data_4Y5O
# 
_entry.id   4Y5O 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4Y5O         
WWPDB D_1000206745 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4Y5O 
_pdbx_database_status.recvd_initial_deposition_date   2015-02-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fisher, O.S.' 1 
'Boggon, T.J.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                7937 
_citation.page_last                 7937 
_citation.title                     'Structure and vascular function of MEKK3-cerebral cavernous malformations 2 complex.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/ncomms8937 
_citation.pdbx_database_id_PubMed   26235885 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fisher, O.S.' 1  ? 
primary 'Deng, H.'     2  ? 
primary 'Liu, D.'      3  ? 
primary 'Zhang, Y.'    4  ? 
primary 'Wei, R.'      5  ? 
primary 'Deng, Y.'     6  ? 
primary 'Zhang, F.'    7  ? 
primary 'Louvi, A.'    8  ? 
primary 'Turk, B.E.'   9  ? 
primary 'Boggon, T.J.' 10 ? 
primary 'Su, B.'       11 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   94.950 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4Y5O 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     43.310 
_cell.length_a_esd                 ? 
_cell.length_b                     45.349 
_cell.length_b_esd                 ? 
_cell.length_c                     61.533 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4Y5O 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Malcavernin                                        11162.600 1  ?         ? ? ? 
2 polymer man 'Mitogen-activated protein kinase kinase kinase 3' 14680.643 1  2.7.11.25 ? ? ? 
3 water   nat water                                              18.015    20 ?         ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Cerebral cavernous malformations 2 protein' 
2 'MAPK/ERK kinase kinase 3,MEKK 3'            
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLLLGLRPFIPEKD
SQHFENFLETIGVKDGRG
;
;GSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLLLGLRPFIPEKD
SQHFENFLETIGVKDGRG
;
A ? 
2 'polypeptide(L)' no no 
;GSMDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFG
QPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQD
;
;GSMDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFG
QPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQD
;
B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   LYS n 
1 4   THR n 
1 5   ILE n 
1 6   SER n 
1 7   GLU n 
1 8   SER n 
1 9   GLU n 
1 10  LEU n 
1 11  SER n 
1 12  ALA n 
1 13  SER n 
1 14  ALA n 
1 15  THR n 
1 16  GLU n 
1 17  LEU n 
1 18  LEU n 
1 19  GLN n 
1 20  ASP n 
1 21  TYR n 
1 22  MET n 
1 23  LEU n 
1 24  THR n 
1 25  LEU n 
1 26  ARG n 
1 27  THR n 
1 28  LYS n 
1 29  LEU n 
1 30  SER n 
1 31  SER n 
1 32  GLN n 
1 33  GLU n 
1 34  ILE n 
1 35  GLN n 
1 36  GLN n 
1 37  PHE n 
1 38  ALA n 
1 39  ALA n 
1 40  LEU n 
1 41  LEU n 
1 42  HIS n 
1 43  GLU n 
1 44  TYR n 
1 45  ARG n 
1 46  ASN n 
1 47  GLY n 
1 48  ALA n 
1 49  SER n 
1 50  ILE n 
1 51  HIS n 
1 52  GLU n 
1 53  PHE n 
1 54  CYS n 
1 55  ILE n 
1 56  ASN n 
1 57  LEU n 
1 58  ARG n 
1 59  GLN n 
1 60  LEU n 
1 61  TYR n 
1 62  GLY n 
1 63  ASP n 
1 64  SER n 
1 65  ARG n 
1 66  LYS n 
1 67  PHE n 
1 68  LEU n 
1 69  LEU n 
1 70  LEU n 
1 71  GLY n 
1 72  LEU n 
1 73  ARG n 
1 74  PRO n 
1 75  PHE n 
1 76  ILE n 
1 77  PRO n 
1 78  GLU n 
1 79  LYS n 
1 80  ASP n 
1 81  SER n 
1 82  GLN n 
1 83  HIS n 
1 84  PHE n 
1 85  GLU n 
1 86  ASN n 
1 87  PHE n 
1 88  LEU n 
1 89  GLU n 
1 90  THR n 
1 91  ILE n 
1 92  GLY n 
1 93  VAL n 
1 94  LYS n 
1 95  ASP n 
1 96  GLY n 
1 97  ARG n 
1 98  GLY n 
2 1   GLY n 
2 2   SER n 
2 3   MET n 
2 4   ASP n 
2 5   GLU n 
2 6   GLN n 
2 7   GLU n 
2 8   ALA n 
2 9   LEU n 
2 10  ASN n 
2 11  SER n 
2 12  ILE n 
2 13  MET n 
2 14  ASN n 
2 15  ASP n 
2 16  LEU n 
2 17  VAL n 
2 18  ALA n 
2 19  LEU n 
2 20  GLN n 
2 21  MET n 
2 22  ASN n 
2 23  ARG n 
2 24  ARG n 
2 25  HIS n 
2 26  ARG n 
2 27  MET n 
2 28  PRO n 
2 29  GLY n 
2 30  TYR n 
2 31  GLU n 
2 32  THR n 
2 33  MET n 
2 34  LYS n 
2 35  ASN n 
2 36  LYS n 
2 37  ASP n 
2 38  THR n 
2 39  GLY n 
2 40  HIS n 
2 41  SER n 
2 42  ASN n 
2 43  ARG n 
2 44  GLN n 
2 45  SER n 
2 46  ASP n 
2 47  VAL n 
2 48  ARG n 
2 49  ILE n 
2 50  LYS n 
2 51  PHE n 
2 52  GLU n 
2 53  HIS n 
2 54  ASN n 
2 55  GLY n 
2 56  GLU n 
2 57  ARG n 
2 58  ARG n 
2 59  ILE n 
2 60  ILE n 
2 61  ALA n 
2 62  PHE n 
2 63  SER n 
2 64  ARG n 
2 65  PRO n 
2 66  VAL n 
2 67  LYS n 
2 68  TYR n 
2 69  GLU n 
2 70  ASP n 
2 71  VAL n 
2 72  GLU n 
2 73  HIS n 
2 74  LYS n 
2 75  VAL n 
2 76  THR n 
2 77  THR n 
2 78  VAL n 
2 79  PHE n 
2 80  GLY n 
2 81  GLN n 
2 82  PRO n 
2 83  LEU n 
2 84  ASP n 
2 85  LEU n 
2 86  HIS n 
2 87  TYR n 
2 88  MET n 
2 89  ASN n 
2 90  ASN n 
2 91  GLU n 
2 92  LEU n 
2 93  SER n 
2 94  ILE n 
2 95  LEU n 
2 96  LEU n 
2 97  LYS n 
2 98  ASN n 
2 99  GLN n 
2 100 ASP n 
2 101 ASP n 
2 102 LEU n 
2 103 ASP n 
2 104 LYS n 
2 105 ALA n 
2 106 ILE n 
2 107 ASP n 
2 108 ILE n 
2 109 LEU n 
2 110 ASP n 
2 111 ARG n 
2 112 SER n 
2 113 SER n 
2 114 SER n 
2 115 MET n 
2 116 LYS n 
2 117 SER n 
2 118 LEU n 
2 119 ARG n 
2 120 ILE n 
2 121 LEU n 
2 122 LEU n 
2 123 LEU n 
2 124 SER n 
2 125 GLN n 
2 126 ASP n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 98  Human ? 'CCM2, C7orf22, PP10187' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 469008 ? ? ? ? ? ? 'Rosetta (DE3)' ? ? ? ? ? ? ? plasmid ? ? ? pET32 ? ? 
2 1 sample 'Biological sequence' 1 126 Human ? 'MAP3K3, MAPKKK3, MEKK3' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 469008 ? ? ? ? ? ? 'BL21 (DE3)'    ? ? ? ? ? ? ? plasmid ? ? ? pCDF  ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CCM2_HUMAN Q9BSQ5 Q9BSQ5-2 1 
;SKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLLLGLRPFIPEKDS
QHFENFLETIGVKDGRG
;
304 
2 UNP M3K3_HUMAN Q99759 ?        2 
;MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAFSRPVKYEDVEHKVTTVFGQP
LDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILLLSQD
;
1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4Y5O A 2 ? 98  ? Q9BSQ5 304 ? 400 ? 283 379 
2 2 4Y5O B 3 ? 126 ? Q99759 1   ? 124 ? 1   124 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4Y5O GLY A 1 ? UNP Q9BSQ5 ? ? 'expression tag' 282 1 
2 4Y5O GLY B 1 ? UNP Q99759 ? ? 'expression tag' -1  2 
2 4Y5O SER B 2 ? UNP Q99759 ? ? 'expression tag' 0   3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4Y5O 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.33 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.20 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.2 M potassium phosphate and 20% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-07-24 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97914 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97914 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            23.9 
_reflns.entry_id                         4Y5O 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.350 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       10025 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.600 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.700 
_reflns.pdbx_Rmerge_I_obs                0.115 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         13.256 
_reflns.pdbx_netI_over_sigmaI            11.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.042 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         57461 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.350 2.430  ? ? ? ? ? 1009 ? 98.700 ? ? ? ? 0.688 ? ? ? ? ? ? ? ? 5.500 ? 1.036 ? ? ? ? 0 1  1 ? ? 
2.430 2.530  ? ? ? ? ? 1014 ? 99.100 ? ? ? ? 0.460 ? ? ? ? ? ? ? ? 5.600 ? 0.944 ? ? ? ? 0 2  1 ? ? 
2.530 2.650  ? ? ? ? ? 994  ? 99.700 ? ? ? ? 0.398 ? ? ? ? ? ? ? ? 5.600 ? 1.059 ? ? ? ? 0 3  1 ? ? 
2.650 2.790  ? ? ? ? ? 1002 ? 99.000 ? ? ? ? 0.350 ? ? ? ? ? ? ? ? 5.800 ? 1.133 ? ? ? ? 0 4  1 ? ? 
2.790 2.960  ? ? ? ? ? 1021 ? 99.000 ? ? ? ? 0.228 ? ? ? ? ? ? ? ? 5.900 ? 1.047 ? ? ? ? 0 5  1 ? ? 
2.960 3.190  ? ? ? ? ? 1013 ? 98.900 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 6.000 ? 1.076 ? ? ? ? 0 6  1 ? ? 
3.190 3.510  ? ? ? ? ? 996  ? 97.300 ? ? ? ? 0.144 ? ? ? ? ? ? ? ? 6.000 ? 1.073 ? ? ? ? 0 7  1 ? ? 
3.510 4.020  ? ? ? ? ? 950  ? 92.700 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 5.300 ? 0.971 ? ? ? ? 0 8  1 ? ? 
4.020 5.060  ? ? ? ? ? 1003 ? 95.900 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 5.800 ? 0.995 ? ? ? ? 0 9  1 ? ? 
5.060 50.000 ? ? ? ? ? 1023 ? 95.700 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 6.000 ? 1.071 ? ? ? ? 0 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                183.490 
_refine.B_iso_mean                               79.8790 
_refine.B_iso_min                                20.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4Y5O 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.3500 
_refine.ls_d_res_low                             36.8110 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     9555 
_refine.ls_number_reflns_R_free                  463 
_refine.ls_number_reflns_R_work                  9092 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    94.5300 
_refine.ls_percent_reflns_R_free                 4.8500 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2087 
_refine.ls_R_factor_R_free                       0.2323 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2075 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.350 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '4FQN, 2O2V' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.4300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.3500 
_refine_hist.d_res_low                        36.8110 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             20 
_refine_hist.number_atoms_total               1463 
_refine_hist.pdbx_number_residues_total       181 
_refine_hist.pdbx_B_iso_mean_solvent          60.69 
_refine_hist.pdbx_number_atoms_protein        1443 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 1473 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.018  ? 1987 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.059  ? 229  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 258  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.151 ? 556  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.3500 2.6900  3030 . 160 2870 91.0000 . . . 0.3214 . 0.2475 . . . . . . 3 . . . 
'X-RAY DIFFRACTION' 2.6900 3.3888  3276 . 156 3120 98.0000 . . . 0.2862 . 0.2596 . . . . . . 3 . . . 
'X-RAY DIFFRACTION' 3.3888 36.8153 3249 . 147 3102 95.0000 . . . 0.1977 . 0.1812 . . . . . . 3 . . . 
# 
_struct.entry_id                     4Y5O 
_struct.title                        'CCM2 HHD in complex with MEKK3 NPB1' 
_struct.pdbx_descriptor              'CCM2, MEKK3' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4Y5O 
_struct_keywords.text            'Complex, kinase, scaffold, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ALA A 14 ? LEU A 29  ? ALA A 295 LEU A 310 1 ? 16 
HELX_P HELX_P2  AA2 SER A 30 ? ASN A 46  ? SER A 311 ASN A 327 1 ? 17 
HELX_P HELX_P3  AA3 SER A 49 ? TYR A 61  ? SER A 330 TYR A 342 1 ? 13 
HELX_P HELX_P4  AA4 GLY A 62 ? SER A 64  ? GLY A 343 SER A 345 5 ? 3  
HELX_P HELX_P5  AA5 ARG A 65 ? ARG A 73  ? ARG A 346 ARG A 354 1 ? 9  
HELX_P HELX_P6  AA6 PRO A 74 ? ILE A 76  ? PRO A 355 ILE A 357 5 ? 3  
HELX_P HELX_P7  AA7 PRO A 77 ? PHE A 87  ? PRO A 358 PHE A 368 1 ? 11 
HELX_P HELX_P8  AA8 MET B 3  ? VAL B 17  ? MET B 1   VAL B 15  1 ? 15 
HELX_P HELX_P9  AA9 LYS B 67 ? GLY B 80  ? LYS B 65  GLY B 78  1 ? 14 
HELX_P HELX_P10 AB1 ASN B 89 ? SER B 93  ? ASN B 87  SER B 91  5 ? 5  
HELX_P HELX_P11 AB2 ASN B 98 ? SER B 112 ? ASN B 96  SER B 110 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           64 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            62 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    65 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     63 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       6.00 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? parallel      
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU B 56  ? PHE B 62  ? GLU B 54  PHE B 60  
AA1 2 VAL B 47  ? HIS B 53  ? VAL B 45  HIS B 51  
AA1 3 LEU B 118 ? LEU B 123 ? LEU B 116 LEU B 121 
AA1 4 ASP B 84  ? TYR B 87  ? ASP B 82  TYR B 85  
AA1 5 ILE B 94  ? LEU B 95  ? ILE B 92  LEU B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O PHE B 62  ? O PHE B 60  N VAL B 47  ? N VAL B 45  
AA1 2 3 N GLU B 52  ? N GLU B 50  O LEU B 122 ? O LEU B 120 
AA1 3 4 O LEU B 123 ? O LEU B 121 N ASP B 84  ? N ASP B 82  
AA1 4 5 N TYR B 87  ? N TYR B 85  O ILE B 94  ? O ILE B 92  
# 
_atom_sites.entry_id                    4Y5O 
_atom_sites.fract_transf_matrix[1][1]   0.023089 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001999 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.022051 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.016312 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 12  ? 19.015  -0.170  -8.809  1.00 117.83 ? 293 ALA A N   1 
ATOM   2    C CA  . ALA A 1 12  ? 18.442  -1.434  -8.356  1.00 110.58 ? 293 ALA A CA  1 
ATOM   3    C C   . ALA A 1 12  ? 19.402  -2.607  -8.564  1.00 128.06 ? 293 ALA A C   1 
ATOM   4    O O   . ALA A 1 12  ? 19.953  -2.791  -9.653  1.00 125.45 ? 293 ALA A O   1 
ATOM   5    C CB  . ALA A 1 12  ? 17.116  -1.697  -9.053  1.00 95.11  ? 293 ALA A CB  1 
ATOM   6    N N   . SER A 1 13  ? 19.584  -3.399  -7.510  1.00 140.87 ? 294 SER A N   1 
ATOM   7    C CA  . SER A 1 13  ? 20.519  -4.524  -7.520  1.00 142.63 ? 294 SER A CA  1 
ATOM   8    C C   . SER A 1 13  ? 19.907  -5.801  -8.101  1.00 127.22 ? 294 SER A C   1 
ATOM   9    O O   . SER A 1 13  ? 20.625  -6.747  -8.434  1.00 119.00 ? 294 SER A O   1 
ATOM   10   C CB  . SER A 1 13  ? 21.052  -4.782  -6.104  1.00 150.79 ? 294 SER A CB  1 
ATOM   11   O OG  . SER A 1 13  ? 20.000  -4.871  -5.155  1.00 147.22 ? 294 SER A OG  1 
ATOM   12   N N   . ALA A 1 14  ? 18.582  -5.809  -8.232  1.00 118.91 ? 295 ALA A N   1 
ATOM   13   C CA  . ALA A 1 14  ? 17.841  -6.991  -8.672  1.00 101.02 ? 295 ALA A CA  1 
ATOM   14   C C   . ALA A 1 14  ? 17.550  -7.016  -10.174 1.00 89.51  ? 295 ALA A C   1 
ATOM   15   O O   . ALA A 1 14  ? 16.716  -7.795  -10.631 1.00 77.46  ? 295 ALA A O   1 
ATOM   16   C CB  . ALA A 1 14  ? 16.545  -7.121  -7.883  1.00 78.20  ? 295 ALA A CB  1 
ATOM   17   N N   . THR A 1 15  ? 18.227  -6.163  -10.936 1.00 102.37 ? 296 THR A N   1 
ATOM   18   C CA  . THR A 1 15  ? 18.116  -6.202  -12.390 1.00 99.42  ? 296 THR A CA  1 
ATOM   19   C C   . THR A 1 15  ? 18.630  -7.547  -12.897 1.00 97.94  ? 296 THR A C   1 
ATOM   20   O O   . THR A 1 15  ? 18.042  -8.151  -13.797 1.00 90.69  ? 296 THR A O   1 
ATOM   21   C CB  . THR A 1 15  ? 18.876  -5.037  -13.054 1.00 107.35 ? 296 THR A CB  1 
ATOM   22   O OG1 . THR A 1 15  ? 18.072  -3.851  -12.996 1.00 111.62 ? 296 THR A OG1 1 
ATOM   23   C CG2 . THR A 1 15  ? 19.190  -5.349  -14.508 1.00 81.13  ? 296 THR A CG2 1 
ATOM   24   N N   . GLU A 1 16  ? 19.710  -8.028  -12.290 1.00 108.39 ? 297 GLU A N   1 
ATOM   25   C CA  . GLU A 1 16  ? 20.261  -9.335  -12.632 1.00 115.28 ? 297 GLU A CA  1 
ATOM   26   C C   . GLU A 1 16  ? 19.247  -10.449 -12.333 1.00 100.00 ? 297 GLU A C   1 
ATOM   27   O O   . GLU A 1 16  ? 19.123  -11.413 -13.091 1.00 82.57  ? 297 GLU A O   1 
ATOM   28   C CB  . GLU A 1 16  ? 21.584  -9.574  -11.881 1.00 125.41 ? 297 GLU A CB  1 
ATOM   29   C CG  . GLU A 1 16  ? 22.450  -10.699 -12.463 1.00 134.80 ? 297 GLU A CG  1 
ATOM   30   C CD  . GLU A 1 16  ? 23.829  -10.806 -11.816 1.00 153.52 ? 297 GLU A CD  1 
ATOM   31   O OE1 . GLU A 1 16  ? 24.055  -10.167 -10.766 1.00 162.29 ? 297 GLU A OE1 1 
ATOM   32   O OE2 . GLU A 1 16  ? 24.690  -11.532 -12.362 1.00 160.17 ? 297 GLU A OE2 1 
ATOM   33   N N   . LEU A 1 17  ? 18.508  -10.299 -11.239 1.00 92.72  ? 298 LEU A N   1 
ATOM   34   C CA  . LEU A 1 17  ? 17.592  -11.347 -10.799 1.00 94.65  ? 298 LEU A CA  1 
ATOM   35   C C   . LEU A 1 17  ? 16.379  -11.461 -11.726 1.00 83.09  ? 298 LEU A C   1 
ATOM   36   O O   . LEU A 1 17  ? 15.752  -12.514 -11.820 1.00 72.42  ? 298 LEU A O   1 
ATOM   37   C CB  . LEU A 1 17  ? 17.193  -11.133 -9.338  1.00 104.06 ? 298 LEU A CB  1 
ATOM   38   C CG  . LEU A 1 17  ? 18.121  -11.802 -8.316  1.00 113.44 ? 298 LEU A CG  1 
ATOM   39   C CD1 . LEU A 1 17  ? 17.856  -13.294 -8.304  1.00 118.47 ? 298 LEU A CD1 1 
ATOM   40   C CD2 . LEU A 1 17  ? 19.613  -11.523 -8.558  1.00 105.06 ? 298 LEU A CD2 1 
ATOM   41   N N   . LEU A 1 18  ? 16.080  -10.373 -12.428 1.00 82.63  ? 299 LEU A N   1 
ATOM   42   C CA  . LEU A 1 18  ? 15.110  -10.390 -13.520 1.00 72.05  ? 299 LEU A CA  1 
ATOM   43   C C   . LEU A 1 18  ? 15.659  -11.111 -14.759 1.00 78.74  ? 299 LEU A C   1 
ATOM   44   O O   . LEU A 1 18  ? 14.965  -11.926 -15.373 1.00 76.33  ? 299 LEU A O   1 
ATOM   45   C CB  . LEU A 1 18  ? 14.698  -8.963  -13.894 1.00 73.48  ? 299 LEU A CB  1 
ATOM   46   C CG  . LEU A 1 18  ? 13.869  -8.825  -15.176 1.00 80.25  ? 299 LEU A CG  1 
ATOM   47   C CD1 . LEU A 1 18  ? 12.513  -9.433  -14.958 1.00 58.93  ? 299 LEU A CD1 1 
ATOM   48   C CD2 . LEU A 1 18  ? 13.735  -7.381  -15.652 1.00 85.10  ? 299 LEU A CD2 1 
ATOM   49   N N   . GLN A 1 19  ? 16.902  -10.814 -15.129 1.00 80.38  ? 300 GLN A N   1 
ATOM   50   C CA  . GLN A 1 19  ? 17.498  -11.408 -16.327 1.00 77.94  ? 300 GLN A CA  1 
ATOM   51   C C   . GLN A 1 19  ? 17.650  -12.925 -16.188 1.00 75.57  ? 300 GLN A C   1 
ATOM   52   O O   . GLN A 1 19  ? 17.414  -13.672 -17.139 1.00 74.04  ? 300 GLN A O   1 
ATOM   53   C CB  . GLN A 1 19  ? 18.836  -10.734 -16.660 1.00 70.88  ? 300 GLN A CB  1 
ATOM   54   C CG  . GLN A 1 19  ? 18.730  -9.220  -16.923 1.00 79.49  ? 300 GLN A CG  1 
ATOM   55   C CD  . GLN A 1 19  ? 20.084  -8.516  -17.028 1.00 104.23 ? 300 GLN A CD  1 
ATOM   56   O OE1 . GLN A 1 19  ? 21.095  -8.981  -16.498 1.00 101.12 ? 300 GLN A OE1 1 
ATOM   57   N NE2 . GLN A 1 19  ? 20.100  -7.381  -17.716 1.00 112.99 ? 300 GLN A NE2 1 
ATOM   58   N N   . ASP A 1 20  ? 18.008  -13.376 -14.992 1.00 63.65  ? 301 ASP A N   1 
ATOM   59   C CA  . ASP A 1 20  ? 18.143  -14.805 -14.742 1.00 72.92  ? 301 ASP A CA  1 
ATOM   60   C C   . ASP A 1 20  ? 16.798  -15.497 -14.848 1.00 68.25  ? 301 ASP A C   1 
ATOM   61   O O   . ASP A 1 20  ? 16.701  -16.615 -15.334 1.00 72.69  ? 301 ASP A O   1 
ATOM   62   C CB  . ASP A 1 20  ? 18.773  -15.049 -13.375 1.00 95.92  ? 301 ASP A CB  1 
ATOM   63   C CG  . ASP A 1 20  ? 20.196  -14.518 -13.290 1.00 118.93 ? 301 ASP A CG  1 
ATOM   64   O OD1 . ASP A 1 20  ? 20.934  -14.618 -14.298 1.00 117.91 ? 301 ASP A OD1 1 
ATOM   65   O OD2 . ASP A 1 20  ? 20.572  -13.995 -12.218 1.00 127.81 ? 301 ASP A OD2 1 
ATOM   66   N N   . TYR A 1 21  ? 15.751  -14.823 -14.397 1.00 72.48  ? 302 TYR A N   1 
ATOM   67   C CA  . TYR A 1 21  ? 14.408  -15.367 -14.525 1.00 71.75  ? 302 TYR A CA  1 
ATOM   68   C C   . TYR A 1 21  ? 13.940  -15.373 -15.985 1.00 54.44  ? 302 TYR A C   1 
ATOM   69   O O   . TYR A 1 21  ? 13.360  -16.354 -16.441 1.00 71.34  ? 302 TYR A O   1 
ATOM   70   C CB  . TYR A 1 21  ? 13.428  -14.592 -13.647 1.00 69.88  ? 302 TYR A CB  1 
ATOM   71   C CG  . TYR A 1 21  ? 12.048  -15.206 -13.614 1.00 66.14  ? 302 TYR A CG  1 
ATOM   72   C CD1 . TYR A 1 21  ? 10.942  -14.505 -14.057 1.00 68.76  ? 302 TYR A CD1 1 
ATOM   73   C CD2 . TYR A 1 21  ? 11.859  -16.497 -13.150 1.00 73.05  ? 302 TYR A CD2 1 
ATOM   74   C CE1 . TYR A 1 21  ? 9.676   -15.067 -14.025 1.00 70.26  ? 302 TYR A CE1 1 
ATOM   75   C CE2 . TYR A 1 21  ? 10.603  -17.070 -13.121 1.00 71.92  ? 302 TYR A CE2 1 
ATOM   76   C CZ  . TYR A 1 21  ? 9.517   -16.348 -13.554 1.00 72.03  ? 302 TYR A CZ  1 
ATOM   77   O OH  . TYR A 1 21  ? 8.264   -16.910 -13.533 1.00 60.87  ? 302 TYR A OH  1 
ATOM   78   N N   . MET A 1 22  ? 14.202  -14.283 -16.708 1.00 54.70  ? 303 MET A N   1 
ATOM   79   C CA  . MET A 1 22  ? 13.906  -14.219 -18.145 1.00 58.70  ? 303 MET A CA  1 
ATOM   80   C C   . MET A 1 22  ? 14.639  -15.330 -18.876 1.00 57.51  ? 303 MET A C   1 
ATOM   81   O O   . MET A 1 22  ? 14.104  -15.953 -19.792 1.00 64.76  ? 303 MET A O   1 
ATOM   82   C CB  . MET A 1 22  ? 14.334  -12.876 -18.742 1.00 64.88  ? 303 MET A CB  1 
ATOM   83   C CG  . MET A 1 22  ? 13.483  -11.678 -18.346 1.00 80.70  ? 303 MET A CG  1 
ATOM   84   S SD  . MET A 1 22  ? 11.755  -11.821 -18.829 1.00 79.89  ? 303 MET A SD  1 
ATOM   85   C CE  . MET A 1 22  ? 11.045  -12.387 -17.290 1.00 80.47  ? 303 MET A CE  1 
ATOM   86   N N   . LEU A 1 23  ? 15.870  -15.570 -18.447 1.00 54.73  ? 304 LEU A N   1 
ATOM   87   C CA  . LEU A 1 23  ? 16.696  -16.606 -19.032 1.00 70.77  ? 304 LEU A CA  1 
ATOM   88   C C   . LEU A 1 23  ? 16.086  -17.983 -18.821 1.00 68.16  ? 304 LEU A C   1 
ATOM   89   O O   . LEU A 1 23  ? 16.030  -18.784 -19.739 1.00 73.87  ? 304 LEU A O   1 
ATOM   90   C CB  . LEU A 1 23  ? 18.102  -16.561 -18.446 1.00 62.42  ? 304 LEU A CB  1 
ATOM   91   C CG  . LEU A 1 23  ? 19.071  -17.321 -19.335 1.00 63.79  ? 304 LEU A CG  1 
ATOM   92   C CD1 . LEU A 1 23  ? 18.941  -16.794 -20.754 1.00 58.21  ? 304 LEU A CD1 1 
ATOM   93   C CD2 . LEU A 1 23  ? 20.520  -17.216 -18.831 1.00 60.85  ? 304 LEU A CD2 1 
ATOM   94   N N   . THR A 1 24  ? 15.633  -18.241 -17.603 1.00 68.04  ? 305 THR A N   1 
ATOM   95   C CA  . THR A 1 24  ? 14.974  -19.493 -17.265 1.00 71.33  ? 305 THR A CA  1 
ATOM   96   C C   . THR A 1 24  ? 13.717  -19.739 -18.123 1.00 74.11  ? 305 THR A C   1 
ATOM   97   O O   . THR A 1 24  ? 13.501  -20.843 -18.632 1.00 74.10  ? 305 THR A O   1 
ATOM   98   C CB  . THR A 1 24  ? 14.607  -19.494 -15.785 1.00 71.65  ? 305 THR A CB  1 
ATOM   99   O OG1 . THR A 1 24  ? 15.802  -19.326 -15.000 1.00 69.98  ? 305 THR A OG1 1 
ATOM   100  C CG2 . THR A 1 24  ? 13.927  -20.786 -15.413 1.00 76.26  ? 305 THR A CG2 1 
ATOM   101  N N   . LEU A 1 25  ? 12.899  -18.704 -18.286 1.00 62.83  ? 306 LEU A N   1 
ATOM   102  C CA  . LEU A 1 25  ? 11.714  -18.791 -19.141 1.00 71.37  ? 306 LEU A CA  1 
ATOM   103  C C   . LEU A 1 25  ? 12.076  -19.089 -20.599 1.00 68.94  ? 306 LEU A C   1 
ATOM   104  O O   . LEU A 1 25  ? 11.518  -20.001 -21.206 1.00 64.83  ? 306 LEU A O   1 
ATOM   105  C CB  . LEU A 1 25  ? 10.914  -17.493 -19.086 1.00 53.95  ? 306 LEU A CB  1 
ATOM   106  C CG  . LEU A 1 25  ? 10.326  -17.067 -17.756 1.00 60.11  ? 306 LEU A CG  1 
ATOM   107  C CD1 . LEU A 1 25  ? 9.526   -15.805 -17.960 1.00 54.45  ? 306 LEU A CD1 1 
ATOM   108  C CD2 . LEU A 1 25  ? 9.466   -18.178 -17.192 1.00 74.74  ? 306 LEU A CD2 1 
ATOM   109  N N   . ARG A 1 26  ? 13.007  -18.307 -21.144 1.00 70.09  ? 307 ARG A N   1 
ATOM   110  C CA  . ARG A 1 26  ? 13.476  -18.464 -22.523 1.00 70.67  ? 307 ARG A CA  1 
ATOM   111  C C   . ARG A 1 26  ? 14.049  -19.856 -22.774 1.00 62.93  ? 307 ARG A C   1 
ATOM   112  O O   . ARG A 1 26  ? 13.946  -20.381 -23.878 1.00 60.78  ? 307 ARG A O   1 
ATOM   113  C CB  . ARG A 1 26  ? 14.516  -17.378 -22.848 1.00 70.67  ? 307 ARG A CB  1 
ATOM   114  C CG  . ARG A 1 26  ? 15.173  -17.455 -24.231 1.00 73.78  ? 307 ARG A CG  1 
ATOM   115  C CD  . ARG A 1 26  ? 16.286  -16.398 -24.388 1.00 63.48  ? 307 ARG A CD  1 
ATOM   116  N NE  . ARG A 1 26  ? 15.752  -15.045 -24.290 1.00 64.10  ? 307 ARG A NE  1 
ATOM   117  C CZ  . ARG A 1 26  ? 15.369  -14.321 -25.337 1.00 75.56  ? 307 ARG A CZ  1 
ATOM   118  N NH1 . ARG A 1 26  ? 15.478  -14.814 -26.563 1.00 68.60  ? 307 ARG A NH1 1 
ATOM   119  N NH2 . ARG A 1 26  ? 14.879  -13.102 -25.163 1.00 77.99  ? 307 ARG A NH2 1 
ATOM   120  N N   . THR A 1 27  ? 14.618  -20.475 -21.743 1.00 68.16  ? 308 THR A N   1 
ATOM   121  C CA  . THR A 1 27  ? 15.350  -21.724 -21.950 1.00 70.56  ? 308 THR A CA  1 
ATOM   122  C C   . THR A 1 27  ? 14.592  -23.015 -21.621 1.00 65.25  ? 308 THR A C   1 
ATOM   123  O O   . THR A 1 27  ? 14.942  -24.070 -22.132 1.00 74.63  ? 308 THR A O   1 
ATOM   124  C CB  . THR A 1 27  ? 16.715  -21.708 -21.234 1.00 72.94  ? 308 THR A CB  1 
ATOM   125  O OG1 . THR A 1 27  ? 16.531  -21.414 -19.843 1.00 86.71  ? 308 THR A OG1 1 
ATOM   126  C CG2 . THR A 1 27  ? 17.614  -20.655 -21.849 1.00 55.19  ? 308 THR A CG2 1 
ATOM   127  N N   . LYS A 1 28  ? 13.554  -22.921 -20.793 1.00 63.44  ? 309 LYS A N   1 
ATOM   128  C CA  . LYS A 1 28  ? 12.803  -24.103 -20.339 1.00 67.35  ? 309 LYS A CA  1 
ATOM   129  C C   . LYS A 1 28  ? 11.344  -24.212 -20.832 1.00 67.04  ? 309 LYS A C   1 
ATOM   130  O O   . LYS A 1 28  ? 10.785  -25.309 -20.869 1.00 67.37  ? 309 LYS A O   1 
ATOM   131  C CB  . LYS A 1 28  ? 12.830  -24.185 -18.810 1.00 60.59  ? 309 LYS A CB  1 
ATOM   132  C CG  . LYS A 1 28  ? 14.243  -24.185 -18.211 1.00 72.87  ? 309 LYS A CG  1 
ATOM   133  C CD  . LYS A 1 28  ? 14.207  -24.163 -16.679 1.00 87.06  ? 309 LYS A CD  1 
ATOM   134  C CE  . LYS A 1 28  ? 14.210  -25.562 -16.087 1.00 90.68  ? 309 LYS A CE  1 
ATOM   135  N NZ  . LYS A 1 28  ? 15.487  -26.280 -16.351 1.00 94.33  ? 309 LYS A NZ  1 
ATOM   136  N N   . LEU A 1 29  ? 10.734  -23.084 -21.201 1.00 60.76  ? 310 LEU A N   1 
ATOM   137  C CA  . LEU A 1 29  ? 9.336   -23.053 -21.667 1.00 61.56  ? 310 LEU A CA  1 
ATOM   138  C C   . LEU A 1 29  ? 9.182   -23.066 -23.193 1.00 63.69  ? 310 LEU A C   1 
ATOM   139  O O   . LEU A 1 29  ? 9.908   -22.370 -23.905 1.00 69.39  ? 310 LEU A O   1 
ATOM   140  C CB  . LEU A 1 29  ? 8.635   -21.806 -21.127 1.00 58.60  ? 310 LEU A CB  1 
ATOM   141  C CG  . LEU A 1 29  ? 7.534   -22.017 -20.100 1.00 62.36  ? 310 LEU A CG  1 
ATOM   142  C CD1 . LEU A 1 29  ? 7.974   -23.029 -19.067 1.00 58.99  ? 310 LEU A CD1 1 
ATOM   143  C CD2 . LEU A 1 29  ? 7.161   -20.703 -19.448 1.00 73.20  ? 310 LEU A CD2 1 
ATOM   144  N N   . SER A 1 30  ? 8.232   -23.851 -23.690 1.00 62.07  ? 311 SER A N   1 
ATOM   145  C CA  . SER A 1 30  ? 7.883   -23.823 -25.110 1.00 65.45  ? 311 SER A CA  1 
ATOM   146  C C   . SER A 1 30  ? 7.354   -22.449 -25.509 1.00 66.31  ? 311 SER A C   1 
ATOM   147  O O   . SER A 1 30  ? 6.906   -21.679 -24.658 1.00 55.94  ? 311 SER A O   1 
ATOM   148  C CB  . SER A 1 30  ? 6.840   -24.896 -25.423 1.00 79.79  ? 311 SER A CB  1 
ATOM   149  O OG  . SER A 1 30  ? 5.688   -24.735 -24.618 1.00 79.82  ? 311 SER A OG  1 
ATOM   150  N N   . SER A 1 31  ? 7.413   -22.130 -26.801 1.00 66.99  ? 312 SER A N   1 
ATOM   151  C CA  . SER A 1 31  ? 7.004   -20.806 -27.261 1.00 48.45  ? 312 SER A CA  1 
ATOM   152  C C   . SER A 1 31  ? 5.579   -20.483 -26.854 1.00 62.79  ? 312 SER A C   1 
ATOM   153  O O   . SER A 1 31  ? 5.285   -19.365 -26.432 1.00 61.83  ? 312 SER A O   1 
ATOM   154  C CB  . SER A 1 31  ? 7.161   -20.664 -28.783 1.00 73.92  ? 312 SER A CB  1 
ATOM   155  O OG  . SER A 1 31  ? 6.825   -19.354 -29.225 1.00 67.24  ? 312 SER A OG  1 
ATOM   156  N N   . GLN A 1 32  ? 4.707   -21.477 -26.975 1.00 58.84  ? 313 GLN A N   1 
ATOM   157  C CA  . GLN A 1 32  ? 3.296   -21.308 -26.674 1.00 77.47  ? 313 GLN A CA  1 
ATOM   158  C C   . GLN A 1 32  ? 3.070   -21.116 -25.172 1.00 75.50  ? 313 GLN A C   1 
ATOM   159  O O   . GLN A 1 32  ? 2.265   -20.272 -24.759 1.00 78.10  ? 313 GLN A O   1 
ATOM   160  C CB  . GLN A 1 32  ? 2.518   -22.520 -27.192 1.00 91.17  ? 313 GLN A CB  1 
ATOM   161  C CG  . GLN A 1 32  ? 1.007   -22.328 -27.239 1.00 114.31 ? 313 GLN A CG  1 
ATOM   162  C CD  . GLN A 1 32  ? 0.565   -21.178 -28.141 1.00 124.88 ? 313 GLN A CD  1 
ATOM   163  O OE1 . GLN A 1 32  ? 1.246   -20.820 -29.105 1.00 130.17 ? 313 GLN A OE1 1 
ATOM   164  N NE2 . GLN A 1 32  ? -0.588  -20.595 -27.825 1.00 120.99 ? 313 GLN A NE2 1 
ATOM   165  N N   . GLU A 1 33  ? 3.798   -21.886 -24.364 1.00 61.19  ? 314 GLU A N   1 
ATOM   166  C CA  . GLU A 1 33  ? 3.680   -21.784 -22.915 1.00 58.86  ? 314 GLU A CA  1 
ATOM   167  C C   . GLU A 1 33  ? 4.136   -20.408 -22.418 1.00 61.56  ? 314 GLU A C   1 
ATOM   168  O O   . GLU A 1 33  ? 3.666   -19.933 -21.389 1.00 51.11  ? 314 GLU A O   1 
ATOM   169  C CB  . GLU A 1 33  ? 4.443   -22.923 -22.215 1.00 68.91  ? 314 GLU A CB  1 
ATOM   170  C CG  . GLU A 1 33  ? 3.716   -24.281 -22.146 1.00 72.96  ? 314 GLU A CG  1 
ATOM   171  C CD  . GLU A 1 33  ? 4.598   -25.430 -21.648 1.00 92.02  ? 314 GLU A CD  1 
ATOM   172  O OE1 . GLU A 1 33  ? 5.782   -25.493 -22.028 1.00 88.67  ? 314 GLU A OE1 1 
ATOM   173  O OE2 . GLU A 1 33  ? 4.093   -26.282 -20.885 1.00 101.10 ? 314 GLU A OE2 1 
ATOM   174  N N   . ILE A 1 34  ? 5.044   -19.776 -23.163 1.00 53.03  ? 315 ILE A N   1 
ATOM   175  C CA  . ILE A 1 34  ? 5.472   -18.401 -22.886 1.00 56.37  ? 315 ILE A CA  1 
ATOM   176  C C   . ILE A 1 34  ? 4.364   -17.363 -23.173 1.00 60.78  ? 315 ILE A C   1 
ATOM   177  O O   . ILE A 1 34  ? 4.132   -16.474 -22.351 1.00 48.27  ? 315 ILE A O   1 
ATOM   178  C CB  . ILE A 1 34  ? 6.753   -18.027 -23.660 1.00 57.61  ? 315 ILE A CB  1 
ATOM   179  C CG1 . ILE A 1 34  ? 7.895   -18.972 -23.294 1.00 77.72  ? 315 ILE A CG1 1 
ATOM   180  C CG2 . ILE A 1 34  ? 7.168   -16.602 -23.351 1.00 61.31  ? 315 ILE A CG2 1 
ATOM   181  C CD1 . ILE A 1 34  ? 9.214   -18.672 -23.998 1.00 80.60  ? 315 ILE A CD1 1 
ATOM   182  N N   . GLN A 1 35  ? 3.701   -17.472 -24.332 1.00 53.91  ? 316 GLN A N   1 
ATOM   183  C CA  . GLN A 1 35  ? 2.608   -16.563 -24.697 1.00 50.37  ? 316 GLN A CA  1 
ATOM   184  C C   . GLN A 1 35  ? 1.468   -16.715 -23.707 1.00 48.12  ? 316 GLN A C   1 
ATOM   185  O O   . GLN A 1 35  ? 0.940   -15.719 -23.206 1.00 55.54  ? 316 GLN A O   1 
ATOM   186  C CB  . GLN A 1 35  ? 2.104   -16.828 -26.121 1.00 52.62  ? 316 GLN A CB  1 
ATOM   187  C CG  . GLN A 1 35  ? 3.209   -16.914 -27.190 1.00 62.99  ? 316 GLN A CG  1 
ATOM   188  C CD  . GLN A 1 35  ? 2.673   -17.055 -28.610 1.00 72.06  ? 316 GLN A CD  1 
ATOM   189  O OE1 . GLN A 1 35  ? 1.759   -16.345 -29.016 1.00 76.41  ? 316 GLN A OE1 1 
ATOM   190  N NE2 . GLN A 1 35  ? 3.257   -17.968 -29.373 1.00 77.03  ? 316 GLN A NE2 1 
ATOM   191  N N   . GLN A 1 36  ? 1.117   -17.964 -23.404 1.00 49.51  ? 317 GLN A N   1 
ATOM   192  C CA  . GLN A 1 36  ? 0.095   -18.251 -22.401 1.00 58.89  ? 317 GLN A CA  1 
ATOM   193  C C   . GLN A 1 36  ? 0.441   -17.614 -21.056 1.00 56.66  ? 317 GLN A C   1 
ATOM   194  O O   . GLN A 1 36  ? -0.365  -16.876 -20.495 1.00 56.66  ? 317 GLN A O   1 
ATOM   195  C CB  . GLN A 1 36  ? -0.083  -19.755 -22.226 1.00 56.04  ? 317 GLN A CB  1 
ATOM   196  C CG  . GLN A 1 36  ? -0.616  -20.459 -23.452 1.00 60.98  ? 317 GLN A CG  1 
ATOM   197  C CD  . GLN A 1 36  ? -0.980  -21.888 -23.166 1.00 70.96  ? 317 GLN A CD  1 
ATOM   198  O OE1 . GLN A 1 36  ? -0.619  -22.435 -22.125 1.00 82.62  ? 317 GLN A OE1 1 
ATOM   199  N NE2 . GLN A 1 36  ? -1.710  -22.504 -24.085 1.00 74.64  ? 317 GLN A NE2 1 
ATOM   200  N N   . PHE A 1 37  ? 1.645   -17.890 -20.560 1.00 50.90  ? 318 PHE A N   1 
ATOM   201  C CA  . PHE A 1 37  ? 2.115   -17.302 -19.308 1.00 63.63  ? 318 PHE A CA  1 
ATOM   202  C C   . PHE A 1 37  ? 2.131   -15.775 -19.342 1.00 59.84  ? 318 PHE A C   1 
ATOM   203  O O   . PHE A 1 37  ? 1.684   -15.138 -18.397 1.00 66.47  ? 318 PHE A O   1 
ATOM   204  C CB  . PHE A 1 37  ? 3.500   -17.834 -18.947 1.00 59.67  ? 318 PHE A CB  1 
ATOM   205  C CG  . PHE A 1 37  ? 4.074   -17.222 -17.709 1.00 69.99  ? 318 PHE A CG  1 
ATOM   206  C CD1 . PHE A 1 37  ? 3.477   -17.422 -16.474 1.00 72.61  ? 318 PHE A CD1 1 
ATOM   207  C CD2 . PHE A 1 37  ? 5.219   -16.447 -17.777 1.00 73.59  ? 318 PHE A CD2 1 
ATOM   208  C CE1 . PHE A 1 37  ? 4.013   -16.854 -15.334 1.00 68.51  ? 318 PHE A CE1 1 
ATOM   209  C CE2 . PHE A 1 37  ? 5.760   -15.875 -16.640 1.00 67.03  ? 318 PHE A CE2 1 
ATOM   210  C CZ  . PHE A 1 37  ? 5.160   -16.079 -15.420 1.00 68.34  ? 318 PHE A CZ  1 
ATOM   211  N N   . ALA A 1 38  ? 2.622   -15.193 -20.433 1.00 48.67  ? 319 ALA A N   1 
ATOM   212  C CA  . ALA A 1 38  ? 2.654   -13.730 -20.565 1.00 53.81  ? 319 ALA A CA  1 
ATOM   213  C C   . ALA A 1 38  ? 1.265   -13.136 -20.396 1.00 57.26  ? 319 ALA A C   1 
ATOM   214  O O   . ALA A 1 38  ? 1.090   -12.135 -19.703 1.00 73.44  ? 319 ALA A O   1 
ATOM   215  C CB  . ALA A 1 38  ? 3.247   -13.316 -21.907 1.00 48.80  ? 319 ALA A CB  1 
ATOM   216  N N   . ALA A 1 39  ? 0.288   -13.781 -21.030 1.00 48.81  ? 320 ALA A N   1 
ATOM   217  C CA  . ALA A 1 39  ? -1.110  -13.382 -20.937 1.00 50.03  ? 320 ALA A CA  1 
ATOM   218  C C   . ALA A 1 39  ? -1.626  -13.402 -19.502 1.00 55.34  ? 320 ALA A C   1 
ATOM   219  O O   . ALA A 1 39  ? -2.183  -12.415 -19.043 1.00 67.38  ? 320 ALA A O   1 
ATOM   220  C CB  . ALA A 1 39  ? -1.972  -14.261 -21.827 1.00 51.15  ? 320 ALA A CB  1 
ATOM   221  N N   . LEU A 1 40  ? -1.459  -14.518 -18.796 1.00 59.41  ? 321 LEU A N   1 
ATOM   222  C CA  . LEU A 1 40  ? -1.907  -14.578 -17.406 1.00 54.96  ? 321 LEU A CA  1 
ATOM   223  C C   . LEU A 1 40  ? -1.178  -13.535 -16.579 1.00 58.01  ? 321 LEU A C   1 
ATOM   224  O O   . LEU A 1 40  ? -1.788  -12.822 -15.789 1.00 55.89  ? 321 LEU A O   1 
ATOM   225  C CB  . LEU A 1 40  ? -1.675  -15.959 -16.801 1.00 64.13  ? 321 LEU A CB  1 
ATOM   226  C CG  . LEU A 1 40  ? -2.502  -17.102 -17.372 1.00 84.06  ? 321 LEU A CG  1 
ATOM   227  C CD1 . LEU A 1 40  ? -2.361  -18.357 -16.528 1.00 88.98  ? 321 LEU A CD1 1 
ATOM   228  C CD2 . LEU A 1 40  ? -3.957  -16.692 -17.477 1.00 88.12  ? 321 LEU A CD2 1 
ATOM   229  N N   . LEU A 1 41  ? 0.132   -13.445 -16.770 1.00 65.64  ? 322 LEU A N   1 
ATOM   230  C CA  . LEU A 1 41  ? 0.932   -12.494 -16.014 1.00 58.62  ? 322 LEU A CA  1 
ATOM   231  C C   . LEU A 1 41  ? 0.457   -11.082 -16.271 1.00 61.62  ? 322 LEU A C   1 
ATOM   232  O O   . LEU A 1 41  ? 0.530   -10.237 -15.397 1.00 54.61  ? 322 LEU A O   1 
ATOM   233  C CB  . LEU A 1 41  ? 2.405   -12.597 -16.388 1.00 62.23  ? 322 LEU A CB  1 
ATOM   234  C CG  . LEU A 1 41  ? 3.322   -11.806 -15.458 1.00 65.12  ? 322 LEU A CG  1 
ATOM   235  C CD1 . LEU A 1 41  ? 3.467   -12.537 -14.144 1.00 70.23  ? 322 LEU A CD1 1 
ATOM   236  C CD2 . LEU A 1 41  ? 4.674   -11.573 -16.081 1.00 60.17  ? 322 LEU A CD2 1 
ATOM   237  N N   . HIS A 1 42  ? -0.035  -10.806 -17.471 1.00 66.33  ? 323 HIS A N   1 
ATOM   238  C CA  . HIS A 1 42  ? -0.490  -9.449  -17.726 1.00 60.90  ? 323 HIS A CA  1 
ATOM   239  C C   . HIS A 1 42  ? -1.782  -9.149  -16.945 1.00 73.23  ? 323 HIS A C   1 
ATOM   240  O O   . HIS A 1 42  ? -1.941  -8.049  -16.400 1.00 67.61  ? 323 HIS A O   1 
ATOM   241  C CB  . HIS A 1 42  ? -0.649  -9.189  -19.217 1.00 64.50  ? 323 HIS A CB  1 
ATOM   242  C CG  . HIS A 1 42  ? -0.715  -7.739  -19.566 1.00 77.86  ? 323 HIS A CG  1 
ATOM   243  N ND1 . HIS A 1 42  ? 0.190   -6.818  -19.086 1.00 85.05  ? 323 HIS A ND1 1 
ATOM   244  C CD2 . HIS A 1 42  ? -1.575  -7.048  -20.350 1.00 90.70  ? 323 HIS A CD2 1 
ATOM   245  C CE1 . HIS A 1 42  ? -0.110  -5.622  -19.557 1.00 91.37  ? 323 HIS A CE1 1 
ATOM   246  N NE2 . HIS A 1 42  ? -1.175  -5.735  -20.329 1.00 100.81 ? 323 HIS A NE2 1 
ATOM   247  N N   . GLU A 1 43  ? -2.680  -10.133 -16.864 1.00 58.43  ? 324 GLU A N   1 
ATOM   248  C CA  . GLU A 1 43  ? -3.911  -9.974  -16.086 1.00 68.36  ? 324 GLU A CA  1 
ATOM   249  C C   . GLU A 1 43  ? -3.594  -9.656  -14.632 1.00 78.32  ? 324 GLU A C   1 
ATOM   250  O O   . GLU A 1 43  ? -4.181  -8.745  -14.046 1.00 79.61  ? 324 GLU A O   1 
ATOM   251  C CB  . GLU A 1 43  ? -4.775  -11.235 -16.142 1.00 62.08  ? 324 GLU A CB  1 
ATOM   252  C CG  . GLU A 1 43  ? -5.489  -11.461 -17.463 1.00 82.20  ? 324 GLU A CG  1 
ATOM   253  C CD  . GLU A 1 43  ? -6.459  -12.637 -17.420 1.00 94.75  ? 324 GLU A CD  1 
ATOM   254  O OE1 . GLU A 1 43  ? -6.876  -13.041 -16.314 1.00 99.15  ? 324 GLU A OE1 1 
ATOM   255  O OE2 . GLU A 1 43  ? -6.802  -13.157 -18.503 1.00 92.76  ? 324 GLU A OE2 1 
ATOM   256  N N   . TYR A 1 44  ? -2.664  -10.414 -14.055 1.00 73.14  ? 325 TYR A N   1 
ATOM   257  C CA  . TYR A 1 44  ? -2.286  -10.218 -12.656 1.00 87.36  ? 325 TYR A CA  1 
ATOM   258  C C   . TYR A 1 44  ? -1.659  -8.853  -12.435 1.00 77.73  ? 325 TYR A C   1 
ATOM   259  O O   . TYR A 1 44  ? -1.904  -8.212  -11.423 1.00 80.09  ? 325 TYR A O   1 
ATOM   260  C CB  . TYR A 1 44  ? -1.321  -11.308 -12.184 1.00 87.07  ? 325 TYR A CB  1 
ATOM   261  C CG  . TYR A 1 44  ? -0.852  -11.114 -10.759 1.00 95.55  ? 325 TYR A CG  1 
ATOM   262  C CD1 . TYR A 1 44  ? -1.609  -11.573 -9.690  1.00 103.53 ? 325 TYR A CD1 1 
ATOM   263  C CD2 . TYR A 1 44  ? 0.347   -10.475 -10.482 1.00 93.05  ? 325 TYR A CD2 1 
ATOM   264  C CE1 . TYR A 1 44  ? -1.187  -11.401 -8.389  1.00 110.64 ? 325 TYR A CE1 1 
ATOM   265  C CE2 . TYR A 1 44  ? 0.777   -10.296 -9.183  1.00 97.46  ? 325 TYR A CE2 1 
ATOM   266  C CZ  . TYR A 1 44  ? 0.007   -10.762 -8.140  1.00 109.70 ? 325 TYR A CZ  1 
ATOM   267  O OH  . TYR A 1 44  ? 0.428   -10.589 -6.843  1.00 111.22 ? 325 TYR A OH  1 
ATOM   268  N N   . ARG A 1 45  ? -0.840  -8.427  -13.387 1.00 72.67  ? 326 ARG A N   1 
ATOM   269  C CA  . ARG A 1 45  ? -0.219  -7.111  -13.346 1.00 70.86  ? 326 ARG A CA  1 
ATOM   270  C C   . ARG A 1 45  ? -1.294  -6.024  -13.343 1.00 76.61  ? 326 ARG A C   1 
ATOM   271  O O   . ARG A 1 45  ? -1.175  -5.014  -12.642 1.00 76.03  ? 326 ARG A O   1 
ATOM   272  C CB  . ARG A 1 45  ? 0.728   -6.948  -14.547 1.00 73.82  ? 326 ARG A CB  1 
ATOM   273  C CG  . ARG A 1 45  ? 1.434   -5.602  -14.653 1.00 66.90  ? 326 ARG A CG  1 
ATOM   274  C CD  . ARG A 1 45  ? 0.731   -4.678  -15.633 1.00 69.35  ? 326 ARG A CD  1 
ATOM   275  N NE  . ARG A 1 45  ? 1.143   -3.289  -15.458 1.00 90.03  ? 326 ARG A NE  1 
ATOM   276  C CZ  . ARG A 1 45  ? 2.042   -2.673  -16.219 1.00 95.29  ? 326 ARG A CZ  1 
ATOM   277  N NH1 . ARG A 1 45  ? 2.627   -3.320  -17.224 1.00 84.78  ? 326 ARG A NH1 1 
ATOM   278  N NH2 . ARG A 1 45  ? 2.350   -1.405  -15.977 1.00 94.95  ? 326 ARG A NH2 1 
ATOM   279  N N   . ASN A 1 46  ? -2.356  -6.264  -14.105 1.00 58.53  ? 327 ASN A N   1 
ATOM   280  C CA  . ASN A 1 46  ? -3.362  -5.253  -14.364 1.00 64.07  ? 327 ASN A CA  1 
ATOM   281  C C   . ASN A 1 46  ? -4.536  -5.284  -13.400 1.00 73.26  ? 327 ASN A C   1 
ATOM   282  O O   . ASN A 1 46  ? -5.608  -4.789  -13.723 1.00 89.24  ? 327 ASN A O   1 
ATOM   283  C CB  . ASN A 1 46  ? -3.856  -5.348  -15.818 1.00 64.71  ? 327 ASN A CB  1 
ATOM   284  C CG  . ASN A 1 46  ? -3.153  -4.364  -16.745 1.00 83.60  ? 327 ASN A CG  1 
ATOM   285  O OD1 . ASN A 1 46  ? -2.181  -3.711  -16.367 1.00 93.96  ? 327 ASN A OD1 1 
ATOM   286  N ND2 . ASN A 1 46  ? -3.644  -4.262  -17.970 1.00 86.82  ? 327 ASN A ND2 1 
ATOM   287  N N   . GLY A 1 47  ? -4.342  -5.867  -12.221 1.00 87.84  ? 328 GLY A N   1 
ATOM   288  C CA  . GLY A 1 47  ? -5.342  -5.759  -11.174 1.00 90.13  ? 328 GLY A CA  1 
ATOM   289  C C   . GLY A 1 47  ? -6.018  -7.030  -10.699 1.00 116.52 ? 328 GLY A C   1 
ATOM   290  O O   . GLY A 1 47  ? -6.866  -6.976  -9.810  1.00 117.97 ? 328 GLY A O   1 
ATOM   291  N N   . ALA A 1 48  ? -5.655  -8.169  -11.281 1.00 112.97 ? 329 ALA A N   1 
ATOM   292  C CA  . ALA A 1 48  ? -6.225  -9.452  -10.869 1.00 113.53 ? 329 ALA A CA  1 
ATOM   293  C C   . ALA A 1 48  ? -5.769  -9.849  -9.471  1.00 117.50 ? 329 ALA A C   1 
ATOM   294  O O   . ALA A 1 48  ? -4.659  -9.509  -9.050  1.00 87.21  ? 329 ALA A O   1 
ATOM   295  C CB  . ALA A 1 48  ? -5.843  -10.529 -11.845 1.00 80.09  ? 329 ALA A CB  1 
ATOM   296  N N   . SER A 1 49  ? -6.618  -10.587 -8.761  1.00 112.02 ? 330 SER A N   1 
ATOM   297  C CA  . SER A 1 49  ? -6.246  -11.098 -7.446  1.00 111.80 ? 330 SER A CA  1 
ATOM   298  C C   . SER A 1 49  ? -5.083  -12.084 -7.551  1.00 93.37  ? 330 SER A C   1 
ATOM   299  O O   . SER A 1 49  ? -4.688  -12.483 -8.644  1.00 93.72  ? 330 SER A O   1 
ATOM   300  C CB  . SER A 1 49  ? -7.441  -11.751 -6.743  1.00 125.02 ? 330 SER A CB  1 
ATOM   301  O OG  . SER A 1 49  ? -7.370  -13.164 -6.810  1.00 126.73 ? 330 SER A OG  1 
ATOM   302  N N   . ILE A 1 50  ? -4.526  -12.451 -6.405  1.00 100.27 ? 331 ILE A N   1 
ATOM   303  C CA  . ILE A 1 50  ? -3.428  -13.403 -6.350  1.00 101.36 ? 331 ILE A CA  1 
ATOM   304  C C   . ILE A 1 50  ? -4.026  -14.796 -6.323  1.00 95.98  ? 331 ILE A C   1 
ATOM   305  O O   . ILE A 1 50  ? -3.485  -15.733 -6.895  1.00 88.07  ? 331 ILE A O   1 
ATOM   306  C CB  . ILE A 1 50  ? -2.557  -13.164 -5.091  1.00 104.34 ? 331 ILE A CB  1 
ATOM   307  C CG1 . ILE A 1 50  ? -1.495  -14.256 -4.931  1.00 93.35  ? 331 ILE A CG1 1 
ATOM   308  C CG2 . ILE A 1 50  ? -3.435  -13.072 -3.844  1.00 99.33  ? 331 ILE A CG2 1 
ATOM   309  C CD1 . ILE A 1 50  ? -0.386  -14.187 -5.947  1.00 90.71  ? 331 ILE A CD1 1 
ATOM   310  N N   . HIS A 1 51  ? -5.160  -14.918 -5.649  1.00 104.59 ? 332 HIS A N   1 
ATOM   311  C CA  . HIS A 1 51  ? -5.843  -16.191 -5.542  1.00 109.45 ? 332 HIS A CA  1 
ATOM   312  C C   . HIS A 1 51  ? -6.256  -16.645 -6.940  1.00 110.50 ? 332 HIS A C   1 
ATOM   313  O O   . HIS A 1 51  ? -6.021  -17.790 -7.334  1.00 114.23 ? 332 HIS A O   1 
ATOM   314  C CB  . HIS A 1 51  ? -7.052  -16.043 -4.621  1.00 115.22 ? 332 HIS A CB  1 
ATOM   315  C CG  . HIS A 1 51  ? -7.915  -17.260 -4.562  1.00 131.30 ? 332 HIS A CG  1 
ATOM   316  N ND1 . HIS A 1 51  ? -7.430  -18.499 -4.209  1.00 140.39 ? 332 HIS A ND1 1 
ATOM   317  C CD2 . HIS A 1 51  ? -9.236  -17.429 -4.819  1.00 138.25 ? 332 HIS A CD2 1 
ATOM   318  C CE1 . HIS A 1 51  ? -8.414  -19.381 -4.247  1.00 147.90 ? 332 HIS A CE1 1 
ATOM   319  N NE2 . HIS A 1 51  ? -9.519  -18.757 -4.616  1.00 144.61 ? 332 HIS A NE2 1 
ATOM   320  N N   . GLU A 1 52  ? -6.856  -15.720 -7.684  1.00 99.45  ? 333 GLU A N   1 
ATOM   321  C CA  . GLU A 1 52  ? -7.185  -15.916 -9.087  1.00 95.81  ? 333 GLU A CA  1 
ATOM   322  C C   . GLU A 1 52  ? -5.977  -16.400 -9.879  1.00 89.39  ? 333 GLU A C   1 
ATOM   323  O O   . GLU A 1 52  ? -6.016  -17.453 -10.522 1.00 88.75  ? 333 GLU A O   1 
ATOM   324  C CB  . GLU A 1 52  ? -7.678  -14.591 -9.673  1.00 106.53 ? 333 GLU A CB  1 
ATOM   325  C CG  . GLU A 1 52  ? -8.040  -14.642 -11.136 1.00 116.89 ? 333 GLU A CG  1 
ATOM   326  C CD  . GLU A 1 52  ? -9.288  -15.458 -11.385 1.00 126.45 ? 333 GLU A CD  1 
ATOM   327  O OE1 . GLU A 1 52  ? -10.141 -15.517 -10.472 1.00 143.46 ? 333 GLU A OE1 1 
ATOM   328  O OE2 . GLU A 1 52  ? -9.411  -16.043 -12.485 1.00 106.20 ? 333 GLU A OE2 1 
ATOM   329  N N   . PHE A 1 53  ? -4.906  -15.617 -9.823  1.00 85.28  ? 334 PHE A N   1 
ATOM   330  C CA  . PHE A 1 53  ? -3.702  -15.889 -10.589 1.00 85.95  ? 334 PHE A CA  1 
ATOM   331  C C   . PHE A 1 53  ? -3.216  -17.312 -10.331 1.00 93.32  ? 334 PHE A C   1 
ATOM   332  O O   . PHE A 1 53  ? -3.001  -18.086 -11.267 1.00 75.99  ? 334 PHE A O   1 
ATOM   333  C CB  . PHE A 1 53  ? -2.622  -14.870 -10.223 1.00 90.26  ? 334 PHE A CB  1 
ATOM   334  C CG  . PHE A 1 53  ? -1.461  -14.841 -11.180 1.00 90.54  ? 334 PHE A CG  1 
ATOM   335  C CD1 . PHE A 1 53  ? -1.667  -14.940 -12.558 1.00 80.35  ? 334 PHE A CD1 1 
ATOM   336  C CD2 . PHE A 1 53  ? -0.165  -14.701 -10.708 1.00 73.63  ? 334 PHE A CD2 1 
ATOM   337  C CE1 . PHE A 1 53  ? -0.598  -14.908 -13.440 1.00 72.04  ? 334 PHE A CE1 1 
ATOM   338  C CE2 . PHE A 1 53  ? 0.912   -14.668 -11.585 1.00 80.63  ? 334 PHE A CE2 1 
ATOM   339  C CZ  . PHE A 1 53  ? 0.699   -14.773 -12.947 1.00 67.07  ? 334 PHE A CZ  1 
ATOM   340  N N   . CYS A 1 54  ? -3.088  -17.656 -9.054  1.00 80.86  ? 335 CYS A N   1 
ATOM   341  C CA  . CYS A 1 54  ? -2.640  -18.981 -8.630  1.00 103.34 ? 335 CYS A CA  1 
ATOM   342  C C   . CYS A 1 54  ? -3.517  -20.115 -9.151  1.00 96.06  ? 335 CYS A C   1 
ATOM   343  O O   . CYS A 1 54  ? -3.015  -21.144 -9.604  1.00 90.34  ? 335 CYS A O   1 
ATOM   344  C CB  . CYS A 1 54  ? -2.570  -19.044 -7.103  1.00 107.82 ? 335 CYS A CB  1 
ATOM   345  S SG  . CYS A 1 54  ? -1.329  -17.954 -6.389  1.00 103.64 ? 335 CYS A SG  1 
ATOM   346  N N   . ILE A 1 55  ? -4.828  -19.930 -9.073  1.00 83.79  ? 336 ILE A N   1 
ATOM   347  C CA  . ILE A 1 55  ? -5.758  -20.900 -9.632  1.00 86.38  ? 336 ILE A CA  1 
ATOM   348  C C   . ILE A 1 55  ? -5.470  -21.130 -11.115 1.00 78.83  ? 336 ILE A C   1 
ATOM   349  O O   . ILE A 1 55  ? -5.419  -22.264 -11.571 1.00 143.81 ? 336 ILE A O   1 
ATOM   350  C CB  . ILE A 1 55  ? -7.207  -20.439 -9.457  1.00 85.94  ? 336 ILE A CB  1 
ATOM   351  C CG1 . ILE A 1 55  ? -7.595  -20.455 -7.986  1.00 91.61  ? 336 ILE A CG1 1 
ATOM   352  C CG2 . ILE A 1 55  ? -8.149  -21.334 -10.242 1.00 105.19 ? 336 ILE A CG2 1 
ATOM   353  C CD1 . ILE A 1 55  ? -9.013  -19.956 -7.717  1.00 94.60  ? 336 ILE A CD1 1 
ATOM   354  N N   . ASN A 1 56  ? -5.259  -20.047 -11.851 1.00 75.45  ? 337 ASN A N   1 
ATOM   355  C CA  . ASN A 1 56  ? -4.952  -20.145 -13.283 1.00 70.95  ? 337 ASN A CA  1 
ATOM   356  C C   . ASN A 1 56  ? -3.635  -20.862 -13.548 1.00 69.44  ? 337 ASN A C   1 
ATOM   357  O O   . ASN A 1 56  ? -3.522  -21.653 -14.474 1.00 72.30  ? 337 ASN A O   1 
ATOM   358  C CB  . ASN A 1 56  ? -4.939  -18.754 -13.925 1.00 68.52  ? 337 ASN A CB  1 
ATOM   359  C CG  . ASN A 1 56  ? -6.297  -18.080 -13.873 1.00 83.95  ? 337 ASN A CG  1 
ATOM   360  O OD1 . ASN A 1 56  ? -7.315  -18.746 -13.735 1.00 82.48  ? 337 ASN A OD1 1 
ATOM   361  N ND2 . ASN A 1 56  ? -6.318  -16.755 -13.980 1.00 86.28  ? 337 ASN A ND2 1 
ATOM   362  N N   . LEU A 1 57  ? -2.637  -20.576 -12.724 1.00 87.39  ? 338 LEU A N   1 
ATOM   363  C CA  . LEU A 1 57  ? -1.339  -21.215 -12.860 1.00 86.24  ? 338 LEU A CA  1 
ATOM   364  C C   . LEU A 1 57  ? -1.447  -22.714 -12.612 1.00 80.22  ? 338 LEU A C   1 
ATOM   365  O O   . LEU A 1 57  ? -0.899  -23.516 -13.360 1.00 85.10  ? 338 LEU A O   1 
ATOM   366  C CB  . LEU A 1 57  ? -0.324  -20.586 -11.898 1.00 89.08  ? 338 LEU A CB  1 
ATOM   367  C CG  . LEU A 1 57  ? 0.557   -19.439 -12.412 1.00 83.09  ? 338 LEU A CG  1 
ATOM   368  C CD1 . LEU A 1 57  ? 0.654   -19.450 -13.918 1.00 70.77  ? 338 LEU A CD1 1 
ATOM   369  C CD2 . LEU A 1 57  ? 0.068   -18.086 -11.940 1.00 83.28  ? 338 LEU A CD2 1 
ATOM   370  N N   . ARG A 1 58  ? -2.174  -23.080 -11.565 1.00 77.10  ? 339 ARG A N   1 
ATOM   371  C CA  . ARG A 1 58  ? -2.300  -24.475 -11.160 1.00 80.77  ? 339 ARG A CA  1 
ATOM   372  C C   . ARG A 1 58  ? -2.973  -25.331 -12.224 1.00 89.81  ? 339 ARG A C   1 
ATOM   373  O O   . ARG A 1 58  ? -2.761  -26.542 -12.280 1.00 94.29  ? 339 ARG A O   1 
ATOM   374  C CB  . ARG A 1 58  ? -3.084  -24.568 -9.849  1.00 85.82  ? 339 ARG A CB  1 
ATOM   375  N N   . GLN A 1 59  ? -3.789  -24.700 -13.062 1.00 80.53  ? 340 GLN A N   1 
ATOM   376  C CA  . GLN A 1 59  ? -4.515  -25.424 -14.095 1.00 76.29  ? 340 GLN A CA  1 
ATOM   377  C C   . GLN A 1 59  ? -3.646  -25.556 -15.329 1.00 79.48  ? 340 GLN A C   1 
ATOM   378  O O   . GLN A 1 59  ? -3.933  -26.349 -16.225 1.00 78.82  ? 340 GLN A O   1 
ATOM   379  C CB  . GLN A 1 59  ? -5.790  -24.676 -14.493 1.00 73.16  ? 340 GLN A CB  1 
ATOM   380  C CG  . GLN A 1 59  ? -6.776  -24.372 -13.383 1.00 77.17  ? 340 GLN A CG  1 
ATOM   381  C CD  . GLN A 1 59  ? -7.984  -23.606 -13.890 1.00 76.30  ? 340 GLN A CD  1 
ATOM   382  O OE1 . GLN A 1 59  ? -8.409  -23.785 -15.034 1.00 95.55  ? 340 GLN A OE1 1 
ATOM   383  N NE2 . GLN A 1 59  ? -8.543  -22.752 -13.046 1.00 119.49 ? 340 GLN A NE2 1 
ATOM   384  N N   . LEU A 1 60  ? -2.589  -24.758 -15.383 1.00 76.78  ? 341 LEU A N   1 
ATOM   385  C CA  . LEU A 1 60  ? -1.809  -24.648 -16.602 1.00 76.74  ? 341 LEU A CA  1 
ATOM   386  C C   . LEU A 1 60  ? -0.439  -25.281 -16.454 1.00 88.52  ? 341 LEU A C   1 
ATOM   387  O O   . LEU A 1 60  ? 0.144   -25.777 -17.423 1.00 87.76  ? 341 LEU A O   1 
ATOM   388  C CB  . LEU A 1 60  ? -1.667  -23.184 -16.985 1.00 76.21  ? 341 LEU A CB  1 
ATOM   389  C CG  . LEU A 1 60  ? -1.590  -22.939 -18.477 1.00 70.23  ? 341 LEU A CG  1 
ATOM   390  C CD1 . LEU A 1 60  ? -2.580  -23.845 -19.154 1.00 77.28  ? 341 LEU A CD1 1 
ATOM   391  C CD2 . LEU A 1 60  ? -1.901  -21.499 -18.779 1.00 55.75  ? 341 LEU A CD2 1 
ATOM   392  N N   . TYR A 1 61  ? 0.060   -25.271 -15.224 1.00 96.76  ? 342 TYR A N   1 
ATOM   393  C CA  . TYR A 1 61  ? 1.414   -25.717 -14.939 1.00 92.84  ? 342 TYR A CA  1 
ATOM   394  C C   . TYR A 1 61  ? 1.474   -26.748 -13.806 1.00 97.12  ? 342 TYR A C   1 
ATOM   395  O O   . TYR A 1 61  ? 1.358   -26.406 -12.629 1.00 97.76  ? 342 TYR A O   1 
ATOM   396  C CB  . TYR A 1 61  ? 2.283   -24.499 -14.630 1.00 80.65  ? 342 TYR A CB  1 
ATOM   397  C CG  . TYR A 1 61  ? 2.281   -23.520 -15.767 1.00 74.18  ? 342 TYR A CG  1 
ATOM   398  C CD1 . TYR A 1 61  ? 2.723   -23.904 -17.021 1.00 72.96  ? 342 TYR A CD1 1 
ATOM   399  C CD2 . TYR A 1 61  ? 1.818   -22.223 -15.602 1.00 66.66  ? 342 TYR A CD2 1 
ATOM   400  C CE1 . TYR A 1 61  ? 2.716   -23.031 -18.076 1.00 71.61  ? 342 TYR A CE1 1 
ATOM   401  C CE2 . TYR A 1 61  ? 1.817   -21.335 -16.653 1.00 70.64  ? 342 TYR A CE2 1 
ATOM   402  C CZ  . TYR A 1 61  ? 2.266   -21.746 -17.892 1.00 76.56  ? 342 TYR A CZ  1 
ATOM   403  O OH  . TYR A 1 61  ? 2.268   -20.880 -18.959 1.00 77.09  ? 342 TYR A OH  1 
ATOM   404  N N   . GLY A 1 62  ? 1.659   -28.013 -14.173 1.00 98.12  ? 343 GLY A N   1 
ATOM   405  C CA  . GLY A 1 62  ? 1.758   -29.084 -13.196 1.00 100.22 ? 343 GLY A CA  1 
ATOM   406  C C   . GLY A 1 62  ? 3.169   -29.204 -12.660 1.00 106.73 ? 343 GLY A C   1 
ATOM   407  O O   . GLY A 1 62  ? 3.919   -28.233 -12.668 1.00 102.77 ? 343 GLY A O   1 
ATOM   408  N N   . ASP A 1 63  ? 3.526   -30.401 -12.205 1.00 124.19 ? 344 ASP A N   1 
ATOM   409  C CA  . ASP A 1 63  ? 4.817   -30.660 -11.567 1.00 138.07 ? 344 ASP A CA  1 
ATOM   410  C C   . ASP A 1 63  ? 6.037   -30.167 -12.360 1.00 143.29 ? 344 ASP A C   1 
ATOM   411  O O   . ASP A 1 63  ? 6.932   -29.529 -11.802 1.00 147.11 ? 344 ASP A O   1 
ATOM   412  C CB  . ASP A 1 63  ? 4.943   -32.159 -11.274 1.00 144.34 ? 344 ASP A CB  1 
ATOM   413  C CG  . ASP A 1 63  ? 6.279   -32.529 -10.666 1.00 155.38 ? 344 ASP A CG  1 
ATOM   414  O OD1 . ASP A 1 63  ? 6.871   -31.686 -9.960  1.00 159.86 ? 344 ASP A OD1 1 
ATOM   415  O OD2 . ASP A 1 63  ? 6.734   -33.671 -10.891 1.00 163.00 ? 344 ASP A OD2 1 
ATOM   416  N N   . SER A 1 64  ? 6.062   -30.454 -13.658 1.00 139.67 ? 345 SER A N   1 
ATOM   417  C CA  . SER A 1 64  ? 7.221   -30.157 -14.498 1.00 135.36 ? 345 SER A CA  1 
ATOM   418  C C   . SER A 1 64  ? 7.585   -28.672 -14.577 1.00 123.51 ? 345 SER A C   1 
ATOM   419  O O   . SER A 1 64  ? 8.664   -28.321 -15.050 1.00 132.94 ? 345 SER A O   1 
ATOM   420  C CB  . SER A 1 64  ? 7.007   -30.716 -15.910 1.00 135.74 ? 345 SER A CB  1 
ATOM   421  O OG  . SER A 1 64  ? 5.798   -30.236 -16.475 1.00 132.39 ? 345 SER A OG  1 
ATOM   422  N N   . ARG A 1 65  ? 6.692   -27.807 -14.109 1.00 101.91 ? 346 ARG A N   1 
ATOM   423  C CA  . ARG A 1 65  ? 6.897   -26.372 -14.223 1.00 79.38  ? 346 ARG A CA  1 
ATOM   424  C C   . ARG A 1 65  ? 7.015   -25.662 -12.876 1.00 117.66 ? 346 ARG A C   1 
ATOM   425  O O   . ARG A 1 65  ? 6.623   -24.503 -12.756 1.00 111.90 ? 346 ARG A O   1 
ATOM   426  C CB  . ARG A 1 65  ? 5.771   -25.746 -15.046 1.00 74.00  ? 346 ARG A CB  1 
ATOM   427  C CG  . ARG A 1 65  ? 6.026   -25.717 -16.558 1.00 77.38  ? 346 ARG A CG  1 
ATOM   428  C CD  . ARG A 1 65  ? 6.039   -27.103 -17.179 1.00 78.86  ? 346 ARG A CD  1 
ATOM   429  N NE  . ARG A 1 65  ? 6.365   -27.050 -18.599 1.00 86.52  ? 346 ARG A NE  1 
ATOM   430  C CZ  . ARG A 1 65  ? 7.601   -27.113 -19.081 1.00 81.64  ? 346 ARG A CZ  1 
ATOM   431  N NH1 . ARG A 1 65  ? 8.632   -27.236 -18.258 1.00 84.09  ? 346 ARG A NH1 1 
ATOM   432  N NH2 . ARG A 1 65  ? 7.807   -27.049 -20.388 1.00 70.15  ? 346 ARG A NH2 1 
ATOM   433  N N   . LYS A 1 66  ? 7.563   -26.347 -11.872 1.00 122.44 ? 347 LYS A N   1 
ATOM   434  C CA  . LYS A 1 66  ? 7.739   -25.756 -10.544 1.00 120.18 ? 347 LYS A CA  1 
ATOM   435  C C   . LYS A 1 66  ? 8.674   -24.553 -10.576 1.00 89.72  ? 347 LYS A C   1 
ATOM   436  O O   . LYS A 1 66  ? 8.392   -23.520 -9.968  1.00 108.55 ? 347 LYS A O   1 
ATOM   437  C CB  . LYS A 1 66  ? 8.257   -26.798 -9.547  1.00 116.62 ? 347 LYS A CB  1 
ATOM   438  N N   . PHE A 1 67  ? 9.782   -24.700 -11.295 1.00 112.14 ? 348 PHE A N   1 
ATOM   439  C CA  . PHE A 1 67  ? 10.782  -23.643 -11.417 1.00 105.42 ? 348 PHE A CA  1 
ATOM   440  C C   . PHE A 1 67  ? 10.160  -22.305 -11.793 1.00 107.35 ? 348 PHE A C   1 
ATOM   441  O O   . PHE A 1 67  ? 10.547  -21.266 -11.261 1.00 115.41 ? 348 PHE A O   1 
ATOM   442  C CB  . PHE A 1 67  ? 11.852  -24.033 -12.438 1.00 101.47 ? 348 PHE A CB  1 
ATOM   443  C CG  . PHE A 1 67  ? 11.308  -24.323 -13.801 1.00 103.53 ? 348 PHE A CG  1 
ATOM   444  C CD1 . PHE A 1 67  ? 11.166  -23.308 -14.737 1.00 94.55  ? 348 PHE A CD1 1 
ATOM   445  C CD2 . PHE A 1 67  ? 10.942  -25.611 -14.150 1.00 107.90 ? 348 PHE A CD2 1 
ATOM   446  C CE1 . PHE A 1 67  ? 10.655  -23.569 -15.985 1.00 87.06  ? 348 PHE A CE1 1 
ATOM   447  C CE2 . PHE A 1 67  ? 10.437  -25.878 -15.403 1.00 99.63  ? 348 PHE A CE2 1 
ATOM   448  C CZ  . PHE A 1 67  ? 10.296  -24.859 -16.319 1.00 92.10  ? 348 PHE A CZ  1 
ATOM   449  N N   . LEU A 1 68  ? 9.189   -22.345 -12.701 1.00 100.13 ? 349 LEU A N   1 
ATOM   450  C CA  . LEU A 1 68  ? 8.490   -21.148 -13.148 1.00 93.13  ? 349 LEU A CA  1 
ATOM   451  C C   . LEU A 1 68  ? 7.812   -20.456 -11.975 1.00 91.67  ? 349 LEU A C   1 
ATOM   452  O O   . LEU A 1 68  ? 7.964   -19.250 -11.779 1.00 85.48  ? 349 LEU A O   1 
ATOM   453  C CB  . LEU A 1 68  ? 7.456   -21.517 -14.212 1.00 86.17  ? 349 LEU A CB  1 
ATOM   454  C CG  . LEU A 1 68  ? 6.270   -20.582 -14.420 1.00 87.07  ? 349 LEU A CG  1 
ATOM   455  C CD1 . LEU A 1 68  ? 6.723   -19.288 -15.037 1.00 96.37  ? 349 LEU A CD1 1 
ATOM   456  C CD2 . LEU A 1 68  ? 5.215   -21.235 -15.290 1.00 89.28  ? 349 LEU A CD2 1 
ATOM   457  N N   . LEU A 1 69  ? 7.074   -21.234 -11.189 1.00 88.87  ? 350 LEU A N   1 
ATOM   458  C CA  . LEU A 1 69  ? 6.324   -20.700 -10.058 1.00 87.89  ? 350 LEU A CA  1 
ATOM   459  C C   . LEU A 1 69  ? 7.278   -20.168 -8.983  1.00 95.54  ? 350 LEU A C   1 
ATOM   460  O O   . LEU A 1 69  ? 7.148   -19.034 -8.518  1.00 93.96  ? 350 LEU A O   1 
ATOM   461  C CB  . LEU A 1 69  ? 5.395   -21.777 -9.483  1.00 98.13  ? 350 LEU A CB  1 
ATOM   462  C CG  . LEU A 1 69  ? 4.062   -22.111 -10.175 1.00 96.53  ? 350 LEU A CG  1 
ATOM   463  C CD1 . LEU A 1 69  ? 4.239   -22.704 -11.547 1.00 77.48  ? 350 LEU A CD1 1 
ATOM   464  C CD2 . LEU A 1 69  ? 3.243   -23.063 -9.315  1.00 108.75 ? 350 LEU A CD2 1 
ATOM   465  N N   . LEU A 1 70  ? 8.241   -21.004 -8.611  1.00 88.92  ? 351 LEU A N   1 
ATOM   466  C CA  . LEU A 1 70  ? 9.310   -20.637 -7.690  1.00 105.25 ? 351 LEU A CA  1 
ATOM   467  C C   . LEU A 1 70  ? 10.059  -19.361 -8.093  1.00 104.29 ? 351 LEU A C   1 
ATOM   468  O O   . LEU A 1 70  ? 10.223  -18.440 -7.286  1.00 93.02  ? 351 LEU A O   1 
ATOM   469  C CB  . LEU A 1 70  ? 10.299  -21.799 -7.576  1.00 106.78 ? 351 LEU A CB  1 
ATOM   470  C CG  . LEU A 1 70  ? 9.810   -23.049 -6.843  1.00 121.62 ? 351 LEU A CG  1 
ATOM   471  C CD1 . LEU A 1 70  ? 10.772  -24.211 -7.048  1.00 134.69 ? 351 LEU A CD1 1 
ATOM   472  C CD2 . LEU A 1 70  ? 9.644   -22.755 -5.357  1.00 114.64 ? 351 LEU A CD2 1 
ATOM   473  N N   . GLY A 1 71  ? 10.501  -19.307 -9.347  1.00 95.90  ? 352 GLY A N   1 
ATOM   474  C CA  . GLY A 1 71  ? 11.298  -18.192 -9.829  1.00 92.49  ? 352 GLY A CA  1 
ATOM   475  C C   . GLY A 1 71  ? 10.505  -16.908 -9.880  1.00 83.17  ? 352 GLY A C   1 
ATOM   476  O O   . GLY A 1 71  ? 11.053  -15.816 -10.016 1.00 114.81 ? 352 GLY A O   1 
ATOM   477  N N   . LEU A 1 72  ? 9.195   -17.049 -9.762  1.00 82.23  ? 353 LEU A N   1 
ATOM   478  C CA  . LEU A 1 72  ? 8.310   -15.910 -9.800  1.00 89.00  ? 353 LEU A CA  1 
ATOM   479  C C   . LEU A 1 72  ? 8.093   -15.317 -8.407  1.00 93.05  ? 353 LEU A C   1 
ATOM   480  O O   . LEU A 1 72  ? 7.742   -14.150 -8.287  1.00 98.15  ? 353 LEU A O   1 
ATOM   481  C CB  . LEU A 1 72  ? 6.982   -16.315 -10.443 1.00 79.76  ? 353 LEU A CB  1 
ATOM   482  C CG  . LEU A 1 72  ? 6.090   -15.147 -10.829 1.00 77.71  ? 353 LEU A CG  1 
ATOM   483  C CD1 . LEU A 1 72  ? 6.841   -14.259 -11.783 1.00 81.14  ? 353 LEU A CD1 1 
ATOM   484  C CD2 . LEU A 1 72  ? 4.796   -15.627 -11.449 1.00 87.30  ? 353 LEU A CD2 1 
ATOM   485  N N   . ARG A 1 73  ? 8.333   -16.107 -7.362  1.00 87.85  ? 354 ARG A N   1 
ATOM   486  C CA  . ARG A 1 73  ? 8.083   -15.669 -5.973  1.00 105.18 ? 354 ARG A CA  1 
ATOM   487  C C   . ARG A 1 73  ? 8.617   -14.293 -5.537  1.00 107.46 ? 354 ARG A C   1 
ATOM   488  O O   . ARG A 1 73  ? 7.892   -13.516 -4.918  1.00 107.93 ? 354 ARG A O   1 
ATOM   489  C CB  . ARG A 1 73  ? 8.533   -16.731 -4.963  1.00 105.02 ? 354 ARG A CB  1 
ATOM   490  C CG  . ARG A 1 73  ? 8.625   -16.219 -3.522  1.00 106.78 ? 354 ARG A CG  1 
ATOM   491  C CD  . ARG A 1 73  ? 8.985   -17.328 -2.538  1.00 121.67 ? 354 ARG A CD  1 
ATOM   492  N NE  . ARG A 1 73  ? 10.228  -18.017 -2.882  1.00 138.55 ? 354 ARG A NE  1 
ATOM   493  C CZ  . ARG A 1 73  ? 10.420  -19.329 -2.752  1.00 143.41 ? 354 ARG A CZ  1 
ATOM   494  N NH1 . ARG A 1 73  ? 9.451   -20.105 -2.287  1.00 136.63 ? 354 ARG A NH1 1 
ATOM   495  N NH2 . ARG A 1 73  ? 11.582  -19.870 -3.091  1.00 147.38 ? 354 ARG A NH2 1 
ATOM   496  N N   . PRO A 1 74  ? 9.883   -13.983 -5.848  1.00 112.43 ? 355 PRO A N   1 
ATOM   497  C CA  . PRO A 1 74  ? 10.410  -12.716 -5.329  1.00 108.60 ? 355 PRO A CA  1 
ATOM   498  C C   . PRO A 1 74  ? 9.858   -11.511 -6.077  1.00 105.74 ? 355 PRO A C   1 
ATOM   499  O O   . PRO A 1 74  ? 9.989   -10.375 -5.624  1.00 109.85 ? 355 PRO A O   1 
ATOM   500  C CB  . PRO A 1 74  ? 11.915  -12.843 -5.575  1.00 106.09 ? 355 PRO A CB  1 
ATOM   501  C CG  . PRO A 1 74  ? 12.024  -13.722 -6.766  1.00 113.66 ? 355 PRO A CG  1 
ATOM   502  C CD  . PRO A 1 74  ? 10.881  -14.701 -6.661  1.00 114.65 ? 355 PRO A CD  1 
ATOM   503  N N   . PHE A 1 75  ? 9.241   -11.766 -7.222  1.00 100.73 ? 356 PHE A N   1 
ATOM   504  C CA  . PHE A 1 75  ? 8.595   -10.708 -7.985  1.00 100.80 ? 356 PHE A CA  1 
ATOM   505  C C   . PHE A 1 75  ? 7.179   -10.406 -7.470  1.00 104.76 ? 356 PHE A C   1 
ATOM   506  O O   . PHE A 1 75  ? 6.553   -9.430  -7.886  1.00 103.20 ? 356 PHE A O   1 
ATOM   507  C CB  . PHE A 1 75  ? 8.572   -11.072 -9.470  1.00 98.11  ? 356 PHE A CB  1 
ATOM   508  C CG  . PHE A 1 75  ? 9.935   -11.159 -10.087 1.00 95.24  ? 356 PHE A CG  1 
ATOM   509  C CD1 . PHE A 1 75  ? 10.492  -10.059 -10.714 1.00 94.17  ? 356 PHE A CD1 1 
ATOM   510  C CD2 . PHE A 1 75  ? 10.664  -12.335 -10.031 1.00 103.63 ? 356 PHE A CD2 1 
ATOM   511  C CE1 . PHE A 1 75  ? 11.750  -10.130 -11.280 1.00 101.63 ? 356 PHE A CE1 1 
ATOM   512  C CE2 . PHE A 1 75  ? 11.927  -12.414 -10.593 1.00 109.92 ? 356 PHE A CE2 1 
ATOM   513  C CZ  . PHE A 1 75  ? 12.469  -11.309 -11.219 1.00 107.47 ? 356 PHE A CZ  1 
ATOM   514  N N   . ILE A 1 76  ? 6.686   -11.244 -6.561  1.00 108.39 ? 357 ILE A N   1 
ATOM   515  C CA  . ILE A 1 76  ? 5.368   -11.058 -5.950  1.00 108.70 ? 357 ILE A CA  1 
ATOM   516  C C   . ILE A 1 76  ? 5.454   -10.174 -4.693  1.00 111.97 ? 357 ILE A C   1 
ATOM   517  O O   . ILE A 1 76  ? 6.196   -10.495 -3.765  1.00 106.75 ? 357 ILE A O   1 
ATOM   518  C CB  . ILE A 1 76  ? 4.747   -12.424 -5.577  1.00 105.63 ? 357 ILE A CB  1 
ATOM   519  C CG1 . ILE A 1 76  ? 4.736   -13.359 -6.792  1.00 98.58  ? 357 ILE A CG1 1 
ATOM   520  C CG2 . ILE A 1 76  ? 3.345   -12.251 -5.012  1.00 92.09  ? 357 ILE A CG2 1 
ATOM   521  C CD1 . ILE A 1 76  ? 3.782   -12.923 -7.912  1.00 82.21  ? 357 ILE A CD1 1 
ATOM   522  N N   . PRO A 1 77  ? 4.699   -9.054  -4.666  1.00 115.88 ? 358 PRO A N   1 
ATOM   523  C CA  . PRO A 1 77  ? 4.648   -8.132  -3.517  1.00 124.33 ? 358 PRO A CA  1 
ATOM   524  C C   . PRO A 1 77  ? 4.325   -8.824  -2.190  1.00 129.80 ? 358 PRO A C   1 
ATOM   525  O O   . PRO A 1 77  ? 3.599   -9.815  -2.185  1.00 131.76 ? 358 PRO A O   1 
ATOM   526  C CB  . PRO A 1 77  ? 3.518   -7.171  -3.894  1.00 118.92 ? 358 PRO A CB  1 
ATOM   527  C CG  . PRO A 1 77  ? 3.547   -7.142  -5.387  1.00 109.25 ? 358 PRO A CG  1 
ATOM   528  C CD  . PRO A 1 77  ? 3.926   -8.542  -5.814  1.00 107.25 ? 358 PRO A CD  1 
ATOM   529  N N   . GLU A 1 78  ? 4.852   -8.295  -1.088  1.00 131.63 ? 359 GLU A N   1 
ATOM   530  C CA  . GLU A 1 78  ? 4.738   -8.937  0.227   1.00 143.23 ? 359 GLU A CA  1 
ATOM   531  C C   . GLU A 1 78  ? 3.333   -9.417  0.587   1.00 142.70 ? 359 GLU A C   1 
ATOM   532  O O   . GLU A 1 78  ? 3.144   -10.573 0.964   1.00 149.15 ? 359 GLU A O   1 
ATOM   533  C CB  . GLU A 1 78  ? 5.258   -8.009  1.330   1.00 119.17 ? 359 GLU A CB  1 
ATOM   534  N N   . LYS A 1 79  ? 2.353   -8.530  0.468   1.00 136.93 ? 360 LYS A N   1 
ATOM   535  C CA  . LYS A 1 79  ? 0.991   -8.846  0.886   1.00 144.65 ? 360 LYS A CA  1 
ATOM   536  C C   . LYS A 1 79  ? 0.399   -10.025 0.114   1.00 150.45 ? 360 LYS A C   1 
ATOM   537  O O   . LYS A 1 79  ? -0.332  -10.840 0.678   1.00 153.47 ? 360 LYS A O   1 
ATOM   538  C CB  . LYS A 1 79  ? 0.096   -7.611  0.777   1.00 140.94 ? 360 LYS A CB  1 
ATOM   539  C CG  . LYS A 1 79  ? 0.285   -6.808  -0.496  1.00 131.97 ? 360 LYS A CG  1 
ATOM   540  C CD  . LYS A 1 79  ? -0.710  -7.222  -1.566  1.00 118.96 ? 360 LYS A CD  1 
ATOM   541  C CE  . LYS A 1 79  ? -0.793  -6.169  -2.649  1.00 116.95 ? 360 LYS A CE  1 
ATOM   542  N NZ  . LYS A 1 79  ? -1.011  -4.822  -2.060  1.00 128.38 ? 360 LYS A NZ  1 
ATOM   543  N N   . ASP A 1 80  ? 0.728   -10.115 -1.170  1.00 146.36 ? 361 ASP A N   1 
ATOM   544  C CA  . ASP A 1 80  ? 0.288   -11.235 -1.990  1.00 144.36 ? 361 ASP A CA  1 
ATOM   545  C C   . ASP A 1 80  ? 1.240   -12.413 -1.828  1.00 144.27 ? 361 ASP A C   1 
ATOM   546  O O   . ASP A 1 80  ? 0.864   -13.560 -2.063  1.00 143.21 ? 361 ASP A O   1 
ATOM   547  C CB  . ASP A 1 80  ? 0.207   -10.838 -3.467  1.00 134.60 ? 361 ASP A CB  1 
ATOM   548  C CG  . ASP A 1 80  ? -1.090  -10.134 -3.821  1.00 134.08 ? 361 ASP A CG  1 
ATOM   549  O OD1 . ASP A 1 80  ? -2.068  -10.252 -3.057  1.00 139.15 ? 361 ASP A OD1 1 
ATOM   550  O OD2 . ASP A 1 80  ? -1.136  -9.470  -4.877  1.00 135.39 ? 361 ASP A OD2 1 
ATOM   551  N N   . SER A 1 81  ? 2.473   -12.121 -1.426  1.00 145.75 ? 362 SER A N   1 
ATOM   552  C CA  . SER A 1 81  ? 3.499   -13.151 -1.305  1.00 146.72 ? 362 SER A CA  1 
ATOM   553  C C   . SER A 1 81  ? 3.100   -14.198 -0.277  1.00 136.63 ? 362 SER A C   1 
ATOM   554  O O   . SER A 1 81  ? 3.365   -15.388 -0.456  1.00 130.64 ? 362 SER A O   1 
ATOM   555  C CB  . SER A 1 81  ? 4.845   -12.533 -0.927  1.00 158.74 ? 362 SER A CB  1 
ATOM   556  O OG  . SER A 1 81  ? 4.858   -12.142 0.434   1.00 173.02 ? 362 SER A OG  1 
ATOM   557  N N   . GLN A 1 82  ? 2.452   -13.738 0.791   1.00 136.04 ? 363 GLN A N   1 
ATOM   558  C CA  . GLN A 1 82  ? 1.973   -14.610 1.857   1.00 142.01 ? 363 GLN A CA  1 
ATOM   559  C C   . GLN A 1 82  ? 1.101   -15.746 1.312   1.00 140.14 ? 363 GLN A C   1 
ATOM   560  O O   . GLN A 1 82  ? 1.249   -16.903 1.712   1.00 138.30 ? 363 GLN A O   1 
ATOM   561  C CB  . GLN A 1 82  ? 1.191   -13.802 2.894   1.00 20.00  ? 363 GLN A CB  1 
ATOM   562  N N   . HIS A 1 83  ? 0.206   -15.412 0.387   1.00 141.68 ? 364 HIS A N   1 
ATOM   563  C CA  . HIS A 1 83  ? -0.659  -16.414 -0.234  1.00 139.48 ? 364 HIS A CA  1 
ATOM   564  C C   . HIS A 1 83  ? 0.057   -17.238 -1.313  1.00 134.24 ? 364 HIS A C   1 
ATOM   565  O O   . HIS A 1 83  ? -0.250  -18.415 -1.498  1.00 136.47 ? 364 HIS A O   1 
ATOM   566  C CB  . HIS A 1 83  ? -1.930  -15.770 -0.802  1.00 131.21 ? 364 HIS A CB  1 
ATOM   567  N N   . PHE A 1 84  ? 1.011   -16.628 -2.015  1.00 131.48 ? 365 PHE A N   1 
ATOM   568  C CA  . PHE A 1 84  ? 1.722   -17.323 -3.091  1.00 100.51 ? 365 PHE A CA  1 
ATOM   569  C C   . PHE A 1 84  ? 2.611   -18.460 -2.583  1.00 124.67 ? 365 PHE A C   1 
ATOM   570  O O   . PHE A 1 84  ? 2.751   -19.483 -3.251  1.00 124.63 ? 365 PHE A O   1 
ATOM   571  C CB  . PHE A 1 84  ? 2.542   -16.347 -3.947  1.00 110.23 ? 365 PHE A CB  1 
ATOM   572  C CG  . PHE A 1 84  ? 3.048   -16.945 -5.246  1.00 106.64 ? 365 PHE A CG  1 
ATOM   573  C CD1 . PHE A 1 84  ? 2.157   -17.338 -6.237  1.00 105.92 ? 365 PHE A CD1 1 
ATOM   574  C CD2 . PHE A 1 84  ? 4.409   -17.106 -5.475  1.00 99.28  ? 365 PHE A CD2 1 
ATOM   575  C CE1 . PHE A 1 84  ? 2.613   -17.889 -7.430  1.00 96.99  ? 365 PHE A CE1 1 
ATOM   576  C CE2 . PHE A 1 84  ? 4.873   -17.654 -6.659  1.00 94.29  ? 365 PHE A CE2 1 
ATOM   577  C CZ  . PHE A 1 84  ? 3.972   -18.045 -7.641  1.00 99.90  ? 365 PHE A CZ  1 
ATOM   578  N N   . GLU A 1 85  ? 3.209   -18.289 -1.406  1.00 108.82 ? 366 GLU A N   1 
ATOM   579  C CA  . GLU A 1 85  ? 4.108   -19.310 -0.876  1.00 144.29 ? 366 GLU A CA  1 
ATOM   580  C C   . GLU A 1 85  ? 3.375   -20.591 -0.467  1.00 140.25 ? 366 GLU A C   1 
ATOM   581  O O   . GLU A 1 85  ? 3.798   -21.695 -0.817  1.00 131.50 ? 366 GLU A O   1 
ATOM   582  C CB  . GLU A 1 85  ? 4.948   -18.750 0.277   1.00 154.27 ? 366 GLU A CB  1 
ATOM   583  C CG  . GLU A 1 85  ? 5.920   -17.661 -0.167  1.00 160.01 ? 366 GLU A CG  1 
ATOM   584  C CD  . GLU A 1 85  ? 6.679   -17.039 0.987   1.00 175.99 ? 366 GLU A CD  1 
ATOM   585  O OE1 . GLU A 1 85  ? 6.637   -17.601 2.102   1.00 183.49 ? 366 GLU A OE1 1 
ATOM   586  O OE2 . GLU A 1 85  ? 7.318   -15.985 0.778   1.00 179.15 ? 366 GLU A OE2 1 
ATOM   587  N N   . ASN A 1 86  ? 2.275   -20.444 0.266   1.00 142.13 ? 367 ASN A N   1 
ATOM   588  C CA  . ASN A 1 86  ? 1.459   -21.593 0.637   1.00 146.57 ? 367 ASN A CA  1 
ATOM   589  C C   . ASN A 1 86  ? 0.901   -22.299 -0.595  1.00 145.84 ? 367 ASN A C   1 
ATOM   590  O O   . ASN A 1 86  ? 0.642   -23.501 -0.560  1.00 120.94 ? 367 ASN A O   1 
ATOM   591  C CB  . ASN A 1 86  ? 0.327   -21.176 1.578   1.00 126.27 ? 367 ASN A CB  1 
ATOM   592  N N   . PHE A 1 87  ? 0.739   -21.537 -1.680  1.00 142.81 ? 368 PHE A N   1 
ATOM   593  C CA  . PHE A 1 87  ? 0.273   -22.039 -2.979  1.00 138.41 ? 368 PHE A CA  1 
ATOM   594  C C   . PHE A 1 87  ? 1.203   -23.105 -3.566  1.00 141.03 ? 368 PHE A C   1 
ATOM   595  O O   . PHE A 1 87  ? 0.787   -23.914 -4.399  1.00 140.00 ? 368 PHE A O   1 
ATOM   596  C CB  . PHE A 1 87  ? 0.066   -20.865 -3.958  1.00 133.89 ? 368 PHE A CB  1 
ATOM   597  C CG  . PHE A 1 87  ? -0.165  -21.279 -5.395  1.00 123.15 ? 368 PHE A CG  1 
ATOM   598  C CD1 . PHE A 1 87  ? -1.259  -22.058 -5.750  1.00 115.32 ? 368 PHE A CD1 1 
ATOM   599  C CD2 . PHE A 1 87  ? 0.703   -20.862 -6.394  1.00 114.77 ? 368 PHE A CD2 1 
ATOM   600  C CE1 . PHE A 1 87  ? -1.466  -22.431 -7.069  1.00 100.28 ? 368 PHE A CE1 1 
ATOM   601  C CE2 . PHE A 1 87  ? 0.502   -21.231 -7.712  1.00 87.09  ? 368 PHE A CE2 1 
ATOM   602  C CZ  . PHE A 1 87  ? -0.581  -22.016 -8.048  1.00 92.97  ? 368 PHE A CZ  1 
ATOM   603  N N   . LEU A 1 88  ? 2.458   -23.107 -3.125  1.00 146.50 ? 369 LEU A N   1 
ATOM   604  C CA  . LEU A 1 88  ? 3.370   -24.203 -3.441  1.00 147.34 ? 369 LEU A CA  1 
ATOM   605  C C   . LEU A 1 88  ? 2.812   -25.509 -2.871  1.00 153.01 ? 369 LEU A C   1 
ATOM   606  O O   . LEU A 1 88  ? 2.080   -25.496 -1.880  1.00 157.48 ? 369 LEU A O   1 
ATOM   607  C CB  . LEU A 1 88  ? 4.763   -23.937 -2.863  1.00 142.95 ? 369 LEU A CB  1 
ATOM   608  C CG  . LEU A 1 88  ? 5.856   -24.941 -3.237  1.00 134.01 ? 369 LEU A CG  1 
ATOM   609  C CD1 . LEU A 1 88  ? 6.133   -24.850 -4.728  1.00 115.94 ? 369 LEU A CD1 1 
ATOM   610  C CD2 . LEU A 1 88  ? 7.132   -24.741 -2.424  1.00 120.44 ? 369 LEU A CD2 1 
ATOM   611  N N   . GLU A 1 89  ? 3.164   -26.629 -3.499  1.00 146.54 ? 370 GLU A N   1 
ATOM   612  C CA  . GLU A 1 89  ? 2.659   -27.943 -3.104  1.00 144.54 ? 370 GLU A CA  1 
ATOM   613  C C   . GLU A 1 89  ? 3.075   -28.352 -1.687  1.00 147.24 ? 370 GLU A C   1 
ATOM   614  O O   . GLU A 1 89  ? 3.792   -27.628 -0.992  1.00 138.80 ? 370 GLU A O   1 
ATOM   615  C CB  . GLU A 1 89  ? 3.112   -29.009 -4.110  1.00 140.27 ? 370 GLU A CB  1 
ATOM   616  C CG  . GLU A 1 89  ? 2.626   -28.783 -5.540  1.00 131.61 ? 370 GLU A CG  1 
ATOM   617  C CD  . GLU A 1 89  ? 3.117   -29.853 -6.500  1.00 134.68 ? 370 GLU A CD  1 
ATOM   618  O OE1 . GLU A 1 89  ? 4.074   -30.574 -6.144  1.00 139.02 ? 370 GLU A OE1 1 
ATOM   619  O OE2 . GLU A 1 89  ? 2.548   -29.974 -7.607  1.00 128.31 ? 370 GLU A OE2 1 
ATOM   620  N N   . SER B 2 2   ? 9.348   -17.305 -33.979 1.00 77.35  ? 0   SER B N   1 
ATOM   621  C CA  . SER B 2 2   ? 9.891   -16.703 -32.764 1.00 90.81  ? 0   SER B CA  1 
ATOM   622  C C   . SER B 2 2   ? 9.370   -15.278 -32.551 1.00 99.15  ? 0   SER B C   1 
ATOM   623  O O   . SER B 2 2   ? 9.504   -14.728 -31.461 1.00 107.56 ? 0   SER B O   1 
ATOM   624  C CB  . SER B 2 2   ? 11.430  -16.737 -32.776 1.00 94.19  ? 0   SER B CB  1 
ATOM   625  O OG  . SER B 2 2   ? 11.992  -16.069 -31.653 1.00 92.13  ? 0   SER B OG  1 
ATOM   626  N N   . MET B 2 3   ? 8.772   -14.691 -33.587 1.00 94.60  ? 1   MET B N   1 
ATOM   627  C CA  . MET B 2 3   ? 8.175   -13.355 -33.491 1.00 90.36  ? 1   MET B CA  1 
ATOM   628  C C   . MET B 2 3   ? 7.245   -13.256 -32.269 1.00 94.47  ? 1   MET B C   1 
ATOM   629  O O   . MET B 2 3   ? 7.407   -12.368 -31.419 1.00 97.84  ? 1   MET B O   1 
ATOM   630  C CB  . MET B 2 3   ? 7.407   -13.036 -34.782 1.00 92.53  ? 1   MET B CB  1 
ATOM   631  C CG  . MET B 2 3   ? 6.659   -11.691 -34.813 1.00 95.40  ? 1   MET B CG  1 
ATOM   632  S SD  . MET B 2 3   ? 7.713   -10.221 -34.770 1.00 133.72 ? 1   MET B SD  1 
ATOM   633  C CE  . MET B 2 3   ? 6.554   -8.942  -35.263 1.00 77.43  ? 1   MET B CE  1 
ATOM   634  N N   . ASP B 2 4   ? 6.304   -14.196 -32.178 1.00 86.34  ? 2   ASP B N   1 
ATOM   635  C CA  . ASP B 2 4   ? 5.343   -14.252 -31.084 1.00 77.58  ? 2   ASP B CA  1 
ATOM   636  C C   . ASP B 2 4   ? 6.035   -14.487 -29.749 1.00 69.53  ? 2   ASP B C   1 
ATOM   637  O O   . ASP B 2 4   ? 5.602   -13.998 -28.708 1.00 76.64  ? 2   ASP B O   1 
ATOM   638  C CB  . ASP B 2 4   ? 4.328   -15.372 -31.342 1.00 86.52  ? 2   ASP B CB  1 
ATOM   639  C CG  . ASP B 2 4   ? 3.512   -15.161 -32.610 1.00 106.57 ? 2   ASP B CG  1 
ATOM   640  O OD1 . ASP B 2 4   ? 3.082   -14.019 -32.858 1.00 97.99  ? 2   ASP B OD1 1 
ATOM   641  O OD2 . ASP B 2 4   ? 3.303   -16.153 -33.349 1.00 118.02 ? 2   ASP B OD2 1 
ATOM   642  N N   . GLU B 2 5   ? 7.122   -15.239 -29.793 1.00 70.85  ? 3   GLU B N   1 
ATOM   643  C CA  . GLU B 2 5   ? 7.874   -15.547 -28.589 1.00 74.46  ? 3   GLU B CA  1 
ATOM   644  C C   . GLU B 2 5   ? 8.581   -14.316 -28.018 1.00 75.01  ? 3   GLU B C   1 
ATOM   645  O O   . GLU B 2 5   ? 8.542   -14.069 -26.808 1.00 66.72  ? 3   GLU B O   1 
ATOM   646  C CB  . GLU B 2 5   ? 8.879   -16.672 -28.856 1.00 73.60  ? 3   GLU B CB  1 
ATOM   647  C CG  . GLU B 2 5   ? 9.648   -17.144 -27.613 1.00 86.37  ? 3   GLU B CG  1 
ATOM   648  C CD  . GLU B 2 5   ? 10.315  -18.503 -27.794 1.00 93.51  ? 3   GLU B CD  1 
ATOM   649  O OE1 . GLU B 2 5   ? 10.119  -19.143 -28.845 1.00 92.05  ? 3   GLU B OE1 1 
ATOM   650  O OE2 . GLU B 2 5   ? 11.038  -18.926 -26.873 1.00 106.48 ? 3   GLU B OE2 1 
ATOM   651  N N   . GLN B 2 6   ? 9.223   -13.540 -28.885 1.00 59.44  ? 4   GLN B N   1 
ATOM   652  C CA  . GLN B 2 6   ? 9.982   -12.388 -28.419 1.00 73.46  ? 4   GLN B CA  1 
ATOM   653  C C   . GLN B 2 6   ? 9.015   -11.373 -27.862 1.00 68.93  ? 4   GLN B C   1 
ATOM   654  O O   . GLN B 2 6   ? 9.271   -10.753 -26.829 1.00 60.84  ? 4   GLN B O   1 
ATOM   655  C CB  . GLN B 2 6   ? 10.796  -11.759 -29.550 1.00 79.07  ? 4   GLN B CB  1 
ATOM   656  C CG  . GLN B 2 6   ? 11.732  -10.659 -29.066 1.00 91.88  ? 4   GLN B CG  1 
ATOM   657  C CD  . GLN B 2 6   ? 12.694  -11.133 -27.968 1.00 85.99  ? 4   GLN B CD  1 
ATOM   658  O OE1 . GLN B 2 6   ? 13.413  -12.116 -28.147 1.00 79.19  ? 4   GLN B OE1 1 
ATOM   659  N NE2 . GLN B 2 6   ? 12.703  -10.435 -26.825 1.00 64.18  ? 4   GLN B NE2 1 
ATOM   660  N N   . GLU B 2 7   ? 7.890   -11.231 -28.552 1.00 57.16  ? 5   GLU B N   1 
ATOM   661  C CA  . GLU B 2 7   ? 6.881   -10.285 -28.144 1.00 66.27  ? 5   GLU B CA  1 
ATOM   662  C C   . GLU B 2 7   ? 6.291   -10.677 -26.792 1.00 69.44  ? 5   GLU B C   1 
ATOM   663  O O   . GLU B 2 7   ? 5.962   -9.806  -25.991 1.00 82.91  ? 5   GLU B O   1 
ATOM   664  C CB  . GLU B 2 7   ? 5.804   -10.155 -29.222 1.00 70.04  ? 5   GLU B CB  1 
ATOM   665  N N   . ALA B 2 8   ? 6.177   -11.975 -26.523 1.00 60.56  ? 6   ALA B N   1 
ATOM   666  C CA  . ALA B 2 8   ? 5.738   -12.429 -25.196 1.00 52.22  ? 6   ALA B CA  1 
ATOM   667  C C   . ALA B 2 8   ? 6.787   -12.118 -24.132 1.00 56.23  ? 6   ALA B C   1 
ATOM   668  O O   . ALA B 2 8   ? 6.476   -11.533 -23.099 1.00 68.84  ? 6   ALA B O   1 
ATOM   669  C CB  . ALA B 2 8   ? 5.435   -13.905 -25.197 1.00 49.16  ? 6   ALA B CB  1 
ATOM   670  N N   . LEU B 2 9   ? 8.025   -12.532 -24.376 1.00 51.68  ? 7   LEU B N   1 
ATOM   671  C CA  . LEU B 2 9   ? 9.098   -12.333 -23.396 1.00 55.43  ? 7   LEU B CA  1 
ATOM   672  C C   . LEU B 2 9   ? 9.298   -10.864 -23.039 1.00 62.53  ? 7   LEU B C   1 
ATOM   673  O O   . LEU B 2 9   ? 9.615   -10.549 -21.899 1.00 64.95  ? 7   LEU B O   1 
ATOM   674  C CB  . LEU B 2 9   ? 10.413  -12.950 -23.872 1.00 52.76  ? 7   LEU B CB  1 
ATOM   675  C CG  . LEU B 2 9   ? 10.579  -14.451 -23.663 1.00 53.33  ? 7   LEU B CG  1 
ATOM   676  C CD1 . LEU B 2 9   ? 11.922  -14.927 -24.205 1.00 54.11  ? 7   LEU B CD1 1 
ATOM   677  C CD2 . LEU B 2 9   ? 10.442  -14.791 -22.193 1.00 71.24  ? 7   LEU B CD2 1 
ATOM   678  N N   . ASN B 2 10  ? 9.096   -9.977  -24.012 1.00 57.76  ? 8   ASN B N   1 
ATOM   679  C CA  . ASN B 2 10  ? 9.121   -8.535  -23.766 1.00 72.68  ? 8   ASN B CA  1 
ATOM   680  C C   . ASN B 2 10  ? 7.976   -8.088  -22.856 1.00 71.24  ? 8   ASN B C   1 
ATOM   681  O O   . ASN B 2 10  ? 8.161   -7.245  -21.974 1.00 76.32  ? 8   ASN B O   1 
ATOM   682  C CB  . ASN B 2 10  ? 9.051   -7.767  -25.091 1.00 79.37  ? 8   ASN B CB  1 
ATOM   683  C CG  . ASN B 2 10  ? 10.378  -7.731  -25.816 1.00 90.67  ? 8   ASN B CG  1 
ATOM   684  O OD1 . ASN B 2 10  ? 11.281  -8.499  -25.505 1.00 85.99  ? 8   ASN B OD1 1 
ATOM   685  N ND2 . ASN B 2 10  ? 10.506  -6.826  -26.785 1.00 109.43 ? 8   ASN B ND2 1 
ATOM   686  N N   . SER B 2 11  ? 6.792   -8.651  -23.096 1.00 65.41  ? 9   SER B N   1 
ATOM   687  C CA  . SER B 2 11  ? 5.619   -8.396  -22.264 1.00 68.27  ? 9   SER B CA  1 
ATOM   688  C C   . SER B 2 11  ? 5.884   -8.838  -20.829 1.00 74.33  ? 9   SER B C   1 
ATOM   689  O O   . SER B 2 11  ? 5.658   -8.083  -19.884 1.00 77.29  ? 9   SER B O   1 
ATOM   690  C CB  . SER B 2 11  ? 4.391   -9.126  -22.827 1.00 72.33  ? 9   SER B CB  1 
ATOM   691  O OG  . SER B 2 11  ? 3.407   -9.364  -21.827 1.00 64.25  ? 9   SER B OG  1 
ATOM   692  N N   . ILE B 2 12  ? 6.380   -10.061 -20.677 1.00 59.51  ? 10  ILE B N   1 
ATOM   693  C CA  . ILE B 2 12  ? 6.676   -10.603 -19.353 1.00 81.32  ? 10  ILE B CA  1 
ATOM   694  C C   . ILE B 2 12  ? 7.678   -9.723  -18.609 1.00 77.40  ? 10  ILE B C   1 
ATOM   695  O O   . ILE B 2 12  ? 7.589   -9.544  -17.394 1.00 78.36  ? 10  ILE B O   1 
ATOM   696  C CB  . ILE B 2 12  ? 7.230   -12.033 -19.451 1.00 76.67  ? 10  ILE B CB  1 
ATOM   697  C CG1 . ILE B 2 12  ? 6.219   -12.952 -20.136 1.00 65.27  ? 10  ILE B CG1 1 
ATOM   698  C CG2 . ILE B 2 12  ? 7.582   -12.558 -18.074 1.00 57.13  ? 10  ILE B CG2 1 
ATOM   699  C CD1 . ILE B 2 12  ? 6.650   -14.385 -20.241 1.00 64.50  ? 10  ILE B CD1 1 
ATOM   700  N N   . MET B 2 13  ? 8.620   -9.159  -19.354 1.00 62.53  ? 11  MET B N   1 
ATOM   701  C CA  . MET B 2 13  ? 9.669   -8.359  -18.753 1.00 75.16  ? 11  MET B CA  1 
ATOM   702  C C   . MET B 2 13  ? 9.097   -7.045  -18.234 1.00 82.18  ? 11  MET B C   1 
ATOM   703  O O   . MET B 2 13  ? 9.361   -6.655  -17.098 1.00 80.85  ? 11  MET B O   1 
ATOM   704  C CB  . MET B 2 13  ? 10.797  -8.100  -19.752 1.00 65.24  ? 11  MET B CB  1 
ATOM   705  C CG  . MET B 2 13  ? 11.927  -7.265  -19.175 1.00 69.38  ? 11  MET B CG  1 
ATOM   706  S SD  . MET B 2 13  ? 13.097  -6.737  -20.432 1.00 99.27  ? 11  MET B SD  1 
ATOM   707  C CE  . MET B 2 13  ? 14.424  -6.118  -19.401 1.00 73.68  ? 11  MET B CE  1 
ATOM   708  N N   . ASN B 2 14  ? 8.304   -6.376  -19.063 1.00 69.22  ? 12  ASN B N   1 
ATOM   709  C CA  . ASN B 2 14  ? 7.710   -5.103  -18.672 1.00 79.87  ? 12  ASN B CA  1 
ATOM   710  C C   . ASN B 2 14  ? 6.705   -5.253  -17.532 1.00 78.03  ? 12  ASN B C   1 
ATOM   711  O O   . ASN B 2 14  ? 6.489   -4.323  -16.751 1.00 81.69  ? 12  ASN B O   1 
ATOM   712  C CB  . ASN B 2 14  ? 7.057   -4.430  -19.877 1.00 88.14  ? 12  ASN B CB  1 
ATOM   713  C CG  . ASN B 2 14  ? 8.042   -4.166  -20.995 1.00 93.18  ? 12  ASN B CG  1 
ATOM   714  O OD1 . ASN B 2 14  ? 9.247   -4.275  -20.802 1.00 104.33 ? 12  ASN B OD1 1 
ATOM   715  N ND2 . ASN B 2 14  ? 7.533   -3.812  -22.173 1.00 80.90  ? 12  ASN B ND2 1 
ATOM   716  N N   . ASP B 2 15  ? 6.089   -6.425  -17.447 1.00 71.22  ? 13  ASP B N   1 
ATOM   717  C CA  . ASP B 2 15  ? 5.134   -6.706  -16.379 1.00 93.49  ? 13  ASP B CA  1 
ATOM   718  C C   . ASP B 2 15  ? 5.864   -6.897  -15.044 1.00 98.00  ? 13  ASP B C   1 
ATOM   719  O O   . ASP B 2 15  ? 5.475   -6.322  -14.031 1.00 110.54 ? 13  ASP B O   1 
ATOM   720  C CB  . ASP B 2 15  ? 4.279   -7.942  -16.708 1.00 69.84  ? 13  ASP B CB  1 
ATOM   721  C CG  . ASP B 2 15  ? 3.164   -7.650  -17.713 1.00 96.05  ? 13  ASP B CG  1 
ATOM   722  O OD1 . ASP B 2 15  ? 2.849   -6.458  -17.926 1.00 100.23 ? 13  ASP B OD1 1 
ATOM   723  O OD2 . ASP B 2 15  ? 2.601   -8.622  -18.280 1.00 77.19  ? 13  ASP B OD2 1 
ATOM   724  N N   . LEU B 2 16  ? 6.926   -7.701  -15.054 1.00 95.15  ? 14  LEU B N   1 
ATOM   725  C CA  . LEU B 2 16  ? 7.726   -7.961  -13.853 1.00 96.91  ? 14  LEU B CA  1 
ATOM   726  C C   . LEU B 2 16  ? 8.488   -6.723  -13.378 1.00 101.37 ? 14  LEU B C   1 
ATOM   727  O O   . LEU B 2 16  ? 8.611   -6.488  -12.177 1.00 105.74 ? 14  LEU B O   1 
ATOM   728  C CB  . LEU B 2 16  ? 8.695   -9.123  -14.091 1.00 85.02  ? 14  LEU B CB  1 
ATOM   729  C CG  . LEU B 2 16  ? 8.054   -10.503 -14.144 1.00 89.50  ? 14  LEU B CG  1 
ATOM   730  C CD1 . LEU B 2 16  ? 9.063   -11.576 -14.469 1.00 93.25  ? 14  LEU B CD1 1 
ATOM   731  C CD2 . LEU B 2 16  ? 7.412   -10.783 -12.816 1.00 99.74  ? 14  LEU B CD2 1 
ATOM   732  N N   . VAL B 2 17  ? 8.989   -5.939  -14.330 1.00 110.79 ? 15  VAL B N   1 
ATOM   733  C CA  . VAL B 2 17  ? 9.718   -4.708  -14.031 1.00 115.77 ? 15  VAL B CA  1 
ATOM   734  C C   . VAL B 2 17  ? 8.757   -3.718  -13.379 1.00 120.67 ? 15  VAL B C   1 
ATOM   735  O O   . VAL B 2 17  ? 9.164   -2.791  -12.685 1.00 132.96 ? 15  VAL B O   1 
ATOM   736  C CB  . VAL B 2 17  ? 10.396  -4.126  -15.299 1.00 87.54  ? 15  VAL B CB  1 
ATOM   737  C CG1 . VAL B 2 17  ? 9.674   -2.878  -15.803 1.00 94.89  ? 15  VAL B CG1 1 
ATOM   738  C CG2 . VAL B 2 17  ? 11.849  -3.825  -15.026 1.00 88.97  ? 15  VAL B CG2 1 
ATOM   739  N N   . ALA B 2 18  ? 7.469   -3.950  -13.596 1.00 118.16 ? 16  ALA B N   1 
ATOM   740  C CA  . ALA B 2 18  ? 6.441   -3.281  -12.829 1.00 102.86 ? 16  ALA B CA  1 
ATOM   741  C C   . ALA B 2 18  ? 6.066   -4.120  -11.602 1.00 109.94 ? 16  ALA B C   1 
ATOM   742  O O   . ALA B 2 18  ? 4.882   -4.332  -11.333 1.00 98.65  ? 16  ALA B O   1 
ATOM   743  C CB  . ALA B 2 18  ? 5.222   -3.022  -13.701 1.00 88.60  ? 16  ALA B CB  1 
ATOM   744  N N   . LEU B 2 19  ? 7.068   -4.610  -10.865 1.00 127.96 ? 17  LEU B N   1 
ATOM   745  C CA  . LEU B 2 19  ? 6.793   -5.325  -9.614  1.00 127.71 ? 17  LEU B CA  1 
ATOM   746  C C   . LEU B 2 19  ? 6.118   -4.353  -8.676  1.00 133.97 ? 17  LEU B C   1 
ATOM   747  O O   . LEU B 2 19  ? 4.996   -4.566  -8.225  1.00 127.04 ? 17  LEU B O   1 
ATOM   748  C CB  . LEU B 2 19  ? 8.070   -5.927  -8.975  1.00 124.27 ? 17  LEU B CB  1 
ATOM   749  C CG  . LEU B 2 19  ? 9.399   -5.197  -8.640  1.00 123.25 ? 17  LEU B CG  1 
ATOM   750  C CD1 . LEU B 2 19  ? 9.422   -4.457  -7.308  1.00 112.88 ? 17  LEU B CD1 1 
ATOM   751  C CD2 . LEU B 2 19  ? 10.499  -6.217  -8.656  1.00 124.11 ? 17  LEU B CD2 1 
ATOM   752  N N   . GLN B 2 20  ? 6.815   -3.261  -8.415  1.00 149.00 ? 18  GLN B N   1 
ATOM   753  C CA  . GLN B 2 20  ? 6.280   -2.108  -7.720  1.00 149.38 ? 18  GLN B CA  1 
ATOM   754  C C   . GLN B 2 20  ? 7.086   -0.954  -8.289  1.00 151.95 ? 18  GLN B C   1 
ATOM   755  O O   . GLN B 2 20  ? 8.207   -0.724  -7.852  1.00 165.50 ? 18  GLN B O   1 
ATOM   756  C CB  . GLN B 2 20  ? 6.525   -2.220  -6.212  1.00 148.97 ? 18  GLN B CB  1 
ATOM   757  C CG  . GLN B 2 20  ? 5.384   -2.902  -5.449  1.00 139.55 ? 18  GLN B CG  1 
ATOM   758  C CD  . GLN B 2 20  ? 4.134   -2.054  -5.402  1.00 130.59 ? 18  GLN B CD  1 
ATOM   759  O OE1 . GLN B 2 20  ? 4.132   -0.915  -5.860  1.00 138.97 ? 18  GLN B OE1 1 
ATOM   760  N NE2 . GLN B 2 20  ? 3.058   -2.608  -4.854  1.00 113.33 ? 18  GLN B NE2 1 
ATOM   761  N N   . MET B 2 21  ? 6.536   -0.257  -9.281  1.00 143.82 ? 19  MET B N   1 
ATOM   762  C CA  . MET B 2 21  ? 7.271   0.766   -10.024 1.00 143.62 ? 19  MET B CA  1 
ATOM   763  C C   . MET B 2 21  ? 8.507   0.183   -10.710 1.00 133.85 ? 19  MET B C   1 
ATOM   764  O O   . MET B 2 21  ? 8.848   0.557   -11.835 1.00 126.57 ? 19  MET B O   1 
ATOM   765  C CB  . MET B 2 21  ? 7.676   1.928   -9.113  1.00 155.01 ? 19  MET B CB  1 
ATOM   766  C CG  . MET B 2 21  ? 6.606   2.380   -8.117  1.00 153.92 ? 19  MET B CG  1 
ATOM   767  S SD  . MET B 2 21  ? 7.239   3.498   -6.842  1.00 180.60 ? 19  MET B SD  1 
ATOM   768  C CE  . MET B 2 21  ? 5.759   3.763   -5.869  1.00 143.91 ? 19  MET B CE  1 
ATOM   769  N N   . GLN B 2 44  ? -15.730 -15.071 -45.748 1.00 126.91 ? 42  GLN B N   1 
ATOM   770  C CA  . GLN B 2 44  ? -16.603 -14.319 -44.848 1.00 121.46 ? 42  GLN B CA  1 
ATOM   771  C C   . GLN B 2 44  ? -15.828 -13.363 -43.934 1.00 117.70 ? 42  GLN B C   1 
ATOM   772  O O   . GLN B 2 44  ? -14.599 -13.403 -43.869 1.00 125.59 ? 42  GLN B O   1 
ATOM   773  C CB  . GLN B 2 44  ? -17.465 -15.275 -44.008 1.00 108.37 ? 42  GLN B CB  1 
ATOM   774  C CG  . GLN B 2 44  ? -18.562 -16.014 -44.791 1.00 115.41 ? 42  GLN B CG  1 
ATOM   775  C CD  . GLN B 2 44  ? -19.853 -15.216 -44.918 1.00 117.08 ? 42  GLN B CD  1 
ATOM   776  O OE1 . GLN B 2 44  ? -19.829 -13.995 -45.076 1.00 114.45 ? 42  GLN B OE1 1 
ATOM   777  N NE2 . GLN B 2 44  ? -20.987 -15.908 -44.851 1.00 116.72 ? 42  GLN B NE2 1 
ATOM   778  N N   . SER B 2 45  ? -16.558 -12.489 -43.246 1.00 99.44  ? 43  SER B N   1 
ATOM   779  C CA  A SER B 2 45  ? -15.966 -11.603 -42.255 0.50 86.59  ? 43  SER B CA  1 
ATOM   780  C CA  B SER B 2 45  ? -15.956 -11.612 -42.251 0.50 86.56  ? 43  SER B CA  1 
ATOM   781  C C   . SER B 2 45  ? -16.300 -12.149 -40.869 1.00 76.40  ? 43  SER B C   1 
ATOM   782  O O   . SER B 2 45  ? -16.288 -11.419 -39.877 1.00 78.19  ? 43  SER B O   1 
ATOM   783  C CB  A SER B 2 45  ? -16.510 -10.184 -42.423 0.50 86.61  ? 43  SER B CB  1 
ATOM   784  C CB  B SER B 2 45  ? -16.459 -10.179 -42.411 0.50 86.67  ? 43  SER B CB  1 
ATOM   785  O OG  A SER B 2 45  ? -15.602 -9.219  -41.920 0.50 87.51  ? 43  SER B OG  1 
ATOM   786  O OG  B SER B 2 45  ? -17.832 -10.075 -42.088 0.50 83.64  ? 43  SER B OG  1 
ATOM   787  N N   . ASP B 2 46  ? -16.610 -13.440 -40.825 1.00 57.30  ? 44  ASP B N   1 
ATOM   788  C CA  . ASP B 2 46  ? -16.917 -14.139 -39.594 1.00 55.06  ? 44  ASP B CA  1 
ATOM   789  C C   . ASP B 2 46  ? -15.696 -14.041 -38.697 1.00 63.43  ? 44  ASP B C   1 
ATOM   790  O O   . ASP B 2 46  ? -14.576 -13.989 -39.188 1.00 54.13  ? 44  ASP B O   1 
ATOM   791  C CB  . ASP B 2 46  ? -17.228 -15.608 -39.892 1.00 58.09  ? 44  ASP B CB  1 
ATOM   792  C CG  . ASP B 2 46  ? -18.621 -15.814 -40.470 1.00 80.66  ? 44  ASP B CG  1 
ATOM   793  O OD1 . ASP B 2 46  ? -19.420 -14.855 -40.465 1.00 92.57  ? 44  ASP B OD1 1 
ATOM   794  O OD2 . ASP B 2 46  ? -18.926 -16.947 -40.907 1.00 78.85  ? 44  ASP B OD2 1 
ATOM   795  N N   . VAL B 2 47  ? -15.903 -13.993 -37.386 1.00 62.90  ? 45  VAL B N   1 
ATOM   796  C CA  . VAL B 2 47  ? -14.779 -13.917 -36.462 1.00 54.06  ? 45  VAL B CA  1 
ATOM   797  C C   . VAL B 2 47  ? -14.391 -15.335 -36.062 1.00 47.03  ? 45  VAL B C   1 
ATOM   798  O O   . VAL B 2 47  ? -15.203 -16.068 -35.524 1.00 43.75  ? 45  VAL B O   1 
ATOM   799  C CB  . VAL B 2 47  ? -15.140 -13.070 -35.241 1.00 56.49  ? 45  VAL B CB  1 
ATOM   800  C CG1 . VAL B 2 47  ? -14.040 -13.101 -34.212 1.00 60.43  ? 45  VAL B CG1 1 
ATOM   801  C CG2 . VAL B 2 47  ? -15.387 -11.664 -35.669 1.00 50.52  ? 45  VAL B CG2 1 
ATOM   802  N N   . ARG B 2 48  ? -13.167 -15.749 -36.365 1.00 53.03  ? 46  ARG B N   1 
ATOM   803  C CA  . ARG B 2 48  ? -12.736 -17.092 -35.992 1.00 50.98  ? 46  ARG B CA  1 
ATOM   804  C C   . ARG B 2 48  ? -12.011 -17.036 -34.664 1.00 62.83  ? 46  ARG B C   1 
ATOM   805  O O   . ARG B 2 48  ? -10.952 -16.411 -34.551 1.00 65.30  ? 46  ARG B O   1 
ATOM   806  C CB  . ARG B 2 48  ? -11.797 -17.692 -37.035 1.00 52.55  ? 46  ARG B CB  1 
ATOM   807  C CG  . ARG B 2 48  ? -12.327 -17.701 -38.446 1.00 61.16  ? 46  ARG B CG  1 
ATOM   808  C CD  . ARG B 2 48  ? -11.209 -18.049 -39.428 1.00 70.51  ? 46  ARG B CD  1 
ATOM   809  N NE  . ARG B 2 48  ? -10.758 -19.435 -39.315 1.00 82.03  ? 46  ARG B NE  1 
ATOM   810  C CZ  . ARG B 2 48  ? -9.549  -19.812 -38.898 1.00 95.06  ? 46  ARG B CZ  1 
ATOM   811  N NH1 . ARG B 2 48  ? -8.639  -18.907 -38.547 1.00 91.94  ? 46  ARG B NH1 1 
ATOM   812  N NH2 . ARG B 2 48  ? -9.244  -21.106 -38.836 1.00 98.23  ? 46  ARG B NH2 1 
ATOM   813  N N   . ILE B 2 49  ? -12.580 -17.698 -33.668 1.00 55.09  ? 47  ILE B N   1 
ATOM   814  C CA  . ILE B 2 49  ? -11.986 -17.753 -32.344 1.00 51.97  ? 47  ILE B CA  1 
ATOM   815  C C   . ILE B 2 49  ? -11.326 -19.120 -32.133 1.00 55.05  ? 47  ILE B C   1 
ATOM   816  O O   . ILE B 2 49  ? -11.982 -20.157 -32.253 1.00 63.06  ? 47  ILE B O   1 
ATOM   817  C CB  . ILE B 2 49  ? -13.057 -17.490 -31.278 1.00 43.68  ? 47  ILE B CB  1 
ATOM   818  C CG1 . ILE B 2 49  ? -13.725 -16.140 -31.544 1.00 38.14  ? 47  ILE B CG1 1 
ATOM   819  C CG2 . ILE B 2 49  ? -12.468 -17.545 -29.892 1.00 54.15  ? 47  ILE B CG2 1 
ATOM   820  C CD1 . ILE B 2 49  ? -14.907 -15.861 -30.678 1.00 45.60  ? 47  ILE B CD1 1 
ATOM   821  N N   . LYS B 2 50  ? -10.022 -19.121 -31.861 1.00 47.49  ? 48  LYS B N   1 
ATOM   822  C CA  . LYS B 2 50  ? -9.306  -20.365 -31.546 1.00 46.54  ? 48  LYS B CA  1 
ATOM   823  C C   . LYS B 2 50  ? -9.409  -20.598 -30.060 1.00 53.31  ? 48  LYS B C   1 
ATOM   824  O O   . LYS B 2 50  ? -8.891  -19.799 -29.269 1.00 50.04  ? 48  LYS B O   1 
ATOM   825  C CB  . LYS B 2 50  ? -7.830  -20.264 -31.932 1.00 47.91  ? 48  LYS B CB  1 
ATOM   826  C CG  . LYS B 2 50  ? -7.014  -21.500 -31.660 1.00 69.89  ? 48  LYS B CG  1 
ATOM   827  C CD  . LYS B 2 50  ? -6.233  -21.911 -32.903 1.00 75.49  ? 48  LYS B CD  1 
ATOM   828  C CE  . LYS B 2 50  ? -5.319  -20.797 -33.414 1.00 88.04  ? 48  LYS B CE  1 
ATOM   829  N NZ  . LYS B 2 50  ? -4.595  -21.168 -34.676 1.00 99.73  ? 48  LYS B NZ  1 
ATOM   830  N N   . PHE B 2 51  ? -10.086 -21.674 -29.674 1.00 49.53  ? 49  PHE B N   1 
ATOM   831  C CA  . PHE B 2 51  ? -10.242 -21.989 -28.255 1.00 56.50  ? 49  PHE B CA  1 
ATOM   832  C C   . PHE B 2 51  ? -9.232  -23.022 -27.777 1.00 57.81  ? 49  PHE B C   1 
ATOM   833  O O   . PHE B 2 51  ? -9.040  -24.058 -28.412 1.00 52.34  ? 49  PHE B O   1 
ATOM   834  C CB  . PHE B 2 51  ? -11.643 -22.522 -27.970 1.00 55.03  ? 49  PHE B CB  1 
ATOM   835  C CG  . PHE B 2 51  ? -12.709 -21.476 -27.967 1.00 49.78  ? 49  PHE B CG  1 
ATOM   836  C CD1 . PHE B 2 51  ? -12.859 -20.630 -26.885 1.00 50.90  ? 49  PHE B CD1 1 
ATOM   837  C CD2 . PHE B 2 51  ? -13.595 -21.364 -29.030 1.00 51.45  ? 49  PHE B CD2 1 
ATOM   838  C CE1 . PHE B 2 51  ? -13.854 -19.665 -26.880 1.00 46.04  ? 49  PHE B CE1 1 
ATOM   839  C CE2 . PHE B 2 51  ? -14.592 -20.404 -29.021 1.00 42.04  ? 49  PHE B CE2 1 
ATOM   840  C CZ  . PHE B 2 51  ? -14.720 -19.565 -27.950 1.00 40.03  ? 49  PHE B CZ  1 
ATOM   841  N N   . GLU B 2 52  ? -8.632  -22.751 -26.626 1.00 53.47  ? 50  GLU B N   1 
ATOM   842  C CA  . GLU B 2 52  ? -7.571  -23.589 -26.078 1.00 54.68  ? 50  GLU B CA  1 
ATOM   843  C C   . GLU B 2 52  ? -7.989  -24.072 -24.690 1.00 55.37  ? 50  GLU B C   1 
ATOM   844  O O   . GLU B 2 52  ? -8.138  -23.271 -23.763 1.00 60.52  ? 50  GLU B O   1 
ATOM   845  C CB  . GLU B 2 52  ? -6.293  -22.758 -25.979 1.00 63.77  ? 50  GLU B CB  1 
ATOM   846  C CG  . GLU B 2 52  ? -5.025  -23.536 -25.684 1.00 100.61 ? 50  GLU B CG  1 
ATOM   847  C CD  . GLU B 2 52  ? -4.482  -24.269 -26.898 1.00 111.59 ? 50  GLU B CD  1 
ATOM   848  O OE1 . GLU B 2 52  ? -4.927  -23.967 -28.026 1.00 128.81 ? 50  GLU B OE1 1 
ATOM   849  O OE2 . GLU B 2 52  ? -3.608  -25.145 -26.720 1.00 95.08  ? 50  GLU B OE2 1 
ATOM   850  N N   . HIS B 2 53  ? -8.190  -25.374 -24.552 1.00 52.62  ? 51  HIS B N   1 
ATOM   851  C CA  . HIS B 2 53  ? -8.610  -25.959 -23.280 1.00 66.21  ? 51  HIS B CA  1 
ATOM   852  C C   . HIS B 2 53  ? -7.926  -27.306 -23.037 1.00 54.97  ? 51  HIS B C   1 
ATOM   853  O O   . HIS B 2 53  ? -8.243  -28.297 -23.694 1.00 73.87  ? 51  HIS B O   1 
ATOM   854  C CB  . HIS B 2 53  ? -10.132 -26.126 -23.238 1.00 67.97  ? 51  HIS B CB  1 
ATOM   855  C CG  . HIS B 2 53  ? -10.635 -26.694 -21.951 1.00 68.72  ? 51  HIS B CG  1 
ATOM   856  N ND1 . HIS B 2 53  ? -10.516 -26.029 -20.748 1.00 72.35  ? 51  HIS B ND1 1 
ATOM   857  C CD2 . HIS B 2 53  ? -11.239 -27.873 -21.673 1.00 62.25  ? 51  HIS B CD2 1 
ATOM   858  C CE1 . HIS B 2 53  ? -11.035 -26.770 -19.786 1.00 63.24  ? 51  HIS B CE1 1 
ATOM   859  N NE2 . HIS B 2 53  ? -11.478 -27.895 -20.321 1.00 71.47  ? 51  HIS B NE2 1 
ATOM   860  N N   . ASN B 2 54  ? -6.993  -27.331 -22.087 1.00 73.94  ? 52  ASN B N   1 
ATOM   861  C CA  . ASN B 2 54  ? -6.136  -28.496 -21.838 1.00 63.78  ? 52  ASN B CA  1 
ATOM   862  C C   . ASN B 2 54  ? -5.485  -29.082 -23.086 1.00 66.00  ? 52  ASN B C   1 
ATOM   863  O O   . ASN B 2 54  ? -5.447  -30.302 -23.251 1.00 72.79  ? 52  ASN B O   1 
ATOM   864  C CB  . ASN B 2 54  ? -6.886  -29.592 -21.074 1.00 62.59  ? 52  ASN B CB  1 
ATOM   865  C CG  . ASN B 2 54  ? -7.411  -29.115 -19.734 1.00 92.03  ? 52  ASN B CG  1 
ATOM   866  O OD1 . ASN B 2 54  ? -6.844  -28.217 -19.113 1.00 88.34  ? 52  ASN B OD1 1 
ATOM   867  N ND2 . ASN B 2 54  ? -8.502  -29.720 -19.279 1.00 84.97  ? 52  ASN B ND2 1 
ATOM   868  N N   . GLY B 2 55  ? -4.970  -28.221 -23.959 1.00 60.38  ? 53  GLY B N   1 
ATOM   869  C CA  . GLY B 2 55  ? -4.244  -28.679 -25.129 1.00 63.68  ? 53  GLY B CA  1 
ATOM   870  C C   . GLY B 2 55  ? -5.156  -29.032 -26.286 1.00 80.06  ? 53  GLY B C   1 
ATOM   871  O O   . GLY B 2 55  ? -4.695  -29.414 -27.361 1.00 84.39  ? 53  GLY B O   1 
ATOM   872  N N   . GLU B 2 56  ? -6.458  -28.907 -26.059 1.00 87.74  ? 54  GLU B N   1 
ATOM   873  C CA  . GLU B 2 56  ? -7.443  -29.147 -27.103 1.00 100.98 ? 54  GLU B CA  1 
ATOM   874  C C   . GLU B 2 56  ? -7.738  -27.854 -27.844 1.00 91.55  ? 54  GLU B C   1 
ATOM   875  O O   . GLU B 2 56  ? -8.452  -26.998 -27.331 1.00 93.50  ? 54  GLU B O   1 
ATOM   876  C CB  . GLU B 2 56  ? -8.747  -29.673 -26.491 1.00 112.99 ? 54  GLU B CB  1 
ATOM   877  C CG  . GLU B 2 56  ? -9.035  -31.147 -26.752 1.00 127.63 ? 54  GLU B CG  1 
ATOM   878  C CD  . GLU B 2 56  ? -9.966  -31.744 -25.707 1.00 133.51 ? 54  GLU B CD  1 
ATOM   879  O OE1 . GLU B 2 56  ? -10.261 -31.058 -24.703 1.00 140.43 ? 54  GLU B OE1 1 
ATOM   880  O OE2 . GLU B 2 56  ? -10.397 -32.902 -25.887 1.00 126.87 ? 54  GLU B OE2 1 
ATOM   881  N N   . ARG B 2 57  ? -7.194  -27.708 -29.047 1.00 77.11  ? 55  ARG B N   1 
ATOM   882  C CA  . ARG B 2 57  ? -7.609  -26.603 -29.899 1.00 77.69  ? 55  ARG B CA  1 
ATOM   883  C C   . ARG B 2 57  ? -9.006  -26.864 -30.488 1.00 55.86  ? 55  ARG B C   1 
ATOM   884  O O   . ARG B 2 57  ? -9.346  -27.985 -30.839 1.00 63.08  ? 55  ARG B O   1 
ATOM   885  C CB  . ARG B 2 57  ? -6.594  -26.363 -31.020 1.00 86.48  ? 55  ARG B CB  1 
ATOM   886  N N   . ARG B 2 58  ? -9.813  -25.817 -30.576 1.00 48.98  ? 56  ARG B N   1 
ATOM   887  C CA  . ARG B 2 58  ? -11.105 -25.886 -31.243 1.00 52.64  ? 56  ARG B CA  1 
ATOM   888  C C   . ARG B 2 58  ? -11.385 -24.548 -31.890 1.00 57.51  ? 56  ARG B C   1 
ATOM   889  O O   . ARG B 2 58  ? -11.480 -23.532 -31.212 1.00 46.52  ? 56  ARG B O   1 
ATOM   890  C CB  . ARG B 2 58  ? -12.228 -26.197 -30.251 1.00 64.20  ? 56  ARG B CB  1 
ATOM   891  C CG  . ARG B 2 58  ? -13.636 -26.114 -30.851 1.00 56.45  ? 56  ARG B CG  1 
ATOM   892  C CD  . ARG B 2 58  ? -13.866 -27.226 -31.850 1.00 52.13  ? 56  ARG B CD  1 
ATOM   893  N NE  . ARG B 2 58  ? -13.660 -28.539 -31.250 1.00 64.69  ? 56  ARG B NE  1 
ATOM   894  C CZ  . ARG B 2 58  ? -14.634 -29.309 -30.778 1.00 79.53  ? 56  ARG B CZ  1 
ATOM   895  N NH1 . ARG B 2 58  ? -15.899 -28.903 -30.842 1.00 69.58  ? 56  ARG B NH1 1 
ATOM   896  N NH2 . ARG B 2 58  ? -14.341 -30.493 -30.245 1.00 80.08  ? 56  ARG B NH2 1 
ATOM   897  N N   . ILE B 2 59  ? -11.534 -24.546 -33.203 1.00 56.14  ? 57  ILE B N   1 
ATOM   898  C CA  . ILE B 2 59  ? -11.842 -23.310 -33.894 1.00 50.39  ? 57  ILE B CA  1 
ATOM   899  C C   . ILE B 2 59  ? -13.327 -23.251 -34.203 1.00 48.38  ? 57  ILE B C   1 
ATOM   900  O O   . ILE B 2 59  ? -13.858 -24.138 -34.875 1.00 56.06  ? 57  ILE B O   1 
ATOM   901  C CB  . ILE B 2 59  ? -11.038 -23.215 -35.192 1.00 59.47  ? 57  ILE B CB  1 
ATOM   902  C CG1 . ILE B 2 59  ? -9.548  -23.270 -34.870 1.00 67.86  ? 57  ILE B CG1 1 
ATOM   903  C CG2 . ILE B 2 59  ? -11.390 -21.951 -35.947 1.00 59.13  ? 57  ILE B CG2 1 
ATOM   904  C CD1 . ILE B 2 59  ? -8.646  -23.338 -36.079 1.00 69.41  ? 57  ILE B CD1 1 
ATOM   905  N N   . ILE B 2 60  ? -13.978 -22.195 -33.715 1.00 50.76  ? 58  ILE B N   1 
ATOM   906  C CA  . ILE B 2 60  ? -15.392 -21.926 -33.968 1.00 50.55  ? 58  ILE B CA  1 
ATOM   907  C C   . ILE B 2 60  ? -15.525 -20.543 -34.610 1.00 57.71  ? 58  ILE B C   1 
ATOM   908  O O   . ILE B 2 60  ? -14.946 -19.580 -34.118 1.00 61.39  ? 58  ILE B O   1 
ATOM   909  C CB  . ILE B 2 60  ? -16.206 -21.947 -32.644 1.00 64.16  ? 58  ILE B CB  1 
ATOM   910  C CG1 . ILE B 2 60  ? -16.063 -23.295 -31.932 1.00 57.63  ? 58  ILE B CG1 1 
ATOM   911  C CG2 . ILE B 2 60  ? -17.684 -21.653 -32.888 1.00 51.64  ? 58  ILE B CG2 1 
ATOM   912  C CD1 . ILE B 2 60  ? -16.700 -23.343 -30.541 1.00 59.76  ? 58  ILE B CD1 1 
ATOM   913  N N   . ALA B 2 61  ? -16.277 -20.432 -35.704 1.00 55.56  ? 59  ALA B N   1 
ATOM   914  C CA  . ALA B 2 61  ? -16.490 -19.121 -36.327 1.00 48.05  ? 59  ALA B CA  1 
ATOM   915  C C   . ALA B 2 61  ? -17.752 -18.465 -35.773 1.00 48.52  ? 59  ALA B C   1 
ATOM   916  O O   . ALA B 2 61  ? -18.705 -19.149 -35.415 1.00 50.84  ? 59  ALA B O   1 
ATOM   917  C CB  . ALA B 2 61  ? -16.567 -19.244 -37.838 1.00 45.05  ? 59  ALA B CB  1 
ATOM   918  N N   . PHE B 2 62  ? -17.754 -17.141 -35.675 1.00 43.51  ? 60  PHE B N   1 
ATOM   919  C CA  . PHE B 2 62  ? -18.951 -16.430 -35.246 1.00 38.18  ? 60  PHE B CA  1 
ATOM   920  C C   . PHE B 2 62  ? -19.238 -15.334 -36.244 1.00 52.64  ? 60  PHE B C   1 
ATOM   921  O O   . PHE B 2 62  ? -18.335 -14.586 -36.623 1.00 60.70  ? 60  PHE B O   1 
ATOM   922  C CB  . PHE B 2 62  ? -18.759 -15.820 -33.866 1.00 40.48  ? 60  PHE B CB  1 
ATOM   923  C CG  . PHE B 2 62  ? -18.672 -16.831 -32.770 1.00 48.93  ? 60  PHE B CG  1 
ATOM   924  C CD1 . PHE B 2 62  ? -19.761 -17.056 -31.935 1.00 41.36  ? 60  PHE B CD1 1 
ATOM   925  C CD2 . PHE B 2 62  ? -17.500 -17.554 -32.563 1.00 31.44  ? 60  PHE B CD2 1 
ATOM   926  C CE1 . PHE B 2 62  ? -19.688 -18.004 -30.906 1.00 38.56  ? 60  PHE B CE1 1 
ATOM   927  C CE2 . PHE B 2 62  ? -17.424 -18.495 -31.548 1.00 43.47  ? 60  PHE B CE2 1 
ATOM   928  C CZ  . PHE B 2 62  ? -18.513 -18.721 -30.722 1.00 44.36  ? 60  PHE B CZ  1 
ATOM   929  N N   . SER B 2 63  ? -20.487 -15.245 -36.688 1.00 54.60  ? 61  SER B N   1 
ATOM   930  C CA  . SER B 2 63  ? -20.858 -14.219 -37.656 1.00 47.22  ? 61  SER B CA  1 
ATOM   931  C C   . SER B 2 63  ? -21.010 -12.865 -36.978 1.00 37.99  ? 61  SER B C   1 
ATOM   932  O O   . SER B 2 63  ? -21.373 -12.778 -35.802 1.00 55.21  ? 61  SER B O   1 
ATOM   933  C CB  . SER B 2 63  ? -22.152 -14.599 -38.359 1.00 54.32  ? 61  SER B CB  1 
ATOM   934  O OG  . SER B 2 63  ? -23.253 -14.471 -37.490 1.00 49.20  ? 61  SER B OG  1 
ATOM   935  N N   . ARG B 2 64  ? -20.714 -11.801 -37.708 1.00 44.66  ? 62  ARG B N   1 
ATOM   936  C CA  . ARG B 2 64  ? -20.904 -10.477 -37.146 1.00 40.37  ? 62  ARG B CA  1 
ATOM   937  C C   . ARG B 2 64  ? -22.355 -10.064 -37.299 1.00 59.50  ? 62  ARG B C   1 
ATOM   938  O O   . ARG B 2 64  ? -22.986 -10.356 -38.317 1.00 61.54  ? 62  ARG B O   1 
ATOM   939  C CB  . ARG B 2 64  ? -19.983 -9.476  -37.812 1.00 39.47  ? 62  ARG B CB  1 
ATOM   940  C CG  . ARG B 2 64  ? -18.508 -9.777  -37.610 1.00 49.14  ? 62  ARG B CG  1 
ATOM   941  C CD  . ARG B 2 64  ? -17.674 -8.687  -38.231 1.00 42.81  ? 62  ARG B CD  1 
ATOM   942  N NE  . ARG B 2 64  ? -16.385 -9.169  -38.708 1.00 60.58  ? 62  ARG B NE  1 
ATOM   943  C CZ  . ARG B 2 64  ? -15.221 -8.741  -38.238 1.00 54.29  ? 62  ARG B CZ  1 
ATOM   944  N NH1 . ARG B 2 64  ? -15.204 -7.822  -37.287 1.00 38.43  ? 62  ARG B NH1 1 
ATOM   945  N NH2 . ARG B 2 64  ? -14.081 -9.229  -38.715 1.00 51.15  ? 62  ARG B NH2 1 
ATOM   946  N N   . PRO B 2 65  ? -22.892 -9.376  -36.285 1.00 54.09  ? 63  PRO B N   1 
ATOM   947  C CA  . PRO B 2 65  ? -22.134 -8.902  -35.122 1.00 45.24  ? 63  PRO B CA  1 
ATOM   948  C C   . PRO B 2 65  ? -22.012 -9.974  -34.034 1.00 61.60  ? 63  PRO B C   1 
ATOM   949  O O   . PRO B 2 65  ? -23.003 -10.626 -33.700 1.00 58.93  ? 63  PRO B O   1 
ATOM   950  C CB  . PRO B 2 65  ? -22.968 -7.719  -34.644 1.00 52.91  ? 63  PRO B CB  1 
ATOM   951  C CG  . PRO B 2 65  ? -24.403 -8.093  -35.037 1.00 48.66  ? 63  PRO B CG  1 
ATOM   952  C CD  . PRO B 2 65  ? -24.319 -9.013  -36.216 1.00 46.04  ? 63  PRO B CD  1 
ATOM   953  N N   . VAL B 2 66  ? -20.803 -10.168 -33.508 1.00 61.52  ? 64  VAL B N   1 
ATOM   954  C CA  . VAL B 2 66  ? -20.572 -11.199 -32.489 1.00 45.53  ? 64  VAL B CA  1 
ATOM   955  C C   . VAL B 2 66  ? -21.064 -10.750 -31.126 1.00 47.87  ? 64  VAL B C   1 
ATOM   956  O O   . VAL B 2 66  ? -20.639 -9.715  -30.614 1.00 58.25  ? 64  VAL B O   1 
ATOM   957  C CB  . VAL B 2 66  ? -19.077 -11.528 -32.324 1.00 40.43  ? 64  VAL B CB  1 
ATOM   958  C CG1 . VAL B 2 66  ? -18.906 -12.697 -31.380 1.00 45.27  ? 64  VAL B CG1 1 
ATOM   959  C CG2 . VAL B 2 66  ? -18.423 -11.819 -33.656 1.00 39.98  ? 64  VAL B CG2 1 
ATOM   960  N N   . LYS B 2 67  ? -21.929 -11.547 -30.515 1.00 40.08  ? 65  LYS B N   1 
ATOM   961  C CA  . LYS B 2 67  ? -22.456 -11.208 -29.206 1.00 41.46  ? 65  LYS B CA  1 
ATOM   962  C C   . LYS B 2 67  ? -21.701 -11.937 -28.091 1.00 46.96  ? 65  LYS B C   1 
ATOM   963  O O   . LYS B 2 67  ? -21.452 -13.138 -28.176 1.00 49.36  ? 65  LYS B O   1 
ATOM   964  C CB  . LYS B 2 67  ? -23.944 -11.528 -29.143 1.00 48.31  ? 65  LYS B CB  1 
ATOM   965  C CG  . LYS B 2 67  ? -24.501 -11.323 -27.765 1.00 40.04  ? 65  LYS B CG  1 
ATOM   966  C CD  . LYS B 2 67  ? -25.954 -10.975 -27.804 1.00 54.69  ? 65  LYS B CD  1 
ATOM   967  C CE  . LYS B 2 67  ? -26.271 -10.026 -26.654 1.00 81.95  ? 65  LYS B CE  1 
ATOM   968  N NZ  . LYS B 2 67  ? -27.721 -9.998  -26.294 1.00 107.02 ? 65  LYS B NZ  1 
ATOM   969  N N   . TYR B 2 68  ? -21.318 -11.209 -27.050 1.00 49.43  ? 66  TYR B N   1 
ATOM   970  C CA  . TYR B 2 68  ? -20.497 -11.807 -25.997 1.00 40.32  ? 66  TYR B CA  1 
ATOM   971  C C   . TYR B 2 68  ? -21.193 -12.999 -25.321 1.00 53.84  ? 66  TYR B C   1 
ATOM   972  O O   . TYR B 2 68  ? -20.612 -14.065 -25.231 1.00 46.21  ? 66  TYR B O   1 
ATOM   973  C CB  . TYR B 2 68  ? -20.120 -10.747 -24.989 1.00 46.20  ? 66  TYR B CB  1 
ATOM   974  C CG  . TYR B 2 68  ? -19.441 -11.249 -23.739 1.00 51.92  ? 66  TYR B CG  1 
ATOM   975  C CD1 . TYR B 2 68  ? -18.174 -11.785 -23.785 1.00 37.69  ? 66  TYR B CD1 1 
ATOM   976  C CD2 . TYR B 2 68  ? -20.054 -11.126 -22.495 1.00 56.18  ? 66  TYR B CD2 1 
ATOM   977  C CE1 . TYR B 2 68  ? -17.537 -12.233 -22.632 1.00 63.07  ? 66  TYR B CE1 1 
ATOM   978  C CE2 . TYR B 2 68  ? -19.425 -11.562 -21.331 1.00 56.04  ? 66  TYR B CE2 1 
ATOM   979  C CZ  . TYR B 2 68  ? -18.169 -12.111 -21.409 1.00 57.69  ? 66  TYR B CZ  1 
ATOM   980  O OH  . TYR B 2 68  ? -17.559 -12.550 -20.269 1.00 53.00  ? 66  TYR B OH  1 
ATOM   981  N N   . GLU B 2 69  ? -22.429 -12.817 -24.861 1.00 40.72  ? 67  GLU B N   1 
ATOM   982  C CA  . GLU B 2 69  ? -23.182 -13.891 -24.212 1.00 61.14  ? 67  GLU B CA  1 
ATOM   983  C C   . GLU B 2 69  ? -23.363 -15.129 -25.095 1.00 53.48  ? 67  GLU B C   1 
ATOM   984  O O   . GLU B 2 69  ? -23.468 -16.235 -24.594 1.00 53.33  ? 67  GLU B O   1 
ATOM   985  C CB  . GLU B 2 69  ? -24.554 -13.383 -23.762 1.00 56.50  ? 67  GLU B CB  1 
ATOM   986  C CG  . GLU B 2 69  ? -24.537 -12.271 -22.710 1.00 66.80  ? 67  GLU B CG  1 
ATOM   987  C CD  . GLU B 2 69  ? -23.989 -10.936 -23.225 1.00 81.68  ? 67  GLU B CD  1 
ATOM   988  O OE1 . GLU B 2 69  ? -23.794 -10.773 -24.453 1.00 64.91  ? 67  GLU B OE1 1 
ATOM   989  O OE2 . GLU B 2 69  ? -23.747 -10.043 -22.390 1.00 92.63  ? 67  GLU B OE2 1 
ATOM   990  N N   . ASP B 2 70  ? -23.395 -14.946 -26.408 1.00 48.23  ? 68  ASP B N   1 
ATOM   991  C CA  . ASP B 2 70  ? -23.511 -16.082 -27.312 1.00 43.71  ? 68  ASP B CA  1 
ATOM   992  C C   . ASP B 2 70  ? -22.210 -16.875 -27.323 1.00 55.24  ? 68  ASP B C   1 
ATOM   993  O O   . ASP B 2 70  ? -22.211 -18.114 -27.399 1.00 59.85  ? 68  ASP B O   1 
ATOM   994  C CB  . ASP B 2 70  ? -23.902 -15.619 -28.726 1.00 59.71  ? 68  ASP B CB  1 
ATOM   995  C CG  . ASP B 2 70  ? -24.037 -16.777 -29.714 1.00 74.73  ? 68  ASP B CG  1 
ATOM   996  O OD1 . ASP B 2 70  ? -25.083 -17.462 -29.709 1.00 85.50  ? 68  ASP B OD1 1 
ATOM   997  O OD2 . ASP B 2 70  ? -23.103 -16.998 -30.509 1.00 76.63  ? 68  ASP B OD2 1 
ATOM   998  N N   . VAL B 2 71  ? -21.097 -16.159 -27.230 1.00 49.35  ? 69  VAL B N   1 
ATOM   999  C CA  . VAL B 2 71  ? -19.789 -16.801 -27.142 1.00 54.60  ? 69  VAL B CA  1 
ATOM   1000 C C   . VAL B 2 71  ? -19.675 -17.618 -25.864 1.00 42.40  ? 69  VAL B C   1 
ATOM   1001 O O   . VAL B 2 71  ? -19.176 -18.743 -25.891 1.00 43.32  ? 69  VAL B O   1 
ATOM   1002 C CB  . VAL B 2 71  ? -18.639 -15.779 -27.187 1.00 61.40  ? 69  VAL B CB  1 
ATOM   1003 C CG1 . VAL B 2 71  ? -17.291 -16.464 -26.952 1.00 45.74  ? 69  VAL B CG1 1 
ATOM   1004 C CG2 . VAL B 2 71  ? -18.636 -15.046 -28.508 1.00 55.88  ? 69  VAL B CG2 1 
ATOM   1005 N N   . GLU B 2 72  ? -20.125 -17.055 -24.749 1.00 51.00  ? 70  GLU B N   1 
ATOM   1006 C CA  . GLU B 2 72  ? -20.133 -17.786 -23.486 1.00 42.54  ? 70  GLU B CA  1 
ATOM   1007 C C   . GLU B 2 72  ? -21.035 -19.002 -23.642 1.00 51.28  ? 70  GLU B C   1 
ATOM   1008 O O   . GLU B 2 72  ? -20.687 -20.104 -23.230 1.00 44.77  ? 70  GLU B O   1 
ATOM   1009 C CB  . GLU B 2 72  ? -20.682 -16.914 -22.352 1.00 43.32  ? 70  GLU B CB  1 
ATOM   1010 C CG  . GLU B 2 72  ? -19.797 -15.758 -21.890 1.00 50.87  ? 70  GLU B CG  1 
ATOM   1011 C CD  . GLU B 2 72  ? -20.448 -14.951 -20.770 1.00 61.49  ? 70  GLU B CD  1 
ATOM   1012 O OE1 . GLU B 2 72  ? -21.591 -14.505 -20.965 1.00 75.74  ? 70  GLU B OE1 1 
ATOM   1013 O OE2 . GLU B 2 72  ? -19.827 -14.770 -19.699 1.00 65.64  ? 70  GLU B OE2 1 
ATOM   1014 N N   . HIS B 2 73  ? -22.211 -18.786 -24.219 1.00 50.62  ? 71  HIS B N   1 
ATOM   1015 C CA  . HIS B 2 73  ? -23.158 -19.865 -24.448 1.00 50.91  ? 71  HIS B CA  1 
ATOM   1016 C C   . HIS B 2 73  ? -22.461 -20.978 -25.212 1.00 58.89  ? 71  HIS B C   1 
ATOM   1017 O O   . HIS B 2 73  ? -22.490 -22.140 -24.792 1.00 49.17  ? 71  HIS B O   1 
ATOM   1018 C CB  . HIS B 2 73  ? -24.365 -19.342 -25.228 1.00 45.20  ? 71  HIS B CB  1 
ATOM   1019 C CG  . HIS B 2 73  ? -25.360 -20.393 -25.599 1.00 50.28  ? 71  HIS B CG  1 
ATOM   1020 N ND1 . HIS B 2 73  ? -25.416 -21.628 -24.977 1.00 59.28  ? 71  HIS B ND1 1 
ATOM   1021 C CD2 . HIS B 2 73  ? -26.341 -20.400 -26.529 1.00 61.23  ? 71  HIS B CD2 1 
ATOM   1022 C CE1 . HIS B 2 73  ? -26.385 -22.342 -25.514 1.00 69.48  ? 71  HIS B CE1 1 
ATOM   1023 N NE2 . HIS B 2 73  ? -26.967 -21.619 -26.459 1.00 73.87  ? 71  HIS B NE2 1 
ATOM   1024 N N   . LYS B 2 74  ? -21.802 -20.619 -26.312 1.00 46.17  ? 72  LYS B N   1 
ATOM   1025 C CA  . LYS B 2 74  ? -21.095 -21.619 -27.095 1.00 46.37  ? 72  LYS B CA  1 
ATOM   1026 C C   . LYS B 2 74  ? -20.048 -22.387 -26.272 1.00 52.15  ? 72  LYS B C   1 
ATOM   1027 O O   . LYS B 2 74  ? -19.953 -23.617 -26.398 1.00 43.09  ? 72  LYS B O   1 
ATOM   1028 C CB  . LYS B 2 74  ? -20.456 -20.999 -28.326 1.00 47.90  ? 72  LYS B CB  1 
ATOM   1029 C CG  . LYS B 2 74  ? -20.090 -22.023 -29.389 1.00 55.25  ? 72  LYS B CG  1 
ATOM   1030 C CD  . LYS B 2 74  ? -21.332 -22.711 -29.943 1.00 70.23  ? 72  LYS B CD  1 
ATOM   1031 C CE  . LYS B 2 74  ? -21.336 -22.732 -31.473 1.00 81.77  ? 72  LYS B CE  1 
ATOM   1032 N NZ  . LYS B 2 74  ? -21.346 -21.358 -32.057 1.00 81.38  ? 72  LYS B NZ  1 
ATOM   1033 N N   . VAL B 2 75  ? -19.280 -21.690 -25.428 1.00 43.66  ? 73  VAL B N   1 
ATOM   1034 C CA  . VAL B 2 75  ? -18.238 -22.377 -24.637 1.00 44.99  ? 73  VAL B CA  1 
ATOM   1035 C C   . VAL B 2 75  ? -18.881 -23.420 -23.729 1.00 41.63  ? 73  VAL B C   1 
ATOM   1036 O O   . VAL B 2 75  ? -18.458 -24.565 -23.707 1.00 45.18  ? 73  VAL B O   1 
ATOM   1037 C CB  . VAL B 2 75  ? -17.361 -21.412 -23.811 1.00 33.98  ? 73  VAL B CB  1 
ATOM   1038 C CG1 . VAL B 2 75  ? -16.425 -22.174 -22.912 1.00 34.32  ? 73  VAL B CG1 1 
ATOM   1039 C CG2 . VAL B 2 75  ? -16.543 -20.543 -24.710 1.00 39.26  ? 73  VAL B CG2 1 
ATOM   1040 N N   . THR B 2 76  ? -19.942 -23.025 -23.032 1.00 44.52  ? 74  THR B N   1 
ATOM   1041 C CA  . THR B 2 76  ? -20.643 -23.915 -22.118 1.00 55.89  ? 74  THR B CA  1 
ATOM   1042 C C   . THR B 2 76  ? -21.139 -25.195 -22.803 1.00 59.90  ? 74  THR B C   1 
ATOM   1043 O O   . THR B 2 76  ? -21.059 -26.275 -22.228 1.00 59.37  ? 74  THR B O   1 
ATOM   1044 C CB  . THR B 2 76  ? -21.804 -23.179 -21.464 1.00 54.74  ? 74  THR B CB  1 
ATOM   1045 O OG1 . THR B 2 76  ? -21.281 -22.129 -20.644 1.00 64.41  ? 74  THR B OG1 1 
ATOM   1046 C CG2 . THR B 2 76  ? -22.628 -24.114 -20.610 1.00 58.41  ? 74  THR B CG2 1 
ATOM   1047 N N   . THR B 2 77  ? -21.610 -25.064 -24.041 1.00 41.69  ? 75  THR B N   1 
ATOM   1048 C CA  . THR B 2 77  ? -22.181 -26.181 -24.779 1.00 50.29  ? 75  THR B CA  1 
ATOM   1049 C C   . THR B 2 77  ? -21.104 -27.112 -25.278 1.00 50.22  ? 75  THR B C   1 
ATOM   1050 O O   . THR B 2 77  ? -21.200 -28.327 -25.124 1.00 46.78  ? 75  THR B O   1 
ATOM   1051 C CB  . THR B 2 77  ? -22.970 -25.713 -26.019 1.00 57.39  ? 75  THR B CB  1 
ATOM   1052 O OG1 . THR B 2 77  ? -23.979 -24.774 -25.633 1.00 59.43  ? 75  THR B OG1 1 
ATOM   1053 C CG2 . THR B 2 77  ? -23.608 -26.909 -26.722 1.00 40.64  ? 75  THR B CG2 1 
ATOM   1054 N N   . VAL B 2 78  ? -20.090 -26.528 -25.895 1.00 48.74  ? 76  VAL B N   1 
ATOM   1055 C CA  . VAL B 2 78  ? -19.044 -27.297 -26.547 1.00 44.50  ? 76  VAL B CA  1 
ATOM   1056 C C   . VAL B 2 78  ? -18.215 -28.031 -25.525 1.00 47.48  ? 76  VAL B C   1 
ATOM   1057 O O   . VAL B 2 78  ? -17.932 -29.214 -25.700 1.00 44.31  ? 76  VAL B O   1 
ATOM   1058 C CB  . VAL B 2 78  ? -18.150 -26.393 -27.404 1.00 51.04  ? 76  VAL B CB  1 
ATOM   1059 C CG1 . VAL B 2 78  ? -16.779 -27.000 -27.568 1.00 50.88  ? 76  VAL B CG1 1 
ATOM   1060 C CG2 . VAL B 2 78  ? -18.795 -26.144 -28.758 1.00 47.16  ? 76  VAL B CG2 1 
ATOM   1061 N N   . PHE B 2 79  ? -17.861 -27.329 -24.448 1.00 52.32  ? 77  PHE B N   1 
ATOM   1062 C CA  . PHE B 2 79  ? -16.966 -27.860 -23.424 1.00 42.24  ? 77  PHE B CA  1 
ATOM   1063 C C   . PHE B 2 79  ? -17.674 -28.332 -22.154 1.00 56.54  ? 77  PHE B C   1 
ATOM   1064 O O   . PHE B 2 79  ? -17.030 -28.836 -21.243 1.00 42.86  ? 77  PHE B O   1 
ATOM   1065 C CB  . PHE B 2 79  ? -15.910 -26.811 -23.050 1.00 54.10  ? 77  PHE B CB  1 
ATOM   1066 C CG  . PHE B 2 79  ? -14.956 -26.499 -24.160 1.00 49.84  ? 77  PHE B CG  1 
ATOM   1067 C CD1 . PHE B 2 79  ? -13.837 -27.301 -24.381 1.00 47.29  ? 77  PHE B CD1 1 
ATOM   1068 C CD2 . PHE B 2 79  ? -15.181 -25.414 -25.004 1.00 44.04  ? 77  PHE B CD2 1 
ATOM   1069 C CE1 . PHE B 2 79  ? -12.955 -27.023 -25.440 1.00 40.07  ? 77  PHE B CE1 1 
ATOM   1070 C CE2 . PHE B 2 79  ? -14.290 -25.128 -26.069 1.00 34.04  ? 77  PHE B CE2 1 
ATOM   1071 C CZ  . PHE B 2 79  ? -13.193 -25.934 -26.278 1.00 34.07  ? 77  PHE B CZ  1 
ATOM   1072 N N   . GLY B 2 80  ? -18.986 -28.146 -22.073 1.00 51.66  ? 78  GLY B N   1 
ATOM   1073 C CA  . GLY B 2 80  ? -19.747 -28.753 -20.995 1.00 61.22  ? 78  GLY B CA  1 
ATOM   1074 C C   . GLY B 2 80  ? -19.524 -28.244 -19.583 1.00 61.32  ? 78  GLY B C   1 
ATOM   1075 O O   . GLY B 2 80  ? -19.969 -28.870 -18.618 1.00 59.55  ? 78  GLY B O   1 
ATOM   1076 N N   . GLN B 2 81  ? -18.842 -27.116 -19.451 1.00 56.25  ? 79  GLN B N   1 
ATOM   1077 C CA  . GLN B 2 81  ? -18.640 -26.528 -18.134 1.00 69.46  ? 79  GLN B CA  1 
ATOM   1078 C C   . GLN B 2 81  ? -18.394 -25.029 -18.247 1.00 70.13  ? 79  GLN B C   1 
ATOM   1079 O O   . GLN B 2 81  ? -17.928 -24.556 -19.271 1.00 66.89  ? 79  GLN B O   1 
ATOM   1080 C CB  . GLN B 2 81  ? -17.472 -27.206 -17.423 1.00 45.86  ? 79  GLN B CB  1 
ATOM   1081 C CG  . GLN B 2 81  ? -16.176 -27.160 -18.198 1.00 46.33  ? 79  GLN B CG  1 
ATOM   1082 C CD  . GLN B 2 81  ? -15.010 -27.720 -17.416 1.00 69.38  ? 79  GLN B CD  1 
ATOM   1083 O OE1 . GLN B 2 81  ? -14.864 -27.465 -16.207 1.00 62.26  ? 79  GLN B OE1 1 
ATOM   1084 N NE2 . GLN B 2 81  ? -14.164 -28.492 -18.099 1.00 66.05  ? 79  GLN B NE2 1 
ATOM   1085 N N   . PRO B 2 82  ? -18.729 -24.269 -17.198 1.00 77.03  ? 80  PRO B N   1 
ATOM   1086 C CA  . PRO B 2 82  ? -18.429 -22.832 -17.252 1.00 80.94  ? 80  PRO B CA  1 
ATOM   1087 C C   . PRO B 2 82  ? -16.922 -22.556 -17.269 1.00 78.93  ? 80  PRO B C   1 
ATOM   1088 O O   . PRO B 2 82  ? -16.203 -22.950 -16.345 1.00 76.66  ? 80  PRO B O   1 
ATOM   1089 C CB  . PRO B 2 82  ? -19.051 -22.299 -15.957 1.00 73.88  ? 80  PRO B CB  1 
ATOM   1090 C CG  . PRO B 2 82  ? -19.116 -23.493 -15.043 1.00 75.45  ? 80  PRO B CG  1 
ATOM   1091 C CD  . PRO B 2 82  ? -19.424 -24.645 -15.957 1.00 68.43  ? 80  PRO B CD  1 
ATOM   1092 N N   . LEU B 2 83  ? -16.463 -21.879 -18.319 1.00 67.04  ? 81  LEU B N   1 
ATOM   1093 C CA  . LEU B 2 83  ? -15.047 -21.562 -18.489 1.00 60.02  ? 81  LEU B CA  1 
ATOM   1094 C C   . LEU B 2 83  ? -14.802 -20.048 -18.653 1.00 63.04  ? 81  LEU B C   1 
ATOM   1095 O O   . LEU B 2 83  ? -15.624 -19.342 -19.242 1.00 69.48  ? 81  LEU B O   1 
ATOM   1096 C CB  . LEU B 2 83  ? -14.511 -22.334 -19.687 1.00 50.85  ? 81  LEU B CB  1 
ATOM   1097 C CG  . LEU B 2 83  ? -14.521 -23.852 -19.492 1.00 54.50  ? 81  LEU B CG  1 
ATOM   1098 C CD1 . LEU B 2 83  ? -14.066 -24.599 -20.751 1.00 41.13  ? 81  LEU B CD1 1 
ATOM   1099 C CD2 . LEU B 2 83  ? -13.619 -24.178 -18.304 1.00 51.37  ? 81  LEU B CD2 1 
ATOM   1100 N N   . ASP B 2 84  ? -13.688 -19.548 -18.120 1.00 58.12  ? 82  ASP B N   1 
ATOM   1101 C CA  . ASP B 2 84  ? -13.309 -18.141 -18.301 1.00 49.17  ? 82  ASP B CA  1 
ATOM   1102 C C   . ASP B 2 84  ? -12.593 -17.947 -19.617 1.00 55.16  ? 82  ASP B C   1 
ATOM   1103 O O   . ASP B 2 84  ? -11.807 -18.806 -20.028 1.00 52.12  ? 82  ASP B O   1 
ATOM   1104 C CB  . ASP B 2 84  ? -12.403 -17.666 -17.164 1.00 57.18  ? 82  ASP B CB  1 
ATOM   1105 C CG  . ASP B 2 84  ? -13.180 -17.302 -15.922 1.00 81.63  ? 82  ASP B CG  1 
ATOM   1106 O OD1 . ASP B 2 84  ? -14.342 -16.856 -16.064 1.00 77.18  ? 82  ASP B OD1 1 
ATOM   1107 O OD2 . ASP B 2 84  ? -12.627 -17.464 -14.810 1.00 89.71  ? 82  ASP B OD2 1 
ATOM   1108 N N   . LEU B 2 85  ? -12.848 -16.824 -20.280 1.00 54.65  ? 83  LEU B N   1 
ATOM   1109 C CA  . LEU B 2 85  ? -12.212 -16.591 -21.572 1.00 48.06  ? 83  LEU B CA  1 
ATOM   1110 C C   . LEU B 2 85  ? -11.006 -15.679 -21.397 1.00 57.56  ? 83  LEU B C   1 
ATOM   1111 O O   . LEU B 2 85  ? -11.155 -14.496 -21.083 1.00 72.44  ? 83  LEU B O   1 
ATOM   1112 C CB  . LEU B 2 85  ? -13.194 -15.972 -22.561 1.00 50.17  ? 83  LEU B CB  1 
ATOM   1113 C CG  . LEU B 2 85  ? -14.675 -16.322 -22.456 1.00 56.79  ? 83  LEU B CG  1 
ATOM   1114 C CD1 . LEU B 2 85  ? -15.487 -15.460 -23.406 1.00 67.88  ? 83  LEU B CD1 1 
ATOM   1115 C CD2 . LEU B 2 85  ? -14.935 -17.767 -22.742 1.00 46.72  ? 83  LEU B CD2 1 
ATOM   1116 N N   . HIS B 2 86  ? -9.808  -16.218 -21.586 1.00 43.16  ? 84  HIS B N   1 
ATOM   1117 C CA  . HIS B 2 86  ? -8.620  -15.390 -21.468 1.00 40.71  ? 84  HIS B CA  1 
ATOM   1118 C C   . HIS B 2 86  ? -8.103  -14.989 -22.848 1.00 41.71  ? 84  HIS B C   1 
ATOM   1119 O O   . HIS B 2 86  ? -7.502  -15.803 -23.557 1.00 49.54  ? 84  HIS B O   1 
ATOM   1120 C CB  . HIS B 2 86  ? -7.554  -16.130 -20.656 1.00 40.26  ? 84  HIS B CB  1 
ATOM   1121 C CG  . HIS B 2 86  ? -7.937  -16.339 -19.219 1.00 60.30  ? 84  HIS B CG  1 
ATOM   1122 N ND1 . HIS B 2 86  ? -7.613  -15.441 -18.225 1.00 51.45  ? 84  HIS B ND1 1 
ATOM   1123 C CD2 . HIS B 2 86  ? -8.620  -17.338 -18.612 1.00 59.41  ? 84  HIS B CD2 1 
ATOM   1124 C CE1 . HIS B 2 86  ? -8.075  -15.880 -17.069 1.00 65.54  ? 84  HIS B CE1 1 
ATOM   1125 N NE2 . HIS B 2 86  ? -8.687  -17.030 -17.275 1.00 67.62  ? 84  HIS B NE2 1 
ATOM   1126 N N   . TYR B 2 87  ? -8.345  -13.741 -23.239 1.00 47.53  ? 85  TYR B N   1 
ATOM   1127 C CA  . TYR B 2 87  ? -7.854  -13.261 -24.528 1.00 57.22  ? 85  TYR B CA  1 
ATOM   1128 C C   . TYR B 2 87  ? -6.339  -13.212 -24.471 1.00 45.40  ? 85  TYR B C   1 
ATOM   1129 O O   . TYR B 2 87  ? -5.788  -12.580 -23.581 1.00 45.69  ? 85  TYR B O   1 
ATOM   1130 C CB  . TYR B 2 87  ? -8.417  -11.877 -24.866 1.00 53.59  ? 85  TYR B CB  1 
ATOM   1131 C CG  . TYR B 2 87  ? -7.843  -11.321 -26.146 1.00 53.34  ? 85  TYR B CG  1 
ATOM   1132 C CD1 . TYR B 2 87  ? -7.819  -12.087 -27.298 1.00 43.63  ? 85  TYR B CD1 1 
ATOM   1133 C CD2 . TYR B 2 87  ? -7.315  -10.041 -26.201 1.00 61.53  ? 85  TYR B CD2 1 
ATOM   1134 C CE1 . TYR B 2 87  ? -7.290  -11.593 -28.468 1.00 45.93  ? 85  TYR B CE1 1 
ATOM   1135 C CE2 . TYR B 2 87  ? -6.777  -9.534  -27.380 1.00 44.25  ? 85  TYR B CE2 1 
ATOM   1136 C CZ  . TYR B 2 87  ? -6.772  -10.317 -28.507 1.00 57.35  ? 85  TYR B CZ  1 
ATOM   1137 O OH  . TYR B 2 87  ? -6.251  -9.830  -29.685 1.00 67.45  ? 85  TYR B OH  1 
ATOM   1138 N N   . MET B 2 88  ? -5.676  -13.881 -25.413 1.00 53.48  ? 86  MET B N   1 
ATOM   1139 C CA  . MET B 2 88  ? -4.213  -14.073 -25.365 1.00 54.75  ? 86  MET B CA  1 
ATOM   1140 C C   . MET B 2 88  ? -3.453  -13.250 -26.416 1.00 60.78  ? 86  MET B C   1 
ATOM   1141 O O   . MET B 2 88  ? -3.422  -13.602 -27.599 1.00 69.63  ? 86  MET B O   1 
ATOM   1142 C CB  . MET B 2 88  ? -3.867  -15.566 -25.501 1.00 58.56  ? 86  MET B CB  1 
ATOM   1143 C CG  . MET B 2 88  ? -2.386  -15.860 -25.712 1.00 85.23  ? 86  MET B CG  1 
ATOM   1144 S SD  . MET B 2 88  ? -2.034  -17.624 -25.816 1.00 96.54  ? 86  MET B SD  1 
ATOM   1145 C CE  . MET B 2 88  ? -3.218  -18.221 -24.620 1.00 48.21  ? 86  MET B CE  1 
ATOM   1146 N N   . ASN B 2 89  ? -2.828  -12.162 -25.970 1.00 62.86  ? 87  ASN B N   1 
ATOM   1147 C CA  . ASN B 2 89  ? -2.125  -11.246 -26.867 1.00 63.11  ? 87  ASN B CA  1 
ATOM   1148 C C   . ASN B 2 89  ? -1.093  -10.412 -26.120 1.00 56.25  ? 87  ASN B C   1 
ATOM   1149 O O   . ASN B 2 89  ? -1.119  -9.192  -26.201 1.00 60.44  ? 87  ASN B O   1 
ATOM   1150 C CB  . ASN B 2 89  ? -3.125  -10.309 -27.558 1.00 57.41  ? 87  ASN B CB  1 
ATOM   1151 C CG  . ASN B 2 89  ? -2.574  -9.693  -28.829 1.00 67.44  ? 87  ASN B CG  1 
ATOM   1152 O OD1 . ASN B 2 89  ? -1.462  -10.003 -29.253 1.00 76.14  ? 87  ASN B OD1 1 
ATOM   1153 N ND2 . ASN B 2 89  ? -3.360  -8.825  -29.454 1.00 78.17  ? 87  ASN B ND2 1 
ATOM   1154 N N   . ASN B 2 90  ? -0.191  -11.069 -25.398 1.00 51.20  ? 88  ASN B N   1 
ATOM   1155 C CA  . ASN B 2 90  ? 0.828   -10.365 -24.620 1.00 63.56  ? 88  ASN B CA  1 
ATOM   1156 C C   . ASN B 2 90  ? 0.231   -9.196  -23.822 1.00 66.68  ? 88  ASN B C   1 
ATOM   1157 O O   . ASN B 2 90  ? -0.731  -9.393  -23.094 1.00 58.09  ? 88  ASN B O   1 
ATOM   1158 C CB  . ASN B 2 90  ? 1.966   -9.914  -25.529 1.00 74.45  ? 88  ASN B CB  1 
ATOM   1159 C CG  . ASN B 2 90  ? 2.525   -11.053 -26.370 1.00 78.08  ? 88  ASN B CG  1 
ATOM   1160 O OD1 . ASN B 2 90  ? 2.474   -12.217 -25.981 1.00 75.27  ? 88  ASN B OD1 1 
ATOM   1161 N ND2 . ASN B 2 90  ? 3.067   -10.715 -27.532 1.00 84.41  ? 88  ASN B ND2 1 
ATOM   1162 N N   . GLU B 2 91  ? 0.751   -7.980  -23.989 1.00 75.91  ? 89  GLU B N   1 
ATOM   1163 C CA  . GLU B 2 91  ? 0.248   -6.837  -23.209 1.00 85.33  ? 89  GLU B CA  1 
ATOM   1164 C C   . GLU B 2 91  ? -1.164  -6.353  -23.578 1.00 80.05  ? 89  GLU B C   1 
ATOM   1165 O O   . GLU B 2 91  ? -1.679  -5.419  -22.972 1.00 89.47  ? 89  GLU B O   1 
ATOM   1166 C CB  . GLU B 2 91  ? 1.216   -5.654  -23.262 1.00 98.05  ? 89  GLU B CB  1 
ATOM   1167 C CG  . GLU B 2 91  ? 1.300   -4.982  -24.617 1.00 110.53 ? 89  GLU B CG  1 
ATOM   1168 C CD  . GLU B 2 91  ? 2.284   -5.664  -25.534 1.00 123.23 ? 89  GLU B CD  1 
ATOM   1169 O OE1 . GLU B 2 91  ? 3.114   -6.449  -25.032 1.00 129.29 ? 89  GLU B OE1 1 
ATOM   1170 O OE2 . GLU B 2 91  ? 2.233   -5.414  -26.755 1.00 128.04 ? 89  GLU B OE2 1 
ATOM   1171 N N   . LEU B 2 92  ? -1.784  -6.978  -24.571 1.00 74.70  ? 90  LEU B N   1 
ATOM   1172 C CA  . LEU B 2 92  ? -3.170  -6.664  -24.920 1.00 78.02  ? 90  LEU B CA  1 
ATOM   1173 C C   . LEU B 2 92  ? -4.095  -7.764  -24.399 1.00 72.30  ? 90  LEU B C   1 
ATOM   1174 O O   . LEU B 2 92  ? -5.287  -7.775  -24.688 1.00 72.84  ? 90  LEU B O   1 
ATOM   1175 C CB  . LEU B 2 92  ? -3.336  -6.510  -26.439 1.00 59.72  ? 90  LEU B CB  1 
ATOM   1176 C CG  . LEU B 2 92  ? -2.501  -5.434  -27.126 1.00 71.91  ? 90  LEU B CG  1 
ATOM   1177 C CD1 . LEU B 2 92  ? -2.552  -5.579  -28.634 1.00 82.82  ? 90  LEU B CD1 1 
ATOM   1178 C CD2 . LEU B 2 92  ? -2.969  -4.060  -26.719 1.00 68.71  ? 90  LEU B CD2 1 
ATOM   1179 N N   . SER B 2 93  ? -3.534  -8.687  -23.627 1.00 65.24  ? 91  SER B N   1 
ATOM   1180 C CA  . SER B 2 93  ? -4.299  -9.799  -23.087 1.00 66.13  ? 91  SER B CA  1 
ATOM   1181 C C   . SER B 2 93  ? -5.239  -9.321  -21.979 1.00 64.79  ? 91  SER B C   1 
ATOM   1182 O O   . SER B 2 93  ? -4.928  -8.365  -21.289 1.00 68.46  ? 91  SER B O   1 
ATOM   1183 C CB  . SER B 2 93  ? -3.354  -10.876 -22.563 1.00 69.31  ? 91  SER B CB  1 
ATOM   1184 O OG  . SER B 2 93  ? -2.431  -11.274 -23.565 1.00 61.82  ? 91  SER B OG  1 
ATOM   1185 N N   . ILE B 2 94  ? -6.382  -9.991  -21.816 1.00 61.04  ? 92  ILE B N   1 
ATOM   1186 C CA  . ILE B 2 94  ? -7.413  -9.553  -20.869 1.00 72.80  ? 92  ILE B CA  1 
ATOM   1187 C C   . ILE B 2 94  ? -8.438  -10.665 -20.594 1.00 64.08  ? 92  ILE B C   1 
ATOM   1188 O O   . ILE B 2 94  ? -8.660  -11.528 -21.441 1.00 51.34  ? 92  ILE B O   1 
ATOM   1189 C CB  . ILE B 2 94  ? -8.136  -8.302  -21.416 1.00 81.57  ? 92  ILE B CB  1 
ATOM   1190 C CG1 . ILE B 2 94  ? -9.103  -7.720  -20.388 1.00 92.15  ? 92  ILE B CG1 1 
ATOM   1191 C CG2 . ILE B 2 94  ? -8.834  -8.624  -22.716 1.00 73.99  ? 92  ILE B CG2 1 
ATOM   1192 C CD1 . ILE B 2 94  ? -9.945  -6.585  -20.921 1.00 92.43  ? 92  ILE B CD1 1 
ATOM   1193 N N   . LEU B 2 95  ? -9.035  -10.665 -19.403 1.00 63.35  ? 93  LEU B N   1 
ATOM   1194 C CA  . LEU B 2 95  ? -10.133 -11.577 -19.112 1.00 57.91  ? 93  LEU B CA  1 
ATOM   1195 C C   . LEU B 2 95  ? -11.389 -10.964 -19.711 1.00 47.49  ? 93  LEU B C   1 
ATOM   1196 O O   . LEU B 2 95  ? -11.880 -9.965  -19.206 1.00 57.36  ? 93  LEU B O   1 
ATOM   1197 C CB  . LEU B 2 95  ? -10.306 -11.774 -17.600 1.00 63.52  ? 93  LEU B CB  1 
ATOM   1198 C CG  . LEU B 2 95  ? -11.082 -13.026 -17.161 1.00 75.01  ? 93  LEU B CG  1 
ATOM   1199 C CD1 . LEU B 2 95  ? -10.816 -13.377 -15.721 1.00 66.48  ? 93  LEU B CD1 1 
ATOM   1200 C CD2 . LEU B 2 95  ? -12.572 -12.883 -17.370 1.00 89.44  ? 93  LEU B CD2 1 
ATOM   1201 N N   . LEU B 2 96  ? -11.903 -11.552 -20.790 1.00 56.73  ? 94  LEU B N   1 
ATOM   1202 C CA  . LEU B 2 96  ? -13.086 -11.005 -21.460 1.00 51.15  ? 94  LEU B CA  1 
ATOM   1203 C C   . LEU B 2 96  ? -14.308 -11.127 -20.561 1.00 58.51  ? 94  LEU B C   1 
ATOM   1204 O O   . LEU B 2 96  ? -14.775 -12.228 -20.285 1.00 59.70  ? 94  LEU B O   1 
ATOM   1205 C CB  . LEU B 2 96  ? -13.326 -11.702 -22.793 1.00 44.82  ? 94  LEU B CB  1 
ATOM   1206 C CG  . LEU B 2 96  ? -12.092 -11.662 -23.686 1.00 50.83  ? 94  LEU B CG  1 
ATOM   1207 C CD1 . LEU B 2 96  ? -12.313 -12.433 -24.979 1.00 40.07  ? 94  LEU B CD1 1 
ATOM   1208 C CD2 . LEU B 2 96  ? -11.730 -10.240 -23.980 1.00 58.36  ? 94  LEU B CD2 1 
ATOM   1209 N N   . LYS B 2 97  ? -14.802 -9.985  -20.094 1.00 58.85  ? 95  LYS B N   1 
ATOM   1210 C CA  . LYS B 2 97  ? -15.884 -9.943  -19.126 1.00 68.64  ? 95  LYS B CA  1 
ATOM   1211 C C   . LYS B 2 97  ? -17.165 -9.326  -19.689 1.00 68.60  ? 95  LYS B C   1 
ATOM   1212 O O   . LYS B 2 97  ? -18.196 -9.343  -19.017 1.00 74.40  ? 95  LYS B O   1 
ATOM   1213 C CB  . LYS B 2 97  ? -15.444 -9.142  -17.909 1.00 52.19  ? 95  LYS B CB  1 
ATOM   1214 C CG  . LYS B 2 97  ? -14.614 -9.912  -16.907 1.00 99.04  ? 95  LYS B CG  1 
ATOM   1215 C CD  . LYS B 2 97  ? -13.963 -8.949  -15.916 1.00 94.44  ? 95  LYS B CD  1 
ATOM   1216 C CE  . LYS B 2 97  ? -13.062 -9.671  -14.913 1.00 86.75  ? 95  LYS B CE  1 
ATOM   1217 N NZ  . LYS B 2 97  ? -12.125 -8.734  -14.204 1.00 78.29  ? 95  LYS B NZ  1 
ATOM   1218 N N   . ASN B 2 98  ? -17.096 -8.788  -20.912 1.00 48.10  ? 96  ASN B N   1 
ATOM   1219 C CA  . ASN B 2 98  ? -18.200 -7.999  -21.478 1.00 47.78  ? 96  ASN B CA  1 
ATOM   1220 C C   . ASN B 2 98  ? -18.074 -7.706  -22.982 1.00 66.58  ? 96  ASN B C   1 
ATOM   1221 O O   . ASN B 2 98  ? -16.982 -7.766  -23.537 1.00 54.66  ? 96  ASN B O   1 
ATOM   1222 C CB  . ASN B 2 98  ? -18.353 -6.691  -20.709 1.00 55.20  ? 96  ASN B CB  1 
ATOM   1223 C CG  . ASN B 2 98  ? -17.126 -5.795  -20.811 1.00 68.13  ? 96  ASN B CG  1 
ATOM   1224 O OD1 . ASN B 2 98  ? -16.531 -5.659  -21.876 1.00 59.65  ? 96  ASN B OD1 1 
ATOM   1225 N ND2 . ASN B 2 98  ? -16.748 -5.177  -19.696 1.00 72.50  ? 96  ASN B ND2 1 
ATOM   1226 N N   . GLN B 2 99  ? -19.192 -7.367  -23.622 1.00 62.90  ? 97  GLN B N   1 
ATOM   1227 C CA  . GLN B 2 99  ? -19.214 -7.044  -25.048 1.00 52.38  ? 97  GLN B CA  1 
ATOM   1228 C C   . GLN B 2 99  ? -18.054 -6.131  -25.447 1.00 51.30  ? 97  GLN B C   1 
ATOM   1229 O O   . GLN B 2 99  ? -17.411 -6.352  -26.466 1.00 57.15  ? 97  GLN B O   1 
ATOM   1230 C CB  . GLN B 2 99  ? -20.541 -6.374  -25.424 1.00 60.04  ? 97  GLN B CB  1 
ATOM   1231 C CG  . GLN B 2 99  ? -20.801 -6.293  -26.920 1.00 45.95  ? 97  GLN B CG  1 
ATOM   1232 C CD  . GLN B 2 99  ? -20.800 -7.655  -27.574 1.00 58.62  ? 97  GLN B CD  1 
ATOM   1233 O OE1 . GLN B 2 99  ? -21.592 -8.529  -27.224 1.00 58.10  ? 97  GLN B OE1 1 
ATOM   1234 N NE2 . GLN B 2 99  ? -19.912 -7.843  -28.527 1.00 50.22  ? 97  GLN B NE2 1 
ATOM   1235 N N   . ASP B 2 100 ? -17.772 -5.136  -24.611 1.00 53.55  ? 98  ASP B N   1 
ATOM   1236 C CA  A ASP B 2 100 ? -16.710 -4.170  -24.878 0.55 58.37  ? 98  ASP B CA  1 
ATOM   1237 C CA  B ASP B 2 100 ? -16.714 -4.177  -24.897 0.45 58.80  ? 98  ASP B CA  1 
ATOM   1238 C C   . ASP B 2 100 ? -15.340 -4.834  -25.024 1.00 63.20  ? 98  ASP B C   1 
ATOM   1239 O O   . ASP B 2 100 ? -14.642 -4.623  -26.017 1.00 47.81  ? 98  ASP B O   1 
ATOM   1240 C CB  A ASP B 2 100 ? -16.651 -3.127  -23.766 0.55 66.69  ? 98  ASP B CB  1 
ATOM   1241 C CB  B ASP B 2 100 ? -16.697 -3.086  -23.832 0.45 68.55  ? 98  ASP B CB  1 
ATOM   1242 C CG  A ASP B 2 100 ? -16.187 -1.772  -24.264 0.55 83.76  ? 98  ASP B CG  1 
ATOM   1243 C CG  B ASP B 2 100 ? -17.706 -1.992  -24.111 0.45 81.12  ? 98  ASP B CG  1 
ATOM   1244 O OD1 A ASP B 2 100 ? -16.578 -1.394  -25.391 0.55 95.75  ? 98  ASP B OD1 1 
ATOM   1245 O OD1 B ASP B 2 100 ? -17.704 -1.451  -25.237 0.45 91.34  ? 98  ASP B OD1 1 
ATOM   1246 O OD2 A ASP B 2 100 ? -15.441 -1.081  -23.533 0.55 91.01  ? 98  ASP B OD2 1 
ATOM   1247 O OD2 B ASP B 2 100 ? -18.510 -1.678  -23.209 0.45 84.58  ? 98  ASP B OD2 1 
ATOM   1248 N N   . ASP B 2 101 ? -14.963 -5.640  -24.032 1.00 44.07  ? 99  ASP B N   1 
ATOM   1249 C CA  . ASP B 2 101 ? -13.690 -6.358  -24.082 1.00 52.44  ? 99  ASP B CA  1 
ATOM   1250 C C   . ASP B 2 101 ? -13.553 -7.125  -25.420 1.00 49.30  ? 99  ASP B C   1 
ATOM   1251 O O   . ASP B 2 101 ? -12.540 -7.024  -26.103 1.00 57.38  ? 99  ASP B O   1 
ATOM   1252 C CB  . ASP B 2 101 ? -13.577 -7.336  -22.903 1.00 51.54  ? 99  ASP B CB  1 
ATOM   1253 C CG  . ASP B 2 101 ? -13.419 -6.632  -21.560 1.00 65.71  ? 99  ASP B CG  1 
ATOM   1254 O OD1 . ASP B 2 101 ? -12.996 -5.467  -21.578 1.00 75.57  ? 99  ASP B OD1 1 
ATOM   1255 O OD2 . ASP B 2 101 ? -13.704 -7.248  -20.488 1.00 47.55  ? 99  ASP B OD2 1 
ATOM   1256 N N   . LEU B 2 102 ? -14.606 -7.852  -25.794 1.00 50.31  ? 100 LEU B N   1 
ATOM   1257 C CA  . LEU B 2 102 ? -14.612 -8.688  -26.991 1.00 54.61  ? 100 LEU B CA  1 
ATOM   1258 C C   . LEU B 2 102 ? -14.452 -7.848  -28.255 1.00 52.69  ? 100 LEU B C   1 
ATOM   1259 O O   . LEU B 2 102 ? -13.684 -8.195  -29.146 1.00 38.16  ? 100 LEU B O   1 
ATOM   1260 C CB  . LEU B 2 102 ? -15.921 -9.489  -27.061 1.00 55.26  ? 100 LEU B CB  1 
ATOM   1261 C CG  . LEU B 2 102 ? -16.210 -10.294 -28.324 1.00 45.10  ? 100 LEU B CG  1 
ATOM   1262 C CD1 . LEU B 2 102 ? -15.156 -11.352 -28.472 1.00 42.16  ? 100 LEU B CD1 1 
ATOM   1263 C CD2 . LEU B 2 102 ? -17.588 -10.945 -28.284 1.00 55.40  ? 100 LEU B CD2 1 
ATOM   1264 N N   . ASP B 2 103 ? -15.204 -6.753  -28.333 1.00 49.79  ? 101 ASP B N   1 
ATOM   1265 C CA  . ASP B 2 103 ? -15.150 -5.875  -29.489 1.00 63.39  ? 101 ASP B CA  1 
ATOM   1266 C C   . ASP B 2 103 ? -13.727 -5.334  -29.677 1.00 63.39  ? 101 ASP B C   1 
ATOM   1267 O O   . ASP B 2 103 ? -13.217 -5.269  -30.793 1.00 64.63  ? 101 ASP B O   1 
ATOM   1268 C CB  . ASP B 2 103 ? -16.179 -4.752  -29.343 1.00 73.99  ? 101 ASP B CB  1 
ATOM   1269 C CG  . ASP B 2 103 ? -17.610 -5.234  -29.603 1.00 105.91 ? 101 ASP B CG  1 
ATOM   1270 O OD1 . ASP B 2 103 ? -17.798 -6.112  -30.474 1.00 101.22 ? 101 ASP B OD1 1 
ATOM   1271 O OD2 . ASP B 2 103 ? -18.547 -4.736  -28.939 1.00 124.99 ? 101 ASP B OD2 1 
ATOM   1272 N N   . LYS B 2 104 ? -13.083 -4.990  -28.574 1.00 41.81  ? 102 LYS B N   1 
ATOM   1273 C CA  . LYS B 2 104 ? -11.686 -4.579  -28.605 1.00 53.50  ? 102 LYS B CA  1 
ATOM   1274 C C   . LYS B 2 104 ? -10.788 -5.689  -29.156 1.00 56.22  ? 102 LYS B C   1 
ATOM   1275 O O   . LYS B 2 104 ? -9.971  -5.439  -30.030 1.00 46.23  ? 102 LYS B O   1 
ATOM   1276 C CB  . LYS B 2 104 ? -11.221 -4.197  -27.212 1.00 44.25  ? 102 LYS B CB  1 
ATOM   1277 C CG  . LYS B 2 104 ? -9.833  -3.580  -27.176 1.00 78.85  ? 102 LYS B CG  1 
ATOM   1278 C CD  . LYS B 2 104 ? -9.300  -3.468  -25.750 1.00 82.18  ? 102 LYS B CD  1 
ATOM   1279 C CE  . LYS B 2 104 ? -8.260  -2.351  -25.616 1.00 86.35  ? 102 LYS B CE  1 
ATOM   1280 N NZ  . LYS B 2 104 ? -7.304  -2.316  -26.757 1.00 75.75  ? 102 LYS B NZ  1 
ATOM   1281 N N   . ALA B 2 105 ? -10.933 -6.911  -28.650 1.00 40.36  ? 103 ALA B N   1 
ATOM   1282 C CA  . ALA B 2 105 ? -10.148 -8.014  -29.201 1.00 54.01  ? 103 ALA B CA  1 
ATOM   1283 C C   . ALA B 2 105 ? -10.416 -8.161  -30.705 1.00 47.64  ? 103 ALA B C   1 
ATOM   1284 O O   . ALA B 2 105 ? -9.495  -8.279  -31.511 1.00 45.70  ? 103 ALA B O   1 
ATOM   1285 C CB  . ALA B 2 105 ? -10.453 -9.292  -28.474 1.00 55.97  ? 103 ALA B CB  1 
ATOM   1286 N N   . ILE B 2 106 ? -11.691 -8.127  -31.070 1.00 43.76  ? 104 ILE B N   1 
ATOM   1287 C CA  . ILE B 2 106 ? -12.086 -8.236  -32.464 1.00 47.28  ? 104 ILE B CA  1 
ATOM   1288 C C   . ILE B 2 106 ? -11.479 -7.112  -33.329 1.00 60.37  ? 104 ILE B C   1 
ATOM   1289 O O   . ILE B 2 106 ? -11.057 -7.331  -34.466 1.00 39.70  ? 104 ILE B O   1 
ATOM   1290 C CB  . ILE B 2 106 ? -13.600 -8.242  -32.580 1.00 38.77  ? 104 ILE B CB  1 
ATOM   1291 C CG1 . ILE B 2 106 ? -14.197 -9.524  -31.984 1.00 47.39  ? 104 ILE B CG1 1 
ATOM   1292 C CG2 . ILE B 2 106 ? -14.018 -8.140  -34.011 1.00 38.17  ? 104 ILE B CG2 1 
ATOM   1293 C CD1 . ILE B 2 106 ? -15.737 -9.609  -32.138 1.00 44.78  ? 104 ILE B CD1 1 
ATOM   1294 N N   . ASP B 2 107 ? -11.418 -5.909  -32.783 1.00 40.76  ? 105 ASP B N   1 
ATOM   1295 C CA  . ASP B 2 107 ? -10.824 -4.796  -33.495 1.00 55.25  ? 105 ASP B CA  1 
ATOM   1296 C C   . ASP B 2 107 ? -9.326  -5.009  -33.691 1.00 62.66  ? 105 ASP B C   1 
ATOM   1297 O O   . ASP B 2 107 ? -8.785  -4.734  -34.770 1.00 46.06  ? 105 ASP B O   1 
ATOM   1298 C CB  . ASP B 2 107 ? -11.049 -3.509  -32.715 1.00 51.89  ? 105 ASP B CB  1 
ATOM   1299 C CG  . ASP B 2 107 ? -10.492 -2.296  -33.428 1.00 69.74  ? 105 ASP B CG  1 
ATOM   1300 O OD1 . ASP B 2 107 ? -10.628 -2.218  -34.669 1.00 63.56  ? 105 ASP B OD1 1 
ATOM   1301 O OD2 . ASP B 2 107 ? -9.918  -1.425  -32.745 1.00 73.98  ? 105 ASP B OD2 1 
ATOM   1302 N N   . ILE B 2 108 ? -8.663  -5.479  -32.635 1.00 49.45  ? 106 ILE B N   1 
ATOM   1303 C CA  . ILE B 2 108 ? -7.230  -5.760  -32.681 1.00 55.78  ? 106 ILE B CA  1 
ATOM   1304 C C   . ILE B 2 108 ? -6.916  -6.735  -33.813 1.00 54.23  ? 106 ILE B C   1 
ATOM   1305 O O   . ILE B 2 108 ? -5.968  -6.532  -34.580 1.00 51.04  ? 106 ILE B O   1 
ATOM   1306 C CB  . ILE B 2 108 ? -6.735  -6.333  -31.345 1.00 56.85  ? 106 ILE B CB  1 
ATOM   1307 C CG1 . ILE B 2 108 ? -6.479  -5.203  -30.357 1.00 57.53  ? 106 ILE B CG1 1 
ATOM   1308 C CG2 . ILE B 2 108 ? -5.474  -7.150  -31.549 1.00 42.07  ? 106 ILE B CG2 1 
ATOM   1309 C CD1 . ILE B 2 108 ? -6.173  -5.654  -28.986 1.00 64.56  ? 106 ILE B CD1 1 
ATOM   1310 N N   . LEU B 2 109 ? -7.734  -7.776  -33.917 1.00 45.37  ? 107 LEU B N   1 
ATOM   1311 C CA  . LEU B 2 109 ? -7.571  -8.809  -34.943 1.00 47.62  ? 107 LEU B CA  1 
ATOM   1312 C C   . LEU B 2 109 ? -7.847  -8.269  -36.351 1.00 52.79  ? 107 LEU B C   1 
ATOM   1313 O O   . LEU B 2 109 ? -7.195  -8.662  -37.325 1.00 62.00  ? 107 LEU B O   1 
ATOM   1314 C CB  . LEU B 2 109 ? -8.502  -9.978  -34.628 1.00 48.23  ? 107 LEU B CB  1 
ATOM   1315 C CG  . LEU B 2 109 ? -8.801  -11.004 -35.714 1.00 70.25  ? 107 LEU B CG  1 
ATOM   1316 C CD1 . LEU B 2 109 ? -7.560  -11.833 -36.016 1.00 77.64  ? 107 LEU B CD1 1 
ATOM   1317 C CD2 . LEU B 2 109 ? -9.983  -11.892 -35.319 1.00 53.41  ? 107 LEU B CD2 1 
ATOM   1318 N N   . ASP B 2 110 ? -8.807  -7.353  -36.447 1.00 46.39  ? 108 ASP B N   1 
ATOM   1319 C CA  . ASP B 2 110 ? -9.143  -6.722  -37.720 1.00 64.44  ? 108 ASP B CA  1 
ATOM   1320 C C   . ASP B 2 110 ? -7.990  -5.908  -38.286 1.00 73.63  ? 108 ASP B C   1 
ATOM   1321 O O   . ASP B 2 110 ? -7.816  -5.836  -39.501 1.00 72.40  ? 108 ASP B O   1 
ATOM   1322 C CB  . ASP B 2 110 ? -10.372 -5.815  -37.575 1.00 64.98  ? 108 ASP B CB  1 
ATOM   1323 C CG  . ASP B 2 110 ? -11.676 -6.593  -37.604 1.00 84.33  ? 108 ASP B CG  1 
ATOM   1324 O OD1 . ASP B 2 110 ? -11.743 -7.617  -38.316 1.00 82.15  ? 108 ASP B OD1 1 
ATOM   1325 O OD2 . ASP B 2 110 ? -12.633 -6.180  -36.914 1.00 85.91  ? 108 ASP B OD2 1 
ATOM   1326 N N   . ARG B 2 111 ? -7.212  -5.289  -37.404 1.00 50.08  ? 109 ARG B N   1 
ATOM   1327 C CA  . ARG B 2 111 ? -6.171  -4.377  -37.837 1.00 53.47  ? 109 ARG B CA  1 
ATOM   1328 C C   . ARG B 2 111 ? -4.781  -5.009  -37.862 1.00 61.03  ? 109 ARG B C   1 
ATOM   1329 O O   . ARG B 2 111 ? -3.819  -4.379  -38.300 1.00 76.72  ? 109 ARG B O   1 
ATOM   1330 C CB  . ARG B 2 111 ? -6.204  -3.107  -36.998 1.00 75.92  ? 109 ARG B CB  1 
ATOM   1331 C CG  . ARG B 2 111 ? -7.534  -2.383  -37.091 1.00 76.99  ? 109 ARG B CG  1 
ATOM   1332 C CD  . ARG B 2 111 ? -7.417  -0.937  -36.668 1.00 87.04  ? 109 ARG B CD  1 
ATOM   1333 N NE  . ARG B 2 111 ? -7.394  -0.763  -35.222 1.00 56.07  ? 109 ARG B NE  1 
ATOM   1334 C CZ  . ARG B 2 111 ? -6.615  0.110   -34.594 1.00 95.53  ? 109 ARG B CZ  1 
ATOM   1335 N NH1 . ARG B 2 111 ? -5.777  0.868   -35.284 1.00 61.24  ? 109 ARG B NH1 1 
ATOM   1336 N NH2 . ARG B 2 111 ? -6.656  0.217   -33.273 1.00 99.15  ? 109 ARG B NH2 1 
ATOM   1337 N N   . SER B 2 112 ? -4.682  -6.257  -37.404 1.00 51.75  ? 110 SER B N   1 
ATOM   1338 C CA  . SER B 2 112 ? -3.425  -6.995  -37.486 1.00 62.87  ? 110 SER B CA  1 
ATOM   1339 C C   . SER B 2 112 ? -3.186  -7.557  -38.871 1.00 68.72  ? 110 SER B C   1 
ATOM   1340 O O   . SER B 2 112 ? -4.117  -7.991  -39.544 1.00 78.59  ? 110 SER B O   1 
ATOM   1341 C CB  . SER B 2 112 ? -3.394  -8.151  -36.504 1.00 66.30  ? 110 SER B CB  1 
ATOM   1342 O OG  . SER B 2 112 ? -2.206  -8.900  -36.691 1.00 77.95  ? 110 SER B OG  1 
ATOM   1343 N N   . SER B 2 113 ? -1.925  -7.565  -39.278 1.00 73.64  ? 111 SER B N   1 
ATOM   1344 C CA  . SER B 2 113 ? -1.540  -8.116  -40.569 1.00 89.70  ? 111 SER B CA  1 
ATOM   1345 C C   . SER B 2 113 ? -1.218  -9.608  -40.493 1.00 87.53  ? 111 SER B C   1 
ATOM   1346 O O   . SER B 2 113 ? -1.225  -10.299 -41.507 1.00 92.32  ? 111 SER B O   1 
ATOM   1347 C CB  . SER B 2 113 ? -0.334  -7.364  -41.121 1.00 93.37  ? 111 SER B CB  1 
ATOM   1348 O OG  . SER B 2 113 ? 0.072   -7.929  -42.349 1.00 111.85 ? 111 SER B OG  1 
ATOM   1349 N N   . SER B 2 114 ? -0.933  -10.100 -39.293 1.00 82.18  ? 112 SER B N   1 
ATOM   1350 C CA  . SER B 2 114 ? -0.527  -11.494 -39.126 1.00 84.61  ? 112 SER B CA  1 
ATOM   1351 C C   . SER B 2 114 ? -1.611  -12.416 -38.537 1.00 87.73  ? 112 SER B C   1 
ATOM   1352 O O   . SER B 2 114 ? -1.787  -13.539 -39.018 1.00 89.60  ? 112 SER B O   1 
ATOM   1353 C CB  . SER B 2 114 ? 0.745   -11.576 -38.285 1.00 88.17  ? 112 SER B CB  1 
ATOM   1354 O OG  . SER B 2 114 ? 0.521   -11.083 -36.978 1.00 93.13  ? 112 SER B OG  1 
ATOM   1355 N N   . MET B 2 115 ? -2.323  -11.949 -37.507 1.00 70.60  ? 113 MET B N   1 
ATOM   1356 C CA  . MET B 2 115 ? -3.347  -12.759 -36.829 1.00 70.29  ? 113 MET B CA  1 
ATOM   1357 C C   . MET B 2 115 ? -4.508  -13.134 -37.749 1.00 67.20  ? 113 MET B C   1 
ATOM   1358 O O   . MET B 2 115 ? -5.031  -12.282 -38.465 1.00 83.89  ? 113 MET B O   1 
ATOM   1359 C CB  . MET B 2 115 ? -3.917  -12.027 -35.607 1.00 70.90  ? 113 MET B CB  1 
ATOM   1360 C CG  . MET B 2 115 ? -2.913  -11.630 -34.526 1.00 63.81  ? 113 MET B CG  1 
ATOM   1361 S SD  . MET B 2 115 ? -3.716  -10.766 -33.144 1.00 110.09 ? 113 MET B SD  1 
ATOM   1362 C CE  . MET B 2 115 ? -4.971  -11.949 -32.631 1.00 81.34  ? 113 MET B CE  1 
ATOM   1363 N N   . LYS B 2 116 ? -4.918  -14.403 -37.705 1.00 52.50  ? 114 LYS B N   1 
ATOM   1364 C CA  . LYS B 2 116 ? -6.039  -14.893 -38.511 1.00 61.21  ? 114 LYS B CA  1 
ATOM   1365 C C   . LYS B 2 116 ? -7.179  -15.381 -37.620 1.00 48.63  ? 114 LYS B C   1 
ATOM   1366 O O   . LYS B 2 116 ? -8.255  -15.732 -38.099 1.00 58.25  ? 114 LYS B O   1 
ATOM   1367 C CB  . LYS B 2 116 ? -5.597  -16.042 -39.425 1.00 69.01  ? 114 LYS B CB  1 
ATOM   1368 C CG  . LYS B 2 116 ? -4.396  -15.754 -40.303 1.00 72.99  ? 114 LYS B CG  1 
ATOM   1369 C CD  . LYS B 2 116 ? -4.666  -14.644 -41.284 1.00 80.24  ? 114 LYS B CD  1 
ATOM   1370 C CE  . LYS B 2 116 ? -5.249  -15.174 -42.585 1.00 100.84 ? 114 LYS B CE  1 
ATOM   1371 N NZ  . LYS B 2 116 ? -5.223  -14.115 -43.645 1.00 107.04 ? 114 LYS B NZ  1 
ATOM   1372 N N   . SER B 2 117 ? -6.934  -15.425 -36.319 1.00 58.51  ? 115 SER B N   1 
ATOM   1373 C CA  . SER B 2 117 ? -7.949  -15.865 -35.377 1.00 56.95  ? 115 SER B CA  1 
ATOM   1374 C C   . SER B 2 117 ? -7.734  -15.225 -34.030 1.00 46.95  ? 115 SER B C   1 
ATOM   1375 O O   . SER B 2 117 ? -6.618  -14.873 -33.677 1.00 52.59  ? 115 SER B O   1 
ATOM   1376 C CB  . SER B 2 117 ? -7.907  -17.383 -35.203 1.00 43.81  ? 115 SER B CB  1 
ATOM   1377 O OG  . SER B 2 117 ? -6.624  -17.785 -34.749 1.00 73.47  ? 115 SER B OG  1 
ATOM   1378 N N   . LEU B 2 118 ? -8.819  -15.104 -33.278 1.00 52.28  ? 116 LEU B N   1 
ATOM   1379 C CA  . LEU B 2 118 ? -8.773  -14.643 -31.904 1.00 49.52  ? 116 LEU B CA  1 
ATOM   1380 C C   . LEU B 2 118 ? -8.381  -15.825 -31.036 1.00 65.36  ? 116 LEU B C   1 
ATOM   1381 O O   . LEU B 2 118 ? -9.057  -16.851 -31.063 1.00 57.75  ? 116 LEU B O   1 
ATOM   1382 C CB  . LEU B 2 118 ? -10.159 -14.173 -31.485 1.00 44.88  ? 116 LEU B CB  1 
ATOM   1383 C CG  . LEU B 2 118 ? -10.256 -12.934 -30.606 1.00 60.55  ? 116 LEU B CG  1 
ATOM   1384 C CD1 . LEU B 2 118 ? -9.620  -11.777 -31.319 1.00 70.35  ? 116 LEU B CD1 1 
ATOM   1385 C CD2 . LEU B 2 118 ? -11.703 -12.627 -30.310 1.00 62.97  ? 116 LEU B CD2 1 
ATOM   1386 N N   . ARG B 2 119 ? -7.293  -15.703 -30.279 1.00 56.97  ? 117 ARG B N   1 
ATOM   1387 C CA  . ARG B 2 119 ? -6.864  -16.811 -29.434 1.00 56.28  ? 117 ARG B CA  1 
ATOM   1388 C C   . ARG B 2 119 ? -7.419  -16.626 -28.051 1.00 42.28  ? 117 ARG B C   1 
ATOM   1389 O O   . ARG B 2 119 ? -7.288  -15.561 -27.478 1.00 53.11  ? 117 ARG B O   1 
ATOM   1390 C CB  . ARG B 2 119 ? -5.347  -16.918 -29.372 1.00 59.09  ? 117 ARG B CB  1 
ATOM   1391 C CG  . ARG B 2 119 ? -4.696  -17.177 -30.709 1.00 69.07  ? 117 ARG B CG  1 
ATOM   1392 C CD  . ARG B 2 119 ? -3.223  -17.422 -30.537 1.00 84.31  ? 117 ARG B CD  1 
ATOM   1393 N NE  . ARG B 2 119 ? -2.733  -18.443 -31.461 1.00 105.79 ? 117 ARG B NE  1 
ATOM   1394 C CZ  . ARG B 2 119 ? -2.548  -19.728 -31.146 1.00 102.45 ? 117 ARG B CZ  1 
ATOM   1395 N NH1 . ARG B 2 119 ? -2.806  -20.175 -29.918 1.00 87.41  ? 117 ARG B NH1 1 
ATOM   1396 N NH2 . ARG B 2 119 ? -2.094  -20.574 -32.065 1.00 103.11 ? 117 ARG B NH2 1 
ATOM   1397 N N   . ILE B 2 120 ? -8.030  -17.683 -27.521 1.00 44.62  ? 118 ILE B N   1 
ATOM   1398 C CA  . ILE B 2 120 ? -8.700  -17.621 -26.229 1.00 41.97  ? 118 ILE B CA  1 
ATOM   1399 C C   . ILE B 2 120 ? -8.375  -18.862 -25.397 1.00 42.72  ? 118 ILE B C   1 
ATOM   1400 O O   . ILE B 2 120 ? -8.750  -19.967 -25.748 1.00 57.28  ? 118 ILE B O   1 
ATOM   1401 C CB  . ILE B 2 120 ? -10.234 -17.436 -26.399 1.00 48.48  ? 118 ILE B CB  1 
ATOM   1402 C CG1 . ILE B 2 120 ? -10.540 -16.074 -27.028 1.00 53.97  ? 118 ILE B CG1 1 
ATOM   1403 C CG2 . ILE B 2 120 ? -10.962 -17.541 -25.077 1.00 35.78  ? 118 ILE B CG2 1 
ATOM   1404 C CD1 . ILE B 2 120 ? -11.980 -15.642 -26.852 1.00 56.49  ? 118 ILE B CD1 1 
ATOM   1405 N N   . LEU B 2 121 ? -7.649  -18.659 -24.303 1.00 58.32  ? 119 LEU B N   1 
ATOM   1406 C CA  . LEU B 2 121 ? -7.304  -19.733 -23.380 1.00 58.31  ? 119 LEU B CA  1 
ATOM   1407 C C   . LEU B 2 121 ? -8.457  -19.973 -22.414 1.00 61.02  ? 119 LEU B C   1 
ATOM   1408 O O   . LEU B 2 121 ? -8.908  -19.051 -21.748 1.00 49.94  ? 119 LEU B O   1 
ATOM   1409 C CB  . LEU B 2 121 ? -6.054  -19.350 -22.582 1.00 47.69  ? 119 LEU B CB  1 
ATOM   1410 C CG  . LEU B 2 121 ? -5.607  -20.276 -21.454 1.00 60.11  ? 119 LEU B CG  1 
ATOM   1411 C CD1 . LEU B 2 121 ? -5.224  -21.639 -21.999 1.00 47.47  ? 119 LEU B CD1 1 
ATOM   1412 C CD2 . LEU B 2 121 ? -4.440  -19.662 -20.683 1.00 61.84  ? 119 LEU B CD2 1 
ATOM   1413 N N   . LEU B 2 122 ? -8.931  -21.208 -22.320 1.00 56.37  ? 120 LEU B N   1 
ATOM   1414 C CA  . LEU B 2 122 ? -10.043 -21.478 -21.418 1.00 54.47  ? 120 LEU B CA  1 
ATOM   1415 C C   . LEU B 2 122 ? -9.561  -22.028 -20.083 1.00 48.66  ? 120 LEU B C   1 
ATOM   1416 O O   . LEU B 2 122 ? -8.888  -23.035 -20.045 1.00 48.40  ? 120 LEU B O   1 
ATOM   1417 C CB  . LEU B 2 122 ? -11.055 -22.424 -22.076 1.00 58.00  ? 120 LEU B CB  1 
ATOM   1418 C CG  . LEU B 2 122 ? -11.632 -21.894 -23.392 1.00 53.68  ? 120 LEU B CG  1 
ATOM   1419 C CD1 . LEU B 2 122 ? -12.577 -22.880 -24.033 1.00 41.81  ? 120 LEU B CD1 1 
ATOM   1420 C CD2 . LEU B 2 122 ? -12.326 -20.564 -23.179 1.00 48.76  ? 120 LEU B CD2 1 
ATOM   1421 N N   . LEU B 2 123 ? -9.899  -21.348 -18.990 1.00 51.51  ? 121 LEU B N   1 
ATOM   1422 C CA  . LEU B 2 123 ? -9.566  -21.840 -17.657 1.00 64.14  ? 121 LEU B CA  1 
ATOM   1423 C C   . LEU B 2 123 ? -10.823 -21.876 -16.786 1.00 66.90  ? 121 LEU B C   1 
ATOM   1424 O O   . LEU B 2 123 ? -11.779 -21.155 -17.044 1.00 61.58  ? 121 LEU B O   1 
ATOM   1425 C CB  . LEU B 2 123 ? -8.476  -20.979 -17.010 1.00 63.71  ? 121 LEU B CB  1 
ATOM   1426 C CG  . LEU B 2 123 ? -7.144  -20.896 -17.762 1.00 78.61  ? 121 LEU B CG  1 
ATOM   1427 C CD1 . LEU B 2 123 ? -6.200  -19.902 -17.107 1.00 86.36  ? 121 LEU B CD1 1 
ATOM   1428 C CD2 . LEU B 2 123 ? -6.482  -22.260 -17.859 1.00 68.50  ? 121 LEU B CD2 1 
ATOM   1429 N N   . SER B 2 124 ? -10.829 -22.730 -15.768 1.00 53.30  ? 122 SER B N   1 
ATOM   1430 C CA  . SER B 2 124 ? -11.961 -22.794 -14.857 1.00 60.30  ? 122 SER B CA  1 
ATOM   1431 C C   . SER B 2 124 ? -11.778 -21.764 -13.753 1.00 78.32  ? 122 SER B C   1 
ATOM   1432 O O   . SER B 2 124 ? -10.658 -21.545 -13.287 1.00 86.42  ? 122 SER B O   1 
ATOM   1433 C CB  . SER B 2 124 ? -12.080 -24.189 -14.249 1.00 56.90  ? 122 SER B CB  1 
ATOM   1434 O OG  . SER B 2 124 ? -11.213 -24.322 -13.135 1.00 106.71 ? 122 SER B OG  1 
ATOM   1435 N N   . GLN B 2 125 ? -12.870 -21.132 -13.335 1.00 76.93  ? 123 GLN B N   1 
ATOM   1436 C CA  . GLN B 2 125 ? -12.796 -20.126 -12.278 1.00 81.07  ? 123 GLN B CA  1 
ATOM   1437 C C   . GLN B 2 125 ? -12.434 -20.757 -10.935 1.00 97.53  ? 123 GLN B C   1 
ATOM   1438 O O   . GLN B 2 125 ? -11.825 -20.109 -10.085 1.00 102.53 ? 123 GLN B O   1 
ATOM   1439 C CB  . GLN B 2 125 ? -14.099 -19.331 -12.190 1.00 86.57  ? 123 GLN B CB  1 
ATOM   1440 C CG  . GLN B 2 125 ? -13.939 -17.937 -11.579 1.00 98.77  ? 123 GLN B CG  1 
ATOM   1441 C CD  . GLN B 2 125 ? -14.931 -16.922 -12.143 1.00 110.70 ? 123 GLN B CD  1 
ATOM   1442 O OE1 . GLN B 2 125 ? -15.110 -16.819 -13.357 1.00 98.94  ? 123 GLN B OE1 1 
ATOM   1443 N NE2 . GLN B 2 125 ? -15.578 -16.168 -11.258 1.00 122.21 ? 123 GLN B NE2 1 
ATOM   1444 N N   . ASP B 2 126 ? -12.796 -22.025 -10.755 1.00 108.58 ? 124 ASP B N   1 
ATOM   1445 C CA  . ASP B 2 126 ? -12.428 -22.767 -9.551  1.00 122.22 ? 124 ASP B CA  1 
ATOM   1446 C C   . ASP B 2 126 ? -11.876 -24.141 -9.901  1.00 125.25 ? 124 ASP B C   1 
ATOM   1447 O O   . ASP B 2 126 ? -12.276 -24.744 -10.896 1.00 126.94 ? 124 ASP B O   1 
ATOM   1448 C CB  . ASP B 2 126 ? -13.626 -22.917 -8.612  1.00 134.99 ? 124 ASP B CB  1 
ATOM   1449 C CG  . ASP B 2 126 ? -13.717 -21.796 -7.597  1.00 148.53 ? 124 ASP B CG  1 
ATOM   1450 O OD1 . ASP B 2 126 ? -12.670 -21.197 -7.272  1.00 153.37 ? 124 ASP B OD1 1 
ATOM   1451 O OD2 . ASP B 2 126 ? -14.838 -21.518 -7.121  1.00 152.87 ? 124 ASP B OD2 1 
HETATM 1452 O O   . HOH C 3 .   ? 17.865  -12.551 -19.564 1.00 60.97  ? 401 HOH A O   1 
HETATM 1453 O O   . HOH C 3 .   ? 21.601  -4.359  -10.193 1.00 76.38  ? 402 HOH A O   1 
HETATM 1454 O O   . HOH D 3 .   ? -15.071 -7.681  -43.526 1.00 68.10  ? 201 HOH B O   1 
HETATM 1455 O O   . HOH D 3 .   ? -18.559 -2.565  -28.216 1.00 62.46  ? 202 HOH B O   1 
HETATM 1456 O O   . HOH D 3 .   ? -4.342  -4.681  -35.244 1.00 54.97  ? 203 HOH B O   1 
HETATM 1457 O O   . HOH D 3 .   ? -7.716  -1.909  -31.276 1.00 73.67  ? 204 HOH B O   1 
HETATM 1458 O O   . HOH D 3 .   ? -20.686 -0.278  -24.043 1.00 68.55  ? 205 HOH B O   1 
HETATM 1459 O O   . HOH D 3 .   ? -18.863 -8.262  -33.423 1.00 46.35  ? 206 HOH B O   1 
HETATM 1460 O O   . HOH D 3 .   ? -19.803 -7.309  -31.891 1.00 62.99  ? 207 HOH B O   1 
HETATM 1461 O O   . HOH D 3 .   ? -15.512 -26.192 -34.042 1.00 61.18  ? 208 HOH B O   1 
HETATM 1462 O O   . HOH D 3 .   ? -11.388 -27.142 -34.321 1.00 56.65  ? 209 HOH B O   1 
HETATM 1463 O O   . HOH D 3 .   ? -21.646 -6.863  -22.137 1.00 49.87  ? 210 HOH B O   1 
HETATM 1464 O O   . HOH D 3 .   ? -22.699 -12.420 -19.130 1.00 63.92  ? 211 HOH B O   1 
HETATM 1465 O O   . HOH D 3 .   ? -6.569  -10.513 -39.738 1.00 49.71  ? 212 HOH B O   1 
HETATM 1466 O O   . HOH D 3 .   ? -19.800 -3.824  -22.789 1.00 59.83  ? 213 HOH B O   1 
HETATM 1467 O O   . HOH D 3 .   ? -17.272 -18.351 -17.425 1.00 62.96  ? 214 HOH B O   1 
HETATM 1468 O O   . HOH D 3 .   ? -23.030 -19.111 -32.220 1.00 43.75  ? 215 HOH B O   1 
HETATM 1469 O O   . HOH D 3 .   ? -11.700 -14.216 -37.958 1.00 60.36  ? 216 HOH B O   1 
HETATM 1470 O O   . HOH D 3 .   ? 6.734   -1.622  -17.295 1.00 59.73  ? 217 HOH B O   1 
HETATM 1471 O O   . HOH D 3 .   ? -5.276  -19.897 -37.179 1.00 71.31  ? 218 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ALA A 12  ? 1.3313 1.4974 1.6483 -0.5544 0.4466  -0.6330 293 ALA A N   
2    C CA  . ALA A 12  ? 1.2225 1.4511 1.5278 -0.4815 0.3510  -0.5787 293 ALA A CA  
3    C C   . ALA A 12  ? 1.3777 1.7568 1.7314 -0.4604 0.2777  -0.6019 293 ALA A C   
4    O O   . ALA A 12  ? 1.3316 1.7207 1.7142 -0.4675 0.2865  -0.6001 293 ALA A O   
5    C CB  . ALA A 12  ? 1.0822 1.1916 1.3399 -0.4228 0.3502  -0.4731 293 ALA A CB  
6    N N   . SER A 13  ? 1.5016 1.9937 1.8572 -0.4280 0.2083  -0.6206 294 SER A N   
7    C CA  . SER A 13  ? 1.4625 2.1042 1.8527 -0.3974 0.1398  -0.6446 294 SER A CA  
8    C C   . SER A 13  ? 1.2833 1.8972 1.6532 -0.3245 0.0863  -0.5570 294 SER A C   
9    O O   . SER A 13  ? 1.1402 1.8472 1.5339 -0.2961 0.0407  -0.5629 294 SER A O   
10   C CB  . SER A 13  ? 1.5183 2.3007 1.9103 -0.3858 0.0956  -0.7066 294 SER A CB  
11   O OG  . SER A 13  ? 1.5107 2.2334 1.8496 -0.3488 0.0805  -0.6626 294 SER A OG  
12   N N   . ALA A 14  ? 1.2343 1.7227 1.5610 -0.2962 0.0965  -0.4802 295 ALA A N   
13   C CA  . ALA A 14  ? 1.0243 1.4827 1.3314 -0.2338 0.0528  -0.4035 295 ALA A CA  
14   C C   . ALA A 14  ? 0.8971 1.2883 1.2155 -0.2332 0.0760  -0.3591 295 ALA A C   
15   O O   . ALA A 14  ? 0.7636 1.1141 1.0655 -0.1906 0.0536  -0.2970 295 ALA A O   
16   C CB  . ALA A 14  ? 0.7764 1.1608 1.0339 -0.2003 0.0453  -0.3520 295 ALA A CB  
17   N N   . THR A 15  ? 1.0540 1.4359 1.3995 -0.2808 0.1248  -0.3942 296 THR A N   
18   C CA  . THR A 15  ? 1.0298 1.3627 1.3849 -0.2751 0.1465  -0.3568 296 THR A CA  
19   C C   . THR A 15  ? 0.9742 1.3909 1.3563 -0.2395 0.0858  -0.3467 296 THR A C   
20   O O   . THR A 15  ? 0.8960 1.2775 1.2724 -0.2062 0.0740  -0.2929 296 THR A O   
21   C CB  . THR A 15  ? 1.1331 1.4373 1.5086 -0.3332 0.2181  -0.4011 296 THR A CB  
22   O OG1 . THR A 15  ? 1.2426 1.4225 1.5761 -0.3500 0.2883  -0.3815 296 THR A OG1 
23   C CG2 . THR A 15  ? 0.7958 1.0950 1.1916 -0.3226 0.2248  -0.3771 296 THR A CG2 
24   N N   . GLU A 16  ? 1.0588 1.5921 1.4674 -0.2431 0.0485  -0.4007 297 GLU A N   
25   C CA  . GLU A 16  ? 1.1137 1.7269 1.5395 -0.2027 -0.0072 -0.3924 297 GLU A CA  
26   C C   . GLU A 16  ? 0.9454 1.5205 1.3337 -0.1431 -0.0471 -0.3288 297 GLU A C   
27   O O   . GLU A 16  ? 0.7243 1.2964 1.1164 -0.1113 -0.0703 -0.2936 297 GLU A O   
28   C CB  . GLU A 16  ? 1.1853 1.9424 1.6374 -0.2082 -0.0377 -0.4646 297 GLU A CB  
29   C CG  . GLU A 16  ? 1.2669 2.1129 1.7420 -0.1740 -0.0810 -0.4674 297 GLU A CG  
30   C CD  . GLU A 16  ? 1.4493 2.4410 1.9429 -0.1736 -0.1025 -0.5384 297 GLU A CD  
31   O OE1 . GLU A 16  ? 1.5497 2.5819 2.0348 -0.1915 -0.0915 -0.5835 297 GLU A OE1 
32   O OE2 . GLU A 16  ? 1.5190 2.5533 2.0134 -0.1443 -0.1195 -0.5341 297 GLU A OE2 
33   N N   . LEU A 17  ? 0.8763 1.4180 1.2287 -0.1316 -0.0492 -0.3171 298 LEU A N   
34   C CA  . LEU A 17  ? 0.9249 1.4306 1.2406 -0.0795 -0.0798 -0.2647 298 LEU A CA  
35   C C   . LEU A 17  ? 0.8124 1.2245 1.1202 -0.0721 -0.0618 -0.2056 298 LEU A C   
36   O O   . LEU A 17  ? 0.6892 1.0799 0.9826 -0.0362 -0.0830 -0.1672 298 LEU A O   
37   C CB  . LEU A 17  ? 1.0579 1.5595 1.3366 -0.0686 -0.0851 -0.2717 298 LEU A CB  
38   C CG  . LEU A 17  ? 1.1449 1.7527 1.4125 -0.0343 -0.1251 -0.3078 298 LEU A CG  
39   C CD1 . LEU A 17  ? 1.2226 1.8182 1.4605 0.0291  -0.1569 -0.2613 298 LEU A CD1 
40   C CD2 . LEU A 17  ? 0.9838 1.7127 1.2951 -0.0590 -0.1322 -0.3766 298 LEU A CD2 
41   N N   . LEU A 18  ? 0.8209 1.1819 1.1368 -0.1048 -0.0177 -0.2023 299 LEU A N   
42   C CA  . LEU A 18  ? 0.7083 1.0085 1.0207 -0.0931 0.0005  -0.1541 299 LEU A CA  
43   C C   . LEU A 18  ? 0.7693 1.1085 1.1138 -0.0838 -0.0150 -0.1506 299 LEU A C   
44   O O   . LEU A 18  ? 0.7425 1.0708 1.0869 -0.0573 -0.0294 -0.1159 299 LEU A O   
45   C CB  . LEU A 18  ? 0.7536 0.9857 1.0525 -0.1188 0.0590  -0.1490 299 LEU A CB  
46   C CG  . LEU A 18  ? 0.8561 1.0444 1.1486 -0.0990 0.0829  -0.1042 299 LEU A CG  
47   C CD1 . LEU A 18  ? 0.5998 0.7681 0.8712 -0.0648 0.0646  -0.0618 299 LEU A CD1 
48   C CD2 . LEU A 18  ? 0.9483 1.0666 1.2186 -0.1163 0.1505  -0.1001 299 LEU A CD2 
49   N N   . GLN A 19  ? 0.7634 1.1528 1.1377 -0.1085 -0.0098 -0.1913 300 GLN A N   
50   C CA  . GLN A 19  ? 0.7099 1.1365 1.1148 -0.1014 -0.0216 -0.1901 300 GLN A CA  
51   C C   . GLN A 19  ? 0.6641 1.1358 1.0713 -0.0641 -0.0725 -0.1802 300 GLN A C   
52   O O   . GLN A 19  ? 0.6418 1.1118 1.0597 -0.0456 -0.0829 -0.1562 300 GLN A O   
53   C CB  . GLN A 19  ? 0.5937 1.0680 1.0312 -0.1395 -0.0013 -0.2413 300 GLN A CB  
54   C CG  . GLN A 19  ? 0.7272 1.1358 1.1573 -0.1791 0.0658  -0.2516 300 GLN A CG  
55   C CD  . GLN A 19  ? 1.0134 1.4689 1.4780 -0.2287 0.0952  -0.3157 300 GLN A CD  
56   O OE1 . GLN A 19  ? 0.9312 1.4865 1.4244 -0.2372 0.0610  -0.3640 300 GLN A OE1 
57   N NE2 . GLN A 19  ? 1.1497 1.5347 1.6088 -0.2592 0.1639  -0.3181 300 GLN A NE2 
58   N N   . ASP A 20  ? 0.5062 1.0142 0.8978 -0.0495 -0.0992 -0.1983 301 ASP A N   
59   C CA  . ASP A 20  ? 0.6196 1.1529 0.9982 -0.0059 -0.1368 -0.1848 301 ASP A CA  
60   C C   . ASP A 20  ? 0.5925 1.0529 0.9480 0.0157  -0.1343 -0.1369 301 ASP A C   
61   O O   . ASP A 20  ? 0.6498 1.1063 1.0056 0.0397  -0.1475 -0.1198 301 ASP A O   
62   C CB  . ASP A 20  ? 0.9007 1.4882 1.2555 0.0157  -0.1599 -0.2117 301 ASP A CB  
63   C CG  . ASP A 20  ? 1.1477 1.8380 1.5332 -0.0053 -0.1660 -0.2714 301 ASP A CG  
64   O OD1 . ASP A 20  ? 1.1099 1.8392 1.5308 -0.0167 -0.1669 -0.2856 301 ASP A OD1 
65   O OD2 . ASP A 20  ? 1.2468 1.9859 1.6233 -0.0121 -0.1687 -0.3085 301 ASP A OD2 
66   N N   . TYR A 21  ? 0.6709 1.0754 1.0074 0.0048  -0.1134 -0.1194 302 TYR A N   
67   C CA  . TYR A 21  ? 0.6856 1.0335 1.0069 0.0189  -0.1066 -0.0814 302 TYR A CA  
68   C C   . TYR A 21  ? 0.4580 0.8034 0.8069 0.0118  -0.0943 -0.0665 302 TYR A C   
69   O O   . TYR A 21  ? 0.6730 1.0113 1.0265 0.0256  -0.1000 -0.0514 302 TYR A O   
70   C CB  . TYR A 21  ? 0.6876 0.9864 0.9813 0.0116  -0.0877 -0.0683 302 TYR A CB  
71   C CG  . TYR A 21  ? 0.6601 0.9131 0.9397 0.0251  -0.0808 -0.0360 302 TYR A CG  
72   C CD1 . TYR A 21  ? 0.7015 0.9287 0.9822 0.0160  -0.0569 -0.0173 302 TYR A CD1 
73   C CD2 . TYR A 21  ? 0.7585 0.9958 1.0213 0.0488  -0.0926 -0.0267 302 TYR A CD2 
74   C CE1 . TYR A 21  ? 0.7303 0.9346 1.0046 0.0250  -0.0500 0.0033  302 TYR A CE1 
75   C CE2 . TYR A 21  ? 0.7603 0.9572 1.0153 0.0525  -0.0785 -0.0059 302 TYR A CE2 
76   C CZ  . TYR A 21  ? 0.7606 0.9501 1.0261 0.0379  -0.0598 0.0057  302 TYR A CZ  
77   O OH  . TYR A 21  ? 0.6267 0.7949 0.8911 0.0383  -0.0455 0.0179  302 TYR A OH  
78   N N   . MET A 22  ? 0.4540 0.8058 0.8187 -0.0085 -0.0728 -0.0736 303 MET A N   
79   C CA  . MET A 22  ? 0.4948 0.8552 0.8803 -0.0063 -0.0604 -0.0604 303 MET A CA  
80   C C   . MET A 22  ? 0.4561 0.8609 0.8680 0.0034  -0.0858 -0.0702 303 MET A C   
81   O O   . MET A 22  ? 0.5398 0.9555 0.9654 0.0143  -0.0883 -0.0581 303 MET A O   
82   C CB  . MET A 22  ? 0.5751 0.9259 0.9640 -0.0247 -0.0256 -0.0672 303 MET A CB  
83   C CG  . MET A 22  ? 0.8052 1.0991 1.1621 -0.0290 0.0125  -0.0508 303 MET A CG  
84   S SD  . MET A 22  ? 0.8057 1.0847 1.1449 0.0029  0.0211  -0.0096 303 MET A SD  
85   C CE  . MET A 22  ? 0.8267 1.0839 1.1471 0.0028  0.0001  -0.0069 303 MET A CE  
86   N N   . LEU A 23  ? 0.4076 0.8459 0.8259 0.0007  -0.1040 -0.0960 304 LEU A N   
87   C CA  . LEU A 23  ? 0.5903 1.0708 1.0278 0.0143  -0.1274 -0.1059 304 LEU A CA  
88   C C   . LEU A 23  ? 0.5699 1.0279 0.9921 0.0395  -0.1411 -0.0890 304 LEU A C   
89   O O   . LEU A 23  ? 0.6335 1.1012 1.0722 0.0469  -0.1452 -0.0852 304 LEU A O   
90   C CB  . LEU A 23  ? 0.4651 0.9991 0.9074 0.0129  -0.1442 -0.1397 304 LEU A CB  
91   C CG  . LEU A 23  ? 0.4573 1.0419 0.9246 0.0240  -0.1618 -0.1514 304 LEU A CG  
92   C CD1 . LEU A 23  ? 0.3777 0.9601 0.8740 0.0059  -0.1418 -0.1451 304 LEU A CD1 
93   C CD2 . LEU A 23  ? 0.3912 1.0525 0.8684 0.0241  -0.1785 -0.1915 304 LEU A CD2 
94   N N   . THR A 24  ? 0.5911 1.0144 0.9797 0.0513  -0.1424 -0.0811 305 THR A N   
95   C CA  . THR A 24  ? 0.6542 1.0358 1.0202 0.0725  -0.1415 -0.0650 305 THR A CA  
96   C C   . THR A 24  ? 0.6898 1.0515 1.0745 0.0591  -0.1240 -0.0529 305 THR A C   
97   O O   . THR A 24  ? 0.6905 1.0432 1.0817 0.0649  -0.1203 -0.0536 305 THR A O   
98   C CB  . THR A 24  ? 0.6859 1.0279 1.0086 0.0868  -0.1385 -0.0563 305 THR A CB  
99   O OG1 . THR A 24  ? 0.6565 1.0400 0.9626 0.1047  -0.1575 -0.0745 305 THR A OG1 
100  C CG2 . THR A 24  ? 0.7736 1.0568 1.0672 0.1078  -0.1258 -0.0392 305 THR A CG2 
101  N N   . LEU A 25  ? 0.5449 0.9055 0.9367 0.0428  -0.1101 -0.0454 306 LEU A N   
102  C CA  . LEU A 25  ? 0.6436 1.0136 1.0546 0.0358  -0.0955 -0.0393 306 LEU A CA  
103  C C   . LEU A 25  ? 0.5844 1.0048 1.0302 0.0356  -0.1007 -0.0494 306 LEU A C   
104  O O   . LEU A 25  ? 0.5217 0.9568 0.9849 0.0340  -0.0971 -0.0573 306 LEU A O   
105  C CB  . LEU A 25  ? 0.4262 0.7937 0.8299 0.0304  -0.0788 -0.0266 306 LEU A CB  
106  C CG  . LEU A 25  ? 0.5307 0.8514 0.9018 0.0292  -0.0702 -0.0157 306 LEU A CG  
107  C CD1 . LEU A 25  ? 0.4619 0.7821 0.8250 0.0288  -0.0491 -0.0016 306 LEU A CD1 
108  C CD2 . LEU A 25  ? 0.7281 1.0212 1.0907 0.0311  -0.0657 -0.0137 306 LEU A CD2 
109  N N   . ARG A 26  ? 0.5868 1.0335 1.0429 0.0346  -0.1050 -0.0528 307 ARG A N   
110  C CA  . ARG A 26  ? 0.5686 1.0623 1.0542 0.0374  -0.1090 -0.0604 307 ARG A CA  
111  C C   . ARG A 26  ? 0.4637 0.9664 0.9610 0.0428  -0.1253 -0.0737 307 ARG A C   
112  O O   . ARG A 26  ? 0.4166 0.9542 0.9385 0.0445  -0.1264 -0.0815 307 ARG A O   
113  C CB  . ARG A 26  ? 0.5632 1.0693 1.0528 0.0320  -0.1036 -0.0638 307 ARG A CB  
114  C CG  . ARG A 26  ? 0.5790 1.1290 1.0953 0.0366  -0.1052 -0.0704 307 ARG A CG  
115  C CD  . ARG A 26  ? 0.4469 0.9989 0.9663 0.0244  -0.0914 -0.0789 307 ARG A CD  
116  N NE  . ARG A 26  ? 0.4740 0.9902 0.9712 0.0205  -0.0559 -0.0646 307 ARG A NE  
117  C CZ  . ARG A 26  ? 0.6214 1.1377 1.1118 0.0353  -0.0269 -0.0478 307 ARG A CZ  
118  N NH1 . ARG A 26  ? 0.5122 1.0726 1.0217 0.0522  -0.0340 -0.0465 307 ARG A NH1 
119  N NH2 . ARG A 26  ? 0.6780 1.1484 1.1370 0.0382  0.0125  -0.0311 307 ARG A NH2 
120  N N   . THR A 27  ? 0.5482 1.0190 1.0226 0.0505  -0.1350 -0.0758 308 THR A N   
121  C CA  . THR A 27  ? 0.5786 1.0496 1.0527 0.0648  -0.1453 -0.0846 308 THR A CA  
122  C C   . THR A 27  ? 0.5341 0.9544 0.9909 0.0696  -0.1295 -0.0831 308 THR A C   
123  O O   . THR A 27  ? 0.6537 1.0683 1.1136 0.0775  -0.1269 -0.0914 308 THR A O   
124  C CB  . THR A 27  ? 0.6109 1.0938 1.0668 0.0825  -0.1635 -0.0907 308 THR A CB  
125  O OG1 . THR A 27  ? 0.8075 1.2590 1.2282 0.0900  -0.1621 -0.0839 308 THR A OG1 
126  C CG2 . THR A 27  ? 0.3580 0.8968 0.8420 0.0692  -0.1715 -0.1036 308 THR A CG2 
127  N N   . LYS A 28  ? 0.5314 0.9100 0.9691 0.0628  -0.1132 -0.0743 309 LYS A N   
128  C CA  . LYS A 28  ? 0.6083 0.9252 1.0256 0.0627  -0.0869 -0.0753 309 LYS A CA  
129  C C   . LYS A 28  ? 0.5912 0.9194 1.0367 0.0334  -0.0639 -0.0883 309 LYS A C   
130  O O   . LYS A 28  ? 0.6081 0.8991 1.0525 0.0220  -0.0356 -0.1025 309 LYS A O   
131  C CB  . LYS A 28  ? 0.5616 0.8144 0.9262 0.0832  -0.0800 -0.0576 309 LYS A CB  
132  C CG  . LYS A 28  ? 0.7249 0.9856 1.0583 0.1192  -0.1026 -0.0516 309 LYS A CG  
133  C CD  . LYS A 28  ? 0.9389 1.1520 1.2171 0.1460  -0.0974 -0.0356 309 LYS A CD  
134  C CE  . LYS A 28  ? 1.0301 1.1616 1.2537 0.1814  -0.0687 -0.0228 309 LYS A CE  
135  N NZ  . LYS A 28  ? 1.0770 1.2259 1.2812 0.2211  -0.0800 -0.0242 309 LYS A NZ  
136  N N   . LEU A 29  ? 0.7214 0.7468 0.8406 0.1797  0.1423  0.1386  310 LEU A N   
137  C CA  . LEU A 29  ? 0.7552 0.7239 0.8598 0.1447  0.1490  0.1187  310 LEU A CA  
138  C C   . LEU A 29  ? 0.8076 0.7014 0.9109 0.1325  0.1563  0.1136  310 LEU A C   
139  O O   . LEU A 29  ? 0.8690 0.7666 1.0008 0.1374  0.1491  0.1097  310 LEU A O   
140  C CB  . LEU A 29  ? 0.6864 0.7131 0.8271 0.1217  0.1194  0.0789  310 LEU A CB  
141  C CG  . LEU A 29  ? 0.7377 0.7761 0.8555 0.1122  0.1261  0.0707  310 LEU A CG  
142  C CD1 . LEU A 29  ? 0.7121 0.7511 0.7782 0.1458  0.1492  0.1063  310 LEU A CD1 
143  C CD2 . LEU A 29  ? 0.8418 0.9475 0.9919 0.1009  0.0942  0.0352  310 LEU A CD2 
144  N N   . SER A 30  ? 0.8222 0.6443 0.8918 0.1182  0.1726  0.1105  311 SER A N   
145  C CA  . SER A 30  ? 0.8934 0.6424 0.9508 0.1118  0.1702  0.0953  311 SER A CA  
146  C C   . SER A 30  ? 0.8861 0.6595 0.9741 0.0989  0.1392  0.0551  311 SER A C   
147  O O   . SER A 30  ? 0.7218 0.5621 0.8415 0.0849  0.1215  0.0340  311 SER A O   
148  C CB  . SER A 30  ? 1.1072 0.7888 1.1356 0.0947  0.1862  0.0860  311 SER A CB  
149  O OG  . SER A 30  ? 1.0839 0.8074 1.1413 0.0663  0.1813  0.0581  311 SER A OG  
150  N N   . SER A 31  ? 0.9229 0.6330 0.9895 0.1102  0.1351  0.0458  312 SER A N   
151  C CA  . SER A 31  ? 0.6832 0.3978 0.7600 0.1092  0.1119  0.0121  312 SER A CA  
152  C C   . SER A 31  ? 0.8477 0.5968 0.9411 0.0884  0.0862  -0.0295 312 SER A C   
153  O O   . SER A 31  ? 0.8117 0.6083 0.9292 0.0824  0.0682  -0.0521 312 SER A O   
154  C CB  . SER A 31  ? 1.0551 0.6730 1.0805 0.1360  0.1164  0.0100  312 SER A CB  
155  O OG  . SER A 31  ? 0.9761 0.5838 0.9949 0.1443  0.1007  -0.0183 312 SER A OG  
156  N N   . GLN A 32  ? 0.8083 0.5334 0.8941 0.0765  0.0877  -0.0415 313 GLN A N   
157  C CA  . GLN A 32  ? 1.0213 0.7838 1.1385 0.0552  0.0678  -0.0855 313 GLN A CA  
158  C C   . GLN A 32  ? 0.9555 0.8005 1.1126 0.0345  0.0763  -0.0805 313 GLN A C   
159  O O   . GLN A 32  ? 0.9614 0.8585 1.1475 0.0259  0.0568  -0.1124 313 GLN A O   
160  C CB  . GLN A 32  ? 1.2111 0.9273 1.3256 0.0421  0.0736  -0.1033 313 GLN A CB  
161  C CG  . GLN A 32  ? 1.4758 1.2302 1.6371 0.0229  0.0479  -0.1621 313 GLN A CG  
162  C CD  . GLN A 32  ? 1.6163 1.3678 1.7607 0.0518  0.0034  -0.2024 313 GLN A CD  
163  O OE1 . GLN A 32  ? 1.7254 1.4114 1.8089 0.0870  -0.0044 -0.1909 313 GLN A OE1 
164  N NE2 . GLN A 32  ? 1.5289 1.3464 1.7219 0.0421  -0.0212 -0.2484 313 GLN A NE2 
165  N N   . GLU A 33  ? 0.7751 0.6265 0.9232 0.0344  0.1056  -0.0400 314 GLU A N   
166  C CA  . GLU A 33  ? 0.7187 0.6347 0.8829 0.0268  0.1161  -0.0311 314 GLU A CA  
167  C C   . GLU A 33  ? 0.7273 0.7047 0.9071 0.0359  0.0893  -0.0403 314 GLU A C   
168  O O   . GLU A 33  ? 0.5719 0.6043 0.7658 0.0297  0.0844  -0.0521 314 GLU A O   
169  C CB  . GLU A 33  ? 0.8634 0.7607 0.9939 0.0395  0.1521  0.0155  314 GLU A CB  
170  C CG  . GLU A 33  ? 0.9379 0.7796 1.0546 0.0222  0.1929  0.0225  314 GLU A CG  
171  C CD  . GLU A 33  ? 1.2122 1.0106 1.2734 0.0461  0.2328  0.0739  314 GLU A CD  
172  O OE1 . GLU A 33  ? 1.1818 0.9691 1.2183 0.0751  0.2258  0.1009  314 GLU A OE1 
173  O OE2 . GLU A 33  ? 1.3431 1.1145 1.3839 0.0387  0.2759  0.0876  314 GLU A OE2 
174  N N   . ILE A 34  ? 0.6258 0.5866 0.8025 0.0502  0.0768  -0.0360 315 ILE A N   
175  C CA  . ILE A 34  ? 0.6464 0.6508 0.8446 0.0528  0.0557  -0.0519 315 ILE A CA  
176  C C   . ILE A 34  ? 0.6995 0.7066 0.9032 0.0454  0.0336  -0.0941 315 ILE A C   
177  O O   . ILE A 34  ? 0.5187 0.5772 0.7380 0.0403  0.0195  -0.1122 315 ILE A O   
178  C CB  . ILE A 34  ? 0.6699 0.6469 0.8722 0.0664  0.0615  -0.0365 315 ILE A CB  
179  C CG1 . ILE A 34  ? 0.9190 0.9103 1.1237 0.0801  0.0795  0.0021  315 ILE A CG1 
180  C CG2 . ILE A 34  ? 0.6932 0.7090 0.9272 0.0614  0.0467  -0.0584 315 ILE A CG2 
181  C CD1 . ILE A 34  ? 0.9529 0.9301 1.1795 0.0926  0.0917  0.0172  315 ILE A CD1 
182  N N   . GLN A 35  ? 0.6376 0.5884 0.8223 0.0510  0.0280  -0.1117 316 GLN A N   
183  C CA  . GLN A 35  ? 0.5928 0.5454 0.7755 0.0555  0.0035  -0.1541 316 GLN A CA  
184  C C   . GLN A 35  ? 0.5310 0.5492 0.7481 0.0368  -0.0011 -0.1751 316 GLN A C   
185  O O   . GLN A 35  ? 0.6083 0.6668 0.8352 0.0379  -0.0163 -0.1992 316 GLN A O   
186  C CB  . GLN A 35  ? 0.6561 0.5383 0.8051 0.0750  -0.0074 -0.1727 316 GLN A CB  
187  C CG  . GLN A 35  ? 0.8303 0.6296 0.9334 0.0983  0.0081  -0.1457 316 GLN A CG  
188  C CD  . GLN A 35  ? 0.9900 0.7091 1.0387 0.1298  -0.0071 -0.1680 316 GLN A CD  
189  O OE1 . GLN A 35  ? 1.0527 0.7676 1.0831 0.1495  -0.0347 -0.2072 316 GLN A OE1 
190  N NE2 . GLN A 35  ? 1.0862 0.7391 1.1013 0.1416  0.0089  -0.1445 316 GLN A NE2 
191  N N   . GLN A 36  ? 0.5419 0.5640 0.7751 0.0203  0.0189  -0.1644 317 GLN A N   
192  C CA  . GLN A 36  ? 0.6303 0.7070 0.9002 0.0002  0.0308  -0.1784 317 GLN A CA  
193  C C   . GLN A 36  ? 0.5858 0.7152 0.8517 0.0026  0.0352  -0.1646 317 GLN A C   
194  O O   . GLN A 36  ? 0.5648 0.7397 0.8484 0.0006  0.0258  -0.1903 317 GLN A O   
195  C CB  . GLN A 36  ? 0.5990 0.6516 0.8786 -0.0188 0.0672  -0.1600 317 GLN A CB  
196  C CG  . GLN A 36  ? 0.6735 0.6787 0.9647 -0.0257 0.0605  -0.1848 317 GLN A CG  
197  C CD  . GLN A 36  ? 0.8016 0.7820 1.1126 -0.0527 0.1026  -0.1751 317 GLN A CD  
198  O OE1 . GLN A 36  ? 0.9540 0.9348 1.2502 -0.0580 0.1427  -0.1377 317 GLN A OE1 
199  N NE2 . GLN A 36  ? 0.8477 0.8004 1.1878 -0.0670 0.0949  -0.2117 317 GLN A NE2 
200  N N   . PHE A 37  ? 0.5227 0.6476 0.7637 0.0118  0.0462  -0.1273 318 PHE A N   
201  C CA  . PHE A 37  ? 0.6707 0.8452 0.9016 0.0213  0.0415  -0.1193 318 PHE A CA  
202  C C   . PHE A 37  ? 0.6124 0.8111 0.8502 0.0253  0.0097  -0.1494 318 PHE A C   
203  O O   . PHE A 37  ? 0.6830 0.9235 0.9192 0.0273  0.0027  -0.1645 318 PHE A O   
204  C CB  . PHE A 37  ? 0.6288 0.8008 0.8377 0.0378  0.0488  -0.0823 318 PHE A CB  
205  C CG  . PHE A 37  ? 0.7446 0.9721 0.9427 0.0540  0.0334  -0.0825 318 PHE A CG  
206  C CD1 . PHE A 37  ? 0.7782 1.0309 0.9499 0.0630  0.0465  -0.0794 318 PHE A CD1 
207  C CD2 . PHE A 37  ? 0.7761 1.0285 0.9915 0.0615  0.0076  -0.0890 318 PHE A CD2 
208  C CE1 . PHE A 37  ? 0.7182 1.0175 0.8675 0.0858  0.0262  -0.0839 318 PHE A CE1 
209  C CE2 . PHE A 37  ? 0.6755 0.9846 0.8867 0.0768  -0.0145 -0.0993 318 PHE A CE2 
210  C CZ  . PHE A 37  ? 0.6979 1.0294 0.8694 0.0923  -0.0093 -0.0972 318 PHE A CZ  
211  N N   . ALA A 38  ? 0.4834 0.6448 0.7210 0.0291  -0.0037 -0.1572 319 ALA A N   
212  C CA  . ALA A 38  ? 0.5486 0.7115 0.7846 0.0335  -0.0243 -0.1848 319 ALA A CA  
213  C C   . ALA A 38  ? 0.5860 0.7681 0.8215 0.0350  -0.0357 -0.2184 319 ALA A C   
214  O O   . ALA A 38  ? 0.7834 0.9932 1.0139 0.0380  -0.0476 -0.2371 319 ALA A O   
215  C CB  . ALA A 38  ? 0.5113 0.6078 0.7351 0.0418  -0.0229 -0.1846 319 ALA A CB  
216  N N   . ALA A 39  ? 0.4799 0.6501 0.7247 0.0341  -0.0331 -0.2293 320 ALA A N   
217  C CA  . ALA A 39  ? 0.4791 0.6814 0.7403 0.0374  -0.0440 -0.2654 320 ALA A CA  
218  C C   . ALA A 39  ? 0.5201 0.7844 0.7983 0.0280  -0.0306 -0.2649 320 ALA A C   
219  O O   . ALA A 39  ? 0.6649 0.9569 0.9383 0.0378  -0.0424 -0.2883 320 ALA A O   
220  C CB  . ALA A 39  ? 0.4887 0.6797 0.7753 0.0342  -0.0451 -0.2828 320 ALA A CB  
221  N N   . LEU A 40  ? 0.5647 0.8407 0.8517 0.0147  -0.0015 -0.2367 321 LEU A N   
222  C CA  . LEU A 40  ? 0.4945 0.8136 0.7800 0.0140  0.0197  -0.2309 321 LEU A CA  
223  C C   . LEU A 40  ? 0.5408 0.8757 0.7878 0.0306  0.0000  -0.2298 321 LEU A C   
224  O O   . LEU A 40  ? 0.5065 0.8725 0.7446 0.0391  -0.0024 -0.2470 321 LEU A O   
225  C CB  . LEU A 40  ? 0.6172 0.9235 0.8959 0.0061  0.0613  -0.1943 321 LEU A CB  
226  C CG  . LEU A 40  ? 0.8602 1.1497 1.1840 -0.0176 0.0916  -0.1990 321 LEU A CG  
227  C CD1 . LEU A 40  ? 0.9374 1.2023 1.2411 -0.0225 0.1460  -0.1607 321 LEU A CD1 
228  C CD2 . LEU A 40  ? 0.8769 1.2115 1.2600 -0.0286 0.0903  -0.2431 321 LEU A CD2 
229  N N   . LEU A 41  ? 0.6499 0.9650 0.8791 0.0348  -0.0138 -0.2133 322 LEU A N   
230  C CA  . LEU A 41  ? 0.5617 0.8969 0.7689 0.0459  -0.0362 -0.2206 322 LEU A CA  
231  C C   . LEU A 41  ? 0.6015 0.9330 0.8067 0.0477  -0.0575 -0.2573 322 LEU A C   
232  O O   . LEU A 41  ? 0.5125 0.8652 0.6973 0.0560  -0.0713 -0.2735 322 LEU A O   
233  C CB  . LEU A 41  ? 0.6095 0.9319 0.8232 0.0456  -0.0468 -0.2054 322 LEU A CB  
234  C CG  . LEU A 41  ? 0.6364 0.9945 0.8433 0.0546  -0.0719 -0.2190 322 LEU A CG  
235  C CD1 . LEU A 41  ? 0.7011 1.0944 0.8729 0.0775  -0.0679 -0.2006 322 LEU A CD1 
236  C CD2 . LEU A 41  ? 0.5644 0.9160 0.8058 0.0469  -0.0824 -0.2187 322 LEU A CD2 
237  N N   . HIS A 42  ? 0.6690 0.9663 0.8850 0.0457  -0.0609 -0.2719 323 HIS A N   
238  C CA  . HIS A 42  ? 0.6114 0.8927 0.8098 0.0565  -0.0773 -0.3046 323 HIS A CA  
239  C C   . HIS A 42  ? 0.7542 1.0783 0.9500 0.0667  -0.0759 -0.3245 323 HIS A C   
240  O O   . HIS A 42  ? 0.6908 1.0180 0.8599 0.0779  -0.0871 -0.3452 323 HIS A O   
241  C CB  . HIS A 42  ? 0.6788 0.9023 0.8698 0.0657  -0.0816 -0.3147 323 HIS A CB  
242  C CG  . HIS A 42  ? 0.8746 1.0549 1.0289 0.0824  -0.0915 -0.3406 323 HIS A CG  
243  N ND1 . HIS A 42  ? 0.9752 1.1387 1.1176 0.0742  -0.0919 -0.3456 323 HIS A ND1 
244  C CD2 . HIS A 42  ? 1.0594 1.2045 1.1825 0.1101  -0.0998 -0.3654 323 HIS A CD2 
245  C CE1 . HIS A 42  ? 1.0868 1.1957 1.1889 0.0921  -0.0929 -0.3689 323 HIS A CE1 
246  N NE2 . HIS A 42  ? 1.2175 1.3126 1.3001 0.1189  -0.0982 -0.3791 323 HIS A NE2 
247  N N   . GLU A 43  ? 0.5459 0.9010 0.7733 0.0614  -0.0577 -0.3193 324 GLU A N   
248  C CA  . GLU A 43  ? 0.6516 1.0543 0.8915 0.0689  -0.0460 -0.3361 324 GLU A CA  
249  C C   . GLU A 43  ? 0.7842 1.2060 0.9856 0.0771  -0.0387 -0.3257 324 GLU A C   
250  O O   . GLU A 43  ? 0.8023 1.2403 0.9823 0.0935  -0.0440 -0.3465 324 GLU A O   
251  C CB  . GLU A 43  ? 0.5438 0.9759 0.8392 0.0529  -0.0159 -0.3310 324 GLU A CB  
252  C CG  . GLU A 43  ? 0.7837 1.2148 1.1248 0.0508  -0.0301 -0.3586 324 GLU A CG  
253  C CD  . GLU A 43  ? 0.9051 1.3749 1.3201 0.0282  0.0009  -0.3658 324 GLU A CD  
254  O OE1 . GLU A 43  ? 0.9452 1.4454 1.3767 0.0184  0.0406  -0.3531 324 GLU A OE1 
255  O OE2 . GLU A 43  ? 0.8683 1.3327 1.3236 0.0212  -0.0117 -0.3863 324 GLU A OE2 
256  N N   . TYR A 44  ? 0.7259 1.1429 0.9103 0.0725  -0.0285 -0.2947 325 TYR A N   
257  C CA  . TYR A 44  ? 0.9174 1.3496 1.0523 0.0905  -0.0270 -0.2862 325 TYR A CA  
258  C C   . TYR A 44  ? 0.8083 1.2330 0.9121 0.0996  -0.0648 -0.3128 325 TYR A C   
259  O O   . TYR A 44  ? 0.8478 1.2849 0.9103 0.1187  -0.0702 -0.3262 325 TYR A O   
260  C CB  . TYR A 44  ? 0.9225 1.3486 1.0373 0.0943  -0.0149 -0.2503 325 TYR A CB  
261  C CG  . TYR A 44  ? 1.0472 1.4863 1.0969 0.1252  -0.0215 -0.2454 325 TYR A CG  
262  C CD1 . TYR A 44  ? 1.1613 1.6030 1.1692 0.1472  0.0164  -0.2298 325 TYR A CD1 
263  C CD2 . TYR A 44  ? 1.0191 1.4666 1.0497 0.1348  -0.0643 -0.2597 325 TYR A CD2 
264  C CE1 . TYR A 44  ? 1.2768 1.7206 1.2063 0.1866  0.0085  -0.2259 325 TYR A CE1 
265  C CE2 . TYR A 44  ? 1.0909 1.5539 1.0583 0.1696  -0.0800 -0.2634 325 TYR A CE2 
266  C CZ  . TYR A 44  ? 1.2679 1.7249 1.1752 0.1997  -0.0453 -0.2451 325 TYR A CZ  
267  O OH  . TYR A 44  ? 1.3125 1.7753 1.1381 0.2452  -0.0624 -0.2490 325 TYR A OH  
268  N N   . ARG A 45  ? 0.7472 1.1442 0.8696 0.0858  -0.0860 -0.3210 326 ARG A N   
269  C CA  . ARG A 45  ? 0.7362 1.1142 0.8419 0.0858  -0.1133 -0.3502 326 ARG A CA  
270  C C   . ARG A 45  ? 0.8217 1.1867 0.9026 0.0991  -0.1151 -0.3791 326 ARG A C   
271  O O   . ARG A 45  ? 0.8282 1.1870 0.8737 0.1083  -0.1304 -0.4035 326 ARG A O   
272  C CB  . ARG A 45  ? 0.7766 1.1149 0.9133 0.0669  -0.1185 -0.3495 326 ARG A CB  
273  C CG  . ARG A 45  ? 0.7017 1.0068 0.8334 0.0587  -0.1341 -0.3807 326 ARG A CG  
274  C CD  . ARG A 45  ? 0.7604 1.0039 0.8706 0.0653  -0.1253 -0.3980 326 ARG A CD  
275  N NE  . ARG A 45  ? 1.0430 1.2452 1.1326 0.0606  -0.1316 -0.4306 326 ARG A NE  
276  C CZ  . ARG A 45  ? 1.1241 1.2674 1.2292 0.0432  -0.1201 -0.4392 326 ARG A CZ  
277  N NH1 . ARG A 45  ? 0.9883 1.1089 1.1242 0.0337  -0.1034 -0.4150 326 ARG A NH1 
278  N NH2 . ARG A 45  ? 1.1399 1.2397 1.2281 0.0351  -0.1197 -0.4725 326 ARG A NH2 
279  N N   . ASN A 46  ? 0.5868 0.9505 0.6867 0.1032  -0.1014 -0.3796 327 ASN A N   
280  C CA  . ASN A 46  ? 0.6677 1.0190 0.7477 0.1230  -0.1055 -0.4083 327 ASN A CA  
281  C C   . ASN A 46  ? 0.7698 1.1697 0.8440 0.1411  -0.0913 -0.4144 327 ASN A C   
282  O O   . ASN A 46  ? 0.9679 1.3772 1.0455 0.1602  -0.0901 -0.4356 327 ASN A O   
283  C CB  . ASN A 46  ? 0.6775 1.0028 0.7784 0.1283  -0.1066 -0.4150 327 ASN A CB  
284  C CG  . ASN A 46  ? 0.9547 1.2014 1.0204 0.1333  -0.1163 -0.4263 327 ASN A CG  
285  O OD1 . ASN A 46  ? 1.1025 1.3188 1.1488 0.1212  -0.1193 -0.4295 327 ASN A OD1 
286  N ND2 . ASN A 46  ? 1.0104 1.2207 1.0676 0.1532  -0.1190 -0.4351 327 ASN A ND2 
287  N N   . GLY A 47  ? 0.9903 1.4488 0.8985 0.2468  -0.1380 -0.6115 328 GLY A N   
288  C CA  . GLY A 47  ? 0.9710 1.5402 0.9135 0.2496  -0.1270 -0.6483 328 GLY A CA  
289  C C   . GLY A 47  ? 1.2547 1.9499 1.2225 0.2334  -0.1099 -0.6380 328 GLY A C   
290  O O   . GLY A 47  ? 1.2302 2.0251 1.2269 0.2283  -0.0988 -0.6693 328 GLY A O   
291  N N   . ALA A 48  ? 1.2162 1.9061 1.1700 0.2217  -0.1064 -0.5953 329 ALA A N   
292  C CA  . ALA A 48  ? 1.1851 1.9805 1.1478 0.1985  -0.0871 -0.5782 329 ALA A CA  
293  C C   . ALA A 48  ? 1.2105 2.1036 1.1504 0.1532  -0.0699 -0.5685 329 ALA A C   
294  O O   . ALA A 48  ? 0.8431 1.7172 0.7533 0.1364  -0.0745 -0.5571 329 ALA A O   
295  C CB  . ALA A 48  ? 0.7819 1.5347 0.7262 0.1961  -0.0873 -0.5335 329 ALA A CB  
296  N N   . SER A 49  ? 1.1019 2.1009 1.0534 0.1288  -0.0507 -0.5703 330 SER A N   
297  C CA  . SER A 49  ? 1.0783 2.1686 1.0008 0.0801  -0.0352 -0.5512 330 SER A CA  
298  C C   . SER A 49  ? 0.8693 1.9384 0.7399 0.0568  -0.0388 -0.4856 330 SER A C   
299  O O   . SER A 49  ? 0.9014 1.8966 0.7631 0.0759  -0.0492 -0.4592 330 SER A O   
300  C CB  . SER A 49  ? 1.2038 2.4027 1.1435 0.0518  -0.0134 -0.5628 330 SER A CB  
301  O OG  . SER A 49  ? 1.2320 2.4491 1.1339 0.0194  -0.0013 -0.5085 330 SER A OG  
302  N N   . ILE A 50  ? 0.9452 2.0814 0.7833 0.0165  -0.0329 -0.4584 331 ILE A N   
303  C CA  . ILE A 50  ? 0.9769 2.1061 0.7680 -0.0038 -0.0419 -0.3892 331 ILE A CA  
304  C C   . ILE A 50  ? 0.9067 2.0683 0.6718 -0.0282 -0.0272 -0.3452 331 ILE A C   
305  O O   . ILE A 50  ? 0.8295 1.9290 0.5875 -0.0264 -0.0315 -0.2784 331 ILE A O   
306  C CB  . ILE A 50  ? 1.0036 2.1899 0.7709 -0.0352 -0.0455 -0.3742 331 ILE A CB  
307  C CG1 . ILE A 50  ? 0.8776 2.0678 0.6015 -0.0526 -0.0590 -0.2939 331 ILE A CG1 
308  C CG2 . ILE A 50  ? 0.9066 2.1893 0.6783 -0.0687 -0.0250 -0.4018 331 ILE A CG2 
309  C CD1 . ILE A 50  ? 0.8681 1.9749 0.6035 -0.0239 -0.0802 -0.2672 331 ILE A CD1 
310  N N   . HIS A 51  ? 0.9885 2.2204 0.7652 -0.0524 -0.0057 -0.3721 332 HIS A N   
311  C CA  . HIS A 51  ? 1.0500 2.3102 0.7983 -0.0860 0.0135  -0.3356 332 HIS A CA  
312  C C   . HIS A 51  ? 1.0802 2.2743 0.8441 -0.0585 0.0171  -0.3314 332 HIS A C   
313  O O   . HIS A 51  ? 1.1518 2.2893 0.8993 -0.0715 0.0226  -0.2634 332 HIS A O   
314  C CB  . HIS A 51  ? 1.0850 2.4371 0.8557 -0.1180 0.0346  -0.3799 332 HIS A CB  
315  C CG  . HIS A 51  ? 1.2887 2.6656 1.0346 -0.1585 0.0570  -0.3534 332 HIS A CG  
316  N ND1 . HIS A 51  ? 1.4340 2.7915 1.1088 -0.1977 0.0615  -0.2766 332 HIS A ND1 
317  C CD2 . HIS A 51  ? 1.3520 2.7664 1.1343 -0.1674 0.0749  -0.3922 332 HIS A CD2 
318  C CE1 . HIS A 51  ? 1.5284 2.9001 1.1910 -0.2335 0.0848  -0.2701 332 HIS A CE1 
319  N NE2 . HIS A 51  ? 1.4505 2.8639 1.1800 -0.2175 0.0933  -0.3419 332 HIS A NE2 
320  N N   . GLU A 52  ? 0.9289 2.1009 0.7489 -0.0179 0.0123  -0.3923 333 GLU A N   
321  C CA  . GLU A 52  ? 0.8979 1.9949 0.7477 0.0147  0.0104  -0.3913 333 GLU A CA  
322  C C   . GLU A 52  ? 0.8557 1.8371 0.7038 0.0266  -0.0036 -0.3194 333 GLU A C   
323  O O   . GLU A 52  ? 0.8642 1.7960 0.7118 0.0176  0.0067  -0.2703 333 GLU A O   
324  C CB  . GLU A 52  ? 1.0236 2.0975 0.9264 0.0639  -0.0050 -0.4600 333 GLU A CB  
325  C CG  . GLU A 52  ? 1.1705 2.1716 1.0993 0.1006  -0.0118 -0.4658 333 GLU A CG  
326  C CD  . GLU A 52  ? 1.2670 2.3207 1.2168 0.0832  0.0096  -0.4708 333 GLU A CD  
327  O OE1 . GLU A 52  ? 1.4463 2.5932 1.4114 0.0553  0.0230  -0.4939 333 GLU A OE1 
328  O OE2 . GLU A 52  ? 1.0266 2.0252 0.9834 0.0922  0.0128  -0.4485 333 GLU A OE2 
329  N N   . PHE A 53  ? 0.8163 1.7597 0.6641 0.0444  -0.0250 -0.3190 334 PHE A N   
330  C CA  . PHE A 53  ? 0.8554 1.7018 0.7087 0.0576  -0.0392 -0.2648 334 PHE A CA  
331  C C   . PHE A 53  ? 0.9592 1.7980 0.7884 0.0311  -0.0308 -0.1861 334 PHE A C   
332  O O   . PHE A 53  ? 0.7601 1.5235 0.6037 0.0388  -0.0271 -0.1447 334 PHE A O   
333  C CB  . PHE A 53  ? 0.9148 1.7537 0.7610 0.0658  -0.0593 -0.2808 334 PHE A CB  
334  C CG  . PHE A 53  ? 0.9456 1.6889 0.8056 0.0823  -0.0740 -0.2473 334 PHE A CG  
335  C CD1 . PHE A 53  ? 0.8375 1.4917 0.7238 0.1042  -0.0742 -0.2437 334 PHE A CD1 
336  C CD2 . PHE A 53  ? 0.7329 1.4852 0.5796 0.0727  -0.0872 -0.2232 334 PHE A CD2 
337  C CE1 . PHE A 53  ? 0.7556 1.3289 0.6528 0.1130  -0.0849 -0.2177 334 PHE A CE1 
338  C CE2 . PHE A 53  ? 0.8412 1.5190 0.7035 0.0840  -0.0984 -0.1995 334 PHE A CE2 
339  C CZ  . PHE A 53  ? 0.6914 1.2787 0.5782 0.1024  -0.0960 -0.1973 334 PHE A CZ  
340  N N   . CYS A 54  ? 0.7896 1.7041 0.5784 -0.0007 -0.0278 -0.1669 335 CYS A N   
341  C CA  . CYS A 54  ? 1.0897 1.9942 0.8427 -0.0250 -0.0239 -0.0893 335 CYS A CA  
342  C C   . CYS A 54  ? 1.0111 1.8806 0.7579 -0.0412 0.0003  -0.0635 335 CYS A C   
343  O O   . CYS A 54  ? 0.9652 1.7612 0.7063 -0.0397 0.0016  -0.0013 335 CYS A O   
344  C CB  . CYS A 54  ? 1.1320 2.1324 0.8322 -0.0615 -0.0253 -0.0807 335 CYS A CB  
345  S SG  . CYS A 54  ? 1.0647 2.1101 0.7631 -0.0518 -0.0531 -0.0974 335 CYS A SG  
346  N N   . ILE A 55  ? 0.8363 1.7623 0.5850 -0.0576 0.0205  -0.1153 336 ILE A N   
347  C CA  . ILE A 55  ? 0.8780 1.7811 0.6230 -0.0778 0.0466  -0.1033 336 ILE A CA  
348  C C   . ILE A 55  ? 0.8028 1.6012 0.5913 -0.0452 0.0438  -0.0868 336 ILE A C   
349  O O   . ILE A 55  ? 1.6509 2.3860 1.4272 -0.0592 0.0579  -0.0369 336 ILE A O   
350  C CB  . ILE A 55  ? 0.8375 1.8341 0.5939 -0.0926 0.0658  -0.1784 336 ILE A CB  
351  C CG1 . ILE A 55  ? 0.8897 1.9953 0.5959 -0.1387 0.0768  -0.1926 336 ILE A CG1 
352  C CG2 . ILE A 55  ? 1.0866 2.0616 0.8485 -0.1113 0.0923  -0.1747 336 ILE A CG2 
353  C CD1 . ILE A 55  ? 0.8841 2.1025 0.6076 -0.1540 0.0969  -0.2769 336 ILE A CD1 
354  N N   . ASN A 56  ? 0.7527 1.5277 0.5862 -0.0046 0.0260  -0.1288 337 ASN A N   
355  C CA  . ASN A 56  ? 0.7154 1.3944 0.5859 0.0227  0.0218  -0.1173 337 ASN A CA  
356  C C   . ASN A 56  ? 0.7235 1.3241 0.5907 0.0277  0.0139  -0.0498 337 ASN A C   
357  O O   . ASN A 56  ? 0.7791 1.3078 0.6602 0.0291  0.0243  -0.0194 337 ASN A O   
358  C CB  . ASN A 56  ? 0.6783 1.3417 0.5835 0.0614  0.0010  -0.1739 337 ASN A CB  
359  C CG  . ASN A 56  ? 0.8458 1.5783 0.7655 0.0691  0.0059  -0.2439 337 ASN A CG  
360  O OD1 . ASN A 56  ? 0.8112 1.5965 0.7263 0.0450  0.0284  -0.2521 337 ASN A OD1 
361  N ND2 . ASN A 56  ? 0.8700 1.6022 0.8062 0.1024  -0.0149 -0.2973 337 ASN A ND2 
362  N N   . LEU A 57  ? 0.9491 1.5710 0.8003 0.0310  -0.0046 -0.0307 338 LEU A N   
363  C CA  . LEU A 57  ? 0.9523 1.5190 0.8054 0.0410  -0.0160 0.0286  338 LEU A CA  
364  C C   . LEU A 57  ? 0.8964 1.4332 0.7185 0.0198  0.0002  0.0911  338 LEU A C   
365  O O   . LEU A 57  ? 0.9785 1.4373 0.8174 0.0315  0.0035  0.1306  338 LEU A O   
366  C CB  . LEU A 57  ? 0.9756 1.5935 0.8155 0.0460  -0.0403 0.0320  338 LEU A CB  
367  C CG  . LEU A 57  ? 0.8950 1.4954 0.7664 0.0701  -0.0600 -0.0013 338 LEU A CG  
368  C CD1 . LEU A 57  ? 0.7558 1.2674 0.6658 0.0884  -0.0556 -0.0072 338 LEU A CD1 
369  C CD2 . LEU A 57  ? 0.8816 1.5364 0.7463 0.0685  -0.0655 -0.0681 338 LEU A CD2 
370  N N   . ARG A 58  ? 0.8536 1.4490 0.6268 -0.0142 0.0117  0.0972  339 ARG A N   
371  C CA  . ARG A 58  ? 0.9280 1.4881 0.6527 -0.0418 0.0263  0.1593  339 ARG A CA  
372  C C   . ARG A 58  ? 1.0633 1.5493 0.7997 -0.0518 0.0545  0.1660  339 ARG A C   
373  O O   . ARG A 58  ? 1.1536 1.5675 0.8616 -0.0630 0.0651  0.2231  339 ARG A O   
374  C CB  . ARG A 58  ? 0.9849 1.6292 0.6468 -0.0870 0.0363  0.1543  339 ARG A CB  
375  N N   . GLN A 59  ? 0.9275 1.4293 0.7031 -0.0473 0.0657  0.1071  340 GLN A N   
376  C CA  . GLN A 59  ? 0.8875 1.3356 0.6756 -0.0609 0.0932  0.1048  340 GLN A CA  
377  C C   . GLN A 59  ? 0.9426 1.2995 0.7779 -0.0274 0.0860  0.1214  340 GLN A C   
378  O O   . GLN A 59  ? 0.9521 1.2459 0.7968 -0.0377 0.1080  0.1328  340 GLN A O   
379  C CB  . GLN A 59  ? 0.8172 1.3330 0.6296 -0.0672 0.1045  0.0323  340 GLN A CB  
380  C CG  . GLN A 59  ? 0.8421 1.4686 0.6215 -0.0991 0.1141  -0.0045 340 GLN A CG  
381  C CD  . GLN A 59  ? 0.7952 1.4919 0.6120 -0.0930 0.1212  -0.0814 340 GLN A CD  
382  O OE1 . GLN A 59  ? 1.0403 1.7015 0.8885 -0.0855 0.1305  -0.0951 340 GLN A OE1 
383  N NE2 . GLN A 59  ? 1.3082 2.1090 1.1231 -0.0948 0.1158  -0.1339 340 GLN A NE2 
384  N N   . LEU A 60  ? 0.8993 1.2548 0.7633 0.0078  0.0573  0.1178  341 LEU A N   
385  C CA  . LEU A 60  ? 0.9061 1.1918 0.8178 0.0355  0.0507  0.1185  341 LEU A CA  
386  C C   . LEU A 60  ? 1.0690 1.3083 0.9861 0.0544  0.0378  0.1721  341 LEU A C   
387  O O   . LEU A 60  ? 1.0716 1.2414 1.0214 0.0679  0.0434  0.1872  341 LEU A O   
388  C CB  . LEU A 60  ? 0.8805 1.1935 0.8218 0.0582  0.0297  0.0649  341 LEU A CB  
389  C CG  . LEU A 60  ? 0.8126 1.0631 0.7926 0.0708  0.0322  0.0444  341 LEU A CG  
390  C CD1 . LEU A 60  ? 0.9109 1.1346 0.8906 0.0492  0.0614  0.0474  341 LEU A CD1 
391  C CD2 . LEU A 60  ? 0.6182 0.8914 0.6087 0.0865  0.0140  -0.0120 341 LEU A CD2 
392  N N   . TYR A 61  ? 1.1684 1.4535 1.0543 0.0557  0.0200  0.1985  342 TYR A N   
393  C CA  . TYR A 61  ? 1.1233 1.3869 1.0172 0.0811  -0.0005 0.2452  342 TYR A CA  
394  C C   . TYR A 61  ? 1.1973 1.4585 1.0341 0.0697  -0.0033 0.3061  342 TYR A C   
395  O O   . TYR A 61  ? 1.1957 1.5280 0.9907 0.0556  -0.0163 0.3097  342 TYR A O   
396  C CB  . TYR A 61  ? 0.9410 1.2668 0.8565 0.1003  -0.0294 0.2164  342 TYR A CB  
397  C CG  . TYR A 61  ? 0.8507 1.1587 0.8092 0.1086  -0.0280 0.1627  342 TYR A CG  
398  C CD1 . TYR A 61  ? 0.8453 1.0825 0.8446 0.1205  -0.0191 0.1660  342 TYR A CD1 
399  C CD2 . TYR A 61  ? 0.7411 1.0968 0.6948 0.1033  -0.0354 0.1084  342 TYR A CD2 
400  C CE1 . TYR A 61  ? 0.8262 1.0410 0.8537 0.1226  -0.0188 0.1210  342 TYR A CE1 
401  C CE2 . TYR A 61  ? 0.7930 1.1163 0.7746 0.1110  -0.0372 0.0646  342 TYR A CE2 
402  C CZ  . TYR A 61  ? 0.8803 1.1331 0.8955 0.1184  -0.0294 0.0732  342 TYR A CZ  
403  O OH  . TYR A 61  ? 0.8938 1.1087 0.9264 0.1208  -0.0321 0.0335  342 TYR A OH  
404  N N   . GLY A 62  ? 1.2415 1.4148 1.0719 0.0743  0.0089  0.3539  343 GLY A N   
405  C CA  . GLY A 62  ? 1.2988 1.4427 1.0662 0.0658  0.0044  0.4194  343 GLY A CA  
406  C C   . GLY A 62  ? 1.3737 1.5291 1.1524 0.1085  -0.0335 0.4606  343 GLY A C   
407  O O   . GLY A 62  ? 1.2868 1.5096 1.1085 0.1311  -0.0562 0.4305  343 GLY A O   
408  N N   . ASP A 63  ? 1.6309 1.7188 1.3688 0.1192  -0.0409 0.5284  344 ASP A N   
409  C CA  . ASP A 63  ? 1.8006 1.9034 1.5422 0.1640  -0.0817 0.5752  344 ASP A CA  
410  C C   . ASP A 63  ? 1.8274 1.9550 1.6617 0.2136  -0.0999 0.5479  344 ASP A C   
411  O O   . ASP A 63  ? 1.8408 2.0554 1.6935 0.2360  -0.1331 0.5437  344 ASP A O   
412  C CB  . ASP A 63  ? 1.9349 1.9259 1.6234 0.1753  -0.0835 0.6519  344 ASP A CB  
413  C CG  . ASP A 63  ? 2.0690 2.0703 1.7643 0.2316  -0.1302 0.7038  344 ASP A CG  
414  O OD1 . ASP A 63  ? 2.0849 2.1999 1.7891 0.2422  -0.1621 0.6926  344 ASP A OD1 
415  O OD2 . ASP A 63  ? 2.2017 2.0983 1.8934 0.2665  -0.1356 0.7542  344 ASP A OD2 
416  N N   . SER A 64  ? 1.7862 1.8441 1.6763 0.2246  -0.0761 0.5257  345 SER A N   
417  C CA  . SER A 64  ? 1.6983 1.7709 1.6738 0.2660  -0.0882 0.5003  345 SER A CA  
418  C C   . SER A 64  ? 1.5014 1.6782 1.5132 0.2598  -0.1008 0.4410  345 SER A C   
419  O O   . SER A 64  ? 1.5893 1.7995 1.6623 0.2880  -0.1152 0.4198  345 SER A O   
420  C CB  . SER A 64  ? 1.7194 1.6985 1.7395 0.2664  -0.0541 0.4817  345 SER A CB  
421  O OG  . SER A 64  ? 1.6847 1.6545 1.6910 0.2204  -0.0220 0.4400  345 SER A OG  
422  N N   . ARG A 65  ? 1.2243 1.4513 1.1967 0.2215  -0.0944 0.4114  346 ARG A N   
423  C CA  . ARG A 65  ? 0.9046 1.2094 0.9020 0.2121  -0.1026 0.3521  346 ARG A CA  
424  C C   . ARG A 65  ? 1.3698 1.7745 1.3263 0.2012  -0.1273 0.3517  346 ARG A C   
425  O O   . ARG A 65  ? 1.2819 1.7378 1.2321 0.1787  -0.1249 0.3013  346 ARG A O   
426  C CB  . ARG A 65  ? 0.8451 1.1224 0.8440 0.1815  -0.0738 0.3014  346 ARG A CB  
427  C CG  . ARG A 65  ? 0.8890 1.1063 0.9447 0.1892  -0.0574 0.2727  346 ARG A CG  
428  C CD  . ARG A 65  ? 0.9324 1.0614 1.0026 0.2011  -0.0387 0.3105  346 ARG A CD  
429  N NE  . ARG A 65  ? 1.0263 1.1096 1.1516 0.2049  -0.0228 0.2794  346 ARG A NE  
430  C CZ  . ARG A 65  ? 0.9444 1.0341 1.1234 0.2313  -0.0332 0.2746  346 ARG A CZ  
431  N NH1 . ARG A 65  ? 0.9543 1.0977 1.1432 0.2615  -0.0621 0.2994  346 ARG A NH1 
432  N NH2 . ARG A 65  ? 0.7973 0.8479 1.0201 0.2259  -0.0151 0.2425  346 ARG A NH2 
433  N N   . LYS A 66  ? 1.4320 1.8615 1.3586 0.2179  -0.1520 0.4070  347 LYS A N   
434  C CA  . LYS A 66  ? 1.3838 1.9149 1.2674 0.2048  -0.1767 0.4104  347 LYS A CA  
435  C C   . LYS A 66  ? 0.9547 1.5737 0.8805 0.2114  -0.1948 0.3614  347 LYS A C   
436  O O   . LYS A 66  ? 1.1775 1.8680 1.0790 0.1836  -0.1969 0.3229  347 LYS A O   
437  C CB  . LYS A 66  ? 1.3517 1.8862 1.1932 0.2256  -0.2048 0.4859  347 LYS A CB  
438  N N   . PHE A 67  ? 1.2198 1.8330 1.2079 0.2453  -0.2055 0.3592  348 PHE A N   
439  C CA  . PHE A 67  ? 1.0943 1.7887 1.1226 0.2469  -0.2202 0.3118  348 PHE A CA  
440  C C   . PHE A 67  ? 1.1195 1.8184 1.1409 0.2091  -0.2007 0.2434  348 PHE A C   
441  O O   . PHE A 67  ? 1.1984 1.9764 1.2104 0.1915  -0.2123 0.2069  348 PHE A O   
442  C CB  . PHE A 67  ? 1.0267 1.7002 1.1286 0.2812  -0.2232 0.3077  348 PHE A CB  
443  C CG  . PHE A 67  ? 1.0786 1.6457 1.2093 0.2776  -0.1905 0.2907  348 PHE A CG  
444  C CD1 . PHE A 67  ? 0.9635 1.5153 1.1138 0.2512  -0.1719 0.2297  348 PHE A CD1 
445  C CD2 . PHE A 67  ? 1.1632 1.6410 1.2955 0.2981  -0.1786 0.3361  348 PHE A CD2 
446  C CE1 . PHE A 67  ? 0.8920 1.3520 1.0641 0.2454  -0.1440 0.2154  348 PHE A CE1 
447  C CE2 . PHE A 67  ? 1.0799 1.4676 1.2378 0.2902  -0.1471 0.3175  348 PHE A CE2 
448  C CZ  . PHE A 67  ? 0.9788 1.3629 1.1576 0.2641  -0.1308 0.2577  348 PHE A CZ  
449  N N   . LEU A 68  ? 1.0565 1.6682 1.0798 0.1974  -0.1720 0.2260  349 LEU A N   
450  C CA  . LEU A 68  ? 0.9749 1.5738 0.9898 0.1696  -0.1561 0.1649  349 LEU A CA  
451  C C   . LEU A 68  ? 0.9523 1.6157 0.9151 0.1452  -0.1603 0.1475  349 LEU A C   
452  O O   . LEU A 68  ? 0.8624 1.5670 0.8183 0.1288  -0.1647 0.0978  349 LEU A O   
453  C CB  . LEU A 68  ? 0.9166 1.4190 0.9383 0.1654  -0.1284 0.1592  349 LEU A CB  
454  C CG  . LEU A 68  ? 0.9413 1.4274 0.9394 0.1426  -0.1138 0.1105  349 LEU A CG  
455  C CD1 . LEU A 68  ? 1.0563 1.5371 1.0683 0.1352  -0.1184 0.0554  349 LEU A CD1 
456  C CD2 . LEU A 68  ? 0.9937 1.4027 0.9959 0.1401  -0.0891 0.1166  349 LEU A CD2 
457  N N   . LEU A 69  ? 0.9280 1.5978 0.8507 0.1393  -0.1572 0.1869  350 LEU A N   
458  C CA  . LEU A 69  ? 0.9104 1.6467 0.7822 0.1114  -0.1569 0.1693  350 LEU A CA  
459  C C   . LEU A 69  ? 0.9781 1.8170 0.8349 0.1065  -0.1834 0.1677  350 LEU A C   
460  O O   . LEU A 69  ? 0.9445 1.8392 0.7865 0.0850  -0.1836 0.1162  350 LEU A O   
461  C CB  . LEU A 69  ? 1.0610 1.7805 0.8869 0.0986  -0.1458 0.2156  350 LEU A CB  
462  C CG  . LEU A 69  ? 1.0643 1.7168 0.8865 0.0856  -0.1146 0.2025  350 LEU A CG  
463  C CD1 . LEU A 69  ? 0.8401 1.3960 0.7078 0.1076  -0.1029 0.2143  350 LEU A CD1 
464  C CD2 . LEU A 69  ? 1.2369 1.8959 0.9990 0.0598  -0.1043 0.2444  350 LEU A CD2 
465  N N   . LEU A 70  ? 0.8848 1.7474 0.7462 0.1283  -0.2063 0.2229  351 LEU A N   
466  C CA  . LEU A 70  ? 1.0587 2.0267 0.9137 0.1290  -0.2358 0.2269  351 LEU A CA  
467  C C   . LEU A 70  ? 1.0219 2.0295 0.9112 0.1207  -0.2379 0.1620  351 LEU A C   
468  O O   . LEU A 70  ? 0.8597 1.9505 0.7241 0.0948  -0.2449 0.1267  351 LEU A O   
469  C CB  . LEU A 70  ? 1.0715 2.0422 0.9435 0.1680  -0.2624 0.2943  351 LEU A CB  
470  C CG  . LEU A 70  ? 1.2873 2.2288 1.1051 0.1732  -0.2699 0.3685  351 LEU A CG  
471  C CD1 . LEU A 70  ? 1.4539 2.3641 1.2994 0.2238  -0.2949 0.4309  351 LEU A CD1 
472  C CD2 . LEU A 70  ? 1.1896 2.2248 0.9413 0.1412  -0.2844 0.3769  351 LEU A CD2 
473  N N   . GLY A 71  ? 0.9191 1.8643 0.8605 0.1371  -0.2296 0.1444  352 GLY A N   
474  C CA  . GLY A 71  ? 0.8587 1.8292 0.8265 0.1241  -0.2303 0.0869  352 GLY A CA  
475  C C   . GLY A 71  ? 0.7578 1.7063 0.6961 0.0913  -0.2126 0.0235  352 GLY A C   
476  O O   . GLY A 71  ? 1.1513 2.1208 1.0901 0.0704  -0.2128 -0.0280 352 GLY A O   
477  N N   . LEU A 72  ? 0.7696 1.6745 0.6803 0.0867  -0.1971 0.0255  353 LEU A N   
478  C CA  . LEU A 72  ? 0.8710 1.7527 0.7577 0.0653  -0.1822 -0.0347 353 LEU A CA  
479  C C   . LEU A 72  ? 0.9047 1.8823 0.7486 0.0402  -0.1877 -0.0566 353 LEU A C   
480  O O   . LEU A 72  ? 0.9751 1.9526 0.8018 0.0220  -0.1799 -0.1171 353 LEU A O   
481  C CB  . LEU A 72  ? 0.7813 1.5811 0.6680 0.0742  -0.1623 -0.0313 353 LEU A CB  
482  C CG  . LEU A 72  ? 0.7737 1.5300 0.6489 0.0655  -0.1498 -0.0960 353 LEU A CG  
483  C CD1 . LEU A 72  ? 0.8310 1.5305 0.7213 0.0635  -0.1527 -0.1317 353 LEU A CD1 
484  C CD2 . LEU A 72  ? 0.9140 1.6087 0.7944 0.0765  -0.1329 -0.0920 353 LEU A CD2 
485  N N   . ARG A 73  ? 0.8195 1.8753 0.6430 0.0389  -0.2018 -0.0080 354 ARG A N   
486  C CA  . ARG A 73  ? 1.0211 2.1770 0.7981 0.0095  -0.2062 -0.0243 354 ARG A CA  
487  C C   . ARG A 73  ? 1.0377 2.2326 0.8125 -0.0168 -0.2012 -0.0878 354 ARG A C   
488  O O   . ARG A 73  ? 1.0462 2.2544 0.8001 -0.0394 -0.1840 -0.1327 354 ARG A O   
489  C CB  . ARG A 73  ? 1.0059 2.2215 0.7629 0.0112  -0.2227 0.0446  354 ARG A CB  
490  C CG  . ARG A 73  ? 1.0113 2.3070 0.7389 -0.0229 -0.2181 0.0278  354 ARG A CG  
491  C CD  . ARG A 73  ? 1.1949 2.5315 0.8964 -0.0213 -0.2353 0.0991  354 ARG A CD  
492  N NE  . ARG A 73  ? 1.3995 2.7327 1.1322 0.0135  -0.2609 0.1454  354 ARG A NE  
493  C CZ  . ARG A 73  ? 1.4731 2.7807 1.1953 0.0393  -0.2793 0.2193  354 ARG A CZ  
494  N NH1 . ARG A 73  ? 1.4132 2.6928 1.0856 0.0274  -0.2738 0.2588  354 ARG A NH1 
495  N NH2 . ARG A 73  ? 1.5114 2.8167 1.2716 0.0763  -0.3021 0.2511  354 ARG A NH2 
496  N N   . PRO A 74  ? 1.0877 2.2959 0.8881 -0.0153 -0.2116 -0.0938 355 PRO A N   
497  C CA  . PRO A 74  ? 1.0310 2.2710 0.8243 -0.0467 -0.2013 -0.1499 355 PRO A CA  
498  C C   . PRO A 74  ? 1.0241 2.1825 0.8111 -0.0570 -0.1846 -0.2182 355 PRO A C   
499  O O   . PRO A 74  ? 1.0789 2.2415 0.8533 -0.0834 -0.1712 -0.2679 355 PRO A O   
500  C CB  . PRO A 74  ? 0.9768 2.2546 0.7997 -0.0428 -0.2159 -0.1359 355 PRO A CB  
501  C CG  . PRO A 74  ? 1.0792 2.3055 0.9339 -0.0086 -0.2284 -0.1016 355 PRO A CG  
502  C CD  . PRO A 74  ? 1.1059 2.3049 0.9454 0.0118  -0.2296 -0.0564 355 PRO A CD  
503  N N   . PHE A 75  ? 0.9849 2.0629 0.7797 -0.0347 -0.1858 -0.2187 356 PHE A N   
504  C CA  . PHE A 75  ? 1.0210 2.0038 0.8051 -0.0373 -0.1728 -0.2784 356 PHE A CA  
505  C C   . PHE A 75  ? 1.0803 2.0525 0.8475 -0.0342 -0.1580 -0.3051 356 PHE A C   
506  O O   . PHE A 75  ? 1.0885 1.9842 0.8486 -0.0312 -0.1474 -0.3564 356 PHE A O   
507  C CB  . PHE A 75  ? 1.0137 1.8881 0.8258 -0.0140 -0.1711 -0.2620 356 PHE A CB  
508  C CG  . PHE A 75  ? 0.9697 1.8445 0.8046 -0.0210 -0.1790 -0.2508 356 PHE A CG  
509  C CD1 . PHE A 75  ? 0.9795 1.7989 0.7995 -0.0453 -0.1744 -0.3006 356 PHE A CD1 
510  C CD2 . PHE A 75  ? 1.0459 1.9764 0.9150 -0.0042 -0.1908 -0.1931 356 PHE A CD2 
511  C CE1 . PHE A 75  ? 1.0628 1.8949 0.9038 -0.0587 -0.1785 -0.2969 356 PHE A CE1 
512  C CE2 . PHE A 75  ? 1.1106 2.0569 1.0090 -0.0085 -0.1975 -0.1904 356 PHE A CE2 
513  C CZ  . PHE A 75  ? 1.0981 2.0018 0.9835 -0.0388 -0.1899 -0.2444 356 PHE A CZ  
514  N N   . ILE A 76  ? 1.1035 2.1501 0.8647 -0.0350 -0.1572 -0.2693 357 ILE A N   
515  C CA  . ILE A 76  ? 1.1065 2.1671 0.8565 -0.0380 -0.1405 -0.2955 357 ILE A CA  
516  C C   . ILE A 76  ? 1.1309 2.2520 0.8714 -0.0674 -0.1280 -0.3310 357 ILE A C   
517  O O   . ILE A 76  ? 1.0406 2.2421 0.7732 -0.0879 -0.1329 -0.3015 357 ILE A O   
518  C CB  . ILE A 76  ? 1.0551 2.1631 0.7952 -0.0343 -0.1419 -0.2397 357 ILE A CB  
519  C CG1 . ILE A 76  ? 0.9838 2.0155 0.7464 -0.0056 -0.1473 -0.1946 357 ILE A CG1 
520  C CG2 . ILE A 76  ? 0.8786 2.0092 0.6111 -0.0425 -0.1212 -0.2731 357 ILE A CG2 
521  C CD1 . ILE A 76  ? 0.8023 1.7351 0.5861 0.0158  -0.1340 -0.2322 357 ILE A CD1 
522  N N   . PRO A 77  ? 1.1927 2.2740 0.9361 -0.0669 -0.1131 -0.3938 358 PRO A N   
523  C CA  . PRO A 77  ? 1.2839 2.4175 1.0226 -0.0933 -0.0992 -0.4343 358 PRO A CA  
524  C C   . PRO A 77  ? 1.3175 2.5668 1.0477 -0.1172 -0.0924 -0.4093 358 PRO A C   
525  O O   . PRO A 77  ? 1.3364 2.6067 1.0631 -0.1103 -0.0920 -0.3776 358 PRO A O   
526  C CB  . PRO A 77  ? 1.2353 2.2980 0.9851 -0.0736 -0.0876 -0.4945 358 PRO A CB  
527  C CG  . PRO A 77  ? 1.1503 2.0974 0.9034 -0.0431 -0.0988 -0.4920 358 PRO A CG  
528  C CD  . PRO A 77  ? 1.1157 2.0902 0.8692 -0.0373 -0.1112 -0.4292 358 PRO A CD  
529  N N   . GLU A 78  ? 1.3192 2.6397 1.0424 -0.1489 -0.0860 -0.4238 359 GLU A N   
530  C CA  . GLU A 78  ? 1.4337 2.8657 1.1427 -0.1782 -0.0818 -0.3956 359 GLU A CA  
531  C C   . GLU A 78  ? 1.4175 2.8779 1.1263 -0.1803 -0.0681 -0.4012 359 GLU A C   
532  O O   . GLU A 78  ? 1.4916 2.9952 1.1805 -0.1903 -0.0727 -0.3479 359 GLU A O   
533  C CB  . GLU A 78  ? 1.1071 2.6071 0.8136 -0.2134 -0.0714 -0.4305 359 GLU A CB  
534  N N   . LYS A 79  ? 1.3461 2.7801 1.0766 -0.1711 -0.0519 -0.4653 360 LYS A N   
535  C CA  . LYS A 79  ? 1.4259 2.9041 1.1659 -0.1766 -0.0357 -0.4829 360 LYS A CA  
536  C C   . LYS A 79  ? 1.5115 2.9587 1.2461 -0.1579 -0.0407 -0.4406 360 LYS A C   
537  O O   . LYS A 79  ? 1.5341 3.0402 1.2568 -0.1796 -0.0312 -0.4206 360 LYS A O   
538  C CB  . LYS A 79  ? 1.3768 2.8273 1.1509 -0.1599 -0.0216 -0.5620 360 LYS A CB  
539  C CG  . LYS A 79  ? 1.3009 2.6260 1.0873 -0.1186 -0.0321 -0.5881 360 LYS A CG  
540  C CD  . LYS A 79  ? 1.1492 2.4155 0.9554 -0.0798 -0.0349 -0.5892 360 LYS A CD  
541  C CE  . LYS A 79  ? 1.1601 2.3038 0.9797 -0.0399 -0.0437 -0.6279 360 LYS A CE  
542  N NZ  . LYS A 79  ? 1.3029 2.4420 1.1328 -0.0420 -0.0353 -0.6894 360 LYS A NZ  
543  N N   . ASP A 80  ? 1.4890 2.8430 1.2292 -0.1227 -0.0544 -0.4273 361 ASP A N   
544  C CA  . ASP A 80  ? 1.4770 2.7968 1.2111 -0.1054 -0.0593 -0.3855 361 ASP A CA  
545  C C   . ASP A 80  ? 1.4810 2.8189 1.1818 -0.1175 -0.0761 -0.3047 361 ASP A C   
546  O O   . ASP A 80  ? 1.4752 2.8084 1.1575 -0.1176 -0.0775 -0.2572 361 ASP A O   
547  C CB  . ASP A 80  ? 1.3819 2.5946 1.1378 -0.0628 -0.0676 -0.4063 361 ASP A CB  
548  C CG  . ASP A 80  ? 1.3726 2.5600 1.1619 -0.0399 -0.0547 -0.4686 361 ASP A CG  
549  O OD1 . ASP A 80  ? 1.4089 2.6693 1.2087 -0.0562 -0.0380 -0.4894 361 ASP A OD1 
550  O OD2 . ASP A 80  ? 1.4144 2.5089 1.2209 -0.0054 -0.0629 -0.4954 361 ASP A OD2 
551  N N   . SER A 81  ? 1.4956 2.8526 1.1897 -0.1267 -0.0891 -0.2890 362 SER A N   
552  C CA  . SER A 81  ? 1.5098 2.8822 1.1826 -0.1283 -0.1103 -0.2131 362 SER A CA  
553  C C   . SER A 81  ? 1.3733 2.8083 1.0096 -0.1566 -0.1083 -0.1637 362 SER A C   
554  O O   . SER A 81  ? 1.3114 2.7274 0.9250 -0.1490 -0.1230 -0.0936 362 SER A O   
555  C CB  . SER A 81  ? 1.6508 3.0509 1.3296 -0.1359 -0.1221 -0.2158 362 SER A CB  
556  O OG  . SER A 81  ? 1.8072 3.2938 1.4728 -0.1719 -0.1125 -0.2318 362 SER A OG  
557  N N   . GLN A 82  ? 1.3452 2.8487 0.9752 -0.1902 -0.0898 -0.2005 363 GLN A N   
558  C CA  . GLN A 82  ? 1.4133 2.9782 1.0043 -0.2274 -0.0849 -0.1626 363 GLN A CA  
559  C C   . GLN A 82  ? 1.4113 2.9329 0.9805 -0.2241 -0.0801 -0.1251 363 GLN A C   
560  O O   . GLN A 82  ? 1.4033 2.9242 0.9275 -0.2394 -0.0904 -0.0552 363 GLN A O   
562  N N   . HIS A 83  ? 1.4348 2.9145 1.0339 -0.2037 -0.0648 -0.1712 364 HIS A N   
563  C CA  . HIS A 83  ? 1.4257 2.8658 1.0080 -0.2023 -0.0558 -0.1439 364 HIS A CA  
564  C C   . HIS A 83  ? 1.3899 2.7483 0.9624 -0.1684 -0.0759 -0.0814 364 HIS A C   
565  O O   . HIS A 83  ? 1.4405 2.7670 0.9776 -0.1764 -0.0737 -0.0253 364 HIS A O   
566  C CB  . HIS A 83  ? 1.3084 2.7446 0.9326 -0.1915 -0.0324 -0.2189 364 HIS A CB  
567  N N   . PHE A 84  ? 1.3567 2.6786 0.9605 -0.1335 -0.0938 -0.0909 365 PHE A N   
568  C CA  . PHE A 84  ? 0.9866 2.2379 0.5943 -0.0993 -0.1133 -0.0380 365 PHE A CA  
569  C C   . PHE A 84  ? 1.3034 2.5551 0.8785 -0.1013 -0.1346 0.0512  365 PHE A C   
570  O O   . PHE A 84  ? 1.3266 2.5098 0.8991 -0.0812 -0.1402 0.1096  365 PHE A O   
571  C CB  . PHE A 84  ? 1.1070 2.3223 0.7592 -0.0676 -0.1267 -0.0754 365 PHE A CB  
572  C CG  . PHE A 84  ? 1.0831 2.1927 0.7761 -0.0310 -0.1325 -0.0353 365 PHE A CG  
573  C CD1 . PHE A 84  ? 1.0928 2.1229 0.8088 -0.0169 -0.1140 -0.0380 365 PHE A CD1 
574  C CD2 . PHE A 84  ? 0.9874 2.0862 0.6986 -0.0127 -0.1552 0.0000  365 PHE A CD2 
575  C CE1 . PHE A 84  ? 0.9988 1.9348 0.7517 0.0121  -0.1166 -0.0049 365 PHE A CE1 
576  C CE2 . PHE A 84  ? 0.9405 1.9492 0.6928 0.0185  -0.1576 0.0303  365 PHE A CE2 
577  C CZ  . PHE A 84  ? 1.0333 1.9574 0.8049 0.0296  -0.1375 0.0282  365 PHE A CZ  
578  N N   . GLU A 85  ? 1.0871 2.4007 0.6470 -0.1223 -0.1439 0.0612  366 GLU A N   
579  C CA  . GLU A 85  ? 1.5465 2.8575 1.0783 -0.1175 -0.1688 0.1428  366 GLU A CA  
580  C C   . GLU A 85  ? 1.5251 2.8062 0.9977 -0.1399 -0.1622 0.2029  366 GLU A C   
581  O O   . GLU A 85  ? 1.4419 2.6568 0.8978 -0.1171 -0.1780 0.2752  366 GLU A O   
582  C CB  . GLU A 85  ? 1.6471 3.0373 1.1770 -0.1347 -0.1811 0.1340  366 GLU A CB  
583  C CG  . GLU A 85  ? 1.6975 3.1031 1.2791 -0.1141 -0.1887 0.0881  366 GLU A CG  
584  C CD  . GLU A 85  ? 1.8725 3.3636 1.4506 -0.1375 -0.1947 0.0727  366 GLU A CD  
585  O OE1 . GLU A 85  ? 1.9658 3.5027 1.5031 -0.1623 -0.2009 0.1101  366 GLU A OE1 
586  O OE2 . GLU A 85  ? 1.8949 3.4049 1.5072 -0.1344 -0.1926 0.0230  366 GLU A OE2 
587  N N   . ASN A 86  ? 1.5444 2.8685 0.9875 -0.1856 -0.1373 0.1705  367 ASN A N   
588  C CA  . ASN A 86  ? 1.6315 2.9236 1.0139 -0.2179 -0.1249 0.2174  367 ASN A CA  
589  C C   . ASN A 86  ? 1.6513 2.8555 1.0344 -0.1998 -0.1112 0.2378  367 ASN A C   
590  O O   . ASN A 86  ? 1.3743 2.5134 0.7073 -0.2130 -0.1077 0.3005  367 ASN A O   
591  C CB  . ASN A 86  ? 1.3555 2.7223 0.7199 -0.2734 -0.0970 0.1638  367 ASN A CB  
592  N N   . PHE A 87  ? 1.5975 2.7936 1.0351 -0.1708 -0.1033 0.1841  368 PHE A N   
593  C CA  . PHE A 87  ? 1.5634 2.6672 1.0285 -0.1480 -0.0873 0.1908  368 PHE A CA  
594  C C   . PHE A 87  ? 1.6279 2.6302 1.1004 -0.1119 -0.1060 0.2715  368 PHE A C   
595  O O   . PHE A 87  ? 1.6427 2.5518 1.1247 -0.1044 -0.0889 0.2950  368 PHE A O   
596  C CB  . PHE A 87  ? 1.4829 2.5783 1.0261 -0.1179 -0.0786 0.1105  368 PHE A CB  
597  C CG  . PHE A 87  ? 1.3663 2.3537 0.9591 -0.0872 -0.0663 0.1157  368 PHE A CG  
598  C CD1 . PHE A 87  ? 1.2848 2.2348 0.8620 -0.1081 -0.0384 0.1223  368 PHE A CD1 
599  C CD2 . PHE A 87  ? 1.2596 2.1892 0.9118 -0.0435 -0.0807 0.1095  368 PHE A CD2 
600  C CE1 . PHE A 87  ? 1.1103 1.9680 0.7318 -0.0836 -0.0265 0.1247  368 PHE A CE1 
601  C CE2 . PHE A 87  ? 0.9264 1.7621 0.6206 -0.0202 -0.0689 0.1127  368 PHE A CE2 
602  C CZ  . PHE A 87  ? 1.0174 1.8178 0.6973 -0.0390 -0.0424 0.1207  368 PHE A CZ  
603  N N   . LEU A 88  ? 1.6900 2.7162 1.1601 -0.0894 -0.1408 0.3099  369 LEU A N   
604  C CA  . LEU A 88  ? 1.7276 2.6730 1.1978 -0.0534 -0.1631 0.3898  369 LEU A CA  
605  C C   . LEU A 88  ? 1.8450 2.7386 1.2301 -0.0837 -0.1564 0.4598  369 LEU A C   
606  O O   . LEU A 88  ? 1.9050 2.8464 1.2319 -0.1350 -0.1437 0.4494  369 LEU A O   
607  C CB  . LEU A 88  ? 1.6483 2.6552 1.1280 -0.0269 -0.2041 0.4130  369 LEU A CB  
608  C CG  . LEU A 88  ? 1.5526 2.4864 1.0529 0.0235  -0.2314 0.4832  369 LEU A CG  
609  C CD1 . LEU A 88  ? 1.3198 2.1824 0.9031 0.0639  -0.2209 0.4594  369 LEU A CD1 
610  C CD2 . LEU A 88  ? 1.3559 2.3491 0.8713 0.0421  -0.2656 0.4927  369 LEU A CD2 
611  N N   . GLU A 89  ? 1.8000 2.5791 1.1886 -0.0534 -0.1608 0.5211  370 GLU A N   
612  C CA  . GLU A 89  ? 1.8302 2.5275 1.1341 -0.0811 -0.1523 0.5901  370 GLU A CA  
613  C C   . GLU A 89  ? 1.8805 2.5927 1.1212 -0.0975 -0.1771 0.6281  370 GLU A C   
614  O O   . GLU A 89  ? 1.7373 2.5397 0.9967 -0.0884 -0.2024 0.6089  370 GLU A O   
615  C CB  . GLU A 89  ? 1.8129 2.3714 1.1452 -0.0360 -0.1534 0.6408  370 GLU A CB  
616  C CG  . GLU A 89  ? 1.6949 2.1992 1.1066 -0.0235 -0.1196 0.5860  370 GLU A CG  
617  C CD  . GLU A 89  ? 1.7686 2.1398 1.2091 0.0178  -0.1187 0.6318  370 GLU A CD  
618  O OE1 . GLU A 89  ? 1.8431 2.1737 1.2651 0.0543  -0.1514 0.6980  370 GLU A OE1 
619  O OE2 . GLU A 89  ? 1.6944 2.0042 1.1767 0.0153  -0.0861 0.5999  370 GLU A OE2 
620  N N   . SER B 2   ? 1.0129 0.9200 1.0062 -0.0006 -0.0515 0.2659  0   SER B N   
621  C CA  . SER B 2   ? 1.1417 1.0964 1.2122 -0.0346 -0.0411 0.2397  0   SER B CA  
622  C C   . SER B 2   ? 1.2538 1.1672 1.3463 -0.0269 -0.0454 0.2217  0   SER B C   
623  O O   . SER B 2   ? 1.3265 1.2802 1.4803 -0.0495 -0.0460 0.1920  0   SER B O   
624  C CB  . SER B 2   ? 1.1753 1.1289 1.2746 -0.0634 -0.0037 0.2563  0   SER B CB  
625  O OG  . SER B 2   ? 1.1116 1.1019 1.2871 -0.0935 0.0009  0.2290  0   SER B OG  
626  N N   . MET B 3   ? 1.2433 1.0707 1.2805 0.0068  -0.0518 0.2384  1   MET B N   
627  C CA  . MET B 3   ? 1.2007 0.9795 1.2530 0.0201  -0.0619 0.2218  1   MET B CA  
628  C C   . MET B 3   ? 1.2048 1.0627 1.3218 0.0147  -0.0901 0.1730  1   MET B C   
629  O O   . MET B 3   ? 1.2245 1.0964 1.3967 -0.0035 -0.0838 0.1479  1   MET B O   
630  C CB  . MET B 3   ? 1.2891 0.9669 1.2596 0.0657  -0.0811 0.2431  1   MET B CB  
631  C CG  . MET B 3   ? 1.3435 0.9594 1.3216 0.0877  -0.1009 0.2260  1   MET B CG  
632  S SD  . MET B 3   ? 1.8477 1.3894 1.8436 0.0646  -0.0582 0.2391  1   MET B SD  
633  C CE  . MET B 3   ? 1.1781 0.6206 1.1434 0.1084  -0.0959 0.2282  1   MET B CE  
634  N N   . ASP B 4   ? 1.0872 0.9951 1.1981 0.0289  -0.1175 0.1587  2   ASP B N   
635  C CA  . ASP B 4   ? 0.9331 0.9140 1.1006 0.0234  -0.1366 0.1121  2   ASP B CA  
636  C C   . ASP B 4   ? 0.7921 0.8458 1.0040 -0.0190 -0.1186 0.0922  2   ASP B C   
637  O O   . ASP B 4   ? 0.8547 0.9446 1.1125 -0.0310 -0.1213 0.0536  2   ASP B O   
638  C CB  . ASP B 4   ? 1.0384 1.0566 1.1925 0.0431  -0.1625 0.1043  2   ASP B CB  
639  C CG  . ASP B 4   ? 1.3309 1.2758 1.4424 0.0904  -0.1925 0.1163  2   ASP B CG  
640  O OD1 . ASP B 4   ? 1.2390 1.1267 1.3575 0.1115  -0.2052 0.1063  2   ASP B OD1 
641  O OD2 . ASP B 4   ? 1.4917 1.4324 1.5600 0.1077  -0.2071 0.1344  2   ASP B OD2 
642  N N   . GLU B 5   ? 0.8090 0.8787 1.0040 -0.0399 -0.1019 0.1171  3   GLU B N   
643  C CA  . GLU B 5   ? 0.8239 0.9529 1.0524 -0.0767 -0.0929 0.0998  3   GLU B CA  
644  C C   . GLU B 5   ? 0.8225 0.9316 1.0958 -0.0951 -0.0800 0.0857  3   GLU B C   
645  O O   . GLU B 5   ? 0.6934 0.8420 0.9998 -0.1148 -0.0848 0.0508  3   GLU B O   
646  C CB  . GLU B 5   ? 0.8141 0.9621 1.0204 -0.0906 -0.0839 0.1282  3   GLU B CB  
647  C CG  . GLU B 5   ? 0.9476 1.1528 1.1814 -0.1248 -0.0850 0.1095  3   GLU B CG  
648  C CD  . GLU B 5   ? 1.0362 1.2701 1.2467 -0.1333 -0.0865 0.1309  3   GLU B CD  
649  O OE1 . GLU B 5   ? 1.0363 1.2522 1.2091 -0.1137 -0.0848 0.1589  3   GLU B OE1 
650  O OE2 . GLU B 5   ? 1.1826 1.4529 1.4101 -0.1580 -0.0929 0.1181  3   GLU B OE2 
651  N N   . GLN B 6   ? 0.6487 0.6905 0.9192 -0.0888 -0.0622 0.1118  4   GLN B N   
652  C CA  . GLN B 6   ? 0.8171 0.8366 1.1376 -0.1080 -0.0477 0.0999  4   GLN B CA  
653  C C   . GLN B 6   ? 0.7541 0.7665 1.0985 -0.0977 -0.0626 0.0649  4   GLN B C   
654  O O   . GLN B 6   ? 0.6287 0.6633 1.0197 -0.1177 -0.0639 0.0333  4   GLN B O   
655  C CB  . GLN B 6   ? 0.9189 0.8575 1.2281 -0.1040 -0.0182 0.1368  4   GLN B CB  
656  C CG  . GLN B 6   ? 1.0659 0.9853 1.4399 -0.1291 0.0006  0.1245  4   GLN B CG  
657  C CD  . GLN B 6   ? 0.9481 0.9385 1.3804 -0.1630 -0.0028 0.1020  4   GLN B CD  
658  O OE1 . GLN B 6   ? 0.8536 0.8720 1.2832 -0.1733 0.0043  0.1182  4   GLN B OE1 
659  N NE2 . GLN B 6   ? 0.6470 0.6620 1.1297 -0.1782 -0.0173 0.0626  4   GLN B NE2 
660  N N   . GLU B 7   ? 0.6259 0.6064 0.9395 -0.0646 -0.0772 0.0678  5   GLU B N   
661  C CA  . GLU B 7   ? 0.7347 0.7064 1.0768 -0.0497 -0.0932 0.0328  5   GLU B CA  
662  C C   . GLU B 7   ? 0.7367 0.7903 1.1114 -0.0656 -0.1024 -0.0130 5   GLU B C   
663  O O   . GLU B 7   ? 0.8919 0.9518 1.3065 -0.0705 -0.1049 -0.0497 5   GLU B O   
664  C CB  . GLU B 7   ? 0.8121 0.7311 1.1178 -0.0071 -0.1139 0.0434  5   GLU B CB  
665  N N   . ALA B 8   ? 0.6127 0.7228 0.9656 -0.0744 -0.1047 -0.0112 6   ALA B N   
666  C CA  . ALA B 8   ? 0.4796 0.6568 0.8478 -0.0942 -0.1060 -0.0511 6   ALA B CA  
667  C C   . ALA B 8   ? 0.5201 0.7116 0.9050 -0.1270 -0.0983 -0.0657 6   ALA B C   
668  O O   . ALA B 8   ? 0.6673 0.8736 1.0747 -0.1372 -0.0985 -0.1057 6   ALA B O   
669  C CB  . ALA B 8   ? 0.4366 0.6599 0.7713 -0.0974 -0.1088 -0.0420 6   ALA B CB  
670  N N   . LEU B 9   ? 0.4672 0.6534 0.8430 -0.1423 -0.0932 -0.0365 7   LEU B N   
671  C CA  . LEU B 9   ? 0.5026 0.7026 0.9009 -0.1715 -0.0941 -0.0524 7   LEU B CA  
672  C C   . LEU B 9   ? 0.5876 0.7547 1.0336 -0.1749 -0.0920 -0.0760 7   LEU B C   
673  O O   . LEU B 9   ? 0.6073 0.7908 1.0698 -0.1937 -0.0999 -0.1094 7   LEU B O   
674  C CB  . LEU B 9   ? 0.4690 0.6670 0.8688 -0.1841 -0.0894 -0.0192 7   LEU B CB  
675  C CG  . LEU B 9   ? 0.4752 0.7162 0.8350 -0.1922 -0.0984 -0.0084 7   LEU B CG  
676  C CD1 . LEU B 9   ? 0.4809 0.7177 0.8572 -0.2024 -0.0929 0.0210  7   LEU B CD1 
677  C CD2 . LEU B 9   ? 0.6960 0.9724 1.0385 -0.2110 -0.1143 -0.0456 7   LEU B CD2 
678  N N   . ASN B 10  ? 0.5399 0.6537 1.0009 -0.1555 -0.0835 -0.0589 8   ASN B N   
679  C CA  . ASN B 10  ? 0.7270 0.8025 1.2322 -0.1552 -0.0820 -0.0807 8   ASN B CA  
680  C C   . ASN B 10  ? 0.6983 0.7961 1.2124 -0.1482 -0.0928 -0.1283 8   ASN B C   
681  O O   . ASN B 10  ? 0.7523 0.8478 1.2996 -0.1604 -0.0961 -0.1626 8   ASN B O   
682  C CB  . ASN B 10  ? 0.8375 0.8383 1.3400 -0.1327 -0.0711 -0.0481 8   ASN B CB  
683  C CG  . ASN B 10  ? 0.9902 0.9534 1.5015 -0.1466 -0.0486 -0.0103 8   ASN B CG  
684  O OD1 . ASN B 10  ? 0.9148 0.9163 1.4360 -0.1686 -0.0445 -0.0046 8   ASN B OD1 
685  N ND2 . ASN B 10  ? 1.2555 1.1386 1.7639 -0.1340 -0.0324 0.0143  8   ASN B ND2 
686  N N   . SER B 11  ? 0.6259 0.7442 1.1152 -0.1282 -0.0973 -0.1326 9   SER B N   
687  C CA  . SER B 11  ? 0.6478 0.7946 1.1516 -0.1222 -0.1009 -0.1804 9   SER B CA  
688  C C   . SER B 11  ? 0.7145 0.9062 1.2037 -0.1514 -0.0973 -0.2130 9   SER B C   
689  O O   . SER B 11  ? 0.7450 0.9377 1.2539 -0.1584 -0.0963 -0.2549 9   SER B O   
690  C CB  . SER B 11  ? 0.6970 0.8642 1.1870 -0.0983 -0.1051 -0.1787 9   SER B CB  
691  O OG  . SER B 11  ? 0.5752 0.7899 1.0762 -0.1036 -0.0987 -0.2253 9   SER B OG  
692  N N   . ILE B 12  ? 0.5307 0.7520 0.9784 -0.1668 -0.0971 -0.1937 10  ILE B N   
693  C CA  . ILE B 12  ? 0.8085 1.0590 1.2224 -0.1927 -0.0981 -0.2201 10  ILE B CA  
694  C C   . ILE B 12  ? 0.7587 0.9874 1.1947 -0.2095 -0.1084 -0.2397 10  ILE B C   
695  O O   . ILE B 12  ? 0.7757 1.0099 1.1917 -0.2229 -0.1112 -0.2793 10  ILE B O   
696  C CB  . ILE B 12  ? 0.7576 1.0320 1.1236 -0.2045 -0.1023 -0.1901 10  ILE B CB  
697  C CG1 . ILE B 12  ? 0.6122 0.9091 0.9586 -0.1888 -0.0941 -0.1741 10  ILE B CG1 
698  C CG2 . ILE B 12  ? 0.5216 0.8100 0.8392 -0.2291 -0.1087 -0.2163 10  ILE B CG2 
699  C CD1 . ILE B 12  ? 0.6109 0.9302 0.9097 -0.1990 -0.0981 -0.1461 10  ILE B CD1 
700  N N   . MET B 13  ? 0.5666 0.7656 1.0437 -0.2085 -0.1124 -0.2134 11  MET B N   
701  C CA  . MET B 13  ? 0.7208 0.9003 1.2346 -0.2252 -0.1237 -0.2310 11  MET B CA  
702  C C   . MET B 13  ? 0.8063 0.9639 1.3523 -0.2191 -0.1229 -0.2712 11  MET B C   
703  O O   . MET B 13  ? 0.7900 0.9473 1.3345 -0.2328 -0.1348 -0.3101 11  MET B O   
704  C CB  . MET B 13  ? 0.5888 0.7413 1.1486 -0.2279 -0.1194 -0.1931 11  MET B CB  
705  C CG  . MET B 13  ? 0.6282 0.7628 1.2450 -0.2466 -0.1310 -0.2140 11  MET B CG  
706  S SD  . MET B 13  ? 0.9971 1.0916 1.6831 -0.2512 -0.1113 -0.1733 11  MET B SD  
707  C CE  . MET B 13  ? 0.6527 0.7464 1.4005 -0.2740 -0.1318 -0.2075 11  MET B CE  
708  N N   . ASN B 14  ? 0.6416 0.7760 1.2124 -0.1965 -0.1124 -0.2635 12  ASN B N   
709  C CA  . ASN B 14  ? 0.7721 0.8832 1.3795 -0.1873 -0.1130 -0.3013 12  ASN B CA  
710  C C   . ASN B 14  ? 0.7470 0.8900 1.3277 -0.1884 -0.1094 -0.3507 12  ASN B C   
711  O O   . ASN B 14  ? 0.7903 0.9210 1.3925 -0.1899 -0.1115 -0.3934 12  ASN B O   
712  C CB  . ASN B 14  ? 0.8811 0.9530 1.5148 -0.1590 -0.1080 -0.2806 12  ASN B CB  
713  C CG  . ASN B 14  ? 0.9556 0.9800 1.6048 -0.1592 -0.1030 -0.2325 12  ASN B CG  
714  O OD1 . ASN B 14  ? 1.0918 1.1164 1.7558 -0.1822 -0.1018 -0.2220 12  ASN B OD1 
715  N ND2 . ASN B 14  ? 0.8167 0.7949 1.4621 -0.1330 -0.0998 -0.2049 12  ASN B ND2 
716  N N   . ASP B 15  ? 0.6638 0.8445 1.1975 -0.1885 -0.1005 -0.3458 13  ASP B N   
717  C CA  . ASP B 15  ? 0.9472 1.1554 1.4496 -0.1934 -0.0869 -0.3907 13  ASP B CA  
718  C C   . ASP B 15  ? 1.0217 1.2280 1.4737 -0.2194 -0.0940 -0.4166 13  ASP B C   
719  O O   . ASP B 15  ? 1.1865 1.3850 1.6284 -0.2240 -0.0877 -0.4640 13  ASP B O   
720  C CB  . ASP B 15  ? 0.6460 0.8911 1.1165 -0.1882 -0.0721 -0.3770 13  ASP B CB  
721  C CG  . ASP B 15  ? 0.9602 1.2078 1.4813 -0.1582 -0.0683 -0.3740 13  ASP B CG  
722  O OD1 . ASP B 15  ? 1.0045 1.2257 1.5781 -0.1414 -0.0740 -0.3925 13  ASP B OD1 
723  O OD2 . ASP B 15  ? 0.7171 0.9900 1.2257 -0.1502 -0.0635 -0.3550 13  ASP B OD2 
724  N N   . LEU B 16  ? 0.9961 1.2046 1.4146 -0.2343 -0.1096 -0.3873 14  LEU B N   
725  C CA  . LEU B 16  ? 1.0397 1.2375 1.4048 -0.2555 -0.1275 -0.4094 14  LEU B CA  
726  C C   . LEU B 16  ? 1.0921 1.2579 1.5016 -0.2598 -0.1485 -0.4366 14  LEU B C   
727  O O   . LEU B 16  ? 1.1684 1.3156 1.5335 -0.2683 -0.1586 -0.4747 14  LEU B O   
728  C CB  . LEU B 16  ? 0.8968 1.1048 1.2289 -0.2665 -0.1453 -0.3717 14  LEU B CB  
729  C CG  . LEU B 16  ? 0.9671 1.2012 1.2324 -0.2684 -0.1298 -0.3539 14  LEU B CG  
730  C CD1 . LEU B 16  ? 1.0196 1.2615 1.2619 -0.2766 -0.1505 -0.3163 14  LEU B CD1 
731  C CD2 . LEU B 16  ? 1.1268 1.3522 1.3105 -0.2798 -0.1178 -0.3948 14  LEU B CD2 
732  N N   . VAL B 17  ? 1.1892 1.3412 1.6790 -0.2521 -0.1529 -0.4141 15  VAL B N   
733  C CA  . VAL B 17  ? 1.2440 1.3639 1.7909 -0.2559 -0.1697 -0.4359 15  VAL B CA  
734  C C   . VAL B 17  ? 1.3084 1.4150 1.8614 -0.2473 -0.1604 -0.4849 15  VAL B C   
735  O O   . VAL B 17  ? 1.4690 1.5484 2.0343 -0.2471 -0.1727 -0.5096 15  VAL B O   
736  C CB  . VAL B 17  ? 0.8652 0.9662 1.4946 -0.2520 -0.1670 -0.3980 15  VAL B CB  
737  C CG1 . VAL B 17  ? 0.9514 1.0231 1.6310 -0.2343 -0.1536 -0.4067 15  VAL B CG1 
738  C CG2 . VAL B 17  ? 0.8807 0.9640 1.5359 -0.2621 -0.1851 -0.3890 15  VAL B CG2 
739  N N   . ALA B 18  ? 1.2151 1.3972 1.8774 -0.3427 -0.1336 -0.4236 16  ALA B N   
740  C CA  . ALA B 18  ? 1.0994 1.1656 1.6434 -0.3416 -0.1338 -0.4310 16  ALA B CA  
741  C C   . ALA B 18  ? 1.2162 1.2713 1.6897 -0.2999 -0.1749 -0.4312 16  ALA B C   
742  O O   . ALA B 18  ? 1.1279 1.1089 1.5112 -0.2670 -0.1569 -0.4169 16  ALA B O   
743  C CB  . ALA B 18  ? 0.9617 0.9493 1.4555 -0.3267 -0.0751 -0.4072 16  ALA B CB  
744  N N   . LEU B 19  ? 1.4042 1.5369 1.9208 -0.3010 -0.2300 -0.4442 17  LEU B N   
745  C CA  . LEU B 19  ? 1.4292 1.5506 1.8726 -0.2658 -0.2740 -0.4426 17  LEU B CA  
746  C C   . LEU B 19  ? 1.5812 1.6016 1.9072 -0.2819 -0.2805 -0.4650 17  LEU B C   
747  O O   . LEU B 19  ? 1.5505 1.4991 1.7773 -0.2494 -0.2650 -0.4524 17  LEU B O   
748  C CB  . LEU B 19  ? 1.3275 1.5533 1.8410 -0.2667 -0.3377 -0.4521 17  LEU B CB  
749  C CG  . LEU B 19  ? 1.2684 1.5608 1.8538 -0.3189 -0.3828 -0.4851 17  LEU B CG  
750  C CD1 . LEU B 19  ? 1.1841 1.4260 1.6788 -0.3438 -0.4314 -0.5171 17  LEU B CD1 
751  C CD2 . LEU B 19  ? 1.2007 1.6195 1.8956 -0.2998 -0.4213 -0.4758 17  LEU B CD2 
752  N N   . GLN B 20  ? 1.7680 1.7836 2.1096 -0.3338 -0.3015 -0.4996 18  GLN B N   
753  C CA  . GLN B 20  ? 1.8405 1.7528 2.0827 -0.3577 -0.3015 -0.5294 18  GLN B CA  
754  C C   . GLN B 20  ? 1.8487 1.7657 2.1590 -0.4178 -0.2952 -0.5478 18  GLN B C   
755  O O   . GLN B 20  ? 1.9877 1.9617 2.3390 -0.4484 -0.3389 -0.5601 18  GLN B O   
756  C CB  . GLN B 20  ? 1.8616 1.7717 2.0269 -0.3539 -0.3637 -0.5544 18  GLN B CB  
757  C CG  . GLN B 20  ? 1.7998 1.6561 1.8465 -0.3001 -0.3571 -0.5353 18  GLN B CG  
758  C CD  . GLN B 20  ? 1.7601 1.4955 1.7062 -0.2954 -0.3091 -0.5434 18  GLN B CD  
759  O OE1 . GLN B 20  ? 1.8800 1.5626 1.8377 -0.3321 -0.2858 -0.5655 18  GLN B OE1 
760  N NE2 . GLN B 20  ? 1.5877 1.2794 1.4388 -0.2496 -0.2932 -0.5234 18  GLN B NE2 
761  N N   . MET B 21  ? 1.7651 1.6233 2.0761 -0.4269 -0.2374 -0.5293 19  MET B N   
762  C CA  . MET B 21  ? 1.7414 1.6048 2.1107 -0.4726 -0.2215 -0.5201 19  MET B CA  
763  C C   . MET B 21  ? 1.5299 1.5248 2.0311 -0.4875 -0.2310 -0.5078 19  MET B C   
764  O O   . MET B 21  ? 1.4079 1.4270 1.9742 -0.5070 -0.1942 -0.4858 19  MET B O   
765  C CB  . MET B 21  ? 1.9236 1.7279 2.2382 -0.5104 -0.2567 -0.5465 19  MET B CB  
766  C CG  . MET B 21  ? 1.9947 1.6810 2.1724 -0.4899 -0.2599 -0.5673 19  MET B CG  
767  S SD  . MET B 21  ? 2.3733 2.0039 2.4848 -0.5312 -0.3156 -0.6069 19  MET B SD  
768  C CE  . MET B 21  ? 2.0051 1.5057 1.9573 -0.4880 -0.3036 -0.6263 19  MET B CE  
769  N N   . GLN B 44  ? 1.7364 1.7641 1.3215 -0.0404 0.2201  -0.1008 42  GLN B N   
770  C CA  . GLN B 44  ? 1.6589 1.6628 1.2933 -0.0400 0.2050  -0.0462 42  GLN B CA  
771  C C   . GLN B 44  ? 1.6000 1.5931 1.2791 -0.0389 0.2426  -0.0214 42  GLN B C   
772  O O   . GLN B 44  ? 1.6929 1.6997 1.3792 -0.0392 0.2768  -0.0485 42  GLN B O   
773  C CB  . GLN B 44  ? 1.4809 1.4602 1.1764 -0.0329 0.1659  -0.0596 42  GLN B CB  
774  C CG  . GLN B 44  ? 1.5789 1.5644 1.2419 -0.0393 0.1190  -0.0698 42  GLN B CG  
775  C CD  . GLN B 44  ? 1.5988 1.5906 1.2593 -0.0439 0.0923  -0.0098 42  GLN B CD  
776  O OE1 . GLN B 44  ? 1.5704 1.5683 1.2101 -0.0439 0.1119  0.0371  42  GLN B OE1 
777  N NE2 . GLN B 44  ? 1.5858 1.5765 1.2725 -0.0476 0.0469  -0.0102 42  GLN B NE2 
778  N N   . SER B 45  ? 1.3660 1.3363 1.0761 -0.0375 0.2356  0.0289  43  SER B N   
779  C CA  A SER B 45  ? 1.1950 1.1455 0.9494 -0.0368 0.2646  0.0496  43  SER B CA  
780  C CA  B SER B 45  ? 1.1945 1.1451 0.9492 -0.0368 0.2647  0.0491  43  SER B CA  
781  C C   . SER B 45  ? 1.0505 0.9751 0.8774 -0.0244 0.2485  0.0393  43  SER B C   
782  O O   . SER B 45  ? 1.0686 0.9690 0.9335 -0.0209 0.2598  0.0632  43  SER B O   
783  C CB  A SER B 45  ? 1.2070 1.1423 0.9416 -0.0414 0.2713  0.1115  43  SER B CB  
784  C CB  B SER B 45  ? 1.2076 1.1430 0.9426 -0.0416 0.2726  0.1106  43  SER B CB  
785  O OG  A SER B 45  ? 1.2174 1.1378 0.9698 -0.0485 0.3076  0.1251  43  SER B OG  
786  O OG  B SER B 45  ? 1.1677 1.0874 0.9227 -0.0314 0.2401  0.1427  43  SER B OG  
787  N N   . ASP B 46  ? 0.8026 0.7299 0.6445 -0.0185 0.2218  0.0038  44  ASP B N   
788  C CA  . ASP B 46  ? 0.7606 0.6652 0.6662 -0.0083 0.2055  -0.0064 44  ASP B CA  
789  C C   . ASP B 46  ? 0.8570 0.7549 0.7983 -0.0039 0.2330  -0.0254 44  ASP B C   
790  O O   . ASP B 46  ? 0.7380 0.6570 0.6617 -0.0080 0.2577  -0.0498 44  ASP B O   
791  C CB  . ASP B 46  ? 0.7972 0.7032 0.7068 -0.0063 0.1751  -0.0466 44  ASP B CB  
792  C CG  . ASP B 46  ? 1.0867 0.9976 0.9804 -0.0125 0.1380  -0.0264 44  ASP B CG  
793  O OD1 . ASP B 46  ? 1.2375 1.1515 1.1283 -0.0135 0.1349  0.0222  44  ASP B OD1 
794  O OD2 . ASP B 46  ? 1.0656 0.9764 0.9540 -0.0159 0.1102  -0.0599 44  ASP B OD2 
795  N N   . VAL B 47  ? 0.8418 0.7152 0.8330 0.0041  0.2292  -0.0135 45  VAL B N   
796  C CA  . VAL B 47  ? 0.7201 0.5887 0.7453 0.0079  0.2490  -0.0311 45  VAL B CA  
797  C C   . VAL B 47  ? 0.6205 0.4882 0.6783 0.0186  0.2331  -0.0723 45  VAL B C   
798  O O   . VAL B 47  ? 0.5776 0.4258 0.6589 0.0249  0.2077  -0.0687 45  VAL B O   
799  C CB  . VAL B 47  ? 0.7512 0.5917 0.8036 0.0116  0.2538  0.0016  45  VAL B CB  
800  C CG1 . VAL B 47  ? 0.7911 0.6273 0.8776 0.0147  0.2663  -0.0188 45  VAL B CG1 
801  C CG2 . VAL B 47  ? 0.6875 0.5217 0.7103 0.0030  0.2712  0.0389  45  VAL B CG2 
802  N N   . ARG B 48  ? 0.6880 0.5775 0.7496 0.0212  0.2484  -0.1103 46  ARG B N   
803  C CA  . ARG B 48  ? 0.6522 0.5367 0.7482 0.0355  0.2333  -0.1494 46  ARG B CA  
804  C C   . ARG B 48  ? 0.7884 0.6655 0.9334 0.0441  0.2378  -0.1496 46  ARG B C   
805  O O   . ARG B 48  ? 0.8088 0.7106 0.9615 0.0395  0.2577  -0.1531 46  ARG B O   
806  C CB  . ARG B 48  ? 0.6677 0.5826 0.7463 0.0397  0.2467  -0.1951 46  ARG B CB  
807  C CG  . ARG B 48  ? 0.7930 0.7208 0.8100 0.0304  0.2450  -0.2002 46  ARG B CG  
808  C CD  . ARG B 48  ? 0.9067 0.8716 0.9010 0.0351  0.2702  -0.2446 46  ARG B CD  
809  N NE  . ARG B 48  ? 1.0455 1.0013 1.0700 0.0550  0.2578  -0.2950 46  ARG B NE  
810  C CZ  . ARG B 48  ? 1.1907 1.1660 1.2552 0.0690  0.2602  -0.3073 46  ARG B CZ  
811  N NH1 . ARG B 48  ? 1.1341 1.1417 1.2174 0.0627  0.2801  -0.2853 46  ARG B NH1 
812  N NH2 . ARG B 48  ? 1.2296 1.1898 1.3129 0.0875  0.2365  -0.3343 46  ARG B NH2 
813  N N   . ILE B 49  ? 0.6904 0.5375 0.8654 0.0531  0.2133  -0.1413 47  ILE B N   
814  C CA  . ILE B 49  ? 0.6411 0.4929 0.8408 0.0549  0.1957  -0.1275 47  ILE B CA  
815  C C   . ILE B 49  ? 0.6715 0.5301 0.8902 0.0673  0.1708  -0.1514 47  ILE B C   
816  O O   . ILE B 49  ? 0.7792 0.6160 1.0008 0.0733  0.1506  -0.1579 47  ILE B O   
817  C CB  . ILE B 49  ? 0.5434 0.3700 0.7464 0.0528  0.1822  -0.0903 47  ILE B CB  
818  C CG1 . ILE B 49  ? 0.4838 0.2979 0.6676 0.0457  0.2078  -0.0640 47  ILE B CG1 
819  C CG2 . ILE B 49  ? 0.6696 0.5035 0.8844 0.0542  0.1668  -0.0806 47  ILE B CG2 
820  C CD1 . ILE B 49  ? 0.5834 0.3814 0.7677 0.0456  0.1960  -0.0274 47  ILE B CD1 
821  N N   . LYS B 50  ? 0.5619 0.4475 0.7952 0.0712  0.1736  -0.1639 48  LYS B N   
822  C CA  . LYS B 50  ? 0.5423 0.4308 0.7952 0.0869  0.1530  -0.1813 48  LYS B CA  
823  C C   . LYS B 50  ? 0.6291 0.5020 0.8942 0.0898  0.1318  -0.1574 48  LYS B C   
824  O O   . LYS B 50  ? 0.5811 0.4666 0.8537 0.0847  0.1371  -0.1462 48  LYS B O   
825  C CB  . LYS B 50  ? 0.5408 0.4696 0.8098 0.0920  0.1680  -0.2049 48  LYS B CB  
826  C CG  . LYS B 50  ? 0.8102 0.7421 1.1032 0.1113  0.1514  -0.2222 48  LYS B CG  
827  C CD  . LYS B 50  ? 0.8723 0.8314 1.1645 0.1209  0.1678  -0.2563 48  LYS B CD  
828  C CE  . LYS B 50  ? 1.0135 1.0214 1.3102 0.1104  0.1984  -0.2622 48  LYS B CE  
829  N NZ  . LYS B 50  ? 1.1534 1.1931 1.4426 0.1198  0.2185  -0.2932 48  LYS B NZ  
830  N N   . PHE B 51  ? 0.5909 0.4353 0.8559 0.0966  0.1091  -0.1506 49  PHE B N   
831  C CA  . PHE B 51  ? 0.6827 0.5125 0.9516 0.0997  0.0913  -0.1271 49  PHE B CA  
832  C C   . PHE B 51  ? 0.6922 0.5228 0.9817 0.1160  0.0779  -0.1394 49  PHE B C   
833  O O   . PHE B 51  ? 0.6231 0.4444 0.9211 0.1260  0.0717  -0.1587 49  PHE B O   
834  C CB  . PHE B 51  ? 0.6778 0.4768 0.9364 0.0948  0.0773  -0.1061 49  PHE B CB  
835  C CG  . PHE B 51  ? 0.6160 0.4148 0.8607 0.0813  0.0880  -0.0838 49  PHE B CG  
836  C CD1 . PHE B 51  ? 0.6316 0.4358 0.8667 0.0766  0.0921  -0.0605 49  PHE B CD1 
837  C CD2 . PHE B 51  ? 0.6408 0.4314 0.8828 0.0747  0.0941  -0.0869 49  PHE B CD2 
838  C CE1 . PHE B 51  ? 0.5737 0.3784 0.7970 0.0666  0.1042  -0.0393 49  PHE B CE1 
839  C CE2 . PHE B 51  ? 0.5245 0.3146 0.7583 0.0650  0.1053  -0.0626 49  PHE B CE2 
840  C CZ  . PHE B 51  ? 0.4993 0.2980 0.7237 0.0616  0.1110  -0.0381 49  PHE B CZ  
841  N N   . GLU B 52  ? 0.6316 0.4699 0.9303 0.1197  0.0729  -0.1283 50  GLU B N   
842  C CA  . GLU B 52  ? 0.6363 0.4795 0.9618 0.1370  0.0610  -0.1381 50  GLU B CA  
843  C C   . GLU B 52  ? 0.6562 0.4726 0.9749 0.1417  0.0428  -0.1122 50  GLU B C   
844  O O   . GLU B 52  ? 0.7250 0.5425 1.0321 0.1363  0.0437  -0.0954 50  GLU B O   
845  C CB  . GLU B 52  ? 0.7293 0.6127 1.0808 0.1382  0.0723  -0.1525 50  GLU B CB  
846  C CG  . GLU B 52  ? 1.1762 1.0781 1.5683 0.1580  0.0624  -0.1688 50  GLU B CG  
847  C CD  . GLU B 52  ? 1.3057 1.2210 1.7130 0.1689  0.0701  -0.1970 50  GLU B CD  
848  O OE1 . GLU B 52  ? 1.5301 1.4476 1.9164 0.1594  0.0860  -0.2073 50  GLU B OE1 
849  O OE2 . GLU B 52  ? 1.0832 1.0064 1.5231 0.1889  0.0605  -0.2094 50  GLU B OE2 
850  N N   . HIS B 53  ? 0.6284 0.4179 0.9528 0.1519  0.0277  -0.1097 51  HIS B N   
851  C CA  . HIS B 53  ? 0.8123 0.5739 1.1295 0.1565  0.0119  -0.0834 51  HIS B CA  
852  C C   . HIS B 53  ? 0.6660 0.4121 1.0103 0.1759  -0.0040 -0.0892 51  HIS B C   
853  O O   . HIS B 53  ? 0.9111 0.6344 1.2611 0.1782  -0.0087 -0.0981 51  HIS B O   
854  C CB  . HIS B 53  ? 0.8524 0.5866 1.1435 0.1420  0.0106  -0.0620 51  HIS B CB  
855  C CG  . HIS B 53  ? 0.8741 0.5814 1.1556 0.1448  -0.0017 -0.0334 51  HIS B CG  
856  N ND1 . HIS B 53  ? 0.9238 0.6346 1.1904 0.1474  -0.0020 -0.0155 51  HIS B ND1 
857  C CD2 . HIS B 53  ? 0.8020 0.4764 1.0870 0.1455  -0.0138 -0.0196 51  HIS B CD2 
858  C CE1 . HIS B 53  ? 0.8208 0.5034 1.0785 0.1505  -0.0128 0.0094  51  HIS B CE1 
859  N NE2 . HIS B 53  ? 0.9281 0.5890 1.1983 0.1483  -0.0196 0.0084  51  HIS B NE2 
860  N N   . ASN B 54  ? 0.8635 0.9428 1.0031 0.2372  -0.0720 0.0476  52  ASN B N   
861  C CA  . ASN B 54  ? 0.7146 0.7907 0.9181 0.2471  -0.0890 0.0756  52  ASN B CA  
862  C C   . ASN B 54  ? 0.7489 0.7605 0.9982 0.2527  -0.0818 0.0449  52  ASN B C   
863  O O   . ASN B 54  ? 0.8272 0.8064 1.1321 0.2578  -0.0943 0.0672  52  ASN B O   
864  C CB  . ASN B 54  ? 0.6841 0.7783 0.9158 0.2444  -0.1071 0.1413  52  ASN B CB  
865  C CG  . ASN B 54  ? 1.0448 1.2211 1.2309 0.2448  -0.1125 0.1770  52  ASN B CG  
866  O OD1 . ASN B 54  ? 0.9953 1.2186 1.1426 0.2518  -0.1130 0.1556  52  ASN B OD1 
867  N ND2 . ASN B 54  ? 0.9461 1.1438 1.1384 0.2383  -0.1180 0.2319  52  ASN B ND2 
868  N N   . GLY B 55  ? 0.6892 0.6859 0.9192 0.2535  -0.0626 -0.0053 53  GLY B N   
869  C CA  . GLY B 55  ? 0.7338 0.6858 1.0000 0.2640  -0.0511 -0.0374 53  GLY B CA  
870  C C   . GLY B 55  ? 0.9664 0.8586 1.2169 0.2571  -0.0412 -0.0583 53  GLY B C   
871  O O   . GLY B 55  ? 1.0276 0.8827 1.2960 0.2680  -0.0302 -0.0916 53  GLY B O   
872  N N   . GLU B 56  ? 1.0767 0.9640 1.2930 0.2402  -0.0459 -0.0386 54  GLU B N   
873  C CA  . GLU B 56  ? 1.2683 1.1019 1.4664 0.2292  -0.0413 -0.0549 54  GLU B CA  
874  C C   . GLU B 56  ? 1.1654 1.0048 1.3081 0.2178  -0.0186 -0.0892 54  GLU B C   
875  O O   . GLU B 56  ? 1.1922 1.0608 1.2994 0.2054  -0.0158 -0.0767 54  GLU B O   
876  C CB  . GLU B 56  ? 1.4208 1.2511 1.6211 0.2148  -0.0593 -0.0075 54  GLU B CB  
877  C CG  . GLU B 56  ? 1.6047 1.3816 1.8632 0.2164  -0.0834 0.0116  54  GLU B CG  
878  C CD  . GLU B 56  ? 1.6621 1.4628 1.9478 0.2052  -0.1058 0.0806  54  GLU B CD  
879  O OE1 . GLU B 56  ? 1.7380 1.6053 1.9923 0.2014  -0.0994 0.1113  54  GLU B OE1 
880  O OE2 . GLU B 56  ? 1.5742 1.3303 1.9159 0.2012  -0.1310 0.1047  54  GLU B OE2 
881  N N   . ARG B 57  ? 0.9917 0.8080 1.1300 0.2235  -0.0023 -0.1307 55  ARG B N   
882  C CA  . ARG B 57  ? 1.0132 0.8326 1.1060 0.2095  0.0165  -0.1553 55  ARG B CA  
883  C C   . ARG B 57  ? 0.7593 0.5381 0.8251 0.1919  0.0107  -0.1516 55  ARG B C   
884  O O   . ARG B 57  ? 0.8599 0.5931 0.9437 0.1945  -0.0039 -0.1512 55  ARG B O   
885  C CB  . ARG B 57  ? 1.1226 0.9444 1.2188 0.2214  0.0373  -0.1931 55  ARG B CB  
886  N N   . ARG B 58  ? 0.6790 0.4735 0.7086 0.1738  0.0188  -0.1481 56  ARG B N   
887  C CA  . ARG B 58  ? 0.7443 0.5064 0.7495 0.1549  0.0145  -0.1441 56  ARG B CA  
888  C C   . ARG B 58  ? 0.8104 0.5921 0.7825 0.1407  0.0321  -0.1586 56  ARG B C   
889  O O   . ARG B 58  ? 0.6607 0.4794 0.6276 0.1370  0.0375  -0.1488 56  ARG B O   
890  C CB  . ARG B 58  ? 0.8866 0.6540 0.8989 0.1451  -0.0016 -0.0992 56  ARG B CB  
891  C CG  . ARG B 58  ? 0.8030 0.5455 0.7964 0.1229  -0.0066 -0.0877 56  ARG B CG  
892  C CD  . ARG B 58  ? 0.7652 0.4463 0.7692 0.1190  -0.0238 -0.1022 56  ARG B CD  
893  N NE  . ARG B 58  ? 0.9156 0.5743 0.9679 0.1295  -0.0469 -0.0812 56  ARG B NE  
894  C CZ  . ARG B 58  ? 1.0980 0.7415 1.1824 0.1177  -0.0714 -0.0370 56  ARG B CZ  
895  N NH1 . ARG B 58  ? 0.9750 0.6242 1.0446 0.0963  -0.0738 -0.0109 56  ARG B NH1 
896  N NH2 . ARG B 58  ? 1.0925 0.7178 1.2325 0.1270  -0.0947 -0.0140 56  ARG B NH2 
897  N N   . ILE B 59  ? 0.8079 0.5660 0.7593 0.1336  0.0388  -0.1821 57  ILE B N   
898  C CA  . ILE B 59  ? 0.7359 0.5156 0.6632 0.1176  0.0532  -0.1880 57  ILE B CA  
899  C C   . ILE B 59  ? 0.7244 0.4817 0.6321 0.0950  0.0433  -0.1703 57  ILE B C   
900  O O   . ILE B 59  ? 0.8387 0.5550 0.7363 0.0895  0.0302  -0.1758 57  ILE B O   
901  C CB  . ILE B 59  ? 0.8533 0.6385 0.7677 0.1233  0.0692  -0.2189 57  ILE B CB  
902  C CG1 . ILE B 59  ? 0.9403 0.7540 0.8839 0.1465  0.0801  -0.2310 57  ILE B CG1 
903  C CG2 . ILE B 59  ? 0.8456 0.6586 0.7425 0.1038  0.0817  -0.2152 57  ILE B CG2 
904  C CD1 . ILE B 59  ? 0.9578 0.7877 0.8918 0.1546  0.0993  -0.2493 57  ILE B CD1 
905  N N   . ILE B 60  ? 0.7460 0.5299 0.6529 0.0832  0.0474  -0.1509 58  ILE B N   
906  C CA  . ILE B 60  ? 0.7505 0.5237 0.6465 0.0620  0.0411  -0.1292 58  ILE B CA  
907  C C   . ILE B 60  ? 0.8348 0.6332 0.7249 0.0482  0.0541  -0.1331 58  ILE B C   
908  O O   . ILE B 60  ? 0.8654 0.6963 0.7710 0.0548  0.0633  -0.1379 58  ILE B O   
909  C CB  . ILE B 60  ? 0.9126 0.7019 0.8230 0.0642  0.0345  -0.0955 58  ILE B CB  
910  C CG1 . ILE B 60  ? 0.8296 0.6031 0.7572 0.0760  0.0194  -0.0800 58  ILE B CG1 
911  C CG2 . ILE B 60  ? 0.7565 0.5412 0.6644 0.0439  0.0299  -0.0685 58  ILE B CG2 
912  C CD1 . ILE B 60  ? 0.8407 0.6485 0.7815 0.0820  0.0160  -0.0410 58  ILE B CD1 
913  N N   . ALA B 61  ? 0.8180 0.6020 0.6909 0.0280  0.0511  -0.1293 59  ALA B N   
914  C CA  . ALA B 61  ? 0.7127 0.5237 0.5892 0.0123  0.0608  -0.1236 59  ALA B CA  
915  C C   . ALA B 61  ? 0.7111 0.5285 0.6039 0.0005  0.0565  -0.0950 59  ALA B C   
916  O O   . ALA B 61  ? 0.7474 0.5457 0.6384 -0.0035 0.0453  -0.0753 59  ALA B O   
917  C CB  . ALA B 61  ? 0.6863 0.4908 0.5348 -0.0028 0.0606  -0.1318 59  ALA B CB  
918  N N   . PHE B 62  ? 0.6300 0.4762 0.5468 -0.0035 0.0644  -0.0909 60  PHE B N   
919  C CA  . PHE B 62  ? 0.5530 0.4076 0.4902 -0.0112 0.0625  -0.0674 60  PHE B CA  
920  C C   . PHE B 62  ? 0.7252 0.5934 0.6814 -0.0322 0.0641  -0.0567 60  PHE B C   
921  O O   . PHE B 62  ? 0.8150 0.7028 0.7885 -0.0328 0.0695  -0.0675 60  PHE B O   
922  C CB  . PHE B 62  ? 0.5676 0.4449 0.5255 0.0108  0.0670  -0.0753 60  PHE B CB  
923  C CG  . PHE B 62  ? 0.6804 0.5565 0.6224 0.0303  0.0646  -0.0743 60  PHE B CG  
924  C CD1 . PHE B 62  ? 0.5799 0.4675 0.5240 0.0362  0.0643  -0.0494 60  PHE B CD1 
925  C CD2 . PHE B 62  ? 0.4643 0.3352 0.3952 0.0432  0.0632  -0.0928 60  PHE B CD2 
926  C CE1 . PHE B 62  ? 0.5446 0.4417 0.4787 0.0530  0.0615  -0.0387 60  PHE B CE1 
927  C CE2 . PHE B 62  ? 0.6182 0.4920 0.5417 0.0596  0.0585  -0.0847 60  PHE B CE2 
928  C CZ  . PHE B 62  ? 0.6241 0.5127 0.5488 0.0635  0.0571  -0.0558 60  PHE B CZ  
929  N N   . SER B 63  ? 0.7509 0.6125 0.7109 -0.0510 0.0576  -0.0296 61  SER B N   
930  C CA  . SER B 63  ? 0.6443 0.5220 0.6279 -0.0735 0.0565  -0.0115 61  SER B CA  
931  C C   . SER B 63  ? 0.5021 0.4011 0.5404 -0.0662 0.0606  -0.0081 61  SER B C   
932  O O   . SER B 63  ? 0.7157 0.6161 0.7657 -0.0463 0.0636  -0.0140 61  SER B O   
933  C CB  . SER B 63  ? 0.7422 0.6063 0.7156 -0.0971 0.0444  0.0183  61  SER B CB  
934  O OG  . SER B 63  ? 0.6684 0.5327 0.6685 -0.0922 0.0434  0.0396  61  SER B OG  
935  N N   . ARG B 64  ? 0.5677 0.4864 0.6426 -0.0805 0.0597  0.0010  62  ARG B N   
936  C CA  . ARG B 64  ? 0.4878 0.4195 0.6265 -0.0744 0.0578  0.0023  62  ARG B CA  
937  C C   . ARG B 64  ? 0.7208 0.6522 0.8877 -0.0866 0.0538  0.0334  62  ARG B C   
938  O O   . ARG B 64  ? 0.7511 0.6824 0.9047 -0.1120 0.0485  0.0632  62  ARG B O   
939  C CB  . ARG B 64  ? 0.4537 0.4078 0.6381 -0.0859 0.0541  0.0063  62  ARG B CB  
940  C CG  . ARG B 64  ? 0.5787 0.5400 0.7484 -0.0727 0.0583  -0.0205 62  ARG B CG  
941  C CD  . ARG B 64  ? 0.4682 0.4592 0.6994 -0.0859 0.0528  -0.0064 62  ARG B CD  
942  N NE  . ARG B 64  ? 0.6934 0.7056 0.9029 -0.0840 0.0611  -0.0127 62  ARG B NE  
943  C CZ  . ARG B 64  ? 0.5965 0.6219 0.8442 -0.0731 0.0573  -0.0274 62  ARG B CZ  
944  N NH1 . ARG B 64  ? 0.3803 0.3945 0.6854 -0.0636 0.0416  -0.0422 62  ARG B NH1 
945  N NH2 . ARG B 64  ? 0.5539 0.6047 0.7848 -0.0700 0.0677  -0.0287 62  ARG B NH2 
946  N N   . PRO B 65  ? 0.6381 0.5725 0.8446 -0.0666 0.0556  0.0252  63  PRO B N   
947  C CA  . PRO B 65  ? 0.5203 0.4572 0.7415 -0.0364 0.0570  -0.0149 63  PRO B CA  
948  C C   . PRO B 65  ? 0.7473 0.6814 0.9119 -0.0109 0.0654  -0.0356 63  PRO B C   
949  O O   . PRO B 65  ? 0.7199 0.6557 0.8635 -0.0068 0.0714  -0.0170 63  PRO B O   
950  C CB  . PRO B 65  ? 0.5937 0.5372 0.8795 -0.0254 0.0542  -0.0146 63  PRO B CB  
951  C CG  . PRO B 65  ? 0.5398 0.4861 0.8228 -0.0387 0.0593  0.0261  63  PRO B CG  
952  C CD  . PRO B 65  ? 0.5238 0.4624 0.7632 -0.0703 0.0556  0.0535  63  PRO B CD  
953  N N   . VAL B 66  ? 0.7524 0.6865 0.8988 0.0043  0.0640  -0.0673 64  VAL B N   
954  C CA  . VAL B 66  ? 0.5655 0.5019 0.6625 0.0270  0.0694  -0.0819 64  VAL B CA  
955  C C   . VAL B 66  ? 0.5866 0.5429 0.6893 0.0584  0.0731  -0.1001 64  VAL B C   
956  O O   . VAL B 66  ? 0.7057 0.6679 0.8398 0.0737  0.0658  -0.1319 64  VAL B O   
957  C CB  . VAL B 66  ? 0.5070 0.4417 0.5875 0.0343  0.0654  -0.1083 64  VAL B CB  
958  C CG1 . VAL B 66  ? 0.5826 0.5210 0.6167 0.0539  0.0690  -0.1136 64  VAL B CG1 
959  C CG2 . VAL B 66  ? 0.5053 0.4311 0.5825 0.0099  0.0651  -0.0967 64  VAL B CG2 
960  N N   . LYS B 67  ? 0.4929 0.4632 0.5665 0.0696  0.0827  -0.0807 65  LYS B N   
961  C CA  . LYS B 67  ? 0.5005 0.5039 0.5709 0.1035  0.0908  -0.0948 65  LYS B CA  
962  C C   . LYS B 67  ? 0.5786 0.6023 0.6034 0.1276  0.0910  -0.1128 65  LYS B C   
963  O O   . LYS B 67  ? 0.6206 0.6389 0.6160 0.1190  0.0908  -0.0910 65  LYS B O   
964  C CB  . LYS B 67  ? 0.5790 0.6017 0.6548 0.1033  0.1035  -0.0533 65  LYS B CB  
965  C CG  . LYS B 67  ? 0.4618 0.5328 0.5268 0.1429  0.1173  -0.0635 65  LYS B CG  
966  C CD  . LYS B 67  ? 0.6285 0.7228 0.7267 0.1467  0.1308  -0.0318 65  LYS B CD  
967  C CE  . LYS B 67  ? 0.9574 1.0936 1.0629 0.1919  0.1428  -0.0687 65  LYS B CE  
968  N NZ  . LYS B 67  ? 1.2527 1.4352 1.3785 0.2086  0.1643  -0.0325 65  LYS B NZ  
969  N N   . TYR B 68  ? 0.4993 0.4634 0.9156 0.0707  -0.0215 -0.1804 66  TYR B N   
970  C CA  . TYR B 68  ? 0.3974 0.3785 0.7559 0.0749  0.0009  -0.1972 66  TYR B CA  
971  C C   . TYR B 68  ? 0.5579 0.5720 0.9157 0.0797  0.0228  -0.1857 66  TYR B C   
972  O O   . TYR B 68  ? 0.4738 0.4938 0.7881 0.0717  0.0234  -0.1757 66  TYR B O   
973  C CB  . TYR B 68  ? 0.4762 0.4528 0.8263 0.0877  0.0146  -0.2319 66  TYR B CB  
974  C CG  . TYR B 68  ? 0.5631 0.5567 0.8527 0.0905  0.0342  -0.2487 66  TYR B CG  
975  C CD1 . TYR B 68  ? 0.3998 0.3920 0.6402 0.0774  0.0216  -0.2424 66  TYR B CD1 
976  C CD2 . TYR B 68  ? 0.6147 0.6250 0.8949 0.1050  0.0650  -0.2676 66  TYR B CD2 
977  C CE1 . TYR B 68  ? 0.7334 0.7408 0.9224 0.0771  0.0318  -0.2522 66  TYR B CE1 
978  C CE2 . TYR B 68  ? 0.6310 0.6526 0.8458 0.1042  0.0790  -0.2826 66  TYR B CE2 
979  C CZ  . TYR B 68  ? 0.6673 0.6872 0.8377 0.0885  0.0578  -0.2719 66  TYR B CZ  
980  O OH  . TYR B 68  ? 0.6246 0.6560 0.7333 0.0840  0.0637  -0.2784 66  TYR B OH  
981  N N   . GLU B 69  ? 0.3655 0.4022 0.7793 0.0929  0.0416  -0.1844 67  GLU B N   
982  C CA  . GLU B 69  ? 0.6088 0.6819 1.0324 0.0956  0.0643  -0.1680 67  GLU B CA  
983  C C   . GLU B 69  ? 0.5134 0.5820 0.9368 0.0766  0.0403  -0.1334 67  GLU B C   
984  O O   . GLU B 69  ? 0.5104 0.5991 0.9168 0.0727  0.0516  -0.1193 67  GLU B O   
985  C CB  . GLU B 69  ? 0.5141 0.6153 1.0175 0.1133  0.0900  -0.1673 67  GLU B CB  
986  C CG  . GLU B 69  ? 0.6479 0.7488 1.1415 0.1345  0.1228  -0.2050 67  GLU B CG  
987  C CD  . GLU B 69  ? 0.8534 0.9109 1.3393 0.1326  0.0976  -0.2221 67  GLU B CD  
988  O OE1 . GLU B 69  ? 0.6391 0.6743 1.1530 0.1206  0.0607  -0.2072 67  GLU B OE1 
989  O OE2 . GLU B 69  ? 1.0089 1.0521 1.4585 0.1420  0.1138  -0.2494 67  GLU B OE2 
990  N N   . ASP B 70  ? 0.4530 0.4899 0.8896 0.0629  0.0056  -0.1199 68  ASP B N   
991  C CA  . ASP B 70  ? 0.4074 0.4256 0.8275 0.0429  -0.0197 -0.0934 68  ASP B CA  
992  C C   . ASP B 70  ? 0.5858 0.5858 0.9274 0.0373  -0.0180 -0.1012 68  ASP B C   
993  O O   . ASP B 70  ? 0.6527 0.6477 0.9735 0.0288  -0.0214 -0.0862 68  ASP B O   
994  C CB  . ASP B 70  ? 0.6149 0.5978 1.0561 0.0268  -0.0590 -0.0774 68  ASP B CB  
995  C CG  . ASP B 70  ? 0.8269 0.7775 1.2351 0.0031  -0.0881 -0.0546 68  ASP B CG  
996  O OD1 . ASP B 70  ? 0.9442 0.9077 1.3966 -0.0049 -0.0987 -0.0305 68  ASP B OD1 
997  O OD2 . ASP B 70  ? 0.8877 0.7978 1.2262 -0.0081 -0.0999 -0.0611 68  ASP B OD2 
998  N N   . VAL B 71  ? 0.5262 0.5162 0.8327 0.0423  -0.0135 -0.1228 69  VAL B N   
999  C CA  . VAL B 71  ? 0.6147 0.5960 0.8637 0.0402  -0.0090 -0.1283 69  VAL B CA  
1000 C C   . VAL B 71  ? 0.4538 0.4669 0.6905 0.0479  0.0120  -0.1274 69  VAL B C   
1001 O O   . VAL B 71  ? 0.4760 0.4833 0.6867 0.0438  0.0111  -0.1163 69  VAL B O   
1002 C CB  . VAL B 71  ? 0.7105 0.6831 0.9394 0.0424  -0.0098 -0.1471 69  VAL B CB  
1003 C CG1 . VAL B 71  ? 0.5252 0.4996 0.7131 0.0422  -0.0031 -0.1482 69  VAL B CG1 
1004 C CG2 . VAL B 71  ? 0.6499 0.5897 0.8835 0.0312  -0.0310 -0.1421 69  VAL B CG2 
1005 N N   . GLU B 72  ? 0.5474 0.5905 0.7998 0.0589  0.0316  -0.1389 70  GLU B N   
1006 C CA  . GLU B 72  ? 0.4365 0.5105 0.6692 0.0629  0.0521  -0.1345 70  GLU B CA  
1007 C C   . GLU B 72  ? 0.5356 0.6193 0.7934 0.0558  0.0514  -0.1046 70  GLU B C   
1008 O O   . GLU B 72  ? 0.4588 0.5484 0.6938 0.0511  0.0525  -0.0890 70  GLU B O   
1009 C CB  . GLU B 72  ? 0.4359 0.5350 0.6751 0.0756  0.0787  -0.1541 70  GLU B CB  
1010 C CG  . GLU B 72  ? 0.5472 0.6329 0.7525 0.0808  0.0786  -0.1867 70  GLU B CG  
1011 C CD  . GLU B 72  ? 0.6780 0.7780 0.8804 0.0946  0.1089  -0.2117 70  GLU B CD  
1012 O OE1 . GLU B 72  ? 0.8367 0.9446 1.0962 0.1055  0.1239  -0.2126 70  GLU B OE1 
1013 O OE2 . GLU B 72  ? 0.7499 0.8514 0.8929 0.0945  0.1178  -0.2302 70  GLU B OE2 
1014 N N   . HIS B 73  ? 0.5088 0.5937 0.8209 0.0537  0.0460  -0.0936 71  HIS B N   
1015 C CA  . HIS B 73  ? 0.4985 0.5908 0.8450 0.0429  0.0387  -0.0622 71  HIS B CA  
1016 C C   . HIS B 73  ? 0.6258 0.6787 0.9329 0.0296  0.0147  -0.0518 71  HIS B C   
1017 O O   . HIS B 73  ? 0.5029 0.5618 0.8036 0.0240  0.0163  -0.0329 71  HIS B O   
1018 C CB  . HIS B 73  ? 0.4034 0.4949 0.8191 0.0389  0.0239  -0.0499 71  HIS B CB  
1019 C CG  . HIS B 73  ? 0.4525 0.5472 0.9108 0.0226  0.0065  -0.0143 71  HIS B CG  
1020 N ND1 . HIS B 73  ? 0.5647 0.6743 1.0133 0.0159  0.0145  0.0057  71  HIS B ND1 
1021 C CD2 . HIS B 73  ? 0.5767 0.6595 1.0902 0.0084  -0.0239 0.0082  71  HIS B CD2 
1022 C CE1 . HIS B 73  ? 0.6793 0.7845 1.1763 -0.0016 -0.0094 0.0372  71  HIS B CE1 
1023 N NE2 . HIS B 73  ? 0.7270 0.8164 1.2634 -0.0072 -0.0344 0.0394  71  HIS B NE2 
1024 N N   . LYS B 74  ? 0.4879 0.4988 0.7675 0.0252  -0.0049 -0.0643 72  LYS B N   
1025 C CA  . LYS B 74  ? 0.5192 0.4866 0.7562 0.0161  -0.0202 -0.0606 72  LYS B CA  
1026 C C   . LYS B 74  ? 0.5989 0.5766 0.8060 0.0243  -0.0049 -0.0617 72  LYS B C   
1027 O O   . LYS B 74  ? 0.4942 0.4513 0.6917 0.0190  -0.0117 -0.0478 72  LYS B O   
1028 C CB  . LYS B 74  ? 0.5637 0.4887 0.7677 0.0114  -0.0341 -0.0753 72  LYS B CB  
1029 C CG  . LYS B 74  ? 0.6902 0.5595 0.8495 0.0002  -0.0487 -0.0726 72  LYS B CG  
1030 C CD  . LYS B 74  ? 0.8827 0.7272 1.0586 -0.0185 -0.0760 -0.0526 72  LYS B CD  
1031 C CE  . LYS B 74  ? 1.0676 0.8459 1.1936 -0.0368 -0.1027 -0.0567 72  LYS B CE  
1032 N NZ  . LYS B 74  ? 1.0616 0.8414 1.1890 -0.0400 -0.1104 -0.0620 72  LYS B NZ  
1033 N N   . VAL B 75  ? 0.4859 0.4918 0.6810 0.0356  0.0113  -0.0762 73  VAL B N   
1034 C CA  . VAL B 75  ? 0.5066 0.5241 0.6785 0.0409  0.0187  -0.0719 73  VAL B CA  
1035 C C   . VAL B 75  ? 0.4524 0.4929 0.6365 0.0369  0.0236  -0.0467 73  VAL B C   
1036 O O   . VAL B 75  ? 0.5038 0.5301 0.6826 0.0348  0.0171  -0.0306 73  VAL B O   
1037 C CB  . VAL B 75  ? 0.3646 0.4071 0.5196 0.0484  0.0274  -0.0889 73  VAL B CB  
1038 C CG1 . VAL B 75  ? 0.3691 0.4275 0.5073 0.0500  0.0277  -0.0764 73  VAL B CG1 
1039 C CG2 . VAL B 75  ? 0.4412 0.4614 0.5892 0.0497  0.0208  -0.1067 73  VAL B CG2 
1040 N N   . THR B 76  ? 0.4702 0.5452 0.6762 0.0363  0.0368  -0.0417 74  THR B N   
1041 C CA  . THR B 76  ? 0.5997 0.7043 0.8197 0.0305  0.0465  -0.0136 74  THR B CA  
1042 C C   . THR B 76  ? 0.6515 0.7286 0.8956 0.0181  0.0270  0.0128  74  THR B C   
1043 O O   . THR B 76  ? 0.6431 0.7260 0.8868 0.0122  0.0251  0.0381  74  THR B O   
1044 C CB  . THR B 76  ? 0.5619 0.7075 0.8104 0.0339  0.0708  -0.0141 74  THR B CB  
1045 O OG1 . THR B 76  ? 0.6906 0.8534 0.9035 0.0447  0.0895  -0.0412 74  THR B OG1 
1046 C CG2 . THR B 76  ? 0.5900 0.7706 0.8589 0.0255  0.0848  0.0205  74  THR B CG2 
1047 N N   . THR B 77  ? 0.4272 0.4687 0.6880 0.0119  0.0084  0.0075  75  THR B N   
1048 C CA  . THR B 77  ? 0.5429 0.5475 0.8204 -0.0037 -0.0160 0.0285  75  THR B CA  
1049 C C   . THR B 77  ? 0.5720 0.5253 0.8110 -0.0023 -0.0278 0.0228  75  THR B C   
1050 O O   . THR B 77  ? 0.5316 0.4672 0.7786 -0.0098 -0.0382 0.0443  75  THR B O   
1051 C CB  . THR B 77  ? 0.6372 0.6109 0.9325 -0.0147 -0.0391 0.0239  75  THR B CB  
1052 O OG1 . THR B 77  ? 0.6297 0.6513 0.9770 -0.0124 -0.0275 0.0297  75  THR B OG1 
1053 C CG2 . THR B 77  ? 0.4362 0.3655 0.7424 -0.0356 -0.0705 0.0459  75  THR B CG2 
1054 N N   . VAL B 78  ? 0.5732 0.5022 0.7765 0.0080  -0.0246 -0.0049 76  VAL B N   
1055 C CA  . VAL B 78  ? 0.5469 0.4252 0.7187 0.0134  -0.0286 -0.0145 76  VAL B CA  
1056 C C   . VAL B 78  ? 0.5752 0.4750 0.7539 0.0233  -0.0193 -0.0004 76  VAL B C   
1057 O O   . VAL B 78  ? 0.5467 0.4100 0.7271 0.0236  -0.0273 0.0098  76  VAL B O   
1058 C CB  . VAL B 78  ? 0.6473 0.5054 0.7864 0.0218  -0.0211 -0.0433 76  VAL B CB  
1059 C CG1 . VAL B 78  ? 0.6587 0.4939 0.7807 0.0361  -0.0095 -0.0512 76  VAL B CG1 
1060 C CG2 . VAL B 78  ? 0.6222 0.4310 0.7385 0.0077  -0.0388 -0.0532 76  VAL B CG2 
1061 N N   . PHE B 79  ? 0.6171 0.5719 0.7990 0.0301  -0.0055 0.0010  77  PHE B N   
1062 C CA  . PHE B 79  ? 0.4808 0.4595 0.6646 0.0367  -0.0022 0.0171  77  PHE B CA  
1063 C C   . PHE B 79  ? 0.6443 0.6641 0.8397 0.0269  -0.0010 0.0484  77  PHE B C   
1064 O O   . PHE B 79  ? 0.4654 0.5045 0.6585 0.0278  -0.0035 0.0684  77  PHE B O   
1065 C CB  . PHE B 79  ? 0.6269 0.6329 0.7956 0.0465  0.0064  -0.0004 77  PHE B CB  
1066 C CG  . PHE B 79  ? 0.5856 0.5591 0.7490 0.0564  0.0090  -0.0225 77  PHE B CG  
1067 C CD1 . PHE B 79  ? 0.5553 0.5097 0.7320 0.0676  0.0098  -0.0163 77  PHE B CD1 
1068 C CD2 . PHE B 79  ? 0.5204 0.4828 0.6701 0.0549  0.0129  -0.0467 77  PHE B CD2 
1069 C CE1 . PHE B 79  ? 0.4739 0.4013 0.6472 0.0781  0.0209  -0.0360 77  PHE B CE1 
1070 C CE2 . PHE B 79  ? 0.4067 0.3402 0.5464 0.0617  0.0192  -0.0636 77  PHE B CE2 
1071 C CZ  . PHE B 79  ? 0.4090 0.3267 0.5589 0.0736  0.0264  -0.0590 77  PHE B CZ  
1072 N N   . GLY B 80  ? 0.5720 0.6085 0.7824 0.0164  0.0033  0.0561  78  GLY B N   
1073 C CA  . GLY B 80  ? 0.6755 0.7494 0.9011 0.0052  0.0088  0.0911  78  GLY B CA  
1074 C C   . GLY B 80  ? 0.6685 0.7955 0.8658 0.0062  0.0274  0.0970  78  GLY B C   
1075 O O   . GLY B 80  ? 0.6357 0.7926 0.8344 -0.0046 0.0334  0.1303  78  GLY B O   
1076 N N   . GLN B 81  ? 0.6117 0.7474 0.7781 0.0164  0.0353  0.0659  79  GLN B N   
1077 C CA  . GLN B 81  ? 0.7796 0.9552 0.9041 0.0150  0.0504  0.0647  79  GLN B CA  
1078 C C   . GLN B 81  ? 0.7953 0.9724 0.8969 0.0249  0.0606  0.0226  79  GLN B C   
1079 O O   . GLN B 81  ? 0.7591 0.9080 0.8742 0.0323  0.0503  0.0002  79  GLN B O   
1080 C CB  . GLN B 81  ? 0.4882 0.6652 0.5890 0.0109  0.0317  0.0862  79  GLN B CB  
1081 C CG  . GLN B 81  ? 0.5004 0.6469 0.6129 0.0213  0.0121  0.0715  79  GLN B CG  
1082 C CD  . GLN B 81  ? 0.7926 0.9479 0.8958 0.0179  -0.0085 0.0965  79  GLN B CD  
1083 O OE1 . GLN B 81  ? 0.7072 0.8918 0.7668 0.0071  -0.0108 0.1075  79  GLN B OE1 
1084 N NE2 . GLN B 81  ? 0.7462 0.8740 0.8896 0.0268  -0.0240 0.1061  79  GLN B NE2 
1085 N N   . PRO B 82  ? 0.8853 1.0919 0.9494 0.0243  0.0825  0.0112  80  PRO B N   
1086 C CA  . PRO B 82  ? 0.9448 1.1441 0.9863 0.0334  0.0888  -0.0308 80  PRO B CA  
1087 C C   . PRO B 82  ? 0.9339 1.1160 0.9490 0.0324  0.0623  -0.0415 80  PRO B C   
1088 O O   . PRO B 82  ? 0.9143 1.1072 0.8913 0.0232  0.0500  -0.0254 80  PRO B O   
1089 C CB  . PRO B 82  ? 0.8613 1.0896 0.8562 0.0322  0.1197  -0.0396 80  PRO B CB  
1090 C CG  . PRO B 82  ? 0.8813 1.1330 0.8525 0.0180  0.1206  0.0023  80  PRO B CG  
1091 C CD  . PRO B 82  ? 0.7734 1.0164 0.8103 0.0152  0.1051  0.0344  80  PRO B CD  
1092 N N   . LEU B 83  ? 0.7835 0.9412 0.8227 0.0397  0.0521  -0.0641 81  LEU B N   
1093 C CA  . LEU B 83  ? 0.7010 0.8469 0.7327 0.0389  0.0293  -0.0711 81  LEU B CA  
1094 C C   . LEU B 83  ? 0.7467 0.8812 0.7671 0.0418  0.0287  -0.1079 81  LEU B C   
1095 O O   . LEU B 83  ? 0.8253 0.9498 0.8648 0.0486  0.0420  -0.1271 81  LEU B O   
1096 C CB  . LEU B 83  ? 0.5774 0.7022 0.6523 0.0437  0.0183  -0.0575 81  LEU B CB  
1097 C CG  . LEU B 83  ? 0.6183 0.7450 0.7075 0.0412  0.0130  -0.0222 81  LEU B CG  
1098 C CD1 . LEU B 83  ? 0.4475 0.5417 0.5736 0.0490  0.0077  -0.0170 81  LEU B CD1 
1099 C CD2 . LEU B 83  ? 0.5789 0.7276 0.6453 0.0337  -0.0031 -0.0016 81  LEU B CD2 
1100 N N   . ASP B 84  ? 0.6928 0.8276 0.6877 0.0350  0.0092  -0.1145 82  ASP B N   
1101 C CA  . ASP B 84  ? 0.5870 0.7053 0.5758 0.0347  0.0019  -0.1466 82  ASP B CA  
1102 C C   . ASP B 84  ? 0.6509 0.7557 0.6890 0.0379  -0.0088 -0.1443 82  ASP B C   
1103 O O   . ASP B 84  ? 0.6019 0.7122 0.6663 0.0382  -0.0174 -0.1201 82  ASP B O   
1104 C CB  . ASP B 84  ? 0.7045 0.8248 0.6434 0.0210  -0.0207 -0.1531 82  ASP B CB  
1105 C CG  . ASP B 84  ? 1.0374 1.1577 0.9066 0.0176  -0.0043 -0.1725 82  ASP B CG  
1106 O OD1 . ASP B 84  ? 0.9812 1.0967 0.8545 0.0297  0.0266  -0.1936 82  ASP B OD1 
1107 O OD2 . ASP B 84  ? 1.1575 1.2825 0.9684 0.0025  -0.0219 -0.1654 82  ASP B OD2 
1108 N N   . LEU B 85  ? 0.6462 0.7321 0.6981 0.0408  -0.0063 -0.1682 83  LEU B N   
1109 C CA  . LEU B 85  ? 0.5540 0.6270 0.6451 0.0412  -0.0131 -0.1636 83  LEU B CA  
1110 C C   . LEU B 85  ? 0.6733 0.7454 0.7683 0.0315  -0.0350 -0.1701 83  LEU B C   
1111 O O   . LEU B 85  ? 0.8711 0.9285 0.9528 0.0272  -0.0424 -0.1947 83  LEU B O   
1112 C CB  . LEU B 85  ? 0.5813 0.6334 0.6915 0.0462  -0.0029 -0.1764 83  LEU B CB  
1113 C CG  . LEU B 85  ? 0.6641 0.7179 0.7759 0.0531  0.0143  -0.1774 83  LEU B CG  
1114 C CD1 . LEU B 85  ? 0.8016 0.8350 0.9426 0.0555  0.0147  -0.1876 83  LEU B CD1 
1115 C CD2 . LEU B 85  ? 0.5329 0.5922 0.6501 0.0538  0.0198  -0.1521 83  LEU B CD2 
1116 N N   . HIS B 86  ? 0.4775 0.5645 0.5977 0.0280  -0.0460 -0.1471 84  HIS B N   
1117 C CA  . HIS B 86  ? 0.4389 0.5308 0.5773 0.0160  -0.0697 -0.1461 84  HIS B CA  
1118 C C   . HIS B 86  ? 0.4383 0.5244 0.6223 0.0169  -0.0626 -0.1394 84  HIS B C   
1119 O O   . HIS B 86  ? 0.5227 0.6205 0.7391 0.0235  -0.0499 -0.1176 84  HIS B O   
1120 C CB  . HIS B 86  ? 0.4208 0.5400 0.5689 0.0093  -0.0900 -0.1198 84  HIS B CB  
1121 C CG  . HIS B 86  ? 0.6931 0.8153 0.7826 0.0016  -0.1028 -0.1245 84  HIS B CG  
1122 N ND1 . HIS B 86  ? 0.5979 0.7110 0.6459 -0.0156 -0.1306 -0.1406 84  HIS B ND1 
1123 C CD2 . HIS B 86  ? 0.6896 0.8196 0.7483 0.0064  -0.0914 -0.1146 84  HIS B CD2 
1124 C CE1 . HIS B 86  ? 0.7966 0.9114 0.7822 -0.0206 -0.1329 -0.1418 84  HIS B CE1 
1125 N NE2 . HIS B 86  ? 0.8151 0.9437 0.8103 -0.0077 -0.1087 -0.1234 84  HIS B NE2 
1126 N N   . TYR B 87  ? 0.5186 0.5839 0.7035 0.0106  -0.0684 -0.1578 85  TYR B N   
1127 C CA  . TYR B 87  ? 0.6309 0.6906 0.8525 0.0071  -0.0628 -0.1476 85  TYR B CA  
1128 C C   . TYR B 87  ? 0.4574 0.5445 0.7230 -0.0025 -0.0762 -0.1245 85  TYR B C   
1129 O O   . TYR B 87  ? 0.4583 0.5511 0.7266 -0.0161 -0.1057 -0.1277 85  TYR B O   
1130 C CB  . TYR B 87  ? 0.5953 0.6260 0.8148 -0.0001 -0.0724 -0.1675 85  TYR B CB  
1131 C CG  . TYR B 87  ? 0.5826 0.6086 0.8357 -0.0086 -0.0697 -0.1512 85  TYR B CG  
1132 C CD1 . TYR B 87  ? 0.4586 0.4856 0.7136 -0.0027 -0.0443 -0.1341 85  TYR B CD1 
1133 C CD2 . TYR B 87  ? 0.6811 0.6979 0.9589 -0.0245 -0.0922 -0.1525 85  TYR B CD2 
1134 C CE1 . TYR B 87  ? 0.4829 0.5055 0.7569 -0.0122 -0.0372 -0.1178 85  TYR B CE1 
1135 C CE2 . TYR B 87  ? 0.4524 0.4682 0.7609 -0.0351 -0.0880 -0.1317 85  TYR B CE2 
1136 C CZ  . TYR B 87  ? 0.6185 0.6390 0.9216 -0.0288 -0.0583 -0.1140 85  TYR B CZ  
1137 O OH  . TYR B 87  ? 0.7408 0.7596 1.0622 -0.0408 -0.0493 -0.0925 85  TYR B OH  
1138 N N   . MET B 88  ? 0.5429 0.6456 0.8436 0.0041  -0.0542 -0.1013 86  MET B N   
1139 C CA  . MET B 88  ? 0.5266 0.6660 0.8876 -0.0003 -0.0595 -0.0725 86  MET B CA  
1140 C C   . MET B 88  ? 0.5860 0.7324 0.9910 -0.0102 -0.0512 -0.0579 86  MET B C   
1141 O O   . MET B 88  ? 0.6985 0.8401 1.1070 -0.0015 -0.0162 -0.0502 86  MET B O   
1142 C CB  . MET B 88  ? 0.5620 0.7196 0.9434 0.0185  -0.0353 -0.0538 86  MET B CB  
1143 C CG  . MET B 88  ? 0.8593 1.0578 1.3213 0.0203  -0.0296 -0.0206 86  MET B CG  
1144 S SD  . MET B 88  ? 0.9875 1.1994 1.4812 0.0472  -0.0003 -0.0018 86  MET B SD  
1145 C CE  . MET B 88  ? 0.4050 0.5963 0.8303 0.0470  -0.0243 -0.0177 86  MET B CE  
1146 N N   . ASN B 89  ? 0.5999 0.7548 1.0339 -0.0306 -0.0842 -0.0533 87  ASN B N   
1147 C CA  . ASN B 89  ? 0.5850 0.7478 1.0652 -0.0450 -0.0815 -0.0353 87  ASN B CA  
1148 C C   . ASN B 89  ? 0.4732 0.6577 1.0062 -0.0686 -0.1245 -0.0197 87  ASN B C   
1149 O O   . ASN B 89  ? 0.5322 0.6957 1.0686 -0.0880 -0.1487 -0.0259 87  ASN B O   
1150 C CB  . ASN B 89  ? 0.5412 0.6603 0.9798 -0.0511 -0.0804 -0.0558 87  ASN B CB  
1151 C CG  . ASN B 89  ? 0.6550 0.7798 1.1277 -0.0627 -0.0633 -0.0315 87  ASN B CG  
1152 O OD1 . ASN B 89  ? 0.7339 0.8978 1.2613 -0.0637 -0.0439 -0.0010 87  ASN B OD1 
1153 N ND2 . ASN B 89  ? 0.8128 0.9002 1.2570 -0.0714 -0.0688 -0.0419 87  ASN B ND2 
1154 N N   . ASN B 90  ? 0.3816 0.6048 0.9591 -0.0686 -0.1384 0.0027  88  ASN B N   
1155 C CA  . ASN B 90  ? 0.5136 0.7578 1.1435 -0.0951 -0.1880 0.0218  88  ASN B CA  
1156 C C   . ASN B 90  ? 0.5895 0.7841 1.1598 -0.1158 -0.2334 -0.0129 88  ASN B C   
1157 O O   . ASN B 90  ? 0.5179 0.6797 1.0095 -0.1076 -0.2381 -0.0469 88  ASN B O   
1158 C CB  . ASN B 90  ? 0.6064 0.8902 1.3321 -0.1064 -0.1766 0.0617  88  ASN B CB  
1159 C CG  . ASN B 90  ? 0.6196 0.9470 1.4000 -0.0813 -0.1210 0.0903  88  ASN B CG  
1160 O OD1 . ASN B 90  ? 0.5815 0.9206 1.3577 -0.0606 -0.1086 0.0911  88  ASN B OD1 
1161 N ND2 . ASN B 90  ? 0.6760 1.0246 1.5067 -0.0833 -0.0856 0.1138  88  ASN B ND2 
1162 N N   . GLU B 91  ? 0.6968 0.8829 1.3043 -0.1414 -0.2631 -0.0054 89  GLU B N   
1163 C CA  . GLU B 91  ? 0.8532 0.9829 1.4062 -0.1603 -0.3073 -0.0421 89  GLU B CA  
1164 C C   . GLU B 91  ? 0.8269 0.9026 1.3122 -0.1456 -0.2852 -0.0840 89  GLU B C   
1165 O O   . GLU B 91  ? 0.9788 1.0028 1.4178 -0.1541 -0.3117 -0.1184 89  GLU B O   
1166 C CB  . GLU B 91  ? 1.0041 1.1262 1.5950 -0.1853 -0.3365 -0.0198 89  GLU B CB  
1167 C CG  . GLU B 91  ? 1.1455 1.2704 1.7838 -0.1882 -0.3121 -0.0005 89  GLU B CG  
1168 C CD  . GLU B 91  ? 1.2536 1.4467 1.9821 -0.1854 -0.2796 0.0500  89  GLU B CD  
1169 O OE1 . GLU B 91  ? 1.3034 1.5392 2.0697 -0.1823 -0.2833 0.0744  89  GLU B OE1 
1170 O OE2 . GLU B 91  ? 1.3011 1.5036 2.0602 -0.1854 -0.2474 0.0665  89  GLU B OE2 
1171 N N   . LEU B 92  ? 0.7583 0.8428 1.2373 -0.1227 -0.2360 -0.0802 90  LEU B N   
1172 C CA  . LEU B 92  ? 0.8333 0.8731 1.2580 -0.1082 -0.2174 -0.1134 90  LEU B CA  
1173 C C   . LEU B 92  ? 0.7807 0.8199 1.1464 -0.0840 -0.1934 -0.1342 90  LEU B C   
1174 O O   . LEU B 92  ? 0.8084 0.8214 1.1378 -0.0690 -0.1732 -0.1560 90  LEU B O   
1175 C CB  . LEU B 92  ? 0.5922 0.6340 1.0427 -0.1054 -0.1867 -0.0931 90  LEU B CB  
1176 C CG  . LEU B 92  ? 0.7256 0.7705 1.2360 -0.1306 -0.2040 -0.0655 90  LEU B CG  
1177 C CD1 . LEU B 92  ? 0.8562 0.9114 1.3790 -0.1279 -0.1659 -0.0387 90  LEU B CD1 
1178 C CD2 . LEU B 92  ? 0.7060 0.6974 1.2073 -0.1450 -0.2432 -0.0916 90  LEU B CD2 
1179 N N   . SER B 93  ? 0.6814 0.7517 1.0456 -0.0820 -0.1986 -0.1224 91  SER B N   
1180 C CA  . SER B 93  ? 0.7082 0.7819 1.0226 -0.0625 -0.1784 -0.1344 91  SER B CA  
1181 C C   . SER B 93  ? 0.7274 0.7631 0.9711 -0.0625 -0.1925 -0.1753 91  SER B C   
1182 O O   . SER B 93  ? 0.7868 0.7980 1.0164 -0.0802 -0.2269 -0.1920 91  SER B O   
1183 C CB  . SER B 93  ? 0.7255 0.8421 1.0660 -0.0626 -0.1849 -0.1045 91  SER B CB  
1184 O OG  . SER B 93  ? 0.5943 0.7467 1.0078 -0.0593 -0.1655 -0.0687 91  SER B OG  
1185 N N   . ILE B 94  ? 0.6967 0.7258 0.8967 -0.0431 -0.1644 -0.1913 92  ILE B N   
1186 C CA  . ILE B 94  ? 0.8777 0.8740 1.0144 -0.0384 -0.1640 -0.2305 92  ILE B CA  
1187 C C   . ILE B 94  ? 0.7745 0.7834 0.8767 -0.0193 -0.1316 -0.2326 92  ILE B C   
1188 O O   . ILE B 94  ? 0.5980 0.6256 0.7270 -0.0079 -0.1088 -0.2114 92  ILE B O   
1189 C CB  . ILE B 94  ? 0.9988 0.9548 1.1457 -0.0354 -0.1615 -0.2567 92  ILE B CB  
1190 C CG1 . ILE B 94  ? 1.1643 1.0834 1.2538 -0.0278 -0.1573 -0.3012 92  ILE B CG1 
1191 C CG2 . ILE B 94  ? 0.8896 0.8517 1.0698 -0.0213 -0.1328 -0.2424 92  ILE B CG2 
1192 C CD1 . ILE B 94  ? 1.1733 1.0545 1.2842 -0.0187 -0.1492 -0.3215 92  ILE B CD1 
1193 N N   . LEU B 95  ? 0.7904 0.7869 0.8298 -0.0177 -0.1296 -0.2571 93  LEU B N   
1194 C CA  . LEU B 95  ? 0.7268 0.7356 0.7381 -0.0013 -0.0969 -0.2582 93  LEU B CA  
1195 C C   . LEU B 95  ? 0.5963 0.5839 0.6241 0.0148  -0.0714 -0.2804 93  LEU B C   
1196 O O   . LEU B 95  ? 0.7391 0.6964 0.7439 0.0176  -0.0698 -0.3150 93  LEU B O   
1197 C CB  . LEU B 95  ? 0.8246 0.8305 0.7584 -0.0072 -0.0997 -0.2733 93  LEU B CB  
1198 C CG  . LEU B 95  ? 0.9697 1.0020 0.8785 0.0028  -0.0718 -0.2575 93  LEU B CG  
1199 C CD1 . LEU B 95  ? 0.8865 0.9222 0.7174 -0.0112 -0.0842 -0.2574 93  LEU B CD1 
1200 C CD2 . LEU B 95  ? 1.1532 1.1794 1.0656 0.0223  -0.0320 -0.2767 93  LEU B CD2 
1201 N N   . LEU B 96  ? 0.6955 0.6954 0.7645 0.0248  -0.0535 -0.2606 94  LEU B N   
1202 C CA  . LEU B 96  ? 0.6214 0.6041 0.7180 0.0373  -0.0368 -0.2732 94  LEU B CA  
1203 C C   . LEU B 96  ? 0.7223 0.7078 0.7930 0.0512  -0.0098 -0.2927 94  LEU B C   
1204 O O   . LEU B 96  ? 0.7326 0.7437 0.7921 0.0557  0.0077  -0.2763 94  LEU B O   
1205 C CB  . LEU B 96  ? 0.5257 0.5170 0.6602 0.0397  -0.0300 -0.2451 94  LEU B CB  
1206 C CG  . LEU B 96  ? 0.5946 0.5866 0.7500 0.0276  -0.0462 -0.2249 94  LEU B CG  
1207 C CD1 . LEU B 96  ? 0.4525 0.4449 0.6250 0.0295  -0.0355 -0.2016 94  LEU B CD1 
1208 C CD2 . LEU B 96  ? 0.6913 0.6591 0.8670 0.0187  -0.0653 -0.2372 94  LEU B CD2 
1209 N N   . LYS B 97  ? 0.7379 0.6959 0.8022 0.0583  -0.0046 -0.3274 95  LYS B N   
1210 C CA  . LYS B 97  ? 0.8704 0.8301 0.9076 0.0730  0.0283  -0.3485 95  LYS B CA  
1211 C C   . LYS B 97  ? 0.8532 0.8058 0.9474 0.0885  0.0472  -0.3434 95  LYS B C   
1212 O O   . LYS B 97  ? 0.9259 0.8863 1.0145 0.1031  0.0799  -0.3519 95  LYS B O   
1213 C CB  . LYS B 97  ? 0.6950 0.6244 0.6636 0.0668  0.0231  -0.3778 95  LYS B CB  
1214 C CG  . LYS B 97  ? 1.3080 1.2519 1.2030 0.0519  0.0115  -0.3810 95  LYS B CG  
1215 C CD  . LYS B 97  ? 1.2875 1.1876 1.1132 0.0383  -0.0089 -0.4098 95  LYS B CD  
1216 C CE  . LYS B 97  ? 1.2114 1.1245 0.9600 0.0171  -0.0322 -0.4047 95  LYS B CE  
1217 N NZ  . LYS B 97  ? 1.1391 1.0055 0.8302 -0.0049 -0.0711 -0.4269 95  LYS B NZ  
1218 N N   . ASN B 98  ? 0.5792 0.5195 0.7288 0.0844  0.0262  -0.3278 96  ASN B N   
1219 C CA  . ASN B 98  ? 0.5591 0.4893 0.7668 0.0957  0.0332  -0.3234 96  ASN B CA  
1220 C C   . ASN B 98  ? 0.7817 0.7041 1.0439 0.0861  0.0056  -0.2991 96  ASN B C   
1221 O O   . ASN B 98  ? 0.6367 0.5527 0.8873 0.0708  -0.0176 -0.2898 96  ASN B O   
1222 C CB  . ASN B 98  ? 0.6696 0.5662 0.8614 0.1034  0.0391  -0.3512 96  ASN B CB  
1223 C CG  . ASN B 98  ? 0.8509 0.7147 1.0231 0.0873  0.0060  -0.3598 96  ASN B CG  
1224 O OD1 . ASN B 98  ? 0.7323 0.5961 0.9382 0.0744  -0.0210 -0.3393 96  ASN B OD1 
1225 N ND2 . ASN B 98  ? 0.9358 0.7688 1.0502 0.0864  0.0081  -0.3891 96  ASN B ND2 
1226 N N   . GLN B 99  ? 0.6729 0.6183 1.0988 0.1334  0.0863  -0.1343 97  GLN B N   
1227 C CA  . GLN B 99  ? 0.5465 0.4640 0.9798 0.1384  0.0541  -0.1022 97  GLN B CA  
1228 C C   . GLN B 99  ? 0.5517 0.4229 0.9746 0.1227  0.0554  -0.1202 97  GLN B C   
1229 O O   . GLN B 99  ? 0.6294 0.4988 1.0433 0.1191  0.0279  -0.1005 97  GLN B O   
1230 C CB  . GLN B 99  ? 0.6439 0.5291 1.1083 0.1520  0.0532  -0.0817 97  GLN B CB  
1231 C CG  . GLN B 99  ? 0.4706 0.3387 0.9367 0.1531  0.0154  -0.0440 97  GLN B CG  
1232 C CD  . GLN B 99  ? 0.6281 0.5379 1.0615 0.1510  -0.0133 -0.0200 97  GLN B CD  
1233 O OE1 . GLN B 99  ? 0.6115 0.5549 1.0410 0.1562  -0.0135 -0.0122 97  GLN B OE1 
1234 N NE2 . GLN B 99  ? 0.5340 0.4354 0.9387 0.1419  -0.0349 -0.0095 97  GLN B NE2 
1235 N N   . ASP B 100 ? 0.5985 0.4258 1.0103 0.1082  0.0891  -0.1592 98  ASP B N   
1236 C CA  A ASP B 100 ? 0.6877 0.4603 1.0698 0.0809  0.0903  -0.1768 98  ASP B CA  
1237 C CA  B ASP B 100 ? 0.6930 0.4658 1.0756 0.0813  0.0898  -0.1761 98  ASP B CA  
1238 C C   . ASP B 100 ? 0.7496 0.5792 1.0724 0.0483  0.0687  -0.1670 98  ASP B C   
1239 O O   . ASP B 100 ? 0.5636 0.3826 0.8702 0.0362  0.0468  -0.1439 98  ASP B O   
1240 C CB  A ASP B 100 ? 0.8205 0.5404 1.1731 0.0601  0.1303  -0.2218 98  ASP B CB  
1241 C CB  B ASP B 100 ? 0.8438 0.5617 1.1991 0.0616  0.1291  -0.2194 98  ASP B CB  
1242 C CG  A ASP B 100 ? 1.0667 0.7123 1.4034 0.0413  0.1269  -0.2231 98  ASP B CG  
1243 C CG  B ASP B 100 ? 1.0089 0.6770 1.3961 0.0807  0.1362  -0.2045 98  ASP B CG  
1244 O OD1 A ASP B 100 ? 1.2137 0.8400 1.5842 0.0588  0.1018  -0.1852 98  ASP B OD1 
1245 O OD1 B ASP B 100 ? 1.1418 0.7809 1.5477 0.0853  0.1094  -0.1741 98  ASP B OD1 
1246 O OD2 A ASP B 100 ? 1.1892 0.7970 1.4720 0.0043  0.1454  -0.2591 98  ASP B OD2 
1247 O OD2 B ASP B 100 ? 1.0535 0.7121 1.4482 0.0893  0.1691  -0.2228 98  ASP B OD2 
1248 N N   . ASP B 101 ? 0.4960 0.3864 0.7919 0.0330  0.0763  -0.1817 99  ASP B N   
1249 C CA  . ASP B 101 ? 0.5928 0.5455 0.8543 0.0042  0.0564  -0.1677 99  ASP B CA  
1250 C C   . ASP B 101 ? 0.5368 0.5167 0.8197 0.0242  0.0300  -0.1289 99  ASP B C   
1251 O O   . ASP B 101 ? 0.6446 0.6287 0.9069 0.0044  0.0195  -0.1131 99  ASP B O   
1252 C CB  . ASP B 101 ? 0.5631 0.5836 0.8115 -0.0075 0.0609  -0.1783 99  ASP B CB  
1253 C CG  . ASP B 101 ? 0.7693 0.7603 0.9670 -0.0430 0.0849  -0.2170 99  ASP B CG  
1254 O OD1 . ASP B 101 ? 0.9252 0.8533 1.0927 -0.0667 0.0924  -0.2335 99  ASP B OD1 
1255 O OD2 . ASP B 101 ? 0.5332 0.5593 0.7144 -0.0508 0.0957  -0.2307 99  ASP B OD2 
1256 N N   . LEU B 102 ? 0.5327 0.5244 0.8544 0.0613  0.0217  -0.1140 100 LEU B N   
1257 C CA  . LEU B 102 ? 0.5793 0.5875 0.9080 0.0779  -0.0031 -0.0811 100 LEU B CA  
1258 C C   . LEU B 102 ? 0.5822 0.5258 0.8940 0.0731  -0.0151 -0.0628 100 LEU B C   
1259 O O   . LEU B 102 ? 0.4059 0.3564 0.6877 0.0621  -0.0245 -0.0443 100 LEU B O   
1260 C CB  . LEU B 102 ? 0.5680 0.5897 0.9420 0.1147  -0.0139 -0.0686 100 LEU B CB  
1261 C CG  . LEU B 102 ? 0.4508 0.4679 0.7950 0.1205  -0.0402 -0.0328 100 LEU B CG  
1262 C CD1 . LEU B 102 ? 0.4019 0.4715 0.7285 0.1126  -0.0431 -0.0290 100 LEU B CD1 
1263 C CD2 . LEU B 102 ? 0.5871 0.6084 0.9095 0.1269  -0.0438 -0.0154 100 LEU B CD2 
1264 N N   . ASP B 103 ? 0.5598 0.4384 0.8937 0.0813  -0.0123 -0.0667 101 ASP B N   
1265 C CA  . ASP B 103 ? 0.7580 0.5705 1.0799 0.0744  -0.0281 -0.0450 101 ASP B CA  
1266 C C   . ASP B 103 ? 0.7762 0.5848 1.0477 0.0367  -0.0204 -0.0490 101 ASP B C   
1267 O O   . ASP B 103 ? 0.8092 0.5978 1.0486 0.0245  -0.0330 -0.0246 101 ASP B O   
1268 C CB  . ASP B 103 ? 0.8976 0.6440 1.2695 0.0897  -0.0239 -0.0490 101 ASP B CB  
1269 C CG  . ASP B 103 ? 1.2862 1.0569 1.6811 0.1134  -0.0372 -0.0243 101 ASP B CG  
1270 O OD1 . ASP B 103 ? 1.2271 1.0186 1.6002 0.1157  -0.0630 0.0030  101 ASP B OD1 
1271 O OD2 . ASP B 103 ? 1.5186 1.2866 1.9438 0.1236  -0.0193 -0.0333 101 ASP B OD2 
1272 N N   . LYS B 104 ? 0.4998 0.3275 0.7613 0.0151  0.0003  -0.0781 102 LYS B N   
1273 C CA  . LYS B 104 ? 0.6571 0.4934 0.8821 -0.0237 0.0048  -0.0787 102 LYS B CA  
1274 C C   . LYS B 104 ? 0.6749 0.5746 0.8865 -0.0298 0.0007  -0.0572 102 LYS B C   
1275 O O   . LYS B 104 ? 0.5596 0.4479 0.7491 -0.0479 0.0005  -0.0383 102 LYS B O   
1276 C CB  . LYS B 104 ? 0.5394 0.3889 0.7529 -0.0500 0.0207  -0.1113 102 LYS B CB  
1277 C CG  . LYS B 104 ? 0.9870 0.8373 1.1715 -0.0950 0.0199  -0.1089 102 LYS B CG  
1278 C CD  . LYS B 104 ? 1.0289 0.9014 1.1923 -0.1286 0.0265  -0.1362 102 LYS B CD  
1279 C CE  . LYS B 104 ? 1.1031 0.9394 1.2385 -0.1757 0.0231  -0.1395 102 LYS B CE  
1280 N NZ  . LYS B 104 ? 0.9600 0.8131 1.1052 -0.1875 0.0141  -0.1033 102 LYS B NZ  
1281 N N   . ALA B 105 ? 0.4468 0.4111 0.6754 -0.0148 0.0009  -0.0597 103 ALA B N   
1282 C CA  . ALA B 105 ? 0.6021 0.6210 0.8289 -0.0158 0.0013  -0.0401 103 ALA B CA  
1283 C C   . ALA B 105 ? 0.5443 0.5200 0.7457 -0.0026 -0.0057 -0.0165 103 ALA B C   
1284 O O   . ALA B 105 ? 0.5267 0.5047 0.7051 -0.0179 0.0046  -0.0013 103 ALA B O   
1285 C CB  . ALA B 105 ? 0.5955 0.6810 0.8501 0.0018  -0.0012 -0.0442 103 ALA B CB  
1286 N N   . ILE B 106 ? 0.5081 0.4412 0.7134 0.0227  -0.0230 -0.0118 104 ILE B N   
1287 C CA  . ILE B 106 ? 0.5812 0.4630 0.7520 0.0290  -0.0389 0.0134  104 ILE B CA  
1288 C C   . ILE B 106 ? 0.7797 0.6032 0.9110 0.0016  -0.0367 0.0269  104 ILE B C   
1289 O O   . ILE B 106 ? 0.5429 0.3418 0.6239 -0.0101 -0.0354 0.0462  104 ILE B O   
1290 C CB  . ILE B 106 ? 0.4765 0.3230 0.6734 0.0561  -0.0654 0.0221  104 ILE B CB  
1291 C CG1 . ILE B 106 ? 0.5562 0.4590 0.7854 0.0818  -0.0697 0.0165  104 ILE B CG1 
1292 C CG2 . ILE B 106 ? 0.5051 0.2861 0.6591 0.0524  -0.0913 0.0531  104 ILE B CG2 
1293 C CD1 . ILE B 106 ? 0.5200 0.3935 0.7880 0.1088  -0.0979 0.0318  104 ILE B CD1 
1294 N N   . ASP B 107 ? 0.5341 0.3314 0.6833 -0.0111 -0.0339 0.0158  105 ASP B N   
1295 C CA  . ASP B 107 ? 0.7454 0.4898 0.8641 -0.0390 -0.0335 0.0295  105 ASP B CA  
1296 C C   . ASP B 107 ? 0.8340 0.6185 0.9283 -0.0670 -0.0090 0.0332  105 ASP B C   
1297 O O   . ASP B 107 ? 0.6488 0.4012 0.7002 -0.0862 -0.0042 0.0549  105 ASP B O   
1298 C CB  . ASP B 107 ? 0.7050 0.4128 0.8537 -0.0466 -0.0332 0.0121  105 ASP B CB  
1299 C CG  . ASP B 107 ? 0.9591 0.6080 1.0826 -0.0762 -0.0368 0.0284  105 ASP B CG  
1300 O OD1 . ASP B 107 ? 0.9063 0.5136 0.9952 -0.0814 -0.0520 0.0593  105 ASP B OD1 
1301 O OD2 . ASP B 107 ? 1.0127 0.6530 1.1452 -0.0979 -0.0264 0.0115  105 ASP B OD2 
1302 N N   . ILE B 108 ? 0.6331 0.4873 0.7584 -0.0716 0.0062  0.0153  106 ILE B N   
1303 C CA  . ILE B 108 ? 0.6953 0.6006 0.8234 -0.0965 0.0286  0.0234  106 ILE B CA  
1304 C C   . ILE B 108 ? 0.6818 0.5961 0.7825 -0.0884 0.0447  0.0420  106 ILE B C   
1305 O O   . ILE B 108 ? 0.6502 0.5589 0.7303 -0.1102 0.0665  0.0586  106 ILE B O   
1306 C CB  . ILE B 108 ? 0.6677 0.6510 0.8412 -0.1011 0.0329  0.0079  106 ILE B CB  
1307 C CG1 . ILE B 108 ? 0.6795 0.6471 0.8593 -0.1292 0.0259  -0.0083 106 ILE B CG1 
1308 C CG2 . ILE B 108 ? 0.4498 0.5003 0.6483 -0.1131 0.0543  0.0250  106 ILE B CG2 
1309 C CD1 . ILE B 108 ? 0.7392 0.7678 0.9460 -0.1404 0.0223  -0.0235 106 ILE B CD1 
1310 N N   . LEU B 109 ? 0.5676 0.4907 0.6655 -0.0587 0.0364  0.0384  107 LEU B N   
1311 C CA  . LEU B 109 ? 0.6090 0.5292 0.6710 -0.0500 0.0521  0.0499  107 LEU B CA  
1312 C C   . LEU B 109 ? 0.7293 0.5632 0.7133 -0.0628 0.0470  0.0686  107 LEU B C   
1313 O O   . LEU B 109 ? 0.8672 0.6856 0.8030 -0.0748 0.0748  0.0790  107 LEU B O   
1314 C CB  . LEU B 109 ? 0.6043 0.5468 0.6813 -0.0176 0.0364  0.0414  107 LEU B CB  
1315 C CG  . LEU B 109 ? 0.9108 0.8229 0.9353 -0.0060 0.0402  0.0496  107 LEU B CG  
1316 C CD1 . LEU B 109 ? 0.9891 0.9421 1.0189 -0.0118 0.0849  0.0498  107 LEU B CD1 
1317 C CD2 . LEU B 109 ? 0.6875 0.6104 0.7315 0.0239  0.0114  0.0440  107 LEU B CD2 
1318 N N   . ASP B 110 ? 0.6714 0.4466 0.6446 -0.0624 0.0132  0.0743  108 ASP B N   
1319 C CA  . ASP B 110 ? 0.9519 0.6418 0.8548 -0.0799 -0.0025 0.0988  108 ASP B CA  
1320 C C   . ASP B 110 ? 1.0844 0.7570 0.9560 -0.1152 0.0236  0.1113  108 ASP B C   
1321 O O   . ASP B 110 ? 1.1130 0.7309 0.9072 -0.1357 0.0298  0.1315  108 ASP B O   
1322 C CB  . ASP B 110 ? 0.9687 0.6061 0.8942 -0.0716 -0.0458 0.1071  108 ASP B CB  
1323 C CG  . ASP B 110 ? 1.2135 0.8416 1.1491 -0.0430 -0.0777 0.1111  108 ASP B CG  
1324 O OD1 . ASP B 110 ? 1.2058 0.8268 1.0885 -0.0414 -0.0780 0.1180  108 ASP B OD1 
1325 O OD2 . ASP B 110 ? 1.2138 0.8387 1.2116 -0.0232 -0.1002 0.1073  108 ASP B OD2 
1326 N N   . ARG B 111 ? 0.7534 0.4692 0.6803 -0.1263 0.0377  0.1010  109 ARG B N   
1327 C CA  . ARG B 111 ? 0.8067 0.5072 0.7176 -0.1615 0.0571  0.1161  109 ARG B CA  
1328 C C   . ARG B 111 ? 0.8749 0.6405 0.8035 -0.1735 0.1048  0.1176  109 ARG B C   
1329 O O   . ARG B 111 ? 1.0781 0.8387 0.9983 -0.2036 0.1275  0.1341  109 ARG B O   
1330 C CB  . ARG B 111 ? 1.0801 0.7691 1.0355 -0.1735 0.0377  0.1092  109 ARG B CB  
1331 C CG  . ARG B 111 ? 1.1186 0.7366 1.0700 -0.1611 -0.0024 0.1123  109 ARG B CG  
1332 C CD  . ARG B 111 ? 1.2499 0.8298 1.2277 -0.1810 -0.0141 0.1110  109 ARG B CD  
1333 N NE  . ARG B 111 ? 0.8265 0.4434 0.8604 -0.1737 -0.0109 0.0782  109 ARG B NE  
1334 C CZ  . ARG B 111 ? 1.3200 0.9381 1.3718 -0.2016 -0.0048 0.0692  109 ARG B CZ  
1335 N NH1 . ARG B 111 ? 0.9013 0.4940 0.9315 -0.2354 -0.0004 0.0927  109 ARG B NH1 
1336 N NH2 . ARG B 111 ? 1.3468 0.9886 1.4320 -0.1998 -0.0035 0.0377  109 ARG B NH2 
1337 N N   . SER B 112 ? 0.7255 0.5530 0.6877 -0.1500 0.1202  0.1037  110 SER B N   
1338 C CA  . SER B 112 ? 0.8346 0.7246 0.8296 -0.1561 0.1680  0.1087  110 SER B CA  
1339 C C   . SER B 112 ? 0.9478 0.7954 0.8679 -0.1601 0.2058  0.1190  110 SER B C   
1340 O O   . SER B 112 ? 1.1161 0.9059 0.9641 -0.1480 0.1906  0.1157  110 SER B O   
1341 C CB  . SER B 112 ? 0.8282 0.7975 0.8933 -0.1303 0.1699  0.0936  110 SER B CB  
1342 O OG  . SER B 112 ? 0.9423 0.9683 1.0512 -0.1338 0.2176  0.1032  110 SER B OG  
1343 N N   . SER B 113 ? 0.9951 0.8701 0.9327 -0.1795 0.2565  0.1323  111 SER B N   
1344 C CA  . SER B 113 ? 1.2370 1.0706 1.1005 -0.1864 0.3076  0.1386  111 SER B CA  
1345 C C   . SER B 113 ? 1.1816 1.0624 1.0816 -0.1590 0.3484  0.1245  111 SER B C   
1346 O O   . SER B 113 ? 1.2845 1.1159 1.1072 -0.1574 0.3870  0.1193  111 SER B O   
1347 C CB  . SER B 113 ? 1.2814 1.1173 1.1488 -0.2210 0.3520  0.1615  111 SER B CB  
1348 O OG  . SER B 113 ? 1.5554 1.3486 1.3458 -0.2290 0.4121  0.1644  111 SER B OG  
1349 N N   . SER B 114 ? 1.0459 1.0166 1.0599 -0.1404 0.3395  0.1188  112 SER B N   
1350 C CA  . SER B 114 ? 1.0396 1.0635 1.1117 -0.1147 0.3767  0.1105  112 SER B CA  
1351 C C   . SER B 114 ? 1.0753 1.1070 1.1508 -0.0820 0.3365  0.0907  112 SER B C   
1352 O O   . SER B 114 ? 1.1132 1.1278 1.1632 -0.0621 0.3618  0.0790  112 SER B O   
1353 C CB  . SER B 114 ? 1.0058 1.1321 1.2121 -0.1181 0.3897  0.1246  112 SER B CB  
1354 O OG  . SER B 114 ? 1.0287 1.2062 1.3036 -0.1249 0.3431  0.1290  112 SER B OG  
1355 N N   . MET B 115 ? 0.8412 0.8947 0.9465 -0.0778 0.2779  0.0864  113 MET B N   
1356 C CA  . MET B 115 ? 0.8271 0.8967 0.9467 -0.0485 0.2400  0.0710  113 MET B CA  
1357 C C   . MET B 115 ? 0.8514 0.8351 0.8669 -0.0363 0.2236  0.0617  113 MET B C   
1358 O O   . MET B 115 ? 1.1150 1.0233 1.0490 -0.0524 0.2054  0.0676  113 MET B O   
1359 C CB  . MET B 115 ? 0.8129 0.9096 0.9713 -0.0508 0.1882  0.0668  113 MET B CB  
1360 C CG  . MET B 115 ? 0.6664 0.8416 0.9164 -0.0699 0.1889  0.0759  113 MET B CG  
1361 S SD  . MET B 115 ? 1.2461 1.4279 1.5090 -0.0765 0.1338  0.0622  113 MET B SD  
1362 C CE  . MET B 115 ? 0.8758 1.0720 1.1426 -0.0384 0.1089  0.0459  113 MET B CE  
1363 N N   . LYS B 116 ? 0.6593 0.6537 0.6816 -0.0106 0.2246  0.0509  114 LYS B N   
1364 C CA  . LYS B 116 ? 0.8277 0.7427 0.7551 -0.0016 0.2022  0.0443  114 LYS B CA  
1365 C C   . LYS B 116 ? 0.6458 0.5884 0.6135 0.0238  0.1502  0.0383  114 LYS B C   
1366 O O   . LYS B 116 ? 0.8067 0.6923 0.7141 0.0314  0.1184  0.0376  114 LYS B O   
1367 C CB  . LYS B 116 ? 0.9525 0.8359 0.8338 0.0036  0.2522  0.0351  114 LYS B CB  
1368 C CG  . LYS B 116 ? 1.0212 0.8820 0.8700 -0.0187 0.3192  0.0393  114 LYS B CG  
1369 C CD  . LYS B 116 ? 1.1809 0.9531 0.9147 -0.0511 0.3087  0.0502  114 LYS B CD  
1370 C CE  . LYS B 116 ? 1.5275 1.1893 1.1145 -0.0628 0.3147  0.0432  114 LYS B CE  
1371 N NZ  . LYS B 116 ? 1.6727 1.2496 1.1449 -0.1026 0.3158  0.0593  114 LYS B NZ  
1372 N N   . SER B 117 ? 0.7083 0.7379 0.7770 0.0335  0.1410  0.0364  115 SER B N   
1373 C CA  . SER B 117 ? 0.6637 0.7259 0.7740 0.0552  0.0985  0.0312  115 SER B CA  
1374 C C   . SER B 117 ? 0.4898 0.6191 0.6751 0.0494  0.0842  0.0303  115 SER B C   
1375 O O   . SER B 117 ? 0.5324 0.7055 0.7603 0.0320  0.1072  0.0352  115 SER B O   
1376 C CB  . SER B 117 ? 0.4724 0.5726 0.6197 0.0778  0.1085  0.0264  115 SER B CB  
1377 O OG  . SER B 117 ? 0.7978 0.9701 1.0236 0.0750  0.1458  0.0301  115 SER B OG  
1378 N N   . LEU B 118 ? 0.6723 0.4812 0.8327 -0.0324 0.1247  -0.0985 116 LEU B N   
1379 C CA  . LEU B 118 ? 0.6339 0.4434 0.8041 -0.0355 0.1131  -0.1055 116 LEU B CA  
1380 C C   . LEU B 118 ? 0.8290 0.6257 1.0287 -0.0269 0.1159  -0.1008 116 LEU B C   
1381 O O   . LEU B 118 ? 0.7435 0.5255 0.9251 -0.0212 0.1168  -0.0901 116 LEU B O   
1382 C CB  . LEU B 118 ? 0.5918 0.3978 0.7156 -0.0382 0.1008  -0.1040 116 LEU B CB  
1383 C CG  . LEU B 118 ? 0.7954 0.6008 0.9044 -0.0422 0.0865  -0.1160 116 LEU B CG  
1384 C CD1 . LEU B 118 ? 0.9134 0.7311 1.0286 -0.0489 0.0819  -0.1208 116 LEU B CD1 
1385 C CD2 . LEU B 118 ? 0.8414 0.6416 0.9095 -0.0398 0.0825  -0.1121 116 LEU B CD2 
1386 N N   . ARG B 119 ? 0.7037 0.5052 0.9559 -0.0260 0.1133  -0.1057 117 ARG B N   
1387 C CA  . ARG B 119 ? 0.6844 0.4775 0.9767 -0.0141 0.1136  -0.0955 117 ARG B CA  
1388 C C   . ARG B 119 ? 0.5116 0.3114 0.7832 -0.0148 0.0917  -0.0947 117 ARG B C   
1389 O O   . ARG B 119 ? 0.6492 0.4629 0.9059 -0.0225 0.0717  -0.1054 117 ARG B O   
1390 C CB  . ARG B 119 ? 0.6885 0.5060 1.0508 -0.0080 0.1146  -0.0859 117 ARG B CB  
1391 C CG  . ARG B 119 ? 0.8084 0.6201 1.1959 0.0010  0.1432  -0.0831 117 ARG B CG  
1392 C CD  . ARG B 119 ? 0.9638 0.8160 1.4234 0.0127  0.1446  -0.0610 117 ARG B CD  
1393 N NE  . ARG B 119 ? 1.2353 1.0708 1.7133 0.0395  0.1773  -0.0503 117 ARG B NE  
1394 C CZ  . ARG B 119 ? 1.1933 1.0207 1.6787 0.0613  0.1812  -0.0347 117 ARG B CZ  
1395 N NH1 . ARG B 119 ? 0.9987 0.8408 1.4815 0.0570  0.1552  -0.0251 117 ARG B NH1 
1396 N NH2 . ARG B 119 ? 1.2098 1.0268 1.6813 0.0815  0.2026  -0.0251 117 ARG B NH2 
1397 N N   . ILE B 120 ? 0.5459 0.3434 0.8061 -0.0046 0.0908  -0.0767 118 ILE B N   
1398 C CA  . ILE B 120 ? 0.5165 0.3348 0.7435 0.0005  0.0719  -0.0664 118 ILE B CA  
1399 C C   . ILE B 120 ? 0.5097 0.3516 0.7618 0.0134  0.0628  -0.0381 118 ILE B C   
1400 O O   . ILE B 120 ? 0.6966 0.5207 0.9592 0.0178  0.0728  -0.0221 118 ILE B O   
1401 C CB  . ILE B 120 ? 0.6219 0.4190 0.8011 -0.0020 0.0811  -0.0668 118 ILE B CB  
1402 C CG1 . ILE B 120 ? 0.7068 0.4851 0.8586 -0.0135 0.0865  -0.0947 118 ILE B CG1 
1403 C CG2 . ILE B 120 ? 0.4625 0.2876 0.6092 0.0108  0.0678  -0.0475 118 ILE B CG2 
1404 C CD1 . ILE B 120 ? 0.7578 0.5284 0.8602 -0.0118 0.0914  -0.0921 118 ILE B CD1 
1405 N N   . LEU B 121 ? 0.6927 0.5701 0.9531 0.0181  0.0401  -0.0316 119 LEU B N   
1406 C CA  . LEU B 121 ? 0.6754 0.5810 0.9591 0.0299  0.0285  -0.0035 119 LEU B CA  
1407 C C   . LEU B 121 ? 0.7201 0.6382 0.9601 0.0392  0.0216  0.0135  119 LEU B C   
1408 O O   . LEU B 121 ? 0.5936 0.5193 0.7845 0.0430  0.0110  0.0039  119 LEU B O   
1409 C CB  . LEU B 121 ? 0.5214 0.4606 0.8302 0.0295  0.0033  -0.0011 119 LEU B CB  
1410 C CG  . LEU B 121 ? 0.6599 0.6338 0.9902 0.0406  -0.0142 0.0276  119 LEU B CG  
1411 C CD1 . LEU B 121 ? 0.4829 0.4541 0.8667 0.0482  0.0030  0.0480  119 LEU B CD1 
1412 C CD2 . LEU B 121 ? 0.6667 0.6688 1.0141 0.0355  -0.0454 0.0284  119 LEU B CD2 
1413 N N   . LEU B 122 ? 0.6553 0.5751 0.9115 0.0452  0.0267  0.0415  120 LEU B N   
1414 C CA  . LEU B 122 ? 0.6347 0.5764 0.8585 0.0548  0.0218  0.0672  120 LEU B CA  
1415 C C   . LEU B 122 ? 0.5433 0.5286 0.7769 0.0681  0.0022  0.0922  120 LEU B C   
1416 O O   . LEU B 122 ? 0.5221 0.5139 0.8028 0.0689  -0.0022 0.1092  120 LEU B O   
1417 C CB  . LEU B 122 ? 0.6838 0.6022 0.9179 0.0494  0.0335  0.0900  120 LEU B CB  
1418 C CG  . LEU B 122 ? 0.6495 0.5218 0.8681 0.0354  0.0505  0.0673  120 LEU B CG  
1419 C CD1 . LEU B 122 ? 0.5065 0.3477 0.7343 0.0269  0.0535  0.0923  120 LEU B CD1 
1420 C CD2 . LEU B 122 ? 0.6007 0.4822 0.7699 0.0366  0.0551  0.0511  120 LEU B CD2 
1421 N N   . LEU B 123 ? 0.5872 0.5989 0.7710 0.0812  -0.0095 0.0941  121 LEU B N   
1422 C CA  . LEU B 123 ? 0.7340 0.7870 0.9161 0.0961  -0.0287 0.1197  121 LEU B CA  
1423 C C   . LEU B 123 ? 0.7756 0.8571 0.9090 0.1162  -0.0243 0.1479  121 LEU B C   
1424 O O   . LEU B 123 ? 0.7264 0.7968 0.8165 0.1211  -0.0103 0.1398  121 LEU B O   
1425 C CB  . LEU B 123 ? 0.7332 0.7907 0.8967 0.0972  -0.0539 0.0969  121 LEU B CB  
1426 C CG  . LEU B 123 ? 0.9076 0.9512 1.1282 0.0789  -0.0595 0.0792  121 LEU B CG  
1427 C CD1 . LEU B 123 ? 1.0117 1.0579 1.2118 0.0754  -0.0916 0.0613  121 LEU B CD1 
1428 C CD2 . LEU B 123 ? 0.7499 0.8112 1.0417 0.0783  -0.0568 0.1067  121 LEU B CD2 
1429 N N   . SER B 124 ? 0.5862 0.7087 0.7302 0.1294  -0.0345 0.1850  122 SER B N   
1430 C CA  . SER B 124 ? 0.6764 0.8370 0.7776 0.1532  -0.0286 0.2197  122 SER B CA  
1431 C C   . SER B 124 ? 0.9280 1.0979 0.9498 0.1784  -0.0421 0.2024  122 SER B C   
1432 O O   . SER B 124 ? 1.0336 1.1978 1.0522 0.1760  -0.0665 0.1836  122 SER B O   
1433 C CB  . SER B 124 ? 0.6036 0.8062 0.7520 0.1570  -0.0344 0.2719  122 SER B CB  
1434 O OG  . SER B 124 ? 1.2280 1.4583 1.3680 0.1694  -0.0557 0.2769  122 SER B OG  
1435 N N   . GLN B 125 ? 0.9289 1.1101 0.8839 0.2041  -0.0280 0.2107  123 GLN B N   
1436 C CA  . GLN B 125 ? 1.0139 1.1916 0.8749 0.2354  -0.0410 0.1924  123 GLN B CA  
1437 C C   . GLN B 125 ? 1.2130 1.4327 1.0601 0.2566  -0.0590 0.2230  123 GLN B C   
1438 O O   . GLN B 125 ? 1.3032 1.5073 1.0851 0.2728  -0.0842 0.2010  123 GLN B O   
1439 C CB  . GLN B 125 ? 1.1068 1.2859 0.8965 0.2650  -0.0166 0.1967  123 GLN B CB  
1440 C CG  . GLN B 125 ? 1.3109 1.4503 0.9918 0.2928  -0.0308 0.1552  123 GLN B CG  
1441 C CD  . GLN B 125 ? 1.4875 1.6007 1.1179 0.3065  -0.0068 0.1380  123 GLN B CD  
1442 O OE1 . GLN B 125 ? 1.3286 1.4216 1.0090 0.2763  0.0065  0.1249  123 GLN B OE1 
1443 N NE2 . GLN B 125 ? 1.6683 1.7800 1.1953 0.3550  -0.0006 0.1386  123 GLN B NE2 
1444 N N   . ASP B 126 ? 1.3164 1.5853 1.2240 0.2548  -0.0498 0.2747  124 ASP B N   
1445 C CA  . ASP B 126 ? 1.4737 1.7878 1.3821 0.2712  -0.0663 0.3092  124 ASP B CA  
1446 C C   . ASP B 126 ? 1.4711 1.8038 1.4842 0.2425  -0.0732 0.3369  124 ASP B C   
1447 O O   . ASP B 126 ? 1.4743 1.7985 1.5503 0.2204  -0.0588 0.3491  124 ASP B O   
1448 C CB  . ASP B 126 ? 1.6334 2.0025 1.4930 0.3121  -0.0474 0.3585  124 ASP B CB  
1449 C CG  . ASP B 126 ? 1.8499 2.2069 1.5866 0.3556  -0.0535 0.3367  124 ASP B CG  
1450 O OD1 . ASP B 126 ? 1.9388 2.2537 1.6349 0.3517  -0.0847 0.2938  124 ASP B OD1 
1451 O OD2 . ASP B 126 ? 1.9130 2.2947 1.6008 0.3872  -0.0261 0.3564  124 ASP B OD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   282 ?   ?   ?   A . n 
A 1 2   SER 2   283 ?   ?   ?   A . n 
A 1 3   LYS 3   284 ?   ?   ?   A . n 
A 1 4   THR 4   285 ?   ?   ?   A . n 
A 1 5   ILE 5   286 ?   ?   ?   A . n 
A 1 6   SER 6   287 ?   ?   ?   A . n 
A 1 7   GLU 7   288 ?   ?   ?   A . n 
A 1 8   SER 8   289 ?   ?   ?   A . n 
A 1 9   GLU 9   290 ?   ?   ?   A . n 
A 1 10  LEU 10  291 ?   ?   ?   A . n 
A 1 11  SER 11  292 ?   ?   ?   A . n 
A 1 12  ALA 12  293 293 ALA ALA A . n 
A 1 13  SER 13  294 294 SER SER A . n 
A 1 14  ALA 14  295 295 ALA ALA A . n 
A 1 15  THR 15  296 296 THR THR A . n 
A 1 16  GLU 16  297 297 GLU GLU A . n 
A 1 17  LEU 17  298 298 LEU LEU A . n 
A 1 18  LEU 18  299 299 LEU LEU A . n 
A 1 19  GLN 19  300 300 GLN GLN A . n 
A 1 20  ASP 20  301 301 ASP ASP A . n 
A 1 21  TYR 21  302 302 TYR TYR A . n 
A 1 22  MET 22  303 303 MET MET A . n 
A 1 23  LEU 23  304 304 LEU LEU A . n 
A 1 24  THR 24  305 305 THR THR A . n 
A 1 25  LEU 25  306 306 LEU LEU A . n 
A 1 26  ARG 26  307 307 ARG ARG A . n 
A 1 27  THR 27  308 308 THR THR A . n 
A 1 28  LYS 28  309 309 LYS LYS A . n 
A 1 29  LEU 29  310 310 LEU LEU A . n 
A 1 30  SER 30  311 311 SER SER A . n 
A 1 31  SER 31  312 312 SER SER A . n 
A 1 32  GLN 32  313 313 GLN GLN A . n 
A 1 33  GLU 33  314 314 GLU GLU A . n 
A 1 34  ILE 34  315 315 ILE ILE A . n 
A 1 35  GLN 35  316 316 GLN GLN A . n 
A 1 36  GLN 36  317 317 GLN GLN A . n 
A 1 37  PHE 37  318 318 PHE PHE A . n 
A 1 38  ALA 38  319 319 ALA ALA A . n 
A 1 39  ALA 39  320 320 ALA ALA A . n 
A 1 40  LEU 40  321 321 LEU LEU A . n 
A 1 41  LEU 41  322 322 LEU LEU A . n 
A 1 42  HIS 42  323 323 HIS HIS A . n 
A 1 43  GLU 43  324 324 GLU GLU A . n 
A 1 44  TYR 44  325 325 TYR TYR A . n 
A 1 45  ARG 45  326 326 ARG ARG A . n 
A 1 46  ASN 46  327 327 ASN ASN A . n 
A 1 47  GLY 47  328 328 GLY GLY A . n 
A 1 48  ALA 48  329 329 ALA ALA A . n 
A 1 49  SER 49  330 330 SER SER A . n 
A 1 50  ILE 50  331 331 ILE ILE A . n 
A 1 51  HIS 51  332 332 HIS HIS A . n 
A 1 52  GLU 52  333 333 GLU GLU A . n 
A 1 53  PHE 53  334 334 PHE PHE A . n 
A 1 54  CYS 54  335 335 CYS CYS A . n 
A 1 55  ILE 55  336 336 ILE ILE A . n 
A 1 56  ASN 56  337 337 ASN ASN A . n 
A 1 57  LEU 57  338 338 LEU LEU A . n 
A 1 58  ARG 58  339 339 ARG ARG A . n 
A 1 59  GLN 59  340 340 GLN GLN A . n 
A 1 60  LEU 60  341 341 LEU LEU A . n 
A 1 61  TYR 61  342 342 TYR TYR A . n 
A 1 62  GLY 62  343 343 GLY GLY A . n 
A 1 63  ASP 63  344 344 ASP ASP A . n 
A 1 64  SER 64  345 345 SER SER A . n 
A 1 65  ARG 65  346 346 ARG ARG A . n 
A 1 66  LYS 66  347 347 LYS LYS A . n 
A 1 67  PHE 67  348 348 PHE PHE A . n 
A 1 68  LEU 68  349 349 LEU LEU A . n 
A 1 69  LEU 69  350 350 LEU LEU A . n 
A 1 70  LEU 70  351 351 LEU LEU A . n 
A 1 71  GLY 71  352 352 GLY GLY A . n 
A 1 72  LEU 72  353 353 LEU LEU A . n 
A 1 73  ARG 73  354 354 ARG ARG A . n 
A 1 74  PRO 74  355 355 PRO PRO A . n 
A 1 75  PHE 75  356 356 PHE PHE A . n 
A 1 76  ILE 76  357 357 ILE ILE A . n 
A 1 77  PRO 77  358 358 PRO PRO A . n 
A 1 78  GLU 78  359 359 GLU GLU A . n 
A 1 79  LYS 79  360 360 LYS LYS A . n 
A 1 80  ASP 80  361 361 ASP ASP A . n 
A 1 81  SER 81  362 362 SER SER A . n 
A 1 82  GLN 82  363 363 GLN GLN A . n 
A 1 83  HIS 83  364 364 HIS HIS A . n 
A 1 84  PHE 84  365 365 PHE PHE A . n 
A 1 85  GLU 85  366 366 GLU GLU A . n 
A 1 86  ASN 86  367 367 ASN ASN A . n 
A 1 87  PHE 87  368 368 PHE PHE A . n 
A 1 88  LEU 88  369 369 LEU LEU A . n 
A 1 89  GLU 89  370 370 GLU GLU A . n 
A 1 90  THR 90  371 ?   ?   ?   A . n 
A 1 91  ILE 91  372 ?   ?   ?   A . n 
A 1 92  GLY 92  373 ?   ?   ?   A . n 
A 1 93  VAL 93  374 ?   ?   ?   A . n 
A 1 94  LYS 94  375 ?   ?   ?   A . n 
A 1 95  ASP 95  376 ?   ?   ?   A . n 
A 1 96  GLY 96  377 ?   ?   ?   A . n 
A 1 97  ARG 97  378 ?   ?   ?   A . n 
A 1 98  GLY 98  379 ?   ?   ?   A . n 
B 2 1   GLY 1   -1  ?   ?   ?   B . n 
B 2 2   SER 2   0   0   SER SER B . n 
B 2 3   MET 3   1   1   MET MET B . n 
B 2 4   ASP 4   2   2   ASP ASP B . n 
B 2 5   GLU 5   3   3   GLU GLU B . n 
B 2 6   GLN 6   4   4   GLN GLN B . n 
B 2 7   GLU 7   5   5   GLU GLU B . n 
B 2 8   ALA 8   6   6   ALA ALA B . n 
B 2 9   LEU 9   7   7   LEU LEU B . n 
B 2 10  ASN 10  8   8   ASN ASN B . n 
B 2 11  SER 11  9   9   SER SER B . n 
B 2 12  ILE 12  10  10  ILE ILE B . n 
B 2 13  MET 13  11  11  MET MET B . n 
B 2 14  ASN 14  12  12  ASN ASN B . n 
B 2 15  ASP 15  13  13  ASP ASP B . n 
B 2 16  LEU 16  14  14  LEU LEU B . n 
B 2 17  VAL 17  15  15  VAL VAL B . n 
B 2 18  ALA 18  16  16  ALA ALA B . n 
B 2 19  LEU 19  17  17  LEU LEU B . n 
B 2 20  GLN 20  18  18  GLN GLN B . n 
B 2 21  MET 21  19  19  MET MET B . n 
B 2 22  ASN 22  20  ?   ?   ?   B . n 
B 2 23  ARG 23  21  ?   ?   ?   B . n 
B 2 24  ARG 24  22  ?   ?   ?   B . n 
B 2 25  HIS 25  23  ?   ?   ?   B . n 
B 2 26  ARG 26  24  ?   ?   ?   B . n 
B 2 27  MET 27  25  ?   ?   ?   B . n 
B 2 28  PRO 28  26  ?   ?   ?   B . n 
B 2 29  GLY 29  27  ?   ?   ?   B . n 
B 2 30  TYR 30  28  ?   ?   ?   B . n 
B 2 31  GLU 31  29  ?   ?   ?   B . n 
B 2 32  THR 32  30  ?   ?   ?   B . n 
B 2 33  MET 33  31  ?   ?   ?   B . n 
B 2 34  LYS 34  32  ?   ?   ?   B . n 
B 2 35  ASN 35  33  ?   ?   ?   B . n 
B 2 36  LYS 36  34  ?   ?   ?   B . n 
B 2 37  ASP 37  35  ?   ?   ?   B . n 
B 2 38  THR 38  36  ?   ?   ?   B . n 
B 2 39  GLY 39  37  ?   ?   ?   B . n 
B 2 40  HIS 40  38  ?   ?   ?   B . n 
B 2 41  SER 41  39  ?   ?   ?   B . n 
B 2 42  ASN 42  40  ?   ?   ?   B . n 
B 2 43  ARG 43  41  ?   ?   ?   B . n 
B 2 44  GLN 44  42  42  GLN GLN B . n 
B 2 45  SER 45  43  43  SER SER B . n 
B 2 46  ASP 46  44  44  ASP ASP B . n 
B 2 47  VAL 47  45  45  VAL VAL B . n 
B 2 48  ARG 48  46  46  ARG ARG B . n 
B 2 49  ILE 49  47  47  ILE ILE B . n 
B 2 50  LYS 50  48  48  LYS LYS B . n 
B 2 51  PHE 51  49  49  PHE PHE B . n 
B 2 52  GLU 52  50  50  GLU GLU B . n 
B 2 53  HIS 53  51  51  HIS HIS B . n 
B 2 54  ASN 54  52  52  ASN ASN B . n 
B 2 55  GLY 55  53  53  GLY GLY B . n 
B 2 56  GLU 56  54  54  GLU GLU B . n 
B 2 57  ARG 57  55  55  ARG ARG B . n 
B 2 58  ARG 58  56  56  ARG ARG B . n 
B 2 59  ILE 59  57  57  ILE ILE B . n 
B 2 60  ILE 60  58  58  ILE ILE B . n 
B 2 61  ALA 61  59  59  ALA ALA B . n 
B 2 62  PHE 62  60  60  PHE PHE B . n 
B 2 63  SER 63  61  61  SER SER B . n 
B 2 64  ARG 64  62  62  ARG ARG B . n 
B 2 65  PRO 65  63  63  PRO PRO B . n 
B 2 66  VAL 66  64  64  VAL VAL B . n 
B 2 67  LYS 67  65  65  LYS LYS B . n 
B 2 68  TYR 68  66  66  TYR TYR B . n 
B 2 69  GLU 69  67  67  GLU GLU B . n 
B 2 70  ASP 70  68  68  ASP ASP B . n 
B 2 71  VAL 71  69  69  VAL VAL B . n 
B 2 72  GLU 72  70  70  GLU GLU B . n 
B 2 73  HIS 73  71  71  HIS HIS B . n 
B 2 74  LYS 74  72  72  LYS LYS B . n 
B 2 75  VAL 75  73  73  VAL VAL B . n 
B 2 76  THR 76  74  74  THR THR B . n 
B 2 77  THR 77  75  75  THR THR B . n 
B 2 78  VAL 78  76  76  VAL VAL B . n 
B 2 79  PHE 79  77  77  PHE PHE B . n 
B 2 80  GLY 80  78  78  GLY GLY B . n 
B 2 81  GLN 81  79  79  GLN GLN B . n 
B 2 82  PRO 82  80  80  PRO PRO B . n 
B 2 83  LEU 83  81  81  LEU LEU B . n 
B 2 84  ASP 84  82  82  ASP ASP B . n 
B 2 85  LEU 85  83  83  LEU LEU B . n 
B 2 86  HIS 86  84  84  HIS HIS B . n 
B 2 87  TYR 87  85  85  TYR TYR B . n 
B 2 88  MET 88  86  86  MET MET B . n 
B 2 89  ASN 89  87  87  ASN ASN B . n 
B 2 90  ASN 90  88  88  ASN ASN B . n 
B 2 91  GLU 91  89  89  GLU GLU B . n 
B 2 92  LEU 92  90  90  LEU LEU B . n 
B 2 93  SER 93  91  91  SER SER B . n 
B 2 94  ILE 94  92  92  ILE ILE B . n 
B 2 95  LEU 95  93  93  LEU LEU B . n 
B 2 96  LEU 96  94  94  LEU LEU B . n 
B 2 97  LYS 97  95  95  LYS LYS B . n 
B 2 98  ASN 98  96  96  ASN ASN B . n 
B 2 99  GLN 99  97  97  GLN GLN B . n 
B 2 100 ASP 100 98  98  ASP ASP B . n 
B 2 101 ASP 101 99  99  ASP ASP B . n 
B 2 102 LEU 102 100 100 LEU LEU B . n 
B 2 103 ASP 103 101 101 ASP ASP B . n 
B 2 104 LYS 104 102 102 LYS LYS B . n 
B 2 105 ALA 105 103 103 ALA ALA B . n 
B 2 106 ILE 106 104 104 ILE ILE B . n 
B 2 107 ASP 107 105 105 ASP ASP B . n 
B 2 108 ILE 108 106 106 ILE ILE B . n 
B 2 109 LEU 109 107 107 LEU LEU B . n 
B 2 110 ASP 110 108 108 ASP ASP B . n 
B 2 111 ARG 111 109 109 ARG ARG B . n 
B 2 112 SER 112 110 110 SER SER B . n 
B 2 113 SER 113 111 111 SER SER B . n 
B 2 114 SER 114 112 112 SER SER B . n 
B 2 115 MET 115 113 113 MET MET B . n 
B 2 116 LYS 116 114 114 LYS LYS B . n 
B 2 117 SER 117 115 115 SER SER B . n 
B 2 118 LEU 118 116 116 LEU LEU B . n 
B 2 119 ARG 119 117 117 ARG ARG B . n 
B 2 120 ILE 120 118 118 ILE ILE B . n 
B 2 121 LEU 121 119 119 LEU LEU B . n 
B 2 122 LEU 122 120 120 LEU LEU B . n 
B 2 123 LEU 123 121 121 LEU LEU B . n 
B 2 124 SER 124 122 122 SER SER B . n 
B 2 125 GLN 125 123 123 GLN GLN B . n 
B 2 126 ASP 126 124 124 ASP ASP B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 HOH 1  401 17 HOH HOH A . 
C 3 HOH 2  402 7  HOH HOH A . 
D 3 HOH 1  201 20 HOH HOH B . 
D 3 HOH 2  202 15 HOH HOH B . 
D 3 HOH 3  203 5  HOH HOH B . 
D 3 HOH 4  204 10 HOH HOH B . 
D 3 HOH 5  205 13 HOH HOH B . 
D 3 HOH 6  206 3  HOH HOH B . 
D 3 HOH 7  207 2  HOH HOH B . 
D 3 HOH 8  208 14 HOH HOH B . 
D 3 HOH 9  209 4  HOH HOH B . 
D 3 HOH 10 210 1  HOH HOH B . 
D 3 HOH 11 211 16 HOH HOH B . 
D 3 HOH 12 212 6  HOH HOH B . 
D 3 HOH 13 213 8  HOH HOH B . 
D 3 HOH 14 214 9  HOH HOH B . 
D 3 HOH 15 215 11 HOH HOH B . 
D 3 HOH 16 216 12 HOH HOH B . 
D 3 HOH 17 217 18 HOH HOH B . 
D 3 HOH 18 218 19 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2590  ? 
1 MORE         -17   ? 
1 'SSA (A^2)'  10150 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-07-01 
2 'Structure model' 1 1 2015-08-12 
3 'Structure model' 1 2 2017-09-06 
4 'Structure model' 1 3 2019-11-27 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Refinement description'     
2 3 'Structure model' 'Author supporting evidence' 
3 3 'Structure model' 'Derived calculations'       
4 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_audit_support    
2 3 'Structure model' pdbx_struct_oper_list 
3 4 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_pdbx_audit_support.funding_organization'  
2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
3 4 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined 16.1405  -13.8073 -15.6813 0.4793 ? -0.0283 ? -0.0869 ? 0.8934 ? -0.1312 ? 0.8510 ? 5.1410 ? 
-3.0360 ? -6.1704 ? 2.0564 ? 3.1706  ? 9.0120 ? 0.3819  ? -0.5195 ? 0.4358  ? 0.5319  ? 0.5983  ? -0.4360 ? -0.3950 ? 1.3075  ? 
-1.2024 ? 
2 'X-RAY DIFFRACTION' ? refined 1.5109   -14.9225 -19.6581 0.4807 ? 0.0247  ? -0.0062 ? 0.6819 ? -0.1782 ? 0.7250 ? 3.7589 ? 
-5.3498 ? -3.3498 ? 9.3464 ? 2.9683  ? 7.5228 ? -0.3281 ? -1.0770 ? -0.2996 ? 0.0436  ? -0.3416 ? 0.2437  ? 0.2483  ? -0.2525 ? 
0.8017  ? 
3 'X-RAY DIFFRACTION' ? refined 2.0976   -18.7974 -8.2265  0.8364 ? 0.0215  ? -0.1030 ? 1.7005 ? 0.0253  ? 0.6017 ? 4.9709 ? 
2.7866  ? -0.2357 ? 2.9373 ? 3.2297  ? 8.6700 ? 0.3063  ? -2.8221 ? -0.3344 ? 0.9385  ? -0.7620 ? -0.2545 ? 0.6439  ? -0.0687 ? 
0.4285  ? 
4 'X-RAY DIFFRACTION' ? refined 8.1194   -10.4126 -23.6990 0.5233 ? -0.1466 ? -0.0911 ? 0.6666 ? -0.0762 ? 0.9643 ? 2.1744 ? 
-0.8568 ? 0.5099  ? 9.2269 ? 2.9107  ? 2.2011 ? 0.3220  ? -0.5982 ? 1.6700  ? -0.2567 ? -0.5508 ? -0.2412 ? -0.8636 ? -0.2087 ? 
0.2288  ? 
5 'X-RAY DIFFRACTION' ? refined -7.5301  -14.2964 -27.4276 0.3796 ? 0.0457  ? 0.2443  ? 0.2577 ? -0.1366 ? 0.6975 ? 5.7779 ? 
-0.0374 ? 0.4358  ? 5.1657 ? -0.6332 ? 4.9786 ? 0.1688  ? 0.5929  ? -0.2916 ? -0.1517 ? 0.4394  ? -0.7690 ? -0.1480 ? 0.8904  ? 
-0.5860 ? 
6 'X-RAY DIFFRACTION' ? refined -15.4595 -19.5868 -31.6787 0.4952 ? 0.0761  ? 0.0553  ? 0.3549 ? -0.1136 ? 0.4157 ? 9.4362 ? 
-0.9418 ? 2.6960  ? 4.1989 ? -2.6665 ? 2.7393 ? -0.1117 ? -0.3908 ? -0.3730 ? -0.1175 ? 0.5590  ? -0.1245 ? 0.5078  ? 0.1452  ? 
-0.3998 ? 
7 'X-RAY DIFFRACTION' ? refined -13.8608 -16.2608 -23.1072 0.3597 ? 0.0495  ? 0.0047  ? 0.4052 ? -0.1722 ? 0.4807 ? 5.8890 ? 
1.7058  ? 1.3283  ? 8.5474 ? -2.7547 ? 3.5832 ? -0.0911 ? -0.9074 ? 0.2838  ? 0.5121  ? -0.0703 ? 0.0715  ? -0.2188 ? 0.0701  ? 
0.1222  ? 
8 'X-RAY DIFFRACTION' ? refined -9.8632  -7.5398  -32.4448 0.4604 ? -0.0205 ? -0.0041 ? 0.3698 ? 0.0109  ? 0.6068 ? 4.8058 ? 
3.6776  ? 0.1293  ? 9.1274 ? -3.1376 ? 2.6568 ? -0.0808 ? -0.0638 ? 0.9248  ? -0.9069 ? -0.0027 ? 0.1376  ? -1.0803 ? 0.7314  ? 
0.0196  ? 
9 'X-RAY DIFFRACTION' ? refined -9.6663  -19.5304 -20.7945 0.5112 ? 0.0574  ? 0.0066  ? 0.4600 ? 0.0290  ? 0.6766 ? 2.8312 ? 
-1.6684 ? 2.2850  ? 4.4825 ? -4.2803 ? 4.1470 ? -0.2915 ? -1.2570 ? -0.6363 ? 0.5601  ? 0.3626  ? -0.7862 ? -0.2578 ? 0.0862  ? 
-0.1636 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 293 through 309 )
;
2 'X-RAY DIFFRACTION' 2 ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 310 through 327 )
;
3 'X-RAY DIFFRACTION' 3 ? ? A 0 ? ? A 0 ? 
;chain 'A' and (resid 328 through 370 )
;
4 'X-RAY DIFFRACTION' 4 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 0 through 15 )
;
5 'X-RAY DIFFRACTION' 5 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 16 through 51 )
;
6 'X-RAY DIFFRACTION' 6 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 52 through 65 )
;
7 'X-RAY DIFFRACTION' 7 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 66 through 96 )
;
8 'X-RAY DIFFRACTION' 8 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 97 through 115 )
;
9 'X-RAY DIFFRACTION' 9 ? ? B 0 ? ? B 0 ? 
;chain 'B' and (resid 116 through 124 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .          1 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.8.1_1168 2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15       3 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot        ? ? ? .          4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .          5 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .          6 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    206 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    207 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.03 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA B 16 ? ? -91.58  47.07   
2 1 ASN B 87 ? ? -158.82 54.18   
3 1 ASN B 88 ? ? 45.68   -124.90 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 339 ? CG  ? A ARG 58 CG  
2  1 Y 1 A ARG 339 ? CD  ? A ARG 58 CD  
3  1 Y 1 A ARG 339 ? NE  ? A ARG 58 NE  
4  1 Y 1 A ARG 339 ? CZ  ? A ARG 58 CZ  
5  1 Y 1 A ARG 339 ? NH1 ? A ARG 58 NH1 
6  1 Y 1 A ARG 339 ? NH2 ? A ARG 58 NH2 
7  1 Y 1 A LYS 347 ? CG  ? A LYS 66 CG  
8  1 Y 1 A LYS 347 ? CD  ? A LYS 66 CD  
9  1 Y 1 A LYS 347 ? CE  ? A LYS 66 CE  
10 1 Y 1 A LYS 347 ? NZ  ? A LYS 66 NZ  
11 1 Y 1 A GLU 359 ? CG  ? A GLU 78 CG  
12 1 Y 1 A GLU 359 ? CD  ? A GLU 78 CD  
13 1 Y 1 A GLU 359 ? OE1 ? A GLU 78 OE1 
14 1 Y 1 A GLU 359 ? OE2 ? A GLU 78 OE2 
15 1 Y 1 A GLN 363 ? CG  ? A GLN 82 CG  
16 1 Y 1 A GLN 363 ? CD  ? A GLN 82 CD  
17 1 Y 1 A GLN 363 ? OE1 ? A GLN 82 OE1 
18 1 Y 1 A GLN 363 ? NE2 ? A GLN 82 NE2 
19 1 Y 1 A HIS 364 ? CG  ? A HIS 83 CG  
20 1 Y 1 A HIS 364 ? ND1 ? A HIS 83 ND1 
21 1 Y 1 A HIS 364 ? CD2 ? A HIS 83 CD2 
22 1 Y 1 A HIS 364 ? CE1 ? A HIS 83 CE1 
23 1 Y 1 A HIS 364 ? NE2 ? A HIS 83 NE2 
24 1 Y 1 A ASN 367 ? CG  ? A ASN 86 CG  
25 1 Y 1 A ASN 367 ? OD1 ? A ASN 86 OD1 
26 1 Y 1 A ASN 367 ? ND2 ? A ASN 86 ND2 
27 1 Y 1 B GLU 5   ? CG  ? B GLU 7  CG  
28 1 Y 1 B GLU 5   ? CD  ? B GLU 7  CD  
29 1 Y 1 B GLU 5   ? OE1 ? B GLU 7  OE1 
30 1 Y 1 B GLU 5   ? OE2 ? B GLU 7  OE2 
31 1 Y 1 B ARG 55  ? CG  ? B ARG 57 CG  
32 1 Y 1 B ARG 55  ? CD  ? B ARG 57 CD  
33 1 Y 1 B ARG 55  ? NE  ? B ARG 57 NE  
34 1 Y 1 B ARG 55  ? CZ  ? B ARG 57 CZ  
35 1 Y 1 B ARG 55  ? NH1 ? B ARG 57 NH1 
36 1 Y 1 B ARG 55  ? NH2 ? B ARG 57 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 282 ? A GLY 1  
2  1 Y 1 A SER 283 ? A SER 2  
3  1 Y 1 A LYS 284 ? A LYS 3  
4  1 Y 1 A THR 285 ? A THR 4  
5  1 Y 1 A ILE 286 ? A ILE 5  
6  1 Y 1 A SER 287 ? A SER 6  
7  1 Y 1 A GLU 288 ? A GLU 7  
8  1 Y 1 A SER 289 ? A SER 8  
9  1 Y 1 A GLU 290 ? A GLU 9  
10 1 Y 1 A LEU 291 ? A LEU 10 
11 1 Y 1 A SER 292 ? A SER 11 
12 1 Y 1 A THR 371 ? A THR 90 
13 1 Y 1 A ILE 372 ? A ILE 91 
14 1 Y 1 A GLY 373 ? A GLY 92 
15 1 Y 1 A VAL 374 ? A VAL 93 
16 1 Y 1 A LYS 375 ? A LYS 94 
17 1 Y 1 A ASP 376 ? A ASP 95 
18 1 Y 1 A GLY 377 ? A GLY 96 
19 1 Y 1 A ARG 378 ? A ARG 97 
20 1 Y 1 A GLY 379 ? A GLY 98 
21 1 Y 1 B GLY -1  ? B GLY 1  
22 1 Y 1 B ASN 20  ? B ASN 22 
23 1 Y 1 B ARG 21  ? B ARG 23 
24 1 Y 1 B ARG 22  ? B ARG 24 
25 1 Y 1 B HIS 23  ? B HIS 25 
26 1 Y 1 B ARG 24  ? B ARG 26 
27 1 Y 1 B MET 25  ? B MET 27 
28 1 Y 1 B PRO 26  ? B PRO 28 
29 1 Y 1 B GLY 27  ? B GLY 29 
30 1 Y 1 B TYR 28  ? B TYR 30 
31 1 Y 1 B GLU 29  ? B GLU 31 
32 1 Y 1 B THR 30  ? B THR 32 
33 1 Y 1 B MET 31  ? B MET 33 
34 1 Y 1 B LYS 32  ? B LYS 34 
35 1 Y 1 B ASN 33  ? B ASN 35 
36 1 Y 1 B LYS 34  ? B LYS 36 
37 1 Y 1 B ASP 35  ? B ASP 37 
38 1 Y 1 B THR 36  ? B THR 38 
39 1 Y 1 B GLY 37  ? B GLY 39 
40 1 Y 1 B HIS 38  ? B HIS 40 
41 1 Y 1 B SER 39  ? B SER 41 
42 1 Y 1 B ASN 40  ? B ASN 42 
43 1 Y 1 B ARG 41  ? B ARG 43 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM007324 1 
'National Science Foundation (NSF, United States)'                                         'United States' ?        2 
# 
_pdbx_entity_nonpoly.entity_id   3 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#