181 1.00 61.72  ?  6   DG  D "C1'" 1 
ATOM   2787 N N9    . DG  D 2 6  ? -41.503 -38.967 -16.982 1.00 58.41  ?  6   DG  D N9    1 
ATOM   2788 C C8    . DG  D 2 6  ? -41.342 -39.879 -15.966 1.00 53.35  ?  6   DG  D C8    1 
ATOM   2789 N N7    . DG  D 2 6  ? -42.228 -39.762 -15.016 1.00 43.94  ?  6   DG  D N7    1 
ATOM   2790 C C5    . DG  D 2 6  ? -43.027 -38.703 -15.428 1.00 44.16  ?  6   DG  D C5    1 
ATOM   2791 C C6    . DG  D 2 6  ? -44.153 -38.115 -14.806 1.00 45.46  ?  6   DG  D C6    1 
ATOM   2792 O O6    . DG  D 2 6  ? -44.685 -38.423 -13.731 1.00 54.35  ?  6   DG  D O6    1 
ATOM   2793 N N1    . DG  D 2 6  ? -44.668 -37.065 -15.563 1.00 51.86  ?  6   DG  D N1    1 
ATOM   2794 C C2    . DG  D 2 6  ? -44.159 -36.638 -16.767 1.00 57.09  ?  6   DG  D C2    1 
ATOM   2795 N N2    . DG  D 2 6  ? -44.792 -35.608 -17.351 1.00 62.00  ?  6   DG  D N2    1 
ATOM   2796 N N3    . DG  D 2 6  ? -43.105 -37.180 -17.360 1.00 45.80  ?  6   DG  D N3    1 
ATOM   2797 C C4    . DG  D 2 6  ? -42.593 -38.203 -16.636 1.00 47.70  ?  6   DG  D C4    1 
ATOM   2798 P P     . DC  D 2 7  ? -38.851 -39.715 -22.403 1.00 80.40  ?  7   DC  D P     1 
ATOM   2799 O OP1   . DC  D 2 7  ? -37.787 -40.745 -22.413 1.00 73.85  ?  7   DC  D OP1   1 
ATOM   2800 O OP2   . DC  D 2 7  ? -38.611 -38.405 -23.048 1.00 64.36  -1 7   DC  D OP2   1 
ATOM   2801 O "O5'" . DC  D 2 7  ? -40.192 -40.340 -23.017 1.00 92.27  ?  7   DC  D "O5'" 1 
ATOM   2802 C "C5'" . DC  D 2 7  ? -40.490 -40.233 -24.402 1.00 96.73  ?  7   DC  D "C5'" 1 
ATOM   2803 C "C4'" . DC  D 2 7  ? -40.213 -41.542 -25.118 1.00 98.28  ?  7   DC  D "C4'" 1 
ATOM   2804 O "O4'" . DC  D 2 7  ? -40.572 -42.654 -24.258 1.00 95.50  ?  7   DC  D "O4'" 1 
ATOM   2805 C "C3'" . DC  D 2 7  ? -40.985 -41.730 -26.418 1.00 96.27  ?  7   DC  D "C3'" 1 
ATOM   2806 O "O3'" . DC  D 2 7  ? -40.150 -42.338 -27.397 1.00 89.75  ?  7   DC  D "O3'" 1 
ATOM   2807 C "C2'" . DC  D 2 7  ? -42.149 -42.635 -26.018 1.00 95.72  ?  7   DC  D "C2'" 1 
ATOM   2808 C "C1'" . DC  D 2 7  ? -41.582 -43.443 -24.854 1.00 94.78  ?  7   DC  D "C1'" 1 
ATOM   2809 N N1    . DC  D 2 7  ? -42.608 -43.779 -23.817 1.00 100.65 ?  7   DC  D N1    1 
ATOM   2810 C C2    . DC  D 2 7  ? -42.216 -44.174 -22.530 1.00 104.97 ?  7   DC  D C2    1 
ATOM   2811 O O2    . DC  D 2 7  ? -41.011 -44.246 -22.255 1.00 101.61 ?  7   DC  D O2    1 
ATOM   2812 N N3    . DC  D 2 7  ? -43.172 -44.471 -21.613 1.00 105.14 ?  7   DC  D N3    1 
ATOM   2813 C C4    . DC  D 2 7  ? -44.463 -44.386 -21.938 1.00 100.65 ?  7   DC  D C4    1 
ATOM   2814 N N4    . DC  D 2 7  ? -45.368 -44.689 -21.000 1.00 99.41  ?  7   DC  D N4    1 
ATOM   2815 C C5    . DC  D 2 7  ? -44.881 -43.986 -23.241 1.00 95.73  ?  7   DC  D C5    1 
ATOM   2816 C C6    . DC  D 2 7  ? -43.932 -43.695 -24.137 1.00 96.72  ?  7   DC  D C6    1 
HETATM 2817 O O     . HOH E 3 .  ? -20.158 -14.414 -16.508 1.00 31.51  ?  201 HOH A O     1 
HETATM 2818 O O     . HOH E 3 .  ? -22.997 -8.335  11.533  1.00 26.08  ?  202 HOH A O     1 
HETATM 2819 O O     . HOH E 3 .  ? -19.904 -13.240 -5.292  1.00 28.37  ?  203 HOH A O     1 
HETATM 2820 O O     . HOH E 3 .  ? 3.435   -23.408 1.366   1.00 38.96  ?  204 HOH A O     1 
HETATM 2821 O O     . HOH E 3 .  ? -24.548 -11.429 -11.464 1.00 24.09  ?  205 HOH A O     1 
HETATM 2822 O O     . HOH E 3 .  ? -7.040  -24.523 -4.784  1.00 28.96  ?  206 HOH A O     1 
HETATM 2823 O O     . HOH E 3 .  ? 6.759   -12.581 14.527  1.00 48.48  ?  207 HOH A O     1 
HETATM 2824 O O     . HOH E 3 .  ? 10.337  -15.522 14.628  1.00 47.47  ?  208 HOH A O     1 
HETATM 2825 O O     . HOH E 3 .  ? 7.774   -13.465 16.357  0.50 56.29  ?  209 HOH A O     1 
HETATM 2826 O O     . HOH E 3 .  ? 9.768   -16.919 16.357  0.50 51.98  ?  210 HOH A O     1 
HETATM 2827 O O     . HOH E 3 .  ? -9.938  -9.648  -5.258  1.00 32.21  ?  211 HOH A O     1 
HETATM 2828 O O     . HOH E 3 .  ? -12.006 -11.541 -6.077  1.00 38.31  ?  212 HOH A O     1 
HETATM 2829 O O     . HOH E 3 .  ? -14.970 -32.856 3.654   1.00 42.90  ?  213 HOH A O     1 
HETATM 2830 O O     . HOH E 3 .  ? -1.900  -35.350 0.724   1.00 37.31  ?  214 HOH A O     1 
HETATM 2831 O O     . HOH E 3 .  ? -1.581  -20.860 7.587   1.00 37.79  ?  215 HOH A O     1 
HETATM 2832 O O     . HOH E 3 .  ? 5.047   -26.961 9.967   1.00 40.94  ?  216 HOH A O     1 
HETATM 2833 O O     . HOH E 3 .  ? -12.401 -20.571 -7.531  1.00 32.82  ?  217 HOH A O     1 
HETATM 2834 O O     . HOH E 3 .  ? 8.417   -16.776 14.375  1.00 55.66  ?  218 HOH A O     1 
HETATM 2835 O O     . HOH F 3 .  ? -43.361 -34.299 10.138  1.00 60.08  ?  201 HOH B O     1 
HETATM 2836 O O     . HOH F 3 .  ? -22.068 -38.537 -13.867 1.00 28.36  ?  202 HOH B O     1 
HETATM 2837 O O     . HOH F 3 .  ? -18.405 -33.582 -8.163  1.00 26.69  ?  203 HOH B O     1 
HETATM 2838 O O     . HOH F 3 .  ? -26.023 -45.186 -23.989 1.00 25.26  ?  204 HOH B O     1 
HETATM 2839 O O     . HOH F 3 .  ? -24.663 -36.551 -18.287 1.00 20.47  ?  205 HOH B O     1 
HETATM 2840 O O     . HOH F 3 .  ? -40.749 -40.316 2.259   1.00 44.38  ?  206 HOH B O     1 
HETATM 2841 O O     . HOH F 3 .  ? -28.006 -41.868 -13.252 1.00 30.56  ?  207 HOH B O     1 
HETATM 2842 O O     . HOH F 3 .  ? -51.636 -38.950 -1.625  1.00 56.53  ?  208 HOH B O     1 
HETATM 2843 O O     . HOH F 3 .  ? -28.024 -35.290 -13.932 1.00 27.94  ?  209 HOH B O     1 
HETATM 2844 O O     . HOH F 3 .  ? -33.751 -39.729 -25.673 1.00 55.42  ?  210 HOH B O     1 
HETATM 2845 O O     . HOH F 3 .  ? -29.948 -45.468 -8.467  1.00 45.70  ?  211 HOH B O     1 
HETATM 2846 O O     . HOH F 3 .  ? -46.900 -39.078 -0.670  1.00 53.34  ?  212 HOH B O     1 
HETATM 2847 O O     . HOH F 3 .  ? -36.359 -44.562 -20.107 1.00 38.05  ?  213 HOH B O     1 
HETATM 2848 O O     . HOH F 3 .  ? -38.418 -45.037 -18.739 1.00 39.02  ?  214 HOH B O     1 
HETATM 2849 O O     . HOH G 3 .  ? -19.154 -26.902 -0.143  1.00 42.37  ?  101 HOH C O     1 
HETATM 2850 O O     . HOH G 3 .  ? -7.970  -20.327 -6.221  1.00 29.81  ?  102 HOH C O     1 
HETATM 2851 O O     . HOH G 3 .  ? -5.696  -28.772 -2.824  1.00 38.16  ?  103 HOH C O     1 
HETATM 2852 O O     . HOH H 3 .  ? -46.669 -43.947 -26.135 1.00 35.41  ?  101 HOH D O     1 
HETATM 2853 O O     . HOH H 3 .  ? -44.489 -43.895 -28.296 1.00 34.62  ?  102 HOH D O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   89  ?   ?   ?   A . n 
A 1 2   ARG 2   90  ?   ?   ?   A . n 
A 1 3   GLY 3   91  ?   ?   ?   A . n 
A 1 4   SER 4   92  ?   ?   ?   A . n 
A 1 5   HIS 5   93  ?   ?   ?   A . n 
A 1 6   HIS 6   94  ?   ?   ?   A . n 
A 1 7   HIS 7   95  ?   ?   ?   A . n 
A 1 8   HIS 8   96  ?   ?   ?   A . n 
A 1 9   HIS 9   97  ?   ?   ?   A . n 
A 1 10  HIS 10  98  ?   ?   ?   A . n 
A 1 11  GLY 11  99  ?   ?   ?   A . n 
A 1 12  SER 12  100 ?   ?   ?   A . n 
A 1 13  GLN 13  101 ?   ?   ?   A . n 
A 1 14  LYS 14  102 ?   ?   ?   A . n 
A 1 15  THR 15  103 103 THR THR A . n 
A 1 16  SER 16  104 104 SER SER A . n 
A 1 17  ASP 17  105 105 ASP ASP A . n 
A 1 18  LEU 18  106 106 LEU LEU A . n 
A 1 19  ILE 19  107 107 ILE ILE A . n 
A 1 20  VAL 20  108 108 VAL VAL A . n 
A 1 21  LEU 21  109 109 LEU LEU A . n 
A 1 22  GLY 22  110 110 GLY GLY A . n 
A 1 23  LEU 23  111 111 LEU LEU A . n 
A 1 24  PRO 24  112 112 PRO PRO A . n 
A 1 25  TRP 25  113 113 TRP TRP A . n 
A 1 26  LYS 26  114 114 LYS LYS A . n 
A 1 27  THR 27  115 115 THR THR A . n 
A 1 28  THR 28  116 116 THR THR A . n 
A 1 29  GLU 29  117 117 GLU GLU A . n 
A 1 30  GLN 30  118 118 GLN GLN A . n 
A 1 31  ASP 31  119 119 ASP ASP A . n 
A 1 32  LEU 32  120 120 LEU LEU A . n 
A 1 33  LYS 33  121 121 LYS LYS A . n 
A 1 34  GLU 34  122 122 GLU GLU A . n 
A 1 35  TYR 35  123 123 TYR TYR A . n 
A 1 36  PHE 36  124 124 PHE PHE A . n 
A 1 37  SER 37  125 125 SER SER A . n 
A 1 38  THR 38  126 126 THR THR A . n 
A 1 39  PHE 39  127 127 PHE PHE A . n 
A 1 40  GLY 40  128 128 GLY GLY A . n 
A 1 41  GLU 41  129 129 GLU GLU A . n 
A 1 42  VAL 42  130 130 VAL VAL A . n 
A 1 43  LEU 43  131 131 LEU LEU A . n 
A 1 44  MET 44  132 132 MET MET A . n 
A 1 45  VAL 45  133 133 VAL VAL A . n 
A 1 46  GLN 46  134 134 GLN GLN A . n 
A 1 47  VAL 47  135 135 VAL VAL A . n 
A 1 48  LYS 48  136 136 LYS LYS A . n 
A 1 49  LYS 49  137 137 LYS LYS A . n 
A 1 50  ASP 50  138 138 ASP ASP A . n 
A 1 51  LEU 51  139 139 LEU LEU A . n 
A 1 52  LYS 52  140 140 LYS LYS A . n 
A 1 53  THR 53  141 141 THR THR A . n 
A 1 54  GLY 54  142 142 GLY GLY A . n 
A 1 55  HIS 55  143 143 HIS HIS A . n 
A 1 56  SER 56  144 144 SER SER A . n 
A 1 57  LYS 57  145 145 LYS LYS A . n 
A 1 58  GLY 58  146 146 GLY GLY A . n 
A 1 59  PHE 59  147 147 PHE PHE A . n 
A 1 60  GLY 60  148 148 GLY GLY A . n 
A 1 61  PHE 61  149 149 PHE PHE A . n 
A 1 62  VAL 62  150 150 VAL VAL A . n 
A 1 63  ARG 63  151 151 ARG ARG A . n 
A 1 64  PHE 64  152 152 PHE PHE A . n 
A 1 65  THR 65  153 153 THR THR A . n 
A 1 66  GLU 66  154 154 GLU GLU A . n 
A 1 67  TYR 67  155 155 TYR TYR A . n 
A 1 68  GLU 68  156 156 GLU GLU A . n 
A 1 69  THR 69  157 157 THR THR A . n 
A 1 70  GLN 70  158 158 GLN GLN A . n 
A 1 71  VAL 71  159 159 VAL VAL A . n 
A 1 72  LYS 72  160 160 LYS LYS A . n 
A 1 73  VAL 73  161 161 VAL VAL A . n 
A 1 74  MET 74  162 162 MET MET A . n 
A 1 75  SER 75  163 163 SER SER A . n 
A 1 76  GLN 76  164 164 GLN GLN A . n 
A 1 77  ARG 77  165 165 ARG ARG A . n 
A 1 78  HIS 78  166 166 HIS HIS A . n 
A 1 79  MET 79  167 167 MET MET A . n 
A 1 80  ILE 80  168 168 ILE ILE A . n 
A 1 81  ASP 81  169 169 ASP ASP A . n 
A 1 82  GLY 82  170 170 GLY GLY A . n 
A 1 83  ARG 83  171 171 ARG ARG A . n 
A 1 84  TRP 84  172 172 TRP TRP A . n 
A 1 85  CYS 85  173 173 CYS CYS A . n 
A 1 86  ASP 86  174 174 ASP ASP A . n 
A 1 87  CYS 87  175 175 CYS CYS A . n 
A 1 88  LYS 88  176 176 LYS LYS A . n 
A 1 89  LEU 89  177 177 LEU LEU A . n 
A 1 90  PRO 90  178 178 PRO PRO A . n 
A 1 91  ASN 91  179 179 ASN ASN A . n 
A 1 92  SER 92  180 180 SER SER A . n 
A 1 93  LYS 93  181 ?   ?   ?   A . n 
A 1 94  GLN 94  182 ?   ?   ?   A . n 
A 1 95  SER 95  183 ?   ?   ?   A . n 
A 1 96  GLN 96  184 ?   ?   ?   A . n 
A 1 97  ASP 97  185 ?   ?   ?   A . n 
A 1 98  GLU 98  186 ?   ?   ?   A . n 
A 1 99  PRO 99  187 ?   ?   ?   A . n 
A 1 100 LEU 100 188 ?   ?   ?   A . n 
A 1 101 ARG 101 189 ?   ?   ?   A . n 
A 1 102 SER 102 190 ?   ?   ?   A . n 
A 1 103 ARG 103 191 ?   ?   ?   A . n 
B 1 1   MET 1   89  ?   ?   ?   B . n 
B 1 2   ARG 2   90  ?   ?   ?   B . n 
B 1 3   GLY 3   91  ?   ?   ?   B . n 
B 1 4   SER 4   92  ?   ?   ?   B . n 
B 1 5   HIS 5   93  ?   ?   ?   B . n 
B 1 6   HIS 6   94  ?   ?   ?   B . n 
B 1 7   HIS 7   95  ?   ?   ?   B . n 
B 1 8   HIS 8   96  ?   ?   ?   B . n 
B 1 9   HIS 9   97  ?   ?   ?   B . n 
B 1 10  HIS 10  98  ?   ?   ?   B . n 
B 1 11  GLY 11  99  ?   ?   ?   B . n 
B 1 12  SER 12  100 ?   ?   ?   B . n 
B 1 13  GLN 13  101 ?   ?   ?   B . n 
B 1 14  LYS 14  102 ?   ?   ?   B . n 
B 1 15  THR 15  103 103 THR THR B . n 
B 1 16  SER 16  104 104 SER SER B . n 
B 1 17  ASP 17  105 105 ASP ASP B . n 
B 1 18  LEU 18  106 106 LEU LEU B . n 
B 1 19  ILE 19  107 107 ILE ILE B . n 
B 1 20  VAL 20  108 108 VAL VAL B . n 
B 1 21  LEU 21  109 109 LEU LEU B . n 
B 1 22  GLY 22  110 110 GLY GLY B . n 
B 1 23  LEU 23  111 111 LEU LEU B . n 
B 1 24  PRO 24  112 112 PRO PRO B . n 
B 1 25  TRP 25  113 113 TRP TRP B . n 
B 1 26  LYS 26  114 114 LYS LYS B . n 
B 1 27  THR 27  115 115 THR THR B . n 
B 1 28  THR 28  116 116 THR THR B . n 
B 1 29  GLU 29  117 117 GLU GLU B . n 
B 1 30  GLN 30  118 118 GLN GLN B . n 
B 1 31  ASP 31  119 119 ASP ASP B . n 
B 1 32  LEU 32  120 120 LEU LEU B . n 
B 1 33  LYS 33  121 121 LYS LYS B . n 
B 1 34  GLU 34  122 122 GLU GLU B . n 
B 1 35  TYR 35  123 123 TYR TYR B . n 
B 1 36  PHE 36  124 124 PHE PHE B . n 
B 1 37  SER 37  125 125 SER SER B . n 
B 1 38  THR 38  126 126 THR THR B . n 
B 1 39  PHE 39  127 127 PHE PHE B . n 
B 1 40  GLY 40  128 128 GLY GLY B . n 
B 1 41  GLU 41  129 129 GLU GLU B . n 
B 1 42  VAL 42  130 130 VAL VAL B . n 
B 1 43  LEU 43  131 131 LEU LEU B . n 
B 1 44  MET 44  132 132 MET MET B . n 
B 1 45  VAL 45  133 133 VAL VAL B . n 
B 1 46  GLN 46  134 134 GLN GLN B . n 
B 1 47  VAL 47  135 135 VAL VAL B . n 
B 1 48  LYS 48  136 136 LYS LYS B . n 
B 1 49  LYS 49  137 137 LYS LYS B . n 
B 1 50  ASP 50  138 138 ASP ASP B . n 
B 1 51  LEU 51  139 139 LEU LEU B . n 
B 1 52  LYS 52  140 140 LYS LYS B . n 
B 1 53  THR 53  141 141 THR THR B . n 
B 1 54  GLY 54  142 142 GLY GLY B . n 
B 1 55  HIS 55  143 143 HIS HIS B . n 
B 1 56  SER 56  144 144 SER SER B . n 
B 1 57  LYS 57  145 145 LYS LYS B . n 
B 1 58  GLY 58  146 146 GLY GLY B . n 
B 1 59  PHE 59  147 147 PHE PHE B . n 
B 1 60  GLY 60  148 148 GLY GLY B . n 
B 1 61  PHE 61  149 149 PHE PHE B . n 
B 1 62  VAL 62  150 150 VAL VAL B . n 
B 1 63  ARG 63  151 151 ARG ARG B . n 
B 1 64  PHE 64  152 152 PHE PHE B . n 
B 1 65  THR 65  153 153 THR THR B . n 
B 1 66  GLU 66  154 154 GLU GLU B . n 
B 1 67  TYR 67  155 155 TYR TYR B . n 
B 1 68  GLU 68  156 156 GLU GLU B . n 
B 1 69  THR 69  157 157 THR THR B . n 
B 1 70  GLN 70  158 158 GLN GLN B . n 
B 1 71  VAL 71  159 159 VAL VAL B . n 
B 1 72  LYS 72  160 160 LYS LYS B . n 
B 1 73  VAL 73  161 161 VAL VAL B . n 
B 1 74  MET 74  162 162 MET MET B . n 
B 1 75  SER 75  163 163 SER SER B . n 
B 1 76  GLN 76  164 164 GLN GLN B . n 
B 1 77  ARG 77  165 165 ARG ARG B . n 
B 1 78  HIS 78  166 166 HIS HIS B . n 
B 1 79  MET 79  167 167 MET MET B . n 
B 1 80  ILE 80  168 168 ILE ILE B . n 
B 1 81  ASP 81  169 169 ASP ASP B . n 
B 1 82  GLY 82  170 170 GLY GLY B . n 
B 1 83  ARG 83  171 171 ARG ARG B . n 
B 1 84  TRP 84  172 172 TRP TRP B . n 
B 1 85  CYS 85  173 173 CYS CYS B . n 
B 1 86  ASP 86  174 174 ASP ASP B . n 
B 1 87  CYS 87  175 175 CYS CYS B . n 
B 1 88  LYS 88  176 176 LYS LYS B . n 
B 1 89  LEU 89  177 177 LEU LEU B . n 
B 1 90  PRO 90  178 178 PRO PRO B . n 
B 1 91  ASN 91  179 179 ASN ASN B . n 
B 1 92  SER 92  180 ?   ?   ?   B . n 
B 1 93  LYS 93  181 ?   ?   ?   B . n 
B 1 94  GLN 94  182 ?   ?   ?   B . n 
B 1 95  SER 95  183 ?   ?   ?   B . n 
B 1 96  GLN 96  184 ?   ?   ?   B . n 
B 1 97  ASP 97  185 ?   ?   ?   B . n 
B 1 98  GLU 98  186 ?   ?   ?   B . n 
B 1 99  PRO 99  187 ?   ?   ?   B . n 
B 1 100 LEU 100 188 ?   ?   ?   B . n 
B 1 101 ARG 101 189 ?   ?   ?   B . n 
B 1 102 SER 102 190 ?   ?   ?   B . n 
B 1 103 ARG 103 191 ?   ?   ?   B . n 
C 2 1   DG  1   1   1   DG  DG  C . n 
C 2 2   DT  2   2   2   DT  DT  C . n 
C 2 3   DT  3   3   3   DT  DT  C . n 
C 2 4   DG  4   4   4   DG  DG  C . n 
C 2 5   DA  5   5   5   DA  DA  C . n 
C 2 6   DG  6   6   6   DG  DG  C . n 
C 2 7   DC  7   7   7   DC  DC  C . n 
C 2 8   DG  8   8   8   DG  DG  C . n 
C 2 9   DT  9   9   9   DT  DT  C . n 
C 2 10  DT  10  10  10  DT  DT  C . n 
D 2 1   DG  1   1   ?   ?   ?   D . n 
D 2 2   DT  2   2   ?   ?   ?   D . n 
D 2 3   DT  3   3   ?   ?   ?   D . n 
D 2 4   DG  4   4   4   DG  DG  D . n 
D 2 5   DA  5   5   5   DA  DA  D . n 
D 2 6   DG  6   6   6   DG  DG  D . n 
D 2 7   DC  7   7   7   DC  DC  D . n 
D 2 8   DG  8   8   ?   ?   ?   D . n 
D 2 9   DT  9   9   ?   ?   ?   D . n 
D 2 10  DT  10  10  ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 HOH 1  201 26 HOH HOH A . 
E 3 HOH 2  202 17 HOH HOH A . 
E 3 HOH 3  203 1  HOH HOH A . 
E 3 HOH 4  204 8  HOH HOH A . 
E 3 HOH 5  205 3  HOH HOH A . 
E 3 HOH 6  206 2  HOH HOH A . 
E 3 HOH 7  207 13 HOH HOH A . 
E 3 HOH 8  208 12 HOH HOH A . 
E 3 HOH 9  209 9  HOH HOH A . 
E 3 HOH 10 210 4  HOH HOH A . 
E 3 HOH 11 211 21 HOH HOH A . 
E 3 HOH 12 212 23 HOH HOH A . 
E 3 HOH 13 213 25 HOH HOH A . 
E 3 HOH 14 214 27 HOH HOH A . 
E 3 HOH 15 215 28 HOH HOH A . 
E 3 HOH 16 216 30 HOH HOH A . 
E 3 HOH 17 217 32 HOH HOH A . 
E 3 HOH 18 218 33 HOH HOH A . 
F 3 HOH 1  201 34 HOH HOH B . 
F 3 HOH 2  202 7  HOH HOH B . 
F 3 HOH 3  203 10 HOH HOH B . 
F 3 HOH 4  204 14 HOH HOH B . 
F 3 HOH 5  205 6  HOH HOH B . 
F 3 HOH 6  206 5  HOH HOH B . 
F 3 HOH 7  207 15 HOH HOH B . 
F 3 HOH 8  208 16 HOH HOH B . 
F 3 HOH 9  209 20 HOH HOH B . 
F 3 HOH 10 210 24 HOH HOH B . 
F 3 HOH 11 211 29 HOH HOH B . 
F 3 HOH 12 212 35 HOH HOH B . 
F 3 HOH 13 213 36 HOH HOH B . 
F 3 HOH 14 214 37 HOH HOH B . 
G 3 HOH 1  101 31 HOH HOH C . 
G 3 HOH 2  102 11 HOH HOH C . 
G 3 HOH 3  103 18 HOH HOH C . 
H 3 HOH 1  101 19 HOH HOH D . 
H 3 HOH 2  102 22 HOH HOH D . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? dimeric 2 
2 author_defined_assembly ? dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G 
2 1 B,D,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 209 ? E HOH . 
2 1 A HOH 210 ? E HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-02-10 
2 'Structure model' 1 1 2016-03-09 
3 'Structure model' 1 2 2017-10-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'      
2 3 'Structure model' 'Derived calculations'     
3 3 'Structure model' 'Experimental preparation' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' exptl_crystal_grow    
2 3 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_exptl_crystal_grow.pH'                    
2 3 'Structure model' '_exptl_crystal_grow.pdbx_details'          
3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                '(phenix.refine: 1.8.1_1168)' 
_software.pdbx_ordinal           1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A ASN 179 ? ? HG A SER 180 ? ? 1.54 
2 1 OE2 B GLU 156 ? ? O  B HOH 201 ? ? 2.07 
3 1 N   B THR 103 ? ? O  B HOH 212 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" C DT 3 ? ? "C4'" C DT 3 ? ? "C3'" C DT 3 ? ? 101.88 104.50 -2.62 0.40 N 
2 1 "C3'" C DG 8 ? ? "C2'" C DG 8 ? ? "C1'" C DG 8 ? ? 96.22  102.40 -6.18 0.80 N 
3 1 "O4'" C DG 8 ? ? "C1'" C DG 8 ? ? N9    C DG 8 ? ? 111.35 108.30 3.05  0.30 N 
4 1 "O4'" C DT 9 ? ? "C1'" C DT 9 ? ? N1    C DT 9 ? ? 110.90 108.30 2.60  0.30 N 
5 1 "O4'" D DA 5 ? ? "C1'" D DA 5 ? ? N9    D DA 5 ? ? 110.23 108.30 1.93  0.30 N 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    LYS 
_pdbx_validate_torsion.auth_asym_id    B 
_pdbx_validate_torsion.auth_seq_id     140 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             -95.50 
_pdbx_validate_torsion.psi             -70.07 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 89  ? A MET 1   
2  1 Y 1 A ARG 90  ? A ARG 2   
3  1 Y 1 A GLY 91  ? A GLY 3   
4  1 Y 1 A SER 92  ? A SER 4   
5  1 Y 1 A HIS 93  ? A HIS 5   
6  1 Y 1 A HIS 94  ? A HIS 6   
7  1 Y 1 A HIS 95  ? A HIS 7   
8  1 Y 1 A HIS 96  ? A HIS 8   
9  1 Y 1 A HIS 97  ? A HIS 9   
10 1 Y 1 A HIS 98  ? A HIS 10  
11 1 Y 1 A GLY 99  ? A GLY 11  
12 1 Y 1 A SER 100 ? A SER 12  
13 1 Y 1 A GLN 101 ? A GLN 13  
14 1 Y 1 A LYS 102 ? A LYS 14  
15 1 Y 1 A LYS 181 ? A LYS 93  
16 1 Y 1 A GLN 182 ? A GLN 94  
17 1 Y 1 A SER 183 ? A SER 95  
18 1 Y 1 A GLN 184 ? A GLN 96  
19 1 Y 1 A ASP 185 ? A ASP 97  
20 1 Y 1 A GLU 186 ? A GLU 98  
21 1 Y 1 A PRO 187 ? A PRO 99  
22 1 Y 1 A LEU 188 ? A LEU 100 
23 1 Y 1 A ARG 189 ? A ARG 101 
24 1 Y 1 A SER 190 ? A SER 102 
25 1 Y 1 A ARG 191 ? A ARG 103 
26 1 Y 1 B MET 89  ? B MET 1   
27 1 Y 1 B ARG 90  ? B ARG 2   
28 1 Y 1 B GLY 91  ? B GLY 3   
29 1 Y 1 B SER 92  ? B SER 4   
30 1 Y 1 B HIS 93  ? B HIS 5   
31 1 Y 1 B HIS 94  ? B HIS 6   
32 1 Y 1 B HIS 95  ? B HIS 7   
33 1 Y 1 B HIS 96  ? B HIS 8   
34 1 Y 1 B HIS 97  ? B HIS 9   
35 1 Y 1 B HIS 98  ? B HIS 10  
36 1 Y 1 B GLY 99  ? B GLY 11  
37 1 Y 1 B SER 100 ? B SER 12  
38 1 Y 1 B GLN 101 ? B GLN 13  
39 1 Y 1 B LYS 102 ? B LYS 14  
40 1 Y 1 B SER 180 ? B SER 92  
41 1 Y 1 B LYS 181 ? B LYS 93  
42 1 Y 1 B GLN 182 ? B GLN 94  
43 1 Y 1 B SER 183 ? B SER 95  
44 1 Y 1 B GLN 184 ? B GLN 96  
45 1 Y 1 B ASP 185 ? B ASP 97  
46 1 Y 1 B GLU 186 ? B GLU 98  
47 1 Y 1 B PRO 187 ? B PRO 99  
48 1 Y 1 B LEU 188 ? B LEU 100 
49 1 Y 1 B ARG 189 ? B ARG 101 
50 1 Y 1 B SER 190 ? B SER 102 
51 1 Y 1 B ARG 191 ? B ARG 103 
52 1 Y 1 D DG  1   ? D DG  1   
53 1 Y 1 D DT  2   ? D DT  2   
54 1 Y 1 D DT  3   ? D DT  3   
55 1 Y 1 D DG  8   ? D DG  8   
56 1 Y 1 D DT  9   ? D DT  9   
57 1 Y 1 D DT  10  ? D DT  10  
# 
_ndb_struct_conf_na.entry_id   4Y0F 
_ndb_struct_conf_na.feature    'double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 C DG 1 1_555 C DA 5 12_554 -1.609 1.678 -0.446 41.180 11.047 161.120 1 C_DG1:DA5_C C 1 ? C 5 ? ? 2 
1 C DG 1 1_555 C DA 5 1_555  -1.609 1.678 -0.446 41.180 11.047 161.120 2 C_DG1:DA5_C C 1 ? C 5 ? ? 2 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Academia Sinica'          Taiwan ? 1 
'National Science Council' Taiwan ? 2 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#