data_4Y1W
# 
_entry.id   4Y1W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Y1W         
WWPDB D_1000206500 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4Y1W 
_pdbx_database_status.recvd_initial_deposition_date   2015-02-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ravulapalli, R.' 1 
'Tempel, W.'      2 
'Merrrill, A.R.'  3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biochemistry 
_citation.journal_id_ASTM           BICHAW 
_citation.journal_id_CSD            0033 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            54 
_citation.language                  ? 
_citation.page_first                5920 
_citation.page_last                 5936 
_citation.title                     'Characterization of Vis Toxin, a Novel ADP-Ribosyltransferase from Vibrio splendidus.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.5b00921 
_citation.pdbx_database_id_PubMed   26352925 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ravulapalli, R.'  1 
primary 'Lugo, M.R.'       2 
primary 'Pfoh, R.'         3 
primary 'Visschedyk, D.'   4 
primary 'Poole, A.'        5 
primary 'Fieldhouse, R.J.' 6 
primary 'Pai, E.F.'        7 
primary 'Merrill, A.R.'    8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4Y1W 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     48.500 
_cell.length_a_esd                 ? 
_cell.length_b                     51.800 
_cell.length_b_esd                 ? 
_cell.length_c                     102.800 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4Y1W 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'NAD(+)--arginine ADP-ribosyltransferase Vis' 27037.045 1   2.4.2.31 ? ? ? 
2 water   nat water                                         18.015    273 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Putative mono(ADP-ribosyl)transferase,mART,Toxin Vis' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGRENLYFQGPFDAIKQPNRSEEEVTQLAEDFKDWSKASNGWRYSFITANEKEAVEDFSISGYQTANDYLRA
TDTSTWGVAGADARQYIRTVKSALNKLPKYKGTAYRGTWVKLSLLNKLEEGDVLVEPAFTSTSTLPEVAKRFSVVHPNSP
QRLKRVLFEVKINQGGHTIAGLSEYSKEAEVLFAPNAHFRITQIERTSNHTYIGVETVKASAVKNTQKYNLYSGEEVEA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGRENLYFQGPFDAIKQPNRSEEEVTQLAEDFKDWSKASNGWRYSFITANEKEAVEDFSISGYQTANDYLRA
TDTSTWGVAGADARQYIRTVKSALNKLPKYKGTAYRGTWVKLSLLNKLEEGDVLVEPAFTSTSTLPEVAKRFSVVHPNSP
QRLKRVLFEVKINQGGHTIAGLSEYSKEAEVLFAPNAHFRITQIERTSNHTYIGVETVKASAVKNTQKYNLYSGEEVEA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  ARG n 
1 12  GLU n 
1 13  ASN n 
1 14  LEU n 
1 15  TYR n 
1 16  PHE n 
1 17  GLN n 
1 18  GLY n 
1 19  PRO n 
1 20  PHE n 
1 21  ASP n 
1 22  ALA n 
1 23  ILE n 
1 24  LYS n 
1 25  GLN n 
1 26  PRO n 
1 27  ASN n 
1 28  ARG n 
1 29  SER n 
1 30  GLU n 
1 31  GLU n 
1 32  GLU n 
1 33  VAL n 
1 34  THR n 
1 35  GLN n 
1 36  LEU n 
1 37  ALA n 
1 38  GLU n 
1 39  ASP n 
1 40  PHE n 
1 41  LYS n 
1 42  ASP n 
1 43  TRP n 
1 44  SER n 
1 45  LYS n 
1 46  ALA n 
1 47  SER n 
1 48  ASN n 
1 49  GLY n 
1 50  TRP n 
1 51  ARG n 
1 52  TYR n 
1 53  SER n 
1 54  PHE n 
1 55  ILE n 
1 56  THR n 
1 57  ALA n 
1 58  ASN n 
1 59  GLU n 
1 60  LYS n 
1 61  GLU n 
1 62  ALA n 
1 63  VAL n 
1 64  GLU n 
1 65  ASP n 
1 66  PHE n 
1 67  SER n 
1 68  ILE n 
1 69  SER n 
1 70  GLY n 
1 71  TYR n 
1 72  GLN n 
1 73  THR n 
1 74  ALA n 
1 75  ASN n 
1 76  ASP n 
1 77  TYR n 
1 78  LEU n 
1 79  ARG n 
1 80  ALA n 
1 81  THR n 
1 82  ASP n 
1 83  THR n 
1 84  SER n 
1 85  THR n 
1 86  TRP n 
1 87  GLY n 
1 88  VAL n 
1 89  ALA n 
1 90  GLY n 
1 91  ALA n 
1 92  ASP n 
1 93  ALA n 
1 94  ARG n 
1 95  GLN n 
1 96  TYR n 
1 97  ILE n 
1 98  ARG n 
1 99  THR n 
1 100 VAL n 
1 101 LYS n 
1 102 SER n 
1 103 ALA n 
1 104 LEU n 
1 105 ASN n 
1 106 LYS n 
1 107 LEU n 
1 108 PRO n 
1 109 LYS n 
1 110 TYR n 
1 111 LYS n 
1 112 GLY n 
1 113 THR n 
1 114 ALA n 
1 115 TYR n 
1 116 ARG n 
1 117 GLY n 
1 118 THR n 
1 119 TRP n 
1 120 VAL n 
1 121 LYS n 
1 122 LEU n 
1 123 SER n 
1 124 LEU n 
1 125 LEU n 
1 126 ASN n 
1 127 LYS n 
1 128 LEU n 
1 129 GLU n 
1 130 GLU n 
1 131 GLY n 
1 132 ASP n 
1 133 VAL n 
1 134 LEU n 
1 135 VAL n 
1 136 GLU n 
1 137 PRO n 
1 138 ALA n 
1 139 PHE n 
1 140 THR n 
1 141 SER n 
1 142 THR n 
1 143 SER n 
1 144 THR n 
1 145 LEU n 
1 146 PRO n 
1 147 GLU n 
1 148 VAL n 
1 149 ALA n 
1 150 LYS n 
1 151 ARG n 
1 152 PHE n 
1 153 SER n 
1 154 VAL n 
1 155 VAL n 
1 156 HIS n 
1 157 PRO n 
1 158 ASN n 
1 159 SER n 
1 160 PRO n 
1 161 GLN n 
1 162 ARG n 
1 163 LEU n 
1 164 LYS n 
1 165 ARG n 
1 166 VAL n 
1 167 LEU n 
1 168 PHE n 
1 169 GLU n 
1 170 VAL n 
1 171 LYS n 
1 172 ILE n 
1 173 ASN n 
1 174 GLN n 
1 175 GLY n 
1 176 GLY n 
1 177 HIS n 
1 178 THR n 
1 179 ILE n 
1 180 ALA n 
1 181 GLY n 
1 182 LEU n 
1 183 SER n 
1 184 GLU n 
1 185 TYR n 
1 186 SER n 
1 187 LYS n 
1 188 GLU n 
1 189 ALA n 
1 190 GLU n 
1 191 VAL n 
1 192 LEU n 
1 193 PHE n 
1 194 ALA n 
1 195 PRO n 
1 196 ASN n 
1 197 ALA n 
1 198 HIS n 
1 199 PHE n 
1 200 ARG n 
1 201 ILE n 
1 202 THR n 
1 203 GLN n 
1 204 ILE n 
1 205 GLU n 
1 206 ARG n 
1 207 THR n 
1 208 SER n 
1 209 ASN n 
1 210 HIS n 
1 211 THR n 
1 212 TYR n 
1 213 ILE n 
1 214 GLY n 
1 215 VAL n 
1 216 GLU n 
1 217 THR n 
1 218 VAL n 
1 219 LYS n 
1 220 ALA n 
1 221 SER n 
1 222 ALA n 
1 223 VAL n 
1 224 LYS n 
1 225 ASN n 
1 226 THR n 
1 227 GLN n 
1 228 LYS n 
1 229 TYR n 
1 230 ASN n 
1 231 LEU n 
1 232 TYR n 
1 233 SER n 
1 234 GLY n 
1 235 GLU n 
1 236 GLU n 
1 237 VAL n 
1 238 GLU n 
1 239 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   239 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 V12B01_18061 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Vibrio splendidus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     29497 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    VIS_VIBSP 
_struct_ref.pdbx_db_accession          A3UNN4 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PFDAIKQPNRSEEEVTQLAEDFKDWSKASNGWRYSFITANEKEAVEDFSISGYQTANDYLRATDTSTWGVAGADARQYIR
TVKSALNKLPKYKGTAYRGTWVKLSLLNKLEEGDVLVEPAFTSTSTLPEVAKRFSVVHPNSPQRLKRVLFEVKINQGGHT
IAGLSEYSKEAEVLFAPNAHFRITQIERTSNHTYIGVETVKASAVKNTQKYNLYSGEEVEA
;
_struct_ref.pdbx_align_begin           20 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4Y1W 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 19 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 239 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             A3UNN4 
_struct_ref_seq.db_align_beg                  20 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  240 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       20 
_struct_ref_seq.pdbx_auth_seq_align_end       240 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Y1W MET A 1  ? UNP A3UNN4 ? ? 'initiating methionine' 2  1  
1 4Y1W HIS A 2  ? UNP A3UNN4 ? ? 'expression tag'        3  2  
1 4Y1W HIS A 3  ? UNP A3UNN4 ? ? 'expression tag'        4  3  
1 4Y1W HIS A 4  ? UNP A3UNN4 ? ? 'expression tag'        5  4  
1 4Y1W HIS A 5  ? UNP A3UNN4 ? ? 'expression tag'        6  5  
1 4Y1W HIS A 6  ? UNP A3UNN4 ? ? 'expression tag'        7  6  
1 4Y1W HIS A 7  ? UNP A3UNN4 ? ? 'expression tag'        8  7  
1 4Y1W SER A 8  ? UNP A3UNN4 ? ? 'expression tag'        9  8  
1 4Y1W SER A 9  ? UNP A3UNN4 ? ? 'expression tag'        10 9  
1 4Y1W GLY A 10 ? UNP A3UNN4 ? ? 'expression tag'        11 10 
1 4Y1W ARG A 11 ? UNP A3UNN4 ? ? 'expression tag'        12 11 
1 4Y1W GLU A 12 ? UNP A3UNN4 ? ? 'expression tag'        13 12 
1 4Y1W ASN A 13 ? UNP A3UNN4 ? ? 'expression tag'        14 13 
1 4Y1W LEU A 14 ? UNP A3UNN4 ? ? 'expression tag'        15 14 
1 4Y1W TYR A 15 ? UNP A3UNN4 ? ? 'expression tag'        16 15 
1 4Y1W PHE A 16 ? UNP A3UNN4 ? ? 'expression tag'        17 16 
1 4Y1W GLN A 17 ? UNP A3UNN4 ? ? 'expression tag'        18 17 
1 4Y1W GLY A 18 ? UNP A3UNN4 ? ? 'expression tag'        19 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4Y1W 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.39 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.49 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            297.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '30% Jeffamine ED-2001, 0.1 M Hepes' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX-300' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-05-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_synchrotron_site       CLSI 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4Y1W 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.4 
_reflns.d_resolution_low                 35.404 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       50597 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.70 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.5 
_reflns.pdbx_Rmerge_I_obs                0.0639 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            14.73 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.4 
_reflns_shell.d_res_low                   1.45 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        83.48 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4Y1W 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.400 
_refine.ls_d_res_low                             35.404 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     50597 
_refine.ls_number_reflns_R_free                  2005 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.69 
_refine.ls_percent_reflns_R_free                 3.96 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1564 
_refine.ls_R_factor_R_free                       0.1848 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1552 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.00 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 17.13 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.13 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1723 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             273 
_refine_hist.number_atoms_total               1996 
_refine_hist.d_res_high                       1.400 
_refine_hist.d_res_low                        35.404 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010  ? 1777 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.226  ? 2407 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 13.549 ? 653  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.065  ? 266  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 310  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.400  1.4351  . . 120 2833 81.00  . . . 0.2941 . 0.2720 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4351 1.4739  . . 138 3187 91.00  . . . 0.2899 . 0.2459 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4739 1.5173  . . 131 3434 98.00  . . . 0.2465 . 0.2066 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5173 1.5662  . . 137 3526 100.00 . . . 0.1856 . 0.1715 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5662 1.6222  . . 158 3505 100.00 . . . 0.1934 . 0.1521 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6222 1.6872  . . 143 3491 100.00 . . . 0.2005 . 0.1469 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6872 1.7640  . . 156 3497 100.00 . . . 0.1595 . 0.1393 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7640 1.8569  . . 138 3560 100.00 . . . 0.1905 . 0.1309 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8569 1.9733  . . 146 3533 100.00 . . . 0.1405 . 0.1282 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9733 2.1256  . . 145 3545 100.00 . . . 0.1683 . 0.1303 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1256 2.3395  . . 149 3576 100.00 . . . 0.1803 . 0.1362 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3395 2.6779  . . 145 3575 100.00 . . . 0.1872 . 0.1451 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6779 3.3735  . . 153 3628 100.00 . . . 0.1847 . 0.1580 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3735 35.4152 . . 146 3702 98.00  . . . 0.1801 . 0.1647 . . . . . . . . . . 
# 
_struct.entry_id                     4Y1W 
_struct.title                        'Vis toxin, an ADP-ribosyltransferase from Vibrio Splendidus' 
_struct.pdbx_descriptor              'NAD(+)--arginine ADP-ribosyltransferase Vis' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4Y1W 
_struct_keywords.text            Transferase 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 PHE A 20  ? GLN A 25  ? PHE A 21  GLN A 26  1 ? 6  
HELX_P HELX_P2 AA2 SER A 29  ? SER A 47  ? SER A 30  SER A 48  1 ? 19 
HELX_P HELX_P3 AA3 ASN A 48  ? ILE A 55  ? ASN A 49  ILE A 56  5 ? 8  
HELX_P HELX_P4 AA4 THR A 56  ? SER A 67  ? THR A 57  SER A 68  1 ? 12 
HELX_P HELX_P5 AA5 SER A 69  ? ALA A 80  ? SER A 70  ALA A 81  1 ? 12 
HELX_P HELX_P6 AA6 GLY A 87  ? ASN A 105 ? GLY A 88  ASN A 106 1 ? 19 
HELX_P HELX_P7 AA7 LEU A 122 ? ASN A 126 ? LEU A 123 ASN A 127 1 ? 5  
HELX_P HELX_P8 AA8 LEU A 145 ? PHE A 152 ? LEU A 146 PHE A 153 1 ? 8  
HELX_P HELX_P9 AA9 LYS A 219 ? VAL A 223 ? LYS A 220 VAL A 224 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 7 ? 
AA2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? parallel      
AA1 6 7 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 112 ? LYS A 121 ? GLY A 113 LYS A 122 
AA1 2 LEU A 163 ? ILE A 172 ? LEU A 164 ILE A 173 
AA1 3 THR A 211 ? VAL A 218 ? THR A 212 VAL A 219 
AA1 4 ALA A 197 ? ARG A 206 ? ALA A 198 ARG A 207 
AA1 5 VAL A 133 ? GLU A 136 ? VAL A 134 GLU A 137 
AA1 6 LYS A 228 ? ASN A 230 ? LYS A 229 ASN A 231 
AA1 7 GLU A 236 ? VAL A 237 ? GLU A 237 VAL A 238 
AA2 1 THR A 140 ? SER A 143 ? THR A 141 SER A 144 
AA2 2 GLU A 190 ? PHE A 193 ? GLU A 191 PHE A 194 
AA2 3 HIS A 177 ? THR A 178 ? HIS A 178 THR A 179 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLY A 112 ? N GLY A 113 O ILE A 172 ? O ILE A 173 
AA1 2 3 N LYS A 171 ? N LYS A 172 O VAL A 215 ? O VAL A 216 
AA1 3 4 O GLU A 216 ? O GLU A 217 N ARG A 200 ? N ARG A 201 
AA1 4 5 O PHE A 199 ? O PHE A 200 N LEU A 134 ? N LEU A 135 
AA1 5 6 N VAL A 135 ? N VAL A 136 O TYR A 229 ? O TYR A 230 
AA1 6 7 N LYS A 228 ? N LYS A 229 O VAL A 237 ? O VAL A 238 
AA2 1 2 N THR A 142 ? N THR A 143 O VAL A 191 ? O VAL A 192 
AA2 2 3 O LEU A 192 ? O LEU A 193 N HIS A 177 ? N HIS A 178 
# 
_atom_sites.entry_id                    4Y1W 
_atom_sites.fract_transf_matrix[1][1]   0.020619 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019305 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009728 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . PRO A 1 19  ? -16.971 38.741 16.744 1.00 50.11 ? 20  PRO A N    1 
ATOM   2    C CA   . PRO A 1 19  ? -15.525 38.485 16.752 1.00 49.33 ? 20  PRO A CA   1 
ATOM   3    C C    . PRO A 1 19  ? -14.933 38.481 15.350 1.00 41.08 ? 20  PRO A C    1 
ATOM   4    O O    . PRO A 1 19  ? -15.508 37.856 14.453 1.00 40.57 ? 20  PRO A O    1 
ATOM   5    C CB   . PRO A 1 19  ? -15.414 37.088 17.388 1.00 48.70 ? 20  PRO A CB   1 
ATOM   6    C CG   . PRO A 1 19  ? -16.795 36.506 17.326 1.00 51.28 ? 20  PRO A CG   1 
ATOM   7    C CD   . PRO A 1 19  ? -17.709 37.682 17.448 1.00 52.92 ? 20  PRO A CD   1 
ATOM   8    H HA   . PRO A 1 19  ? -15.062 39.135 17.303 1.00 59.19 ? 20  PRO A HA   1 
ATOM   9    H HB2  . PRO A 1 19  ? -14.792 36.546 16.879 1.00 58.43 ? 20  PRO A HB2  1 
ATOM   10   H HB3  . PRO A 1 19  ? -15.120 37.172 18.309 1.00 58.43 ? 20  PRO A HB3  1 
ATOM   11   H HG2  . PRO A 1 19  ? -16.923 36.057 16.475 1.00 61.54 ? 20  PRO A HG2  1 
ATOM   12   H HG3  . PRO A 1 19  ? -16.925 35.890 18.064 1.00 61.54 ? 20  PRO A HG3  1 
ATOM   13   H HD2  . PRO A 1 19  ? -18.554 37.504 17.005 1.00 63.50 ? 20  PRO A HD2  1 
ATOM   14   H HD3  . PRO A 1 19  ? -17.837 37.918 18.380 1.00 63.50 ? 20  PRO A HD3  1 
ATOM   15   N N    . PHE A 1 20  ? -13.820 39.186 15.169 1.00 35.32 ? 21  PHE A N    1 
ATOM   16   C CA   . PHE A 1 20  ? -13.114 39.215 13.886 1.00 28.00 ? 21  PHE A CA   1 
ATOM   17   C C    . PHE A 1 20  ? -13.944 39.870 12.791 1.00 29.01 ? 21  PHE A C    1 
ATOM   18   O O    . PHE A 1 20  ? -13.743 39.614 11.602 1.00 24.02 ? 21  PHE A O    1 
ATOM   19   C CB   . PHE A 1 20  ? -12.723 37.800 13.462 1.00 24.74 ? 21  PHE A CB   1 
ATOM   20   C CG   . PHE A 1 20  ? -11.893 37.084 14.488 1.00 20.30 ? 21  PHE A CG   1 
ATOM   21   C CD1  . PHE A 1 20  ? -10.611 37.497 14.731 1.00 19.39 ? 21  PHE A CD1  1 
ATOM   22   C CD2  . PHE A 1 20  ? -12.385 35.993 15.185 1.00 20.25 ? 21  PHE A CD2  1 
ATOM   23   C CE1  . PHE A 1 20  ? -9.831  36.840 15.667 1.00 18.52 ? 21  PHE A CE1  1 
ATOM   24   C CE2  . PHE A 1 20  ? -11.608 35.332 16.114 1.00 20.49 ? 21  PHE A CE2  1 
ATOM   25   C CZ   . PHE A 1 20  ? -10.331 35.762 16.346 1.00 19.28 ? 21  PHE A CZ   1 
ATOM   26   H H    . PHE A 1 20  ? -13.447 39.662 15.780 1.00 42.38 ? 21  PHE A H    1 
ATOM   27   H HA   . PHE A 1 20  ? -12.298 39.730 13.989 1.00 33.60 ? 21  PHE A HA   1 
ATOM   28   H HB2  . PHE A 1 20  ? -13.530 37.282 13.316 1.00 29.69 ? 21  PHE A HB2  1 
ATOM   29   H HB3  . PHE A 1 20  ? -12.208 37.848 12.642 1.00 29.69 ? 21  PHE A HB3  1 
ATOM   30   H HD1  . PHE A 1 20  ? -10.265 38.227 14.270 1.00 23.26 ? 21  PHE A HD1  1 
ATOM   31   H HD2  . PHE A 1 20  ? -13.252 35.699 15.023 1.00 24.30 ? 21  PHE A HD2  1 
ATOM   32   H HE1  . PHE A 1 20  ? -8.962  37.127 15.830 1.00 22.22 ? 21  PHE A HE1  1 
ATOM   33   H HE2  . PHE A 1 20  ? -11.950 34.602 16.579 1.00 24.59 ? 21  PHE A HE2  1 
ATOM   34   H HZ   . PHE A 1 20  ? -9.803  35.326 16.975 1.00 23.14 ? 21  PHE A HZ   1 
ATOM   35   N N    . ASP A 1 21  ? -14.857 40.735 13.211 1.00 27.79 ? 22  ASP A N    1 
ATOM   36   C CA   . ASP A 1 21  ? -15.760 41.383 12.289 1.00 24.59 ? 22  ASP A CA   1 
ATOM   37   C C    . ASP A 1 21  ? -15.001 42.120 11.159 1.00 22.50 ? 22  ASP A C    1 
ATOM   38   O O    . ASP A 1 21  ? -15.385 42.064 9.983  1.00 24.33 ? 22  ASP A O    1 
ATOM   39   C CB   . ASP A 1 21  ? -16.676 42.344 13.059 1.00 31.37 ? 22  ASP A CB   1 
ATOM   40   C CG   . ASP A 1 21  ? -17.722 41.621 13.912 1.00 42.64 ? 22  ASP A CG   1 
ATOM   41   O OD1  . ASP A 1 21  ? -18.134 40.485 13.564 1.00 36.61 ? 22  ASP A OD1  1 
ATOM   42   O OD2  . ASP A 1 21  ? -18.146 42.207 14.936 1.00 52.90 ? 22  ASP A OD2  1 
ATOM   43   H H    . ASP A 1 21  ? -14.971 40.962 14.032 1.00 33.35 ? 22  ASP A H    1 
ATOM   44   H HA   . ASP A 1 21  ? -16.321 40.708 11.877 1.00 29.50 ? 22  ASP A HA   1 
ATOM   45   H HB2  . ASP A 1 21  ? -16.134 42.890 13.650 1.00 37.65 ? 22  ASP A HB2  1 
ATOM   46   H HB3  . ASP A 1 21  ? -17.145 42.908 12.425 1.00 37.65 ? 22  ASP A HB3  1 
ATOM   47   N N    . ALA A 1 22  ? -13.920 42.794 11.514 1.00 22.71 ? 23  ALA A N    1 
ATOM   48   C CA   . ALA A 1 22  ? -13.167 43.570 10.540 1.00 22.19 ? 23  ALA A CA   1 
ATOM   49   C C    . ALA A 1 22  ? -12.588 42.708 9.422  1.00 21.22 ? 23  ALA A C    1 
ATOM   50   O O    . ALA A 1 22  ? -12.423 43.161 8.296  1.00 22.97 ? 23  ALA A O    1 
ATOM   51   C CB   . ALA A 1 22  ? -12.056 44.346 11.235 1.00 26.08 ? 23  ALA A CB   1 
ATOM   52   H H    . ALA A 1 22  ? -13.600 42.819 12.312 1.00 27.25 ? 23  ALA A H    1 
ATOM   53   H HA   . ALA A 1 22  ? -13.765 44.216 10.132 1.00 26.63 ? 23  ALA A HA   1 
ATOM   54   H HB1  . ALA A 1 22  ? -11.566 44.857 10.571 1.00 31.29 ? 23  ALA A HB1  1 
ATOM   55   H HB2  . ALA A 1 22  ? -12.450 44.944 11.889 1.00 31.29 ? 23  ALA A HB2  1 
ATOM   56   H HB3  . ALA A 1 22  ? -11.462 43.719 11.675 1.00 31.29 ? 23  ALA A HB3  1 
ATOM   57   N N    . ILE A 1 23  ? -12.240 41.465 9.740  1.00 19.85 ? 24  ILE A N    1 
ATOM   58   C CA   . ILE A 1 23  ? -11.692 40.542 8.754  1.00 21.89 ? 24  ILE A CA   1 
ATOM   59   C C    . ILE A 1 23  ? -12.790 39.919 7.876  1.00 21.71 ? 24  ILE A C    1 
ATOM   60   O O    . ILE A 1 23  ? -12.590 39.662 6.695  1.00 24.52 ? 24  ILE A O    1 
ATOM   61   C CB   . ILE A 1 23  ? -10.920 39.412 9.448  1.00 21.63 ? 24  ILE A CB   1 
ATOM   62   C CG1  . ILE A 1 23  ? -9.746  39.978 10.255 1.00 23.09 ? 24  ILE A CG1  1 
ATOM   63   C CG2  . ILE A 1 23  ? -10.430 38.386 8.409  1.00 28.13 ? 24  ILE A CG2  1 
ATOM   64   C CD1  . ILE A 1 23  ? -9.179  38.977 11.262 1.00 24.50 ? 24  ILE A CD1  1 
ATOM   65   H H    . ILE A 1 23  ? -12.313 41.130 10.529 1.00 23.82 ? 24  ILE A H    1 
ATOM   66   H HA   . ILE A 1 23  ? -11.076 41.020 8.176  1.00 26.27 ? 24  ILE A HA   1 
ATOM   67   H HB   . ILE A 1 23  ? -11.523 38.962 10.061 1.00 25.95 ? 24  ILE A HB   1 
ATOM   68   H HG12 . ILE A 1 23  ? -9.033  40.225 9.645  1.00 27.71 ? 24  ILE A HG12 1 
ATOM   69   H HG13 . ILE A 1 23  ? -10.047 40.758 10.746 1.00 27.71 ? 24  ILE A HG13 1 
ATOM   70   H HG21 . ILE A 1 23  ? -9.946  37.680 8.866  1.00 33.75 ? 24  ILE A HG21 1 
ATOM   71   H HG22 . ILE A 1 23  ? -11.198 38.014 7.946  1.00 33.75 ? 24  ILE A HG22 1 
ATOM   72   H HG23 . ILE A 1 23  ? -9.846  38.832 7.776  1.00 33.75 ? 24  ILE A HG23 1 
ATOM   73   H HD11 . ILE A 1 23  ? -8.443  39.391 11.739 1.00 29.40 ? 24  ILE A HD11 1 
ATOM   74   H HD12 . ILE A 1 23  ? -9.878  38.726 11.886 1.00 29.40 ? 24  ILE A HD12 1 
ATOM   75   H HD13 . ILE A 1 23  ? -8.865  38.193 10.785 1.00 29.40 ? 24  ILE A HD13 1 
ATOM   76   N N    . LYS A 1 24  ? -13.957 39.715 8.476  1.00 21.04 ? 25  LYS A N    1 
ATOM   77   C CA   . LYS A 1 24  ? -15.050 38.998 7.835  1.00 23.73 ? 25  LYS A CA   1 
ATOM   78   C C    . LYS A 1 24  ? -15.760 39.834 6.787  1.00 24.52 ? 25  LYS A C    1 
ATOM   79   O O    . LYS A 1 24  ? -16.431 39.300 5.921  1.00 26.94 ? 25  LYS A O    1 
ATOM   80   C CB   . LYS A 1 24  ? -16.060 38.554 8.896  1.00 24.74 ? 25  LYS A CB   1 
ATOM   81   C CG   . LYS A 1 24  ? -15.511 37.459 9.801  1.00 25.91 ? 25  LYS A CG   1 
ATOM   82   C CD   . LYS A 1 24  ? -16.486 37.131 10.904 1.00 26.46 ? 25  LYS A CD   1 
ATOM   83   C CE   . LYS A 1 24  ? -15.879 36.174 11.887 1.00 29.59 ? 25  LYS A CE   1 
ATOM   84   N NZ   . LYS A 1 24  ? -16.324 34.788 11.681 1.00 40.20 ? 25  LYS A NZ   1 
ATOM   85   H H    . LYS A 1 24  ? -14.143 39.989 9.270  1.00 25.25 ? 25  LYS A H    1 
ATOM   86   H HA   . LYS A 1 24  ? -14.698 38.205 7.401  1.00 28.48 ? 25  LYS A HA   1 
ATOM   87   H HB2  . LYS A 1 24  ? -16.292 39.314 9.450  1.00 29.69 ? 25  LYS A HB2  1 
ATOM   88   H HB3  . LYS A 1 24  ? -16.852 38.210 8.454  1.00 29.69 ? 25  LYS A HB3  1 
ATOM   89   H HG2  . LYS A 1 24  ? -15.359 36.655 9.279  1.00 31.10 ? 25  LYS A HG2  1 
ATOM   90   H HG3  . LYS A 1 24  ? -14.683 37.761 10.206 1.00 31.10 ? 25  LYS A HG3  1 
ATOM   91   H HD2  . LYS A 1 24  ? -16.725 37.944 11.375 1.00 31.75 ? 25  LYS A HD2  1 
ATOM   92   H HD3  . LYS A 1 24  ? -17.277 36.717 10.522 1.00 31.75 ? 25  LYS A HD3  1 
ATOM   93   H HE2  . LYS A 1 24  ? -14.913 36.196 11.795 1.00 35.50 ? 25  LYS A HE2  1 
ATOM   94   H HE3  . LYS A 1 24  ? -16.132 36.440 12.785 1.00 35.50 ? 25  LYS A HE3  1 
ATOM   95   H HZ1  . LYS A 1 24  ? -15.942 34.254 12.281 1.00 48.24 ? 25  LYS A HZ1  1 
ATOM   96   H HZ2  . LYS A 1 24  ? -17.208 34.737 11.767 1.00 48.24 ? 25  LYS A HZ2  1 
ATOM   97   H HZ3  . LYS A 1 24  ? -16.097 34.515 10.865 1.00 48.24 ? 25  LYS A HZ3  1 
ATOM   98   N N    . GLN A 1 25  ? -15.636 41.143 6.865  1.00 23.27 ? 26  GLN A N    1 
ATOM   99   C CA   . GLN A 1 25  ? -16.434 41.957 5.963  1.00 24.66 ? 26  GLN A CA   1 
ATOM   100  C C    . GLN A 1 25  ? -15.752 42.114 4.613  1.00 21.02 ? 26  GLN A C    1 
ATOM   101  O O    . GLN A 1 25  ? -14.550 41.832 4.484  1.00 20.81 ? 26  GLN A O    1 
ATOM   102  C CB   . GLN A 1 25  ? -16.737 43.280 6.609  1.00 31.97 ? 26  GLN A CB   1 
ATOM   103  C CG   . GLN A 1 25  ? -15.599 44.133 6.880  1.00 37.04 ? 26  GLN A CG   1 
ATOM   104  C CD   . GLN A 1 25  ? -15.986 45.228 7.845  1.00 48.99 ? 26  GLN A CD   1 
ATOM   105  O OE1  . GLN A 1 25  ? -16.665 44.980 8.840  1.00 52.87 ? 26  GLN A OE1  1 
ATOM   106  N NE2  . GLN A 1 25  ? -15.588 46.450 7.542  1.00 55.22 ? 26  GLN A NE2  1 
ATOM   107  H H    . GLN A 1 25  ? -15.122 41.573 7.403  1.00 27.93 ? 26  GLN A H    1 
ATOM   108  H HA   . GLN A 1 25  ? -17.280 41.508 5.810  1.00 29.59 ? 26  GLN A HA   1 
ATOM   109  H HB2  . GLN A 1 25  ? -17.335 43.774 6.026  1.00 38.37 ? 26  GLN A HB2  1 
ATOM   110  H HB3  . GLN A 1 25  ? -17.180 43.111 7.455  1.00 38.37 ? 26  GLN A HB3  1 
ATOM   111  H HG2  . GLN A 1 25  ? -14.888 43.608 7.279  1.00 44.45 ? 26  GLN A HG2  1 
ATOM   112  H HG3  . GLN A 1 25  ? -15.297 44.543 6.055  1.00 44.45 ? 26  GLN A HG3  1 
ATOM   113  H HE21 . GLN A 1 25  ? -15.133 46.589 6.825  1.00 66.26 ? 26  GLN A HE21 1 
ATOM   114  H HE22 . GLN A 1 25  ? -15.784 47.108 8.060  1.00 66.26 ? 26  GLN A HE22 1 
ATOM   115  N N    . PRO A 1 26  ? -16.528 42.544 3.604  1.00 21.29 ? 27  PRO A N    1 
ATOM   116  C CA   . PRO A 1 26  ? -15.904 42.661 2.288  1.00 20.01 ? 27  PRO A CA   1 
ATOM   117  C C    . PRO A 1 26  ? -14.832 43.725 2.273  1.00 18.89 ? 27  PRO A C    1 
ATOM   118  O O    . PRO A 1 26  ? -14.899 44.693 3.017  1.00 20.13 ? 27  PRO A O    1 
ATOM   119  C CB   . PRO A 1 26  ? -17.069 43.030 1.365  1.00 24.71 ? 27  PRO A CB   1 
ATOM   120  C CG   . PRO A 1 26  ? -18.142 43.555 2.242  1.00 30.42 ? 27  PRO A CG   1 
ATOM   121  C CD   . PRO A 1 26  ? -17.941 42.963 3.603  1.00 23.57 ? 27  PRO A CD   1 
ATOM   122  H HA   . PRO A 1 26  ? -15.526 41.812 2.012  1.00 24.01 ? 27  PRO A HA   1 
ATOM   123  H HB2  . PRO A 1 26  ? -16.781 43.710 0.737  1.00 29.65 ? 27  PRO A HB2  1 
ATOM   124  H HB3  . PRO A 1 26  ? -17.372 42.238 0.894  1.00 29.65 ? 27  PRO A HB3  1 
ATOM   125  H HG2  . PRO A 1 26  ? -18.077 44.522 2.284  1.00 36.50 ? 27  PRO A HG2  1 
ATOM   126  H HG3  . PRO A 1 26  ? -19.005 43.291 1.885  1.00 36.50 ? 27  PRO A HG3  1 
ATOM   127  H HD2  . PRO A 1 26  ? -18.094 43.633 4.287  1.00 28.29 ? 27  PRO A HD2  1 
ATOM   128  H HD3  . PRO A 1 26  ? -18.520 42.194 3.724  1.00 28.29 ? 27  PRO A HD3  1 
ATOM   129  N N    . ASN A 1 27  ? -13.825 43.540 1.430  1.00 18.24 ? 28  ASN A N    1 
ATOM   130  C CA   . ASN A 1 27  ? -12.817 44.565 1.256  1.00 17.41 ? 28  ASN A CA   1 
ATOM   131  C C    . ASN A 1 27  ? -13.418 45.887 0.815  1.00 18.17 ? 28  ASN A C    1 
ATOM   132  O O    . ASN A 1 27  ? -14.350 45.919 0.008  1.00 20.53 ? 28  ASN A O    1 
ATOM   133  C CB   . ASN A 1 27  ? -11.817 44.132 0.181  1.00 16.80 ? 28  ASN A CB   1 
ATOM   134  C CG   . ASN A 1 27  ? -10.874 43.065 0.644  1.00 17.68 ? 28  ASN A CG   1 
ATOM   135  O OD1  . ASN A 1 27  ? -10.926 42.615 1.791  1.00 19.54 ? 28  ASN A OD1  1 
ATOM   136  N ND2  . ASN A 1 27  ? -9.988  42.632 -0.253 1.00 17.65 ? 28  ASN A ND2  1 
ATOM   137  H H    . ASN A 1 27  ? -13.706 42.835 0.952  1.00 21.89 ? 28  ASN A H    1 
ATOM   138  H HA   . ASN A 1 27  ? -12.340 44.701 2.089  1.00 20.89 ? 28  ASN A HA   1 
ATOM   139  H HB2  . ASN A 1 27  ? -12.306 43.786 -0.582 1.00 20.16 ? 28  ASN A HB2  1 
ATOM   140  H HB3  . ASN A 1 27  ? -11.290 44.901 -0.086 1.00 20.16 ? 28  ASN A HB3  1 
ATOM   141  H HD21 . ASN A 1 27  ? -9.423  42.020 -0.039 1.00 21.18 ? 28  ASN A HD21 1 
ATOM   142  H HD22 . ASN A 1 27  ? -9.981  42.966 -1.046 1.00 21.18 ? 28  ASN A HD22 1 
ATOM   143  N N    . ARG A 1 28  ? -12.864 46.984 1.330  1.00 18.53 ? 29  ARG A N    1 
ATOM   144  C CA   . ARG A 1 28  ? -13.220 48.306 0.850  1.00 18.72 ? 29  ARG A CA   1 
ATOM   145  C C    . ARG A 1 28  ? -12.608 48.541 -0.542 1.00 19.22 ? 29  ARG A C    1 
ATOM   146  O O    . ARG A 1 28  ? -11.765 47.774 -0.986 1.00 20.53 ? 29  ARG A O    1 
ATOM   147  C CB   . ARG A 1 28  ? -12.759 49.342 1.883  1.00 21.06 ? 29  ARG A CB   1 
ATOM   148  C CG   . ARG A 1 28  ? -13.556 49.225 3.175  1.00 21.38 ? 29  ARG A CG   1 
ATOM   149  C CD   . ARG A 1 28  ? -12.943 50.029 4.298  1.00 22.15 ? 29  ARG A CD   1 
ATOM   150  N NE   . ARG A 1 28  ? -11.756 49.360 4.802  1.00 22.63 ? 29  ARG A NE   1 
ATOM   151  C CZ   . ARG A 1 28  ? -11.130 49.654 5.933  1.00 22.07 ? 29  ARG A CZ   1 
ATOM   152  N NH1  . ARG A 1 28  ? -10.067 48.949 6.280  1.00 21.33 ? 29  ARG A NH1  1 
ATOM   153  N NH2  . ARG A 1 28  ? -11.572 50.642 6.705  1.00 22.98 ? 29  ARG A NH2  1 
ATOM   154  H H    . ARG A 1 28  ? -12.277 46.983 1.959  1.00 22.23 ? 29  ARG A H    1 
ATOM   155  H HA   . ARG A 1 28  ? -14.185 48.367 0.770  1.00 22.46 ? 29  ARG A HA   1 
ATOM   156  H HB2  . ARG A 1 28  ? -11.822 49.196 2.089  1.00 25.27 ? 29  ARG A HB2  1 
ATOM   157  H HB3  . ARG A 1 28  ? -12.889 50.234 1.524  1.00 25.27 ? 29  ARG A HB3  1 
ATOM   158  H HG2  . ARG A 1 28  ? -14.456 49.555 3.025  1.00 25.65 ? 29  ARG A HG2  1 
ATOM   159  H HG3  . ARG A 1 28  ? -13.582 48.295 3.450  1.00 25.65 ? 29  ARG A HG3  1 
ATOM   160  H HD2  . ARG A 1 28  ? -12.686 50.905 3.968  1.00 26.58 ? 29  ARG A HD2  1 
ATOM   161  H HD3  . ARG A 1 28  ? -13.581 50.113 5.024  1.00 26.58 ? 29  ARG A HD3  1 
ATOM   162  H HE   . ARG A 1 28  ? -11.433 48.720 4.327  1.00 27.15 ? 29  ARG A HE   1 
ATOM   163  H HH11 . ARG A 1 28  ? -9.787  48.314 5.772  1.00 25.59 ? 29  ARG A HH11 1 
ATOM   164  H HH12 . ARG A 1 28  ? -9.647  49.134 7.008  1.00 25.59 ? 29  ARG A HH12 1 
ATOM   165  H HH21 . ARG A 1 28  ? -12.267 51.092 6.473  1.00 27.58 ? 29  ARG A HH21 1 
ATOM   166  H HH22 . ARG A 1 28  ? -11.162 50.831 7.437  1.00 27.58 ? 29  ARG A HH22 1 
ATOM   167  N N    . SER A 1 29  ? -13.026 49.605 -1.214 1.00 22.60 ? 30  SER A N    1 
ATOM   168  C CA   . SER A 1 29  ? -12.516 49.906 -2.550 1.00 21.91 ? 30  SER A CA   1 
ATOM   169  C C    . SER A 1 29  ? -11.045 50.306 -2.504 1.00 21.02 ? 30  SER A C    1 
ATOM   170  O O    . SER A 1 29  ? -10.539 50.733 -1.466 1.00 21.68 ? 30  SER A O    1 
ATOM   171  C CB   . SER A 1 29  ? -13.301 51.049 -3.167 1.00 23.48 ? 30  SER A CB   1 
ATOM   172  O OG   . SER A 1 29  ? -13.040 52.262 -2.477 1.00 25.68 ? 30  SER A OG   1 
ATOM   173  H H    . SER A 1 29  ? -13.604 50.171 -0.922 1.00 27.12 ? 30  SER A H    1 
ATOM   174  H HA   . SER A 1 29  ? -12.608 49.124 -3.117 1.00 26.29 ? 30  SER A HA   1 
ATOM   175  H HB2  . SER A 1 29  ? -13.038 51.149 -4.095 1.00 28.18 ? 30  SER A HB2  1 
ATOM   176  H HB3  . SER A 1 29  ? -14.249 50.850 -3.109 1.00 28.18 ? 30  SER A HB3  1 
ATOM   177  H HG   . SER A 1 29  ? -13.263 52.188 -1.670 1.00 30.81 ? 30  SER A HG   1 
ATOM   178  N N    . GLU A 1 30  ? -10.372 50.205 -3.645 1.00 21.70 ? 31  GLU A N    1 
ATOM   179  C CA   . GLU A 1 30  ? -9.001  50.659 -3.793 1.00 21.48 ? 31  GLU A CA   1 
ATOM   180  C C    . GLU A 1 30  ? -8.890  52.123 -3.398 1.00 23.32 ? 31  GLU A C    1 
ATOM   181  O O    . GLU A 1 30  ? -7.936  52.496 -2.720 1.00 22.82 ? 31  GLU A O    1 
ATOM   182  C CB   . GLU A 1 30  ? -8.524  50.489 -5.249 1.00 23.18 ? 31  GLU A CB   1 
ATOM   183  C CG   . GLU A 1 30  ? -7.053  50.889 -5.485 1.00 26.10 ? 31  GLU A CG   1 
ATOM   184  C CD   . GLU A 1 30  ? -6.591  50.740 -6.925 1.00 31.85 ? 31  GLU A CD   1 
ATOM   185  O OE1  . GLU A 1 30  ? -7.451  50.624 -7.816 1.00 33.47 ? 31  GLU A OE1  1 
ATOM   186  O OE2  . GLU A 1 30  ? -5.359  50.731 -7.157 1.00 37.97 ? 31  GLU A OE2  1 
ATOM   187  H H    . GLU A 1 30  ? -10.699 49.867 -4.364 1.00 26.04 ? 31  GLU A H    1 
ATOM   188  H HA   . GLU A 1 30  ? -8.421  50.138 -3.215 1.00 25.78 ? 31  GLU A HA   1 
ATOM   189  H HB2  . GLU A 1 30  ? -8.620  49.557 -5.501 1.00 27.81 ? 31  GLU A HB2  1 
ATOM   190  H HB3  . GLU A 1 30  ? -9.076  51.042 -5.824 1.00 27.81 ? 31  GLU A HB3  1 
ATOM   191  H HG2  . GLU A 1 30  ? -6.938  51.819 -5.233 1.00 31.33 ? 31  GLU A HG2  1 
ATOM   192  H HG3  . GLU A 1 30  ? -6.485  50.328 -4.934 1.00 31.33 ? 31  GLU A HG3  1 
ATOM   193  N N    . GLU A 1 31  ? -9.856  52.951 -3.797 1.00 23.23 ? 32  GLU A N    1 
ATOM   194  C CA   . GLU A 1 31  ? -9.774  54.385 -3.521 1.00 24.90 ? 32  GLU A CA   1 
ATOM   195  C C    . GLU A 1 31  ? -9.834  54.625 -2.024 1.00 24.48 ? 32  GLU A C    1 
ATOM   196  O O    . GLU A 1 31  ? -9.071  55.444 -1.497 1.00 24.09 ? 32  GLU A O    1 
ATOM   197  C CB   . GLU A 1 31  ? -10.886 55.161 -4.230 1.00 30.22 ? 32  GLU A CB   1 
ATOM   198  C CG   . GLU A 1 31  ? -10.774 56.664 -4.100 1.00 42.58 ? 32  GLU A CG   1 
ATOM   199  C CD   . GLU A 1 31  ? -11.897 57.395 -4.818 1.00 59.32 ? 32  GLU A CD   1 
ATOM   200  O OE1  . GLU A 1 31  ? -12.589 58.214 -4.171 1.00 62.23 ? 32  GLU A OE1  1 
ATOM   201  O OE2  . GLU A 1 31  ? -12.084 57.153 -6.029 1.00 65.65 ? 32  GLU A OE2  1 
ATOM   202  H H    . GLU A 1 31  ? -10.562 52.710 -4.224 1.00 27.88 ? 32  GLU A H    1 
ATOM   203  H HA   . GLU A 1 31  ? -8.922  54.720 -3.845 1.00 29.88 ? 32  GLU A HA   1 
ATOM   204  H HB2  . GLU A 1 31  ? -10.864 54.944 -5.175 1.00 36.27 ? 32  GLU A HB2  1 
ATOM   205  H HB3  . GLU A 1 31  ? -11.740 54.895 -3.853 1.00 36.27 ? 32  GLU A HB3  1 
ATOM   206  H HG2  . GLU A 1 31  ? -10.810 56.905 -3.161 1.00 51.10 ? 32  GLU A HG2  1 
ATOM   207  H HG3  . GLU A 1 31  ? -9.932  56.954 -4.485 1.00 51.10 ? 32  GLU A HG3  1 
ATOM   208  N N    . GLU A 1 32  ? -10.697 53.887 -1.323 1.00 21.46 ? 33  GLU A N    1 
ATOM   209  C CA   . GLU A 1 32  ? -10.817 54.060 0.122  1.00 21.98 ? 33  GLU A CA   1 
ATOM   210  C C    . GLU A 1 32  ? -9.578  53.559 0.851  1.00 21.42 ? 33  GLU A C    1 
ATOM   211  O O    . GLU A 1 32  ? -9.067  54.226 1.748  1.00 22.35 ? 33  GLU A O    1 
ATOM   212  C CB   . GLU A 1 32  ? -12.051 53.368 0.701  1.00 23.69 ? 33  GLU A CB   1 
ATOM   213  C CG   . GLU A 1 32  ? -12.269 53.770 2.173  1.00 26.87 ? 33  GLU A CG   1 
ATOM   214  C CD   . GLU A 1 32  ? -13.598 53.324 2.755  1.00 35.73 ? 33  GLU A CD   1 
ATOM   215  O OE1  . GLU A 1 32  ? -13.884 53.724 3.910  1.00 34.76 ? 33  GLU A OE1  1 
ATOM   216  O OE2  . GLU A 1 32  ? -14.345 52.588 2.074  1.00 34.87 ? 33  GLU A OE2  1 
ATOM   217  H H    . GLU A 1 32  ? -11.217 53.289 -1.656 1.00 25.75 ? 33  GLU A H    1 
ATOM   218  H HA   . GLU A 1 32  ? -10.901 55.008 0.310  1.00 26.37 ? 33  GLU A HA   1 
ATOM   219  H HB2  . GLU A 1 32  ? -12.834 53.630 0.193  1.00 28.43 ? 33  GLU A HB2  1 
ATOM   220  H HB3  . GLU A 1 32  ? -11.929 52.406 0.662  1.00 28.43 ? 33  GLU A HB3  1 
ATOM   221  H HG2  . GLU A 1 32  ? -11.565 53.375 2.710  1.00 32.24 ? 33  GLU A HG2  1 
ATOM   222  H HG3  . GLU A 1 32  ? -12.228 54.737 2.240  1.00 32.24 ? 33  GLU A HG3  1 
ATOM   223  N N    . VAL A 1 33  ? -9.101  52.381 0.474  1.00 20.91 ? 34  VAL A N    1 
ATOM   224  C CA   . VAL A 1 33  ? -7.914  51.820 1.087  1.00 20.17 ? 34  VAL A CA   1 
ATOM   225  C C    . VAL A 1 33  ? -6.722  52.751 0.885  1.00 22.23 ? 34  VAL A C    1 
ATOM   226  O O    . VAL A 1 33  ? -5.961  53.000 1.824  1.00 22.08 ? 34  VAL A O    1 
ATOM   227  C CB   . VAL A 1 33  ? -7.623  50.399 0.539  1.00 22.62 ? 34  VAL A CB   1 
ATOM   228  C CG1  . VAL A 1 33  ? -6.227  49.935 0.965  1.00 26.42 ? 34  VAL A CG1  1 
ATOM   229  C CG2  . VAL A 1 33  ? -8.673  49.414 1.035  1.00 25.36 ? 34  VAL A CG2  1 
ATOM   230  H H    . VAL A 1 33  ? -9.451  51.887 -0.137 1.00 25.09 ? 34  VAL A H    1 
ATOM   231  H HA   . VAL A 1 33  ? -8.066  51.741 2.041  1.00 24.20 ? 34  VAL A HA   1 
ATOM   232  H HB   . VAL A 1 33  ? -7.656  50.416 -0.430 1.00 27.14 ? 34  VAL A HB   1 
ATOM   233  H HG11 . VAL A 1 33  ? -6.068  49.046 0.612  1.00 31.71 ? 34  VAL A HG11 1 
ATOM   234  H HG12 . VAL A 1 33  ? -5.568  50.554 0.612  1.00 31.71 ? 34  VAL A HG12 1 
ATOM   235  H HG13 . VAL A 1 33  ? -6.181  49.920 1.934  1.00 31.71 ? 34  VAL A HG13 1 
ATOM   236  H HG21 . VAL A 1 33  ? -8.472  48.534 0.681  1.00 30.43 ? 34  VAL A HG21 1 
ATOM   237  H HG22 . VAL A 1 33  ? -8.654  49.394 2.005  1.00 30.43 ? 34  VAL A HG22 1 
ATOM   238  H HG23 . VAL A 1 33  ? -9.547  49.703 0.727  1.00 30.43 ? 34  VAL A HG23 1 
ATOM   239  N N    . THR A 1 34  ? -6.555  53.265 -0.325 1.00 21.81 ? 35  THR A N    1 
ATOM   240  C CA   . THR A 1 34  ? -5.481  54.198 -0.641 1.00 23.76 ? 35  THR A CA   1 
ATOM   241  C C    . THR A 1 34  ? -5.562  55.473 0.200  1.00 22.14 ? 35  THR A C    1 
ATOM   242  O O    . THR A 1 34  ? -4.539  55.940 0.716  1.00 22.68 ? 35  THR A O    1 
ATOM   243  C CB   . THR A 1 34  ? -5.469  54.521 -2.137 1.00 27.28 ? 35  THR A CB   1 
ATOM   244  O OG1  . THR A 1 34  ? -5.182  53.313 -2.839 1.00 31.13 ? 35  THR A OG1  1 
ATOM   245  C CG2  . THR A 1 34  ? -4.409  55.547 -2.469 1.00 27.55 ? 35  THR A CG2  1 
ATOM   246  H H    . THR A 1 34  ? -7.061  53.085 -0.996 1.00 26.18 ? 35  THR A H    1 
ATOM   247  H HA   . THR A 1 34  ? -4.636  53.770 -0.433 1.00 28.51 ? 35  THR A HA   1 
ATOM   248  H HB   . THR A 1 34  ? -6.335  54.863 -2.408 1.00 32.74 ? 35  THR A HB   1 
ATOM   249  H HG1  . THR A 1 34  ? -5.770  52.737 -2.672 1.00 37.35 ? 35  THR A HG1  1 
ATOM   250  H HG21 . THR A 1 34  ? -4.418  55.737 -3.421 1.00 33.06 ? 35  THR A HG21 1 
ATOM   251  H HG22 . THR A 1 34  ? -4.578  56.369 -1.982 1.00 33.06 ? 35  THR A HG22 1 
ATOM   252  H HG23 . THR A 1 34  ? -3.533  55.210 -2.224 1.00 33.06 ? 35  THR A HG23 1 
ATOM   253  N N    . GLN A 1 35  ? -6.767  56.014 0.378  1.00 21.97 ? 36  GLN A N    1 
ATOM   254  C CA   . GLN A 1 35  ? -6.934  57.204 1.201  1.00 22.92 ? 36  GLN A CA   1 
ATOM   255  C C    . GLN A 1 35  ? -6.574  56.899 2.657  1.00 20.41 ? 36  GLN A C    1 
ATOM   256  O O    . GLN A 1 35  ? -5.896  57.691 3.310  1.00 20.80 ? 36  GLN A O    1 
ATOM   257  C CB   . GLN A 1 35  ? -8.363  57.746 1.122  1.00 26.64 ? 36  GLN A CB   1 
ATOM   258  C CG   . GLN A 1 35  ? -8.516  59.091 1.825  1.00 30.63 ? 36  GLN A CG   1 
ATOM   259  C CD   . GLN A 1 35  ? -7.586  60.140 1.255  1.00 35.07 ? 36  GLN A CD   1 
ATOM   260  O OE1  . GLN A 1 35  ? -7.678  60.490 0.078  1.00 38.57 ? 36  GLN A OE1  1 
ATOM   261  N NE2  . GLN A 1 35  ? -6.678  60.643 2.083  1.00 35.05 ? 36  GLN A NE2  1 
ATOM   262  H H    . GLN A 1 35  ? -7.496  55.713 0.034  1.00 26.36 ? 36  GLN A H    1 
ATOM   263  H HA   . GLN A 1 35  ? -6.333  57.895 0.882  1.00 27.51 ? 36  GLN A HA   1 
ATOM   264  H HB2  . GLN A 1 35  ? -8.606  57.864 0.190  1.00 31.97 ? 36  GLN A HB2  1 
ATOM   265  H HB3  . GLN A 1 35  ? -8.966  57.115 1.545  1.00 31.97 ? 36  GLN A HB3  1 
ATOM   266  H HG2  . GLN A 1 35  ? -9.428  59.405 1.718  1.00 36.76 ? 36  GLN A HG2  1 
ATOM   267  H HG3  . GLN A 1 35  ? -8.309  58.983 2.767  1.00 36.76 ? 36  GLN A HG3  1 
ATOM   268  H HE21 . GLN A 1 35  ? -6.641  60.370 2.897  1.00 42.06 ? 36  GLN A HE21 1 
ATOM   269  H HE22 . GLN A 1 35  ? -6.128  61.242 1.804  1.00 42.06 ? 36  GLN A HE22 1 
ATOM   270  N N    . LEU A 1 36  ? -7.062  55.776 3.175  1.00 19.70 ? 37  LEU A N    1 
ATOM   271  C CA   . LEU A 1 36  ? -6.747  55.385 4.547  1.00 18.06 ? 37  LEU A CA   1 
ATOM   272  C C    . LEU A 1 36  ? -5.243  55.220 4.729  1.00 18.36 ? 37  LEU A C    1 
ATOM   273  O O    . LEU A 1 36  ? -4.687  55.634 5.746  1.00 19.39 ? 37  LEU A O    1 
ATOM   274  C CB   . LEU A 1 36  ? -7.478  54.107 4.942  1.00 20.65 ? 37  LEU A CB   1 
ATOM   275  C CG   . LEU A 1 36  ? -8.995  54.248 5.044  1.00 23.05 ? 37  LEU A CG   1 
ATOM   276  C CD1  . LEU A 1 36  ? -9.592  52.873 5.129  1.00 25.33 ? 37  LEU A CD1  1 
ATOM   277  C CD2  . LEU A 1 36  ? -9.418  55.105 6.233  1.00 29.53 ? 37  LEU A CD2  1 
ATOM   278  H H    . LEU A 1 36  ? -7.575  55.226 2.757  1.00 23.65 ? 37  LEU A H    1 
ATOM   279  H HA   . LEU A 1 36  ? -7.041  56.090 5.146  1.00 21.68 ? 37  LEU A HA   1 
ATOM   280  H HB2  . LEU A 1 36  ? -7.290  53.425 4.278  1.00 24.78 ? 37  LEU A HB2  1 
ATOM   281  H HB3  . LEU A 1 36  ? -7.151  53.818 5.808  1.00 24.78 ? 37  LEU A HB3  1 
ATOM   282  H HG   . LEU A 1 36  ? -9.329  54.670 4.236  1.00 27.66 ? 37  LEU A HG   1 
ATOM   283  H HD11 . LEU A 1 36  ? -10.557 52.951 5.195  1.00 30.39 ? 37  LEU A HD11 1 
ATOM   284  H HD12 . LEU A 1 36  ? -9.354  52.375 4.332  1.00 30.39 ? 37  LEU A HD12 1 
ATOM   285  H HD13 . LEU A 1 36  ? -9.242  52.426 5.916  1.00 30.39 ? 37  LEU A HD13 1 
ATOM   286  H HD21 . LEU A 1 36  ? -10.386 55.162 6.251  1.00 35.43 ? 37  LEU A HD21 1 
ATOM   287  H HD22 . LEU A 1 36  ? -9.094  54.692 7.049  1.00 35.43 ? 37  LEU A HD22 1 
ATOM   288  H HD23 . LEU A 1 36  ? -9.035  55.991 6.135  1.00 35.43 ? 37  LEU A HD23 1 
ATOM   289  N N    . ALA A 1 37  ? -4.560  54.662 3.742  1.00 19.14 ? 38  ALA A N    1 
ATOM   290  C CA   . ALA A 1 37  ? -3.109  54.513 3.819  1.00 19.26 ? 38  ALA A CA   1 
ATOM   291  C C    . ALA A 1 37  ? -2.408  55.878 3.813  1.00 18.97 ? 38  ALA A C    1 
ATOM   292  O O    . ALA A 1 37  ? -1.437  56.099 4.554  1.00 19.38 ? 38  ALA A O    1 
ATOM   293  C CB   . ALA A 1 37  ? -2.597  53.622 2.690  1.00 21.16 ? 38  ALA A CB   1 
ATOM   294  H H    . ALA A 1 37  ? -4.909  54.360 3.016  1.00 22.97 ? 38  ALA A H    1 
ATOM   295  H HA   . ALA A 1 37  ? -2.888  54.076 4.657  1.00 23.11 ? 38  ALA A HA   1 
ATOM   296  H HB1  . ALA A 1 37  ? -1.634  53.540 2.764  1.00 25.39 ? 38  ALA A HB1  1 
ATOM   297  H HB2  . ALA A 1 37  ? -3.011  52.748 2.766  1.00 25.39 ? 38  ALA A HB2  1 
ATOM   298  H HB3  . ALA A 1 37  ? -2.831  54.026 1.839  1.00 25.39 ? 38  ALA A HB3  1 
ATOM   299  N N    . GLU A 1 38  ? -2.902  56.811 3.009  1.00 20.49 ? 39  GLU A N    1 
ATOM   300  C CA   . GLU A 1 38  ? -2.348  58.158 2.966  1.00 20.64 ? 39  GLU A CA   1 
ATOM   301  C C    . GLU A 1 38  ? -2.548  58.859 4.304  1.00 19.61 ? 39  GLU A C    1 
ATOM   302  O O    . GLU A 1 38  ? -1.639  59.521 4.828  1.00 22.53 ? 39  GLU A O    1 
ATOM   303  C CB   . GLU A 1 38  ? -3.003  58.982 1.845  1.00 27.48 ? 39  GLU A CB   1 
ATOM   304  C CG   . GLU A 1 38  ? -2.361  60.358 1.654  1.00 43.98 ? 39  GLU A CG   1 
ATOM   305  C CD   . GLU A 1 38  ? -1.011  60.291 0.967  1.00 62.35 ? 39  GLU A CD   1 
ATOM   306  O OE1  . GLU A 1 38  ? -0.660  59.210 0.447  1.00 67.77 ? 39  GLU A OE1  1 
ATOM   307  O OE2  . GLU A 1 38  ? -0.300  61.322 0.947  1.00 69.41 ? 39  GLU A OE2  1 
ATOM   308  H H    . GLU A 1 38  ? -3.564  56.689 2.474  1.00 24.59 ? 39  GLU A H    1 
ATOM   309  H HA   . GLU A 1 38  ? -1.396  58.107 2.789  1.00 24.76 ? 39  GLU A HA   1 
ATOM   310  H HB2  . GLU A 1 38  ? -2.922  58.496 1.010  1.00 32.97 ? 39  GLU A HB2  1 
ATOM   311  H HB3  . GLU A 1 38  ? -3.939  59.116 2.060  1.00 32.97 ? 39  GLU A HB3  1 
ATOM   312  H HG2  . GLU A 1 38  ? -2.948  60.906 1.110  1.00 52.78 ? 39  GLU A HG2  1 
ATOM   313  H HG3  . GLU A 1 38  ? -2.235  60.770 2.523  1.00 52.78 ? 39  GLU A HG3  1 
ATOM   314  N N    . ASP A 1 39  ? -3.744  58.718 4.864  1.00 20.67 ? 40  ASP A N    1 
ATOM   315  C CA   . ASP A 1 39  ? -4.043  59.307 6.170  1.00 20.96 ? 40  ASP A CA   1 
ATOM   316  C C    . ASP A 1 39  ? -3.080  58.760 7.227  1.00 20.88 ? 40  ASP A C    1 
ATOM   317  O O    . ASP A 1 39  ? -2.622  59.500 8.098  1.00 21.26 ? 40  ASP A O    1 
ATOM   318  C CB   . ASP A 1 39  ? -5.488  59.017 6.607  1.00 22.38 ? 40  ASP A CB   1 
ATOM   319  C CG   . ASP A 1 39  ? -6.523  59.722 5.760  1.00 28.97 ? 40  ASP A CG   1 
ATOM   320  O OD1  . ASP A 1 39  ? -6.178  60.675 5.042  1.00 30.75 ? 40  ASP A OD1  1 
ATOM   321  O OD2  . ASP A 1 39  ? -7.697  59.309 5.829  1.00 33.67 ? 40  ASP A OD2  1 
ATOM   322  H H    . ASP A 1 39  ? -4.400  58.288 4.512  1.00 24.81 ? 40  ASP A H    1 
ATOM   323  H HA   . ASP A 1 39  ? -3.926  60.268 6.122  1.00 25.15 ? 40  ASP A HA   1 
ATOM   324  H HB2  . ASP A 1 39  ? -5.651  58.063 6.543  1.00 26.85 ? 40  ASP A HB2  1 
ATOM   325  H HB3  . ASP A 1 39  ? -5.604  59.311 7.524  1.00 26.85 ? 40  ASP A HB3  1 
ATOM   326  N N    . PHE A 1 40  ? -2.787  57.464 7.169  1.00 17.19 ? 41  PHE A N    1 
ATOM   327  C CA   . PHE A 1 40  ? -1.905  56.841 8.129  1.00 16.31 ? 41  PHE A CA   1 
ATOM   328  C C    . PHE A 1 40  ? -0.462  57.306 7.973  1.00 17.37 ? 41  PHE A C    1 
ATOM   329  O O    . PHE A 1 40  ? 0.240   57.528 8.965  1.00 17.43 ? 41  PHE A O    1 
ATOM   330  C CB   . PHE A 1 40  ? -1.977  55.311 8.020  1.00 17.64 ? 41  PHE A CB   1 
ATOM   331  C CG   . PHE A 1 40  ? -1.314  54.592 9.166  1.00 15.45 ? 41  PHE A CG   1 
ATOM   332  C CD1  . PHE A 1 40  ? -1.940  54.497 10.384 1.00 16.41 ? 41  PHE A CD1  1 
ATOM   333  C CD2  . PHE A 1 40  ? -0.055  54.032 9.037  1.00 16.14 ? 41  PHE A CD2  1 
ATOM   334  C CE1  . PHE A 1 40  ? -1.324  53.835 11.451 1.00 18.50 ? 41  PHE A CE1  1 
ATOM   335  C CE2  . PHE A 1 40  ? 0.546   53.379 10.077 1.00 14.99 ? 41  PHE A CE2  1 
ATOM   336  C CZ   . PHE A 1 40  ? -0.089  53.293 11.297 1.00 15.74 ? 41  PHE A CZ   1 
ATOM   337  H H    . PHE A 1 40  ? -3.093  56.924 6.574  1.00 20.62 ? 41  PHE A H    1 
ATOM   338  H HA   . PHE A 1 40  ? -2.198  57.085 9.021  1.00 19.57 ? 41  PHE A HA   1 
ATOM   339  H HB2  . PHE A 1 40  ? -2.909  55.042 8.000  1.00 21.16 ? 41  PHE A HB2  1 
ATOM   340  H HB3  . PHE A 1 40  ? -1.537  55.034 7.201  1.00 21.16 ? 41  PHE A HB3  1 
ATOM   341  H HD1  . PHE A 1 40  ? -2.785  54.869 10.498 1.00 19.69 ? 41  PHE A HD1  1 
ATOM   342  H HD2  . PHE A 1 40  ? 0.385   54.087 8.219  1.00 19.37 ? 41  PHE A HD2  1 
ATOM   343  H HE1  . PHE A 1 40  ? -1.758  53.774 12.271 1.00 22.20 ? 41  PHE A HE1  1 
ATOM   344  H HE2  . PHE A 1 40  ? 1.392   53.010 9.966  1.00 17.99 ? 41  PHE A HE2  1 
ATOM   345  H HZ   . PHE A 1 40  ? 0.319   52.850 12.006 1.00 18.89 ? 41  PHE A HZ   1 
ATOM   346  N N    . LYS A 1 41  ? -0.030  57.457 6.725  1.00 17.02 ? 42  LYS A N    1 
ATOM   347  C CA   . LYS A 1 41  ? 1.286   58.004 6.447  1.00 18.99 ? 42  LYS A CA   1 
ATOM   348  C C    . LYS A 1 41  ? 1.400   59.429 7.021  1.00 19.90 ? 42  LYS A C    1 
ATOM   349  O O    . LYS A 1 41  ? 2.407   59.794 7.660  1.00 20.83 ? 42  LYS A O    1 
ATOM   350  C CB   . LYS A 1 41  ? 1.553   57.992 4.943  1.00 22.76 ? 42  LYS A CB   1 
ATOM   351  C CG   . LYS A 1 41  ? 2.787   58.751 4.592  1.00 26.89 ? 42  LYS A CG   1 
ATOM   352  C CD   . LYS A 1 41  ? 3.225   58.474 3.189  1.00 39.73 ? 42  LYS A CD   1 
ATOM   353  C CE   . LYS A 1 41  ? 2.458   59.337 2.228  1.00 50.66 ? 42  LYS A CE   1 
ATOM   354  N NZ   . LYS A 1 41  ? 2.809   58.976 0.827  1.00 56.09 ? 42  LYS A NZ   1 
ATOM   355  H H    . LYS A 1 41  ? -0.482  57.249 6.024  1.00 20.42 ? 42  LYS A H    1 
ATOM   356  H HA   . LYS A 1 41  ? 1.957   57.451 6.877  1.00 22.78 ? 42  LYS A HA   1 
ATOM   357  H HB2  . LYS A 1 41  ? 1.666   57.076 4.646  1.00 27.31 ? 42  LYS A HB2  1 
ATOM   358  H HB3  . LYS A 1 41  ? 0.804   58.403 4.483  1.00 27.31 ? 42  LYS A HB3  1 
ATOM   359  H HG2  . LYS A 1 41  ? 2.612   59.702 4.674  1.00 32.27 ? 42  LYS A HG2  1 
ATOM   360  H HG3  . LYS A 1 41  ? 3.504   58.489 5.191  1.00 32.27 ? 42  LYS A HG3  1 
ATOM   361  H HD2  . LYS A 1 41  ? 4.170   58.676 3.098  1.00 47.68 ? 42  LYS A HD2  1 
ATOM   362  H HD3  . LYS A 1 41  ? 3.054   57.544 2.973  1.00 47.68 ? 42  LYS A HD3  1 
ATOM   363  H HE2  . LYS A 1 41  ? 1.507   59.196 2.354  1.00 60.79 ? 42  LYS A HE2  1 
ATOM   364  H HE3  . LYS A 1 41  ? 2.687   60.268 2.373  1.00 60.79 ? 42  LYS A HE3  1 
ATOM   365  H HZ1  . LYS A 1 41  ? 2.354   59.488 0.258  1.00 67.30 ? 42  LYS A HZ1  1 
ATOM   366  H HZ2  . LYS A 1 41  ? 3.680   59.097 0.691  1.00 67.30 ? 42  LYS A HZ2  1 
ATOM   367  H HZ3  . LYS A 1 41  ? 2.607   58.123 0.673  1.00 67.30 ? 42  LYS A HZ3  1 
ATOM   368  N N    . ASP A 1 42  ? 0.356   60.226 6.824  1.00 21.93 ? 43  ASP A N    1 
ATOM   369  C CA   . ASP A 1 42  ? 0.362   61.603 7.322  1.00 23.17 ? 43  ASP A CA   1 
ATOM   370  C C    . ASP A 1 42  ? 0.411   61.626 8.850  1.00 23.26 ? 43  ASP A C    1 
ATOM   371  O O    . ASP A 1 42  ? 1.190   62.390 9.449  1.00 23.38 ? 43  ASP A O    1 
ATOM   372  C CB   . ASP A 1 42  ? -0.861  62.380 6.825  1.00 26.39 ? 43  ASP A CB   1 
ATOM   373  C CG   . ASP A 1 42  ? -0.815  62.667 5.321  1.00 35.38 ? 43  ASP A CG   1 
ATOM   374  O OD1  . ASP A 1 42  ? 0.286   62.616 4.727  1.00 35.64 ? 43  ASP A OD1  1 
ATOM   375  O OD2  . ASP A 1 42  ? -1.889  62.954 4.745  1.00 36.51 ? 43  ASP A OD2  1 
ATOM   376  H H    . ASP A 1 42  ? -0.363  60.000 6.410  1.00 26.31 ? 43  ASP A H    1 
ATOM   377  H HA   . ASP A 1 42  ? 1.155   62.052 6.991  1.00 27.80 ? 43  ASP A HA   1 
ATOM   378  H HB2  . ASP A 1 42  ? -1.660  61.861 7.006  1.00 31.67 ? 43  ASP A HB2  1 
ATOM   379  H HB3  . ASP A 1 42  ? -0.905  63.230 7.291  1.00 31.67 ? 43  ASP A HB3  1 
ATOM   380  N N    . TRP A 1 43  ? -0.409  60.786 9.482  1.00 21.32 ? 44  TRP A N    1 
ATOM   381  C CA   . TRP A 1 43  ? -0.390  60.681 10.944 1.00 19.21 ? 44  TRP A CA   1 
ATOM   382  C C    . TRP A 1 43  ? 0.998   60.274 11.429 1.00 19.82 ? 44  TRP A C    1 
ATOM   383  O O    . TRP A 1 43  ? 1.513   60.812 12.416 1.00 20.84 ? 44  TRP A O    1 
ATOM   384  C CB   . TRP A 1 43  ? -1.442  59.681 11.447 1.00 19.65 ? 44  TRP A CB   1 
ATOM   385  C CG   . TRP A 1 43  ? -1.214  59.388 12.888 1.00 19.31 ? 44  TRP A CG   1 
ATOM   386  C CD1  . TRP A 1 43  ? -1.559  60.170 13.945 1.00 20.30 ? 44  TRP A CD1  1 
ATOM   387  C CD2  . TRP A 1 43  ? -0.497  58.276 13.425 1.00 19.06 ? 44  TRP A CD2  1 
ATOM   388  N NE1  . TRP A 1 43  ? -1.130  59.594 15.110 1.00 22.06 ? 44  TRP A NE1  1 
ATOM   389  C CE2  . TRP A 1 43  ? -0.463  58.435 14.818 1.00 19.84 ? 44  TRP A CE2  1 
ATOM   390  C CE3  . TRP A 1 43  ? 0.113   57.151 12.865 1.00 19.85 ? 44  TRP A CE3  1 
ATOM   391  C CZ2  . TRP A 1 43  ? 0.155   57.508 15.653 1.00 19.77 ? 44  TRP A CZ2  1 
ATOM   392  C CZ3  . TRP A 1 43  ? 0.715   56.229 13.707 1.00 18.86 ? 44  TRP A CZ3  1 
ATOM   393  C CH2  . TRP A 1 43  ? 0.738   56.423 15.073 1.00 18.90 ? 44  TRP A CH2  1 
ATOM   394  H H    . TRP A 1 43  ? -0.979  60.272 9.095  1.00 25.58 ? 44  TRP A H    1 
ATOM   395  H HA   . TRP A 1 43  ? -0.597  61.549 11.325 1.00 23.05 ? 44  TRP A HA   1 
ATOM   396  H HB2  . TRP A 1 43  ? -2.328  60.063 11.346 1.00 23.59 ? 44  TRP A HB2  1 
ATOM   397  H HB3  . TRP A 1 43  ? -1.369  58.853 10.948 1.00 23.59 ? 44  TRP A HB3  1 
ATOM   398  H HD1  . TRP A 1 43  ? -2.023  60.974 13.886 1.00 24.36 ? 44  TRP A HD1  1 
ATOM   399  H HE1  . TRP A 1 43  ? -1.244  59.919 15.898 1.00 26.48 ? 44  TRP A HE1  1 
ATOM   400  H HE3  . TRP A 1 43  ? 0.115   57.023 11.944 1.00 23.82 ? 44  TRP A HE3  1 
ATOM   401  H HZ2  . TRP A 1 43  ? 0.155   57.618 16.577 1.00 23.72 ? 44  TRP A HZ2  1 
ATOM   402  H HZ3  . TRP A 1 43  ? 1.131   55.481 13.344 1.00 22.63 ? 44  TRP A HZ3  1 
ATOM   403  H HH2  . TRP A 1 43  ? 1.144   55.784 15.614 1.00 22.68 ? 44  TRP A HH2  1 
ATOM   404  N N    . SER A 1 44  ? 1.621   59.346 10.715 1.00 19.01 ? 45  SER A N    1 
ATOM   405  C CA   . SER A 1 44  ? 2.912   58.826 11.125 1.00 17.13 ? 45  SER A CA   1 
ATOM   406  C C    . SER A 1 44  ? 3.985   59.896 11.111 1.00 20.71 ? 45  SER A C    1 
ATOM   407  O O    . SER A 1 44  ? 4.775   60.012 12.047 1.00 23.86 ? 45  SER A O    1 
ATOM   408  C CB   . SER A 1 44  ? 3.342   57.675 10.222 1.00 17.24 ? 45  SER A CB   1 
ATOM   409  O OG   . SER A 1 44  ? 2.471   56.549 10.289 1.00 16.97 ? 45  SER A OG   1 
ATOM   410  H H    . SER A 1 44  ? 1.316   59.002 9.988  1.00 22.81 ? 45  SER A H    1 
ATOM   411  H HA   . SER A 1 44  ? 2.841   58.486 12.031 1.00 20.55 ? 45  SER A HA   1 
ATOM   412  H HB2  . SER A 1 44  ? 3.361   57.994 9.306  1.00 20.69 ? 45  SER A HB2  1 
ATOM   413  H HB3  . SER A 1 44  ? 4.231   57.393 10.486 1.00 20.69 ? 45  SER A HB3  1 
ATOM   414  H HG   . SER A 1 44  ? 1.695   56.771 10.057 1.00 20.37 ? 45  SER A HG   1 
ATOM   415  N N    . LYS A 1 45  ? 4.012   60.680 10.041 1.00 22.77 ? 46  LYS A N    1 
ATOM   416  C CA   . LYS A 1 45  ? 4.936   61.817 9.914  1.00 25.80 ? 46  LYS A CA   1 
ATOM   417  C C    . LYS A 1 45  ? 4.681   62.877 10.978 1.00 25.34 ? 46  LYS A C    1 
ATOM   418  O O    . LYS A 1 45  ? 5.613   63.437 11.563 1.00 30.70 ? 46  LYS A O    1 
ATOM   419  C CB   . LYS A 1 45  ? 4.785   62.454 8.533  1.00 27.77 ? 46  LYS A CB   1 
ATOM   420  C CG   . LYS A 1 45  ? 5.324   61.607 7.422  1.00 32.55 ? 46  LYS A CG   1 
ATOM   421  C CD   . LYS A 1 45  ? 5.060   62.238 6.064  1.00 38.10 ? 46  LYS A CD   1 
ATOM   422  C CE   . LYS A 1 45  ? 5.919   61.596 4.995  1.00 45.05 ? 46  LYS A CE   1 
ATOM   423  N NZ   . LYS A 1 45  ? 5.819   62.308 3.685  1.00 50.43 ? 46  LYS A NZ   1 
ATOM   424  H H    . LYS A 1 45  ? 3.498   60.577 9.359  1.00 27.33 ? 46  LYS A H    1 
ATOM   425  H HA   . LYS A 1 45  ? 5.848   61.503 10.007 1.00 30.97 ? 46  LYS A HA   1 
ATOM   426  H HB2  . LYS A 1 45  ? 3.843   62.606 8.360  1.00 33.33 ? 46  LYS A HB2  1 
ATOM   427  H HB3  . LYS A 1 45  ? 5.263   63.298 8.523  1.00 33.33 ? 46  LYS A HB3  1 
ATOM   428  H HG2  . LYS A 1 45  ? 6.283   61.509 7.530  1.00 39.06 ? 46  LYS A HG2  1 
ATOM   429  H HG3  . LYS A 1 45  ? 4.894   60.738 7.443  1.00 39.06 ? 46  LYS A HG3  1 
ATOM   430  H HD2  . LYS A 1 45  ? 4.128   62.111 5.826  1.00 45.72 ? 46  LYS A HD2  1 
ATOM   431  H HD3  . LYS A 1 45  ? 5.273   63.184 6.102  1.00 45.72 ? 46  LYS A HD3  1 
ATOM   432  H HE2  . LYS A 1 45  ? 6.846   61.615 5.278  1.00 54.06 ? 46  LYS A HE2  1 
ATOM   433  H HE3  . LYS A 1 45  ? 5.630   60.680 4.863  1.00 54.06 ? 46  LYS A HE3  1 
ATOM   434  H HZ1  . LYS A 1 45  ? 6.334   61.906 3.081  1.00 60.52 ? 46  LYS A HZ1  1 
ATOM   435  H HZ2  . LYS A 1 45  ? 4.977   62.299 3.398  1.00 60.52 ? 46  LYS A HZ2  1 
ATOM   436  H HZ3  . LYS A 1 45  ? 6.085   63.152 3.777  1.00 60.52 ? 46  LYS A HZ3  1 
ATOM   437  N N    . ALA A 1 46  ? 3.415   63.157 11.245 1.00 23.84 ? 47  ALA A N    1 
ATOM   438  C CA   . ALA A 1 46  ? 3.068   64.158 12.247 1.00 25.85 ? 47  ALA A CA   1 
ATOM   439  C C    . ALA A 1 46  ? 3.417   63.729 13.672 1.00 27.13 ? 47  ALA A C    1 
ATOM   440  O O    . ALA A 1 46  ? 3.455   64.557 14.576 1.00 28.75 ? 47  ALA A O    1 
ATOM   441  C CB   . ALA A 1 46  ? 1.590   64.496 12.157 1.00 27.88 ? 47  ALA A CB   1 
ATOM   442  H H    . ALA A 1 46  ? 2.740   62.785 10.864 1.00 28.61 ? 47  ALA A H    1 
ATOM   443  H HA   . ALA A 1 46  ? 3.566   64.969 12.057 1.00 31.02 ? 47  ALA A HA   1 
ATOM   444  H HB1  . ALA A 1 46  ? 1.377   65.162 12.830 1.00 33.46 ? 47  ALA A HB1  1 
ATOM   445  H HB2  . ALA A 1 46  ? 1.400   64.846 11.273 1.00 33.46 ? 47  ALA A HB2  1 
ATOM   446  H HB3  . ALA A 1 46  ? 1.072   63.691 12.314 1.00 33.46 ? 47  ALA A HB3  1 
ATOM   447  N N    . SER A 1 47  ? 3.675   62.442 13.871 1.00 25.58 ? 48  SER A N    1 
ATOM   448  C CA   . SER A 1 47  ? 3.844   61.896 15.213 1.00 24.71 ? 48  SER A CA   1 
ATOM   449  C C    . SER A 1 47  ? 5.314   61.670 15.588 1.00 25.85 ? 48  SER A C    1 
ATOM   450  O O    . SER A 1 47  ? 5.602   61.148 16.668 1.00 26.01 ? 48  SER A O    1 
ATOM   451  C CB   . SER A 1 47  ? 3.065   60.584 15.353 1.00 26.14 ? 48  SER A CB   1 
ATOM   452  O OG   . SER A 1 47  ? 1.667   60.812 15.218 1.00 28.28 ? 48  SER A OG   1 
ATOM   453  H H    . SER A 1 47  ? 3.757   61.860 13.242 1.00 30.70 ? 48  SER A H    1 
ATOM   454  H HA   . SER A 1 47  ? 3.473   62.526 15.851 1.00 29.66 ? 48  SER A HA   1 
ATOM   455  H HB2  . SER A 1 47  ? 3.353   59.969 14.659 1.00 31.37 ? 48  SER A HB2  1 
ATOM   456  H HB3  . SER A 1 47  ? 3.240   60.203 16.227 1.00 31.37 ? 48  SER A HB3  1 
ATOM   457  H HG   . SER A 1 47  ? 1.501   61.143 14.464 1.00 33.94 ? 48  SER A HG   1 
ATOM   458  N N    . ASN A 1 48  ? 6.243   62.040 14.709 1.00 28.04 ? 49  ASN A N    1 
ATOM   459  C CA   . ASN A 1 48  ? 7.655   61.878 15.028 1.00 28.87 ? 49  ASN A CA   1 
ATOM   460  C C    . ASN A 1 48  ? 7.979   62.653 16.304 1.00 30.27 ? 49  ASN A C    1 
ATOM   461  O O    . ASN A 1 48  ? 7.464   63.749 16.512 1.00 31.47 ? 49  ASN A O    1 
ATOM   462  C CB   . ASN A 1 48  ? 8.546   62.341 13.875 1.00 30.44 ? 49  ASN A CB   1 
ATOM   463  C CG   . ASN A 1 48  ? 8.518   61.390 12.691 1.00 30.79 ? 49  ASN A CG   1 
ATOM   464  O OD1  . ASN A 1 48  ? 8.380   60.174 12.849 1.00 30.97 ? 49  ASN A OD1  1 
ATOM   465  N ND2  . ASN A 1 48  ? 8.656   61.943 11.492 1.00 33.90 ? 49  ASN A ND2  1 
ATOM   466  H H    . ASN A 1 48  ? 6.084   62.380 13.935 1.00 33.65 ? 49  ASN A H    1 
ATOM   467  H HA   . ASN A 1 48  ? 7.838   60.940 15.191 1.00 34.64 ? 49  ASN A HA   1 
ATOM   468  H HB2  . ASN A 1 48  ? 8.242   63.210 13.570 1.00 36.53 ? 49  ASN A HB2  1 
ATOM   469  H HB3  . ASN A 1 48  ? 9.462   62.402 14.189 1.00 36.53 ? 49  ASN A HB3  1 
ATOM   470  H HD21 . ASN A 1 48  ? 8.647   61.450 10.788 1.00 40.68 ? 49  ASN A HD21 1 
ATOM   471  H HD22 . ASN A 1 48  ? 8.755   62.794 11.420 1.00 40.68 ? 49  ASN A HD22 1 
ATOM   472  N N    . GLY A 1 49  ? 8.799   62.051 17.167 1.00 31.34 ? 50  GLY A N    1 
ATOM   473  C CA   . GLY A 1 49  ? 9.150   62.652 18.445 1.00 31.41 ? 50  GLY A CA   1 
ATOM   474  C C    . GLY A 1 49  ? 10.612  63.036 18.473 1.00 30.92 ? 50  GLY A C    1 
ATOM   475  O O    . GLY A 1 49  ? 11.299  62.979 17.452 1.00 30.53 ? 50  GLY A O    1 
ATOM   476  H H    . GLY A 1 49  ? 9.166   61.286 17.030 1.00 37.60 ? 50  GLY A H    1 
ATOM   477  H HA2  . GLY A 1 49  ? 8.615   63.447 18.593 1.00 37.69 ? 50  GLY A HA2  1 
ATOM   478  H HA3  . GLY A 1 49  ? 8.978   62.022 19.163 1.00 37.69 ? 50  GLY A HA3  1 
ATOM   479  N N    . TRP A 1 50  ? 11.095  63.435 19.646 1.00 30.44 ? 51  TRP A N    1 
ATOM   480  C CA   . TRP A 1 50  ? 12.469  63.880 19.760 1.00 30.30 ? 51  TRP A CA   1 
ATOM   481  C C    . TRP A 1 50  ? 13.476  62.808 19.323 1.00 28.83 ? 51  TRP A C    1 
ATOM   482  O O    . TRP A 1 50  ? 14.552  63.128 18.839 1.00 31.21 ? 51  TRP A O    1 
ATOM   483  C CB   . TRP A 1 50  ? 12.764  64.387 21.185 1.00 32.56 ? 51  TRP A CB   1 
ATOM   484  C CG   . TRP A 1 50  ? 12.825  63.308 22.252 1.00 33.84 ? 51  TRP A CG   1 
ATOM   485  C CD1  . TRP A 1 50  ? 11.817  62.919 23.093 1.00 36.32 ? 51  TRP A CD1  1 
ATOM   486  C CD2  . TRP A 1 50  ? 13.958  62.499 22.596 1.00 36.79 ? 51  TRP A CD2  1 
ATOM   487  N NE1  . TRP A 1 50  ? 12.254  61.921 23.929 1.00 41.26 ? 51  TRP A NE1  1 
ATOM   488  C CE2  . TRP A 1 50  ? 13.563  61.646 23.646 1.00 38.22 ? 51  TRP A CE2  1 
ATOM   489  C CE3  . TRP A 1 50  ? 15.264  62.413 22.117 1.00 37.08 ? 51  TRP A CE3  1 
ATOM   490  C CZ2  . TRP A 1 50  ? 14.430  60.720 24.220 1.00 41.55 ? 51  TRP A CZ2  1 
ATOM   491  C CZ3  . TRP A 1 50  ? 16.119  61.494 22.688 1.00 41.05 ? 51  TRP A CZ3  1 
ATOM   492  C CH2  . TRP A 1 50  ? 15.698  60.660 23.727 1.00 41.32 ? 51  TRP A CH2  1 
ATOM   493  H H    . TRP A 1 50  ? 10.649  63.457 20.381 1.00 36.53 ? 51  TRP A H    1 
ATOM   494  H HA   . TRP A 1 50  ? 12.587  64.635 19.163 1.00 36.37 ? 51  TRP A HA   1 
ATOM   495  H HB2  . TRP A 1 50  ? 13.622  64.841 21.179 1.00 39.07 ? 51  TRP A HB2  1 
ATOM   496  H HB3  . TRP A 1 50  ? 12.068  65.011 21.441 1.00 39.07 ? 51  TRP A HB3  1 
ATOM   497  H HD1  . TRP A 1 50  ? 10.960  63.280 23.099 1.00 43.58 ? 51  TRP A HD1  1 
ATOM   498  H HE1  . TRP A 1 50  ? 11.781  61.533 24.533 1.00 49.51 ? 51  TRP A HE1  1 
ATOM   499  H HE3  . TRP A 1 50  ? 15.553  62.965 21.426 1.00 44.50 ? 51  TRP A HE3  1 
ATOM   500  H HZ2  . TRP A 1 50  ? 14.152  60.162 24.910 1.00 49.87 ? 51  TRP A HZ2  1 
ATOM   501  H HZ3  . TRP A 1 50  ? 16.992  61.429 22.377 1.00 49.25 ? 51  TRP A HZ3  1 
ATOM   502  H HH2  . TRP A 1 50  ? 16.299  60.051 24.092 1.00 49.59 ? 51  TRP A HH2  1 
ATOM   503  N N    . ARG A 1 51  ? 13.115  61.538 19.444 1.00 28.69 ? 52  ARG A N    1 
ATOM   504  C CA   . ARG A 1 51  ? 14.038  60.475 19.068 1.00 26.84 ? 52  ARG A CA   1 
ATOM   505  C C    . ARG A 1 51  ? 14.265  60.446 17.564 1.00 28.67 ? 52  ARG A C    1 
ATOM   506  O O    . ARG A 1 51  ? 15.316  60.004 17.103 1.00 27.22 ? 52  ARG A O    1 
ATOM   507  C CB   . ARG A 1 51  ? 13.516  59.123 19.525 1.00 30.66 ? 52  ARG A CB   1 
ATOM   508  C CG   . ARG A 1 51  ? 13.535  58.962 21.015 1.00 33.17 ? 52  ARG A CG   1 
ATOM   509  C CD   . ARG A 1 51  ? 12.798  57.719 21.431 1.00 38.09 ? 52  ARG A CD   1 
ATOM   510  N NE   . ARG A 1 51  ? 12.455  57.764 22.849 1.00 42.01 ? 52  ARG A NE   1 
ATOM   511  C CZ   . ARG A 1 51  ? 13.286  57.411 23.812 1.00 42.94 ? 52  ARG A CZ   1 
ATOM   512  N NH1  . ARG A 1 51  ? 14.511  56.996 23.516 1.00 49.99 ? 52  ARG A NH1  1 
ATOM   513  N NH2  . ARG A 1 51  ? 12.898  57.479 25.068 1.00 39.04 ? 52  ARG A NH2  1 
ATOM   514  H H    . ARG A 1 51  ? 12.354  61.266 19.737 1.00 34.43 ? 52  ARG A H    1 
ATOM   515  H HA   . ARG A 1 51  ? 14.893  60.630 19.499 1.00 32.21 ? 52  ARG A HA   1 
ATOM   516  H HB2  . ARG A 1 51  ? 12.600  59.020 19.224 1.00 36.79 ? 52  ARG A HB2  1 
ATOM   517  H HB3  . ARG A 1 51  ? 14.071  58.425 19.142 1.00 36.79 ? 52  ARG A HB3  1 
ATOM   518  H HG2  . ARG A 1 51  ? 14.453  58.889 21.320 1.00 39.80 ? 52  ARG A HG2  1 
ATOM   519  H HG3  . ARG A 1 51  ? 13.101  59.726 21.426 1.00 39.80 ? 52  ARG A HG3  1 
ATOM   520  H HD2  . ARG A 1 51  ? 11.977  57.645 20.920 1.00 45.71 ? 52  ARG A HD2  1 
ATOM   521  H HD3  . ARG A 1 51  ? 13.362  56.945 21.278 1.00 45.71 ? 52  ARG A HD3  1 
ATOM   522  H HE   . ARG A 1 51  ? 11.635  57.913 23.059 1.00 50.41 ? 52  ARG A HE   1 
ATOM   523  H HH11 . ARG A 1 51  ? 14.763  56.951 22.695 1.00 59.98 ? 52  ARG A HH11 1 
ATOM   524  H HH12 . ARG A 1 51  ? 15.051  56.767 24.145 1.00 59.98 ? 52  ARG A HH12 1 
ATOM   525  H HH21 . ARG A 1 51  ? 12.105  57.750 25.259 1.00 46.85 ? 52  ARG A HH21 1 
ATOM   526  H HH22 . ARG A 1 51  ? 13.438  57.252 25.698 1.00 46.85 ? 52  ARG A HH22 1 
ATOM   527  N N    . TYR A 1 52  ? 13.278  60.931 16.812 1.00 28.82 ? 53  TYR A N    1 
ATOM   528  C CA   . TYR A 1 52  ? 13.370  60.952 15.350 1.00 30.92 ? 53  TYR A CA   1 
ATOM   529  C C    . TYR A 1 52  ? 14.558  61.795 14.871 1.00 33.58 ? 53  TYR A C    1 
ATOM   530  O O    . TYR A 1 52  ? 15.144  61.531 13.817 1.00 30.49 ? 53  TYR A O    1 
ATOM   531  C CB   . TYR A 1 52  ? 12.079  61.487 14.726 1.00 30.31 ? 53  TYR A CB   1 
ATOM   532  C CG   . TYR A 1 52  ? 12.031  61.264 13.226 1.00 30.12 ? 53  TYR A CG   1 
ATOM   533  C CD1  . TYR A 1 52  ? 11.737  60.020 12.702 1.00 36.06 ? 53  TYR A CD1  1 
ATOM   534  C CD2  . TYR A 1 52  ? 12.292  62.291 12.346 1.00 30.77 ? 53  TYR A CD2  1 
ATOM   535  C CE1  . TYR A 1 52  ? 11.704  59.805 11.339 1.00 36.50 ? 53  TYR A CE1  1 
ATOM   536  C CE2  . TYR A 1 52  ? 12.260  62.083 10.979 1.00 31.15 ? 53  TYR A CE2  1 
ATOM   537  C CZ   . TYR A 1 52  ? 11.961  60.840 10.482 1.00 36.83 ? 53  TYR A CZ   1 
ATOM   538  O OH   . TYR A 1 52  ? 11.929  60.624 9.116  1.00 44.23 ? 53  TYR A OH   1 
ATOM   539  H H    . TYR A 1 52  ? 12.544  61.254 17.123 1.00 34.59 ? 53  TYR A H    1 
ATOM   540  H HA   . TYR A 1 52  ? 13.501  60.045 15.031 1.00 37.11 ? 53  TYR A HA   1 
ATOM   541  H HB2  . TYR A 1 52  ? 11.321  61.031 15.124 1.00 36.37 ? 53  TYR A HB2  1 
ATOM   542  H HB3  . TYR A 1 52  ? 12.018  62.441 14.892 1.00 36.37 ? 53  TYR A HB3  1 
ATOM   543  H HD1  . TYR A 1 52  ? 11.561  59.312 13.279 1.00 43.27 ? 53  TYR A HD1  1 
ATOM   544  H HD2  . TYR A 1 52  ? 12.495  63.136 12.676 1.00 36.93 ? 53  TYR A HD2  1 
ATOM   545  H HE1  . TYR A 1 52  ? 11.502  58.961 11.004 1.00 43.80 ? 53  TYR A HE1  1 
ATOM   546  H HE2  . TYR A 1 52  ? 12.437  62.787 10.397 1.00 37.38 ? 53  TYR A HE2  1 
ATOM   547  H HH   . TYR A 1 52  ? 12.104  61.337 8.708  1.00 53.07 ? 53  TYR A HH   1 
ATOM   548  N N    . SER A 1 53  ? 14.914  62.806 15.657 1.00 31.78 ? 54  SER A N    1 
ATOM   549  C CA   . SER A 1 53  ? 16.024  63.692 15.330 1.00 33.49 ? 54  SER A CA   1 
ATOM   550  C C    . SER A 1 53  ? 17.339  62.945 15.175 1.00 36.62 ? 54  SER A C    1 
ATOM   551  O O    . SER A 1 53  ? 18.237  63.402 14.466 1.00 41.39 ? 54  SER A O    1 
ATOM   552  C CB   . SER A 1 53  ? 16.192  64.743 16.432 1.00 35.76 ? 54  SER A CB   1 
ATOM   553  O OG   . SER A 1 53  ? 15.092  65.627 16.466 1.00 44.69 ? 54  SER A OG   1 
ATOM   554  H H    . SER A 1 53  ? 14.521  63.003 16.396 1.00 38.13 ? 54  SER A H    1 
ATOM   555  H HA   . SER A 1 53  ? 15.833  64.151 14.497 1.00 40.19 ? 54  SER A HA   1 
ATOM   556  H HB2  . SER A 1 53  ? 16.260  64.293 17.289 1.00 42.92 ? 54  SER A HB2  1 
ATOM   557  H HB3  . SER A 1 53  ? 17.000  65.252 16.261 1.00 42.92 ? 54  SER A HB3  1 
ATOM   558  H HG   . SER A 1 53  ? 15.199  66.196 17.075 1.00 53.63 ? 54  SER A HG   1 
ATOM   559  N N    . PHE A 1 54  ? 17.447  61.810 15.856 1.00 33.56 ? 55  PHE A N    1 
ATOM   560  C CA   . PHE A 1 54  ? 18.686  61.052 15.944 1.00 36.33 ? 55  PHE A CA   1 
ATOM   561  C C    . PHE A 1 54  ? 18.752  59.923 14.937 1.00 34.85 ? 55  PHE A C    1 
ATOM   562  O O    . PHE A 1 54  ? 19.704  59.149 14.941 1.00 35.90 ? 55  PHE A O    1 
ATOM   563  C CB   . PHE A 1 54  ? 18.842  60.493 17.357 1.00 39.52 ? 55  PHE A CB   1 
ATOM   564  C CG   . PHE A 1 54  ? 19.102  61.549 18.384 1.00 41.46 ? 55  PHE A CG   1 
ATOM   565  C CD1  . PHE A 1 54  ? 20.387  62.011 18.609 1.00 42.03 ? 55  PHE A CD1  1 
ATOM   566  C CD2  . PHE A 1 54  ? 18.064  62.099 19.107 1.00 43.14 ? 55  PHE A CD2  1 
ATOM   567  C CE1  . PHE A 1 54  ? 20.634  62.991 19.542 1.00 47.88 ? 55  PHE A CE1  1 
ATOM   568  C CE2  . PHE A 1 54  ? 18.306  63.085 20.049 1.00 41.26 ? 55  PHE A CE2  1 
ATOM   569  C CZ   . PHE A 1 54  ? 19.592  63.530 20.267 1.00 46.28 ? 55  PHE A CZ   1 
ATOM   570  H H    . PHE A 1 54  ? 16.796  61.451 16.288 1.00 40.27 ? 55  PHE A H    1 
ATOM   571  H HA   . PHE A 1 54  ? 19.432  61.648 15.774 1.00 43.60 ? 55  PHE A HA   1 
ATOM   572  H HB2  . PHE A 1 54  ? 18.025  60.031 17.604 1.00 47.42 ? 55  PHE A HB2  1 
ATOM   573  H HB3  . PHE A 1 54  ? 19.589  59.874 17.370 1.00 47.42 ? 55  PHE A HB3  1 
ATOM   574  H HD1  . PHE A 1 54  ? 21.094  61.651 18.123 1.00 50.43 ? 55  PHE A HD1  1 
ATOM   575  H HD2  . PHE A 1 54  ? 17.195  61.801 18.964 1.00 51.77 ? 55  PHE A HD2  1 
ATOM   576  H HE1  . PHE A 1 54  ? 21.503  63.288 19.685 1.00 57.45 ? 55  PHE A HE1  1 
ATOM   577  H HE2  . PHE A 1 54  ? 17.601  63.446 20.536 1.00 49.51 ? 55  PHE A HE2  1 
ATOM   578  H HZ   . PHE A 1 54  ? 19.756  64.191 20.899 1.00 55.54 ? 55  PHE A HZ   1 
ATOM   579  N N    . ILE A 1 55  ? 17.747  59.821 14.074 1.00 30.91 ? 56  ILE A N    1 
ATOM   580  C CA   . ILE A 1 55  ? 17.771  58.806 13.025 1.00 29.55 ? 56  ILE A CA   1 
ATOM   581  C C    . ILE A 1 55  ? 18.852  59.160 12.014 1.00 31.63 ? 56  ILE A C    1 
ATOM   582  O O    . ILE A 1 55  ? 18.997  60.318 11.619 1.00 33.10 ? 56  ILE A O    1 
ATOM   583  C CB   . ILE A 1 55  ? 16.403  58.674 12.320 1.00 30.90 ? 56  ILE A CB   1 
ATOM   584  C CG1  . ILE A 1 55  ? 16.303  57.345 11.581 1.00 37.10 ? 56  ILE A CG1  1 
ATOM   585  C CG2  . ILE A 1 55  ? 16.156  59.827 11.385 1.00 35.25 ? 56  ILE A CG2  1 
ATOM   586  C CD1  . ILE A 1 55  ? 14.880  56.940 11.379 1.00 42.15 ? 56  ILE A CD1  1 
ATOM   587  H H    . ILE A 1 55  ? 17.047  60.321 14.073 1.00 37.09 ? 56  ILE A H    1 
ATOM   588  H HA   . ILE A 1 55  ? 17.994  57.947 13.418 1.00 35.46 ? 56  ILE A HA   1 
ATOM   589  H HB   . ILE A 1 55  ? 15.713  58.689 13.002 1.00 37.08 ? 56  ILE A HB   1 
ATOM   590  H HG12 . ILE A 1 55  ? 16.722  57.431 10.710 1.00 44.52 ? 56  ILE A HG12 1 
ATOM   591  H HG13 . ILE A 1 55  ? 16.745  56.656 12.100 1.00 44.52 ? 56  ILE A HG13 1 
ATOM   592  H HG21 . ILE A 1 55  ? 15.290  59.711 10.962 1.00 42.29 ? 56  ILE A HG21 1 
ATOM   593  H HG22 . ILE A 1 55  ? 16.167  60.654 11.893 1.00 42.29 ? 56  ILE A HG22 1 
ATOM   594  H HG23 . ILE A 1 55  ? 16.854  59.843 10.712 1.00 42.29 ? 56  ILE A HG23 1 
ATOM   595  H HD11 . ILE A 1 55  ? 14.858  56.093 10.907 1.00 50.58 ? 56  ILE A HD11 1 
ATOM   596  H HD12 . ILE A 1 55  ? 14.452  56.848 12.245 1.00 50.58 ? 56  ILE A HD12 1 
ATOM   597  H HD13 . ILE A 1 55  ? 14.429  57.622 10.857 1.00 50.58 ? 56  ILE A HD13 1 
ATOM   598  N N    . THR A 1 56  ? 19.624  58.157 11.617 1.00 33.69 ? 57  THR A N    1 
ATOM   599  C CA   . THR A 1 56  ? 20.727  58.369 10.681 1.00 33.12 ? 57  THR A CA   1 
ATOM   600  C C    . THR A 1 56  ? 20.304  58.103 9.248  1.00 33.08 ? 57  THR A C    1 
ATOM   601  O O    . THR A 1 56  ? 19.261  57.510 9.001  1.00 35.38 ? 57  THR A O    1 
ATOM   602  C CB   . THR A 1 56  ? 21.913  57.449 10.993 1.00 34.39 ? 57  THR A CB   1 
ATOM   603  O OG1  . THR A 1 56  ? 21.572  56.102 10.657 1.00 32.54 ? 57  THR A OG1  1 
ATOM   604  C CG2  . THR A 1 56  ? 22.301  57.535 12.463 1.00 37.79 ? 57  THR A CG2  1 
ATOM   605  H H    . THR A 1 56  ? 19.532  57.341 11.873 1.00 40.43 ? 57  THR A H    1 
ATOM   606  H HA   . THR A 1 56  ? 21.029  59.289 10.744 1.00 39.75 ? 57  THR A HA   1 
ATOM   607  H HB   . THR A 1 56  ? 22.677  57.725 10.462 1.00 41.27 ? 57  THR A HB   1 
ATOM   608  H HG1  . THR A 1 56  ? 21.387  56.047 9.840  1.00 39.04 ? 57  THR A HG1  1 
ATOM   609  H HG21 . THR A 1 56  ? 23.052  56.948 12.642 1.00 45.35 ? 57  THR A HG21 1 
ATOM   610  H HG22 . THR A 1 56  ? 22.553  58.445 12.686 1.00 45.35 ? 57  THR A HG22 1 
ATOM   611  H HG23 . THR A 1 56  ? 21.553  57.269 13.019 1.00 45.35 ? 57  THR A HG23 1 
ATOM   612  N N    . ALA A 1 57  ? 21.136  58.534 8.304  1.00 35.21 ? 58  ALA A N    1 
ATOM   613  C CA   . ALA A 1 57  ? 20.829  58.379 6.888  1.00 37.02 ? 58  ALA A CA   1 
ATOM   614  C C    . ALA A 1 57  ? 20.749  56.904 6.530  1.00 36.31 ? 58  ALA A C    1 
ATOM   615  O O    . ALA A 1 57  ? 19.862  56.476 5.785  1.00 36.90 ? 58  ALA A O    1 
ATOM   616  C CB   . ALA A 1 57  ? 21.887  59.065 6.052  1.00 38.35 ? 58  ALA A CB   1 
ATOM   617  H H    . ALA A 1 57  ? 21.888  58.921 8.459  1.00 42.25 ? 58  ALA A H    1 
ATOM   618  H HA   . ALA A 1 57  ? 19.972  58.789 6.696  1.00 44.42 ? 58  ALA A HA   1 
ATOM   619  H HB1  . ALA A 1 57  ? 21.669  58.953 5.114  1.00 46.02 ? 58  ALA A HB1  1 
ATOM   620  H HB2  . ALA A 1 57  ? 21.904  60.008 6.278  1.00 46.02 ? 58  ALA A HB2  1 
ATOM   621  H HB3  . ALA A 1 57  ? 22.749  58.663 6.242  1.00 46.02 ? 58  ALA A HB3  1 
ATOM   622  N N    . ASN A 1 58  ? 21.661  56.117 7.093  1.00 35.87 ? 59  ASN A N    1 
ATOM   623  C CA   . ASN A 1 58  ? 21.650  54.675 6.865  1.00 36.71 ? 59  ASN A CA   1 
ATOM   624  C C    . ASN A 1 58  ? 20.409  54.025 7.457  1.00 30.62 ? 59  ASN A C    1 
ATOM   625  O O    . ASN A 1 58  ? 19.870  53.079 6.890  1.00 29.22 ? 59  ASN A O    1 
ATOM   626  C CB   . ASN A 1 58  ? 22.910  54.012 7.434  1.00 41.63 ? 59  ASN A CB   1 
ATOM   627  C CG   . ASN A 1 58  ? 24.163  54.398 6.664  1.00 47.76 ? 59  ASN A CG   1 
ATOM   628  O OD1  . ASN A 1 58  ? 24.091  55.105 5.659  1.00 49.28 ? 59  ASN A OD1  1 
ATOM   629  N ND2  . ASN A 1 58  ? 25.317  53.943 7.137  1.00 51.23 ? 59  ASN A ND2  1 
ATOM   630  H H    . ASN A 1 58  ? 22.293  56.391 7.607  1.00 43.05 ? 59  ASN A H    1 
ATOM   631  H HA   . ASN A 1 58  ? 21.639  54.512 5.909  1.00 44.05 ? 59  ASN A HA   1 
ATOM   632  H HB2  . ASN A 1 58  ? 23.026  54.289 8.356  1.00 49.96 ? 59  ASN A HB2  1 
ATOM   633  H HB3  . ASN A 1 58  ? 22.812  53.049 7.385  1.00 49.96 ? 59  ASN A HB3  1 
ATOM   634  H HD21 . ASN A 1 58  ? 26.053  54.136 6.735  1.00 61.47 ? 59  ASN A HD21 1 
ATOM   635  H HD22 . ASN A 1 58  ? 25.330  53.456 7.846  1.00 61.47 ? 59  ASN A HD22 1 
ATOM   636  N N    . GLU A 1 59  ? 19.954  54.522 8.603  1.00 29.46 ? 60  GLU A N    1 
ATOM   637  C CA   . GLU A 1 59  ? 18.748  53.984 9.215  1.00 27.61 ? 60  GLU A CA   1 
ATOM   638  C C    . GLU A 1 59  ? 17.516  54.257 8.369  1.00 26.73 ? 60  GLU A C    1 
ATOM   639  O O    . GLU A 1 59  ? 16.678  53.367 8.187  1.00 25.20 ? 60  GLU A O    1 
ATOM   640  C CB   . GLU A 1 59  ? 18.561  54.542 10.629 1.00 30.71 ? 60  GLU A CB   1 
ATOM   641  C CG   . GLU A 1 59  ? 19.448  53.850 11.660 1.00 26.34 ? 60  GLU A CG   1 
ATOM   642  C CD   . GLU A 1 59  ? 19.527  54.572 13.000 1.00 31.96 ? 60  GLU A CD   1 
ATOM   643  O OE1  . GLU A 1 59  ? 19.060  55.727 13.108 1.00 30.83 ? 60  GLU A OE1  1 
ATOM   644  O OE2  . GLU A 1 59  ? 20.079  53.973 13.948 1.00 34.35 ? 60  GLU A OE2  1 
ATOM   645  H H    . GLU A 1 59  ? 20.322  55.164 9.042  1.00 35.35 ? 60  GLU A H    1 
ATOM   646  H HA   . GLU A 1 59  ? 18.844  53.022 9.290  1.00 33.14 ? 60  GLU A HA   1 
ATOM   647  H HB2  . GLU A 1 59  ? 18.784  55.486 10.628 1.00 36.85 ? 60  GLU A HB2  1 
ATOM   648  H HB3  . GLU A 1 59  ? 17.638  54.419 10.898 1.00 36.85 ? 60  GLU A HB3  1 
ATOM   649  H HG2  . GLU A 1 59  ? 19.098  52.960 11.824 1.00 31.61 ? 60  GLU A HG2  1 
ATOM   650  H HG3  . GLU A 1 59  ? 20.348  53.787 11.304 1.00 31.61 ? 60  GLU A HG3  1 
ATOM   651  N N    . LYS A 1 60  ? 17.391  55.483 7.874  1.00 27.79 ? 61  LYS A N    1 
ATOM   652  C CA   . LYS A 1 60  ? 16.265  55.856 7.019  1.00 28.90 ? 61  LYS A CA   1 
ATOM   653  C C    . LYS A 1 60  ? 16.231  54.985 5.774  1.00 32.65 ? 61  LYS A C    1 
ATOM   654  O O    . LYS A 1 60  ? 15.189  54.475 5.368  1.00 30.04 ? 61  LYS A O    1 
ATOM   655  C CB   . LYS A 1 60  ? 16.376  57.313 6.577  1.00 34.85 ? 61  LYS A CB   1 
ATOM   656  C CG   . LYS A 1 60  ? 15.273  57.725 5.621  1.00 45.29 ? 61  LYS A CG   1 
ATOM   657  C CD   . LYS A 1 60  ? 15.423  59.164 5.198  1.00 59.38 ? 61  LYS A CD   1 
ATOM   658  C CE   . LYS A 1 60  ? 14.357  59.534 4.186  1.00 69.22 ? 61  LYS A CE   1 
ATOM   659  N NZ   . LYS A 1 60  ? 14.367  60.973 3.814  1.00 75.05 ? 61  LYS A NZ   1 
ATOM   660  H H    . LYS A 1 60  ? 17.948  56.122 8.017  1.00 33.35 ? 61  LYS A H    1 
ATOM   661  H HA   . LYS A 1 60  ? 15.433  55.740 7.504  1.00 34.68 ? 61  LYS A HA   1 
ATOM   662  H HB2  . LYS A 1 60  ? 16.325  57.885 7.358  1.00 41.81 ? 61  LYS A HB2  1 
ATOM   663  H HB3  . LYS A 1 60  ? 17.226  57.442 6.126  1.00 41.81 ? 61  LYS A HB3  1 
ATOM   664  H HG2  . LYS A 1 60  ? 15.311  57.169 4.828  1.00 54.35 ? 61  LYS A HG2  1 
ATOM   665  H HG3  . LYS A 1 60  ? 14.414  57.625 6.061  1.00 54.35 ? 61  LYS A HG3  1 
ATOM   666  H HD2  . LYS A 1 60  ? 15.325  59.740 5.972  1.00 71.26 ? 61  LYS A HD2  1 
ATOM   667  H HD3  . LYS A 1 60  ? 16.293  59.291 4.788  1.00 71.26 ? 61  LYS A HD3  1 
ATOM   668  H HE2  . LYS A 1 60  ? 14.499  59.017 3.378  1.00 83.06 ? 61  LYS A HE2  1 
ATOM   669  H HE3  . LYS A 1 60  ? 13.486  59.329 4.560  1.00 83.06 ? 61  LYS A HE3  1 
ATOM   670  H HZ1  . LYS A 1 60  ? 13.725  61.138 3.220  1.00 90.06 ? 61  LYS A HZ1  1 
ATOM   671  H HZ2  . LYS A 1 60  ? 14.229  61.474 4.536  1.00 90.06 ? 61  LYS A HZ2  1 
ATOM   672  H HZ3  . LYS A 1 60  ? 15.154  61.189 3.458  1.00 90.06 ? 61  LYS A HZ3  1 
ATOM   673  N N    . GLU A 1 61  ? 17.396  54.851 5.155  1.00 30.71 ? 62  GLU A N    1 
ATOM   674  C CA   . GLU A 1 61  ? 17.557  54.052 3.954  1.00 29.43 ? 62  GLU A CA   1 
ATOM   675  C C    . GLU A 1 61  ? 17.199  52.575 4.202  1.00 27.61 ? 62  GLU A C    1 
ATOM   676  O O    . GLU A 1 61  ? 16.509  51.934 3.403  1.00 27.44 ? 62  GLU A O    1 
ATOM   677  C CB   . GLU A 1 61  ? 19.012  54.172 3.525  1.00 36.01 ? 62  GLU A CB   1 
ATOM   678  C CG   . GLU A 1 61  ? 19.337  53.662 2.174  1.00 44.52 ? 62  GLU A CG   1 
ATOM   679  C CD   . GLU A 1 61  ? 20.683  54.189 1.719  1.00 53.19 ? 62  GLU A CD   1 
ATOM   680  O OE1  . GLU A 1 61  ? 21.682  53.972 2.449  1.00 53.61 ? 62  GLU A OE1  1 
ATOM   681  O OE2  . GLU A 1 61  ? 20.732  54.856 0.663  1.00 57.49 ? 62  GLU A OE2  1 
ATOM   682  H H    . GLU A 1 61  ? 18.124  55.223 5.420  1.00 36.85 ? 62  GLU A H    1 
ATOM   683  H HA   . GLU A 1 61  ? 16.990  54.399 3.247  1.00 35.32 ? 62  GLU A HA   1 
ATOM   684  H HB2  . GLU A 1 61  ? 19.260  55.109 3.548  1.00 43.21 ? 62  GLU A HB2  1 
ATOM   685  H HB3  . GLU A 1 61  ? 19.558  53.680 4.158  1.00 43.21 ? 62  GLU A HB3  1 
ATOM   686  H HG2  . GLU A 1 61  ? 19.377  52.693 2.194  1.00 53.43 ? 62  GLU A HG2  1 
ATOM   687  H HG3  . GLU A 1 61  ? 18.662  53.961 1.545  1.00 53.43 ? 62  GLU A HG3  1 
ATOM   688  N N    . ALA A 1 62  ? 17.659  52.036 5.319  1.00 24.15 ? 63  ALA A N    1 
ATOM   689  C CA   . ALA A 1 62  ? 17.368  50.651 5.659  1.00 21.62 ? 63  ALA A CA   1 
ATOM   690  C C    . ALA A 1 62  ? 15.861  50.409 5.811  1.00 22.36 ? 63  ALA A C    1 
ATOM   691  O O    . ALA A 1 62  ? 15.326  49.396 5.355  1.00 21.16 ? 63  ALA A O    1 
ATOM   692  C CB   . ALA A 1 62  ? 18.087  50.254 6.942  1.00 24.25 ? 63  ALA A CB   1 
ATOM   693  H H    . ALA A 1 62  ? 18.143  52.449 5.898  1.00 28.98 ? 63  ALA A H    1 
ATOM   694  H HA   . ALA A 1 62  ? 17.691  50.078 4.946  1.00 25.94 ? 63  ALA A HA   1 
ATOM   695  H HB1  . ALA A 1 62  ? 17.878  49.329 7.147  1.00 29.10 ? 63  ALA A HB1  1 
ATOM   696  H HB2  . ALA A 1 62  ? 19.043  50.356 6.812  1.00 29.10 ? 63  ALA A HB2  1 
ATOM   697  H HB3  . ALA A 1 62  ? 17.787  50.830 7.663  1.00 29.10 ? 63  ALA A HB3  1 
ATOM   698  N N    . VAL A 1 63  ? 15.168  51.311 6.491  1.00 20.47 ? 64  VAL A N    1 
ATOM   699  C CA   . VAL A 1 63  ? 13.727  51.142 6.643  1.00 20.95 ? 64  VAL A CA   1 
ATOM   700  C C    . VAL A 1 63  ? 13.009  51.299 5.304  1.00 22.41 ? 64  VAL A C    1 
ATOM   701  O O    . VAL A 1 63  ? 12.109  50.523 4.982  1.00 24.80 ? 64  VAL A O    1 
ATOM   702  C CB   . VAL A 1 63  ? 13.174  52.120 7.668  1.00 22.66 ? 64  VAL A CB   1 
ATOM   703  C CG1  . VAL A 1 63  ? 11.641  52.015 7.744  1.00 23.86 ? 64  VAL A CG1  1 
ATOM   704  C CG2  . VAL A 1 63  ? 13.793  51.845 9.016  1.00 22.69 ? 64  VAL A CG2  1 
ATOM   705  H H    . VAL A 1 63  ? 15.496  52.012 6.866  1.00 24.56 ? 64  VAL A H    1 
ATOM   706  H HA   . VAL A 1 63  ? 13.553  50.245 6.967  1.00 25.15 ? 64  VAL A HA   1 
ATOM   707  H HB   . VAL A 1 63  ? 13.405  53.025 7.405  1.00 27.19 ? 64  VAL A HB   1 
ATOM   708  H HG11 . VAL A 1 63  ? 11.314  52.647 8.403  1.00 28.64 ? 64  VAL A HG11 1 
ATOM   709  H HG12 . VAL A 1 63  ? 11.267  52.221 6.873  1.00 28.64 ? 64  VAL A HG12 1 
ATOM   710  H HG13 . VAL A 1 63  ? 11.399  51.112 8.002  1.00 28.64 ? 64  VAL A HG13 1 
ATOM   711  H HG21 . VAL A 1 63  ? 13.433  52.474 9.662  1.00 27.23 ? 64  VAL A HG21 1 
ATOM   712  H HG22 . VAL A 1 63  ? 13.579  50.938 9.282  1.00 27.23 ? 64  VAL A HG22 1 
ATOM   713  H HG23 . VAL A 1 63  ? 14.755  51.953 8.949  1.00 27.23 ? 64  VAL A HG23 1 
ATOM   714  N N    . GLU A 1 64  ? 13.444  52.259 4.501  1.00 25.30 ? 65  GLU A N    1 
ATOM   715  C CA   . GLU A 1 64  ? 12.860  52.465 3.185  1.00 28.23 ? 65  GLU A CA   1 
ATOM   716  C C    . GLU A 1 64  ? 12.992  51.210 2.316  1.00 31.05 ? 65  GLU A C    1 
ATOM   717  O O    . GLU A 1 64  ? 12.090  50.880 1.555  1.00 31.03 ? 65  GLU A O    1 
ATOM   718  C CB   . GLU A 1 64  ? 13.521  53.663 2.502  1.00 35.65 ? 65  GLU A CB   1 
ATOM   719  C CG   . GLU A 1 64  ? 13.125  54.998 3.117  1.00 40.35 ? 65  GLU A CG   1 
ATOM   720  C CD   . GLU A 1 64  ? 13.885  56.181 2.525  1.00 47.84 ? 65  GLU A CD   1 
ATOM   721  O OE1  . GLU A 1 64  ? 15.049  56.004 2.100  1.00 50.96 ? 65  GLU A OE1  1 
ATOM   722  O OE2  . GLU A 1 64  ? 13.306  57.288 2.477  1.00 48.83 ? 65  GLU A OE2  1 
ATOM   723  H H    . GLU A 1 64  ? 14.078  52.807 4.696  1.00 30.35 ? 65  GLU A H    1 
ATOM   724  H HA   . GLU A 1 64  ? 11.915  52.661 3.286  1.00 33.88 ? 65  GLU A HA   1 
ATOM   725  H HB2  . GLU A 1 64  ? 14.484  53.575 2.576  1.00 42.78 ? 65  GLU A HB2  1 
ATOM   726  H HB3  . GLU A 1 64  ? 13.260  53.676 1.568  1.00 42.78 ? 65  GLU A HB3  1 
ATOM   727  H HG2  . GLU A 1 64  ? 12.179  55.146 2.966  1.00 48.42 ? 65  GLU A HG2  1 
ATOM   728  H HG3  . GLU A 1 64  ? 13.308  54.972 4.069  1.00 48.42 ? 65  GLU A HG3  1 
ATOM   729  N N    . ASP A 1 65  ? 14.114  50.508 2.451  1.00 23.00 ? 66  ASP A N    1 
ATOM   730  C CA   . ASP A 1 65  ? 14.370  49.291 1.681  1.00 22.54 ? 66  ASP A CA   1 
ATOM   731  C C    . ASP A 1 65  ? 13.669  48.066 2.277  1.00 20.62 ? 66  ASP A C    1 
ATOM   732  O O    . ASP A 1 65  ? 13.541  47.039 1.605  1.00 20.33 ? 66  ASP A O    1 
ATOM   733  C CB   . ASP A 1 65  ? 15.885  49.005 1.615  1.00 26.26 ? 66  ASP A CB   1 
ATOM   734  C CG   . ASP A 1 65  ? 16.689  50.110 0.949  1.00 48.19 ? 66  ASP A CG   1 
ATOM   735  O OD1  . ASP A 1 65  ? 16.101  50.994 0.289  1.00 54.41 ? 66  ASP A OD1  1 
ATOM   736  O OD2  . ASP A 1 65  ? 17.933  50.071 1.081  1.00 50.40 ? 66  ASP A OD2  1 
ATOM   737  H H    . ASP A 1 65  ? 14.751  50.718 2.988  1.00 27.60 ? 66  ASP A H    1 
ATOM   738  H HA   . ASP A 1 65  ? 14.046  49.414 0.775  1.00 27.05 ? 66  ASP A HA   1 
ATOM   739  H HB2  . ASP A 1 65  ? 16.222  48.896 2.518  1.00 31.51 ? 66  ASP A HB2  1 
ATOM   740  H HB3  . ASP A 1 65  ? 16.028  48.189 1.111  1.00 31.51 ? 66  ASP A HB3  1 
ATOM   741  N N    . PHE A 1 66  ? 13.227  48.154 3.533  1.00 21.30 ? 67  PHE A N    1 
ATOM   742  C CA   . PHE A 1 66  ? 12.719  46.984 4.235  1.00 18.84 ? 67  PHE A CA   1 
ATOM   743  C C    . PHE A 1 66  ? 11.517  46.338 3.599  1.00 20.74 ? 67  PHE A C    1 
ATOM   744  O O    . PHE A 1 66  ? 11.509  45.129 3.419  1.00 18.40 ? 67  PHE A O    1 
ATOM   745  C CB   . PHE A 1 66  ? 12.342  47.339 5.685  1.00 22.30 ? 67  PHE A CB   1 
ATOM   746  C CG   . PHE A 1 66  ? 11.935  46.147 6.507  1.00 21.98 ? 67  PHE A CG   1 
ATOM   747  C CD1  . PHE A 1 66  ? 12.897  45.362 7.102  1.00 26.03 ? 67  PHE A CD1  1 
ATOM   748  C CD2  . PHE A 1 66  ? 10.608  45.786 6.633  1.00 23.65 ? 67  PHE A CD2  1 
ATOM   749  C CE1  . PHE A 1 66  ? 12.540  44.255 7.858  1.00 25.28 ? 67  PHE A CE1  1 
ATOM   750  C CE2  . PHE A 1 66  ? 10.266  44.668 7.387  1.00 22.77 ? 67  PHE A CE2  1 
ATOM   751  C CZ   . PHE A 1 66  ? 11.255  43.915 7.976  1.00 22.59 ? 67  PHE A CZ   1 
ATOM   752  H H    . PHE A 1 66  ? 13.212  48.879 3.996  1.00 25.56 ? 67  PHE A H    1 
ATOM   753  H HA   . PHE A 1 66  ? 13.423  46.318 4.271  1.00 22.60 ? 67  PHE A HA   1 
ATOM   754  H HB2  . PHE A 1 66  ? 13.107  47.750 6.116  1.00 26.76 ? 67  PHE A HB2  1 
ATOM   755  H HB3  . PHE A 1 66  ? 11.597  47.960 5.672  1.00 26.76 ? 67  PHE A HB3  1 
ATOM   756  H HD1  . PHE A 1 66  ? 13.795  45.593 7.020  1.00 31.23 ? 67  PHE A HD1  1 
ATOM   757  H HD2  . PHE A 1 66  ? 9.945   46.298 6.229  1.00 28.38 ? 67  PHE A HD2  1 
ATOM   758  H HE1  . PHE A 1 66  ? 13.197  43.736 8.261  1.00 30.34 ? 67  PHE A HE1  1 
ATOM   759  H HE2  . PHE A 1 66  ? 9.373   44.425 7.483  1.00 27.33 ? 67  PHE A HE2  1 
ATOM   760  H HZ   . PHE A 1 66  ? 11.023  43.171 8.483  1.00 27.10 ? 67  PHE A HZ   1 
ATOM   761  N N    . SER A 1 67  ? 10.481  47.129 3.317  1.00 24.65 ? 68  SER A N    1 
ATOM   762  C CA   . SER A 1 67  ? 9.190   46.593 2.890  1.00 30.04 ? 68  SER A CA   1 
ATOM   763  C C    . SER A 1 67  ? 9.301   46.023 1.526  1.00 40.12 ? 68  SER A C    1 
ATOM   764  O O    . SER A 1 67  ? 8.586   45.085 1.164  1.00 41.26 ? 68  SER A O    1 
ATOM   765  C CB   . SER A 1 67  ? 8.150   47.701 2.808  1.00 36.93 ? 68  SER A CB   1 
ATOM   766  O OG   . SER A 1 67  ? 8.108   48.402 4.013  1.00 35.56 ? 68  SER A OG   1 
ATOM   767  H H    . SER A 1 67  ? 10.501  47.988 3.366  1.00 29.58 ? 68  SER A H    1 
ATOM   768  H HA   . SER A 1 67  ? 8.885   45.906 3.504  1.00 36.05 ? 68  SER A HA   1 
ATOM   769  H HB2  . SER A 1 67  ? 8.389   48.311 2.093  1.00 44.32 ? 68  SER A HB2  1 
ATOM   770  H HB3  . SER A 1 67  ? 7.279   47.310 2.637  1.00 44.32 ? 68  SER A HB3  1 
ATOM   771  H HG   . SER A 1 67  ? 7.905   47.882 4.640  1.00 42.67 ? 68  SER A HG   1 
ATOM   772  N N    . ILE A 1 68  ? 10.185  46.632 0.749  1.00 37.51 ? 69  ILE A N    1 
ATOM   773  C CA   . ILE A 1 68  ? 10.305  46.295 -0.642 1.00 42.51 ? 69  ILE A CA   1 
ATOM   774  C C    . ILE A 1 68  ? 11.057  44.982 -0.754 1.00 45.72 ? 69  ILE A C    1 
ATOM   775  O O    . ILE A 1 68  ? 10.473  43.972 -1.144 1.00 57.43 ? 69  ILE A O    1 
ATOM   776  C CB   . ILE A 1 68  ? 10.979  47.437 -1.420 1.00 44.84 ? 69  ILE A CB   1 
ATOM   777  C CG1  . ILE A 1 68  ? 10.025  48.634 -1.466 1.00 52.49 ? 69  ILE A CG1  1 
ATOM   778  C CG2  . ILE A 1 68  ? 11.325  46.979 -2.828 1.00 46.74 ? 69  ILE A CG2  1 
ATOM   779  C CD1  . ILE A 1 68  ? 10.668  49.927 -1.875 1.00 52.66 ? 69  ILE A CD1  1 
ATOM   780  H H    . ILE A 1 68  ? 10.727  47.245 1.014  1.00 45.01 ? 69  ILE A H    1 
ATOM   781  H HA   . ILE A 1 68  ? 9.418   46.165 -1.012 1.00 51.01 ? 69  ILE A HA   1 
ATOM   782  H HB   . ILE A 1 68  ? 11.794  47.696 -0.962 1.00 53.81 ? 69  ILE A HB   1 
ATOM   783  H HG12 . ILE A 1 68  ? 9.318   48.443 -2.102 1.00 62.98 ? 69  ILE A HG12 1 
ATOM   784  H HG13 . ILE A 1 68  ? 9.644   48.761 -0.583 1.00 62.98 ? 69  ILE A HG13 1 
ATOM   785  H HG21 . ILE A 1 68  ? 11.748  47.712 -3.302 1.00 56.09 ? 69  ILE A HG21 1 
ATOM   786  H HG22 . ILE A 1 68  ? 11.932  46.225 -2.774 1.00 56.09 ? 69  ILE A HG22 1 
ATOM   787  H HG23 . ILE A 1 68  ? 10.509  46.717 -3.283 1.00 56.09 ? 69  ILE A HG23 1 
ATOM   788  H HD11 . ILE A 1 68  ? 9.996   50.627 -1.877 1.00 63.19 ? 69  ILE A HD11 1 
ATOM   789  H HD12 . ILE A 1 68  ? 11.370  50.145 -1.242 1.00 63.19 ? 69  ILE A HD12 1 
ATOM   790  H HD13 . ILE A 1 68  ? 11.043  49.826 -2.764 1.00 63.19 ? 69  ILE A HD13 1 
ATOM   791  N N    . SER A 1 69  ? 12.326  44.975 -0.358 1.00 34.99 ? 70  SER A N    1 
ATOM   792  C CA   . SER A 1 69  ? 13.157  43.794 -0.556 1.00 35.69 ? 70  SER A CA   1 
ATOM   793  C C    . SER A 1 69  ? 13.877  43.336 0.717  1.00 31.00 ? 70  SER A C    1 
ATOM   794  O O    . SER A 1 69  ? 14.040  42.135 0.932  1.00 32.48 ? 70  SER A O    1 
ATOM   795  C CB   . SER A 1 69  ? 14.152  44.041 -1.695 1.00 42.10 ? 70  SER A CB   1 
ATOM   796  O OG   . SER A 1 69  ? 15.405  44.470 -1.211 1.00 41.63 ? 70  SER A OG   1 
ATOM   797  H H    . SER A 1 69  ? 12.727  45.634 0.023  1.00 41.98 ? 70  SER A H    1 
ATOM   798  H HA   . SER A 1 69  ? 12.581  43.065 -0.834 1.00 42.82 ? 70  SER A HA   1 
ATOM   799  H HB2  . SER A 1 69  ? 14.274  43.216 -2.189 1.00 50.52 ? 70  SER A HB2  1 
ATOM   800  H HB3  . SER A 1 69  ? 13.793  44.726 -2.281 1.00 50.52 ? 70  SER A HB3  1 
ATOM   801  H HG   . SER A 1 69  ? 15.932  44.599 -1.852 1.00 49.95 ? 70  SER A HG   1 
ATOM   802  N N    . GLY A 1 70  ? 14.274  44.280 1.570  1.00 22.39 ? 71  GLY A N    1 
ATOM   803  C CA   . GLY A 1 70  ? 15.095  43.975 2.722  1.00 23.30 ? 71  GLY A CA   1 
ATOM   804  C C    . GLY A 1 70  ? 14.557  42.878 3.611  1.00 22.14 ? 71  GLY A C    1 
ATOM   805  O O    . GLY A 1 70  ? 15.325  42.034 4.069  1.00 21.90 ? 71  GLY A O    1 
ATOM   806  H H    . GLY A 1 70  ? 14.075  45.114 1.496  1.00 26.87 ? 71  GLY A H    1 
ATOM   807  H HA2  . GLY A 1 70  ? 15.977  43.708 2.418  1.00 27.95 ? 71  GLY A HA2  1 
ATOM   808  H HA3  . GLY A 1 70  ? 15.192  44.776 3.260  1.00 27.95 ? 71  GLY A HA3  1 
ATOM   809  N N    . TYR A 1 71  ? 13.249  42.870 3.861  1.00 19.82 ? 72  TYR A N    1 
ATOM   810  C CA   . TYR A 1 71  ? 12.673  41.879 4.765  1.00 17.32 ? 72  TYR A CA   1 
ATOM   811  C C    . TYR A 1 71  ? 12.872  40.424 4.329  1.00 18.77 ? 72  TYR A C    1 
ATOM   812  O O    . TYR A 1 71  ? 12.955  39.548 5.189  1.00 17.01 ? 72  TYR A O    1 
ATOM   813  C CB   . TYR A 1 71  ? 11.182  42.152 5.012  1.00 18.04 ? 72  TYR A CB   1 
ATOM   814  C CG   . TYR A 1 71  ? 10.279  41.587 3.952  1.00 21.07 ? 72  TYR A CG   1 
ATOM   815  C CD1  . TYR A 1 71  ? 9.786   40.293 4.045  1.00 22.76 ? 72  TYR A CD1  1 
ATOM   816  C CD2  . TYR A 1 71  ? 9.924   42.340 2.860  1.00 21.35 ? 72  TYR A CD2  1 
ATOM   817  C CE1  . TYR A 1 71  ? 8.953   39.781 3.069  1.00 25.77 ? 72  TYR A CE1  1 
ATOM   818  C CE2  . TYR A 1 71  ? 9.101   41.833 1.875  1.00 24.57 ? 72  TYR A CE2  1 
ATOM   819  C CZ   . TYR A 1 71  ? 8.617   40.556 1.989  1.00 25.50 ? 72  TYR A CZ   1 
ATOM   820  O OH   . TYR A 1 71  ? 7.789   40.099 0.963  1.00 27.90 ? 72  TYR A OH   1 
ATOM   821  H H    . TYR A 1 71  ? 12.680  43.420 3.525  1.00 23.78 ? 72  TYR A H    1 
ATOM   822  H HA   . TYR A 1 71  ? 13.117  41.974 5.622  1.00 20.79 ? 72  TYR A HA   1 
ATOM   823  H HB2  . TYR A 1 71  ? 10.928  41.756 5.860  1.00 21.65 ? 72  TYR A HB2  1 
ATOM   824  H HB3  . TYR A 1 71  ? 11.041  43.111 5.042  1.00 21.65 ? 72  TYR A HB3  1 
ATOM   825  H HD1  . TYR A 1 71  ? 10.011  39.767 4.778  1.00 27.31 ? 72  TYR A HD1  1 
ATOM   826  H HD2  . TYR A 1 71  ? 10.250  43.208 2.780  1.00 25.62 ? 72  TYR A HD2  1 
ATOM   827  H HE1  . TYR A 1 71  ? 8.628   38.913 3.140  1.00 30.92 ? 72  TYR A HE1  1 
ATOM   828  H HE2  . TYR A 1 71  ? 8.869   42.358 1.143  1.00 29.48 ? 72  TYR A HE2  1 
ATOM   829  H HH   . TYR A 1 71  ? 7.549   39.309 1.119  1.00 33.48 ? 72  TYR A HH   1 
ATOM   830  N N    . GLN A 1 72  ? 12.943  40.151 3.028  1.00 18.21 ? 73  GLN A N    1 
ATOM   831  C CA   . GLN A 1 72  ? 12.999  38.772 2.575  1.00 19.33 ? 73  GLN A CA   1 
ATOM   832  C C    . GLN A 1 72  ? 14.286  38.095 3.032  1.00 19.46 ? 73  GLN A C    1 
ATOM   833  O O    . GLN A 1 72  ? 14.278  36.973 3.549  1.00 18.47 ? 73  GLN A O    1 
ATOM   834  C CB   . GLN A 1 72  ? 12.866  38.712 1.065  1.00 21.74 ? 73  GLN A CB   1 
ATOM   835  C CG   . GLN A 1 72  ? 11.519  39.255 0.617  1.00 27.03 ? 73  GLN A CG   1 
ATOM   836  C CD   . GLN A 1 72  ? 11.299  39.103 -0.864 1.00 32.60 ? 73  GLN A CD   1 
ATOM   837  O OE1  . GLN A 1 72  ? 11.146  37.999 -1.366 1.00 34.49 ? 73  GLN A OE1  1 
ATOM   838  N NE2  . GLN A 1 72  ? 11.277  40.225 -1.578 1.00 36.48 ? 73  GLN A NE2  1 
ATOM   839  H H    . GLN A 1 72  ? 12.959  40.738 2.400  1.00 21.85 ? 73  GLN A H    1 
ATOM   840  H HA   . GLN A 1 72  ? 12.253  38.285 2.959  1.00 23.19 ? 73  GLN A HA   1 
ATOM   841  H HB2  . GLN A 1 72  ? 13.563  39.251 0.658  1.00 26.09 ? 73  GLN A HB2  1 
ATOM   842  H HB3  . GLN A 1 72  ? 12.938  37.790 0.771  1.00 26.09 ? 73  GLN A HB3  1 
ATOM   843  H HG2  . GLN A 1 72  ? 10.814  38.771 1.076  1.00 32.43 ? 73  GLN A HG2  1 
ATOM   844  H HG3  . GLN A 1 72  ? 11.470  40.199 0.834  1.00 32.43 ? 73  GLN A HG3  1 
ATOM   845  H HE21 . GLN A 1 72  ? 11.384  40.984 -1.188 1.00 43.78 ? 73  GLN A HE21 1 
ATOM   846  H HE22 . GLN A 1 72  ? 11.154  40.191 -2.428 1.00 43.78 ? 73  GLN A HE22 1 
ATOM   847  N N    . THR A 1 73  ? 15.392  38.790 2.873  1.00 18.42 ? 74  THR A N    1 
ATOM   848  C CA   . THR A 1 73  ? 16.672  38.246 3.301  1.00 18.32 ? 74  THR A CA   1 
ATOM   849  C C    . THR A 1 73  ? 16.816  38.314 4.814  1.00 16.31 ? 74  THR A C    1 
ATOM   850  O O    . THR A 1 73  ? 17.268  37.340 5.419  1.00 17.19 ? 74  THR A O    1 
ATOM   851  C CB   . THR A 1 73  ? 17.822  38.957 2.616  1.00 20.70 ? 74  THR A CB   1 
ATOM   852  O OG1  . THR A 1 73  ? 17.756  38.700 1.200  1.00 22.35 ? 74  THR A OG1  1 
ATOM   853  C CG2  . THR A 1 73  ? 19.145  38.443 3.135  1.00 22.90 ? 74  THR A CG2  1 
ATOM   854  H H    . THR A 1 73  ? 15.434  39.574 2.523  1.00 22.10 ? 74  THR A H    1 
ATOM   855  H HA   . THR A 1 73  ? 16.712  37.311 3.045  1.00 21.98 ? 74  THR A HA   1 
ATOM   856  H HB   . THR A 1 73  ? 17.767  39.911 2.782  1.00 24.84 ? 74  THR A HB   1 
ATOM   857  H HG1  . THR A 1 73  ? 17.028  38.983 0.890  1.00 26.82 ? 74  THR A HG1  1 
ATOM   858  H HG21 . THR A 1 73  ? 19.875  38.902 2.692  1.00 27.48 ? 74  THR A HG21 1 
ATOM   859  H HG22 . THR A 1 73  ? 19.208  38.597 4.091  1.00 27.48 ? 74  THR A HG22 1 
ATOM   860  H HG23 . THR A 1 73  ? 19.221  37.491 2.964  1.00 27.48 ? 74  THR A HG23 1 
ATOM   861  N N    . ALA A 1 74  ? 16.422  39.430 5.421  1.00 15.59 ? 75  ALA A N    1 
ATOM   862  C CA   . ALA A 1 74  ? 16.536  39.568 6.868  1.00 15.50 ? 75  ALA A CA   1 
ATOM   863  C C    . ALA A 1 74  ? 15.757  38.488 7.569  1.00 13.39 ? 75  ALA A C    1 
ATOM   864  O O    . ALA A 1 74  ? 16.262  37.864 8.502  1.00 13.70 ? 75  ALA A O    1 
ATOM   865  C CB   . ALA A 1 74  ? 16.052  40.947 7.343  1.00 16.69 ? 75  ALA A CB   1 
ATOM   866  H H    . ALA A 1 74  ? 16.088  40.115 5.022  1.00 18.71 ? 75  ALA A H    1 
ATOM   867  H HA   . ALA A 1 74  ? 17.468  39.475 7.120  1.00 18.60 ? 75  ALA A HA   1 
ATOM   868  H HB1  . ALA A 1 74  ? 16.144  40.998 8.307  1.00 20.03 ? 75  ALA A HB1  1 
ATOM   869  H HB2  . ALA A 1 74  ? 16.592  41.633 6.921  1.00 20.03 ? 75  ALA A HB2  1 
ATOM   870  H HB3  . ALA A 1 74  ? 15.121  41.057 7.092  1.00 20.03 ? 75  ALA A HB3  1 
ATOM   871  N N    . ASN A 1 75  ? 14.519  38.249 7.159  1.00 12.92 ? 76  ASN A N    1 
ATOM   872  C CA   . ASN A 1 75  ? 13.702  37.254 7.832  1.00 13.73 ? 76  ASN A CA   1 
ATOM   873  C C    . ASN A 1 75  ? 14.195  35.827 7.564  1.00 14.00 ? 76  ASN A C    1 
ATOM   874  O O    . ASN A 1 75  ? 14.130  34.972 8.429  1.00 15.19 ? 76  ASN A O    1 
ATOM   875  C CB   . ASN A 1 75  ? 12.239  37.419 7.445  1.00 14.30 ? 76  ASN A CB   1 
ATOM   876  C CG   . ASN A 1 75  ? 11.612  38.677 8.025  1.00 14.48 ? 76  ASN A CG   1 
ATOM   877  O OD1  . ASN A 1 75  ? 12.134  39.287 8.969  1.00 14.60 ? 76  ASN A OD1  1 
ATOM   878  N ND2  . ASN A 1 75  ? 10.448  39.039 7.495  1.00 17.66 ? 76  ASN A ND2  1 
ATOM   879  H H    . ASN A 1 75  ? 14.133  38.646 6.501  1.00 15.50 ? 76  ASN A H    1 
ATOM   880  H HA   . ASN A 1 75  ? 13.766  37.405 8.788  1.00 16.48 ? 76  ASN A HA   1 
ATOM   881  H HB2  . ASN A 1 75  ? 12.172  37.470 6.479  1.00 17.16 ? 76  ASN A HB2  1 
ATOM   882  H HB3  . ASN A 1 75  ? 11.738  36.656 7.773  1.00 17.16 ? 76  ASN A HB3  1 
ATOM   883  H HD21 . ASN A 1 75  ? 10.045  39.743 7.783  1.00 21.19 ? 76  ASN A HD21 1 
ATOM   884  H HD22 . ASN A 1 75  ? 10.098  38.571 6.865  1.00 21.19 ? 76  ASN A HD22 1 
ATOM   885  N N    . ASP A 1 76  ? 14.733  35.567 6.376  1.00 14.45 ? 77  ASP A N    1 
ATOM   886  C CA   . ASP A 1 76  ? 15.319  34.256 6.109  1.00 15.04 ? 77  ASP A CA   1 
ATOM   887  C C    . ASP A 1 76  ? 16.513  34.031 7.015  1.00 14.51 ? 77  ASP A C    1 
ATOM   888  O O    . ASP A 1 76  ? 16.679  32.944 7.565  1.00 16.83 ? 77  ASP A O    1 
ATOM   889  C CB   . ASP A 1 76  ? 15.755  34.147 4.648  1.00 15.68 ? 77  ASP A CB   1 
ATOM   890  C CG   . ASP A 1 76  ? 14.651  33.633 3.718  1.00 19.97 ? 77  ASP A CG   1 
ATOM   891  O OD1  . ASP A 1 76  ? 13.501  33.443 4.143  1.00 24.73 ? 77  ASP A OD1  1 
ATOM   892  O OD2  . ASP A 1 76  ? 14.967  33.426 2.533  1.00 21.01 ? 77  ASP A OD2  1 
ATOM   893  H H    . ASP A 1 76  ? 14.772  36.121 5.719  1.00 17.34 ? 77  ASP A H    1 
ATOM   894  H HA   . ASP A 1 76  ? 14.662  33.565 6.287  1.00 18.05 ? 77  ASP A HA   1 
ATOM   895  H HB2  . ASP A 1 76  ? 16.024  35.024 4.335  1.00 18.81 ? 77  ASP A HB2  1 
ATOM   896  H HB3  . ASP A 1 76  ? 16.504  33.532 4.589  1.00 18.81 ? 77  ASP A HB3  1 
ATOM   897  N N    . TYR A 1 77  ? 17.314  35.070 7.216  1.00 14.93 ? 78  TYR A N    1 
ATOM   898  C CA   . TYR A 1 77  ? 18.456  34.961 8.123  1.00 15.87 ? 78  TYR A CA   1 
ATOM   899  C C    . TYR A 1 77  ? 17.971  34.634 9.543  1.00 15.79 ? 78  TYR A C    1 
ATOM   900  O O    . TYR A 1 77  ? 18.499  33.740 10.190 1.00 17.14 ? 78  TYR A O    1 
ATOM   901  C CB   . TYR A 1 77  ? 19.313  36.240 8.101  1.00 16.05 ? 78  TYR A CB   1 
ATOM   902  C CG   . TYR A 1 77  ? 20.517  36.140 9.015  1.00 17.40 ? 78  TYR A CG   1 
ATOM   903  C CD1  . TYR A 1 77  ? 20.433  36.501 10.347 1.00 18.97 ? 78  TYR A CD1  1 
ATOM   904  C CD2  . TYR A 1 77  ? 21.718  35.623 8.556  1.00 18.06 ? 78  TYR A CD2  1 
ATOM   905  C CE1  . TYR A 1 77  ? 21.507  36.382 11.182 1.00 19.23 ? 78  TYR A CE1  1 
ATOM   906  C CE2  . TYR A 1 77  ? 22.798  35.500 9.404  1.00 19.07 ? 78  TYR A CE2  1 
ATOM   907  C CZ   . TYR A 1 77  ? 22.674  35.873 10.716 1.00 19.24 ? 78  TYR A CZ   1 
ATOM   908  O OH   . TYR A 1 77  ? 23.763  35.738 11.558 1.00 23.09 ? 78  TYR A OH   1 
ATOM   909  H H    . TYR A 1 77  ? 17.222  35.841 6.847  1.00 17.91 ? 78  TYR A H    1 
ATOM   910  H HA   . TYR A 1 77  ? 19.017  34.227 7.828  1.00 19.05 ? 78  TYR A HA   1 
ATOM   911  H HB2  . TYR A 1 77  ? 19.632  36.394 7.198  1.00 19.26 ? 78  TYR A HB2  1 
ATOM   912  H HB3  . TYR A 1 77  ? 18.773  36.990 8.396  1.00 19.26 ? 78  TYR A HB3  1 
ATOM   913  H HD1  . TYR A 1 77  ? 19.633  36.841 10.678 1.00 22.77 ? 78  TYR A HD1  1 
ATOM   914  H HD2  . TYR A 1 77  ? 21.797  35.360 7.667  1.00 21.67 ? 78  TYR A HD2  1 
ATOM   915  H HE1  . TYR A 1 77  ? 21.432  36.632 12.075 1.00 23.07 ? 78  TYR A HE1  1 
ATOM   916  H HE2  . TYR A 1 77  ? 23.603  35.155 9.089  1.00 22.89 ? 78  TYR A HE2  1 
ATOM   917  H HH   . TYR A 1 77  ? 24.413  35.412 11.138 1.00 27.71 ? 78  TYR A HH   1 
ATOM   918  N N    . LEU A 1 78  ? 16.958  35.353 10.004 1.00 14.89 ? 79  LEU A N    1 
ATOM   919  C CA   . LEU A 1 78  ? 16.447  35.167 11.369 1.00 15.60 ? 79  LEU A CA   1 
ATOM   920  C C    . LEU A 1 78  ? 15.810  33.806 11.598 1.00 15.68 ? 79  LEU A C    1 
ATOM   921  O O    . LEU A 1 78  ? 15.812  33.303 12.724 1.00 18.26 ? 79  LEU A O    1 
ATOM   922  C CB   . LEU A 1 78  ? 15.444  36.266 11.655 1.00 15.32 ? 79  LEU A CB   1 
ATOM   923  C CG   . LEU A 1 78  ? 16.095  37.640 11.828 1.00 15.48 ? 79  LEU A CG   1 
ATOM   924  C CD1  . LEU A 1 78  ? 15.075  38.740 11.684 1.00 15.17 ? 79  LEU A CD1  1 
ATOM   925  C CD2  . LEU A 1 78  ? 16.804  37.763 13.154 1.00 16.58 ? 79  LEU A CD2  1 
ATOM   926  H H    . LEU A 1 78  ? 16.544  35.956 9.552  1.00 17.87 ? 79  LEU A H    1 
ATOM   927  H HA   . LEU A 1 78  ? 17.182  35.261 11.995 1.00 18.72 ? 79  LEU A HA   1 
ATOM   928  H HB2  . LEU A 1 78  ? 14.818  36.322 10.916 1.00 18.39 ? 79  LEU A HB2  1 
ATOM   929  H HB3  . LEU A 1 78  ? 14.970  36.055 12.475 1.00 18.39 ? 79  LEU A HB3  1 
ATOM   930  H HG   . LEU A 1 78  ? 16.757  37.760 11.128 1.00 18.57 ? 79  LEU A HG   1 
ATOM   931  H HD11 . LEU A 1 78  ? 15.516  39.596 11.798 1.00 18.20 ? 79  LEU A HD11 1 
ATOM   932  H HD12 . LEU A 1 78  ? 14.676  38.687 10.801 1.00 18.20 ? 79  LEU A HD12 1 
ATOM   933  H HD13 . LEU A 1 78  ? 14.391  38.626 12.363 1.00 18.20 ? 79  LEU A HD13 1 
ATOM   934  H HD21 . LEU A 1 78  ? 17.200  38.645 13.219 1.00 19.89 ? 79  LEU A HD21 1 
ATOM   935  H HD22 . LEU A 1 78  ? 16.161  37.634 13.868 1.00 19.89 ? 79  LEU A HD22 1 
ATOM   936  H HD23 . LEU A 1 78  ? 17.496  37.084 13.205 1.00 19.89 ? 79  LEU A HD23 1 
ATOM   937  N N    . ARG A 1 79  ? 15.272  33.201 10.549 1.00 17.55 ? 80  ARG A N    1 
ATOM   938  C CA   . ARG A 1 79  ? 14.645  31.877 10.640 1.00 19.51 ? 80  ARG A CA   1 
ATOM   939  C C    . ARG A 1 79  ? 15.604  30.718 10.368 1.00 20.51 ? 80  ARG A C    1 
ATOM   940  O O    . ARG A 1 79  ? 15.242  29.564 10.570 1.00 22.71 ? 80  ARG A O    1 
ATOM   941  C CB   . ARG A 1 79  ? 13.490  31.770 9.628  1.00 19.71 ? 80  ARG A CB   1 
ATOM   942  C CG   . ARG A 1 79  ? 12.248  32.566 9.991  1.00 20.06 ? 80  ARG A CG   1 
ATOM   943  C CD   . ARG A 1 79  ? 11.119  32.303 9.005  1.00 25.03 ? 80  ARG A CD   1 
ATOM   944  N NE   . ARG A 1 79  ? 11.444  32.802 7.671  1.00 23.95 ? 80  ARG A NE   1 
ATOM   945  C CZ   . ARG A 1 79  ? 10.868  33.845 7.082  1.00 20.05 ? 80  ARG A CZ   1 
ATOM   946  N NH1  . ARG A 1 79  ? 9.928   34.544 7.704  1.00 21.47 ? 80  ARG A NH1  1 
ATOM   947  N NH2  . ARG A 1 79  ? 11.268  34.224 5.897  1.00 22.30 ? 80  ARG A NH2  1 
ATOM   948  H H    . ARG A 1 79  ? 15.254  33.538 9.758  1.00 21.06 ? 80  ARG A H    1 
ATOM   949  H HA   . ARG A 1 79  ? 14.277  31.761 11.530 1.00 23.41 ? 80  ARG A HA   1 
ATOM   950  H HB2  . ARG A 1 79  ? 13.803  32.091 8.768  1.00 23.66 ? 80  ARG A HB2  1 
ATOM   951  H HB3  . ARG A 1 79  ? 13.230  30.839 9.553  1.00 23.66 ? 80  ARG A HB3  1 
ATOM   952  H HG2  . ARG A 1 79  ? 11.948  32.306 10.876 1.00 24.07 ? 80  ARG A HG2  1 
ATOM   953  H HG3  . ARG A 1 79  ? 12.457  33.513 9.971  1.00 24.07 ? 80  ARG A HG3  1 
ATOM   954  H HD2  . ARG A 1 79  ? 10.964  31.348 8.943  1.00 30.04 ? 80  ARG A HD2  1 
ATOM   955  H HD3  . ARG A 1 79  ? 10.316  32.754 9.310  1.00 30.04 ? 80  ARG A HD3  1 
ATOM   956  H HE   . ARG A 1 79  ? 12.057  32.387 7.231  1.00 28.74 ? 80  ARG A HE   1 
ATOM   957  H HH11 . ARG A 1 79  ? 9.667   34.312 8.490  1.00 25.77 ? 80  ARG A HH11 1 
ATOM   958  H HH12 . ARG A 1 79  ? 9.566   35.220 7.313  1.00 25.77 ? 80  ARG A HH12 1 
ATOM   959  H HH21 . ARG A 1 79  ? 11.878  33.778 5.486  1.00 26.76 ? 80  ARG A HH21 1 
ATOM   960  H HH22 . ARG A 1 79  ? 10.895  34.896 5.512  1.00 26.76 ? 80  ARG A HH22 1 
ATOM   961  N N    . ALA A 1 80  ? 16.804  31.016 9.883  1.00 18.77 ? 81  ALA A N    1 
ATOM   962  C CA   . ALA A 1 80  ? 17.709  29.977 9.397  1.00 21.54 ? 81  ALA A CA   1 
ATOM   963  C C    . ALA A 1 80  ? 18.230  29.140 10.526 1.00 28.25 ? 81  ALA A C    1 
ATOM   964  O O    . ALA A 1 80  ? 18.625  29.661 11.549 1.00 27.97 ? 81  ALA A O    1 
ATOM   965  C CB   . ALA A 1 80  ? 18.867  30.592 8.646  1.00 22.88 ? 81  ALA A CB   1 
ATOM   966  H H    . ALA A 1 80  ? 17.120  31.814 9.823  1.00 22.53 ? 81  ALA A H    1 
ATOM   967  H HA   . ALA A 1 80  ? 17.227  29.396 8.788  1.00 25.85 ? 81  ALA A HA   1 
ATOM   968  H HB1  . ALA A 1 80  ? 19.452  29.884 8.334  1.00 27.46 ? 81  ALA A HB1  1 
ATOM   969  H HB2  . ALA A 1 80  ? 18.522  31.094 7.891  1.00 27.46 ? 81  ALA A HB2  1 
ATOM   970  H HB3  . ALA A 1 80  ? 19.351  31.183 9.243  1.00 27.46 ? 81  ALA A HB3  1 
ATOM   971  N N    . THR A 1 81  ? 18.252  27.831 10.321 1.00 30.41 ? 82  THR A N    1 
ATOM   972  C CA   . THR A 1 81  ? 18.878  26.924 11.273 1.00 33.14 ? 82  THR A CA   1 
ATOM   973  C C    . THR A 1 81  ? 20.400  26.941 11.133 1.00 38.29 ? 82  THR A C    1 
ATOM   974  O O    . THR A 1 81  ? 21.122  26.687 12.097 1.00 41.78 ? 82  THR A O    1 
ATOM   975  C CB   . THR A 1 81  ? 18.343  25.505 11.082 1.00 37.11 ? 82  THR A CB   1 
ATOM   976  O OG1  . THR A 1 81  ? 18.612  25.069 9.741  1.00 38.62 ? 82  THR A OG1  1 
ATOM   977  C CG2  . THR A 1 81  ? 16.844  25.485 11.329 1.00 38.71 ? 82  THR A CG2  1 
ATOM   978  H H    . THR A 1 81  ? 17.910  27.439 9.636  1.00 36.49 ? 82  THR A H    1 
ATOM   979  H HA   . THR A 1 81  ? 18.656  27.209 12.174 1.00 39.77 ? 82  THR A HA   1 
ATOM   980  H HB   . THR A 1 81  ? 18.771  24.906 11.713 1.00 44.53 ? 82  THR A HB   1 
ATOM   981  H HG1  . THR A 1 81  ? 18.320  24.290 9.629  1.00 46.34 ? 82  THR A HG1  1 
ATOM   982  H HG21 . THR A 1 81  ? 16.501  24.586 11.208 1.00 46.46 ? 82  THR A HG21 1 
ATOM   983  H HG22 . THR A 1 81  ? 16.654  25.776 12.234 1.00 46.46 ? 82  THR A HG22 1 
ATOM   984  H HG23 . THR A 1 81  ? 16.398  26.079 10.706 1.00 46.46 ? 82  THR A HG23 1 
ATOM   985  N N    . ASP A 1 82  ? 20.876  27.268 9.935  1.00 34.33 ? 83  ASP A N    1 
ATOM   986  C CA   . ASP A 1 82  ? 22.306  27.270 9.624  1.00 38.87 ? 83  ASP A CA   1 
ATOM   987  C C    . ASP A 1 82  ? 22.602  28.324 8.554  1.00 37.94 ? 83  ASP A C    1 
ATOM   988  O O    . ASP A 1 82  ? 21.993  28.308 7.481  1.00 37.40 ? 83  ASP A O    1 
ATOM   989  C CB   . ASP A 1 82  ? 22.724  25.871 9.140  1.00 42.23 ? 83  ASP A CB   1 
ATOM   990  C CG   . ASP A 1 82  ? 24.118  25.839 8.522  1.00 51.19 ? 83  ASP A CG   1 
ATOM   991  O OD1  . ASP A 1 82  ? 24.993  26.615 8.954  1.00 47.25 ? 83  ASP A OD1  1 
ATOM   992  O OD2  . ASP A 1 82  ? 24.337  25.015 7.606  1.00 55.83 ? 83  ASP A OD2  1 
ATOM   993  H H    . ASP A 1 82  ? 20.381  27.497 9.270  1.00 41.19 ? 83  ASP A H    1 
ATOM   994  H HA   . ASP A 1 82  ? 22.813  27.487 10.422 1.00 46.64 ? 83  ASP A HA   1 
ATOM   995  H HB2  . ASP A 1 82  ? 22.719  25.262 9.896  1.00 50.68 ? 83  ASP A HB2  1 
ATOM   996  H HB3  . ASP A 1 82  ? 22.093  25.569 8.469  1.00 50.68 ? 83  ASP A HB3  1 
ATOM   997  N N    . THR A 1 83  ? 23.527  29.239 8.845  1.00 36.92 ? 84  THR A N    1 
ATOM   998  C CA   . THR A 1 83  ? 23.889  30.299 7.888  1.00 36.92 ? 84  THR A CA   1 
ATOM   999  C C    . THR A 1 83  ? 25.341  30.205 7.393  1.00 37.85 ? 84  THR A C    1 
ATOM   1000 O O    . THR A 1 83  ? 25.923  31.191 6.926  1.00 35.36 ? 84  THR A O    1 
ATOM   1001 C CB   . THR A 1 83  ? 23.614  31.710 8.476  1.00 38.93 ? 84  THR A CB   1 
ATOM   1002 O OG1  . THR A 1 83  ? 24.282  31.848 9.736  1.00 43.68 ? 84  THR A OG1  1 
ATOM   1003 C CG2  . THR A 1 83  ? 22.110  31.932 8.663  1.00 33.84 ? 84  THR A CG2  1 
ATOM   1004 H H    . THR A 1 83  ? 23.962  29.272 9.586  1.00 44.31 ? 84  THR A H    1 
ATOM   1005 H HA   . THR A 1 83  ? 23.320  30.202 7.109  1.00 44.31 ? 84  THR A HA   1 
ATOM   1006 H HB   . THR A 1 83  ? 23.946  32.384 7.862  1.00 46.71 ? 84  THR A HB   1 
ATOM   1007 H HG1  . THR A 1 83  ? 24.135  32.610 10.057 1.00 52.41 ? 84  THR A HG1  1 
ATOM   1008 H HG21 . THR A 1 83  ? 21.948  32.815 9.031  1.00 40.60 ? 84  THR A HG21 1 
ATOM   1009 H HG22 . THR A 1 83  ? 21.655  31.858 7.810  1.00 40.60 ? 84  THR A HG22 1 
ATOM   1010 H HG23 . THR A 1 83  ? 21.750  31.267 9.271  1.00 40.60 ? 84  THR A HG23 1 
ATOM   1011 N N    . SER A 1 84  ? 25.916  29.003 7.449  1.00 39.89 ? 85  SER A N    1 
ATOM   1012 C CA   . SER A 1 84  ? 27.302  28.799 7.045  1.00 36.72 ? 85  SER A CA   1 
ATOM   1013 C C    . SER A 1 84  ? 27.569  29.148 5.582  1.00 37.42 ? 85  SER A C    1 
ATOM   1014 O O    . SER A 1 84  ? 28.694  29.494 5.212  1.00 41.89 ? 85  SER A O    1 
ATOM   1015 C CB   . SER A 1 84  ? 27.700  27.345 7.291  1.00 44.35 ? 85  SER A CB   1 
ATOM   1016 O OG   . SER A 1 84  ? 27.576  27.017 8.663  1.00 53.86 ? 85  SER A OG   1 
ATOM   1017 H H    . SER A 1 84  ? 25.521  28.289 7.720  1.00 47.87 ? 85  SER A H    1 
ATOM   1018 H HA   . SER A 1 84  ? 27.873  29.361 7.592  1.00 44.06 ? 85  SER A HA   1 
ATOM   1019 H HB2  . SER A 1 84  ? 27.118  26.766 6.774  1.00 53.21 ? 85  SER A HB2  1 
ATOM   1020 H HB3  . SER A 1 84  ? 28.622  27.219 7.018  1.00 53.21 ? 85  SER A HB3  1 
ATOM   1021 H HG   . SER A 1 84  ? 26.781  27.123 8.913  1.00 64.63 ? 85  SER A HG   1 
ATOM   1022 N N    . THR A 1 85  ? 26.538  29.038 4.748  1.00 37.88 ? 86  THR A N    1 
ATOM   1023 C CA   . THR A 1 85  ? 26.694  29.303 3.318  1.00 35.09 ? 86  THR A CA   1 
ATOM   1024 C C    . THR A 1 85  ? 26.593  30.787 2.980  1.00 37.54 ? 86  THR A C    1 
ATOM   1025 O O    . THR A 1 85  ? 26.837  31.178 1.838  1.00 38.23 ? 86  THR A O    1 
ATOM   1026 C CB   . THR A 1 85  ? 25.635  28.556 2.466  1.00 37.50 ? 86  THR A CB   1 
ATOM   1027 O OG1  . THR A 1 85  ? 24.316  28.960 2.854  1.00 37.05 ? 86  THR A OG1  1 
ATOM   1028 C CG2  . THR A 1 85  ? 25.779  27.047 2.604  1.00 39.72 ? 86  THR A CG2  1 
ATOM   1029 H H    . THR A 1 85  ? 25.742  28.812 4.982  1.00 45.46 ? 86  THR A H    1 
ATOM   1030 H HA   . THR A 1 85  ? 27.570  28.994 3.038  1.00 42.11 ? 86  THR A HA   1 
ATOM   1031 H HB   . THR A 1 85  ? 25.769  28.783 1.532  1.00 44.99 ? 86  THR A HB   1 
ATOM   1032 H HG1  . THR A 1 85  ? 23.744  28.555 2.392  1.00 44.46 ? 86  THR A HG1  1 
ATOM   1033 H HG21 . THR A 1 85  ? 25.109  26.599 2.064  1.00 47.66 ? 86  THR A HG21 1 
ATOM   1034 H HG22 . THR A 1 85  ? 26.660  26.769 2.307  1.00 47.66 ? 86  THR A HG22 1 
ATOM   1035 H HG23 . THR A 1 85  ? 25.662  26.786 3.531  1.00 47.66 ? 86  THR A HG23 1 
ATOM   1036 N N    . TRP A 1 86  ? 26.251  31.612 3.967  1.00 29.43 ? 87  TRP A N    1 
ATOM   1037 C CA   . TRP A 1 86  ? 25.954  33.011 3.711  1.00 28.10 ? 87  TRP A CA   1 
ATOM   1038 C C    . TRP A 1 86  ? 27.171  33.908 3.439  1.00 29.37 ? 87  TRP A C    1 
ATOM   1039 O O    . TRP A 1 86  ? 27.070  34.853 2.660  1.00 30.17 ? 87  TRP A O    1 
ATOM   1040 C CB   . TRP A 1 86  ? 25.115  33.580 4.853  1.00 26.10 ? 87  TRP A CB   1 
ATOM   1041 C CG   . TRP A 1 86  ? 23.668  33.114 4.850  1.00 24.42 ? 87  TRP A CG   1 
ATOM   1042 C CD1  . TRP A 1 86  ? 23.204  31.834 4.913  1.00 27.38 ? 87  TRP A CD1  1 
ATOM   1043 C CD2  . TRP A 1 86  ? 22.513  33.953 4.790  1.00 20.65 ? 87  TRP A CD2  1 
ATOM   1044 N NE1  . TRP A 1 86  ? 21.824  31.827 4.900  1.00 26.07 ? 87  TRP A NE1  1 
ATOM   1045 C CE2  . TRP A 1 86  ? 21.378  33.111 4.821  1.00 21.35 ? 87  TRP A CE2  1 
ATOM   1046 C CE3  . TRP A 1 86  ? 22.333  35.321 4.700  1.00 20.91 ? 87  TRP A CE3  1 
ATOM   1047 C CZ2  . TRP A 1 86  ? 20.082  33.611 4.776  1.00 21.01 ? 87  TRP A CZ2  1 
ATOM   1048 C CZ3  . TRP A 1 86  ? 21.063  35.809 4.654  1.00 21.46 ? 87  TRP A CZ3  1 
ATOM   1049 C CH2  . TRP A 1 86  ? 19.943  34.959 4.684  1.00 20.57 ? 87  TRP A CH2  1 
ATOM   1050 H H    . TRP A 1 86  ? 26.184  31.382 4.793  1.00 35.32 ? 87  TRP A H    1 
ATOM   1051 H HA   . TRP A 1 86  ? 25.402  33.050 2.915  1.00 33.71 ? 87  TRP A HA   1 
ATOM   1052 H HB2  . TRP A 1 86  ? 25.511  33.310 5.696  1.00 31.32 ? 87  TRP A HB2  1 
ATOM   1053 H HB3  . TRP A 1 86  ? 25.113  34.548 4.786  1.00 31.32 ? 87  TRP A HB3  1 
ATOM   1054 H HD1  . TRP A 1 86  ? 23.740  31.076 4.973  1.00 32.86 ? 87  TRP A HD1  1 
ATOM   1055 H HE1  . TRP A 1 86  ? 21.326  31.127 4.934  1.00 31.29 ? 87  TRP A HE1  1 
ATOM   1056 H HE3  . TRP A 1 86  ? 23.063  35.896 4.678  1.00 25.10 ? 87  TRP A HE3  1 
ATOM   1057 H HZ2  . TRP A 1 86  ? 19.343  33.047 4.792  1.00 25.21 ? 87  TRP A HZ2  1 
ATOM   1058 H HZ3  . TRP A 1 86  ? 20.932  36.728 4.598  1.00 25.76 ? 87  TRP A HZ3  1 
ATOM   1059 H HH2  . TRP A 1 86  ? 19.090  35.328 4.653  1.00 24.68 ? 87  TRP A HH2  1 
ATOM   1060 N N    . GLY A 1 87  ? 28.318  33.619 4.051  1.00 31.42 ? 88  GLY A N    1 
ATOM   1061 C CA   . GLY A 1 87  ? 29.507  34.420 3.793  1.00 28.39 ? 88  GLY A CA   1 
ATOM   1062 C C    . GLY A 1 87  ? 29.273  35.884 4.136  1.00 26.04 ? 88  GLY A C    1 
ATOM   1063 O O    . GLY A 1 87  ? 28.690  36.213 5.180  1.00 27.79 ? 88  GLY A O    1 
ATOM   1064 H H    . GLY A 1 87  ? 28.431  32.976 4.610  1.00 37.70 ? 88  GLY A H    1 
ATOM   1065 H HA2  . GLY A 1 87  ? 30.246  34.089 4.329  1.00 34.06 ? 88  GLY A HA2  1 
ATOM   1066 H HA3  . GLY A 1 87  ? 29.749  34.354 2.856  1.00 34.06 ? 88  GLY A HA3  1 
ATOM   1067 N N    . VAL A 1 88  ? 29.707  36.772 3.249  1.00 23.70 ? 89  VAL A N    1 
ATOM   1068 C CA   . VAL A 1 88  ? 29.542  38.196 3.491  1.00 22.64 ? 89  VAL A CA   1 
ATOM   1069 C C    . VAL A 1 88  ? 28.083  38.590 3.572  1.00 22.68 ? 89  VAL A C    1 
ATOM   1070 O O    . VAL A 1 88  ? 27.756  39.594 4.185  1.00 24.32 ? 89  VAL A O    1 
ATOM   1071 C CB   . VAL A 1 88  ? 30.246  39.077 2.448  1.00 21.92 ? 89  VAL A CB   1 
ATOM   1072 C CG1  . VAL A 1 88  ? 31.728  38.834 2.467  1.00 26.50 ? 89  VAL A CG1  1 
ATOM   1073 C CG2  . VAL A 1 88  ? 29.672  38.856 1.039  1.00 26.12 ? 89  VAL A CG2  1 
ATOM   1074 H H    . VAL A 1 88  ? 30.096  36.578 2.507  1.00 28.44 ? 89  VAL A H    1 
ATOM   1075 H HA   . VAL A 1 88  ? 29.941  38.401 4.351  1.00 27.17 ? 89  VAL A HA   1 
ATOM   1076 H HB   . VAL A 1 88  ? 30.099  40.008 2.681  1.00 26.30 ? 89  VAL A HB   1 
ATOM   1077 H HG11 . VAL A 1 88  ? 32.149  39.401 1.801  1.00 31.80 ? 89  VAL A HG11 1 
ATOM   1078 H HG12 . VAL A 1 88  ? 32.072  39.047 3.348  1.00 31.80 ? 89  VAL A HG12 1 
ATOM   1079 H HG13 . VAL A 1 88  ? 31.897  37.901 2.262  1.00 31.80 ? 89  VAL A HG13 1 
ATOM   1080 H HG21 . VAL A 1 88  ? 30.141  39.429 0.414  1.00 31.35 ? 89  VAL A HG21 1 
ATOM   1081 H HG22 . VAL A 1 88  ? 29.793  37.926 0.792  1.00 31.35 ? 89  VAL A HG22 1 
ATOM   1082 H HG23 . VAL A 1 88  ? 28.727  39.076 1.045  1.00 31.35 ? 89  VAL A HG23 1 
ATOM   1083 N N    . ALA A 1 89  ? 27.202  37.830 2.919  1.00 22.65 ? 90  ALA A N    1 
ATOM   1084 C CA   . ALA A 1 89  ? 25.774  38.105 3.000  1.00 23.26 ? 90  ALA A CA   1 
ATOM   1085 C C    . ALA A 1 89  ? 25.249  37.968 4.428  1.00 20.49 ? 90  ALA A C    1 
ATOM   1086 O O    . ALA A 1 89  ? 24.344  38.684 4.803  1.00 19.86 ? 90  ALA A O    1 
ATOM   1087 C CB   . ALA A 1 89  ? 24.982  37.202 2.040  1.00 21.16 ? 90  ALA A CB   1 
ATOM   1088 H H    . ALA A 1 89  ? 27.407  37.155 2.426  1.00 27.18 ? 90  ALA A H    1 
ATOM   1089 H HA   . ALA A 1 89  ? 25.624  39.023 2.724  1.00 27.91 ? 90  ALA A HA   1 
ATOM   1090 H HB1  . ALA A 1 89  ? 24.038  37.409 2.118  1.00 25.39 ? 90  ALA A HB1  1 
ATOM   1091 H HB2  . ALA A 1 89  ? 25.284  37.366 1.132  1.00 25.39 ? 90  ALA A HB2  1 
ATOM   1092 H HB3  . ALA A 1 89  ? 25.139  36.275 2.278  1.00 25.39 ? 90  ALA A HB3  1 
ATOM   1093 N N    . GLY A 1 90  ? 25.836  37.071 5.218  1.00 21.46 ? 91  GLY A N    1 
ATOM   1094 C CA   . GLY A 1 90  ? 25.452  36.930 6.615  1.00 20.65 ? 91  GLY A CA   1 
ATOM   1095 C C    . GLY A 1 90  ? 25.886  38.132 7.434  1.00 18.85 ? 91  GLY A C    1 
ATOM   1096 O O    . GLY A 1 90  ? 25.124  38.644 8.256  1.00 18.56 ? 91  GLY A O    1 
ATOM   1097 H H    . GLY A 1 90  ? 26.459  36.534 4.967  1.00 25.75 ? 91  GLY A H    1 
ATOM   1098 H HA2  . GLY A 1 90  ? 24.488  36.841 6.681  1.00 24.78 ? 91  GLY A HA2  1 
ATOM   1099 H HA3  . GLY A 1 90  ? 25.864  36.135 6.988  1.00 24.78 ? 91  GLY A HA3  1 
ATOM   1100 N N    . ALA A 1 91  ? 27.104  38.592 7.209  1.00 19.00 ? 92  ALA A N    1 
ATOM   1101 C CA   . ALA A 1 91  ? 27.571  39.795 7.882  1.00 18.49 ? 92  ALA A CA   1 
ATOM   1102 C C    . ALA A 1 91  ? 26.711  41.002 7.509  1.00 18.76 ? 92  ALA A C    1 
ATOM   1103 O O    . ALA A 1 91  ? 26.343  41.814 8.367  1.00 18.59 ? 92  ALA A O    1 
ATOM   1104 C CB   . ALA A 1 91  ? 29.042  40.057 7.524  1.00 22.71 ? 92  ALA A CB   1 
ATOM   1105 H H    . ALA A 1 91  ? 27.676  38.233 6.677  1.00 22.80 ? 92  ALA A H    1 
ATOM   1106 H HA   . ALA A 1 91  ? 27.511  39.667 8.842  1.00 22.18 ? 92  ALA A HA   1 
ATOM   1107 H HB1  . ALA A 1 91  ? 29.339  40.860 7.979  1.00 27.25 ? 92  ALA A HB1  1 
ATOM   1108 H HB2  . ALA A 1 91  ? 29.575  39.298 7.809  1.00 27.25 ? 92  ALA A HB2  1 
ATOM   1109 H HB3  . ALA A 1 91  ? 29.117  40.173 6.564  1.00 27.25 ? 92  ALA A HB3  1 
ATOM   1110 N N    . ASP A 1 92  ? 26.371  41.129 6.229  1.00 18.86 ? 93  ASP A N    1 
ATOM   1111 C CA   . ASP A 1 92  ? 25.502  42.211 5.794  1.00 21.51 ? 93  ASP A CA   1 
ATOM   1112 C C    . ASP A 1 92  ? 24.112  42.087 6.397  1.00 18.84 ? 93  ASP A C    1 
ATOM   1113 O O    . ASP A 1 92  ? 23.529  43.073 6.810  1.00 19.01 ? 93  ASP A O    1 
ATOM   1114 C CB   . ASP A 1 92  ? 25.403  42.245 4.266  1.00 23.86 ? 93  ASP A CB   1 
ATOM   1115 C CG   . ASP A 1 92  ? 26.564  42.991 3.613  1.00 35.56 ? 93  ASP A CG   1 
ATOM   1116 O OD1  . ASP A 1 92  ? 27.312  43.711 4.312  1.00 34.01 ? 93  ASP A OD1  1 
ATOM   1117 O OD2  . ASP A 1 92  ? 26.714  42.866 2.381  1.00 39.63 ? 93  ASP A OD2  1 
ATOM   1118 H H    . ASP A 1 92  ? 26.629  40.604 5.598  1.00 22.63 ? 93  ASP A H    1 
ATOM   1119 H HA   . ASP A 1 92  ? 25.881  43.054 6.088  1.00 25.81 ? 93  ASP A HA   1 
ATOM   1120 H HB2  . ASP A 1 92  ? 25.404  41.335 3.929  1.00 28.64 ? 93  ASP A HB2  1 
ATOM   1121 H HB3  . ASP A 1 92  ? 24.580  42.691 4.013  1.00 28.64 ? 93  ASP A HB3  1 
ATOM   1122 N N    . ALA A 1 93  ? 23.566  40.879 6.434  1.00 17.79 ? 94  ALA A N    1 
ATOM   1123 C CA   . ALA A 1 93  ? 22.273  40.670 7.063  1.00 17.26 ? 94  ALA A CA   1 
ATOM   1124 C C    . ALA A 1 93  ? 22.272  41.068 8.547  1.00 16.79 ? 94  ALA A C    1 
ATOM   1125 O O    . ALA A 1 93  ? 21.338  41.708 9.005  1.00 16.00 ? 94  ALA A O    1 
ATOM   1126 C CB   . ALA A 1 93  ? 21.803  39.221 6.881  1.00 19.21 ? 94  ALA A CB   1 
ATOM   1127 H H    . ALA A 1 93  ? 23.921  40.169 6.103  1.00 21.35 ? 94  ALA A H    1 
ATOM   1128 H HA   . ALA A 1 93  ? 21.626  41.237 6.616  1.00 20.71 ? 94  ALA A HA   1 
ATOM   1129 H HB1  . ALA A 1 93  ? 20.940  39.113 7.311  1.00 23.06 ? 94  ALA A HB1  1 
ATOM   1130 H HB2  . ALA A 1 93  ? 21.727  39.031 5.933  1.00 23.06 ? 94  ALA A HB2  1 
ATOM   1131 H HB3  . ALA A 1 93  ? 22.452  38.625 7.287  1.00 23.06 ? 94  ALA A HB3  1 
ATOM   1132 N N    . ARG A 1 94  ? 23.310  40.686 9.280  1.00 16.76 ? 95  ARG A N    1 
ATOM   1133 C CA   . ARG A 1 94  ? 23.389  41.080 10.692 1.00 16.95 ? 95  ARG A CA   1 
ATOM   1134 C C    . ARG A 1 94  ? 23.432  42.586 10.841 1.00 16.39 ? 95  ARG A C    1 
ATOM   1135 O O    . ARG A 1 94  ? 22.749  43.146 11.702 1.00 18.17 ? 95  ARG A O    1 
ATOM   1136 C CB   . ARG A 1 94  ? 24.583  40.427 11.370 1.00 16.73 ? 95  ARG A CB   1 
ATOM   1137 C CG   . ARG A 1 94  ? 24.417  38.913 11.591 1.00 17.15 ? 95  ARG A CG   1 
ATOM   1138 C CD   . ARG A 1 94  ? 25.608  38.310 12.333 1.00 20.13 ? 95  ARG A CD   1 
ATOM   1139 N NE   . ARG A 1 94  ? 26.860  38.312 11.601 1.00 19.17 ? 95  ARG A NE   1 
ATOM   1140 C CZ   . ARG A 1 94  ? 27.246  37.373 10.751 1.00 19.28 ? 95  ARG A CZ   1 
ATOM   1141 N NH1  . ARG A 1 94  ? 26.413  36.375 10.450 1.00 21.40 ? 95  ARG A NH1  1 
ATOM   1142 N NH2  . ARG A 1 94  ? 28.420  37.467 10.152 1.00 22.06 ? 95  ARG A NH2  1 
ATOM   1143 H H    . ARG A 1 94  ? 23.969  40.211 8.999  1.00 20.11 ? 95  ARG A H    1 
ATOM   1144 H HA   . ARG A 1 94  ? 22.590  40.765 11.143 1.00 20.33 ? 95  ARG A HA   1 
ATOM   1145 H HB2  . ARG A 1 94  ? 25.369  40.562 10.818 1.00 20.08 ? 95  ARG A HB2  1 
ATOM   1146 H HB3  . ARG A 1 94  ? 24.715  40.841 12.238 1.00 20.08 ? 95  ARG A HB3  1 
ATOM   1147 H HG2  . ARG A 1 94  ? 23.619  38.754 12.120 1.00 20.58 ? 95  ARG A HG2  1 
ATOM   1148 H HG3  . ARG A 1 94  ? 24.341  38.472 10.731 1.00 20.58 ? 95  ARG A HG3  1 
ATOM   1149 H HD2  . ARG A 1 94  ? 25.748  38.813 13.150 1.00 24.16 ? 95  ARG A HD2  1 
ATOM   1150 H HD3  . ARG A 1 94  ? 25.399  37.388 12.552 1.00 24.16 ? 95  ARG A HD3  1 
ATOM   1151 H HE   . ARG A 1 94  ? 27.393  38.974 11.729 1.00 23.00 ? 95  ARG A HE   1 
ATOM   1152 H HH11 . ARG A 1 94  ? 25.650  36.318 10.842 1.00 25.68 ? 95  ARG A HH11 1 
ATOM   1153 H HH12 . ARG A 1 94  ? 26.653  35.770 9.888  1.00 25.68 ? 95  ARG A HH12 1 
ATOM   1154 H HH21 . ARG A 1 94  ? 28.946  38.123 10.337 1.00 26.48 ? 95  ARG A HH21 1 
ATOM   1155 H HH22 . ARG A 1 94  ? 28.661  36.871 9.581  1.00 26.48 ? 95  ARG A HH22 1 
ATOM   1156 N N    . GLN A 1 95  ? 24.190  43.261 9.989  1.00 18.00 ? 96  GLN A N    1 
ATOM   1157 C CA   . GLN A 1 95  ? 24.295  44.715 10.085 1.00 19.24 ? 96  GLN A CA   1 
ATOM   1158 C C    . GLN A 1 95  ? 22.951  45.338 9.733  1.00 18.09 ? 96  GLN A C    1 
ATOM   1159 O O    . GLN A 1 95  ? 22.480  46.263 10.394 1.00 19.71 ? 96  GLN A O    1 
ATOM   1160 C CB   . GLN A 1 95  ? 25.379  45.253 9.155  1.00 21.66 ? 96  GLN A CB   1 
ATOM   1161 C CG   . GLN A 1 95  ? 25.484  46.772 9.105  1.00 28.96 ? 96  GLN A CG   1 
ATOM   1162 C CD   . GLN A 1 95  ? 25.955  47.388 10.423 1.00 45.75 ? 96  GLN A CD   1 
ATOM   1163 O OE1  . GLN A 1 95  ? 26.406  46.690 11.334 1.00 44.56 ? 96  GLN A OE1  1 
ATOM   1164 N NE2  . GLN A 1 95  ? 25.858  48.707 10.522 1.00 57.35 ? 96  GLN A NE2  1 
ATOM   1165 H H    . GLN A 1 95  ? 24.649  42.909 9.352  1.00 21.60 ? 96  GLN A H    1 
ATOM   1166 H HA   . GLN A 1 95  ? 24.520  44.964 10.995 1.00 23.09 ? 96  GLN A HA   1 
ATOM   1167 H HB2  . GLN A 1 95  ? 26.237  44.910 9.449  1.00 26.00 ? 96  GLN A HB2  1 
ATOM   1168 H HB3  . GLN A 1 95  ? 25.196  44.942 8.254  1.00 26.00 ? 96  GLN A HB3  1 
ATOM   1169 H HG2  . GLN A 1 95  ? 26.119  47.021 8.416  1.00 34.75 ? 96  GLN A HG2  1 
ATOM   1170 H HG3  . GLN A 1 95  ? 24.611  47.140 8.899  1.00 34.75 ? 96  GLN A HG3  1 
ATOM   1171 H HE21 . GLN A 1 95  ? 25.544  49.166 9.866  1.00 68.82 ? 96  GLN A HE21 1 
ATOM   1172 H HE22 . GLN A 1 95  ? 26.109  49.104 11.243 1.00 68.82 ? 96  GLN A HE22 1 
ATOM   1173 N N    . TYR A 1 96  ? 22.305  44.809 8.701  1.00 17.31 ? 97  TYR A N    1 
ATOM   1174 C CA   . TYR A 1 96  ? 21.020  45.342 8.265  1.00 17.81 ? 97  TYR A CA   1 
ATOM   1175 C C    . TYR A 1 96  ? 19.959  45.181 9.355  1.00 17.14 ? 97  TYR A C    1 
ATOM   1176 O O    . TYR A 1 96  ? 19.205  46.112 9.667  1.00 17.57 ? 97  TYR A O    1 
ATOM   1177 C CB   . TYR A 1 96  ? 20.571  44.654 6.967  1.00 17.97 ? 97  TYR A CB   1 
ATOM   1178 C CG   . TYR A 1 96  ? 19.258  45.179 6.455  1.00 17.70 ? 97  TYR A CG   1 
ATOM   1179 C CD1  . TYR A 1 96  ? 19.181  46.416 5.854  1.00 19.18 ? 97  TYR A CD1  1 
ATOM   1180 C CD2  . TYR A 1 96  ? 18.090  44.467 6.625  1.00 21.05 ? 97  TYR A CD2  1 
ATOM   1181 C CE1  . TYR A 1 96  ? 17.978  46.923 5.419  1.00 23.82 ? 97  TYR A CE1  1 
ATOM   1182 C CE2  . TYR A 1 96  ? 16.874  44.965 6.196  1.00 23.37 ? 97  TYR A CE2  1 
ATOM   1183 C CZ   . TYR A 1 96  ? 16.823  46.191 5.594  1.00 24.81 ? 97  TYR A CZ   1 
ATOM   1184 O OH   . TYR A 1 96  ? 15.606  46.683 5.165  1.00 25.84 ? 97  TYR A OH   1 
ATOM   1185 H H    . TYR A 1 96  ? 22.587  44.142 8.237  1.00 20.77 ? 97  TYR A H    1 
ATOM   1186 H HA   . TYR A 1 96  ? 21.118  46.290 8.082  1.00 21.37 ? 97  TYR A HA   1 
ATOM   1187 H HB2  . TYR A 1 96  ? 21.242  44.804 6.282  1.00 21.56 ? 97  TYR A HB2  1 
ATOM   1188 H HB3  . TYR A 1 96  ? 20.471  43.704 7.131  1.00 21.56 ? 97  TYR A HB3  1 
ATOM   1189 H HD1  . TYR A 1 96  ? 19.956  46.917 5.741  1.00 23.02 ? 97  TYR A HD1  1 
ATOM   1190 H HD2  . TYR A 1 96  ? 18.120  43.636 7.041  1.00 25.25 ? 97  TYR A HD2  1 
ATOM   1191 H HE1  . TYR A 1 96  ? 17.943  47.758 5.010  1.00 28.58 ? 97  TYR A HE1  1 
ATOM   1192 H HE2  . TYR A 1 96  ? 16.096  44.468 6.313  1.00 28.04 ? 97  TYR A HE2  1 
ATOM   1193 H HH   . TYR A 1 96  ? 15.709  47.439 4.813  1.00 31.01 ? 97  TYR A HH   1 
ATOM   1194 N N    . ILE A 1 97  ? 19.897  43.993 9.940  1.00 15.48 ? 98  ILE A N    1 
ATOM   1195 C CA   . ILE A 1 97  ? 18.979  43.738 11.048 1.00 16.06 ? 98  ILE A CA   1 
ATOM   1196 C C    . ILE A 1 97  ? 19.212  44.732 12.206 1.00 18.08 ? 98  ILE A C    1 
ATOM   1197 O O    . ILE A 1 97  ? 18.268  45.326 12.726 1.00 17.76 ? 98  ILE A O    1 
ATOM   1198 C CB   . ILE A 1 97  ? 19.085  42.272 11.515 1.00 14.30 ? 98  ILE A CB   1 
ATOM   1199 C CG1  . ILE A 1 97  ? 18.519  41.332 10.440 1.00 16.85 ? 98  ILE A CG1  1 
ATOM   1200 C CG2  . ILE A 1 97  ? 18.342  42.049 12.824 1.00 16.15 ? 98  ILE A CG2  1 
ATOM   1201 C CD1  . ILE A 1 97  ? 18.989  39.884 10.557 1.00 18.02 ? 98  ILE A CD1  1 
ATOM   1202 H H    . ILE A 1 97  ? 20.376  43.314 9.716  1.00 18.57 ? 98  ILE A H    1 
ATOM   1203 H HA   . ILE A 1 97  ? 18.073  43.874 10.730 1.00 19.27 ? 98  ILE A HA   1 
ATOM   1204 H HB   . ILE A 1 97  ? 20.021  42.058 11.651 1.00 17.16 ? 98  ILE A HB   1 
ATOM   1205 H HG12 . ILE A 1 97  ? 17.551  41.334 10.504 1.00 20.22 ? 98  ILE A HG12 1 
ATOM   1206 H HG13 . ILE A 1 97  ? 18.790  41.660 9.568  1.00 20.22 ? 98  ILE A HG13 1 
ATOM   1207 H HG21 . ILE A 1 97  ? 18.432  41.118 13.083 1.00 19.38 ? 98  ILE A HG21 1 
ATOM   1208 H HG22 . ILE A 1 97  ? 18.726  42.621 13.507 1.00 19.38 ? 98  ILE A HG22 1 
ATOM   1209 H HG23 . ILE A 1 97  ? 17.406  42.268 12.697 1.00 19.38 ? 98  ILE A HG23 1 
ATOM   1210 H HD11 . ILE A 1 97  ? 18.587  39.364 9.844  1.00 21.62 ? 98  ILE A HD11 1 
ATOM   1211 H HD12 . ILE A 1 97  ? 19.955  39.859 10.481 1.00 21.62 ? 98  ILE A HD12 1 
ATOM   1212 H HD13 . ILE A 1 97  ? 18.715  39.533 11.419 1.00 21.62 ? 98  ILE A HD13 1 
ATOM   1213 N N    . ARG A 1 98  ? 20.468  44.937 12.576 1.00 17.81 ? 99  ARG A N    1 
ATOM   1214 C CA   . ARG A 1 98  ? 20.819  45.853 13.667 1.00 18.71 ? 99  ARG A CA   1 
ATOM   1215 C C    . ARG A 1 98  ? 20.352  47.283 13.336 1.00 18.86 ? 99  ARG A C    1 
ATOM   1216 O O    . ARG A 1 98  ? 19.822  48.017 14.192 1.00 19.38 ? 99  ARG A O    1 
ATOM   1217 C CB   . ARG A 1 98  ? 22.341  45.800 13.842 1.00 22.85 ? 99  ARG A CB   1 
ATOM   1218 C CG   . ARG A 1 98  ? 22.931  46.184 15.151 1.00 37.90 ? 99  ARG A CG   1 
ATOM   1219 C CD   . ARG A 1 98  ? 24.229  45.350 15.364 1.00 39.39 ? 99  ARG A CD   1 
ATOM   1220 N NE   . ARG A 1 98  ? 25.180  45.429 14.240 1.00 44.06 ? 99  ARG A NE   1 
ATOM   1221 C CZ   . ARG A 1 98  ? 25.730  44.384 13.609 1.00 48.02 ? 99  ARG A CZ   1 
ATOM   1222 N NH1  . ARG A 1 98  ? 25.448  43.136 13.958 1.00 49.05 ? 99  ARG A NH1  1 
ATOM   1223 N NH2  . ARG A 1 98  ? 26.585  44.584 12.610 1.00 43.20 ? 99  ARG A NH2  1 
ATOM   1224 H H    . ARG A 1 98  ? 21.146  44.556 12.210 1.00 21.37 ? 99  ARG A H    1 
ATOM   1225 H HA   . ARG A 1 98  ? 20.396  45.566 14.492 1.00 22.45 ? 99  ARG A HA   1 
ATOM   1226 H HB2  . ARG A 1 98  ? 22.625  44.889 13.665 1.00 27.43 ? 99  ARG A HB2  1 
ATOM   1227 H HB3  . ARG A 1 98  ? 22.734  46.386 13.177 1.00 27.43 ? 99  ARG A HB3  1 
ATOM   1228 H HG2  . ARG A 1 98  ? 23.161  47.126 15.146 1.00 45.48 ? 99  ARG A HG2  1 
ATOM   1229 H HG3  . ARG A 1 98  ? 22.308  45.983 15.866 1.00 45.48 ? 99  ARG A HG3  1 
ATOM   1230 H HD2  . ARG A 1 98  ? 24.681  45.674 16.158 1.00 47.27 ? 99  ARG A HD2  1 
ATOM   1231 H HD3  . ARG A 1 98  ? 23.985  44.418 15.481 1.00 47.27 ? 99  ARG A HD3  1 
ATOM   1232 H HE   . ARG A 1 98  ? 25.400  46.214 13.967 1.00 52.87 ? 99  ARG A HE   1 
ATOM   1233 H HH11 . ARG A 1 98  ? 24.900  42.983 14.603 1.00 58.86 ? 99  ARG A HH11 1 
ATOM   1234 H HH12 . ARG A 1 98  ? 25.813  42.480 13.539 1.00 58.86 ? 99  ARG A HH12 1 
ATOM   1235 H HH21 . ARG A 1 98  ? 26.781  45.385 12.367 1.00 51.85 ? 99  ARG A HH21 1 
ATOM   1236 H HH22 . ARG A 1 98  ? 26.936  43.913 12.204 1.00 51.85 ? 99  ARG A HH22 1 
ATOM   1237 N N    . THR A 1 99  ? 20.545  47.674 12.088 1.00 20.85 ? 100 THR A N    1 
ATOM   1238 C CA   . THR A 1 99  ? 20.203  49.015 11.640 1.00 18.94 ? 100 THR A CA   1 
ATOM   1239 C C    . THR A 1 99  ? 18.694  49.251 11.661 1.00 20.55 ? 100 THR A C    1 
ATOM   1240 O O    . THR A 1 99  ? 18.220  50.299 12.138 1.00 19.56 ? 100 THR A O    1 
ATOM   1241 C CB   . THR A 1 99  ? 20.762  49.271 10.221 1.00 22.39 ? 100 THR A CB   1 
ATOM   1242 O OG1  . THR A 1 99  ? 22.190  49.122 10.254 1.00 24.19 ? 100 THR A OG1  1 
ATOM   1243 C CG2  . THR A 1 99  ? 20.427  50.668 9.723  1.00 25.84 ? 100 THR A CG2  1 
ATOM   1244 H H    . THR A 1 99  ? 20.878  47.175 11.472 1.00 25.02 ? 100 THR A H    1 
ATOM   1245 H HA   . THR A 1 99  ? 20.611  49.658 12.240 1.00 22.72 ? 100 THR A HA   1 
ATOM   1246 H HB   . THR A 1 99  ? 20.384  48.626 9.603  1.00 26.87 ? 100 THR A HB   1 
ATOM   1247 H HG1  . THR A 1 99  ? 22.393  48.345 10.501 1.00 29.02 ? 100 THR A HG1  1 
ATOM   1248 H HG21 . THR A 1 99  ? 20.790  50.798 8.833  1.00 31.01 ? 100 THR A HG21 1 
ATOM   1249 H HG22 . THR A 1 99  ? 19.465  50.787 9.692  1.00 31.01 ? 100 THR A HG22 1 
ATOM   1250 H HG23 . THR A 1 99  ? 20.808  51.331 10.319 1.00 31.01 ? 100 THR A HG23 1 
ATOM   1251 N N    . VAL A 1 100 ? 17.931  48.278 11.169 1.00 19.83 ? 101 VAL A N    1 
ATOM   1252 C CA   . VAL A 1 100 ? 16.468  48.392 11.178 1.00 17.32 ? 101 VAL A CA   1 
ATOM   1253 C C    . VAL A 1 100 ? 15.945  48.435 12.618 1.00 17.15 ? 101 VAL A C    1 
ATOM   1254 O O    . VAL A 1 100 ? 15.093  49.259 12.937 1.00 19.49 ? 101 VAL A O    1 
ATOM   1255 C CB   . VAL A 1 100 ? 15.813  47.267 10.381 1.00 16.75 ? 101 VAL A CB   1 
ATOM   1256 C CG1  . VAL A 1 100 ? 14.307  47.309 10.536 1.00 19.62 ? 101 VAL A CG1  1 
ATOM   1257 C CG2  . VAL A 1 100 ? 16.187  47.390 8.917  1.00 19.36 ? 101 VAL A CG2  1 
ATOM   1258 H H    . VAL A 1 100 ? 18.229  47.548 10.825 1.00 23.80 ? 101 VAL A H    1 
ATOM   1259 H HA   . VAL A 1 100 ? 16.223  49.229 10.754 1.00 20.78 ? 101 VAL A HA   1 
ATOM   1260 H HB   . VAL A 1 100 ? 16.132  46.411 10.707 1.00 20.10 ? 101 VAL A HB   1 
ATOM   1261 H HG11 . VAL A 1 100 ? 13.917  46.586 10.021 1.00 23.54 ? 101 VAL A HG11 1 
ATOM   1262 H HG12 . VAL A 1 100 ? 14.084  47.205 11.475 1.00 23.54 ? 101 VAL A HG12 1 
ATOM   1263 H HG13 . VAL A 1 100 ? 13.980  48.162 10.210 1.00 23.54 ? 101 VAL A HG13 1 
ATOM   1264 H HG21 . VAL A 1 100 ? 15.765  46.671 8.422  1.00 23.23 ? 101 VAL A HG21 1 
ATOM   1265 H HG22 . VAL A 1 100 ? 15.877  48.247 8.584  1.00 23.23 ? 101 VAL A HG22 1 
ATOM   1266 H HG23 . VAL A 1 100 ? 17.151  47.330 8.832  1.00 23.23 ? 101 VAL A HG23 1 
ATOM   1267 N N    . LYS A 1 101 ? 16.480  47.593 13.502 1.00 17.65 ? 102 LYS A N    1 
ATOM   1268 C CA   . LYS A 1 101 ? 16.075  47.607 14.907 1.00 17.29 ? 102 LYS A CA   1 
ATOM   1269 C C    . LYS A 1 101 ? 16.350  48.958 15.552 1.00 19.11 ? 102 LYS A C    1 
ATOM   1270 O O    . LYS A 1 101 ? 15.512  49.500 16.270 1.00 19.80 ? 102 LYS A O    1 
ATOM   1271 C CB   . LYS A 1 101 ? 16.783  46.491 15.682 1.00 19.19 ? 102 LYS A CB   1 
ATOM   1272 C CG   . LYS A 1 101 ? 16.238  45.119 15.327 1.00 18.48 ? 102 LYS A CG   1 
ATOM   1273 C CD   . LYS A 1 101 ? 17.102  43.990 15.802 1.00 22.92 ? 102 LYS A CD   1 
ATOM   1274 C CE   . LYS A 1 101 ? 17.134  43.885 17.277 1.00 26.16 ? 102 LYS A CE   1 
ATOM   1275 N NZ   . LYS A 1 101 ? 18.048  42.770 17.661 1.00 28.11 ? 102 LYS A NZ   1 
ATOM   1276 H H    . LYS A 1 101 ? 17.079  47.004 13.314 1.00 21.18 ? 102 LYS A H    1 
ATOM   1277 H HA   . LYS A 1 101 ? 15.120  47.444 14.958 1.00 20.74 ? 102 LYS A HA   1 
ATOM   1278 H HB2  . LYS A 1 101 ? 17.729  46.505 15.467 1.00 23.03 ? 102 LYS A HB2  1 
ATOM   1279 H HB3  . LYS A 1 101 ? 16.653  46.631 16.633 1.00 23.03 ? 102 LYS A HB3  1 
ATOM   1280 H HG2  . LYS A 1 101 ? 15.363  45.014 15.733 1.00 22.17 ? 102 LYS A HG2  1 
ATOM   1281 H HG3  . LYS A 1 101 ? 16.163  45.051 14.362 1.00 22.17 ? 102 LYS A HG3  1 
ATOM   1282 H HD2  . LYS A 1 101 ? 16.756  43.156 15.448 1.00 27.50 ? 102 LYS A HD2  1 
ATOM   1283 H HD3  . LYS A 1 101 ? 18.009  44.133 15.490 1.00 27.50 ? 102 LYS A HD3  1 
ATOM   1284 H HE2  . LYS A 1 101 ? 17.472  44.710 17.658 1.00 31.40 ? 102 LYS A HE2  1 
ATOM   1285 H HE3  . LYS A 1 101 ? 16.245  43.689 17.612 1.00 31.40 ? 102 LYS A HE3  1 
ATOM   1286 H HZ1  . LYS A 1 101 ? 18.078  42.693 18.547 1.00 33.73 ? 102 LYS A HZ1  1 
ATOM   1287 H HZ2  . LYS A 1 101 ? 17.755  42.004 17.314 1.00 33.73 ? 102 LYS A HZ2  1 
ATOM   1288 H HZ3  . LYS A 1 101 ? 18.868  42.930 17.356 1.00 33.73 ? 102 LYS A HZ3  1 
ATOM   1289 N N    . SER A 1 102 ? 17.522  49.513 15.282 1.00 19.91 ? 103 SER A N    1 
ATOM   1290 C CA   . SER A 1 102 ? 17.886  50.815 15.818 1.00 20.98 ? 103 SER A CA   1 
ATOM   1291 C C    . SER A 1 102 ? 16.924  51.902 15.325 1.00 20.40 ? 103 SER A C    1 
ATOM   1292 O O    . SER A 1 102 ? 16.461  52.743 16.098 1.00 22.32 ? 103 SER A O    1 
ATOM   1293 C CB   . SER A 1 102 ? 19.322  51.149 15.414 1.00 24.18 ? 103 SER A CB   1 
ATOM   1294 O OG   . SER A 1 102 ? 19.649  52.471 15.813 1.00 30.59 ? 103 SER A OG   1 
ATOM   1295 H H    . SER A 1 102 ? 18.127  49.154 14.788 1.00 23.89 ? 103 SER A H    1 
ATOM   1296 H HA   . SER A 1 102 ? 17.842  50.786 16.787 1.00 25.17 ? 103 SER A HA   1 
ATOM   1297 H HB2  . SER A 1 102 ? 19.927  50.527 15.848 1.00 29.02 ? 103 SER A HB2  1 
ATOM   1298 H HB3  . SER A 1 102 ? 19.405  51.078 14.450 1.00 29.02 ? 103 SER A HB3  1 
ATOM   1299 H HG   . SER A 1 102 ? 20.439  52.651 15.590 1.00 36.71 ? 103 SER A HG   1 
ATOM   1300 N N    . ALA A 1 103 ? 16.622  51.883 14.034 1.00 20.66 ? 104 ALA A N    1 
ATOM   1301 C CA   . ALA A 1 103 ? 15.681  52.814 13.444 1.00 20.76 ? 104 ALA A CA   1 
ATOM   1302 C C    . ALA A 1 103 ? 14.294  52.707 14.066 1.00 19.02 ? 104 ALA A C    1 
ATOM   1303 O O    . ALA A 1 103 ? 13.656  53.722 14.330 1.00 20.16 ? 104 ALA A O    1 
ATOM   1304 C CB   . ALA A 1 103 ? 15.584  52.572 11.948 1.00 20.73 ? 104 ALA A CB   1 
ATOM   1305 H H    . ALA A 1 103 ? 16.958  51.327 13.470 1.00 24.79 ? 104 ALA A H    1 
ATOM   1306 H HA   . ALA A 1 103 ? 16.002  53.719 13.582 1.00 24.91 ? 104 ALA A HA   1 
ATOM   1307 H HB1  . ALA A 1 103 ? 14.952  53.201 11.567 1.00 24.88 ? 104 ALA A HB1  1 
ATOM   1308 H HB2  . ALA A 1 103 ? 16.460  52.701 11.551 1.00 24.88 ? 104 ALA A HB2  1 
ATOM   1309 H HB3  . ALA A 1 103 ? 15.281  51.663 11.795 1.00 24.88 ? 104 ALA A HB3  1 
ATOM   1310 N N    . LEU A 1 104 ? 13.823  51.478 14.297 1.00 20.04 ? 105 LEU A N    1 
ATOM   1311 C CA   . LEU A 1 104 ? 12.473  51.280 14.835 1.00 20.11 ? 105 LEU A CA   1 
ATOM   1312 C C    . LEU A 1 104 ? 12.288  51.999 16.143 1.00 20.05 ? 105 LEU A C    1 
ATOM   1313 O O    . LEU A 1 104 ? 11.243  52.596 16.380 1.00 20.87 ? 105 LEU A O    1 
ATOM   1314 C CB   . LEU A 1 104 ? 12.177  49.794 15.044 1.00 22.69 ? 105 LEU A CB   1 
ATOM   1315 C CG   . LEU A 1 104 ? 11.715  49.019 13.822 1.00 26.89 ? 105 LEU A CG   1 
ATOM   1316 C CD1  . LEU A 1 104 ? 11.444  47.577 14.248 1.00 26.36 ? 105 LEU A CD1  1 
ATOM   1317 C CD2  . LEU A 1 104 ? 10.471  49.648 13.204 1.00 24.41 ? 105 LEU A CD2  1 
ATOM   1318 H H    . LEU A 1 104 ? 14.258  50.751 14.152 1.00 24.05 ? 105 LEU A H    1 
ATOM   1319 H HA   . LEU A 1 104 ? 11.825  51.631 14.204 1.00 24.13 ? 105 LEU A HA   1 
ATOM   1320 H HB2  . LEU A 1 104 ? 12.985  49.366 15.368 1.00 27.23 ? 105 LEU A HB2  1 
ATOM   1321 H HB3  . LEU A 1 104 ? 11.481  49.715 15.715 1.00 27.23 ? 105 LEU A HB3  1 
ATOM   1322 H HG   . LEU A 1 104 ? 12.420  49.015 13.156 1.00 32.27 ? 105 LEU A HG   1 
ATOM   1323 H HD11 . LEU A 1 104 ? 11.148  47.071 13.476 1.00 31.63 ? 105 LEU A HD11 1 
ATOM   1324 H HD12 . LEU A 1 104 ? 12.261  47.194 14.602 1.00 31.63 ? 105 LEU A HD12 1 
ATOM   1325 H HD13 . LEU A 1 104 ? 10.754  47.575 14.930 1.00 31.63 ? 105 LEU A HD13 1 
ATOM   1326 H HD21 . LEU A 1 104 ? 10.206  49.128 12.429 1.00 29.29 ? 105 LEU A HD21 1 
ATOM   1327 H HD22 . LEU A 1 104 ? 9.758   49.648 13.862 1.00 29.29 ? 105 LEU A HD22 1 
ATOM   1328 H HD23 . LEU A 1 104 ? 10.676  50.558 12.938 1.00 29.29 ? 105 LEU A HD23 1 
ATOM   1329 N N    . ASN A 1 105 ? 13.297  51.951 17.001 1.00 22.44 ? 106 ASN A N    1 
ATOM   1330 C CA   . ASN A 1 105 ? 13.188  52.591 18.307 1.00 24.88 ? 106 ASN A CA   1 
ATOM   1331 C C    . ASN A 1 105 ? 13.117  54.109 18.238 1.00 22.77 ? 106 ASN A C    1 
ATOM   1332 O O    . ASN A 1 105 ? 12.778  54.748 19.227 1.00 26.33 ? 106 ASN A O    1 
ATOM   1333 C CB   . ASN A 1 105 ? 14.334  52.142 19.211 1.00 27.12 ? 106 ASN A CB   1 
ATOM   1334 C CG   . ASN A 1 105 ? 14.032  50.831 19.910 1.00 34.98 ? 106 ASN A CG   1 
ATOM   1335 O OD1  . ASN A 1 105 ? 12.909  50.594 20.344 1.00 42.49 ? 106 ASN A OD1  1 
ATOM   1336 N ND2  . ASN A 1 105 ? 15.033  49.972 20.014 1.00 35.82 ? 106 ASN A ND2  1 
ATOM   1337 H H    . ASN A 1 105 ? 14.048  51.559 16.856 1.00 26.92 ? 106 ASN A H    1 
ATOM   1338 H HA   . ASN A 1 105 ? 12.365  52.288 18.721 1.00 29.86 ? 106 ASN A HA   1 
ATOM   1339 H HB2  . ASN A 1 105 ? 15.133  52.021 18.675 1.00 32.55 ? 106 ASN A HB2  1 
ATOM   1340 H HB3  . ASN A 1 105 ? 14.486  52.818 19.890 1.00 32.55 ? 106 ASN A HB3  1 
ATOM   1341 H HD21 . ASN A 1 105 ? 14.910  49.214 20.402 1.00 42.98 ? 106 ASN A HD21 1 
ATOM   1342 H HD22 . ASN A 1 105 ? 15.805  50.171 19.693 1.00 42.98 ? 106 ASN A HD22 1 
ATOM   1343 N N    . LYS A 1 106 ? 13.410  54.686 17.075 1.00 20.94 ? 107 LYS A N    1 
ATOM   1344 C CA   . LYS A 1 106 ? 13.336  56.136 16.883 1.00 20.31 ? 107 LYS A CA   1 
ATOM   1345 C C    . LYS A 1 106 ? 12.064  56.583 16.161 1.00 21.44 ? 107 LYS A C    1 
ATOM   1346 O O    . LYS A 1 106 ? 11.873  57.784 15.933 1.00 23.51 ? 107 LYS A O    1 
ATOM   1347 C CB   . LYS A 1 106 ? 14.551  56.624 16.106 1.00 21.53 ? 107 LYS A CB   1 
ATOM   1348 C CG   . LYS A 1 106 ? 15.863  56.346 16.803 1.00 24.06 ? 107 LYS A CG   1 
ATOM   1349 C CD   . LYS A 1 106 ? 17.041  56.588 15.892 1.00 26.13 ? 107 LYS A CD   1 
ATOM   1350 C CE   . LYS A 1 106 ? 18.316  56.196 16.581 1.00 27.39 ? 107 LYS A CE   1 
ATOM   1351 N NZ   . LYS A 1 106 ? 19.467  56.439 15.675 1.00 31.41 ? 107 LYS A NZ   1 
ATOM   1352 H H    . LYS A 1 106 ? 13.658  54.256 16.372 1.00 25.12 ? 107 LYS A H    1 
ATOM   1353 H HA   . LYS A 1 106 ? 13.348  56.566 17.753 1.00 24.37 ? 107 LYS A HA   1 
ATOM   1354 H HB2  . LYS A 1 106 ? 14.572  56.178 15.245 1.00 25.84 ? 107 LYS A HB2  1 
ATOM   1355 H HB3  . LYS A 1 106 ? 14.478  57.583 15.980 1.00 25.84 ? 107 LYS A HB3  1 
ATOM   1356 H HG2  . LYS A 1 106 ? 15.948  56.934 17.570 1.00 28.87 ? 107 LYS A HG2  1 
ATOM   1357 H HG3  . LYS A 1 106 ? 15.885  55.419 17.086 1.00 28.87 ? 107 LYS A HG3  1 
ATOM   1358 H HD2  . LYS A 1 106 ? 16.946  56.051 15.090 1.00 31.35 ? 107 LYS A HD2  1 
ATOM   1359 H HD3  . LYS A 1 106 ? 17.089  57.530 15.667 1.00 31.35 ? 107 LYS A HD3  1 
ATOM   1360 H HE2  . LYS A 1 106 ? 18.432  56.732 17.381 1.00 32.86 ? 107 LYS A HE2  1 
ATOM   1361 H HE3  . LYS A 1 106 ? 18.289  55.252 16.803 1.00 32.86 ? 107 LYS A HE3  1 
ATOM   1362 H HZ1  . LYS A 1 106 ? 20.225  56.208 16.080 1.00 37.69 ? 107 LYS A HZ1  1 
ATOM   1363 H HZ2  . LYS A 1 106 ? 19.376  55.957 14.933 1.00 37.69 ? 107 LYS A HZ2  1 
ATOM   1364 H HZ3  . LYS A 1 106 ? 19.506  57.301 15.458 1.00 37.69 ? 107 LYS A HZ3  1 
ATOM   1365 N N    . LEU A 1 107 ? 11.216  55.625 15.773 1.00 19.09 ? 108 LEU A N    1 
ATOM   1366 C CA   . LEU A 1 107 ? 10.002  55.912 15.003 1.00 17.57 ? 108 LEU A CA   1 
ATOM   1367 C C    . LEU A 1 107 ? 8.789   55.879 15.919 1.00 18.91 ? 108 LEU A C    1 
ATOM   1368 O O    . LEU A 1 107 ? 8.837   55.262 16.993 1.00 17.61 ? 108 LEU A O    1 
ATOM   1369 C CB   . LEU A 1 107 ? 9.827   54.891 13.878 1.00 17.64 ? 108 LEU A CB   1 
ATOM   1370 C CG   . LEU A 1 107 ? 10.844  55.012 12.738 1.00 20.32 ? 108 LEU A CG   1 
ATOM   1371 C CD1  . LEU A 1 107 ? 10.771  53.801 11.834 1.00 22.06 ? 108 LEU A CD1  1 
ATOM   1372 C CD2  . LEU A 1 107 ? 10.620  56.276 11.934 1.00 24.96 ? 108 LEU A CD2  1 
ATOM   1373 H H    . LEU A 1 107 ? 11.323  54.790 15.947 1.00 22.91 ? 108 LEU A H    1 
ATOM   1374 H HA   . LEU A 1 107 ? 10.069  56.796 14.610 1.00 21.09 ? 108 LEU A HA   1 
ATOM   1375 H HB2  . LEU A 1 107 ? 9.910   54.001 14.252 1.00 21.17 ? 108 LEU A HB2  1 
ATOM   1376 H HB3  . LEU A 1 107 ? 8.943   55.003 13.494 1.00 21.17 ? 108 LEU A HB3  1 
ATOM   1377 H HG   . LEU A 1 107 ? 11.737  55.051 13.115 1.00 24.38 ? 108 LEU A HG   1 
ATOM   1378 H HD11 . LEU A 1 107 ? 11.422  53.900 11.122 1.00 26.47 ? 108 LEU A HD11 1 
ATOM   1379 H HD12 . LEU A 1 107 ? 10.967  53.007 12.355 1.00 26.47 ? 108 LEU A HD12 1 
ATOM   1380 H HD13 . LEU A 1 107 ? 9.878   53.741 11.460 1.00 26.47 ? 108 LEU A HD13 1 
ATOM   1381 H HD21 . LEU A 1 107 ? 11.279  56.320 11.223 1.00 29.95 ? 108 LEU A HD21 1 
ATOM   1382 H HD22 . LEU A 1 107 ? 9.727   56.255 11.556 1.00 29.95 ? 108 LEU A HD22 1 
ATOM   1383 H HD23 . LEU A 1 107 ? 10.713  57.043 12.520 1.00 29.95 ? 108 LEU A HD23 1 
ATOM   1384 N N    . PRO A 1 108 ? 7.687   56.523 15.504 1.00 17.61 ? 109 PRO A N    1 
ATOM   1385 C CA   . PRO A 1 108 ? 6.526   56.588 16.396 1.00 16.90 ? 109 PRO A CA   1 
ATOM   1386 C C    . PRO A 1 108 ? 5.947   55.216 16.712 1.00 14.60 ? 109 PRO A C    1 
ATOM   1387 O O    . PRO A 1 108 ? 5.888   54.345 15.852 1.00 14.13 ? 109 PRO A O    1 
ATOM   1388 C CB   . PRO A 1 108 ? 5.517   57.443 15.604 1.00 19.23 ? 109 PRO A CB   1 
ATOM   1389 C CG   . PRO A 1 108 ? 6.333   58.225 14.653 1.00 19.52 ? 109 PRO A CG   1 
ATOM   1390 C CD   . PRO A 1 108 ? 7.469   57.319 14.282 1.00 20.07 ? 109 PRO A CD   1 
ATOM   1391 H HA   . PRO A 1 108 ? 6.757   57.041 17.222 1.00 20.28 ? 109 PRO A HA   1 
ATOM   1392 H HB2  . PRO A 1 108 ? 4.899   56.865 15.130 1.00 23.08 ? 109 PRO A HB2  1 
ATOM   1393 H HB3  . PRO A 1 108 ? 5.040   58.031 16.210 1.00 23.08 ? 109 PRO A HB3  1 
ATOM   1394 H HG2  . PRO A 1 108 ? 5.802   58.449 13.873 1.00 23.43 ? 109 PRO A HG2  1 
ATOM   1395 H HG3  . PRO A 1 108 ? 6.662   59.028 15.088 1.00 23.43 ? 109 PRO A HG3  1 
ATOM   1396 H HD2  . PRO A 1 108 ? 7.214   56.743 13.544 1.00 24.08 ? 109 PRO A HD2  1 
ATOM   1397 H HD3  . PRO A 1 108 ? 8.260   57.838 14.071 1.00 24.08 ? 109 PRO A HD3  1 
ATOM   1398 N N    . LYS A 1 109 ? 5.509   55.013 17.946 1.00 17.42 ? 110 LYS A N    1 
ATOM   1399 C CA   . LYS A 1 109 ? 4.752   53.829 18.292 1.00 15.35 ? 110 LYS A CA   1 
ATOM   1400 C C    . LYS A 1 109 ? 3.354   53.896 17.708 1.00 13.04 ? 110 LYS A C    1 
ATOM   1401 O O    . LYS A 1 109 ? 2.789   54.983 17.523 1.00 16.08 ? 110 LYS A O    1 
ATOM   1402 C CB   . LYS A 1 109 ? 4.646   53.661 19.818 1.00 17.87 ? 110 LYS A CB   1 
ATOM   1403 C CG   . LYS A 1 109 ? 5.990   53.611 20.512 1.00 21.71 ? 110 LYS A CG   1 
ATOM   1404 C CD   . LYS A 1 109 ? 5.821   53.828 22.002 1.00 28.03 ? 110 LYS A CD   1 
ATOM   1405 C CE   . LYS A 1 109 ? 7.164   53.673 22.677 1.00 32.13 ? 110 LYS A CE   1 
ATOM   1406 N NZ   . LYS A 1 109 ? 7.291   54.493 23.876 1.00 36.04 ? 110 LYS A NZ   1 
ATOM   1407 H H    . LYS A 1 109 ? 5.639   55.552 18.603 1.00 20.91 ? 110 LYS A H    1 
ATOM   1408 H HA   . LYS A 1 109 ? 5.197   53.046 17.929 1.00 18.42 ? 110 LYS A HA   1 
ATOM   1409 H HB2  . LYS A 1 109 ? 4.151   54.412 20.182 1.00 21.45 ? 110 LYS A HB2  1 
ATOM   1410 H HB3  . LYS A 1 109 ? 4.180   52.833 20.011 1.00 21.45 ? 110 LYS A HB3  1 
ATOM   1411 H HG2  . LYS A 1 109 ? 6.395   52.741 20.371 1.00 26.05 ? 110 LYS A HG2  1 
ATOM   1412 H HG3  . LYS A 1 109 ? 6.562   54.312 20.161 1.00 26.05 ? 110 LYS A HG3  1 
ATOM   1413 H HD2  . LYS A 1 109 ? 5.491   54.726 22.167 1.00 33.63 ? 110 LYS A HD2  1 
ATOM   1414 H HD3  . LYS A 1 109 ? 5.212   53.166 22.363 1.00 33.63 ? 110 LYS A HD3  1 
ATOM   1415 H HE2  . LYS A 1 109 ? 7.282   52.745 22.934 1.00 38.56 ? 110 LYS A HE2  1 
ATOM   1416 H HE3  . LYS A 1 109 ? 7.862   53.937 22.057 1.00 38.56 ? 110 LYS A HE3  1 
ATOM   1417 H HZ1  . LYS A 1 109 ? 8.093   54.373 24.243 1.00 43.25 ? 110 LYS A HZ1  1 
ATOM   1418 H HZ2  . LYS A 1 109 ? 7.194   55.353 23.668 1.00 43.25 ? 110 LYS A HZ2  1 
ATOM   1419 H HZ3  . LYS A 1 109 ? 6.666   54.266 24.468 1.00 43.25 ? 110 LYS A HZ3  1 
ATOM   1420 N N    . TYR A 1 110 ? 2.819   52.733 17.389 1.00 13.36 ? 111 TYR A N    1 
ATOM   1421 C CA   . TYR A 1 110 ? 1.414   52.586 17.071 1.00 13.32 ? 111 TYR A CA   1 
ATOM   1422 C C    . TYR A 1 110 ? 0.803   51.653 18.100 1.00 12.33 ? 111 TYR A C    1 
ATOM   1423 O O    . TYR A 1 110 ? 1.367   50.592 18.348 1.00 13.82 ? 111 TYR A O    1 
ATOM   1424 C CB   . TYR A 1 110 ? 1.220   51.963 15.674 1.00 13.67 ? 111 TYR A CB   1 
ATOM   1425 C CG   . TYR A 1 110 ? -0.215  51.607 15.385 1.00 13.38 ? 111 TYR A CG   1 
ATOM   1426 C CD1  . TYR A 1 110 ? -1.114  52.549 14.899 1.00 14.07 ? 111 TYR A CD1  1 
ATOM   1427 C CD2  . TYR A 1 110 ? -0.701  50.335 15.678 1.00 13.30 ? 111 TYR A CD2  1 
ATOM   1428 C CE1  . TYR A 1 110 ? -2.443  52.215 14.678 1.00 14.75 ? 111 TYR A CE1  1 
ATOM   1429 C CE2  . TYR A 1 110 ? -1.986  49.987 15.430 1.00 13.86 ? 111 TYR A CE2  1 
ATOM   1430 C CZ   . TYR A 1 110 ? -2.880  50.924 14.944 1.00 13.37 ? 111 TYR A CZ   1 
ATOM   1431 O OH   . TYR A 1 110 ? -4.216  50.627 14.706 1.00 16.30 ? 111 TYR A OH   1 
ATOM   1432 H H    . TYR A 1 110 ? 3.261   51.996 17.350 1.00 16.04 ? 111 TYR A H    1 
ATOM   1433 H HA   . TYR A 1 110 ? 0.966   53.446 17.108 1.00 15.98 ? 111 TYR A HA   1 
ATOM   1434 H HB2  . TYR A 1 110 ? 1.512   52.598 15.002 1.00 16.41 ? 111 TYR A HB2  1 
ATOM   1435 H HB3  . TYR A 1 110 ? 1.748   51.151 15.614 1.00 16.41 ? 111 TYR A HB3  1 
ATOM   1436 H HD1  . TYR A 1 110 ? -0.821  53.413 14.718 1.00 16.89 ? 111 TYR A HD1  1 
ATOM   1437 H HD2  . TYR A 1 110 ? -0.114  49.691 16.002 1.00 15.96 ? 111 TYR A HD2  1 
ATOM   1438 H HE1  . TYR A 1 110 ? -3.034  52.847 14.337 1.00 17.70 ? 111 TYR A HE1  1 
ATOM   1439 H HE2  . TYR A 1 110 ? -2.280  49.127 15.628 1.00 16.63 ? 111 TYR A HE2  1 
ATOM   1440 H HH   . TYR A 1 110 ? -4.370  49.824 14.899 1.00 19.56 ? 111 TYR A HH   1 
ATOM   1441 N N    . LYS A 1 111 ? -0.328  52.051 18.684 1.00 12.27 ? 112 LYS A N    1 
ATOM   1442 C CA   . LYS A 1 111 ? -1.109  51.156 19.530 1.00 11.73 ? 112 LYS A CA   1 
ATOM   1443 C C    . LYS A 1 111 ? -2.543  51.183 19.053 1.00 13.00 ? 112 LYS A C    1 
ATOM   1444 O O    . LYS A 1 111 ? -3.078  52.223 18.647 1.00 15.44 ? 112 LYS A O    1 
ATOM   1445 C CB   . LYS A 1 111 ? -0.964  51.514 21.019 1.00 13.80 ? 112 LYS A CB   1 
ATOM   1446 C CG   . LYS A 1 111 ? 0.467   51.401 21.473 1.00 14.26 ? 112 LYS A CG   1 
ATOM   1447 C CD   . LYS A 1 111 ? 0.693   51.639 22.946 1.00 15.90 ? 112 LYS A CD   1 
ATOM   1448 C CE   . LYS A 1 111 ? 2.172   51.546 23.311 1.00 15.16 ? 112 LYS A CE   1 
ATOM   1449 N NZ   . LYS A 1 111 ? 2.350   51.453 24.784 1.00 15.79 ? 112 LYS A NZ   1 
ATOM   1450 H H    . LYS A 1 111 ? -0.664  52.839 18.604 1.00 14.72 ? 112 LYS A H    1 
ATOM   1451 H HA   . LYS A 1 111 ? -0.778  50.252 19.413 1.00 14.07 ? 112 LYS A HA   1 
ATOM   1452 H HB2  . LYS A 1 111 ? -1.257  52.428 21.159 1.00 16.56 ? 112 LYS A HB2  1 
ATOM   1453 H HB3  . LYS A 1 111 ? -1.501  50.904 21.549 1.00 16.56 ? 112 LYS A HB3  1 
ATOM   1454 H HG2  . LYS A 1 111 ? 0.784   50.507 21.270 1.00 17.11 ? 112 LYS A HG2  1 
ATOM   1455 H HG3  . LYS A 1 111 ? 0.996   52.052 20.987 1.00 17.11 ? 112 LYS A HG3  1 
ATOM   1456 H HD2  . LYS A 1 111 ? 0.379   52.527 23.178 1.00 19.08 ? 112 LYS A HD2  1 
ATOM   1457 H HD3  . LYS A 1 111 ? 0.212   50.969 23.456 1.00 19.08 ? 112 LYS A HD3  1 
ATOM   1458 H HE2  . LYS A 1 111 ? 2.553   50.752 22.905 1.00 18.20 ? 112 LYS A HE2  1 
ATOM   1459 H HE3  . LYS A 1 111 ? 2.631   52.340 22.996 1.00 18.20 ? 112 LYS A HE3  1 
ATOM   1460 H HZ1  . LYS A 1 111 ? 3.216   51.399 24.982 1.00 18.95 ? 112 LYS A HZ1  1 
ATOM   1461 H HZ2  . LYS A 1 111 ? 2.008   52.174 25.178 1.00 18.95 ? 112 LYS A HZ2  1 
ATOM   1462 H HZ3  . LYS A 1 111 ? 1.937   50.729 25.095 1.00 18.95 ? 112 LYS A HZ3  1 
ATOM   1463 N N    . GLY A 1 112 ? -3.162  50.018 19.069 1.00 13.24 ? 113 GLY A N    1 
ATOM   1464 C CA   . GLY A 1 112 ? -4.464  49.811 18.481 1.00 12.98 ? 113 GLY A CA   1 
ATOM   1465 C C    . GLY A 1 112 ? -4.451  48.452 17.836 1.00 14.53 ? 113 GLY A C    1 
ATOM   1466 O O    . GLY A 1 112 ? -3.660  47.579 18.201 1.00 17.21 ? 113 GLY A O    1 
ATOM   1467 H H    . GLY A 1 112 ? -2.833  49.309 19.427 1.00 15.89 ? 113 GLY A H    1 
ATOM   1468 H HA2  . GLY A 1 112 ? -5.153  49.839 19.164 1.00 15.58 ? 113 GLY A HA2  1 
ATOM   1469 H HA3  . GLY A 1 112 ? -4.646  50.486 17.810 1.00 15.58 ? 113 GLY A HA3  1 
ATOM   1470 N N    . THR A 1 113 ? -5.320  48.268 16.863 1.00 13.78 ? 114 THR A N    1 
ATOM   1471 C CA   . THR A 1 113 ? -5.463  46.978 16.204 1.00 14.40 ? 114 THR A CA   1 
ATOM   1472 C C    . THR A 1 113 ? -4.769  46.952 14.853 1.00 13.28 ? 114 THR A C    1 
ATOM   1473 O O    . THR A 1 113 ? -4.803  47.948 14.106 1.00 14.24 ? 114 THR A O    1 
ATOM   1474 C CB   . THR A 1 113 ? -6.936  46.629 16.051 1.00 16.90 ? 114 THR A CB   1 
ATOM   1475 O OG1  . THR A 1 113 ? -7.526  46.581 17.353 1.00 20.99 ? 114 THR A OG1  1 
ATOM   1476 C CG2  . THR A 1 113 ? -7.150  45.286 15.383 1.00 18.46 ? 114 THR A CG2  1 
ATOM   1477 H H    . THR A 1 113 ? -5.846  48.877 16.560 1.00 16.54 ? 114 THR A H    1 
ATOM   1478 H HA   . THR A 1 113 ? -5.054  46.297 16.760 1.00 17.28 ? 114 THR A HA   1 
ATOM   1479 H HB   . THR A 1 113 ? -7.377  47.311 15.521 1.00 20.28 ? 114 THR A HB   1 
ATOM   1480 H HG1  . THR A 1 113 ? -7.143  45.998 17.821 1.00 25.19 ? 114 THR A HG1  1 
ATOM   1481 H HG21 . THR A 1 113 ? -8.100  45.102 15.306 1.00 22.15 ? 114 THR A HG21 1 
ATOM   1482 H HG22 . THR A 1 113 ? -6.756  45.290 14.497 1.00 22.15 ? 114 THR A HG22 1 
ATOM   1483 H HG23 . THR A 1 113 ? -6.735  44.584 15.909 1.00 22.15 ? 114 THR A HG23 1 
ATOM   1484 N N    . ALA A 1 114 ? -4.122  45.842 14.553 1.00 13.31 ? 115 ALA A N    1 
ATOM   1485 C CA   . ALA A 1 114 ? -3.528  45.627 13.228 1.00 12.95 ? 115 ALA A CA   1 
ATOM   1486 C C    . ALA A 1 114 ? -3.706  44.176 12.834 1.00 11.82 ? 115 ALA A C    1 
ATOM   1487 O O    . ALA A 1 114 ? -4.271  43.378 13.604 1.00 14.71 ? 115 ALA A O    1 
ATOM   1488 C CB   . ALA A 1 114 ? -2.087  46.028 13.210 1.00 13.72 ? 115 ALA A CB   1 
ATOM   1489 H H    . ALA A 1 114 ? -4.006  45.187 15.098 1.00 15.97 ? 115 ALA A H    1 
ATOM   1490 H HA   . ALA A 1 114 ? -3.999  46.173 12.580 1.00 15.54 ? 115 ALA A HA   1 
ATOM   1491 H HB1  . ALA A 1 114 ? -1.727  45.873 12.323 1.00 16.47 ? 115 ALA A HB1  1 
ATOM   1492 H HB2  . ALA A 1 114 ? -2.019  46.969 13.436 1.00 16.47 ? 115 ALA A HB2  1 
ATOM   1493 H HB3  . ALA A 1 114 ? -1.603  45.496 13.861 1.00 16.47 ? 115 ALA A HB3  1 
ATOM   1494 N N    . TYR A 1 115 ? -3.300  43.847 11.614 1.00 11.63 ? 116 TYR A N    1 
ATOM   1495 C CA   . TYR A 1 115 ? -3.626  42.568 10.993 1.00 11.68 ? 116 TYR A CA   1 
ATOM   1496 C C    . TYR A 1 115 ? -2.431  41.984 10.291 1.00 10.69 ? 116 TYR A C    1 
ATOM   1497 O O    . TYR A 1 115 ? -1.606  42.696 9.727  1.00 12.38 ? 116 TYR A O    1 
ATOM   1498 C CB   . TYR A 1 115 ? -4.789  42.733 10.005 1.00 13.32 ? 116 TYR A CB   1 
ATOM   1499 C CG   . TYR A 1 115 ? -6.006  43.260 10.685 1.00 13.72 ? 116 TYR A CG   1 
ATOM   1500 C CD1  . TYR A 1 115 ? -6.904  42.398 11.270 1.00 14.91 ? 116 TYR A CD1  1 
ATOM   1501 C CD2  . TYR A 1 115 ? -6.250  44.606 10.766 1.00 15.78 ? 116 TYR A CD2  1 
ATOM   1502 C CE1  . TYR A 1 115 ? -7.983  42.850 11.935 1.00 17.77 ? 116 TYR A CE1  1 
ATOM   1503 C CE2  . TYR A 1 115 ? -7.341  45.085 11.459 1.00 18.10 ? 116 TYR A CE2  1 
ATOM   1504 C CZ   . TYR A 1 115 ? -8.202  44.191 12.026 1.00 17.70 ? 116 TYR A CZ   1 
ATOM   1505 O OH   . TYR A 1 115 ? -9.300  44.634 12.725 1.00 23.28 ? 116 TYR A OH   1 
ATOM   1506 H H    . TYR A 1 115 ? -2.824  44.360 11.114 1.00 13.95 ? 116 TYR A H    1 
ATOM   1507 H HA   . TYR A 1 115 ? -3.904  41.944 11.682 1.00 14.02 ? 116 TYR A HA   1 
ATOM   1508 H HB2  . TYR A 1 115 ? -4.533  43.360 9.310  1.00 15.98 ? 116 TYR A HB2  1 
ATOM   1509 H HB3  . TYR A 1 115 ? -5.005  41.871 9.617  1.00 15.98 ? 116 TYR A HB3  1 
ATOM   1510 H HD1  . TYR A 1 115 ? -6.747  41.482 11.228 1.00 17.89 ? 116 TYR A HD1  1 
ATOM   1511 H HD2  . TYR A 1 115 ? -5.644  45.205 10.393 1.00 18.93 ? 116 TYR A HD2  1 
ATOM   1512 H HE1  . TYR A 1 115 ? -8.572  42.251 12.334 1.00 21.33 ? 116 TYR A HE1  1 
ATOM   1513 H HE2  . TYR A 1 115 ? -7.501  45.999 11.519 1.00 21.73 ? 116 TYR A HE2  1 
ATOM   1514 H HH   . TYR A 1 115 ? -9.729  43.979 13.030 1.00 27.93 ? 116 TYR A HH   1 
ATOM   1515 N N    . ARG A 1 116 ? -2.367  40.664 10.263 1.00 13.09 ? 117 ARG A N    1 
ATOM   1516 C CA   . ARG A 1 116 ? -1.316  39.946 9.562  1.00 14.19 ? 117 ARG A CA   1 
ATOM   1517 C C    . ARG A 1 116 ? -1.856  38.612 9.099  1.00 14.15 ? 117 ARG A C    1 
ATOM   1518 O O    . ARG A 1 116 ? -2.610  37.984 9.808  1.00 16.42 ? 117 ARG A O    1 
ATOM   1519 C CB   . ARG A 1 116 ? -0.125  39.740 10.513 1.00 18.91 ? 117 ARG A CB   1 
ATOM   1520 C CG   . ARG A 1 116 ? 0.904   38.812 10.032 1.00 24.21 ? 117 ARG A CG   1 
ATOM   1521 C CD   . ARG A 1 116 ? 2.076   38.752 11.010 1.00 25.91 ? 117 ARG A CD   1 
ATOM   1522 N NE   . ARG A 1 116 ? 3.118   37.936 10.405 1.00 32.57 ? 117 ARG A NE   1 
ATOM   1523 C CZ   . ARG A 1 116 ? 3.829   37.003 11.020 1.00 34.45 ? 117 ARG A CZ   1 
ATOM   1524 N NH1  . ARG A 1 116 ? 3.661   36.739 12.303 1.00 29.51 ? 117 ARG A NH1  1 
ATOM   1525 N NH2  . ARG A 1 116 ? 4.732   36.333 10.330 1.00 45.39 ? 117 ARG A NH2  1 
ATOM   1526 H H    . ARG A 1 116 ? -2.935  40.148 10.652 1.00 15.71 ? 117 ARG A H    1 
ATOM   1527 H HA   . ARG A 1 116 ? -1.022  40.456 8.791  1.00 17.03 ? 117 ARG A HA   1 
ATOM   1528 H HB2  . ARG A 1 116 ? 0.302   40.598 10.662 1.00 22.69 ? 117 ARG A HB2  1 
ATOM   1529 H HB3  . ARG A 1 116 ? -0.460  39.394 11.355 1.00 22.69 ? 117 ARG A HB3  1 
ATOM   1530 H HG2  . ARG A 1 116 ? 0.525   37.922 9.952  1.00 29.05 ? 117 ARG A HG2  1 
ATOM   1531 H HG3  . ARG A 1 116 ? 1.236   39.116 9.173  1.00 29.05 ? 117 ARG A HG3  1 
ATOM   1532 H HD2  . ARG A 1 116 ? 2.425   39.643 11.166 1.00 31.10 ? 117 ARG A HD2  1 
ATOM   1533 H HD3  . ARG A 1 116 ? 1.794   38.338 11.841 1.00 31.10 ? 117 ARG A HD3  1 
ATOM   1534 H HE   . ARG A 1 116 ? 3.287   38.072 9.573  1.00 39.08 ? 117 ARG A HE   1 
ATOM   1535 H HH11 . ARG A 1 116 ? 3.071   37.171 12.756 1.00 35.42 ? 117 ARG A HH11 1 
ATOM   1536 H HH12 . ARG A 1 116 ? 4.136   36.132 12.683 1.00 35.42 ? 117 ARG A HH12 1 
ATOM   1537 H HH21 . ARG A 1 116 ? 4.850   36.504 9.496  1.00 54.47 ? 117 ARG A HH21 1 
ATOM   1538 H HH22 . ARG A 1 116 ? 5.209   35.730 10.717 1.00 54.47 ? 117 ARG A HH22 1 
ATOM   1539 N N    . GLY A 1 117 ? -1.465  38.175 7.916  1.00 14.78 ? 118 GLY A N    1 
ATOM   1540 C CA   . GLY A 1 117 ? -1.818  36.838 7.468  1.00 17.16 ? 118 GLY A CA   1 
ATOM   1541 C C    . GLY A 1 117 ? -0.547  36.036 7.364  1.00 17.68 ? 118 GLY A C    1 
ATOM   1542 O O    . GLY A 1 117 ? 0.494   36.576 6.994  1.00 20.49 ? 118 GLY A O    1 
ATOM   1543 H H    . GLY A 1 117 ? -0.996  38.628 7.354  1.00 17.74 ? 118 GLY A H    1 
ATOM   1544 H HA2  . GLY A 1 117 ? -2.415  36.415 8.105  1.00 20.59 ? 118 GLY A HA2  1 
ATOM   1545 H HA3  . GLY A 1 117 ? -2.247  36.875 6.599  1.00 20.59 ? 118 GLY A HA3  1 
ATOM   1546 N N    . THR A 1 118 ? -0.591  34.762 7.719  1.00 17.79 ? 119 THR A N    1 
ATOM   1547 C CA   . THR A 1 118 ? 0.570   33.913 7.501  1.00 20.89 ? 119 THR A CA   1 
ATOM   1548 C C    . THR A 1 118 ? 0.158   32.458 7.434  1.00 19.47 ? 119 THR A C    1 
ATOM   1549 O O    . THR A 1 118 ? -0.957  32.120 7.753  1.00 21.61 ? 119 THR A O    1 
ATOM   1550 C CB   . THR A 1 118 ? 1.627   34.090 8.575  1.00 27.86 ? 119 THR A CB   1 
ATOM   1551 O OG1  . THR A 1 118 ? 2.870   33.542 8.116  1.00 36.54 ? 119 THR A OG1  1 
ATOM   1552 C CG2  . THR A 1 118 ? 1.206   33.419 9.841  1.00 27.34 ? 119 THR A CG2  1 
ATOM   1553 H H    . THR A 1 118 ? -1.265  34.370 8.082  1.00 21.34 ? 119 THR A H    1 
ATOM   1554 H HA   . THR A 1 118 ? 0.971   34.147 6.649  1.00 25.07 ? 119 THR A HA   1 
ATOM   1555 H HB   . THR A 1 118 ? 1.743   35.036 8.756  1.00 33.43 ? 119 THR A HB   1 
ATOM   1556 H HG1  . THR A 1 118 ? 3.461   33.636 8.705  1.00 43.85 ? 119 THR A HG1  1 
ATOM   1557 H HG21 . THR A 1 118 ? 1.887   33.538 10.522 1.00 32.81 ? 119 THR A HG21 1 
ATOM   1558 H HG22 . THR A 1 118 ? 0.373   33.804 10.159 1.00 32.81 ? 119 THR A HG22 1 
ATOM   1559 H HG23 . THR A 1 118 ? 1.076   32.471 9.687  1.00 32.81 ? 119 THR A HG23 1 
ATOM   1560 N N    . TRP A 1 119 ? 1.075   31.612 7.005  1.00 18.22 ? 120 TRP A N    1 
ATOM   1561 C CA   . TRP A 1 119 ? 0.811   30.187 6.927  1.00 18.56 ? 120 TRP A CA   1 
ATOM   1562 C C    . TRP A 1 119 ? 1.408   29.526 8.145  1.00 18.85 ? 120 TRP A C    1 
ATOM   1563 O O    . TRP A 1 119 ? 2.542   29.808 8.517  1.00 19.99 ? 120 TRP A O    1 
ATOM   1564 C CB   . TRP A 1 119 ? 1.416   29.637 5.647  1.00 23.97 ? 120 TRP A CB   1 
ATOM   1565 C CG   . TRP A 1 119 ? 0.667   30.123 4.441  1.00 26.62 ? 120 TRP A CG   1 
ATOM   1566 C CD1  . TRP A 1 119 ? 0.899   31.263 3.736  1.00 32.68 ? 120 TRP A CD1  1 
ATOM   1567 C CD2  . TRP A 1 119 ? -0.473  29.512 3.852  1.00 26.75 ? 120 TRP A CD2  1 
ATOM   1568 N NE1  . TRP A 1 119 ? -0.011  31.382 2.716  1.00 35.86 ? 120 TRP A NE1  1 
ATOM   1569 C CE2  . TRP A 1 119 ? -0.868  30.318 2.770  1.00 34.97 ? 120 TRP A CE2  1 
ATOM   1570 C CE3  . TRP A 1 119 ? -1.189  28.351 4.119  1.00 26.72 ? 120 TRP A CE3  1 
ATOM   1571 C CZ2  . TRP A 1 119 ? -1.946  29.998 1.962  1.00 35.29 ? 120 TRP A CZ2  1 
ATOM   1572 C CZ3  . TRP A 1 119 ? -2.252  28.035 3.309  1.00 31.61 ? 120 TRP A CZ3  1 
ATOM   1573 C CH2  . TRP A 1 119 ? -2.623  28.858 2.249  1.00 31.87 ? 120 TRP A CH2  1 
ATOM   1574 H H    . TRP A 1 119 ? 1.865   31.839 6.750  1.00 21.87 ? 120 TRP A H    1 
ATOM   1575 H HA   . TRP A 1 119 ? -0.145  30.027 6.917  1.00 22.27 ? 120 TRP A HA   1 
ATOM   1576 H HB2  . TRP A 1 119 ? 2.337   29.933 5.574  1.00 28.77 ? 120 TRP A HB2  1 
ATOM   1577 H HB3  . TRP A 1 119 ? 1.374   28.668 5.662  1.00 28.77 ? 120 TRP A HB3  1 
ATOM   1578 H HD1  . TRP A 1 119 ? 1.584   31.868 3.912  1.00 39.21 ? 120 TRP A HD1  1 
ATOM   1579 H HE1  . TRP A 1 119 ? -0.043  32.025 2.145  1.00 43.03 ? 120 TRP A HE1  1 
ATOM   1580 H HE3  . TRP A 1 119 ? -0.948  27.796 4.825  1.00 32.06 ? 120 TRP A HE3  1 
ATOM   1581 H HZ2  . TRP A 1 119 ? -2.193  30.541 1.248  1.00 42.34 ? 120 TRP A HZ2  1 
ATOM   1582 H HZ3  . TRP A 1 119 ? -2.741  27.263 3.480  1.00 37.93 ? 120 TRP A HZ3  1 
ATOM   1583 H HH2  . TRP A 1 119 ? -3.350  28.617 1.721  1.00 38.25 ? 120 TRP A HH2  1 
ATOM   1584 N N    . VAL A 1 120 ? 0.623   28.677 8.796  1.00 17.12 ? 121 VAL A N    1 
ATOM   1585 C CA   . VAL A 1 120 ? 1.026   28.058 10.042 1.00 16.31 ? 121 VAL A CA   1 
ATOM   1586 C C    . VAL A 1 120 ? 0.871   26.547 9.924  1.00 16.67 ? 121 VAL A C    1 
ATOM   1587 O O    . VAL A 1 120 ? -0.100  26.074 9.329  1.00 17.91 ? 121 VAL A O    1 
ATOM   1588 C CB   . VAL A 1 120 ? 0.140   28.578 11.177 1.00 16.82 ? 121 VAL A CB   1 
ATOM   1589 C CG1  . VAL A 1 120 ? 0.524   27.939 12.510 1.00 21.41 ? 121 VAL A CG1  1 
ATOM   1590 C CG2  . VAL A 1 120 ? 0.232   30.103 11.262 1.00 18.92 ? 121 VAL A CG2  1 
ATOM   1591 H H    . VAL A 1 120 ? -0.160  28.442 8.528  1.00 20.55 ? 121 VAL A H    1 
ATOM   1592 H HA   . VAL A 1 120 ? 1.952   28.270 10.238 1.00 19.58 ? 121 VAL A HA   1 
ATOM   1593 H HB   . VAL A 1 120 ? -0.783  28.344 10.988 1.00 20.18 ? 121 VAL A HB   1 
ATOM   1594 H HG11 . VAL A 1 120 ? -0.054  28.289 13.206 1.00 25.69 ? 121 VAL A HG11 1 
ATOM   1595 H HG12 . VAL A 1 120 ? 0.417   26.978 12.442 1.00 25.69 ? 121 VAL A HG12 1 
ATOM   1596 H HG13 . VAL A 1 120 ? 1.449   28.156 12.708 1.00 25.69 ? 121 VAL A HG13 1 
ATOM   1597 H HG21 . VAL A 1 120 ? -0.335  30.414 11.986 1.00 22.70 ? 121 VAL A HG21 1 
ATOM   1598 H HG22 . VAL A 1 120 ? 1.154   30.354 11.433 1.00 22.70 ? 121 VAL A HG22 1 
ATOM   1599 H HG23 . VAL A 1 120 ? -0.064  30.485 10.421 1.00 22.70 ? 121 VAL A HG23 1 
ATOM   1600 N N    . LYS A 1 121 ? 1.798   25.778 10.494 1.00 15.91 ? 122 LYS A N    1 
ATOM   1601 C CA   . LYS A 1 121 ? 1.677   24.328 10.487 1.00 16.47 ? 122 LYS A CA   1 
ATOM   1602 C C    . LYS A 1 121 ? 0.416   23.854 11.192 1.00 17.89 ? 122 LYS A C    1 
ATOM   1603 O O    . LYS A 1 121 ? 0.104   24.301 12.291 1.00 16.48 ? 122 LYS A O    1 
ATOM   1604 C CB   . LYS A 1 121 ? 2.888   23.681 11.154 1.00 18.41 ? 122 LYS A CB   1 
ATOM   1605 C CG   . LYS A 1 121 ? 4.195   23.913 10.414 1.00 19.58 ? 122 LYS A CG   1 
ATOM   1606 C CD   . LYS A 1 121 ? 5.362   23.403 11.235 1.00 23.19 ? 122 LYS A CD   1 
ATOM   1607 C CE   . LYS A 1 121 ? 6.663   23.545 10.474 1.00 25.94 ? 122 LYS A CE   1 
ATOM   1608 N NZ   . LYS A 1 121 ? 7.726   22.753 11.147 1.00 30.15 ? 122 LYS A NZ   1 
ATOM   1609 H H    . LYS A 1 121 ? 2.503   26.073 10.889 1.00 19.10 ? 122 LYS A H    1 
ATOM   1610 H HA   . LYS A 1 121 ? 1.641   24.019 9.568  1.00 19.76 ? 122 LYS A HA   1 
ATOM   1611 H HB2  . LYS A 1 121 ? 2.985   24.046 12.047 1.00 22.10 ? 122 LYS A HB2  1 
ATOM   1612 H HB3  . LYS A 1 121 ? 2.743   22.723 11.204 1.00 22.10 ? 122 LYS A HB3  1 
ATOM   1613 H HG2  . LYS A 1 121 ? 4.180   23.434 9.571  1.00 23.49 ? 122 LYS A HG2  1 
ATOM   1614 H HG3  . LYS A 1 121 ? 4.318   24.863 10.262 1.00 23.49 ? 122 LYS A HG3  1 
ATOM   1615 H HD2  . LYS A 1 121 ? 5.429   23.919 12.053 1.00 27.82 ? 122 LYS A HD2  1 
ATOM   1616 H HD3  . LYS A 1 121 ? 5.227   22.464 11.437 1.00 27.82 ? 122 LYS A HD3  1 
ATOM   1617 H HE2  . LYS A 1 121 ? 6.551   23.208 9.571  1.00 31.13 ? 122 LYS A HE2  1 
ATOM   1618 H HE3  . LYS A 1 121 ? 6.933   24.477 10.460 1.00 31.13 ? 122 LYS A HE3  1 
ATOM   1619 H HZ1  . LYS A 1 121 ? 8.493   22.834 10.702 1.00 36.18 ? 122 LYS A HZ1  1 
ATOM   1620 H HZ2  . LYS A 1 121 ? 7.842   23.046 11.979 1.00 36.18 ? 122 LYS A HZ2  1 
ATOM   1621 H HZ3  . LYS A 1 121 ? 7.495   21.894 11.172 1.00 36.18 ? 122 LYS A HZ3  1 
ATOM   1622 N N    . LEU A 1 122 ? -0.314  22.953 10.551 1.00 18.76 ? 123 LEU A N    1 
ATOM   1623 C CA   . LEU A 1 122 ? -1.533  22.415 11.131 1.00 20.39 ? 123 LEU A CA   1 
ATOM   1624 C C    . LEU A 1 122 ? -1.233  21.750 12.471 1.00 23.66 ? 123 LEU A C    1 
ATOM   1625 O O    . LEU A 1 122 ? -2.025  21.827 13.412 1.00 20.48 ? 123 LEU A O    1 
ATOM   1626 C CB   . LEU A 1 122 ? -2.192  21.453 10.126 1.00 22.84 ? 123 LEU A CB   1 
ATOM   1627 C CG   . LEU A 1 122 ? -3.380  20.637 10.628 1.00 25.75 ? 123 LEU A CG   1 
ATOM   1628 C CD1  . LEU A 1 122 ? -4.532  21.538 10.988 1.00 28.52 ? 123 LEU A CD1  1 
ATOM   1629 C CD2  . LEU A 1 122 ? -3.768  19.607 9.569  1.00 28.34 ? 123 LEU A CD2  1 
ATOM   1630 H H    . LEU A 1 122 ? -0.124  22.635 9.775  1.00 22.52 ? 123 LEU A H    1 
ATOM   1631 H HA   . LEU A 1 122 ? -2.152  23.145 11.294 1.00 24.47 ? 123 LEU A HA   1 
ATOM   1632 H HB2  . LEU A 1 122 ? -2.502  21.973 9.368  1.00 27.41 ? 123 LEU A HB2  1 
ATOM   1633 H HB3  . LEU A 1 122 ? -1.519  20.822 9.826  1.00 27.41 ? 123 LEU A HB3  1 
ATOM   1634 H HG   . LEU A 1 122 ? -3.115  20.157 11.428 1.00 30.90 ? 123 LEU A HG   1 
ATOM   1635 H HD11 . LEU A 1 122 ? -5.271  20.994 11.303 1.00 34.22 ? 123 LEU A HD11 1 
ATOM   1636 H HD12 . LEU A 1 122 ? -4.249  22.148 11.687 1.00 34.22 ? 123 LEU A HD12 1 
ATOM   1637 H HD13 . LEU A 1 122 ? -4.801  22.037 10.201 1.00 34.22 ? 123 LEU A HD13 1 
ATOM   1638 H HD21 . LEU A 1 122 ? -4.524  19.092 9.893  1.00 34.01 ? 123 LEU A HD21 1 
ATOM   1639 H HD22 . LEU A 1 122 ? -4.010  20.071 8.752  1.00 34.01 ? 123 LEU A HD22 1 
ATOM   1640 H HD23 . LEU A 1 122 ? -3.013  19.022 9.407  1.00 34.01 ? 123 LEU A HD23 1 
ATOM   1641 N N    . SER A 1 123 ? -0.067  21.126 12.564 1.00 20.90 ? 124 SER A N    1 
ATOM   1642 C CA   . SER A 1 123 ? 0.327   20.434 13.788 1.00 20.21 ? 124 SER A CA   1 
ATOM   1643 C C    . SER A 1 123 ? 0.431   21.429 14.956 1.00 21.04 ? 124 SER A C    1 
ATOM   1644 O O    . SER A 1 123 ? 0.082   21.088 16.095 1.00 23.88 ? 124 SER A O    1 
ATOM   1645 C CB   . SER A 1 123 ? 1.640   19.667 13.582 1.00 22.18 ? 124 SER A CB   1 
ATOM   1646 O OG   . SER A 1 123 ? 2.675   20.511 13.118 1.00 25.27 ? 124 SER A OG   1 
ATOM   1647 H H    . SER A 1 123 ? 0.516   21.087 11.934 1.00 25.08 ? 124 SER A H    1 
ATOM   1648 H HA   . SER A 1 123 ? -0.359  19.787 14.014 1.00 24.25 ? 124 SER A HA   1 
ATOM   1649 H HB2  . SER A 1 123 ? 1.910   19.277 14.428 1.00 26.61 ? 124 SER A HB2  1 
ATOM   1650 H HB3  . SER A 1 123 ? 1.493   18.965 12.929 1.00 26.61 ? 124 SER A HB3  1 
ATOM   1651 H HG   . SER A 1 123 ? 3.382   20.069 13.013 1.00 30.33 ? 124 SER A HG   1 
ATOM   1652 N N    . LEU A 1 124 ? 0.901   22.642 14.678 1.00 18.66 ? 125 LEU A N    1 
ATOM   1653 C CA   . LEU A 1 124 ? 0.959   23.697 15.691 1.00 16.55 ? 125 LEU A CA   1 
ATOM   1654 C C    . LEU A 1 124 ? -0.448  24.188 15.973 1.00 14.96 ? 125 LEU A C    1 
ATOM   1655 O O    . LEU A 1 124 ? -0.866  24.304 17.118 1.00 15.55 ? 125 LEU A O    1 
ATOM   1656 C CB   . LEU A 1 124 ? 1.844   24.861 15.247 1.00 15.49 ? 125 LEU A CB   1 
ATOM   1657 C CG   . LEU A 1 124 ? 1.799   26.074 16.180 1.00 16.08 ? 125 LEU A CG   1 
ATOM   1658 C CD1  . LEU A 1 124 ? 2.237   25.662 17.598 1.00 17.63 ? 125 LEU A CD1  1 
ATOM   1659 C CD2  . LEU A 1 124 ? 2.637   27.234 15.674 1.00 17.81 ? 125 LEU A CD2  1 
ATOM   1660 H H    . LEU A 1 124 ? 1.195   22.882 13.907 1.00 22.39 ? 125 LEU A H    1 
ATOM   1661 H HA   . LEU A 1 124 ? 1.324   23.333 16.513 1.00 19.86 ? 125 LEU A HA   1 
ATOM   1662 H HB2  . LEU A 1 124 ? 2.763   24.554 15.204 1.00 18.59 ? 125 LEU A HB2  1 
ATOM   1663 H HB3  . LEU A 1 124 ? 1.555   25.153 14.368 1.00 18.59 ? 125 LEU A HB3  1 
ATOM   1664 H HG   . LEU A 1 124 ? 0.881   26.382 16.238 1.00 19.29 ? 125 LEU A HG   1 
ATOM   1665 H HD11 . LEU A 1 124 ? 2.203   26.439 18.177 1.00 21.16 ? 125 LEU A HD11 1 
ATOM   1666 H HD12 . LEU A 1 124 ? 1.634   24.977 17.928 1.00 21.16 ? 125 LEU A HD12 1 
ATOM   1667 H HD13 . LEU A 1 124 ? 3.142   25.316 17.560 1.00 21.16 ? 125 LEU A HD13 1 
ATOM   1668 H HD21 . LEU A 1 124 ? 2.570   27.970 16.303 1.00 21.37 ? 125 LEU A HD21 1 
ATOM   1669 H HD22 . LEU A 1 124 ? 3.560   26.947 15.598 1.00 21.37 ? 125 LEU A HD22 1 
ATOM   1670 H HD23 . LEU A 1 124 ? 2.303   27.510 14.806 1.00 21.37 ? 125 LEU A HD23 1 
ATOM   1671 N N    . LEU A 1 125 ? -1.208  24.500 14.934 1.00 16.19 ? 126 LEU A N    1 
ATOM   1672 C CA   . LEU A 1 125 ? -2.543  25.036 15.123 1.00 16.41 ? 126 LEU A CA   1 
ATOM   1673 C C    . LEU A 1 125 ? -3.416  24.146 15.997 1.00 18.16 ? 126 LEU A C    1 
ATOM   1674 O O    . LEU A 1 125 ? -4.172  24.635 16.835 1.00 19.13 ? 126 LEU A O    1 
ATOM   1675 C CB   . LEU A 1 125 ? -3.197  25.246 13.765 1.00 18.63 ? 126 LEU A CB   1 
ATOM   1676 C CG   . LEU A 1 125 ? -4.595  25.812 13.790 1.00 26.70 ? 126 LEU A CG   1 
ATOM   1677 C CD1  . LEU A 1 125 ? -4.552  27.178 14.428 1.00 26.46 ? 126 LEU A CD1  1 
ATOM   1678 C CD2  . LEU A 1 125 ? -5.118  25.856 12.382 1.00 28.92 ? 126 LEU A CD2  1 
ATOM   1679 H H    . LEU A 1 125 ? -0.975  24.409 14.111 1.00 19.42 ? 126 LEU A H    1 
ATOM   1680 H HA   . LEU A 1 125 ? -2.474  25.901 15.556 1.00 19.70 ? 126 LEU A HA   1 
ATOM   1681 H HB2  . LEU A 1 125 ? -2.646  25.858 13.252 1.00 22.36 ? 126 LEU A HB2  1 
ATOM   1682 H HB3  . LEU A 1 125 ? -3.238  24.391 13.310 1.00 22.36 ? 126 LEU A HB3  1 
ATOM   1683 H HG   . LEU A 1 125 ? -5.171  25.238 14.319 1.00 32.04 ? 126 LEU A HG   1 
ATOM   1684 H HD11 . LEU A 1 125 ? -5.450  27.546 14.446 1.00 31.75 ? 126 LEU A HD11 1 
ATOM   1685 H HD12 . LEU A 1 125 ? -4.211  27.093 15.332 1.00 31.75 ? 126 LEU A HD12 1 
ATOM   1686 H HD13 . LEU A 1 125 ? -3.969  27.752 13.907 1.00 31.75 ? 126 LEU A HD13 1 
ATOM   1687 H HD21 . LEU A 1 125 ? -6.018  26.219 12.391 1.00 34.70 ? 126 LEU A HD21 1 
ATOM   1688 H HD22 . LEU A 1 125 ? -4.538  26.421 11.848 1.00 34.70 ? 126 LEU A HD22 1 
ATOM   1689 H HD23 . LEU A 1 125 ? -5.128  24.956 12.021 1.00 34.70 ? 126 LEU A HD23 1 
ATOM   1690 N N    . ASN A 1 126 ? -3.290  22.835 15.830 1.00 19.20 ? 127 ASN A N    1 
ATOM   1691 C CA   . ASN A 1 126 ? -4.093  21.882 16.594 1.00 21.28 ? 127 ASN A CA   1 
ATOM   1692 C C    . ASN A 1 126 ? -3.827  21.934 18.113 1.00 23.22 ? 127 ASN A C    1 
ATOM   1693 O O    . ASN A 1 126 ? -4.692  21.542 18.906 1.00 25.35 ? 127 ASN A O    1 
ATOM   1694 C CB   . ASN A 1 126 ? -3.920  20.477 16.009 1.00 21.40 ? 127 ASN A CB   1 
ATOM   1695 C CG   . ASN A 1 126 ? -4.740  20.268 14.752 1.00 26.06 ? 127 ASN A CG   1 
ATOM   1696 O OD1  . ASN A 1 126 ? -5.686  21.004 14.488 1.00 28.65 ? 127 ASN A OD1  1 
ATOM   1697 N ND2  . ASN A 1 126 ? -4.393  19.250 13.988 1.00 29.13 ? 127 ASN A ND2  1 
ATOM   1698 H H    . ASN A 1 126 ? -2.742  22.468 15.278 1.00 23.04 ? 127 ASN A H    1 
ATOM   1699 H HA   . ASN A 1 126 ? -5.025  22.120 16.470 1.00 25.53 ? 127 ASN A HA   1 
ATOM   1700 H HB2  . ASN A 1 126 ? -2.986  20.340 15.785 1.00 25.68 ? 127 ASN A HB2  1 
ATOM   1701 H HB3  . ASN A 1 126 ? -4.204  19.823 16.666 1.00 25.68 ? 127 ASN A HB3  1 
ATOM   1702 H HD21 . ASN A 1 126 ? -4.828  19.089 13.264 1.00 34.96 ? 127 ASN A HD21 1 
ATOM   1703 H HD22 . ASN A 1 126 ? -3.733  18.748 14.215 1.00 34.96 ? 127 ASN A HD22 1 
ATOM   1704 N N    . LYS A 1 127 ? -2.665  22.456 18.508 1.00 18.61 ? 128 LYS A N    1 
ATOM   1705 C CA   . LYS A 1 127 ? -2.288  22.581 19.927 1.00 20.58 ? 128 LYS A CA   1 
ATOM   1706 C C    . LYS A 1 127 ? -2.731  23.887 20.576 1.00 19.50 ? 128 LYS A C    1 
ATOM   1707 O O    . LYS A 1 127 ? -2.782  23.988 21.795 1.00 21.54 ? 128 LYS A O    1 
ATOM   1708 C CB   . LYS A 1 127 ? -0.775  22.501 20.088 1.00 21.75 ? 128 LYS A CB   1 
ATOM   1709 C CG   . LYS A 1 127 ? -0.130  21.262 19.526 1.00 23.36 ? 128 LYS A CG   1 
ATOM   1710 C CD   . LYS A 1 127 ? 1.383   21.354 19.625 1.00 24.99 ? 128 LYS A CD   1 
ATOM   1711 C CE   . LYS A 1 127 ? 2.016   20.036 19.226 1.00 31.53 ? 128 LYS A CE   1 
ATOM   1712 N NZ   . LYS A 1 127 ? 3.502   20.123 19.101 1.00 32.92 ? 128 LYS A NZ   1 
ATOM   1713 H H    . LYS A 1 127 ? -2.064  22.750 17.967 1.00 22.33 ? 128 LYS A H    1 
ATOM   1714 H HA   . LYS A 1 127 ? -2.683  21.848 20.425 1.00 24.70 ? 128 LYS A HA   1 
ATOM   1715 H HB2  . LYS A 1 127 ? -0.378  23.264 19.641 1.00 26.10 ? 128 LYS A HB2  1 
ATOM   1716 H HB3  . LYS A 1 127 ? -0.565  22.534 21.035 1.00 26.10 ? 128 LYS A HB3  1 
ATOM   1717 H HG2  . LYS A 1 127 ? -0.423  20.488 20.031 1.00 28.04 ? 128 LYS A HG2  1 
ATOM   1718 H HG3  . LYS A 1 127 ? -0.371  21.168 18.591 1.00 28.04 ? 128 LYS A HG3  1 
ATOM   1719 H HD2  . LYS A 1 127 ? 1.705   22.044 19.024 1.00 29.99 ? 128 LYS A HD2  1 
ATOM   1720 H HD3  . LYS A 1 127 ? 1.637   21.553 20.539 1.00 29.99 ? 128 LYS A HD3  1 
ATOM   1721 H HE2  . LYS A 1 127 ? 1.811   19.370 19.901 1.00 37.84 ? 128 LYS A HE2  1 
ATOM   1722 H HE3  . LYS A 1 127 ? 1.658   19.761 18.368 1.00 37.84 ? 128 LYS A HE3  1 
ATOM   1723 H HZ1  . LYS A 1 127 ? 3.833   19.331 18.866 1.00 39.50 ? 128 LYS A HZ1  1 
ATOM   1724 H HZ2  . LYS A 1 127 ? 3.720   20.723 18.481 1.00 39.50 ? 128 LYS A HZ2  1 
ATOM   1725 H HZ3  . LYS A 1 127 ? 3.859   20.367 19.878 1.00 39.50 ? 128 LYS A HZ3  1 
ATOM   1726 N N    . LEU A 1 128 ? -3.011  24.920 19.793 1.00 15.15 ? 129 LEU A N    1 
ATOM   1727 C CA   . LEU A 1 128 ? -3.142  26.251 20.335 1.00 14.37 ? 129 LEU A CA   1 
ATOM   1728 C C    . LEU A 1 128 ? -4.421  26.462 21.114 1.00 14.13 ? 129 LEU A C    1 
ATOM   1729 O O    . LEU A 1 128 ? -5.495  25.996 20.730 1.00 16.39 ? 129 LEU A O    1 
ATOM   1730 C CB   . LEU A 1 128 ? -3.055  27.287 19.214 1.00 15.47 ? 129 LEU A CB   1 
ATOM   1731 C CG   . LEU A 1 128 ? -1.727  27.325 18.465 1.00 15.64 ? 129 LEU A CG   1 
ATOM   1732 C CD1  . LEU A 1 128 ? -1.740  28.427 17.409 1.00 15.15 ? 129 LEU A CD1  1 
ATOM   1733 C CD2  . LEU A 1 128 ? -0.540  27.551 19.402 1.00 15.92 ? 129 LEU A CD2  1 
ATOM   1734 H H    . LEU A 1 128 ? -3.129  24.870 18.942 1.00 18.18 ? 129 LEU A H    1 
ATOM   1735 H HA   . LEU A 1 128 ? -2.402  26.411 20.940 1.00 17.24 ? 129 LEU A HA   1 
ATOM   1736 H HB2  . LEU A 1 128 ? -3.751  27.098 18.565 1.00 18.57 ? 129 LEU A HB2  1 
ATOM   1737 H HB3  . LEU A 1 128 ? -3.199  28.167 19.597 1.00 18.57 ? 129 LEU A HB3  1 
ATOM   1738 H HG   . LEU A 1 128 ? -1.595  26.477 18.012 1.00 18.76 ? 129 LEU A HG   1 
ATOM   1739 H HD11 . LEU A 1 128 ? -0.887  28.431 16.946 1.00 18.18 ? 129 LEU A HD11 1 
ATOM   1740 H HD12 . LEU A 1 128 ? -2.457  28.252 16.779 1.00 18.18 ? 129 LEU A HD12 1 
ATOM   1741 H HD13 . LEU A 1 128 ? -1.884  29.281 17.846 1.00 18.18 ? 129 LEU A HD13 1 
ATOM   1742 H HD21 . LEU A 1 128 ? 0.277   27.567 18.879 1.00 19.10 ? 129 LEU A HD21 1 
ATOM   1743 H HD22 . LEU A 1 128 ? -0.657  28.399 19.859 1.00 19.10 ? 129 LEU A HD22 1 
ATOM   1744 H HD23 . LEU A 1 128 ? -0.506  26.829 20.048 1.00 19.10 ? 129 LEU A HD23 1 
ATOM   1745 N N    . GLU A 1 129 ? -4.281  27.197 22.217 1.00 14.35 ? 130 GLU A N    1 
ATOM   1746 C CA   . GLU A 1 129 ? -5.397  27.569 23.084 1.00 15.47 ? 130 GLU A CA   1 
ATOM   1747 C C    . GLU A 1 129 ? -5.238  29.018 23.487 1.00 14.18 ? 130 GLU A C    1 
ATOM   1748 O O    . GLU A 1 129 ? -4.142  29.567 23.458 1.00 14.34 ? 130 GLU A O    1 
ATOM   1749 C CB   . GLU A 1 129 ? -5.416  26.736 24.374 1.00 17.20 ? 130 GLU A CB   1 
ATOM   1750 C CG   . GLU A 1 129 ? -5.462  25.260 24.218 1.00 20.85 ? 130 GLU A CG   1 
ATOM   1751 C CD   . GLU A 1 129 ? -5.760  24.593 25.543 1.00 21.78 ? 130 GLU A CD   1 
ATOM   1752 O OE1  . GLU A 1 129 ? -5.048  24.905 26.526 1.00 20.24 ? 130 GLU A OE1  1 
ATOM   1753 O OE2  . GLU A 1 129 ? -6.705  23.782 25.617 1.00 28.82 ? 130 GLU A OE2  1 
ATOM   1754 H H    . GLU A 1 129 ? -3.525  27.501 22.491 1.00 17.23 ? 130 GLU A H    1 
ATOM   1755 H HA   . GLU A 1 129 ? -6.240  27.456 22.616 1.00 18.57 ? 130 GLU A HA   1 
ATOM   1756 H HB2  . GLU A 1 129 ? -4.615  26.946 24.880 1.00 20.64 ? 130 GLU A HB2  1 
ATOM   1757 H HB3  . GLU A 1 129 ? -6.196  26.995 24.888 1.00 20.64 ? 130 GLU A HB3  1 
ATOM   1758 H HG2  . GLU A 1 129 ? -6.163  25.024 23.591 1.00 25.02 ? 130 GLU A HG2  1 
ATOM   1759 H HG3  . GLU A 1 129 ? -4.603  24.942 23.901 1.00 25.02 ? 130 GLU A HG3  1 
ATOM   1760 N N    . GLU A 1 130 ? -6.331  29.662 23.901 1.00 15.21 ? 131 GLU A N    1 
ATOM   1761 C CA   . GLU A 1 130 ? -6.244  30.956 24.552 1.00 13.74 ? 131 GLU A CA   1 
ATOM   1762 C C    . GLU A 1 130 ? -5.213  30.910 25.667 1.00 14.49 ? 131 GLU A C    1 
ATOM   1763 O O    . GLU A 1 130 ? -5.169  29.941 26.450 1.00 15.74 ? 131 GLU A O    1 
ATOM   1764 C CB   . GLU A 1 130 ? -7.586  31.383 25.159 1.00 18.31 ? 131 GLU A CB   1 
ATOM   1765 C CG   . GLU A 1 130 ? -8.681  31.630 24.170 1.00 23.83 ? 131 GLU A CG   1 
ATOM   1766 C CD   . GLU A 1 130 ? -9.961  32.154 24.835 1.00 30.40 ? 131 GLU A CD   1 
ATOM   1767 O OE1  . GLU A 1 130 ? -9.942  32.432 26.056 1.00 35.05 ? 131 GLU A OE1  1 
ATOM   1768 O OE2  . GLU A 1 130 ? -10.986 32.281 24.134 1.00 29.48 ? 131 GLU A OE2  1 
ATOM   1769 H H    . GLU A 1 130 ? -7.133  29.364 23.813 1.00 18.25 ? 131 GLU A H    1 
ATOM   1770 H HA   . GLU A 1 130 ? -5.970  31.626 23.907 1.00 16.49 ? 131 GLU A HA   1 
ATOM   1771 H HB2  . GLU A 1 130 ? -7.889  30.684 25.760 1.00 21.97 ? 131 GLU A HB2  1 
ATOM   1772 H HB3  . GLU A 1 130 ? -7.452  32.204 25.657 1.00 21.97 ? 131 GLU A HB3  1 
ATOM   1773 H HG2  . GLU A 1 130 ? -8.383  32.293 23.527 1.00 28.59 ? 131 GLU A HG2  1 
ATOM   1774 H HG3  . GLU A 1 130 ? -8.894  30.799 23.718 1.00 28.59 ? 131 GLU A HG3  1 
ATOM   1775 N N    . GLY A 1 131 ? -4.427  31.971 25.749 1.00 14.13 ? 132 GLY A N    1 
ATOM   1776 C CA   . GLY A 1 131 ? -3.390  32.144 26.733 1.00 14.12 ? 132 GLY A CA   1 
ATOM   1777 C C    . GLY A 1 131 ? -2.033  31.662 26.319 1.00 13.65 ? 132 GLY A C    1 
ATOM   1778 O O    . GLY A 1 131 ? -1.044  31.998 26.975 1.00 14.53 ? 132 GLY A O    1 
ATOM   1779 H H    . GLY A 1 131 ? -4.485  32.638 25.209 1.00 16.96 ? 132 GLY A H    1 
ATOM   1780 H HA2  . GLY A 1 131 ? -3.318  33.087 26.950 1.00 16.94 ? 132 GLY A HA2  1 
ATOM   1781 H HA3  . GLY A 1 131 ? -3.641  31.670 27.541 1.00 16.94 ? 132 GLY A HA3  1 
ATOM   1782 N N    . ASP A 1 132 ? -1.963  30.860 25.251 1.00 13.12 ? 133 ASP A N    1 
ATOM   1783 C CA   . ASP A 1 132 ? -0.679  30.423 24.732 1.00 12.72 ? 133 ASP A CA   1 
ATOM   1784 C C    . ASP A 1 132 ? 0.001   31.624 24.099 1.00 12.56 ? 133 ASP A C    1 
ATOM   1785 O O    . ASP A 1 132 ? -0.666  32.582 23.687 1.00 12.91 ? 133 ASP A O    1 
ATOM   1786 C CB   . ASP A 1 132 ? -0.825  29.327 23.683 1.00 11.61 ? 133 ASP A CB   1 
ATOM   1787 C CG   . ASP A 1 132 ? -1.293  28.016 24.256 1.00 12.85 ? 133 ASP A CG   1 
ATOM   1788 O OD1  . ASP A 1 132 ? -1.285  27.835 25.500 1.00 14.97 ? 133 ASP A OD1  1 
ATOM   1789 O OD2  . ASP A 1 132 ? -1.656  27.110 23.468 1.00 15.58 ? 133 ASP A OD2  1 
ATOM   1790 H H    . ASP A 1 132 ? -2.643  30.562 24.817 1.00 15.75 ? 133 ASP A H    1 
ATOM   1791 H HA   . ASP A 1 132 ? -0.124  30.093 25.456 1.00 15.27 ? 133 ASP A HA   1 
ATOM   1792 H HB2  . ASP A 1 132 ? -1.474  29.611 23.020 1.00 13.93 ? 133 ASP A HB2  1 
ATOM   1793 H HB3  . ASP A 1 132 ? 0.035   29.178 23.261 1.00 13.93 ? 133 ASP A HB3  1 
ATOM   1794 N N    . VAL A 1 133 ? 1.325   31.572 24.004 1.00 10.81 ? 134 VAL A N    1 
ATOM   1795 C CA   . VAL A 1 133 ? 2.106   32.677 23.466 1.00 11.13 ? 134 VAL A CA   1 
ATOM   1796 C C    . VAL A 1 133 ? 2.823   32.199 22.195 1.00 11.36 ? 134 VAL A C    1 
ATOM   1797 O O    . VAL A 1 133 ? 3.459   31.141 22.161 1.00 12.53 ? 134 VAL A O    1 
ATOM   1798 C CB   . VAL A 1 133 ? 3.065   33.220 24.509 1.00 12.71 ? 134 VAL A CB   1 
ATOM   1799 C CG1  . VAL A 1 133 ? 4.002   34.221 23.913 1.00 15.51 ? 134 VAL A CG1  1 
ATOM   1800 C CG2  . VAL A 1 133 ? 2.290   33.863 25.647 1.00 15.19 ? 134 VAL A CG2  1 
ATOM   1801 H H    . VAL A 1 133 ? 1.800   30.897 24.247 1.00 12.98 ? 134 VAL A H    1 
ATOM   1802 H HA   . VAL A 1 133 ? 1.503   33.394 23.216 1.00 13.36 ? 134 VAL A HA   1 
ATOM   1803 H HB   . VAL A 1 133 ? 3.590   32.490 24.872 1.00 15.25 ? 134 VAL A HB   1 
ATOM   1804 H HG11 . VAL A 1 133 ? 4.598   34.546 24.606 1.00 18.61 ? 134 VAL A HG11 1 
ATOM   1805 H HG12 . VAL A 1 133 ? 4.514   33.794 23.209 1.00 18.61 ? 134 VAL A HG12 1 
ATOM   1806 H HG13 . VAL A 1 133 ? 3.487   34.957 23.548 1.00 18.61 ? 134 VAL A HG13 1 
ATOM   1807 H HG21 . VAL A 1 133 ? 2.917   34.204 26.303 1.00 18.23 ? 134 VAL A HG21 1 
ATOM   1808 H HG22 . VAL A 1 133 ? 1.753   34.589 25.292 1.00 18.23 ? 134 VAL A HG22 1 
ATOM   1809 H HG23 . VAL A 1 133 ? 1.715   33.196 26.054 1.00 18.23 ? 134 VAL A HG23 1 
ATOM   1810 N N    . LEU A 1 134 ? 2.674   32.994 21.148 1.00 11.59 ? 135 LEU A N    1 
ATOM   1811 C CA   . LEU A 1 134 ? 3.344   32.776 19.870 1.00 11.54 ? 135 LEU A CA   1 
ATOM   1812 C C    . LEU A 1 134 ? 4.534   33.709 19.743 1.00 12.28 ? 135 LEU A C    1 
ATOM   1813 O O    . LEU A 1 134 ? 4.409   34.910 19.962 1.00 12.39 ? 135 LEU A O    1 
ATOM   1814 C CB   . LEU A 1 134 ? 2.356   33.022 18.739 1.00 12.98 ? 135 LEU A CB   1 
ATOM   1815 C CG   . LEU A 1 134 ? 1.094   32.154 18.796 1.00 14.64 ? 135 LEU A CG   1 
ATOM   1816 C CD1  . LEU A 1 134 ? 0.105   32.624 17.749 1.00 13.74 ? 135 LEU A CD1  1 
ATOM   1817 C CD2  . LEU A 1 134 ? 1.442   30.681 18.624 1.00 17.52 ? 135 LEU A CD2  1 
ATOM   1818 H H    . LEU A 1 134 ? 2.172   33.692 21.151 1.00 13.91 ? 135 LEU A H    1 
ATOM   1819 H HA   . LEU A 1 134 ? 3.659   31.860 19.816 1.00 13.85 ? 135 LEU A HA   1 
ATOM   1820 H HB2  . LEU A 1 134 ? 2.076   33.950 18.769 1.00 15.58 ? 135 LEU A HB2  1 
ATOM   1821 H HB3  . LEU A 1 134 ? 2.799   32.841 17.895 1.00 15.58 ? 135 LEU A HB3  1 
ATOM   1822 H HG   . LEU A 1 134 ? 0.679   32.262 19.666 1.00 17.57 ? 135 LEU A HG   1 
ATOM   1823 H HD11 . LEU A 1 134 ? -0.689  32.069 17.793 1.00 16.48 ? 135 LEU A HD11 1 
ATOM   1824 H HD12 . LEU A 1 134 ? -0.127  33.549 17.927 1.00 16.48 ? 135 LEU A HD12 1 
ATOM   1825 H HD13 . LEU A 1 134 ? 0.514   32.548 16.872 1.00 16.48 ? 135 LEU A HD13 1 
ATOM   1826 H HD21 . LEU A 1 134 ? 0.627   30.157 18.664 1.00 21.02 ? 135 LEU A HD21 1 
ATOM   1827 H HD22 . LEU A 1 134 ? 1.874   30.557 17.764 1.00 21.02 ? 135 LEU A HD22 1 
ATOM   1828 H HD23 . LEU A 1 134 ? 2.043   30.413 19.338 1.00 21.02 ? 135 LEU A HD23 1 
ATOM   1829 N N    . VAL A 1 135 ? 5.678   33.146 19.390 1.00 12.32 ? 136 VAL A N    1 
ATOM   1830 C CA   . VAL A 1 135 ? 6.915   33.908 19.257 1.00 13.50 ? 136 VAL A CA   1 
ATOM   1831 C C    . VAL A 1 135 ? 7.315   33.931 17.791 1.00 11.22 ? 136 VAL A C    1 
ATOM   1832 O O    . VAL A 1 135 ? 7.435   32.883 17.180 1.00 13.17 ? 136 VAL A O    1 
ATOM   1833 C CB   . VAL A 1 135 ? 8.041   33.264 20.038 1.00 14.40 ? 136 VAL A CB   1 
ATOM   1834 C CG1  . VAL A 1 135 ? 9.302   34.083 19.889 1.00 15.40 ? 136 VAL A CG1  1 
ATOM   1835 C CG2  . VAL A 1 135 ? 7.662   33.133 21.509 1.00 18.24 ? 136 VAL A CG2  1 
ATOM   1836 H H    . VAL A 1 135 ? 5.769   32.309 19.219 1.00 14.78 ? 136 VAL A H    1 
ATOM   1837 H HA   . VAL A 1 135 ? 6.787   34.817 19.569 1.00 16.20 ? 136 VAL A HA   1 
ATOM   1838 H HB   . VAL A 1 135 ? 8.210   32.376 19.686 1.00 17.28 ? 136 VAL A HB   1 
ATOM   1839 H HG11 . VAL A 1 135 ? 10.014  33.660 20.394 1.00 18.48 ? 136 VAL A HG11 1 
ATOM   1840 H HG12 . VAL A 1 135 ? 9.541   34.126 18.950 1.00 18.48 ? 136 VAL A HG12 1 
ATOM   1841 H HG13 . VAL A 1 135 ? 9.140   34.976 20.230 1.00 18.48 ? 136 VAL A HG13 1 
ATOM   1842 H HG21 . VAL A 1 135 ? 8.397   32.719 21.988 1.00 21.89 ? 136 VAL A HG21 1 
ATOM   1843 H HG22 . VAL A 1 135 ? 7.488   34.017 21.870 1.00 21.89 ? 136 VAL A HG22 1 
ATOM   1844 H HG23 . VAL A 1 135 ? 6.867   32.583 21.583 1.00 21.89 ? 136 VAL A HG23 1 
ATOM   1845 N N    . GLU A 1 136 ? 7.466   35.123 17.225 1.00 13.00 ? 137 GLU A N    1 
ATOM   1846 C CA   . GLU A 1 136 ? 7.841   35.249 15.818 1.00 12.24 ? 137 GLU A CA   1 
ATOM   1847 C C    . GLU A 1 136 ? 9.337   35.491 15.719 1.00 11.86 ? 137 GLU A C    1 
ATOM   1848 O O    . GLU A 1 136 ? 9.813   36.515 16.166 1.00 13.40 ? 137 GLU A O    1 
ATOM   1849 C CB   . GLU A 1 136 ? 7.068   36.399 15.218 1.00 14.17 ? 137 GLU A CB   1 
ATOM   1850 C CG   . GLU A 1 136 ? 7.474   36.727 13.784 1.00 17.32 ? 137 GLU A CG   1 
ATOM   1851 C CD   . GLU A 1 136 ? 7.370   35.542 12.831 1.00 20.01 ? 137 GLU A CD   1 
ATOM   1852 O OE1  . GLU A 1 136 ? 6.227   35.113 12.518 1.00 24.06 ? 137 GLU A OE1  1 
ATOM   1853 O OE2  . GLU A 1 136 ? 8.419   35.031 12.368 1.00 17.90 ? 137 GLU A OE2  1 
ATOM   1854 H H    . GLU A 1 136 ? 7.357   35.874 17.631 1.00 15.60 ? 137 GLU A H    1 
ATOM   1855 H HA   . GLU A 1 136 ? 7.619   34.434 15.340 1.00 14.69 ? 137 GLU A HA   1 
ATOM   1856 H HB2  . GLU A 1 136 ? 6.124   36.174 15.215 1.00 17.01 ? 137 GLU A HB2  1 
ATOM   1857 H HB3  . GLU A 1 136 ? 7.216   37.191 15.757 1.00 17.01 ? 137 GLU A HB3  1 
ATOM   1858 H HG2  . GLU A 1 136 ? 6.896   37.430 13.448 1.00 20.79 ? 137 GLU A HG2  1 
ATOM   1859 H HG3  . GLU A 1 136 ? 8.396   37.031 13.781 1.00 20.79 ? 137 GLU A HG3  1 
ATOM   1860 N N    . PRO A 1 137 ? 10.082  34.537 15.121 1.00 13.57 ? 138 PRO A N    1 
ATOM   1861 C CA   . PRO A 1 137 ? 11.541  34.733 15.056 1.00 13.87 ? 138 PRO A CA   1 
ATOM   1862 C C    . PRO A 1 137 ? 11.976  35.846 14.087 1.00 13.33 ? 138 PRO A C    1 
ATOM   1863 O O    . PRO A 1 137 ? 13.017  36.477 14.307 1.00 15.29 ? 138 PRO A O    1 
ATOM   1864 C CB   . PRO A 1 137 ? 12.047  33.379 14.581 1.00 14.83 ? 138 PRO A CB   1 
ATOM   1865 C CG   . PRO A 1 137 ? 10.899  32.758 13.847 1.00 16.12 ? 138 PRO A CG   1 
ATOM   1866 C CD   . PRO A 1 137 ? 9.692   33.194 14.639 1.00 14.56 ? 138 PRO A CD   1 
ATOM   1867 H HA   . PRO A 1 137 ? 11.897  34.918 15.940 1.00 16.65 ? 138 PRO A HA   1 
ATOM   1868 H HB2  . PRO A 1 137 ? 12.805  33.503 13.989 1.00 17.79 ? 138 PRO A HB2  1 
ATOM   1869 H HB3  . PRO A 1 137 ? 12.296  32.837 15.347 1.00 17.79 ? 138 PRO A HB3  1 
ATOM   1870 H HG2  . PRO A 1 137 ? 10.862  33.102 12.940 1.00 19.35 ? 138 PRO A HG2  1 
ATOM   1871 H HG3  . PRO A 1 137 ? 10.987  31.792 13.850 1.00 19.35 ? 138 PRO A HG3  1 
ATOM   1872 H HD2  . PRO A 1 137 ? 8.912   33.252 14.065 1.00 17.47 ? 138 PRO A HD2  1 
ATOM   1873 H HD3  . PRO A 1 137 ? 9.542   32.594 15.387 1.00 17.47 ? 138 PRO A HD3  1 
ATOM   1874 N N    . ALA A 1 138 ? 11.191  36.057 13.045 1.00 13.50 ? 139 ALA A N    1 
ATOM   1875 C CA   . ALA A 1 138 ? 11.460  37.108 12.065 1.00 13.32 ? 139 ALA A CA   1 
ATOM   1876 C C    . ALA A 1 138 ? 10.961  38.452 12.577 1.00 13.43 ? 139 ALA A C    1 
ATOM   1877 O O    . ALA A 1 138 ? 10.386  38.551 13.672 1.00 13.63 ? 139 ALA A O    1 
ATOM   1878 C CB   . ALA A 1 138 ? 10.807  36.745 10.738 1.00 16.49 ? 139 ALA A CB   1 
ATOM   1879 H H    . ALA A 1 138 ? 10.483  35.600 12.876 1.00 16.19 ? 139 ALA A H    1 
ATOM   1880 H HA   . ALA A 1 138 ? 12.418  37.175 11.923 1.00 15.99 ? 139 ALA A HA   1 
ATOM   1881 H HB1  . ALA A 1 138 ? 10.991  37.447 10.094 1.00 19.79 ? 139 ALA A HB1  1 
ATOM   1882 H HB2  . ALA A 1 138 ? 11.175  35.904 10.425 1.00 19.79 ? 139 ALA A HB2  1 
ATOM   1883 H HB3  . ALA A 1 138 ? 9.850   36.659 10.871 1.00 19.79 ? 139 ALA A HB3  1 
ATOM   1884 N N    . PHE A 1 139 ? 11.201  39.527 11.831 1.00 12.54 ? 140 PHE A N    1 
ATOM   1885 C CA   . PHE A 1 139 ? 10.477  40.761 12.081 1.00 12.12 ? 140 PHE A CA   1 
ATOM   1886 C C    . PHE A 1 139 ? 9.013   40.433 11.867 1.00 12.46 ? 140 PHE A C    1 
ATOM   1887 O O    . PHE A 1 139 ? 8.675   39.575 11.042 1.00 15.70 ? 140 PHE A O    1 
ATOM   1888 C CB   . PHE A 1 139 ? 10.864  41.857 11.084 1.00 13.57 ? 140 PHE A CB   1 
ATOM   1889 C CG   . PHE A 1 139 ? 12.204  42.493 11.328 1.00 12.79 ? 140 PHE A CG   1 
ATOM   1890 C CD1  . PHE A 1 139 ? 13.359  41.975 10.753 1.00 15.33 ? 140 PHE A CD1  1 
ATOM   1891 C CD2  . PHE A 1 139 ? 12.311  43.622 12.110 1.00 13.37 ? 140 PHE A CD2  1 
ATOM   1892 C CE1  . PHE A 1 139 ? 14.575  42.555 10.982 1.00 15.69 ? 140 PHE A CE1  1 
ATOM   1893 C CE2  . PHE A 1 139 ? 13.542  44.215 12.328 1.00 15.47 ? 140 PHE A CE2  1 
ATOM   1894 C CZ   . PHE A 1 139 ? 14.669  43.659 11.774 1.00 16.49 ? 140 PHE A CZ   1 
ATOM   1895 H H    . PHE A 1 139 ? 11.769  39.566 11.186 1.00 15.05 ? 140 PHE A H    1 
ATOM   1896 H HA   . PHE A 1 139 ? 10.618  41.072 12.989 1.00 14.54 ? 140 PHE A HA   1 
ATOM   1897 H HB2  . PHE A 1 139 ? 10.880  41.473 10.194 1.00 16.28 ? 140 PHE A HB2  1 
ATOM   1898 H HB3  . PHE A 1 139 ? 10.196  42.559 11.123 1.00 16.28 ? 140 PHE A HB3  1 
ATOM   1899 H HD1  . PHE A 1 139 ? 13.306  41.211 10.225 1.00 18.40 ? 140 PHE A HD1  1 
ATOM   1900 H HD2  . PHE A 1 139 ? 11.549  43.988 12.497 1.00 16.04 ? 140 PHE A HD2  1 
ATOM   1901 H HE1  . PHE A 1 139 ? 15.341  42.192 10.600 1.00 18.83 ? 140 PHE A HE1  1 
ATOM   1902 H HE2  . PHE A 1 139 ? 13.610  44.969 12.867 1.00 18.56 ? 140 PHE A HE2  1 
ATOM   1903 H HZ   . PHE A 1 139 ? 15.498  44.058 11.914 1.00 19.79 ? 140 PHE A HZ   1 
ATOM   1904 N N    . THR A 1 140 ? 8.133   41.119 12.574 1.00 11.71 ? 141 THR A N    1 
ATOM   1905 C CA   . THR A 1 140 ? 6.693   40.974 12.348 1.00 10.83 ? 141 THR A CA   1 
ATOM   1906 C C    . THR A 1 140 ? 6.157   42.219 11.688 1.00 12.49 ? 141 THR A C    1 
ATOM   1907 O O    . THR A 1 140 ? 6.241   43.307 12.246 1.00 14.61 ? 141 THR A O    1 
ATOM   1908 C CB   . THR A 1 140 ? 5.898   40.765 13.661 1.00 14.90 ? 141 THR A CB   1 
ATOM   1909 O OG1  . THR A 1 140 ? 6.362   39.600 14.347 1.00 16.45 ? 141 THR A OG1  1 
ATOM   1910 C CG2  . THR A 1 140 ? 4.408   40.555 13.349 1.00 15.38 ? 141 THR A CG2  1 
ATOM   1911 H H    . THR A 1 140 ? 8.338   41.679 13.194 1.00 14.05 ? 141 THR A H    1 
ATOM   1912 H HA   . THR A 1 140 ? 6.529   40.217 11.763 1.00 12.99 ? 141 THR A HA   1 
ATOM   1913 H HB   . THR A 1 140 ? 5.993   41.544 14.231 1.00 17.88 ? 141 THR A HB   1 
ATOM   1914 H HG1  . THR A 1 140 ? 7.176   39.682 14.536 1.00 19.74 ? 141 THR A HG1  1 
ATOM   1915 H HG21 . THR A 1 140 ? 3.913   40.425 14.173 1.00 18.46 ? 141 THR A HG21 1 
ATOM   1916 H HG22 . THR A 1 140 ? 4.053   41.331 12.888 1.00 18.46 ? 141 THR A HG22 1 
ATOM   1917 H HG23 . THR A 1 140 ? 4.294   39.774 12.786 1.00 18.46 ? 141 THR A HG23 1 
ATOM   1918 N N    . SER A 1 141 ? 5.613   42.065 10.483 1.00 12.32 ? 142 SER A N    1 
ATOM   1919 C CA   . SER A 1 141 ? 4.970   43.146 9.771  1.00 12.93 ? 142 SER A CA   1 
ATOM   1920 C C    . SER A 1 141 ? 3.461   42.998 9.833  1.00 12.68 ? 142 SER A C    1 
ATOM   1921 O O    . SER A 1 141 ? 2.929   41.924 9.528  1.00 15.53 ? 142 SER A O    1 
ATOM   1922 C CB   . SER A 1 141 ? 5.406   43.133 8.305  1.00 15.32 ? 142 SER A CB   1 
ATOM   1923 O OG   . SER A 1 141 ? 4.698   44.092 7.563  1.00 19.55 ? 142 SER A OG   1 
ATOM   1924 H H    . SER A 1 141 ? 5.609   41.321 10.053 1.00 14.78 ? 142 SER A H    1 
ATOM   1925 H HA   . SER A 1 141 ? 5.219   43.996 10.166 1.00 15.52 ? 142 SER A HA   1 
ATOM   1926 H HB2  . SER A 1 141 ? 6.354   43.333 8.256  1.00 18.39 ? 142 SER A HB2  1 
ATOM   1927 H HB3  . SER A 1 141 ? 5.233   42.254 7.932  1.00 18.39 ? 142 SER A HB3  1 
ATOM   1928 H HG   . SER A 1 141 ? 4.838   44.859 7.876  1.00 23.46 ? 142 SER A HG   1 
ATOM   1929 N N    . THR A 1 142 ? 2.784   44.067 10.220 1.00 12.00 ? 143 THR A N    1 
ATOM   1930 C CA   . THR A 1 142 ? 1.332   44.117 10.257 1.00 12.43 ? 143 THR A CA   1 
ATOM   1931 C C    . THR A 1 142 ? 0.860   45.344 9.465  1.00 13.18 ? 143 THR A C    1 
ATOM   1932 O O    . THR A 1 142 ? 1.649   46.243 9.126  1.00 13.55 ? 143 THR A O    1 
ATOM   1933 C CB   . THR A 1 142 ? 0.789   44.220 11.695 1.00 13.14 ? 143 THR A CB   1 
ATOM   1934 O OG1  . THR A 1 142 ? 1.195   45.468 12.286 1.00 14.56 ? 143 THR A OG1  1 
ATOM   1935 C CG2  . THR A 1 142 ? 1.294   43.078 12.543 1.00 15.37 ? 143 THR A CG2  1 
ATOM   1936 H H    . THR A 1 142 ? 3.156   44.799 10.474 1.00 14.40 ? 143 THR A H    1 
ATOM   1937 H HA   . THR A 1 142 ? 0.967   43.320 9.843  1.00 14.92 ? 143 THR A HA   1 
ATOM   1938 H HB   . THR A 1 142 ? -0.180  44.176 11.674 1.00 15.77 ? 143 THR A HB   1 
ATOM   1939 H HG1  . THR A 1 142 ? 2.033   45.516 12.308 1.00 17.47 ? 143 THR A HG1  1 
ATOM   1940 H HG21 . THR A 1 142 ? 0.945   43.155 13.445 1.00 18.44 ? 143 THR A HG21 1 
ATOM   1941 H HG22 . THR A 1 142 ? 1.007   42.232 12.165 1.00 18.44 ? 143 THR A HG22 1 
ATOM   1942 H HG23 . THR A 1 142 ? 2.263   43.095 12.578 1.00 18.44 ? 143 THR A HG23 1 
ATOM   1943 N N    . SER A 1 143 ? -0.433  45.381 9.173  1.00 12.46 ? 144 SER A N    1 
ATOM   1944 C CA   . SER A 1 143 ? -1.047  46.567 8.576  1.00 12.03 ? 144 SER A CA   1 
ATOM   1945 C C    . SER A 1 143 ? -2.263  46.908 9.388  1.00 12.98 ? 144 SER A C    1 
ATOM   1946 O O    . SER A 1 143 ? -2.962  46.021 9.865  1.00 13.68 ? 144 SER A O    1 
ATOM   1947 C CB   . SER A 1 143 ? -1.468  46.318 7.123  1.00 14.65 ? 144 SER A CB   1 
ATOM   1948 O OG   . SER A 1 143 ? -2.178  47.437 6.601  1.00 14.38 ? 144 SER A OG   1 
ATOM   1949 H H    . SER A 1 143 ? -0.982  44.733 9.310  1.00 14.95 ? 144 SER A H    1 
ATOM   1950 H HA   . SER A 1 143 ? -0.427  47.312 8.603  1.00 14.43 ? 144 SER A HA   1 
ATOM   1951 H HB2  . SER A 1 143 ? -0.675  46.168 6.586  1.00 17.58 ? 144 SER A HB2  1 
ATOM   1952 H HB3  . SER A 1 143 ? -2.043  45.537 7.090  1.00 17.58 ? 144 SER A HB3  1 
ATOM   1953 H HG   . SER A 1 143 ? -1.691  48.122 6.624  1.00 17.25 ? 144 SER A HG   1 
ATOM   1954 N N    . THR A 1 144 ? -2.581  48.179 9.522  1.00 12.51 ? 145 THR A N    1 
ATOM   1955 C CA   . THR A 1 144 ? -3.834  48.536 10.180 1.00 13.70 ? 145 THR A CA   1 
ATOM   1956 C C    . THR A 1 144 ? -5.049  48.233 9.281  1.00 12.94 ? 145 THR A C    1 
ATOM   1957 O O    . THR A 1 144 ? -6.193  48.297 9.758  1.00 15.96 ? 145 THR A O    1 
ATOM   1958 C CB   . THR A 1 144 ? -3.875  50.011 10.559 1.00 17.25 ? 145 THR A CB   1 
ATOM   1959 O OG1  . THR A 1 144 ? -3.937  50.783 9.350  1.00 18.21 ? 145 THR A OG1  1 
ATOM   1960 C CG2  . THR A 1 144 ? -2.660  50.416 11.378 1.00 16.80 ? 145 THR A CG2  1 
ATOM   1961 H H    . THR A 1 144 ? -2.107  48.844 9.251  1.00 15.01 ? 145 THR A H    1 
ATOM   1962 H HA   . THR A 1 144 ? -3.923  48.015 10.993 1.00 16.45 ? 145 THR A HA   1 
ATOM   1963 H HB   . THR A 1 144 ? -4.669  50.182 11.088 1.00 20.70 ? 145 THR A HB   1 
ATOM   1964 H HG1  . THR A 1 144 ? -3.960  51.603 9.534  1.00 21.85 ? 145 THR A HG1  1 
ATOM   1965 H HG21 . THR A 1 144 ? -2.713  51.358 11.604 1.00 20.16 ? 145 THR A HG21 1 
ATOM   1966 H HG22 . THR A 1 144 ? -2.624  49.897 12.196 1.00 20.16 ? 145 THR A HG22 1 
ATOM   1967 H HG23 . THR A 1 144 ? -1.850  50.259 10.868 1.00 20.16 ? 145 THR A HG23 1 
ATOM   1968 N N    . LEU A 1 145 ? -4.825  47.868 8.011  1.00 13.57 ? 146 LEU A N    1 
ATOM   1969 C CA   . LEU A 1 145 ? -5.907  47.601 7.069  1.00 14.79 ? 146 LEU A CA   1 
ATOM   1970 C C    . LEU A 1 145 ? -6.047  46.104 6.824  1.00 14.17 ? 146 LEU A C    1 
ATOM   1971 O O    . LEU A 1 145 ? -5.109  45.464 6.356  1.00 15.37 ? 146 LEU A O    1 
ATOM   1972 C CB   . LEU A 1 145 ? -5.597  48.314 5.753  1.00 16.92 ? 146 LEU A CB   1 
ATOM   1973 C CG   . LEU A 1 145 ? -5.355  49.815 5.912  1.00 17.74 ? 146 LEU A CG   1 
ATOM   1974 C CD1  . LEU A 1 145 ? -4.916  50.460 4.588  1.00 22.68 ? 146 LEU A CD1  1 
ATOM   1975 C CD2  . LEU A 1 145 ? -6.595  50.508 6.478  1.00 23.53 ? 146 LEU A CD2  1 
ATOM   1976 H H    . LEU A 1 145 ? -4.041  47.769 7.672  1.00 16.28 ? 146 LEU A H    1 
ATOM   1977 H HA   . LEU A 1 145 ? -6.744  47.941 7.422  1.00 17.75 ? 146 LEU A HA   1 
ATOM   1978 H HB2  . LEU A 1 145 ? -4.799  47.923 5.366  1.00 20.31 ? 146 LEU A HB2  1 
ATOM   1979 H HB3  . LEU A 1 145 ? -6.347  48.196 5.150  1.00 20.31 ? 146 LEU A HB3  1 
ATOM   1980 H HG   . LEU A 1 145 ? -4.635  49.943 6.549  1.00 21.29 ? 146 LEU A HG   1 
ATOM   1981 H HD11 . LEU A 1 145 ? -4.773  51.408 4.731  1.00 27.22 ? 146 LEU A HD11 1 
ATOM   1982 H HD12 . LEU A 1 145 ? -4.092  50.042 4.291  1.00 27.22 ? 146 LEU A HD12 1 
ATOM   1983 H HD13 . LEU A 1 145 ? -5.612  50.326 3.926  1.00 27.22 ? 146 LEU A HD13 1 
ATOM   1984 H HD21 . LEU A 1 145 ? -6.412  51.456 6.567  1.00 28.24 ? 146 LEU A HD21 1 
ATOM   1985 H HD22 . LEU A 1 145 ? -7.338  50.369 5.870  1.00 28.24 ? 146 LEU A HD22 1 
ATOM   1986 H HD23 . LEU A 1 145 ? -6.800  50.127 7.346  1.00 28.24 ? 146 LEU A HD23 1 
ATOM   1987 N N    . PRO A 1 146 ? -7.200  45.517 7.163  1.00 14.00 ? 147 PRO A N    1 
ATOM   1988 C CA   . PRO A 1 146 ? -7.317  44.079 6.942  1.00 14.54 ? 147 PRO A CA   1 
ATOM   1989 C C    . PRO A 1 146 ? -7.177  43.657 5.488  1.00 15.23 ? 147 PRO A C    1 
ATOM   1990 O O    . PRO A 1 146 ? -6.690  42.570 5.201  1.00 16.13 ? 147 PRO A O    1 
ATOM   1991 C CB   . PRO A 1 146 ? -8.702  43.737 7.498  1.00 17.85 ? 147 PRO A CB   1 
ATOM   1992 C CG   . PRO A 1 146 ? -9.364  45.024 7.829  1.00 23.83 ? 147 PRO A CG   1 
ATOM   1993 C CD   . PRO A 1 146 ? -8.365  46.104 7.849  1.00 16.61 ? 147 PRO A CD   1 
ATOM   1994 H HA   . PRO A 1 146 ? -6.648  43.612 7.466  1.00 17.45 ? 147 PRO A HA   1 
ATOM   1995 H HB2  . PRO A 1 146 ? -9.210  43.259 6.824  1.00 21.41 ? 147 PRO A HB2  1 
ATOM   1996 H HB3  . PRO A 1 146 ? -8.603  43.193 8.295  1.00 21.41 ? 147 PRO A HB3  1 
ATOM   1997 H HG2  . PRO A 1 146 ? -10.038 45.212 7.156  1.00 28.59 ? 147 PRO A HG2  1 
ATOM   1998 H HG3  . PRO A 1 146 ? -9.782  44.946 8.700  1.00 28.59 ? 147 PRO A HG3  1 
ATOM   1999 H HD2  . PRO A 1 146 ? -8.692  46.875 7.359  1.00 19.93 ? 147 PRO A HD2  1 
ATOM   2000 H HD3  . PRO A 1 146 ? -8.137  46.335 8.763  1.00 19.93 ? 147 PRO A HD3  1 
ATOM   2001 N N    . GLU A 1 147 ? -7.570  44.516 4.572  1.00 15.33 ? 148 GLU A N    1 
ATOM   2002 C CA   . GLU A 1 147 ? -7.441  44.213 3.143  1.00 15.64 ? 148 GLU A CA   1 
ATOM   2003 C C    . GLU A 1 147 ? -5.999  43.884 2.783  1.00 16.79 ? 148 GLU A C    1 
ATOM   2004 O O    . GLU A 1 147 ? -5.713  42.968 1.999  1.00 17.01 ? 148 GLU A O    1 
ATOM   2005 C CB   . GLU A 1 147 ? -7.903  45.408 2.319  1.00 18.12 ? 148 GLU A CB   1 
ATOM   2006 C CG   . GLU A 1 147 ? -9.389  45.677 2.400  1.00 19.73 ? 148 GLU A CG   1 
ATOM   2007 C CD   . GLU A 1 147 ? -9.806  46.607 3.542  1.00 20.47 ? 148 GLU A CD   1 
ATOM   2008 O OE1  . GLU A 1 147 ? -8.985  46.917 4.457  1.00 19.56 ? 148 GLU A OE1  1 
ATOM   2009 O OE2  . GLU A 1 147 ? -10.991 47.013 3.533  1.00 19.52 ? 148 GLU A OE2  1 
ATOM   2010 H H    . GLU A 1 147 ? -7.916  45.285 4.740  1.00 18.39 ? 148 GLU A H    1 
ATOM   2011 H HA   . GLU A 1 147 ? -7.997  43.450 2.920  1.00 18.76 ? 148 GLU A HA   1 
ATOM   2012 H HB2  . GLU A 1 147 ? -7.441  46.200 2.635  1.00 21.74 ? 148 GLU A HB2  1 
ATOM   2013 H HB3  . GLU A 1 147 ? -7.682  45.249 1.388  1.00 21.74 ? 148 GLU A HB3  1 
ATOM   2014 H HG2  . GLU A 1 147 ? -9.675  46.086 1.568  1.00 23.67 ? 148 GLU A HG2  1 
ATOM   2015 H HG3  . GLU A 1 147 ? -9.850  44.833 2.524  1.00 23.67 ? 148 GLU A HG3  1 
ATOM   2016 N N    . VAL A 1 148 ? -5.085  44.646 3.355  1.00 16.96 ? 149 VAL A N    1 
ATOM   2017 C CA   . VAL A 1 148 ? -3.684  44.493 3.056  1.00 19.62 ? 149 VAL A CA   1 
ATOM   2018 C C    . VAL A 1 148 ? -3.164  43.191 3.624  1.00 18.55 ? 149 VAL A C    1 
ATOM   2019 O O    . VAL A 1 148 ? -2.429  42.452 2.967  1.00 19.24 ? 149 VAL A O    1 
ATOM   2020 C CB   . VAL A 1 148 ? -2.909  45.694 3.594  1.00 20.80 ? 149 VAL A CB   1 
ATOM   2021 C CG1  . VAL A 1 148 ? -1.422  45.432 3.508  1.00 23.69 ? 149 VAL A CG1  1 
ATOM   2022 C CG2  . VAL A 1 148 ? -3.291  46.919 2.813  1.00 26.23 ? 149 VAL A CG2  1 
ATOM   2023 H H    . VAL A 1 148 ? -5.256  45.266 3.927  1.00 20.35 ? 149 VAL A H    1 
ATOM   2024 H HA   . VAL A 1 148 ? -3.567  44.468 2.093  1.00 23.55 ? 149 VAL A HA   1 
ATOM   2025 H HB   . VAL A 1 148 ? -3.142  45.838 4.525  1.00 24.96 ? 149 VAL A HB   1 
ATOM   2026 H HG11 . VAL A 1 148 ? -0.945  46.203 3.853  1.00 28.43 ? 149 VAL A HG11 1 
ATOM   2027 H HG12 . VAL A 1 148 ? -1.209  44.647 4.037  1.00 28.43 ? 149 VAL A HG12 1 
ATOM   2028 H HG13 . VAL A 1 148 ? -1.181  45.281 2.580  1.00 28.43 ? 149 VAL A HG13 1 
ATOM   2029 H HG21 . VAL A 1 148 ? -2.797  47.679 3.158  1.00 31.48 ? 149 VAL A HG21 1 
ATOM   2030 H HG22 . VAL A 1 148 ? -3.072  46.778 1.879  1.00 31.48 ? 149 VAL A HG22 1 
ATOM   2031 H HG23 . VAL A 1 148 ? -4.244  47.071 2.911  1.00 31.48 ? 149 VAL A HG23 1 
ATOM   2032 N N    . ALA A 1 149 ? -3.534  42.862 4.856  1.00 17.14 ? 150 ALA A N    1 
ATOM   2033 C CA   . ALA A 1 149 ? -3.141  41.595 5.425  1.00 20.79 ? 150 ALA A CA   1 
ATOM   2034 C C    . ALA A 1 149 ? -3.632  40.383 4.628  1.00 22.52 ? 150 ALA A C    1 
ATOM   2035 O O    . ALA A 1 149 ? -2.917  39.392 4.478  1.00 28.18 ? 150 ALA A O    1 
ATOM   2036 C CB   . ALA A 1 149 ? -3.644  41.505 6.859  1.00 21.75 ? 150 ALA A CB   1 
ATOM   2037 H H    . ALA A 1 149 ? -4.009  43.357 5.375  1.00 20.57 ? 150 ALA A H    1 
ATOM   2038 H HA   . ALA A 1 149 ? -2.172  41.555 5.451  1.00 24.95 ? 150 ALA A HA   1 
ATOM   2039 H HB1  . ALA A 1 149 ? -3.376  40.651 7.233  1.00 26.10 ? 150 ALA A HB1  1 
ATOM   2040 H HB2  . ALA A 1 149 ? -3.257  42.229 7.375  1.00 26.10 ? 150 ALA A HB2  1 
ATOM   2041 H HB3  . ALA A 1 149 ? -4.611  41.578 6.859  1.00 26.10 ? 150 ALA A HB3  1 
ATOM   2042 N N    . LYS A 1 150 ? -4.859  40.445 4.132  1.00 18.70 ? 151 LYS A N    1 
ATOM   2043 C CA   . LYS A 1 150 ? -5.423  39.327 3.397  1.00 23.32 ? 151 LYS A CA   1 
ATOM   2044 C C    . LYS A 1 150 ? -4.597  39.077 2.120  1.00 27.28 ? 151 LYS A C    1 
ATOM   2045 O O    . LYS A 1 150 ? -4.415  37.926 1.680  1.00 29.29 ? 151 LYS A O    1 
ATOM   2046 C CB   . LYS A 1 150 ? -6.858  39.650 3.040  1.00 22.10 ? 151 LYS A CB   1 
ATOM   2047 C CG   . LYS A 1 150 ? -7.852  39.677 4.199  1.00 23.37 ? 151 LYS A CG   1 
ATOM   2048 C CD   . LYS A 1 150 ? -9.193  40.069 3.609  1.00 34.59 ? 151 LYS A CD   1 
ATOM   2049 C CE   . LYS A 1 150 ? -10.220 40.501 4.609  1.00 34.60 ? 151 LYS A CE   1 
ATOM   2050 N NZ   . LYS A 1 150 ? -11.515 40.687 3.844  1.00 30.59 ? 151 LYS A NZ   1 
ATOM   2051 H H    . LYS A 1 150 ? -5.383  41.122 4.207  1.00 22.45 ? 151 LYS A H    1 
ATOM   2052 H HA   . LYS A 1 150 ? -5.407  38.527 3.946  1.00 27.99 ? 151 LYS A HA   1 
ATOM   2053 H HB2  . LYS A 1 150 ? -6.877  40.525 2.622  1.00 26.52 ? 151 LYS A HB2  1 
ATOM   2054 H HB3  . LYS A 1 150 ? -7.171  38.984 2.407  1.00 26.52 ? 151 LYS A HB3  1 
ATOM   2055 H HG2  . LYS A 1 150 ? -7.924  38.797 4.600  1.00 28.04 ? 151 LYS A HG2  1 
ATOM   2056 H HG3  . LYS A 1 150 ? -7.585  40.341 4.854  1.00 28.04 ? 151 LYS A HG3  1 
ATOM   2057 H HD2  . LYS A 1 150 ? -9.057  40.805 2.993  1.00 41.51 ? 151 LYS A HD2  1 
ATOM   2058 H HD3  . LYS A 1 150 ? -9.554  39.306 3.129  1.00 41.51 ? 151 LYS A HD3  1 
ATOM   2059 H HE2  . LYS A 1 150 ? -10.343 39.813 5.282  1.00 41.52 ? 151 LYS A HE2  1 
ATOM   2060 H HE3  . LYS A 1 150 ? -9.963  41.345 5.011  1.00 41.52 ? 151 LYS A HE3  1 
ATOM   2061 H HZ1  . LYS A 1 150 ? -12.161 40.945 4.398  1.00 36.70 ? 151 LYS A HZ1  1 
ATOM   2062 H HZ2  . LYS A 1 150 ? -11.409 41.306 3.213  1.00 36.70 ? 151 LYS A HZ2  1 
ATOM   2063 H HZ3  . LYS A 1 150 ? -11.753 39.920 3.459  1.00 36.70 ? 151 LYS A HZ3  1 
ATOM   2064 N N    . ARG A 1 151 ? -4.071  40.143 1.522  1.00 19.44 ? 152 ARG A N    1 
ATOM   2065 C CA   . ARG A 1 151 ? -3.327  40.001 0.253  1.00 20.78 ? 152 ARG A CA   1 
ATOM   2066 C C    . ARG A 1 151 ? -2.143  39.070 0.317  1.00 26.21 ? 152 ARG A C    1 
ATOM   2067 O O    . ARG A 1 151 ? -1.805  38.447 -0.659 1.00 22.07 ? 152 ARG A O    1 
ATOM   2068 C CB   . ARG A 1 151 ? -2.719  41.323 -0.222 1.00 23.31 ? 152 ARG A CB   1 
ATOM   2069 C CG   . ARG A 1 151 ? -3.669  42.333 -0.585 1.00 25.81 ? 152 ARG A CG   1 
ATOM   2070 C CD   . ARG A 1 151 ? -2.961  43.551 -1.106 1.00 21.05 ? 152 ARG A CD   1 
ATOM   2071 N NE   . ARG A 1 151 ? -3.971  44.565 -1.300 1.00 25.73 ? 152 ARG A NE   1 
ATOM   2072 C CZ   . ARG A 1 151 ? -3.751  45.864 -1.372 1.00 27.61 ? 152 ARG A CZ   1 
ATOM   2073 N NH1  . ARG A 1 151 ? -2.531  46.345 -1.265 1.00 28.49 ? 152 ARG A NH1  1 
ATOM   2074 N NH2  . ARG A 1 151 ? -4.786  46.671 -1.550 1.00 32.46 ? 152 ARG A NH2  1 
ATOM   2075 H H    . ARG A 1 151 ? -4.124  40.949 1.818  1.00 23.33 ? 152 ARG A H    1 
ATOM   2076 H HA   . ARG A 1 151 ? -3.930  39.679 -0.435 1.00 24.94 ? 152 ARG A HA   1 
ATOM   2077 H HB2  . ARG A 1 151 ? -2.167  41.682 0.490  1.00 27.98 ? 152 ARG A HB2  1 
ATOM   2078 H HB3  . ARG A 1 151 ? -2.168  41.146 -1.001 1.00 27.98 ? 152 ARG A HB3  1 
ATOM   2079 H HG2  . ARG A 1 151 ? -4.252  41.994 -1.282 1.00 30.97 ? 152 ARG A HG2  1 
ATOM   2080 H HG3  . ARG A 1 151 ? -4.185  42.587 0.196  1.00 30.97 ? 152 ARG A HG3  1 
ATOM   2081 H HD2  . ARG A 1 151 ? -2.313  43.866 -0.456 1.00 25.26 ? 152 ARG A HD2  1 
ATOM   2082 H HD3  . ARG A 1 151 ? -2.538  43.355 -1.957 1.00 25.26 ? 152 ARG A HD3  1 
ATOM   2083 H HE   . ARG A 1 151 ? -4.786  44.299 -1.376 1.00 30.87 ? 152 ARG A HE   1 
ATOM   2084 H HH11 . ARG A 1 151 ? -1.867  45.812 -1.149 1.00 34.19 ? 152 ARG A HH11 1 
ATOM   2085 H HH12 . ARG A 1 151 ? -2.398  47.194 -1.313 1.00 34.19 ? 152 ARG A HH12 1 
ATOM   2086 H HH21 . ARG A 1 151 ? -5.578  46.345 -1.618 1.00 38.95 ? 152 ARG A HH21 1 
ATOM   2087 H HH22 . ARG A 1 151 ? -4.664  47.521 -1.600 1.00 38.95 ? 152 ARG A HH22 1 
ATOM   2088 N N    . PHE A 1 152 ? -1.455  39.023 1.454  1.00 28.33 ? 153 PHE A N    1 
ATOM   2089 C CA   . PHE A 1 152 ? -0.115  38.432 1.502  1.00 29.20 ? 153 PHE A CA   1 
ATOM   2090 C C    . PHE A 1 152 ? -0.118  36.974 1.882  1.00 36.64 ? 153 PHE A C    1 
ATOM   2091 O O    . PHE A 1 152 ? 0.947   36.371 2.034  1.00 39.30 ? 153 PHE A O    1 
ATOM   2092 C CB   . PHE A 1 152 ? 0.805   39.218 2.455  1.00 33.14 ? 153 PHE A CB   1 
ATOM   2093 C CG   . PHE A 1 152 ? 1.327   40.479 1.860  1.00 33.17 ? 153 PHE A CG   1 
ATOM   2094 C CD1  . PHE A 1 152 ? 0.615   41.664 1.975  1.00 33.62 ? 153 PHE A CD1  1 
ATOM   2095 C CD2  . PHE A 1 152 ? 2.507   40.472 1.129  1.00 32.35 ? 153 PHE A CD2  1 
ATOM   2096 C CE1  . PHE A 1 152 ? 1.077   42.825 1.389  1.00 33.67 ? 153 PHE A CE1  1 
ATOM   2097 C CE2  . PHE A 1 152 ? 2.983   41.632 0.541  1.00 31.97 ? 153 PHE A CE2  1 
ATOM   2098 C CZ   . PHE A 1 152 ? 2.264   42.813 0.667  1.00 36.14 ? 153 PHE A CZ   1 
ATOM   2099 H H    . PHE A 1 152 ? -1.737  39.324 2.209  1.00 34.00 ? 153 PHE A H    1 
ATOM   2100 H HA   . PHE A 1 152 ? 0.273   38.494 0.615  1.00 35.04 ? 153 PHE A HA   1 
ATOM   2101 H HB2  . PHE A 1 152 ? 0.305   39.449 3.254  1.00 39.77 ? 153 PHE A HB2  1 
ATOM   2102 H HB3  . PHE A 1 152 ? 1.564   38.661 2.690  1.00 39.77 ? 153 PHE A HB3  1 
ATOM   2103 H HD1  . PHE A 1 152 ? -0.185  41.676 2.450  1.00 40.35 ? 153 PHE A HD1  1 
ATOM   2104 H HD2  . PHE A 1 152 ? 2.986   39.681 1.037  1.00 38.82 ? 153 PHE A HD2  1 
ATOM   2105 H HE1  . PHE A 1 152 ? 0.596   43.616 1.481  1.00 40.41 ? 153 PHE A HE1  1 
ATOM   2106 H HE2  . PHE A 1 152 ? 3.780   41.619 0.061  1.00 38.37 ? 153 PHE A HE2  1 
ATOM   2107 H HZ   . PHE A 1 152 ? 2.583   43.597 0.282  1.00 43.37 ? 153 PHE A HZ   1 
ATOM   2108 N N    . SER A 1 153 ? -1.304  36.397 2.018  1.00 33.56 ? 154 SER A N    1 
ATOM   2109 C CA   . SER A 1 153 ? -1.389  34.991 2.403  1.00 34.05 ? 154 SER A CA   1 
ATOM   2110 C C    . SER A 1 153 ? -2.300  34.179 1.483  1.00 41.37 ? 154 SER A C    1 
ATOM   2111 O O    . SER A 1 153 ? -2.804  33.131 1.872  1.00 40.60 ? 154 SER A O    1 
ATOM   2112 C CB   . SER A 1 153 ? -1.816  34.870 3.878  1.00 35.96 ? 154 SER A CB   1 
ATOM   2113 O OG   . SER A 1 153 ? -2.954  35.666 4.148  1.00 36.89 ? 154 SER A OG   1 
ATOM   2114 H H    . SER A 1 153 ? -2.062  36.786 1.897  1.00 40.27 ? 154 SER A H    1 
ATOM   2115 H HA   . SER A 1 153 ? -0.501  34.607 2.333  1.00 40.86 ? 154 SER A HA   1 
ATOM   2116 H HB2  . SER A 1 153 ? -2.028  33.943 4.069  1.00 43.15 ? 154 SER A HB2  1 
ATOM   2117 H HB3  . SER A 1 153 ? -1.085  35.165 4.443  1.00 43.15 ? 154 SER A HB3  1 
ATOM   2118 H HG   . SER A 1 153 ? -3.174  35.589 4.956  1.00 44.26 ? 154 SER A HG   1 
ATOM   2119 N N    . VAL A 1 154 ? -2.509  34.636 0.255  1.00 35.53 ? 155 VAL A N    1 
ATOM   2120 C CA   . VAL A 1 154 ? -3.391  33.890 -0.638 1.00 33.90 ? 155 VAL A CA   1 
ATOM   2121 C C    . VAL A 1 154 ? -2.802  32.562 -1.121 1.00 28.47 ? 155 VAL A C    1 
ATOM   2122 O O    . VAL A 1 154 ? -3.497  31.541 -1.113 1.00 39.48 ? 155 VAL A O    1 
ATOM   2123 C CB   . VAL A 1 154 ? -3.796  34.700 -1.871 1.00 31.68 ? 155 VAL A CB   1 
ATOM   2124 C CG1  . VAL A 1 154 ? -4.718  33.853 -2.750 1.00 35.94 ? 155 VAL A CG1  1 
ATOM   2125 C CG2  . VAL A 1 154 ? -4.484  36.011 -1.444 1.00 32.03 ? 155 VAL A CG2  1 
ATOM   2126 H H    . VAL A 1 154 ? -2.166  35.350 -0.079 1.00 42.64 ? 155 VAL A H    1 
ATOM   2127 H HA   . VAL A 1 154 ? -4.204  33.682 -0.152 1.00 40.67 ? 155 VAL A HA   1 
ATOM   2128 H HB   . VAL A 1 154 ? -3.004  34.923 -2.384 1.00 38.02 ? 155 VAL A HB   1 
ATOM   2129 H HG11 . VAL A 1 154 ? -4.972  34.370 -3.530 1.00 43.13 ? 155 VAL A HG11 1 
ATOM   2130 H HG12 . VAL A 1 154 ? -4.244  33.052 -3.023 1.00 43.13 ? 155 VAL A HG12 1 
ATOM   2131 H HG13 . VAL A 1 154 ? -5.507  33.613 -2.240 1.00 43.13 ? 155 VAL A HG13 1 
ATOM   2132 H HG21 . VAL A 1 154 ? -4.733  36.509 -2.238 1.00 38.44 ? 155 VAL A HG21 1 
ATOM   2133 H HG22 . VAL A 1 154 ? -5.275  35.797 -0.925 1.00 38.44 ? 155 VAL A HG22 1 
ATOM   2134 H HG23 . VAL A 1 154 ? -3.866  36.531 -0.907 1.00 38.44 ? 155 VAL A HG23 1 
ATOM   2135 N N    . VAL A 1 155 ? -1.538  32.564 -1.538 1.00 35.96 ? 156 VAL A N    1 
ATOM   2136 C CA   . VAL A 1 155 ? -0.946  31.373 -2.181 1.00 35.11 ? 156 VAL A CA   1 
ATOM   2137 C C    . VAL A 1 155 ? -0.223  30.411 -1.223 1.00 44.56 ? 156 VAL A C    1 
ATOM   2138 O O    . VAL A 1 155 ? 0.425   30.843 -0.274 1.00 43.02 ? 156 VAL A O    1 
ATOM   2139 C CB   . VAL A 1 155 ? 0.047   31.773 -3.285 1.00 39.61 ? 156 VAL A CB   1 
ATOM   2140 C CG1  . VAL A 1 155 ? 0.720   30.534 -3.884 1.00 40.79 ? 156 VAL A CG1  1 
ATOM   2141 C CG2  . VAL A 1 155 ? -0.681  32.551 -4.369 1.00 41.06 ? 156 VAL A CG2  1 
ATOM   2142 H H    . VAL A 1 155 ? -1.001  33.231 -1.465 1.00 43.16 ? 156 VAL A H    1 
ATOM   2143 H HA   . VAL A 1 155 ? -1.661  30.872 -2.605 1.00 42.13 ? 156 VAL A HA   1 
ATOM   2144 H HB   . VAL A 1 155 ? 0.735   32.343 -2.908 1.00 47.54 ? 156 VAL A HB   1 
ATOM   2145 H HG11 . VAL A 1 155 ? 1.339   30.814 -4.575 1.00 48.95 ? 156 VAL A HG11 1 
ATOM   2146 H HG12 . VAL A 1 155 ? 1.197   30.064 -3.182 1.00 48.95 ? 156 VAL A HG12 1 
ATOM   2147 H HG13 . VAL A 1 155 ? 0.038   29.957 -4.264 1.00 48.95 ? 156 VAL A HG13 1 
ATOM   2148 H HG21 . VAL A 1 155 ? -0.046  32.798 -5.060 1.00 49.28 ? 156 VAL A HG21 1 
ATOM   2149 H HG22 . VAL A 1 155 ? -1.378  31.991 -4.745 1.00 49.28 ? 156 VAL A HG22 1 
ATOM   2150 H HG23 . VAL A 1 155 ? -1.071  33.348 -3.977 1.00 49.28 ? 156 VAL A HG23 1 
ATOM   2151 N N    . HIS A 1 156 ? -0.315  29.115 -1.541 1.00 47.30 ? 157 HIS A N    1 
ATOM   2152 C CA   . HIS A 1 156 ? 0.152   28.006 -0.696 1.00 49.80 ? 157 HIS A CA   1 
ATOM   2153 C C    . HIS A 1 156 ? 1.620   27.607 -0.960 1.00 44.16 ? 157 HIS A C    1 
ATOM   2154 O O    . HIS A 1 156 ? 1.935   27.119 -2.037 1.00 42.76 ? 157 HIS A O    1 
ATOM   2155 C CB   . HIS A 1 156 ? -0.743  26.790 -0.973 1.00 55.71 ? 157 HIS A CB   1 
ATOM   2156 C CG   . HIS A 1 156 ? -0.915  25.877 0.200  1.00 59.41 ? 157 HIS A CG   1 
ATOM   2157 N ND1  . HIS A 1 156 ? 0.147   25.284 0.846  1.00 64.76 ? 157 HIS A ND1  1 
ATOM   2158 C CD2  . HIS A 1 156 ? -2.032  25.444 0.834  1.00 57.41 ? 157 HIS A CD2  1 
ATOM   2159 C CE1  . HIS A 1 156 ? -0.304  24.530 1.833  1.00 60.86 ? 157 HIS A CE1  1 
ATOM   2160 N NE2  . HIS A 1 156 ? -1.624  24.610 1.848  1.00 57.60 ? 157 HIS A NE2  1 
ATOM   2161 H H    . HIS A 1 156 ? -0.662  28.841 -2.279 1.00 56.76 ? 157 HIS A H    1 
ATOM   2162 H HA   . HIS A 1 156 ? 0.061   28.249 0.239  1.00 59.76 ? 157 HIS A HA   1 
ATOM   2163 H HB2  . HIS A 1 156 ? -1.622  27.104 -1.235 1.00 66.85 ? 157 HIS A HB2  1 
ATOM   2164 H HB3  . HIS A 1 156 ? -0.351  26.273 -1.694 1.00 66.85 ? 157 HIS A HB3  1 
ATOM   2165 H HD2  . HIS A 1 156 ? -2.909  25.672 0.626  1.00 68.90 ? 157 HIS A HD2  1 
ATOM   2166 H HE1  . HIS A 1 156 ? 0.217   24.029 2.418  1.00 73.03 ? 157 HIS A HE1  1 
ATOM   2167 H HE2  . HIS A 1 156 ? -2.143  24.206 2.402  1.00 69.12 ? 157 HIS A HE2  1 
ATOM   2168 N N    . PRO A 1 157 ? 2.518   27.792 0.025  1.00 41.98 ? 158 PRO A N    1 
ATOM   2169 C CA   . PRO A 1 157 ? 3.932   27.386 -0.102 1.00 42.72 ? 158 PRO A CA   1 
ATOM   2170 C C    . PRO A 1 157 ? 4.144   25.882 -0.302 1.00 43.86 ? 158 PRO A C    1 
ATOM   2171 O O    . PRO A 1 157 ? 3.278   25.099 0.086  1.00 41.89 ? 158 PRO A O    1 
ATOM   2172 C CB   . PRO A 1 157 ? 4.537   27.815 1.241  1.00 39.84 ? 158 PRO A CB   1 
ATOM   2173 C CG   . PRO A 1 157 ? 3.642   28.867 1.748  1.00 39.33 ? 158 PRO A CG   1 
ATOM   2174 C CD   . PRO A 1 157 ? 2.273   28.522 1.278  1.00 40.57 ? 158 PRO A CD   1 
ATOM   2175 H HA   . PRO A 1 157 ? 4.363   27.873 -0.822 1.00 51.26 ? 158 PRO A HA   1 
ATOM   2176 H HB2  . PRO A 1 157 ? 4.556   27.059 1.848  1.00 47.81 ? 158 PRO A HB2  1 
ATOM   2177 H HB3  . PRO A 1 157 ? 5.432   28.164 1.100  1.00 47.81 ? 158 PRO A HB3  1 
ATOM   2178 H HG2  . PRO A 1 157 ? 3.675   28.880 2.717  1.00 47.19 ? 158 PRO A HG2  1 
ATOM   2179 H HG3  . PRO A 1 157 ? 3.917   29.725 1.388  1.00 47.19 ? 158 PRO A HG3  1 
ATOM   2180 H HD2  . PRO A 1 157 ? 1.829   27.949 1.922  1.00 48.68 ? 158 PRO A HD2  1 
ATOM   2181 H HD3  . PRO A 1 157 ? 1.761   29.328 1.105  1.00 48.68 ? 158 PRO A HD3  1 
ATOM   2182 N N    . ASN A 1 158 ? 5.270   25.489 -0.905 1.00 40.61 ? 159 ASN A N    1 
ATOM   2183 C CA   . ASN A 1 158 ? 5.661   24.082 -0.954 1.00 39.38 ? 159 ASN A CA   1 
ATOM   2184 C C    . ASN A 1 158 ? 6.122   23.653 0.425  1.00 40.72 ? 159 ASN A C    1 
ATOM   2185 O O    . ASN A 1 158 ? 7.064   24.220 0.981  1.00 43.35 ? 159 ASN A O    1 
ATOM   2186 C CB   . ASN A 1 158 ? 6.804   23.829 -1.940 1.00 46.56 ? 159 ASN A CB   1 
ATOM   2187 C CG   . ASN A 1 158 ? 6.326   23.530 -3.347 1.00 55.04 ? 159 ASN A CG   1 
ATOM   2188 O OD1  . ASN A 1 158 ? 5.125   23.481 -3.620 1.00 55.15 ? 159 ASN A OD1  1 
ATOM   2189 N ND2  . ASN A 1 158 ? 7.280   23.320 -4.255 1.00 57.35 ? 159 ASN A ND2  1 
ATOM   2190 H H    . ASN A 1 158 ? 5.824   26.021 -1.293 1.00 48.73 ? 159 ASN A H    1 
ATOM   2191 H HA   . ASN A 1 158 ? 4.900   23.538 -1.211 1.00 47.26 ? 159 ASN A HA   1 
ATOM   2192 H HB2  . ASN A 1 158 ? 7.367   24.618 -1.977 1.00 55.87 ? 159 ASN A HB2  1 
ATOM   2193 H HB3  . ASN A 1 158 ? 7.321   23.068 -1.632 1.00 55.87 ? 159 ASN A HB3  1 
ATOM   2194 H HD21 . ASN A 1 158 ? 7.067   23.146 -5.070 1.00 68.83 ? 159 ASN A HD21 1 
ATOM   2195 H HD22 . ASN A 1 158 ? 8.108   23.358 -4.026 1.00 68.83 ? 159 ASN A HD22 1 
ATOM   2196 N N    . SER A 1 159 ? 5.446   22.655 0.980  1.00 38.15 ? 160 SER A N    1 
ATOM   2197 C CA   . SER A 1 159 ? 5.807   22.126 2.287  1.00 37.79 ? 160 SER A CA   1 
ATOM   2198 C C    . SER A 1 159 ? 5.463   20.642 2.361  1.00 38.10 ? 160 SER A C    1 
ATOM   2199 O O    . SER A 1 159 ? 4.475   20.209 1.779  1.00 41.36 ? 160 SER A O    1 
ATOM   2200 C CB   . SER A 1 159 ? 5.070   22.864 3.399  1.00 37.83 ? 160 SER A CB   1 
ATOM   2201 O OG   . SER A 1 159 ? 5.435   22.305 4.647  1.00 40.05 ? 160 SER A OG   1 
ATOM   2202 H H    . SER A 1 159 ? 4.770   22.265 0.618  1.00 45.78 ? 160 SER A H    1 
ATOM   2203 H HA   . SER A 1 159 ? 6.761   22.229 2.427  1.00 45.35 ? 160 SER A HA   1 
ATOM   2204 H HB2  . SER A 1 159 ? 5.318   23.802 3.382  1.00 45.39 ? 160 SER A HB2  1 
ATOM   2205 H HB3  . SER A 1 159 ? 4.113   22.766 3.271  1.00 45.39 ? 160 SER A HB3  1 
ATOM   2206 H HG   . SER A 1 159 ? 5.035   22.704 5.269  1.00 48.06 ? 160 SER A HG   1 
ATOM   2207 N N    . PRO A 1 160 ? 6.281   19.859 3.076  1.00 42.55 ? 161 PRO A N    1 
ATOM   2208 C CA   . PRO A 1 160 ? 5.975   18.446 3.333  1.00 45.44 ? 161 PRO A CA   1 
ATOM   2209 C C    . PRO A 1 160 ? 4.971   18.266 4.466  1.00 47.36 ? 161 PRO A C    1 
ATOM   2210 O O    . PRO A 1 160 ? 4.454   17.164 4.666  1.00 46.83 ? 161 PRO A O    1 
ATOM   2211 C CB   . PRO A 1 160 ? 7.328   17.879 3.754  1.00 47.83 ? 161 PRO A CB   1 
ATOM   2212 C CG   . PRO A 1 160 ? 8.031   19.053 4.372  1.00 47.81 ? 161 PRO A CG   1 
ATOM   2213 C CD   . PRO A 1 160 ? 7.635   20.216 3.528  1.00 45.60 ? 161 PRO A CD   1 
ATOM   2214 H HA   . PRO A 1 160 ? 5.661   18.002 2.530  1.00 54.53 ? 161 PRO A HA   1 
ATOM   2215 H HB2  . PRO A 1 160 ? 7.202   17.169 4.403  1.00 57.39 ? 161 PRO A HB2  1 
ATOM   2216 H HB3  . PRO A 1 160 ? 7.809   17.557 2.976  1.00 57.39 ? 161 PRO A HB3  1 
ATOM   2217 H HG2  . PRO A 1 160 ? 7.730   19.172 5.286  1.00 57.38 ? 161 PRO A HG2  1 
ATOM   2218 H HG3  . PRO A 1 160 ? 8.991   18.915 4.340  1.00 57.38 ? 161 PRO A HG3  1 
ATOM   2219 H HD2  . PRO A 1 160 ? 7.611   21.028 4.059  1.00 54.72 ? 161 PRO A HD2  1 
ATOM   2220 H HD3  . PRO A 1 160 ? 8.233   20.304 2.770  1.00 54.72 ? 161 PRO A HD3  1 
ATOM   2221 N N    . GLN A 1 161 ? 4.724   19.349 5.196  1.00 42.73 ? 162 GLN A N    1 
ATOM   2222 C CA   . GLN A 1 161 ? 3.821   19.360 6.337  1.00 42.93 ? 162 GLN A CA   1 
ATOM   2223 C C    . GLN A 1 161 ? 2.614   20.215 5.938  1.00 37.21 ? 162 GLN A C    1 
ATOM   2224 O O    . GLN A 1 161 ? 2.769   21.175 5.189  1.00 34.89 ? 162 GLN A O    1 
ATOM   2225 C CB   . GLN A 1 161 ? 4.576   19.936 7.546  1.00 50.92 ? 162 GLN A CB   1 
ATOM   2226 C CG   . GLN A 1 161 ? 3.771   20.061 8.808  1.00 58.92 ? 162 GLN A CG   1 
ATOM   2227 C CD   . GLN A 1 161 ? 4.561   19.756 10.080 1.00 62.14 ? 162 GLN A CD   1 
ATOM   2228 O OE1  . GLN A 1 161 ? 3.988   19.349 11.095 1.00 54.83 ? 162 GLN A OE1  1 
ATOM   2229 N NE2  . GLN A 1 161 ? 5.877   19.954 10.033 1.00 67.02 ? 162 GLN A NE2  1 
ATOM   2230 H H    . GLN A 1 161 ? 5.082   20.115 5.041  1.00 51.27 ? 162 GLN A H    1 
ATOM   2231 H HA   . GLN A 1 161 ? 3.524   18.459 6.541  1.00 51.51 ? 162 GLN A HA   1 
ATOM   2232 H HB2  . GLN A 1 161 ? 5.332   19.359 7.739  1.00 61.10 ? 162 GLN A HB2  1 
ATOM   2233 H HB3  . GLN A 1 161 ? 4.895   20.822 7.316  1.00 61.10 ? 162 GLN A HB3  1 
ATOM   2234 H HG2  . GLN A 1 161 ? 3.438   20.969 8.877  1.00 70.71 ? 162 GLN A HG2  1 
ATOM   2235 H HG3  . GLN A 1 161 ? 3.027   19.440 8.766  1.00 70.71 ? 162 GLN A HG3  1 
ATOM   2236 H HE21 . GLN A 1 161 ? 6.243   20.241 9.310  1.00 80.42 ? 162 GLN A HE21 1 
ATOM   2237 H HE22 . GLN A 1 161 ? 6.361   19.796 10.726 1.00 80.42 ? 162 GLN A HE22 1 
ATOM   2238 N N    . ARG A 1 162 ? 1.409   19.851 6.379  1.00 31.10 ? 163 ARG A N    1 
ATOM   2239 C CA   . ARG A 1 162 ? 0.228   20.640 6.036  1.00 27.47 ? 163 ARG A CA   1 
ATOM   2240 C C    . ARG A 1 162 ? 0.314   22.012 6.695  1.00 24.83 ? 163 ARG A C    1 
ATOM   2241 O O    . ARG A 1 162 ? 0.580   22.110 7.901  1.00 24.99 ? 163 ARG A O    1 
ATOM   2242 C CB   . ARG A 1 162 ? -1.074  19.950 6.472  1.00 32.10 ? 163 ARG A CB   1 
ATOM   2243 C CG   . ARG A 1 162 ? -1.481  18.714 5.661  1.00 48.97 ? 163 ARG A CG   1 
ATOM   2244 C CD   . ARG A 1 162 ? -2.870  18.175 6.069  1.00 63.20 ? 163 ARG A CD   1 
ATOM   2245 N NE   . ARG A 1 162 ? -3.972  19.035 5.627  1.00 74.07 ? 163 ARG A NE   1 
ATOM   2246 C CZ   . ARG A 1 162 ? -5.242  18.891 6.002  1.00 77.88 ? 163 ARG A CZ   1 
ATOM   2247 N NH1  . ARG A 1 162 ? -5.593  17.922 6.838  1.00 77.61 ? 163 ARG A NH1  1 
ATOM   2248 N NH2  . ARG A 1 162 ? -6.166  19.724 5.541  1.00 79.15 ? 163 ARG A NH2  1 
ATOM   2249 H H    . ARG A 1 162 ? 1.251   19.163 6.870  1.00 37.32 ? 163 ARG A H    1 
ATOM   2250 H HA   . ARG A 1 162 ? 0.197   20.766 5.075  1.00 32.97 ? 163 ARG A HA   1 
ATOM   2251 H HB2  . ARG A 1 162 ? -0.977  19.671 7.396  1.00 38.52 ? 163 ARG A HB2  1 
ATOM   2252 H HB3  . ARG A 1 162 ? -1.797  20.593 6.404  1.00 38.52 ? 163 ARG A HB3  1 
ATOM   2253 H HG2  . ARG A 1 162 ? -1.513  18.949 4.720  1.00 58.76 ? 163 ARG A HG2  1 
ATOM   2254 H HG3  . ARG A 1 162 ? -0.830  18.010 5.806  1.00 58.76 ? 163 ARG A HG3  1 
ATOM   2255 H HD2  . ARG A 1 162 ? -2.997  17.299 5.672  1.00 75.84 ? 163 ARG A HD2  1 
ATOM   2256 H HD3  . ARG A 1 162 ? -2.911  18.109 7.036  1.00 75.84 ? 163 ARG A HD3  1 
ATOM   2257 H HE   . ARG A 1 162 ? -3.785  19.678 5.087  1.00 88.88 ? 163 ARG A HE   1 
ATOM   2258 H HH11 . ARG A 1 162 ? -4.999  17.379 7.140  1.00 93.13 ? 163 ARG A HH11 1 
ATOM   2259 H HH12 . ARG A 1 162 ? -6.415  17.837 7.076  1.00 93.13 ? 163 ARG A HH12 1 
ATOM   2260 H HH21 . ARG A 1 162 ? -5.945  20.355 5.000  1.00 94.98 ? 163 ARG A HH21 1 
ATOM   2261 H HH22 . ARG A 1 162 ? -6.986  19.633 5.784  1.00 94.98 ? 163 ARG A HH22 1 
ATOM   2262 N N    . LEU A 1 163 ? 0.097   23.060 5.901  1.00 24.97 ? 164 LEU A N    1 
ATOM   2263 C CA   . LEU A 1 163 ? 0.017   24.430 6.394  1.00 20.50 ? 164 LEU A CA   1 
ATOM   2264 C C    . LEU A 1 163 ? -1.393  24.946 6.213  1.00 22.47 ? 164 LEU A C    1 
ATOM   2265 O O    . LEU A 1 163 ? -2.101  24.534 5.283  1.00 26.32 ? 164 LEU A O    1 
ATOM   2266 C CB   . LEU A 1 163 ? 0.957   25.344 5.618  1.00 19.73 ? 164 LEU A CB   1 
ATOM   2267 C CG   . LEU A 1 163 ? 2.436   24.998 5.576  1.00 22.14 ? 164 LEU A CG   1 
ATOM   2268 C CD1  . LEU A 1 163 ? 3.127   25.963 4.633  1.00 26.11 ? 164 LEU A CD1  1 
ATOM   2269 C CD2  . LEU A 1 163 ? 3.047   25.083 6.939  1.00 31.48 ? 164 LEU A CD2  1 
ATOM   2270 H H    . LEU A 1 163 ? -0.010  22.998 5.050  1.00 29.97 ? 164 LEU A H    1 
ATOM   2271 H HA   . LEU A 1 163 ? 0.248   24.461 7.336  1.00 24.60 ? 164 LEU A HA   1 
ATOM   2272 H HB2  . LEU A 1 163 ? 0.650   25.372 4.699  1.00 23.67 ? 164 LEU A HB2  1 
ATOM   2273 H HB3  . LEU A 1 163 ? 0.888   26.233 6.000  1.00 23.67 ? 164 LEU A HB3  1 
ATOM   2274 H HG   . LEU A 1 163 ? 2.552   24.096 5.238  1.00 26.57 ? 164 LEU A HG   1 
ATOM   2275 H HD11 . LEU A 1 163 ? 4.073   25.749 4.600  1.00 31.33 ? 164 LEU A HD11 1 
ATOM   2276 H HD12 . LEU A 1 163 ? 2.736   25.875 3.750  1.00 31.33 ? 164 LEU A HD12 1 
ATOM   2277 H HD13 . LEU A 1 163 ? 3.003   26.867 4.961  1.00 31.33 ? 164 LEU A HD13 1 
ATOM   2278 H HD21 . LEU A 1 163 ? 3.988   24.858 6.878  1.00 37.78 ? 164 LEU A HD21 1 
ATOM   2279 H HD22 . LEU A 1 163 ? 2.944   25.988 7.275  1.00 37.78 ? 164 LEU A HD22 1 
ATOM   2280 H HD23 . LEU A 1 163 ? 2.594   24.458 7.527  1.00 37.78 ? 164 LEU A HD23 1 
ATOM   2281 N N    . LYS A 1 164 ? -1.804  25.838 7.107  1.00 20.14 ? 165 LYS A N    1 
ATOM   2282 C CA   . LYS A 1 164 ? -3.108  26.475 7.034  1.00 22.83 ? 165 LYS A CA   1 
ATOM   2283 C C    . LYS A 1 164 ? -2.933  27.979 7.059  1.00 19.56 ? 165 LYS A C    1 
ATOM   2284 O O    . LYS A 1 164 ? -2.052  28.513 7.730  1.00 19.53 ? 165 LYS A O    1 
ATOM   2285 C CB   . LYS A 1 164 ? -3.985  26.047 8.211  1.00 25.40 ? 165 LYS A CB   1 
ATOM   2286 C CG   . LYS A 1 164 ? -4.149  24.555 8.342  1.00 29.55 ? 165 LYS A CG   1 
ATOM   2287 C CD   . LYS A 1 164 ? -4.724  23.939 7.085  1.00 36.97 ? 165 LYS A CD   1 
ATOM   2288 C CE   . LYS A 1 164 ? -6.216  24.130 6.977  1.00 42.18 ? 165 LYS A CE   1 
ATOM   2289 N NZ   . LYS A 1 164 ? -6.729  23.320 5.833  1.00 43.91 ? 165 LYS A NZ   1 
ATOM   2290 H H    . LYS A 1 164 ? -1.333  26.094 7.780  1.00 24.17 ? 165 LYS A H    1 
ATOM   2291 H HA   . LYS A 1 164 ? -3.550  26.226 6.208  1.00 27.39 ? 165 LYS A HA   1 
ATOM   2292 H HB2  . LYS A 1 164 ? -3.586  26.374 9.032  1.00 30.48 ? 165 LYS A HB2  1 
ATOM   2293 H HB3  . LYS A 1 164 ? -4.868  26.433 8.098  1.00 30.48 ? 165 LYS A HB3  1 
ATOM   2294 H HG2  . LYS A 1 164 ? -3.283  24.152 8.508  1.00 35.46 ? 165 LYS A HG2  1 
ATOM   2295 H HG3  . LYS A 1 164 ? -4.754  24.364 9.076  1.00 35.46 ? 165 LYS A HG3  1 
ATOM   2296 H HD2  . LYS A 1 164 ? -4.311  24.355 6.312  1.00 44.36 ? 165 LYS A HD2  1 
ATOM   2297 H HD3  . LYS A 1 164 ? -4.542  22.986 7.087  1.00 44.36 ? 165 LYS A HD3  1 
ATOM   2298 H HE2  . LYS A 1 164 ? -6.645  23.826 7.792  1.00 50.62 ? 165 LYS A HE2  1 
ATOM   2299 H HE3  . LYS A 1 164 ? -6.416  25.065 6.812  1.00 50.62 ? 165 LYS A HE3  1 
ATOM   2300 H HZ1  . LYS A 1 164 ? -7.610  23.424 5.758  1.00 52.69 ? 165 LYS A HZ1  1 
ATOM   2301 H HZ2  . LYS A 1 164 ? -6.341  23.583 5.077  1.00 52.69 ? 165 LYS A HZ2  1 
ATOM   2302 H HZ3  . LYS A 1 164 ? -6.550  22.459 5.966  1.00 52.69 ? 165 LYS A HZ3  1 
ATOM   2303 N N    . ARG A 1 165 ? -3.778  28.654 6.299  1.00 21.22 ? 166 ARG A N    1 
ATOM   2304 C CA   . ARG A 1 165 ? -3.814  30.108 6.258  1.00 19.29 ? 166 ARG A CA   1 
ATOM   2305 C C    . ARG A 1 165 ? -4.440  30.622 7.535  1.00 19.93 ? 166 ARG A C    1 
ATOM   2306 O O    . ARG A 1 165 ? -5.546  30.224 7.917  1.00 21.22 ? 166 ARG A O    1 
ATOM   2307 C CB   . ARG A 1 165 ? -4.657  30.529 5.054  1.00 26.25 ? 166 ARG A CB   1 
ATOM   2308 C CG   . ARG A 1 165 ? -4.524  31.970 4.640  1.00 31.47 ? 166 ARG A CG   1 
ATOM   2309 C CD   . ARG A 1 165 ? -5.118  32.132 3.217  1.00 33.74 ? 166 ARG A CD   1 
ATOM   2310 N NE   . ARG A 1 165 ? -4.848  33.460 2.679  1.00 44.44 ? 166 ARG A NE   1 
ATOM   2311 C CZ   . ARG A 1 165 ? -5.646  34.510 2.841  1.00 39.81 ? 166 ARG A CZ   1 
ATOM   2312 N NH1  . ARG A 1 165 ? -6.800  34.386 3.480  1.00 44.34 ? 166 ARG A NH1  1 
ATOM   2313 N NH2  . ARG A 1 165 ? -5.296  35.680 2.331  1.00 26.54 ? 166 ARG A NH2  1 
ATOM   2314 H H    . ARG A 1 165 ? -4.358  28.283 5.783  1.00 25.46 ? 166 ARG A H    1 
ATOM   2315 H HA   . ARG A 1 165 ? -2.918  30.468 6.169  1.00 23.15 ? 166 ARG A HA   1 
ATOM   2316 H HB2  . ARG A 1 165 ? -4.401  29.984 4.294  1.00 31.50 ? 166 ARG A HB2  1 
ATOM   2317 H HB3  . ARG A 1 165 ? -5.591  30.373 5.265  1.00 31.50 ? 166 ARG A HB3  1 
ATOM   2318 H HG2  . ARG A 1 165 ? -5.019  32.536 5.253  1.00 37.76 ? 166 ARG A HG2  1 
ATOM   2319 H HG3  . ARG A 1 165 ? -3.587  32.221 4.619  1.00 37.76 ? 166 ARG A HG3  1 
ATOM   2320 H HD2  . ARG A 1 165 ? -4.717  31.477 2.625  1.00 40.49 ? 166 ARG A HD2  1 
ATOM   2321 H HD3  . ARG A 1 165 ? -6.079  32.009 3.255  1.00 40.49 ? 166 ARG A HD3  1 
ATOM   2322 H HE   . ARG A 1 165 ? -4.125  33.571 2.227  1.00 53.33 ? 166 ARG A HE   1 
ATOM   2323 H HH11 . ARG A 1 165 ? -7.026  33.627 3.815  1.00 53.20 ? 166 ARG A HH11 1 
ATOM   2324 H HH12 . ARG A 1 165 ? -7.315  35.068 3.573  1.00 53.20 ? 166 ARG A HH12 1 
ATOM   2325 H HH21 . ARG A 1 165 ? -4.552  35.759 1.906  1.00 31.84 ? 166 ARG A HH21 1 
ATOM   2326 H HH22 . ARG A 1 165 ? -5.816  36.360 2.416  1.00 31.84 ? 166 ARG A HH22 1 
ATOM   2327 N N    . VAL A 1 166 ? -3.711  31.489 8.222  1.00 17.89 ? 167 VAL A N    1 
ATOM   2328 C CA   . VAL A 1 166 ? -4.232  32.091 9.433  1.00 16.85 ? 167 VAL A CA   1 
ATOM   2329 C C    . VAL A 1 166 ? -4.245  33.607 9.293  1.00 15.86 ? 167 VAL A C    1 
ATOM   2330 O O    . VAL A 1 166 ? -3.256  34.204 8.845  1.00 15.95 ? 167 VAL A O    1 
ATOM   2331 C CB   . VAL A 1 166 ? -3.397  31.705 10.656 1.00 18.73 ? 167 VAL A CB   1 
ATOM   2332 C CG1  . VAL A 1 166 ? -3.923  32.396 11.906 1.00 19.88 ? 167 VAL A CG1  1 
ATOM   2333 C CG2  . VAL A 1 166 ? -3.373  30.175 10.799 1.00 19.42 ? 167 VAL A CG2  1 
ATOM   2334 H H    . VAL A 1 166 ? -2.918  31.744 8.008  1.00 21.46 ? 167 VAL A H    1 
ATOM   2335 H HA   . VAL A 1 166 ? -5.142  31.789 9.577  1.00 20.22 ? 167 VAL A HA   1 
ATOM   2336 H HB   . VAL A 1 166 ? -2.484  32.003 10.516 1.00 22.48 ? 167 VAL A HB   1 
ATOM   2337 H HG11 . VAL A 1 166 ? -3.377  32.135 12.664 1.00 23.85 ? 167 VAL A HG11 1 
ATOM   2338 H HG12 . VAL A 1 166 ? -3.877  33.356 11.780 1.00 23.85 ? 167 VAL A HG12 1 
ATOM   2339 H HG13 . VAL A 1 166 ? -4.843  32.125 12.052 1.00 23.85 ? 167 VAL A HG13 1 
ATOM   2340 H HG21 . VAL A 1 166 ? -2.841  29.940 11.576 1.00 23.30 ? 167 VAL A HG21 1 
ATOM   2341 H HG22 . VAL A 1 166 ? -4.281  29.855 10.909 1.00 23.30 ? 167 VAL A HG22 1 
ATOM   2342 H HG23 . VAL A 1 166 ? -2.980  29.790 10.000 1.00 23.30 ? 167 VAL A HG23 1 
ATOM   2343 N N    . LEU A 1 167 ? -5.372  34.213 9.649  1.00 14.26 ? 168 LEU A N    1 
ATOM   2344 C CA   . LEU A 1 167 ? -5.427  35.664 9.752  1.00 15.36 ? 168 LEU A CA   1 
ATOM   2345 C C    . LEU A 1 167 ? -5.444  36.057 11.212 1.00 14.28 ? 168 LEU A C    1 
ATOM   2346 O O    . LEU A 1 167 ? -6.286  35.595 11.990 1.00 16.61 ? 168 LEU A O    1 
ATOM   2347 C CB   . LEU A 1 167 ? -6.645  36.238 9.023  1.00 16.55 ? 168 LEU A CB   1 
ATOM   2348 C CG   . LEU A 1 167 ? -6.769  35.845 7.542  1.00 25.32 ? 168 LEU A CG   1 
ATOM   2349 C CD1  . LEU A 1 167 ? -7.999  36.511 6.883  1.00 29.48 ? 168 LEU A CD1  1 
ATOM   2350 C CD2  . LEU A 1 167 ? -5.541  36.176 6.758  1.00 27.75 ? 168 LEU A CD2  1 
ATOM   2351 H H    . LEU A 1 167 ? -6.110  33.812 9.835  1.00 17.11 ? 168 LEU A H    1 
ATOM   2352 H HA   . LEU A 1 167 ? -4.629  36.041 9.348  1.00 18.43 ? 168 LEU A HA   1 
ATOM   2353 H HB2  . LEU A 1 167 ? -7.446  35.930 9.475  1.00 19.86 ? 168 LEU A HB2  1 
ATOM   2354 H HB3  . LEU A 1 167 ? -6.600  37.206 9.065  1.00 19.86 ? 168 LEU A HB3  1 
ATOM   2355 H HG   . LEU A 1 167 ? -6.897  34.885 7.490  1.00 30.38 ? 168 LEU A HG   1 
ATOM   2356 H HD11 . LEU A 1 167 ? -8.043  36.240 5.953  1.00 35.37 ? 168 LEU A HD11 1 
ATOM   2357 H HD12 . LEU A 1 167 ? -8.799  36.225 7.350  1.00 35.37 ? 168 LEU A HD12 1 
ATOM   2358 H HD13 . LEU A 1 167 ? -7.906  37.474 6.944  1.00 35.37 ? 168 LEU A HD13 1 
ATOM   2359 H HD21 . LEU A 1 167 ? -5.674  35.908 5.835  1.00 33.30 ? 168 LEU A HD21 1 
ATOM   2360 H HD22 . LEU A 1 167 ? -5.384  37.132 6.806  1.00 33.30 ? 168 LEU A HD22 1 
ATOM   2361 H HD23 . LEU A 1 167 ? -4.787  35.697 7.137  1.00 33.30 ? 168 LEU A HD23 1 
ATOM   2362 N N    . PHE A 1 168 ? -4.474  36.894 11.567 1.00 13.60 ? 169 PHE A N    1 
ATOM   2363 C CA   . PHE A 1 168 ? -4.329  37.423 12.910 1.00 12.71 ? 169 PHE A CA   1 
ATOM   2364 C C    . PHE A 1 168 ? -4.916  38.813 13.068 1.00 13.25 ? 169 PHE A C    1 
ATOM   2365 O O    . PHE A 1 168 ? -4.621  39.703 12.264 1.00 14.99 ? 169 PHE A O    1 
ATOM   2366 C CB   . PHE A 1 168 ? -2.854  37.481 13.318 1.00 13.11 ? 169 PHE A CB   1 
ATOM   2367 C CG   . PHE A 1 168 ? -2.225  36.129 13.533 1.00 12.40 ? 169 PHE A CG   1 
ATOM   2368 C CD1  . PHE A 1 168 ? -2.294  35.509 14.768 1.00 14.14 ? 169 PHE A CD1  1 
ATOM   2369 C CD2  . PHE A 1 168 ? -1.557  35.480 12.516 1.00 18.04 ? 169 PHE A CD2  1 
ATOM   2370 C CE1  . PHE A 1 168 ? -1.717  34.275 14.983 1.00 15.00 ? 169 PHE A CE1  1 
ATOM   2371 C CE2  . PHE A 1 168 ? -0.986  34.224 12.739 1.00 20.16 ? 169 PHE A CE2  1 
ATOM   2372 C CZ   . PHE A 1 168 ? -1.076  33.637 13.982 1.00 17.80 ? 169 PHE A CZ   1 
ATOM   2373 H H    . PHE A 1 168 ? -3.869  37.177 11.024 1.00 16.32 ? 169 PHE A H    1 
ATOM   2374 H HA   . PHE A 1 168 ? -4.788  36.834 13.530 1.00 15.25 ? 169 PHE A HA   1 
ATOM   2375 H HB2  . PHE A 1 168 ? -2.355  37.932 12.620 1.00 15.73 ? 169 PHE A HB2  1 
ATOM   2376 H HB3  . PHE A 1 168 ? -2.779  37.977 14.148 1.00 15.73 ? 169 PHE A HB3  1 
ATOM   2377 H HD1  . PHE A 1 168 ? -2.736  35.934 15.468 1.00 16.97 ? 169 PHE A HD1  1 
ATOM   2378 H HD2  . PHE A 1 168 ? -1.499  35.873 11.675 1.00 21.64 ? 169 PHE A HD2  1 
ATOM   2379 H HE1  . PHE A 1 168 ? -1.780  33.875 15.820 1.00 18.00 ? 169 PHE A HE1  1 
ATOM   2380 H HE2  . PHE A 1 168 ? -0.537  33.788 12.050 1.00 24.20 ? 169 PHE A HE2  1 
ATOM   2381 H HZ   . PHE A 1 168 ? -0.690  32.805 14.133 1.00 21.36 ? 169 PHE A HZ   1 
ATOM   2382 N N    . GLU A 1 169 ? -5.682  39.010 14.117 1.00 12.61 ? 170 GLU A N    1 
ATOM   2383 C CA   . GLU A 1 169 ? -6.117  40.316 14.599 1.00 11.65 ? 170 GLU A CA   1 
ATOM   2384 C C    . GLU A 1 169 ? -5.288  40.623 15.828 1.00 12.46 ? 170 GLU A C    1 
ATOM   2385 O O    . GLU A 1 169 ? -5.434  39.948 16.851 1.00 13.77 ? 170 GLU A O    1 
ATOM   2386 C CB   . GLU A 1 169 ? -7.589  40.305 14.931 1.00 13.91 ? 170 GLU A CB   1 
ATOM   2387 C CG   . GLU A 1 169 ? -8.163  41.652 15.354 1.00 15.68 ? 170 GLU A CG   1 
ATOM   2388 C CD   . GLU A 1 169 ? -9.687  41.679 15.274 1.00 22.46 ? 170 GLU A CD   1 
ATOM   2389 O OE1  . GLU A 1 169 ? -10.338 41.033 16.106 1.00 24.04 ? 170 GLU A OE1  1 
ATOM   2390 O OE2  . GLU A 1 169 ? -10.244 42.338 14.356 1.00 27.43 ? 170 GLU A OE2  1 
ATOM   2391 H H    . GLU A 1 169 ? -5.985  38.365 14.599 1.00 15.13 ? 170 GLU A H    1 
ATOM   2392 H HA   . GLU A 1 169 ? -5.949  40.993 13.926 1.00 13.98 ? 170 GLU A HA   1 
ATOM   2393 H HB2  . GLU A 1 169 ? -8.080  40.011 14.147 1.00 16.70 ? 170 GLU A HB2  1 
ATOM   2394 H HB3  . GLU A 1 169 ? -7.737  39.682 15.659 1.00 16.70 ? 170 GLU A HB3  1 
ATOM   2395 H HG2  . GLU A 1 169 ? -7.907  41.832 16.272 1.00 18.82 ? 170 GLU A HG2  1 
ATOM   2396 H HG3  . GLU A 1 169 ? -7.818  42.343 14.769 1.00 18.82 ? 170 GLU A HG3  1 
ATOM   2397 N N    . VAL A 1 170 ? -4.405  41.602 15.716 1.00 12.81 ? 171 VAL A N    1 
ATOM   2398 C CA   . VAL A 1 170 ? -3.375  41.901 16.711 1.00 13.30 ? 171 VAL A CA   1 
ATOM   2399 C C    . VAL A 1 170 ? -3.747  43.150 17.489 1.00 11.92 ? 171 VAL A C    1 
ATOM   2400 O O    . VAL A 1 170 ? -3.839  44.240 16.918 1.00 13.09 ? 171 VAL A O    1 
ATOM   2401 C CB   . VAL A 1 170 ? -2.015  42.116 16.048 1.00 11.61 ? 171 VAL A CB   1 
ATOM   2402 C CG1  . VAL A 1 170 ? -0.928  42.274 17.098 1.00 13.97 ? 171 VAL A CG1  1 
ATOM   2403 C CG2  . VAL A 1 170 ? -1.671  40.978 15.099 1.00 14.17 ? 171 VAL A CG2  1 
ATOM   2404 H H    . VAL A 1 170 ? -4.379  42.135 15.041 1.00 15.37 ? 171 VAL A H    1 
ATOM   2405 H HA   . VAL A 1 170 ? -3.301  41.160 17.333 1.00 15.96 ? 171 VAL A HA   1 
ATOM   2406 H HB   . VAL A 1 170 ? -2.047  42.935 15.529 1.00 13.93 ? 171 VAL A HB   1 
ATOM   2407 H HG11 . VAL A 1 170 ? -0.077  42.409 16.653 1.00 16.76 ? 171 VAL A HG11 1 
ATOM   2408 H HG12 . VAL A 1 170 ? -1.135  43.041 17.655 1.00 16.76 ? 171 VAL A HG12 1 
ATOM   2409 H HG13 . VAL A 1 170 ? -0.894  41.470 17.640 1.00 16.76 ? 171 VAL A HG13 1 
ATOM   2410 H HG21 . VAL A 1 170 ? -0.804  41.152 14.700 1.00 17.00 ? 171 VAL A HG21 1 
ATOM   2411 H HG22 . VAL A 1 170 ? -1.646  40.148 15.599 1.00 17.00 ? 171 VAL A HG22 1 
ATOM   2412 H HG23 . VAL A 1 170 ? -2.350  40.928 14.408 1.00 17.00 ? 171 VAL A HG23 1 
ATOM   2413 N N    . LYS A 1 171 ? -3.961  43.013 18.795 1.00 11.91 ? 172 LYS A N    1 
ATOM   2414 C CA   . LYS A 1 171 ? -4.086  44.165 19.677 1.00 12.82 ? 172 LYS A CA   1 
ATOM   2415 C C    . LYS A 1 171 ? -2.696  44.562 20.098 1.00 12.24 ? 172 LYS A C    1 
ATOM   2416 O O    . LYS A 1 171 ? -1.983  43.779 20.720 1.00 12.22 ? 172 LYS A O    1 
ATOM   2417 C CB   . LYS A 1 171 ? -4.939  43.844 20.899 1.00 14.93 ? 172 LYS A CB   1 
ATOM   2418 C CG   . LYS A 1 171 ? -4.976  44.975 21.914 1.00 16.72 ? 172 LYS A CG   1 
ATOM   2419 C CD   . LYS A 1 171 ? -5.464  46.308 21.353 1.00 21.73 ? 172 LYS A CD   1 
ATOM   2420 C CE   . LYS A 1 171 ? -5.471  47.399 22.449 1.00 33.00 ? 172 LYS A CE   1 
ATOM   2421 N NZ   . LYS A 1 171 ? -4.141  48.075 22.627 1.00 37.53 ? 172 LYS A NZ   1 
ATOM   2422 H H    . LYS A 1 171 ? -4.039  42.256 19.196 1.00 14.29 ? 172 LYS A H    1 
ATOM   2423 H HA   . LYS A 1 171 ? -4.492  44.905 19.198 1.00 15.38 ? 172 LYS A HA   1 
ATOM   2424 H HB2  . LYS A 1 171 ? -5.849  43.671 20.611 1.00 17.92 ? 172 LYS A HB2  1 
ATOM   2425 H HB3  . LYS A 1 171 ? -4.576  43.059 21.339 1.00 17.92 ? 172 LYS A HB3  1 
ATOM   2426 H HG2  . LYS A 1 171 ? -5.572  44.724 22.638 1.00 20.06 ? 172 LYS A HG2  1 
ATOM   2427 H HG3  . LYS A 1 171 ? -4.080  45.111 22.261 1.00 20.06 ? 172 LYS A HG3  1 
ATOM   2428 H HD2  . LYS A 1 171 ? -4.871  46.594 20.641 1.00 26.07 ? 172 LYS A HD2  1 
ATOM   2429 H HD3  . LYS A 1 171 ? -6.368  46.204 21.019 1.00 26.07 ? 172 LYS A HD3  1 
ATOM   2430 H HE2  . LYS A 1 171 ? -6.121  48.079 22.210 1.00 39.60 ? 172 LYS A HE2  1 
ATOM   2431 H HE3  . LYS A 1 171 ? -5.715  46.993 23.295 1.00 39.60 ? 172 LYS A HE3  1 
ATOM   2432 H HZ1  . LYS A 1 171 ? -4.197  48.692 23.265 1.00 45.03 ? 172 LYS A HZ1  1 
ATOM   2433 H HZ2  . LYS A 1 171 ? -3.525  47.476 22.856 1.00 45.03 ? 172 LYS A HZ2  1 
ATOM   2434 H HZ3  . LYS A 1 171 ? -3.896  48.467 21.866 1.00 45.03 ? 172 LYS A HZ3  1 
ATOM   2435 N N    . ILE A 1 172 ? -2.271  45.743 19.667 1.00 12.17 ? 173 ILE A N    1 
ATOM   2436 C CA   . ILE A 1 172 ? -0.926  46.230 19.914 1.00 12.73 ? 173 ILE A CA   1 
ATOM   2437 C C    . ILE A 1 172 ? -0.952  47.233 21.067 1.00 12.26 ? 173 ILE A C    1 
ATOM   2438 O O    . ILE A 1 172 ? -1.573  48.290 20.989 1.00 13.30 ? 173 ILE A O    1 
ATOM   2439 C CB   . ILE A 1 172 ? -0.354  46.901 18.667 1.00 11.53 ? 173 ILE A CB   1 
ATOM   2440 C CG1  . ILE A 1 172 ? -0.340  45.892 17.528 1.00 12.81 ? 173 ILE A CG1  1 
ATOM   2441 C CG2  . ILE A 1 172 ? 1.043   47.431 18.955 1.00 13.17 ? 173 ILE A CG2  1 
ATOM   2442 C CD1  . ILE A 1 172 ? 0.207   46.449 16.215 1.00 13.95 ? 173 ILE A CD1  1 
ATOM   2443 H H    . ILE A 1 172 ? -2.757  46.292 19.219 1.00 14.60 ? 173 ILE A H    1 
ATOM   2444 H HA   . ILE A 1 172 ? -0.350  45.489 20.159 1.00 15.27 ? 173 ILE A HA   1 
ATOM   2445 H HB   . ILE A 1 172 ? -0.926  47.645 18.421 1.00 13.84 ? 173 ILE A HB   1 
ATOM   2446 H HG12 . ILE A 1 172 ? 0.214   45.139 17.785 1.00 15.37 ? 173 ILE A HG12 1 
ATOM   2447 H HG13 . ILE A 1 172 ? -1.248  45.591 17.367 1.00 15.37 ? 173 ILE A HG13 1 
ATOM   2448 H HG21 . ILE A 1 172 ? 1.391   47.854 18.154 1.00 15.80 ? 173 ILE A HG21 1 
ATOM   2449 H HG22 . ILE A 1 172 ? 0.992   48.078 19.675 1.00 15.80 ? 173 ILE A HG22 1 
ATOM   2450 H HG23 . ILE A 1 172 ? 1.614   46.691 19.214 1.00 15.80 ? 173 ILE A HG23 1 
ATOM   2451 H HD11 . ILE A 1 172 ? 0.183   45.750 15.542 1.00 16.74 ? 173 ILE A HD11 1 
ATOM   2452 H HD12 . ILE A 1 172 ? -0.344  47.197 15.935 1.00 16.74 ? 173 ILE A HD12 1 
ATOM   2453 H HD13 . ILE A 1 172 ? 1.120   46.744 16.354 1.00 16.74 ? 173 ILE A HD13 1 
ATOM   2454 N N    . ASN A 1 173 ? -0.283  46.888 22.161 1.00 12.50 ? 174 ASN A N    1 
ATOM   2455 C CA   . ASN A 1 173 ? -0.113  47.813 23.278 1.00 12.87 ? 174 ASN A CA   1 
ATOM   2456 C C    . ASN A 1 173 ? 1.353   48.063 23.634 1.00 14.36 ? 174 ASN A C    1 
ATOM   2457 O O    . ASN A 1 173 ? 1.633   48.714 24.656 1.00 15.27 ? 174 ASN A O    1 
ATOM   2458 C CB   . ASN A 1 173 ? -0.898  47.342 24.511 1.00 15.62 ? 174 ASN A CB   1 
ATOM   2459 C CG   . ASN A 1 173 ? -0.514  45.970 24.951 1.00 17.05 ? 174 ASN A CG   1 
ATOM   2460 O OD1  . ASN A 1 173 ? 0.652   45.575 24.895 1.00 15.75 ? 174 ASN A OD1  1 
ATOM   2461 N ND2  . ASN A 1 173 ? -1.502  45.228 25.433 1.00 22.47 ? 174 ASN A ND2  1 
ATOM   2462 H H    . ASN A 1 173 ? 0.085   46.120 22.283 1.00 15.00 ? 174 ASN A H    1 
ATOM   2463 H HA   . ASN A 1 173 ? -0.487  48.669 23.015 1.00 15.44 ? 174 ASN A HA   1 
ATOM   2464 H HB2  . ASN A 1 173 ? -0.727  47.952 25.246 1.00 18.75 ? 174 ASN A HB2  1 
ATOM   2465 H HB3  . ASN A 1 173 ? -1.844  47.335 24.299 1.00 18.75 ? 174 ASN A HB3  1 
ATOM   2466 H HD21 . ASN A 1 173 ? -1.346  44.427 25.703 1.00 26.97 ? 174 ASN A HD21 1 
ATOM   2467 H HD22 . ASN A 1 173 ? -2.299  45.548 25.474 1.00 26.97 ? 174 ASN A HD22 1 
ATOM   2468 N N    . GLN A 1 174 ? 2.257   47.570 22.796 1.00 12.84 ? 175 GLN A N    1 
ATOM   2469 C CA   . GLN A 1 174 ? 3.686   47.724 22.952 1.00 13.30 ? 175 GLN A CA   1 
ATOM   2470 C C    . GLN A 1 174 ? 4.358   47.125 21.726 1.00 12.80 ? 175 GLN A C    1 
ATOM   2471 O O    . GLN A 1 174 ? 3.756   46.307 21.027 1.00 14.98 ? 175 GLN A O    1 
ATOM   2472 C CB   . GLN A 1 174 ? 4.172   47.020 24.226 1.00 13.80 ? 175 GLN A CB   1 
ATOM   2473 C CG   . GLN A 1 174 ? 3.995   45.490 24.192 1.00 14.33 ? 175 GLN A CG   1 
ATOM   2474 C CD   . GLN A 1 174 ? 4.235   44.864 25.538 1.00 16.90 ? 175 GLN A CD   1 
ATOM   2475 O OE1  . GLN A 1 174 ? 5.381   44.770 25.992 1.00 20.44 ? 175 GLN A OE1  1 
ATOM   2476 N NE2  . GLN A 1 174 ? 3.160   44.475 26.202 1.00 18.85 ? 175 GLN A NE2  1 
ATOM   2477 H H    . GLN A 1 174 ? 2.048   47.119 22.094 1.00 15.40 ? 175 GLN A H    1 
ATOM   2478 H HA   . GLN A 1 174 ? 3.912   48.666 23.007 1.00 15.96 ? 175 GLN A HA   1 
ATOM   2479 H HB2  . GLN A 1 174 ? 5.116   47.208 24.346 1.00 16.56 ? 175 GLN A HB2  1 
ATOM   2480 H HB3  . GLN A 1 174 ? 3.669   47.360 24.983 1.00 16.56 ? 175 GLN A HB3  1 
ATOM   2481 H HG2  . GLN A 1 174 ? 3.089   45.280 23.918 1.00 17.19 ? 175 GLN A HG2  1 
ATOM   2482 H HG3  . GLN A 1 174 ? 4.630   45.110 23.565 1.00 17.19 ? 175 GLN A HG3  1 
ATOM   2483 H HE21 . GLN A 1 174 ? 2.379   44.586 25.859 1.00 22.62 ? 175 GLN A HE21 1 
ATOM   2484 H HE22 . GLN A 1 174 ? 3.241   44.111 26.977 1.00 22.62 ? 175 GLN A HE22 1 
ATOM   2485 N N    . GLY A 1 175 ? 5.599   47.530 21.481 1.00 13.17 ? 176 GLY A N    1 
ATOM   2486 C CA   . GLY A 1 175 ? 6.462   46.884 20.515 1.00 14.09 ? 176 GLY A CA   1 
ATOM   2487 C C    . GLY A 1 175 ? 6.310   47.335 19.076 1.00 14.73 ? 176 GLY A C    1 
ATOM   2488 O O    . GLY A 1 175 ? 7.252   47.229 18.336 1.00 15.67 ? 176 GLY A O    1 
ATOM   2489 H H    . GLY A 1 175 ? 5.969   48.198 21.876 1.00 15.81 ? 176 GLY A H    1 
ATOM   2490 H HA2  . GLY A 1 175 ? 7.384   47.034 20.775 1.00 16.91 ? 176 GLY A HA2  1 
ATOM   2491 H HA3  . GLY A 1 175 ? 6.297   45.929 20.543 1.00 16.91 ? 176 GLY A HA3  1 
ATOM   2492 N N    . GLY A 1 176 ? 5.131   47.772 18.664 1.00 13.42 ? 177 GLY A N    1 
ATOM   2493 C CA   . GLY A 1 176 ? 4.889   48.156 17.283 1.00 12.47 ? 177 GLY A CA   1 
ATOM   2494 C C    . GLY A 1 176 ? 5.229   49.587 16.966 1.00 11.99 ? 177 GLY A C    1 
ATOM   2495 O O    . GLY A 1 176 ? 4.884   50.510 17.686 1.00 14.42 ? 177 GLY A O    1 
ATOM   2496 H H    . GLY A 1 176 ? 4.443   47.856 19.173 1.00 16.10 ? 177 GLY A H    1 
ATOM   2497 H HA2  . GLY A 1 176 ? 5.414   47.586 16.700 1.00 14.96 ? 177 GLY A HA2  1 
ATOM   2498 H HA3  . GLY A 1 176 ? 3.951   48.016 17.076 1.00 14.96 ? 177 GLY A HA3  1 
ATOM   2499 N N    . HIS A 1 177 ? 5.932   49.784 15.859 1.00 12.76 ? 178 HIS A N    1 
ATOM   2500 C CA   . HIS A 1 177 ? 6.266   51.123 15.402 1.00 12.82 ? 178 HIS A CA   1 
ATOM   2501 C C    . HIS A 1 177 ? 5.797   51.318 13.969 1.00 13.57 ? 178 HIS A C    1 
ATOM   2502 O O    . HIS A 1 177 ? 5.986   50.436 13.122 1.00 13.95 ? 178 HIS A O    1 
ATOM   2503 C CB   . HIS A 1 177 ? 7.777   51.368 15.470 1.00 15.25 ? 178 HIS A CB   1 
ATOM   2504 C CG   . HIS A 1 177 ? 8.331   51.318 16.862 1.00 15.22 ? 178 HIS A CG   1 
ATOM   2505 N ND1  . HIS A 1 177 ? 8.572   52.446 17.589 1.00 18.88 ? 178 HIS A ND1  1 
ATOM   2506 C CD2  . HIS A 1 177 ? 8.631   50.257 17.647 1.00 16.01 ? 178 HIS A CD2  1 
ATOM   2507 C CE1  . HIS A 1 177 ? 9.031   52.089 18.794 1.00 20.42 ? 178 HIS A CE1  1 
ATOM   2508 N NE2  . HIS A 1 177 ? 9.070   50.779 18.846 1.00 20.07 ? 178 HIS A NE2  1 
ATOM   2509 H H    . HIS A 1 177 ? 6.229   49.155 15.353 1.00 15.32 ? 178 HIS A H    1 
ATOM   2510 H HA   . HIS A 1 177 ? 5.822   51.778 15.963 1.00 15.38 ? 178 HIS A HA   1 
ATOM   2511 H HB2  . HIS A 1 177 ? 8.228   50.689 14.945 1.00 18.31 ? 178 HIS A HB2  1 
ATOM   2512 H HB3  . HIS A 1 177 ? 7.968   52.247 15.106 1.00 18.31 ? 178 HIS A HB3  1 
ATOM   2513 H HD1  . HIS A 1 177 ? 8.455   53.253 17.316 1.00 22.65 ? 178 HIS A HD1  1 
ATOM   2514 H HD2  . HIS A 1 177 ? 8.561   49.357 17.421 1.00 19.22 ? 178 HIS A HD2  1 
ATOM   2515 H HE1  . HIS A 1 177 ? 9.281   52.670 19.477 1.00 24.51 ? 178 HIS A HE1  1 
ATOM   2516 N N    . THR A 1 178 ? 5.212   52.469 13.677 1.00 14.46 ? 179 THR A N    1 
ATOM   2517 C CA   . THR A 1 178 ? 4.850   52.741 12.300 1.00 14.86 ? 179 THR A CA   1 
ATOM   2518 C C    . THR A 1 178 ? 6.079   53.068 11.471 1.00 14.79 ? 179 THR A C    1 
ATOM   2519 O O    . THR A 1 178 ? 6.913   53.886 11.837 1.00 15.86 ? 179 THR A O    1 
ATOM   2520 C CB   . THR A 1 178 ? 3.835   53.871 12.141 1.00 15.16 ? 179 THR A CB   1 
ATOM   2521 O OG1  . THR A 1 178 ? 3.731   54.175 10.745 1.00 16.27 ? 179 THR A OG1  1 
ATOM   2522 C CG2  . THR A 1 178 ? 4.266   55.154 12.883 1.00 15.79 ? 179 THR A CG2  1 
ATOM   2523 H H    . THR A 1 178 ? 5.019   53.091 14.239 1.00 17.35 ? 179 THR A H    1 
ATOM   2524 H HA   . THR A 1 178 ? 4.451   51.940 11.926 1.00 17.83 ? 179 THR A HA   1 
ATOM   2525 H HB   . THR A 1 178 ? 2.972   53.588 12.481 1.00 18.19 ? 179 THR A HB   1 
ATOM   2526 H HG1  . THR A 1 178 ? 3.177   54.795 10.627 1.00 19.53 ? 179 THR A HG1  1 
ATOM   2527 H HG21 . THR A 1 178 ? 3.599   55.848 12.760 1.00 18.95 ? 179 THR A HG21 1 
ATOM   2528 H HG22 . THR A 1 178 ? 4.361   54.973 13.831 1.00 18.95 ? 179 THR A HG22 1 
ATOM   2529 H HG23 . THR A 1 178 ? 5.116   55.468 12.535 1.00 18.95 ? 179 THR A HG23 1 
ATOM   2530 N N    . ILE A 1 179 ? 6.195   52.408 10.332 1.00 14.89 ? 180 ILE A N    1 
ATOM   2531 C CA   . ILE A 1 179 ? 7.199   52.786 9.333  1.00 18.00 ? 180 ILE A CA   1 
ATOM   2532 C C    . ILE A 1 179 ? 6.593   53.491 8.127  1.00 17.87 ? 180 ILE A C    1 
ATOM   2533 O O    . ILE A 1 179 ? 7.295   53.807 7.176  1.00 19.54 ? 180 ILE A O    1 
ATOM   2534 C CB   . ILE A 1 179 ? 8.054   51.575 8.871  1.00 17.15 ? 180 ILE A CB   1 
ATOM   2535 C CG1  . ILE A 1 179 ? 7.193   50.547 8.139  1.00 16.34 ? 180 ILE A CG1  1 
ATOM   2536 C CG2  . ILE A 1 179 ? 8.761   50.928 10.050 1.00 16.79 ? 180 ILE A CG2  1 
ATOM   2537 C CD1  . ILE A 1 179 ? 8.027   49.490 7.407  1.00 21.81 ? 180 ILE A CD1  1 
ATOM   2538 H H    . ILE A 1 179 ? 5.707   51.736 10.105 1.00 17.87 ? 180 ILE A H    1 
ATOM   2539 H HA   . ILE A 1 179 ? 7.807   53.417 9.750  1.00 21.60 ? 180 ILE A HA   1 
ATOM   2540 H HB   . ILE A 1 179 ? 8.729   51.899 8.254  1.00 20.58 ? 180 ILE A HB   1 
ATOM   2541 H HG12 . ILE A 1 179 ? 6.629   50.090 8.784  1.00 19.60 ? 180 ILE A HG12 1 
ATOM   2542 H HG13 . ILE A 1 179 ? 6.644   51.003 7.483  1.00 19.60 ? 180 ILE A HG13 1 
ATOM   2543 H HG21 . ILE A 1 179 ? 9.286   50.178 9.730  1.00 20.15 ? 180 ILE A HG21 1 
ATOM   2544 H HG22 . ILE A 1 179 ? 9.342   51.584 10.468 1.00 20.15 ? 180 ILE A HG22 1 
ATOM   2545 H HG23 . ILE A 1 179 ? 8.097   50.621 10.686 1.00 20.15 ? 180 ILE A HG23 1 
ATOM   2546 H HD11 . ILE A 1 179 ? 7.430   48.868 6.964  1.00 26.17 ? 180 ILE A HD11 1 
ATOM   2547 H HD12 . ILE A 1 179 ? 8.591   49.931 6.752  1.00 26.17 ? 180 ILE A HD12 1 
ATOM   2548 H HD13 . ILE A 1 179 ? 8.577   49.019 8.053  1.00 26.17 ? 180 ILE A HD13 1 
ATOM   2549 N N    . ALA A 1 180 ? 5.301   53.785 8.183  1.00 17.28 ? 181 ALA A N    1 
ATOM   2550 C CA   . ALA A 1 180 ? 4.582   54.353 7.052  1.00 18.75 ? 181 ALA A CA   1 
ATOM   2551 C C    . ALA A 1 180 ? 5.007   55.770 6.715  1.00 21.38 ? 181 ALA A C    1 
ATOM   2552 O O    . ALA A 1 180 ? 4.785   56.236 5.604  1.00 24.43 ? 181 ALA A O    1 
ATOM   2553 C CB   . ALA A 1 180 ? 3.092   54.306 7.322  1.00 19.41 ? 181 ALA A CB   1 
ATOM   2554 H H    . ALA A 1 180 ? 4.810   53.662 8.878  1.00 20.74 ? 181 ALA A H    1 
ATOM   2555 H HA   . ALA A 1 180 ? 4.755   53.805 6.271  1.00 22.50 ? 181 ALA A HA   1 
ATOM   2556 H HB1  . ALA A 1 180 ? 2.622   54.686 6.564  1.00 23.29 ? 181 ALA A HB1  1 
ATOM   2557 H HB2  . ALA A 1 180 ? 2.824   53.382 7.449  1.00 23.29 ? 181 ALA A HB2  1 
ATOM   2558 H HB3  . ALA A 1 180 ? 2.900   54.819 8.123  1.00 23.29 ? 181 ALA A HB3  1 
ATOM   2559 N N    . GLY A 1 181 ? 5.625   56.460 7.673  1.00 22.01 ? 182 GLY A N    1 
ATOM   2560 C CA   . GLY A 1 181 ? 6.143   57.789 7.432  1.00 25.01 ? 182 GLY A CA   1 
ATOM   2561 C C    . GLY A 1 181 ? 7.421   57.776 6.612  1.00 28.76 ? 182 GLY A C    1 
ATOM   2562 O O    . GLY A 1 181 ? 7.782   58.808 6.055  1.00 32.50 ? 182 GLY A O    1 
ATOM   2563 H H    . GLY A 1 181 ? 5.754   56.173 8.473  1.00 26.42 ? 182 GLY A H    1 
ATOM   2564 H HA2  . GLY A 1 181 ? 5.479   58.313 6.956  1.00 30.01 ? 182 GLY A HA2  1 
ATOM   2565 H HA3  . GLY A 1 181 ? 6.327   58.223 8.280  1.00 30.01 ? 182 GLY A HA3  1 
ATOM   2566 N N    . LEU A 1 182 ? 8.099   56.627 6.531  1.00 31.23 ? 183 LEU A N    1 
ATOM   2567 C CA   . LEU A 1 182 ? 9.326   56.488 5.733  1.00 28.71 ? 183 LEU A CA   1 
ATOM   2568 C C    . LEU A 1 182 ? 9.134   55.663 4.462  1.00 36.37 ? 183 LEU A C    1 
ATOM   2569 O O    . LEU A 1 182 ? 9.996   55.677 3.593  1.00 38.04 ? 183 LEU A O    1 
ATOM   2570 C CB   . LEU A 1 182 ? 10.458  55.882 6.570  1.00 34.23 ? 183 LEU A CB   1 
ATOM   2571 C CG   . LEU A 1 182 ? 11.177  56.818 7.548  1.00 35.90 ? 183 LEU A CG   1 
ATOM   2572 C CD1  . LEU A 1 182 ? 12.296  56.078 8.259  1.00 36.19 ? 183 LEU A CD1  1 
ATOM   2573 C CD2  . LEU A 1 182 ? 11.738  58.043 6.836  1.00 34.48 ? 183 LEU A CD2  1 
ATOM   2574 H H    . LEU A 1 182 ? 7.866   55.903 6.934  1.00 37.47 ? 183 LEU A H    1 
ATOM   2575 H HA   . LEU A 1 182 ? 9.611   57.374 5.460  1.00 34.45 ? 183 LEU A HA   1 
ATOM   2576 H HB2  . LEU A 1 182 ? 10.089  55.152 7.092  1.00 41.07 ? 183 LEU A HB2  1 
ATOM   2577 H HB3  . LEU A 1 182 ? 11.128  55.534 5.962  1.00 41.07 ? 183 LEU A HB3  1 
ATOM   2578 H HG   . LEU A 1 182 ? 10.545  57.122 8.218  1.00 43.08 ? 183 LEU A HG   1 
ATOM   2579 H HD11 . LEU A 1 182 ? 12.737  56.686 8.872  1.00 43.43 ? 183 LEU A HD11 1 
ATOM   2580 H HD12 . LEU A 1 182 ? 11.918  55.331 8.749  1.00 43.43 ? 183 LEU A HD12 1 
ATOM   2581 H HD13 . LEU A 1 182 ? 12.929  55.754 7.600  1.00 43.43 ? 183 LEU A HD13 1 
ATOM   2582 H HD21 . LEU A 1 182 ? 12.184  58.609 7.485  1.00 41.37 ? 183 LEU A HD21 1 
ATOM   2583 H HD22 . LEU A 1 182 ? 12.370  57.753 6.159  1.00 41.37 ? 183 LEU A HD22 1 
ATOM   2584 H HD23 . LEU A 1 182 ? 11.007  58.528 6.421  1.00 41.37 ? 183 LEU A HD23 1 
ATOM   2585 N N    . SER A 1 183 ? 7.992   54.992 4.338  1.00 43.87 ? 184 SER A N    1 
ATOM   2586 C CA   . SER A 1 183 ? 7.724   54.094 3.212  1.00 45.47 ? 184 SER A CA   1 
ATOM   2587 C C    . SER A 1 183 ? 6.841   54.764 2.158  1.00 39.68 ? 184 SER A C    1 
ATOM   2588 O O    . SER A 1 183 ? 7.118   54.678 0.955  1.00 50.44 ? 184 SER A O    1 
ATOM   2589 C CB   . SER A 1 183 ? 7.055   52.809 3.716  1.00 52.79 ? 184 SER A CB   1 
ATOM   2590 O OG   . SER A 1 183 ? 7.870   52.149 4.677  1.00 50.92 ? 184 SER A OG   1 
ATOM   2591 H H    . SER A 1 183 ? 7.344   55.039 4.901  1.00 52.65 ? 184 SER A H    1 
ATOM   2592 H HA   . SER A 1 183 ? 8.564   53.852 2.792  1.00 54.56 ? 184 SER A HA   1 
ATOM   2593 H HB2  . SER A 1 183 ? 6.206   53.037 4.127  1.00 63.35 ? 184 SER A HB2  1 
ATOM   2594 H HB3  . SER A 1 183 ? 6.910   52.214 2.964  1.00 63.35 ? 184 SER A HB3  1 
ATOM   2595 H HG   . SER A 1 183 ? 8.004   52.654 5.335  1.00 61.10 ? 184 SER A HG   1 
ATOM   2596 N N    . LYS A 1 187 ? 4.004   48.385 1.232  1.00 37.53 ? 188 LYS A N    1 
ATOM   2597 C CA   . LYS A 1 187 ? 2.835   47.928 1.979  1.00 31.73 ? 188 LYS A CA   1 
ATOM   2598 C C    . LYS A 1 187 ? 2.149   49.048 2.792  1.00 31.63 ? 188 LYS A C    1 
ATOM   2599 O O    . LYS A 1 187 ? 2.801   49.833 3.476  1.00 33.30 ? 188 LYS A O    1 
ATOM   2600 C CB   . LYS A 1 187 ? 3.253   46.767 2.887  1.00 30.75 ? 188 LYS A CB   1 
ATOM   2601 C CG   . LYS A 1 187 ? 2.112   46.126 3.653  1.00 30.66 ? 188 LYS A CG   1 
ATOM   2602 C CD   . LYS A 1 187 ? 2.602   45.011 4.543  1.00 35.11 ? 188 LYS A CD   1 
ATOM   2603 C CE   . LYS A 1 187 ? 1.736   44.943 5.769  1.00 37.58 ? 188 LYS A CE   1 
ATOM   2604 N NZ   . LYS A 1 187 ? 2.118   43.828 6.637  1.00 31.71 ? 188 LYS A NZ   1 
ATOM   2605 H H    . LYS A 1 187 ? 4.724   47.954 1.423  1.00 45.03 ? 188 LYS A H    1 
ATOM   2606 H HA   . LYS A 1 187 ? 2.182   47.585 1.348  1.00 38.07 ? 188 LYS A HA   1 
ATOM   2607 H HB2  . LYS A 1 187 ? 3.665   46.079 2.341  1.00 36.90 ? 188 LYS A HB2  1 
ATOM   2608 H HB3  . LYS A 1 187 ? 3.894   47.097 3.535  1.00 36.90 ? 188 LYS A HB3  1 
ATOM   2609 H HG2  . LYS A 1 187 ? 1.685   46.795 4.210  1.00 36.80 ? 188 LYS A HG2  1 
ATOM   2610 H HG3  . LYS A 1 187 ? 1.474   45.754 3.024  1.00 36.80 ? 188 LYS A HG3  1 
ATOM   2611 H HD2  . LYS A 1 187 ? 2.542   44.165 4.072  1.00 42.13 ? 188 LYS A HD2  1 
ATOM   2612 H HD3  . LYS A 1 187 ? 3.515   45.188 4.817  1.00 42.13 ? 188 LYS A HD3  1 
ATOM   2613 H HE2  . LYS A 1 187 ? 1.830   45.766 6.273  1.00 45.09 ? 188 LYS A HE2  1 
ATOM   2614 H HE3  . LYS A 1 187 ? 0.812   44.816 5.502  1.00 45.09 ? 188 LYS A HE3  1 
ATOM   2615 H HZ1  . LYS A 1 187 ? 1.593   43.808 7.355  1.00 38.05 ? 188 LYS A HZ1  1 
ATOM   2616 H HZ2  . LYS A 1 187 ? 2.037   43.059 6.198  1.00 38.05 ? 188 LYS A HZ2  1 
ATOM   2617 H HZ3  . LYS A 1 187 ? 2.963   43.924 6.900  1.00 38.05 ? 188 LYS A HZ3  1 
ATOM   2618 N N    . GLU A 1 188 ? 0.819   49.090 2.710  1.00 23.98 ? 189 GLU A N    1 
ATOM   2619 C CA   . GLU A 1 188 ? 0.022   50.172 3.249  1.00 22.74 ? 189 GLU A CA   1 
ATOM   2620 C C    . GLU A 1 188 ? -0.110  50.067 4.751  1.00 17.00 ? 189 GLU A C    1 
ATOM   2621 O O    . GLU A 1 188 ? -0.290  48.997 5.307  1.00 16.99 ? 189 GLU A O    1 
ATOM   2622 C CB   . GLU A 1 188 ? -1.384  50.197 2.636  1.00 21.21 ? 189 GLU A CB   1 
ATOM   2623 C CG   . GLU A 1 188 ? -1.428  50.590 1.220  1.00 23.23 ? 189 GLU A CG   1 
ATOM   2624 C CD   . GLU A 1 188 ? -1.255  49.396 0.269  1.00 31.25 ? 189 GLU A CD   1 
ATOM   2625 O OE1  . GLU A 1 188 ? -0.653  48.384 0.693  1.00 31.58 ? 189 GLU A OE1  1 
ATOM   2626 O OE2  . GLU A 1 188 ? -1.719  49.483 -0.896 1.00 35.95 ? 189 GLU A OE2  1 
ATOM   2627 H H    . GLU A 1 188 ? 0.347   48.477 2.333  1.00 28.78 ? 189 GLU A H    1 
ATOM   2628 H HA   . GLU A 1 188 ? 0.454   51.015 3.043  1.00 27.29 ? 189 GLU A HA   1 
ATOM   2629 H HB2  . GLU A 1 188 ? -1.768  49.309 2.706  1.00 25.45 ? 189 GLU A HB2  1 
ATOM   2630 H HB3  . GLU A 1 188 ? -1.927  50.828 3.133  1.00 25.45 ? 189 GLU A HB3  1 
ATOM   2631 H HG2  . GLU A 1 188 ? -2.287  51.001 1.033  1.00 27.87 ? 189 GLU A HG2  1 
ATOM   2632 H HG3  . GLU A 1 188 ? -0.712  51.221 1.044  1.00 27.87 ? 189 GLU A HG3  1 
ATOM   2633 N N    . ALA A 1 189 ? -0.018  51.223 5.393  1.00 17.65 ? 190 ALA A N    1 
ATOM   2634 C CA   . ALA A 1 189 ? -0.254  51.345 6.821  1.00 16.03 ? 190 ALA A CA   1 
ATOM   2635 C C    . ALA A 1 189 ? 0.511   50.313 7.653  1.00 13.61 ? 190 ALA A C    1 
ATOM   2636 O O    . ALA A 1 189 ? -0.043  49.653 8.516  1.00 15.03 ? 190 ALA A O    1 
ATOM   2637 C CB   . ALA A 1 189 ? -1.756  51.280 7.111  1.00 18.96 ? 190 ALA A CB   1 
ATOM   2638 H H    . ALA A 1 189 ? 0.184   51.968 5.013  1.00 21.18 ? 190 ALA A H    1 
ATOM   2639 H HA   . ALA A 1 189 ? 0.053   52.221 7.102  1.00 19.23 ? 190 ALA A HA   1 
ATOM   2640 H HB1  . ALA A 1 189 ? -1.896  51.363 8.067  1.00 22.75 ? 190 ALA A HB1  1 
ATOM   2641 H HB2  . ALA A 1 189 ? -2.199  52.008 6.647  1.00 22.75 ? 190 ALA A HB2  1 
ATOM   2642 H HB3  . ALA A 1 189 ? -2.101  50.429 6.798  1.00 22.75 ? 190 ALA A HB3  1 
ATOM   2643 N N    . GLU A 1 190 ? 1.815   50.228 7.404  1.00 14.22 ? 191 GLU A N    1 
ATOM   2644 C CA   . GLU A 1 190 ? 2.651   49.186 7.960  1.00 13.54 ? 191 GLU A CA   1 
ATOM   2645 C C    . GLU A 1 190 ? 3.195   49.521 9.346  1.00 13.79 ? 191 GLU A C    1 
ATOM   2646 O O    . GLU A 1 190 ? 3.776   50.588 9.550  1.00 13.63 ? 191 GLU A O    1 
ATOM   2647 C CB   . GLU A 1 190 ? 3.804   48.853 7.007  1.00 15.81 ? 191 GLU A CB   1 
ATOM   2648 C CG   . GLU A 1 190 ? 4.570   47.590 7.377  1.00 17.21 ? 191 GLU A CG   1 
ATOM   2649 C CD   . GLU A 1 190 ? 5.518   47.108 6.277  1.00 18.68 ? 191 GLU A CD   1 
ATOM   2650 O OE1  . GLU A 1 190 ? 5.727   47.832 5.298  1.00 20.39 ? 191 GLU A OE1  1 
ATOM   2651 O OE2  . GLU A 1 190 ? 6.077   45.990 6.418  1.00 23.65 ? 191 GLU A OE2  1 
ATOM   2652 H H    . GLU A 1 190 ? 2.243   50.779 6.902  1.00 17.06 ? 191 GLU A H    1 
ATOM   2653 H HA   . GLU A 1 190 ? 2.113   48.384 8.050  1.00 16.25 ? 191 GLU A HA   1 
ATOM   2654 H HB2  . GLU A 1 190 ? 3.445   48.730 6.114  1.00 18.97 ? 191 GLU A HB2  1 
ATOM   2655 H HB3  . GLU A 1 190 ? 4.433   49.591 7.009  1.00 18.97 ? 191 GLU A HB3  1 
ATOM   2656 H HG2  . GLU A 1 190 ? 5.099   47.765 8.170  1.00 20.65 ? 191 GLU A HG2  1 
ATOM   2657 H HG3  . GLU A 1 190 ? 3.934   46.879 7.554  1.00 20.65 ? 191 GLU A HG3  1 
ATOM   2658 N N    . VAL A 1 191 ? 2.992   48.593 10.263 1.00 12.64 ? 192 VAL A N    1 
ATOM   2659 C CA   . VAL A 1 191 ? 3.473   48.666 11.647 1.00 12.10 ? 192 VAL A CA   1 
ATOM   2660 C C    . VAL A 1 191 ? 4.382   47.465 11.865 1.00 12.35 ? 192 VAL A C    1 
ATOM   2661 O O    . VAL A 1 191 ? 3.952   46.316 11.661 1.00 13.06 ? 192 VAL A O    1 
ATOM   2662 C CB   . VAL A 1 191 ? 2.301   48.715 12.647 1.00 12.15 ? 192 VAL A CB   1 
ATOM   2663 C CG1  . VAL A 1 191 ? 2.796   48.671 14.091 1.00 12.46 ? 192 VAL A CG1  1 
ATOM   2664 C CG2  . VAL A 1 191 ? 1.464   49.975 12.420 1.00 13.82 ? 192 VAL A CG2  1 
ATOM   2665 H H    . VAL A 1 191 ? 2.554   47.870 10.105 1.00 15.17 ? 192 VAL A H    1 
ATOM   2666 H HA   . VAL A 1 191 ? 4.002   49.471 11.760 1.00 14.52 ? 192 VAL A HA   1 
ATOM   2667 H HB   . VAL A 1 191 ? 1.730   47.945 12.503 1.00 14.58 ? 192 VAL A HB   1 
ATOM   2668 H HG11 . VAL A 1 191 ? 2.032   48.704 14.688 1.00 14.95 ? 192 VAL A HG11 1 
ATOM   2669 H HG12 . VAL A 1 191 ? 3.290   47.848 14.231 1.00 14.95 ? 192 VAL A HG12 1 
ATOM   2670 H HG13 . VAL A 1 191 ? 3.374   49.434 14.250 1.00 14.95 ? 192 VAL A HG13 1 
ATOM   2671 H HG21 . VAL A 1 191 ? 0.734   49.987 13.058 1.00 16.59 ? 192 VAL A HG21 1 
ATOM   2672 H HG22 . VAL A 1 191 ? 2.027   50.755 12.546 1.00 16.59 ? 192 VAL A HG22 1 
ATOM   2673 H HG23 . VAL A 1 191 ? 1.114   49.962 11.515 1.00 16.59 ? 192 VAL A HG23 1 
ATOM   2674 N N    . LEU A 1 192 ? 5.633   47.712 12.260 1.00 12.27 ? 193 LEU A N    1 
ATOM   2675 C CA   . LEU A 1 192 ? 6.647   46.683 12.341 1.00 11.54 ? 193 LEU A CA   1 
ATOM   2676 C C    . LEU A 1 192 ? 7.072   46.449 13.779 1.00 12.21 ? 193 LEU A C    1 
ATOM   2677 O O    . LEU A 1 192 ? 7.101   47.393 14.591 1.00 13.07 ? 193 LEU A O    1 
ATOM   2678 C CB   . LEU A 1 192 ? 7.877   47.099 11.526 1.00 14.41 ? 193 LEU A CB   1 
ATOM   2679 C CG   . LEU A 1 192 ? 8.989   46.120 11.213 1.00 18.35 ? 193 LEU A CG   1 
ATOM   2680 C CD1  . LEU A 1 192 ? 8.459   44.943 10.417 1.00 18.96 ? 193 LEU A CD1  1 
ATOM   2681 C CD2  . LEU A 1 192 ? 10.063  46.875 10.422 1.00 20.95 ? 193 LEU A CD2  1 
ATOM   2682 H H    . LEU A 1 192 ? 5.917   48.490 12.490 1.00 14.73 ? 193 LEU A H    1 
ATOM   2683 H HA   . LEU A 1 192 ? 6.300   45.852 11.980 1.00 13.85 ? 193 LEU A HA   1 
ATOM   2684 H HB2  . LEU A 1 192 ? 7.555   47.423 10.670 1.00 17.29 ? 193 LEU A HB2  1 
ATOM   2685 H HB3  . LEU A 1 192 ? 8.294   47.838 11.996 1.00 17.29 ? 193 LEU A HB3  1 
ATOM   2686 H HG   . LEU A 1 192 ? 9.380   45.791 12.038 1.00 22.02 ? 193 LEU A HG   1 
ATOM   2687 H HD11 . LEU A 1 192 ? 9.190   44.333 10.231 1.00 22.76 ? 193 LEU A HD11 1 
ATOM   2688 H HD12 . LEU A 1 192 ? 7.776   44.492 10.939 1.00 22.76 ? 193 LEU A HD12 1 
ATOM   2689 H HD13 . LEU A 1 192 ? 8.080   45.269 9.586  1.00 22.76 ? 193 LEU A HD13 1 
ATOM   2690 H HD21 . LEU A 1 192 ? 10.787  46.264 10.211 1.00 25.14 ? 193 LEU A HD21 1 
ATOM   2691 H HD22 . LEU A 1 192 ? 9.670   47.218 9.604  1.00 25.14 ? 193 LEU A HD22 1 
ATOM   2692 H HD23 . LEU A 1 192 ? 10.396  47.609 10.963 1.00 25.14 ? 193 LEU A HD23 1 
ATOM   2693 N N    . PHE A 1 193 ? 7.414   45.201 14.067 1.00 12.27 ? 194 PHE A N    1 
ATOM   2694 C CA   . PHE A 1 193 ? 8.017   44.767 15.319 1.00 12.27 ? 194 PHE A CA   1 
ATOM   2695 C C    . PHE A 1 193 ? 9.401   44.196 15.059 1.00 11.81 ? 194 PHE A C    1 
ATOM   2696 O O    . PHE A 1 193 ? 9.626   43.484 14.085 1.00 12.66 ? 194 PHE A O    1 
ATOM   2697 C CB   . PHE A 1 193 ? 7.233   43.638 15.971 1.00 12.07 ? 194 PHE A CB   1 
ATOM   2698 C CG   . PHE A 1 193 ? 5.839   44.005 16.382 1.00 10.97 ? 194 PHE A CG   1 
ATOM   2699 C CD1  . PHE A 1 193 ? 4.825   44.141 15.444 1.00 12.22 ? 194 PHE A CD1  1 
ATOM   2700 C CD2  . PHE A 1 193 ? 5.528   44.208 17.699 1.00 11.28 ? 194 PHE A CD2  1 
ATOM   2701 C CE1  . PHE A 1 193 ? 3.543   44.476 15.840 1.00 13.01 ? 194 PHE A CE1  1 
ATOM   2702 C CE2  . PHE A 1 193 ? 4.263   44.542 18.079 1.00 12.44 ? 194 PHE A CE2  1 
ATOM   2703 C CZ   . PHE A 1 193 ? 3.290   44.686 17.193 1.00 12.53 ? 194 PHE A CZ   1 
ATOM   2704 H H    . PHE A 1 193 ? 7.298   44.550 13.517 1.00 14.73 ? 194 PHE A H    1 
ATOM   2705 H HA   . PHE A 1 193 ? 8.086   45.511 15.937 1.00 14.72 ? 194 PHE A HA   1 
ATOM   2706 H HB2  . PHE A 1 193 ? 7.171   42.901 15.344 1.00 14.49 ? 194 PHE A HB2  1 
ATOM   2707 H HB3  . PHE A 1 193 ? 7.708   43.351 16.766 1.00 14.49 ? 194 PHE A HB3  1 
ATOM   2708 H HD1  . PHE A 1 193 ? 5.009   44.006 14.543 1.00 14.67 ? 194 PHE A HD1  1 
ATOM   2709 H HD2  . PHE A 1 193 ? 6.193   44.123 18.344 1.00 13.54 ? 194 PHE A HD2  1 
ATOM   2710 H HE1  . PHE A 1 193 ? 2.865   44.573 15.211 1.00 15.61 ? 194 PHE A HE1  1 
ATOM   2711 H HE2  . PHE A 1 193 ? 4.080   44.680 18.980 1.00 14.93 ? 194 PHE A HE2  1 
ATOM   2712 H HZ   . PHE A 1 193 ? 2.432   44.908 17.476 1.00 15.04 ? 194 PHE A HZ   1 
ATOM   2713 N N    . ALA A 1 194 ? 10.313  44.454 15.996 1.00 12.70 ? 195 ALA A N    1 
ATOM   2714 C CA   . ALA A 1 194 ? 11.623  43.817 16.018 1.00 12.05 ? 195 ALA A CA   1 
ATOM   2715 C C    . ALA A 1 194 ? 11.471  42.314 16.137 1.00 11.93 ? 195 ALA A C    1 
ATOM   2716 O O    . ALA A 1 194 ? 10.407  41.827 16.536 1.00 13.12 ? 195 ALA A O    1 
ATOM   2717 C CB   . ALA A 1 194 ? 12.429  44.335 17.191 1.00 14.51 ? 195 ALA A CB   1 
ATOM   2718 H H    . ALA A 1 194 ? 10.191  45.008 16.643 1.00 15.24 ? 195 ALA A H    1 
ATOM   2719 H HA   . ALA A 1 194 ? 12.100  44.019 15.198 1.00 14.46 ? 195 ALA A HA   1 
ATOM   2720 H HB1  . ALA A 1 194 ? 13.297  43.903 17.193 1.00 17.42 ? 195 ALA A HB1  1 
ATOM   2721 H HB2  . ALA A 1 194 ? 12.537  45.295 17.101 1.00 17.42 ? 195 ALA A HB2  1 
ATOM   2722 H HB3  . ALA A 1 194 ? 11.956  44.132 18.013 1.00 17.42 ? 195 ALA A HB3  1 
ATOM   2723 N N    . PRO A 1 195 ? 12.518  41.568 15.799 1.00 12.33 ? 196 PRO A N    1 
ATOM   2724 C CA   . PRO A 1 195 ? 12.444  40.099 15.869 1.00 11.37 ? 196 PRO A CA   1 
ATOM   2725 C C    . PRO A 1 195 ? 12.151  39.566 17.262 1.00 12.17 ? 196 PRO A C    1 
ATOM   2726 O O    . PRO A 1 195 ? 12.407  40.250 18.247 1.00 14.27 ? 196 PRO A O    1 
ATOM   2727 C CB   . PRO A 1 195 ? 13.833  39.657 15.414 1.00 14.53 ? 196 PRO A CB   1 
ATOM   2728 C CG   . PRO A 1 195 ? 14.339  40.804 14.571 1.00 14.30 ? 196 PRO A CG   1 
ATOM   2729 C CD   . PRO A 1 195 ? 13.798  42.021 15.234 1.00 13.24 ? 196 PRO A CD   1 
ATOM   2730 H HA   . PRO A 1 195 ? 11.779  39.763 15.247 1.00 13.65 ? 196 PRO A HA   1 
ATOM   2731 H HB2  . PRO A 1 195 ? 14.404  39.519 16.186 1.00 17.44 ? 196 PRO A HB2  1 
ATOM   2732 H HB3  . PRO A 1 195 ? 13.764  38.846 14.886 1.00 17.44 ? 196 PRO A HB3  1 
ATOM   2733 H HG2  . PRO A 1 195 ? 15.309  40.812 14.575 1.00 17.16 ? 196 PRO A HG2  1 
ATOM   2734 H HG3  . PRO A 1 195 ? 13.998  40.723 13.667 1.00 17.16 ? 196 PRO A HG3  1 
ATOM   2735 H HD2  . PRO A 1 195 ? 14.394  42.313 15.941 1.00 15.89 ? 196 PRO A HD2  1 
ATOM   2736 H HD3  . PRO A 1 195 ? 13.650  42.723 14.581 1.00 15.89 ? 196 PRO A HD3  1 
ATOM   2737 N N    . ASN A 1 196 ? 11.589  38.365 17.320 1.00 13.29 ? 197 ASN A N    1 
ATOM   2738 C CA   . ASN A 1 196 ? 11.292  37.666 18.578 1.00 13.49 ? 197 ASN A CA   1 
ATOM   2739 C C    . ASN A 1 196 ? 10.126  38.287 19.339 1.00 14.08 ? 197 ASN A C    1 
ATOM   2740 O O    . ASN A 1 196 ? 10.019  38.146 20.566 1.00 15.31 ? 197 ASN A O    1 
ATOM   2741 C CB   . ASN A 1 196 ? 12.545  37.556 19.453 1.00 16.47 ? 197 ASN A CB   1 
ATOM   2742 C CG   . ASN A 1 196 ? 12.450  36.484 20.510 1.00 31.31 ? 197 ASN A CG   1 
ATOM   2743 O OD1  . ASN A 1 196 ? 12.668  36.745 21.697 1.00 44.88 ? 197 ASN A OD1  1 
ATOM   2744 N ND2  . ASN A 1 196 ? 12.147  35.274 20.094 1.00 33.42 ? 197 ASN A ND2  1 
ATOM   2745 H H    . ASN A 1 196 ? 11.362  37.915 16.623 1.00 15.94 ? 197 ASN A H    1 
ATOM   2746 H HA   . ASN A 1 196 ? 11.027  36.759 18.356 1.00 16.19 ? 197 ASN A HA   1 
ATOM   2747 H HB2  . ASN A 1 196 ? 13.305  37.349 18.887 1.00 19.76 ? 197 ASN A HB2  1 
ATOM   2748 H HB3  . ASN A 1 196 ? 12.689  38.404 19.902 1.00 19.76 ? 197 ASN A HB3  1 
ATOM   2749 H HD21 . ASN A 1 196 ? 12.082  34.629 20.659 1.00 40.10 ? 197 ASN A HD21 1 
ATOM   2750 H HD22 . ASN A 1 196 ? 12.015  35.128 19.257 1.00 40.10 ? 197 ASN A HD22 1 
ATOM   2751 N N    . ALA A 1 197 ? 9.214   38.953 18.635 1.00 12.69 ? 198 ALA A N    1 
ATOM   2752 C CA   . ALA A 1 197 ? 8.026   39.503 19.288 1.00 11.97 ? 198 ALA A CA   1 
ATOM   2753 C C    . ALA A 1 197 ? 7.133   38.372 19.795 1.00 10.83 ? 198 ALA A C    1 
ATOM   2754 O O    . ALA A 1 197 ? 7.009   37.320 19.162 1.00 12.12 ? 198 ALA A O    1 
ATOM   2755 C CB   . ALA A 1 197 ? 7.261   40.406 18.328 1.00 14.62 ? 198 ALA A CB   1 
ATOM   2756 H H    . ALA A 1 197 ? 9.257   39.100 17.789 1.00 15.23 ? 198 ALA A H    1 
ATOM   2757 H HA   . ALA A 1 197 ? 8.300   40.036 20.051 1.00 14.37 ? 198 ALA A HA   1 
ATOM   2758 H HB1  . ALA A 1 197 ? 6.479   40.758 18.782 1.00 17.54 ? 198 ALA A HB1  1 
ATOM   2759 H HB2  . ALA A 1 197 ? 7.839   41.134 18.052 1.00 17.54 ? 198 ALA A HB2  1 
ATOM   2760 H HB3  . ALA A 1 197 ? 6.989   39.887 17.556 1.00 17.54 ? 198 ALA A HB3  1 
ATOM   2761 N N    . HIS A 1 198 ? 6.521   38.597 20.957 1.00 11.85 ? 199 HIS A N    1 
ATOM   2762 C CA   . HIS A 1 198 ? 5.648   37.624 21.600 1.00 11.96 ? 199 HIS A CA   1 
ATOM   2763 C C    . HIS A 1 198 ? 4.199   38.123 21.538 1.00 11.94 ? 199 HIS A C    1 
ATOM   2764 O O    . HIS A 1 198 ? 3.915   39.296 21.792 1.00 12.53 ? 199 HIS A O    1 
ATOM   2765 C CB   . HIS A 1 198 ? 6.016   37.475 23.082 1.00 12.93 ? 199 HIS A CB   1 
ATOM   2766 C CG   . HIS A 1 198 ? 7.272   36.685 23.335 1.00 13.94 ? 199 HIS A CG   1 
ATOM   2767 N ND1  . HIS A 1 198 ? 8.449   36.830 22.623 1.00 16.60 ? 199 HIS A ND1  1 
ATOM   2768 C CD2  . HIS A 1 198 ? 7.533   35.744 24.270 1.00 15.87 ? 199 HIS A CD2  1 
ATOM   2769 C CE1  . HIS A 1 198 ? 9.356   36.016 23.088 1.00 15.32 ? 199 HIS A CE1  1 
ATOM   2770 N NE2  . HIS A 1 198 ? 8.838   35.328 24.103 1.00 19.40 ? 199 HIS A NE2  1 
ATOM   2771 H H    . HIS A 1 198 ? 6.600   39.328 21.402 1.00 14.22 ? 199 HIS A H    1 
ATOM   2772 H HA   . HIS A 1 198 ? 5.714   36.762 21.160 1.00 14.36 ? 199 HIS A HA   1 
ATOM   2773 H HB2  . HIS A 1 198 ? 6.143   38.359 23.461 1.00 15.52 ? 199 HIS A HB2  1 
ATOM   2774 H HB3  . HIS A 1 198 ? 5.288   37.025 23.539 1.00 15.52 ? 199 HIS A HB3  1 
ATOM   2775 H HD1  . HIS A 1 198 ? 8.563   37.371 21.965 1.00 19.92 ? 199 HIS A HD1  1 
ATOM   2776 H HD2  . HIS A 1 198 ? 6.936   35.426 24.908 1.00 19.05 ? 199 HIS A HD2  1 
ATOM   2777 H HE1  . HIS A 1 198 ? 10.224  35.931 22.765 1.00 18.38 ? 199 HIS A HE1  1 
ATOM   2778 N N    . PHE A 1 199 ? 3.286   37.206 21.256 1.00 10.04 ? 200 PHE A N    1 
ATOM   2779 C CA   . PHE A 1 199 ? 1.872   37.521 21.106 1.00 11.65 ? 200 PHE A CA   1 
ATOM   2780 C C    . PHE A 1 199 ? 1.040   36.494 21.853 1.00 12.25 ? 200 PHE A C    1 
ATOM   2781 O O    . PHE A 1 199 ? 1.139   35.309 21.580 1.00 13.81 ? 200 PHE A O    1 
ATOM   2782 C CB   . PHE A 1 199 ? 1.500   37.495 19.632 1.00 12.39 ? 200 PHE A CB   1 
ATOM   2783 C CG   . PHE A 1 199 ? 2.262   38.469 18.794 1.00 12.21 ? 200 PHE A CG   1 
ATOM   2784 C CD1  . PHE A 1 199 ? 1.859   39.782 18.669 1.00 13.69 ? 200 PHE A CD1  1 
ATOM   2785 C CD2  . PHE A 1 199 ? 3.396   38.051 18.105 1.00 13.21 ? 200 PHE A CD2  1 
ATOM   2786 C CE1  . PHE A 1 199 ? 2.600   40.673 17.862 1.00 13.78 ? 200 PHE A CE1  1 
ATOM   2787 C CE2  . PHE A 1 199 ? 4.124   38.942 17.323 1.00 13.64 ? 200 PHE A CE2  1 
ATOM   2788 C CZ   . PHE A 1 199 ? 3.724   40.245 17.218 1.00 13.20 ? 200 PHE A CZ   1 
ATOM   2789 H H    . PHE A 1 199 ? 3.464   36.372 21.144 1.00 12.04 ? 200 PHE A H    1 
ATOM   2790 H HA   . PHE A 1 199 ? 1.687   38.403 21.465 1.00 13.98 ? 200 PHE A HA   1 
ATOM   2791 H HB2  . PHE A 1 199 ? 1.672   36.607 19.283 1.00 14.87 ? 200 PHE A HB2  1 
ATOM   2792 H HB3  . PHE A 1 199 ? 0.557   37.705 19.545 1.00 14.87 ? 200 PHE A HB3  1 
ATOM   2793 H HD1  . PHE A 1 199 ? 1.101   40.081 19.116 1.00 16.43 ? 200 PHE A HD1  1 
ATOM   2794 H HD2  . PHE A 1 199 ? 3.681   37.170 18.183 1.00 15.86 ? 200 PHE A HD2  1 
ATOM   2795 H HE1  . PHE A 1 199 ? 2.332   41.560 17.786 1.00 16.54 ? 200 PHE A HE1  1 
ATOM   2796 H HE2  . PHE A 1 199 ? 4.885   38.652 16.873 1.00 16.37 ? 200 PHE A HE2  1 
ATOM   2797 H HZ   . PHE A 1 199 ? 4.204   40.836 16.684 1.00 15.83 ? 200 PHE A HZ   1 
ATOM   2798 N N    . ARG A 1 200 ? 0.231   36.937 22.796 1.00 10.62 ? 201 ARG A N    1 
ATOM   2799 C CA   . ARG A 1 200 ? -0.610  36.043 23.576 1.00 11.27 ? 201 ARG A CA   1 
ATOM   2800 C C    . ARG A 1 200 ? -1.981  35.865 22.909 1.00 11.73 ? 201 ARG A C    1 
ATOM   2801 O O    . ARG A 1 200 ? -2.645  36.835 22.559 1.00 11.64 ? 201 ARG A O    1 
ATOM   2802 C CB   . ARG A 1 200 ? -0.783  36.583 24.980 1.00 13.03 ? 201 ARG A CB   1 
ATOM   2803 C CG   . ARG A 1 200 ? -1.604  35.670 25.836 1.00 15.25 ? 201 ARG A CG   1 
ATOM   2804 C CD   . ARG A 1 200 ? -1.522  36.049 27.279 1.00 27.03 ? 201 ARG A CD   1 
ATOM   2805 N NE   . ARG A 1 200 ? -1.220  34.821 27.984 1.00 42.47 ? 201 ARG A NE   1 
ATOM   2806 C CZ   . ARG A 1 200 ? -1.372  34.643 29.280 1.00 48.18 ? 201 ARG A CZ   1 
ATOM   2807 N NH1  . ARG A 1 200 ? -1.821  35.626 30.050 1.00 54.74 ? 201 ARG A NH1  1 
ATOM   2808 N NH2  . ARG A 1 200 ? -1.063  33.469 29.788 1.00 38.59 ? 201 ARG A NH2  1 
ATOM   2809 H H    . ARG A 1 200 ? 0.147   37.766 23.009 1.00 12.75 ? 201 ARG A H    1 
ATOM   2810 H HA   . ARG A 1 200 ? -0.185  35.173 23.635 1.00 13.52 ? 201 ARG A HA   1 
ATOM   2811 H HB2  . ARG A 1 200 ? 0.090   36.681 25.393 1.00 15.64 ? 201 ARG A HB2  1 
ATOM   2812 H HB3  . ARG A 1 200 ? -1.231  37.442 24.938 1.00 15.64 ? 201 ARG A HB3  1 
ATOM   2813 H HG2  . ARG A 1 200 ? -2.532  35.722 25.560 1.00 18.30 ? 201 ARG A HG2  1 
ATOM   2814 H HG3  . ARG A 1 200 ? -1.276  34.762 25.741 1.00 18.30 ? 201 ARG A HG3  1 
ATOM   2815 H HD2  . ARG A 1 200 ? -0.805  36.687 27.422 1.00 32.44 ? 201 ARG A HD2  1 
ATOM   2816 H HD3  . ARG A 1 200 ? -2.374  36.396 27.587 1.00 32.44 ? 201 ARG A HD3  1 
ATOM   2817 H HE   . ARG A 1 200 ? -0.920  34.161 27.523 1.00 50.96 ? 201 ARG A HE   1 
ATOM   2818 H HH11 . ARG A 1 200 ? -2.020  36.388 29.703 1.00 65.69 ? 201 ARG A HH11 1 
ATOM   2819 H HH12 . ARG A 1 200 ? -1.915  35.501 30.896 1.00 65.69 ? 201 ARG A HH12 1 
ATOM   2820 H HH21 . ARG A 1 200 ? -0.772  32.842 29.277 1.00 46.31 ? 201 ARG A HH21 1 
ATOM   2821 H HH22 . ARG A 1 200 ? -1.150  33.330 30.632 1.00 46.31 ? 201 ARG A HH22 1 
ATOM   2822 N N    . ILE A 1 201 ? -2.408  34.621 22.718 1.00 11.62 ? 202 ILE A N    1 
ATOM   2823 C CA   . ILE A 1 201 ? -3.689  34.324 22.111 1.00 10.96 ? 202 ILE A CA   1 
ATOM   2824 C C    . ILE A 1 201 ? -4.839  34.727 23.022 1.00 12.22 ? 202 ILE A C    1 
ATOM   2825 O O    . ILE A 1 201 ? -4.911  34.290 24.175 1.00 13.39 ? 202 ILE A O    1 
ATOM   2826 C CB   . ILE A 1 201 ? -3.807  32.840 21.714 1.00 11.78 ? 202 ILE A CB   1 
ATOM   2827 C CG1  . ILE A 1 201 ? -2.739  32.495 20.659 1.00 12.53 ? 202 ILE A CG1  1 
ATOM   2828 C CG2  . ILE A 1 201 ? -5.205  32.520 21.161 1.00 13.31 ? 202 ILE A CG2  1 
ATOM   2829 C CD1  . ILE A 1 201 ? -2.696  31.043 20.302 1.00 14.16 ? 202 ILE A CD1  1 
ATOM   2830 H H    . ILE A 1 201 ? -1.960  33.920 22.937 1.00 13.94 ? 202 ILE A H    1 
ATOM   2831 H HA   . ILE A 1 201 ? -3.769  34.847 21.298 1.00 13.16 ? 202 ILE A HA   1 
ATOM   2832 H HB   . ILE A 1 201 ? -3.653  32.295 22.501 1.00 14.13 ? 202 ILE A HB   1 
ATOM   2833 H HG12 . ILE A 1 201 ? -2.926  32.994 19.849 1.00 15.03 ? 202 ILE A HG12 1 
ATOM   2834 H HG13 . ILE A 1 201 ? -1.867  32.742 21.005 1.00 15.03 ? 202 ILE A HG13 1 
ATOM   2835 H HG21 . ILE A 1 201 ? -5.243  31.581 20.922 1.00 15.97 ? 202 ILE A HG21 1 
ATOM   2836 H HG22 . ILE A 1 201 ? -5.866  32.715 21.843 1.00 15.97 ? 202 ILE A HG22 1 
ATOM   2837 H HG23 . ILE A 1 201 ? -5.367  33.068 20.377 1.00 15.97 ? 202 ILE A HG23 1 
ATOM   2838 H HD11 . ILE A 1 201 ? -2.004  30.903 19.637 1.00 16.99 ? 202 ILE A HD11 1 
ATOM   2839 H HD12 . ILE A 1 201 ? -2.499  30.528 21.100 1.00 16.99 ? 202 ILE A HD12 1 
ATOM   2840 H HD13 . ILE A 1 201 ? -3.558  30.781 19.944 1.00 16.99 ? 202 ILE A HD13 1 
ATOM   2841 N N    . THR A 1 202 ? -5.768  35.520 22.495 1.00 12.37 ? 203 THR A N    1 
ATOM   2842 C CA   . THR A 1 202 ? -6.952  35.923 23.236 1.00 15.04 ? 203 THR A CA   1 
ATOM   2843 C C    . THR A 1 202 ? -8.233  35.256 22.740 1.00 16.56 ? 203 THR A C    1 
ATOM   2844 O O    . THR A 1 202 ? -9.195  35.171 23.501 1.00 17.58 ? 203 THR A O    1 
ATOM   2845 C CB   . THR A 1 202 ? -7.119  37.462 23.213 1.00 16.19 ? 203 THR A CB   1 
ATOM   2846 O OG1  . THR A 1 202 ? -7.246  37.901 21.864 1.00 18.69 ? 203 THR A OG1  1 
ATOM   2847 C CG2  . THR A 1 202 ? -5.967  38.150 23.886 1.00 18.46 ? 203 THR A CG2  1 
ATOM   2848 H H    . THR A 1 202 ? -5.732  35.841 21.698 1.00 14.84 ? 203 THR A H    1 
ATOM   2849 H HA   . THR A 1 202 ? -6.832  35.661 24.162 1.00 18.05 ? 203 THR A HA   1 
ATOM   2850 H HB   . THR A 1 202 ? -7.927  37.695 23.696 1.00 19.43 ? 203 THR A HB   1 
ATOM   2851 H HG1  . THR A 1 202 ? -7.338  38.736 21.841 1.00 22.43 ? 203 THR A HG1  1 
ATOM   2852 H HG21 . THR A 1 202 ? -6.095  39.111 23.859 1.00 22.15 ? 203 THR A HG21 1 
ATOM   2853 H HG22 . THR A 1 202 ? -5.906  37.865 24.811 1.00 22.15 ? 203 THR A HG22 1 
ATOM   2854 H HG23 . THR A 1 202 ? -5.139  37.929 23.432 1.00 22.15 ? 203 THR A HG23 1 
ATOM   2855 N N    . GLN A 1 203 ? -8.265  34.784 21.494 1.00 15.07 ? 204 GLN A N    1 
ATOM   2856 C CA   . GLN A 1 203 ? -9.435  34.135 20.920 1.00 15.71 ? 204 GLN A CA   1 
ATOM   2857 C C    . GLN A 1 203 ? -9.041  33.380 19.678 1.00 15.39 ? 204 GLN A C    1 
ATOM   2858 O O    . GLN A 1 203 ? -8.132  33.805 18.964 1.00 15.20 ? 204 GLN A O    1 
ATOM   2859 C CB   . GLN A 1 203 ? -10.498 35.173 20.562 1.00 23.26 ? 204 GLN A CB   1 
ATOM   2860 C CG   . GLN A 1 203 ? -11.811 34.581 20.149 1.00 30.21 ? 204 GLN A CG   1 
ATOM   2861 C CD   . GLN A 1 203 ? -12.902 35.623 19.979 1.00 39.03 ? 204 GLN A CD   1 
ATOM   2862 O OE1  . GLN A 1 203 ? -14.034 35.290 19.633 1.00 40.66 ? 204 GLN A OE1  1 
ATOM   2863 N NE2  . GLN A 1 203 ? -12.567 36.890 20.215 1.00 38.49 ? 204 GLN A NE2  1 
ATOM   2864 H H    . GLN A 1 203 ? -7.601  34.830 20.951 1.00 18.08 ? 204 GLN A H    1 
ATOM   2865 H HA   . GLN A 1 203 ? -9.811  33.510 21.559 1.00 18.85 ? 204 GLN A HA   1 
ATOM   2866 H HB2  . GLN A 1 203 ? -10.657 35.735 21.336 1.00 27.91 ? 204 GLN A HB2  1 
ATOM   2867 H HB3  . GLN A 1 203 ? -10.171 35.712 19.826 1.00 27.91 ? 204 GLN A HB3  1 
ATOM   2868 H HG2  . GLN A 1 203 ? -11.699 34.124 19.301 1.00 36.26 ? 204 GLN A HG2  1 
ATOM   2869 H HG3  . GLN A 1 203 ? -12.102 33.952 20.828 1.00 36.26 ? 204 GLN A HG3  1 
ATOM   2870 H HE21 . GLN A 1 203 ? -11.764 37.085 20.452 1.00 46.19 ? 204 GLN A HE21 1 
ATOM   2871 H HE22 . GLN A 1 203 ? -13.154 37.513 20.130 1.00 46.19 ? 204 GLN A HE22 1 
ATOM   2872 N N    . ILE A 1 204 ? -9.698  32.253 19.436 1.00 17.54 ? 205 ILE A N    1 
ATOM   2873 C CA   . ILE A 1 204 ? -9.475  31.474 18.230 1.00 16.02 ? 205 ILE A CA   1 
ATOM   2874 C C    . ILE A 1 204 ? -10.825 31.148 17.634 1.00 20.94 ? 205 ILE A C    1 
ATOM   2875 O O    . ILE A 1 204 ? -11.738 30.740 18.356 1.00 22.14 ? 205 ILE A O    1 
ATOM   2876 C CB   . ILE A 1 204 ? -8.738  30.148 18.527 1.00 16.74 ? 205 ILE A CB   1 
ATOM   2877 C CG1  . ILE A 1 204 ? -7.369  30.399 19.142 1.00 18.31 ? 205 ILE A CG1  1 
ATOM   2878 C CG2  . ILE A 1 204 ? -8.577  29.327 17.268 1.00 20.57 ? 205 ILE A CG2  1 
ATOM   2879 C CD1  . ILE A 1 204 ? -6.732  29.121 19.697 1.00 19.92 ? 205 ILE A CD1  1 
ATOM   2880 H H    . ILE A 1 204 ? -10.286 31.914 19.964 1.00 21.05 ? 205 ILE A H    1 
ATOM   2881 H HA   . ILE A 1 204 ? -8.960  31.988 17.590 1.00 19.22 ? 205 ILE A HA   1 
ATOM   2882 H HB   . ILE A 1 204 ? -9.268  29.638 19.159 1.00 20.09 ? 205 ILE A HB   1 
ATOM   2883 H HG12 . ILE A 1 204 ? -6.778  30.760 18.463 1.00 21.98 ? 205 ILE A HG12 1 
ATOM   2884 H HG13 . ILE A 1 204 ? -7.461  31.031 19.873 1.00 21.98 ? 205 ILE A HG13 1 
ATOM   2885 H HG21 . ILE A 1 204 ? -8.113  28.504 17.485 1.00 24.68 ? 205 ILE A HG21 1 
ATOM   2886 H HG22 . ILE A 1 204 ? -9.456  29.127 16.908 1.00 24.68 ? 205 ILE A HG22 1 
ATOM   2887 H HG23 . ILE A 1 204 ? -8.063  29.837 16.622 1.00 24.68 ? 205 ILE A HG23 1 
ATOM   2888 H HD11 . ILE A 1 204 ? -5.866  29.339 20.075 1.00 23.91 ? 205 ILE A HD11 1 
ATOM   2889 H HD12 . ILE A 1 204 ? -7.310  28.753 20.384 1.00 23.91 ? 205 ILE A HD12 1 
ATOM   2890 H HD13 . ILE A 1 204 ? -6.627  28.482 18.975 1.00 23.91 ? 205 ILE A HD13 1 
ATOM   2891 N N    . GLU A 1 205 ? -10.952 31.335 16.322 1.00 18.85 ? 206 GLU A N    1 
ATOM   2892 C CA   . GLU A 1 205 ? -12.113 30.872 15.574 1.00 20.96 ? 206 GLU A CA   1 
ATOM   2893 C C    . GLU A 1 205 ? -11.635 29.964 14.466 1.00 20.67 ? 206 GLU A C    1 
ATOM   2894 O O    . GLU A 1 205 ? -10.979 30.406 13.524 1.00 23.25 ? 206 GLU A O    1 
ATOM   2895 C CB   . GLU A 1 205 ? -12.913 32.038 14.998 1.00 23.64 ? 206 GLU A CB   1 
ATOM   2896 C CG   . GLU A 1 205 ? -14.138 31.583 14.205 1.00 25.43 ? 206 GLU A CG   1 
ATOM   2897 C CD   . GLU A 1 205 ? -14.952 32.745 13.673 1.00 35.51 ? 206 GLU A CD   1 
ATOM   2898 O OE1  . GLU A 1 205 ? -15.332 33.628 14.470 1.00 32.44 ? 206 GLU A OE1  1 
ATOM   2899 O OE2  . GLU A 1 205 ? -15.207 32.776 12.454 1.00 37.18 ? 206 GLU A OE2  1 
ATOM   2900 H H    . GLU A 1 205 ? -10.367 31.735 15.836 1.00 22.62 ? 206 GLU A H    1 
ATOM   2901 H HA   . GLU A 1 205 ? -12.693 30.361 16.161 1.00 25.15 ? 206 GLU A HA   1 
ATOM   2902 H HB2  . GLU A 1 205 ? -13.219 32.600 15.726 1.00 28.36 ? 206 GLU A HB2  1 
ATOM   2903 H HB3  . GLU A 1 205 ? -12.342 32.548 14.402 1.00 28.36 ? 206 GLU A HB3  1 
ATOM   2904 H HG2  . GLU A 1 205 ? -13.845 31.051 13.449 1.00 30.52 ? 206 GLU A HG2  1 
ATOM   2905 H HG3  . GLU A 1 205 ? -14.710 31.054 14.782 1.00 30.52 ? 206 GLU A HG3  1 
ATOM   2906 N N    A ARG A 1 206 ? -11.918 28.675 14.612 0.46 23.76 ? 207 ARG A N    1 
ATOM   2907 N N    B ARG A 1 206 ? -11.958 28.686 14.596 0.54 23.12 ? 207 ARG A N    1 
ATOM   2908 C CA   A ARG A 1 206 ? -11.612 27.690 13.591 0.46 27.61 ? 207 ARG A CA   1 
ATOM   2909 C CA   B ARG A 1 206 ? -11.634 27.701 13.589 0.54 27.58 ? 207 ARG A CA   1 
ATOM   2910 C C    A ARG A 1 206 ? -12.924 27.192 13.033 0.46 31.75 ? 207 ARG A C    1 
ATOM   2911 C C    B ARG A 1 206 ? -12.926 27.171 13.031 0.54 31.81 ? 207 ARG A C    1 
ATOM   2912 O O    A ARG A 1 206 ? -13.788 26.724 13.774 0.46 34.81 ? 207 ARG A O    1 
ATOM   2913 O O    B ARG A 1 206 ? -13.778 26.674 13.766 0.54 34.08 ? 207 ARG A O    1 
ATOM   2914 C CB   A ARG A 1 206 ? -10.896 26.450 14.143 0.46 30.02 ? 207 ARG A CB   1 
ATOM   2915 C CB   B ARG A 1 206 ? -10.857 26.513 14.162 0.54 31.91 ? 207 ARG A CB   1 
ATOM   2916 C CG   A ARG A 1 206 ? -9.547  26.613 14.805 0.46 31.90 ? 207 ARG A CG   1 
ATOM   2917 C CG   B ARG A 1 206 ? -9.414  26.782 14.477 0.54 35.99 ? 207 ARG A CG   1 
ATOM   2918 C CD   A ARG A 1 206 ? -9.166  25.253 15.410 0.46 32.85 ? 207 ARG A CD   1 
ATOM   2919 C CD   B ARG A 1 206 ? -8.701  25.486 14.820 0.54 38.34 ? 207 ARG A CD   1 
ATOM   2920 N NE   A ARG A 1 206 ? -7.936  25.284 16.196 0.46 25.50 ? 207 ARG A NE   1 
ATOM   2921 N NE   B ARG A 1 206 ? -8.400  24.638 13.667 0.54 35.82 ? 207 ARG A NE   1 
ATOM   2922 C CZ   A ARG A 1 206 ? -7.867  25.575 17.490 0.46 22.63 ? 207 ARG A CZ   1 
ATOM   2923 C CZ   B ARG A 1 206 ? -7.688  23.520 13.763 0.54 33.10 ? 207 ARG A CZ   1 
ATOM   2924 N NH1  A ARG A 1 206 ? -8.966  25.885 18.169 0.46 21.49 ? 207 ARG A NH1  1 
ATOM   2925 N NH1  B ARG A 1 206 ? -7.220  23.146 14.945 0.54 34.31 ? 207 ARG A NH1  1 
ATOM   2926 N NH2  A ARG A 1 206 ? -6.683  25.578 18.098 0.46 17.62 ? 207 ARG A NH2  1 
ATOM   2927 N NH2  B ARG A 1 206 ? -7.437  22.777 12.694 0.54 32.16 ? 207 ARG A NH2  1 
ATOM   2928 H H    A ARG A 1 206 ? -12.295 28.342 15.310 0.46 28.52 ? 207 ARG A H    1 
ATOM   2929 H H    B ARG A 1 206 ? -12.375 28.362 15.275 0.54 27.74 ? 207 ARG A H    1 
ATOM   2930 H HA   A ARG A 1 206 ? -11.083 28.085 12.881 0.46 33.14 ? 207 ARG A HA   1 
ATOM   2931 H HA   B ARG A 1 206 ? -11.119 28.107 12.874 0.54 33.10 ? 207 ARG A HA   1 
ATOM   2932 H HB2  A ARG A 1 206 ? -11.481 26.042 14.801 0.46 36.02 ? 207 ARG A HB2  1 
ATOM   2933 H HB2  B ARG A 1 206 ? -11.287 26.232 14.984 0.54 38.29 ? 207 ARG A HB2  1 
ATOM   2934 H HB3  A ARG A 1 206 ? -10.772 25.831 13.407 0.46 36.02 ? 207 ARG A HB3  1 
ATOM   2935 H HB3  B ARG A 1 206 ? -10.884 25.789 13.517 0.54 38.29 ? 207 ARG A HB3  1 
ATOM   2936 H HG2  A ARG A 1 206 ? -8.881  26.864 14.146 0.46 38.29 ? 207 ARG A HG2  1 
ATOM   2937 H HG2  B ARG A 1 206 ? -8.981  27.176 13.704 0.54 43.18 ? 207 ARG A HG2  1 
ATOM   2938 H HG3  A ARG A 1 206 ? -9.601  27.271 15.516 0.46 38.29 ? 207 ARG A HG3  1 
ATOM   2939 H HG3  B ARG A 1 206 ? -9.354  27.378 15.240 0.54 43.18 ? 207 ARG A HG3  1 
ATOM   2940 H HD2  A ARG A 1 206 ? -9.884  24.958 15.992 0.46 39.42 ? 207 ARG A HD2  1 
ATOM   2941 H HD2  B ARG A 1 206 ? -7.861  25.700 15.256 0.54 46.01 ? 207 ARG A HD2  1 
ATOM   2942 H HD3  A ARG A 1 206 ? -9.043  24.615 14.690 0.46 39.42 ? 207 ARG A HD3  1 
ATOM   2943 H HD3  B ARG A 1 206 ? -9.262  24.974 15.424 0.54 46.01 ? 207 ARG A HD3  1 
ATOM   2944 H HE   A ARG A 1 206 ? -7.201  25.099 15.790 0.46 30.60 ? 207 ARG A HE   1 
ATOM   2945 H HE   B ARG A 1 206 ? -8.536  24.962 12.883 0.54 42.98 ? 207 ARG A HE   1 
ATOM   2946 H HH11 A ARG A 1 206 ? -9.730  25.886 17.773 0.46 25.78 ? 207 ARG A HH11 1 
ATOM   2947 H HH11 B ARG A 1 206 ? -7.380  23.625 15.642 0.54 41.17 ? 207 ARG A HH11 1 
ATOM   2948 H HH12 A ARG A 1 206 ? -8.915  26.075 19.006 0.46 25.78 ? 207 ARG A HH12 1 
ATOM   2949 H HH12 B ARG A 1 206 ? -6.757  22.425 15.016 0.54 41.17 ? 207 ARG A HH12 1 
ATOM   2950 H HH21 A ARG A 1 206 ? -5.973  25.380 17.657 0.46 21.14 ? 207 ARG A HH21 1 
ATOM   2951 H HH21 B ARG A 1 206 ? -7.738  23.015 11.924 0.54 38.59 ? 207 ARG A HH21 1 
ATOM   2952 H HH22 A ARG A 1 206 ? -6.631  25.767 18.936 0.46 21.14 ? 207 ARG A HH22 1 
ATOM   2953 H HH22 B ARG A 1 206 ? -6.974  22.056 12.770 0.54 38.59 ? 207 ARG A HH22 1 
ATOM   2954 N N    . THR A 1 207 ? -13.072 27.279 11.724 1.00 27.70 ? 208 THR A N    1 
ATOM   2955 C CA   . THR A 1 207 ? -14.198 26.658 11.061 1.00 32.63 ? 208 THR A CA   1 
ATOM   2956 C C    . THR A 1 207 ? -13.591 25.799 9.988  1.00 34.53 ? 208 THR A C    1 
ATOM   2957 O O    . THR A 1 207 ? -12.371 25.767 9.806  1.00 37.50 ? 208 THR A O    1 
ATOM   2958 C CB   . THR A 1 207 ? -15.128 27.681 10.460 1.00 33.23 ? 208 THR A CB   1 
ATOM   2959 O OG1  . THR A 1 207 ? -14.440 28.371 9.412  1.00 36.60 ? 208 THR A OG1  1 
ATOM   2960 C CG2  . THR A 1 207 ? -15.587 28.674 11.537 1.00 34.26 ? 208 THR A CG2  1 
ATOM   2961 H H    A THR A 1 207 ? -12.533 27.692 11.196 0.46 33.25 ? 208 THR A H    1 
ATOM   2962 H H    B THR A 1 207 ? -12.537 27.703 11.201 0.54 33.25 ? 208 THR A H    1 
ATOM   2963 H HA   . THR A 1 207 ? -14.690 26.098 11.681 1.00 39.16 ? 208 THR A HA   1 
ATOM   2964 H HB   . THR A 1 207 ? -15.909 27.235 10.097 1.00 39.87 ? 208 THR A HB   1 
ATOM   2965 H HG1  . THR A 1 207 ? -14.945 28.946 9.066  1.00 43.92 ? 208 THR A HG1  1 
ATOM   2966 H HG21 . THR A 1 207 ? -16.185 29.331 11.148 1.00 41.11 ? 208 THR A HG21 1 
ATOM   2967 H HG22 . THR A 1 207 ? -16.054 28.203 12.245 1.00 41.11 ? 208 THR A HG22 1 
ATOM   2968 H HG23 . THR A 1 207 ? -14.820 29.131 11.914 1.00 41.11 ? 208 THR A HG23 1 
ATOM   2969 N N    . SER A 1 208 ? -14.437 25.077 9.280  1.00 39.37 ? 209 SER A N    1 
ATOM   2970 C CA   . SER A 1 208 ? -13.932 24.264 8.203  1.00 41.50 ? 209 SER A CA   1 
ATOM   2971 C C    . SER A 1 208 ? -13.285 25.144 7.129  1.00 44.38 ? 209 SER A C    1 
ATOM   2972 O O    . SER A 1 208 ? -12.389 24.690 6.417  1.00 51.54 ? 209 SER A O    1 
ATOM   2973 C CB   . SER A 1 208 ? -15.055 23.408 7.634  1.00 46.29 ? 209 SER A CB   1 
ATOM   2974 O OG   . SER A 1 208 ? -15.256 22.267 8.454  1.00 55.13 ? 209 SER A OG   1 
ATOM   2975 H H    . SER A 1 208 ? -15.288 25.040 9.400  1.00 47.24 ? 209 SER A H    1 
ATOM   2976 H HA   . SER A 1 208 ? -13.250 23.669 8.551  1.00 49.80 ? 209 SER A HA   1 
ATOM   2977 H HB2  . SER A 1 208 ? -15.872 23.930 7.609  1.00 55.55 ? 209 SER A HB2  1 
ATOM   2978 H HB3  . SER A 1 208 ? -14.814 23.119 6.740  1.00 55.55 ? 209 SER A HB3  1 
ATOM   2979 H HG   . SER A 1 208 ? -15.876 21.794 8.141  1.00 66.15 ? 209 SER A HG   1 
ATOM   2980 N N    . ASN A 1 209 ? -13.701 26.411 7.054  1.00 36.75 ? 210 ASN A N    1 
ATOM   2981 C CA   . ASN A 1 209 ? -13.251 27.317 5.990  1.00 39.07 ? 210 ASN A CA   1 
ATOM   2982 C C    . ASN A 1 209 ? -12.049 28.196 6.329  1.00 36.10 ? 210 ASN A C    1 
ATOM   2983 O O    . ASN A 1 209 ? -11.289 28.574 5.441  1.00 36.13 ? 210 ASN A O    1 
ATOM   2984 C CB   . ASN A 1 209 ? -14.376 28.272 5.596  1.00 41.18 ? 210 ASN A CB   1 
ATOM   2985 C CG   . ASN A 1 209 ? -15.468 27.605 4.804  1.00 52.13 ? 210 ASN A CG   1 
ATOM   2986 O OD1  . ASN A 1 209 ? -15.240 26.612 4.116  1.00 56.43 ? 210 ASN A OD1  1 
ATOM   2987 N ND2  . ASN A 1 209 ? -16.672 28.162 4.885  1.00 49.68 ? 210 ASN A ND2  1 
ATOM   2988 H H    . ASN A 1 209 ? -14.248 26.773 7.611  1.00 44.10 ? 210 ASN A H    1 
ATOM   2989 H HA   . ASN A 1 209 ? -13.021 26.790 5.209  1.00 46.88 ? 210 ASN A HA   1 
ATOM   2990 H HB2  . ASN A 1 209 ? -14.773 28.641 6.401  1.00 49.42 ? 210 ASN A HB2  1 
ATOM   2991 H HB3  . ASN A 1 209 ? -14.007 28.986 5.053  1.00 49.42 ? 210 ASN A HB3  1 
ATOM   2992 H HD21 . ASN A 1 209 ? -17.333 27.821 4.453  1.00 59.62 ? 210 ASN A HD21 1 
ATOM   2993 H HD22 . ASN A 1 209 ? -16.791 28.862 5.370  1.00 59.62 ? 210 ASN A HD22 1 
ATOM   2994 N N    . HIS A 1 210 ? -11.898 28.573 7.593  1.00 31.82 ? 211 HIS A N    1 
ATOM   2995 C CA   . HIS A 1 210 ? -10.874 29.554 7.931  1.00 28.93 ? 211 HIS A CA   1 
ATOM   2996 C C    . HIS A 1 210 ? -10.395 29.395 9.351  1.00 24.75 ? 211 HIS A C    1 
ATOM   2997 O O    . HIS A 1 210 ? -11.033 28.716 10.156 1.00 26.31 ? 211 HIS A O    1 
ATOM   2998 C CB   . HIS A 1 210 ? -11.416 30.974 7.745  1.00 29.59 ? 211 HIS A CB   1 
ATOM   2999 C CG   . HIS A 1 210 ? -12.566 31.308 8.650  1.00 31.46 ? 211 HIS A CG   1 
ATOM   3000 N ND1  . HIS A 1 210 ? -13.869 31.316 8.217  1.00 32.06 ? 211 HIS A ND1  1 
ATOM   3001 C CD2  . HIS A 1 210 ? -12.594 31.645 9.961  1.00 32.30 ? 211 HIS A CD2  1 
ATOM   3002 C CE1  . HIS A 1 210 ? -14.664 31.647 9.227  1.00 34.11 ? 211 HIS A CE1  1 
ATOM   3003 N NE2  . HIS A 1 210 ? -13.914 31.851 10.291 1.00 33.60 ? 211 HIS A NE2  1 
ATOM   3004 H H    . HIS A 1 210 ? -12.361 28.286 8.258  1.00 38.18 ? 211 HIS A H    1 
ATOM   3005 H HA   . HIS A 1 210 ? -10.114 29.439 7.340  1.00 34.71 ? 211 HIS A HA   1 
ATOM   3006 H HB2  . HIS A 1 210 ? -10.704 31.607 7.925  1.00 35.50 ? 211 HIS A HB2  1 
ATOM   3007 H HB3  . HIS A 1 210 ? -11.721 31.075 6.829  1.00 35.50 ? 211 HIS A HB3  1 
ATOM   3008 H HD2  . HIS A 1 210 ? -11.862 31.724 10.529 1.00 38.77 ? 211 HIS A HD2  1 
ATOM   3009 H HE1  . HIS A 1 210 ? -15.590 31.722 9.190  1.00 40.93 ? 211 HIS A HE1  1 
ATOM   3010 H HE2  . HIS A 1 210 ? -14.204 32.075 11.069 1.00 40.32 ? 211 HIS A HE2  1 
ATOM   3011 N N    . THR A 1 211 ? -9.271  30.028 9.642  1.00 23.98 ? 212 THR A N    1 
ATOM   3012 C CA   . THR A 1 211 ? -8.748  30.101 11.004 1.00 19.90 ? 212 THR A CA   1 
ATOM   3013 C C    . THR A 1 211 ? -8.371  31.543 11.292 1.00 19.19 ? 212 THR A C    1 
ATOM   3014 O O    . THR A 1 211 ? -7.514  32.116 10.611 1.00 19.54 ? 212 THR A O    1 
ATOM   3015 C CB   . THR A 1 211 ? -7.506  29.236 11.187 1.00 21.55 ? 212 THR A CB   1 
ATOM   3016 O OG1  . THR A 1 211 ? -7.808  27.896 10.779 1.00 26.84 ? 212 THR A OG1  1 
ATOM   3017 C CG2  . THR A 1 211 ? -7.048  29.234 12.637 1.00 25.91 ? 212 THR A CG2  1 
ATOM   3018 H H    . THR A 1 211 ? -8.781  30.431 9.061  1.00 28.78 ? 212 THR A H    1 
ATOM   3019 H HA   . THR A 1 211 ? -9.427  29.819 11.637 1.00 23.88 ? 212 THR A HA   1 
ATOM   3020 H HB   . THR A 1 211 ? -6.786  29.585 10.639 1.00 25.86 ? 212 THR A HB   1 
ATOM   3021 H HG1  . THR A 1 211 ? -8.435  27.588 11.245 1.00 32.21 ? 212 THR A HG1  1 
ATOM   3022 H HG21 . THR A 1 211 ? -6.258  28.679 12.734 1.00 31.09 ? 212 THR A HG21 1 
ATOM   3023 H HG22 . THR A 1 211 ? -6.836  30.137 12.919 1.00 31.09 ? 212 THR A HG22 1 
ATOM   3024 H HG23 . THR A 1 211 ? -7.752  28.884 13.206 1.00 31.09 ? 212 THR A HG23 1 
ATOM   3025 N N    . TYR A 1 212 ? -9.020  32.134 12.288 1.00 16.53 ? 213 TYR A N    1 
ATOM   3026 C CA   . TYR A 1 212 ? -8.707  33.478 12.722 1.00 15.30 ? 213 TYR A CA   1 
ATOM   3027 C C    . TYR A 1 212 ? -8.232  33.422 14.157 1.00 15.71 ? 213 TYR A C    1 
ATOM   3028 O O    . TYR A 1 212 ? -8.826  32.701 14.983 1.00 16.91 ? 213 TYR A O    1 
ATOM   3029 C CB   . TYR A 1 212 ? -9.928  34.388 12.675 1.00 18.86 ? 213 TYR A CB   1 
ATOM   3030 C CG   . TYR A 1 212 ? -10.598 34.543 11.335 1.00 21.78 ? 213 TYR A CG   1 
ATOM   3031 C CD1  . TYR A 1 212 ? -9.908  34.393 10.139 1.00 22.06 ? 213 TYR A CD1  1 
ATOM   3032 C CD2  . TYR A 1 212 ? -11.933 34.844 11.273 1.00 25.55 ? 213 TYR A CD2  1 
ATOM   3033 C CE1  . TYR A 1 212 ? -10.549 34.536 8.935  1.00 26.64 ? 213 TYR A CE1  1 
ATOM   3034 C CE2  . TYR A 1 212 ? -12.571 34.983 10.074 1.00 28.92 ? 213 TYR A CE2  1 
ATOM   3035 C CZ   . TYR A 1 212 ? -11.873 34.825 8.916  1.00 26.13 ? 213 TYR A CZ   1 
ATOM   3036 O OH   . TYR A 1 212 ? -12.522 34.977 7.708  1.00 32.65 ? 213 TYR A OH   1 
ATOM   3037 H H    . TYR A 1 212 ? -9.657  31.765 12.733 1.00 19.83 ? 213 TYR A H    1 
ATOM   3038 H HA   . TYR A 1 212 ? -8.006  33.856 12.168 1.00 18.37 ? 213 TYR A HA   1 
ATOM   3039 H HB2  . TYR A 1 212 ? -10.592 34.037 13.289 1.00 22.64 ? 213 TYR A HB2  1 
ATOM   3040 H HB3  . TYR A 1 212 ? -9.659  35.273 12.966 1.00 22.64 ? 213 TYR A HB3  1 
ATOM   3041 H HD1  . TYR A 1 212 ? -9.001  34.189 10.154 1.00 26.47 ? 213 TYR A HD1  1 
ATOM   3042 H HD2  . TYR A 1 212 ? -12.415 34.946 12.061 1.00 30.66 ? 213 TYR A HD2  1 
ATOM   3043 H HE1  . TYR A 1 212 ? -10.080 34.432 8.138  1.00 31.97 ? 213 TYR A HE1  1 
ATOM   3044 H HE2  . TYR A 1 212 ? -13.478 35.186 10.048 1.00 34.70 ? 213 TYR A HE2  1 
ATOM   3045 H HH   . TYR A 1 212 ? -11.982 34.863 7.075  1.00 39.18 ? 213 TYR A HH   1 
ATOM   3046 N N    . ILE A 1 213 ? -7.184  34.167 14.457 1.00 13.74 ? 214 ILE A N    1 
ATOM   3047 C CA   . ILE A 1 213 ? -6.630  34.156 15.798 1.00 13.21 ? 214 ILE A CA   1 
ATOM   3048 C C    . ILE A 1 213 ? -6.468  35.575 16.259 1.00 11.62 ? 214 ILE A C    1 
ATOM   3049 O O    . ILE A 1 213 ? -5.854  36.400 15.573 1.00 13.07 ? 214 ILE A O    1 
ATOM   3050 C CB   . ILE A 1 213 ? -5.294  33.404 15.863 1.00 13.15 ? 214 ILE A CB   1 
ATOM   3051 C CG1  . ILE A 1 213 ? -5.473  31.971 15.389 1.00 16.79 ? 214 ILE A CG1  1 
ATOM   3052 C CG2  . ILE A 1 213 ? -4.780  33.404 17.296 1.00 16.28 ? 214 ILE A CG2  1 
ATOM   3053 C CD1  . ILE A 1 213 ? -4.223  31.151 15.467 1.00 18.55 ? 214 ILE A CD1  1 
ATOM   3054 H H    . ILE A 1 213 ? -6.776  34.686 13.906 1.00 16.49 ? 214 ILE A H    1 
ATOM   3055 H HA   . ILE A 1 213 ? -7.253  33.715 16.396 1.00 15.85 ? 214 ILE A HA   1 
ATOM   3056 H HB   . ILE A 1 213 ? -4.649  33.851 15.293 1.00 15.79 ? 214 ILE A HB   1 
ATOM   3057 H HG12 . ILE A 1 213 ? -6.145  31.540 15.940 1.00 20.15 ? 214 ILE A HG12 1 
ATOM   3058 H HG13 . ILE A 1 213 ? -5.764  31.981 14.464 1.00 20.15 ? 214 ILE A HG13 1 
ATOM   3059 H HG21 . ILE A 1 213 ? -3.936  32.926 17.327 1.00 19.54 ? 214 ILE A HG21 1 
ATOM   3060 H HG22 . ILE A 1 213 ? -4.653  34.321 17.585 1.00 19.54 ? 214 ILE A HG22 1 
ATOM   3061 H HG23 . ILE A 1 213 ? -5.431  32.964 17.864 1.00 19.54 ? 214 ILE A HG23 1 
ATOM   3062 H HD11 . ILE A 1 213 ? -4.413  30.255 15.150 1.00 22.26 ? 214 ILE A HD11 1 
ATOM   3063 H HD12 . ILE A 1 213 ? -3.542  31.561 14.911 1.00 22.26 ? 214 ILE A HD12 1 
ATOM   3064 H HD13 . ILE A 1 213 ? -3.923  31.120 16.389 1.00 22.26 ? 214 ILE A HD13 1 
ATOM   3065 N N    . GLY A 1 214 ? -7.047  35.897 17.402 1.00 12.26 ? 215 GLY A N    1 
ATOM   3066 C CA   . GLY A 1 214 ? -6.806  37.163 18.037 1.00 12.19 ? 215 GLY A CA   1 
ATOM   3067 C C    . GLY A 1 214 ? -5.657  37.061 19.007 1.00 12.22 ? 215 GLY A C    1 
ATOM   3068 O O    . GLY A 1 214 ? -5.587  36.083 19.765 1.00 13.09 ? 215 GLY A O    1 
ATOM   3069 H H    . GLY A 1 214 ? -7.590  35.387 17.832 1.00 14.72 ? 215 GLY A H    1 
ATOM   3070 H HA2  . GLY A 1 214 ? -6.591  37.831 17.367 1.00 14.62 ? 215 GLY A HA2  1 
ATOM   3071 H HA3  . GLY A 1 214 ? -7.599  37.447 18.519 1.00 14.62 ? 215 GLY A HA3  1 
ATOM   3072 N N    . VAL A 1 215 ? -4.736  38.016 18.974 1.00 12.19 ? 216 VAL A N    1 
ATOM   3073 C CA   . VAL A 1 215 ? -3.591  38.025 19.852 1.00 10.63 ? 216 VAL A CA   1 
ATOM   3074 C C    . VAL A 1 215 ? -3.354  39.416 20.389 1.00 11.19 ? 216 VAL A C    1 
ATOM   3075 O O    . VAL A 1 215 ? -3.766  40.407 19.784 1.00 13.19 ? 216 VAL A O    1 
ATOM   3076 C CB   . VAL A 1 215 ? -2.291  37.546 19.173 1.00 11.43 ? 216 VAL A CB   1 
ATOM   3077 C CG1  . VAL A 1 215 ? -2.401  36.109 18.668 1.00 13.08 ? 216 VAL A CG1  1 
ATOM   3078 C CG2  . VAL A 1 215 ? -1.910  38.489 18.032 1.00 12.80 ? 216 VAL A CG2  1 
ATOM   3079 H H    . VAL A 1 215 ? -4.759  38.685 18.434 1.00 14.63 ? 216 VAL A H    1 
ATOM   3080 H HA   . VAL A 1 215 ? -3.767  37.440 20.605 1.00 12.75 ? 216 VAL A HA   1 
ATOM   3081 H HB   . VAL A 1 215 ? -1.574  37.572 19.826 1.00 13.71 ? 216 VAL A HB   1 
ATOM   3082 H HG11 . VAL A 1 215 ? -1.562  35.856 18.251 1.00 15.70 ? 216 VAL A HG11 1 
ATOM   3083 H HG12 . VAL A 1 215 ? -2.587  35.524 19.420 1.00 15.70 ? 216 VAL A HG12 1 
ATOM   3084 H HG13 . VAL A 1 215 ? -3.122  36.056 18.021 1.00 15.70 ? 216 VAL A HG13 1 
ATOM   3085 H HG21 . VAL A 1 215 ? -1.092  38.171 17.619 1.00 15.35 ? 216 VAL A HG21 1 
ATOM   3086 H HG22 . VAL A 1 215 ? -2.628  38.500 17.380 1.00 15.35 ? 216 VAL A HG22 1 
ATOM   3087 H HG23 . VAL A 1 215 ? -1.775  39.380 18.392 1.00 15.35 ? 216 VAL A HG23 1 
ATOM   3088 N N    . GLU A 1 216 ? -2.693  39.490 21.537 1.00 10.91 ? 217 GLU A N    1 
ATOM   3089 C CA   . GLU A 1 216 ? -2.248  40.754 22.128 1.00 11.71 ? 217 GLU A CA   1 
ATOM   3090 C C    . GLU A 1 216 ? -0.742  40.721 22.326 1.00 11.28 ? 217 GLU A C    1 
ATOM   3091 O O    . GLU A 1 216 ? -0.172  39.717 22.771 1.00 12.04 ? 217 GLU A O    1 
ATOM   3092 C CB   . GLU A 1 216 ? -2.952  41.008 23.460 1.00 14.16 ? 217 GLU A CB   1 
ATOM   3093 C CG   . GLU A 1 216 ? -2.577  40.019 24.544 1.00 21.20 ? 217 GLU A CG   1 
ATOM   3094 C CD   . GLU A 1 216 ? -3.156  40.360 25.902 1.00 35.08 ? 217 GLU A CD   1 
ATOM   3095 O OE1  . GLU A 1 216 ? -3.117  39.469 26.793 1.00 33.98 ? 217 GLU A OE1  1 
ATOM   3096 O OE2  . GLU A 1 216 ? -3.618  41.514 26.076 1.00 39.51 ? 217 GLU A OE2  1 
ATOM   3097 H H    . GLU A 1 216 ? -2.482  38.802 22.009 1.00 13.09 ? 217 GLU A H    1 
ATOM   3098 H HA   . GLU A 1 216 ? -2.461  41.484 21.525 1.00 14.05 ? 217 GLU A HA   1 
ATOM   3099 H HB2  . GLU A 1 216 ? -2.717  41.896 23.774 1.00 17.00 ? 217 GLU A HB2  1 
ATOM   3100 H HB3  . GLU A 1 216 ? -3.910  40.950 23.324 1.00 17.00 ? 217 GLU A HB3  1 
ATOM   3101 H HG2  . GLU A 1 216 ? -2.904  39.141 24.293 1.00 25.45 ? 217 GLU A HG2  1 
ATOM   3102 H HG3  . GLU A 1 216 ? -1.611  39.999 24.629 1.00 25.45 ? 217 GLU A HG3  1 
ATOM   3103 N N    . THR A 1 217 ? -0.065  41.816 22.012 1.00 10.95 ? 218 THR A N    1 
ATOM   3104 C CA   . THR A 1 217 ? 1.344   41.945 22.265 1.00 10.49 ? 218 THR A CA   1 
ATOM   3105 C C    . THR A 1 217 ? 1.632   41.768 23.767 1.00 13.86 ? 218 THR A C    1 
ATOM   3106 O O    . THR A 1 217 ? 0.961   42.385 24.605 1.00 14.13 ? 218 THR A O    1 
ATOM   3107 C CB   . THR A 1 217 ? 1.842   43.333 21.826 1.00 12.23 ? 218 THR A CB   1 
ATOM   3108 O OG1  . THR A 1 217 ? 1.020   44.331 22.416 1.00 12.24 ? 218 THR A OG1  1 
ATOM   3109 C CG2  . THR A 1 217 ? 1.761   43.523 20.336 1.00 12.42 ? 218 THR A CG2  1 
ATOM   3110 H H    . THR A 1 217 ? -0.415  42.510 21.642 1.00 13.14 ? 218 THR A H    1 
ATOM   3111 H HA   . THR A 1 217 ? 1.831   41.267 21.771 1.00 12.59 ? 218 THR A HA   1 
ATOM   3112 H HB   . THR A 1 217 ? 2.762   43.457 22.108 1.00 14.68 ? 218 THR A HB   1 
ATOM   3113 H HG1  . THR A 1 217 ? 1.055   44.274 23.254 1.00 14.68 ? 218 THR A HG1  1 
ATOM   3114 H HG21 . THR A 1 217 ? 2.082   44.406 20.097 1.00 14.90 ? 218 THR A HG21 1 
ATOM   3115 H HG22 . THR A 1 217 ? 2.305   42.857 19.887 1.00 14.90 ? 218 THR A HG22 1 
ATOM   3116 H HG23 . THR A 1 217 ? 0.842   43.431 20.040 1.00 14.90 ? 218 THR A HG23 1 
ATOM   3117 N N    . VAL A 1 218 ? 2.668   40.993 24.077 1.00 11.97 ? 219 VAL A N    1 
ATOM   3118 C CA   . VAL A 1 218 ? 3.116   40.839 25.470 1.00 11.59 ? 219 VAL A CA   1 
ATOM   3119 C C    . VAL A 1 218 ? 4.627   40.910 25.520 1.00 13.93 ? 219 VAL A C    1 
ATOM   3120 O O    . VAL A 1 218 ? 5.309   40.538 24.560 1.00 14.62 ? 219 VAL A O    1 
ATOM   3121 C CB   . VAL A 1 218 ? 2.614   39.519 26.108 1.00 13.28 ? 219 VAL A CB   1 
ATOM   3122 C CG1  . VAL A 1 218 ? 1.122   39.518 26.217 1.00 15.84 ? 219 VAL A CG1  1 
ATOM   3123 C CG2  . VAL A 1 218 ? 3.118   38.280 25.364 1.00 13.50 ? 219 VAL A CG2  1 
ATOM   3124 H H    . VAL A 1 218 ? 3.130   40.545 23.506 1.00 14.36 ? 219 VAL A H    1 
ATOM   3125 H HA   . VAL A 1 218 ? 2.765   41.575 25.996 1.00 13.91 ? 219 VAL A HA   1 
ATOM   3126 H HB   . VAL A 1 218 ? 2.965   39.470 27.011 1.00 15.93 ? 219 VAL A HB   1 
ATOM   3127 H HG11 . VAL A 1 218 ? 0.836   38.682 26.619 1.00 19.01 ? 219 VAL A HG11 1 
ATOM   3128 H HG12 . VAL A 1 218 ? 0.845   40.263 26.772 1.00 19.01 ? 219 VAL A HG12 1 
ATOM   3129 H HG13 . VAL A 1 218 ? 0.741   39.606 25.330 1.00 19.01 ? 219 VAL A HG13 1 
ATOM   3130 H HG21 . VAL A 1 218 ? 2.774   37.487 25.804 1.00 16.20 ? 219 VAL A HG21 1 
ATOM   3131 H HG22 . VAL A 1 218 ? 2.802   38.313 24.447 1.00 16.20 ? 219 VAL A HG22 1 
ATOM   3132 H HG23 . VAL A 1 218 ? 4.087   38.275 25.381 1.00 16.20 ? 219 VAL A HG23 1 
ATOM   3133 N N    . LYS A 1 219 ? 5.156   41.334 26.663 1.00 15.48 ? 220 LYS A N    1 
ATOM   3134 C CA   . LYS A 1 219 ? 6.586   41.350 26.883 1.00 19.47 ? 220 LYS A CA   1 
ATOM   3135 C C    . LYS A 1 219 ? 7.056   39.952 27.223 1.00 17.76 ? 220 LYS A C    1 
ATOM   3136 O O    . LYS A 1 219 ? 6.424   39.267 28.022 1.00 19.08 ? 220 LYS A O    1 
ATOM   3137 C CB   . LYS A 1 219 ? 6.887   42.257 28.048 1.00 25.78 ? 220 LYS A CB   1 
ATOM   3138 C CG   . LYS A 1 219 ? 8.324   42.646 28.157 1.00 33.04 ? 220 LYS A CG   1 
ATOM   3139 C CD   . LYS A 1 219 ? 8.480   43.846 29.081 1.00 43.67 ? 220 LYS A CD   1 
ATOM   3140 C CE   . LYS A 1 219 ? 7.698   43.694 30.397 1.00 53.40 ? 220 LYS A CE   1 
ATOM   3141 N NZ   . LYS A 1 219 ? 7.201   44.996 30.910 1.00 67.02 ? 220 LYS A NZ   1 
ATOM   3142 H H    . LYS A 1 219 ? 4.697   41.621 27.331 1.00 18.57 ? 220 LYS A H    1 
ATOM   3143 H HA   . LYS A 1 219 ? 7.050   41.668 26.093 1.00 23.36 ? 220 LYS A HA   1 
ATOM   3144 H HB2  . LYS A 1 219 ? 6.366   43.070 27.953 1.00 30.93 ? 220 LYS A HB2  1 
ATOM   3145 H HB3  . LYS A 1 219 ? 6.640   41.802 28.868 1.00 30.93 ? 220 LYS A HB3  1 
ATOM   3146 H HG2  . LYS A 1 219 ? 8.833   41.907 28.524 1.00 39.65 ? 220 LYS A HG2  1 
ATOM   3147 H HG3  . LYS A 1 219 ? 8.662   42.888 27.280 1.00 39.65 ? 220 LYS A HG3  1 
ATOM   3148 H HD2  . LYS A 1 219 ? 9.419   43.955 29.302 1.00 52.41 ? 220 LYS A HD2  1 
ATOM   3149 H HD3  . LYS A 1 219 ? 8.153   44.638 28.628 1.00 52.41 ? 220 LYS A HD3  1 
ATOM   3150 H HE2  . LYS A 1 219 ? 6.932   43.118 30.247 1.00 64.08 ? 220 LYS A HE2  1 
ATOM   3151 H HE3  . LYS A 1 219 ? 8.280   43.307 31.070 1.00 64.08 ? 220 LYS A HE3  1 
ATOM   3152 H HZ1  . LYS A 1 219 ? 6.754   44.873 31.670 1.00 80.43 ? 220 LYS A HZ1  1 
ATOM   3153 H HZ2  . LYS A 1 219 ? 7.886   45.544 31.063 1.00 80.43 ? 220 LYS A HZ2  1 
ATOM   3154 H HZ3  . LYS A 1 219 ? 6.658   45.371 30.313 1.00 80.43 ? 220 LYS A HZ3  1 
ATOM   3155 N N    . ALA A 1 220 ? 8.150   39.519 26.624 1.00 20.85 ? 221 ALA A N    1 
ATOM   3156 C CA   . ALA A 1 220 ? 8.658   38.179 26.867 1.00 22.77 ? 221 ALA A CA   1 
ATOM   3157 C C    . ALA A 1 220 ? 8.945   37.914 28.329 1.00 21.81 ? 221 ALA A C    1 
ATOM   3158 O O    . ALA A 1 220 ? 8.667   36.832 28.834 1.00 27.14 ? 221 ALA A O    1 
ATOM   3159 C CB   . ALA A 1 220 ? 9.920   37.933 26.038 1.00 27.66 ? 221 ALA A CB   1 
ATOM   3160 H H    . ALA A 1 220 ? 8.620   39.981 26.071 1.00 25.02 ? 221 ALA A H    1 
ATOM   3161 H HA   . ALA A 1 220 ? 7.988   37.539 26.579 1.00 27.33 ? 221 ALA A HA   1 
ATOM   3162 H HB1  . ALA A 1 220 ? 10.242  37.035 26.214 1.00 33.19 ? 221 ALA A HB1  1 
ATOM   3163 H HB2  . ALA A 1 220 ? 9.704   38.029 25.098 1.00 33.19 ? 221 ALA A HB2  1 
ATOM   3164 H HB3  . ALA A 1 220 ? 10.595  38.582 26.291 1.00 33.19 ? 221 ALA A HB3  1 
ATOM   3165 N N    . SER A 1 221 ? 9.499   38.904 29.023 1.00 22.06 ? 222 SER A N    1 
ATOM   3166 C CA   . SER A 1 221 ? 9.858   38.723 30.433 1.00 28.26 ? 222 SER A CA   1 
ATOM   3167 C C    . SER A 1 221 ? 8.624   38.608 31.344 1.00 25.45 ? 222 SER A C    1 
ATOM   3168 O O    . SER A 1 221 ? 8.734   38.155 32.492 1.00 35.58 ? 222 SER A O    1 
ATOM   3169 C CB   . SER A 1 221 ? 10.744  39.874 30.893 1.00 28.08 ? 222 SER A CB   1 
ATOM   3170 O OG   . SER A 1 221 ? 10.037  41.096 30.843 1.00 29.04 ? 222 SER A OG   1 
ATOM   3171 H H    . SER A 1 221 ? 9.678   39.684 28.707 1.00 26.47 ? 222 SER A H    1 
ATOM   3172 H HA   . SER A 1 221 ? 10.368  37.903 30.521 1.00 33.91 ? 222 SER A HA   1 
ATOM   3173 H HB2  . SER A 1 221 ? 11.028  39.710 31.807 1.00 33.69 ? 222 SER A HB2  1 
ATOM   3174 H HB3  . SER A 1 221 ? 11.518  39.932 30.311 1.00 33.69 ? 222 SER A HB3  1 
ATOM   3175 H HG   . SER A 1 221 ? 9.784   41.249 30.056 1.00 34.85 ? 222 SER A HG   1 
ATOM   3176 N N    . ALA A 1 222 ? 7.457   39.006 30.843 1.00 27.00 ? 223 ALA A N    1 
ATOM   3177 C CA   . ALA A 1 222 ? 6.213   38.959 31.620 1.00 25.79 ? 223 ALA A CA   1 
ATOM   3178 C C    . ALA A 1 222 ? 5.453   37.654 31.403 1.00 28.87 ? 223 ALA A C    1 
ATOM   3179 O O    . ALA A 1 222 ? 4.440   37.416 32.050 1.00 36.21 ? 223 ALA A O    1 
ATOM   3180 C CB   . ALA A 1 222 ? 5.306   40.123 31.265 1.00 27.43 ? 223 ALA A CB   1 
ATOM   3181 H H    . ALA A 1 222 ? 7.355   39.310 30.045 1.00 32.40 ? 223 ALA A H    1 
ATOM   3182 H HA   . ALA A 1 222 ? 6.429   39.025 32.563 1.00 30.95 ? 223 ALA A HA   1 
ATOM   3183 H HB1  . ALA A 1 222 ? 4.495   40.063 31.794 1.00 32.91 ? 223 ALA A HB1  1 
ATOM   3184 H HB2  . ALA A 1 222 ? 5.768   40.953 31.460 1.00 32.91 ? 223 ALA A HB2  1 
ATOM   3185 H HB3  . ALA A 1 222 ? 5.089   40.078 30.321 1.00 32.91 ? 223 ALA A HB3  1 
ATOM   3186 N N    . VAL A 1 223 ? 5.926   36.834 30.466 1.00 24.24 ? 224 VAL A N    1 
ATOM   3187 C CA   . VAL A 1 223 ? 5.249   35.584 30.131 1.00 23.90 ? 224 VAL A CA   1 
ATOM   3188 C C    . VAL A 1 223 ? 5.594   34.555 31.210 1.00 20.11 ? 224 VAL A C    1 
ATOM   3189 O O    . VAL A 1 223 ? 6.772   34.279 31.440 1.00 26.29 ? 224 VAL A O    1 
ATOM   3190 C CB   . VAL A 1 223 ? 5.656   35.054 28.715 1.00 22.90 ? 224 VAL A CB   1 
ATOM   3191 C CG1  . VAL A 1 223 ? 5.050   33.682 28.477 1.00 24.96 ? 224 VAL A CG1  1 
ATOM   3192 C CG2  . VAL A 1 223 ? 5.205   36.022 27.590 1.00 23.61 ? 224 VAL A CG2  1 
ATOM   3193 H H    . VAL A 1 223 ? 6.640   36.979 30.009 1.00 29.09 ? 224 VAL A H    1 
ATOM   3194 H HA   . VAL A 1 223 ? 4.290   35.726 30.140 1.00 28.67 ? 224 VAL A HA   1 
ATOM   3195 H HB   . VAL A 1 223 ? 6.621   34.970 28.672 1.00 27.48 ? 224 VAL A HB   1 
ATOM   3196 H HG11 . VAL A 1 223 ? 5.312   33.370 27.596 1.00 29.95 ? 224 VAL A HG11 1 
ATOM   3197 H HG12 . VAL A 1 223 ? 5.377   33.071 29.155 1.00 29.95 ? 224 VAL A HG12 1 
ATOM   3198 H HG13 . VAL A 1 223 ? 4.084   33.750 28.530 1.00 29.95 ? 224 VAL A HG13 1 
ATOM   3199 H HG21 . VAL A 1 223 ? 5.476   35.657 26.733 1.00 28.33 ? 224 VAL A HG21 1 
ATOM   3200 H HG22 . VAL A 1 223 ? 4.240   36.114 27.621 1.00 28.33 ? 224 VAL A HG22 1 
ATOM   3201 H HG23 . VAL A 1 223 ? 5.624   36.885 27.729 1.00 28.33 ? 224 VAL A HG23 1 
ATOM   3202 N N    . LYS A 1 224 ? 4.575   34.026 31.895 1.00 20.24 ? 225 LYS A N    1 
ATOM   3203 C CA   . LYS A 1 224 ? 4.767   33.118 33.039 1.00 20.98 ? 225 LYS A CA   1 
ATOM   3204 C C    . LYS A 1 224 ? 3.735   31.981 33.070 1.00 16.05 ? 225 LYS A C    1 
ATOM   3205 O O    . LYS A 1 224 ? 2.539   32.208 32.923 1.00 17.32 ? 225 LYS A O    1 
ATOM   3206 C CB   . LYS A 1 224 ? 4.712   33.933 34.346 1.00 26.24 ? 225 LYS A CB   1 
ATOM   3207 C CG   . LYS A 1 224 ? 4.994   33.151 35.563 1.00 30.75 ? 225 LYS A CG   1 
ATOM   3208 C CD   . LYS A 1 224 ? 5.177   34.093 36.748 1.00 33.65 ? 225 LYS A CD   1 
ATOM   3209 C CE   . LYS A 1 224 ? 5.469   33.341 38.034 1.00 40.50 ? 225 LYS A CE   1 
ATOM   3210 N NZ   . LYS A 1 224 ? 6.180   34.205 39.010 1.00 43.92 ? 225 LYS A NZ   1 
ATOM   3211 H H    . LYS A 1 224 ? 3.748   34.179 31.715 1.00 24.28 ? 225 LYS A H    1 
ATOM   3212 H HA   . LYS A 1 224 ? 5.648   32.717 32.975 1.00 25.18 ? 225 LYS A HA   1 
ATOM   3213 H HB2  . LYS A 1 224 ? 5.368   34.646 34.295 1.00 31.49 ? 225 LYS A HB2  1 
ATOM   3214 H HB3  . LYS A 1 224 ? 3.824   34.311 34.439 1.00 31.49 ? 225 LYS A HB3  1 
ATOM   3215 H HG2  . LYS A 1 224 ? 4.249   32.559 35.751 1.00 36.90 ? 225 LYS A HG2  1 
ATOM   3216 H HG3  . LYS A 1 224 ? 5.812   32.644 35.442 1.00 36.90 ? 225 LYS A HG3  1 
ATOM   3217 H HD2  . LYS A 1 224 ? 5.922   34.688 36.570 1.00 40.38 ? 225 LYS A HD2  1 
ATOM   3218 H HD3  . LYS A 1 224 ? 4.363   34.606 36.876 1.00 40.38 ? 225 LYS A HD3  1 
ATOM   3219 H HE2  . LYS A 1 224 ? 4.634   33.051 38.433 1.00 48.60 ? 225 LYS A HE2  1 
ATOM   3220 H HE3  . LYS A 1 224 ? 6.032   32.575 37.837 1.00 48.60 ? 225 LYS A HE3  1 
ATOM   3221 H HZ1  . LYS A 1 224 ? 6.343   33.749 39.757 1.00 52.70 ? 225 LYS A HZ1  1 
ATOM   3222 H HZ2  . LYS A 1 224 ? 6.952   34.481 38.665 1.00 52.70 ? 225 LYS A HZ2  1 
ATOM   3223 H HZ3  . LYS A 1 224 ? 5.680   34.914 39.207 1.00 52.70 ? 225 LYS A HZ3  1 
ATOM   3224 N N    . ASN A 1 225 ? 4.213   30.754 33.256 1.00 15.67 ? 226 ASN A N    1 
ATOM   3225 C CA   . ASN A 1 225 ? 3.344   29.580 33.436 1.00 16.34 ? 226 ASN A CA   1 
ATOM   3226 C C    . ASN A 1 225 ? 2.368   29.373 32.296 1.00 14.48 ? 226 ASN A C    1 
ATOM   3227 O O    . ASN A 1 225 ? 1.211   29.046 32.507 1.00 14.28 ? 226 ASN A O    1 
ATOM   3228 C CB   . ASN A 1 225 ? 2.599   29.660 34.774 1.00 16.92 ? 226 ASN A CB   1 
ATOM   3229 C CG   . ASN A 1 225 ? 3.514   29.624 35.949 1.00 17.34 ? 226 ASN A CG   1 
ATOM   3230 O OD1  . ASN A 1 225 ? 4.636   29.123 35.873 1.00 18.01 ? 226 ASN A OD1  1 
ATOM   3231 N ND2  . ASN A 1 225 ? 3.027   30.104 37.068 1.00 19.50 ? 226 ASN A ND2  1 
ATOM   3232 H H    . ASN A 1 225 ? 5.052   30.567 33.283 1.00 18.80 ? 226 ASN A H    1 
ATOM   3233 H HA   . ASN A 1 225 ? 3.910   28.792 33.472 1.00 19.61 ? 226 ASN A HA   1 
ATOM   3234 H HB2  . ASN A 1 225 ? 2.099   30.491 34.808 1.00 20.31 ? 226 ASN A HB2  1 
ATOM   3235 H HB3  . ASN A 1 225 ? 1.993   28.905 34.844 1.00 20.31 ? 226 ASN A HB3  1 
ATOM   3236 H HD21 . ASN A 1 225 ? 3.509   30.110 37.780 1.00 23.40 ? 226 ASN A HD21 1 
ATOM   3237 H HD22 . ASN A 1 225 ? 2.224   30.413 37.090 1.00 23.40 ? 226 ASN A HD22 1 
ATOM   3238 N N    . THR A 1 226 ? 2.840   29.598 31.076 1.00 14.72 ? 227 THR A N    1 
ATOM   3239 C CA   . THR A 1 226 ? 2.042   29.268 29.908 1.00 14.75 ? 227 THR A CA   1 
ATOM   3240 C C    . THR A 1 226 ? 2.925   28.492 28.966 1.00 16.45 ? 227 THR A C    1 
ATOM   3241 O O    . THR A 1 226 ? 4.002   28.046 29.350 1.00 22.73 ? 227 THR A O    1 
ATOM   3242 C CB   . THR A 1 226 ? 1.360   30.472 29.294 1.00 16.51 ? 227 THR A CB   1 
ATOM   3243 O OG1  . THR A 1 226 ? 0.418   30.032 28.305 1.00 16.88 ? 227 THR A OG1  1 
ATOM   3244 C CG2  . THR A 1 226 ? 2.359   31.427 28.664 1.00 19.06 ? 227 THR A CG2  1 
ATOM   3245 H H    . THR A 1 226 ? 3.610   29.938 30.900 1.00 17.67 ? 227 THR A H    1 
ATOM   3246 H HA   . THR A 1 226 ? 1.338   28.665 30.192 1.00 17.70 ? 227 THR A HA   1 
ATOM   3247 H HB   . THR A 1 226 ? 0.884   30.953 29.990 1.00 19.81 ? 227 THR A HB   1 
ATOM   3248 H HG1  . THR A 1 226 ? 0.034   30.694 27.959 1.00 20.26 ? 227 THR A HG1  1 
ATOM   3249 H HG21 . THR A 1 226 ? 1.895   32.187 28.280 1.00 22.87 ? 227 THR A HG21 1 
ATOM   3250 H HG22 . THR A 1 226 ? 2.982   31.745 29.337 1.00 22.87 ? 227 THR A HG22 1 
ATOM   3251 H HG23 . THR A 1 226 ? 2.855   30.974 27.965 1.00 22.87 ? 227 THR A HG23 1 
ATOM   3252 N N    . GLN A 1 227 ? 2.415   28.211 27.782 1.00 13.73 ? 228 GLN A N    1 
ATOM   3253 C CA   . GLN A 1 227 ? 3.189   27.526 26.780 1.00 13.15 ? 228 GLN A CA   1 
ATOM   3254 C C    . GLN A 1 227 ? 3.492   28.512 25.670 1.00 11.80 ? 228 GLN A C    1 
ATOM   3255 O O    . GLN A 1 227 ? 2.593   29.188 25.149 1.00 13.67 ? 228 GLN A O    1 
ATOM   3256 C CB   . GLN A 1 227 ? 2.416   26.323 26.224 1.00 16.35 ? 228 GLN A CB   1 
ATOM   3257 C CG   . GLN A 1 227 ? 3.216   25.456 25.302 1.00 22.10 ? 228 GLN A CG   1 
ATOM   3258 C CD   . GLN A 1 227 ? 4.444   24.884 25.966 1.00 26.34 ? 228 GLN A CD   1 
ATOM   3259 O OE1  . GLN A 1 227 ? 4.359   24.131 26.947 1.00 24.66 ? 228 GLN A OE1  1 
ATOM   3260 N NE2  . GLN A 1 227 ? 5.601   25.247 25.455 1.00 23.72 ? 228 GLN A NE2  1 
ATOM   3261 H H    . GLN A 1 227 ? 1.615   28.410 27.536 1.00 16.48 ? 228 GLN A H    1 
ATOM   3262 H HA   . GLN A 1 227 ? 4.025   27.214 27.162 1.00 15.78 ? 228 GLN A HA   1 
ATOM   3263 H HB2  . GLN A 1 227 ? 2.121   25.773 26.966 1.00 19.62 ? 228 GLN A HB2  1 
ATOM   3264 H HB3  . GLN A 1 227 ? 1.647   26.649 25.731 1.00 19.62 ? 228 GLN A HB3  1 
ATOM   3265 H HG2  . GLN A 1 227 ? 2.664   24.716 25.004 1.00 26.52 ? 228 GLN A HG2  1 
ATOM   3266 H HG3  . GLN A 1 227 ? 3.504   25.984 24.541 1.00 26.52 ? 228 GLN A HG3  1 
ATOM   3267 H HE21 . GLN A 1 227 ? 5.625   25.781 24.781 1.00 28.47 ? 228 GLN A HE21 1 
ATOM   3268 H HE22 . GLN A 1 227 ? 6.333   24.951 25.795 1.00 28.47 ? 228 GLN A HE22 1 
ATOM   3269 N N    . LYS A 1 228 ? 4.777   28.606 25.332 1.00 12.61 ? 229 LYS A N    1 
ATOM   3270 C CA   . LYS A 1 228 ? 5.245   29.407 24.218 1.00 12.08 ? 229 LYS A CA   1 
ATOM   3271 C C    . LYS A 1 228 ? 5.603   28.514 23.052 1.00 13.08 ? 229 LYS A C    1 
ATOM   3272 O O    . LYS A 1 228 ? 6.151   27.440 23.233 1.00 16.29 ? 229 LYS A O    1 
ATOM   3273 C CB   . LYS A 1 228 ? 6.482   30.200 24.613 1.00 15.52 ? 229 LYS A CB   1 
ATOM   3274 C CG   . LYS A 1 228 ? 6.270   31.269 25.697 1.00 20.23 ? 229 LYS A CG   1 
ATOM   3275 C CD   . LYS A 1 228 ? 7.578   32.023 26.013 1.00 22.69 ? 229 LYS A CD   1 
ATOM   3276 C CE   . LYS A 1 228 ? 8.609   31.100 26.630 1.00 27.75 ? 229 LYS A CE   1 
ATOM   3277 N NZ   . LYS A 1 228 ? 9.896   31.785 27.010 1.00 33.18 ? 229 LYS A NZ   1 
ATOM   3278 H H    . LYS A 1 228 ? 5.410   28.201 25.750 1.00 15.13 ? 229 LYS A H    1 
ATOM   3279 H HA   . LYS A 1 228 ? 4.551   30.025 23.939 1.00 14.50 ? 229 LYS A HA   1 
ATOM   3280 H HB2  . LYS A 1 228 ? 7.150   29.579 24.944 1.00 18.62 ? 229 LYS A HB2  1 
ATOM   3281 H HB3  . LYS A 1 228 ? 6.823   30.650 23.824 1.00 18.62 ? 229 LYS A HB3  1 
ATOM   3282 H HG2  . LYS A 1 228 ? 5.614   31.913 25.387 1.00 24.28 ? 229 LYS A HG2  1 
ATOM   3283 H HG3  . LYS A 1 228 ? 5.961   30.841 26.512 1.00 24.28 ? 229 LYS A HG3  1 
ATOM   3284 H HD2  . LYS A 1 228 ? 7.946   32.385 25.191 1.00 27.23 ? 229 LYS A HD2  1 
ATOM   3285 H HD3  . LYS A 1 228 ? 7.393   32.737 26.642 1.00 27.23 ? 229 LYS A HD3  1 
ATOM   3286 H HE2  . LYS A 1 228 ? 8.234   30.707 27.434 1.00 33.30 ? 229 LYS A HE2  1 
ATOM   3287 H HE3  . LYS A 1 228 ? 8.823   30.401 25.992 1.00 33.30 ? 229 LYS A HE3  1 
ATOM   3288 H HZ1  . LYS A 1 228 ? 10.460  31.196 27.365 1.00 39.81 ? 229 LYS A HZ1  1 
ATOM   3289 H HZ2  . LYS A 1 228 ? 10.272  32.147 26.289 1.00 39.81 ? 229 LYS A HZ2  1 
ATOM   3290 H HZ3  . LYS A 1 228 ? 9.734   32.427 27.605 1.00 39.81 ? 229 LYS A HZ3  1 
ATOM   3291 N N    . TYR A 1 229 ? 5.283   28.990 21.858 1.00 12.03 ? 230 TYR A N    1 
ATOM   3292 C CA   . TYR A 1 229 ? 5.614   28.276 20.634 1.00 12.70 ? 230 TYR A CA   1 
ATOM   3293 C C    . TYR A 1 229 ? 6.253   29.209 19.625 1.00 12.96 ? 230 TYR A C    1 
ATOM   3294 O O    . TYR A 1 229 ? 5.849   30.345 19.476 1.00 14.25 ? 230 TYR A O    1 
ATOM   3295 C CB   . TYR A 1 229 ? 4.363   27.697 19.986 1.00 13.42 ? 230 TYR A CB   1 
ATOM   3296 C CG   . TYR A 1 229 ? 3.593   26.676 20.787 1.00 13.68 ? 230 TYR A CG   1 
ATOM   3297 C CD1  . TYR A 1 229 ? 3.976   25.339 20.832 1.00 15.75 ? 230 TYR A CD1  1 
ATOM   3298 C CD2  . TYR A 1 229 ? 2.453   27.053 21.483 1.00 14.80 ? 230 TYR A CD2  1 
ATOM   3299 C CE1  . TYR A 1 229 ? 3.236   24.402 21.560 1.00 16.56 ? 230 TYR A CE1  1 
ATOM   3300 C CE2  . TYR A 1 229 ? 1.719   26.125 22.207 1.00 16.70 ? 230 TYR A CE2  1 
ATOM   3301 C CZ   . TYR A 1 229 ? 2.109   24.812 22.227 1.00 15.74 ? 230 TYR A CZ   1 
ATOM   3302 O OH   . TYR A 1 229 ? 1.389   23.880 22.945 1.00 20.36 ? 230 TYR A OH   1 
ATOM   3303 H H    . TYR A 1 229 ? 4.870   29.733 21.728 1.00 14.44 ? 230 TYR A H    1 
ATOM   3304 H HA   . TYR A 1 229 ? 6.231   27.553 20.830 1.00 15.24 ? 230 TYR A HA   1 
ATOM   3305 H HB2  . TYR A 1 229 ? 3.755   28.429 19.796 1.00 16.11 ? 230 TYR A HB2  1 
ATOM   3306 H HB3  . TYR A 1 229 ? 4.622   27.272 19.154 1.00 16.11 ? 230 TYR A HB3  1 
ATOM   3307 H HD1  . TYR A 1 229 ? 4.732   25.063 20.366 1.00 18.90 ? 230 TYR A HD1  1 
ATOM   3308 H HD2  . TYR A 1 229 ? 2.175   27.940 21.462 1.00 17.77 ? 230 TYR A HD2  1 
ATOM   3309 H HE1  . TYR A 1 229 ? 3.498   23.509 21.582 1.00 19.87 ? 230 TYR A HE1  1 
ATOM   3310 H HE2  . TYR A 1 229 ? 0.956   26.392 22.666 1.00 20.04 ? 230 TYR A HE2  1 
ATOM   3311 H HH   . TYR A 1 229 ? 0.726   24.246 23.307 1.00 24.43 ? 230 TYR A HH   1 
ATOM   3312 N N    . ASN A 1 230 ? 7.208   28.681 18.875 1.00 13.46 ? 231 ASN A N    1 
ATOM   3313 C CA   . ASN A 1 230 ? 7.795   29.389 17.722 1.00 13.00 ? 231 ASN A CA   1 
ATOM   3314 C C    . ASN A 1 230 ? 6.795   29.287 16.598 1.00 13.59 ? 231 ASN A C    1 
ATOM   3315 O O    . ASN A 1 230 ? 6.441   28.184 16.180 1.00 14.79 ? 231 ASN A O    1 
ATOM   3316 C CB   . ASN A 1 230 ? 9.114   28.721 17.367 1.00 13.49 ? 231 ASN A CB   1 
ATOM   3317 C CG   . ASN A 1 230 ? 9.826   29.368 16.202 1.00 16.11 ? 231 ASN A CG   1 
ATOM   3318 O OD1  . ASN A 1 230 ? 9.233   29.648 15.173 1.00 15.13 ? 231 ASN A OD1  1 
ATOM   3319 N ND2  . ASN A 1 230 ? 11.131  29.596 16.361 1.00 20.38 ? 231 ASN A ND2  1 
ATOM   3320 H H    . ASN A 1 230 ? 7.546   27.902 19.008 1.00 16.15 ? 231 ASN A H    1 
ATOM   3321 H HA   . ASN A 1 230 ? 7.949   30.322 17.937 1.00 15.60 ? 231 ASN A HA   1 
ATOM   3322 H HB2  . ASN A 1 230 ? 9.703   28.763 18.136 1.00 16.19 ? 231 ASN A HB2  1 
ATOM   3323 H HB3  . ASN A 1 230 ? 8.943   27.795 17.133 1.00 16.19 ? 231 ASN A HB3  1 
ATOM   3324 H HD21 . ASN A 1 230 ? 11.583  29.963 15.728 1.00 24.45 ? 231 ASN A HD21 1 
ATOM   3325 H HD22 . ASN A 1 230 ? 11.519  29.378 17.097 1.00 24.45 ? 231 ASN A HD22 1 
ATOM   3326 N N    . LEU A 1 231 ? 6.316   30.435 16.121 1.00 13.54 ? 232 LEU A N    1 
ATOM   3327 C CA   . LEU A 1 231 ? 5.217   30.470 15.163 1.00 13.14 ? 232 LEU A CA   1 
ATOM   3328 C C    . LEU A 1 231 ? 5.622   29.886 13.813 1.00 14.07 ? 232 LEU A C    1 
ATOM   3329 O O    . LEU A 1 231 ? 4.777   29.395 13.076 1.00 16.95 ? 232 LEU A O    1 
ATOM   3330 C CB   . LEU A 1 231 ? 4.739   31.924 14.997 1.00 15.68 ? 232 LEU A CB   1 
ATOM   3331 C CG   . LEU A 1 231 ? 3.550   32.165 14.084 1.00 17.03 ? 232 LEU A CG   1 
ATOM   3332 C CD1  . LEU A 1 231 ? 2.388   31.281 14.424 1.00 18.65 ? 232 LEU A CD1  1 
ATOM   3333 C CD2  . LEU A 1 231 ? 3.174   33.644 14.201 1.00 20.00 ? 232 LEU A CD2  1 
ATOM   3334 H H    . LEU A 1 231 ? 6.614   31.211 16.340 1.00 16.25 ? 232 LEU A H    1 
ATOM   3335 H HA   . LEU A 1 231 ? 4.477   29.947 15.508 1.00 15.77 ? 232 LEU A HA   1 
ATOM   3336 H HB2  . LEU A 1 231 ? 4.498   32.262 15.874 1.00 18.82 ? 232 LEU A HB2  1 
ATOM   3337 H HB3  . LEU A 1 231 ? 5.477   32.445 14.646 1.00 18.82 ? 232 LEU A HB3  1 
ATOM   3338 H HG   . LEU A 1 231 ? 3.809   31.988 13.166 1.00 20.43 ? 232 LEU A HG   1 
ATOM   3339 H HD11 . LEU A 1 231 ? 1.658   31.473 13.816 1.00 22.37 ? 232 LEU A HD11 1 
ATOM   3340 H HD12 . LEU A 1 231 ? 2.660   30.354 14.335 1.00 22.37 ? 232 LEU A HD12 1 
ATOM   3341 H HD13 . LEU A 1 231 ? 2.114   31.459 15.337 1.00 22.37 ? 232 LEU A HD13 1 
ATOM   3342 H HD21 . LEU A 1 231 ? 2.414   33.823 13.625 1.00 24.00 ? 232 LEU A HD21 1 
ATOM   3343 H HD22 . LEU A 1 231 ? 2.943   33.839 15.123 1.00 24.00 ? 232 LEU A HD22 1 
ATOM   3344 H HD23 . LEU A 1 231 ? 3.932   34.185 13.928 1.00 24.00 ? 232 LEU A HD23 1 
ATOM   3345 N N    . TYR A 1 232 ? 6.908   29.965 13.477 1.00 14.04 ? 233 TYR A N    1 
ATOM   3346 C CA   . TYR A 1 232 ? 7.385   29.469 12.201 1.00 15.74 ? 233 TYR A CA   1 
ATOM   3347 C C    . TYR A 1 232 ? 7.685   27.976 12.267 1.00 17.90 ? 233 TYR A C    1 
ATOM   3348 O O    . TYR A 1 232 ? 7.213   27.215 11.424 1.00 21.25 ? 233 TYR A O    1 
ATOM   3349 C CB   . TYR A 1 232 ? 8.617   30.275 11.756 1.00 17.35 ? 233 TYR A CB   1 
ATOM   3350 C CG   . TYR A 1 232 ? 9.101   29.798 10.427 1.00 21.79 ? 233 TYR A CG   1 
ATOM   3351 C CD1  . TYR A 1 232 ? 8.385   30.072 9.286  1.00 25.51 ? 233 TYR A CD1  1 
ATOM   3352 C CD2  . TYR A 1 232 ? 10.227  29.029 10.328 1.00 21.61 ? 233 TYR A CD2  1 
ATOM   3353 C CE1  . TYR A 1 232 ? 8.807   29.617 8.059  1.00 28.64 ? 233 TYR A CE1  1 
ATOM   3354 C CE2  . TYR A 1 232 ? 10.666  28.555 9.099  1.00 23.74 ? 233 TYR A CE2  1 
ATOM   3355 C CZ   . TYR A 1 232 ? 9.936   28.860 7.979  1.00 27.45 ? 233 TYR A CZ   1 
ATOM   3356 O OH   . TYR A 1 232 ? 10.315  28.418 6.744  1.00 30.48 ? 233 TYR A OH   1 
ATOM   3357 H H    . TYR A 1 232 ? 7.521   30.304 13.975 1.00 16.84 ? 233 TYR A H    1 
ATOM   3358 H HA   . TYR A 1 232 ? 6.691   29.601 11.537 1.00 18.89 ? 233 TYR A HA   1 
ATOM   3359 H HB2  . TYR A 1 232 ? 8.379   31.212 11.679 1.00 20.82 ? 233 TYR A HB2  1 
ATOM   3360 H HB3  . TYR A 1 232 ? 9.330   30.158 12.403 1.00 20.82 ? 233 TYR A HB3  1 
ATOM   3361 H HD1  . TYR A 1 232 ? 7.612   30.587 9.342  1.00 30.61 ? 233 TYR A HD1  1 
ATOM   3362 H HD2  . TYR A 1 232 ? 10.712  28.827 11.095 1.00 25.93 ? 233 TYR A HD2  1 
ATOM   3363 H HE1  . TYR A 1 232 ? 8.320   29.813 7.292  1.00 34.36 ? 233 TYR A HE1  1 
ATOM   3364 H HE2  . TYR A 1 232 ? 11.437  28.039 9.037  1.00 28.49 ? 233 TYR A HE2  1 
ATOM   3365 H HH   . TYR A 1 232 ? 11.018  27.963 6.805  1.00 36.57 ? 233 TYR A HH   1 
ATOM   3366 N N    . SER A 1 233 ? 8.448   27.533 13.265 1.00 16.56 ? 234 SER A N    1 
ATOM   3367 C CA   . SER A 1 233 ? 8.864   26.127 13.310 1.00 17.44 ? 234 SER A CA   1 
ATOM   3368 C C    . SER A 1 233 ? 7.829   25.226 13.960 1.00 17.11 ? 234 SER A C    1 
ATOM   3369 O O    . SER A 1 233 ? 7.815   24.015 13.742 1.00 20.44 ? 234 SER A O    1 
ATOM   3370 C CB   . SER A 1 233 ? 10.178  25.961 14.068 1.00 20.68 ? 234 SER A CB   1 
ATOM   3371 O OG   . SER A 1 233 ? 9.987   26.302 15.433 1.00 19.36 ? 234 SER A OG   1 
ATOM   3372 H H    . SER A 1 233 ? 8.735   28.014 13.918 1.00 19.87 ? 234 SER A H    1 
ATOM   3373 H HA   . SER A 1 233 ? 9.003   25.814 12.402 1.00 20.93 ? 234 SER A HA   1 
ATOM   3374 H HB2  . SER A 1 233 ? 10.467  25.037 14.007 1.00 24.81 ? 234 SER A HB2  1 
ATOM   3375 H HB3  . SER A 1 233 ? 10.846  26.548 13.682 1.00 24.81 ? 234 SER A HB3  1 
ATOM   3376 H HG   . SER A 1 233 ? 10.708  26.212 15.855 1.00 23.23 ? 234 SER A HG   1 
ATOM   3377 N N    . GLY A 1 234 ? 6.973   25.818 14.783 1.00 18.75 ? 235 GLY A N    1 
ATOM   3378 C CA   . GLY A 1 234 ? 6.030   25.050 15.573 1.00 20.19 ? 235 GLY A CA   1 
ATOM   3379 C C    . GLY A 1 234 ? 6.604   24.507 16.866 1.00 21.23 ? 235 GLY A C    1 
ATOM   3380 O O    . GLY A 1 234 ? 5.893   23.888 17.663 1.00 24.32 ? 235 GLY A O    1 
ATOM   3381 H H    . GLY A 1 234 ? 6.920   26.668 14.901 1.00 22.49 ? 235 GLY A H    1 
ATOM   3382 H HA2  . GLY A 1 234 ? 5.269   25.609 15.792 1.00 24.23 ? 235 GLY A HA2  1 
ATOM   3383 H HA3  . GLY A 1 234 ? 5.712   24.299 15.046 1.00 24.23 ? 235 GLY A HA3  1 
ATOM   3384 N N    . GLU A 1 235 ? 7.884   24.716 17.108 1.00 20.89 ? 236 GLU A N    1 
ATOM   3385 C CA   . GLU A 1 235 ? 8.488   24.098 18.279 1.00 22.71 ? 236 GLU A CA   1 
ATOM   3386 C C    . GLU A 1 235 ? 8.152   24.835 19.563 1.00 19.61 ? 236 GLU A C    1 
ATOM   3387 O O    . GLU A 1 235 ? 7.989   26.043 19.565 1.00 18.44 ? 236 GLU A O    1 
ATOM   3388 C CB   . GLU A 1 235 ? 9.999   23.995 18.106 1.00 28.50 ? 236 GLU A CB   1 
ATOM   3389 C CG   . GLU A 1 235 ? 10.406  23.001 17.014 1.00 35.10 ? 236 GLU A CG   1 
ATOM   3390 C CD   . GLU A 1 235 ? 9.873   21.586 17.275 1.00 51.49 ? 236 GLU A CD   1 
ATOM   3391 O OE1  . GLU A 1 235 ? 10.204  21.002 18.331 1.00 46.41 ? 236 GLU A OE1  1 
ATOM   3392 O OE2  . GLU A 1 235 ? 9.112   21.064 16.430 1.00 60.48 ? 236 GLU A OE2  1 
ATOM   3393 H H    . GLU A 1 235 ? 8.414   25.194 16.628 1.00 25.07 ? 236 GLU A H    1 
ATOM   3394 H HA   . GLU A 1 235 ? 8.142   23.195 18.362 1.00 27.25 ? 236 GLU A HA   1 
ATOM   3395 H HB2  . GLU A 1 235 ? 10.349  24.867 17.863 1.00 34.20 ? 236 GLU A HB2  1 
ATOM   3396 H HB3  . GLU A 1 235 ? 10.393  23.701 18.942 1.00 34.20 ? 236 GLU A HB3  1 
ATOM   3397 H HG2  . GLU A 1 235 ? 10.051  23.303 16.163 1.00 42.12 ? 236 GLU A HG2  1 
ATOM   3398 H HG3  . GLU A 1 235 ? 11.374  22.955 16.972 1.00 42.12 ? 236 GLU A HG3  1 
ATOM   3399 N N    . GLU A 1 236 ? 8.021   24.100 20.669 1.00 21.15 ? 237 GLU A N    1 
ATOM   3400 C CA   . GLU A 1 236 ? 7.900   24.756 21.954 1.00 20.77 ? 237 GLU A CA   1 
ATOM   3401 C C    . GLU A 1 236 ? 9.145   25.568 22.243 1.00 22.05 ? 237 GLU A C    1 
ATOM   3402 O O    . GLU A 1 236 ? 10.262  25.174 21.883 1.00 24.06 ? 237 GLU A O    1 
ATOM   3403 C CB   . GLU A 1 236 ? 7.707   23.733 23.068 1.00 24.77 ? 237 GLU A CB   1 
ATOM   3404 C CG   . GLU A 1 236 ? 6.416   22.966 22.966 1.00 26.73 ? 237 GLU A CG   1 
ATOM   3405 C CD   . GLU A 1 236 ? 6.235   22.004 24.121 1.00 38.63 ? 237 GLU A CD   1 
ATOM   3406 O OE1  . GLU A 1 236 ? 7.140   21.940 24.979 1.00 40.26 ? 237 GLU A OE1  1 
ATOM   3407 O OE2  . GLU A 1 236 ? 5.189   21.322 24.165 1.00 38.45 ? 237 GLU A OE2  1 
ATOM   3408 H H    . GLU A 1 236 ? 8.001   23.241 20.696 1.00 25.38 ? 237 GLU A H    1 
ATOM   3409 H HA   . GLU A 1 236 ? 7.135   25.352 21.945 1.00 24.92 ? 237 GLU A HA   1 
ATOM   3410 H HB2  . GLU A 1 236 ? 8.436   23.093 23.036 1.00 29.72 ? 237 GLU A HB2  1 
ATOM   3411 H HB3  . GLU A 1 236 ? 7.712   24.194 23.921 1.00 29.72 ? 237 GLU A HB3  1 
ATOM   3412 H HG2  . GLU A 1 236 ? 5.673   23.590 22.973 1.00 32.08 ? 237 GLU A HG2  1 
ATOM   3413 H HG3  . GLU A 1 236 ? 6.414   22.453 22.143 1.00 32.08 ? 237 GLU A HG3  1 
ATOM   3414 N N    . VAL A 1 237 ? 8.948   26.697 22.901 1.00 21.19 ? 238 VAL A N    1 
ATOM   3415 C CA   . VAL A 1 237 ? 10.037  27.556 23.317 1.00 23.76 ? 238 VAL A CA   1 
ATOM   3416 C C    . VAL A 1 237 ? 10.076  27.469 24.815 1.00 26.59 ? 238 VAL A C    1 
ATOM   3417 O O    . VAL A 1 237 ? 9.016   27.464 25.441 1.00 26.71 ? 238 VAL A O    1 
ATOM   3418 C CB   . VAL A 1 237 ? 9.802   28.997 22.914 1.00 24.97 ? 238 VAL A CB   1 
ATOM   3419 C CG1  . VAL A 1 237 ? 10.928  29.871 23.449 1.00 28.95 ? 238 VAL A CG1  1 
ATOM   3420 C CG2  . VAL A 1 237 ? 9.708   29.113 21.404 1.00 25.47 ? 238 VAL A CG2  1 
ATOM   3421 H H    . VAL A 1 237 ? 8.172   26.994 23.124 1.00 25.43 ? 238 VAL A H    1 
ATOM   3422 H HA   . VAL A 1 237 ? 10.879  27.245 22.949 1.00 28.51 ? 238 VAL A HA   1 
ATOM   3423 H HB   . VAL A 1 237 ? 8.966   29.306 23.297 1.00 29.96 ? 238 VAL A HB   1 
ATOM   3424 H HG11 . VAL A 1 237 ? 10.765  30.790 23.185 1.00 34.74 ? 238 VAL A HG11 1 
ATOM   3425 H HG12 . VAL A 1 237 ? 10.947  29.803 24.416 1.00 34.74 ? 238 VAL A HG12 1 
ATOM   3426 H HG13 . VAL A 1 237 ? 11.769  29.564 23.078 1.00 34.74 ? 238 VAL A HG13 1 
ATOM   3427 H HG21 . VAL A 1 237 ? 9.558   30.042 21.168 1.00 30.56 ? 238 VAL A HG21 1 
ATOM   3428 H HG22 . VAL A 1 237 ? 10.539  28.802 21.011 1.00 30.56 ? 238 VAL A HG22 1 
ATOM   3429 H HG23 . VAL A 1 237 ? 8.969   28.568 21.091 1.00 30.56 ? 238 VAL A HG23 1 
ATOM   3430 N N    . GLU A 1 238 ? 11.286  27.372 25.365 1.00 30.11 ? 239 GLU A N    1 
ATOM   3431 C CA   . GLU A 1 238 ? 11.501  27.300 26.810 1.00 36.10 ? 239 GLU A CA   1 
ATOM   3432 C C    . GLU A 1 238 ? 11.284  25.881 27.312 1.00 50.10 ? 239 GLU A C    1 
ATOM   3433 O O    . GLU A 1 238 ? 12.245  25.187 27.644 1.00 60.29 ? 239 GLU A O    1 
ATOM   3434 C CB   . GLU A 1 238 ? 10.619  28.315 27.565 1.00 38.78 ? 239 GLU A CB   1 
ATOM   3435 C CG   . GLU A 1 238 ? 10.465  28.074 29.048 1.00 34.17 ? 239 GLU A CG   1 
ATOM   3436 C CD   . GLU A 1 238 ? 10.777  29.319 29.865 1.00 48.80 ? 239 GLU A CD   1 
ATOM   3437 O OE1  . GLU A 1 238 ? 10.115  30.356 29.652 1.00 56.43 ? 239 GLU A OE1  1 
ATOM   3438 O OE2  . GLU A 1 238 ? 11.698  29.266 30.710 1.00 49.29 ? 239 GLU A OE2  1 
ATOM   3439 H H    . GLU A 1 238 ? 12.015  27.345 24.909 1.00 36.13 ? 239 GLU A H    1 
ATOM   3440 H HA   . GLU A 1 238 ? 12.425  27.532 26.991 1.00 43.32 ? 239 GLU A HA   1 
ATOM   3441 H HB2  . GLU A 1 238 ? 11.004  29.198 27.453 1.00 46.54 ? 239 GLU A HB2  1 
ATOM   3442 H HB3  . GLU A 1 238 ? 9.731   28.298 27.176 1.00 46.54 ? 239 GLU A HB3  1 
ATOM   3443 H HG2  . GLU A 1 238 ? 9.551   27.812 29.235 1.00 41.00 ? 239 GLU A HG2  1 
ATOM   3444 H HG3  . GLU A 1 238 ? 11.077  27.373 29.321 1.00 41.00 ? 239 GLU A HG3  1 
HETATM 3445 O O    . HOH B 2 .   ? 25.835  41.176 15.174 1.00 64.31 ? 301 HOH A O    1 
HETATM 3446 O O    . HOH B 2 .   ? 28.115  44.534 6.392  1.00 48.30 ? 302 HOH A O    1 
HETATM 3447 O O    . HOH B 2 .   ? -0.348  32.926 31.991 1.00 36.61 ? 303 HOH A O    1 
HETATM 3448 O O    . HOH B 2 .   ? -8.235  36.312 3.433  1.00 36.02 ? 304 HOH A O    1 
HETATM 3449 O O    . HOH B 2 .   ? -14.887 51.500 -0.060 1.00 30.24 ? 305 HOH A O    1 
HETATM 3450 O O    . HOH B 2 .   ? 12.722  28.358 6.186  1.00 29.32 ? 306 HOH A O    1 
HETATM 3451 O O    . HOH B 2 .   ? -9.721  49.798 -8.346 1.00 30.12 ? 307 HOH A O    1 
HETATM 3452 O O    . HOH B 2 .   ? -18.978 40.039 11.221 1.00 28.64 ? 308 HOH A O    1 
HETATM 3453 O O    . HOH B 2 .   ? 26.976  41.050 0.621  1.00 61.87 ? 309 HOH A O    1 
HETATM 3454 O O    . HOH B 2 .   ? -8.347  58.142 8.024  1.00 47.97 ? 310 HOH A O    1 
HETATM 3455 O O    . HOH B 2 .   ? 23.725  27.975 5.177  1.00 44.91 ? 311 HOH A O    1 
HETATM 3456 O O    . HOH B 2 .   ? -1.594  37.313 -2.980 1.00 29.83 ? 312 HOH A O    1 
HETATM 3457 O O    . HOH B 2 .   ? -0.930  24.663 23.982 1.00 19.01 ? 313 HOH A O    1 
HETATM 3458 O O    . HOH B 2 .   ? -7.446  22.772 27.903 1.00 26.00 ? 314 HOH A O    1 
HETATM 3459 O O    . HOH B 2 .   ? 10.388  36.252 0.438  1.00 29.88 ? 315 HOH A O    1 
HETATM 3460 O O    . HOH B 2 .   ? -6.939  48.038 -2.177 1.00 30.96 ? 316 HOH A O    1 
HETATM 3461 O O    . HOH B 2 .   ? 4.180   20.492 21.623 1.00 51.79 ? 317 HOH A O    1 
HETATM 3462 O O    . HOH B 2 .   ? 7.612   45.530 24.800 1.00 42.66 ? 318 HOH A O    1 
HETATM 3463 O O    . HOH B 2 .   ? 4.309   19.986 26.277 1.00 28.01 ? 319 HOH A O    1 
HETATM 3464 O O    . HOH B 2 .   ? -11.294 31.293 21.679 1.00 26.13 ? 320 HOH A O    1 
HETATM 3465 O O    . HOH B 2 .   ? -18.958 40.929 17.138 1.00 49.02 ? 321 HOH A O    1 
HETATM 3466 O O    . HOH B 2 .   ? 15.681  30.654 6.612  1.00 21.21 ? 322 HOH A O    1 
HETATM 3467 O O    . HOH B 2 .   ? -13.640 52.614 6.332  1.00 33.50 ? 323 HOH A O    1 
HETATM 3468 O O    . HOH B 2 .   ? -16.715 24.253 10.449 1.00 47.46 ? 324 HOH A O    1 
HETATM 3469 O O    . HOH B 2 .   ? 6.060   44.227 0.795  1.00 41.57 ? 325 HOH A O    1 
HETATM 3470 O O    . HOH B 2 .   ? 11.813  31.576 3.159  1.00 25.03 ? 326 HOH A O    1 
HETATM 3471 O O    . HOH B 2 .   ? 16.437  40.748 0.026  1.00 33.68 ? 327 HOH A O    1 
HETATM 3472 O O    . HOH B 2 .   ? 2.417   21.445 23.546 1.00 28.74 ? 328 HOH A O    1 
HETATM 3473 O O    . HOH B 2 .   ? 29.133  32.010 0.657  1.00 44.73 ? 329 HOH A O    1 
HETATM 3474 O O    . HOH B 2 .   ? -16.645 46.557 3.941  1.00 34.40 ? 330 HOH A O    1 
HETATM 3475 O O    . HOH B 2 .   ? -20.836 40.335 13.805 1.00 49.32 ? 331 HOH A O    1 
HETATM 3476 O O    . HOH B 2 .   ? -14.998 44.246 -2.033 1.00 40.43 ? 332 HOH A O    1 
HETATM 3477 O O    . HOH B 2 .   ? -16.665 47.282 -0.409 1.00 31.03 ? 333 HOH A O    1 
HETATM 3478 O O    . HOH B 2 .   ? -12.061 34.781 24.417 1.00 36.93 ? 334 HOH A O    1 
HETATM 3479 O O    . HOH B 2 .   ? 1.155   56.292 19.294 1.00 19.77 ? 335 HOH A O    1 
HETATM 3480 O O    . HOH B 2 .   ? 0.336   62.973 16.263 1.00 50.98 ? 336 HOH A O    1 
HETATM 3481 O O    . HOH B 2 .   ? 17.544  33.963 1.734  1.00 24.76 ? 337 HOH A O    1 
HETATM 3482 O O    . HOH B 2 .   ? 15.047  31.029 1.176  1.00 25.34 ? 338 HOH A O    1 
HETATM 3483 O O    . HOH B 2 .   ? -12.076 43.220 5.558  1.00 31.88 ? 339 HOH A O    1 
HETATM 3484 O O    . HOH B 2 .   ? -15.204 34.686 7.105  1.00 42.90 ? 340 HOH A O    1 
HETATM 3485 O O    . HOH B 2 .   ? 13.387  28.203 12.114 1.00 36.27 ? 341 HOH A O    1 
HETATM 3486 O O    . HOH B 2 .   ? -3.860  61.791 9.077  1.00 33.39 ? 342 HOH A O    1 
HETATM 3487 O O    . HOH B 2 .   ? 27.983  42.507 10.529 1.00 27.25 ? 343 HOH A O    1 
HETATM 3488 O O    . HOH B 2 .   ? 3.417   49.875 20.134 1.00 16.30 ? 344 HOH A O    1 
HETATM 3489 O O    . HOH B 2 .   ? -5.584  53.109 19.585 1.00 28.78 ? 345 HOH A O    1 
HETATM 3490 O O    . HOH B 2 .   ? 9.291   53.469 25.580 1.00 48.31 ? 346 HOH A O    1 
HETATM 3491 O O    . HOH B 2 .   ? -2.889  28.755 27.657 1.00 18.68 ? 347 HOH A O    1 
HETATM 3492 O O    . HOH B 2 .   ? -2.208  52.113 -1.889 1.00 45.41 ? 348 HOH A O    1 
HETATM 3493 O O    . HOH B 2 .   ? 6.859   42.094 -0.865 1.00 27.43 ? 349 HOH A O    1 
HETATM 3494 O O    . HOH B 2 .   ? 9.401   49.117 21.152 1.00 45.31 ? 350 HOH A O    1 
HETATM 3495 O O    . HOH B 2 .   ? -11.686 52.578 -5.972 1.00 29.13 ? 351 HOH A O    1 
HETATM 3496 O O    . HOH B 2 .   ? 29.336  35.865 7.953  1.00 29.79 ? 352 HOH A O    1 
HETATM 3497 O O    . HOH B 2 .   ? 5.477   57.190 19.819 1.00 35.95 ? 353 HOH A O    1 
HETATM 3498 O O    . HOH B 2 .   ? -12.998 56.310 4.793  1.00 43.19 ? 354 HOH A O    1 
HETATM 3499 O O    . HOH B 2 .   ? 13.046  31.063 6.032  1.00 23.37 ? 355 HOH A O    1 
HETATM 3500 O O    . HOH B 2 .   ? 0.853   60.549 17.965 1.00 48.05 ? 356 HOH A O    1 
HETATM 3501 O O    . HOH B 2 .   ? 7.083   30.463 33.379 1.00 29.04 ? 357 HOH A O    1 
HETATM 3502 O O    . HOH B 2 .   ? 7.912   24.162 26.814 1.00 35.47 ? 358 HOH A O    1 
HETATM 3503 O O    . HOH B 2 .   ? -7.247  41.520 0.019  1.00 18.94 ? 359 HOH A O    1 
HETATM 3504 O O    . HOH B 2 .   ? 20.275  29.392 5.162  1.00 29.18 ? 360 HOH A O    1 
HETATM 3505 O O    . HOH B 2 .   ? -5.630  24.622 29.356 1.00 31.50 ? 361 HOH A O    1 
HETATM 3506 O O    . HOH B 2 .   ? -9.207  36.115 26.249 1.00 31.98 ? 362 HOH A O    1 
HETATM 3507 O O    . HOH B 2 .   ? 4.870   29.847 39.305 1.00 29.20 ? 363 HOH A O    1 
HETATM 3508 O O    . HOH B 2 .   ? 9.641   30.324 4.644  1.00 37.75 ? 364 HOH A O    1 
HETATM 3509 O O    . HOH B 2 .   ? -6.070  23.009 21.025 1.00 44.09 ? 365 HOH A O    1 
HETATM 3510 O O    . HOH B 2 .   ? 1.902   47.667 27.377 1.00 22.86 ? 366 HOH A O    1 
HETATM 3511 O O    . HOH B 2 .   ? 5.650   30.278 30.300 1.00 32.93 ? 367 HOH A O    1 
HETATM 3512 O O    . HOH B 2 .   ? 7.988   37.171 0.936  1.00 35.91 ? 368 HOH A O    1 
HETATM 3513 O O    . HOH B 2 .   ? -8.877  30.168 4.932  1.00 46.01 ? 369 HOH A O    1 
HETATM 3514 O O    . HOH B 2 .   ? -6.461  51.882 13.287 1.00 47.54 ? 370 HOH A O    1 
HETATM 3515 O O    . HOH B 2 .   ? -8.752  28.035 23.499 1.00 26.42 ? 371 HOH A O    1 
HETATM 3516 O O    . HOH B 2 .   ? 5.755   25.669 29.348 1.00 36.54 ? 372 HOH A O    1 
HETATM 3517 O O    . HOH B 2 .   ? -7.205  50.429 16.100 1.00 24.34 ? 373 HOH A O    1 
HETATM 3518 O O    . HOH B 2 .   ? 4.247   59.845 18.966 1.00 47.91 ? 374 HOH A O    1 
HETATM 3519 O O    . HOH B 2 .   ? -5.760  27.238 4.590  1.00 29.64 ? 375 HOH A O    1 
HETATM 3520 O O    . HOH B 2 .   ? 1.037   33.629 0.595  1.00 49.78 ? 376 HOH A O    1 
HETATM 3521 O O    . HOH B 2 .   ? 11.131  40.151 -4.569 1.00 40.72 ? 377 HOH A O    1 
HETATM 3522 O O    . HOH B 2 .   ? -1.760  61.592 17.279 1.00 36.85 ? 378 HOH A O    1 
HETATM 3523 O O    . HOH B 2 .   ? 18.399  48.813 -1.630 1.00 47.38 ? 379 HOH A O    1 
HETATM 3524 O O    . HOH B 2 .   ? 10.616  60.336 20.681 1.00 31.63 ? 380 HOH A O    1 
HETATM 3525 O O    . HOH B 2 .   ? -4.308  21.744 23.165 1.00 38.24 ? 381 HOH A O    1 
HETATM 3526 O O    . HOH B 2 .   ? 11.578  35.634 3.063  1.00 31.71 ? 382 HOH A O    1 
HETATM 3527 O O    . HOH B 2 .   ? -16.795 50.928 2.895  1.00 58.91 ? 383 HOH A O    1 
HETATM 3528 O O    . HOH B 2 .   ? 14.681  40.725 -1.744 1.00 35.41 ? 384 HOH A O    1 
HETATM 3529 O O    . HOH B 2 .   ? 3.272   16.388 11.645 1.00 38.05 ? 385 HOH A O    1 
HETATM 3530 O O    . HOH B 2 .   ? 8.397   26.148 5.807  1.00 53.69 ? 386 HOH A O    1 
HETATM 3531 O O    . HOH B 2 .   ? 3.341   31.460 -1.416 1.00 37.58 ? 387 HOH A O    1 
HETATM 3532 O O    . HOH B 2 .   ? 2.513   67.538 13.898 1.00 44.45 ? 388 HOH A O    1 
HETATM 3533 O O    . HOH B 2 .   ? -18.562 47.713 7.894  1.00 58.58 ? 389 HOH A O    1 
HETATM 3534 O O    . HOH B 2 .   ? 22.345  25.927 5.180  1.00 52.20 ? 390 HOH A O    1 
HETATM 3535 O O    . HOH B 2 .   ? -8.907  32.463 5.124  1.00 52.15 ? 391 HOH A O    1 
HETATM 3536 O O    . HOH B 2 .   ? -15.637 36.269 4.908  1.00 40.62 ? 392 HOH A O    1 
HETATM 3537 O O    . HOH B 2 .   ? -2.626  30.568 29.734 1.00 21.01 ? 393 HOH A O    1 
HETATM 3538 O O    . HOH B 2 .   ? -2.666  28.327 -3.760 1.00 47.42 ? 394 HOH A O    1 
HETATM 3539 O O    . HOH B 2 .   ? -20.205 43.736 17.068 1.00 51.33 ? 395 HOH A O    1 
HETATM 3540 O O    . HOH B 2 .   ? -10.830 35.868 4.974  1.00 60.19 ? 396 HOH A O    1 
HETATM 3541 O O    . HOH B 2 .   ? -4.593  57.437 10.058 1.00 27.13 ? 397 HOH A O    1 
HETATM 3542 O O    . HOH B 2 .   ? -17.063 33.857 8.478  1.00 47.96 ? 398 HOH A O    1 
HETATM 3543 O O    . HOH B 2 .   ? -1.999  63.686 10.623 1.00 41.68 ? 399 HOH A O    1 
HETATM 3544 O O    . HOH B 2 .   ? 0.358   45.541 28.434 1.00 31.17 ? 400 HOH A O    1 
HETATM 3545 O O    . HOH B 2 .   ? 2.525   18.979 22.323 1.00 56.46 ? 401 HOH A O    1 
HETATM 3546 O O    . HOH B 2 .   ? -6.596  47.096 -4.637 1.00 25.74 ? 402 HOH A O    1 
HETATM 3547 O O    . HOH B 2 .   ? 7.844   32.705 5.283  1.00 47.73 ? 403 HOH A O    1 
HETATM 3548 O O    . HOH B 2 .   ? 3.931   66.505 9.581  1.00 42.24 ? 404 HOH A O    1 
HETATM 3549 O O    . HOH B 2 .   ? -6.031  33.774 28.651 1.00 43.94 ? 405 HOH A O    1 
HETATM 3550 O O    . HOH B 2 .   ? -10.774 52.357 -8.657 1.00 57.63 ? 406 HOH A O    1 
HETATM 3551 O O    . HOH B 2 .   ? 6.134   61.128 20.596 1.00 43.13 ? 407 HOH A O    1 
HETATM 3552 O O    . HOH B 2 .   ? 1.364   52.462 0.603  1.00 35.55 ? 408 HOH A O    1 
HETATM 3553 O O    . HOH B 2 .   ? -0.561  53.483 -1.193 1.00 39.81 ? 409 HOH A O    1 
HETATM 3554 O O    . HOH B 2 .   ? 1.899   17.185 16.600 1.00 45.73 ? 410 HOH A O    1 
HETATM 3555 O O    . HOH B 2 .   ? -17.210 48.424 1.923  1.00 42.76 ? 411 HOH A O    1 
HETATM 3556 O O    . HOH B 2 .   ? -2.270  17.913 18.945 1.00 48.10 ? 412 HOH A O    1 
HETATM 3557 O O    . HOH B 2 .   ? -0.046  67.460 13.853 1.00 56.82 ? 413 HOH A O    1 
HETATM 3558 O O    . HOH B 2 .   ? 12.497  25.668 10.927 1.00 43.60 ? 414 HOH A O    1 
HETATM 3559 O O    . HOH B 2 .   ? 7.060   40.927 22.527 1.00 16.20 ? 415 HOH A O    1 
HETATM 3560 O O    . HOH B 2 .   ? 9.592   46.025 18.404 1.00 17.17 ? 416 HOH A O    1 
HETATM 3561 O O    . HOH B 2 .   ? 4.114   27.084 11.661 1.00 21.16 ? 417 HOH A O    1 
HETATM 3562 O O    . HOH B 2 .   ? -0.004  39.994 6.145  1.00 19.67 ? 418 HOH A O    1 
HETATM 3563 O O    . HOH B 2 .   ? 6.994   56.173 10.169 1.00 20.12 ? 419 HOH A O    1 
HETATM 3564 O O    . HOH B 2 .   ? 6.925   27.749 27.187 1.00 23.82 ? 420 HOH A O    1 
HETATM 3565 O O    . HOH B 2 .   ? 14.812  35.948 16.189 1.00 21.54 ? 421 HOH A O    1 
HETATM 3566 O O    . HOH B 2 .   ? 0.374   54.016 4.827  1.00 19.07 ? 422 HOH A O    1 
HETATM 3567 O O    . HOH B 2 .   ? -5.833  55.469 8.282  1.00 26.53 ? 423 HOH A O    1 
HETATM 3568 O O    . HOH B 2 .   ? -0.186  42.906 26.948 1.00 22.24 ? 424 HOH A O    1 
HETATM 3569 O O    . HOH B 2 .   ? 3.234   51.745 5.113  1.00 23.93 ? 425 HOH A O    1 
HETATM 3570 O O    . HOH B 2 .   ? -0.225  42.589 7.117  1.00 21.46 ? 426 HOH A O    1 
HETATM 3571 O O    . HOH B 2 .   ? 14.668  41.733 18.705 1.00 22.49 ? 427 HOH A O    1 
HETATM 3572 O O    . HOH B 2 .   ? 3.344   42.485 28.690 1.00 20.66 ? 428 HOH A O    1 
HETATM 3573 O O    . HOH B 2 .   ? -6.921  48.752 12.384 1.00 19.68 ? 429 HOH A O    1 
HETATM 3574 O O    . HOH B 2 .   ? -6.906  41.270 18.942 1.00 20.88 ? 430 HOH A O    1 
HETATM 3575 O O    . HOH B 2 .   ? -8.777  49.291 9.008  1.00 21.91 ? 431 HOH A O    1 
HETATM 3576 O O    . HOH B 2 .   ? 10.559  41.913 19.936 1.00 24.08 ? 432 HOH A O    1 
HETATM 3577 O O    . HOH B 2 .   ? -0.707  18.601 16.674 1.00 32.53 ? 433 HOH A O    1 
HETATM 3578 O O    . HOH B 2 .   ? -5.494  52.990 9.806  1.00 31.97 ? 434 HOH A O    1 
HETATM 3579 O O    . HOH B 2 .   ? -9.260  39.845 18.381 1.00 28.15 ? 435 HOH A O    1 
HETATM 3580 O O    . HOH B 2 .   ? 4.110   30.747 10.709 1.00 24.28 ? 436 HOH A O    1 
HETATM 3581 O O    . HOH B 2 .   ? 8.621   41.228 8.211  1.00 21.58 ? 437 HOH A O    1 
HETATM 3582 O O    . HOH B 2 .   ? 13.846  47.611 17.570 1.00 23.28 ? 438 HOH A O    1 
HETATM 3583 O O    . HOH B 2 .   ? 8.284   33.829 10.058 1.00 26.53 ? 439 HOH A O    1 
HETATM 3584 O O    . HOH B 2 .   ? -5.262  35.340 26.789 1.00 28.32 ? 440 HOH A O    1 
HETATM 3585 O O    . HOH B 2 .   ? 7.439   58.676 10.880 1.00 32.01 ? 441 HOH A O    1 
HETATM 3586 O O    . HOH B 2 .   ? 10.071  55.807 19.334 1.00 35.58 ? 442 HOH A O    1 
HETATM 3587 O O    . HOH B 2 .   ? 5.827   27.360 9.113  1.00 27.13 ? 443 HOH A O    1 
HETATM 3588 O O    . HOH B 2 .   ? -7.798  43.959 18.691 1.00 25.17 ? 444 HOH A O    1 
HETATM 3589 O O    . HOH B 2 .   ? -6.360  40.422 21.578 1.00 25.34 ? 445 HOH A O    1 
HETATM 3590 O O    . HOH B 2 .   ? -12.766 43.021 14.291 1.00 32.32 ? 446 HOH A O    1 
HETATM 3591 O O    . HOH B 2 .   ? 9.412   44.248 20.319 1.00 29.25 ? 447 HOH A O    1 
HETATM 3592 O O    . HOH B 2 .   ? 4.734   41.751 20.734 1.00 20.74 ? 448 HOH A O    1 
HETATM 3593 O O    . HOH B 2 .   ? 12.891  29.867 13.968 1.00 26.84 ? 449 HOH A O    1 
HETATM 3594 O O    . HOH B 2 .   ? -7.904  31.569 7.459  1.00 27.97 ? 450 HOH A O    1 
HETATM 3595 O O    . HOH B 2 .   ? 20.205  47.578 17.006 1.00 29.32 ? 451 HOH A O    1 
HETATM 3596 O O    . HOH B 2 .   ? 9.422   40.652 24.305 1.00 29.59 ? 452 HOH A O    1 
HETATM 3597 O O    . HOH B 2 .   ? 11.607  48.150 18.780 1.00 35.47 ? 453 HOH A O    1 
HETATM 3598 O O    . HOH B 2 .   ? -7.845  57.541 -2.886 1.00 31.47 ? 454 HOH A O    1 
HETATM 3599 O O    . HOH B 2 .   ? -2.192  17.495 14.940 1.00 34.98 ? 455 HOH A O    1 
HETATM 3600 O O    . HOH B 2 .   ? 3.047   54.409 3.856  1.00 30.26 ? 456 HOH A O    1 
HETATM 3601 O O    . HOH B 2 .   ? 5.942   39.571 9.047  1.00 27.18 ? 457 HOH A O    1 
HETATM 3602 O O    . HOH B 2 .   ? 5.013   29.437 7.536  1.00 30.22 ? 458 HOH A O    1 
HETATM 3603 O O    . HOH B 2 .   ? 17.575  40.288 16.057 1.00 28.63 ? 459 HOH A O    1 
HETATM 3604 O O    . HOH B 2 .   ? 12.467  26.544 20.404 1.00 38.89 ? 460 HOH A O    1 
HETATM 3605 O O    . HOH B 2 .   ? 16.657  34.296 15.099 1.00 26.76 ? 461 HOH A O    1 
HETATM 3606 O O    . HOH B 2 .   ? 9.566   59.350 16.784 1.00 32.71 ? 462 HOH A O    1 
HETATM 3607 O O    . HOH B 2 .   ? 12.389  26.024 16.627 1.00 34.58 ? 463 HOH A O    1 
HETATM 3608 O O    . HOH B 2 .   ? 11.029  39.492 22.724 1.00 34.73 ? 464 HOH A O    1 
HETATM 3609 O O    . HOH B 2 .   ? 5.658   33.008 10.605 1.00 35.40 ? 465 HOH A O    1 
HETATM 3610 O O    . HOH B 2 .   ? 1.835   64.839 8.330  1.00 33.52 ? 466 HOH A O    1 
HETATM 3611 O O    . HOH B 2 .   ? 17.609  53.191 18.553 1.00 32.21 ? 467 HOH A O    1 
HETATM 3612 O O    . HOH B 2 .   ? 23.374  32.332 11.732 1.00 44.30 ? 468 HOH A O    1 
HETATM 3613 O O    . HOH B 2 .   ? 16.683  37.936 17.123 1.00 28.79 ? 469 HOH A O    1 
HETATM 3614 O O    . HOH B 2 .   ? 15.198  31.065 14.238 1.00 30.56 ? 470 HOH A O    1 
HETATM 3615 O O    . HOH B 2 .   ? 23.291  36.210 14.239 1.00 34.56 ? 471 HOH A O    1 
HETATM 3616 O O    . HOH B 2 .   ? -7.706  48.416 19.441 1.00 29.84 ? 472 HOH A O    1 
HETATM 3617 O O    . HOH B 2 .   ? -8.275  25.940 21.209 1.00 34.73 ? 473 HOH A O    1 
HETATM 3618 O O    . HOH B 2 .   ? 8.562   21.271 20.479 1.00 39.45 ? 474 HOH A O    1 
HETATM 3619 O O    . HOH B 2 .   ? -6.981  42.116 23.384 1.00 32.72 ? 475 HOH A O    1 
HETATM 3620 O O    . HOH B 2 .   ? 22.049  41.652 14.106 1.00 31.60 ? 476 HOH A O    1 
HETATM 3621 O O    . HOH B 2 .   ? 9.066   58.685 19.271 1.00 35.39 ? 477 HOH A O    1 
HETATM 3622 O O    . HOH B 2 .   ? 7.816   31.789 30.705 1.00 37.62 ? 478 HOH A O    1 
HETATM 3623 O O    . HOH B 2 .   ? 15.340  46.356 19.393 1.00 36.72 ? 479 HOH A O    1 
HETATM 3624 O O    . HOH B 2 .   ? 17.625  50.899 19.667 1.00 40.74 ? 480 HOH A O    1 
HETATM 3625 O O    . HOH B 2 .   ? 6.872   44.386 4.375  1.00 33.71 ? 481 HOH A O    1 
HETATM 3626 O O    . HOH B 2 .   ? -7.011  27.968 8.100  1.00 34.78 ? 482 HOH A O    1 
HETATM 3627 O O    . HOH B 2 .   ? 12.560  28.834 18.809 1.00 33.12 ? 483 HOH A O    1 
HETATM 3628 O O    . HOH B 2 .   ? 10.675  33.402 24.749 1.00 41.94 ? 484 HOH A O    1 
HETATM 3629 O O    . HOH B 2 .   ? 20.185  39.400 14.838 1.00 45.06 ? 485 HOH A O    1 
HETATM 3630 O O    . HOH B 2 .   ? 9.785   25.067 9.820  1.00 38.00 ? 486 HOH A O    1 
HETATM 3631 O O    . HOH B 2 .   ? 6.916   21.488 14.787 1.00 37.09 ? 487 HOH A O    1 
HETATM 3632 O O    . HOH B 2 .   ? -5.024  37.672 27.574 1.00 36.08 ? 488 HOH A O    1 
HETATM 3633 O O    . HOH B 2 .   ? -12.728 45.881 7.834  1.00 38.74 ? 489 HOH A O    1 
HETATM 3634 O O    . HOH B 2 .   ? 20.720  43.152 16.182 1.00 34.60 ? 490 HOH A O    1 
HETATM 3635 O O    . HOH B 2 .   ? 4.338   21.799 14.990 1.00 38.50 ? 491 HOH A O    1 
HETATM 3636 O O    . HOH B 2 .   ? 19.378  34.854 14.559 1.00 45.98 ? 492 HOH A O    1 
HETATM 3637 O O    . HOH B 2 .   ? -12.781 45.670 4.995  1.00 32.85 ? 493 HOH A O    1 
HETATM 3638 O O    . HOH B 2 .   ? -14.773 42.252 16.256 1.00 37.25 ? 494 HOH A O    1 
HETATM 3639 O O    . HOH B 2 .   ? 11.201  41.157 27.898 1.00 37.48 ? 495 HOH A O    1 
HETATM 3640 O O    . HOH B 2 .   ? 18.133  48.338 18.820 1.00 42.63 ? 496 HOH A O    1 
HETATM 3641 O O    . HOH B 2 .   ? 6.988   30.230 36.977 1.00 46.07 ? 497 HOH A O    1 
HETATM 3642 O O    . HOH B 2 .   ? -8.204  51.975 9.610  1.00 43.86 ? 498 HOH A O    1 
HETATM 3643 O O    . HOH B 2 .   ? -4.313  62.199 4.101  1.00 50.71 ? 499 HOH A O    1 
HETATM 3644 O O    . HOH B 2 .   ? 16.722  54.733 20.695 1.00 48.89 ? 500 HOH A O    1 
HETATM 3645 O O    . HOH B 2 .   ? 1.101   17.116 7.407  1.00 38.75 ? 501 HOH A O    1 
HETATM 3646 O O    . HOH B 2 .   ? -10.784 47.793 9.980  1.00 36.29 ? 502 HOH A O    1 
HETATM 3647 O O    . HOH B 2 .   ? 24.402  56.973 8.373  1.00 44.83 ? 503 HOH A O    1 
HETATM 3648 O O    . HOH B 2 .   ? 7.225   37.583 10.086 1.00 36.83 ? 504 HOH A O    1 
HETATM 3649 O O    . HOH B 2 .   ? -5.654  58.859 -1.953 1.00 46.03 ? 505 HOH A O    1 
HETATM 3650 O O    . HOH B 2 .   ? 14.787  43.893 20.317 1.00 32.80 ? 506 HOH A O    1 
HETATM 3651 O O    . HOH B 2 .   ? -12.647 40.306 17.247 1.00 35.95 ? 507 HOH A O    1 
HETATM 3652 O O    . HOH B 2 .   ? -13.360 27.840 16.864 1.00 44.67 ? 508 HOH A O    1 
HETATM 3653 O O    . HOH B 2 .   ? 5.410   31.566 3.667  1.00 51.61 ? 509 HOH A O    1 
HETATM 3654 O O    . HOH B 2 .   ? -9.499  38.468 20.469 1.00 38.03 ? 510 HOH A O    1 
HETATM 3655 O O    . HOH B 2 .   ? 23.241  54.101 11.173 1.00 51.77 ? 511 HOH A O    1 
HETATM 3656 O O    . HOH B 2 .   ? 4.812   64.764 17.042 1.00 50.55 ? 512 HOH A O    1 
HETATM 3657 O O    . HOH B 2 .   ? 26.722  34.150 8.584  1.00 31.14 ? 513 HOH A O    1 
HETATM 3658 O O    . HOH B 2 .   ? 10.631  42.307 25.600 1.00 48.68 ? 514 HOH A O    1 
HETATM 3659 O O    . HOH B 2 .   ? 10.169  44.503 25.384 1.00 47.72 ? 515 HOH A O    1 
HETATM 3660 O O    . HOH B 2 .   ? 3.684   32.742 6.143  1.00 45.34 ? 516 HOH A O    1 
HETATM 3661 O O    . HOH B 2 .   ? 14.936  39.322 21.782 1.00 47.98 ? 517 HOH A O    1 
HETATM 3662 O O    . HOH B 2 .   ? 12.187  31.580 20.172 1.00 52.58 ? 518 HOH A O    1 
HETATM 3663 O O    . HOH B 2 .   ? -9.705  47.292 12.888 1.00 38.47 ? 519 HOH A O    1 
HETATM 3664 O O    . HOH B 2 .   ? 22.132  51.855 13.178 1.00 50.00 ? 520 HOH A O    1 
HETATM 3665 O O    . HOH B 2 .   ? -0.484  38.570 29.303 1.00 33.15 ? 521 HOH A O    1 
HETATM 3666 O O    . HOH B 2 .   ? 9.147   60.350 8.875  1.00 40.73 ? 522 HOH A O    1 
HETATM 3667 O O    . HOH B 2 .   ? 9.754   50.258 3.588  1.00 36.27 ? 523 HOH A O    1 
HETATM 3668 O O    . HOH B 2 .   ? 3.456   39.951 7.710  1.00 33.31 ? 524 HOH A O    1 
HETATM 3669 O O    . HOH B 2 .   ? 2.018   34.754 30.352 1.00 44.78 ? 525 HOH A O    1 
HETATM 3670 O O    . HOH B 2 .   ? 7.433   42.043 5.615  1.00 37.79 ? 526 HOH A O    1 
HETATM 3671 O O    . HOH B 2 .   ? 9.392   34.268 27.761 1.00 48.93 ? 527 HOH A O    1 
HETATM 3672 O O    . HOH B 2 .   ? 8.906   64.209 21.620 1.00 38.05 ? 528 HOH A O    1 
HETATM 3673 O O    . HOH B 2 .   ? -13.971 32.887 18.488 1.00 49.38 ? 529 HOH A O    1 
HETATM 3674 O O    . HOH B 2 .   ? 7.045   59.669 18.574 1.00 42.45 ? 530 HOH A O    1 
HETATM 3675 O O    . HOH B 2 .   ? -6.924  56.636 -5.406 1.00 48.77 ? 531 HOH A O    1 
HETATM 3676 O O    . HOH B 2 .   ? 20.595  45.321 17.811 1.00 43.25 ? 532 HOH A O    1 
HETATM 3677 O O    . HOH B 2 .   ? 16.225  39.779 19.272 1.00 40.81 ? 533 HOH A O    1 
HETATM 3678 O O    . HOH B 2 .   ? -6.304  18.125 12.018 1.00 44.06 ? 534 HOH A O    1 
HETATM 3679 O O    . HOH B 2 .   ? 6.826   25.553 7.442  1.00 45.84 ? 535 HOH A O    1 
HETATM 3680 O O    . HOH B 2 .   ? 22.987  50.314 14.547 1.00 48.46 ? 536 HOH A O    1 
HETATM 3681 O O    . HOH B 2 .   ? 15.646  63.302 9.192  1.00 60.39 ? 537 HOH A O    1 
HETATM 3682 O O    . HOH B 2 .   ? -12.090 27.812 19.367 1.00 52.63 ? 538 HOH A O    1 
HETATM 3683 O O    . HOH B 2 .   ? 15.972  47.683 21.209 1.00 61.78 ? 539 HOH A O    1 
HETATM 3684 O O    . HOH B 2 .   ? 5.485   29.432 4.843  1.00 43.03 ? 540 HOH A O    1 
HETATM 3685 O O    . HOH B 2 .   ? 7.160   36.097 8.422  1.00 52.61 ? 541 HOH A O    1 
HETATM 3686 O O    . HOH B 2 .   ? 2.106   37.119 28.980 1.00 49.14 ? 542 HOH A O    1 
HETATM 3687 O O    . HOH B 2 .   ? 14.158  65.568 11.851 1.00 51.76 ? 543 HOH A O    1 
HETATM 3688 O O    . HOH B 2 .   ? 11.271  22.477 22.847 1.00 52.83 ? 544 HOH A O    1 
HETATM 3689 O O    . HOH B 2 .   ? 17.049  34.626 19.649 1.00 58.76 ? 545 HOH A O    1 
HETATM 3690 O O    . HOH B 2 .   ? 21.750  55.503 17.618 1.00 51.91 ? 546 HOH A O    1 
HETATM 3691 O O    . HOH B 2 .   ? 12.849  62.186 7.542  1.00 54.51 ? 547 HOH A O    1 
HETATM 3692 O O    . HOH B 2 .   ? -15.713 32.987 17.010 1.00 51.80 ? 548 HOH A O    1 
HETATM 3693 O O    . HOH B 2 .   ? 17.251  33.008 17.163 1.00 56.95 ? 549 HOH A O    1 
HETATM 3694 O O    . HOH B 2 .   ? 6.837   65.709 12.208 1.00 57.04 ? 550 HOH A O    1 
HETATM 3695 O O    . HOH B 2 .   ? -1.637  55.811 -0.275 1.00 35.93 ? 551 HOH A O    1 
HETATM 3696 O O    . HOH B 2 .   ? 8.828   39.722 15.592 1.00 12.67 ? 552 HOH A O    1 
HETATM 3697 O O    . HOH B 2 .   ? 1.289   20.334 9.927  1.00 25.22 ? 553 HOH A O    1 
HETATM 3698 O O    . HOH B 2 .   ? 14.599  31.696 17.324 1.00 46.23 ? 554 HOH A O    1 
HETATM 3699 O O    . HOH B 2 .   ? 6.211   23.093 6.552  1.00 51.41 ? 555 HOH A O    1 
HETATM 3700 O O    . HOH B 2 .   ? 23.895  50.048 8.234  1.00 50.49 ? 556 HOH A O    1 
HETATM 3701 O O    . HOH B 2 .   ? 11.454  66.005 10.814 1.00 59.12 ? 557 HOH A O    1 
HETATM 3702 O O    . HOH B 2 .   ? 6.087   37.536 35.323 1.00 53.04 ? 558 HOH A O    1 
HETATM 3703 O O    . HOH B 2 .   ? -11.557 38.194 18.547 1.00 45.52 ? 559 HOH A O    1 
HETATM 3704 O O    . HOH B 2 .   ? 9.486   64.780 11.256 1.00 48.18 ? 560 HOH A O    1 
HETATM 3705 O O    . HOH B 2 .   ? -8.851  44.336 21.242 1.00 39.61 ? 561 HOH A O    1 
HETATM 3706 O O    . HOH B 2 .   ? -12.571 54.511 8.304  1.00 47.57 ? 562 HOH A O    1 
HETATM 3707 O O    . HOH B 2 .   ? 10.574  38.080 34.477 1.00 49.18 ? 563 HOH A O    1 
HETATM 3708 O O    . HOH B 2 .   ? 20.486  33.021 12.184 1.00 42.43 ? 564 HOH A O    1 
HETATM 3709 O O    . HOH B 2 .   ? 12.443  33.125 21.727 1.00 53.38 ? 565 HOH A O    1 
HETATM 3710 O O    . HOH B 2 .   ? 18.865  58.245 3.919  1.00 47.64 ? 566 HOH A O    1 
HETATM 3711 O O    . HOH B 2 .   ? 10.955  65.578 13.307 1.00 68.89 ? 567 HOH A O    1 
HETATM 3712 O O    . HOH B 2 .   ? 5.139   17.429 18.910 1.00 58.42 ? 568 HOH A O    1 
HETATM 3713 O O    . HOH B 2 .   ? 0.515   56.779 1.229  1.00 52.30 ? 569 HOH A O    1 
HETATM 3714 O O    . HOH B 2 .   ? 16.291  36.149 23.338 1.00 52.75 ? 570 HOH A O    1 
HETATM 3715 O O    . HOH B 2 .   ? -0.127  17.952 10.210 1.00 52.89 ? 571 HOH A O    1 
HETATM 3716 O O    . HOH B 2 .   ? 11.926  64.925 15.642 1.00 51.69 ? 572 HOH A O    1 
HETATM 3717 O O    . HOH B 2 .   ? -1.640  64.619 2.693  1.00 57.24 ? 573 HOH A O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . PRO A 19  ? 0.4916 0.7349 0.6772 -0.0658 0.0649  0.0969  20  PRO A N   
2    C CA  . PRO A 19  ? 0.5094 0.7075 0.6574 -0.0216 0.0446  0.1151  20  PRO A CA  
3    C C   . PRO A 19  ? 0.4389 0.5437 0.5783 0.0626  0.0224  0.1606  20  PRO A C   
4    O O   . PRO A 19  ? 0.4819 0.5114 0.5480 -0.0299 0.0361  0.1933  20  PRO A O   
5    C CB  . PRO A 19  ? 0.4893 0.7158 0.6451 -0.0382 0.0482  0.1016  20  PRO A CB  
6    C CG  . PRO A 19  ? 0.5289 0.7383 0.6812 -0.0534 0.0686  0.0987  20  PRO A CG  
7    C CD  . PRO A 19  ? 0.5322 0.7649 0.7135 -0.0643 0.0753  0.0931  20  PRO A CD  
15   N N   . PHE A 20  ? 0.3837 0.4443 0.5140 0.1301  -0.0051 0.1178  21  PHE A N   
16   C CA  . PHE A 20  ? 0.2818 0.3409 0.4412 0.0800  -0.0028 0.1240  21  PHE A CA  
17   C C   . PHE A 20  ? 0.2449 0.3766 0.4809 0.0506  0.0237  0.1188  21  PHE A C   
18   O O   . PHE A 20  ? 0.1938 0.3200 0.3988 0.0231  -0.0265 0.1316  21  PHE A O   
19   C CB  . PHE A 20  ? 0.2251 0.3169 0.3982 0.0314  -0.0339 0.1245  21  PHE A CB  
20   C CG  . PHE A 20  ? 0.1915 0.2406 0.3390 0.0168  -0.0325 0.0967  21  PHE A CG  
21   C CD1 . PHE A 20  ? 0.1909 0.2247 0.3211 -0.0009 -0.0253 0.0699  21  PHE A CD1 
22   C CD2 . PHE A 20  ? 0.1622 0.2661 0.3412 0.0379  -0.0148 0.0564  21  PHE A CD2 
23   C CE1 . PHE A 20  ? 0.2001 0.2131 0.2904 -0.0055 0.0022  0.0742  21  PHE A CE1 
24   C CE2 . PHE A 20  ? 0.1821 0.2690 0.3276 0.0171  -0.0278 0.0364  21  PHE A CE2 
25   C CZ  . PHE A 20  ? 0.1848 0.2328 0.3151 -0.0151 -0.0361 0.0563  21  PHE A CZ  
35   N N   . ASP A 21  ? 0.2114 0.3759 0.4687 0.0341  0.0378  0.0952  22  ASP A N   
36   C CA  . ASP A 21  ? 0.1705 0.3587 0.4050 -0.0031 0.0260  0.0842  22  ASP A CA  
37   C C   . ASP A 21  ? 0.1537 0.3045 0.3966 0.0140  -0.0029 0.0676  22  ASP A C   
38   O O   . ASP A 21  ? 0.1822 0.3139 0.4281 0.0028  -0.0149 0.0744  22  ASP A O   
39   C CB  . ASP A 21  ? 0.2598 0.4898 0.4424 -0.0055 0.0265  0.0652  22  ASP A CB  
40   C CG  . ASP A 21  ? 0.4141 0.6296 0.5763 -0.0091 0.0352  0.0298  22  ASP A CG  
41   O OD1 . ASP A 21  ? 0.3372 0.5858 0.4681 -0.0041 0.0313  -0.0026 22  ASP A OD1 
42   O OD2 . ASP A 21  ? 0.5178 0.7642 0.7282 -0.0313 0.0579  0.0199  22  ASP A OD2 
47   N N   . ALA A 22  ? 0.1748 0.3231 0.3650 0.0365  0.0006  0.0622  23  ALA A N   
48   C CA  . ALA A 22  ? 0.1794 0.3129 0.3510 -0.0165 -0.0248 0.0728  23  ALA A CA  
49   C C   . ALA A 22  ? 0.2212 0.2427 0.3422 -0.0237 -0.0578 0.0748  23  ALA A C   
50   O O   . ALA A 22  ? 0.2494 0.2771 0.3462 -0.0107 -0.0478 0.0782  23  ALA A O   
51   C CB  . ALA A 22  ? 0.2072 0.4138 0.3697 -0.0057 -0.0347 0.0314  23  ALA A CB  
57   N N   . ILE A 23  ? 0.1483 0.2652 0.3407 -0.0098 -0.0402 0.0544  24  ILE A N   
58   C CA  . ILE A 23  ? 0.1681 0.3139 0.3497 -0.0115 -0.0396 0.0350  24  ILE A CA  
59   C C   . ILE A 23  ? 0.1684 0.3021 0.3542 -0.0182 -0.0503 0.0487  24  ILE A C   
60   O O   . ILE A 23  ? 0.1922 0.3299 0.4094 0.0045  -0.0644 0.0349  24  ILE A O   
61   C CB  . ILE A 23  ? 0.1816 0.2952 0.3448 0.0235  -0.0689 -0.0079 24  ILE A CB  
62   C CG1 . ILE A 23  ? 0.2284 0.3071 0.3417 0.0016  -0.0665 0.0231  24  ILE A CG1 
63   C CG2 . ILE A 23  ? 0.2850 0.3607 0.4230 0.0671  -0.0708 -0.0240 24  ILE A CG2 
64   C CD1 . ILE A 23  ? 0.2617 0.3224 0.3468 0.0133  -0.0623 0.0040  24  ILE A CD1 
76   N N   . LYS A 24  ? 0.1582 0.2989 0.3422 -0.0453 -0.0562 0.0672  25  LYS A N   
77   C CA  . LYS A 24  ? 0.1847 0.3391 0.3779 -0.0363 -0.0615 0.1278  25  LYS A CA  
78   C C   . LYS A 24  ? 0.1981 0.3654 0.3681 -0.0686 -0.0517 0.1243  25  LYS A C   
79   O O   . LYS A 24  ? 0.2481 0.4082 0.3674 -0.0650 -0.1026 0.1122  25  LYS A O   
80   C CB  . LYS A 24  ? 0.1929 0.3460 0.4010 -0.0447 -0.0788 0.1481  25  LYS A CB  
81   C CG  . LYS A 24  ? 0.2206 0.3333 0.4307 -0.0601 -0.0827 0.1711  25  LYS A CG  
82   C CD  . LYS A 24  ? 0.2251 0.3426 0.4376 -0.0347 -0.0711 0.1741  25  LYS A CD  
83   C CE  . LYS A 24  ? 0.2477 0.3985 0.4780 -0.0259 -0.0643 0.1558  25  LYS A CE  
84   N NZ  . LYS A 24  ? 0.3960 0.5342 0.5972 -0.0122 -0.0743 0.1529  25  LYS A NZ  
98   N N   . GLN A 25  ? 0.1660 0.3722 0.3460 0.0251  -0.0181 0.1210  26  GLN A N   
99   C CA  . GLN A 25  ? 0.1845 0.3985 0.3540 0.0567  0.0016  0.1181  26  GLN A CA  
100  C C   . GLN A 25  ? 0.1373 0.3493 0.3121 0.0044  -0.0220 0.0832  26  GLN A C   
101  O O   . GLN A 25  ? 0.1455 0.3302 0.3152 -0.0160 -0.0205 0.0943  26  GLN A O   
102  C CB  . GLN A 25  ? 0.3210 0.4465 0.4473 0.1221  -0.0061 0.1382  26  GLN A CB  
103  C CG  . GLN A 25  ? 0.4217 0.4966 0.4891 0.0733  -0.0172 0.1144  26  GLN A CG  
104  C CD  . GLN A 25  ? 0.5430 0.6497 0.6685 0.0917  -0.0079 0.0557  26  GLN A CD  
105  O OE1 . GLN A 25  ? 0.5737 0.6943 0.7406 0.1257  0.0027  0.0396  26  GLN A OE1 
106  N NE2 . GLN A 25  ? 0.6110 0.7209 0.7661 0.0985  -0.0149 0.0258  26  GLN A NE2 
115  N N   . PRO A 26  ? 0.1703 0.3226 0.3161 0.0202  -0.0361 0.0681  27  PRO A N   
116  C CA  . PRO A 26  ? 0.1620 0.2930 0.3052 0.0216  0.0073  0.0242  27  PRO A CA  
117  C C   . PRO A 26  ? 0.1865 0.2463 0.2850 0.0562  -0.0006 0.0084  27  PRO A C   
118  O O   . PRO A 26  ? 0.2062 0.2848 0.2739 0.0322  0.0128  -0.0037 27  PRO A O   
119  C CB  . PRO A 26  ? 0.1975 0.3700 0.3713 0.0740  -0.0268 0.0298  27  PRO A CB  
120  C CG  . PRO A 26  ? 0.2570 0.4400 0.4587 0.0910  -0.0634 0.0472  27  PRO A CG  
121  C CD  . PRO A 26  ? 0.2049 0.3323 0.3585 0.0791  -0.0665 0.0520  27  PRO A CD  
129  N N   . ASN A 27  ? 0.2011 0.2403 0.2518 0.0275  -0.0127 0.0061  28  ASN A N   
130  C CA  . ASN A 27  ? 0.2041 0.2257 0.2316 0.0013  -0.0331 0.0367  28  ASN A CA  
131  C C   . ASN A 27  ? 0.2176 0.2328 0.2399 -0.0042 -0.0761 0.0039  28  ASN A C   
132  O O   . ASN A 27  ? 0.2335 0.2751 0.2716 0.0062  -0.0614 0.0157  28  ASN A O   
133  C CB  . ASN A 27  ? 0.1955 0.2439 0.1990 0.0315  -0.0192 -0.0151 28  ASN A CB  
134  C CG  . ASN A 27  ? 0.1794 0.2757 0.2167 0.0031  0.0093  0.0115  28  ASN A CG  
135  O OD1 . ASN A 27  ? 0.2397 0.2726 0.2300 0.0093  0.0162  0.0402  28  ASN A OD1 
136  N ND2 . ASN A 27  ? 0.1900 0.2926 0.1880 0.0214  -0.0248 0.0167  28  ASN A ND2 
143  N N   . ARG A 28  ? 0.2354 0.2173 0.2512 0.0042  -0.0602 -0.0008 29  ARG A N   
144  C CA  . ARG A 28  ? 0.2427 0.2040 0.2645 0.0258  -0.0561 -0.0197 29  ARG A CA  
145  C C   . ARG A 28  ? 0.2848 0.1951 0.2504 0.0257  -0.0959 -0.0018 29  ARG A C   
146  O O   . ARG A 28  ? 0.2922 0.2192 0.2688 0.0043  -0.0789 -0.0055 29  ARG A O   
147  C CB  . ARG A 28  ? 0.2703 0.2238 0.3060 0.0069  -0.0543 -0.0236 29  ARG A CB  
148  C CG  . ARG A 28  ? 0.2391 0.2672 0.3059 0.0596  -0.0556 -0.0168 29  ARG A CG  
149  C CD  . ARG A 28  ? 0.2401 0.3115 0.2900 0.0467  -0.0142 -0.0294 29  ARG A CD  
150  N NE  . ARG A 28  ? 0.2782 0.3144 0.2671 0.0536  -0.0137 -0.0535 29  ARG A NE  
151  C CZ  . ARG A 28  ? 0.2856 0.2969 0.2561 0.0480  -0.0145 -0.0583 29  ARG A CZ  
152  N NH1 . ARG A 28  ? 0.2606 0.3061 0.2437 0.0611  -0.0457 -0.0567 29  ARG A NH1 
153  N NH2 . ARG A 28  ? 0.3115 0.2915 0.2702 0.0292  -0.0246 -0.0373 29  ARG A NH2 
167  N N   . SER A 29  ? 0.3712 0.2188 0.2687 0.0271  -0.1148 0.0336  30  SER A N   
168  C CA  . SER A 29  ? 0.3866 0.2066 0.2392 -0.0010 -0.1259 0.0315  30  SER A CA  
169  C C   . SER A 29  ? 0.3866 0.2002 0.2120 -0.0267 -0.1146 0.0158  30  SER A C   
170  O O   . SER A 29  ? 0.4141 0.1951 0.2145 -0.0164 -0.1331 -0.0036 30  SER A O   
171  C CB  . SER A 29  ? 0.3841 0.2530 0.2551 -0.0258 -0.1472 0.0397  30  SER A CB  
172  O OG  . SER A 29  ? 0.4435 0.2671 0.2650 0.0070  -0.1385 0.0327  30  SER A OG  
178  N N   . GLU A 30  ? 0.3797 0.2189 0.2258 -0.0246 -0.0926 0.0155  31  GLU A N   
179  C CA  . GLU A 30  ? 0.3660 0.2330 0.2172 -0.0261 -0.1089 -0.0091 31  GLU A CA  
180  C C   . GLU A 30  ? 0.3699 0.2307 0.2857 -0.0079 -0.1052 -0.0157 31  GLU A C   
181  O O   . GLU A 30  ? 0.3690 0.2279 0.2700 -0.0116 -0.1120 0.0010  31  GLU A O   
182  C CB  . GLU A 30  ? 0.4128 0.2607 0.2071 -0.0056 -0.1158 -0.0229 31  GLU A CB  
183  C CG  . GLU A 30  ? 0.4257 0.3459 0.2202 -0.0280 -0.1077 -0.0174 31  GLU A CG  
184  C CD  . GLU A 30  ? 0.4875 0.4474 0.2751 -0.0290 -0.1154 -0.0144 31  GLU A CD  
185  O OE1 . GLU A 30  ? 0.4896 0.5043 0.2777 -0.0162 -0.1052 -0.0151 31  GLU A OE1 
186  O OE2 . GLU A 30  ? 0.5863 0.5068 0.3497 -0.0799 -0.0950 -0.0127 31  GLU A OE2 
193  N N   . GLU A 31  ? 0.3598 0.2166 0.3063 0.0194  -0.1142 -0.0191 32  GLU A N   
194  C CA  . GLU A 31  ? 0.4136 0.2074 0.3249 0.0429  -0.1197 -0.0159 32  GLU A CA  
195  C C   . GLU A 31  ? 0.3954 0.2332 0.3014 0.0052  -0.0974 -0.0099 32  GLU A C   
196  O O   . GLU A 31  ? 0.4199 0.2198 0.2755 0.0100  -0.1024 0.0107  32  GLU A O   
197  C CB  . GLU A 31  ? 0.5073 0.2500 0.3911 0.0762  -0.1531 -0.0069 32  GLU A CB  
198  C CG  . GLU A 31  ? 0.6585 0.4472 0.5122 0.0564  -0.1750 0.0184  32  GLU A CG  
199  C CD  . GLU A 31  ? 0.8696 0.6636 0.7209 0.0406  -0.1884 0.0279  32  GLU A CD  
200  O OE1 . GLU A 31  ? 0.8941 0.7061 0.7643 0.0635  -0.1977 0.0507  32  GLU A OE1 
201  O OE2 . GLU A 31  ? 0.9649 0.7259 0.8036 0.0309  -0.1896 0.0136  32  GLU A OE2 
208  N N   . GLU A 32  ? 0.3093 0.2287 0.2772 0.0156  -0.0963 -0.0153 33  GLU A N   
209  C CA  . GLU A 32  ? 0.3101 0.2430 0.2819 0.0398  -0.0972 -0.0318 33  GLU A CA  
210  C C   . GLU A 32  ? 0.3564 0.2079 0.2497 0.0398  -0.0910 -0.0342 33  GLU A C   
211  O O   . GLU A 32  ? 0.3597 0.2239 0.2658 0.0198  -0.0851 -0.0360 33  GLU A O   
212  C CB  . GLU A 32  ? 0.3428 0.2496 0.3078 0.0056  -0.0887 -0.0358 33  GLU A CB  
213  C CG  . GLU A 32  ? 0.3655 0.2990 0.3564 0.0458  -0.0864 -0.0514 33  GLU A CG  
214  C CD  . GLU A 32  ? 0.4482 0.4229 0.4866 0.0616  -0.0547 -0.0493 33  GLU A CD  
215  O OE1 . GLU A 32  ? 0.4560 0.4211 0.4438 0.0938  -0.0495 -0.0415 33  GLU A OE1 
216  O OE2 . GLU A 32  ? 0.4264 0.4100 0.4887 0.0792  -0.0126 -0.0429 33  GLU A OE2 
223  N N   . VAL A 33  ? 0.3543 0.2024 0.2376 0.0386  -0.1325 -0.0104 34  VAL A N   
224  C CA  . VAL A 33  ? 0.3385 0.1954 0.2324 0.0360  -0.1282 -0.0149 34  VAL A CA  
225  C C   . VAL A 33  ? 0.3692 0.2260 0.2495 0.0175  -0.1305 -0.0155 34  VAL A C   
226  O O   . VAL A 33  ? 0.3758 0.2053 0.2581 0.0280  -0.1229 -0.0331 34  VAL A O   
227  C CB  . VAL A 33  ? 0.3698 0.2288 0.2609 0.0585  -0.1255 -0.0249 34  VAL A CB  
228  C CG1 . VAL A 33  ? 0.4030 0.2814 0.3196 0.0920  -0.1063 -0.0415 34  VAL A CG1 
229  C CG2 . VAL A 33  ? 0.4282 0.2698 0.2657 0.0415  -0.1261 -0.0004 34  VAL A CG2 
239  N N   . THR A 34  ? 0.3820 0.2170 0.2299 -0.0071 -0.1103 0.0064  35  THR A N   
240  C CA  . THR A 34  ? 0.3857 0.2723 0.2447 -0.0137 -0.1101 0.0031  35  THR A CA  
241  C C   . THR A 34  ? 0.3675 0.2408 0.2327 0.0008  -0.1146 0.0295  35  THR A C   
242  O O   . THR A 34  ? 0.3573 0.2503 0.2540 -0.0064 -0.1012 0.0048  35  THR A O   
243  C CB  . THR A 34  ? 0.4128 0.3653 0.2584 -0.0908 -0.0966 -0.0078 35  THR A CB  
244  O OG1 . THR A 34  ? 0.4608 0.4250 0.2968 -0.0930 -0.0587 -0.0102 35  THR A OG1 
245  C CG2 . THR A 34  ? 0.4144 0.3973 0.2352 -0.0771 -0.1068 0.0017  35  THR A CG2 
253  N N   . GLN A 35  ? 0.3884 0.2077 0.2385 0.0303  -0.0949 0.0152  36  GLN A N   
254  C CA  . GLN A 35  ? 0.3830 0.2295 0.2584 0.0281  -0.1163 0.0080  36  GLN A CA  
255  C C   . GLN A 35  ? 0.3409 0.2027 0.2319 -0.0046 -0.0945 -0.0104 36  GLN A C   
256  O O   . GLN A 35  ? 0.3636 0.2053 0.2213 0.0085  -0.1040 0.0170  36  GLN A O   
257  C CB  . GLN A 35  ? 0.4762 0.2329 0.3032 0.0465  -0.1372 -0.0048 36  GLN A CB  
258  C CG  . GLN A 35  ? 0.5241 0.2759 0.3639 -0.0023 -0.1588 0.0061  36  GLN A CG  
259  C CD  . GLN A 35  ? 0.5990 0.3209 0.4127 -0.0070 -0.1811 0.0499  36  GLN A CD  
260  O OE1 . GLN A 35  ? 0.6615 0.3634 0.4405 -0.0131 -0.1542 0.0579  36  GLN A OE1 
261  N NE2 . GLN A 35  ? 0.6124 0.2903 0.4289 0.0118  -0.1982 0.0406  36  GLN A NE2 
270  N N   . LEU A 36  ? 0.3595 0.1592 0.2299 0.0223  -0.0636 -0.0271 37  LEU A N   
271  C CA  . LEU A 36  ? 0.3469 0.1427 0.1967 0.0200  -0.0622 0.0008  37  LEU A CA  
272  C C   . LEU A 36  ? 0.3476 0.1520 0.1981 0.0010  -0.0711 -0.0138 37  LEU A C   
273  O O   . LEU A 36  ? 0.3281 0.2015 0.2071 -0.0100 -0.0695 -0.0007 37  LEU A O   
274  C CB  . LEU A 36  ? 0.3412 0.1953 0.2480 0.0421  -0.0769 -0.0003 37  LEU A CB  
275  C CG  . LEU A 36  ? 0.3396 0.2414 0.2948 0.0145  -0.0613 -0.0290 37  LEU A CG  
276  C CD1 . LEU A 36  ? 0.3555 0.3002 0.3067 -0.0200 -0.0973 0.0263  37  LEU A CD1 
277  C CD2 . LEU A 36  ? 0.3978 0.3282 0.3958 -0.0081 -0.0555 -0.0633 37  LEU A CD2 
289  N N   . ALA A 37  ? 0.3536 0.1650 0.2088 0.0058  -0.0923 -0.0130 38  ALA A N   
290  C CA  . ALA A 37  ? 0.3104 0.1950 0.2263 0.0394  -0.0779 -0.0154 38  ALA A CA  
291  C C   . ALA A 37  ? 0.3181 0.1788 0.2237 -0.0016 -0.0700 0.0100  38  ALA A C   
292  O O   . ALA A 37  ? 0.3337 0.1809 0.2219 -0.0031 -0.0739 0.0175  38  ALA A O   
293  C CB  . ALA A 37  ? 0.3313 0.2042 0.2686 0.0376  -0.0500 -0.0302 38  ALA A CB  
299  N N   . GLU A 38  ? 0.3249 0.2091 0.2447 -0.0326 -0.0602 0.0085  39  GLU A N   
300  C CA  . GLU A 38  ? 0.3461 0.1817 0.2563 -0.0277 -0.0974 0.0359  39  GLU A CA  
301  C C   . GLU A 38  ? 0.3226 0.1682 0.2544 -0.0088 -0.1084 0.0345  39  GLU A C   
302  O O   . GLU A 38  ? 0.4043 0.1727 0.2790 -0.0315 -0.0936 0.0481  39  GLU A O   
303  C CB  . GLU A 38  ? 0.4758 0.2183 0.3499 -0.0192 -0.0875 0.0773  39  GLU A CB  
304  C CG  . GLU A 38  ? 0.6881 0.4594 0.5237 -0.0538 -0.0865 0.0745  39  GLU A CG  
305  C CD  . GLU A 38  ? 0.9400 0.6950 0.7340 -0.0693 -0.0907 0.0735  39  GLU A CD  
306  O OE1 . GLU A 38  ? 1.0314 0.7627 0.7806 -0.0743 -0.1056 0.0737  39  GLU A OE1 
307  O OE2 . GLU A 38  ? 1.0329 0.7771 0.8273 -0.0781 -0.0869 0.0724  39  GLU A OE2 
314  N N   . ASP A 39  ? 0.3446 0.1687 0.2722 -0.0080 -0.0858 0.0267  40  ASP A N   
315  C CA  . ASP A 39  ? 0.3655 0.1757 0.2553 -0.0068 -0.0881 -0.0051 40  ASP A CA  
316  C C   . ASP A 39  ? 0.3659 0.1795 0.2480 -0.0345 -0.0617 -0.0071 40  ASP A C   
317  O O   . ASP A 39  ? 0.3647 0.1776 0.2654 -0.0026 -0.0764 -0.0067 40  ASP A O   
318  C CB  . ASP A 39  ? 0.3750 0.2088 0.2665 0.0398  -0.1069 -0.0116 40  ASP A CB  
319  C CG  . ASP A 39  ? 0.4804 0.2738 0.3465 0.0177  -0.0701 -0.0322 40  ASP A CG  
320  O OD1 . ASP A 39  ? 0.5367 0.2793 0.3522 0.0371  -0.0532 -0.0026 40  ASP A OD1 
321  O OD2 . ASP A 39  ? 0.5048 0.3860 0.3885 0.0561  -0.0446 -0.0575 40  ASP A OD2 
326  N N   . PHE A 40  ? 0.3239 0.1392 0.1899 -0.0375 -0.0418 0.0221  41  PHE A N   
327  C CA  . PHE A 40  ? 0.3215 0.1277 0.1703 -0.0361 -0.0276 0.0106  41  PHE A CA  
328  C C   . PHE A 40  ? 0.3269 0.1469 0.1862 -0.0427 -0.0332 0.0125  41  PHE A C   
329  O O   . PHE A 40  ? 0.3145 0.1333 0.2144 -0.0411 -0.0284 0.0064  41  PHE A O   
330  C CB  . PHE A 40  ? 0.3241 0.1548 0.1912 -0.0169 -0.0128 0.0152  41  PHE A CB  
331  C CG  . PHE A 40  ? 0.2556 0.1495 0.1821 -0.0204 0.0090  0.0059  41  PHE A CG  
332  C CD1 . PHE A 40  ? 0.2623 0.1566 0.2047 -0.0055 -0.0058 0.0395  41  PHE A CD1 
333  C CD2 . PHE A 40  ? 0.2665 0.1732 0.1734 -0.0209 0.0092  -0.0050 41  PHE A CD2 
334  C CE1 . PHE A 40  ? 0.2666 0.2012 0.2351 0.0251  -0.0047 0.0410  41  PHE A CE1 
335  C CE2 . PHE A 40  ? 0.2212 0.1826 0.1658 -0.0333 0.0007  0.0273  41  PHE A CE2 
336  C CZ  . PHE A 40  ? 0.2369 0.1687 0.1926 -0.0174 -0.0061 0.0096  41  PHE A CZ  
346  N N   . LYS A 41  ? 0.2962 0.1628 0.1875 -0.0365 -0.0348 0.0151  42  LYS A N   
347  C CA  . LYS A 41  ? 0.3168 0.1809 0.2236 -0.0493 -0.0214 0.0229  42  LYS A CA  
348  C C   . LYS A 41  ? 0.3392 0.1674 0.2494 -0.0866 -0.0598 0.0246  42  LYS A C   
349  O O   . LYS A 41  ? 0.3690 0.1780 0.2445 -0.0956 -0.0598 0.0264  42  LYS A O   
350  C CB  . LYS A 41  ? 0.3322 0.2693 0.2630 -0.0794 -0.0020 -0.0234 42  LYS A CB  
351  C CG  . LYS A 41  ? 0.4279 0.3106 0.2833 -0.1411 0.0058  0.0050  42  LYS A CG  
352  C CD  . LYS A 41  ? 0.6103 0.4887 0.4105 -0.1432 0.0044  0.0300  42  LYS A CD  
353  C CE  . LYS A 41  ? 0.7574 0.6138 0.5536 -0.1044 -0.0202 0.0664  42  LYS A CE  
354  N NZ  . LYS A 41  ? 0.8421 0.6633 0.6256 -0.0878 -0.0161 0.1034  42  LYS A NZ  
368  N N   . ASP A 42  ? 0.3789 0.1849 0.2693 -0.0845 -0.0738 0.0297  43  ASP A N   
369  C CA  . ASP A 42  ? 0.4083 0.1874 0.2844 -0.0778 -0.1038 0.0662  43  ASP A CA  
370  C C   . ASP A 42  ? 0.4240 0.1708 0.2888 -0.0599 -0.0858 0.0382  43  ASP A C   
371  O O   . ASP A 42  ? 0.4076 0.1886 0.2923 -0.0470 -0.1002 0.0217  43  ASP A O   
372  C CB  . ASP A 42  ? 0.4754 0.2212 0.3060 -0.0990 -0.1354 0.0718  43  ASP A CB  
373  C CG  . ASP A 42  ? 0.6109 0.3072 0.4264 -0.0842 -0.1418 0.0736  43  ASP A CG  
374  O OD1 . ASP A 42  ? 0.6252 0.3124 0.4165 -0.0768 -0.1015 0.0642  43  ASP A OD1 
375  O OD2 . ASP A 42  ? 0.6511 0.2837 0.4523 -0.0565 -0.1782 0.0639  43  ASP A OD2 
380  N N   . TRP A 43  ? 0.3921 0.1507 0.2672 -0.0288 -0.0918 0.0251  44  TRP A N   
381  C CA  . TRP A 43  ? 0.3516 0.1484 0.2298 -0.0254 -0.0714 -0.0129 44  TRP A CA  
382  C C   . TRP A 43  ? 0.3423 0.1679 0.2430 -0.0582 -0.0712 0.0046  44  TRP A C   
383  O O   . TRP A 43  ? 0.3349 0.1848 0.2721 -0.0406 -0.0945 0.0004  44  TRP A O   
384  C CB  . TRP A 43  ? 0.3210 0.1900 0.2358 -0.0413 -0.0553 -0.0151 44  TRP A CB  
385  C CG  . TRP A 43  ? 0.3074 0.2102 0.2159 -0.0326 -0.0342 -0.0269 44  TRP A CG  
386  C CD1 . TRP A 43  ? 0.3072 0.2271 0.2372 -0.0323 0.0050  -0.0322 44  TRP A CD1 
387  C CD2 . TRP A 43  ? 0.3152 0.1850 0.2242 -0.0287 -0.0100 0.0142  44  TRP A CD2 
388  N NE1 . TRP A 43  ? 0.3930 0.1979 0.2475 -0.0274 -0.0080 -0.0260 44  TRP A NE1 
389  C CE2 . TRP A 43  ? 0.3566 0.1642 0.2329 -0.0383 -0.0036 -0.0291 44  TRP A CE2 
390  C CE3 . TRP A 43  ? 0.2829 0.2176 0.2536 -0.0135 -0.0020 0.0227  44  TRP A CE3 
391  C CZ2 . TRP A 43  ? 0.3385 0.1689 0.2436 -0.0378 0.0096  -0.0112 44  TRP A CZ2 
392  C CZ3 . TRP A 43  ? 0.2628 0.1963 0.2576 0.0015  0.0046  0.0183  44  TRP A CZ3 
393  C CH2 . TRP A 43  ? 0.2849 0.1883 0.2450 -0.0322 0.0168  0.0118  44  TRP A CH2 
404  N N   . SER A 44  ? 0.3226 0.1536 0.2461 -0.0377 -0.0411 -0.0024 45  SER A N   
405  C CA  . SER A 44  ? 0.2690 0.1511 0.2306 0.0069  -0.0412 0.0186  45  SER A CA  
406  C C   . SER A 44  ? 0.3384 0.1819 0.2666 -0.0826 -0.0764 0.0425  45  SER A C   
407  O O   . SER A 44  ? 0.3868 0.2436 0.2760 -0.0894 -0.0802 0.0252  45  SER A O   
408  C CB  . SER A 44  ? 0.2420 0.1748 0.2382 -0.0085 -0.0073 0.0039  45  SER A CB  
409  O OG  . SER A 44  ? 0.2590 0.1670 0.2189 -0.0475 -0.0022 -0.0005 45  SER A OG  
415  N N   . LYS A 45  ? 0.3771 0.1859 0.3023 -0.0845 -0.0898 0.0458  46  LYS A N   
416  C CA  . LYS A 45  ? 0.3880 0.2432 0.3492 -0.1358 -0.0718 0.0443  46  LYS A CA  
417  C C   . LYS A 45  ? 0.3846 0.2193 0.3589 -0.1245 -0.0916 0.0253  46  LYS A C   
418  O O   . LYS A 45  ? 0.4369 0.2930 0.4364 -0.1458 -0.0965 -0.0021 46  LYS A O   
419  C CB  . LYS A 45  ? 0.4450 0.2649 0.3453 -0.1573 -0.0501 0.0691  46  LYS A CB  
420  C CG  . LYS A 45  ? 0.5294 0.3256 0.3817 -0.1737 -0.0226 0.0826  46  LYS A CG  
421  C CD  . LYS A 45  ? 0.6181 0.4035 0.4261 -0.1622 -0.0194 0.1098  46  LYS A CD  
422  C CE  . LYS A 45  ? 0.7267 0.4867 0.4983 -0.1493 -0.0385 0.1227  46  LYS A CE  
423  N NZ  . LYS A 45  ? 0.7696 0.5687 0.5778 -0.1369 -0.0588 0.1407  46  LYS A NZ  
437  N N   . ALA A 46  ? 0.4156 0.1526 0.3376 -0.0620 -0.1161 0.0068  47  ALA A N   
438  C CA  . ALA A 46  ? 0.4393 0.1787 0.3641 -0.0622 -0.1212 -0.0301 47  ALA A CA  
439  C C   . ALA A 46  ? 0.4199 0.2256 0.3853 -0.0784 -0.1091 -0.0493 47  ALA A C   
440  O O   . ALA A 46  ? 0.4696 0.2317 0.3909 -0.0382 -0.1291 -0.0747 47  ALA A O   
441  C CB  . ALA A 46  ? 0.4801 0.1842 0.3952 -0.0011 -0.1301 -0.0459 47  ALA A CB  
447  N N   . SER A 47  ? 0.4037 0.1921 0.3761 -0.0578 -0.1067 -0.0284 48  SER A N   
448  C CA  . SER A 47  ? 0.3716 0.1977 0.3697 -0.0415 -0.0689 -0.0513 48  SER A CA  
449  C C   . SER A 47  ? 0.3447 0.2176 0.4197 -0.0593 -0.0500 -0.0225 48  SER A C   
450  O O   . SER A 47  ? 0.3401 0.2303 0.4177 -0.0369 -0.0517 -0.0268 48  SER A O   
451  C CB  . SER A 47  ? 0.4122 0.2151 0.3659 -0.0405 -0.0546 -0.0601 48  SER A CB  
452  O OG  . SER A 47  ? 0.4213 0.2934 0.3598 -0.0551 -0.0572 -0.0605 48  SER A OG  
458  N N   . ASN A 48  ? 0.3700 0.2311 0.4645 -0.0422 -0.0159 -0.0349 49  ASN A N   
459  C CA  . ASN A 48  ? 0.4004 0.2058 0.4907 -0.0368 -0.0096 -0.0774 49  ASN A CA  
460  C C   . ASN A 48  ? 0.4215 0.2297 0.4989 -0.0379 -0.0032 -0.1159 49  ASN A C   
461  O O   . ASN A 48  ? 0.4152 0.2519 0.5287 -0.0442 0.0002  -0.1179 49  ASN A O   
462  C CB  . ASN A 48  ? 0.4502 0.2122 0.4941 -0.0369 -0.0059 -0.0602 49  ASN A CB  
463  C CG  . ASN A 48  ? 0.4454 0.2307 0.4937 -0.0513 -0.0113 -0.0228 49  ASN A CG  
464  O OD1 . ASN A 48  ? 0.4390 0.2261 0.5117 -0.0656 -0.0134 -0.0158 49  ASN A OD1 
465  N ND2 . ASN A 48  ? 0.4632 0.3246 0.5003 -0.0611 -0.0099 0.0227  49  ASN A ND2 
472  N N   . GLY A 49  ? 0.4365 0.2629 0.4912 -0.0889 -0.0030 -0.1228 50  GLY A N   
473  C CA  . GLY A 49  ? 0.4313 0.2809 0.4812 -0.0892 0.0003  -0.1454 50  GLY A CA  
474  C C   . GLY A 49  ? 0.4040 0.2836 0.4873 -0.0867 0.0035  -0.1452 50  GLY A C   
475  O O   . GLY A 49  ? 0.3766 0.2982 0.4851 -0.0832 0.0261  -0.1346 50  GLY A O   
479  N N   . TRP A 50  ? 0.3931 0.2832 0.4802 -0.0791 0.0190  -0.1697 51  TRP A N   
480  C CA  . TRP A 50  ? 0.3896 0.2694 0.4924 -0.0849 0.0417  -0.1657 51  TRP A CA  
481  C C   . TRP A 50  ? 0.3719 0.2635 0.4601 -0.1081 0.0276  -0.1375 51  TRP A C   
482  O O   . TRP A 50  ? 0.3701 0.3142 0.5015 -0.1527 0.0499  -0.1105 51  TRP A O   
483  C CB  . TRP A 50  ? 0.4021 0.3059 0.5292 -0.0771 0.0719  -0.2063 51  TRP A CB  
484  C CG  . TRP A 50  ? 0.4266 0.3357 0.5234 -0.0968 0.0906  -0.2048 51  TRP A CG  
485  C CD1 . TRP A 50  ? 0.4675 0.3838 0.5287 -0.1135 0.0952  -0.1899 51  TRP A CD1 
486  C CD2 . TRP A 50  ? 0.4466 0.4099 0.5413 -0.0930 0.0804  -0.1815 51  TRP A CD2 
487  N NE1 . TRP A 50  ? 0.5162 0.4569 0.5946 -0.1022 0.0810  -0.1748 51  TRP A NE1 
488  C CE2 . TRP A 50  ? 0.4619 0.4247 0.5658 -0.1034 0.0718  -0.1795 51  TRP A CE2 
489  C CE3 . TRP A 50  ? 0.4476 0.4213 0.5400 -0.0607 0.0960  -0.1748 51  TRP A CE3 
490  C CZ2 . TRP A 50  ? 0.5197 0.4663 0.5928 -0.1138 0.0662  -0.1654 51  TRP A CZ2 
491  C CZ3 . TRP A 50  ? 0.4910 0.4713 0.5973 -0.0925 0.0899  -0.1589 51  TRP A CZ3 
492  C CH2 . TRP A 50  ? 0.4996 0.4685 0.6019 -0.1087 0.0739  -0.1560 51  TRP A CH2 
503  N N   . ARG A 51  ? 0.3684 0.2815 0.4402 -0.0987 0.0171  -0.1419 52  ARG A N   
504  C CA  . ARG A 51  ? 0.3459 0.2696 0.4045 -0.0790 0.0258  -0.1461 52  ARG A CA  
505  C C   . ARG A 51  ? 0.3742 0.2899 0.4252 -0.0756 0.0608  -0.1432 52  ARG A C   
506  O O   . ARG A 51  ? 0.3682 0.2588 0.4071 -0.0874 0.0573  -0.1023 52  ARG A O   
507  C CB  . ARG A 51  ? 0.4089 0.3175 0.4385 -0.0923 0.0011  -0.1377 52  ARG A CB  
508  C CG  . ARG A 51  ? 0.4337 0.3683 0.4583 -0.1259 -0.0029 -0.1448 52  ARG A CG  
509  C CD  . ARG A 51  ? 0.5043 0.4321 0.5108 -0.1392 -0.0026 -0.1205 52  ARG A CD  
510  N NE  . ARG A 51  ? 0.5379 0.4837 0.5746 -0.1557 -0.0047 -0.0902 52  ARG A NE  
511  C CZ  . ARG A 51  ? 0.5498 0.5124 0.5692 -0.1475 0.0424  -0.0906 52  ARG A CZ  
512  N NH1 . ARG A 51  ? 0.6350 0.6291 0.6351 -0.0879 0.0507  -0.1015 52  ARG A NH1 
513  N NH2 . ARG A 51  ? 0.4823 0.4826 0.5186 -0.1258 0.0929  -0.0795 52  ARG A NH2 
527  N N   . TYR A 52  ? 0.3760 0.2978 0.4213 -0.1157 0.0730  -0.1421 53  TYR A N   
528  C CA  . TYR A 52  ? 0.4244 0.2950 0.4556 -0.0848 0.0794  -0.1132 53  TYR A CA  
529  C C   . TYR A 52  ? 0.4646 0.2889 0.5225 -0.0753 0.0975  -0.0936 53  TYR A C   
530  O O   . TYR A 52  ? 0.4160 0.2519 0.4906 -0.0678 0.1169  -0.0976 53  TYR A O   
531  C CB  . TYR A 52  ? 0.4077 0.2993 0.4446 -0.1082 0.0687  -0.0748 53  TYR A CB  
532  C CG  . TYR A 52  ? 0.4415 0.2533 0.4495 -0.1092 0.0518  -0.0536 53  TYR A CG  
533  C CD1 . TYR A 52  ? 0.5399 0.3208 0.5094 -0.1126 0.0670  -0.0247 53  TYR A CD1 
534  C CD2 . TYR A 52  ? 0.4464 0.2610 0.4618 -0.0659 0.0533  -0.0172 53  TYR A CD2 
535  C CE1 . TYR A 52  ? 0.5550 0.3231 0.5089 -0.1067 0.0721  -0.0227 53  TYR A CE1 
536  C CE2 . TYR A 52  ? 0.4906 0.2393 0.4536 -0.0778 0.0702  -0.0140 53  TYR A CE2 
537  C CZ  . TYR A 52  ? 0.5583 0.3263 0.5147 -0.0871 0.0643  -0.0142 53  TYR A CZ  
538  O OH  . TYR A 52  ? 0.6418 0.4249 0.6137 -0.0721 0.0471  0.0010  53  TYR A OH  
548  N N   . SER A 53  ? 0.4204 0.2507 0.5363 -0.1074 0.0944  -0.0767 54  SER A N   
549  C CA  . SER A 53  ? 0.4414 0.2735 0.5576 -0.1539 0.1093  -0.0663 54  SER A CA  
550  C C   . SER A 53  ? 0.4535 0.3327 0.6053 -0.1651 0.1177  -0.0480 54  SER A C   
551  O O   . SER A 53  ? 0.5248 0.3820 0.6657 -0.1839 0.1285  -0.0143 54  SER A O   
552  C CB  . SER A 53  ? 0.4835 0.2698 0.6055 -0.1551 0.0989  -0.0854 54  SER A CB  
553  O OG  . SER A 53  ? 0.5981 0.3562 0.7438 -0.1570 0.0931  -0.0960 54  SER A OG  
559  N N   . PHE A 54  ? 0.3850 0.3123 0.5777 -0.1585 0.1073  -0.0887 55  PHE A N   
560  C CA  . PHE A 54  ? 0.4153 0.3571 0.6080 -0.1358 0.1100  -0.0884 55  PHE A CA  
561  C C   . PHE A 54  ? 0.4096 0.3420 0.5725 -0.1322 0.1049  -0.0607 55  PHE A C   
562  O O   . PHE A 54  ? 0.4013 0.3876 0.5751 -0.1467 0.0683  -0.0427 55  PHE A O   
563  C CB  . PHE A 54  ? 0.4377 0.3966 0.6673 -0.1355 0.1035  -0.1239 55  PHE A CB  
564  C CG  . PHE A 54  ? 0.4734 0.4310 0.6708 -0.1483 0.0764  -0.1576 55  PHE A CG  
565  C CD1 . PHE A 54  ? 0.4851 0.4412 0.6705 -0.1325 0.0619  -0.1670 55  PHE A CD1 
566  C CD2 . PHE A 54  ? 0.4939 0.4562 0.6891 -0.1594 0.0615  -0.1573 55  PHE A CD2 
567  C CE1 . PHE A 54  ? 0.5481 0.5145 0.7566 -0.1356 0.0586  -0.1594 55  PHE A CE1 
568  C CE2 . PHE A 54  ? 0.4799 0.4230 0.6646 -0.2044 0.0580  -0.1557 55  PHE A CE2 
569  C CZ  . PHE A 54  ? 0.5337 0.4946 0.7302 -0.1880 0.0559  -0.1562 55  PHE A CZ  
579  N N   . ILE A 55  ? 0.3866 0.2722 0.5157 -0.0988 0.1376  -0.0546 56  ILE A N   
580  C CA  . ILE A 55  ? 0.3945 0.2486 0.4798 -0.1015 0.1502  -0.0555 56  ILE A CA  
581  C C   . ILE A 55  ? 0.4150 0.2889 0.4977 -0.1073 0.1515  -0.0527 56  ILE A C   
582  O O   . ILE A 55  ? 0.4393 0.3048 0.5134 -0.1029 0.1437  -0.0739 56  ILE A O   
583  C CB  . ILE A 55  ? 0.4279 0.2577 0.4883 -0.0917 0.1056  -0.0728 56  ILE A CB  
584  C CG1 . ILE A 55  ? 0.4750 0.3525 0.5821 -0.1160 0.0649  -0.0602 56  ILE A CG1 
585  C CG2 . ILE A 55  ? 0.4560 0.3616 0.5215 -0.0334 0.0690  -0.0580 56  ILE A CG2 
586  C CD1 . ILE A 55  ? 0.5201 0.4215 0.6599 -0.1209 0.0395  -0.0533 56  ILE A CD1 
598  N N   . THR A 56  ? 0.4157 0.3445 0.5200 -0.1073 0.1692  -0.0581 57  THR A N   
599  C CA  . THR A 56  ? 0.3799 0.3598 0.5188 -0.1458 0.1750  -0.0483 57  THR A CA  
600  C C   . THR A 56  ? 0.3916 0.3674 0.4979 -0.1543 0.1866  -0.0210 57  THR A C   
601  O O   . THR A 56  ? 0.4532 0.3667 0.5243 -0.1568 0.1958  -0.0214 57  THR A O   
602  C CB  . THR A 56  ? 0.3530 0.4085 0.5452 -0.1341 0.1437  -0.0660 57  THR A CB  
603  O OG1 . THR A 56  ? 0.3295 0.3696 0.5372 -0.1412 0.1439  -0.0743 57  THR A OG1 
604  C CG2 . THR A 56  ? 0.3931 0.4687 0.5740 -0.1126 0.1399  -0.0665 57  THR A CG2 
612  N N   . ALA A 57  ? 0.4500 0.3881 0.4998 -0.1657 0.1988  0.0032  58  ALA A N   
613  C CA  . ALA A 57  ? 0.4748 0.4214 0.5103 -0.1602 0.2075  0.0253  58  ALA A CA  
614  C C   . ALA A 57  ? 0.4531 0.4178 0.5085 -0.1503 0.2068  0.0200  58  ALA A C   
615  O O   . ALA A 57  ? 0.4747 0.4298 0.4975 -0.1612 0.1992  0.0200  58  ALA A O   
616  C CB  . ALA A 57  ? 0.4852 0.4340 0.5378 -0.1726 0.1936  0.0307  58  ALA A CB  
622  N N   . ASN A 58  ? 0.4088 0.4301 0.5242 -0.1513 0.1887  0.0038  59  ASN A N   
623  C CA  . ASN A 58  ? 0.4159 0.4465 0.5322 -0.1540 0.1839  -0.0312 59  ASN A CA  
624  C C   . ASN A 58  ? 0.3218 0.3849 0.4567 -0.1307 0.1517  -0.0281 59  ASN A C   
625  O O   . ASN A 58  ? 0.3095 0.3736 0.4272 -0.1381 0.1247  -0.0242 59  ASN A O   
626  C CB  . ASN A 58  ? 0.4536 0.5395 0.5888 -0.1534 0.1751  -0.0124 59  ASN A CB  
627  C CG  . ASN A 58  ? 0.5378 0.6244 0.6523 -0.1458 0.1761  0.0170  59  ASN A CG  
628  O OD1 . ASN A 58  ? 0.5557 0.6515 0.6652 -0.1400 0.1851  0.0187  59  ASN A OD1 
629  N ND2 . ASN A 58  ? 0.5938 0.6494 0.7032 -0.1281 0.1625  0.0236  59  ASN A ND2 
636  N N   . GLU A 59  ? 0.2961 0.3680 0.4552 -0.1142 0.1425  -0.0390 60  GLU A N   
637  C CA  . GLU A 59  ? 0.3004 0.3092 0.4396 -0.1069 0.1379  -0.0398 60  GLU A CA  
638  C C   . GLU A 59  ? 0.3092 0.2683 0.4380 -0.0886 0.1348  -0.0259 60  GLU A C   
639  O O   . GLU A 59  ? 0.2921 0.2462 0.4193 -0.0691 0.1303  -0.0103 60  GLU A O   
640  C CB  . GLU A 59  ? 0.3514 0.3599 0.4554 -0.0698 0.1446  -0.0563 60  GLU A CB  
641  C CG  . GLU A 59  ? 0.3034 0.3061 0.3915 -0.1129 0.1296  -0.0719 60  GLU A CG  
642  C CD  . GLU A 59  ? 0.3898 0.3666 0.4580 -0.0976 0.0852  -0.0555 60  GLU A CD  
643  O OE1 . GLU A 59  ? 0.3346 0.3612 0.4756 -0.0690 0.0963  -0.0460 60  GLU A OE1 
644  O OE2 . GLU A 59  ? 0.4579 0.3789 0.4685 -0.0907 0.0372  -0.0382 60  GLU A OE2 
651  N N   . LYS A 60  ? 0.3388 0.2769 0.4402 -0.1151 0.1440  -0.0057 61  LYS A N   
652  C CA  . LYS A 60  ? 0.3854 0.2536 0.4591 -0.0974 0.1302  0.0518  61  LYS A CA  
653  C C   . LYS A 60  ? 0.4259 0.3185 0.4963 -0.0755 0.1554  0.0593  61  LYS A C   
654  O O   . LYS A 60  ? 0.4050 0.2650 0.4715 -0.0524 0.1492  0.0669  61  LYS A O   
655  C CB  . LYS A 60  ? 0.4941 0.3031 0.5267 -0.1204 0.0982  0.0924  61  LYS A CB  
656  C CG  . LYS A 60  ? 0.6606 0.4192 0.6409 -0.1020 0.1213  0.1194  61  LYS A CG  
657  C CD  . LYS A 60  ? 0.8563 0.6157 0.7842 -0.0686 0.1198  0.1147  61  LYS A CD  
658  C CE  . LYS A 60  ? 0.9996 0.7318 0.8986 -0.0663 0.1075  0.1114  61  LYS A CE  
659  N NZ  . LYS A 60  ? 1.0889 0.7821 0.9805 -0.0623 0.1020  0.1143  61  LYS A NZ  
673  N N   . GLU A 61  ? 0.4261 0.2744 0.4663 -0.0521 0.1663  0.0553  62  GLU A N   
674  C CA  . GLU A 61  ? 0.3871 0.3131 0.4182 -0.0834 0.1662  0.0483  62  GLU A CA  
675  C C   . GLU A 61  ? 0.3269 0.3423 0.3799 -0.0404 0.1217  0.0384  62  GLU A C   
676  O O   . GLU A 61  ? 0.3387 0.3274 0.3764 -0.0364 0.1263  0.0640  62  GLU A O   
677  C CB  . GLU A 61  ? 0.4541 0.4363 0.4777 -0.0995 0.1623  0.0381  62  GLU A CB  
678  C CG  . GLU A 61  ? 0.5780 0.5612 0.5524 -0.0963 0.1709  0.0523  62  GLU A CG  
679  C CD  . GLU A 61  ? 0.7061 0.6723 0.6425 -0.1046 0.1913  0.0636  62  GLU A CD  
680  O OE1 . GLU A 61  ? 0.7070 0.6917 0.6380 -0.1062 0.2007  0.0670  62  GLU A OE1 
681  O OE2 . GLU A 61  ? 0.7762 0.7117 0.6967 -0.0996 0.1952  0.0579  62  GLU A OE2 
688  N N   . ALA A 62  ? 0.2705 0.3178 0.3294 -0.0271 0.0840  0.0279  63  ALA A N   
689  C CA  . ALA A 62  ? 0.2233 0.2846 0.3135 -0.0258 0.0553  0.0334  63  ALA A CA  
690  C C   . ALA A 62  ? 0.2590 0.2600 0.3304 0.0134  0.0465  0.0398  63  ALA A C   
691  O O   . ALA A 62  ? 0.2395 0.2538 0.3106 -0.0157 0.0369  0.0763  63  ALA A O   
692  C CB  . ALA A 62  ? 0.2632 0.3054 0.3528 -0.0319 0.0497  0.0052  63  ALA A CB  
698  N N   . VAL A 63  ? 0.2251 0.2404 0.3123 -0.0077 0.0664  0.0298  64  VAL A N   
699  C CA  . VAL A 63  ? 0.2284 0.2489 0.3189 -0.0084 0.0516  0.0353  64  VAL A CA  
700  C C   . VAL A 63  ? 0.2434 0.3079 0.3002 0.0064  0.1048  0.0587  64  VAL A C   
701  O O   . VAL A 63  ? 0.2800 0.3678 0.2946 0.0470  0.0924  0.0721  64  VAL A O   
702  C CB  . VAL A 63  ? 0.2406 0.2891 0.3314 -0.0526 0.0613  -0.0129 64  VAL A CB  
703  C CG1 . VAL A 63  ? 0.2534 0.3039 0.3495 -0.0561 0.0699  -0.0131 64  VAL A CG1 
704  C CG2 . VAL A 63  ? 0.2440 0.2997 0.3186 -0.0255 0.0474  -0.0112 64  VAL A CG2 
714  N N   . GLU A 64  ? 0.3244 0.3085 0.3282 -0.0279 0.1172  0.0478  65  GLU A N   
715  C CA  . GLU A 64  ? 0.4005 0.3261 0.3463 -0.0111 0.1093  0.0710  65  GLU A CA  
716  C C   . GLU A 64  ? 0.4394 0.3725 0.3676 -0.0141 0.0640  0.0662  65  GLU A C   
717  O O   . GLU A 64  ? 0.4342 0.3822 0.3627 0.0410  0.0411  0.0458  65  GLU A O   
718  C CB  . GLU A 64  ? 0.5547 0.3932 0.4065 -0.0030 0.0871  0.1134  65  GLU A CB  
719  C CG  . GLU A 64  ? 0.6379 0.4551 0.4403 -0.0068 0.0713  0.1362  65  GLU A CG  
720  C CD  . GLU A 64  ? 0.7347 0.5371 0.5461 -0.0196 0.0868  0.1453  65  GLU A CD  
721  O OE1 . GLU A 64  ? 0.7662 0.5634 0.6065 -0.0412 0.0905  0.1577  65  GLU A OE1 
722  O OE2 . GLU A 64  ? 0.7466 0.5335 0.5752 -0.0389 0.0951  0.1437  65  GLU A OE2 
729  N N   . ASP A 65  ? 0.3137 0.2743 0.2860 -0.0189 0.0667  0.0734  66  ASP A N   
730  C CA  . ASP A 65  ? 0.3109 0.2856 0.2600 -0.0025 0.0601  0.0710  66  ASP A CA  
731  C C   . ASP A 65  ? 0.2927 0.2652 0.2254 0.0300  0.0539  0.0459  66  ASP A C   
732  O O   . ASP A 65  ? 0.2926 0.2647 0.2150 0.0324  0.0581  0.0382  66  ASP A O   
733  C CB  . ASP A 65  ? 0.3340 0.3775 0.2862 -0.0399 0.0741  0.0688  66  ASP A CB  
734  C CG  . ASP A 65  ? 0.6590 0.6400 0.5322 -0.0412 0.0965  0.0710  66  ASP A CG  
735  O OD1 . ASP A 65  ? 0.7557 0.7115 0.6000 -0.0450 0.1156  0.0689  66  ASP A OD1 
736  O OD2 . ASP A 65  ? 0.6852 0.6635 0.5663 -0.0476 0.0948  0.0761  66  ASP A OD2 
741  N N   . PHE A 66  ? 0.3536 0.2354 0.2202 -0.0437 0.0668  0.0667  67  PHE A N   
742  C CA  . PHE A 66  ? 0.3382 0.2148 0.1627 -0.0412 0.0335  0.0407  67  PHE A CA  
743  C C   . PHE A 66  ? 0.2710 0.2962 0.2209 -0.0052 0.0335  0.0611  67  PHE A C   
744  O O   . PHE A 66  ? 0.2227 0.3053 0.1713 0.0054  0.0125  0.0110  67  PHE A O   
745  C CB  . PHE A 66  ? 0.3943 0.2830 0.1701 -0.0228 0.0337  0.0473  67  PHE A CB  
746  C CG  . PHE A 66  ? 0.3800 0.2853 0.1700 -0.0747 0.0260  0.0275  67  PHE A CG  
747  C CD1 . PHE A 66  ? 0.4082 0.3601 0.2205 -0.0801 -0.0029 0.0557  67  PHE A CD1 
748  C CD2 . PHE A 66  ? 0.4229 0.2952 0.1803 -0.0557 0.0431  -0.0017 67  PHE A CD2 
749  C CE1 . PHE A 66  ? 0.4047 0.3613 0.1945 -0.0658 0.0119  0.0534  67  PHE A CE1 
750  C CE2 . PHE A 66  ? 0.3958 0.2800 0.1895 -0.0552 0.0641  0.0033  67  PHE A CE2 
751  C CZ  . PHE A 66  ? 0.3924 0.2992 0.1665 -0.0660 0.0367  0.0211  67  PHE A CZ  
761  N N   . SER A 67  ? 0.3363 0.3170 0.2833 0.0715  0.0421  0.0822  68  SER A N   
762  C CA  . SER A 67  ? 0.3756 0.3962 0.3697 0.1058  0.0084  0.0934  68  SER A CA  
763  C C   . SER A 67  ? 0.5107 0.5394 0.4742 0.1119  -0.0391 0.1053  68  SER A C   
764  O O   . SER A 67  ? 0.5076 0.5668 0.4933 0.1247  -0.0593 0.0838  68  SER A O   
765  C CB  . SER A 67  ? 0.4712 0.4831 0.4490 0.0929  0.0311  0.0793  68  SER A CB  
766  O OG  . SER A 67  ? 0.4487 0.4922 0.4102 0.0912  0.0766  0.0548  68  SER A OG  
772  N N   . ILE A 68  ? 0.4926 0.5292 0.4035 0.0912  -0.0193 0.1293  69  ILE A N   
773  C CA  . ILE A 68  ? 0.6051 0.6148 0.3953 0.0132  0.0064  0.0914  69  ILE A CA  
774  C C   . ILE A 68  ? 0.6577 0.6531 0.4264 -0.0163 0.0186  0.0642  69  ILE A C   
775  O O   . ILE A 68  ? 0.7920 0.8063 0.5837 -0.0535 0.0378  0.0339  69  ILE A O   
776  C CB  . ILE A 68  ? 0.6674 0.6407 0.3958 0.0103  0.0280  0.0792  69  ILE A CB  
777  C CG1 . ILE A 68  ? 0.7848 0.7191 0.4904 0.0031  0.0417  0.0853  69  ILE A CG1 
778  C CG2 . ILE A 68  ? 0.6866 0.6601 0.4293 0.0320  0.0193  0.0583  69  ILE A CG2 
779  C CD1 . ILE A 68  ? 0.7946 0.6942 0.5121 0.0135  0.0345  0.0984  69  ILE A CD1 
791  N N   . SER A 69  ? 0.5309 0.5198 0.2786 0.0278  0.0009  0.0812  70  SER A N   
792  C CA  . SER A 69  ? 0.5331 0.5117 0.3110 0.0215  0.0415  0.0830  70  SER A CA  
793  C C   . SER A 69  ? 0.4812 0.4124 0.2843 0.0252  0.0829  0.0422  70  SER A C   
794  O O   . SER A 69  ? 0.5460 0.4146 0.2734 0.0128  0.1358  0.0372  70  SER A O   
795  C CB  . SER A 69  ? 0.5842 0.6207 0.3945 -0.0313 0.0702  0.1098  70  SER A CB  
796  O OG  . SER A 69  ? 0.5720 0.6229 0.3868 -0.0536 0.1229  0.1130  70  SER A OG  
802  N N   . GLY A 70  ? 0.2868 0.3064 0.2575 0.0070  0.0523  0.0344  71  GLY A N   
803  C CA  . GLY A 70  ? 0.2790 0.3204 0.2857 -0.0052 0.0242  0.0561  71  GLY A CA  
804  C C   . GLY A 70  ? 0.2459 0.3338 0.2613 0.0832  -0.0065 0.0799  71  GLY A C   
805  O O   . GLY A 70  ? 0.2115 0.3640 0.2564 0.0075  -0.0023 0.0708  71  GLY A O   
809  N N   . TYR A 71  ? 0.2438 0.2948 0.2145 0.0773  0.0048  0.0605  72  TYR A N   
810  C CA  . TYR A 71  ? 0.1852 0.2807 0.1923 0.0473  0.0274  0.0560  72  TYR A CA  
811  C C   . TYR A 71  ? 0.2040 0.3026 0.2066 0.0164  0.0314  0.0487  72  TYR A C   
812  O O   . TYR A 71  ? 0.1594 0.2880 0.1987 0.0128  0.0353  0.0545  72  TYR A O   
813  C CB  . TYR A 71  ? 0.2066 0.2880 0.1907 0.0366  0.0179  0.0250  72  TYR A CB  
814  C CG  . TYR A 71  ? 0.2175 0.3325 0.2507 0.0377  -0.0059 -0.0087 72  TYR A CG  
815  C CD1 . TYR A 71  ? 0.2459 0.3342 0.2847 0.0287  -0.0052 -0.0303 72  TYR A CD1 
816  C CD2 . TYR A 71  ? 0.2191 0.3314 0.2606 0.0309  -0.0471 -0.0366 72  TYR A CD2 
817  C CE1 . TYR A 71  ? 0.2748 0.3800 0.3243 -0.0006 -0.0203 -0.0568 72  TYR A CE1 
818  C CE2 . TYR A 71  ? 0.2579 0.3865 0.2890 0.0020  -0.0551 -0.0409 72  TYR A CE2 
819  C CZ  . TYR A 71  ? 0.2686 0.3859 0.3143 -0.0092 -0.0596 -0.0521 72  TYR A CZ  
820  O OH  . TYR A 71  ? 0.3145 0.4024 0.3430 0.0134  -0.0685 -0.0585 72  TYR A OH  
830  N N   . GLN A 72  ? 0.2274 0.2730 0.1913 0.0049  0.0199  0.0292  73  GLN A N   
831  C CA  . GLN A 72  ? 0.2114 0.3093 0.2137 0.0002  0.0051  0.0239  73  GLN A CA  
832  C C   . GLN A 72  ? 0.1962 0.3342 0.2089 0.0058  0.0051  0.0235  73  GLN A C   
833  O O   . GLN A 72  ? 0.2159 0.2856 0.2003 0.0080  0.0367  0.0145  73  GLN A O   
834  C CB  . GLN A 72  ? 0.2475 0.3612 0.2173 0.0795  -0.0189 0.0327  73  GLN A CB  
835  C CG  . GLN A 72  ? 0.3384 0.4207 0.2678 0.0874  -0.0304 0.0252  73  GLN A CG  
836  C CD  . GLN A 72  ? 0.4409 0.4868 0.3111 0.0488  -0.0292 -0.0015 73  GLN A CD  
837  O OE1 . GLN A 72  ? 0.4575 0.4998 0.3530 0.1063  -0.0068 -0.0064 73  GLN A OE1 
838  N NE2 . GLN A 72  ? 0.5465 0.5256 0.3140 0.0018  -0.0289 0.0149  73  GLN A NE2 
847  N N   . THR A 73  ? 0.1973 0.3239 0.1786 0.0307  0.0185  0.0388  74  THR A N   
848  C CA  . THR A 73  ? 0.1860 0.3342 0.1758 0.0208  0.0393  0.0305  74  THR A CA  
849  C C   . THR A 73  ? 0.1678 0.2727 0.1794 0.0534  0.0310  0.0387  74  THR A C   
850  O O   . THR A 73  ? 0.1644 0.2971 0.1916 0.0311  0.0325  0.0324  74  THR A O   
851  C CB  . THR A 73  ? 0.2241 0.3852 0.1772 -0.0318 0.0402  0.0533  74  THR A CB  
852  O OG1 . THR A 73  ? 0.2396 0.4114 0.1980 -0.0465 0.0499  0.0508  74  THR A OG1 
853  C CG2 . THR A 73  ? 0.2463 0.4267 0.1970 -0.0435 0.0210  0.0663  74  THR A CG2 
861  N N   . ALA A 74  ? 0.1568 0.2659 0.1696 0.0120  0.0273  0.0615  75  ALA A N   
862  C CA  . ALA A 74  ? 0.1865 0.2477 0.1548 -0.0474 0.0108  0.0011  75  ALA A CA  
863  C C   . ALA A 74  ? 0.1381 0.2138 0.1570 -0.0146 0.0124  -0.0137 75  ALA A C   
864  O O   . ALA A 74  ? 0.1465 0.2208 0.1532 0.0083  0.0082  0.0056  75  ALA A O   
865  C CB  . ALA A 74  ? 0.2219 0.2443 0.1681 -0.0616 -0.0040 0.0115  75  ALA A CB  
871  N N   . ASN A 75  ? 0.1444 0.2093 0.1371 -0.0004 0.0286  0.0047  76  ASN A N   
872  C CA  . ASN A 75  ? 0.1496 0.2094 0.1627 -0.0032 0.0263  -0.0077 76  ASN A CA  
873  C C   . ASN A 75  ? 0.1622 0.2075 0.1621 0.0026  0.0175  -0.0194 76  ASN A C   
874  O O   . ASN A 75  ? 0.1848 0.2165 0.1757 0.0105  0.0256  0.0099  76  ASN A O   
875  C CB  . ASN A 75  ? 0.1430 0.2459 0.1543 -0.0013 0.0019  0.0206  76  ASN A CB  
876  C CG  . ASN A 75  ? 0.1285 0.2441 0.1775 0.0289  0.0148  0.0177  76  ASN A CG  
877  O OD1 . ASN A 75  ? 0.1518 0.2510 0.1518 0.0103  0.0304  0.0076  76  ASN A OD1 
878  N ND2 . ASN A 75  ? 0.1811 0.2918 0.1980 0.0383  0.0294  0.0285  76  ASN A ND2 
885  N N   . ASP A 76  ? 0.1617 0.2270 0.1602 0.0239  0.0275  -0.0215 77  ASP A N   
886  C CA  . ASP A 76  ? 0.1762 0.2405 0.1549 -0.0032 0.0227  -0.0213 77  ASP A CA  
887  C C   . ASP A 76  ? 0.1680 0.2084 0.1748 0.0128  0.0057  -0.0446 77  ASP A C   
888  O O   . ASP A 76  ? 0.2193 0.2106 0.2096 0.0160  0.0157  -0.0214 77  ASP A O   
889  C CB  . ASP A 76  ? 0.1874 0.2655 0.1428 0.0024  0.0122  -0.0173 77  ASP A CB  
890  C CG  . ASP A 76  ? 0.2476 0.3315 0.1798 -0.0406 0.0306  -0.0360 77  ASP A CG  
891  O OD1 . ASP A 76  ? 0.2418 0.4824 0.2153 -0.0387 0.0242  -0.0221 77  ASP A OD1 
892  O OD2 . ASP A 76  ? 0.2504 0.3579 0.1899 -0.0290 0.0228  -0.0204 77  ASP A OD2 
897  N N   . TYR A 77  ? 0.1648 0.2539 0.1485 -0.0028 0.0088  -0.0338 78  TYR A N   
898  C CA  . TYR A 77  ? 0.1867 0.2481 0.1683 -0.0123 -0.0046 -0.0412 78  TYR A CA  
899  C C   . TYR A 77  ? 0.1885 0.2164 0.1951 0.0359  0.0193  -0.0215 78  TYR A C   
900  O O   . TYR A 77  ? 0.2198 0.2262 0.2052 0.0333  0.0261  -0.0181 78  TYR A O   
901  C CB  . TYR A 77  ? 0.1465 0.2847 0.1787 -0.0259 0.0105  -0.0444 78  TYR A CB  
902  C CG  . TYR A 77  ? 0.1424 0.3102 0.2086 0.0067  0.0219  -0.0332 78  TYR A CG  
903  C CD1 . TYR A 77  ? 0.1650 0.3258 0.2300 -0.0008 0.0001  -0.0153 78  TYR A CD1 
904  C CD2 . TYR A 77  ? 0.1588 0.2973 0.2302 0.0549  0.0146  0.0028  78  TYR A CD2 
905  C CE1 . TYR A 77  ? 0.1813 0.3224 0.2268 -0.0048 -0.0110 0.0215  78  TYR A CE1 
906  C CE2 . TYR A 77  ? 0.1772 0.2856 0.2619 0.0259  -0.0012 0.0278  78  TYR A CE2 
907  C CZ  . TYR A 77  ? 0.1744 0.2980 0.2587 -0.0035 -0.0408 0.0414  78  TYR A CZ  
908  O OH  . TYR A 77  ? 0.2169 0.3417 0.3187 -0.0093 -0.0592 0.0345  78  TYR A OH  
918  N N   . LEU A 78  ? 0.2113 0.2012 0.1532 0.0529  0.0269  -0.0204 79  LEU A N   
919  C CA  . LEU A 78  ? 0.1911 0.2513 0.1504 0.0081  0.0251  -0.0121 79  LEU A CA  
920  C C   . LEU A 78  ? 0.1829 0.2438 0.1691 0.0366  0.0400  -0.0094 79  LEU A C   
921  O O   . LEU A 78  ? 0.2461 0.2544 0.1931 0.0377  0.0304  0.0114  79  LEU A O   
922  C CB  . LEU A 78  ? 0.1814 0.2480 0.1528 0.0447  0.0320  0.0183  79  LEU A CB  
923  C CG  . LEU A 78  ? 0.2173 0.2139 0.1569 0.0191  0.0382  0.0030  79  LEU A CG  
924  C CD1 . LEU A 78  ? 0.2316 0.1839 0.1609 -0.0174 0.0477  0.0136  79  LEU A CD1 
925  C CD2 . LEU A 78  ? 0.2665 0.2178 0.1457 0.0098  0.0250  -0.0033 79  LEU A CD2 
937  N N   . ARG A 79  ? 0.2138 0.2617 0.1914 0.0023  0.0365  -0.0006 80  ARG A N   
938  C CA  . ARG A 79  ? 0.2522 0.2651 0.2239 -0.0278 0.0563  -0.0042 80  ARG A CA  
939  C C   . ARG A 79  ? 0.2975 0.2397 0.2421 0.0096  0.0668  0.0239  80  ARG A C   
940  O O   . ARG A 79  ? 0.3442 0.2351 0.2838 0.0243  0.0744  0.0306  80  ARG A O   
941  C CB  . ARG A 79  ? 0.2294 0.2810 0.2385 -0.0577 0.0655  -0.0245 80  ARG A CB  
942  C CG  . ARG A 79  ? 0.2238 0.2880 0.2503 -0.0352 0.0786  -0.0259 80  ARG A CG  
943  C CD  . ARG A 79  ? 0.2883 0.3395 0.3234 -0.0454 0.0682  -0.0093 80  ARG A CD  
944  N NE  . ARG A 79  ? 0.2591 0.3231 0.3278 -0.0618 0.0409  -0.0118 80  ARG A NE  
945  C CZ  . ARG A 79  ? 0.1952 0.2603 0.3062 -0.0217 0.0322  -0.0280 80  ARG A CZ  
946  N NH1 . ARG A 79  ? 0.1900 0.2937 0.3323 -0.0005 0.0035  -0.0690 80  ARG A NH1 
947  N NH2 . ARG A 79  ? 0.2716 0.2799 0.2957 -0.0545 0.0263  -0.0226 80  ARG A NH2 
961  N N   . ALA A 80  ? 0.2787 0.2074 0.2271 0.0323  0.0584  -0.0114 81  ALA A N   
962  C CA  . ALA A 80  ? 0.3129 0.2371 0.2686 0.0653  0.0469  -0.0088 81  ALA A CA  
963  C C   . ALA A 80  ? 0.4020 0.3270 0.3443 0.1031  0.0270  -0.0101 81  ALA A C   
964  O O   . ALA A 80  ? 0.3947 0.3606 0.3075 0.1081  -0.0101 -0.0182 81  ALA A O   
965  C CB  . ALA A 80  ? 0.2865 0.3342 0.2487 0.0439  0.0653  -0.0404 81  ALA A CB  
971  N N   . THR A 81  ? 0.4487 0.3270 0.3796 0.1176  0.0118  0.0175  82  THR A N   
972  C CA  . THR A 81  ? 0.4503 0.3844 0.4247 0.1159  -0.0201 0.0268  82  THR A CA  
973  C C   . THR A 81  ? 0.4730 0.4511 0.5306 0.1407  -0.0425 0.0113  82  THR A C   
974  O O   . THR A 81  ? 0.5243 0.4840 0.5793 0.1213  -0.0971 0.0175  82  THR A O   
975  C CB  . THR A 81  ? 0.4976 0.4255 0.4868 0.0842  -0.0089 0.0292  82  THR A CB  
976  O OG1 . THR A 81  ? 0.5363 0.4030 0.5279 0.0711  -0.0047 0.0100  82  THR A OG1 
977  C CG2 . THR A 81  ? 0.5242 0.4442 0.5026 0.0689  -0.0094 0.0563  82  THR A CG2 
985  N N   . ASP A 82  ? 0.3774 0.3978 0.5289 0.1641  -0.0107 0.0173  83  ASP A N   
986  C CA  . ASP A 82  ? 0.4009 0.4701 0.6057 0.1332  0.0001  0.0099  83  ASP A CA  
987  C C   . ASP A 82  ? 0.3881 0.4586 0.5946 0.0586  -0.0395 0.0191  83  ASP A C   
988  O O   . ASP A 82  ? 0.4299 0.4101 0.5809 0.0405  -0.0437 0.0277  83  ASP A O   
989  C CB  . ASP A 82  ? 0.4324 0.5072 0.6652 0.1389  0.0302  -0.0177 83  ASP A CB  
990  C CG  . ASP A 82  ? 0.5468 0.6290 0.7692 0.1222  0.0047  -0.0510 83  ASP A CG  
991  O OD1 . ASP A 82  ? 0.4991 0.5850 0.7112 0.1112  -0.0437 -0.0566 83  ASP A OD1 
992  O OD2 . ASP A 82  ? 0.5808 0.7143 0.8263 0.1051  0.0150  -0.0702 83  ASP A OD2 
997  N N   . THR A 83  ? 0.3737 0.4704 0.5588 0.0578  -0.0588 0.0064  84  THR A N   
998  C CA  . THR A 83  ? 0.3574 0.4776 0.5679 0.0514  -0.0423 -0.0296 84  THR A CA  
999  C C   . THR A 83  ? 0.3572 0.4874 0.5935 0.0727  -0.0336 -0.0300 84  THR A C   
1000 O O   . THR A 83  ? 0.3161 0.4607 0.5666 0.0995  -0.0213 -0.0335 84  THR A O   
1001 C CB  . THR A 83  ? 0.3957 0.4995 0.5839 0.0504  -0.0366 -0.0711 84  THR A CB  
1002 O OG1 . THR A 83  ? 0.4937 0.5702 0.5956 0.0516  -0.0625 -0.0801 84  THR A OG1 
1003 C CG2 . THR A 83  ? 0.3158 0.4327 0.5372 0.0484  0.0125  -0.0863 84  THR A CG2 
1011 N N   . SER A 84  ? 0.3587 0.5316 0.6253 0.0838  -0.0386 -0.0374 85  SER A N   
1012 C CA  . SER A 84  ? 0.3146 0.5003 0.5802 0.1493  -0.0138 -0.0573 85  SER A CA  
1013 C C   . SER A 84  ? 0.3228 0.5108 0.5881 0.1073  -0.0051 -0.0893 85  SER A C   
1014 O O   . SER A 84  ? 0.3740 0.5647 0.6528 0.0586  0.0057  -0.0972 85  SER A O   
1015 C CB  . SER A 84  ? 0.3992 0.6023 0.6835 0.1808  0.0315  -0.0484 85  SER A CB  
1016 O OG  . SER A 84  ? 0.5088 0.7052 0.8324 0.1604  0.0386  -0.0510 85  SER A OG  
1022 N N   . THR A 85  ? 0.3436 0.5207 0.5751 0.1297  0.0119  -0.1022 86  THR A N   
1023 C CA  . THR A 85  ? 0.3084 0.4906 0.5344 0.0967  0.0536  -0.1170 86  THR A CA  
1024 C C   . THR A 85  ? 0.3539 0.5241 0.5485 0.0478  0.0851  -0.1109 86  THR A C   
1025 O O   . THR A 85  ? 0.3848 0.5303 0.5374 0.0085  0.0960  -0.1491 86  THR A O   
1026 C CB  . THR A 85  ? 0.3322 0.5168 0.5757 0.0454  0.0369  -0.1316 86  THR A CB  
1027 O OG1 . THR A 85  ? 0.3258 0.5141 0.5680 0.0086  0.0264  -0.1601 86  THR A OG1 
1028 C CG2 . THR A 85  ? 0.3526 0.5438 0.6128 0.0892  0.0303  -0.0994 86  THR A CG2 
1036 N N   . TRP A 86  ? 0.2404 0.4469 0.4309 0.0714  0.0597  -0.0851 87  TRP A N   
1037 C CA  . TRP A 86  ? 0.2088 0.4463 0.4124 0.0577  0.0461  -0.0890 87  TRP A CA  
1038 C C   . TRP A 86  ? 0.1948 0.4646 0.4564 0.0891  0.0522  -0.0569 87  TRP A C   
1039 O O   . TRP A 86  ? 0.2539 0.4480 0.4445 0.0846  0.0675  -0.0320 87  TRP A O   
1040 C CB  . TRP A 86  ? 0.2051 0.4291 0.3576 0.0211  0.0336  -0.1089 87  TRP A CB  
1041 C CG  . TRP A 86  ? 0.2025 0.3857 0.3396 0.0110  0.0328  -0.0769 87  TRP A CG  
1042 C CD1 . TRP A 86  ? 0.2363 0.4154 0.3887 -0.0182 0.0065  -0.0484 87  TRP A CD1 
1043 C CD2 . TRP A 86  ? 0.1639 0.3422 0.2784 0.0348  0.0104  -0.0957 87  TRP A CD2 
1044 N NE1 . TRP A 86  ? 0.2509 0.3932 0.3464 -0.0238 -0.0025 -0.0368 87  TRP A NE1 
1045 C CE2 . TRP A 86  ? 0.1728 0.3651 0.2731 -0.0091 0.0007  -0.0658 87  TRP A CE2 
1046 C CE3 . TRP A 86  ? 0.1976 0.3547 0.2423 0.0406  0.0141  -0.0715 87  TRP A CE3 
1047 C CZ2 . TRP A 86  ? 0.2065 0.3623 0.2293 0.0321  0.0175  -0.0816 87  TRP A CZ2 
1048 C CZ3 . TRP A 86  ? 0.1748 0.3924 0.2483 0.0317  0.0122  -0.0599 87  TRP A CZ3 
1049 C CH2 . TRP A 86  ? 0.1759 0.3746 0.2309 0.0208  0.0082  -0.0489 87  TRP A CH2 
1060 N N   . GLY A 87  ? 0.2487 0.4790 0.4660 0.0807  0.0440  -0.0557 88  GLY A N   
1061 C CA  . GLY A 87  ? 0.2210 0.4619 0.3957 0.0897  0.0342  -0.0666 88  GLY A CA  
1062 C C   . GLY A 87  ? 0.2027 0.4635 0.3234 0.0676  0.0346  -0.0556 88  GLY A C   
1063 O O   . GLY A 87  ? 0.2172 0.5327 0.3060 0.0429  0.0115  -0.0268 88  GLY A O   
1067 N N   . VAL A 88  ? 0.1943 0.4447 0.2616 0.0018  0.0183  -0.0733 89  VAL A N   
1068 C CA  . VAL A 88  ? 0.1895 0.4454 0.2253 -0.0017 0.0038  -0.0679 89  VAL A CA  
1069 C C   . VAL A 88  ? 0.2003 0.4401 0.2214 -0.0237 -0.0015 -0.0720 89  VAL A C   
1070 O O   . VAL A 88  ? 0.2593 0.4361 0.2287 0.0040  0.0247  -0.0445 89  VAL A O   
1071 C CB  . VAL A 88  ? 0.1874 0.4205 0.2248 -0.0246 -0.0020 -0.0649 89  VAL A CB  
1072 C CG1 . VAL A 88  ? 0.2410 0.4855 0.2804 -0.0255 -0.0019 -0.0659 89  VAL A CG1 
1073 C CG2 . VAL A 88  ? 0.2108 0.4906 0.2912 -0.0238 0.0210  -0.0663 89  VAL A CG2 
1083 N N   . ALA A 89  ? 0.1839 0.4586 0.2183 -0.0205 0.0297  -0.0755 90  ALA A N   
1084 C CA  . ALA A 89  ? 0.2292 0.4429 0.2116 -0.0253 0.0181  -0.0695 90  ALA A CA  
1085 C C   . ALA A 89  ? 0.2052 0.3747 0.1987 0.0053  0.0143  -0.0691 90  ALA A C   
1086 O O   . ALA A 89  ? 0.1987 0.3386 0.2172 0.0010  0.0102  -0.0643 90  ALA A O   
1087 C CB  . ALA A 89  ? 0.1951 0.4330 0.1757 0.0308  0.0220  -0.0803 90  ALA A CB  
1093 N N   . GLY A 90  ? 0.2189 0.3833 0.2132 -0.0066 0.0184  -0.0656 91  GLY A N   
1094 C CA  . GLY A 90  ? 0.2174 0.3491 0.2180 -0.0158 0.0334  -0.0821 91  GLY A CA  
1095 C C   . GLY A 90  ? 0.1550 0.3519 0.2092 -0.0172 0.0356  -0.0537 91  GLY A C   
1096 O O   . GLY A 90  ? 0.1580 0.3485 0.1986 0.0150  0.0348  -0.0259 91  GLY A O   
1100 N N   . ALA A 91  ? 0.1688 0.3470 0.2061 -0.0299 0.0312  -0.0263 92  ALA A N   
1101 C CA  . ALA A 91  ? 0.1296 0.3587 0.2140 -0.0382 0.0292  -0.0329 92  ALA A CA  
1102 C C   . ALA A 91  ? 0.1533 0.3411 0.2184 0.0071  0.0316  -0.0158 92  ALA A C   
1103 O O   . ALA A 91  ? 0.1844 0.3055 0.2164 -0.0045 0.0475  -0.0015 92  ALA A O   
1104 C CB  . ALA A 91  ? 0.1686 0.4356 0.2586 -0.0406 0.0228  -0.0503 92  ALA A CB  
1110 N N   . ASP A 92  ? 0.1581 0.3577 0.2007 0.0015  0.0332  0.0100  93  ASP A N   
1111 C CA  . ASP A 92  ? 0.2023 0.3992 0.2158 0.0121  0.0201  0.0338  93  ASP A CA  
1112 C C   . ASP A 92  ? 0.1861 0.3285 0.2014 0.0313  0.0240  0.0051  93  ASP A C   
1113 O O   . ASP A 92  ? 0.2006 0.2878 0.2338 0.0256  0.0348  0.0194  93  ASP A O   
1114 C CB  . ASP A 92  ? 0.2091 0.4956 0.2019 0.0120  0.0065  0.0624  93  ASP A CB  
1115 C CG  . ASP A 92  ? 0.3688 0.6305 0.3517 -0.0444 0.0356  0.0723  93  ASP A CG  
1116 O OD1 . ASP A 92  ? 0.3684 0.6043 0.3195 -0.0761 0.0469  0.0684  93  ASP A OD1 
1117 O OD2 . ASP A 92  ? 0.4012 0.6870 0.4177 -0.0268 0.0628  0.0989  93  ASP A OD2 
1122 N N   . ALA A 93  ? 0.1679 0.3293 0.1786 0.0195  0.0069  0.0154  94  ALA A N   
1123 C CA  . ALA A 93  ? 0.1723 0.3079 0.1757 -0.0047 0.0198  -0.0037 94  ALA A CA  
1124 C C   . ALA A 93  ? 0.1750 0.2915 0.1717 -0.0099 0.0248  0.0099  94  ALA A C   
1125 O O   . ALA A 93  ? 0.1418 0.2672 0.1991 -0.0204 0.0275  -0.0090 94  ALA A O   
1126 C CB  . ALA A 93  ? 0.2008 0.3320 0.1972 0.0086  0.0342  0.0107  94  ALA A CB  
1132 N N   . ARG A 94  ? 0.1760 0.2785 0.1824 -0.0079 0.0157  -0.0191 95  ARG A N   
1133 C CA  . ARG A 94  ? 0.1815 0.2732 0.1891 0.0228  0.0175  -0.0219 95  ARG A CA  
1134 C C   . ARG A 94  ? 0.1810 0.2664 0.1754 0.0135  0.0179  0.0001  95  ARG A C   
1135 O O   . ARG A 94  ? 0.2017 0.2868 0.2020 -0.0178 0.0272  -0.0450 95  ARG A O   
1136 C CB  . ARG A 94  ? 0.1851 0.2672 0.1834 0.0481  0.0135  -0.0155 95  ARG A CB  
1137 C CG  . ARG A 94  ? 0.1803 0.2916 0.1798 0.0049  0.0292  0.0284  95  ARG A CG  
1138 C CD  . ARG A 94  ? 0.2293 0.3135 0.2221 -0.0007 -0.0022 -0.0176 95  ARG A CD  
1139 N NE  . ARG A 94  ? 0.2013 0.3028 0.2243 0.0129  -0.0299 0.0048  95  ARG A NE  
1140 C CZ  . ARG A 94  ? 0.1611 0.3265 0.2450 -0.0187 -0.0164 0.0046  95  ARG A CZ  
1141 N NH1 . ARG A 94  ? 0.1775 0.3424 0.2933 0.0103  -0.0044 0.0092  95  ARG A NH1 
1142 N NH2 . ARG A 94  ? 0.1564 0.4191 0.2629 -0.0079 -0.0339 0.0033  95  ARG A NH2 
1156 N N   . GLN A 95  ? 0.1735 0.3142 0.1960 0.0141  0.0256  -0.0015 96  GLN A N   
1157 C CA  . GLN A 95  ? 0.1801 0.3108 0.2403 0.0155  0.0311  -0.0299 96  GLN A CA  
1158 C C   . GLN A 95  ? 0.1677 0.2700 0.2496 0.0001  0.0255  -0.0260 96  GLN A C   
1159 O O   . GLN A 95  ? 0.1795 0.2947 0.2747 -0.0164 0.0118  -0.0134 96  GLN A O   
1160 C CB  . GLN A 95  ? 0.1592 0.3553 0.3086 -0.0018 0.0496  0.0031  96  GLN A CB  
1161 C CG  . GLN A 95  ? 0.2546 0.4583 0.3873 -0.0292 0.0624  0.0343  96  GLN A CG  
1162 C CD  . GLN A 95  ? 0.4841 0.6614 0.5929 -0.0427 0.0112  0.0149  96  GLN A CD  
1163 O OE1 . GLN A 95  ? 0.4471 0.6615 0.5843 -0.0548 -0.0210 0.0273  96  GLN A OE1 
1164 N NE2 . GLN A 95  ? 0.6230 0.8185 0.7373 -0.0271 0.0018  -0.0150 96  GLN A NE2 
1173 N N   . TYR A 96  ? 0.1798 0.2458 0.2321 -0.0247 0.0077  -0.0048 97  TYR A N   
1174 C CA  . TYR A 96  ? 0.2040 0.2432 0.2293 -0.0470 0.0108  -0.0170 97  TYR A CA  
1175 C C   . TYR A 96  ? 0.1779 0.2298 0.2436 -0.0327 0.0295  -0.0077 97  TYR A C   
1176 O O   . TYR A 96  ? 0.2047 0.2419 0.2210 -0.0306 0.0295  -0.0019 97  TYR A O   
1177 C CB  . TYR A 96  ? 0.2138 0.2482 0.2206 -0.0443 0.0218  -0.0115 97  TYR A CB  
1178 C CG  . TYR A 96  ? 0.1842 0.2364 0.2521 -0.0363 0.0203  0.0337  97  TYR A CG  
1179 C CD1 . TYR A 96  ? 0.2108 0.2552 0.2628 -0.0639 -0.0215 0.0734  97  TYR A CD1 
1180 C CD2 . TYR A 96  ? 0.2082 0.2823 0.3091 -0.0507 -0.0363 0.0189  97  TYR A CD2 
1181 C CE1 . TYR A 96  ? 0.2508 0.3239 0.3302 -0.0471 -0.0339 0.0546  97  TYR A CE1 
1182 C CE2 . TYR A 96  ? 0.2267 0.3188 0.3423 -0.0431 -0.0371 0.0613  97  TYR A CE2 
1183 C CZ  . TYR A 96  ? 0.2487 0.3405 0.3533 -0.0041 -0.0360 0.0674  97  TYR A CZ  
1184 O OH  . TYR A 96  ? 0.2657 0.3679 0.3481 0.0300  -0.0371 0.0901  97  TYR A OH  
1194 N N   . ILE A 97  ? 0.1340 0.2464 0.2077 -0.0192 0.0234  0.0217  98  ILE A N   
1195 C CA  . ILE A 97  ? 0.1430 0.2560 0.2111 -0.0483 0.0186  -0.0005 98  ILE A CA  
1196 C C   . ILE A 97  ? 0.1576 0.2954 0.2341 -0.0424 0.0254  -0.0102 98  ILE A C   
1197 O O   . ILE A 97  ? 0.1736 0.2898 0.2116 -0.0342 0.0284  -0.0368 98  ILE A O   
1198 C CB  . ILE A 97  ? 0.1135 0.2312 0.1984 -0.0226 0.0051  -0.0058 98  ILE A CB  
1199 C CG1 . ILE A 97  ? 0.1393 0.2757 0.2252 -0.0056 0.0396  -0.0061 98  ILE A CG1 
1200 C CG2 . ILE A 97  ? 0.1702 0.2074 0.2361 -0.0279 0.0159  -0.0023 98  ILE A CG2 
1201 C CD1 . ILE A 97  ? 0.1441 0.3090 0.2316 -0.0170 0.0319  -0.0068 98  ILE A CD1 
1213 N N   . ARG A 98  ? 0.1873 0.2652 0.2243 -0.0517 0.0353  -0.0292 99  ARG A N   
1214 C CA  . ARG A 98  ? 0.1838 0.2937 0.2333 -0.0424 0.0154  -0.0651 99  ARG A CA  
1215 C C   . ARG A 98  ? 0.1957 0.2522 0.2686 -0.0473 0.0350  -0.0676 99  ARG A C   
1216 O O   . ARG A 98  ? 0.1908 0.2581 0.2876 -0.0341 0.0337  -0.0400 99  ARG A O   
1217 C CB  . ARG A 98  ? 0.1949 0.3901 0.2833 -0.0586 0.0307  -0.0755 99  ARG A CB  
1218 C CG  . ARG A 98  ? 0.3827 0.5917 0.4658 -0.0077 0.0469  -0.0549 99  ARG A CG  
1219 C CD  . ARG A 98  ? 0.3824 0.6422 0.4721 0.0147  0.0149  -0.0235 99  ARG A CD  
1220 N NE  . ARG A 98  ? 0.4503 0.6922 0.5315 0.0154  -0.0189 -0.0150 99  ARG A NE  
1221 C CZ  . ARG A 98  ? 0.5210 0.7295 0.5740 -0.0335 -0.0492 -0.0286 99  ARG A CZ  
1222 N NH1 . ARG A 98  ? 0.5631 0.7199 0.5806 -0.0705 -0.0478 -0.0372 99  ARG A NH1 
1223 N NH2 . ARG A 98  ? 0.4523 0.6943 0.4950 -0.0224 -0.0501 -0.0446 99  ARG A NH2 
1237 N N   . THR A 99  ? 0.2125 0.2754 0.3041 -0.0832 0.0179  -0.0502 100 THR A N   
1238 C CA  . THR A 99  ? 0.1701 0.2449 0.3045 -0.0570 0.0486  -0.0304 100 THR A CA  
1239 C C   . THR A 99  ? 0.2035 0.2620 0.3152 -0.0503 0.0551  -0.0147 100 THR A C   
1240 O O   . THR A 99  ? 0.2098 0.2222 0.3112 -0.0503 0.0570  -0.0425 100 THR A O   
1241 C CB  . THR A 99  ? 0.2022 0.2913 0.3572 -0.0245 0.0718  0.0275  100 THR A CB  
1242 O OG1 . THR A 99  ? 0.2134 0.3213 0.3842 -0.0325 0.0706  0.0343  100 THR A OG1 
1243 C CG2 . THR A 99  ? 0.2766 0.3225 0.3829 -0.0727 0.0674  0.0456  100 THR A CG2 
1251 N N   . VAL A 100 ? 0.1880 0.2500 0.3156 -0.0365 0.0608  -0.0082 101 VAL A N   
1252 C CA  . VAL A 100 ? 0.1887 0.1892 0.2801 -0.0450 0.0477  0.0096  101 VAL A CA  
1253 C C   . VAL A 100 ? 0.1669 0.1996 0.2850 -0.0369 0.0326  0.0108  101 VAL A C   
1254 O O   . VAL A 100 ? 0.1925 0.2528 0.2951 -0.0308 0.0175  -0.0084 101 VAL A O   
1255 C CB  . VAL A 100 ? 0.1879 0.1811 0.2673 -0.0442 0.0403  -0.0052 101 VAL A CB  
1256 C CG1 . VAL A 100 ? 0.1947 0.2377 0.3129 -0.0279 0.0083  0.0043  101 VAL A CG1 
1257 C CG2 . VAL A 100 ? 0.2188 0.2420 0.2747 -0.0566 0.0362  0.0112  101 VAL A CG2 
1267 N N   . LYS A 101 ? 0.1739 0.2186 0.2779 -0.0296 0.0406  -0.0267 102 LYS A N   
1268 C CA  . LYS A 101 ? 0.1549 0.2484 0.2534 -0.0463 0.0139  -0.0147 102 LYS A CA  
1269 C C   . LYS A 101 ? 0.1711 0.2718 0.2831 -0.0446 0.0429  -0.0184 102 LYS A C   
1270 O O   . LYS A 101 ? 0.1821 0.2811 0.2893 -0.0500 0.0404  -0.0364 102 LYS A O   
1271 C CB  . LYS A 101 ? 0.1827 0.2791 0.2674 -0.0546 0.0229  -0.0223 102 LYS A CB  
1272 C CG  . LYS A 101 ? 0.1683 0.2682 0.2656 -0.0417 0.0366  -0.0182 102 LYS A CG  
1273 C CD  . LYS A 101 ? 0.2360 0.3100 0.3249 -0.0340 0.0428  -0.0210 102 LYS A CD  
1274 C CE  . LYS A 101 ? 0.2666 0.3440 0.3835 -0.0471 0.0260  0.0481  102 LYS A CE  
1275 N NZ  . LYS A 101 ? 0.2924 0.3738 0.4017 -0.0370 -0.0127 0.0792  102 LYS A NZ  
1289 N N   . SER A 102 ? 0.1928 0.2649 0.2989 -0.0507 0.0222  -0.0327 103 SER A N   
1290 C CA  . SER A 102 ? 0.2309 0.2590 0.3071 -0.0818 0.0045  -0.0601 103 SER A CA  
1291 C C   . SER A 102 ? 0.2555 0.2186 0.3012 -0.0614 0.0326  -0.0773 103 SER A C   
1292 O O   . SER A 102 ? 0.2768 0.2521 0.3190 -0.0720 0.0421  -0.0764 103 SER A O   
1293 C CB  . SER A 102 ? 0.2665 0.2903 0.3621 -0.0878 -0.0272 -0.0468 103 SER A CB  
1294 O OG  . SER A 102 ? 0.3326 0.3896 0.4400 -0.1093 -0.0106 -0.0653 103 SER A OG  
1300 N N   . ALA A 103 ? 0.2311 0.2390 0.3148 -0.0647 0.0238  -0.0721 104 ALA A N   
1301 C CA  . ALA A 103 ? 0.2308 0.2377 0.3203 -0.0702 0.0642  -0.0398 104 ALA A CA  
1302 C C   . ALA A 103 ? 0.1947 0.2062 0.3219 -0.0457 0.0206  -0.0206 104 ALA A C   
1303 O O   . ALA A 103 ? 0.2246 0.2064 0.3351 -0.0204 0.0157  -0.0114 104 ALA A O   
1304 C CB  . ALA A 103 ? 0.2198 0.2621 0.3058 -0.0405 0.0395  -0.0623 104 ALA A CB  
1310 N N   . LEU A 104 ? 0.2323 0.2044 0.3247 -0.0650 0.0201  0.0045  105 LEU A N   
1311 C CA  . LEU A 104 ? 0.2340 0.1997 0.3304 -0.0643 0.0107  -0.0075 105 LEU A CA  
1312 C C   . LEU A 104 ? 0.2119 0.2107 0.3394 -0.0582 0.0181  0.0004  105 LEU A C   
1313 O O   . LEU A 104 ? 0.2068 0.2275 0.3585 -0.0427 0.0262  0.0138  105 LEU A O   
1314 C CB  . LEU A 104 ? 0.2430 0.2394 0.3798 -0.0528 0.0191  -0.0022 105 LEU A CB  
1315 C CG  . LEU A 104 ? 0.3108 0.2775 0.4334 -0.0575 -0.0282 -0.0279 105 LEU A CG  
1316 C CD1 . LEU A 104 ? 0.3296 0.2745 0.3974 -0.0718 -0.0334 -0.0357 105 LEU A CD1 
1317 C CD2 . LEU A 104 ? 0.2992 0.2165 0.4117 -0.0145 -0.0601 -0.0324 105 LEU A CD2 
1329 N N   . ASN A 105 ? 0.2351 0.2592 0.3582 -0.0468 0.0354  -0.0010 106 ASN A N   
1330 C CA  . ASN A 105 ? 0.2960 0.2939 0.3555 -0.0290 0.0061  -0.0316 106 ASN A CA  
1331 C C   . ASN A 105 ? 0.2772 0.2737 0.3142 -0.0087 0.0033  -0.0807 106 ASN A C   
1332 O O   . ASN A 105 ? 0.3789 0.3181 0.3034 0.0397  0.0238  -0.0741 106 ASN A O   
1333 C CB  . ASN A 105 ? 0.3533 0.3307 0.3466 -0.0463 -0.0204 -0.0232 106 ASN A CB  
1334 C CG  . ASN A 105 ? 0.4495 0.4549 0.4246 -0.0088 -0.0168 -0.0122 106 ASN A CG  
1335 O OD1 . ASN A 105 ? 0.5435 0.5372 0.5339 0.0120  -0.0011 0.0457  106 ASN A OD1 
1336 N ND2 . ASN A 105 ? 0.4929 0.4508 0.4173 0.0549  -0.0144 -0.0742 106 ASN A ND2 
1343 N N   . LYS A 106 ? 0.2271 0.2556 0.3128 -0.0380 -0.0067 -0.0521 107 LYS A N   
1344 C CA  . LYS A 106 ? 0.2525 0.2061 0.3130 -0.0334 -0.0069 -0.0719 107 LYS A CA  
1345 C C   . LYS A 106 ? 0.2505 0.2055 0.3584 -0.0199 -0.0219 -0.0623 107 LYS A C   
1346 O O   . LYS A 106 ? 0.2747 0.2277 0.3910 -0.0472 -0.0143 -0.0746 107 LYS A O   
1347 C CB  . LYS A 106 ? 0.2742 0.2247 0.3192 -0.0753 -0.0273 -0.0588 107 LYS A CB  
1348 C CG  . LYS A 106 ? 0.3018 0.2603 0.3520 -0.0943 0.0021  0.0019  107 LYS A CG  
1349 C CD  . LYS A 106 ? 0.2999 0.3195 0.3732 -0.1056 0.0043  -0.0064 107 LYS A CD  
1350 C CE  . LYS A 106 ? 0.2962 0.3713 0.3731 -0.1135 0.0076  -0.0273 107 LYS A CE  
1351 N NZ  . LYS A 106 ? 0.3259 0.4540 0.4136 -0.1113 0.0192  -0.0431 107 LYS A NZ  
1365 N N   . LEU A 107 ? 0.1989 0.1926 0.3338 -0.0425 -0.0027 -0.0194 108 LEU A N   
1366 C CA  . LEU A 107 ? 0.2245 0.1485 0.2947 -0.0469 0.0001  -0.0178 108 LEU A CA  
1367 C C   . LEU A 107 ? 0.2680 0.1683 0.2820 -0.0496 -0.0051 -0.0221 108 LEU A C   
1368 O O   . LEU A 107 ? 0.2189 0.1769 0.2735 -0.0223 0.0099  -0.0103 108 LEU A O   
1369 C CB  . LEU A 107 ? 0.2177 0.1549 0.2975 -0.0381 0.0054  -0.0328 108 LEU A CB  
1370 C CG  . LEU A 107 ? 0.2560 0.2064 0.3097 -0.0803 0.0193  -0.0263 108 LEU A CG  
1371 C CD1 . LEU A 107 ? 0.2767 0.2598 0.3017 -0.0584 0.0142  -0.0233 108 LEU A CD1 
1372 C CD2 . LEU A 107 ? 0.3492 0.2605 0.3385 -0.0822 0.0256  -0.0445 108 LEU A CD2 
1384 N N   . PRO A 108 ? 0.2406 0.1712 0.2572 -0.0539 0.0057  -0.0050 109 PRO A N   
1385 C CA  . PRO A 108 ? 0.2188 0.1702 0.2530 -0.0311 -0.0009 -0.0208 109 PRO A CA  
1386 C C   . PRO A 108 ? 0.1934 0.1581 0.2033 -0.0458 -0.0172 -0.0406 109 PRO A C   
1387 O O   . PRO A 108 ? 0.2348 0.1381 0.1641 -0.0337 -0.0050 -0.0323 109 PRO A O   
1388 C CB  . PRO A 108 ? 0.2573 0.1983 0.2751 -0.0270 -0.0187 -0.0295 109 PRO A CB  
1389 C CG  . PRO A 108 ? 0.2517 0.1998 0.2903 -0.0175 -0.0154 -0.0124 109 PRO A CG  
1390 C CD  . PRO A 108 ? 0.2742 0.1856 0.3028 -0.0184 0.0172  0.0211  109 PRO A CD  
1398 N N   . LYS A 109 ? 0.2348 0.2183 0.2090 0.0059  0.0009  -0.0259 110 LYS A N   
1399 C CA  . LYS A 109 ? 0.2149 0.1923 0.1759 -0.0061 0.0128  -0.0174 110 LYS A CA  
1400 C C   . LYS A 109 ? 0.1947 0.1468 0.1542 0.0031  0.0178  0.0045  110 LYS A C   
1401 O O   . LYS A 109 ? 0.2427 0.1586 0.2095 -0.0159 -0.0120 0.0043  110 LYS A O   
1402 C CB  . LYS A 109 ? 0.2170 0.2690 0.1932 0.0389  0.0113  -0.0233 110 LYS A CB  
1403 C CG  . LYS A 109 ? 0.2589 0.3474 0.2184 0.0347  0.0211  -0.0456 110 LYS A CG  
1404 C CD  . LYS A 109 ? 0.3397 0.4228 0.3024 0.0563  0.0059  -0.0500 110 LYS A CD  
1405 C CE  . LYS A 109 ? 0.4001 0.4434 0.3773 0.0608  -0.0385 -0.0427 110 LYS A CE  
1406 N NZ  . LYS A 109 ? 0.4586 0.4672 0.4436 0.1018  -0.0231 -0.0458 110 LYS A NZ  
1420 N N   . TYR A 110 ? 0.2060 0.1441 0.1577 -0.0006 0.0309  -0.0090 111 TYR A N   
1421 C CA  . TYR A 110 ? 0.2049 0.1318 0.1694 -0.0172 0.0258  -0.0239 111 TYR A CA  
1422 C C   . TYR A 110 ? 0.1816 0.1183 0.1686 0.0234  0.0227  -0.0273 111 TYR A C   
1423 O O   . TYR A 110 ? 0.1975 0.1536 0.1740 0.0148  0.0388  -0.0158 111 TYR A O   
1424 C CB  . TYR A 110 ? 0.2225 0.1326 0.1644 -0.0240 0.0195  -0.0314 111 TYR A CB  
1425 C CG  . TYR A 110 ? 0.2259 0.1300 0.1527 -0.0132 0.0051  -0.0287 111 TYR A CG  
1426 C CD1 . TYR A 110 ? 0.2551 0.1320 0.1476 -0.0026 -0.0095 -0.0142 111 TYR A CD1 
1427 C CD2 . TYR A 110 ? 0.2213 0.1364 0.1478 -0.0156 -0.0037 -0.0369 111 TYR A CD2 
1428 C CE1 . TYR A 110 ? 0.2675 0.1319 0.1611 -0.0053 -0.0221 -0.0055 111 TYR A CE1 
1429 C CE2 . TYR A 110 ? 0.2241 0.1587 0.1437 -0.0021 -0.0229 -0.0312 111 TYR A CE2 
1430 C CZ  . TYR A 110 ? 0.1937 0.1399 0.1742 0.0091  -0.0225 -0.0058 111 TYR A CZ  
1431 O OH  . TYR A 110 ? 0.2155 0.1736 0.2301 -0.0049 -0.0290 0.0231  111 TYR A OH  
1441 N N   . LYS A 111 ? 0.1792 0.1178 0.1692 0.0147  0.0131  -0.0144 112 LYS A N   
1442 C CA  . LYS A 111 ? 0.1720 0.1187 0.1548 0.0110  0.0419  -0.0259 112 LYS A CA  
1443 C C   . LYS A 111 ? 0.1818 0.1386 0.1735 0.0237  0.0289  -0.0188 112 LYS A C   
1444 O O   . LYS A 111 ? 0.2085 0.1556 0.2226 0.0116  0.0081  0.0070  112 LYS A O   
1445 C CB  . LYS A 111 ? 0.2193 0.1302 0.1747 0.0173  0.0493  -0.0096 112 LYS A CB  
1446 C CG  . LYS A 111 ? 0.2054 0.1568 0.1797 -0.0096 0.0601  -0.0494 112 LYS A CG  
1447 C CD  . LYS A 111 ? 0.2342 0.1705 0.1995 -0.0202 0.0363  -0.0640 112 LYS A CD  
1448 C CE  . LYS A 111 ? 0.2369 0.1778 0.1615 0.0044  0.0206  -0.0647 112 LYS A CE  
1449 N NZ  . LYS A 111 ? 0.2711 0.1660 0.1631 -0.0150 0.0205  -0.0475 112 LYS A NZ  
1463 N N   . GLY A 112 ? 0.2025 0.1373 0.1633 0.0153  -0.0081 0.0000  113 GLY A N   
1464 C CA  . GLY A 112 ? 0.1811 0.1370 0.1751 0.0335  -0.0124 0.0061  113 GLY A CA  
1465 C C   . GLY A 112 ? 0.1961 0.1473 0.2085 0.0323  -0.0012 -0.0136 113 GLY A C   
1466 O O   . GLY A 112 ? 0.2449 0.1568 0.2522 0.0225  -0.0326 -0.0146 113 GLY A O   
1470 N N   . THR A 113 ? 0.1966 0.1716 0.1555 -0.0146 -0.0263 -0.0151 114 THR A N   
1471 C CA  . THR A 113 ? 0.2252 0.1577 0.1641 -0.0478 -0.0012 0.0139  114 THR A CA  
1472 C C   . THR A 113 ? 0.1940 0.1619 0.1486 -0.0229 0.0244  0.0257  114 THR A C   
1473 O O   . THR A 113 ? 0.2228 0.1667 0.1514 0.0098  0.0181  0.0299  114 THR A O   
1474 C CB  . THR A 113 ? 0.2397 0.1871 0.2153 -0.0558 0.0322  -0.0038 114 THR A CB  
1475 O OG1 . THR A 113 ? 0.2530 0.2682 0.2764 -0.0538 0.0583  -0.0272 114 THR A OG1 
1476 C CG2 . THR A 113 ? 0.2449 0.2227 0.2338 -0.0592 0.0192  -0.0106 114 THR A CG2 
1484 N N   . ALA A 114 ? 0.2116 0.1612 0.1327 -0.0095 -0.0111 0.0095  115 ALA A N   
1485 C CA  . ALA A 114 ? 0.2086 0.1387 0.1448 -0.0282 -0.0253 0.0142  115 ALA A CA  
1486 C C   . ALA A 114 ? 0.1761 0.1286 0.1445 -0.0183 -0.0277 0.0201  115 ALA A C   
1487 O O   . ALA A 114 ? 0.2472 0.1428 0.1687 -0.0210 -0.0114 0.0168  115 ALA A O   
1488 C CB  . ALA A 114 ? 0.2103 0.1394 0.1717 -0.0271 -0.0246 -0.0022 115 ALA A CB  
1494 N N   . TYR A 115 ? 0.1643 0.1589 0.1185 -0.0246 -0.0196 0.0008  116 TYR A N   
1495 C CA  . TYR A 115 ? 0.1524 0.1510 0.1406 -0.0130 -0.0056 0.0012  116 TYR A CA  
1496 C C   . TYR A 115 ? 0.1297 0.1396 0.1368 -0.0354 -0.0023 -0.0110 116 TYR A C   
1497 O O   . TYR A 115 ? 0.1702 0.1351 0.1651 -0.0340 0.0048  -0.0015 116 TYR A O   
1498 C CB  . TYR A 115 ? 0.1628 0.1955 0.1476 -0.0317 -0.0097 0.0099  116 TYR A CB  
1499 C CG  . TYR A 115 ? 0.1616 0.2187 0.1409 -0.0504 -0.0048 -0.0164 116 TYR A CG  
1500 C CD1 . TYR A 115 ? 0.1547 0.2368 0.1749 -0.0417 0.0065  0.0146  116 TYR A CD1 
1501 C CD2 . TYR A 115 ? 0.1514 0.2849 0.1632 -0.0073 -0.0067 -0.0152 116 TYR A CD2 
1502 C CE1 . TYR A 115 ? 0.1709 0.3198 0.1847 -0.0181 0.0018  0.0032  116 TYR A CE1 
1503 C CE2 . TYR A 115 ? 0.1636 0.3175 0.2068 0.0163  -0.0163 -0.0536 116 TYR A CE2 
1504 C CZ  . TYR A 115 ? 0.1607 0.3177 0.1942 0.0203  0.0114  -0.0396 116 TYR A CZ  
1505 O OH  . TYR A 115 ? 0.2201 0.4003 0.2639 0.0053  0.0166  -0.0587 116 TYR A OH  
1515 N N   . ARG A 116 ? 0.1742 0.1366 0.1865 -0.0360 0.0123  -0.0228 117 ARG A N   
1516 C CA  . ARG A 116 ? 0.1818 0.1469 0.2103 -0.0297 -0.0044 -0.0378 117 ARG A CA  
1517 C C   . ARG A 116 ? 0.1743 0.1773 0.1861 0.0095  -0.0120 -0.0374 117 ARG A C   
1518 O O   . ARG A 116 ? 0.2170 0.2053 0.2015 -0.0517 0.0171  -0.0322 117 ARG A O   
1519 C CB  . ARG A 116 ? 0.2087 0.2305 0.2792 -0.0375 -0.0175 -0.0527 117 ARG A CB  
1520 C CG  . ARG A 116 ? 0.2405 0.3439 0.3353 -0.0322 -0.0589 -0.0199 117 ARG A CG  
1521 C CD  . ARG A 116 ? 0.2555 0.3770 0.3521 -0.0182 -0.0573 0.0092  117 ARG A CD  
1522 N NE  . ARG A 116 ? 0.3769 0.4691 0.3914 -0.0005 -0.0292 0.0170  117 ARG A NE  
1523 C CZ  . ARG A 116 ? 0.4477 0.4395 0.4218 0.0324  0.0096  0.0023  117 ARG A CZ  
1524 N NH1 . ARG A 116 ? 0.4145 0.3354 0.3715 -0.0292 0.0103  -0.0302 117 ARG A NH1 
1525 N NH2 . ARG A 116 ? 0.5868 0.5691 0.5688 0.0127  0.0335  -0.0073 117 ARG A NH2 
1539 N N   . GLY A 117 ? 0.2081 0.1561 0.1974 -0.0197 -0.0235 -0.0143 118 GLY A N   
1540 C CA  . GLY A 117 ? 0.2238 0.1878 0.2403 -0.0487 -0.0104 -0.0360 118 GLY A CA  
1541 C C   . GLY A 117 ? 0.2287 0.1853 0.2577 -0.0427 0.0211  -0.0401 118 GLY A C   
1542 O O   . GLY A 117 ? 0.2572 0.2057 0.3155 -0.0210 0.0704  -0.0414 118 GLY A O   
1546 N N   . THR A 118 ? 0.2425 0.1727 0.2606 -0.0238 0.0337  -0.0527 119 THR A N   
1547 C CA  . THR A 118 ? 0.2940 0.1828 0.3170 -0.0129 0.0293  -0.0400 119 THR A CA  
1548 C C   . THR A 118 ? 0.2513 0.1896 0.2989 -0.0031 0.0087  -0.0397 119 THR A C   
1549 O O   . THR A 118 ? 0.2587 0.1947 0.3676 -0.0214 0.0213  -0.0460 119 THR A O   
1550 C CB  . THR A 118 ? 0.3989 0.2732 0.3863 -0.0334 0.0323  -0.0766 119 THR A CB  
1551 O OG1 . THR A 118 ? 0.4999 0.4185 0.4700 -0.0037 0.0116  -0.0577 119 THR A OG1 
1552 C CG2 . THR A 118 ? 0.4116 0.2650 0.3621 -0.0703 0.0293  -0.0659 119 THR A CG2 
1560 N N   . TRP A 119 ? 0.2730 0.1708 0.2486 -0.0038 -0.0043 -0.0355 120 TRP A N   
1561 C CA  . TRP A 119 ? 0.2743 0.1799 0.2510 0.0121  -0.0030 -0.0442 120 TRP A CA  
1562 C C   . TRP A 119 ? 0.2563 0.2128 0.2472 -0.0111 0.0161  -0.0457 120 TRP A C   
1563 O O   . TRP A 119 ? 0.2687 0.2197 0.2712 -0.0310 0.0096  -0.0376 120 TRP A O   
1564 C CB  . TRP A 119 ? 0.3907 0.2369 0.2832 0.0735  -0.0322 -0.0353 120 TRP A CB  
1565 C CG  . TRP A 119 ? 0.4459 0.2801 0.2855 0.0310  -0.0547 -0.0097 120 TRP A CG  
1566 C CD1 . TRP A 119 ? 0.5151 0.3702 0.3563 -0.0109 -0.0673 0.0033  120 TRP A CD1 
1567 C CD2 . TRP A 119 ? 0.4408 0.2936 0.2821 0.0222  -0.0592 -0.0133 120 TRP A CD2 
1568 N NE1 . TRP A 119 ? 0.5265 0.4242 0.4119 -0.0280 -0.0706 0.0038  120 TRP A NE1 
1569 C CE2 . TRP A 119 ? 0.5107 0.4109 0.4073 -0.0184 -0.0732 0.0039  120 TRP A CE2 
1570 C CE3 . TRP A 119 ? 0.3853 0.3198 0.3101 0.0281  -0.0581 -0.0515 120 TRP A CE3 
1571 C CZ2 . TRP A 119 ? 0.5075 0.4380 0.3952 -0.0005 -0.0774 0.0079  120 TRP A CZ2 
1572 C CZ3 . TRP A 119 ? 0.4505 0.3846 0.3658 0.0469  -0.0656 -0.0559 120 TRP A CZ3 
1573 C CH2 . TRP A 119 ? 0.4780 0.3905 0.3426 0.0087  -0.0751 -0.0350 120 TRP A CH2 
1584 N N   . VAL A 120 ? 0.2607 0.1689 0.2210 -0.0144 -0.0226 -0.0615 121 VAL A N   
1585 C CA  . VAL A 120 ? 0.2527 0.1763 0.1908 -0.0141 -0.0093 -0.0527 121 VAL A CA  
1586 C C   . VAL A 120 ? 0.2514 0.1717 0.2102 0.0092  -0.0305 -0.0442 121 VAL A C   
1587 O O   . VAL A 120 ? 0.2728 0.2120 0.1957 -0.0152 -0.0357 -0.0269 121 VAL A O   
1588 C CB  . VAL A 120 ? 0.2748 0.1581 0.2060 0.0030  0.0127  -0.0497 121 VAL A CB  
1589 C CG1 . VAL A 120 ? 0.3498 0.2033 0.2604 0.0309  -0.0211 -0.0115 121 VAL A CG1 
1590 C CG2 . VAL A 120 ? 0.2588 0.2094 0.2507 0.0074  0.0405  -0.0796 121 VAL A CG2 
1600 N N   . LYS A 121 ? 0.2328 0.1584 0.2134 -0.0146 0.0291  -0.0429 122 LYS A N   
1601 C CA  . LYS A 121 ? 0.2491 0.1628 0.2138 -0.0191 0.0010  -0.0280 122 LYS A CA  
1602 C C   . LYS A 121 ? 0.2649 0.1760 0.2389 -0.0094 0.0082  -0.0417 122 LYS A C   
1603 O O   . LYS A 121 ? 0.2690 0.1567 0.2005 -0.0212 0.0175  -0.0188 122 LYS A O   
1604 C CB  . LYS A 121 ? 0.2543 0.2117 0.2337 0.0159  0.0061  -0.0530 122 LYS A CB  
1605 C CG  . LYS A 121 ? 0.2488 0.2500 0.2450 0.0356  0.0114  -0.0745 122 LYS A CG  
1606 C CD  . LYS A 121 ? 0.3044 0.2952 0.2814 0.0637  0.0145  -0.0843 122 LYS A CD  
1607 C CE  . LYS A 121 ? 0.3443 0.3218 0.3196 0.1147  0.0086  -0.0679 122 LYS A CE  
1608 N NZ  . LYS A 121 ? 0.4143 0.3623 0.3691 0.1136  0.0020  -0.0785 122 LYS A NZ  
1622 N N   . LEU A 122 ? 0.3085 0.1632 0.2412 -0.0631 0.0151  -0.0579 123 LEU A N   
1623 C CA  . LEU A 122 ? 0.3407 0.1818 0.2523 -0.0927 0.0107  -0.0449 123 LEU A CA  
1624 C C   . LEU A 122 ? 0.3720 0.2286 0.2984 -0.0748 0.0013  -0.0307 123 LEU A C   
1625 O O   . LEU A 122 ? 0.3424 0.1691 0.2666 -0.0603 -0.0033 -0.0211 123 LEU A O   
1626 C CB  . LEU A 122 ? 0.3550 0.2295 0.2833 -0.1041 -0.0111 -0.0592 123 LEU A CB  
1627 C CG  . LEU A 122 ? 0.3690 0.2968 0.3125 -0.1147 -0.0661 -0.0291 123 LEU A CG  
1628 C CD1 . LEU A 122 ? 0.4216 0.3180 0.3439 -0.1163 -0.0658 0.0105  123 LEU A CD1 
1629 C CD2 . LEU A 122 ? 0.3620 0.3724 0.3424 -0.1199 -0.0646 -0.0555 123 LEU A CD2 
1641 N N   . SER A 123 ? 0.3714 0.1761 0.2467 -0.0673 0.0143  -0.0152 124 SER A N   
1642 C CA  . SER A 123 ? 0.3633 0.1567 0.2479 -0.0419 0.0438  -0.0185 124 SER A CA  
1643 C C   . SER A 123 ? 0.3802 0.1774 0.2417 -0.0360 0.0335  -0.0217 124 SER A C   
1644 O O   . SER A 123 ? 0.4828 0.1735 0.2512 -0.0065 0.0138  -0.0103 124 SER A O   
1645 C CB  . SER A 123 ? 0.4226 0.1596 0.2606 0.0117  0.0693  -0.0067 124 SER A CB  
1646 O OG  . SER A 123 ? 0.4675 0.1765 0.3163 0.0166  0.0742  0.0090  124 SER A OG  
1652 N N   . LEU A 124 ? 0.3267 0.1791 0.2032 0.0095  0.0404  -0.0058 125 LEU A N   
1653 C CA  . LEU A 124 ? 0.2649 0.1819 0.1821 -0.0226 0.0164  -0.0021 125 LEU A CA  
1654 C C   . LEU A 124 ? 0.2645 0.1399 0.1640 -0.0202 -0.0069 -0.0262 125 LEU A C   
1655 O O   . LEU A 124 ? 0.2934 0.1371 0.1604 -0.0017 0.0165  -0.0117 125 LEU A O   
1656 C CB  . LEU A 124 ? 0.2620 0.1407 0.1861 0.0035  0.0356  -0.0065 125 LEU A CB  
1657 C CG  . LEU A 124 ? 0.2545 0.1601 0.1963 0.0151  0.0276  -0.0156 125 LEU A CG  
1658 C CD1 . LEU A 124 ? 0.2831 0.1853 0.2015 0.0742  0.0035  0.0203  125 LEU A CD1 
1659 C CD2 . LEU A 124 ? 0.2666 0.1631 0.2470 -0.0298 0.0043  0.0013  125 LEU A CD2 
1671 N N   . LEU A 125 ? 0.2563 0.1701 0.1885 -0.0344 0.0062  -0.0241 126 LEU A N   
1672 C CA  . LEU A 125 ? 0.2468 0.1831 0.1936 -0.0522 -0.0044 -0.0459 126 LEU A CA  
1673 C C   . LEU A 125 ? 0.2549 0.2046 0.2307 -0.0533 0.0093  -0.0187 126 LEU A C   
1674 O O   . LEU A 125 ? 0.2973 0.2014 0.2282 -0.0292 0.0034  -0.0035 126 LEU A O   
1675 C CB  . LEU A 125 ? 0.2833 0.2210 0.2037 -0.0621 -0.0172 -0.0572 126 LEU A CB  
1676 C CG  . LEU A 125 ? 0.3835 0.3127 0.3182 -0.0365 -0.0285 -0.0245 126 LEU A CG  
1677 C CD1 . LEU A 125 ? 0.3693 0.2830 0.3530 -0.0566 -0.0355 -0.0314 126 LEU A CD1 
1678 C CD2 . LEU A 125 ? 0.3965 0.3656 0.3367 0.0368  -0.0606 -0.0117 126 LEU A CD2 
1690 N N   . ASN A 126 ? 0.2733 0.2057 0.2505 -0.0561 -0.0127 -0.0256 127 ASN A N   
1691 C CA  . ASN A 126 ? 0.3057 0.2261 0.2766 -0.0966 0.0177  -0.0261 127 ASN A CA  
1692 C C   . ASN A 126 ? 0.3618 0.2323 0.2881 -0.1092 0.0279  0.0116  127 ASN A C   
1693 O O   . ASN A 126 ? 0.3710 0.2842 0.3082 -0.1167 0.0240  0.0359  127 ASN A O   
1694 C CB  . ASN A 126 ? 0.3115 0.2214 0.2802 -0.1054 -0.0058 -0.0115 127 ASN A CB  
1695 C CG  . ASN A 126 ? 0.3859 0.2773 0.3271 -0.1251 -0.0242 -0.0202 127 ASN A CG  
1696 O OD1 . ASN A 126 ? 0.4331 0.3203 0.3353 -0.0949 -0.0561 -0.0272 127 ASN A OD1 
1697 N ND2 . ASN A 126 ? 0.4608 0.2931 0.3530 -0.1249 -0.0031 -0.0269 127 ASN A ND2 
1704 N N   . LYS A 127 ? 0.3582 0.1312 0.2177 -0.0360 0.0392  0.0040  128 LYS A N   
1705 C CA  . LYS A 127 ? 0.4228 0.1520 0.2072 0.0125  0.0438  0.0164  128 LYS A CA  
1706 C C   . LYS A 127 ? 0.3882 0.1511 0.2016 -0.0046 0.0106  0.0287  128 LYS A C   
1707 O O   . LYS A 127 ? 0.4178 0.1834 0.2174 0.0048  0.0009  0.0337  128 LYS A O   
1708 C CB  . LYS A 127 ? 0.4159 0.2059 0.2045 0.0290  -0.0028 0.0076  128 LYS A CB  
1709 C CG  . LYS A 127 ? 0.4174 0.2489 0.2214 0.0367  0.0240  -0.0204 128 LYS A CG  
1710 C CD  . LYS A 127 ? 0.4341 0.2624 0.2531 0.0358  0.0087  -0.0542 128 LYS A CD  
1711 C CE  . LYS A 127 ? 0.4916 0.3260 0.3803 0.0372  0.0167  -0.0559 128 LYS A CE  
1712 N NZ  . LYS A 127 ? 0.5118 0.3274 0.4117 -0.0337 0.0145  -0.0523 128 LYS A NZ  
1726 N N   . LEU A 128 ? 0.2666 0.1374 0.1718 -0.0223 -0.0055 -0.0096 129 LEU A N   
1727 C CA  . LEU A 128 ? 0.2181 0.1753 0.1525 -0.0198 -0.0030 0.0058  129 LEU A CA  
1728 C C   . LEU A 128 ? 0.2181 0.1585 0.1604 -0.0422 -0.0064 0.0076  129 LEU A C   
1729 O O   . LEU A 128 ? 0.2312 0.1813 0.2103 -0.0387 -0.0186 0.0210  129 LEU A O   
1730 C CB  . LEU A 128 ? 0.2539 0.1862 0.1478 -0.0377 0.0109  0.0165  129 LEU A CB  
1731 C CG  . LEU A 128 ? 0.2688 0.1636 0.1618 -0.0126 0.0248  0.0026  129 LEU A CG  
1732 C CD1 . LEU A 128 ? 0.2584 0.1525 0.1649 -0.0069 0.0308  -0.0240 129 LEU A CD1 
1733 C CD2 . LEU A 128 ? 0.2323 0.1771 0.1955 -0.0023 0.0017  0.0266  129 LEU A CD2 
1745 N N   . GLU A 129 ? 0.1879 0.1778 0.1797 -0.0272 0.0058  0.0164  130 GLU A N   
1746 C CA  . GLU A 129 ? 0.1967 0.1933 0.1980 -0.0328 0.0260  0.0530  130 GLU A CA  
1747 C C   . GLU A 129 ? 0.1526 0.2032 0.1831 -0.0129 0.0147  0.0575  130 GLU A C   
1748 O O   . GLU A 129 ? 0.1719 0.2045 0.1683 0.0036  0.0350  0.0237  130 GLU A O   
1749 C CB  . GLU A 129 ? 0.2400 0.1632 0.2504 -0.0624 0.0365  0.0467  130 GLU A CB  
1750 C CG  . GLU A 129 ? 0.2989 0.2253 0.2680 -0.0974 0.0185  0.0463  130 GLU A CG  
1751 C CD  . GLU A 129 ? 0.2966 0.2761 0.2547 -0.1048 -0.0094 0.0604  130 GLU A CD  
1752 O OE1 . GLU A 129 ? 0.2729 0.2670 0.2291 -0.0670 0.0170  0.0487  130 GLU A OE1 
1753 O OE2 . GLU A 129 ? 0.3722 0.3822 0.3405 -0.1134 -0.0206 0.0831  130 GLU A OE2 
1760 N N   . GLU A 130 ? 0.1871 0.1845 0.2062 0.0048  -0.0051 0.0565  131 GLU A N   
1761 C CA  . GLU A 130 ? 0.1460 0.1665 0.2096 0.0131  0.0220  0.0487  131 GLU A CA  
1762 C C   . GLU A 130 ? 0.2103 0.1445 0.1958 0.0073  0.0258  0.0459  131 GLU A C   
1763 O O   . GLU A 130 ? 0.2285 0.1728 0.1968 -0.0096 0.0225  0.0203  131 GLU A O   
1764 C CB  . GLU A 130 ? 0.1874 0.2410 0.2674 -0.0251 0.0133  0.0760  131 GLU A CB  
1765 C CG  . GLU A 130 ? 0.2486 0.3458 0.3110 0.0184  0.0210  0.0543  131 GLU A CG  
1766 C CD  . GLU A 130 ? 0.3392 0.4428 0.3729 0.0636  0.0257  0.0329  131 GLU A CD  
1767 O OE1 . GLU A 130 ? 0.4139 0.5048 0.4131 0.1458  0.0175  0.0078  131 GLU A OE1 
1768 O OE2 . GLU A 130 ? 0.3055 0.4458 0.3687 -0.0094 0.0384  0.0603  131 GLU A OE2 
1775 N N   . GLY A 131 ? 0.1870 0.1810 0.1690 -0.0015 0.0493  0.0197  132 GLY A N   
1776 C CA  . GLY A 131 ? 0.2200 0.1664 0.1501 -0.0006 0.0353  0.0111  132 GLY A CA  
1777 C C   . GLY A 131 ? 0.2017 0.1586 0.1584 0.0177  0.0381  0.0092  132 GLY A C   
1778 O O   . GLY A 131 ? 0.1971 0.1643 0.1909 0.0029  0.0293  0.0006  132 GLY A O   
1782 N N   . ASP A 132 ? 0.2075 0.1412 0.1500 -0.0038 0.0442  0.0143  133 ASP A N   
1783 C CA  . ASP A 132 ? 0.1824 0.1602 0.1409 0.0206  0.0314  0.0278  133 ASP A CA  
1784 C C   . ASP A 132 ? 0.1750 0.1570 0.1453 0.0351  0.0309  0.0303  133 ASP A C   
1785 O O   . ASP A 132 ? 0.1605 0.1575 0.1727 0.0180  0.0187  0.0264  133 ASP A O   
1786 C CB  . ASP A 132 ? 0.1567 0.1346 0.1497 0.0052  0.0149  0.0081  133 ASP A CB  
1787 C CG  . ASP A 132 ? 0.1799 0.1397 0.1687 -0.0235 0.0099  0.0025  133 ASP A CG  
1788 O OD1 . ASP A 132 ? 0.2453 0.1401 0.1834 -0.0275 0.0249  0.0170  133 ASP A OD1 
1789 O OD2 . ASP A 132 ? 0.2317 0.1650 0.1953 0.0018  0.0091  -0.0086 133 ASP A OD2 
1794 N N   . VAL A 133 ? 0.1682 0.1233 0.1194 0.0122  0.0212  0.0281  134 VAL A N   
1795 C CA  . VAL A 133 ? 0.1540 0.1276 0.1413 0.0069  0.0204  0.0178  134 VAL A CA  
1796 C C   . VAL A 133 ? 0.1592 0.1237 0.1487 0.0243  0.0240  0.0029  134 VAL A C   
1797 O O   . VAL A 133 ? 0.1945 0.1313 0.1504 0.0316  0.0442  0.0256  134 VAL A O   
1798 C CB  . VAL A 133 ? 0.1614 0.1612 0.1604 0.0009  0.0289  -0.0064 134 VAL A CB  
1799 C CG1 . VAL A 133 ? 0.1980 0.2039 0.1872 -0.0393 0.0154  0.0124  134 VAL A CG1 
1800 C CG2 . VAL A 133 ? 0.2028 0.2053 0.1691 -0.0066 0.0340  0.0102  134 VAL A CG2 
1810 N N   . LEU A 134 ? 0.1693 0.1306 0.1406 0.0005  0.0305  -0.0024 135 LEU A N   
1811 C CA  . LEU A 134 ? 0.1760 0.1092 0.1534 -0.0088 0.0290  -0.0020 135 LEU A CA  
1812 C C   . LEU A 134 ? 0.1972 0.1085 0.1610 0.0055  0.0248  -0.0142 135 LEU A C   
1813 O O   . LEU A 134 ? 0.1635 0.1199 0.1875 -0.0080 0.0424  0.0064  135 LEU A O   
1814 C CB  . LEU A 134 ? 0.1773 0.1365 0.1793 -0.0059 -0.0013 -0.0030 135 LEU A CB  
1815 C CG  . LEU A 134 ? 0.2367 0.1385 0.1813 -0.0286 -0.0234 0.0093  135 LEU A CG  
1816 C CD1 . LEU A 134 ? 0.2126 0.1776 0.1318 -0.0253 0.0043  0.0209  135 LEU A CD1 
1817 C CD2 . LEU A 134 ? 0.2535 0.1717 0.2405 -0.0371 -0.0414 0.0209  135 LEU A CD2 
1829 N N   . VAL A 135 ? 0.1913 0.1399 0.1368 0.0104  0.0308  -0.0061 136 VAL A N   
1830 C CA  . VAL A 135 ? 0.1922 0.1636 0.1570 -0.0131 0.0271  -0.0093 136 VAL A CA  
1831 C C   . VAL A 135 ? 0.1722 0.1165 0.1375 -0.0206 0.0397  0.0003  136 VAL A C   
1832 O O   . VAL A 135 ? 0.2279 0.1248 0.1479 -0.0155 0.0469  -0.0096 136 VAL A O   
1833 C CB  . VAL A 135 ? 0.1800 0.2178 0.1493 -0.0200 0.0263  -0.0087 136 VAL A CB  
1834 C CG1 . VAL A 135 ? 0.1714 0.2376 0.1760 -0.0149 0.0284  0.0051  136 VAL A CG1 
1835 C CG2 . VAL A 135 ? 0.2575 0.2540 0.1816 -0.0414 -0.0031 0.0126  136 VAL A CG2 
1845 N N   . GLU A 136 ? 0.1914 0.1515 0.1510 -0.0308 0.0491  0.0041  137 GLU A N   
1846 C CA  . GLU A 136 ? 0.1645 0.1516 0.1490 -0.0363 0.0330  0.0160  137 GLU A CA  
1847 C C   . GLU A 136 ? 0.1646 0.1333 0.1529 -0.0036 0.0362  0.0044  137 GLU A C   
1848 O O   . GLU A 136 ? 0.1917 0.1608 0.1565 -0.0212 0.0343  -0.0079 137 GLU A O   
1849 C CB  . GLU A 136 ? 0.2184 0.1588 0.1613 -0.0038 0.0445  0.0230  137 GLU A CB  
1850 C CG  . GLU A 136 ? 0.2334 0.2480 0.1767 0.0034  0.0214  0.0294  137 GLU A CG  
1851 C CD  . GLU A 136 ? 0.2029 0.3420 0.2155 0.0311  0.0319  0.0048  137 GLU A CD  
1852 O OE1 . GLU A 136 ? 0.2444 0.4134 0.2564 0.0342  0.0352  -0.0231 137 GLU A OE1 
1853 O OE2 . GLU A 136 ? 0.1917 0.2675 0.2211 -0.0008 0.0293  0.0119  137 GLU A OE2 
1860 N N   . PRO A 137 ? 0.2023 0.1410 0.1722 0.0174  0.0499  -0.0198 138 PRO A N   
1861 C CA  . PRO A 137 ? 0.1613 0.2042 0.1615 0.0175  0.0384  -0.0038 138 PRO A CA  
1862 C C   . PRO A 137 ? 0.1783 0.1598 0.1683 -0.0058 0.0284  -0.0080 138 PRO A C   
1863 O O   . PRO A 137 ? 0.1810 0.2165 0.1836 0.0009  0.0552  -0.0021 138 PRO A O   
1864 C CB  . PRO A 137 ? 0.1716 0.2277 0.1641 0.0231  0.0044  0.0024  138 PRO A CB  
1865 C CG  . PRO A 137 ? 0.2317 0.1945 0.1863 0.0186  0.0437  -0.0347 138 PRO A CG  
1866 C CD  . PRO A 137 ? 0.2305 0.1466 0.1761 0.0159  0.0670  -0.0162 138 PRO A CD  
1874 N N   . ALA A 138 ? 0.1627 0.1871 0.1629 -0.0166 0.0328  0.0153  139 ALA A N   
1875 C CA  . ALA A 138 ? 0.2010 0.1758 0.1294 0.0049  0.0449  0.0035  139 ALA A CA  
1876 C C   . ALA A 138 ? 0.1740 0.1795 0.1568 -0.0107 0.0263  -0.0082 139 ALA A C   
1877 O O   . ALA A 138 ? 0.1546 0.1991 0.1644 -0.0181 0.0244  -0.0050 139 ALA A O   
1878 C CB  . ALA A 138 ? 0.3224 0.1565 0.1476 -0.0087 0.0395  -0.0055 139 ALA A CB  
1884 N N   . PHE A 139 ? 0.1292 0.1922 0.1552 -0.0130 0.0393  -0.0150 140 PHE A N   
1885 C CA  . PHE A 139 ? 0.1178 0.2023 0.1404 -0.0151 0.0211  -0.0244 140 PHE A CA  
1886 C C   . PHE A 139 ? 0.1423 0.1812 0.1500 -0.0275 0.0283  -0.0242 140 PHE A C   
1887 O O   . PHE A 139 ? 0.1773 0.2099 0.2093 -0.0004 0.0216  -0.0616 140 PHE A O   
1888 C CB  . PHE A 139 ? 0.1427 0.2284 0.1445 -0.0259 0.0261  0.0147  140 PHE A CB  
1889 C CG  . PHE A 139 ? 0.1478 0.1981 0.1401 -0.0095 0.0411  0.0068  140 PHE A CG  
1890 C CD1 . PHE A 139 ? 0.1515 0.2597 0.1713 -0.0066 0.0238  0.0356  140 PHE A CD1 
1891 C CD2 . PHE A 139 ? 0.1540 0.1771 0.1769 -0.0199 0.0436  0.0219  140 PHE A CD2 
1892 C CE1 . PHE A 139 ? 0.1341 0.2796 0.1826 -0.0069 0.0189  0.0105  140 PHE A CE1 
1893 C CE2 . PHE A 139 ? 0.1473 0.2419 0.1987 -0.0411 0.0242  0.0050  140 PHE A CE2 
1894 C CZ  . PHE A 139 ? 0.1442 0.2840 0.1983 -0.0340 0.0224  0.0057  140 PHE A CZ  
1904 N N   . THR A 140 ? 0.1131 0.1690 0.1626 -0.0004 0.0346  -0.0073 141 THR A N   
1905 C CA  . THR A 140 ? 0.1056 0.1454 0.1605 0.0145  0.0232  -0.0245 141 THR A CA  
1906 C C   . THR A 140 ? 0.1783 0.1557 0.1404 -0.0317 -0.0117 -0.0296 141 THR A C   
1907 O O   . THR A 140 ? 0.1935 0.1898 0.1718 -0.0035 -0.0198 -0.0296 141 THR A O   
1908 C CB  . THR A 140 ? 0.1387 0.2338 0.1938 0.0060  0.0214  -0.0036 141 THR A CB  
1909 O OG1 . THR A 140 ? 0.1535 0.2505 0.2210 -0.0253 0.0204  0.0333  141 THR A OG1 
1910 C CG2 . THR A 140 ? 0.1372 0.2635 0.1837 0.0123  0.0125  0.0008  141 THR A CG2 
1918 N N   . SER A 141 ? 0.1569 0.1716 0.1394 -0.0068 0.0182  -0.0122 142 SER A N   
1919 C CA  . SER A 141 ? 0.1434 0.1895 0.1584 -0.0057 0.0003  -0.0212 142 SER A CA  
1920 C C   . SER A 141 ? 0.1622 0.1348 0.1848 -0.0229 -0.0170 -0.0098 142 SER A C   
1921 O O   . SER A 141 ? 0.1691 0.1637 0.2574 -0.0184 -0.0134 -0.0120 142 SER A O   
1922 C CB  . SER A 141 ? 0.1991 0.2032 0.1799 0.0162  0.0022  -0.0299 142 SER A CB  
1923 O OG  . SER A 141 ? 0.2441 0.2760 0.2228 0.0159  0.0387  0.0117  142 SER A OG  
1929 N N   . THR A 142 ? 0.1475 0.1379 0.1704 0.0007  -0.0114 -0.0099 143 THR A N   
1930 C CA  . THR A 142 ? 0.1461 0.1407 0.1855 0.0015  -0.0101 -0.0114 143 THR A CA  
1931 C C   . THR A 142 ? 0.1618 0.1454 0.1935 -0.0407 -0.0130 0.0114  143 THR A C   
1932 O O   . THR A 142 ? 0.1574 0.1555 0.2020 -0.0100 0.0031  0.0152  143 THR A O   
1933 C CB  . THR A 142 ? 0.1468 0.1685 0.1840 0.0155  -0.0091 -0.0405 143 THR A CB  
1934 O OG1 . THR A 142 ? 0.1812 0.1633 0.2088 -0.0041 -0.0017 -0.0218 143 THR A OG1 
1935 C CG2 . THR A 142 ? 0.1712 0.2263 0.1864 0.0321  -0.0114 -0.0170 143 THR A CG2 
1943 N N   . SER A 143 ? 0.1671 0.1235 0.1826 -0.0235 -0.0217 0.0038  144 SER A N   
1944 C CA  . SER A 143 ? 0.1559 0.1280 0.1730 0.0048  -0.0156 0.0178  144 SER A CA  
1945 C C   . SER A 143 ? 0.1830 0.1295 0.1808 -0.0176 -0.0209 -0.0021 144 SER A C   
1946 O O   . SER A 143 ? 0.1774 0.1583 0.1843 -0.0201 -0.0199 0.0201  144 SER A O   
1947 C CB  . SER A 143 ? 0.1832 0.1954 0.1782 0.0045  -0.0387 0.0052  144 SER A CB  
1948 O OG  . SER A 143 ? 0.1809 0.1967 0.1686 -0.0322 -0.0067 0.0093  144 SER A OG  
1954 N N   . THR A 144 ? 0.1632 0.1536 0.1585 -0.0406 -0.0115 -0.0112 145 THR A N   
1955 C CA  . THR A 144 ? 0.1438 0.2065 0.1705 -0.0047 -0.0105 0.0186  145 THR A CA  
1956 C C   . THR A 144 ? 0.1358 0.1976 0.1585 -0.0097 0.0042  0.0375  145 THR A C   
1957 O O   . THR A 144 ? 0.1665 0.2534 0.1866 -0.0236 0.0068  0.0101  145 THR A O   
1958 C CB  . THR A 144 ? 0.2599 0.2055 0.1900 -0.0345 -0.0072 -0.0097 145 THR A CB  
1959 O OG1 . THR A 144 ? 0.2769 0.2001 0.2150 0.0015  0.0112  0.0090  145 THR A OG1 
1960 C CG2 . THR A 144 ? 0.2579 0.1975 0.1829 -0.0287 0.0022  -0.0424 145 THR A CG2 
1968 N N   . LEU A 145 ? 0.1510 0.2173 0.1472 0.0177  -0.0018 0.0227  146 LEU A N   
1969 C CA  . LEU A 145 ? 0.1446 0.2518 0.1657 0.0231  0.0089  -0.0039 146 LEU A CA  
1970 C C   . LEU A 145 ? 0.1257 0.2357 0.1770 0.0035  -0.0152 -0.0007 146 LEU A C   
1971 O O   . LEU A 145 ? 0.1549 0.2281 0.2011 0.0036  -0.0143 -0.0162 146 LEU A O   
1972 C CB  . LEU A 145 ? 0.1910 0.2661 0.1859 -0.0028 -0.0406 -0.0107 146 LEU A CB  
1973 C CG  . LEU A 145 ? 0.2387 0.2263 0.2089 -0.0076 -0.0149 0.0159  146 LEU A CG  
1974 C CD1 . LEU A 145 ? 0.3629 0.2663 0.2327 -0.0257 -0.0334 0.0436  146 LEU A CD1 
1975 C CD2 . LEU A 145 ? 0.3093 0.3018 0.2830 0.0299  -0.0325 0.0153  146 LEU A CD2 
1987 N N   . PRO A 146 ? 0.1199 0.2457 0.1664 -0.0115 0.0014  -0.0108 147 PRO A N   
1988 C CA  . PRO A 146 ? 0.1419 0.2260 0.1845 -0.0025 -0.0077 -0.0210 147 PRO A CA  
1989 C C   . PRO A 146 ? 0.1628 0.2267 0.1891 -0.0146 0.0006  -0.0045 147 PRO A C   
1990 O O   . PRO A 146 ? 0.1862 0.2329 0.1939 -0.0031 -0.0162 0.0187  147 PRO A O   
1991 C CB  . PRO A 146 ? 0.1877 0.2568 0.2335 -0.0439 0.0212  0.0080  147 PRO A CB  
1992 C CG  . PRO A 146 ? 0.2367 0.3626 0.3060 -0.0648 0.0118  -0.0231 147 PRO A CG  
1993 C CD  . PRO A 146 ? 0.1428 0.2683 0.2200 -0.0161 -0.0012 -0.0140 147 PRO A CD  
2001 N N   . GLU A 147 ? 0.1830 0.2185 0.1809 0.0038  0.0028  -0.0226 148 GLU A N   
2002 C CA  . GLU A 147 ? 0.2157 0.2059 0.1725 0.0362  0.0176  -0.0308 148 GLU A CA  
2003 C C   . GLU A 147 ? 0.2344 0.2144 0.1891 0.0243  0.0063  -0.0109 148 GLU A C   
2004 O O   . GLU A 147 ? 0.2036 0.2408 0.2018 -0.0041 0.0140  -0.0222 148 GLU A O   
2005 C CB  . GLU A 147 ? 0.2572 0.2366 0.1946 0.0406  -0.0201 -0.0113 148 GLU A CB  
2006 C CG  . GLU A 147 ? 0.2695 0.2783 0.2018 0.0367  0.0079  -0.0033 148 GLU A CG  
2007 C CD  . GLU A 147 ? 0.2708 0.2700 0.2369 0.0403  -0.0415 0.0094  148 GLU A CD  
2008 O OE1 . GLU A 147 ? 0.2228 0.2799 0.2405 0.0468  -0.0276 0.0075  148 GLU A OE1 
2009 O OE2 . GLU A 147 ? 0.2462 0.2528 0.2426 0.0473  -0.0800 -0.0233 148 GLU A OE2 
2016 N N   . VAL A 148 ? 0.2165 0.2413 0.1864 -0.0203 0.0122  -0.0450 149 VAL A N   
2017 C CA  . VAL A 148 ? 0.2094 0.3215 0.2146 -0.0560 0.0238  -0.0636 149 VAL A CA  
2018 C C   . VAL A 148 ? 0.1725 0.3375 0.1947 -0.0270 0.0121  -0.0614 149 VAL A C   
2019 O O   . VAL A 148 ? 0.1819 0.3427 0.2066 -0.0326 0.0155  -0.0663 149 VAL A O   
2020 C CB  . VAL A 148 ? 0.2402 0.3201 0.2300 -0.0678 0.0497  -0.0580 149 VAL A CB  
2021 C CG1 . VAL A 148 ? 0.2620 0.3593 0.2788 -0.0537 0.0484  -0.0484 149 VAL A CG1 
2022 C CG2 . VAL A 148 ? 0.3349 0.3729 0.2890 -0.0559 0.0763  -0.0444 149 VAL A CG2 
2032 N N   . ALA A 149 ? 0.1507 0.3362 0.1644 -0.0112 0.0005  -0.0580 150 ALA A N   
2033 C CA  . ALA A 149 ? 0.2447 0.3663 0.1789 0.0310  -0.0083 -0.0579 150 ALA A CA  
2034 C C   . ALA A 149 ? 0.3099 0.3322 0.2138 0.1034  -0.0327 -0.0414 150 ALA A C   
2035 O O   . ALA A 149 ? 0.4288 0.3758 0.2661 0.1454  -0.0319 -0.0378 150 ALA A O   
2036 C CB  . ALA A 149 ? 0.2656 0.3776 0.1833 0.0686  -0.0159 -0.0519 150 ALA A CB  
2042 N N   . LYS A 150 ? 0.2979 0.2340 0.1788 -0.0011 -0.0170 -0.0303 151 LYS A N   
2043 C CA  . LYS A 150 ? 0.3887 0.2552 0.2423 -0.0590 -0.0240 -0.0351 151 LYS A CA  
2044 C C   . LYS A 150 ? 0.4709 0.3016 0.2640 -0.0221 -0.0403 -0.0417 151 LYS A C   
2045 O O   . LYS A 150 ? 0.5140 0.3155 0.2835 -0.0228 -0.0355 -0.0543 151 LYS A O   
2046 C CB  . LYS A 150 ? 0.3398 0.2478 0.2522 -0.0846 -0.0024 -0.0354 151 LYS A CB  
2047 C CG  . LYS A 150 ? 0.3498 0.2540 0.2840 -0.0794 -0.0046 -0.0441 151 LYS A CG  
2048 C CD  . LYS A 150 ? 0.4397 0.4421 0.4327 -0.0263 -0.0081 -0.0234 151 LYS A CD  
2049 C CE  . LYS A 150 ? 0.4095 0.4683 0.4368 0.0084  -0.0432 -0.0029 151 LYS A CE  
2050 N NZ  . LYS A 150 ? 0.3425 0.4342 0.3855 -0.0866 -0.0560 0.0071  151 LYS A NZ  
2064 N N   . ARG A 151 ? 0.3669 0.1960 0.1758 0.0257  -0.0398 -0.0203 152 ARG A N   
2065 C CA  . ARG A 151 ? 0.3658 0.2602 0.1635 0.0042  -0.0431 -0.0079 152 ARG A CA  
2066 C C   . ARG A 151 ? 0.4259 0.3341 0.2357 0.0882  -0.0412 -0.0298 152 ARG A C   
2067 O O   . ARG A 151 ? 0.3612 0.2834 0.1941 0.0130  -0.0194 0.0027  152 ARG A O   
2068 C CB  . ARG A 151 ? 0.3830 0.3288 0.1740 -0.0061 -0.0145 0.0298  152 ARG A CB  
2069 C CG  . ARG A 151 ? 0.3813 0.3832 0.2161 -0.0447 -0.0361 0.0170  152 ARG A CG  
2070 C CD  . ARG A 151 ? 0.3124 0.3030 0.1843 -0.0416 -0.0471 0.0107  152 ARG A CD  
2071 N NE  . ARG A 151 ? 0.3593 0.3746 0.2436 0.0183  -0.0635 0.0401  152 ARG A NE  
2072 C CZ  . ARG A 151 ? 0.3974 0.3718 0.2797 0.0456  -0.0378 0.0391  152 ARG A CZ  
2073 N NH1 . ARG A 151 ? 0.4025 0.3772 0.3029 -0.0230 -0.0152 0.0037  152 ARG A NH1 
2074 N NH2 . ARG A 151 ? 0.4569 0.4497 0.3267 0.0926  -0.0366 0.0512  152 ARG A NH2 
2088 N N   . PHE A 152 ? 0.3798 0.4520 0.2447 0.1397  -0.0255 -0.0375 153 PHE A N   
2089 C CA  . PHE A 152 ? 0.3746 0.4618 0.2731 0.0693  0.0002  -0.0188 153 PHE A CA  
2090 C C   . PHE A 152 ? 0.4631 0.5185 0.4105 -0.0261 0.0152  0.0164  153 PHE A C   
2091 O O   . PHE A 152 ? 0.4974 0.5364 0.4593 -0.0501 0.0257  0.0511  153 PHE A O   
2092 C CB  . PHE A 152 ? 0.4068 0.5101 0.3425 0.0116  -0.0249 -0.0306 153 PHE A CB  
2093 C CG  . PHE A 152 ? 0.3892 0.4786 0.3925 -0.0200 -0.0360 -0.0458 153 PHE A CG  
2094 C CD1 . PHE A 152 ? 0.4050 0.4430 0.4294 -0.0189 -0.0261 -0.0739 153 PHE A CD1 
2095 C CD2 . PHE A 152 ? 0.3778 0.4575 0.3937 -0.0507 -0.0468 -0.0460 153 PHE A CD2 
2096 C CE1 . PHE A 152 ? 0.4138 0.4225 0.4431 0.0075  -0.0208 -0.0685 153 PHE A CE1 
2097 C CE2 . PHE A 152 ? 0.4018 0.4210 0.3921 -0.0705 -0.0452 -0.0524 153 PHE A CE2 
2098 C CZ  . PHE A 152 ? 0.4650 0.4487 0.4595 -0.0184 -0.0217 -0.0559 153 PHE A CZ  
2108 N N   . SER A 153 ? 0.4041 0.4642 0.4068 -0.0357 0.0229  0.0027  154 SER A N   
2109 C CA  . SER A 153 ? 0.4460 0.4669 0.3809 -0.0338 0.0023  0.0143  154 SER A CA  
2110 C C   . SER A 153 ? 0.5350 0.5530 0.4839 -0.0215 -0.0562 0.0364  154 SER A C   
2111 O O   . SER A 153 ? 0.5727 0.4981 0.4719 0.0094  -0.0603 0.0389  154 SER A O   
2112 C CB  . SER A 153 ? 0.5155 0.4894 0.3614 0.0083  0.0452  -0.0036 154 SER A CB  
2113 O OG  . SER A 153 ? 0.5243 0.4984 0.3788 0.0343  0.0884  0.0134  154 SER A OG  
2119 N N   . VAL A 154 ? 0.4413 0.5138 0.3949 -0.0372 -0.0789 0.0399  155 VAL A N   
2120 C CA  . VAL A 154 ? 0.4306 0.4691 0.3882 0.0307  -0.0835 -0.0065 155 VAL A CA  
2121 C C   . VAL A 154 ? 0.3503 0.3617 0.3695 0.0898  -0.0550 -0.0509 155 VAL A C   
2122 O O   . VAL A 154 ? 0.5013 0.4922 0.5065 0.0968  -0.0181 -0.0623 155 VAL A O   
2123 C CB  . VAL A 154 ? 0.4356 0.4170 0.3512 0.0435  -0.0854 -0.0194 155 VAL A CB  
2124 C CG1 . VAL A 154 ? 0.4816 0.4950 0.3890 0.0000  -0.0708 -0.0234 155 VAL A CG1 
2125 C CG2 . VAL A 154 ? 0.4645 0.3807 0.3718 0.0485  -0.0849 -0.0407 155 VAL A CG2 
2135 N N   . VAL A 155 ? 0.4881 0.4535 0.4248 0.0262  -0.0276 -0.0182 156 VAL A N   
2136 C CA  . VAL A 155 ? 0.5002 0.4356 0.3982 0.0587  -0.0232 0.0029  156 VAL A CA  
2137 C C   . VAL A 155 ? 0.6082 0.5884 0.4965 0.0116  0.0300  0.0105  156 VAL A C   
2138 O O   . VAL A 155 ? 0.5655 0.6099 0.4592 0.0071  0.0300  0.0066  156 VAL A O   
2139 C CB  . VAL A 155 ? 0.5487 0.5160 0.4405 0.0635  -0.0654 -0.0031 156 VAL A CB  
2140 C CG1 . VAL A 155 ? 0.5574 0.5216 0.4711 0.0951  -0.0715 -0.0234 156 VAL A CG1 
2141 C CG2 . VAL A 155 ? 0.5606 0.5341 0.4655 0.0117  -0.0820 0.0385  156 VAL A CG2 
2151 N N   . HIS A 156 ? 0.6374 0.6053 0.5546 0.0241  0.0416  -0.0036 157 HIS A N   
2152 C CA  . HIS A 156 ? 0.6719 0.6365 0.5836 0.0093  0.0269  -0.0397 157 HIS A CA  
2153 C C   . HIS A 156 ? 0.5851 0.5865 0.5064 0.0121  0.0032  -0.0276 157 HIS A C   
2154 O O   . HIS A 156 ? 0.5435 0.6100 0.4711 -0.0317 0.0078  -0.0168 157 HIS A O   
2155 C CB  . HIS A 156 ? 0.7800 0.6856 0.6512 0.0093  0.0169  -0.0853 157 HIS A CB  
2156 C CG  . HIS A 156 ? 0.8340 0.7154 0.7080 -0.0040 0.0034  -0.1012 157 HIS A CG  
2157 N ND1 . HIS A 156 ? 0.8845 0.7848 0.7913 -0.0179 -0.0045 -0.1103 157 HIS A ND1 
2158 C CD2 . HIS A 156 ? 0.8074 0.6897 0.6844 -0.0274 0.0010  -0.1149 157 HIS A CD2 
2159 C CE1 . HIS A 156 ? 0.8445 0.7408 0.7269 -0.0271 -0.0077 -0.1235 157 HIS A CE1 
2160 N NE2 . HIS A 156 ? 0.8066 0.6976 0.6844 -0.0388 -0.0022 -0.1238 157 HIS A NE2 
2168 N N   . PRO A 157 ? 0.5618 0.5344 0.4987 -0.0067 -0.0128 -0.0292 158 PRO A N   
2169 C CA  . PRO A 157 ? 0.5759 0.5406 0.5066 -0.0162 -0.0273 -0.0114 158 PRO A CA  
2170 C C   . PRO A 157 ? 0.5917 0.5652 0.5095 -0.0319 -0.0151 0.0058  158 PRO A C   
2171 O O   . PRO A 157 ? 0.5803 0.5583 0.4530 -0.0576 0.0184  0.0675  158 PRO A O   
2172 C CB  . PRO A 157 ? 0.5528 0.4892 0.4718 -0.0380 -0.0336 -0.0146 158 PRO A CB  
2173 C CG  . PRO A 157 ? 0.5455 0.4713 0.4775 -0.0259 -0.0380 -0.0141 158 PRO A CG  
2174 C CD  . PRO A 157 ? 0.5592 0.4864 0.4957 -0.0160 -0.0220 -0.0253 158 PRO A CD  
2182 N N   . ASN A 158 ? 0.5526 0.5216 0.4687 -0.0308 -0.0183 -0.0390 159 ASN A N   
2183 C CA  . ASN A 158 ? 0.5306 0.4994 0.4664 -0.0179 -0.0083 -0.0655 159 ASN A CA  
2184 C C   . ASN A 158 ? 0.5515 0.4923 0.5033 -0.0313 -0.0076 -0.0458 159 ASN A C   
2185 O O   . ASN A 158 ? 0.5763 0.5234 0.5476 -0.0320 0.0009  -0.0180 159 ASN A O   
2186 C CB  . ASN A 158 ? 0.6371 0.6007 0.5314 -0.0062 -0.0052 -0.0926 159 ASN A CB  
2187 C CG  . ASN A 158 ? 0.7639 0.7123 0.6151 0.0267  0.0140  -0.0943 159 ASN A CG  
2188 O OD1 . ASN A 158 ? 0.7664 0.7317 0.5972 0.0095  0.0367  -0.0816 159 ASN A OD1 
2189 N ND2 . ASN A 158 ? 0.7969 0.7316 0.6507 0.0503  0.0169  -0.1065 159 ASN A ND2 
2196 N N   . SER A 159 ? 0.5316 0.4285 0.4893 -0.0213 -0.0036 -0.0330 160 SER A N   
2197 C CA  . SER A 159 ? 0.5406 0.4125 0.4828 0.0013  0.0195  -0.0304 160 SER A CA  
2198 C C   . SER A 159 ? 0.5711 0.4003 0.4764 0.0022  0.0451  -0.0395 160 SER A C   
2199 O O   . SER A 159 ? 0.6073 0.4582 0.5061 -0.0370 0.0756  -0.0315 160 SER A O   
2200 C CB  . SER A 159 ? 0.5570 0.4066 0.4736 -0.0040 0.0437  -0.0583 160 SER A CB  
2201 O OG  . SER A 159 ? 0.5626 0.4755 0.4837 -0.0275 0.0870  -0.0855 160 SER A OG  
2207 N N   . PRO A 160 ? 0.6271 0.4654 0.5243 0.0344  0.0334  -0.0637 161 PRO A N   
2208 C CA  . PRO A 160 ? 0.6667 0.4926 0.5673 0.0196  0.0317  -0.0801 161 PRO A CA  
2209 C C   . PRO A 160 ? 0.6938 0.5126 0.5930 0.0119  0.0523  -0.0937 161 PRO A C   
2210 O O   . PRO A 160 ? 0.7015 0.4919 0.5860 0.0113  0.0578  -0.1054 161 PRO A O   
2211 C CB  . PRO A 160 ? 0.6900 0.5270 0.6002 0.0329  0.0269  -0.0813 161 PRO A CB  
2212 C CG  . PRO A 160 ? 0.6857 0.5351 0.5959 0.0458  0.0342  -0.0763 161 PRO A CG  
2213 C CD  . PRO A 160 ? 0.6706 0.4995 0.5626 0.0420  0.0381  -0.0677 161 PRO A CD  
2221 N N   . GLN A 161 ? 0.6307 0.4539 0.5388 0.0347  0.0675  -0.0896 162 GLN A N   
2222 C CA  . GLN A 161 ? 0.6260 0.4593 0.5457 0.0431  0.0743  -0.0873 162 GLN A CA  
2223 C C   . GLN A 161 ? 0.5408 0.3789 0.4941 0.0549  0.1272  -0.0715 162 GLN A C   
2224 O O   . GLN A 161 ? 0.4950 0.3491 0.4815 0.0696  0.1576  -0.0493 162 GLN A O   
2225 C CB  . GLN A 161 ? 0.7332 0.5646 0.6368 0.0337  0.0293  -0.0774 162 GLN A CB  
2226 C CG  . GLN A 161 ? 0.8458 0.6454 0.7476 0.0295  0.0059  -0.0769 162 GLN A CG  
2227 C CD  . GLN A 161 ? 0.8865 0.6799 0.7944 0.0221  0.0212  -0.0853 162 GLN A CD  
2228 O OE1 . GLN A 161 ? 0.7831 0.5933 0.7069 0.0213  0.0766  -0.1110 162 GLN A OE1 
2229 N NE2 . GLN A 161 ? 0.9512 0.7391 0.8561 0.0159  -0.0006 -0.0697 162 GLN A NE2 
2238 N N   . ARG A 162 ? 0.4583 0.3153 0.4082 -0.0209 0.1272  -0.0762 163 ARG A N   
2239 C CA  . ARG A 162 ? 0.4493 0.2625 0.3320 -0.0180 0.0822  -0.1056 163 ARG A CA  
2240 C C   . ARG A 162 ? 0.4334 0.2251 0.2850 0.0001  0.0667  -0.0916 163 ARG A C   
2241 O O   . ARG A 162 ? 0.4602 0.2207 0.2684 -0.0220 0.0390  -0.0599 163 ARG A O   
2242 C CB  . ARG A 162 ? 0.5016 0.3144 0.4038 -0.0606 0.0393  -0.1127 163 ARG A CB  
2243 C CG  . ARG A 162 ? 0.6926 0.5438 0.6243 -0.0547 0.0105  -0.1055 163 ARG A CG  
2244 C CD  . ARG A 162 ? 0.8726 0.7147 0.8140 -0.0535 -0.0091 -0.0923 163 ARG A CD  
2245 N NE  . ARG A 162 ? 1.0136 0.8473 0.9534 -0.0692 -0.0195 -0.0874 163 ARG A NE  
2246 C CZ  . ARG A 162 ? 1.0686 0.8995 0.9909 -0.0741 -0.0228 -0.0845 163 ARG A CZ  
2247 N NH1 . ARG A 162 ? 1.0646 0.9003 0.9840 -0.0811 -0.0286 -0.0917 163 ARG A NH1 
2248 N NH2 . ARG A 162 ? 1.0951 0.9129 0.9993 -0.0662 -0.0168 -0.0744 163 ARG A NH2 
2262 N N   . LEU A 163 ? 0.3950 0.2649 0.2890 0.0139  0.0341  -0.1153 164 LEU A N   
2263 C CA  . LEU A 163 ? 0.3272 0.2252 0.2266 -0.0134 0.0171  -0.1058 164 LEU A CA  
2264 C C   . LEU A 163 ? 0.3569 0.2366 0.2601 -0.0138 -0.0225 -0.1038 164 LEU A C   
2265 O O   . LEU A 163 ? 0.4044 0.3152 0.2804 0.0102  -0.0420 -0.1194 164 LEU A O   
2266 C CB  . LEU A 163 ? 0.3030 0.2203 0.2262 -0.0186 0.0447  -0.0752 164 LEU A CB  
2267 C CG  . LEU A 163 ? 0.3417 0.2577 0.2419 -0.0153 0.0954  -0.0541 164 LEU A CG  
2268 C CD1 . LEU A 163 ? 0.4087 0.2948 0.2886 0.0027  0.1027  -0.0115 164 LEU A CD1 
2269 C CD2 . LEU A 163 ? 0.4225 0.4348 0.3390 0.0172  0.0824  -0.0194 164 LEU A CD2 
2281 N N   . LYS A 164 ? 0.3018 0.1979 0.2656 -0.0272 -0.0002 -0.0897 165 LYS A N   
2282 C CA  . LYS A 164 ? 0.3300 0.2278 0.3096 -0.0224 0.0032  -0.0681 165 LYS A CA  
2283 C C   . LYS A 164 ? 0.3023 0.1577 0.2833 -0.0070 -0.0024 -0.0454 165 LYS A C   
2284 O O   . LYS A 164 ? 0.2701 0.1925 0.2793 -0.0129 -0.0218 -0.0569 165 LYS A O   
2285 C CB  . LYS A 164 ? 0.3697 0.2390 0.3563 -0.0663 0.0282  -0.0261 165 LYS A CB  
2286 C CG  . LYS A 164 ? 0.4359 0.2860 0.4010 -0.0553 0.0147  -0.0011 165 LYS A CG  
2287 C CD  . LYS A 164 ? 0.5269 0.3892 0.4884 -0.0452 -0.0006 -0.0094 165 LYS A CD  
2288 C CE  . LYS A 164 ? 0.5899 0.4719 0.5411 -0.0484 -0.0074 -0.0374 165 LYS A CE  
2289 N NZ  . LYS A 164 ? 0.6109 0.5053 0.5522 -0.1056 -0.0147 -0.0769 165 LYS A NZ  
2303 N N   . ARG A 165 ? 0.3408 0.1737 0.2916 0.0192  -0.0318 -0.0559 166 ARG A N   
2304 C CA  . ARG A 165 ? 0.2876 0.1677 0.2777 0.0039  -0.0420 -0.0432 166 ARG A CA  
2305 C C   . ARG A 165 ? 0.2557 0.1963 0.3050 -0.0126 0.0009  -0.0591 166 ARG A C   
2306 O O   . ARG A 165 ? 0.2608 0.2458 0.2998 -0.0050 -0.0037 -0.0800 166 ARG A O   
2307 C CB  . ARG A 165 ? 0.3735 0.2892 0.3347 -0.0097 -0.0766 -0.0096 166 ARG A CB  
2308 C CG  . ARG A 165 ? 0.4719 0.3633 0.3606 -0.0744 -0.0766 0.0266  166 ARG A CG  
2309 C CD  . ARG A 165 ? 0.4695 0.4006 0.4120 -0.0460 -0.0810 0.0525  166 ARG A CD  
2310 N NE  . ARG A 165 ? 0.5710 0.5683 0.5493 0.0088  -0.0807 0.0092  166 ARG A NE  
2311 C CZ  . ARG A 165 ? 0.5069 0.5068 0.4989 -0.0014 -0.0692 -0.0493 166 ARG A CZ  
2312 N NH1 . ARG A 165 ? 0.5560 0.5971 0.5315 -0.0426 -0.0729 -0.0757 166 ARG A NH1 
2313 N NH2 . ARG A 165 ? 0.3252 0.3017 0.3813 -0.0182 -0.0502 -0.0555 166 ARG A NH2 
2327 N N   . VAL A 166 ? 0.2206 0.1912 0.2678 -0.0307 -0.0001 -0.0295 167 VAL A N   
2328 C CA  . VAL A 166 ? 0.1953 0.1821 0.2627 -0.0281 -0.0052 -0.0401 167 VAL A CA  
2329 C C   . VAL A 166 ? 0.1741 0.1826 0.2461 -0.0365 -0.0108 -0.0157 167 VAL A C   
2330 O O   . VAL A 166 ? 0.1941 0.1681 0.2439 -0.0152 -0.0103 -0.0233 167 VAL A O   
2331 C CB  . VAL A 166 ? 0.2318 0.2118 0.2682 -0.0494 -0.0420 0.0039  167 VAL A CB  
2332 C CG1 . VAL A 166 ? 0.2311 0.2606 0.2635 -0.0236 -0.0600 0.0366  167 VAL A CG1 
2333 C CG2 . VAL A 166 ? 0.2655 0.2025 0.2697 -0.0547 -0.0401 0.0408  167 VAL A CG2 
2343 N N   . LEU A 167 ? 0.1821 0.1610 0.1988 -0.0511 -0.0348 -0.0223 168 LEU A N   
2344 C CA  . LEU A 167 ? 0.2337 0.1520 0.1980 -0.0267 -0.0446 -0.0236 168 LEU A CA  
2345 C C   . LEU A 167 ? 0.1883 0.1692 0.1850 -0.0394 -0.0149 0.0175  168 LEU A C   
2346 O O   . LEU A 167 ? 0.2293 0.2083 0.1937 -0.0764 -0.0203 0.0048  168 LEU A O   
2347 C CB  . LEU A 167 ? 0.2481 0.1746 0.2062 -0.0102 -0.0491 -0.0039 168 LEU A CB  
2348 C CG  . LEU A 167 ? 0.3330 0.3514 0.2776 0.0100  -0.0722 0.0326  168 LEU A CG  
2349 C CD1 . LEU A 167 ? 0.3857 0.3794 0.3549 0.0286  -0.0755 0.0198  168 LEU A CD1 
2350 C CD2 . LEU A 167 ? 0.3381 0.4455 0.2707 -0.0014 -0.0721 0.0390  168 LEU A CD2 
2362 N N   . PHE A 168 ? 0.2020 0.1661 0.1488 -0.0430 0.0001  -0.0044 169 PHE A N   
2363 C CA  . PHE A 168 ? 0.1789 0.1346 0.1695 -0.0442 -0.0030 0.0154  169 PHE A CA  
2364 C C   . PHE A 168 ? 0.2143 0.1195 0.1699 -0.0327 -0.0135 0.0033  169 PHE A C   
2365 O O   . PHE A 168 ? 0.2486 0.1286 0.1921 -0.0144 0.0117  0.0110  169 PHE A O   
2366 C CB  . PHE A 168 ? 0.1726 0.1473 0.1780 -0.0397 -0.0053 -0.0229 169 PHE A CB  
2367 C CG  . PHE A 168 ? 0.1563 0.1360 0.1788 0.0067  0.0145  0.0074  169 PHE A CG  
2368 C CD1 . PHE A 168 ? 0.1816 0.1581 0.1976 0.0053  -0.0096 0.0235  169 PHE A CD1 
2369 C CD2 . PHE A 168 ? 0.2535 0.1929 0.2389 0.0433  0.0206  -0.0110 169 PHE A CD2 
2370 C CE1 . PHE A 168 ? 0.1807 0.1768 0.2124 0.0114  -0.0325 -0.0344 169 PHE A CE1 
2371 C CE2 . PHE A 168 ? 0.2630 0.2547 0.2485 0.0403  0.0383  -0.0278 169 PHE A CE2 
2372 C CZ  . PHE A 168 ? 0.2220 0.2171 0.2373 0.0408  0.0303  -0.0286 169 PHE A CZ  
2382 N N   . GLU A 169 ? 0.1899 0.1253 0.1638 -0.0360 0.0037  0.0227  170 GLU A N   
2383 C CA  . GLU A 169 ? 0.1600 0.1166 0.1661 -0.0232 -0.0196 0.0238  170 GLU A CA  
2384 C C   . GLU A 169 ? 0.1857 0.1269 0.1609 -0.0087 0.0088  0.0258  170 GLU A C   
2385 O O   . GLU A 169 ? 0.2025 0.1549 0.1658 -0.0239 0.0010  0.0366  170 GLU A O   
2386 C CB  . GLU A 169 ? 0.1794 0.1548 0.1945 -0.0016 -0.0187 0.0222  170 GLU A CB  
2387 C CG  . GLU A 169 ? 0.1895 0.1823 0.2240 0.0393  -0.0128 0.0359  170 GLU A CG  
2388 C CD  . GLU A 169 ? 0.2619 0.3104 0.2810 0.0641  -0.0036 0.0605  170 GLU A CD  
2389 O OE1 . GLU A 169 ? 0.3349 0.2839 0.2945 0.0060  0.0306  0.0473  170 GLU A OE1 
2390 O OE2 . GLU A 169 ? 0.2598 0.4561 0.3265 0.0487  0.0114  0.0797  170 GLU A OE2 
2397 N N   . VAL A 170 ? 0.2057 0.1352 0.1458 -0.0044 0.0097  0.0143  171 VAL A N   
2398 C CA  . VAL A 170 ? 0.2115 0.1239 0.1699 -0.0113 -0.0043 0.0247  171 VAL A CA  
2399 C C   . VAL A 170 ? 0.1984 0.1101 0.1444 -0.0006 -0.0052 0.0117  171 VAL A C   
2400 O O   . VAL A 170 ? 0.2344 0.1222 0.1406 0.0119  0.0098  0.0057  171 VAL A O   
2401 C CB  . VAL A 170 ? 0.1701 0.1067 0.1642 -0.0208 0.0044  0.0207  171 VAL A CB  
2402 C CG1 . VAL A 170 ? 0.1730 0.1693 0.1886 -0.0152 -0.0277 0.0164  171 VAL A CG1 
2403 C CG2 . VAL A 170 ? 0.1743 0.1527 0.2115 -0.0056 0.0174  0.0241  171 VAL A CG2 
2413 N N   . LYS A 171 ? 0.1976 0.1301 0.1249 -0.0215 0.0154  0.0013  172 LYS A N   
2414 C CA  . LYS A 171 ? 0.1963 0.1472 0.1434 0.0028  0.0037  0.0032  172 LYS A CA  
2415 C C   . LYS A 171 ? 0.1825 0.1208 0.1618 0.0284  -0.0022 0.0172  172 LYS A C   
2416 O O   . LYS A 171 ? 0.1735 0.1208 0.1698 -0.0049 -0.0124 0.0095  172 LYS A O   
2417 C CB  . LYS A 171 ? 0.2299 0.1725 0.1650 -0.0313 -0.0022 0.0011  172 LYS A CB  
2418 C CG  . LYS A 171 ? 0.2598 0.1854 0.1900 0.0063  0.0358  0.0173  172 LYS A CG  
2419 C CD  . LYS A 171 ? 0.2896 0.2584 0.2774 0.0148  0.0163  -0.0056 172 LYS A CD  
2420 C CE  . LYS A 171 ? 0.4153 0.4086 0.4298 0.0386  -0.0126 -0.0256 172 LYS A CE  
2421 N NZ  . LYS A 171 ? 0.4599 0.4891 0.4768 0.0790  0.0364  -0.0200 172 LYS A NZ  
2435 N N   . ILE A 172 ? 0.1796 0.1173 0.1654 -0.0022 -0.0098 -0.0020 173 ILE A N   
2436 C CA  . ILE A 172 ? 0.1975 0.1123 0.1739 -0.0110 0.0100  0.0182  173 ILE A CA  
2437 C C   . ILE A 172 ? 0.1631 0.1181 0.1846 0.0156  0.0323  0.0013  173 ILE A C   
2438 O O   . ILE A 172 ? 0.2051 0.1111 0.1893 0.0155  0.0020  -0.0112 173 ILE A O   
2439 C CB  . ILE A 172 ? 0.1754 0.0951 0.1677 -0.0009 0.0094  -0.0033 173 ILE A CB  
2440 C CG1 . ILE A 172 ? 0.1712 0.1280 0.1875 0.0059  0.0088  -0.0304 173 ILE A CG1 
2441 C CG2 . ILE A 172 ? 0.1830 0.1463 0.1710 0.0199  0.0205  -0.0147 173 ILE A CG2 
2442 C CD1 . ILE A 172 ? 0.1926 0.1373 0.2000 -0.0001 -0.0054 -0.0188 173 ILE A CD1 
2454 N N   . ASN A 173 ? 0.1828 0.1387 0.1536 -0.0110 0.0220  -0.0134 174 ASN A N   
2455 C CA  . ASN A 173 ? 0.1879 0.1625 0.1384 0.0044  0.0241  -0.0259 174 ASN A CA  
2456 C C   . ASN A 173 ? 0.2358 0.1410 0.1687 0.0131  0.0162  -0.0220 174 ASN A C   
2457 O O   . ASN A 173 ? 0.2558 0.1468 0.1776 0.0112  0.0298  -0.0346 174 ASN A O   
2458 C CB  . ASN A 173 ? 0.2372 0.1982 0.1582 0.0202  0.0308  -0.0058 174 ASN A CB  
2459 C CG  . ASN A 173 ? 0.2638 0.2042 0.1799 0.0285  0.0439  0.0286  174 ASN A CG  
2460 O OD1 . ASN A 173 ? 0.2643 0.1737 0.1606 -0.0118 0.0449  -0.0056 174 ASN A OD1 
2461 N ND2 . ASN A 173 ? 0.3248 0.2895 0.2396 0.0029  0.0652  0.0616  174 ASN A ND2 
2468 N N   . GLN A 174 ? 0.1799 0.1468 0.1610 -0.0003 -0.0023 -0.0171 175 GLN A N   
2469 C CA  . GLN A 174 ? 0.2092 0.1289 0.1671 -0.0228 -0.0155 -0.0249 175 GLN A CA  
2470 C C   . GLN A 174 ? 0.2018 0.1260 0.1585 -0.0358 0.0114  -0.0059 175 GLN A C   
2471 O O   . GLN A 174 ? 0.2239 0.1613 0.1841 -0.0166 0.0164  -0.0205 175 GLN A O   
2472 C CB  . GLN A 174 ? 0.2120 0.1497 0.1627 0.0107  0.0112  -0.0383 175 GLN A CB  
2473 C CG  . GLN A 174 ? 0.2397 0.1545 0.1500 -0.0114 -0.0195 0.0019  175 GLN A CG  
2474 C CD  . GLN A 174 ? 0.2975 0.1818 0.1630 0.0042  -0.0256 0.0208  175 GLN A CD  
2475 O OE1 . GLN A 174 ? 0.2716 0.2915 0.2134 0.0183  -0.0356 0.0594  175 GLN A OE1 
2476 N NE2 . GLN A 174 ? 0.3339 0.2123 0.1700 0.0396  0.0152  -0.0176 175 GLN A NE2 
2485 N N   . GLY A 175 ? 0.1954 0.1549 0.1502 -0.0026 0.0180  -0.0158 176 GLY A N   
2486 C CA  . GLY A 175 ? 0.1789 0.1959 0.1605 -0.0079 0.0303  -0.0103 176 GLY A CA  
2487 C C   . GLY A 175 ? 0.1703 0.2063 0.1830 -0.0090 0.0329  -0.0102 176 GLY A C   
2488 O O   . GLY A 175 ? 0.1933 0.2058 0.1965 0.0153  0.0241  -0.0048 176 GLY A O   
2492 N N   . GLY A 176 ? 0.1555 0.1914 0.1629 -0.0038 0.0377  -0.0022 177 GLY A N   
2493 C CA  . GLY A 176 ? 0.1756 0.1542 0.1441 0.0027  0.0354  -0.0127 177 GLY A CA  
2494 C C   . GLY A 176 ? 0.1609 0.1489 0.1457 -0.0166 0.0253  -0.0078 177 GLY A C   
2495 O O   . GLY A 176 ? 0.2170 0.1607 0.1701 -0.0013 0.0402  -0.0150 177 GLY A O   
2499 N N   . HIS A 177 ? 0.1713 0.1610 0.1527 -0.0365 0.0309  -0.0063 178 HIS A N   
2500 C CA  . HIS A 177 ? 0.1836 0.1363 0.1671 -0.0370 0.0049  -0.0179 178 HIS A CA  
2501 C C   . HIS A 177 ? 0.2089 0.1564 0.1502 -0.0395 0.0178  -0.0360 178 HIS A C   
2502 O O   . HIS A 177 ? 0.2255 0.1478 0.1567 -0.0255 0.0138  -0.0168 178 HIS A O   
2503 C CB  . HIS A 177 ? 0.2172 0.1764 0.1860 -0.0623 0.0068  -0.0129 178 HIS A CB  
2504 C CG  . HIS A 177 ? 0.1723 0.2164 0.1896 -0.0656 0.0029  -0.0331 178 HIS A CG  
2505 N ND1 . HIS A 177 ? 0.2254 0.2768 0.2151 -0.0720 -0.0055 -0.0523 178 HIS A ND1 
2506 C CD2 . HIS A 177 ? 0.2318 0.1801 0.1965 -0.0605 -0.0168 -0.0030 178 HIS A CD2 
2507 C CE1 . HIS A 177 ? 0.2426 0.2989 0.2345 -0.0786 -0.0091 -0.0609 178 HIS A CE1 
2508 N NE2 . HIS A 177 ? 0.2695 0.2599 0.2331 -0.0815 -0.0261 -0.0292 178 HIS A NE2 
2516 N N   . THR A 178 ? 0.2352 0.1677 0.1466 -0.0519 -0.0005 -0.0406 179 THR A N   
2517 C CA  . THR A 178 ? 0.2135 0.1928 0.1582 -0.0186 0.0152  -0.0241 179 THR A CA  
2518 C C   . THR A 178 ? 0.2252 0.1547 0.1820 -0.0173 0.0145  -0.0074 179 THR A C   
2519 O O   . THR A 178 ? 0.2438 0.1761 0.1826 -0.0512 0.0135  -0.0100 179 THR A O   
2520 C CB  . THR A 178 ? 0.2452 0.1559 0.1748 -0.0013 0.0154  -0.0284 179 THR A CB  
2521 O OG1 . THR A 178 ? 0.2445 0.1939 0.1800 -0.0343 0.0019  0.0060  179 THR A OG1 
2522 C CG2 . THR A 178 ? 0.2630 0.1333 0.2038 0.0085  0.0186  0.0087  179 THR A CG2 
2530 N N   . ILE A 179 ? 0.2041 0.1761 0.1855 -0.0460 0.0333  -0.0174 180 ILE A N   
2531 C CA  . ILE A 179 ? 0.2377 0.2424 0.2038 -0.0248 0.0246  -0.0216 180 ILE A CA  
2532 C C   . ILE A 179 ? 0.2409 0.2465 0.1917 0.0068  0.0341  -0.0086 180 ILE A C   
2533 O O   . ILE A 179 ? 0.2429 0.2986 0.2011 0.0037  0.0303  0.0154  180 ILE A O   
2534 C CB  . ILE A 179 ? 0.2567 0.2233 0.1715 -0.0407 0.0214  -0.0168 180 ILE A CB  
2535 C CG1 . ILE A 179 ? 0.2410 0.2092 0.1705 -0.0073 0.0207  -0.0288 180 ILE A CG1 
2536 C CG2 . ILE A 179 ? 0.2826 0.1910 0.1643 -0.0265 0.0157  -0.0093 180 ILE A CG2 
2537 C CD1 . ILE A 179 ? 0.2946 0.2976 0.2364 -0.0726 -0.0071 -0.0340 180 ILE A CD1 
2549 N N   . ALA A 180 ? 0.2588 0.2184 0.1793 -0.0216 0.0108  0.0205  181 ALA A N   
2550 C CA  . ALA A 180 ? 0.2694 0.2459 0.1972 -0.0241 0.0266  0.0408  181 ALA A CA  
2551 C C   . ALA A 180 ? 0.3045 0.2830 0.2249 -0.0427 -0.0322 0.0311  181 ALA A C   
2552 O O   . ALA A 180 ? 0.3632 0.3155 0.2497 -0.0302 -0.0314 0.0367  181 ALA A O   
2553 C CB  . ALA A 180 ? 0.2543 0.2885 0.1945 0.0171  0.0154  0.0103  181 ALA A CB  
2559 N N   . GLY A 181 ? 0.3529 0.2615 0.2220 -0.0758 -0.0086 0.0637  182 GLY A N   
2560 C CA  . GLY A 181 ? 0.4027 0.2925 0.2551 -0.0381 0.0105  0.0914  182 GLY A CA  
2561 C C   . GLY A 181 ? 0.4538 0.3033 0.3357 -0.0637 0.0242  0.1306  182 GLY A C   
2562 O O   . GLY A 181 ? 0.5141 0.3404 0.3805 -0.0825 0.0213  0.1353  182 GLY A O   
2566 N N   . LEU A 182 ? 0.4385 0.3767 0.3713 -0.0660 0.0525  0.1385  183 LEU A N   
2567 C CA  . LEU A 182 ? 0.3835 0.3530 0.3543 -0.0911 0.0931  0.1046  183 LEU A CA  
2568 C C   . LEU A 182 ? 0.4932 0.4652 0.4234 -0.1170 0.1200  0.0583  183 LEU A C   
2569 O O   . LEU A 182 ? 0.5535 0.4861 0.4058 -0.0994 0.0799  0.0340  183 LEU A O   
2570 C CB  . LEU A 182 ? 0.4580 0.4055 0.4370 -0.0689 0.1222  0.0782  183 LEU A CB  
2571 C CG  . LEU A 182 ? 0.4945 0.4113 0.4584 -0.0827 0.0958  0.0517  183 LEU A CG  
2572 C CD1 . LEU A 182 ? 0.4616 0.4449 0.4687 -0.0674 0.0941  0.0320  183 LEU A CD1 
2573 C CD2 . LEU A 182 ? 0.4676 0.3826 0.4598 -0.0898 0.0783  0.0440  183 LEU A CD2 
2585 N N   . SER A 183 ? 0.6161 0.5544 0.4964 -0.0971 0.1204  0.0406  184 SER A N   
2586 C CA  . SER A 183 ? 0.6466 0.5897 0.4913 -0.0938 0.1146  0.0748  184 SER A CA  
2587 C C   . SER A 183 ? 0.5856 0.5342 0.3879 -0.1120 0.0952  0.0939  184 SER A C   
2588 O O   . SER A 183 ? 0.7043 0.6452 0.5670 -0.1148 0.0731  0.1016  184 SER A O   
2589 C CB  . SER A 183 ? 0.7331 0.6633 0.6094 -0.0667 0.0948  0.0901  184 SER A CB  
2590 O OG  . SER A 183 ? 0.7377 0.6215 0.5754 -0.0636 0.0960  0.1093  184 SER A OG  
2596 N N   . LYS A 187 ? 0.5228 0.5176 0.3855 -0.0132 0.0202  0.1016  188 LYS A N   
2597 C CA  . LYS A 187 ? 0.4353 0.4253 0.3449 -0.0128 -0.0224 0.0928  188 LYS A CA  
2598 C C   . LYS A 187 ? 0.4254 0.4306 0.3460 -0.0767 -0.0570 0.0850  188 LYS A C   
2599 O O   . LYS A 187 ? 0.4393 0.4434 0.3826 -0.0847 -0.0514 0.1468  188 LYS A O   
2600 C CB  . LYS A 187 ? 0.4359 0.3960 0.3364 -0.0056 -0.0404 0.1127  188 LYS A CB  
2601 C CG  . LYS A 187 ? 0.4678 0.4027 0.2946 0.0174  -0.0480 0.1099  188 LYS A CG  
2602 C CD  . LYS A 187 ? 0.5047 0.4686 0.3607 0.0008  -0.0412 0.1066  188 LYS A CD  
2603 C CE  . LYS A 187 ? 0.5060 0.5166 0.4052 -0.0294 -0.0443 0.0991  188 LYS A CE  
2604 N NZ  . LYS A 187 ? 0.4215 0.4614 0.3218 -0.0794 -0.0552 0.1193  188 LYS A NZ  
2618 N N   . GLU A 188 ? 0.3136 0.3625 0.2352 -0.0537 -0.0221 0.0376  189 GLU A N   
2619 C CA  . GLU A 188 ? 0.3173 0.3108 0.2360 -0.0810 -0.0718 0.0118  189 GLU A CA  
2620 C C   . GLU A 188 ? 0.2596 0.2136 0.1727 -0.0673 -0.0298 0.0413  189 GLU A C   
2621 O O   . GLU A 188 ? 0.2542 0.1975 0.1938 -0.0236 0.0042  0.0084  189 GLU A O   
2622 C CB  . GLU A 188 ? 0.2999 0.2558 0.2502 -0.0790 -0.0350 0.0281  189 GLU A CB  
2623 C CG  . GLU A 188 ? 0.3351 0.2956 0.2519 0.0154  -0.0230 0.0320  189 GLU A CG  
2624 C CD  . GLU A 188 ? 0.4523 0.4191 0.3157 0.0170  0.0024  0.0236  189 GLU A CD  
2625 O OE1 . GLU A 188 ? 0.4390 0.4269 0.3341 -0.0747 0.0555  0.0091  189 GLU A OE1 
2626 O OE2 . GLU A 188 ? 0.5052 0.5005 0.3601 0.0747  -0.0402 0.0285  189 GLU A OE2 
2633 N N   . ALA A 189 ? 0.2585 0.2039 0.2081 -0.0371 -0.0415 0.0138  190 ALA A N   
2634 C CA  . ALA A 189 ? 0.2346 0.1771 0.1973 -0.0408 -0.0158 0.0161  190 ALA A CA  
2635 C C   . ALA A 189 ? 0.1994 0.1444 0.1735 -0.0423 -0.0012 0.0263  190 ALA A C   
2636 O O   . ALA A 189 ? 0.2265 0.1728 0.1718 -0.0336 0.0243  0.0174  190 ALA A O   
2637 C CB  . ALA A 189 ? 0.2654 0.2245 0.2305 -0.0499 0.0036  0.0392  190 ALA A CB  
2643 N N   . GLU A 190 ? 0.1890 0.1862 0.1650 -0.0360 0.0063  0.0000  191 GLU A N   
2644 C CA  . GLU A 190 ? 0.2003 0.1578 0.1563 0.0125  -0.0052 -0.0153 191 GLU A CA  
2645 C C   . GLU A 190 ? 0.2008 0.1379 0.1854 -0.0215 0.0020  -0.0012 191 GLU A C   
2646 O O   . GLU A 190 ? 0.2101 0.1413 0.1667 -0.0251 -0.0077 -0.0111 191 GLU A O   
2647 C CB  . GLU A 190 ? 0.2555 0.1842 0.1611 -0.0203 0.0064  -0.0272 191 GLU A CB  
2648 C CG  . GLU A 190 ? 0.2293 0.2131 0.2115 -0.0054 0.0373  -0.0006 191 GLU A CG  
2649 C CD  . GLU A 190 ? 0.2464 0.2255 0.2378 -0.0014 0.0330  0.0390  191 GLU A CD  
2650 O OE1 . GLU A 190 ? 0.2740 0.2755 0.2253 -0.0131 0.0186  0.0016  191 GLU A OE1 
2651 O OE2 . GLU A 190 ? 0.3062 0.2952 0.2973 0.0067  0.0312  0.0084  191 GLU A OE2 
2658 N N   . VAL A 191 ? 0.1850 0.1455 0.1498 0.0006  0.0021  0.0034  192 VAL A N   
2659 C CA  . VAL A 191 ? 0.1861 0.1244 0.1493 -0.0305 0.0003  0.0033  192 VAL A CA  
2660 C C   . VAL A 191 ? 0.1919 0.1263 0.1508 -0.0433 0.0168  -0.0145 192 VAL A C   
2661 O O   . VAL A 191 ? 0.1775 0.1487 0.1701 -0.0071 -0.0099 -0.0138 192 VAL A O   
2662 C CB  . VAL A 191 ? 0.1836 0.1396 0.1384 -0.0040 0.0152  -0.0075 192 VAL A CB  
2663 C CG1 . VAL A 191 ? 0.1843 0.1459 0.1430 -0.0282 0.0270  0.0124  192 VAL A CG1 
2664 C CG2 . VAL A 191 ? 0.1842 0.1760 0.1651 -0.0018 0.0068  -0.0250 192 VAL A CG2 
2674 N N   . LEU A 192 ? 0.2016 0.1181 0.1466 -0.0425 0.0280  -0.0178 193 LEU A N   
2675 C CA  . LEU A 192 ? 0.1635 0.1116 0.1635 -0.0124 0.0294  0.0122  193 LEU A CA  
2676 C C   . LEU A 192 ? 0.1443 0.1652 0.1543 -0.0095 0.0145  -0.0082 193 LEU A C   
2677 O O   . LEU A 192 ? 0.1690 0.1741 0.1535 -0.0189 0.0258  -0.0065 193 LEU A O   
2678 C CB  . LEU A 192 ? 0.1657 0.1973 0.1844 -0.0296 0.0237  0.0180  193 LEU A CB  
2679 C CG  . LEU A 192 ? 0.1925 0.2459 0.2588 -0.0151 0.0365  0.0000  193 LEU A CG  
2680 C CD1 . LEU A 192 ? 0.2654 0.1949 0.2603 -0.0106 0.0807  -0.0257 193 LEU A CD1 
2681 C CD2 . LEU A 192 ? 0.2036 0.2944 0.2980 -0.0365 0.0778  -0.0111 193 LEU A CD2 
2693 N N   . PHE A 193 ? 0.1471 0.1616 0.1575 -0.0161 0.0150  -0.0209 194 PHE A N   
2694 C CA  . PHE A 193 ? 0.1638 0.1461 0.1561 -0.0090 0.0198  -0.0153 194 PHE A CA  
2695 C C   . PHE A 193 ? 0.1498 0.1529 0.1458 0.0050  0.0076  -0.0142 194 PHE A C   
2696 O O   . PHE A 193 ? 0.1572 0.1763 0.1477 0.0146  0.0088  -0.0013 194 PHE A O   
2697 C CB  . PHE A 193 ? 0.1488 0.1590 0.1510 -0.0220 0.0113  -0.0130 194 PHE A CB  
2698 C CG  . PHE A 193 ? 0.1082 0.1600 0.1488 0.0104  0.0282  -0.0201 194 PHE A CG  
2699 C CD1 . PHE A 193 ? 0.1229 0.1801 0.1613 0.0036  0.0017  -0.0023 194 PHE A CD1 
2700 C CD2 . PHE A 193 ? 0.1366 0.1498 0.1422 -0.0042 0.0199  -0.0281 194 PHE A CD2 
2701 C CE1 . PHE A 193 ? 0.1288 0.2008 0.1646 -0.0011 0.0049  -0.0079 194 PHE A CE1 
2702 C CE2 . PHE A 193 ? 0.1414 0.1682 0.1632 0.0023  0.0320  0.0047  194 PHE A CE2 
2703 C CZ  . PHE A 193 ? 0.1159 0.1937 0.1665 0.0196  0.0268  -0.0043 194 PHE A CZ  
2713 N N   . ALA A 194 ? 0.1446 0.1684 0.1695 -0.0168 0.0087  -0.0067 195 ALA A N   
2714 C CA  . ALA A 194 ? 0.1393 0.1712 0.1474 0.0195  0.0099  -0.0126 195 ALA A CA  
2715 C C   . ALA A 194 ? 0.1254 0.1697 0.1583 0.0222  -0.0056 -0.0057 195 ALA A C   
2716 O O   . ALA A 194 ? 0.1484 0.1810 0.1690 0.0073  0.0161  -0.0015 195 ALA A O   
2717 C CB  . ALA A 194 ? 0.1747 0.1992 0.1776 -0.0170 -0.0133 -0.0192 195 ALA A CB  
2723 N N   . PRO A 195 ? 0.1268 0.1827 0.1591 -0.0133 0.0067  0.0067  196 PRO A N   
2724 C CA  . PRO A 195 ? 0.1287 0.1449 0.1585 -0.0251 0.0266  -0.0069 196 PRO A CA  
2725 C C   . PRO A 195 ? 0.1019 0.1871 0.1735 -0.0227 -0.0031 -0.0150 196 PRO A C   
2726 O O   . PRO A 195 ? 0.1764 0.1990 0.1668 -0.0235 0.0030  -0.0110 196 PRO A O   
2727 C CB  . PRO A 195 ? 0.1490 0.2259 0.1772 -0.0042 0.0417  -0.0262 196 PRO A CB  
2728 C CG  . PRO A 195 ? 0.1322 0.2366 0.1744 -0.0166 0.0442  -0.0313 196 PRO A CG  
2729 C CD  . PRO A 195 ? 0.1194 0.2038 0.1799 0.0122  0.0268  -0.0077 196 PRO A CD  
2737 N N   . ASN A 196 ? 0.1347 0.1977 0.1724 -0.0286 0.0169  -0.0114 197 ASN A N   
2738 C CA  . ASN A 196 ? 0.1350 0.2005 0.1771 -0.0026 0.0269  0.0164  197 ASN A CA  
2739 C C   . ASN A 196 ? 0.1494 0.2121 0.1733 0.0066  0.0217  0.0185  197 ASN A C   
2740 O O   . ASN A 196 ? 0.1896 0.2301 0.1619 -0.0078 0.0219  0.0164  197 ASN A O   
2741 C CB  . ASN A 196 ? 0.1623 0.2470 0.2165 -0.0078 -0.0037 -0.0011 197 ASN A CB  
2742 C CG  . ASN A 196 ? 0.3355 0.4566 0.3975 -0.0077 0.0271  -0.0050 197 ASN A CG  
2743 O OD1 . ASN A 196 ? 0.5234 0.6068 0.5752 0.0035  -0.0165 -0.0178 197 ASN A OD1 
2744 N ND2 . ASN A 196 ? 0.3654 0.4885 0.4158 0.0151  0.0718  0.0251  197 ASN A ND2 
2751 N N   . ALA A 197 ? 0.1457 0.1802 0.1563 -0.0058 0.0254  0.0123  198 ALA A N   
2752 C CA  . ALA A 197 ? 0.1755 0.1431 0.1364 -0.0180 0.0263  0.0131  198 ALA A CA  
2753 C C   . ALA A 197 ? 0.1766 0.0958 0.1391 -0.0036 0.0217  -0.0127 198 ALA A C   
2754 O O   . ALA A 197 ? 0.1776 0.1388 0.1443 0.0011  0.0284  -0.0336 198 ALA A O   
2755 C CB  . ALA A 197 ? 0.2041 0.1915 0.1598 -0.0028 0.0482  0.0274  198 ALA A CB  
2761 N N   . HIS A 198 ? 0.1607 0.1479 0.1418 -0.0071 0.0172  -0.0019 199 HIS A N   
2762 C CA  . HIS A 198 ? 0.1640 0.1543 0.1363 0.0023  0.0222  0.0057  199 HIS A CA  
2763 C C   . HIS A 198 ? 0.1682 0.1475 0.1379 0.0001  0.0157  -0.0218 199 HIS A C   
2764 O O   . HIS A 198 ? 0.1578 0.1624 0.1561 -0.0062 0.0061  -0.0170 199 HIS A O   
2765 C CB  . HIS A 198 ? 0.1725 0.1712 0.1476 0.0003  0.0076  0.0226  199 HIS A CB  
2766 C CG  . HIS A 198 ? 0.1481 0.2109 0.1707 -0.0058 -0.0198 0.0010  199 HIS A CG  
2767 N ND1 . HIS A 198 ? 0.1777 0.2388 0.2142 0.0285  -0.0401 0.0026  199 HIS A ND1 
2768 C CD2 . HIS A 198 ? 0.1847 0.2200 0.1985 -0.0041 -0.0327 0.0550  199 HIS A CD2 
2769 C CE1 . HIS A 198 ? 0.1661 0.2219 0.1940 0.0016  -0.0336 0.0177  199 HIS A CE1 
2770 N NE2 . HIS A 198 ? 0.2513 0.2414 0.2445 -0.0353 -0.0611 0.0132  199 HIS A NE2 
2778 N N   . PHE A 199 ? 0.1255 0.1327 0.1232 0.0091  0.0191  -0.0134 200 PHE A N   
2779 C CA  . PHE A 199 ? 0.1727 0.1111 0.1589 0.0013  0.0218  -0.0037 200 PHE A CA  
2780 C C   . PHE A 199 ? 0.1771 0.1216 0.1666 -0.0130 0.0252  -0.0215 200 PHE A C   
2781 O O   . PHE A 199 ? 0.1840 0.1291 0.2115 -0.0060 0.0384  -0.0195 200 PHE A O   
2782 C CB  . PHE A 199 ? 0.1409 0.1776 0.1524 -0.0251 0.0113  0.0176  200 PHE A CB  
2783 C CG  . PHE A 199 ? 0.1310 0.1669 0.1661 -0.0020 0.0235  -0.0300 200 PHE A CG  
2784 C CD1 . PHE A 199 ? 0.1380 0.2089 0.1733 0.0048  0.0346  -0.0227 200 PHE A CD1 
2785 C CD2 . PHE A 199 ? 0.1554 0.1741 0.1725 -0.0035 0.0253  -0.0067 200 PHE A CD2 
2786 C CE1 . PHE A 199 ? 0.1384 0.2201 0.1652 -0.0344 0.0290  0.0039  200 PHE A CE1 
2787 C CE2 . PHE A 199 ? 0.1530 0.1915 0.1738 0.0115  0.0306  0.0097  200 PHE A CE2 
2788 C CZ  . PHE A 199 ? 0.1517 0.2040 0.1456 -0.0194 0.0032  0.0031  200 PHE A CZ  
2798 N N   . ARG A 200 ? 0.1576 0.1001 0.1460 -0.0115 0.0218  0.0150  201 ARG A N   
2799 C CA  . ARG A 200 ? 0.1791 0.1122 0.1368 -0.0095 0.0081  0.0071  201 ARG A CA  
2800 C C   . ARG A 200 ? 0.1584 0.1621 0.1253 -0.0151 0.0231  0.0156  201 ARG A C   
2801 O O   . ARG A 200 ? 0.1582 0.1410 0.1432 0.0098  0.0117  0.0035  201 ARG A O   
2802 C CB  . ARG A 200 ? 0.2129 0.1572 0.1250 -0.0022 0.0129  -0.0114 201 ARG A CB  
2803 C CG  . ARG A 200 ? 0.2928 0.1576 0.1289 0.0034  0.0078  0.0257  201 ARG A CG  
2804 C CD  . ARG A 200 ? 0.4066 0.3359 0.2847 -0.0461 0.0523  0.0683  201 ARG A CD  
2805 N NE  . ARG A 200 ? 0.5949 0.5478 0.4709 -0.0169 0.0386  0.0262  201 ARG A NE  
2806 C CZ  . ARG A 200 ? 0.6826 0.6009 0.5470 -0.0023 -0.0212 0.0209  201 ARG A CZ  
2807 N NH1 . ARG A 200 ? 0.7390 0.7003 0.6405 0.0352  -0.0141 0.0156  201 ARG A NH1 
2808 N NH2 . ARG A 200 ? 0.6404 0.4101 0.4159 0.0077  -0.0427 0.0183  201 ARG A NH2 
2822 N N   . ILE A 201 ? 0.1479 0.1606 0.1330 0.0079  0.0278  0.0136  202 ILE A N   
2823 C CA  . ILE A 201 ? 0.1459 0.1363 0.1343 0.0010  0.0239  0.0321  202 ILE A CA  
2824 C C   . ILE A 201 ? 0.1758 0.1395 0.1489 -0.0043 0.0170  0.0274  202 ILE A C   
2825 O O   . ILE A 201 ? 0.1919 0.1518 0.1649 -0.0025 0.0324  0.0247  202 ILE A O   
2826 C CB  . ILE A 201 ? 0.1712 0.1291 0.1472 -0.0145 0.0100  0.0168  202 ILE A CB  
2827 C CG1 . ILE A 201 ? 0.1850 0.1426 0.1483 -0.0030 0.0064  0.0031  202 ILE A CG1 
2828 C CG2 . ILE A 201 ? 0.1819 0.1578 0.1659 -0.0118 -0.0051 0.0122  202 ILE A CG2 
2829 C CD1 . ILE A 201 ? 0.2187 0.1447 0.1746 -0.0124 -0.0030 -0.0111 202 ILE A CD1 
2841 N N   . THR A 202 ? 0.1599 0.1762 0.1339 0.0175  0.0302  0.0237  203 THR A N   
2842 C CA  . THR A 202 ? 0.1831 0.1960 0.1925 -0.0002 0.0556  0.0527  203 THR A CA  
2843 C C   . THR A 202 ? 0.1951 0.2373 0.1969 -0.0060 0.0436  0.0444  203 THR A C   
2844 O O   . THR A 202 ? 0.1851 0.2667 0.2161 -0.0021 0.0529  0.0331  203 THR A O   
2845 C CB  . THR A 202 ? 0.2313 0.1745 0.2094 -0.0024 0.0389  0.0414  203 THR A CB  
2846 O OG1 . THR A 202 ? 0.2468 0.2046 0.2588 0.0505  0.0128  0.0243  203 THR A OG1 
2847 C CG2 . THR A 202 ? 0.3165 0.1666 0.2182 0.0235  0.0828  -0.0062 203 THR A CG2 
2855 N N   . GLN A 203 ? 0.1435 0.2135 0.2156 0.0053  0.0396  0.0291  204 GLN A N   
2856 C CA  . GLN A 203 ? 0.1549 0.2097 0.2322 -0.0237 0.0154  0.0395  204 GLN A CA  
2857 C C   . GLN A 203 ? 0.1585 0.1849 0.2414 -0.0534 -0.0049 0.0519  204 GLN A C   
2858 O O   . GLN A 203 ? 0.1733 0.1765 0.2277 -0.0428 0.0057  0.0576  204 GLN A O   
2859 C CB  . GLN A 203 ? 0.2009 0.3537 0.3290 -0.0030 0.0067  0.0151  204 GLN A CB  
2860 C CG  . GLN A 203 ? 0.3134 0.4073 0.4274 0.0420  0.0042  0.0223  204 GLN A CG  
2861 C CD  . GLN A 203 ? 0.4072 0.5209 0.5547 0.0236  -0.0363 0.0307  204 GLN A CD  
2862 O OE1 . GLN A 203 ? 0.4238 0.5463 0.5748 -0.0066 -0.0566 0.0351  204 GLN A OE1 
2863 N NE2 . GLN A 203 ? 0.3979 0.5056 0.5591 0.0890  -0.0476 0.0375  204 GLN A NE2 
2872 N N   . ILE A 204 ? 0.1763 0.2435 0.2466 -0.0400 -0.0192 0.0336  205 ILE A N   
2873 C CA  . ILE A 204 ? 0.1677 0.2054 0.2355 -0.0461 -0.0310 0.0479  205 ILE A CA  
2874 C C   . ILE A 204 ? 0.1981 0.3034 0.2941 -0.0577 -0.0296 0.0726  205 ILE A C   
2875 O O   . ILE A 204 ? 0.2040 0.3328 0.3046 -0.0972 -0.0250 0.0854  205 ILE A O   
2876 C CB  . ILE A 204 ? 0.1707 0.2149 0.2504 -0.0443 -0.0496 0.0508  205 ILE A CB  
2877 C CG1 . ILE A 204 ? 0.2033 0.2248 0.2677 -0.0313 -0.0186 0.0451  205 ILE A CG1 
2878 C CG2 . ILE A 204 ? 0.2589 0.2276 0.2950 -0.0384 -0.0855 0.0180  205 ILE A CG2 
2879 C CD1 . ILE A 204 ? 0.2126 0.2583 0.2862 -0.0258 -0.0217 0.0402  205 ILE A CD1 
2891 N N   . GLU A 205 ? 0.1589 0.2682 0.2892 -0.0707 -0.0487 0.0673  206 GLU A N   
2892 C CA  . GLU A 205 ? 0.1807 0.2931 0.3226 -0.0749 -0.0604 0.0950  206 GLU A CA  
2893 C C   . GLU A 205 ? 0.2179 0.2351 0.3325 -0.0778 -0.0867 0.1049  206 GLU A C   
2894 O O   . GLU A 205 ? 0.2812 0.2504 0.3518 -0.1092 -0.0768 0.0491  206 GLU A O   
2895 C CB  . GLU A 205 ? 0.1890 0.3349 0.3741 -0.0687 -0.0661 0.0879  206 GLU A CB  
2896 C CG  . GLU A 205 ? 0.2194 0.3488 0.3980 -0.0028 -0.0972 0.0896  206 GLU A CG  
2897 C CD  . GLU A 205 ? 0.3737 0.4811 0.4943 0.0162  -0.1221 0.0765  206 GLU A CD  
2898 O OE1 . GLU A 205 ? 0.3596 0.4434 0.4294 -0.0438 -0.0994 0.0624  206 GLU A OE1 
2899 O OE2 . GLU A 205 ? 0.4153 0.5094 0.4879 0.0511  -0.1019 0.0564  206 GLU A OE2 
2906 N N   A ARG A 206 ? 0.2650 0.2707 0.3671 -0.0974 -0.0898 0.1079  207 ARG A N   
2907 N N   B ARG A 206 ? 0.2500 0.2626 0.3657 -0.0899 -0.0999 0.1236  207 ARG A N   
2908 C CA  A ARG A 206 ? 0.3328 0.3201 0.3963 -0.1011 -0.0986 0.0491  207 ARG A CA  
2909 C CA  B ARG A 206 ? 0.3255 0.3159 0.4066 -0.0947 -0.1112 0.0588  207 ARG A CA  
2910 C C   A ARG A 206 ? 0.3924 0.3661 0.4480 -0.1405 -0.0904 -0.0066 207 ARG A C   
2911 C C   B ARG A 206 ? 0.3909 0.3666 0.4512 -0.1389 -0.0886 -0.0048 207 ARG A C   
2912 O O   A ARG A 206 ? 0.4352 0.3972 0.4901 -0.1610 -0.0641 -0.0321 207 ARG A O   
2913 O O   B ARG A 206 ? 0.4280 0.3858 0.4811 -0.1598 -0.0579 -0.0354 207 ARG A O   
2914 C CB  A ARG A 206 ? 0.3777 0.3477 0.4153 -0.0814 -0.0851 0.0404  207 ARG A CB  
2915 C CB  B ARG A 206 ? 0.3916 0.3670 0.4539 -0.0698 -0.0958 0.0378  207 ARG A CB  
2916 C CG  A ARG A 206 ? 0.4183 0.3505 0.4434 -0.0945 -0.0737 0.0279  207 ARG A CG  
2917 C CG  B ARG A 206 ? 0.4675 0.4015 0.4983 -0.0781 -0.0853 0.0088  207 ARG A CG  
2918 C CD  A ARG A 206 ? 0.4140 0.3756 0.4587 -0.0762 -0.0614 0.0211  207 ARG A CD  
2919 C CD  B ARG A 206 ? 0.4921 0.4361 0.5286 -0.0727 -0.0746 -0.0124 207 ARG A CD  
2920 N NE  A ARG A 206 ? 0.3266 0.3070 0.3354 -0.0354 -0.0378 0.0321  207 ARG A NE  
2921 N NE  B ARG A 206 ? 0.4530 0.4112 0.4967 -0.0812 -0.0658 -0.0178 207 ARG A NE  
2922 C CZ  A ARG A 206 ? 0.2905 0.2631 0.3064 -0.0244 -0.0194 0.0398  207 ARG A CZ  
2923 C CZ  B ARG A 206 ? 0.4219 0.3712 0.4644 -0.0920 -0.0550 -0.0295 207 ARG A CZ  
2924 N NH1 A ARG A 206 ? 0.3122 0.2030 0.3012 -0.0695 -0.0228 0.0935  207 ARG A NH1 
2925 N NH1 B ARG A 206 ? 0.4327 0.4016 0.4695 -0.0581 -0.0766 -0.0251 207 ARG A NH1 
2926 N NH2 A ARG A 206 ? 0.2027 0.2202 0.2467 -0.0125 -0.0115 -0.0151 207 ARG A NH2 
2927 N NH2 B ARG A 206 ? 0.3876 0.3809 0.4534 -0.1265 -0.0502 -0.0371 207 ARG A NH2 
2954 N N   . THR A 207 ? 0.3544 0.3062 0.3921 -0.1336 -0.1172 -0.0228 208 THR A N   
2955 C CA  . THR A 207 ? 0.3975 0.3883 0.4541 -0.1607 -0.1215 -0.0160 208 THR A CA  
2956 C C   . THR A 207 ? 0.4435 0.3810 0.4877 -0.1597 -0.1362 -0.0288 208 THR A C   
2957 O O   . THR A 207 ? 0.4819 0.4219 0.5212 -0.1157 -0.1576 -0.0408 208 THR A O   
2958 C CB  . THR A 207 ? 0.3603 0.4342 0.4680 -0.1151 -0.1161 -0.0029 208 THR A CB  
2959 O OG1 . THR A 207 ? 0.4134 0.4794 0.4977 -0.1354 -0.1100 0.0377  208 THR A OG1 
2960 C CG2 . THR A 207 ? 0.3514 0.4625 0.4877 -0.1159 -0.0972 -0.0213 208 THR A CG2 
2969 N N   . SER A 208 ? 0.5016 0.4525 0.5416 -0.1922 -0.1225 -0.0210 209 SER A N   
2970 C CA  . SER A 208 ? 0.5368 0.4823 0.5577 -0.2032 -0.1152 -0.0465 209 SER A CA  
2971 C C   . SER A 208 ? 0.5772 0.5318 0.5773 -0.1585 -0.1127 -0.0481 209 SER A C   
2972 O O   . SER A 208 ? 0.6728 0.6246 0.6610 -0.1226 -0.0897 -0.0351 209 SER A O   
2973 C CB  . SER A 208 ? 0.6096 0.5328 0.6166 -0.1911 -0.0995 -0.0595 209 SER A CB  
2974 O OG  . SER A 208 ? 0.7163 0.6391 0.7392 -0.1325 -0.0789 -0.0579 209 SER A OG  
2980 N N   . ASN A 209 ? 0.4882 0.4118 0.4965 -0.1703 -0.1284 -0.0657 210 ASN A N   
2981 C CA  . ASN A 209 ? 0.4895 0.4778 0.5170 -0.1787 -0.1278 -0.0466 210 ASN A CA  
2982 C C   . ASN A 209 ? 0.4554 0.4629 0.4532 -0.1451 -0.1480 -0.0529 210 ASN A C   
2983 O O   . ASN A 209 ? 0.4589 0.4886 0.4253 -0.1066 -0.1584 -0.0471 210 ASN A O   
2984 C CB  . ASN A 209 ? 0.4817 0.5496 0.5336 -0.1728 -0.1366 -0.0265 210 ASN A CB  
2985 C CG  . ASN A 209 ? 0.6443 0.6835 0.6530 -0.1371 -0.1302 -0.0348 210 ASN A CG  
2986 O OD1 . ASN A 209 ? 0.7177 0.7177 0.7087 -0.1215 -0.1179 -0.0404 210 ASN A OD1 
2987 N ND2 . ASN A 209 ? 0.5972 0.6604 0.6301 -0.1356 -0.1453 -0.0405 210 ASN A ND2 
2994 N N   . HIS A 210 ? 0.4064 0.4128 0.3897 -0.1411 -0.1338 -0.0352 211 HIS A N   
2995 C CA  . HIS A 210 ? 0.3907 0.3612 0.3472 -0.0884 -0.1181 -0.0129 211 HIS A CA  
2996 C C   . HIS A 210 ? 0.3774 0.2751 0.2877 -0.0770 -0.1028 0.0080  211 HIS A C   
2997 O O   . HIS A 210 ? 0.3929 0.2945 0.3122 -0.1042 -0.1283 -0.0108 211 HIS A O   
2998 C CB  . HIS A 210 ? 0.3527 0.3950 0.3764 -0.0739 -0.1061 -0.0142 211 HIS A CB  
2999 C CG  . HIS A 210 ? 0.3594 0.4341 0.4020 -0.0668 -0.1040 -0.0072 211 HIS A CG  
3000 N ND1 . HIS A 210 ? 0.3539 0.4377 0.4265 -0.0500 -0.0774 -0.0046 211 HIS A ND1 
3001 C CD2 . HIS A 210 ? 0.3611 0.4594 0.4069 -0.0914 -0.1285 -0.0156 211 HIS A CD2 
3002 C CE1 . HIS A 210 ? 0.4068 0.4611 0.4280 -0.0570 -0.1166 0.0078  211 HIS A CE1 
3003 N NE2 . HIS A 210 ? 0.3948 0.4702 0.4116 -0.0699 -0.1378 0.0082  211 HIS A NE2 
3011 N N   . THR A 211 ? 0.3633 0.2558 0.2920 -0.0455 -0.0795 0.0168  212 THR A N   
3012 C CA  . THR A 211 ? 0.2580 0.1952 0.3028 -0.0047 -0.0870 -0.0180 212 THR A CA  
3013 C C   . THR A 211 ? 0.2293 0.2103 0.2894 -0.0633 -0.0404 -0.0109 212 THR A C   
3014 O O   . THR A 211 ? 0.2578 0.2157 0.2691 -0.0608 -0.0050 -0.0172 212 THR A O   
3015 C CB  . THR A 211 ? 0.2775 0.1923 0.3491 -0.0349 -0.0678 -0.0713 212 THR A CB  
3016 O OG1 . THR A 211 ? 0.3433 0.2525 0.4242 -0.0712 -0.0888 -0.0550 212 THR A OG1 
3017 C CG2 . THR A 211 ? 0.3021 0.2779 0.4043 -0.0567 -0.0836 -0.0669 212 THR A CG2 
3025 N N   . TYR A 212 ? 0.2183 0.1803 0.2294 -0.0517 -0.0523 0.0118  213 TYR A N   
3026 C CA  . TYR A 212 ? 0.2101 0.1624 0.2090 -0.0119 -0.0652 0.0162  213 TYR A CA  
3027 C C   . TYR A 212 ? 0.2172 0.1653 0.2145 -0.0495 -0.0499 0.0308  213 TYR A C   
3028 O O   . TYR A 212 ? 0.2327 0.1871 0.2227 -0.0655 -0.0304 0.0479  213 TYR A O   
3029 C CB  . TYR A 212 ? 0.2250 0.2528 0.2390 -0.0290 -0.0504 0.0166  213 TYR A CB  
3030 C CG  . TYR A 212 ? 0.2396 0.3345 0.2534 -0.0059 -0.0554 0.0311  213 TYR A CG  
3031 C CD1 . TYR A 212 ? 0.2490 0.3433 0.2460 -0.0186 -0.0899 0.0666  213 TYR A CD1 
3032 C CD2 . TYR A 212 ? 0.2725 0.4161 0.2821 -0.0161 -0.0802 0.0443  213 TYR A CD2 
3033 C CE1 . TYR A 212 ? 0.2959 0.4121 0.3041 0.0105  -0.1039 0.0696  213 TYR A CE1 
3034 C CE2 . TYR A 212 ? 0.3438 0.4219 0.3331 0.0098  -0.0928 0.0899  213 TYR A CE2 
3035 C CZ  . TYR A 212 ? 0.2960 0.3922 0.3047 0.0536  -0.1036 0.0792  213 TYR A CZ  
3036 O OH  . TYR A 212 ? 0.4004 0.4859 0.3543 0.0404  -0.1286 0.0902  213 TYR A OH  
3046 N N   . ILE A 213 ? 0.1901 0.1578 0.1741 -0.0355 -0.0472 0.0153  214 ILE A N   
3047 C CA  . ILE A 213 ? 0.1985 0.1232 0.1803 -0.0119 -0.0387 0.0275  214 ILE A CA  
3048 C C   . ILE A 213 ? 0.1748 0.1197 0.1471 -0.0130 -0.0014 0.0392  214 ILE A C   
3049 O O   . ILE A 213 ? 0.1973 0.1270 0.1724 -0.0231 0.0086  0.0323  214 ILE A O   
3050 C CB  . ILE A 213 ? 0.1818 0.1219 0.1962 -0.0063 -0.0476 0.0197  214 ILE A CB  
3051 C CG1 . ILE A 213 ? 0.2667 0.1638 0.2075 0.0132  -0.0525 0.0416  214 ILE A CG1 
3052 C CG2 . ILE A 213 ? 0.2017 0.1716 0.2453 -0.0071 -0.0514 0.0432  214 ILE A CG2 
3053 C CD1 . ILE A 213 ? 0.3105 0.2004 0.1940 0.0343  -0.0527 0.0147  214 ILE A CD1 
3065 N N   . GLY A 214 ? 0.1644 0.1408 0.1608 -0.0208 0.0175  0.0232  215 GLY A N   
3066 C CA  . GLY A 214 ? 0.1642 0.1561 0.1428 -0.0302 0.0131  0.0137  215 GLY A CA  
3067 C C   . GLY A 214 ? 0.1677 0.1445 0.1521 -0.0034 0.0004  0.0264  215 GLY A C   
3068 O O   . GLY A 214 ? 0.1792 0.1585 0.1595 -0.0153 0.0045  0.0363  215 GLY A O   
3072 N N   . VAL A 215 ? 0.1591 0.1519 0.1522 -0.0001 -0.0013 0.0128  216 VAL A N   
3073 C CA  . VAL A 215 ? 0.1562 0.1145 0.1331 -0.0005 0.0122  0.0039  216 VAL A CA  
3074 C C   . VAL A 215 ? 0.1731 0.1155 0.1366 0.0152  0.0171  0.0196  216 VAL A C   
3075 O O   . VAL A 215 ? 0.2213 0.1210 0.1587 -0.0029 -0.0166 0.0173  216 VAL A O   
3076 C CB  . VAL A 215 ? 0.1467 0.1269 0.1606 0.0046  0.0139  0.0107  216 VAL A CB  
3077 C CG1 . VAL A 215 ? 0.1583 0.1414 0.1973 -0.0161 0.0323  0.0248  216 VAL A CG1 
3078 C CG2 . VAL A 215 ? 0.1498 0.1566 0.1798 0.0146  0.0311  0.0262  216 VAL A CG2 
3088 N N   . GLU A 216 ? 0.1736 0.1124 0.1285 0.0068  0.0103  0.0031  217 GLU A N   
3089 C CA  . GLU A 216 ? 0.1837 0.1101 0.1511 0.0240  0.0135  0.0024  217 GLU A CA  
3090 C C   . GLU A 216 ? 0.1981 0.1017 0.1288 0.0245  0.0142  0.0030  217 GLU A C   
3091 O O   . GLU A 216 ? 0.1976 0.1091 0.1508 0.0131  0.0125  -0.0067 217 GLU A O   
3092 C CB  . GLU A 216 ? 0.2062 0.1404 0.1916 0.0108  0.0204  -0.0020 217 GLU A CB  
3093 C CG  . GLU A 216 ? 0.3257 0.2173 0.2627 0.0099  0.0313  0.0079  217 GLU A CG  
3094 C CD  . GLU A 216 ? 0.5082 0.4231 0.4014 0.0672  0.1041  -0.0194 217 GLU A CD  
3095 O OE1 . GLU A 216 ? 0.5610 0.4025 0.3276 0.0387  0.1117  -0.0002 217 GLU A OE1 
3096 O OE2 . GLU A 216 ? 0.5967 0.4707 0.4338 0.1401  0.0992  -0.0022 217 GLU A OE2 
3103 N N   . THR A 217 ? 0.1898 0.1049 0.1213 0.0245  0.0022  -0.0026 218 THR A N   
3104 C CA  . THR A 217 ? 0.1674 0.1105 0.1206 0.0131  -0.0020 0.0037  218 THR A CA  
3105 C C   . THR A 217 ? 0.2347 0.1394 0.1527 -0.0036 -0.0081 0.0056  218 THR A C   
3106 O O   . THR A 217 ? 0.2185 0.1385 0.1798 0.0008  -0.0112 -0.0144 218 THR A O   
3107 C CB  . THR A 217 ? 0.2135 0.1088 0.1425 0.0096  -0.0121 -0.0023 218 THR A CB  
3108 O OG1 . THR A 217 ? 0.1939 0.1186 0.1525 0.0019  0.0268  0.0069  218 THR A OG1 
3109 C CG2 . THR A 217 ? 0.2101 0.1198 0.1419 0.0173  0.0021  0.0046  218 THR A CG2 
3117 N N   . VAL A 218 ? 0.2138 0.1442 0.0969 0.0042  0.0134  0.0101  219 VAL A N   
3118 C CA  . VAL A 218 ? 0.2105 0.1207 0.1093 0.0374  0.0043  0.0046  219 VAL A CA  
3119 C C   . VAL A 218 ? 0.2327 0.1473 0.1492 0.0438  -0.0046 -0.0149 219 VAL A C   
3120 O O   . VAL A 218 ? 0.1904 0.2040 0.1610 -0.0065 0.0112  0.0001  219 VAL A O   
3121 C CB  . VAL A 218 ? 0.2251 0.1347 0.1446 0.0232  0.0265  0.0199  219 VAL A CB  
3122 C CG1 . VAL A 218 ? 0.2348 0.1817 0.1853 0.0294  0.0029  0.0380  219 VAL A CG1 
3123 C CG2 . VAL A 218 ? 0.2233 0.1321 0.1575 -0.0026 0.0290  0.0283  219 VAL A CG2 
3133 N N   . LYS A 219 ? 0.2640 0.1582 0.1659 -0.0206 -0.0244 -0.0010 220 LYS A N   
3134 C CA  . LYS A 219 ? 0.2775 0.2379 0.2244 -0.0423 -0.0233 0.0051  220 LYS A CA  
3135 C C   . LYS A 219 ? 0.2149 0.2428 0.2170 -0.0516 -0.0470 -0.0169 220 LYS A C   
3136 O O   . LYS A 219 ? 0.2249 0.2519 0.2481 -0.0249 -0.0161 0.0528  220 LYS A O   
3137 C CB  . LYS A 219 ? 0.3634 0.3192 0.2969 -0.0444 -0.0895 -0.0164 220 LYS A CB  
3138 C CG  . LYS A 219 ? 0.4982 0.3736 0.3837 -0.0684 -0.0923 -0.0628 220 LYS A CG  
3139 C CD  . LYS A 219 ? 0.6501 0.5011 0.5081 -0.0773 -0.0793 -0.0701 220 LYS A CD  
3140 C CE  . LYS A 219 ? 0.7822 0.6237 0.6231 -0.1049 -0.0522 -0.0463 220 LYS A CE  
3141 N NZ  . LYS A 219 ? 0.9527 0.8072 0.7866 -0.1039 -0.0458 -0.0175 220 LYS A NZ  
3155 N N   . ALA A 220 ? 0.2554 0.2958 0.2410 -0.0564 -0.0500 -0.0411 221 ALA A N   
3156 C CA  . ALA A 220 ? 0.2534 0.3206 0.2913 -0.0056 -0.0188 -0.0473 221 ALA A CA  
3157 C C   . ALA A 220 ? 0.2612 0.2642 0.3034 -0.0065 -0.0790 -0.0460 221 ALA A C   
3158 O O   . ALA A 220 ? 0.3507 0.3256 0.3548 0.0163  -0.1111 -0.0347 221 ALA A O   
3159 C CB  . ALA A 220 ? 0.2851 0.4010 0.3648 -0.0041 0.0357  -0.0437 221 ALA A CB  
3165 N N   . SER A 221 ? 0.2992 0.2660 0.2728 -0.0166 -0.0934 -0.0471 222 SER A N   
3166 C CA  . SER A 221 ? 0.4171 0.3452 0.3115 -0.0333 -0.1399 0.0004  222 SER A CA  
3167 C C   . SER A 221 ? 0.4304 0.2705 0.2661 -0.0851 -0.1220 -0.0006 222 SER A C   
3168 O O   . SER A 221 ? 0.5812 0.4126 0.3581 -0.0961 -0.1282 -0.0064 222 SER A O   
3169 C CB  . SER A 221 ? 0.4138 0.3597 0.2933 -0.0006 -0.1473 0.0102  222 SER A CB  
3170 O OG  . SER A 221 ? 0.4819 0.3493 0.2722 -0.0576 -0.1396 0.0365  222 SER A OG  
3176 N N   . ALA A 222 ? 0.4738 0.2765 0.2756 -0.1024 -0.0761 0.0323  223 ALA A N   
3177 C CA  . ALA A 222 ? 0.4444 0.2699 0.2656 -0.1073 -0.0009 0.0334  223 ALA A CA  
3178 C C   . ALA A 222 ? 0.4589 0.3276 0.3105 -0.0851 0.0436  0.0414  223 ALA A C   
3179 O O   . ALA A 222 ? 0.5031 0.4504 0.4223 -0.0654 0.0884  0.0597  223 ALA A O   
3180 C CB  . ALA A 222 ? 0.4022 0.3234 0.3165 -0.1115 0.0447  -0.0018 223 ALA A CB  
3186 N N   . VAL A 223 ? 0.4045 0.2655 0.2510 -0.0803 -0.0203 0.0521  224 VAL A N   
3187 C CA  . VAL A 223 ? 0.3684 0.2596 0.2800 -0.0760 -0.0425 0.0533  224 VAL A CA  
3188 C C   . VAL A 223 ? 0.2885 0.2130 0.2627 -0.0683 -0.0450 0.0593  224 VAL A C   
3189 O O   . VAL A 223 ? 0.3412 0.3276 0.3302 -0.0516 -0.0462 0.0382  224 VAL A O   
3190 C CB  . VAL A 223 ? 0.3709 0.2577 0.2415 -0.0695 -0.0958 0.0450  224 VAL A CB  
3191 C CG1 . VAL A 223 ? 0.3711 0.3179 0.2593 -0.0593 -0.0930 0.0177  224 VAL A CG1 
3192 C CG2 . VAL A 223 ? 0.3627 0.2502 0.2840 -0.0604 -0.1016 0.0531  224 VAL A CG2 
3202 N N   . LYS A 224 ? 0.2948 0.2041 0.2700 -0.0631 -0.0714 0.0524  225 LYS A N   
3203 C CA  . LYS A 224 ? 0.3567 0.2007 0.2398 -0.0663 -0.0654 0.0264  225 LYS A CA  
3204 C C   . LYS A 224 ? 0.2848 0.1428 0.1823 0.0158  -0.0256 0.0371  225 LYS A C   
3205 O O   . LYS A 224 ? 0.2954 0.1597 0.2027 -0.0024 -0.0142 0.0168  225 LYS A O   
3206 C CB  . LYS A 224 ? 0.4087 0.3098 0.2785 -0.0757 -0.0407 0.0110  225 LYS A CB  
3207 C CG  . LYS A 224 ? 0.4704 0.3821 0.3157 -0.0727 -0.0419 -0.0278 225 LYS A CG  
3208 C CD  . LYS A 224 ? 0.5214 0.4336 0.3236 -0.0848 -0.0708 -0.0358 225 LYS A CD  
3209 C CE  . LYS A 224 ? 0.6160 0.5353 0.3875 -0.0822 -0.0590 -0.0270 225 LYS A CE  
3210 N NZ  . LYS A 224 ? 0.6522 0.5925 0.4240 -0.0721 -0.0450 -0.0099 225 LYS A NZ  
3224 N N   . ASN A 225 ? 0.2732 0.1568 0.1653 -0.0154 -0.0299 0.0402  226 ASN A N   
3225 C CA  . ASN A 225 ? 0.2585 0.1885 0.1739 -0.0116 -0.0028 0.0092  226 ASN A CA  
3226 C C   . ASN A 225 ? 0.2150 0.1730 0.1620 -0.0078 0.0126  0.0135  226 ASN A C   
3227 O O   . ASN A 225 ? 0.2318 0.1529 0.1579 -0.0096 -0.0012 0.0148  226 ASN A O   
3228 C CB  . ASN A 225 ? 0.2609 0.2154 0.1668 0.0098  -0.0364 0.0168  226 ASN A CB  
3229 C CG  . ASN A 225 ? 0.2766 0.2003 0.1819 0.0065  -0.0269 0.0029  226 ASN A CG  
3230 O OD1 . ASN A 225 ? 0.2904 0.2126 0.1813 -0.0010 -0.0289 0.0100  226 ASN A OD1 
3231 N ND2 . ASN A 225 ? 0.3094 0.2455 0.1860 -0.0059 -0.0136 -0.0200 226 ASN A ND2 
3238 N N   . THR A 226 ? 0.2452 0.1795 0.1348 -0.0485 0.0071  0.0094  227 THR A N   
3239 C CA  . THR A 226 ? 0.2729 0.1531 0.1346 -0.0042 0.0119  0.0128  227 THR A CA  
3240 C C   . THR A 226 ? 0.2516 0.2096 0.1637 -0.0152 -0.0133 0.0206  227 THR A C   
3241 O O   . THR A 226 ? 0.2708 0.3703 0.2225 0.0359  -0.0359 -0.0299 227 THR A O   
3242 C CB  . THR A 226 ? 0.3072 0.1598 0.1603 0.0000  0.0115  0.0197  227 THR A CB  
3243 O OG1 . THR A 226 ? 0.2656 0.2016 0.1742 0.0300  -0.0008 0.0086  227 THR A OG1 
3244 C CG2 . THR A 226 ? 0.3229 0.1886 0.2127 -0.0056 0.0211  0.0340  227 THR A CG2 
3252 N N   . GLN A 227 ? 0.2004 0.1693 0.1521 0.0026  0.0019  0.0324  228 GLN A N   
3253 C CA  . GLN A 227 ? 0.2108 0.1469 0.1420 0.0241  0.0169  0.0183  228 GLN A CA  
3254 C C   . GLN A 227 ? 0.1749 0.1412 0.1324 0.0395  -0.0091 0.0341  228 GLN A C   
3255 O O   . GLN A 227 ? 0.1885 0.1856 0.1451 0.0332  0.0113  0.0371  228 GLN A O   
3256 C CB  . GLN A 227 ? 0.2488 0.2006 0.1717 -0.0128 0.0350  0.0022  228 GLN A CB  
3257 C CG  . GLN A 227 ? 0.3729 0.2369 0.2299 0.0249  0.0671  0.0050  228 GLN A CG  
3258 C CD  . GLN A 227 ? 0.4249 0.2910 0.2850 0.0860  0.1126  0.0501  228 GLN A CD  
3259 O OE1 . GLN A 227 ? 0.4014 0.2453 0.2904 0.0735  0.1146  0.0898  228 GLN A OE1 
3260 N NE2 . GLN A 227 ? 0.4345 0.1927 0.2743 0.0570  0.0901  0.0150  228 GLN A NE2 
3269 N N   . LYS A 228 ? 0.1825 0.1568 0.1399 0.0107  0.0009  0.0189  229 LYS A N   
3270 C CA  . LYS A 228 ? 0.1836 0.1530 0.1225 0.0214  0.0097  0.0063  229 LYS A CA  
3271 C C   . LYS A 228 ? 0.1749 0.1740 0.1480 0.0578  0.0010  0.0061  229 LYS A C   
3272 O O   . LYS A 228 ? 0.2197 0.2145 0.1847 0.0758  0.0023  0.0089  229 LYS A O   
3273 C CB  . LYS A 228 ? 0.2208 0.2103 0.1586 -0.0087 -0.0192 0.0357  229 LYS A CB  
3274 C CG  . LYS A 228 ? 0.2888 0.2235 0.2563 -0.0411 -0.0354 0.0074  229 LYS A CG  
3275 C CD  . LYS A 228 ? 0.3249 0.2607 0.2766 -0.0393 -0.0812 0.0117  229 LYS A CD  
3276 C CE  . LYS A 228 ? 0.3451 0.3598 0.3495 -0.0231 -0.0926 -0.0060 229 LYS A CE  
3277 N NZ  . LYS A 228 ? 0.3963 0.4500 0.4143 -0.0235 -0.1033 -0.0180 229 LYS A NZ  
3291 N N   . TYR A 229 ? 0.1769 0.1474 0.1328 0.0216  0.0177  -0.0020 230 TYR A N   
3292 C CA  . TYR A 229 ? 0.2031 0.1384 0.1411 0.0273  0.0216  -0.0147 230 TYR A CA  
3293 C C   . TYR A 229 ? 0.1990 0.1637 0.1296 0.0238  0.0238  -0.0063 230 TYR A C   
3294 O O   . TYR A 229 ? 0.2093 0.1544 0.1778 0.0185  0.0437  0.0043  230 TYR A O   
3295 C CB  . TYR A 229 ? 0.2252 0.1393 0.1455 0.0017  0.0170  -0.0086 230 TYR A CB  
3296 C CG  . TYR A 229 ? 0.2191 0.1573 0.1434 0.0150  0.0358  -0.0001 230 TYR A CG  
3297 C CD1 . TYR A 229 ? 0.2669 0.1721 0.1595 0.0168  0.0652  0.0408  230 TYR A CD1 
3298 C CD2 . TYR A 229 ? 0.1930 0.1942 0.1753 0.0260  0.0162  0.0117  230 TYR A CD2 
3299 C CE1 . TYR A 229 ? 0.2732 0.1773 0.1789 0.0706  0.0780  0.0311  230 TYR A CE1 
3300 C CE2 . TYR A 229 ? 0.2091 0.2286 0.1969 0.0515  0.0355  0.0357  230 TYR A CE2 
3301 C CZ  . TYR A 229 ? 0.2318 0.1974 0.1687 0.0421  0.0523  0.0480  230 TYR A CZ  
3302 O OH  . TYR A 229 ? 0.3151 0.2312 0.2273 -0.0285 0.0531  0.0742  230 TYR A OH  
3312 N N   . ASN A 230 ? 0.2157 0.1600 0.1357 0.0585  0.0389  0.0176  231 ASN A N   
3313 C CA  . ASN A 230 ? 0.1910 0.1652 0.1379 0.0232  0.0323  0.0327  231 ASN A CA  
3314 C C   . ASN A 230 ? 0.1892 0.1718 0.1555 0.0307  0.0453  0.0080  231 ASN A C   
3315 O O   . ASN A 230 ? 0.2234 0.1739 0.1647 0.0266  0.0411  -0.0073 231 ASN A O   
3316 C CB  . ASN A 230 ? 0.1784 0.1860 0.1482 0.0544  0.0534  0.0180  231 ASN A CB  
3317 C CG  . ASN A 230 ? 0.1888 0.2404 0.1831 0.0424  0.0342  -0.0102 231 ASN A CG  
3318 O OD1 . ASN A 230 ? 0.1761 0.2125 0.1862 0.0089  0.0405  -0.0097 231 ASN A OD1 
3319 N ND2 . ASN A 230 ? 0.2323 0.3127 0.2291 0.0242  0.0313  -0.0040 231 ASN A ND2 
3326 N N   . LEU A 231 ? 0.1787 0.1802 0.1557 0.0388  0.0294  -0.0016 232 LEU A N   
3327 C CA  . LEU A 231 ? 0.1742 0.1779 0.1471 0.0165  0.0263  -0.0028 232 LEU A CA  
3328 C C   . LEU A 231 ? 0.1821 0.1872 0.1654 -0.0086 0.0434  0.0011  232 LEU A C   
3329 O O   . LEU A 231 ? 0.2236 0.2208 0.1995 -0.0322 0.0184  0.0028  232 LEU A O   
3330 C CB  . LEU A 231 ? 0.2177 0.2008 0.1773 0.0142  0.0075  0.0071  232 LEU A CB  
3331 C CG  . LEU A 231 ? 0.2160 0.2193 0.2116 0.0257  0.0232  0.0033  232 LEU A CG  
3332 C CD1 . LEU A 231 ? 0.2224 0.2695 0.2165 0.0187  0.0127  0.0022  232 LEU A CD1 
3333 C CD2 . LEU A 231 ? 0.2540 0.2184 0.2876 0.0204  0.0276  -0.0113 232 LEU A CD2 
3345 N N   . TYR A 232 ? 0.1785 0.2070 0.1478 -0.0152 0.0386  -0.0138 233 TYR A N   
3346 C CA  . TYR A 232 ? 0.2173 0.2049 0.1761 -0.0307 0.0703  -0.0168 233 TYR A CA  
3347 C C   . TYR A 232 ? 0.2615 0.2195 0.1991 -0.0167 0.0591  -0.0192 233 TYR A C   
3348 O O   . TYR A 232 ? 0.3913 0.2004 0.2155 -0.0149 0.0407  -0.0190 233 TYR A O   
3349 C CB  . TYR A 232 ? 0.2673 0.2148 0.1772 -0.0280 0.0733  -0.0157 233 TYR A CB  
3350 C CG  . TYR A 232 ? 0.3161 0.2797 0.2323 -0.0323 0.1019  -0.0338 233 TYR A CG  
3351 C CD1 . TYR A 232 ? 0.3564 0.3536 0.2591 -0.0479 0.1138  -0.0422 233 TYR A CD1 
3352 C CD2 . TYR A 232 ? 0.2900 0.2767 0.2543 0.0296  0.1276  -0.0337 233 TYR A CD2 
3353 C CE1 . TYR A 232 ? 0.4100 0.3990 0.2791 0.0105  0.1271  -0.0179 233 TYR A CE1 
3354 C CE2 . TYR A 232 ? 0.3388 0.3217 0.2415 0.0187  0.1269  -0.0272 233 TYR A CE2 
3355 C CZ  . TYR A 232 ? 0.3772 0.4010 0.2648 0.0472  0.1295  -0.0554 233 TYR A CZ  
3356 O OH  . TYR A 232 ? 0.4171 0.4655 0.2755 0.0323  0.1347  -0.0606 233 TYR A OH  
3366 N N   . SER A 233 ? 0.2488 0.1946 0.1858 -0.0103 0.0452  -0.0438 234 SER A N   
3367 C CA  . SER A 233 ? 0.2724 0.1734 0.2169 -0.0238 0.0504  -0.0497 234 SER A CA  
3368 C C   . SER A 233 ? 0.2975 0.1375 0.2152 -0.0023 0.0603  -0.0489 234 SER A C   
3369 O O   . SER A 233 ? 0.3663 0.1890 0.2215 -0.0039 0.0580  -0.0714 234 SER A O   
3370 C CB  . SER A 233 ? 0.2925 0.2413 0.2519 0.0528  0.0506  -0.0620 234 SER A CB  
3371 O OG  . SER A 233 ? 0.2630 0.2430 0.2295 0.0548  0.0538  -0.0161 234 SER A OG  
3377 N N   . GLY A 234 ? 0.3024 0.1668 0.2430 0.0172  0.0833  -0.0240 235 GLY A N   
3378 C CA  . GLY A 234 ? 0.3385 0.1611 0.2674 -0.0109 0.0884  0.0090  235 GLY A CA  
3379 C C   . GLY A 234 ? 0.3652 0.1522 0.2894 0.0005  0.1439  -0.0170 235 GLY A C   
3380 O O   . GLY A 234 ? 0.3876 0.1839 0.3527 0.0182  0.1551  0.0235  235 GLY A O   
3384 N N   . GLU A 235 ? 0.3720 0.1694 0.2523 0.0412  0.1246  -0.0132 236 GLU A N   
3385 C CA  . GLU A 235 ? 0.3933 0.2108 0.2588 0.1234  0.0962  0.0329  236 GLU A CA  
3386 C C   . GLU A 235 ? 0.3476 0.1758 0.2216 0.0930  0.0764  0.0572  236 GLU A C   
3387 O O   . GLU A 235 ? 0.3107 0.1766 0.2133 0.0935  0.0753  0.0401  236 GLU A O   
3388 C CB  . GLU A 235 ? 0.4516 0.3113 0.3201 0.1763  0.0718  0.0157  236 GLU A CB  
3389 C CG  . GLU A 235 ? 0.5850 0.3543 0.3943 0.1673  0.1155  -0.0080 236 GLU A CG  
3390 C CD  . GLU A 235 ? 0.7998 0.5372 0.6193 0.1220  0.1034  -0.0162 236 GLU A CD  
3391 O OE1 . GLU A 235 ? 0.7809 0.4645 0.5181 0.1271  0.1107  -0.0327 236 GLU A OE1 
3392 O OE2 . GLU A 235 ? 0.9196 0.6356 0.7426 0.1056  0.0824  0.0107  236 GLU A OE2 
3399 N N   . GLU A 236 ? 0.3447 0.2197 0.2391 0.1038  0.0876  0.0730  237 GLU A N   
3400 C CA  . GLU A 236 ? 0.3035 0.2464 0.2391 0.1149  0.0619  0.0691  237 GLU A CA  
3401 C C   . GLU A 236 ? 0.2772 0.2810 0.2795 0.1238  0.0567  0.0438  237 GLU A C   
3402 O O   . GLU A 236 ? 0.2912 0.3202 0.3028 0.1351  0.0560  0.0076  237 GLU A O   
3403 C CB  . GLU A 236 ? 0.4086 0.2758 0.2566 0.1142  0.0941  0.0750  237 GLU A CB  
3404 C CG  . GLU A 236 ? 0.4789 0.2576 0.2791 0.0407  0.0864  0.0851  237 GLU A CG  
3405 C CD  . GLU A 236 ? 0.6255 0.4053 0.4369 0.0160  0.0347  0.1343  237 GLU A CD  
3406 O OE1 . GLU A 236 ? 0.6218 0.4329 0.4749 0.0345  0.0022  0.1685  237 GLU A OE1 
3407 O OE2 . GLU A 236 ? 0.6363 0.3995 0.4250 0.0124  0.0217  0.1361  237 GLU A OE2 
3414 N N   . VAL A 237 ? 0.2418 0.2895 0.2737 0.1216  0.0396  0.0461  238 VAL A N   
3415 C CA  . VAL A 237 ? 0.2370 0.3858 0.2799 0.0881  0.0361  0.0556  238 VAL A CA  
3416 C C   . VAL A 237 ? 0.2605 0.4387 0.3113 0.1268  0.0404  0.0609  238 VAL A C   
3417 O O   . VAL A 237 ? 0.2796 0.4294 0.3060 0.1161  0.0439  0.0706  238 VAL A O   
3418 C CB  . VAL A 237 ? 0.2880 0.3669 0.2937 0.0062  0.0256  0.0670  238 VAL A CB  
3419 C CG1 . VAL A 237 ? 0.3104 0.4289 0.3607 0.0070  0.0289  0.0620  238 VAL A CG1 
3420 C CG2 . VAL A 237 ? 0.3440 0.3367 0.2869 -0.0007 0.0150  0.0907  238 VAL A CG2 
3430 N N   . GLU A 238 ? 0.3277 0.4856 0.3307 0.1216  -0.0004 0.0416  239 GLU A N   
3431 C CA  . GLU A 238 ? 0.4128 0.5332 0.4255 0.1591  -0.0560 0.0508  239 GLU A CA  
3432 C C   . GLU A 238 ? 0.6298 0.6654 0.6083 0.1514  -0.0249 0.0527  239 GLU A C   
3433 O O   . GLU A 238 ? 0.7539 0.7754 0.7616 0.1644  -0.0129 0.0560  239 GLU A O   
3434 C CB  . GLU A 238 ? 0.4365 0.5641 0.4728 0.1694  -0.0853 0.0392  239 GLU A CB  
3435 C CG  . GLU A 238 ? 0.3906 0.5077 0.3998 0.1063  -0.0994 0.0982  239 GLU A CG  
3436 C CD  . GLU A 238 ? 0.6039 0.6809 0.5695 0.1133  -0.0742 0.1039  239 GLU A CD  
3437 O OE1 . GLU A 238 ? 0.6973 0.7747 0.6720 0.1226  -0.0364 0.1199  239 GLU A OE1 
3438 O OE2 . GLU A 238 ? 0.5894 0.6851 0.5985 0.1087  -0.0794 0.0696  239 GLU A OE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   2   ?   ?   ?   A . n 
A 1 2   HIS 2   3   ?   ?   ?   A . n 
A 1 3   HIS 3   4   ?   ?   ?   A . n 
A 1 4   HIS 4   5   ?   ?   ?   A . n 
A 1 5   HIS 5   6   ?   ?   ?   A . n 
A 1 6   HIS 6   7   ?   ?   ?   A . n 
A 1 7   HIS 7   8   ?   ?   ?   A . n 
A 1 8   SER 8   9   ?   ?   ?   A . n 
A 1 9   SER 9   10  ?   ?   ?   A . n 
A 1 10  GLY 10  11  ?   ?   ?   A . n 
A 1 11  ARG 11  12  ?   ?   ?   A . n 
A 1 12  GLU 12  13  ?   ?   ?   A . n 
A 1 13  ASN 13  14  ?   ?   ?   A . n 
A 1 14  LEU 14  15  ?   ?   ?   A . n 
A 1 15  TYR 15  16  ?   ?   ?   A . n 
A 1 16  PHE 16  17  ?   ?   ?   A . n 
A 1 17  GLN 17  18  ?   ?   ?   A . n 
A 1 18  GLY 18  19  ?   ?   ?   A . n 
A 1 19  PRO 19  20  20  PRO PRO A . n 
A 1 20  PHE 20  21  21  PHE PHE A . n 
A 1 21  ASP 21  22  22  ASP ASP A . n 
A 1 22  ALA 22  23  23  ALA ALA A . n 
A 1 23  ILE 23  24  24  ILE ILE A . n 
A 1 24  LYS 24  25  25  LYS LYS A . n 
A 1 25  GLN 25  26  26  GLN GLN A . n 
A 1 26  PRO 26  27  27  PRO PRO A . n 
A 1 27  ASN 27  28  28  ASN ASN A . n 
A 1 28  ARG 28  29  29  ARG ARG A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  GLU 30  31  31  GLU GLU A . n 
A 1 31  GLU 31  32  32  GLU GLU A . n 
A 1 32  GLU 32  33  33  GLU GLU A . n 
A 1 33  VAL 33  34  34  VAL VAL A . n 
A 1 34  THR 34  35  35  THR THR A . n 
A 1 35  GLN 35  36  36  GLN GLN A . n 
A 1 36  LEU 36  37  37  LEU LEU A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  GLU 38  39  39  GLU GLU A . n 
A 1 39  ASP 39  40  40  ASP ASP A . n 
A 1 40  PHE 40  41  41  PHE PHE A . n 
A 1 41  LYS 41  42  42  LYS LYS A . n 
A 1 42  ASP 42  43  43  ASP ASP A . n 
A 1 43  TRP 43  44  44  TRP TRP A . n 
A 1 44  SER 44  45  45  SER SER A . n 
A 1 45  LYS 45  46  46  LYS LYS A . n 
A 1 46  ALA 46  47  47  ALA ALA A . n 
A 1 47  SER 47  48  48  SER SER A . n 
A 1 48  ASN 48  49  49  ASN ASN A . n 
A 1 49  GLY 49  50  50  GLY GLY A . n 
A 1 50  TRP 50  51  51  TRP TRP A . n 
A 1 51  ARG 51  52  52  ARG ARG A . n 
A 1 52  TYR 52  53  53  TYR TYR A . n 
A 1 53  SER 53  54  54  SER SER A . n 
A 1 54  PHE 54  55  55  PHE PHE A . n 
A 1 55  ILE 55  56  56  ILE ILE A . n 
A 1 56  THR 56  57  57  THR THR A . n 
A 1 57  ALA 57  58  58  ALA ALA A . n 
A 1 58  ASN 58  59  59  ASN ASN A . n 
A 1 59  GLU 59  60  60  GLU GLU A . n 
A 1 60  LYS 60  61  61  LYS LYS A . n 
A 1 61  GLU 61  62  62  GLU GLU A . n 
A 1 62  ALA 62  63  63  ALA ALA A . n 
A 1 63  VAL 63  64  64  VAL VAL A . n 
A 1 64  GLU 64  65  65  GLU GLU A . n 
A 1 65  ASP 65  66  66  ASP ASP A . n 
A 1 66  PHE 66  67  67  PHE PHE A . n 
A 1 67  SER 67  68  68  SER SER A . n 
A 1 68  ILE 68  69  69  ILE ILE A . n 
A 1 69  SER 69  70  70  SER SER A . n 
A 1 70  GLY 70  71  71  GLY GLY A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  GLN 72  73  73  GLN GLN A . n 
A 1 73  THR 73  74  74  THR THR A . n 
A 1 74  ALA 74  75  75  ALA ALA A . n 
A 1 75  ASN 75  76  76  ASN ASN A . n 
A 1 76  ASP 76  77  77  ASP ASP A . n 
A 1 77  TYR 77  78  78  TYR TYR A . n 
A 1 78  LEU 78  79  79  LEU LEU A . n 
A 1 79  ARG 79  80  80  ARG ARG A . n 
A 1 80  ALA 80  81  81  ALA ALA A . n 
A 1 81  THR 81  82  82  THR THR A . n 
A 1 82  ASP 82  83  83  ASP ASP A . n 
A 1 83  THR 83  84  84  THR THR A . n 
A 1 84  SER 84  85  85  SER SER A . n 
A 1 85  THR 85  86  86  THR THR A . n 
A 1 86  TRP 86  87  87  TRP TRP A . n 
A 1 87  GLY 87  88  88  GLY GLY A . n 
A 1 88  VAL 88  89  89  VAL VAL A . n 
A 1 89  ALA 89  90  90  ALA ALA A . n 
A 1 90  GLY 90  91  91  GLY GLY A . n 
A 1 91  ALA 91  92  92  ALA ALA A . n 
A 1 92  ASP 92  93  93  ASP ASP A . n 
A 1 93  ALA 93  94  94  ALA ALA A . n 
A 1 94  ARG 94  95  95  ARG ARG A . n 
A 1 95  GLN 95  96  96  GLN GLN A . n 
A 1 96  TYR 96  97  97  TYR TYR A . n 
A 1 97  ILE 97  98  98  ILE ILE A . n 
A 1 98  ARG 98  99  99  ARG ARG A . n 
A 1 99  THR 99  100 100 THR THR A . n 
A 1 100 VAL 100 101 101 VAL VAL A . n 
A 1 101 LYS 101 102 102 LYS LYS A . n 
A 1 102 SER 102 103 103 SER SER A . n 
A 1 103 ALA 103 104 104 ALA ALA A . n 
A 1 104 LEU 104 105 105 LEU LEU A . n 
A 1 105 ASN 105 106 106 ASN ASN A . n 
A 1 106 LYS 106 107 107 LYS LYS A . n 
A 1 107 LEU 107 108 108 LEU LEU A . n 
A 1 108 PRO 108 109 109 PRO PRO A . n 
A 1 109 LYS 109 110 110 LYS LYS A . n 
A 1 110 TYR 110 111 111 TYR TYR A . n 
A 1 111 LYS 111 112 112 LYS LYS A . n 
A 1 112 GLY 112 113 113 GLY GLY A . n 
A 1 113 THR 113 114 114 THR THR A . n 
A 1 114 ALA 114 115 115 ALA ALA A . n 
A 1 115 TYR 115 116 116 TYR TYR A . n 
A 1 116 ARG 116 117 117 ARG ARG A . n 
A 1 117 GLY 117 118 118 GLY GLY A . n 
A 1 118 THR 118 119 119 THR THR A . n 
A 1 119 TRP 119 120 120 TRP TRP A . n 
A 1 120 VAL 120 121 121 VAL VAL A . n 
A 1 121 LYS 121 122 122 LYS LYS A . n 
A 1 122 LEU 122 123 123 LEU LEU A . n 
A 1 123 SER 123 124 124 SER SER A . n 
A 1 124 LEU 124 125 125 LEU LEU A . n 
A 1 125 LEU 125 126 126 LEU LEU A . n 
A 1 126 ASN 126 127 127 ASN ASN A . n 
A 1 127 LYS 127 128 128 LYS LYS A . n 
A 1 128 LEU 128 129 129 LEU LEU A . n 
A 1 129 GLU 129 130 130 GLU GLU A . n 
A 1 130 GLU 130 131 131 GLU GLU A . n 
A 1 131 GLY 131 132 132 GLY GLY A . n 
A 1 132 ASP 132 133 133 ASP ASP A . n 
A 1 133 VAL 133 134 134 VAL VAL A . n 
A 1 134 LEU 134 135 135 LEU LEU A . n 
A 1 135 VAL 135 136 136 VAL VAL A . n 
A 1 136 GLU 136 137 137 GLU GLU A . n 
A 1 137 PRO 137 138 138 PRO PRO A . n 
A 1 138 ALA 138 139 139 ALA ALA A . n 
A 1 139 PHE 139 140 140 PHE PHE A . n 
A 1 140 THR 140 141 141 THR THR A . n 
A 1 141 SER 141 142 142 SER SER A . n 
A 1 142 THR 142 143 143 THR THR A . n 
A 1 143 SER 143 144 144 SER SER A . n 
A 1 144 THR 144 145 145 THR THR A . n 
A 1 145 LEU 145 146 146 LEU LEU A . n 
A 1 146 PRO 146 147 147 PRO PRO A . n 
A 1 147 GLU 147 148 148 GLU GLU A . n 
A 1 148 VAL 148 149 149 VAL VAL A . n 
A 1 149 ALA 149 150 150 ALA ALA A . n 
A 1 150 LYS 150 151 151 LYS LYS A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 PHE 152 153 153 PHE PHE A . n 
A 1 153 SER 153 154 154 SER SER A . n 
A 1 154 VAL 154 155 155 VAL VAL A . n 
A 1 155 VAL 155 156 156 VAL VAL A . n 
A 1 156 HIS 156 157 157 HIS HIS A . n 
A 1 157 PRO 157 158 158 PRO PRO A . n 
A 1 158 ASN 158 159 159 ASN ASN A . n 
A 1 159 SER 159 160 160 SER SER A . n 
A 1 160 PRO 160 161 161 PRO PRO A . n 
A 1 161 GLN 161 162 162 GLN GLN A . n 
A 1 162 ARG 162 163 163 ARG ARG A . n 
A 1 163 LEU 163 164 164 LEU LEU A . n 
A 1 164 LYS 164 165 165 LYS LYS A . n 
A 1 165 ARG 165 166 166 ARG ARG A . n 
A 1 166 VAL 166 167 167 VAL VAL A . n 
A 1 167 LEU 167 168 168 LEU LEU A . n 
A 1 168 PHE 168 169 169 PHE PHE A . n 
A 1 169 GLU 169 170 170 GLU GLU A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 LYS 171 172 172 LYS LYS A . n 
A 1 172 ILE 172 173 173 ILE ILE A . n 
A 1 173 ASN 173 174 174 ASN ASN A . n 
A 1 174 GLN 174 175 175 GLN GLN A . n 
A 1 175 GLY 175 176 176 GLY GLY A . n 
A 1 176 GLY 176 177 177 GLY GLY A . n 
A 1 177 HIS 177 178 178 HIS HIS A . n 
A 1 178 THR 178 179 179 THR THR A . n 
A 1 179 ILE 179 180 180 ILE ILE A . n 
A 1 180 ALA 180 181 181 ALA ALA A . n 
A 1 181 GLY 181 182 182 GLY GLY A . n 
A 1 182 LEU 182 183 183 LEU LEU A . n 
A 1 183 SER 183 184 184 SER SER A . n 
A 1 184 GLU 184 185 ?   ?   ?   A . n 
A 1 185 TYR 185 186 ?   ?   ?   A . n 
A 1 186 SER 186 187 ?   ?   ?   A . n 
A 1 187 LYS 187 188 188 LYS LYS A . n 
A 1 188 GLU 188 189 189 GLU GLU A . n 
A 1 189 ALA 189 190 190 ALA ALA A . n 
A 1 190 GLU 190 191 191 GLU GLU A . n 
A 1 191 VAL 191 192 192 VAL VAL A . n 
A 1 192 LEU 192 193 193 LEU LEU A . n 
A 1 193 PHE 193 194 194 PHE PHE A . n 
A 1 194 ALA 194 195 195 ALA ALA A . n 
A 1 195 PRO 195 196 196 PRO PRO A . n 
A 1 196 ASN 196 197 197 ASN ASN A . n 
A 1 197 ALA 197 198 198 ALA ALA A . n 
A 1 198 HIS 198 199 199 HIS HIS A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 ARG 200 201 201 ARG ARG A . n 
A 1 201 ILE 201 202 202 ILE ILE A . n 
A 1 202 THR 202 203 203 THR THR A . n 
A 1 203 GLN 203 204 204 GLN GLN A . n 
A 1 204 ILE 204 205 205 ILE ILE A . n 
A 1 205 GLU 205 206 206 GLU GLU A . n 
A 1 206 ARG 206 207 207 ARG ARG A . n 
A 1 207 THR 207 208 208 THR THR A . n 
A 1 208 SER 208 209 209 SER SER A . n 
A 1 209 ASN 209 210 210 ASN ASN A . n 
A 1 210 HIS 210 211 211 HIS HIS A . n 
A 1 211 THR 211 212 212 THR THR A . n 
A 1 212 TYR 212 213 213 TYR TYR A . n 
A 1 213 ILE 213 214 214 ILE ILE A . n 
A 1 214 GLY 214 215 215 GLY GLY A . n 
A 1 215 VAL 215 216 216 VAL VAL A . n 
A 1 216 GLU 216 217 217 GLU GLU A . n 
A 1 217 THR 217 218 218 THR THR A . n 
A 1 218 VAL 218 219 219 VAL VAL A . n 
A 1 219 LYS 219 220 220 LYS LYS A . n 
A 1 220 ALA 220 221 221 ALA ALA A . n 
A 1 221 SER 221 222 222 SER SER A . n 
A 1 222 ALA 222 223 223 ALA ALA A . n 
A 1 223 VAL 223 224 224 VAL VAL A . n 
A 1 224 LYS 224 225 225 LYS LYS A . n 
A 1 225 ASN 225 226 226 ASN ASN A . n 
A 1 226 THR 226 227 227 THR THR A . n 
A 1 227 GLN 227 228 228 GLN GLN A . n 
A 1 228 LYS 228 229 229 LYS LYS A . n 
A 1 229 TYR 229 230 230 TYR TYR A . n 
A 1 230 ASN 230 231 231 ASN ASN A . n 
A 1 231 LEU 231 232 232 LEU LEU A . n 
A 1 232 TYR 232 233 233 TYR TYR A . n 
A 1 233 SER 233 234 234 SER SER A . n 
A 1 234 GLY 234 235 235 GLY GLY A . n 
A 1 235 GLU 235 236 236 GLU GLU A . n 
A 1 236 GLU 236 237 237 GLU GLU A . n 
A 1 237 VAL 237 238 238 VAL VAL A . n 
A 1 238 GLU 238 239 239 GLU GLU A . n 
A 1 239 ALA 239 240 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   301 172 HOH HOH A . 
B 2 HOH 2   302 232 HOH HOH A . 
B 2 HOH 3   303 215 HOH HOH A . 
B 2 HOH 4   304 154 HOH HOH A . 
B 2 HOH 5   305 32  HOH HOH A . 
B 2 HOH 6   306 84  HOH HOH A . 
B 2 HOH 7   307 38  HOH HOH A . 
B 2 HOH 8   308 63  HOH HOH A . 
B 2 HOH 9   309 255 HOH HOH A . 
B 2 HOH 10  310 160 HOH HOH A . 
B 2 HOH 11  311 211 HOH HOH A . 
B 2 HOH 12  312 124 HOH HOH A . 
B 2 HOH 13  313 4   HOH HOH A . 
B 2 HOH 14  314 40  HOH HOH A . 
B 2 HOH 15  315 75  HOH HOH A . 
B 2 HOH 16  316 96  HOH HOH A . 
B 2 HOH 17  317 223 HOH HOH A . 
B 2 HOH 18  318 145 HOH HOH A . 
B 2 HOH 19  319 68  HOH HOH A . 
B 2 HOH 20  320 19  HOH HOH A . 
B 2 HOH 21  321 272 HOH HOH A . 
B 2 HOH 22  322 22  HOH HOH A . 
B 2 HOH 23  323 130 HOH HOH A . 
B 2 HOH 24  324 212 HOH HOH A . 
B 2 HOH 25  325 113 HOH HOH A . 
B 2 HOH 26  326 53  HOH HOH A . 
B 2 HOH 27  327 117 HOH HOH A . 
B 2 HOH 28  328 66  HOH HOH A . 
B 2 HOH 29  329 229 HOH HOH A . 
B 2 HOH 30  330 95  HOH HOH A . 
B 2 HOH 31  331 197 HOH HOH A . 
B 2 HOH 32  332 192 HOH HOH A . 
B 2 HOH 33  333 91  HOH HOH A . 
B 2 HOH 34  334 186 HOH HOH A . 
B 2 HOH 35  335 3   HOH HOH A . 
B 2 HOH 36  336 191 HOH HOH A . 
B 2 HOH 37  337 9   HOH HOH A . 
B 2 HOH 38  338 27  HOH HOH A . 
B 2 HOH 39  339 71  HOH HOH A . 
B 2 HOH 40  340 123 HOH HOH A . 
B 2 HOH 41  341 135 HOH HOH A . 
B 2 HOH 42  342 90  HOH HOH A . 
B 2 HOH 43  343 51  HOH HOH A . 
B 2 HOH 44  344 1   HOH HOH A . 
B 2 HOH 45  345 79  HOH HOH A . 
B 2 HOH 46  346 242 HOH HOH A . 
B 2 HOH 47  347 6   HOH HOH A . 
B 2 HOH 48  348 118 HOH HOH A . 
B 2 HOH 49  349 47  HOH HOH A . 
B 2 HOH 50  350 133 HOH HOH A . 
B 2 HOH 51  351 54  HOH HOH A . 
B 2 HOH 52  352 62  HOH HOH A . 
B 2 HOH 53  353 143 HOH HOH A . 
B 2 HOH 54  354 253 HOH HOH A . 
B 2 HOH 55  355 42  HOH HOH A . 
B 2 HOH 56  356 219 HOH HOH A . 
B 2 HOH 57  357 55  HOH HOH A . 
B 2 HOH 58  358 93  HOH HOH A . 
B 2 HOH 59  359 11  HOH HOH A . 
B 2 HOH 60  360 58  HOH HOH A . 
B 2 HOH 61  361 187 HOH HOH A . 
B 2 HOH 62  362 83  HOH HOH A . 
B 2 HOH 63  363 45  HOH HOH A . 
B 2 HOH 64  364 99  HOH HOH A . 
B 2 HOH 65  365 202 HOH HOH A . 
B 2 HOH 66  366 30  HOH HOH A . 
B 2 HOH 67  367 240 HOH HOH A . 
B 2 HOH 68  368 201 HOH HOH A . 
B 2 HOH 69  369 157 HOH HOH A . 
B 2 HOH 70  370 138 HOH HOH A . 
B 2 HOH 71  371 39  HOH HOH A . 
B 2 HOH 72  372 97  HOH HOH A . 
B 2 HOH 73  373 14  HOH HOH A . 
B 2 HOH 74  374 144 HOH HOH A . 
B 2 HOH 75  375 86  HOH HOH A . 
B 2 HOH 76  376 259 HOH HOH A . 
B 2 HOH 77  377 164 HOH HOH A . 
B 2 HOH 78  378 190 HOH HOH A . 
B 2 HOH 79  379 267 HOH HOH A . 
B 2 HOH 80  380 41  HOH HOH A . 
B 2 HOH 81  381 181 HOH HOH A . 
B 2 HOH 82  382 69  HOH HOH A . 
B 2 HOH 83  383 216 HOH HOH A . 
B 2 HOH 84  384 73  HOH HOH A . 
B 2 HOH 85  385 261 HOH HOH A . 
B 2 HOH 86  386 120 HOH HOH A . 
B 2 HOH 87  387 262 HOH HOH A . 
B 2 HOH 88  388 260 HOH HOH A . 
B 2 HOH 89  389 237 HOH HOH A . 
B 2 HOH 90  390 196 HOH HOH A . 
B 2 HOH 91  391 199 HOH HOH A . 
B 2 HOH 92  392 111 HOH HOH A . 
B 2 HOH 93  393 18  HOH HOH A . 
B 2 HOH 94  394 257 HOH HOH A . 
B 2 HOH 95  395 264 HOH HOH A . 
B 2 HOH 96  396 205 HOH HOH A . 
B 2 HOH 97  397 56  HOH HOH A . 
B 2 HOH 98  398 175 HOH HOH A . 
B 2 HOH 99  399 166 HOH HOH A . 
B 2 HOH 100 400 128 HOH HOH A . 
B 2 HOH 101 401 217 HOH HOH A . 
B 2 HOH 102 402 46  HOH HOH A . 
B 2 HOH 103 403 169 HOH HOH A . 
B 2 HOH 104 404 105 HOH HOH A . 
B 2 HOH 105 405 210 HOH HOH A . 
B 2 HOH 106 406 218 HOH HOH A . 
B 2 HOH 107 407 245 HOH HOH A . 
B 2 HOH 108 408 98  HOH HOH A . 
B 2 HOH 109 409 158 HOH HOH A . 
B 2 HOH 110 410 244 HOH HOH A . 
B 2 HOH 111 411 208 HOH HOH A . 
B 2 HOH 112 412 170 HOH HOH A . 
B 2 HOH 113 413 214 HOH HOH A . 
B 2 HOH 114 414 114 HOH HOH A . 
B 2 HOH 115 415 2   HOH HOH A . 
B 2 HOH 116 416 5   HOH HOH A . 
B 2 HOH 117 417 7   HOH HOH A . 
B 2 HOH 118 418 8   HOH HOH A . 
B 2 HOH 119 419 10  HOH HOH A . 
B 2 HOH 120 420 12  HOH HOH A . 
B 2 HOH 121 421 13  HOH HOH A . 
B 2 HOH 122 422 15  HOH HOH A . 
B 2 HOH 123 423 16  HOH HOH A . 
B 2 HOH 124 424 17  HOH HOH A . 
B 2 HOH 125 425 20  HOH HOH A . 
B 2 HOH 126 426 21  HOH HOH A . 
B 2 HOH 127 427 23  HOH HOH A . 
B 2 HOH 128 428 24  HOH HOH A . 
B 2 HOH 129 429 25  HOH HOH A . 
B 2 HOH 130 430 26  HOH HOH A . 
B 2 HOH 131 431 28  HOH HOH A . 
B 2 HOH 132 432 29  HOH HOH A . 
B 2 HOH 133 433 31  HOH HOH A . 
B 2 HOH 134 434 33  HOH HOH A . 
B 2 HOH 135 435 34  HOH HOH A . 
B 2 HOH 136 436 35  HOH HOH A . 
B 2 HOH 137 437 36  HOH HOH A . 
B 2 HOH 138 438 37  HOH HOH A . 
B 2 HOH 139 439 43  HOH HOH A . 
B 2 HOH 140 440 44  HOH HOH A . 
B 2 HOH 141 441 48  HOH HOH A . 
B 2 HOH 142 442 49  HOH HOH A . 
B 2 HOH 143 443 50  HOH HOH A . 
B 2 HOH 144 444 52  HOH HOH A . 
B 2 HOH 145 445 57  HOH HOH A . 
B 2 HOH 146 446 59  HOH HOH A . 
B 2 HOH 147 447 60  HOH HOH A . 
B 2 HOH 148 448 61  HOH HOH A . 
B 2 HOH 149 449 64  HOH HOH A . 
B 2 HOH 150 450 65  HOH HOH A . 
B 2 HOH 151 451 67  HOH HOH A . 
B 2 HOH 152 452 70  HOH HOH A . 
B 2 HOH 153 453 72  HOH HOH A . 
B 2 HOH 154 454 74  HOH HOH A . 
B 2 HOH 155 455 76  HOH HOH A . 
B 2 HOH 156 456 77  HOH HOH A . 
B 2 HOH 157 457 78  HOH HOH A . 
B 2 HOH 158 458 80  HOH HOH A . 
B 2 HOH 159 459 81  HOH HOH A . 
B 2 HOH 160 460 82  HOH HOH A . 
B 2 HOH 161 461 85  HOH HOH A . 
B 2 HOH 162 462 87  HOH HOH A . 
B 2 HOH 163 463 88  HOH HOH A . 
B 2 HOH 164 464 89  HOH HOH A . 
B 2 HOH 165 465 92  HOH HOH A . 
B 2 HOH 166 466 94  HOH HOH A . 
B 2 HOH 167 467 100 HOH HOH A . 
B 2 HOH 168 468 101 HOH HOH A . 
B 2 HOH 169 469 102 HOH HOH A . 
B 2 HOH 170 470 103 HOH HOH A . 
B 2 HOH 171 471 104 HOH HOH A . 
B 2 HOH 172 472 106 HOH HOH A . 
B 2 HOH 173 473 107 HOH HOH A . 
B 2 HOH 174 474 108 HOH HOH A . 
B 2 HOH 175 475 109 HOH HOH A . 
B 2 HOH 176 476 110 HOH HOH A . 
B 2 HOH 177 477 112 HOH HOH A . 
B 2 HOH 178 478 115 HOH HOH A . 
B 2 HOH 179 479 116 HOH HOH A . 
B 2 HOH 180 480 119 HOH HOH A . 
B 2 HOH 181 481 121 HOH HOH A . 
B 2 HOH 182 482 122 HOH HOH A . 
B 2 HOH 183 483 125 HOH HOH A . 
B 2 HOH 184 484 126 HOH HOH A . 
B 2 HOH 185 485 127 HOH HOH A . 
B 2 HOH 186 486 129 HOH HOH A . 
B 2 HOH 187 487 131 HOH HOH A . 
B 2 HOH 188 488 132 HOH HOH A . 
B 2 HOH 189 489 134 HOH HOH A . 
B 2 HOH 190 490 136 HOH HOH A . 
B 2 HOH 191 491 137 HOH HOH A . 
B 2 HOH 192 492 139 HOH HOH A . 
B 2 HOH 193 493 140 HOH HOH A . 
B 2 HOH 194 494 141 HOH HOH A . 
B 2 HOH 195 495 142 HOH HOH A . 
B 2 HOH 196 496 146 HOH HOH A . 
B 2 HOH 197 497 147 HOH HOH A . 
B 2 HOH 198 498 148 HOH HOH A . 
B 2 HOH 199 499 149 HOH HOH A . 
B 2 HOH 200 500 150 HOH HOH A . 
B 2 HOH 201 501 151 HOH HOH A . 
B 2 HOH 202 502 152 HOH HOH A . 
B 2 HOH 203 503 153 HOH HOH A . 
B 2 HOH 204 504 155 HOH HOH A . 
B 2 HOH 205 505 156 HOH HOH A . 
B 2 HOH 206 506 159 HOH HOH A . 
B 2 HOH 207 507 161 HOH HOH A . 
B 2 HOH 208 508 162 HOH HOH A . 
B 2 HOH 209 509 163 HOH HOH A . 
B 2 HOH 210 510 165 HOH HOH A . 
B 2 HOH 211 511 167 HOH HOH A . 
B 2 HOH 212 512 168 HOH HOH A . 
B 2 HOH 213 513 171 HOH HOH A . 
B 2 HOH 214 514 173 HOH HOH A . 
B 2 HOH 215 515 174 HOH HOH A . 
B 2 HOH 216 516 176 HOH HOH A . 
B 2 HOH 217 517 177 HOH HOH A . 
B 2 HOH 218 518 178 HOH HOH A . 
B 2 HOH 219 519 179 HOH HOH A . 
B 2 HOH 220 520 180 HOH HOH A . 
B 2 HOH 221 521 182 HOH HOH A . 
B 2 HOH 222 522 183 HOH HOH A . 
B 2 HOH 223 523 184 HOH HOH A . 
B 2 HOH 224 524 185 HOH HOH A . 
B 2 HOH 225 525 188 HOH HOH A . 
B 2 HOH 226 526 189 HOH HOH A . 
B 2 HOH 227 527 193 HOH HOH A . 
B 2 HOH 228 528 194 HOH HOH A . 
B 2 HOH 229 529 195 HOH HOH A . 
B 2 HOH 230 530 198 HOH HOH A . 
B 2 HOH 231 531 200 HOH HOH A . 
B 2 HOH 232 532 203 HOH HOH A . 
B 2 HOH 233 533 204 HOH HOH A . 
B 2 HOH 234 534 206 HOH HOH A . 
B 2 HOH 235 535 207 HOH HOH A . 
B 2 HOH 236 536 209 HOH HOH A . 
B 2 HOH 237 537 213 HOH HOH A . 
B 2 HOH 238 538 220 HOH HOH A . 
B 2 HOH 239 539 221 HOH HOH A . 
B 2 HOH 240 540 222 HOH HOH A . 
B 2 HOH 241 541 224 HOH HOH A . 
B 2 HOH 242 542 225 HOH HOH A . 
B 2 HOH 243 543 226 HOH HOH A . 
B 2 HOH 244 544 227 HOH HOH A . 
B 2 HOH 245 545 228 HOH HOH A . 
B 2 HOH 246 546 230 HOH HOH A . 
B 2 HOH 247 547 231 HOH HOH A . 
B 2 HOH 248 548 233 HOH HOH A . 
B 2 HOH 249 549 234 HOH HOH A . 
B 2 HOH 250 550 235 HOH HOH A . 
B 2 HOH 251 551 236 HOH HOH A . 
B 2 HOH 252 552 238 HOH HOH A . 
B 2 HOH 253 553 239 HOH HOH A . 
B 2 HOH 254 554 241 HOH HOH A . 
B 2 HOH 255 555 243 HOH HOH A . 
B 2 HOH 256 556 246 HOH HOH A . 
B 2 HOH 257 557 247 HOH HOH A . 
B 2 HOH 258 558 248 HOH HOH A . 
B 2 HOH 259 559 249 HOH HOH A . 
B 2 HOH 260 560 250 HOH HOH A . 
B 2 HOH 261 561 251 HOH HOH A . 
B 2 HOH 262 562 252 HOH HOH A . 
B 2 HOH 263 563 254 HOH HOH A . 
B 2 HOH 264 564 256 HOH HOH A . 
B 2 HOH 265 565 258 HOH HOH A . 
B 2 HOH 266 566 263 HOH HOH A . 
B 2 HOH 267 567 265 HOH HOH A . 
B 2 HOH 268 568 266 HOH HOH A . 
B 2 HOH 269 569 268 HOH HOH A . 
B 2 HOH 270 570 269 HOH HOH A . 
B 2 HOH 271 571 270 HOH HOH A . 
B 2 HOH 272 572 271 HOH HOH A . 
B 2 HOH 273 573 273 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2015-11-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -7.1241 51.8565 5.9912  0.1753 0.1327 0.1668 0.0256  -0.0404 0.0085  1.9170 1.9306 2.7183 -0.1436 
1.3166  0.4242  -0.1907 0.0563  0.0735  -0.0089 0.2184  0.3366  -0.2496 -0.4163 -0.0988 
'X-RAY DIFFRACTION' 2 ? refined 16.3793 46.3291 8.3897  0.1805 0.2630 0.1996 -0.0447 0.0525  -0.0404 2.7261 3.1039 2.4071 0.0806  
-0.2724 1.0815  0.0891  0.0327  -0.0733 0.1192  0.2758  -0.3705 -0.3005 -0.3058 0.2491  
'X-RAY DIFFRACTION' 3 ? refined 4.2428  37.8470 11.0957 0.1123 0.1007 0.1021 -0.0043 0.0077  -0.0192 1.0237 0.6158 1.1820 -0.1982 
0.0561  -0.0468 0.0000  0.0135  -0.0008 0.0000  0.0000  0.0145  -0.0413 0.1114  0.0495  
'X-RAY DIFFRACTION' 4 ? refined -0.7478 40.2382 14.7740 0.1113 0.1095 0.0900 -0.0052 0.0021  -0.0084 1.8858 2.0975 1.4996 0.2725  
0.0449  -0.2239 -0.0053 0.0772  -0.0204 0.1449  -0.0223 0.1275  -0.1521 0.0468  -0.1099 
'X-RAY DIFFRACTION' 5 ? refined 6.7245  30.1685 23.8280 0.1414 0.1449 0.1640 0.0307  -0.0035 0.0259  1.5636 2.9727 6.0129 0.5753  
-1.2401 0.0827  -0.1673 -0.0498 0.0591  -0.0850 -0.1787 -0.2848 0.0524  0.4853  0.4045  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 0 A 0 
;chain 'A' and (resid 20 through 48 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2 2 A 0 A 0 
;chain 'A' and (resid 49 through 87 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3 3 A 0 A 0 
;chain 'A' and (resid 88 through 173 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 4 4 A 0 A 0 
;chain 'A' and (resid 174 through 219 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 5 5 A 0 A 0 
;chain 'A' and (resid 220 through 239 )
;
? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                           4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O    A SER 154 ? ? HE A ARG 166 ? ? 1.44 
2 1 HH12 A ARG 166 ? ? O  A HOH 304 ? ? 1.55 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 2   ? A MET 1   
2  1 Y 1 A HIS 3   ? A HIS 2   
3  1 Y 1 A HIS 4   ? A HIS 3   
4  1 Y 1 A HIS 5   ? A HIS 4   
5  1 Y 1 A HIS 6   ? A HIS 5   
6  1 Y 1 A HIS 7   ? A HIS 6   
7  1 Y 1 A HIS 8   ? A HIS 7   
8  1 Y 1 A SER 9   ? A SER 8   
9  1 Y 1 A SER 10  ? A SER 9   
10 1 Y 1 A GLY 11  ? A GLY 10  
11 1 Y 1 A ARG 12  ? A ARG 11  
12 1 Y 1 A GLU 13  ? A GLU 12  
13 1 Y 1 A ASN 14  ? A ASN 13  
14 1 Y 1 A LEU 15  ? A LEU 14  
15 1 Y 1 A TYR 16  ? A TYR 15  
16 1 Y 1 A PHE 17  ? A PHE 16  
17 1 Y 1 A GLN 18  ? A GLN 17  
18 1 Y 1 A GLY 19  ? A GLY 18  
19 1 Y 1 A GLU 185 ? A GLU 184 
20 1 Y 1 A TYR 186 ? A TYR 185 
21 1 Y 1 A SER 187 ? A SER 186 
22 1 Y 1 A ALA 240 ? A ALA 239 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#