data_4YAY
# 
_entry.id   4YAY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YAY         
WWPDB D_1000206382 
# 
_pdbx_database_related.db_name        TargetTrack 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          GPCR-11 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YAY 
_pdbx_database_status.recvd_initial_deposition_date   2015-02-18 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, H.'           1  
'Unal, H.'            2  
'Gati, C.'            3  
'Han, G.W.'           4  
'Zatsepin, N.A.'      5  
'James, D.'           6  
'Wang, D.'            7  
'Nelson, G.'          8  
'Weierstall, U.'      9  
'Messerschmidt, M.'   10 
'Williams, G.J.'      11 
'Boutet, S.'          12 
'Yefanov, O.M.'       13 
'White, T.A.'         14 
'Liu, W.'             15 
'Ishchenko, A.'       16 
'Tirupula, K.C.'      17 
'Desnoyer, R.'        18 
'Sawaya, M.C.'        19 
'Xu, Q.'              20 
'Coe, J.'             21 
'Cornrad, C.E.'       22 
'Fromme, P.'          23 
'Stevens, R.C.'       24 
'Katritch, V.'        25 
'Karnik, S.S.'        26 
'Cherezov, V.'        27 
'GPCR Network (GPCR)' 28 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            161 
_citation.language                  ? 
_citation.page_first                833 
_citation.page_last                 844 
_citation.title                     'Structure of the Angiotensin receptor revealed by serial femtosecond crystallography.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2015.04.011 
_citation.pdbx_database_id_PubMed   25913193 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, H.'         1  ? 
primary 'Unal, H.'          2  ? 
primary 'Gati, C.'          3  ? 
primary 'Han, G.W.'         4  ? 
primary 'Liu, W.'           5  ? 
primary 'Zatsepin, N.A.'    6  ? 
primary 'James, D.'         7  ? 
primary 'Wang, D.'          8  ? 
primary 'Nelson, G.'        9  ? 
primary 'Weierstall, U.'    10 ? 
primary 'Sawaya, M.R.'      11 ? 
primary 'Xu, Q.'            12 ? 
primary 'Messerschmidt, M.' 13 ? 
primary 'Williams, G.J.'    14 ? 
primary 'Boutet, S.'        15 ? 
primary 'Yefanov, O.M.'     16 ? 
primary 'White, T.A.'       17 ? 
primary 'Wang, C.'          18 ? 
primary 'Ishchenko, A.'     19 ? 
primary 'Tirupula, K.C.'    20 ? 
primary 'Desnoyer, R.'      21 ? 
primary 'Coe, J.'           22 ? 
primary 'Conrad, C.E.'      23 ? 
primary 'Fromme, P.'        24 ? 
primary 'Stevens, R.C.'     25 ? 
primary 'Katritch, V.'      26 ? 
primary 'Karnik, S.S.'      27 ? 
primary 'Cherezov, V.'      28 ? 
# 
_cell.entry_id           4YAY 
_cell.length_a           72.800 
_cell.length_b           41.000 
_cell.length_c           167.700 
_cell.angle_alpha        90.00 
_cell.angle_beta         99.40 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4YAY 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Soluble cytochrome b562,Type-1 angiotensin II receptor'                                            47240.707 1 
? 'M1007W, H1102I, R1106L' ? ? 
2 non-polymer syn "5,7-diethyl-1-{[2'-(1H-tetrazol-5-yl)biphenyl-4-yl]methyl}-3,4-dihydro-1,6-naphthyridin-2(1H)-one" 438.524   1 
? ?                        ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Cytochrome b-562,AT1AR,AT1BR,Angiotensin II type-1 receptor,AT1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYIQKYLILNSSDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASV
FLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVA
KVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKA
YEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFL
GKKFKRYFLQLLKY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;ADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYIQKYLILNSSDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASV
FLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVA
KVTCIIIWLLAGLASLPAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKA
YEIQKNKPRNDDIFKIIMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFL
GKKFKRYFLQLLKY
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         GPCR-11 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ASP n 
1 3   LEU n 
1 4   GLU n 
1 5   ASP n 
1 6   ASN n 
1 7   TRP n 
1 8   GLU n 
1 9   THR n 
1 10  LEU n 
1 11  ASN n 
1 12  ASP n 
1 13  ASN n 
1 14  LEU n 
1 15  LYS n 
1 16  VAL n 
1 17  ILE n 
1 18  GLU n 
1 19  LYS n 
1 20  ALA n 
1 21  ASP n 
1 22  ASN n 
1 23  ALA n 
1 24  ALA n 
1 25  GLN n 
1 26  VAL n 
1 27  LYS n 
1 28  ASP n 
1 29  ALA n 
1 30  LEU n 
1 31  THR n 
1 32  LYS n 
1 33  MET n 
1 34  ARG n 
1 35  ALA n 
1 36  ALA n 
1 37  ALA n 
1 38  LEU n 
1 39  ASP n 
1 40  ALA n 
1 41  GLN n 
1 42  LYS n 
1 43  ALA n 
1 44  THR n 
1 45  PRO n 
1 46  PRO n 
1 47  LYS n 
1 48  LEU n 
1 49  GLU n 
1 50  ASP n 
1 51  LYS n 
1 52  SER n 
1 53  PRO n 
1 54  ASP n 
1 55  SER n 
1 56  PRO n 
1 57  GLU n 
1 58  MET n 
1 59  LYS n 
1 60  ASP n 
1 61  PHE n 
1 62  ARG n 
1 63  HIS n 
1 64  GLY n 
1 65  PHE n 
1 66  ASP n 
1 67  ILE n 
1 68  LEU n 
1 69  VAL n 
1 70  GLY n 
1 71  GLN n 
1 72  ILE n 
1 73  ASP n 
1 74  ASP n 
1 75  ALA n 
1 76  LEU n 
1 77  LYS n 
1 78  LEU n 
1 79  ALA n 
1 80  ASN n 
1 81  GLU n 
1 82  GLY n 
1 83  LYS n 
1 84  VAL n 
1 85  LYS n 
1 86  GLU n 
1 87  ALA n 
1 88  GLN n 
1 89  ALA n 
1 90  ALA n 
1 91  ALA n 
1 92  GLU n 
1 93  GLN n 
1 94  LEU n 
1 95  LYS n 
1 96  THR n 
1 97  THR n 
1 98  ARG n 
1 99  ASN n 
1 100 ALA n 
1 101 TYR n 
1 102 ILE n 
1 103 GLN n 
1 104 LYS n 
1 105 TYR n 
1 106 LEU n 
1 107 ILE n 
1 108 LEU n 
1 109 ASN n 
1 110 SER n 
1 111 SER n 
1 112 ASP n 
1 113 CYS n 
1 114 PRO n 
1 115 LYS n 
1 116 ALA n 
1 117 GLY n 
1 118 ARG n 
1 119 HIS n 
1 120 ASN n 
1 121 TYR n 
1 122 ILE n 
1 123 PHE n 
1 124 VAL n 
1 125 MET n 
1 126 ILE n 
1 127 PRO n 
1 128 THR n 
1 129 LEU n 
1 130 TYR n 
1 131 SER n 
1 132 ILE n 
1 133 ILE n 
1 134 PHE n 
1 135 VAL n 
1 136 VAL n 
1 137 GLY n 
1 138 ILE n 
1 139 PHE n 
1 140 GLY n 
1 141 ASN n 
1 142 SER n 
1 143 LEU n 
1 144 VAL n 
1 145 VAL n 
1 146 ILE n 
1 147 VAL n 
1 148 ILE n 
1 149 TYR n 
1 150 PHE n 
1 151 TYR n 
1 152 MET n 
1 153 LYS n 
1 154 LEU n 
1 155 LYS n 
1 156 THR n 
1 157 VAL n 
1 158 ALA n 
1 159 SER n 
1 160 VAL n 
1 161 PHE n 
1 162 LEU n 
1 163 LEU n 
1 164 ASN n 
1 165 LEU n 
1 166 ALA n 
1 167 LEU n 
1 168 ALA n 
1 169 ASP n 
1 170 LEU n 
1 171 CYS n 
1 172 PHE n 
1 173 LEU n 
1 174 LEU n 
1 175 THR n 
1 176 LEU n 
1 177 PRO n 
1 178 LEU n 
1 179 TRP n 
1 180 ALA n 
1 181 VAL n 
1 182 TYR n 
1 183 THR n 
1 184 ALA n 
1 185 MET n 
1 186 GLU n 
1 187 TYR n 
1 188 ARG n 
1 189 TRP n 
1 190 PRO n 
1 191 PHE n 
1 192 GLY n 
1 193 ASN n 
1 194 TYR n 
1 195 LEU n 
1 196 CYS n 
1 197 LYS n 
1 198 ILE n 
1 199 ALA n 
1 200 SER n 
1 201 ALA n 
1 202 SER n 
1 203 VAL n 
1 204 SER n 
1 205 PHE n 
1 206 ASN n 
1 207 LEU n 
1 208 TYR n 
1 209 ALA n 
1 210 SER n 
1 211 VAL n 
1 212 PHE n 
1 213 LEU n 
1 214 LEU n 
1 215 THR n 
1 216 CYS n 
1 217 LEU n 
1 218 SER n 
1 219 ILE n 
1 220 ASP n 
1 221 ARG n 
1 222 TYR n 
1 223 LEU n 
1 224 ALA n 
1 225 ILE n 
1 226 VAL n 
1 227 HIS n 
1 228 PRO n 
1 229 MET n 
1 230 LYS n 
1 231 SER n 
1 232 ARG n 
1 233 LEU n 
1 234 ARG n 
1 235 ARG n 
1 236 THR n 
1 237 MET n 
1 238 LEU n 
1 239 VAL n 
1 240 ALA n 
1 241 LYS n 
1 242 VAL n 
1 243 THR n 
1 244 CYS n 
1 245 ILE n 
1 246 ILE n 
1 247 ILE n 
1 248 TRP n 
1 249 LEU n 
1 250 LEU n 
1 251 ALA n 
1 252 GLY n 
1 253 LEU n 
1 254 ALA n 
1 255 SER n 
1 256 LEU n 
1 257 PRO n 
1 258 ALA n 
1 259 ILE n 
1 260 ILE n 
1 261 HIS n 
1 262 ARG n 
1 263 ASN n 
1 264 VAL n 
1 265 PHE n 
1 266 PHE n 
1 267 ILE n 
1 268 GLU n 
1 269 ASN n 
1 270 THR n 
1 271 ASN n 
1 272 ILE n 
1 273 THR n 
1 274 VAL n 
1 275 CYS n 
1 276 ALA n 
1 277 PHE n 
1 278 HIS n 
1 279 TYR n 
1 280 GLU n 
1 281 SER n 
1 282 GLN n 
1 283 ASN n 
1 284 SER n 
1 285 THR n 
1 286 LEU n 
1 287 PRO n 
1 288 ILE n 
1 289 GLY n 
1 290 LEU n 
1 291 GLY n 
1 292 LEU n 
1 293 THR n 
1 294 LYS n 
1 295 ASN n 
1 296 ILE n 
1 297 LEU n 
1 298 GLY n 
1 299 PHE n 
1 300 LEU n 
1 301 PHE n 
1 302 PRO n 
1 303 PHE n 
1 304 LEU n 
1 305 ILE n 
1 306 ILE n 
1 307 LEU n 
1 308 THR n 
1 309 SER n 
1 310 TYR n 
1 311 THR n 
1 312 LEU n 
1 313 ILE n 
1 314 TRP n 
1 315 LYS n 
1 316 ALA n 
1 317 LEU n 
1 318 LYS n 
1 319 LYS n 
1 320 ALA n 
1 321 TYR n 
1 322 GLU n 
1 323 ILE n 
1 324 GLN n 
1 325 LYS n 
1 326 ASN n 
1 327 LYS n 
1 328 PRO n 
1 329 ARG n 
1 330 ASN n 
1 331 ASP n 
1 332 ASP n 
1 333 ILE n 
1 334 PHE n 
1 335 LYS n 
1 336 ILE n 
1 337 ILE n 
1 338 MET n 
1 339 ALA n 
1 340 ILE n 
1 341 VAL n 
1 342 LEU n 
1 343 PHE n 
1 344 PHE n 
1 345 PHE n 
1 346 PHE n 
1 347 SER n 
1 348 TRP n 
1 349 ILE n 
1 350 PRO n 
1 351 HIS n 
1 352 GLN n 
1 353 ILE n 
1 354 PHE n 
1 355 THR n 
1 356 PHE n 
1 357 LEU n 
1 358 ASP n 
1 359 VAL n 
1 360 LEU n 
1 361 ILE n 
1 362 GLN n 
1 363 LEU n 
1 364 GLY n 
1 365 ILE n 
1 366 ILE n 
1 367 ARG n 
1 368 ASP n 
1 369 CYS n 
1 370 ARG n 
1 371 ILE n 
1 372 ALA n 
1 373 ASP n 
1 374 ILE n 
1 375 VAL n 
1 376 ASP n 
1 377 THR n 
1 378 ALA n 
1 379 MET n 
1 380 PRO n 
1 381 ILE n 
1 382 THR n 
1 383 ILE n 
1 384 CYS n 
1 385 ILE n 
1 386 ALA n 
1 387 TYR n 
1 388 PHE n 
1 389 ASN n 
1 390 ASN n 
1 391 CYS n 
1 392 LEU n 
1 393 ASN n 
1 394 PRO n 
1 395 LEU n 
1 396 PHE n 
1 397 TYR n 
1 398 GLY n 
1 399 PHE n 
1 400 LEU n 
1 401 GLY n 
1 402 LYS n 
1 403 LYS n 
1 404 PHE n 
1 405 LYS n 
1 406 ARG n 
1 407 TYR n 
1 408 PHE n 
1 409 LEU n 
1 410 GLN n 
1 411 LEU n 
1 412 LEU n 
1 413 LYS n 
1 414 TYR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   106 ?     ? cybC                                   ? ? ? ? ? ? 'Escherichia coli' 562  ? ? ? 
? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? sf9 ? sf9 CRL-1711 ? ? ? ? plasmid ? ? ? pFASTBAC ? ? 
1 2 sample 'Biological sequence' 107 414 Human ? 'AGTR1, AGTR1A, AGTR1B, AT2R1, AT2R1B' ? ? ? ? ? ? 'Homo sapiens'     9606 ? ? ? 
? ? ? ? ? 'Spodoptera frugiperda' 7108 ? ? ? ? ? ? sf9 ? sf9 CRL-1711 ? ? ? ? plasmid ? ? ? pFASTBAC ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP C562_ECOLX  P0ABE7 ? 1 
;ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLAN
EGKVKEAQAAAEQLKTTRNAYIQKYL
;
23 
2 UNP AGTR1_HUMAN P30556 ? 1 
;ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLKTVASVFLLNLALADLCFLLTL
PLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLTCLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASL
PAIIHRNVFFIENTNITVCAFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKALKKAYEIQKNKPRNDDIFKI
IMAIVLFFFFSWIPHQIFTFLDVLIQLGIIRDCRIADIVDTAMPITICIAYFNNCLNPLFYGFLGKKFKRYFLQLLKY
;
2  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YAY A 1   ? 106 ? P0ABE7 23 ? 128 ? 1001 1106 
2 2 4YAY A 107 ? 414 ? P30556 2  ? 319 ? 12   319  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4YAY TRP A 7   ? UNP P0ABE7 MET 29  'engineered mutation' 1007 1  
1 4YAY ILE A 102 ? UNP P0ABE7 ILE 124 'engineered mutation' 1102 2  
1 4YAY LEU A 106 ? UNP P0ABE7 LEU 128 'engineered mutation' 1106 3  
2 4YAY ?   A ?   ? UNP P30556 THR 7   deletion              ?    4  
2 4YAY ?   A ?   ? UNP P30556 GLU 8   deletion              ?    5  
2 4YAY ?   A ?   ? UNP P30556 ASP 9   deletion              ?    6  
2 4YAY ?   A ?   ? UNP P30556 GLY 10  deletion              ?    7  
2 4YAY ?   A ?   ? UNP P30556 ILE 11  deletion              ?    8  
2 4YAY ?   A ?   ? UNP P30556 LYS 12  deletion              ?    9  
2 4YAY ?   A ?   ? UNP P30556 ARG 13  deletion              ?    10 
2 4YAY ?   A ?   ? UNP P30556 ILE 14  deletion              ?    11 
2 4YAY ?   A ?   ? UNP P30556 GLN 15  deletion              ?    12 
2 4YAY ?   A ?   ? UNP P30556 ASP 16  deletion              ?    13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                             ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                            ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                          ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                     ? 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                            ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                           ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                     ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                             ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                           ? 
'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                          ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                             ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                              ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                          ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                       ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                             ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                                              ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                                           ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                          ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                            ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                              ? 
'C5 H11 N O2'    117.146 
ZD7 non-polymer         . "5,7-diethyl-1-{[2'-(1H-tetrazol-5-yl)biphenyl-4-yl]methyl}-3,4-dihydro-1,6-naphthyridin-2(1H)-one" ? 
'C26 H26 N6 O'   438.524 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YAY 
_exptl.crystals_number            457275 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.61 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.92 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'LIPIDIC CUBIC PHASE' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM sodium citrate, pH 5.0, 450 mM NH4H2PO4, 28% (v/v) PEG400 and 4% (v/v) DMSO' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           294 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'CS-PAD CXI-1' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-02-01 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    Mirrors 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.56 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'FREE ELECTRON LASER' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLAC LCLS BEAMLINE CXI' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.56 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   CXI 
_diffrn_source.pdbx_synchrotron_site       'SLAC LCLS' 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4YAY 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             32.629 
_reflns.d_resolution_high            2.90 
_reflns.number_obs                   11190 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.2 
_reflns.B_iso_Wilson_estimate        76.13 
_reflns.pdbx_redundancy              1288 
# 
_reflns_shell.d_res_high                  2.9 
_reflns_shell.d_res_low                   3.0 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.84 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             215 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4YAY 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     11167 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             32.91 
_refine.ls_d_res_high                            2.90 
_refine.ls_percent_reflns_obs                    99.99 
_refine.ls_R_factor_obs                          0.2306 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2283 
_refine.ls_R_factor_R_free                       0.2742 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.16 
_refine.ls_number_reflns_R_free                  576 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9017 
_refine.correlation_coeff_Fo_to_Fc_free          0.8509 
_refine.B_iso_mean                               95.45 
_refine.aniso_B[1][1]                            -11.8521 
_refine.aniso_B[2][2]                            -4.0788 
_refine.aniso_B[3][3]                            15.9309 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -6.6407 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'GPCR hybrid model' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.406 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        4YAY 
_refine_analyze.Luzzati_coordinate_error_obs    0.612 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3077 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         33 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3110 
_refine_hist.d_res_high                       2.90 
_refine_hist.d_res_low                        32.91 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.010 ? 2.00  3187 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               0.95  ? 2.00  4336 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 4.00  1448 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  54   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  460  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 3187 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_omega_torsion           1.99  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           2.46  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  436  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  3683 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.90 
_refine_ls_shell.d_res_low                        3.18 
_refine_ls_shell.number_reflns_R_work             2500 
_refine_ls_shell.R_factor_R_work                  0.2539 
_refine_ls_shell.percent_reflns_obs               99.99 
_refine_ls_shell.R_factor_R_free                  0.3131 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.66 
_refine_ls_shell.number_reflns_R_free             150 
_refine_ls_shell.number_reflns_all                2650 
_refine_ls_shell.R_factor_all                     0.2573 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     4YAY 
_struct.title                        'XFEL structure of human Angiotensin Receptor' 
_struct.pdbx_descriptor              'human Angiotensin Receptor_Bril Chimera' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YAY 
_struct_keywords.text            
;XFEL, Serial Femtosecond Crystallography, human Angiotensin Receptor AT1R, BRIL, G Protein-Coupled Receptor, GPCR, GPCR network, Lipidic Cubic Phase, LCP, membrane protein, structural genomics, ZD7155, angiotensin receptor blocker, room temperature, PSI-Biology
;
_struct_keywords.pdbx_keywords   'MEMBRANE PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.details                      'Authors state that the biological unit is unknown' 
_struct_biol.id                           1 
_struct_biol.pdbx_parent_biol_id          ? 
_struct_biol.pdbx_formula_weight          ? 
_struct_biol.pdbx_formula_weight_method   ? 
_struct_biol.pdbx_aggregation_state       ? 
_struct_biol.pdbx_assembly_method         ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 2   ? ALA A 20  ? ASP A 1002 ALA A 1020 1 ? 19 
HELX_P HELX_P2  AA2 ASN A 22  ? LYS A 42  ? ASN A 1022 LYS A 1042 1 ? 21 
HELX_P HELX_P3  AA3 SER A 55  ? GLY A 82  ? SER A 1055 GLY A 1082 1 ? 28 
HELX_P HELX_P4  AA4 VAL A 84  ? GLU A 92  ? VAL A 1084 GLU A 1092 1 ? 9  
HELX_P HELX_P5  AA5 GLN A 93  ? LEU A 106 ? GLN A 1093 LEU A 1106 1 ? 14 
HELX_P HELX_P6  AA6 TYR A 121 ? TYR A 151 ? TYR A 26   TYR A 56   1 ? 31 
HELX_P HELX_P7  AA7 THR A 156 ? MET A 185 ? THR A 61   MET A 90   1 ? 30 
HELX_P HELX_P8  AA8 ASN A 193 ? VAL A 226 ? ASN A 98   VAL A 131  1 ? 34 
HELX_P HELX_P9  AA9 ARG A 232 ? SER A 255 ? ARG A 137  SER A 160  1 ? 24 
HELX_P HELX_P10 AB1 SER A 255 ? HIS A 261 ? SER A 160  HIS A 166  1 ? 7  
HELX_P HELX_P11 AB2 PRO A 287 ? PHE A 299 ? PRO A 192  PHE A 204  1 ? 13 
HELX_P HELX_P12 AB3 PHE A 299 ? ALA A 316 ? PHE A 204  ALA A 221  1 ? 18 
HELX_P HELX_P13 AB4 ASP A 331 ? GLY A 364 ? ASP A 236  GLY A 269  1 ? 34 
HELX_P HELX_P14 AB5 ASP A 368 ? ALA A 386 ? ASP A 273  ALA A 291  1 ? 19 
HELX_P HELX_P15 AB6 PHE A 388 ? ASN A 393 ? PHE A 293  ASN A 298  1 ? 6  
HELX_P HELX_P16 AB7 PRO A 394 ? PHE A 399 ? PRO A 299  PHE A 304  5 ? 6  
HELX_P HELX_P17 AB8 LEU A 400 ? LEU A 412 ? LEU A 305  LEU A 317  1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 113 SG ? ? ? 1_555 A CYS 369 SG ? ? A CYS 18  A CYS 274 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? A CYS 196 SG ? ? ? 1_555 A CYS 275 SG ? ? A CYS 101 A CYS 180 1_555 ? ? ? ? ? ? ? 2.031 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     AA1 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 262 ? PHE A 265 ? ARG A 167 PHE A 170 
AA1 2 VAL A 274 ? PHE A 277 ? VAL A 179 PHE A 182 
# 
_pdbx_struct_sheet_hbond.sheet_id                AA1 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   PHE 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    265 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    PHE 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     170 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    274 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     179 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    ZD7 
_struct_site.pdbx_auth_seq_id     1201 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    12 
_struct_site.details              'binding site for residue ZD7 A 1201' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 TYR A 130 ? TYR A 35  . ? 1_555 ? 
2  AC1 12 TRP A 179 ? TRP A 84  . ? 1_555 ? 
3  AC1 12 THR A 183 ? THR A 88  . ? 1_555 ? 
4  AC1 12 SER A 200 ? SER A 105 . ? 1_555 ? 
5  AC1 12 VAL A 203 ? VAL A 108 . ? 1_555 ? 
6  AC1 12 SER A 204 ? SER A 109 . ? 1_555 ? 
7  AC1 12 LEU A 207 ? LEU A 112 . ? 1_555 ? 
8  AC1 12 ALA A 258 ? ALA A 163 . ? 1_555 ? 
9  AC1 12 ARG A 262 ? ARG A 167 . ? 1_555 ? 
10 AC1 12 PHE A 277 ? PHE A 182 . ? 1_555 ? 
11 AC1 12 ILE A 383 ? ILE A 288 . ? 1_555 ? 
12 AC1 12 TYR A 387 ? TYR A 292 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YAY 
_atom_sites.fract_transf_matrix[1][1]   0.013736 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002274 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.024390 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006044 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 2   ? 4.112   9.113   28.690 1.00 121.44 ? 1002 ASP A N   1 
ATOM   2    C CA  . ASP A 1 2   ? 2.704   9.390   28.419 1.00 120.40 ? 1002 ASP A CA  1 
ATOM   3    C C   . ASP A 1 2   ? 2.386   9.218   26.923 1.00 123.60 ? 1002 ASP A C   1 
ATOM   4    O O   . ASP A 1 2   ? 3.045   9.826   26.073 1.00 123.49 ? 1002 ASP A O   1 
ATOM   5    C CB  . ASP A 1 2   ? 2.333   10.811  28.886 1.00 121.92 ? 1002 ASP A CB  1 
ATOM   6    C CG  . ASP A 1 2   ? 0.857   11.171  28.800 1.00 132.33 ? 1002 ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 2   ? 0.008   10.251  28.890 1.00 132.39 ? 1002 ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 2   ? 0.548   12.379  28.708 1.00 139.34 ? 1002 ASP A OD2 1 
ATOM   9    N N   . LEU A 1 3   ? 1.370   8.386   26.615 1.00 118.95 ? 1003 LEU A N   1 
ATOM   10   C CA  . LEU A 1 3   ? 0.912   8.099   25.252 1.00 117.71 ? 1003 LEU A CA  1 
ATOM   11   C C   . LEU A 1 3   ? 0.234   9.322   24.641 1.00 119.41 ? 1003 LEU A C   1 
ATOM   12   O O   . LEU A 1 3   ? 0.426   9.591   23.456 1.00 119.16 ? 1003 LEU A O   1 
ATOM   13   C CB  . LEU A 1 3   ? -0.063  6.905   25.255 1.00 117.89 ? 1003 LEU A CB  1 
ATOM   14   C CG  . LEU A 1 3   ? 0.183   5.774   24.252 1.00 122.69 ? 1003 LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 3   ? -0.649  4.562   24.603 1.00 123.34 ? 1003 LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 3   ? -0.087  6.207   22.811 1.00 124.70 ? 1003 LEU A CD2 1 
ATOM   17   N N   . GLU A 1 4   ? -0.551  10.056  25.459 1.00 114.23 ? 1004 GLU A N   1 
ATOM   18   C CA  . GLU A 1 4   ? -1.302  11.255  25.083 1.00 113.17 ? 1004 GLU A CA  1 
ATOM   19   C C   . GLU A 1 4   ? -0.356  12.391  24.665 1.00 116.81 ? 1004 GLU A C   1 
ATOM   20   O O   . GLU A 1 4   ? -0.677  13.145  23.740 1.00 116.23 ? 1004 GLU A O   1 
ATOM   21   C CB  . GLU A 1 4   ? -2.188  11.696  26.259 1.00 114.12 ? 1004 GLU A CB  1 
ATOM   22   C CG  . GLU A 1 4   ? -3.356  12.587  25.867 1.00 121.60 ? 1004 GLU A CG  1 
ATOM   23   C CD  . GLU A 1 4   ? -4.312  12.966  26.985 1.00 130.29 ? 1004 GLU A CD  1 
ATOM   24   O OE1 . GLU A 1 4   ? -5.472  13.319  26.671 1.00 117.22 ? 1004 GLU A OE1 1 
ATOM   25   O OE2 . GLU A 1 4   ? -3.909  12.913  28.170 1.00 116.25 ? 1004 GLU A OE2 1 
ATOM   26   N N   . ASP A 1 5   ? 0.810   12.493  25.337 1.00 113.50 ? 1005 ASP A N   1 
ATOM   27   C CA  . ASP A 1 5   ? 1.836   13.499  25.061 1.00 113.81 ? 1005 ASP A CA  1 
ATOM   28   C C   . ASP A 1 5   ? 2.480   13.236  23.697 1.00 116.59 ? 1005 ASP A C   1 
ATOM   29   O O   . ASP A 1 5   ? 2.522   14.145  22.869 1.00 116.33 ? 1005 ASP A O   1 
ATOM   30   C CB  . ASP A 1 5   ? 2.897   13.516  26.180 1.00 116.49 ? 1005 ASP A CB  1 
ATOM   31   C CG  . ASP A 1 5   ? 3.993   14.559  26.017 1.00 130.74 ? 1005 ASP A CG  1 
ATOM   32   O OD1 . ASP A 1 5   ? 3.687   15.682  25.545 1.00 131.90 ? 1005 ASP A OD1 1 
ATOM   33   O OD2 . ASP A 1 5   ? 5.145   14.274  26.412 1.00 138.64 ? 1005 ASP A OD2 1 
ATOM   34   N N   . ASN A 1 6   ? 2.943   11.986  23.455 1.00 112.61 ? 1006 ASN A N   1 
ATOM   35   C CA  . ASN A 1 6   ? 3.554   11.552  22.194 1.00 112.52 ? 1006 ASN A CA  1 
ATOM   36   C C   . ASN A 1 6   ? 2.552   11.625  21.050 1.00 116.12 ? 1006 ASN A C   1 
ATOM   37   O O   . ASN A 1 6   ? 2.950   11.823  19.905 1.00 115.75 ? 1006 ASN A O   1 
ATOM   38   C CB  . ASN A 1 6   ? 4.102   10.133  22.316 1.00 112.37 ? 1006 ASN A CB  1 
ATOM   39   C CG  . ASN A 1 6   ? 5.291   10.011  23.233 1.00 135.99 ? 1006 ASN A CG  1 
ATOM   40   O OD1 . ASN A 1 6   ? 5.271   9.260   24.211 1.00 131.60 ? 1006 ASN A OD1 1 
ATOM   41   N ND2 . ASN A 1 6   ? 6.368   10.725  22.928 1.00 128.37 ? 1006 ASN A ND2 1 
ATOM   42   N N   . TRP A 1 7   ? 1.252   11.484  21.368 1.00 112.90 ? 1007 TRP A N   1 
ATOM   43   C CA  . TRP A 1 7   ? 0.152   11.569  20.413 1.00 113.02 ? 1007 TRP A CA  1 
ATOM   44   C C   . TRP A 1 7   ? -0.033  13.017  19.945 1.00 115.88 ? 1007 TRP A C   1 
ATOM   45   O O   . TRP A 1 7   ? -0.381  13.238  18.786 1.00 115.39 ? 1007 TRP A O   1 
ATOM   46   C CB  . TRP A 1 7   ? -1.142  11.017  21.031 1.00 112.10 ? 1007 TRP A CB  1 
ATOM   47   C CG  . TRP A 1 7   ? -2.162  10.584  20.021 1.00 113.63 ? 1007 TRP A CG  1 
ATOM   48   C CD1 . TRP A 1 7   ? -3.419  11.088  19.855 1.00 116.81 ? 1007 TRP A CD1 1 
ATOM   49   C CD2 . TRP A 1 7   ? -1.993  9.581   19.011 1.00 113.74 ? 1007 TRP A CD2 1 
ATOM   50   N NE1 . TRP A 1 7   ? -4.054  10.443  18.820 1.00 116.69 ? 1007 TRP A NE1 1 
ATOM   51   C CE2 . TRP A 1 7   ? -3.196  9.522   18.275 1.00 118.15 ? 1007 TRP A CE2 1 
ATOM   52   C CE3 . TRP A 1 7   ? -0.934  8.729   18.647 1.00 115.16 ? 1007 TRP A CE3 1 
ATOM   53   C CZ2 . TRP A 1 7   ? -3.372  8.640   17.205 1.00 117.74 ? 1007 TRP A CZ2 1 
ATOM   54   C CZ3 . TRP A 1 7   ? -1.103  7.874   17.572 1.00 116.85 ? 1007 TRP A CZ3 1 
ATOM   55   C CH2 . TRP A 1 7   ? -2.308  7.835   16.861 1.00 117.66 ? 1007 TRP A CH2 1 
ATOM   56   N N   . GLU A 1 8   ? 0.216   13.995  20.843 1.00 111.98 ? 1008 GLU A N   1 
ATOM   57   C CA  . GLU A 1 8   ? 0.151   15.424  20.527 1.00 112.02 ? 1008 GLU A CA  1 
ATOM   58   C C   . GLU A 1 8   ? 1.408   15.839  19.766 1.00 115.21 ? 1008 GLU A C   1 
ATOM   59   O O   . GLU A 1 8   ? 1.349   16.760  18.951 1.00 115.59 ? 1008 GLU A O   1 
ATOM   60   C CB  . GLU A 1 8   ? -0.027  16.278  21.795 1.00 113.43 ? 1008 GLU A CB  1 
ATOM   61   C CG  . GLU A 1 8   ? -1.385  16.956  21.901 1.00 124.44 ? 1008 GLU A CG  1 
ATOM   62   C CD  . GLU A 1 8   ? -1.670  18.039  20.876 1.00 146.58 ? 1008 GLU A CD  1 
ATOM   63   O OE1 . GLU A 1 8   ? -1.294  19.208  21.125 1.00 139.71 ? 1008 GLU A OE1 1 
ATOM   64   O OE2 . GLU A 1 8   ? -2.290  17.724  19.834 1.00 140.43 ? 1008 GLU A OE2 1 
ATOM   65   N N   . THR A 1 9   ? 2.538   15.140  20.021 1.00 110.58 ? 1009 THR A N   1 
ATOM   66   C CA  . THR A 1 9   ? 3.829   15.359  19.359 1.00 110.94 ? 1009 THR A CA  1 
ATOM   67   C C   . THR A 1 9   ? 3.711   14.994  17.868 1.00 113.99 ? 1009 THR A C   1 
ATOM   68   O O   . THR A 1 9   ? 4.326   15.654  17.036 1.00 114.82 ? 1009 THR A O   1 
ATOM   69   C CB  . THR A 1 9   ? 4.938   14.545  20.055 1.00 117.58 ? 1009 THR A CB  1 
ATOM   70   O OG1 . THR A 1 9   ? 4.837   14.702  21.470 1.00 115.36 ? 1009 THR A OG1 1 
ATOM   71   C CG2 . THR A 1 9   ? 6.342   14.925  19.583 1.00 117.55 ? 1009 THR A CG2 1 
ATOM   72   N N   . LEU A 1 10  ? 2.907   13.964  17.541 1.00 108.67 ? 1010 LEU A N   1 
ATOM   73   C CA  . LEU A 1 10  ? 2.697   13.506  16.168 1.00 108.29 ? 1010 LEU A CA  1 
ATOM   74   C C   . LEU A 1 10  ? 1.788   14.456  15.379 1.00 112.79 ? 1010 LEU A C   1 
ATOM   75   O O   . LEU A 1 10  ? 2.103   14.776  14.231 1.00 113.21 ? 1010 LEU A O   1 
ATOM   76   C CB  . LEU A 1 10  ? 2.096   12.082  16.139 1.00 107.14 ? 1010 LEU A CB  1 
ATOM   77   C CG  . LEU A 1 10  ? 2.965   10.912  16.618 1.00 111.03 ? 1010 LEU A CG  1 
ATOM   78   C CD1 . LEU A 1 10  ? 2.139   9.648   16.738 1.00 110.30 ? 1010 LEU A CD1 1 
ATOM   79   C CD2 . LEU A 1 10  ? 4.148   10.667  15.691 1.00 113.66 ? 1010 LEU A CD2 1 
ATOM   80   N N   . ASN A 1 11  ? 0.662   14.887  15.981 1.00 109.04 ? 1011 ASN A N   1 
ATOM   81   C CA  . ASN A 1 11  ? -0.340  15.744  15.341 1.00 109.55 ? 1011 ASN A CA  1 
ATOM   82   C C   . ASN A 1 11  ? 0.180   17.159  15.082 1.00 114.38 ? 1011 ASN A C   1 
ATOM   83   O O   . ASN A 1 11  ? -0.131  17.725  14.033 1.00 115.05 ? 1011 ASN A O   1 
ATOM   84   C CB  . ASN A 1 11  ? -1.613  15.809  16.190 1.00 111.30 ? 1011 ASN A CB  1 
ATOM   85   C CG  . ASN A 1 11  ? -2.272  14.467  16.445 1.00 140.24 ? 1011 ASN A CG  1 
ATOM   86   O OD1 . ASN A 1 11  ? -1.726  13.396  16.143 1.00 136.17 ? 1011 ASN A OD1 1 
ATOM   87   N ND2 . ASN A 1 11  ? -3.461  14.491  17.030 1.00 133.10 ? 1011 ASN A ND2 1 
ATOM   88   N N   . ASP A 1 12  ? 0.962   17.726  16.018 1.00 111.05 ? 1012 ASP A N   1 
ATOM   89   C CA  . ASP A 1 12  ? 1.508   19.080  15.880 1.00 112.44 ? 1012 ASP A CA  1 
ATOM   90   C C   . ASP A 1 12  ? 2.668   19.118  14.874 1.00 117.23 ? 1012 ASP A C   1 
ATOM   91   O O   . ASP A 1 12  ? 2.791   20.103  14.140 1.00 118.54 ? 1012 ASP A O   1 
ATOM   92   C CB  . ASP A 1 12  ? 1.967   19.637  17.240 1.00 114.18 ? 1012 ASP A CB  1 
ATOM   93   C CG  . ASP A 1 12  ? 0.862   19.797  18.272 1.00 121.38 ? 1012 ASP A CG  1 
ATOM   94   O OD1 . ASP A 1 12  ? -0.295  20.061  17.874 1.00 121.50 ? 1012 ASP A OD1 1 
ATOM   95   O OD2 . ASP A 1 12  ? 1.160   19.685  19.478 1.00 126.19 ? 1012 ASP A OD2 1 
ATOM   96   N N   . ASN A 1 13  ? 3.503   18.054  14.828 1.00 112.72 ? 1013 ASN A N   1 
ATOM   97   C CA  . ASN A 1 13  ? 4.642   17.960  13.904 1.00 113.55 ? 1013 ASN A CA  1 
ATOM   98   C C   . ASN A 1 13  ? 4.169   17.701  12.463 1.00 117.52 ? 1013 ASN A C   1 
ATOM   99   O O   . ASN A 1 13  ? 4.913   17.980  11.518 1.00 118.41 ? 1013 ASN A O   1 
ATOM   100  C CB  . ASN A 1 13  ? 5.629   16.875  14.343 1.00 112.91 ? 1013 ASN A CB  1 
ATOM   101  C CG  . ASN A 1 13  ? 6.598   17.281  15.435 1.00 131.62 ? 1013 ASN A CG  1 
ATOM   102  O OD1 . ASN A 1 13  ? 7.819   17.151  15.284 1.00 125.33 ? 1013 ASN A OD1 1 
ATOM   103  N ND2 . ASN A 1 13  ? 6.089   17.754  16.571 1.00 121.38 ? 1013 ASN A ND2 1 
ATOM   104  N N   . LEU A 1 14  ? 2.939   17.178  12.297 1.00 112.88 ? 1014 LEU A N   1 
ATOM   105  C CA  . LEU A 1 14  ? 2.344   16.948  10.985 1.00 112.92 ? 1014 LEU A CA  1 
ATOM   106  C C   . LEU A 1 14  ? 1.958   18.290  10.372 1.00 119.02 ? 1014 LEU A C   1 
ATOM   107  O O   . LEU A 1 14  ? 2.132   18.481  9.170  1.00 120.03 ? 1014 LEU A O   1 
ATOM   108  C CB  . LEU A 1 14  ? 1.126   16.012  11.078 1.00 111.47 ? 1014 LEU A CB  1 
ATOM   109  C CG  . LEU A 1 14  ? 0.558   15.507  9.746  1.00 116.38 ? 1014 LEU A CG  1 
ATOM   110  C CD1 . LEU A 1 14  ? 1.483   14.493  9.099  1.00 116.30 ? 1014 LEU A CD1 1 
ATOM   111  C CD2 . LEU A 1 14  ? -0.827  14.913  9.926  1.00 117.64 ? 1014 LEU A CD2 1 
ATOM   112  N N   . LYS A 1 15  ? 1.476   19.229  11.217 1.00 116.12 ? 1015 LYS A N   1 
ATOM   113  C CA  . LYS A 1 15  ? 1.088   20.590  10.837 1.00 118.00 ? 1015 LYS A CA  1 
ATOM   114  C C   . LYS A 1 15  ? 2.311   21.368  10.329 1.00 124.23 ? 1015 LYS A C   1 
ATOM   115  O O   . LYS A 1 15  ? 2.172   22.197  9.428  1.00 125.93 ? 1015 LYS A O   1 
ATOM   116  C CB  . LYS A 1 15  ? 0.440   21.310  12.033 1.00 120.42 ? 1015 LYS A CB  1 
ATOM   117  C CG  . LYS A 1 15  ? -0.373  22.551  11.657 1.00 137.27 ? 1015 LYS A CG  1 
ATOM   118  C CD  . LYS A 1 15  ? -0.769  23.391  12.876 1.00 148.08 ? 1015 LYS A CD  1 
ATOM   119  C CE  . LYS A 1 15  ? -1.842  22.773  13.745 1.00 156.76 ? 1015 LYS A CE  1 
ATOM   120  N NZ  . LYS A 1 15  ? -2.115  23.602  14.949 1.00 163.78 ? 1015 LYS A NZ  1 
ATOM   121  N N   . VAL A 1 16  ? 3.506   21.074  10.900 1.00 120.76 ? 1016 VAL A N   1 
ATOM   122  C CA  . VAL A 1 16  ? 4.808   21.656  10.539 1.00 122.65 ? 1016 VAL A CA  1 
ATOM   123  C C   . VAL A 1 16  ? 5.155   21.213  9.101  1.00 127.83 ? 1016 VAL A C   1 
ATOM   124  O O   . VAL A 1 16  ? 5.530   22.051  8.279  1.00 129.79 ? 1016 VAL A O   1 
ATOM   125  C CB  . VAL A 1 16  ? 5.921   21.267  11.564 1.00 125.78 ? 1016 VAL A CB  1 
ATOM   126  C CG1 . VAL A 1 16  ? 7.291   21.802  11.148 1.00 128.02 ? 1016 VAL A CG1 1 
ATOM   127  C CG2 . VAL A 1 16  ? 5.571   21.734  12.973 1.00 124.69 ? 1016 VAL A CG2 1 
ATOM   128  N N   . ILE A 1 17  ? 4.986   19.903  8.808  1.00 122.97 ? 1017 ILE A N   1 
ATOM   129  C CA  . ILE A 1 17  ? 5.232   19.271  7.504  1.00 123.33 ? 1017 ILE A CA  1 
ATOM   130  C C   . ILE A 1 17  ? 4.257   19.852  6.454  1.00 128.78 ? 1017 ILE A C   1 
ATOM   131  O O   . ILE A 1 17  ? 4.687   20.148  5.337  1.00 130.27 ? 1017 ILE A O   1 
ATOM   132  C CB  . ILE A 1 17  ? 5.120   17.720  7.635  1.00 124.10 ? 1017 ILE A CB  1 
ATOM   133  C CG1 . ILE A 1 17  ? 6.333   17.164  8.413  1.00 124.25 ? 1017 ILE A CG1 1 
ATOM   134  C CG2 . ILE A 1 17  ? 4.990   17.022  6.270  1.00 124.73 ? 1017 ILE A CG2 1 
ATOM   135  C CD1 . ILE A 1 17  ? 6.166   15.777  9.009  1.00 130.64 ? 1017 ILE A CD1 1 
ATOM   136  N N   . GLU A 1 18  ? 2.976   20.058  6.830  1.00 124.66 ? 1018 GLU A N   1 
ATOM   137  C CA  . GLU A 1 18  ? 1.925   20.606  5.962  1.00 125.58 ? 1018 GLU A CA  1 
ATOM   138  C C   . GLU A 1 18  ? 2.219   22.055  5.517  1.00 133.57 ? 1018 GLU A C   1 
ATOM   139  O O   . GLU A 1 18  ? 1.693   22.490  4.488  1.00 134.52 ? 1018 GLU A O   1 
ATOM   140  C CB  . GLU A 1 18  ? 0.561   20.554  6.665  1.00 125.48 ? 1018 GLU A CB  1 
ATOM   141  C CG  . GLU A 1 18  ? -0.030  19.155  6.760  1.00 131.00 ? 1018 GLU A CG  1 
ATOM   142  C CD  . GLU A 1 18  ? -1.365  19.013  7.468  1.00 144.34 ? 1018 GLU A CD  1 
ATOM   143  O OE1 . GLU A 1 18  ? -1.797  17.857  7.676  1.00 126.42 ? 1018 GLU A OE1 1 
ATOM   144  O OE2 . GLU A 1 18  ? -1.979  20.046  7.822  1.00 141.57 ? 1018 GLU A OE2 1 
ATOM   145  N N   . LYS A 1 19  ? 3.060   22.787  6.273  1.00 132.20 ? 1019 LYS A N   1 
ATOM   146  C CA  . LYS A 1 19  ? 3.425   24.171  5.961  1.00 135.64 ? 1019 LYS A CA  1 
ATOM   147  C C   . LYS A 1 19  ? 4.925   24.313  5.597  1.00 142.08 ? 1019 LYS A C   1 
ATOM   148  O O   . LYS A 1 19  ? 5.365   25.419  5.263  1.00 144.52 ? 1019 LYS A O   1 
ATOM   149  C CB  . LYS A 1 19  ? 3.070   25.098  7.143  1.00 138.54 ? 1019 LYS A CB  1 
ATOM   150  C CG  . LYS A 1 19  ? 1.581   25.454  7.238  1.00 153.51 ? 1019 LYS A CG  1 
ATOM   151  C CD  . LYS A 1 19  ? 1.148   26.451  6.155  1.00 167.36 ? 1019 LYS A CD  1 
ATOM   152  C CE  . LYS A 1 19  ? -0.335  26.723  6.164  1.00 178.68 ? 1019 LYS A CE  1 
ATOM   153  N NZ  . LYS A 1 19  ? -0.723  27.658  5.074  1.00 190.92 ? 1019 LYS A NZ  1 
ATOM   154  N N   . ALA A 1 20  ? 5.689   23.196  5.622  1.00 137.65 ? 1020 ALA A N   1 
ATOM   155  C CA  . ALA A 1 20  ? 7.125   23.153  5.310  1.00 139.26 ? 1020 ALA A CA  1 
ATOM   156  C C   . ALA A 1 20  ? 7.407   23.495  3.839  1.00 145.96 ? 1020 ALA A C   1 
ATOM   157  O O   . ALA A 1 20  ? 6.605   23.166  2.961  1.00 145.04 ? 1020 ALA A O   1 
ATOM   158  C CB  . ALA A 1 20  ? 7.687   21.779  5.633  1.00 137.72 ? 1020 ALA A CB  1 
ATOM   159  N N   . ASP A 1 21  ? 8.552   24.155  3.582  1.00 145.65 ? 1021 ASP A N   1 
ATOM   160  C CA  . ASP A 1 21  ? 8.966   24.557  2.237  1.00 148.46 ? 1021 ASP A CA  1 
ATOM   161  C C   . ASP A 1 21  ? 10.095  23.664  1.726  1.00 152.18 ? 1021 ASP A C   1 
ATOM   162  O O   . ASP A 1 21  ? 9.970   23.094  0.643  1.00 151.49 ? 1021 ASP A O   1 
ATOM   163  C CB  . ASP A 1 21  ? 9.399   26.037  2.210  1.00 154.37 ? 1021 ASP A CB  1 
ATOM   164  C CG  . ASP A 1 21  ? 8.340   27.023  2.669  1.00 166.15 ? 1021 ASP A CG  1 
ATOM   165  O OD1 . ASP A 1 21  ? 7.189   26.930  2.186  1.00 165.48 ? 1021 ASP A OD1 1 
ATOM   166  O OD2 . ASP A 1 21  ? 8.675   27.921  3.473  1.00 174.54 ? 1021 ASP A OD2 1 
ATOM   167  N N   . ASN A 1 22  ? 11.188  23.538  2.504  1.00 149.12 ? 1022 ASN A N   1 
ATOM   168  C CA  . ASN A 1 22  ? 12.356  22.733  2.139  1.00 149.38 ? 1022 ASN A CA  1 
ATOM   169  C C   . ASN A 1 22  ? 12.345  21.368  2.858  1.00 149.52 ? 1022 ASN A C   1 
ATOM   170  O O   . ASN A 1 22  ? 11.588  21.177  3.815  1.00 146.75 ? 1022 ASN A O   1 
ATOM   171  C CB  . ASN A 1 22  ? 13.658  23.496  2.435  1.00 154.36 ? 1022 ASN A CB  1 
ATOM   172  C CG  . ASN A 1 22  ? 13.771  24.047  3.837  1.00 179.92 ? 1022 ASN A CG  1 
ATOM   173  O OD1 . ASN A 1 22  ? 13.968  23.313  4.811  1.00 172.75 ? 1022 ASN A OD1 1 
ATOM   174  N ND2 . ASN A 1 22  ? 13.699  25.364  3.961  1.00 175.00 ? 1022 ASN A ND2 1 
ATOM   175  N N   . ALA A 1 23  ? 13.189  20.424  2.372  1.00 145.54 ? 1023 ALA A N   1 
ATOM   176  C CA  . ALA A 1 23  ? 13.340  19.053  2.876  1.00 142.31 ? 1023 ALA A CA  1 
ATOM   177  C C   . ALA A 1 23  ? 13.893  19.008  4.310  1.00 145.31 ? 1023 ALA A C   1 
ATOM   178  O O   . ALA A 1 23  ? 13.537  18.095  5.054  1.00 142.33 ? 1023 ALA A O   1 
ATOM   179  C CB  . ALA A 1 23  ? 14.252  18.259  1.955  1.00 143.63 ? 1023 ALA A CB  1 
ATOM   180  N N   . ALA A 1 24  ? 14.750  19.983  4.693  1.00 144.14 ? 1024 ALA A N   1 
ATOM   181  C CA  . ALA A 1 24  ? 15.351  20.086  6.029  1.00 143.79 ? 1024 ALA A CA  1 
ATOM   182  C C   . ALA A 1 24  ? 14.281  20.320  7.109  1.00 144.88 ? 1024 ALA A C   1 
ATOM   183  O O   . ALA A 1 24  ? 14.440  19.837  8.230  1.00 143.10 ? 1024 ALA A O   1 
ATOM   184  C CB  . ALA A 1 24  ? 16.379  21.206  6.058  1.00 148.37 ? 1024 ALA A CB  1 
ATOM   185  N N   . GLN A 1 25  ? 13.191  21.040  6.762  1.00 140.72 ? 1025 GLN A N   1 
ATOM   186  C CA  . GLN A 1 25  ? 12.057  21.309  7.652  1.00 138.38 ? 1025 GLN A CA  1 
ATOM   187  C C   . GLN A 1 25  ? 11.210  20.046  7.848  1.00 138.71 ? 1025 GLN A C   1 
ATOM   188  O O   . GLN A 1 25  ? 10.637  19.850  8.921  1.00 136.59 ? 1025 GLN A O   1 
ATOM   189  C CB  . GLN A 1 25  ? 11.187  22.447  7.099  1.00 140.93 ? 1025 GLN A CB  1 
ATOM   190  C CG  . GLN A 1 25  ? 11.791  23.833  7.297  1.00 160.70 ? 1025 GLN A CG  1 
ATOM   191  C CD  . GLN A 1 25  ? 10.996  24.917  6.610  1.00 183.45 ? 1025 GLN A CD  1 
ATOM   192  O OE1 . GLN A 1 25  ? 11.460  25.546  5.652  1.00 182.20 ? 1025 GLN A OE1 1 
ATOM   193  N NE2 . GLN A 1 25  ? 9.786   25.174  7.087  1.00 174.78 ? 1025 GLN A NE2 1 
ATOM   194  N N   . VAL A 1 26  ? 11.137  19.196  6.808  1.00 134.26 ? 1026 VAL A N   1 
ATOM   195  C CA  . VAL A 1 26  ? 10.390  17.934  6.805  1.00 131.03 ? 1026 VAL A CA  1 
ATOM   196  C C   . VAL A 1 26  ? 11.209  16.864  7.556  1.00 133.00 ? 1026 VAL A C   1 
ATOM   197  O O   . VAL A 1 26  ? 10.630  16.098  8.328  1.00 130.40 ? 1026 VAL A O   1 
ATOM   198  C CB  . VAL A 1 26  ? 10.030  17.476  5.358  1.00 135.23 ? 1026 VAL A CB  1 
ATOM   199  C CG1 . VAL A 1 26  ? 9.087   16.277  5.369  1.00 132.37 ? 1026 VAL A CG1 1 
ATOM   200  C CG2 . VAL A 1 26  ? 9.418   18.614  4.541  1.00 136.62 ? 1026 VAL A CG2 1 
ATOM   201  N N   . LYS A 1 27  ? 12.548  16.822  7.330  1.00 130.84 ? 1027 LYS A N   1 
ATOM   202  C CA  . LYS A 1 27  ? 13.493  15.873  7.939  1.00 130.00 ? 1027 LYS A CA  1 
ATOM   203  C C   . LYS A 1 27  ? 13.465  15.933  9.472  1.00 132.52 ? 1027 LYS A C   1 
ATOM   204  O O   . LYS A 1 27  ? 13.238  14.905  10.109 1.00 130.10 ? 1027 LYS A O   1 
ATOM   205  C CB  . LYS A 1 27  ? 14.931  16.127  7.445  1.00 135.21 ? 1027 LYS A CB  1 
ATOM   206  C CG  . LYS A 1 27  ? 15.266  15.464  6.110  1.00 150.22 ? 1027 LYS A CG  1 
ATOM   207  C CD  . LYS A 1 27  ? 16.671  15.823  5.592  1.00 162.87 ? 1027 LYS A CD  1 
ATOM   208  C CE  . LYS A 1 27  ? 17.797  15.048  6.246  1.00 172.56 ? 1027 LYS A CE  1 
ATOM   209  N NZ  . LYS A 1 27  ? 19.126  15.448  5.711  1.00 183.04 ? 1027 LYS A NZ  1 
ATOM   210  N N   . ASP A 1 28  ? 13.678  17.134  10.052 1.00 130.22 ? 1028 ASP A N   1 
ATOM   211  C CA  . ASP A 1 28  ? 13.702  17.371  11.499 1.00 129.36 ? 1028 ASP A CA  1 
ATOM   212  C C   . ASP A 1 28  ? 12.349  17.071  12.158 1.00 129.66 ? 1028 ASP A C   1 
ATOM   213  O O   . ASP A 1 28  ? 12.329  16.596  13.293 1.00 128.16 ? 1028 ASP A O   1 
ATOM   214  C CB  . ASP A 1 28  ? 14.117  18.820  11.803 1.00 133.78 ? 1028 ASP A CB  1 
ATOM   215  C CG  . ASP A 1 28  ? 15.581  19.129  11.534 1.00 147.76 ? 1028 ASP A CG  1 
ATOM   216  O OD1 . ASP A 1 28  ? 16.224  19.753  12.407 1.00 150.07 ? 1028 ASP A OD1 1 
ATOM   217  O OD2 . ASP A 1 28  ? 16.086  18.743  10.453 1.00 154.47 ? 1028 ASP A OD2 1 
ATOM   218  N N   . ALA A 1 29  ? 11.233  17.334  11.449 1.00 124.51 ? 1029 ALA A N   1 
ATOM   219  C CA  . ALA A 1 29  ? 9.878   17.089  11.946 1.00 121.55 ? 1029 ALA A CA  1 
ATOM   220  C C   . ALA A 1 29  ? 9.572   15.585  12.020 1.00 121.96 ? 1029 ALA A C   1 
ATOM   221  O O   . ALA A 1 29  ? 8.993   15.138  13.010 1.00 119.93 ? 1029 ALA A O   1 
ATOM   222  C CB  . ALA A 1 29  ? 8.861   17.790  11.061 1.00 122.52 ? 1029 ALA A CB  1 
ATOM   223  N N   . LEU A 1 30  ? 9.976   14.809  10.990 1.00 117.76 ? 1030 LEU A N   1 
ATOM   224  C CA  . LEU A 1 30  ? 9.770   13.357  10.927 1.00 115.43 ? 1030 LEU A CA  1 
ATOM   225  C C   . LEU A 1 30  ? 10.701  12.603  11.884 1.00 117.53 ? 1030 LEU A C   1 
ATOM   226  O O   . LEU A 1 30  ? 10.378  11.477  12.274 1.00 115.70 ? 1030 LEU A O   1 
ATOM   227  C CB  . LEU A 1 30  ? 9.976   12.830  9.499  1.00 115.85 ? 1030 LEU A CB  1 
ATOM   228  C CG  . LEU A 1 30  ? 8.887   13.128  8.474  1.00 120.61 ? 1030 LEU A CG  1 
ATOM   229  C CD1 . LEU A 1 30  ? 9.406   12.918  7.075  1.00 121.88 ? 1030 LEU A CD1 1 
ATOM   230  C CD2 . LEU A 1 30  ? 7.651   12.264  8.698  1.00 121.47 ? 1030 LEU A CD2 1 
ATOM   231  N N   . THR A 1 31  ? 11.858  13.210  12.244 1.00 114.25 ? 1031 THR A N   1 
ATOM   232  C CA  . THR A 1 31  ? 12.841  12.625  13.165 1.00 113.62 ? 1031 THR A CA  1 
ATOM   233  C C   . THR A 1 31  ? 12.242  12.614  14.576 1.00 113.70 ? 1031 THR A C   1 
ATOM   234  O O   . THR A 1 31  ? 12.360  11.607  15.273 1.00 112.21 ? 1031 THR A O   1 
ATOM   235  C CB  . THR A 1 31  ? 14.178  13.389  13.094 1.00 123.73 ? 1031 THR A CB  1 
ATOM   236  O OG1 . THR A 1 31  ? 14.607  13.462  11.734 1.00 123.73 ? 1031 THR A OG1 1 
ATOM   237  C CG2 . THR A 1 31  ? 15.278  12.737  13.932 1.00 123.03 ? 1031 THR A CG2 1 
ATOM   238  N N   . LYS A 1 32  ? 11.579  13.726  14.968 1.00 108.82 ? 1032 LYS A N   1 
ATOM   239  C CA  . LYS A 1 32  ? 10.906  13.899  16.260 1.00 107.07 ? 1032 LYS A CA  1 
ATOM   240  C C   . LYS A 1 32  ? 9.701   12.953  16.362 1.00 108.17 ? 1032 LYS A C   1 
ATOM   241  O O   . LYS A 1 32  ? 9.454   12.383  17.428 1.00 106.61 ? 1032 LYS A O   1 
ATOM   242  C CB  . LYS A 1 32  ? 10.466  15.366  16.464 1.00 109.92 ? 1032 LYS A CB  1 
ATOM   243  C CG  . LYS A 1 32  ? 11.610  16.398  16.565 1.00 124.80 ? 1032 LYS A CG  1 
ATOM   244  C CD  . LYS A 1 32  ? 12.505  16.282  17.825 1.00 136.06 ? 1032 LYS A CD  1 
ATOM   245  C CE  . LYS A 1 32  ? 11.867  16.779  19.108 1.00 144.19 ? 1032 LYS A CE  1 
ATOM   246  N NZ  . LYS A 1 32  ? 12.811  16.720  20.258 1.00 150.81 ? 1032 LYS A NZ  1 
ATOM   247  N N   . MET A 1 33  ? 8.977   12.775  15.238 1.00 103.88 ? 1033 MET A N   1 
ATOM   248  C CA  . MET A 1 33  ? 7.824   11.885  15.099 1.00 101.82 ? 1033 MET A CA  1 
ATOM   249  C C   . MET A 1 33  ? 8.237   10.420  15.213 1.00 104.99 ? 1033 MET A C   1 
ATOM   250  O O   . MET A 1 33  ? 7.469   9.621   15.746 1.00 102.97 ? 1033 MET A O   1 
ATOM   251  C CB  . MET A 1 33  ? 7.127   12.116  13.746 1.00 104.03 ? 1033 MET A CB  1 
ATOM   252  C CG  . MET A 1 33  ? 6.166   13.292  13.740 1.00 107.80 ? 1033 MET A CG  1 
ATOM   253  S SD  . MET A 1 33  ? 5.521   13.752  12.098 1.00 112.28 ? 1033 MET A SD  1 
ATOM   254  C CE  . MET A 1 33  ? 4.536   12.319  11.704 1.00 107.17 ? 1033 MET A CE  1 
ATOM   255  N N   . ARG A 1 34  ? 9.441   10.065  14.693 1.00 103.18 ? 1034 ARG A N   1 
ATOM   256  C CA  . ARG A 1 34  ? 9.966   8.694   14.690 1.00 102.85 ? 1034 ARG A CA  1 
ATOM   257  C C   . ARG A 1 34  ? 10.232  8.216   16.113 1.00 107.06 ? 1034 ARG A C   1 
ATOM   258  O O   . ARG A 1 34  ? 9.758   7.142   16.485 1.00 105.83 ? 1034 ARG A O   1 
ATOM   259  C CB  . ARG A 1 34  ? 11.242  8.564   13.836 1.00 103.33 ? 1034 ARG A CB  1 
ATOM   260  C CG  . ARG A 1 34  ? 11.527  7.115   13.450 1.00 110.64 ? 1034 ARG A CG  1 
ATOM   261  C CD  . ARG A 1 34  ? 12.828  6.926   12.699 1.00 118.15 ? 1034 ARG A CD  1 
ATOM   262  N NE  . ARG A 1 34  ? 12.977  5.546   12.229 1.00 122.14 ? 1034 ARG A NE  1 
ATOM   263  C CZ  . ARG A 1 34  ? 13.566  4.569   12.915 1.00 133.50 ? 1034 ARG A CZ  1 
ATOM   264  N NH1 . ARG A 1 34  ? 14.079  4.807   14.118 1.00 121.92 ? 1034 ARG A NH1 1 
ATOM   265  N NH2 . ARG A 1 34  ? 13.650  3.349   12.404 1.00 115.35 ? 1034 ARG A NH2 1 
ATOM   266  N N   . ALA A 1 35  ? 10.961  9.018   16.908 1.00 105.05 ? 1035 ALA A N   1 
ATOM   267  C CA  . ALA A 1 35  ? 11.276  8.700   18.298 1.00 105.46 ? 1035 ALA A CA  1 
ATOM   268  C C   . ALA A 1 35  ? 10.010  8.685   19.154 1.00 108.84 ? 1035 ALA A C   1 
ATOM   269  O O   . ALA A 1 35  ? 9.937   7.908   20.107 1.00 108.34 ? 1035 ALA A O   1 
ATOM   270  C CB  . ALA A 1 35  ? 12.273  9.703   18.850 1.00 107.75 ? 1035 ALA A CB  1 
ATOM   271  N N   . ALA A 1 36  ? 9.007   9.516   18.789 1.00 105.24 ? 1036 ALA A N   1 
ATOM   272  C CA  . ALA A 1 36  ? 7.722   9.625   19.482 1.00 104.27 ? 1036 ALA A CA  1 
ATOM   273  C C   . ALA A 1 36  ? 6.920   8.317   19.391 1.00 108.21 ? 1036 ALA A C   1 
ATOM   274  O O   . ALA A 1 36  ? 6.478   7.816   20.424 1.00 108.41 ? 1036 ALA A O   1 
ATOM   275  C CB  . ALA A 1 36  ? 6.908   10.781  18.916 1.00 104.62 ? 1036 ALA A CB  1 
ATOM   276  N N   . ALA A 1 37  ? 6.774   7.748   18.183 1.00 104.28 ? 1037 ALA A N   1 
ATOM   277  C CA  . ALA A 1 37  ? 6.030   6.506   17.961 1.00 103.72 ? 1037 ALA A CA  1 
ATOM   278  C C   . ALA A 1 37  ? 6.780   5.271   18.501 1.00 108.73 ? 1037 ALA A C   1 
ATOM   279  O O   . ALA A 1 37  ? 6.152   4.225   18.692 1.00 108.34 ? 1037 ALA A O   1 
ATOM   280  C CB  . ALA A 1 37  ? 5.746   6.329   16.478 1.00 104.35 ? 1037 ALA A CB  1 
ATOM   281  N N   . LEU A 1 38  ? 8.105   5.389   18.749 1.00 106.23 ? 1038 LEU A N   1 
ATOM   282  C CA  . LEU A 1 38  ? 8.922   4.290   19.275 1.00 106.68 ? 1038 LEU A CA  1 
ATOM   283  C C   . LEU A 1 38  ? 8.664   4.067   20.776 1.00 109.79 ? 1038 LEU A C   1 
ATOM   284  O O   . LEU A 1 38  ? 8.531   2.914   21.190 1.00 109.46 ? 1038 LEU A O   1 
ATOM   285  C CB  . LEU A 1 38  ? 10.425  4.519   19.024 1.00 108.00 ? 1038 LEU A CB  1 
ATOM   286  C CG  . LEU A 1 38  ? 10.938  4.296   17.595 1.00 112.86 ? 1038 LEU A CG  1 
ATOM   287  C CD1 . LEU A 1 38  ? 12.358  4.799   17.448 1.00 114.59 ? 1038 LEU A CD1 1 
ATOM   288  C CD2 . LEU A 1 38  ? 10.856  2.827   17.179 1.00 114.92 ? 1038 LEU A CD2 1 
ATOM   289  N N   . ASP A 1 39  ? 8.595   5.149   21.586 1.00 105.79 ? 1039 ASP A N   1 
ATOM   290  C CA  . ASP A 1 39  ? 8.339   5.022   23.028 1.00 105.69 ? 1039 ASP A CA  1 
ATOM   291  C C   . ASP A 1 39  ? 6.815   4.956   23.309 1.00 107.32 ? 1039 ASP A C   1 
ATOM   292  O O   . ASP A 1 39  ? 6.421   4.607   24.428 1.00 106.61 ? 1039 ASP A O   1 
ATOM   293  C CB  . ASP A 1 39  ? 9.020   6.135   23.850 1.00 108.21 ? 1039 ASP A CB  1 
ATOM   294  C CG  . ASP A 1 39  ? 8.902   7.537   23.290 1.00 119.89 ? 1039 ASP A CG  1 
ATOM   295  O OD1 . ASP A 1 39  ? 7.761   8.023   23.140 1.00 119.37 ? 1039 ASP A OD1 1 
ATOM   296  O OD2 . ASP A 1 39  ? 9.953   8.175   23.067 1.00 127.82 ? 1039 ASP A OD2 1 
ATOM   297  N N   . ALA A 1 40  ? 5.972   5.243   22.281 1.00 102.08 ? 1040 ALA A N   1 
ATOM   298  C CA  . ALA A 1 40  ? 4.508   5.128   22.358 1.00 100.66 ? 1040 ALA A CA  1 
ATOM   299  C C   . ALA A 1 40  ? 4.098   3.665   22.145 1.00 103.47 ? 1040 ALA A C   1 
ATOM   300  O O   . ALA A 1 40  ? 3.019   3.246   22.575 1.00 102.80 ? 1040 ALA A O   1 
ATOM   301  C CB  . ALA A 1 40  ? 3.845   6.028   21.327 1.00 100.65 ? 1040 ALA A CB  1 
ATOM   302  N N   . GLN A 1 41  ? 4.985   2.895   21.479 1.00 99.42  ? 1041 GLN A N   1 
ATOM   303  C CA  . GLN A 1 41  ? 4.875   1.461   21.206 1.00 99.28  ? 1041 GLN A CA  1 
ATOM   304  C C   . GLN A 1 41  ? 5.141   0.682   22.501 1.00 102.92 ? 1041 GLN A C   1 
ATOM   305  O O   . GLN A 1 41  ? 4.573   -0.395  22.708 1.00 103.26 ? 1041 GLN A O   1 
ATOM   306  C CB  . GLN A 1 41  ? 5.876   1.076   20.103 1.00 100.93 ? 1041 GLN A CB  1 
ATOM   307  C CG  . GLN A 1 41  ? 5.673   -0.303  19.496 1.00 115.80 ? 1041 GLN A CG  1 
ATOM   308  C CD  . GLN A 1 41  ? 6.617   -0.515  18.345 1.00 133.81 ? 1041 GLN A CD  1 
ATOM   309  O OE1 . GLN A 1 41  ? 7.731   -1.017  18.510 1.00 130.91 ? 1041 GLN A OE1 1 
ATOM   310  N NE2 . GLN A 1 41  ? 6.199   -0.117  17.154 1.00 124.30 ? 1041 GLN A NE2 1 
ATOM   311  N N   . LYS A 1 42  ? 6.006   1.256   23.375 1.00 98.50  ? 1042 LYS A N   1 
ATOM   312  C CA  . LYS A 1 42  ? 6.387   0.747   24.699 1.00 98.44  ? 1042 LYS A CA  1 
ATOM   313  C C   . LYS A 1 42  ? 5.251   0.941   25.706 1.00 101.44 ? 1042 LYS A C   1 
ATOM   314  O O   . LYS A 1 42  ? 5.257   0.315   26.769 1.00 102.81 ? 1042 LYS A O   1 
ATOM   315  C CB  . LYS A 1 42  ? 7.648   1.469   25.213 1.00 100.63 ? 1042 LYS A CB  1 
ATOM   316  C CG  . LYS A 1 42  ? 8.935   1.182   24.454 1.00 111.42 ? 1042 LYS A CG  1 
ATOM   317  C CD  . LYS A 1 42  ? 10.060  2.060   24.983 1.00 118.99 ? 1042 LYS A CD  1 
ATOM   318  C CE  . LYS A 1 42  ? 11.358  1.861   24.245 1.00 127.88 ? 1042 LYS A CE  1 
ATOM   319  N NZ  . LYS A 1 42  ? 12.417  2.771   24.755 1.00 136.23 ? 1042 LYS A NZ  1 
ATOM   320  N N   . ALA A 1 43  ? 4.298   1.835   25.382 1.00 95.47  ? 1043 ALA A N   1 
ATOM   321  C CA  . ALA A 1 43  ? 3.159   2.189   26.224 1.00 94.37  ? 1043 ALA A CA  1 
ATOM   322  C C   . ALA A 1 43  ? 1.972   1.208   26.060 1.00 97.44  ? 1043 ALA A C   1 
ATOM   323  O O   . ALA A 1 43  ? 2.052   0.249   25.284 1.00 97.00  ? 1043 ALA A O   1 
ATOM   324  C CB  . ALA A 1 43  ? 2.717   3.606   25.907 1.00 93.88  ? 1043 ALA A CB  1 
ATOM   325  N N   . THR A 1 44  ? 0.887   1.444   26.839 1.00 93.71  ? 1044 THR A N   1 
ATOM   326  C CA  . THR A 1 44  ? -0.329  0.627   26.873 1.00 93.73  ? 1044 THR A CA  1 
ATOM   327  C C   . THR A 1 44  ? -1.567  1.523   26.617 1.00 95.21  ? 1044 THR A C   1 
ATOM   328  O O   . THR A 1 44  ? -1.783  2.485   27.363 1.00 94.14  ? 1044 THR A O   1 
ATOM   329  C CB  . THR A 1 44  ? -0.429  -0.127  28.214 1.00 102.97 ? 1044 THR A CB  1 
ATOM   330  O OG1 . THR A 1 44  ? 0.859   -0.627  28.588 1.00 103.36 ? 1044 THR A OG1 1 
ATOM   331  C CG2 . THR A 1 44  ? -1.426  -1.273  28.167 1.00 103.44 ? 1044 THR A CG2 1 
ATOM   332  N N   . PRO A 1 45  ? -2.388  1.202   25.580 1.00 90.59  ? 1045 PRO A N   1 
ATOM   333  C CA  . PRO A 1 45  ? -3.567  2.033   25.261 1.00 89.27  ? 1045 PRO A CA  1 
ATOM   334  C C   . PRO A 1 45  ? -4.630  2.060   26.371 1.00 92.11  ? 1045 PRO A C   1 
ATOM   335  O O   . PRO A 1 45  ? -4.634  1.178   27.228 1.00 92.55  ? 1045 PRO A O   1 
ATOM   336  C CB  . PRO A 1 45  ? -4.124  1.378   23.992 1.00 91.51  ? 1045 PRO A CB  1 
ATOM   337  C CG  . PRO A 1 45  ? -3.613  -0.003  24.020 1.00 97.22  ? 1045 PRO A CG  1 
ATOM   338  C CD  . PRO A 1 45  ? -2.247  0.103   24.607 1.00 92.61  ? 1045 PRO A CD  1 
ATOM   339  N N   . PRO A 1 46  ? -5.535  3.073   26.364 1.00 87.69  ? 1046 PRO A N   1 
ATOM   340  C CA  . PRO A 1 46  ? -6.511  3.215   27.458 1.00 87.91  ? 1046 PRO A CA  1 
ATOM   341  C C   . PRO A 1 46  ? -7.511  2.064   27.639 1.00 92.63  ? 1046 PRO A C   1 
ATOM   342  O O   . PRO A 1 46  ? -7.983  1.887   28.767 1.00 94.55  ? 1046 PRO A O   1 
ATOM   343  C CB  . PRO A 1 46  ? -7.281  4.489   27.088 1.00 88.70  ? 1046 PRO A CB  1 
ATOM   344  C CG  . PRO A 1 46  ? -6.988  4.741   25.685 1.00 92.73  ? 1046 PRO A CG  1 
ATOM   345  C CD  . PRO A 1 46  ? -5.618  4.225   25.447 1.00 88.23  ? 1046 PRO A CD  1 
ATOM   346  N N   . LYS A 1 47  ? -7.860  1.309   26.587 1.00 86.59  ? 1047 LYS A N   1 
ATOM   347  C CA  . LYS A 1 47  ? -8.850  0.246   26.768 1.00 87.16  ? 1047 LYS A CA  1 
ATOM   348  C C   . LYS A 1 47  ? -8.220  -1.116  27.135 1.00 90.47  ? 1047 LYS A C   1 
ATOM   349  O O   . LYS A 1 47  ? -8.963  -2.061  27.409 1.00 91.17  ? 1047 LYS A O   1 
ATOM   350  C CB  . LYS A 1 47  ? -9.717  0.092   25.508 1.00 89.56  ? 1047 LYS A CB  1 
ATOM   351  C CG  . LYS A 1 47  ? -10.984 0.927   25.557 1.00 97.85  ? 1047 LYS A CG  1 
ATOM   352  C CD  . LYS A 1 47  ? -11.967 0.534   24.470 1.00 103.13 ? 1047 LYS A CD  1 
ATOM   353  C CE  . LYS A 1 47  ? -13.325 1.139   24.714 1.00 111.21 ? 1047 LYS A CE  1 
ATOM   354  N NZ  . LYS A 1 47  ? -14.319 0.694   23.705 1.00 120.00 ? 1047 LYS A NZ  1 
ATOM   355  N N   . LEU A 1 48  ? -6.879  -1.214  27.184 1.00 86.02  ? 1048 LEU A N   1 
ATOM   356  C CA  . LEU A 1 48  ? -6.205  -2.485  27.466 1.00 87.16  ? 1048 LEU A CA  1 
ATOM   357  C C   . LEU A 1 48  ? -5.341  -2.417  28.734 1.00 90.50  ? 1048 LEU A C   1 
ATOM   358  O O   . LEU A 1 48  ? -4.229  -2.952  28.756 1.00 89.74  ? 1048 LEU A O   1 
ATOM   359  C CB  . LEU A 1 48  ? -5.337  -2.890  26.256 1.00 86.84  ? 1048 LEU A CB  1 
ATOM   360  C CG  . LEU A 1 48  ? -6.022  -2.982  24.885 1.00 91.60  ? 1048 LEU A CG  1 
ATOM   361  C CD1 . LEU A 1 48  ? -5.023  -3.376  23.815 1.00 91.47  ? 1048 LEU A CD1 1 
ATOM   362  C CD2 . LEU A 1 48  ? -7.176  -3.981  24.892 1.00 96.47  ? 1048 LEU A CD2 1 
ATOM   363  N N   . GLU A 1 49  ? -5.895  -1.816  29.807 1.00 87.53  ? 1049 GLU A N   1 
ATOM   364  C CA  . GLU A 1 49  ? -5.257  -1.607  31.115 1.00 87.28  ? 1049 GLU A CA  1 
ATOM   365  C C   . GLU A 1 49  ? -4.857  -2.929  31.814 1.00 93.86  ? 1049 GLU A C   1 
ATOM   366  O O   . GLU A 1 49  ? -3.876  -2.929  32.562 1.00 94.30  ? 1049 GLU A O   1 
ATOM   367  C CB  . GLU A 1 49  ? -6.155  -0.771  32.061 1.00 88.07  ? 1049 GLU A CB  1 
ATOM   368  C CG  . GLU A 1 49  ? -7.527  -1.341  32.404 1.00 97.12  ? 1049 GLU A CG  1 
ATOM   369  C CD  . GLU A 1 49  ? -8.666  -1.017  31.456 1.00 111.22 ? 1049 GLU A CD  1 
ATOM   370  O OE1 . GLU A 1 49  ? -9.706  -0.508  31.929 1.00 103.21 ? 1049 GLU A OE1 1 
ATOM   371  O OE2 . GLU A 1 49  ? -8.534  -1.287  30.244 1.00 110.17 ? 1049 GLU A OE2 1 
ATOM   372  N N   . ASP A 1 50  ? -5.603  -4.028  31.586 1.00 91.94  ? 1050 ASP A N   1 
ATOM   373  C CA  . ASP A 1 50  ? -5.306  -5.317  32.205 1.00 94.49  ? 1050 ASP A CA  1 
ATOM   374  C C   . ASP A 1 50  ? -5.164  -6.392  31.129 1.00 99.26  ? 1050 ASP A C   1 
ATOM   375  O O   . ASP A 1 50  ? -5.845  -7.418  31.157 1.00 101.12 ? 1050 ASP A O   1 
ATOM   376  C CB  . ASP A 1 50  ? -6.364  -5.699  33.268 1.00 99.05  ? 1050 ASP A CB  1 
ATOM   377  C CG  . ASP A 1 50  ? -7.822  -5.459  32.907 1.00 109.40 ? 1050 ASP A CG  1 
ATOM   378  O OD1 . ASP A 1 50  ? -8.609  -5.121  33.821 1.00 110.35 ? 1050 ASP A OD1 1 
ATOM   379  O OD2 . ASP A 1 50  ? -8.176  -5.607  31.711 1.00 113.98 ? 1050 ASP A OD2 1 
ATOM   380  N N   . LYS A 1 51  ? -4.253  -6.132  30.177 1.00 94.48  ? 1051 LYS A N   1 
ATOM   381  C CA  . LYS A 1 51  ? -3.893  -7.010  29.062 1.00 94.58  ? 1051 LYS A CA  1 
ATOM   382  C C   . LYS A 1 51  ? -2.379  -7.167  29.033 1.00 98.94  ? 1051 LYS A C   1 
ATOM   383  O O   . LYS A 1 51  ? -1.666  -6.176  28.830 1.00 96.66  ? 1051 LYS A O   1 
ATOM   384  C CB  . LYS A 1 51  ? -4.418  -6.465  27.706 1.00 94.76  ? 1051 LYS A CB  1 
ATOM   385  C CG  . LYS A 1 51  ? -5.936  -6.469  27.523 1.00 102.95 ? 1051 LYS A CG  1 
ATOM   386  C CD  . LYS A 1 51  ? -6.487  -7.805  27.058 1.00 110.60 ? 1051 LYS A CD  1 
ATOM   387  C CE  . LYS A 1 51  ? -7.992  -7.793  27.023 1.00 119.37 ? 1051 LYS A CE  1 
ATOM   388  N NZ  . LYS A 1 51  ? -8.544  -9.134  26.700 1.00 132.54 ? 1051 LYS A NZ  1 
ATOM   389  N N   . SER A 1 52  ? -1.888  -8.406  29.261 1.00 98.09  ? 1052 SER A N   1 
ATOM   390  C CA  . SER A 1 52  ? -0.464  -8.762  29.245 1.00 98.35  ? 1052 SER A CA  1 
ATOM   391  C C   . SER A 1 52  ? 0.242   -8.205  27.993 1.00 99.65  ? 1052 SER A C   1 
ATOM   392  O O   . SER A 1 52  ? -0.346  -8.254  26.908 1.00 98.47  ? 1052 SER A O   1 
ATOM   393  C CB  . SER A 1 52  ? -0.296  -10.280 29.294 1.00 104.95 ? 1052 SER A CB  1 
ATOM   394  O OG  . SER A 1 52  ? 1.060   -10.673 29.148 1.00 113.66 ? 1052 SER A OG  1 
ATOM   395  N N   . PRO A 1 53  ? 1.494   -7.692  28.101 1.00 94.96  ? 1053 PRO A N   1 
ATOM   396  C CA  . PRO A 1 53  ? 2.181   -7.159  26.906 1.00 92.72  ? 1053 PRO A CA  1 
ATOM   397  C C   . PRO A 1 53  ? 2.665   -8.282  25.966 1.00 96.48  ? 1053 PRO A C   1 
ATOM   398  O O   . PRO A 1 53  ? 3.721   -8.170  25.340 1.00 95.39  ? 1053 PRO A O   1 
ATOM   399  C CB  . PRO A 1 53  ? 3.358   -6.359  27.500 1.00 94.17  ? 1053 PRO A CB  1 
ATOM   400  C CG  . PRO A 1 53  ? 3.102   -6.298  28.988 1.00 99.59  ? 1053 PRO A CG  1 
ATOM   401  C CD  . PRO A 1 53  ? 2.335   -7.532  29.300 1.00 97.20  ? 1053 PRO A CD  1 
ATOM   402  N N   . ASP A 1 54  ? 1.858   -9.353  25.852 1.00 93.98  ? 1054 ASP A N   1 
ATOM   403  C CA  . ASP A 1 54  ? 2.085   -10.539 25.028 1.00 94.37  ? 1054 ASP A CA  1 
ATOM   404  C C   . ASP A 1 54  ? 0.784   -11.010 24.372 1.00 97.60  ? 1054 ASP A C   1 
ATOM   405  O O   . ASP A 1 54  ? 0.819   -11.846 23.465 1.00 97.76  ? 1054 ASP A O   1 
ATOM   406  C CB  . ASP A 1 54  ? 2.685   -11.663 25.883 1.00 98.81  ? 1054 ASP A CB  1 
ATOM   407  C CG  . ASP A 1 54  ? 4.135   -11.447 26.240 1.00 108.01 ? 1054 ASP A CG  1 
ATOM   408  O OD1 . ASP A 1 54  ? 4.469   -11.541 27.437 1.00 110.80 ? 1054 ASP A OD1 1 
ATOM   409  O OD2 . ASP A 1 54  ? 4.934   -11.188 25.324 1.00 112.40 ? 1054 ASP A OD2 1 
ATOM   410  N N   . SER A 1 55  ? -0.358  -10.470 24.841 1.00 93.17  ? 1055 SER A N   1 
ATOM   411  C CA  . SER A 1 55  ? -1.703  -10.766 24.351 1.00 93.16  ? 1055 SER A CA  1 
ATOM   412  C C   . SER A 1 55  ? -1.865  -10.320 22.885 1.00 94.42  ? 1055 SER A C   1 
ATOM   413  O O   . SER A 1 55  ? -1.195  -9.363  22.478 1.00 91.47  ? 1055 SER A O   1 
ATOM   414  C CB  . SER A 1 55  ? -2.745  -10.075 25.230 1.00 96.68  ? 1055 SER A CB  1 
ATOM   415  O OG  . SER A 1 55  ? -2.633  -8.662  25.182 1.00 102.68 ? 1055 SER A OG  1 
ATOM   416  N N   . PRO A 1 56  ? -2.754  -10.966 22.081 1.00 91.42  ? 1056 PRO A N   1 
ATOM   417  C CA  . PRO A 1 56  ? -2.921  -10.537 20.681 1.00 89.52  ? 1056 PRO A CA  1 
ATOM   418  C C   . PRO A 1 56  ? -3.414  -9.092  20.553 1.00 90.97  ? 1056 PRO A C   1 
ATOM   419  O O   . PRO A 1 56  ? -3.142  -8.466  19.529 1.00 89.13  ? 1056 PRO A O   1 
ATOM   420  C CB  . PRO A 1 56  ? -3.957  -11.522 20.130 1.00 93.25  ? 1056 PRO A CB  1 
ATOM   421  C CG  . PRO A 1 56  ? -3.866  -12.712 21.030 1.00 100.29 ? 1056 PRO A CG  1 
ATOM   422  C CD  . PRO A 1 56  ? -3.622  -12.123 22.380 1.00 95.66  ? 1056 PRO A CD  1 
ATOM   423  N N   . GLU A 1 57  ? -4.103  -8.558  21.593 1.00 87.26  ? 1057 GLU A N   1 
ATOM   424  C CA  . GLU A 1 57  ? -4.604  -7.179  21.639 1.00 85.06  ? 1057 GLU A CA  1 
ATOM   425  C C   . GLU A 1 57  ? -3.438  -6.181  21.636 1.00 86.66  ? 1057 GLU A C   1 
ATOM   426  O O   . GLU A 1 57  ? -3.390  -5.317  20.754 1.00 83.90  ? 1057 GLU A O   1 
ATOM   427  C CB  . GLU A 1 57  ? -5.501  -6.944  22.872 1.00 87.35  ? 1057 GLU A CB  1 
ATOM   428  C CG  . GLU A 1 57  ? -6.848  -7.649  22.843 1.00 98.55  ? 1057 GLU A CG  1 
ATOM   429  C CD  . GLU A 1 57  ? -6.905  -9.068  23.378 1.00 117.93 ? 1057 GLU A CD  1 
ATOM   430  O OE1 . GLU A 1 57  ? -5.852  -9.742  23.435 1.00 108.92 ? 1057 GLU A OE1 1 
ATOM   431  O OE2 . GLU A 1 57  ? -8.021  -9.515  23.727 1.00 113.86 ? 1057 GLU A OE2 1 
ATOM   432  N N   . MET A 1 58  ? -2.490  -6.323  22.603 1.00 83.88  ? 1058 MET A N   1 
ATOM   433  C CA  . MET A 1 58  ? -1.306  -5.467  22.734 1.00 82.64  ? 1058 MET A CA  1 
ATOM   434  C C   . MET A 1 58  ? -0.358  -5.612  21.541 1.00 87.97  ? 1058 MET A C   1 
ATOM   435  O O   . MET A 1 58  ? 0.289   -4.630  21.166 1.00 86.13  ? 1058 MET A O   1 
ATOM   436  C CB  . MET A 1 58  ? -0.547  -5.757  24.031 1.00 85.89  ? 1058 MET A CB  1 
ATOM   437  C CG  . MET A 1 58  ? -0.986  -4.879  25.188 1.00 89.07  ? 1058 MET A CG  1 
ATOM   438  S SD  . MET A 1 58  ? -0.576  -3.117  25.009 1.00 90.38  ? 1058 MET A SD  1 
ATOM   439  C CE  . MET A 1 58  ? 1.158   -3.117  25.459 1.00 87.01  ? 1058 MET A CE  1 
ATOM   440  N N   . LYS A 1 59  ? -0.282  -6.822  20.944 1.00 87.36  ? 1059 LYS A N   1 
ATOM   441  C CA  . LYS A 1 59  ? 0.544   -7.098  19.765 1.00 87.42  ? 1059 LYS A CA  1 
ATOM   442  C C   . LYS A 1 59  ? -0.005  -6.346  18.554 1.00 90.47  ? 1059 LYS A C   1 
ATOM   443  O O   . LYS A 1 59  ? 0.782   -5.864  17.739 1.00 88.98  ? 1059 LYS A O   1 
ATOM   444  C CB  . LYS A 1 59  ? 0.632   -8.606  19.473 1.00 92.53  ? 1059 LYS A CB  1 
ATOM   445  C CG  . LYS A 1 59  ? 1.558   -9.354  20.428 1.00 115.57 ? 1059 LYS A CG  1 
ATOM   446  C CD  . LYS A 1 59  ? 1.823   -10.782 19.979 1.00 129.39 ? 1059 LYS A CD  1 
ATOM   447  C CE  . LYS A 1 59  ? 2.861   -11.447 20.849 1.00 145.63 ? 1059 LYS A CE  1 
ATOM   448  N NZ  . LYS A 1 59  ? 3.135   -12.842 20.417 1.00 158.04 ? 1059 LYS A NZ  1 
ATOM   449  N N   . ASP A 1 60  ? -1.351  -6.219  18.461 1.00 87.73  ? 1060 ASP A N   1 
ATOM   450  C CA  . ASP A 1 60  ? -2.041  -5.487  17.393 1.00 86.62  ? 1060 ASP A CA  1 
ATOM   451  C C   . ASP A 1 60  ? -1.825  -3.985  17.578 1.00 88.26  ? 1060 ASP A C   1 
ATOM   452  O O   . ASP A 1 60  ? -1.814  -3.250  16.592 1.00 87.23  ? 1060 ASP A O   1 
ATOM   453  C CB  . ASP A 1 60  ? -3.546  -5.829  17.354 1.00 89.90  ? 1060 ASP A CB  1 
ATOM   454  C CG  . ASP A 1 60  ? -4.353  -5.121  16.269 1.00 105.81 ? 1060 ASP A CG  1 
ATOM   455  O OD1 . ASP A 1 60  ? -3.810  -4.917  15.151 1.00 107.66 ? 1060 ASP A OD1 1 
ATOM   456  O OD2 . ASP A 1 60  ? -5.537  -4.804  16.521 1.00 113.04 ? 1060 ASP A OD2 1 
ATOM   457  N N   . PHE A 1 61  ? -1.642  -3.536  18.837 1.00 84.16  ? 1061 PHE A N   1 
ATOM   458  C CA  . PHE A 1 61  ? -1.365  -2.141  19.164 1.00 82.39  ? 1061 PHE A CA  1 
ATOM   459  C C   . PHE A 1 61  ? 0.054   -1.788  18.721 1.00 85.75  ? 1061 PHE A C   1 
ATOM   460  O O   . PHE A 1 61  ? 0.247   -0.763  18.063 1.00 83.98  ? 1061 PHE A O   1 
ATOM   461  C CB  . PHE A 1 61  ? -1.563  -1.875  20.669 1.00 84.37  ? 1061 PHE A CB  1 
ATOM   462  C CG  . PHE A 1 61  ? -1.000  -0.564  21.171 1.00 84.85  ? 1061 PHE A CG  1 
ATOM   463  C CD1 . PHE A 1 61  ? -1.701  0.625   21.000 1.00 87.02  ? 1061 PHE A CD1 1 
ATOM   464  C CD2 . PHE A 1 61  ? 0.226   -0.519  21.826 1.00 87.18  ? 1061 PHE A CD2 1 
ATOM   465  C CE1 . PHE A 1 61  ? -1.185  1.835   21.479 1.00 87.08  ? 1061 PHE A CE1 1 
ATOM   466  C CE2 . PHE A 1 61  ? 0.748   0.694   22.287 1.00 89.26  ? 1061 PHE A CE2 1 
ATOM   467  C CZ  . PHE A 1 61  ? 0.037   1.863   22.114 1.00 86.32  ? 1061 PHE A CZ  1 
ATOM   468  N N   . ARG A 1 62  ? 1.037   -2.642  19.084 1.00 83.80  ? 1062 ARG A N   1 
ATOM   469  C CA  . ARG A 1 62  ? 2.454   -2.459  18.765 1.00 83.86  ? 1062 ARG A CA  1 
ATOM   470  C C   . ARG A 1 62  ? 2.697   -2.521  17.244 1.00 89.41  ? 1062 ARG A C   1 
ATOM   471  O O   . ARG A 1 62  ? 3.485   -1.721  16.730 1.00 88.50  ? 1062 ARG A O   1 
ATOM   472  C CB  . ARG A 1 62  ? 3.324   -3.493  19.498 1.00 84.20  ? 1062 ARG A CB  1 
ATOM   473  C CG  . ARG A 1 62  ? 3.354   -3.293  21.016 1.00 91.11  ? 1062 ARG A CG  1 
ATOM   474  C CD  . ARG A 1 62  ? 4.513   -4.003  21.704 1.00 99.65  ? 1062 ARG A CD  1 
ATOM   475  N NE  . ARG A 1 62  ? 4.447   -5.466  21.612 1.00 106.71 ? 1062 ARG A NE  1 
ATOM   476  C CZ  . ARG A 1 62  ? 3.797   -6.251  22.467 1.00 120.83 ? 1062 ARG A CZ  1 
ATOM   477  N NH1 . ARG A 1 62  ? 3.121   -5.726  23.482 1.00 108.60 ? 1062 ARG A NH1 1 
ATOM   478  N NH2 . ARG A 1 62  ? 3.804   -7.567  22.305 1.00 108.35 ? 1062 ARG A NH2 1 
ATOM   479  N N   . HIS A 1 63  ? 1.993   -3.436  16.531 1.00 87.67  ? 1063 HIS A N   1 
ATOM   480  C CA  . HIS A 1 63  ? 2.064   -3.600  15.071 1.00 87.48  ? 1063 HIS A CA  1 
ATOM   481  C C   . HIS A 1 63  ? 1.557   -2.334  14.359 1.00 90.14  ? 1063 HIS A C   1 
ATOM   482  O O   . HIS A 1 63  ? 2.086   -1.970  13.307 1.00 89.47  ? 1063 HIS A O   1 
ATOM   483  C CB  . HIS A 1 63  ? 1.256   -4.833  14.623 1.00 89.35  ? 1063 HIS A CB  1 
ATOM   484  C CG  . HIS A 1 63  ? 1.211   -5.034  13.138 1.00 92.73  ? 1063 HIS A CG  1 
ATOM   485  N ND1 . HIS A 1 63  ? 2.314   -5.492  12.434 1.00 94.66  ? 1063 HIS A ND1 1 
ATOM   486  C CD2 . HIS A 1 63  ? 0.189   -4.843  12.270 1.00 94.35  ? 1063 HIS A CD2 1 
ATOM   487  C CE1 . HIS A 1 63  ? 1.929   -5.562  11.170 1.00 93.66  ? 1063 HIS A CE1 1 
ATOM   488  N NE2 . HIS A 1 63  ? 0.657   -5.188  11.023 1.00 93.78  ? 1063 HIS A NE2 1 
ATOM   489  N N   . GLY A 1 64  ? 0.555   -1.683  14.952 1.00 86.20  ? 1064 GLY A N   1 
ATOM   490  C CA  . GLY A 1 64  ? -0.040  -0.451  14.444 1.00 85.09  ? 1064 GLY A CA  1 
ATOM   491  C C   . GLY A 1 64  ? 0.966   0.671   14.287 1.00 87.72  ? 1064 GLY A C   1 
ATOM   492  O O   . GLY A 1 64  ? 0.982   1.345   13.256 1.00 86.53  ? 1064 GLY A O   1 
ATOM   493  N N   . PHE A 1 65  ? 1.836   0.849   15.294 1.00 84.66  ? 1065 PHE A N   1 
ATOM   494  C CA  . PHE A 1 65  ? 2.871   1.875   15.268 1.00 84.54  ? 1065 PHE A CA  1 
ATOM   495  C C   . PHE A 1 65  ? 4.046   1.445   14.396 1.00 88.23  ? 1065 PHE A C   1 
ATOM   496  O O   . PHE A 1 65  ? 4.742   2.319   13.880 1.00 87.50  ? 1065 PHE A O   1 
ATOM   497  C CB  . PHE A 1 65  ? 3.342   2.234   16.679 1.00 86.93  ? 1065 PHE A CB  1 
ATOM   498  C CG  . PHE A 1 65  ? 2.382   3.168   17.371 1.00 88.44  ? 1065 PHE A CG  1 
ATOM   499  C CD1 . PHE A 1 65  ? 2.519   4.546   17.250 1.00 91.49  ? 1065 PHE A CD1 1 
ATOM   500  C CD2 . PHE A 1 65  ? 1.317   2.672   18.114 1.00 91.13  ? 1065 PHE A CD2 1 
ATOM   501  C CE1 . PHE A 1 65  ? 1.619   5.412   17.875 1.00 92.33  ? 1065 PHE A CE1 1 
ATOM   502  C CE2 . PHE A 1 65  ? 0.417   3.538   18.738 1.00 93.85  ? 1065 PHE A CE2 1 
ATOM   503  C CZ  . PHE A 1 65  ? 0.577   4.903   18.621 1.00 91.54  ? 1065 PHE A CZ  1 
ATOM   504  N N   . ASP A 1 66  ? 4.251   0.119   14.196 1.00 85.29  ? 1066 ASP A N   1 
ATOM   505  C CA  . ASP A 1 66  ? 5.309   -0.390  13.311 1.00 85.65  ? 1066 ASP A CA  1 
ATOM   506  C C   . ASP A 1 66  ? 5.032   0.056   11.876 1.00 89.40  ? 1066 ASP A C   1 
ATOM   507  O O   . ASP A 1 66  ? 5.963   0.468   11.182 1.00 89.59  ? 1066 ASP A O   1 
ATOM   508  C CB  . ASP A 1 66  ? 5.446   -1.920  13.390 1.00 88.19  ? 1066 ASP A CB  1 
ATOM   509  C CG  . ASP A 1 66  ? 6.313   -2.430  14.525 1.00 99.67  ? 1066 ASP A CG  1 
ATOM   510  O OD1 . ASP A 1 66  ? 7.284   -1.727  14.900 1.00 99.77  ? 1066 ASP A OD1 1 
ATOM   511  O OD2 . ASP A 1 66  ? 6.074   -3.565  14.988 1.00 108.29 ? 1066 ASP A OD2 1 
ATOM   512  N N   . ILE A 1 67  ? 3.739   0.023   11.461 1.00 85.40  ? 1067 ILE A N   1 
ATOM   513  C CA  . ILE A 1 67  ? 3.250   0.484   10.155 1.00 84.77  ? 1067 ILE A CA  1 
ATOM   514  C C   . ILE A 1 67  ? 3.448   2.007   10.097 1.00 89.60  ? 1067 ILE A C   1 
ATOM   515  O O   . ILE A 1 67  ? 3.932   2.512   9.084  1.00 89.92  ? 1067 ILE A O   1 
ATOM   516  C CB  . ILE A 1 67  ? 1.769   0.051   9.901  1.00 87.48  ? 1067 ILE A CB  1 
ATOM   517  C CG1 . ILE A 1 67  ? 1.653   -1.494  9.791  1.00 88.42  ? 1067 ILE A CG1 1 
ATOM   518  C CG2 . ILE A 1 67  ? 1.171   0.738   8.658  1.00 87.30  ? 1067 ILE A CG2 1 
ATOM   519  C CD1 . ILE A 1 67  ? 0.216   -2.074  9.802  1.00 96.08  ? 1067 ILE A CD1 1 
ATOM   520  N N   . LEU A 1 68  ? 3.141   2.717   11.207 1.00 86.50  ? 1068 LEU A N   1 
ATOM   521  C CA  . LEU A 1 68  ? 3.311   4.164   11.318 1.00 86.77  ? 1068 LEU A CA  1 
ATOM   522  C C   . LEU A 1 68  ? 4.780   4.546   11.136 1.00 92.06  ? 1068 LEU A C   1 
ATOM   523  O O   . LEU A 1 68  ? 5.055   5.490   10.400 1.00 92.51  ? 1068 LEU A O   1 
ATOM   524  C CB  . LEU A 1 68  ? 2.778   4.701   12.658 1.00 86.79  ? 1068 LEU A CB  1 
ATOM   525  C CG  . LEU A 1 68  ? 2.705   6.232   12.788 1.00 91.89  ? 1068 LEU A CG  1 
ATOM   526  C CD1 . LEU A 1 68  ? 1.715   6.822   11.802 1.00 92.13  ? 1068 LEU A CD1 1 
ATOM   527  C CD2 . LEU A 1 68  ? 2.335   6.647   14.196 1.00 94.67  ? 1068 LEU A CD2 1 
ATOM   528  N N   . VAL A 1 69  ? 5.717   3.790   11.755 1.00 89.12  ? 1069 VAL A N   1 
ATOM   529  C CA  . VAL A 1 69  ? 7.162   4.014   11.616 1.00 89.82  ? 1069 VAL A CA  1 
ATOM   530  C C   . VAL A 1 69  ? 7.529   3.825   10.133 1.00 94.51  ? 1069 VAL A C   1 
ATOM   531  O O   . VAL A 1 69  ? 8.215   4.676   9.569  1.00 95.12  ? 1069 VAL A O   1 
ATOM   532  C CB  . VAL A 1 69  ? 8.006   3.109   12.562 1.00 94.12  ? 1069 VAL A CB  1 
ATOM   533  C CG1 . VAL A 1 69  ? 9.491   3.143   12.205 1.00 94.99  ? 1069 VAL A CG1 1 
ATOM   534  C CG2 . VAL A 1 69  ? 7.810   3.506   14.019 1.00 93.97  ? 1069 VAL A CG2 1 
ATOM   535  N N   . GLY A 1 70  ? 7.005   2.759   9.521  1.00 90.64  ? 1070 GLY A N   1 
ATOM   536  C CA  . GLY A 1 70  ? 7.200   2.430   8.112  1.00 90.58  ? 1070 GLY A CA  1 
ATOM   537  C C   . GLY A 1 70  ? 6.785   3.538   7.162  1.00 94.10  ? 1070 GLY A C   1 
ATOM   538  O O   . GLY A 1 70  ? 7.542   3.876   6.249  1.00 94.11  ? 1070 GLY A O   1 
ATOM   539  N N   . GLN A 1 71  ? 5.596   4.136   7.395  1.00 90.03  ? 1071 GLN A N   1 
ATOM   540  C CA  . GLN A 1 71  ? 5.071   5.251   6.600  1.00 90.35  ? 1071 GLN A CA  1 
ATOM   541  C C   . GLN A 1 71  ? 5.961   6.492   6.750  1.00 97.26  ? 1071 GLN A C   1 
ATOM   542  O O   . GLN A 1 71  ? 6.119   7.244   5.786  1.00 97.82  ? 1071 GLN A O   1 
ATOM   543  C CB  . GLN A 1 71  ? 3.631   5.587   7.004  1.00 91.00  ? 1071 GLN A CB  1 
ATOM   544  C CG  . GLN A 1 71  ? 2.616   4.490   6.700  1.00 101.26 ? 1071 GLN A CG  1 
ATOM   545  C CD  . GLN A 1 71  ? 1.245   4.768   7.283  1.00 120.65 ? 1071 GLN A CD  1 
ATOM   546  O OE1 . GLN A 1 71  ? 0.224   4.607   6.608  1.00 116.95 ? 1071 GLN A OE1 1 
ATOM   547  N NE2 . GLN A 1 71  ? 1.174   5.153   8.558  1.00 110.43 ? 1071 GLN A NE2 1 
ATOM   548  N N   . ILE A 1 72  ? 6.545   6.694   7.957  1.00 95.15  ? 1072 ILE A N   1 
ATOM   549  C CA  . ILE A 1 72  ? 7.461   7.798   8.282  1.00 96.41  ? 1072 ILE A CA  1 
ATOM   550  C C   . ILE A 1 72  ? 8.829   7.511   7.613  1.00 101.54 ? 1072 ILE A C   1 
ATOM   551  O O   . ILE A 1 72  ? 9.438   8.437   7.072  1.00 102.08 ? 1072 ILE A O   1 
ATOM   552  C CB  . ILE A 1 72  ? 7.563   8.007   9.831  1.00 99.40  ? 1072 ILE A CB  1 
ATOM   553  C CG1 . ILE A 1 72  ? 6.236   8.579   10.392 1.00 99.02  ? 1072 ILE A CG1 1 
ATOM   554  C CG2 . ILE A 1 72  ? 8.738   8.921   10.221 1.00 101.78 ? 1072 ILE A CG2 1 
ATOM   555  C CD1 . ILE A 1 72  ? 6.005   8.424   11.918 1.00 104.94 ? 1072 ILE A CD1 1 
ATOM   556  N N   . ASP A 1 73  ? 9.274   6.228   7.620  1.00 98.39  ? 1073 ASP A N   1 
ATOM   557  C CA  . ASP A 1 73  ? 10.529  5.749   7.024  1.00 99.66  ? 1073 ASP A CA  1 
ATOM   558  C C   . ASP A 1 73  ? 10.561  5.945   5.490  1.00 105.05 ? 1073 ASP A C   1 
ATOM   559  O O   . ASP A 1 73  ? 11.634  6.186   4.927  1.00 105.64 ? 1073 ASP A O   1 
ATOM   560  C CB  . ASP A 1 73  ? 10.762  4.264   7.359  1.00 100.90 ? 1073 ASP A CB  1 
ATOM   561  C CG  . ASP A 1 73  ? 11.222  3.973   8.778  1.00 110.52 ? 1073 ASP A CG  1 
ATOM   562  O OD1 . ASP A 1 73  ? 11.727  4.906   9.446  1.00 111.62 ? 1073 ASP A OD1 1 
ATOM   563  O OD2 . ASP A 1 73  ? 11.126  2.802   9.202  1.00 116.39 ? 1073 ASP A OD2 1 
ATOM   564  N N   . ASP A 1 74  ? 9.397   5.834   4.827  1.00 101.65 ? 1074 ASP A N   1 
ATOM   565  C CA  . ASP A 1 74  ? 9.269   6.054   3.388  1.00 102.25 ? 1074 ASP A CA  1 
ATOM   566  C C   . ASP A 1 74  ? 9.351   7.552   3.095  1.00 108.16 ? 1074 ASP A C   1 
ATOM   567  O O   . ASP A 1 74  ? 9.989   7.949   2.118  1.00 108.90 ? 1074 ASP A O   1 
ATOM   568  C CB  . ASP A 1 74  ? 7.950   5.460   2.853  1.00 103.03 ? 1074 ASP A CB  1 
ATOM   569  C CG  . ASP A 1 74  ? 7.771   3.963   3.056  1.00 113.74 ? 1074 ASP A CG  1 
ATOM   570  O OD1 . ASP A 1 74  ? 8.793   3.249   3.178  1.00 115.21 ? 1074 ASP A OD1 1 
ATOM   571  O OD2 . ASP A 1 74  ? 6.607   3.503   3.076  1.00 118.71 ? 1074 ASP A OD2 1 
ATOM   572  N N   . ALA A 1 75  ? 8.720   8.378   3.965  1.00 105.27 ? 1075 ALA A N   1 
ATOM   573  C CA  . ALA A 1 75  ? 8.696   9.840   3.880  1.00 106.86 ? 1075 ALA A CA  1 
ATOM   574  C C   . ALA A 1 75  ? 10.082  10.432  4.154  1.00 113.93 ? 1075 ALA A C   1 
ATOM   575  O O   . ALA A 1 75  ? 10.436  11.445  3.548  1.00 115.16 ? 1075 ALA A O   1 
ATOM   576  C CB  . ALA A 1 75  ? 7.681   10.408  4.858  1.00 106.91 ? 1075 ALA A CB  1 
ATOM   577  N N   . LEU A 1 76  ? 10.865  9.798   5.057  1.00 111.69 ? 1076 LEU A N   1 
ATOM   578  C CA  . LEU A 1 76  ? 12.236  10.209  5.380  1.00 114.00 ? 1076 LEU A CA  1 
ATOM   579  C C   . LEU A 1 76  ? 13.158  9.933   4.185  1.00 121.29 ? 1076 LEU A C   1 
ATOM   580  O O   . LEU A 1 76  ? 13.984  10.781  3.841  1.00 123.27 ? 1076 LEU A O   1 
ATOM   581  C CB  . LEU A 1 76  ? 12.752  9.490   6.638  1.00 113.51 ? 1076 LEU A CB  1 
ATOM   582  C CG  . LEU A 1 76  ? 12.302  10.045  7.987  1.00 117.79 ? 1076 LEU A CG  1 
ATOM   583  C CD1 . LEU A 1 76  ? 12.346  8.969   9.053  1.00 116.85 ? 1076 LEU A CD1 1 
ATOM   584  C CD2 . LEU A 1 76  ? 13.152  11.239  8.409  1.00 122.44 ? 1076 LEU A CD2 1 
ATOM   585  N N   . LYS A 1 77  ? 12.975  8.760   3.535  1.00 117.57 ? 1077 LYS A N   1 
ATOM   586  C CA  . LYS A 1 77  ? 13.712  8.318   2.352  1.00 118.67 ? 1077 LYS A CA  1 
ATOM   587  C C   . LYS A 1 77  ? 13.520  9.327   1.204  1.00 125.58 ? 1077 LYS A C   1 
ATOM   588  O O   . LYS A 1 77  ? 14.482  9.638   0.500  1.00 127.05 ? 1077 LYS A O   1 
ATOM   589  C CB  . LYS A 1 77  ? 13.237  6.910   1.944  1.00 119.23 ? 1077 LYS A CB  1 
ATOM   590  C CG  . LYS A 1 77  ? 14.004  6.272   0.788  1.00 133.88 ? 1077 LYS A CG  1 
ATOM   591  C CD  . LYS A 1 77  ? 13.348  4.969   0.350  1.00 140.78 ? 1077 LYS A CD  1 
ATOM   592  C CE  . LYS A 1 77  ? 14.005  4.371   -0.867 1.00 149.38 ? 1077 LYS A CE  1 
ATOM   593  N NZ  . LYS A 1 77  ? 13.341  3.109   -1.281 1.00 155.31 ? 1077 LYS A NZ  1 
ATOM   594  N N   . LEU A 1 78  ? 12.285  9.858   1.051  1.00 122.55 ? 1078 LEU A N   1 
ATOM   595  C CA  . LEU A 1 78  ? 11.921  10.844  0.028  1.00 124.25 ? 1078 LEU A CA  1 
ATOM   596  C C   . LEU A 1 78  ? 12.553  12.211  0.317  1.00 131.71 ? 1078 LEU A C   1 
ATOM   597  O O   . LEU A 1 78  ? 13.035  12.859  -0.615 1.00 133.66 ? 1078 LEU A O   1 
ATOM   598  C CB  . LEU A 1 78  ? 10.392  10.989  -0.077 1.00 122.97 ? 1078 LEU A CB  1 
ATOM   599  C CG  . LEU A 1 78  ? 9.629   9.824   -0.709 1.00 125.69 ? 1078 LEU A CG  1 
ATOM   600  C CD1 . LEU A 1 78  ? 8.195   9.796   -0.232 1.00 124.55 ? 1078 LEU A CD1 1 
ATOM   601  C CD2 . LEU A 1 78  ? 9.696   9.868   -2.232 1.00 128.57 ? 1078 LEU A CD2 1 
ATOM   602  N N   . ALA A 1 79  ? 12.548  12.646  1.599  1.00 128.59 ? 1079 ALA A N   1 
ATOM   603  C CA  . ALA A 1 79  ? 13.124  13.922  2.038  1.00 130.92 ? 1079 ALA A CA  1 
ATOM   604  C C   . ALA A 1 79  ? 14.650  13.933  1.850  1.00 137.75 ? 1079 ALA A C   1 
ATOM   605  O O   . ALA A 1 79  ? 15.208  14.963  1.458  1.00 139.96 ? 1079 ALA A O   1 
ATOM   606  C CB  . ALA A 1 79  ? 12.771  14.183  3.495  1.00 130.63 ? 1079 ALA A CB  1 
ATOM   607  N N   . ASN A 1 80  ? 15.309  12.776  2.101  1.00 133.86 ? 1080 ASN A N   1 
ATOM   608  C CA  . ASN A 1 80  ? 16.754  12.587  1.948  1.00 135.84 ? 1080 ASN A CA  1 
ATOM   609  C C   . ASN A 1 80  ? 17.153  12.647  0.467  1.00 140.89 ? 1080 ASN A C   1 
ATOM   610  O O   . ASN A 1 80  ? 18.248  13.118  0.153  1.00 143.31 ? 1080 ASN A O   1 
ATOM   611  C CB  . ASN A 1 80  ? 17.202  11.259  2.578  1.00 136.06 ? 1080 ASN A CB  1 
ATOM   612  C CG  . ASN A 1 80  ? 17.103  11.193  4.093  1.00 159.87 ? 1080 ASN A CG  1 
ATOM   613  O OD1 . ASN A 1 80  ? 16.717  12.150  4.779  1.00 155.02 ? 1080 ASN A OD1 1 
ATOM   614  N ND2 . ASN A 1 80  ? 17.448  10.045  4.656  1.00 150.89 ? 1080 ASN A ND2 1 
ATOM   615  N N   . GLU A 1 81  ? 16.253  12.198  -0.436 1.00 135.46 ? 1081 GLU A N   1 
ATOM   616  C CA  . GLU A 1 81  ? 16.454  12.243  -1.889 1.00 136.19 ? 1081 GLU A CA  1 
ATOM   617  C C   . GLU A 1 81  ? 16.313  13.682  -2.396 1.00 142.36 ? 1081 GLU A C   1 
ATOM   618  O O   . GLU A 1 81  ? 16.927  14.035  -3.403 1.00 144.49 ? 1081 GLU A O   1 
ATOM   619  C CB  . GLU A 1 81  ? 15.467  11.315  -2.622 1.00 134.94 ? 1081 GLU A CB  1 
ATOM   620  C CG  . GLU A 1 81  ? 15.832  9.838   -2.551 1.00 142.44 ? 1081 GLU A CG  1 
ATOM   621  C CD  . GLU A 1 81  ? 14.818  8.846   -3.096 1.00 156.94 ? 1081 GLU A CD  1 
ATOM   622  O OE1 . GLU A 1 81  ? 13.632  9.215   -3.259 1.00 152.47 ? 1081 GLU A OE1 1 
ATOM   623  O OE2 . GLU A 1 81  ? 15.206  7.677   -3.323 1.00 145.17 ? 1081 GLU A OE2 1 
ATOM   624  N N   . GLY A 1 82  ? 15.521  14.489  -1.685 1.00 138.15 ? 1082 GLY A N   1 
ATOM   625  C CA  . GLY A 1 82  ? 15.274  15.890  -2.008 1.00 140.14 ? 1082 GLY A CA  1 
ATOM   626  C C   . GLY A 1 82  ? 13.817  16.236  -2.247 1.00 142.04 ? 1082 GLY A C   1 
ATOM   627  O O   . GLY A 1 82  ? 13.441  17.409  -2.156 1.00 143.12 ? 1082 GLY A O   1 
ATOM   628  N N   . LYS A 1 83  ? 12.989  15.215  -2.564 1.00 135.42 ? 1083 LYS A N   1 
ATOM   629  C CA  . LYS A 1 83  ? 11.549  15.322  -2.842 1.00 133.51 ? 1083 LYS A CA  1 
ATOM   630  C C   . LYS A 1 83  ? 10.793  15.767  -1.578 1.00 135.53 ? 1083 LYS A C   1 
ATOM   631  O O   . LYS A 1 83  ? 10.732  15.020  -0.597 1.00 133.09 ? 1083 LYS A O   1 
ATOM   632  C CB  . LYS A 1 83  ? 11.004  13.976  -3.362 1.00 133.47 ? 1083 LYS A CB  1 
ATOM   633  C CG  . LYS A 1 83  ? 11.678  13.485  -4.639 1.00 149.49 ? 1083 LYS A CG  1 
ATOM   634  C CD  . LYS A 1 83  ? 11.438  12.001  -4.866 1.00 158.30 ? 1083 LYS A CD  1 
ATOM   635  C CE  . LYS A 1 83  ? 11.982  11.535  -6.193 1.00 172.38 ? 1083 LYS A CE  1 
ATOM   636  N NZ  . LYS A 1 83  ? 11.712  10.091  -6.424 1.00 180.37 ? 1083 LYS A NZ  1 
ATOM   637  N N   . VAL A 1 84  ? 10.255  17.003  -1.598 1.00 132.76 ? 1084 VAL A N   1 
ATOM   638  C CA  . VAL A 1 84  ? 9.534   17.623  -0.474 1.00 131.30 ? 1084 VAL A CA  1 
ATOM   639  C C   . VAL A 1 84  ? 8.021   17.383  -0.627 1.00 131.77 ? 1084 VAL A C   1 
ATOM   640  O O   . VAL A 1 84  ? 7.373   16.958  0.332  1.00 128.98 ? 1084 VAL A O   1 
ATOM   641  C CB  . VAL A 1 84  ? 9.855   19.144  -0.354 1.00 138.28 ? 1084 VAL A CB  1 
ATOM   642  C CG1 . VAL A 1 84  ? 9.198   19.763  0.878  1.00 137.32 ? 1084 VAL A CG1 1 
ATOM   643  C CG2 . VAL A 1 84  ? 11.359  19.399  -0.338 1.00 140.46 ? 1084 VAL A CG2 1 
ATOM   644  N N   . LYS A 1 85  ? 7.472   17.660  -1.833 1.00 128.43 ? 1085 LYS A N   1 
ATOM   645  C CA  . LYS A 1 85  ? 6.054   17.517  -2.197 1.00 126.55 ? 1085 LYS A CA  1 
ATOM   646  C C   . LYS A 1 85  ? 5.573   16.073  -2.019 1.00 125.89 ? 1085 LYS A C   1 
ATOM   647  O O   . LYS A 1 85  ? 4.418   15.853  -1.647 1.00 123.76 ? 1085 LYS A O   1 
ATOM   648  C CB  . LYS A 1 85  ? 5.817   17.963  -3.659 1.00 131.00 ? 1085 LYS A CB  1 
ATOM   649  C CG  . LYS A 1 85  ? 6.344   19.356  -4.027 1.00 149.58 ? 1085 LYS A CG  1 
ATOM   650  C CD  . LYS A 1 85  ? 5.438   20.504  -3.561 1.00 161.10 ? 1085 LYS A CD  1 
ATOM   651  C CE  . LYS A 1 85  ? 6.028   21.874  -3.834 1.00 175.97 ? 1085 LYS A CE  1 
ATOM   652  N NZ  . LYS A 1 85  ? 6.154   22.168  -5.290 1.00 186.93 ? 1085 LYS A NZ  1 
ATOM   653  N N   . GLU A 1 86  ? 6.471   15.101  -2.284 1.00 120.90 ? 1086 GLU A N   1 
ATOM   654  C CA  . GLU A 1 86  ? 6.224   13.661  -2.186 1.00 117.91 ? 1086 GLU A CA  1 
ATOM   655  C C   . GLU A 1 86  ? 6.351   13.174  -0.736 1.00 119.82 ? 1086 GLU A C   1 
ATOM   656  O O   . GLU A 1 86  ? 5.583   12.299  -0.324 1.00 117.50 ? 1086 GLU A O   1 
ATOM   657  C CB  . GLU A 1 86  ? 7.184   12.887  -3.101 1.00 119.37 ? 1086 GLU A CB  1 
ATOM   658  C CG  . GLU A 1 86  ? 6.909   13.125  -4.578 1.00 130.59 ? 1086 GLU A CG  1 
ATOM   659  C CD  . GLU A 1 86  ? 7.896   12.499  -5.541 1.00 147.77 ? 1086 GLU A CD  1 
ATOM   660  O OE1 . GLU A 1 86  ? 7.877   11.256  -5.697 1.00 128.84 ? 1086 GLU A OE1 1 
ATOM   661  O OE2 . GLU A 1 86  ? 8.651   13.262  -6.184 1.00 148.21 ? 1086 GLU A OE2 1 
ATOM   662  N N   . ALA A 1 87  ? 7.303   13.748  0.038  1.00 116.91 ? 1087 ALA A N   1 
ATOM   663  C CA  . ALA A 1 87  ? 7.524   13.424  1.454  1.00 115.11 ? 1087 ALA A CA  1 
ATOM   664  C C   . ALA A 1 87  ? 6.340   13.879  2.311  1.00 116.72 ? 1087 ALA A C   1 
ATOM   665  O O   . ALA A 1 87  ? 6.012   13.218  3.299  1.00 114.70 ? 1087 ALA A O   1 
ATOM   666  C CB  . ALA A 1 87  ? 8.806   14.075  1.951  1.00 117.55 ? 1087 ALA A CB  1 
ATOM   667  N N   . GLN A 1 88  ? 5.700   15.004  1.920  1.00 113.36 ? 1088 GLN A N   1 
ATOM   668  C CA  . GLN A 1 88  ? 4.524   15.573  2.584  1.00 112.13 ? 1088 GLN A CA  1 
ATOM   669  C C   . GLN A 1 88  ? 3.288   14.699  2.360  1.00 112.84 ? 1088 GLN A C   1 
ATOM   670  O O   . GLN A 1 88  ? 2.431   14.629  3.241  1.00 111.74 ? 1088 GLN A O   1 
ATOM   671  C CB  . GLN A 1 88  ? 4.254   16.999  2.090  1.00 115.70 ? 1088 GLN A CB  1 
ATOM   672  C CG  . GLN A 1 88  ? 5.218   18.035  2.653  1.00 132.44 ? 1088 GLN A CG  1 
ATOM   673  C CD  . GLN A 1 88  ? 4.957   19.406  2.093  1.00 157.14 ? 1088 GLN A CD  1 
ATOM   674  O OE1 . GLN A 1 88  ? 5.755   19.944  1.320  1.00 157.12 ? 1088 GLN A OE1 1 
ATOM   675  N NE2 . GLN A 1 88  ? 3.834   20.006  2.470  1.00 148.55 ? 1088 GLN A NE2 1 
ATOM   676  N N   . ALA A 1 89  ? 3.200   14.036  1.188  1.00 107.75 ? 1089 ALA A N   1 
ATOM   677  C CA  . ALA A 1 89  ? 2.099   13.140  0.824  1.00 105.55 ? 1089 ALA A CA  1 
ATOM   678  C C   . ALA A 1 89  ? 2.146   11.841  1.637  1.00 105.89 ? 1089 ALA A C   1 
ATOM   679  O O   . ALA A 1 89  ? 1.098   11.339  2.047  1.00 104.26 ? 1089 ALA A O   1 
ATOM   680  C CB  . ALA A 1 89  ? 2.154   12.826  -0.659 1.00 106.89 ? 1089 ALA A CB  1 
ATOM   681  N N   . ALA A 1 90  ? 3.360   11.304  1.872  1.00 101.08 ? 1090 ALA A N   1 
ATOM   682  C CA  . ALA A 1 90  ? 3.561   10.077  2.643  1.00 98.87  ? 1090 ALA A CA  1 
ATOM   683  C C   . ALA A 1 90  ? 3.335   10.321  4.144  1.00 100.76 ? 1090 ALA A C   1 
ATOM   684  O O   . ALA A 1 90  ? 2.944   9.398   4.857  1.00 99.04  ? 1090 ALA A O   1 
ATOM   685  C CB  . ALA A 1 90  ? 4.957   9.529   2.400  1.00 99.84  ? 1090 ALA A CB  1 
ATOM   686  N N   . ALA A 1 91  ? 3.566   11.563  4.613  1.00 97.36  ? 1091 ALA A N   1 
ATOM   687  C CA  . ALA A 1 91  ? 3.365   11.960  6.008  1.00 96.30  ? 1091 ALA A CA  1 
ATOM   688  C C   . ALA A 1 91  ? 1.876   12.047  6.343  1.00 97.83  ? 1091 ALA A C   1 
ATOM   689  O O   . ALA A 1 91  ? 1.488   11.741  7.466  1.00 96.54  ? 1091 ALA A O   1 
ATOM   690  C CB  . ALA A 1 91  ? 4.039   13.294  6.278  1.00 98.64  ? 1091 ALA A CB  1 
ATOM   691  N N   . GLU A 1 92  ? 1.040   12.409  5.352  1.00 93.67  ? 1092 GLU A N   1 
ATOM   692  C CA  . GLU A 1 92  ? -0.418  12.511  5.475  1.00 92.38  ? 1092 GLU A CA  1 
ATOM   693  C C   . GLU A 1 92  ? -1.086  11.150  5.759  1.00 93.29  ? 1092 GLU A C   1 
ATOM   694  O O   . GLU A 1 92  ? -2.295  11.104  6.000  1.00 92.61  ? 1092 GLU A O   1 
ATOM   695  C CB  . GLU A 1 92  ? -1.007  13.107  4.193  1.00 94.84  ? 1092 GLU A CB  1 
ATOM   696  C CG  . GLU A 1 92  ? -0.837  14.610  4.072  1.00 105.19 ? 1092 GLU A CG  1 
ATOM   697  C CD  . GLU A 1 92  ? -1.743  15.469  4.933  1.00 118.20 ? 1092 GLU A CD  1 
ATOM   698  O OE1 . GLU A 1 92  ? -2.781  14.963  5.417  1.00 93.47  ? 1092 GLU A OE1 1 
ATOM   699  O OE2 . GLU A 1 92  ? -1.447  16.678  5.060  1.00 117.58 ? 1092 GLU A OE2 1 
ATOM   700  N N   . GLN A 1 93  ? -0.305  10.051  5.735  1.00 88.15  ? 1093 GLN A N   1 
ATOM   701  C CA  . GLN A 1 93  ? -0.794  8.703   6.015  1.00 86.79  ? 1093 GLN A CA  1 
ATOM   702  C C   . GLN A 1 93  ? -0.893  8.473   7.529  1.00 89.51  ? 1093 GLN A C   1 
ATOM   703  O O   . GLN A 1 93  ? -1.489  7.480   7.954  1.00 88.83  ? 1093 GLN A O   1 
ATOM   704  C CB  . GLN A 1 93  ? 0.086   7.635   5.347  1.00 87.88  ? 1093 GLN A CB  1 
ATOM   705  C CG  . GLN A 1 93  ? -0.150  7.508   3.839  1.00 102.26 ? 1093 GLN A CG  1 
ATOM   706  C CD  . GLN A 1 93  ? 0.464   6.270   3.230  1.00 121.58 ? 1093 GLN A CD  1 
ATOM   707  O OE1 . GLN A 1 93  ? 1.639   5.941   3.445  1.00 115.13 ? 1093 GLN A OE1 1 
ATOM   708  N NE2 . GLN A 1 93  ? -0.306  5.587   2.395  1.00 116.68 ? 1093 GLN A NE2 1 
ATOM   709  N N   . LEU A 1 94  ? -0.342  9.410   8.339  1.00 85.71  ? 1094 LEU A N   1 
ATOM   710  C CA  . LEU A 1 94  ? -0.421  9.407   9.800  1.00 84.73  ? 1094 LEU A CA  1 
ATOM   711  C C   . LEU A 1 94  ? -1.891  9.557   10.225 1.00 87.68  ? 1094 LEU A C   1 
ATOM   712  O O   . LEU A 1 94  ? -2.329  8.870   11.151 1.00 86.13  ? 1094 LEU A O   1 
ATOM   713  C CB  . LEU A 1 94  ? 0.459   10.540  10.393 1.00 85.47  ? 1094 LEU A CB  1 
ATOM   714  C CG  . LEU A 1 94  ? 0.178   11.023  11.848 1.00 90.61  ? 1094 LEU A CG  1 
ATOM   715  C CD1 . LEU A 1 94  ? 0.689   10.040  12.895 1.00 90.27  ? 1094 LEU A CD1 1 
ATOM   716  C CD2 . LEU A 1 94  ? 0.818   12.360  12.113 1.00 94.37  ? 1094 LEU A CD2 1 
ATOM   717  N N   . LYS A 1 95  ? -2.655  10.418  9.505  1.00 84.95  ? 1095 LYS A N   1 
ATOM   718  C CA  . LYS A 1 95  ? -4.074  10.703  9.760  1.00 85.14  ? 1095 LYS A CA  1 
ATOM   719  C C   . LYS A 1 95  ? -4.946  9.431   9.701  1.00 89.83  ? 1095 LYS A C   1 
ATOM   720  O O   . LYS A 1 95  ? -5.965  9.381   10.389 1.00 90.19  ? 1095 LYS A O   1 
ATOM   721  C CB  . LYS A 1 95  ? -4.627  11.760  8.787  1.00 88.14  ? 1095 LYS A CB  1 
ATOM   722  C CG  . LYS A 1 95  ? -4.129  13.180  9.062  1.00 96.84  ? 1095 LYS A CG  1 
ATOM   723  C CD  . LYS A 1 95  ? -4.898  14.216  8.247  1.00 106.42 ? 1095 LYS A CD  1 
ATOM   724  C CE  . LYS A 1 95  ? -4.285  15.600  8.289  1.00 121.62 ? 1095 LYS A CE  1 
ATOM   725  N NZ  . LYS A 1 95  ? -4.465  16.277  9.601  1.00 134.77 ? 1095 LYS A NZ  1 
ATOM   726  N N   . THR A 1 96  ? -4.536  8.404   8.924  1.00 86.19  ? 1096 THR A N   1 
ATOM   727  C CA  . THR A 1 96  ? -5.248  7.122   8.824  1.00 86.08  ? 1096 THR A CA  1 
ATOM   728  C C   . THR A 1 96  ? -5.070  6.346   10.149 1.00 90.59  ? 1096 THR A C   1 
ATOM   729  O O   . THR A 1 96  ? -6.055  5.881   10.731 1.00 90.34  ? 1096 THR A O   1 
ATOM   730  C CB  . THR A 1 96  ? -4.745  6.317   7.608  1.00 91.59  ? 1096 THR A CB  1 
ATOM   731  O OG1 . THR A 1 96  ? -4.677  7.168   6.462  1.00 93.66  ? 1096 THR A OG1 1 
ATOM   732  C CG2 . THR A 1 96  ? -5.616  5.107   7.303  1.00 88.68  ? 1096 THR A CG2 1 
ATOM   733  N N   . THR A 1 97  ? -3.805  6.244   10.620 1.00 87.09  ? 1097 THR A N   1 
ATOM   734  C CA  . THR A 1 97  ? -3.385  5.573   11.852 1.00 86.63  ? 1097 THR A CA  1 
ATOM   735  C C   . THR A 1 97  ? -3.946  6.341   13.046 1.00 90.66  ? 1097 THR A C   1 
ATOM   736  O O   . THR A 1 97  ? -4.343  5.727   14.038 1.00 90.44  ? 1097 THR A O   1 
ATOM   737  C CB  . THR A 1 97  ? -1.841  5.477   11.885 1.00 96.41  ? 1097 THR A CB  1 
ATOM   738  O OG1 . THR A 1 97  ? -1.369  4.846   10.686 1.00 98.49  ? 1097 THR A OG1 1 
ATOM   739  C CG2 . THR A 1 97  ? -1.310  4.730   13.106 1.00 94.09  ? 1097 THR A CG2 1 
ATOM   740  N N   . ARG A 1 98  ? -3.994  7.683   12.932 1.00 87.20  ? 1098 ARG A N   1 
ATOM   741  C CA  . ARG A 1 98  ? -4.519  8.572   13.963 1.00 86.76  ? 1098 ARG A CA  1 
ATOM   742  C C   . ARG A 1 98  ? -6.016  8.349   14.137 1.00 91.13  ? 1098 ARG A C   1 
ATOM   743  O O   . ARG A 1 98  ? -6.492  8.302   15.272 1.00 90.96  ? 1098 ARG A O   1 
ATOM   744  C CB  . ARG A 1 98  ? -4.223  10.039  13.625 1.00 86.15  ? 1098 ARG A CB  1 
ATOM   745  C CG  . ARG A 1 98  ? -4.519  11.015  14.758 1.00 91.52  ? 1098 ARG A CG  1 
ATOM   746  C CD  . ARG A 1 98  ? -4.302  12.445  14.320 1.00 97.78  ? 1098 ARG A CD  1 
ATOM   747  N NE  . ARG A 1 98  ? -5.337  12.911  13.396 1.00 99.62  ? 1098 ARG A NE  1 
ATOM   748  C CZ  . ARG A 1 98  ? -5.274  14.051  12.716 1.00 107.33 ? 1098 ARG A CZ  1 
ATOM   749  N NH1 . ARG A 1 98  ? -6.261  14.400  11.904 1.00 96.02  ? 1098 ARG A NH1 1 
ATOM   750  N NH2 . ARG A 1 98  ? -4.219  14.849  12.838 1.00 87.36  ? 1098 ARG A NH2 1 
ATOM   751  N N   . ASN A 1 99  ? -6.753  8.191   13.025 1.00 88.02  ? 1099 ASN A N   1 
ATOM   752  C CA  . ASN A 1 99  ? -8.190  7.966   13.103 1.00 88.72  ? 1099 ASN A CA  1 
ATOM   753  C C   . ASN A 1 99  ? -8.480  6.502   13.478 1.00 92.83  ? 1099 ASN A C   1 
ATOM   754  O O   . ASN A 1 99  ? -9.517  6.238   14.090 1.00 93.12  ? 1099 ASN A O   1 
ATOM   755  C CB  . ASN A 1 99  ? -8.889  8.376   11.809 1.00 89.92  ? 1099 ASN A CB  1 
ATOM   756  C CG  . ASN A 1 99  ? -8.895  9.879   11.565 1.00 114.28 ? 1099 ASN A CG  1 
ATOM   757  O OD1 . ASN A 1 99  ? -8.385  10.688  12.359 1.00 104.32 ? 1099 ASN A OD1 1 
ATOM   758  N ND2 . ASN A 1 99  ? -9.460  10.290  10.440 1.00 110.08 ? 1099 ASN A ND2 1 
ATOM   759  N N   . ALA A 1 100 ? -7.538  5.574   13.186 1.00 88.73  ? 1100 ALA A N   1 
ATOM   760  C CA  . ALA A 1 100 ? -7.661  4.153   13.537 1.00 88.82  ? 1100 ALA A CA  1 
ATOM   761  C C   . ALA A 1 100 ? -7.461  3.928   15.050 1.00 92.86  ? 1100 ALA A C   1 
ATOM   762  O O   . ALA A 1 100 ? -8.097  3.045   15.629 1.00 93.64  ? 1100 ALA A O   1 
ATOM   763  C CB  . ALA A 1 100 ? -6.653  3.327   12.754 1.00 89.07  ? 1100 ALA A CB  1 
ATOM   764  N N   . TYR A 1 101 ? -6.586  4.725   15.683 1.00 88.12  ? 1101 TYR A N   1 
ATOM   765  C CA  . TYR A 1 101 ? -6.286  4.618   17.109 1.00 87.84  ? 1101 TYR A CA  1 
ATOM   766  C C   . TYR A 1 101 ? -7.445  5.164   17.974 1.00 91.45  ? 1101 TYR A C   1 
ATOM   767  O O   . TYR A 1 101 ? -7.772  4.541   18.986 1.00 91.41  ? 1101 TYR A O   1 
ATOM   768  C CB  . TYR A 1 101 ? -4.973  5.358   17.423 1.00 88.31  ? 1101 TYR A CB  1 
ATOM   769  C CG  . TYR A 1 101 ? -4.576  5.374   18.884 1.00 90.18  ? 1101 TYR A CG  1 
ATOM   770  C CD1 . TYR A 1 101 ? -3.806  4.351   19.428 1.00 92.31  ? 1101 TYR A CD1 1 
ATOM   771  C CD2 . TYR A 1 101 ? -4.902  6.452   19.703 1.00 90.99  ? 1101 TYR A CD2 1 
ATOM   772  C CE1 . TYR A 1 101 ? -3.418  4.372   20.768 1.00 93.53  ? 1101 TYR A CE1 1 
ATOM   773  C CE2 . TYR A 1 101 ? -4.521  6.484   21.044 1.00 91.93  ? 1101 TYR A CE2 1 
ATOM   774  C CZ  . TYR A 1 101 ? -3.775  5.443   21.572 1.00 100.06 ? 1101 TYR A CZ  1 
ATOM   775  O OH  . TYR A 1 101 ? -3.405  5.472   22.896 1.00 101.35 ? 1101 TYR A OH  1 
ATOM   776  N N   . ILE A 1 102 ? -8.044  6.321   17.592 1.00 87.12  ? 1102 ILE A N   1 
ATOM   777  C CA  . ILE A 1 102 ? -9.133  6.955   18.351 1.00 86.89  ? 1102 ILE A CA  1 
ATOM   778  C C   . ILE A 1 102 ? -10.417 6.105   18.261 1.00 90.45  ? 1102 ILE A C   1 
ATOM   779  O O   . ILE A 1 102 ? -11.213 6.125   19.190 1.00 90.12  ? 1102 ILE A O   1 
ATOM   780  C CB  . ILE A 1 102 ? -9.414  8.441   17.945 1.00 90.20  ? 1102 ILE A CB  1 
ATOM   781  C CG1 . ILE A 1 102 ? -10.089 8.584   16.560 1.00 91.67  ? 1102 ILE A CG1 1 
ATOM   782  C CG2 . ILE A 1 102 ? -8.152  9.315   18.056 1.00 90.44  ? 1102 ILE A CG2 1 
ATOM   783  C CD1 . ILE A 1 102 ? -10.994 9.829   16.399 1.00 100.19 ? 1102 ILE A CD1 1 
ATOM   784  N N   . GLN A 1 103 ? -10.614 5.365   17.162 1.00 87.67  ? 1103 GLN A N   1 
ATOM   785  C CA  . GLN A 1 103 ? -11.806 4.538   16.988 1.00 88.93  ? 1103 GLN A CA  1 
ATOM   786  C C   . GLN A 1 103 ? -11.665 3.205   17.741 1.00 92.67  ? 1103 GLN A C   1 
ATOM   787  O O   . GLN A 1 103 ? -12.678 2.642   18.165 1.00 93.81  ? 1103 GLN A O   1 
ATOM   788  C CB  . GLN A 1 103 ? -12.087 4.295   15.498 1.00 90.79  ? 1103 GLN A CB  1 
ATOM   789  C CG  . GLN A 1 103 ? -12.689 5.509   14.781 1.00 113.39 ? 1103 GLN A CG  1 
ATOM   790  C CD  . GLN A 1 103 ? -12.625 5.420   13.266 1.00 144.61 ? 1103 GLN A CD  1 
ATOM   791  O OE1 . GLN A 1 103 ? -12.876 4.373   12.646 1.00 142.90 ? 1103 GLN A OE1 1 
ATOM   792  N NE2 . GLN A 1 103 ? -12.330 6.545   12.626 1.00 138.49 ? 1103 GLN A NE2 1 
ATOM   793  N N   . LYS A 1 104 ? -10.418 2.720   17.929 1.00 87.34  ? 1104 LYS A N   1 
ATOM   794  C CA  . LYS A 1 104 ? -10.140 1.455   18.608 1.00 87.35  ? 1104 LYS A CA  1 
ATOM   795  C C   . LYS A 1 104 ? -9.998  1.587   20.128 1.00 89.67  ? 1104 LYS A C   1 
ATOM   796  O O   . LYS A 1 104 ? -10.461 0.698   20.842 1.00 90.49  ? 1104 LYS A O   1 
ATOM   797  C CB  . LYS A 1 104 ? -8.851  0.810   18.066 1.00 89.14  ? 1104 LYS A CB  1 
ATOM   798  C CG  . LYS A 1 104 ? -9.027  0.000   16.793 1.00 104.70 ? 1104 LYS A CG  1 
ATOM   799  C CD  . LYS A 1 104 ? -7.705  -0.621  16.369 1.00 113.60 ? 1104 LYS A CD  1 
ATOM   800  C CE  . LYS A 1 104 ? -7.779  -1.231  14.996 1.00 126.74 ? 1104 LYS A CE  1 
ATOM   801  N NZ  . LYS A 1 104 ? -6.459  -1.762  14.565 1.00 136.88 ? 1104 LYS A NZ  1 
ATOM   802  N N   . TYR A 1 105 ? -9.324  2.639   20.624 1.00 83.92  ? 1105 TYR A N   1 
ATOM   803  C CA  . TYR A 1 105 ? -9.041  2.740   22.055 1.00 83.34  ? 1105 TYR A CA  1 
ATOM   804  C C   . TYR A 1 105 ? -9.611  4.004   22.755 1.00 86.85  ? 1105 TYR A C   1 
ATOM   805  O O   . TYR A 1 105 ? -9.634  4.029   23.987 1.00 86.96  ? 1105 TYR A O   1 
ATOM   806  C CB  . TYR A 1 105 ? -7.515  2.707   22.272 1.00 83.09  ? 1105 TYR A CB  1 
ATOM   807  C CG  . TYR A 1 105 ? -6.806  1.594   21.526 1.00 84.46  ? 1105 TYR A CG  1 
ATOM   808  C CD1 . TYR A 1 105 ? -6.925  0.268   21.932 1.00 87.67  ? 1105 TYR A CD1 1 
ATOM   809  C CD2 . TYR A 1 105 ? -6.003  1.868   20.424 1.00 84.23  ? 1105 TYR A CD2 1 
ATOM   810  C CE1 . TYR A 1 105 ? -6.270  -0.759  21.253 1.00 88.91  ? 1105 TYR A CE1 1 
ATOM   811  C CE2 . TYR A 1 105 ? -5.333  0.852   19.744 1.00 85.29  ? 1105 TYR A CE2 1 
ATOM   812  C CZ  . TYR A 1 105 ? -5.473  -0.463  20.160 1.00 93.69  ? 1105 TYR A CZ  1 
ATOM   813  O OH  . TYR A 1 105 ? -4.825  -1.478  19.497 1.00 94.05  ? 1105 TYR A OH  1 
ATOM   814  N N   . LEU A 1 106 ? -10.073 5.024   22.013 1.00 82.47  ? 1106 LEU A N   1 
ATOM   815  C CA  . LEU A 1 106 ? -10.573 6.240   22.656 1.00 81.78  ? 1106 LEU A CA  1 
ATOM   816  C C   . LEU A 1 106 ? -12.096 6.403   22.537 1.00 88.10  ? 1106 LEU A C   1 
ATOM   817  O O   . LEU A 1 106 ? -12.686 7.006   23.424 1.00 88.04  ? 1106 LEU A O   1 
ATOM   818  C CB  . LEU A 1 106 ? -9.874  7.493   22.099 1.00 80.38  ? 1106 LEU A CB  1 
ATOM   819  C CG  . LEU A 1 106 ? -8.381  7.662   22.439 1.00 83.69  ? 1106 LEU A CG  1 
ATOM   820  C CD1 . LEU A 1 106 ? -7.756  8.762   21.625 1.00 82.72  ? 1106 LEU A CD1 1 
ATOM   821  C CD2 . LEU A 1 106 ? -8.169  7.949   23.914 1.00 86.33  ? 1106 LEU A CD2 1 
ATOM   822  N N   . ILE A 1 107 ? -12.737 5.895   21.477 1.00 98.91  ? 12   ILE A N   1 
ATOM   823  C CA  . ILE A 1 107 ? -14.188 6.048   21.371 1.00 99.06  ? 12   ILE A CA  1 
ATOM   824  C C   . ILE A 1 107 ? -14.821 4.943   22.213 1.00 105.92 ? 12   ILE A C   1 
ATOM   825  O O   . ILE A 1 107 ? -14.567 3.763   21.971 1.00 107.62 ? 12   ILE A O   1 
ATOM   826  C CB  . ILE A 1 107 ? -14.714 6.084   19.902 1.00 103.93 ? 12   ILE A CB  1 
ATOM   827  C CG1 . ILE A 1 107 ? -14.318 7.425   19.220 1.00 104.35 ? 12   ILE A CG1 1 
ATOM   828  C CG2 . ILE A 1 107 ? -16.246 5.890   19.848 1.00 104.43 ? 12   ILE A CG2 1 
ATOM   829  C CD1 . ILE A 1 107 ? -14.494 7.506   17.681 1.00 113.53 ? 12   ILE A CD1 1 
ATOM   830  N N   . LEU A 1 108 ? -15.602 5.346   23.232 1.00 102.47 ? 13   LEU A N   1 
ATOM   831  C CA  . LEU A 1 108 ? -16.300 4.441   24.138 1.00 102.83 ? 13   LEU A CA  1 
ATOM   832  C C   . LEU A 1 108 ? -17.800 4.727   24.074 1.00 108.69 ? 13   LEU A C   1 
ATOM   833  O O   . LEU A 1 108 ? -18.376 5.294   25.004 1.00 106.64 ? 13   LEU A O   1 
ATOM   834  C CB  . LEU A 1 108 ? -15.752 4.586   25.566 1.00 101.26 ? 13   LEU A CB  1 
ATOM   835  N N   . ASN A 1 109 ? -18.424 4.350   22.951 1.00 109.40 ? 14   ASN A N   1 
ATOM   836  C CA  . ASN A 1 109 ? -19.850 4.555   22.706 1.00 110.87 ? 14   ASN A CA  1 
ATOM   837  C C   . ASN A 1 109 ? -20.673 3.520   23.471 1.00 117.62 ? 14   ASN A C   1 
ATOM   838  O O   . ASN A 1 109 ? -20.692 2.345   23.089 1.00 120.08 ? 14   ASN A O   1 
ATOM   839  C CB  . ASN A 1 109 ? -20.157 4.495   21.200 1.00 115.11 ? 14   ASN A CB  1 
ATOM   840  N N   . SER A 1 110 ? -21.331 3.956   24.565 1.00 113.43 ? 15   SER A N   1 
ATOM   841  C CA  . SER A 1 110 ? -22.176 3.101   25.408 1.00 114.50 ? 15   SER A CA  1 
ATOM   842  C C   . SER A 1 110 ? -23.642 3.139   24.948 1.00 119.75 ? 15   SER A C   1 
ATOM   843  O O   . SER A 1 110 ? -24.343 2.132   25.085 1.00 121.33 ? 15   SER A O   1 
ATOM   844  C CB  . SER A 1 110 ? -22.079 3.518   26.873 1.00 117.01 ? 15   SER A CB  1 
ATOM   845  O OG  . SER A 1 110 ? -20.779 3.292   27.393 1.00 126.97 ? 15   SER A OG  1 
ATOM   846  N N   . SER A 1 111 ? -24.089 4.304   24.403 1.00 115.24 ? 16   SER A N   1 
ATOM   847  C CA  . SER A 1 111 ? -25.425 4.609   23.866 1.00 116.51 ? 16   SER A CA  1 
ATOM   848  C C   . SER A 1 111 ? -26.572 4.118   24.801 1.00 120.46 ? 16   SER A C   1 
ATOM   849  O O   . SER A 1 111 ? -26.497 4.346   26.013 1.00 118.25 ? 16   SER A O   1 
ATOM   850  C CB  . SER A 1 111 ? -25.591 4.026   22.461 1.00 123.29 ? 16   SER A CB  1 
ATOM   851  O OG  . SER A 1 111 ? -25.622 2.607   22.458 1.00 135.95 ? 16   SER A OG  1 
ATOM   852  N N   . ASP A 1 112 ? -27.622 3.463   24.222 1.00 119.42 ? 17   ASP A N   1 
ATOM   853  C CA  . ASP A 1 112 ? -28.851 2.940   24.850 1.00 120.96 ? 17   ASP A CA  1 
ATOM   854  C C   . ASP A 1 112 ? -29.668 4.123   25.389 1.00 122.10 ? 17   ASP A C   1 
ATOM   855  O O   . ASP A 1 112 ? -30.717 4.438   24.820 1.00 124.48 ? 17   ASP A O   1 
ATOM   856  C CB  . ASP A 1 112 ? -28.575 1.869   25.932 1.00 122.96 ? 17   ASP A CB  1 
ATOM   857  C CG  . ASP A 1 112 ? -28.026 0.550   25.401 1.00 135.15 ? 17   ASP A CG  1 
ATOM   858  O OD1 . ASP A 1 112 ? -28.123 0.310   24.170 1.00 137.37 ? 17   ASP A OD1 1 
ATOM   859  O OD2 . ASP A 1 112 ? -27.527 -0.256  26.217 1.00 141.06 ? 17   ASP A OD2 1 
ATOM   860  N N   . CYS A 1 113 ? -29.162 4.814   26.424 1.00 113.19 ? 18   CYS A N   1 
ATOM   861  C CA  . CYS A 1 113 ? -29.771 6.025   26.957 1.00 110.90 ? 18   CYS A CA  1 
ATOM   862  C C   . CYS A 1 113 ? -28.710 7.148   26.936 1.00 109.67 ? 18   CYS A C   1 
ATOM   863  O O   . CYS A 1 113 ? -28.153 7.480   27.988 1.00 106.69 ? 18   CYS A O   1 
ATOM   864  C CB  . CYS A 1 113 ? -30.351 5.798   28.351 1.00 110.92 ? 18   CYS A CB  1 
ATOM   865  S SG  . CYS A 1 113 ? -31.673 4.560   28.421 1.00 118.63 ? 18   CYS A SG  1 
ATOM   866  N N   . PRO A 1 114 ? -28.347 7.695   25.741 1.00 105.10 ? 19   PRO A N   1 
ATOM   867  C CA  . PRO A 1 114 ? -27.333 8.763   25.709 1.00 102.10 ? 19   PRO A CA  1 
ATOM   868  C C   . PRO A 1 114 ? -27.929 10.102  26.139 1.00 104.32 ? 19   PRO A C   1 
ATOM   869  O O   . PRO A 1 114 ? -29.144 10.276  26.083 1.00 105.90 ? 19   PRO A O   1 
ATOM   870  C CB  . PRO A 1 114 ? -26.876 8.789   24.243 1.00 104.73 ? 19   PRO A CB  1 
ATOM   871  C CG  . PRO A 1 114 ? -27.714 7.768   23.517 1.00 111.93 ? 19   PRO A CG  1 
ATOM   872  C CD  . PRO A 1 114 ? -28.870 7.431   24.386 1.00 108.80 ? 19   PRO A CD  1 
ATOM   873  N N   . LYS A 1 115 ? -27.080 11.036  26.600 1.00 97.53  ? 20   LYS A N   1 
ATOM   874  C CA  . LYS A 1 115 ? -27.483 12.368  27.078 1.00 96.60  ? 20   LYS A CA  1 
ATOM   875  C C   . LYS A 1 115 ? -28.464 12.261  28.288 1.00 100.63 ? 20   LYS A C   1 
ATOM   876  O O   . LYS A 1 115 ? -29.250 13.181  28.542 1.00 100.98 ? 20   LYS A O   1 
ATOM   877  C CB  . LYS A 1 115 ? -28.095 13.215  25.941 1.00 100.47 ? 20   LYS A CB  1 
ATOM   878  N N   . ALA A 1 116 ? -28.386 11.137  29.038 1.00 96.27  ? 21   ALA A N   1 
ATOM   879  C CA  . ALA A 1 116 ? -29.203 10.877  30.222 1.00 96.17  ? 21   ALA A CA  1 
ATOM   880  C C   . ALA A 1 116 ? -28.669 11.676  31.403 1.00 98.04  ? 21   ALA A C   1 
ATOM   881  O O   . ALA A 1 116 ? -27.452 11.731  31.611 1.00 95.81  ? 21   ALA A O   1 
ATOM   882  C CB  . ALA A 1 116 ? -29.214 9.393   30.537 1.00 97.25  ? 21   ALA A CB  1 
ATOM   883  N N   . GLY A 1 117 ? -29.576 12.324  32.131 1.00 95.08  ? 22   GLY A N   1 
ATOM   884  C CA  . GLY A 1 117 ? -29.231 13.174  33.265 1.00 93.24  ? 22   GLY A CA  1 
ATOM   885  C C   . GLY A 1 117 ? -28.485 14.434  32.860 1.00 95.47  ? 22   GLY A C   1 
ATOM   886  O O   . GLY A 1 117 ? -27.756 15.013  33.670 1.00 92.86  ? 22   GLY A O   1 
ATOM   887  N N   . ARG A 1 118 ? -28.647 14.853  31.593 1.00 93.49  ? 23   ARG A N   1 
ATOM   888  C CA  . ARG A 1 118 ? -28.000 16.040  31.043 1.00 93.14  ? 23   ARG A CA  1 
ATOM   889  C C   . ARG A 1 118 ? -28.990 17.190  31.015 1.00 100.22 ? 23   ARG A C   1 
ATOM   890  O O   . ARG A 1 118 ? -29.429 17.622  29.947 1.00 102.15 ? 23   ARG A O   1 
ATOM   891  C CB  . ARG A 1 118 ? -27.418 15.767  29.650 1.00 91.82  ? 23   ARG A CB  1 
ATOM   892  C CG  . ARG A 1 118 ? -26.061 15.110  29.709 1.00 96.67  ? 23   ARG A CG  1 
ATOM   893  C CD  . ARG A 1 118 ? -25.412 15.101  28.353 1.00 102.70 ? 23   ARG A CD  1 
ATOM   894  N NE  . ARG A 1 118 ? -23.988 14.794  28.452 1.00 107.95 ? 23   ARG A NE  1 
ATOM   895  C CZ  . ARG A 1 118 ? -23.023 15.705  28.397 1.00 123.12 ? 23   ARG A CZ  1 
ATOM   896  N NH1 . ARG A 1 118 ? -21.753 15.339  28.499 1.00 113.17 ? 23   ARG A NH1 1 
ATOM   897  N NH2 . ARG A 1 118 ? -23.319 16.988  28.226 1.00 108.76 ? 23   ARG A NH2 1 
ATOM   898  N N   . HIS A 1 119 ? -29.351 17.672  32.209 1.00 97.26  ? 24   HIS A N   1 
ATOM   899  C CA  . HIS A 1 119 ? -30.291 18.771  32.372 1.00 99.61  ? 24   HIS A CA  1 
ATOM   900  C C   . HIS A 1 119 ? -29.537 20.051  32.678 1.00 101.61 ? 24   HIS A C   1 
ATOM   901  O O   . HIS A 1 119 ? -28.470 20.029  33.294 1.00 98.89  ? 24   HIS A O   1 
ATOM   902  C CB  . HIS A 1 119 ? -31.326 18.448  33.448 1.00 101.91 ? 24   HIS A CB  1 
ATOM   903  C CG  . HIS A 1 119 ? -32.123 17.229  33.112 1.00 106.64 ? 24   HIS A CG  1 
ATOM   904  N ND1 . HIS A 1 119 ? -33.174 17.280  32.212 1.00 111.62 ? 24   HIS A ND1 1 
ATOM   905  C CD2 . HIS A 1 119 ? -31.957 15.950  33.520 1.00 107.27 ? 24   HIS A CD2 1 
ATOM   906  C CE1 . HIS A 1 119 ? -33.627 16.040  32.121 1.00 111.52 ? 24   HIS A CE1 1 
ATOM   907  N NE2 . HIS A 1 119 ? -32.927 15.205  32.891 1.00 109.29 ? 24   HIS A NE2 1 
ATOM   908  N N   . ASN A 1 120 ? -30.103 21.160  32.203 1.00 99.95  ? 25   ASN A N   1 
ATOM   909  C CA  . ASN A 1 120 ? -29.594 22.527  32.246 1.00 100.80 ? 25   ASN A CA  1 
ATOM   910  C C   . ASN A 1 120 ? -29.226 23.016  33.662 1.00 103.58 ? 25   ASN A C   1 
ATOM   911  O O   . ASN A 1 120 ? -28.231 23.729  33.807 1.00 102.42 ? 25   ASN A O   1 
ATOM   912  C CB  . ASN A 1 120 ? -30.645 23.467  31.652 1.00 106.66 ? 25   ASN A CB  1 
ATOM   913  C CG  . ASN A 1 120 ? -31.220 22.998  30.324 1.00 132.85 ? 25   ASN A CG  1 
ATOM   914  O OD1 . ASN A 1 120 ? -30.638 23.202  29.246 1.00 122.03 ? 25   ASN A OD1 1 
ATOM   915  N ND2 . ASN A 1 120 ? -32.378 22.344  30.380 1.00 127.48 ? 25   ASN A ND2 1 
ATOM   916  N N   . TYR A 1 121 ? -30.011 22.647  34.690 1.00 100.44 ? 26   TYR A N   1 
ATOM   917  C CA  . TYR A 1 121 ? -29.773 23.110  36.059 1.00 99.84  ? 26   TYR A CA  1 
ATOM   918  C C   . TYR A 1 121 ? -28.547 22.451  36.717 1.00 100.24 ? 26   TYR A C   1 
ATOM   919  O O   . TYR A 1 121 ? -27.909 23.108  37.537 1.00 99.55  ? 26   TYR A O   1 
ATOM   920  C CB  . TYR A 1 121 ? -31.006 22.917  36.961 1.00 102.55 ? 26   TYR A CB  1 
ATOM   921  C CG  . TYR A 1 121 ? -31.603 21.526  36.986 1.00 104.15 ? 26   TYR A CG  1 
ATOM   922  C CD1 . TYR A 1 121 ? -31.224 20.600  37.956 1.00 103.54 ? 26   TYR A CD1 1 
ATOM   923  C CD2 . TYR A 1 121 ? -32.629 21.170  36.114 1.00 107.49 ? 26   TYR A CD2 1 
ATOM   924  C CE1 . TYR A 1 121 ? -31.810 19.336  38.019 1.00 104.11 ? 26   TYR A CE1 1 
ATOM   925  C CE2 . TYR A 1 121 ? -33.225 19.911  36.170 1.00 108.42 ? 26   TYR A CE2 1 
ATOM   926  C CZ  . TYR A 1 121 ? -32.812 18.996  37.125 1.00 113.67 ? 26   TYR A CZ  1 
ATOM   927  O OH  . TYR A 1 121 ? -33.398 17.755  37.179 1.00 115.30 ? 26   TYR A OH  1 
ATOM   928  N N   . ILE A 1 122 ? -28.212 21.196  36.361 1.00 94.36  ? 27   ILE A N   1 
ATOM   929  C CA  . ILE A 1 122 ? -27.078 20.449  36.931 1.00 91.09  ? 27   ILE A CA  1 
ATOM   930  C C   . ILE A 1 122 ? -25.736 21.124  36.573 1.00 93.40  ? 27   ILE A C   1 
ATOM   931  O O   . ILE A 1 122 ? -24.869 21.252  37.438 1.00 90.99  ? 27   ILE A O   1 
ATOM   932  C CB  . ILE A 1 122 ? -27.109 18.963  36.457 1.00 93.26  ? 27   ILE A CB  1 
ATOM   933  C CG1 . ILE A 1 122 ? -28.394 18.262  36.949 1.00 95.07  ? 27   ILE A CG1 1 
ATOM   934  C CG2 . ILE A 1 122 ? -25.854 18.178  36.905 1.00 91.20  ? 27   ILE A CG2 1 
ATOM   935  C CD1 . ILE A 1 122 ? -28.830 17.143  36.094 1.00 105.11 ? 27   ILE A CD1 1 
ATOM   936  N N   . PHE A 1 123 ? -25.581 21.577  35.325 1.00 91.81  ? 28   PHE A N   1 
ATOM   937  C CA  . PHE A 1 123 ? -24.340 22.194  34.850 1.00 91.77  ? 28   PHE A CA  1 
ATOM   938  C C   . PHE A 1 123 ? -24.107 23.588  35.481 1.00 96.90  ? 28   PHE A C   1 
ATOM   939  O O   . PHE A 1 123 ? -23.039 24.169  35.286 1.00 96.17  ? 28   PHE A O   1 
ATOM   940  C CB  . PHE A 1 123 ? -24.336 22.282  33.311 1.00 94.89  ? 28   PHE A CB  1 
ATOM   941  C CG  . PHE A 1 123 ? -24.684 20.985  32.608 1.00 95.84  ? 28   PHE A CG  1 
ATOM   942  C CD1 . PHE A 1 123 ? -24.000 19.808  32.899 1.00 96.74  ? 28   PHE A CD1 1 
ATOM   943  C CD2 . PHE A 1 123 ? -25.681 20.945  31.642 1.00 100.12 ? 28   PHE A CD2 1 
ATOM   944  C CE1 . PHE A 1 123 ? -24.324 18.612  32.253 1.00 97.43  ? 28   PHE A CE1 1 
ATOM   945  C CE2 . PHE A 1 123 ? -25.992 19.750  30.983 1.00 102.62 ? 28   PHE A CE2 1 
ATOM   946  C CZ  . PHE A 1 123 ? -25.314 18.592  31.296 1.00 98.50  ? 28   PHE A CZ  1 
ATOM   947  N N   . VAL A 1 124 ? -25.072 24.079  36.277 1.00 95.40  ? 29   VAL A N   1 
ATOM   948  C CA  . VAL A 1 124 ? -24.999 25.364  36.978 1.00 97.68  ? 29   VAL A CA  1 
ATOM   949  C C   . VAL A 1 124 ? -24.994 25.129  38.514 1.00 100.43 ? 29   VAL A C   1 
ATOM   950  O O   . VAL A 1 124 ? -24.162 25.714  39.208 1.00 99.97  ? 29   VAL A O   1 
ATOM   951  C CB  . VAL A 1 124 ? -26.157 26.314  36.545 1.00 105.19 ? 29   VAL A CB  1 
ATOM   952  C CG1 . VAL A 1 124 ? -26.170 27.606  37.364 1.00 107.45 ? 29   VAL A CG1 1 
ATOM   953  C CG2 . VAL A 1 124 ? -26.095 26.628  35.050 1.00 106.37 ? 29   VAL A CG2 1 
ATOM   954  N N   . MET A 1 125 ? -25.910 24.275  39.023 1.00 96.42  ? 30   MET A N   1 
ATOM   955  C CA  . MET A 1 125 ? -26.104 23.979  40.450 1.00 95.48  ? 30   MET A CA  1 
ATOM   956  C C   . MET A 1 125 ? -24.887 23.302  41.111 1.00 96.12  ? 30   MET A C   1 
ATOM   957  O O   . MET A 1 125 ? -24.490 23.731  42.192 1.00 95.72  ? 30   MET A O   1 
ATOM   958  C CB  . MET A 1 125 ? -27.339 23.087  40.647 1.00 98.10  ? 30   MET A CB  1 
ATOM   959  C CG  . MET A 1 125 ? -27.868 23.079  42.061 1.00 101.86 ? 30   MET A CG  1 
ATOM   960  S SD  . MET A 1 125 ? -29.324 22.027  42.254 1.00 107.21 ? 30   MET A SD  1 
ATOM   961  C CE  . MET A 1 125 ? -28.567 20.411  42.235 1.00 100.91 ? 30   MET A CE  1 
ATOM   962  N N   . ILE A 1 126 ? -24.330 22.242  40.497 1.00 90.38  ? 31   ILE A N   1 
ATOM   963  C CA  . ILE A 1 126 ? -23.201 21.477  41.047 1.00 87.56  ? 31   ILE A CA  1 
ATOM   964  C C   . ILE A 1 126 ? -21.899 22.354  41.078 1.00 92.65  ? 31   ILE A C   1 
ATOM   965  O O   . ILE A 1 126 ? -21.322 22.431  42.167 1.00 90.70  ? 31   ILE A O   1 
ATOM   966  C CB  . ILE A 1 126 ? -22.993 20.120  40.299 1.00 88.69  ? 31   ILE A CB  1 
ATOM   967  C CG1 . ILE A 1 126 ? -24.285 19.243  40.296 1.00 88.98  ? 31   ILE A CG1 1 
ATOM   968  C CG2 . ILE A 1 126 ? -21.781 19.339  40.814 1.00 87.01  ? 31   ILE A CG2 1 
ATOM   969  C CD1 . ILE A 1 126 ? -24.896 18.799  41.708 1.00 94.74  ? 31   ILE A CD1 1 
ATOM   970  N N   . PRO A 1 127 ? -21.431 23.050  39.994 1.00 92.29  ? 32   PRO A N   1 
ATOM   971  C CA  . PRO A 1 127 ? -20.195 23.855  40.128 1.00 93.26  ? 32   PRO A CA  1 
ATOM   972  C C   . PRO A 1 127 ? -20.305 25.022  41.131 1.00 99.49  ? 32   PRO A C   1 
ATOM   973  O O   . PRO A 1 127 ? -19.285 25.390  41.713 1.00 99.05  ? 32   PRO A O   1 
ATOM   974  C CB  . PRO A 1 127 ? -19.944 24.384  38.712 1.00 96.69  ? 32   PRO A CB  1 
ATOM   975  C CG  . PRO A 1 127 ? -21.242 24.280  38.023 1.00 101.73 ? 32   PRO A CG  1 
ATOM   976  C CD  . PRO A 1 127 ? -21.935 23.092  38.603 1.00 95.15  ? 32   PRO A CD  1 
ATOM   977  N N   . THR A 1 128 ? -21.515 25.588  41.350 1.00 98.19  ? 33   THR A N   1 
ATOM   978  C CA  . THR A 1 128 ? -21.708 26.675  42.325 1.00 100.31 ? 33   THR A CA  1 
ATOM   979  C C   . THR A 1 128 ? -21.609 26.116  43.759 1.00 101.47 ? 33   THR A C   1 
ATOM   980  O O   . THR A 1 128 ? -21.009 26.764  44.619 1.00 102.01 ? 33   THR A O   1 
ATOM   981  C CB  . THR A 1 128 ? -23.033 27.431  42.104 1.00 115.56 ? 33   THR A CB  1 
ATOM   982  O OG1 . THR A 1 128 ? -24.120 26.505  42.041 1.00 117.03 ? 33   THR A OG1 1 
ATOM   983  C CG2 . THR A 1 128 ? -23.007 28.307  40.857 1.00 117.31 ? 33   THR A CG2 1 
ATOM   984  N N   . LEU A 1 129 ? -22.167 24.905  43.995 1.00 94.83  ? 34   LEU A N   1 
ATOM   985  C CA  . LEU A 1 129 ? -22.125 24.192  45.277 1.00 92.34  ? 34   LEU A CA  1 
ATOM   986  C C   . LEU A 1 129 ? -20.702 23.728  45.597 1.00 93.07  ? 34   LEU A C   1 
ATOM   987  O O   . LEU A 1 129 ? -20.297 23.770  46.757 1.00 92.24  ? 34   LEU A O   1 
ATOM   988  C CB  . LEU A 1 129 ? -23.079 22.978  45.261 1.00 91.01  ? 34   LEU A CB  1 
ATOM   989  C CG  . LEU A 1 129 ? -24.377 23.090  46.075 1.00 96.97  ? 34   LEU A CG  1 
ATOM   990  C CD1 . LEU A 1 129 ? -25.407 23.980  45.378 1.00 100.47 ? 34   LEU A CD1 1 
ATOM   991  C CD2 . LEU A 1 129 ? -24.995 21.730  46.283 1.00 97.47  ? 34   LEU A CD2 1 
ATOM   992  N N   . TYR A 1 130 ? -19.945 23.293  44.563 1.00 87.81  ? 35   TYR A N   1 
ATOM   993  C CA  . TYR A 1 130 ? -18.563 22.813  44.690 1.00 85.64  ? 35   TYR A CA  1 
ATOM   994  C C   . TYR A 1 130 ? -17.599 23.953  45.005 1.00 90.49  ? 35   TYR A C   1 
ATOM   995  O O   . TYR A 1 130 ? -16.565 23.717  45.631 1.00 89.37  ? 35   TYR A O   1 
ATOM   996  C CB  . TYR A 1 130 ? -18.119 22.089  43.415 1.00 85.76  ? 35   TYR A CB  1 
ATOM   997  C CG  . TYR A 1 130 ? -18.553 20.640  43.319 1.00 84.67  ? 35   TYR A CG  1 
ATOM   998  C CD1 . TYR A 1 130 ? -19.485 20.108  44.207 1.00 85.22  ? 35   TYR A CD1 1 
ATOM   999  C CD2 . TYR A 1 130 ? -18.051 19.808  42.324 1.00 84.93  ? 35   TYR A CD2 1 
ATOM   1000 C CE1 . TYR A 1 130 ? -19.896 18.781  44.116 1.00 84.29  ? 35   TYR A CE1 1 
ATOM   1001 C CE2 . TYR A 1 130 ? -18.444 18.473  42.231 1.00 84.61  ? 35   TYR A CE2 1 
ATOM   1002 C CZ  . TYR A 1 130 ? -19.367 17.963  43.131 1.00 90.70  ? 35   TYR A CZ  1 
ATOM   1003 O OH  . TYR A 1 130 ? -19.772 16.652  43.042 1.00 89.88  ? 35   TYR A OH  1 
ATOM   1004 N N   . SER A 1 131 ? -17.941 25.184  44.582 1.00 89.04  ? 36   SER A N   1 
ATOM   1005 C CA  . SER A 1 131 ? -17.150 26.384  44.850 1.00 90.91  ? 36   SER A CA  1 
ATOM   1006 C C   . SER A 1 131 ? -17.145 26.672  46.344 1.00 93.57  ? 36   SER A C   1 
ATOM   1007 O O   . SER A 1 131 ? -16.095 26.966  46.920 1.00 93.99  ? 36   SER A O   1 
ATOM   1008 C CB  . SER A 1 131 ? -17.715 27.571  44.079 1.00 97.89  ? 36   SER A CB  1 
ATOM   1009 O OG  . SER A 1 131 ? -17.771 27.291  42.689 1.00 108.24 ? 36   SER A OG  1 
ATOM   1010 N N   . ILE A 1 132 ? -18.324 26.518  46.974 1.00 88.25  ? 37   ILE A N   1 
ATOM   1011 C CA  . ILE A 1 132 ? -18.567 26.744  48.394 1.00 87.18  ? 37   ILE A CA  1 
ATOM   1012 C C   . ILE A 1 132 ? -17.866 25.646  49.200 1.00 86.65  ? 37   ILE A C   1 
ATOM   1013 O O   . ILE A 1 132 ? -17.078 25.985  50.080 1.00 87.13  ? 37   ILE A O   1 
ATOM   1014 C CB  . ILE A 1 132 ? -20.094 26.833  48.685 1.00 90.34  ? 37   ILE A CB  1 
ATOM   1015 C CG1 . ILE A 1 132 ? -20.717 28.020  47.903 1.00 93.38  ? 37   ILE A CG1 1 
ATOM   1016 C CG2 . ILE A 1 132 ? -20.373 26.954  50.200 1.00 91.60  ? 37   ILE A CG2 1 
ATOM   1017 C CD1 . ILE A 1 132 ? -22.229 27.967  47.636 1.00 99.63  ? 37   ILE A CD1 1 
ATOM   1018 N N   . ILE A 1 133 ? -18.106 24.354  48.886 1.00 79.03  ? 38   ILE A N   1 
ATOM   1019 C CA  . ILE A 1 133 ? -17.463 23.245  49.600 1.00 75.91  ? 38   ILE A CA  1 
ATOM   1020 C C   . ILE A 1 133 ? -15.934 23.472  49.617 1.00 79.94  ? 38   ILE A C   1 
ATOM   1021 O O   . ILE A 1 133 ? -15.345 23.433  50.695 1.00 79.31  ? 38   ILE A O   1 
ATOM   1022 C CB  . ILE A 1 133 ? -17.832 21.838  49.033 1.00 76.68  ? 38   ILE A CB  1 
ATOM   1023 C CG1 . ILE A 1 133 ? -19.352 21.578  49.100 1.00 77.05  ? 38   ILE A CG1 1 
ATOM   1024 C CG2 . ILE A 1 133 ? -17.058 20.718  49.761 1.00 75.23  ? 38   ILE A CG2 1 
ATOM   1025 C CD1 . ILE A 1 133 ? -19.843 20.270  48.390 1.00 82.31  ? 38   ILE A CD1 1 
ATOM   1026 N N   . PHE A 1 134 ? -15.317 23.773  48.452 1.00 77.06  ? 39   PHE A N   1 
ATOM   1027 C CA  . PHE A 1 134 ? -13.873 23.981  48.346 1.00 77.67  ? 39   PHE A CA  1 
ATOM   1028 C C   . PHE A 1 134 ? -13.404 25.137  49.247 1.00 83.28  ? 39   PHE A C   1 
ATOM   1029 O O   . PHE A 1 134 ? -12.609 24.879  50.147 1.00 82.12  ? 39   PHE A O   1 
ATOM   1030 C CB  . PHE A 1 134 ? -13.443 24.218  46.881 1.00 81.00  ? 39   PHE A CB  1 
ATOM   1031 C CG  . PHE A 1 134 ? -12.009 24.667  46.659 1.00 84.46  ? 39   PHE A CG  1 
ATOM   1032 C CD1 . PHE A 1 134 ? -10.956 23.761  46.735 1.00 86.14  ? 39   PHE A CD1 1 
ATOM   1033 C CD2 . PHE A 1 134 ? -11.719 25.986  46.324 1.00 89.49  ? 39   PHE A CD2 1 
ATOM   1034 C CE1 . PHE A 1 134 ? -9.637  24.172  46.512 1.00 88.84  ? 39   PHE A CE1 1 
ATOM   1035 C CE2 . PHE A 1 134 ? -10.399 26.394  46.100 1.00 94.31  ? 39   PHE A CE2 1 
ATOM   1036 C CZ  . PHE A 1 134 ? -9.368  25.484  46.196 1.00 91.16  ? 39   PHE A CZ  1 
ATOM   1037 N N   . VAL A 1 135 ? -13.918 26.376  49.035 1.00 82.35  ? 40   VAL A N   1 
ATOM   1038 C CA  . VAL A 1 135 ? -13.528 27.600  49.756 1.00 84.96  ? 40   VAL A CA  1 
ATOM   1039 C C   . VAL A 1 135 ? -13.789 27.470  51.286 1.00 88.24  ? 40   VAL A C   1 
ATOM   1040 O O   . VAL A 1 135 ? -12.865 27.718  52.065 1.00 88.22  ? 40   VAL A O   1 
ATOM   1041 C CB  . VAL A 1 135 ? -14.221 28.864  49.167 1.00 91.45  ? 40   VAL A CB  1 
ATOM   1042 C CG1 . VAL A 1 135 ? -14.038 30.094  50.065 1.00 94.64  ? 40   VAL A CG1 1 
ATOM   1043 C CG2 . VAL A 1 135 ? -13.709 29.156  47.762 1.00 92.42  ? 40   VAL A CG2 1 
ATOM   1044 N N   . VAL A 1 136 ? -15.014 27.087  51.701 1.00 84.50  ? 41   VAL A N   1 
ATOM   1045 C CA  . VAL A 1 136 ? -15.386 26.933  53.118 1.00 84.21  ? 41   VAL A CA  1 
ATOM   1046 C C   . VAL A 1 136 ? -14.501 25.841  53.781 1.00 85.63  ? 41   VAL A C   1 
ATOM   1047 O O   . VAL A 1 136 ? -13.931 26.086  54.849 1.00 86.24  ? 41   VAL A O   1 
ATOM   1048 C CB  . VAL A 1 136 ? -16.911 26.638  53.292 1.00 87.51  ? 41   VAL A CB  1 
ATOM   1049 C CG1 . VAL A 1 136 ? -17.257 26.195  54.716 1.00 85.90  ? 41   VAL A CG1 1 
ATOM   1050 C CG2 . VAL A 1 136 ? -17.753 27.849  52.890 1.00 90.37  ? 41   VAL A CG2 1 
ATOM   1051 N N   . GLY A 1 137 ? -14.380 24.689  53.122 1.00 78.97  ? 42   GLY A N   1 
ATOM   1052 C CA  . GLY A 1 137 ? -13.596 23.554  53.595 1.00 76.52  ? 42   GLY A CA  1 
ATOM   1053 C C   . GLY A 1 137 ? -12.103 23.776  53.720 1.00 81.57  ? 42   GLY A C   1 
ATOM   1054 O O   . GLY A 1 137 ? -11.485 23.223  54.634 1.00 80.39  ? 42   GLY A O   1 
ATOM   1055 N N   . ILE A 1 138 ? -11.501 24.547  52.787 1.00 80.37  ? 43   ILE A N   1 
ATOM   1056 C CA  . ILE A 1 138 ? -10.059 24.823  52.794 1.00 82.36  ? 43   ILE A CA  1 
ATOM   1057 C C   . ILE A 1 138 ? -9.721  25.650  54.044 1.00 88.18  ? 43   ILE A C   1 
ATOM   1058 O O   . ILE A 1 138 ? -8.833  25.247  54.795 1.00 87.21  ? 43   ILE A O   1 
ATOM   1059 C CB  . ILE A 1 138 ? -9.577  25.492  51.466 1.00 88.05  ? 43   ILE A CB  1 
ATOM   1060 C CG1 . ILE A 1 138 ? -9.409  24.447  50.331 1.00 87.05  ? 43   ILE A CG1 1 
ATOM   1061 C CG2 . ILE A 1 138 ? -8.302  26.339  51.629 1.00 92.21  ? 43   ILE A CG2 1 
ATOM   1062 C CD1 . ILE A 1 138 ? -8.349  23.277  50.541 1.00 95.93  ? 43   ILE A CD1 1 
ATOM   1063 N N   . PHE A 1 139 ? -10.453 26.762  54.285 1.00 87.23  ? 44   PHE A N   1 
ATOM   1064 C CA  . PHE A 1 139 ? -10.256 27.635  55.443 1.00 89.63  ? 44   PHE A CA  1 
ATOM   1065 C C   . PHE A 1 139 ? -10.637 26.913  56.730 1.00 90.92  ? 44   PHE A C   1 
ATOM   1066 O O   . PHE A 1 139 ? -9.952  27.064  57.744 1.00 92.28  ? 44   PHE A O   1 
ATOM   1067 C CB  . PHE A 1 139 ? -11.062 28.935  55.295 1.00 94.67  ? 44   PHE A CB  1 
ATOM   1068 C CG  . PHE A 1 139 ? -10.280 30.083  54.700 1.00 101.01 ? 44   PHE A CG  1 
ATOM   1069 C CD1 . PHE A 1 139 ? -9.763  31.089  55.511 1.00 108.16 ? 44   PHE A CD1 1 
ATOM   1070 C CD2 . PHE A 1 139 ? -10.059 30.160  53.327 1.00 104.12 ? 44   PHE A CD2 1 
ATOM   1071 C CE1 . PHE A 1 139 ? -9.048  32.162  54.958 1.00 113.60 ? 44   PHE A CE1 1 
ATOM   1072 C CE2 . PHE A 1 139 ? -9.335  31.224  52.777 1.00 111.37 ? 44   PHE A CE2 1 
ATOM   1073 C CZ  . PHE A 1 139 ? -8.839  32.222  53.595 1.00 113.23 ? 44   PHE A CZ  1 
ATOM   1074 N N   . GLY A 1 140 ? -11.698 26.114  56.661 1.00 83.48  ? 45   GLY A N   1 
ATOM   1075 C CA  . GLY A 1 140 ? -12.199 25.331  57.781 1.00 80.51  ? 45   GLY A CA  1 
ATOM   1076 C C   . GLY A 1 140 ? -11.209 24.315  58.318 1.00 81.65  ? 45   GLY A C   1 
ATOM   1077 O O   . GLY A 1 140 ? -10.854 24.373  59.499 1.00 82.24  ? 45   GLY A O   1 
ATOM   1078 N N   . ASN A 1 141 ? -10.747 23.386  57.455 1.00 74.74  ? 46   ASN A N   1 
ATOM   1079 C CA  . ASN A 1 141 ? -9.823  22.323  57.847 1.00 72.47  ? 46   ASN A CA  1 
ATOM   1080 C C   . ASN A 1 141 ? -8.413  22.845  58.141 1.00 77.93  ? 46   ASN A C   1 
ATOM   1081 O O   . ASN A 1 141 ? -7.742  22.250  58.975 1.00 77.39  ? 46   ASN A O   1 
ATOM   1082 C CB  . ASN A 1 141 ? -9.765  21.225  56.798 1.00 68.80  ? 46   ASN A CB  1 
ATOM   1083 C CG  . ASN A 1 141 ? -11.026 20.402  56.742 1.00 81.66  ? 46   ASN A CG  1 
ATOM   1084 O OD1 . ASN A 1 141 ? -11.443 19.789  57.727 1.00 80.15  ? 46   ASN A OD1 1 
ATOM   1085 N ND2 . ASN A 1 141 ? -11.661 20.356  55.585 1.00 68.13  ? 46   ASN A ND2 1 
ATOM   1086 N N   . SER A 1 142 ? -7.973  23.950  57.522 1.00 77.10  ? 47   SER A N   1 
ATOM   1087 C CA  . SER A 1 142 ? -6.642  24.491  57.826 1.00 80.16  ? 47   SER A CA  1 
ATOM   1088 C C   . SER A 1 142 ? -6.637  25.112  59.239 1.00 84.81  ? 47   SER A C   1 
ATOM   1089 O O   . SER A 1 142 ? -5.623  25.016  59.934 1.00 85.13  ? 47   SER A O   1 
ATOM   1090 C CB  . SER A 1 142 ? -6.178  25.490  56.768 1.00 87.67  ? 47   SER A CB  1 
ATOM   1091 O OG  . SER A 1 142 ? -7.159  26.474  56.485 1.00 101.19 ? 47   SER A OG  1 
ATOM   1092 N N   . LEU A 1 143 ? -7.789  25.666  59.688 1.00 81.66  ? 48   LEU A N   1 
ATOM   1093 C CA  . LEU A 1 143 ? -7.954  26.195  61.047 1.00 82.98  ? 48   LEU A CA  1 
ATOM   1094 C C   . LEU A 1 143 ? -7.937  25.048  62.074 1.00 84.78  ? 48   LEU A C   1 
ATOM   1095 O O   . LEU A 1 143 ? -7.391  25.221  63.161 1.00 85.53  ? 48   LEU A O   1 
ATOM   1096 C CB  . LEU A 1 143 ? -9.247  27.023  61.194 1.00 83.53  ? 48   LEU A CB  1 
ATOM   1097 C CG  . LEU A 1 143 ? -9.204  28.498  60.733 1.00 92.11  ? 48   LEU A CG  1 
ATOM   1098 C CD1 . LEU A 1 143 ? -10.591 29.111  60.731 1.00 92.25  ? 48   LEU A CD1 1 
ATOM   1099 C CD2 . LEU A 1 143 ? -8.290  29.345  61.613 1.00 98.20  ? 48   LEU A CD2 1 
ATOM   1100 N N   . VAL A 1 144 ? -8.503  23.876  61.706 1.00 78.82  ? 49   VAL A N   1 
ATOM   1101 C CA  . VAL A 1 144 ? -8.564  22.651  62.522 1.00 76.55  ? 49   VAL A CA  1 
ATOM   1102 C C   . VAL A 1 144 ? -7.128  22.133  62.784 1.00 81.91  ? 49   VAL A C   1 
ATOM   1103 O O   . VAL A 1 144 ? -6.825  21.751  63.918 1.00 81.05  ? 49   VAL A O   1 
ATOM   1104 C CB  . VAL A 1 144 ? -9.471  21.578  61.847 1.00 77.59  ? 49   VAL A CB  1 
ATOM   1105 C CG1 . VAL A 1 144 ? -9.270  20.187  62.439 1.00 75.29  ? 49   VAL A CG1 1 
ATOM   1106 C CG2 . VAL A 1 144 ? -10.937 21.975  61.942 1.00 76.88  ? 49   VAL A CG2 1 
ATOM   1107 N N   . VAL A 1 145 ? -6.249  22.169  61.755 1.00 80.32  ? 50   VAL A N   1 
ATOM   1108 C CA  . VAL A 1 145 ? -4.843  21.744  61.834 1.00 81.87  ? 50   VAL A CA  1 
ATOM   1109 C C   . VAL A 1 145 ? -4.090  22.649  62.843 1.00 89.03  ? 50   VAL A C   1 
ATOM   1110 O O   . VAL A 1 145 ? -3.307  22.133  63.645 1.00 88.82  ? 50   VAL A O   1 
ATOM   1111 C CB  . VAL A 1 145 ? -4.170  21.744  60.430 1.00 87.52  ? 50   VAL A CB  1 
ATOM   1112 C CG1 . VAL A 1 145 ? -2.671  21.462  60.514 1.00 89.82  ? 50   VAL A CG1 1 
ATOM   1113 C CG2 . VAL A 1 145 ? -4.841  20.740  59.494 1.00 84.48  ? 50   VAL A CG2 1 
ATOM   1114 N N   . ILE A 1 146 ? -4.362  23.977  62.823 1.00 88.57  ? 51   ILE A N   1 
ATOM   1115 C CA  . ILE A 1 146 ? -3.742  24.958  63.732 1.00 92.29  ? 51   ILE A CA  1 
ATOM   1116 C C   . ILE A 1 146 ? -4.223  24.701  65.177 1.00 95.55  ? 51   ILE A C   1 
ATOM   1117 O O   . ILE A 1 146 ? -3.401  24.695  66.095 1.00 96.51  ? 51   ILE A O   1 
ATOM   1118 C CB  . ILE A 1 146 ? -4.022  26.429  63.276 1.00 98.44  ? 51   ILE A CB  1 
ATOM   1119 C CG1 . ILE A 1 146 ? -3.475  26.729  61.852 1.00 100.99 ? 51   ILE A CG1 1 
ATOM   1120 C CG2 . ILE A 1 146 ? -3.538  27.470  64.289 1.00 102.60 ? 51   ILE A CG2 1 
ATOM   1121 C CD1 . ILE A 1 146 ? -1.917  26.507  61.576 1.00 114.25 ? 51   ILE A CD1 1 
ATOM   1122 N N   . VAL A 1 147 ? -5.541  24.470  65.362 1.00 90.20  ? 52   VAL A N   1 
ATOM   1123 C CA  . VAL A 1 147 ? -6.179  24.204  66.656 1.00 89.00  ? 52   VAL A CA  1 
ATOM   1124 C C   . VAL A 1 147 ? -5.588  22.916  67.279 1.00 92.07  ? 52   VAL A C   1 
ATOM   1125 O O   . VAL A 1 147 ? -5.255  22.929  68.462 1.00 92.45  ? 52   VAL A O   1 
ATOM   1126 C CB  . VAL A 1 147 ? -7.728  24.132  66.510 1.00 90.67  ? 52   VAL A CB  1 
ATOM   1127 C CG1 . VAL A 1 147 ? -8.396  23.425  67.693 1.00 88.61  ? 52   VAL A CG1 1 
ATOM   1128 C CG2 . VAL A 1 147 ? -8.321  25.527  66.313 1.00 92.80  ? 52   VAL A CG2 1 
ATOM   1129 N N   . ILE A 1 148 ? -5.418  21.840  66.481 1.00 86.88  ? 53   ILE A N   1 
ATOM   1130 C CA  . ILE A 1 148 ? -4.884  20.556  66.953 1.00 85.42  ? 53   ILE A CA  1 
ATOM   1131 C C   . ILE A 1 148 ? -3.404  20.720  67.401 1.00 93.15  ? 53   ILE A C   1 
ATOM   1132 O O   . ILE A 1 148 ? -3.023  20.161  68.434 1.00 92.81  ? 53   ILE A O   1 
ATOM   1133 C CB  . ILE A 1 148 ? -5.076  19.463  65.860 1.00 86.24  ? 53   ILE A CB  1 
ATOM   1134 C CG1 . ILE A 1 148 ? -6.565  19.026  65.830 1.00 83.66  ? 53   ILE A CG1 1 
ATOM   1135 C CG2 . ILE A 1 148 ? -4.159  18.240  66.079 1.00 86.25  ? 53   ILE A CG2 1 
ATOM   1136 C CD1 . ILE A 1 148 ? -7.049  18.343  64.588 1.00 88.82  ? 53   ILE A CD1 1 
ATOM   1137 N N   . TYR A 1 149 ? -2.605  21.518  66.677 1.00 93.03  ? 54   TYR A N   1 
ATOM   1138 C CA  . TYR A 1 149 ? -1.203  21.725  67.033 1.00 96.77  ? 54   TYR A CA  1 
ATOM   1139 C C   . TYR A 1 149 ? -0.996  22.673  68.231 1.00 103.37 ? 54   TYR A C   1 
ATOM   1140 O O   . TYR A 1 149 ? -0.004  22.508  68.943 1.00 105.09 ? 54   TYR A O   1 
ATOM   1141 C CB  . TYR A 1 149 ? -0.417  22.277  65.840 1.00 101.19 ? 54   TYR A CB  1 
ATOM   1142 C CG  . TYR A 1 149 ? 0.279   21.216  65.018 1.00 103.28 ? 54   TYR A CG  1 
ATOM   1143 C CD1 . TYR A 1 149 ? 1.489   20.667  65.433 1.00 107.84 ? 54   TYR A CD1 1 
ATOM   1144 C CD2 . TYR A 1 149 ? -0.233  20.814  63.789 1.00 101.99 ? 54   TYR A CD2 1 
ATOM   1145 C CE1 . TYR A 1 149 ? 2.158   19.720  64.658 1.00 109.30 ? 54   TYR A CE1 1 
ATOM   1146 C CE2 . TYR A 1 149 ? 0.424   19.863  63.007 1.00 103.17 ? 54   TYR A CE2 1 
ATOM   1147 C CZ  . TYR A 1 149 ? 1.621   19.318  63.446 1.00 113.99 ? 54   TYR A CZ  1 
ATOM   1148 O OH  . TYR A 1 149 ? 2.274   18.381  62.678 1.00 115.58 ? 54   TYR A OH  1 
ATOM   1149 N N   . PHE A 1 150 ? -1.887  23.669  68.438 1.00 100.10 ? 55   PHE A N   1 
ATOM   1150 C CA  . PHE A 1 150 ? -1.719  24.672  69.498 1.00 102.73 ? 55   PHE A CA  1 
ATOM   1151 C C   . PHE A 1 150 ? -2.651  24.468  70.702 1.00 103.88 ? 55   PHE A C   1 
ATOM   1152 O O   . PHE A 1 150 ? -2.181  24.584  71.833 1.00 104.34 ? 55   PHE A O   1 
ATOM   1153 C CB  . PHE A 1 150 ? -1.935  26.085  68.936 1.00 107.53 ? 55   PHE A CB  1 
ATOM   1154 C CG  . PHE A 1 150 ? -0.786  26.640  68.127 1.00 113.11 ? 55   PHE A CG  1 
ATOM   1155 C CD1 . PHE A 1 150 ? -0.605  26.271  66.798 1.00 115.51 ? 55   PHE A CD1 1 
ATOM   1156 C CD2 . PHE A 1 150 ? 0.087   27.572  68.677 1.00 120.24 ? 55   PHE A CD2 1 
ATOM   1157 C CE1 . PHE A 1 150 ? 0.450   26.793  66.048 1.00 120.52 ? 55   PHE A CE1 1 
ATOM   1158 C CE2 . PHE A 1 150 ? 1.138   28.103  67.922 1.00 127.29 ? 55   PHE A CE2 1 
ATOM   1159 C CZ  . PHE A 1 150 ? 1.310   27.712  66.612 1.00 124.61 ? 55   PHE A CZ  1 
ATOM   1160 N N   . TYR A 1 151 ? -3.956  24.212  70.476 1.00 97.81  ? 56   TYR A N   1 
ATOM   1161 C CA  . TYR A 1 151 ? -4.925  24.026  71.561 1.00 96.06  ? 56   TYR A CA  1 
ATOM   1162 C C   . TYR A 1 151 ? -4.862  22.600  72.130 1.00 97.55  ? 56   TYR A C   1 
ATOM   1163 O O   . TYR A 1 151 ? -4.923  22.442  73.351 1.00 97.36  ? 56   TYR A O   1 
ATOM   1164 C CB  . TYR A 1 151 ? -6.357  24.356  71.094 1.00 95.76  ? 56   TYR A CB  1 
ATOM   1165 C CG  . TYR A 1 151 ? -7.430  24.037  72.113 1.00 96.16  ? 56   TYR A CG  1 
ATOM   1166 C CD1 . TYR A 1 151 ? -7.613  24.840  73.237 1.00 100.28 ? 56   TYR A CD1 1 
ATOM   1167 C CD2 . TYR A 1 151 ? -8.271  22.940  71.950 1.00 93.65  ? 56   TYR A CD2 1 
ATOM   1168 C CE1 . TYR A 1 151 ? -8.589  24.545  74.185 1.00 100.02 ? 56   TYR A CE1 1 
ATOM   1169 C CE2 . TYR A 1 151 ? -9.254  22.636  72.891 1.00 93.50  ? 56   TYR A CE2 1 
ATOM   1170 C CZ  . TYR A 1 151 ? -9.412  23.445  74.006 1.00 104.56 ? 56   TYR A CZ  1 
ATOM   1171 O OH  . TYR A 1 151 ? -10.383 23.159  74.935 1.00 106.76 ? 56   TYR A OH  1 
ATOM   1172 N N   . MET A 1 152 ? -4.771  21.575  71.259 1.00 91.99  ? 57   MET A N   1 
ATOM   1173 C CA  . MET A 1 152 ? -4.710  20.168  71.668 1.00 89.54  ? 57   MET A CA  1 
ATOM   1174 C C   . MET A 1 152 ? -3.253  19.703  71.850 1.00 94.84  ? 57   MET A C   1 
ATOM   1175 O O   . MET A 1 152 ? -3.006  18.772  72.626 1.00 93.80  ? 57   MET A O   1 
ATOM   1176 C CB  . MET A 1 152 ? -5.433  19.268  70.657 1.00 89.18  ? 57   MET A CB  1 
ATOM   1177 C CG  . MET A 1 152 ? -6.906  19.578  70.522 1.00 91.40  ? 57   MET A CG  1 
ATOM   1178 S SD  . MET A 1 152 ? -7.784  18.315  69.578 1.00 92.74  ? 57   MET A SD  1 
ATOM   1179 C CE  . MET A 1 152 ? -9.339  19.117  69.374 1.00 89.06  ? 57   MET A CE  1 
ATOM   1180 N N   . LYS A 1 153 ? -2.300  20.349  71.122 1.00 93.25  ? 58   LYS A N   1 
ATOM   1181 C CA  . LYS A 1 153 ? -0.843  20.133  71.145 1.00 95.31  ? 58   LYS A CA  1 
ATOM   1182 C C   . LYS A 1 153 ? -0.429  18.659  70.876 1.00 97.58  ? 58   LYS A C   1 
ATOM   1183 O O   . LYS A 1 153 ? 0.695   18.274  71.219 1.00 99.31  ? 58   LYS A O   1 
ATOM   1184 C CB  . LYS A 1 153 ? -0.244  20.599  72.486 1.00 99.60  ? 58   LYS A CB  1 
ATOM   1185 C CG  . LYS A 1 153 ? -0.081  22.105  72.591 1.00 111.85 ? 58   LYS A CG  1 
ATOM   1186 C CD  . LYS A 1 153 ? 0.494   22.504  73.940 1.00 123.37 ? 58   LYS A CD  1 
ATOM   1187 C CE  . LYS A 1 153 ? 0.879   23.963  74.005 1.00 139.15 ? 58   LYS A CE  1 
ATOM   1188 N NZ  . LYS A 1 153 ? 2.076   24.272  73.172 1.00 151.49 ? 58   LYS A NZ  1 
ATOM   1189 N N   . LEU A 1 154 ? -1.314  17.867  70.219 1.00 90.48  ? 59   LEU A N   1 
ATOM   1190 C CA  . LEU A 1 154 ? -1.126  16.449  69.864 1.00 88.53  ? 59   LEU A CA  1 
ATOM   1191 C C   . LEU A 1 154 ? -0.647  15.628  71.075 1.00 92.02  ? 59   LEU A C   1 
ATOM   1192 O O   . LEU A 1 154 ? 0.407   14.989  71.020 1.00 93.47  ? 59   LEU A O   1 
ATOM   1193 C CB  . LEU A 1 154 ? -0.147  16.294  68.680 1.00 90.41  ? 59   LEU A CB  1 
ATOM   1194 C CG  . LEU A 1 154 ? -0.683  16.674  67.306 1.00 94.17  ? 59   LEU A CG  1 
ATOM   1195 C CD1 . LEU A 1 154 ? 0.446   17.001  66.368 1.00 97.54  ? 59   LEU A CD1 1 
ATOM   1196 C CD2 . LEU A 1 154 ? -1.557  15.570  66.725 1.00 93.41  ? 59   LEU A CD2 1 
ATOM   1197 N N   . LYS A 1 155 ? -1.419  15.671  72.173 1.00 86.41  ? 60   LYS A N   1 
ATOM   1198 C CA  . LYS A 1 155 ? -1.062  14.965  73.400 1.00 86.24  ? 60   LYS A CA  1 
ATOM   1199 C C   . LYS A 1 155 ? -1.893  13.682  73.568 1.00 86.46  ? 60   LYS A C   1 
ATOM   1200 O O   . LYS A 1 155 ? -1.510  12.814  74.355 1.00 86.40  ? 60   LYS A O   1 
ATOM   1201 C CB  . LYS A 1 155 ? -1.225  15.891  74.621 1.00 89.83  ? 60   LYS A CB  1 
ATOM   1202 C CG  . LYS A 1 155 ? -0.295  15.559  75.794 1.00 107.38 ? 60   LYS A CG  1 
ATOM   1203 C CD  . LYS A 1 155 ? 1.190   15.786  75.463 1.00 121.76 ? 60   LYS A CD  1 
ATOM   1204 C CE  . LYS A 1 155 ? 2.112   15.251  76.531 1.00 133.72 ? 60   LYS A CE  1 
ATOM   1205 N NZ  . LYS A 1 155 ? 3.537   15.332  76.115 1.00 143.74 ? 60   LYS A NZ  1 
ATOM   1206 N N   . THR A 1 156 ? -2.999  13.543  72.813 1.00 79.92  ? 61   THR A N   1 
ATOM   1207 C CA  . THR A 1 156 ? -3.852  12.352  72.883 1.00 77.12  ? 61   THR A CA  1 
ATOM   1208 C C   . THR A 1 156 ? -3.845  11.580  71.555 1.00 79.90  ? 61   THR A C   1 
ATOM   1209 O O   . THR A 1 156 ? -3.407  12.099  70.525 1.00 80.55  ? 61   THR A O   1 
ATOM   1210 C CB  . THR A 1 156 ? -5.296  12.714  73.273 1.00 82.92  ? 61   THR A CB  1 
ATOM   1211 O OG1 . THR A 1 156 ? -5.841  13.623  72.314 1.00 82.30  ? 61   THR A OG1 1 
ATOM   1212 C CG2 . THR A 1 156 ? -5.408  13.279  74.690 1.00 82.38  ? 61   THR A CG2 1 
ATOM   1213 N N   . VAL A 1 157 ? -4.329  10.325  71.607 1.00 74.04  ? 62   VAL A N   1 
ATOM   1214 C CA  . VAL A 1 157 ? -4.485  9.390   70.489 1.00 72.27  ? 62   VAL A CA  1 
ATOM   1215 C C   . VAL A 1 157 ? -5.549  9.953   69.525 1.00 73.66  ? 62   VAL A C   1 
ATOM   1216 O O   . VAL A 1 157 ? -5.352  9.951   68.307 1.00 73.52  ? 62   VAL A O   1 
ATOM   1217 C CB  . VAL A 1 157 ? -4.871  7.991   71.049 1.00 75.13  ? 62   VAL A CB  1 
ATOM   1218 C CG1 . VAL A 1 157 ? -5.286  7.026   69.948 1.00 74.81  ? 62   VAL A CG1 1 
ATOM   1219 C CG2 . VAL A 1 157 ? -3.744  7.401   71.891 1.00 76.71  ? 62   VAL A CG2 1 
ATOM   1220 N N   . ALA A 1 158 ? -6.656  10.470  70.099 1.00 68.01  ? 63   ALA A N   1 
ATOM   1221 C CA  . ALA A 1 158 ? -7.787  11.062  69.391 1.00 65.82  ? 63   ALA A CA  1 
ATOM   1222 C C   . ALA A 1 158 ? -7.351  12.252  68.538 1.00 68.57  ? 63   ALA A C   1 
ATOM   1223 O O   . ALA A 1 158 ? -7.809  12.375  67.403 1.00 68.17  ? 63   ALA A O   1 
ATOM   1224 C CB  . ALA A 1 158 ? -8.850  11.494  70.388 1.00 65.59  ? 63   ALA A CB  1 
ATOM   1225 N N   . SER A 1 159 ? -6.431  13.089  69.069 1.00 64.29  ? 64   SER A N   1 
ATOM   1226 C CA  . SER A 1 159 ? -5.871  14.279  68.419 1.00 64.36  ? 64   SER A CA  1 
ATOM   1227 C C   . SER A 1 159 ? -5.181  13.942  67.086 1.00 67.26  ? 64   SER A C   1 
ATOM   1228 O O   . SER A 1 159 ? -5.360  14.675  66.109 1.00 66.74  ? 64   SER A O   1 
ATOM   1229 C CB  . SER A 1 159 ? -4.876  14.960  69.353 1.00 69.14  ? 64   SER A CB  1 
ATOM   1230 O OG  . SER A 1 159 ? -4.283  16.089  68.736 1.00 79.43  ? 64   SER A OG  1 
ATOM   1231 N N   . VAL A 1 160 ? -4.402  12.828  67.064 1.00 63.71  ? 65   VAL A N   1 
ATOM   1232 C CA  . VAL A 1 160 ? -3.631  12.316  65.921 1.00 64.44  ? 65   VAL A CA  1 
ATOM   1233 C C   . VAL A 1 160 ? -4.596  11.930  64.780 1.00 67.44  ? 65   VAL A C   1 
ATOM   1234 O O   . VAL A 1 160 ? -4.400  12.382  63.643 1.00 67.47  ? 65   VAL A O   1 
ATOM   1235 C CB  . VAL A 1 160 ? -2.711  11.124  66.329 1.00 69.01  ? 65   VAL A CB  1 
ATOM   1236 C CG1 . VAL A 1 160 ? -1.867  10.629  65.153 1.00 70.09  ? 65   VAL A CG1 1 
ATOM   1237 C CG2 . VAL A 1 160 ? -1.812  11.501  67.503 1.00 70.53  ? 65   VAL A CG2 1 
ATOM   1238 N N   . PHE A 1 161 ? -5.643  11.129  65.088 1.00 62.62  ? 66   PHE A N   1 
ATOM   1239 C CA  . PHE A 1 161 ? -6.633  10.726  64.089 1.00 61.35  ? 66   PHE A CA  1 
ATOM   1240 C C   . PHE A 1 161 ? -7.475  11.931  63.619 1.00 63.73  ? 66   PHE A C   1 
ATOM   1241 O O   . PHE A 1 161 ? -7.791  12.009  62.434 1.00 62.55  ? 66   PHE A O   1 
ATOM   1242 C CB  . PHE A 1 161 ? -7.542  9.610   64.613 1.00 62.23  ? 66   PHE A CB  1 
ATOM   1243 C CG  . PHE A 1 161 ? -6.858  8.301   64.935 1.00 65.22  ? 66   PHE A CG  1 
ATOM   1244 C CD1 . PHE A 1 161 ? -6.359  7.491   63.925 1.00 69.33  ? 66   PHE A CD1 1 
ATOM   1245 C CD2 . PHE A 1 161 ? -6.787  7.839   66.241 1.00 68.00  ? 66   PHE A CD2 1 
ATOM   1246 C CE1 . PHE A 1 161 ? -5.725  6.286   64.223 1.00 71.64  ? 66   PHE A CE1 1 
ATOM   1247 C CE2 . PHE A 1 161 ? -6.180  6.615   66.535 1.00 71.61  ? 66   PHE A CE2 1 
ATOM   1248 C CZ  . PHE A 1 161 ? -5.658  5.847   65.525 1.00 70.82  ? 66   PHE A CZ  1 
ATOM   1249 N N   . LEU A 1 162 ? -7.795  12.884  64.522 1.00 60.42  ? 67   LEU A N   1 
ATOM   1250 C CA  . LEU A 1 162 ? -8.562  14.087  64.171 1.00 59.79  ? 67   LEU A CA  1 
ATOM   1251 C C   . LEU A 1 162 ? -7.752  15.014  63.247 1.00 66.38  ? 67   LEU A C   1 
ATOM   1252 O O   . LEU A 1 162 ? -8.355  15.706  62.418 1.00 66.67  ? 67   LEU A O   1 
ATOM   1253 C CB  . LEU A 1 162 ? -9.032  14.848  65.415 1.00 59.39  ? 67   LEU A CB  1 
ATOM   1254 C CG  . LEU A 1 162 ? -10.200 14.215  66.170 1.00 61.63  ? 67   LEU A CG  1 
ATOM   1255 C CD1 . LEU A 1 162 ? -10.294 14.757  67.582 1.00 61.99  ? 67   LEU A CD1 1 
ATOM   1256 C CD2 . LEU A 1 162 ? -11.511 14.363  65.414 1.00 61.65  ? 67   LEU A CD2 1 
ATOM   1257 N N   . LEU A 1 163 ? -6.397  14.998  63.363 1.00 64.19  ? 68   LEU A N   1 
ATOM   1258 C CA  . LEU A 1 163 ? -5.497  15.758  62.484 1.00 65.69  ? 68   LEU A CA  1 
ATOM   1259 C C   . LEU A 1 163 ? -5.445  15.103  61.089 1.00 67.65  ? 68   LEU A C   1 
ATOM   1260 O O   . LEU A 1 163 ? -5.525  15.818  60.088 1.00 68.16  ? 68   LEU A O   1 
ATOM   1261 C CB  . LEU A 1 163 ? -4.077  15.867  63.086 1.00 68.20  ? 68   LEU A CB  1 
ATOM   1262 C CG  . LEU A 1 163 ? -2.996  16.582  62.235 1.00 75.50  ? 68   LEU A CG  1 
ATOM   1263 C CD1 . LEU A 1 163 ? -3.084  18.102  62.370 1.00 76.94  ? 68   LEU A CD1 1 
ATOM   1264 C CD2 . LEU A 1 163 ? -1.613  16.134  62.639 1.00 80.19  ? 68   LEU A CD2 1 
ATOM   1265 N N   . ASN A 1 164 ? -5.310  13.753  61.031 1.00 61.50  ? 69   ASN A N   1 
ATOM   1266 C CA  . ASN A 1 164 ? -5.234  12.996  59.779 1.00 60.75  ? 69   ASN A CA  1 
ATOM   1267 C C   . ASN A 1 164 ? -6.512  13.135  58.940 1.00 61.95  ? 69   ASN A C   1 
ATOM   1268 O O   . ASN A 1 164 ? -6.405  13.231  57.716 1.00 62.12  ? 69   ASN A O   1 
ATOM   1269 C CB  . ASN A 1 164 ? -4.935  11.530  60.040 1.00 61.64  ? 69   ASN A CB  1 
ATOM   1270 C CG  . ASN A 1 164 ? -3.453  11.238  60.066 1.00 82.41  ? 69   ASN A CG  1 
ATOM   1271 O OD1 . ASN A 1 164 ? -2.888  10.693  59.105 1.00 74.64  ? 69   ASN A OD1 1 
ATOM   1272 N ND2 . ASN A 1 164 ? -2.780  11.629  61.148 1.00 70.85  ? 69   ASN A ND2 1 
ATOM   1273 N N   . LEU A 1 165 ? -7.699  13.199  59.590 1.00 55.95  ? 70   LEU A N   1 
ATOM   1274 C CA  . LEU A 1 165 ? -8.996  13.395  58.929 1.00 53.98  ? 70   LEU A CA  1 
ATOM   1275 C C   . LEU A 1 165 ? -9.039  14.795  58.273 1.00 60.69  ? 70   LEU A C   1 
ATOM   1276 O O   . LEU A 1 165 ? -9.599  14.929  57.182 1.00 59.72  ? 70   LEU A O   1 
ATOM   1277 C CB  . LEU A 1 165 ? -10.163 13.201  59.927 1.00 52.01  ? 70   LEU A CB  1 
ATOM   1278 C CG  . LEU A 1 165 ? -11.605 13.354  59.399 1.00 54.67  ? 70   LEU A CG  1 
ATOM   1279 C CD1 . LEU A 1 165 ? -11.950 12.273  58.385 1.00 54.84  ? 70   LEU A CD1 1 
ATOM   1280 C CD2 . LEU A 1 165 ? -12.596 13.308  60.524 1.00 54.57  ? 70   LEU A CD2 1 
ATOM   1281 N N   . ALA A 1 166 ? -8.409  15.817  58.912 1.00 59.97  ? 71   ALA A N   1 
ATOM   1282 C CA  . ALA A 1 166 ? -8.320  17.169  58.349 1.00 61.83  ? 71   ALA A CA  1 
ATOM   1283 C C   . ALA A 1 166 ? -7.485  17.160  57.066 1.00 67.65  ? 71   ALA A C   1 
ATOM   1284 O O   . ALA A 1 166 ? -7.934  17.697  56.054 1.00 67.01  ? 71   ALA A O   1 
ATOM   1285 C CB  . ALA A 1 166 ? -7.727  18.138  59.361 1.00 64.21  ? 71   ALA A CB  1 
ATOM   1286 N N   . LEU A 1 167 ? -6.310  16.489  57.098 1.00 66.06  ? 72   LEU A N   1 
ATOM   1287 C CA  . LEU A 1 167 ? -5.396  16.359  55.958 1.00 67.97  ? 72   LEU A CA  1 
ATOM   1288 C C   . LEU A 1 167 ? -6.044  15.563  54.819 1.00 71.00  ? 72   LEU A C   1 
ATOM   1289 O O   . LEU A 1 167 ? -5.928  15.969  53.664 1.00 70.49  ? 72   LEU A O   1 
ATOM   1290 C CB  . LEU A 1 167 ? -4.073  15.695  56.379 1.00 69.71  ? 72   LEU A CB  1 
ATOM   1291 C CG  . LEU A 1 167 ? -3.231  16.414  57.437 1.00 76.59  ? 72   LEU A CG  1 
ATOM   1292 C CD1 . LEU A 1 167 ? -2.181  15.494  57.993 1.00 77.76  ? 72   LEU A CD1 1 
ATOM   1293 C CD2 . LEU A 1 167 ? -2.575  17.666  56.877 1.00 82.69  ? 72   LEU A CD2 1 
ATOM   1294 N N   . ALA A 1 168 ? -6.744  14.451  55.143 1.00 67.35  ? 73   ALA A N   1 
ATOM   1295 C CA  . ALA A 1 168 ? -7.453  13.631  54.152 1.00 66.59  ? 73   ALA A CA  1 
ATOM   1296 C C   . ALA A 1 168 ? -8.568  14.455  53.478 1.00 70.27  ? 73   ALA A C   1 
ATOM   1297 O O   . ALA A 1 168 ? -8.653  14.458  52.247 1.00 69.39  ? 73   ALA A O   1 
ATOM   1298 C CB  . ALA A 1 168 ? -8.025  12.379  54.805 1.00 65.94  ? 73   ALA A CB  1 
ATOM   1299 N N   . ASP A 1 169 ? -9.374  15.196  54.285 1.00 67.40  ? 74   ASP A N   1 
ATOM   1300 C CA  . ASP A 1 169 ? -10.440 16.084  53.800 1.00 67.21  ? 74   ASP A CA  1 
ATOM   1301 C C   . ASP A 1 169 ? -9.853  17.231  52.972 1.00 73.07  ? 74   ASP A C   1 
ATOM   1302 O O   . ASP A 1 169 ? -10.429 17.595  51.947 1.00 72.99  ? 74   ASP A O   1 
ATOM   1303 C CB  . ASP A 1 169 ? -11.287 16.649  54.961 1.00 68.50  ? 74   ASP A CB  1 
ATOM   1304 C CG  . ASP A 1 169 ? -12.329 15.711  55.563 1.00 79.17  ? 74   ASP A CG  1 
ATOM   1305 O OD1 . ASP A 1 169 ? -12.248 14.473  55.316 1.00 77.73  ? 74   ASP A OD1 1 
ATOM   1306 O OD2 . ASP A 1 169 ? -13.216 16.206  56.297 1.00 86.94  ? 74   ASP A OD2 1 
ATOM   1307 N N   . LEU A 1 170 ? -8.690  17.766  53.397 1.00 70.83  ? 75   LEU A N   1 
ATOM   1308 C CA  . LEU A 1 170 ? -7.971  18.851  52.725 1.00 72.91  ? 75   LEU A CA  1 
ATOM   1309 C C   . LEU A 1 170 ? -7.458  18.388  51.348 1.00 77.48  ? 75   LEU A C   1 
ATOM   1310 O O   . LEU A 1 170 ? -7.552  19.149  50.390 1.00 78.53  ? 75   LEU A O   1 
ATOM   1311 C CB  . LEU A 1 170 ? -6.805  19.317  53.622 1.00 74.89  ? 75   LEU A CB  1 
ATOM   1312 C CG  . LEU A 1 170 ? -6.389  20.793  53.615 1.00 82.12  ? 75   LEU A CG  1 
ATOM   1313 C CD1 . LEU A 1 170 ? -7.542  21.714  53.982 1.00 81.97  ? 75   LEU A CD1 1 
ATOM   1314 C CD2 . LEU A 1 170 ? -5.266  21.026  54.606 1.00 86.11  ? 75   LEU A CD2 1 
ATOM   1315 N N   . CYS A 1 171 ? -6.974  17.125  51.248 1.00 73.42  ? 76   CYS A N   1 
ATOM   1316 C CA  . CYS A 1 171 ? -6.474  16.500  50.018 1.00 73.90  ? 76   CYS A CA  1 
ATOM   1317 C C   . CYS A 1 171 ? -7.576  16.403  48.971 1.00 75.48  ? 76   CYS A C   1 
ATOM   1318 O O   . CYS A 1 171 ? -7.356  16.826  47.840 1.00 76.31  ? 76   CYS A O   1 
ATOM   1319 C CB  . CYS A 1 171 ? -5.878  15.128  50.308 1.00 74.14  ? 76   CYS A CB  1 
ATOM   1320 S SG  . CYS A 1 171 ? -4.193  15.182  50.956 1.00 80.98  ? 76   CYS A SG  1 
ATOM   1321 N N   . PHE A 1 172 ? -8.752  15.849  49.342 1.00 69.39  ? 77   PHE A N   1 
ATOM   1322 C CA  . PHE A 1 172 ? -9.905  15.729  48.450 1.00 68.24  ? 77   PHE A CA  1 
ATOM   1323 C C   . PHE A 1 172 ? -10.328 17.105  47.944 1.00 75.52  ? 77   PHE A C   1 
ATOM   1324 O O   . PHE A 1 172 ? -10.599 17.252  46.752 1.00 76.52  ? 77   PHE A O   1 
ATOM   1325 C CB  . PHE A 1 172 ? -11.088 15.026  49.146 1.00 67.66  ? 77   PHE A CB  1 
ATOM   1326 C CG  . PHE A 1 172 ? -12.416 15.218  48.446 1.00 68.19  ? 77   PHE A CG  1 
ATOM   1327 C CD1 . PHE A 1 172 ? -12.738 14.478  47.315 1.00 71.14  ? 77   PHE A CD1 1 
ATOM   1328 C CD2 . PHE A 1 172 ? -13.330 16.159  48.901 1.00 69.93  ? 77   PHE A CD2 1 
ATOM   1329 C CE1 . PHE A 1 172 ? -13.952 14.679  46.651 1.00 71.83  ? 77   PHE A CE1 1 
ATOM   1330 C CE2 . PHE A 1 172 ? -14.542 16.360  48.236 1.00 72.69  ? 77   PHE A CE2 1 
ATOM   1331 C CZ  . PHE A 1 172 ? -14.840 15.626  47.111 1.00 70.75  ? 77   PHE A CZ  1 
ATOM   1332 N N   . LEU A 1 173 ? -10.381 18.107  48.848 1.00 73.41  ? 78   LEU A N   1 
ATOM   1333 C CA  . LEU A 1 173 ? -10.769 19.480  48.520 1.00 74.83  ? 78   LEU A CA  1 
ATOM   1334 C C   . LEU A 1 173 ? -9.882  20.066  47.433 1.00 80.46  ? 78   LEU A C   1 
ATOM   1335 O O   . LEU A 1 173 ? -10.412 20.719  46.543 1.00 81.43  ? 78   LEU A O   1 
ATOM   1336 C CB  . LEU A 1 173 ? -10.739 20.390  49.757 1.00 75.69  ? 78   LEU A CB  1 
ATOM   1337 C CG  . LEU A 1 173 ? -11.874 20.213  50.755 1.00 78.52  ? 78   LEU A CG  1 
ATOM   1338 C CD1 . LEU A 1 173 ? -11.515 20.824  52.082 1.00 79.47  ? 78   LEU A CD1 1 
ATOM   1339 C CD2 . LEU A 1 173 ? -13.205 20.747  50.218 1.00 80.60  ? 78   LEU A CD2 1 
ATOM   1340 N N   . LEU A 1 174 ? -8.557  19.779  47.460 1.00 77.33  ? 79   LEU A N   1 
ATOM   1341 C CA  . LEU A 1 174 ? -7.592  20.273  46.467 1.00 79.44  ? 79   LEU A CA  1 
ATOM   1342 C C   . LEU A 1 174 ? -7.953  19.835  45.034 1.00 82.31  ? 79   LEU A C   1 
ATOM   1343 O O   . LEU A 1 174 ? -7.622  20.558  44.099 1.00 84.13  ? 79   LEU A O   1 
ATOM   1344 C CB  . LEU A 1 174 ? -6.153  19.831  46.795 1.00 80.82  ? 79   LEU A CB  1 
ATOM   1345 C CG  . LEU A 1 174 ? -5.535  20.379  48.094 1.00 86.14  ? 79   LEU A CG  1 
ATOM   1346 C CD1 . LEU A 1 174 ? -4.232  19.692  48.404 1.00 87.82  ? 79   LEU A CD1 1 
ATOM   1347 C CD2 . LEU A 1 174 ? -5.335  21.891  48.045 1.00 90.53  ? 79   LEU A CD2 1 
ATOM   1348 N N   . THR A 1 175 ? -8.664  18.701  44.867 1.00 76.26  ? 80   THR A N   1 
ATOM   1349 C CA  . THR A 1 175 ? -9.083  18.204  43.552 1.00 75.91  ? 80   THR A CA  1 
ATOM   1350 C C   . THR A 1 175 ? -10.503 18.649  43.172 1.00 79.08  ? 80   THR A C   1 
ATOM   1351 O O   . THR A 1 175 ? -10.904 18.431  42.029 1.00 79.87  ? 80   THR A O   1 
ATOM   1352 C CB  . THR A 1 175 ? -9.022  16.664  43.480 1.00 85.02  ? 80   THR A CB  1 
ATOM   1353 O OG1 . THR A 1 175 ? -9.793  16.086  44.539 1.00 81.78  ? 80   THR A OG1 1 
ATOM   1354 C CG2 . THR A 1 175 ? -7.601  16.126  43.457 1.00 86.05  ? 80   THR A CG2 1 
ATOM   1355 N N   . LEU A 1 176 ? -11.254 19.264  44.095 1.00 74.12  ? 81   LEU A N   1 
ATOM   1356 C CA  . LEU A 1 176 ? -12.643 19.652  43.849 1.00 73.60  ? 81   LEU A CA  1 
ATOM   1357 C C   . LEU A 1 176 ? -12.821 20.658  42.675 1.00 80.80  ? 81   LEU A C   1 
ATOM   1358 O O   . LEU A 1 176 ? -13.734 20.397  41.885 1.00 80.47  ? 81   LEU A O   1 
ATOM   1359 C CB  . LEU A 1 176 ? -13.299 20.220  45.112 1.00 73.36  ? 81   LEU A CB  1 
ATOM   1360 C CG  . LEU A 1 176 ? -14.827 20.329  45.124 1.00 77.82  ? 81   LEU A CG  1 
ATOM   1361 C CD1 . LEU A 1 176 ? -15.500 18.997  44.777 1.00 76.34  ? 81   LEU A CD1 1 
ATOM   1362 C CD2 . LEU A 1 176 ? -15.296 20.761  46.477 1.00 80.94  ? 81   LEU A CD2 1 
ATOM   1363 N N   . PRO A 1 177 ? -12.015 21.754  42.488 1.00 79.76  ? 82   PRO A N   1 
ATOM   1364 C CA  . PRO A 1 177 ? -12.270 22.668  41.353 1.00 81.19  ? 82   PRO A CA  1 
ATOM   1365 C C   . PRO A 1 177 ? -12.158 21.995  39.978 1.00 84.35  ? 82   PRO A C   1 
ATOM   1366 O O   . PRO A 1 177 ? -12.765 22.485  39.021 1.00 85.21  ? 82   PRO A O   1 
ATOM   1367 C CB  . PRO A 1 177 ? -11.193 23.744  41.514 1.00 85.88  ? 82   PRO A CB  1 
ATOM   1368 C CG  . PRO A 1 177 ? -10.855 23.720  42.964 1.00 90.06  ? 82   PRO A CG  1 
ATOM   1369 C CD  . PRO A 1 177 ? -10.897 22.262  43.312 1.00 82.93  ? 82   PRO A CD  1 
ATOM   1370 N N   . LEU A 1 178 ? -11.409 20.873  39.884 1.00 79.06  ? 83   LEU A N   1 
ATOM   1371 C CA  . LEU A 1 178 ? -11.259 20.087  38.659 1.00 78.37  ? 83   LEU A CA  1 
ATOM   1372 C C   . LEU A 1 178 ? -12.597 19.455  38.272 1.00 80.59  ? 83   LEU A C   1 
ATOM   1373 O O   . LEU A 1 178 ? -13.002 19.572  37.114 1.00 80.94  ? 83   LEU A O   1 
ATOM   1374 C CB  . LEU A 1 178 ? -10.178 19.004  38.833 1.00 77.99  ? 83   LEU A CB  1 
ATOM   1375 C CG  . LEU A 1 178 ? -8.780  19.299  38.272 1.00 85.29  ? 83   LEU A CG  1 
ATOM   1376 C CD1 . LEU A 1 178 ? -8.057  20.389  39.065 1.00 86.39  ? 83   LEU A CD1 1 
ATOM   1377 C CD2 . LEU A 1 178 ? -7.936  18.038  38.267 1.00 87.87  ? 83   LEU A CD2 1 
ATOM   1378 N N   . TRP A 1 179 ? -13.304 18.838  39.256 1.00 75.31  ? 84   TRP A N   1 
ATOM   1379 C CA  . TRP A 1 179 ? -14.612 18.192  39.064 1.00 73.92  ? 84   TRP A CA  1 
ATOM   1380 C C   . TRP A 1 179 ? -15.728 19.226  38.912 1.00 78.02  ? 84   TRP A C   1 
ATOM   1381 O O   . TRP A 1 179 ? -16.758 18.917  38.314 1.00 76.65  ? 84   TRP A O   1 
ATOM   1382 C CB  . TRP A 1 179 ? -14.945 17.216  40.217 1.00 71.02  ? 84   TRP A CB  1 
ATOM   1383 C CG  . TRP A 1 179 ? -13.996 16.057  40.291 1.00 71.60  ? 84   TRP A CG  1 
ATOM   1384 C CD1 . TRP A 1 179 ? -13.015 15.860  41.220 1.00 74.22  ? 84   TRP A CD1 1 
ATOM   1385 C CD2 . TRP A 1 179 ? -13.839 15.016  39.314 1.00 71.73  ? 84   TRP A CD2 1 
ATOM   1386 N NE1 . TRP A 1 179 ? -12.275 14.745  40.899 1.00 73.83  ? 84   TRP A NE1 1 
ATOM   1387 C CE2 . TRP A 1 179 ? -12.766 14.202  39.737 1.00 75.77  ? 84   TRP A CE2 1 
ATOM   1388 C CE3 . TRP A 1 179 ? -14.509 14.686  38.121 1.00 73.34  ? 84   TRP A CE3 1 
ATOM   1389 C CZ2 . TRP A 1 179 ? -12.353 13.074  39.015 1.00 75.52  ? 84   TRP A CZ2 1 
ATOM   1390 C CZ3 . TRP A 1 179 ? -14.089 13.579  37.402 1.00 75.01  ? 84   TRP A CZ3 1 
ATOM   1391 C CH2 . TRP A 1 179 ? -13.010 12.800  37.837 1.00 75.65  ? 84   TRP A CH2 1 
ATOM   1392 N N   . ALA A 1 180 ? -15.514 20.450  39.432 1.00 76.59  ? 85   ALA A N   1 
ATOM   1393 C CA  . ALA A 1 180 ? -16.471 21.552  39.348 1.00 77.80  ? 85   ALA A CA  1 
ATOM   1394 C C   . ALA A 1 180 ? -16.582 22.066  37.915 1.00 82.20  ? 85   ALA A C   1 
ATOM   1395 O O   . ALA A 1 180 ? -17.701 22.172  37.415 1.00 82.30  ? 85   ALA A O   1 
ATOM   1396 C CB  . ALA A 1 180 ? -16.071 22.682  40.289 1.00 79.84  ? 85   ALA A CB  1 
ATOM   1397 N N   . VAL A 1 181 ? -15.439 22.354  37.246 1.00 79.31  ? 86   VAL A N   1 
ATOM   1398 C CA  . VAL A 1 181 ? -15.453 22.841  35.859 1.00 81.23  ? 86   VAL A CA  1 
ATOM   1399 C C   . VAL A 1 181 ? -15.866 21.704  34.913 1.00 83.36  ? 86   VAL A C   1 
ATOM   1400 O O   . VAL A 1 181 ? -16.574 21.983  33.953 1.00 83.80  ? 86   VAL A O   1 
ATOM   1401 C CB  . VAL A 1 181 ? -14.154 23.532  35.362 1.00 87.52  ? 86   VAL A CB  1 
ATOM   1402 C CG1 . VAL A 1 181 ? -14.009 24.928  35.958 1.00 89.56  ? 86   VAL A CG1 1 
ATOM   1403 C CG2 . VAL A 1 181 ? -12.914 22.694  35.626 1.00 86.40  ? 86   VAL A CG2 1 
ATOM   1404 N N   . TYR A 1 182 ? -15.471 20.439  35.201 1.00 77.94  ? 87   TYR A N   1 
ATOM   1405 C CA  . TYR A 1 182 ? -15.854 19.259  34.416 1.00 77.00  ? 87   TYR A CA  1 
ATOM   1406 C C   . TYR A 1 182 ? -17.376 19.233  34.231 1.00 81.29  ? 87   TYR A C   1 
ATOM   1407 O O   . TYR A 1 182 ? -17.847 19.126  33.100 1.00 82.11  ? 87   TYR A O   1 
ATOM   1408 C CB  . TYR A 1 182 ? -15.356 17.967  35.096 1.00 76.78  ? 87   TYR A CB  1 
ATOM   1409 C CG  . TYR A 1 182 ? -15.804 16.671  34.441 1.00 78.28  ? 87   TYR A CG  1 
ATOM   1410 C CD1 . TYR A 1 182 ? -15.253 16.248  33.235 1.00 81.47  ? 87   TYR A CD1 1 
ATOM   1411 C CD2 . TYR A 1 182 ? -16.716 15.828  35.071 1.00 77.48  ? 87   TYR A CD2 1 
ATOM   1412 C CE1 . TYR A 1 182 ? -15.632 15.043  32.648 1.00 82.35  ? 87   TYR A CE1 1 
ATOM   1413 C CE2 . TYR A 1 182 ? -17.109 14.624  34.490 1.00 77.84  ? 87   TYR A CE2 1 
ATOM   1414 C CZ  . TYR A 1 182 ? -16.560 14.233  33.280 1.00 87.72  ? 87   TYR A CZ  1 
ATOM   1415 O OH  . TYR A 1 182 ? -16.929 13.046  32.697 1.00 90.54  ? 87   TYR A OH  1 
ATOM   1416 N N   . THR A 1 183 ? -18.129 19.425  35.332 1.00 77.14  ? 88   THR A N   1 
ATOM   1417 C CA  . THR A 1 183 ? -19.593 19.462  35.364 1.00 77.01  ? 88   THR A CA  1 
ATOM   1418 C C   . THR A 1 183 ? -20.125 20.731  34.693 1.00 82.39  ? 88   THR A C   1 
ATOM   1419 O O   . THR A 1 183 ? -21.165 20.674  34.042 1.00 82.46  ? 88   THR A O   1 
ATOM   1420 C CB  . THR A 1 183 ? -20.091 19.378  36.810 1.00 85.16  ? 88   THR A CB  1 
ATOM   1421 O OG1 . THR A 1 183 ? -19.242 18.510  37.558 1.00 83.98  ? 88   THR A OG1 1 
ATOM   1422 C CG2 . THR A 1 183 ? -21.539 18.914  36.908 1.00 84.85  ? 88   THR A CG2 1 
ATOM   1423 N N   . ALA A 1 184 ? -19.426 21.870  34.872 1.00 80.38  ? 89   ALA A N   1 
ATOM   1424 C CA  . ALA A 1 184 ? -19.800 23.172  34.313 1.00 82.98  ? 89   ALA A CA  1 
ATOM   1425 C C   . ALA A 1 184 ? -19.619 23.204  32.783 1.00 90.30  ? 89   ALA A C   1 
ATOM   1426 O O   . ALA A 1 184 ? -20.348 23.923  32.094 1.00 92.53  ? 89   ALA A O   1 
ATOM   1427 C CB  . ALA A 1 184 ? -18.971 24.268  34.958 1.00 84.74  ? 89   ALA A CB  1 
ATOM   1428 N N   . MET A 1 185 ? -18.662 22.407  32.261 1.00 86.30  ? 90   MET A N   1 
ATOM   1429 C CA  . MET A 1 185 ? -18.351 22.285  30.834 1.00 87.18  ? 90   MET A CA  1 
ATOM   1430 C C   . MET A 1 185 ? -19.207 21.181  30.174 1.00 88.40  ? 90   MET A C   1 
ATOM   1431 O O   . MET A 1 185 ? -18.965 20.822  29.017 1.00 87.82  ? 90   MET A O   1 
ATOM   1432 C CB  . MET A 1 185 ? -16.852 22.005  30.628 1.00 89.72  ? 90   MET A CB  1 
ATOM   1433 C CG  . MET A 1 185 ? -15.968 23.193  30.953 1.00 95.41  ? 90   MET A CG  1 
ATOM   1434 S SD  . MET A 1 185 ? -14.224 22.897  30.585 1.00 100.58 ? 90   MET A SD  1 
ATOM   1435 C CE  . MET A 1 185 ? -14.233 23.029  28.793 1.00 99.20  ? 90   MET A CE  1 
ATOM   1436 N N   . GLU A 1 186 ? -20.227 20.679  30.915 1.00 83.13  ? 91   GLU A N   1 
ATOM   1437 C CA  . GLU A 1 186 ? -21.211 19.658  30.529 1.00 81.91  ? 91   GLU A CA  1 
ATOM   1438 C C   . GLU A 1 186 ? -20.501 18.294  30.316 1.00 82.52  ? 91   GLU A C   1 
ATOM   1439 O O   . GLU A 1 186 ? -20.620 17.661  29.266 1.00 82.53  ? 91   GLU A O   1 
ATOM   1440 C CB  . GLU A 1 186 ? -22.038 20.101  29.293 1.00 85.40  ? 91   GLU A CB  1 
ATOM   1441 C CG  . GLU A 1 186 ? -22.768 21.425  29.503 1.00 98.27  ? 91   GLU A CG  1 
ATOM   1442 C CD  . GLU A 1 186 ? -23.597 21.997  28.365 1.00 123.17 ? 91   GLU A CD  1 
ATOM   1443 O OE1 . GLU A 1 186 ? -23.455 21.528  27.212 1.00 117.85 ? 91   GLU A OE1 1 
ATOM   1444 O OE2 . GLU A 1 186 ? -24.367 22.951  28.628 1.00 118.40 ? 91   GLU A OE2 1 
ATOM   1445 N N   . TYR A 1 187 ? -19.784 17.852  31.366 1.00 76.52  ? 92   TYR A N   1 
ATOM   1446 C CA  . TYR A 1 187 ? -18.999 16.612  31.489 1.00 74.44  ? 92   TYR A CA  1 
ATOM   1447 C C   . TYR A 1 187 ? -17.887 16.541  30.401 1.00 79.88  ? 92   TYR A C   1 
ATOM   1448 O O   . TYR A 1 187 ? -17.705 15.509  29.755 1.00 78.85  ? 92   TYR A O   1 
ATOM   1449 C CB  . TYR A 1 187 ? -19.881 15.342  31.488 1.00 73.83  ? 92   TYR A CB  1 
ATOM   1450 C CG  . TYR A 1 187 ? -20.962 15.337  32.551 1.00 73.08  ? 92   TYR A CG  1 
ATOM   1451 C CD1 . TYR A 1 187 ? -20.639 15.308  33.907 1.00 72.83  ? 92   TYR A CD1 1 
ATOM   1452 C CD2 . TYR A 1 187 ? -22.309 15.313  32.201 1.00 74.57  ? 92   TYR A CD2 1 
ATOM   1453 C CE1 . TYR A 1 187 ? -21.631 15.312  34.887 1.00 71.51  ? 92   TYR A CE1 1 
ATOM   1454 C CE2 . TYR A 1 187 ? -23.309 15.305  33.173 1.00 74.90  ? 92   TYR A CE2 1 
ATOM   1455 C CZ  . TYR A 1 187 ? -22.966 15.309  34.514 1.00 77.43  ? 92   TYR A CZ  1 
ATOM   1456 O OH  . TYR A 1 187 ? -23.957 15.285  35.464 1.00 75.60  ? 92   TYR A OH  1 
ATOM   1457 N N   . ARG A 1 188 ? -17.114 17.642  30.249 1.00 78.75  ? 93   ARG A N   1 
ATOM   1458 C CA  . ARG A 1 188 ? -15.952 17.705  29.349 1.00 80.26  ? 93   ARG A CA  1 
ATOM   1459 C C   . ARG A 1 188 ? -14.699 17.891  30.204 1.00 84.92  ? 93   ARG A C   1 
ATOM   1460 O O   . ARG A 1 188 ? -14.623 18.837  30.995 1.00 85.16  ? 93   ARG A O   1 
ATOM   1461 C CB  . ARG A 1 188 ? -16.078 18.792  28.272 1.00 82.39  ? 93   ARG A CB  1 
ATOM   1462 C CG  . ARG A 1 188 ? -17.113 18.491  27.195 1.00 94.66  ? 93   ARG A CG  1 
ATOM   1463 C CD  . ARG A 1 188 ? -16.868 19.293  25.923 1.00 112.15 ? 93   ARG A CD  1 
ATOM   1464 N NE  . ARG A 1 188 ? -15.675 18.823  25.214 1.00 127.50 ? 93   ARG A NE  1 
ATOM   1465 C CZ  . ARG A 1 188 ? -15.226 19.328  24.070 1.00 147.79 ? 93   ARG A CZ  1 
ATOM   1466 N NH1 . ARG A 1 188 ? -15.864 20.333  23.483 1.00 138.47 ? 93   ARG A NH1 1 
ATOM   1467 N NH2 . ARG A 1 188 ? -14.137 18.829  23.502 1.00 137.37 ? 93   ARG A NH2 1 
ATOM   1468 N N   . TRP A 1 189 ? -13.759 16.928  30.100 1.00 81.27  ? 94   TRP A N   1 
ATOM   1469 C CA  . TRP A 1 189 ? -12.514 16.867  30.872 1.00 80.78  ? 94   TRP A CA  1 
ATOM   1470 C C   . TRP A 1 189 ? -11.345 17.467  30.070 1.00 85.98  ? 94   TRP A C   1 
ATOM   1471 O O   . TRP A 1 189 ? -10.817 16.813  29.157 1.00 85.80  ? 94   TRP A O   1 
ATOM   1472 C CB  . TRP A 1 189 ? -12.209 15.410  31.281 1.00 78.08  ? 94   TRP A CB  1 
ATOM   1473 C CG  . TRP A 1 189 ? -11.038 15.269  32.200 1.00 79.16  ? 94   TRP A CG  1 
ATOM   1474 C CD1 . TRP A 1 189 ? -9.747  15.020  31.847 1.00 83.39  ? 94   TRP A CD1 1 
ATOM   1475 C CD2 . TRP A 1 189 ? -11.038 15.457  33.621 1.00 78.16  ? 94   TRP A CD2 1 
ATOM   1476 N NE1 . TRP A 1 189 ? -8.944  15.016  32.960 1.00 83.11  ? 94   TRP A NE1 1 
ATOM   1477 C CE2 . TRP A 1 189 ? -9.714  15.266  34.068 1.00 83.17  ? 94   TRP A CE2 1 
ATOM   1478 C CE3 . TRP A 1 189 ? -12.034 15.745  34.568 1.00 77.99  ? 94   TRP A CE3 1 
ATOM   1479 C CZ2 . TRP A 1 189 ? -9.357  15.377  35.422 1.00 81.94  ? 94   TRP A CZ2 1 
ATOM   1480 C CZ3 . TRP A 1 189 ? -11.681 15.829  35.907 1.00 79.01  ? 94   TRP A CZ3 1 
ATOM   1481 C CH2 . TRP A 1 189 ? -10.359 15.637  36.322 1.00 80.57  ? 94   TRP A CH2 1 
ATOM   1482 N N   . PRO A 1 190 ? -10.895 18.690  30.427 1.00 83.66  ? 95   PRO A N   1 
ATOM   1483 C CA  . PRO A 1 190 ? -9.791  19.303  29.683 1.00 86.10  ? 95   PRO A CA  1 
ATOM   1484 C C   . PRO A 1 190 ? -8.406  19.173  30.357 1.00 91.54  ? 95   PRO A C   1 
ATOM   1485 O O   . PRO A 1 190 ? -7.489  19.893  29.958 1.00 93.80  ? 95   PRO A O   1 
ATOM   1486 C CB  . PRO A 1 190 ? -10.218 20.767  29.644 1.00 89.27  ? 95   PRO A CB  1 
ATOM   1487 C CG  . PRO A 1 190 ? -11.065 20.964  30.894 1.00 91.78  ? 95   PRO A CG  1 
ATOM   1488 C CD  . PRO A 1 190 ? -11.425 19.623  31.442 1.00 84.80  ? 95   PRO A CD  1 
ATOM   1489 N N   . PHE A 1 191 ? -8.239  18.269  31.347 1.00 86.73  ? 96   PHE A N   1 
ATOM   1490 C CA  . PHE A 1 191 ? -6.987  18.133  32.105 1.00 87.49  ? 96   PHE A CA  1 
ATOM   1491 C C   . PHE A 1 191 ? -6.134  16.891  31.715 1.00 91.20  ? 96   PHE A C   1 
ATOM   1492 O O   . PHE A 1 191 ? -5.106  16.633  32.354 1.00 91.60  ? 96   PHE A O   1 
ATOM   1493 C CB  . PHE A 1 191 ? -7.313  18.070  33.609 1.00 87.62  ? 96   PHE A CB  1 
ATOM   1494 C CG  . PHE A 1 191 ? -8.279  19.132  34.084 1.00 88.62  ? 96   PHE A CG  1 
ATOM   1495 C CD1 . PHE A 1 191 ? -7.890  20.471  34.152 1.00 93.10  ? 96   PHE A CD1 1 
ATOM   1496 C CD2 . PHE A 1 191 ? -9.579  18.797  34.465 1.00 88.81  ? 96   PHE A CD2 1 
ATOM   1497 C CE1 . PHE A 1 191 ? -8.785  21.455  34.571 1.00 93.35  ? 96   PHE A CE1 1 
ATOM   1498 C CE2 . PHE A 1 191 ? -10.474 19.781  34.890 1.00 91.24  ? 96   PHE A CE2 1 
ATOM   1499 C CZ  . PHE A 1 191 ? -10.068 21.103  34.938 1.00 90.70  ? 96   PHE A CZ  1 
ATOM   1500 N N   . GLY A 1 192 ? -6.539  16.161  30.679 1.00 86.66  ? 97   GLY A N   1 
ATOM   1501 C CA  . GLY A 1 192 ? -5.801  14.987  30.228 1.00 87.41  ? 97   GLY A CA  1 
ATOM   1502 C C   . GLY A 1 192 ? -6.033  13.707  31.012 1.00 90.27  ? 97   GLY A C   1 
ATOM   1503 O O   . GLY A 1 192 ? -6.979  13.604  31.798 1.00 88.07  ? 97   GLY A O   1 
ATOM   1504 N N   . ASN A 1 193 ? -5.151  12.717  30.791 1.00 87.65  ? 98   ASN A N   1 
ATOM   1505 C CA  . ASN A 1 193 ? -5.218  11.371  31.353 1.00 85.85  ? 98   ASN A CA  1 
ATOM   1506 C C   . ASN A 1 193 ? -4.612  11.258  32.752 1.00 88.06  ? 98   ASN A C   1 
ATOM   1507 O O   . ASN A 1 193 ? -5.140  10.488  33.551 1.00 85.18  ? 98   ASN A O   1 
ATOM   1508 C CB  . ASN A 1 193 ? -4.492  10.405  30.420 1.00 89.13  ? 98   ASN A CB  1 
ATOM   1509 C CG  . ASN A 1 193 ? -4.939  8.973   30.545 1.00 109.04 ? 98   ASN A CG  1 
ATOM   1510 O OD1 . ASN A 1 193 ? -6.131  8.677   30.645 1.00 101.04 ? 98   ASN A OD1 1 
ATOM   1511 N ND2 . ASN A 1 193 ? -3.994  8.049   30.475 1.00 101.58 ? 98   ASN A ND2 1 
ATOM   1512 N N   . TYR A 1 194 ? -3.490  11.966  33.033 1.00 86.86  ? 99   TYR A N   1 
ATOM   1513 C CA  . TYR A 1 194 ? -2.790  11.929  34.331 1.00 87.08  ? 99   TYR A CA  1 
ATOM   1514 C C   . TYR A 1 194 ? -3.668  12.453  35.457 1.00 87.56  ? 99   TYR A C   1 
ATOM   1515 O O   . TYR A 1 194 ? -3.746  11.824  36.509 1.00 85.80  ? 99   TYR A O   1 
ATOM   1516 C CB  . TYR A 1 194 ? -1.485  12.747  34.297 1.00 92.14  ? 99   TYR A CB  1 
ATOM   1517 C CG  . TYR A 1 194 ? -0.242  11.960  33.936 1.00 98.26  ? 99   TYR A CG  1 
ATOM   1518 C CD1 . TYR A 1 194 ? 0.530   11.345  34.920 1.00 101.36 ? 99   TYR A CD1 1 
ATOM   1519 C CD2 . TYR A 1 194 ? 0.207   11.893  32.620 1.00 101.67 ? 99   TYR A CD2 1 
ATOM   1520 C CE1 . TYR A 1 194 ? 1.697   10.650  34.596 1.00 105.52 ? 99   TYR A CE1 1 
ATOM   1521 C CE2 . TYR A 1 194 ? 1.367   11.195  32.284 1.00 105.79 ? 99   TYR A CE2 1 
ATOM   1522 C CZ  . TYR A 1 194 ? 2.110   10.576  33.275 1.00 113.55 ? 99   TYR A CZ  1 
ATOM   1523 O OH  . TYR A 1 194 ? 3.256   9.895   32.938 1.00 117.58 ? 99   TYR A OH  1 
ATOM   1524 N N   . LEU A 1 195 ? -4.323  13.604  35.236 1.00 82.86  ? 100  LEU A N   1 
ATOM   1525 C CA  . LEU A 1 195 ? -5.194  14.223  36.224 1.00 79.78  ? 100  LEU A CA  1 
ATOM   1526 C C   . LEU A 1 195 ? -6.549  13.533  36.271 1.00 80.16  ? 100  LEU A C   1 
ATOM   1527 O O   . LEU A 1 195 ? -7.224  13.654  37.284 1.00 78.24  ? 100  LEU A O   1 
ATOM   1528 C CB  . LEU A 1 195 ? -5.362  15.727  35.967 1.00 80.63  ? 100  LEU A CB  1 
ATOM   1529 C CG  . LEU A 1 195 ? -4.132  16.592  36.265 1.00 87.90  ? 100  LEU A CG  1 
ATOM   1530 C CD1 . LEU A 1 195 ? -4.299  17.978  35.710 1.00 89.25  ? 100  LEU A CD1 1 
ATOM   1531 C CD2 . LEU A 1 195 ? -3.820  16.651  37.757 1.00 89.39  ? 100  LEU A CD2 1 
ATOM   1532 N N   . CYS A 1 196 ? -6.950  12.800  35.211 1.00 76.51  ? 101  CYS A N   1 
ATOM   1533 C CA  . CYS A 1 196 ? -8.200  12.035  35.223 1.00 74.54  ? 101  CYS A CA  1 
ATOM   1534 C C   . CYS A 1 196 ? -8.054  10.902  36.230 1.00 77.46  ? 101  CYS A C   1 
ATOM   1535 O O   . CYS A 1 196 ? -8.970  10.660  37.015 1.00 75.21  ? 101  CYS A O   1 
ATOM   1536 C CB  . CYS A 1 196 ? -8.563  11.518  33.832 1.00 75.98  ? 101  CYS A CB  1 
ATOM   1537 S SG  . CYS A 1 196 ? -9.939  10.331  33.798 1.00 78.63  ? 101  CYS A SG  1 
ATOM   1538 N N   . LYS A 1 197 ? -6.863  10.275  36.256 1.00 75.22  ? 102  LYS A N   1 
ATOM   1539 C CA  . LYS A 1 197 ? -6.518  9.176   37.152 1.00 74.66  ? 102  LYS A CA  1 
ATOM   1540 C C   . LYS A 1 197 ? -6.334  9.666   38.597 1.00 78.05  ? 102  LYS A C   1 
ATOM   1541 O O   . LYS A 1 197 ? -6.993  9.127   39.487 1.00 76.00  ? 102  LYS A O   1 
ATOM   1542 C CB  . LYS A 1 197 ? -5.255  8.456   36.667 1.00 78.69  ? 102  LYS A CB  1 
ATOM   1543 C CG  . LYS A 1 197 ? -5.462  7.703   35.371 1.00 81.51  ? 102  LYS A CG  1 
ATOM   1544 C CD  . LYS A 1 197 ? -4.156  7.182   34.815 1.00 87.66  ? 102  LYS A CD  1 
ATOM   1545 C CE  . LYS A 1 197 ? -4.382  6.277   33.636 1.00 96.38  ? 102  LYS A CE  1 
ATOM   1546 N NZ  . LYS A 1 197 ? -5.186  5.073   33.990 1.00 102.64 ? 102  LYS A NZ  1 
ATOM   1547 N N   . ILE A 1 198 ? -5.469  10.684  38.826 1.00 76.09  ? 103  ILE A N   1 
ATOM   1548 C CA  . ILE A 1 198 ? -5.181  11.226  40.162 1.00 75.86  ? 103  ILE A CA  1 
ATOM   1549 C C   . ILE A 1 198 ? -6.457  11.841  40.771 1.00 76.96  ? 103  ILE A C   1 
ATOM   1550 O O   . ILE A 1 198 ? -6.764  11.532  41.921 1.00 74.60  ? 103  ILE A O   1 
ATOM   1551 C CB  . ILE A 1 198 ? -3.995  12.238  40.160 1.00 81.76  ? 103  ILE A CB  1 
ATOM   1552 C CG1 . ILE A 1 198 ? -2.696  11.564  39.657 1.00 85.49  ? 103  ILE A CG1 1 
ATOM   1553 C CG2 . ILE A 1 198 ? -3.765  12.830  41.561 1.00 82.55  ? 103  ILE A CG2 1 
ATOM   1554 C CD1 . ILE A 1 198 ? -1.607  12.536  39.082 1.00 99.21  ? 103  ILE A CD1 1 
ATOM   1555 N N   . ALA A 1 199 ? -7.213  12.655  40.004 1.00 74.03  ? 104  ALA A N   1 
ATOM   1556 C CA  . ALA A 1 199 ? -8.443  13.287  40.498 1.00 72.86  ? 104  ALA A CA  1 
ATOM   1557 C C   . ALA A 1 199 ? -9.531  12.265  40.844 1.00 76.21  ? 104  ALA A C   1 
ATOM   1558 O O   . ALA A 1 199 ? -10.340 12.541  41.724 1.00 75.33  ? 104  ALA A O   1 
ATOM   1559 C CB  . ALA A 1 199 ? -8.983  14.275  39.484 1.00 74.21  ? 104  ALA A CB  1 
ATOM   1560 N N   . SER A 1 200 ? -9.566  11.112  40.161 1.00 73.23  ? 105  SER A N   1 
ATOM   1561 C CA  . SER A 1 200 ? -10.556 10.073  40.443 1.00 72.30  ? 105  SER A CA  1 
ATOM   1562 C C   . SER A 1 200 ? -10.114 9.223   41.640 1.00 77.62  ? 105  SER A C   1 
ATOM   1563 O O   . SER A 1 200 ? -10.954 8.783   42.430 1.00 75.77  ? 105  SER A O   1 
ATOM   1564 C CB  . SER A 1 200 ? -10.784 9.191   39.221 1.00 76.61  ? 105  SER A CB  1 
ATOM   1565 O OG  . SER A 1 200 ? -11.210 9.953   38.102 1.00 84.49  ? 105  SER A OG  1 
ATOM   1566 N N   . ALA A 1 201 ? -8.789  9.006   41.776 1.00 76.58  ? 106  ALA A N   1 
ATOM   1567 C CA  . ALA A 1 201 ? -8.197  8.245   42.877 1.00 76.49  ? 106  ALA A CA  1 
ATOM   1568 C C   . ALA A 1 201 ? -8.288  9.019   44.186 1.00 78.73  ? 106  ALA A C   1 
ATOM   1569 O O   . ALA A 1 201 ? -8.389  8.394   45.236 1.00 78.55  ? 106  ALA A O   1 
ATOM   1570 C CB  . ALA A 1 201 ? -6.748  7.912   42.570 1.00 79.46  ? 106  ALA A CB  1 
ATOM   1571 N N   . SER A 1 202 ? -8.256  10.369  44.119 1.00 73.88  ? 107  SER A N   1 
ATOM   1572 C CA  . SER A 1 202 ? -8.342  11.280  45.260 1.00 72.61  ? 107  SER A CA  1 
ATOM   1573 C C   . SER A 1 202 ? -9.757  11.278  45.872 1.00 74.47  ? 107  SER A C   1 
ATOM   1574 O O   . SER A 1 202 ? -9.902  11.475  47.086 1.00 72.88  ? 107  SER A O   1 
ATOM   1575 C CB  . SER A 1 202 ? -7.957  12.689  44.830 1.00 77.06  ? 107  SER A CB  1 
ATOM   1576 O OG  . SER A 1 202 ? -8.088  13.626  45.886 1.00 86.89  ? 107  SER A OG  1 
ATOM   1577 N N   . VAL A 1 203 ? -10.792 11.070  45.024 1.00 69.96  ? 108  VAL A N   1 
ATOM   1578 C CA  . VAL A 1 203 ? -12.205 11.007  45.428 1.00 67.96  ? 108  VAL A CA  1 
ATOM   1579 C C   . VAL A 1 203 ? -12.448 9.650   46.110 1.00 70.55  ? 108  VAL A C   1 
ATOM   1580 O O   . VAL A 1 203 ? -13.138 9.586   47.124 1.00 69.08  ? 108  VAL A O   1 
ATOM   1581 C CB  . VAL A 1 203 ? -13.152 11.258  44.215 1.00 71.64  ? 108  VAL A CB  1 
ATOM   1582 C CG1 . VAL A 1 203 ? -14.618 10.985  44.555 1.00 70.36  ? 108  VAL A CG1 1 
ATOM   1583 C CG2 . VAL A 1 203 ? -12.987 12.679  43.678 1.00 72.09  ? 108  VAL A CG2 1 
ATOM   1584 N N   . SER A 1 204 ? -11.848 8.583   45.570 1.00 68.35  ? 109  SER A N   1 
ATOM   1585 C CA  . SER A 1 204 ? -11.936 7.226   46.106 1.00 68.54  ? 109  SER A CA  1 
ATOM   1586 C C   . SER A 1 204 ? -11.210 7.138   47.463 1.00 72.74  ? 109  SER A C   1 
ATOM   1587 O O   . SER A 1 204 ? -11.793 6.634   48.428 1.00 72.18  ? 109  SER A O   1 
ATOM   1588 C CB  . SER A 1 204 ? -11.350 6.230   45.109 1.00 73.46  ? 109  SER A CB  1 
ATOM   1589 O OG  . SER A 1 204 ? -11.357 4.909   45.623 1.00 85.33  ? 109  SER A OG  1 
ATOM   1590 N N   . PHE A 1 205 ? -9.961  7.674   47.536 1.00 69.21  ? 110  PHE A N   1 
ATOM   1591 C CA  . PHE A 1 205 ? -9.075  7.710   48.712 1.00 68.75  ? 110  PHE A CA  1 
ATOM   1592 C C   . PHE A 1 205 ? -9.749  8.381   49.930 1.00 69.84  ? 110  PHE A C   1 
ATOM   1593 O O   . PHE A 1 205 ? -9.547  7.935   51.061 1.00 68.16  ? 110  PHE A O   1 
ATOM   1594 C CB  . PHE A 1 205 ? -7.766  8.452   48.361 1.00 71.89  ? 110  PHE A CB  1 
ATOM   1595 C CG  . PHE A 1 205 ? -6.852  8.762   49.522 1.00 74.25  ? 110  PHE A CG  1 
ATOM   1596 C CD1 . PHE A 1 205 ? -5.902  7.839   49.945 1.00 79.15  ? 110  PHE A CD1 1 
ATOM   1597 C CD2 . PHE A 1 205 ? -6.940  9.979   50.192 1.00 75.90  ? 110  PHE A CD2 1 
ATOM   1598 C CE1 . PHE A 1 205 ? -5.069  8.119   51.031 1.00 80.80  ? 110  PHE A CE1 1 
ATOM   1599 C CE2 . PHE A 1 205 ? -6.111  10.257  51.280 1.00 79.55  ? 110  PHE A CE2 1 
ATOM   1600 C CZ  . PHE A 1 205 ? -5.182  9.325   51.691 1.00 79.10  ? 110  PHE A CZ  1 
ATOM   1601 N N   . ASN A 1 206 ? -10.510 9.459   49.691 1.00 66.00  ? 111  ASN A N   1 
ATOM   1602 C CA  . ASN A 1 206 ? -11.211 10.222  50.718 1.00 65.14  ? 111  ASN A CA  1 
ATOM   1603 C C   . ASN A 1 206 ? -12.226 9.353   51.450 1.00 69.82  ? 111  ASN A C   1 
ATOM   1604 O O   . ASN A 1 206 ? -12.363 9.498   52.663 1.00 69.23  ? 111  ASN A O   1 
ATOM   1605 C CB  . ASN A 1 206 ? -11.907 11.441  50.104 1.00 63.68  ? 111  ASN A CB  1 
ATOM   1606 C CG  . ASN A 1 206 ? -12.589 12.328  51.109 1.00 74.43  ? 111  ASN A CG  1 
ATOM   1607 O OD1 . ASN A 1 206 ? -13.821 12.363  51.214 1.00 66.05  ? 111  ASN A OD1 1 
ATOM   1608 N ND2 . ASN A 1 206 ? -11.802 13.046  51.883 1.00 65.65  ? 111  ASN A ND2 1 
ATOM   1609 N N   . LEU A 1 207 ? -12.927 8.460   50.725 1.00 67.25  ? 112  LEU A N   1 
ATOM   1610 C CA  . LEU A 1 207 ? -13.924 7.570   51.314 1.00 67.23  ? 112  LEU A CA  1 
ATOM   1611 C C   . LEU A 1 207 ? -13.262 6.515   52.203 1.00 73.72  ? 112  LEU A C   1 
ATOM   1612 O O   . LEU A 1 207 ? -13.717 6.319   53.327 1.00 73.74  ? 112  LEU A O   1 
ATOM   1613 C CB  . LEU A 1 207 ? -14.786 6.888   50.225 1.00 67.63  ? 112  LEU A CB  1 
ATOM   1614 C CG  . LEU A 1 207 ? -15.666 5.693   50.650 1.00 71.81  ? 112  LEU A CG  1 
ATOM   1615 C CD1 . LEU A 1 207 ? -16.770 6.100   51.623 1.00 70.28  ? 112  LEU A CD1 1 
ATOM   1616 C CD2 . LEU A 1 207 ? -16.247 4.995   49.446 1.00 75.33  ? 112  LEU A CD2 1 
ATOM   1617 N N   . TYR A 1 208 ? -12.211 5.839   51.709 1.00 72.10  ? 113  TYR A N   1 
ATOM   1618 C CA  . TYR A 1 208 ? -11.551 4.771   52.455 1.00 73.06  ? 113  TYR A CA  1 
ATOM   1619 C C   . TYR A 1 208 ? -10.831 5.305   53.709 1.00 73.96  ? 113  TYR A C   1 
ATOM   1620 O O   . TYR A 1 208 ? -11.104 4.798   54.803 1.00 72.43  ? 113  TYR A O   1 
ATOM   1621 C CB  . TYR A 1 208 ? -10.590 3.991   51.550 1.00 76.66  ? 113  TYR A CB  1 
ATOM   1622 C CG  . TYR A 1 208 ? -11.330 3.133   50.550 1.00 80.32  ? 113  TYR A CG  1 
ATOM   1623 C CD1 . TYR A 1 208 ? -11.882 1.912   50.925 1.00 83.74  ? 113  TYR A CD1 1 
ATOM   1624 C CD2 . TYR A 1 208 ? -11.500 3.550   49.233 1.00 81.39  ? 113  TYR A CD2 1 
ATOM   1625 C CE1 . TYR A 1 208 ? -12.574 1.119   50.010 1.00 86.58  ? 113  TYR A CE1 1 
ATOM   1626 C CE2 . TYR A 1 208 ? -12.191 2.765   48.308 1.00 83.29  ? 113  TYR A CE2 1 
ATOM   1627 C CZ  . TYR A 1 208 ? -12.727 1.549   48.702 1.00 91.70  ? 113  TYR A CZ  1 
ATOM   1628 O OH  . TYR A 1 208 ? -13.421 0.768   47.809 1.00 92.33  ? 113  TYR A OH  1 
ATOM   1629 N N   . ALA A 1 209 ? -9.974  6.345   53.560 1.00 69.37  ? 114  ALA A N   1 
ATOM   1630 C CA  . ALA A 1 209 ? -9.222  6.964   54.657 1.00 68.53  ? 114  ALA A CA  1 
ATOM   1631 C C   . ALA A 1 209 ? -10.152 7.462   55.764 1.00 70.03  ? 114  ALA A C   1 
ATOM   1632 O O   . ALA A 1 209 ? -9.883  7.186   56.932 1.00 69.92  ? 114  ALA A O   1 
ATOM   1633 C CB  . ALA A 1 209 ? -8.369  8.109   54.139 1.00 69.79  ? 114  ALA A CB  1 
ATOM   1634 N N   . SER A 1 210 ? -11.262 8.142   55.401 1.00 64.80  ? 115  SER A N   1 
ATOM   1635 C CA  . SER A 1 210 ? -12.251 8.634   56.358 1.00 63.40  ? 115  SER A CA  1 
ATOM   1636 C C   . SER A 1 210 ? -12.862 7.463   57.138 1.00 66.84  ? 115  SER A C   1 
ATOM   1637 O O   . SER A 1 210 ? -12.753 7.439   58.360 1.00 66.51  ? 115  SER A O   1 
ATOM   1638 C CB  . SER A 1 210 ? -13.337 9.446   55.658 1.00 65.98  ? 115  SER A CB  1 
ATOM   1639 O OG  . SER A 1 210 ? -12.899 10.770  55.401 1.00 74.19  ? 115  SER A OG  1 
ATOM   1640 N N   . VAL A 1 211 ? -13.402 6.459   56.425 1.00 63.17  ? 116  VAL A N   1 
ATOM   1641 C CA  . VAL A 1 211 ? -13.996 5.242   56.980 1.00 63.66  ? 116  VAL A CA  1 
ATOM   1642 C C   . VAL A 1 211 ? -13.000 4.538   57.942 1.00 68.69  ? 116  VAL A C   1 
ATOM   1643 O O   . VAL A 1 211 ? -13.431 4.026   58.980 1.00 68.84  ? 116  VAL A O   1 
ATOM   1644 C CB  . VAL A 1 211 ? -14.459 4.305   55.828 1.00 68.56  ? 116  VAL A CB  1 
ATOM   1645 C CG1 . VAL A 1 211 ? -14.441 2.829   56.220 1.00 69.44  ? 116  VAL A CG1 1 
ATOM   1646 C CG2 . VAL A 1 211 ? -15.834 4.718   55.308 1.00 68.02  ? 116  VAL A CG2 1 
ATOM   1647 N N   . PHE A 1 212 ? -11.689 4.541   57.616 1.00 65.29  ? 117  PHE A N   1 
ATOM   1648 C CA  . PHE A 1 212 ? -10.669 3.913   58.456 1.00 65.77  ? 117  PHE A CA  1 
ATOM   1649 C C   . PHE A 1 212 ? -10.366 4.756   59.697 1.00 67.34  ? 117  PHE A C   1 
ATOM   1650 O O   . PHE A 1 212 ? -10.185 4.198   60.782 1.00 67.25  ? 117  PHE A O   1 
ATOM   1651 C CB  . PHE A 1 212 ? -9.379  3.655   57.664 1.00 69.40  ? 117  PHE A CB  1 
ATOM   1652 C CG  . PHE A 1 212 ? -9.497  2.649   56.543 1.00 72.15  ? 117  PHE A CG  1 
ATOM   1653 C CD1 . PHE A 1 212 ? -10.364 1.567   56.643 1.00 75.58  ? 117  PHE A CD1 1 
ATOM   1654 C CD2 . PHE A 1 212 ? -8.691  2.744   55.418 1.00 75.66  ? 117  PHE A CD2 1 
ATOM   1655 C CE1 . PHE A 1 212 ? -10.465 0.634   55.613 1.00 78.05  ? 117  PHE A CE1 1 
ATOM   1656 C CE2 . PHE A 1 212 ? -8.786  1.801   54.390 1.00 79.93  ? 117  PHE A CE2 1 
ATOM   1657 C CZ  . PHE A 1 212 ? -9.671  0.752   54.496 1.00 78.24  ? 117  PHE A CZ  1 
ATOM   1658 N N   . LEU A 1 213 ? -10.326 6.088   59.546 1.00 61.86  ? 118  LEU A N   1 
ATOM   1659 C CA  . LEU A 1 213 ? -10.061 6.995   60.660 1.00 60.60  ? 118  LEU A CA  1 
ATOM   1660 C C   . LEU A 1 213 ? -11.249 7.028   61.636 1.00 63.03  ? 118  LEU A C   1 
ATOM   1661 O O   . LEU A 1 213 ? -11.040 6.980   62.853 1.00 61.70  ? 118  LEU A O   1 
ATOM   1662 C CB  . LEU A 1 213 ? -9.734  8.399   60.143 1.00 60.17  ? 118  LEU A CB  1 
ATOM   1663 C CG  . LEU A 1 213 ? -8.344  8.548   59.544 1.00 66.01  ? 118  LEU A CG  1 
ATOM   1664 C CD1 . LEU A 1 213 ? -8.282  9.713   58.578 1.00 66.14  ? 118  LEU A CD1 1 
ATOM   1665 C CD2 . LEU A 1 213 ? -7.282  8.655   60.626 1.00 69.84  ? 118  LEU A CD2 1 
ATOM   1666 N N   . LEU A 1 214 ? -12.484 7.041   61.099 1.00 59.79  ? 119  LEU A N   1 
ATOM   1667 C CA  . LEU A 1 214 ? -13.727 7.054   61.876 1.00 59.15  ? 119  LEU A CA  1 
ATOM   1668 C C   . LEU A 1 214 ? -13.894 5.754   62.684 1.00 63.42  ? 119  LEU A C   1 
ATOM   1669 O O   . LEU A 1 214 ? -14.462 5.798   63.774 1.00 63.32  ? 119  LEU A O   1 
ATOM   1670 C CB  . LEU A 1 214 ? -14.944 7.285   60.967 1.00 58.81  ? 119  LEU A CB  1 
ATOM   1671 C CG  . LEU A 1 214 ? -15.014 8.667   60.295 1.00 62.99  ? 119  LEU A CG  1 
ATOM   1672 C CD1 . LEU A 1 214 ? -15.913 8.647   59.071 1.00 63.08  ? 119  LEU A CD1 1 
ATOM   1673 C CD2 . LEU A 1 214 ? -15.406 9.759   61.273 1.00 64.84  ? 119  LEU A CD2 1 
ATOM   1674 N N   . THR A 1 215 ? -13.357 4.626   62.179 1.00 59.92  ? 120  THR A N   1 
ATOM   1675 C CA  . THR A 1 215 ? -13.374 3.342   62.881 1.00 60.55  ? 120  THR A CA  1 
ATOM   1676 C C   . THR A 1 215 ? -12.380 3.408   64.064 1.00 65.49  ? 120  THR A C   1 
ATOM   1677 O O   . THR A 1 215 ? -12.726 3.008   65.183 1.00 65.29  ? 120  THR A O   1 
ATOM   1678 C CB  . THR A 1 215 ? -13.052 2.177   61.911 1.00 63.87  ? 120  THR A CB  1 
ATOM   1679 O OG1 . THR A 1 215 ? -13.892 2.255   60.756 1.00 57.80  ? 120  THR A OG1 1 
ATOM   1680 C CG2 . THR A 1 215 ? -13.235 0.813   62.562 1.00 63.92  ? 120  THR A CG2 1 
ATOM   1681 N N   . CYS A 1 216 ? -11.161 3.940   63.806 1.00 62.19  ? 121  CYS A N   1 
ATOM   1682 C CA  . CYS A 1 216 ? -10.074 4.093   64.784 1.00 62.39  ? 121  CYS A CA  1 
ATOM   1683 C C   . CYS A 1 216 ? -10.482 5.008   65.925 1.00 63.18  ? 121  CYS A C   1 
ATOM   1684 O O   . CYS A 1 216 ? -10.180 4.693   67.072 1.00 62.91  ? 121  CYS A O   1 
ATOM   1685 C CB  . CYS A 1 216 ? -8.807  4.607   64.110 1.00 63.77  ? 121  CYS A CB  1 
ATOM   1686 S SG  . CYS A 1 216 ? -7.956  3.376   63.094 1.00 69.43  ? 121  CYS A SG  1 
ATOM   1687 N N   . LEU A 1 217 ? -11.156 6.136   65.621 1.00 57.82  ? 122  LEU A N   1 
ATOM   1688 C CA  . LEU A 1 217 ? -11.618 7.080   66.640 1.00 56.60  ? 122  LEU A CA  1 
ATOM   1689 C C   . LEU A 1 217 ? -12.725 6.450   67.512 1.00 59.68  ? 122  LEU A C   1 
ATOM   1690 O O   . LEU A 1 217 ? -12.773 6.716   68.722 1.00 59.98  ? 122  LEU A O   1 
ATOM   1691 C CB  . LEU A 1 217 ? -12.112 8.389   66.004 1.00 55.98  ? 122  LEU A CB  1 
ATOM   1692 C CG  . LEU A 1 217 ? -11.041 9.377   65.520 1.00 61.42  ? 122  LEU A CG  1 
ATOM   1693 C CD1 . LEU A 1 217 ? -11.626 10.414  64.584 1.00 61.05  ? 122  LEU A CD1 1 
ATOM   1694 C CD2 . LEU A 1 217 ? -10.356 10.072  66.681 1.00 65.19  ? 122  LEU A CD2 1 
ATOM   1695 N N   . SER A 1 218 ? -13.582 5.590   66.909 1.00 53.96  ? 123  SER A N   1 
ATOM   1696 C CA  . SER A 1 218 ? -14.659 4.903   67.617 1.00 53.44  ? 123  SER A CA  1 
ATOM   1697 C C   . SER A 1 218 ? -14.095 3.913   68.637 1.00 58.31  ? 123  SER A C   1 
ATOM   1698 O O   . SER A 1 218 ? -14.546 3.894   69.789 1.00 58.00  ? 123  SER A O   1 
ATOM   1699 C CB  . SER A 1 218 ? -15.565 4.176   66.634 1.00 56.48  ? 123  SER A CB  1 
ATOM   1700 O OG  . SER A 1 218 ? -16.005 5.070   65.629 1.00 63.65  ? 123  SER A OG  1 
ATOM   1701 N N   . ILE A 1 219 ? -13.097 3.099   68.212 1.00 54.61  ? 124  ILE A N   1 
ATOM   1702 C CA  . ILE A 1 219 ? -12.427 2.110   69.063 1.00 54.82  ? 124  ILE A CA  1 
ATOM   1703 C C   . ILE A 1 219 ? -11.737 2.868   70.210 1.00 57.02  ? 124  ILE A C   1 
ATOM   1704 O O   . ILE A 1 219 ? -11.905 2.482   71.366 1.00 56.91  ? 124  ILE A O   1 
ATOM   1705 C CB  . ILE A 1 219 ? -11.456 1.221   68.232 1.00 58.78  ? 124  ILE A CB  1 
ATOM   1706 C CG1 . ILE A 1 219 ? -12.251 0.374   67.207 1.00 59.50  ? 124  ILE A CG1 1 
ATOM   1707 C CG2 . ILE A 1 219 ? -10.592 0.325   69.132 1.00 60.95  ? 124  ILE A CG2 1 
ATOM   1708 C CD1 . ILE A 1 219 ? -11.464 -0.092  65.956 1.00 66.80  ? 124  ILE A CD1 1 
ATOM   1709 N N   . ASP A 1 220 ? -11.055 3.997   69.892 1.00 51.93  ? 125  ASP A N   1 
ATOM   1710 C CA  . ASP A 1 220 ? -10.395 4.854   70.880 1.00 51.23  ? 125  ASP A CA  1 
ATOM   1711 C C   . ASP A 1 220 ? -11.397 5.349   71.926 1.00 53.08  ? 125  ASP A C   1 
ATOM   1712 O O   . ASP A 1 220 ? -11.093 5.279   73.118 1.00 52.86  ? 125  ASP A O   1 
ATOM   1713 C CB  . ASP A 1 220 ? -9.687  6.051   70.218 1.00 52.71  ? 125  ASP A CB  1 
ATOM   1714 C CG  . ASP A 1 220 ? -8.942  6.937   71.203 1.00 63.93  ? 125  ASP A CG  1 
ATOM   1715 O OD1 . ASP A 1 220 ? -8.091  6.407   71.958 1.00 65.28  ? 125  ASP A OD1 1 
ATOM   1716 O OD2 . ASP A 1 220 ? -9.224  8.156   71.237 1.00 71.09  ? 125  ASP A OD2 1 
ATOM   1717 N N   . ARG A 1 221 ? -12.591 5.819   71.485 1.00 48.10  ? 126  ARG A N   1 
ATOM   1718 C CA  . ARG A 1 221 ? -13.645 6.310   72.382 1.00 46.82  ? 126  ARG A CA  1 
ATOM   1719 C C   . ARG A 1 221 ? -14.192 5.188   73.228 1.00 50.88  ? 126  ARG A C   1 
ATOM   1720 O O   . ARG A 1 221 ? -14.365 5.374   74.429 1.00 50.52  ? 126  ARG A O   1 
ATOM   1721 C CB  . ARG A 1 221 ? -14.785 6.992   71.614 1.00 46.40  ? 126  ARG A CB  1 
ATOM   1722 C CG  . ARG A 1 221 ? -14.500 8.413   71.126 1.00 59.65  ? 126  ARG A CG  1 
ATOM   1723 C CD  . ARG A 1 221 ? -14.125 9.408   72.218 1.00 68.41  ? 126  ARG A CD  1 
ATOM   1724 N NE  . ARG A 1 221 ? -12.725 9.257   72.618 1.00 73.41  ? 126  ARG A NE  1 
ATOM   1725 C CZ  . ARG A 1 221 ? -12.213 9.743   73.742 1.00 88.00  ? 126  ARG A CZ  1 
ATOM   1726 N NH1 . ARG A 1 221 ? -12.976 10.428  74.584 1.00 77.67  ? 126  ARG A NH1 1 
ATOM   1727 N NH2 . ARG A 1 221 ? -10.936 9.544   74.035 1.00 73.09  ? 126  ARG A NH2 1 
ATOM   1728 N N   . TYR A 1 222 ? -14.413 4.008   72.624 1.00 48.24  ? 127  TYR A N   1 
ATOM   1729 C CA  . TYR A 1 222 ? -14.895 2.832   73.334 1.00 49.46  ? 127  TYR A CA  1 
ATOM   1730 C C   . TYR A 1 222 ? -13.909 2.433   74.456 1.00 53.72  ? 127  TYR A C   1 
ATOM   1731 O O   . TYR A 1 222 ? -14.334 2.275   75.603 1.00 54.00  ? 127  TYR A O   1 
ATOM   1732 C CB  . TYR A 1 222 ? -15.115 1.672   72.356 1.00 52.05  ? 127  TYR A CB  1 
ATOM   1733 C CG  . TYR A 1 222 ? -15.379 0.347   73.031 1.00 56.19  ? 127  TYR A CG  1 
ATOM   1734 C CD1 . TYR A 1 222 ? -16.634 0.044   73.546 1.00 59.54  ? 127  TYR A CD1 1 
ATOM   1735 C CD2 . TYR A 1 222 ? -14.378 -0.615  73.139 1.00 58.30  ? 127  TYR A CD2 1 
ATOM   1736 C CE1 . TYR A 1 222 ? -16.880 -1.169  74.184 1.00 63.86  ? 127  TYR A CE1 1 
ATOM   1737 C CE2 . TYR A 1 222 ? -14.619 -1.843  73.751 1.00 61.58  ? 127  TYR A CE2 1 
ATOM   1738 C CZ  . TYR A 1 222 ? -15.875 -2.117  74.270 1.00 73.01  ? 127  TYR A CZ  1 
ATOM   1739 O OH  . TYR A 1 222 ? -16.130 -3.316  74.890 1.00 79.91  ? 127  TYR A OH  1 
ATOM   1740 N N   . LEU A 1 223 ? -12.605 2.317   74.135 1.00 49.64  ? 128  LEU A N   1 
ATOM   1741 C CA  . LEU A 1 223 ? -11.583 1.924   75.109 1.00 49.99  ? 128  LEU A CA  1 
ATOM   1742 C C   . LEU A 1 223 ? -11.357 3.005   76.173 1.00 50.89  ? 128  LEU A C   1 
ATOM   1743 O O   . LEU A 1 223 ? -11.049 2.647   77.302 1.00 51.49  ? 128  LEU A O   1 
ATOM   1744 C CB  . LEU A 1 223 ? -10.235 1.580   74.437 1.00 51.14  ? 128  LEU A CB  1 
ATOM   1745 C CG  . LEU A 1 223 ? -10.201 0.522   73.320 1.00 56.86  ? 128  LEU A CG  1 
ATOM   1746 C CD1 . LEU A 1 223 ? -8.833  0.470   72.672 1.00 57.52  ? 128  LEU A CD1 1 
ATOM   1747 C CD2 . LEU A 1 223 ? -10.627 -0.857  73.815 1.00 61.10  ? 128  LEU A CD2 1 
ATOM   1748 N N   . ALA A 1 224 ? -11.511 4.306   75.838 1.00 44.67  ? 129  ALA A N   1 
ATOM   1749 C CA  . ALA A 1 224 ? -11.309 5.390   76.813 1.00 43.68  ? 129  ALA A CA  1 
ATOM   1750 C C   . ALA A 1 224 ? -12.413 5.425   77.873 1.00 49.52  ? 129  ALA A C   1 
ATOM   1751 O O   . ALA A 1 224 ? -12.108 5.493   79.067 1.00 50.45  ? 129  ALA A O   1 
ATOM   1752 C CB  . ALA A 1 224 ? -11.234 6.733   76.111 1.00 43.13  ? 129  ALA A CB  1 
ATOM   1753 N N   . ILE A 1 225 ? -13.679 5.322   77.441 1.00 46.87  ? 130  ILE A N   1 
ATOM   1754 C CA  . ILE A 1 225 ? -14.877 5.428   78.276 1.00 47.22  ? 130  ILE A CA  1 
ATOM   1755 C C   . ILE A 1 225 ? -15.283 4.077   78.929 1.00 53.88  ? 130  ILE A C   1 
ATOM   1756 O O   . ILE A 1 225 ? -15.595 4.068   80.127 1.00 54.31  ? 130  ILE A O   1 
ATOM   1757 C CB  . ILE A 1 225 ? -16.050 6.002   77.412 1.00 49.33  ? 130  ILE A CB  1 
ATOM   1758 C CG1 . ILE A 1 225 ? -15.858 7.505   77.098 1.00 48.16  ? 130  ILE A CG1 1 
ATOM   1759 C CG2 . ILE A 1 225 ? -17.443 5.780   78.069 1.00 50.75  ? 130  ILE A CG2 1 
ATOM   1760 C CD1 . ILE A 1 225 ? -14.779 7.923   76.156 1.00 46.13  ? 130  ILE A CD1 1 
ATOM   1761 N N   . VAL A 1 226 ? -15.324 2.972   78.155 1.00 51.69  ? 131  VAL A N   1 
ATOM   1762 C CA  . VAL A 1 226 ? -15.816 1.689   78.665 1.00 53.72  ? 131  VAL A CA  1 
ATOM   1763 C C   . VAL A 1 226 ? -14.705 0.890   79.389 1.00 59.39  ? 131  VAL A C   1 
ATOM   1764 O O   . VAL A 1 226 ? -14.975 0.358   80.467 1.00 60.06  ? 131  VAL A O   1 
ATOM   1765 C CB  . VAL A 1 226 ? -16.476 0.837   77.545 1.00 58.66  ? 131  VAL A CB  1 
ATOM   1766 C CG1 . VAL A 1 226 ? -17.168 -0.403  78.116 1.00 60.59  ? 131  VAL A CG1 1 
ATOM   1767 C CG2 . VAL A 1 226 ? -17.471 1.675   76.735 1.00 57.59  ? 131  VAL A CG2 1 
ATOM   1768 N N   . HIS A 1 227 ? -13.485 0.800   78.833 1.00 56.82  ? 132  HIS A N   1 
ATOM   1769 C CA  . HIS A 1 227 ? -12.446 -0.004  79.481 1.00 58.77  ? 132  HIS A CA  1 
ATOM   1770 C C   . HIS A 1 227 ? -11.156 0.814   79.737 1.00 64.23  ? 132  HIS A C   1 
ATOM   1771 O O   . HIS A 1 227 ? -10.142 0.575   79.078 1.00 64.62  ? 132  HIS A O   1 
ATOM   1772 C CB  . HIS A 1 227 ? -12.139 -1.259  78.630 1.00 61.17  ? 132  HIS A CB  1 
ATOM   1773 C CG  . HIS A 1 227 ? -13.352 -2.079  78.310 1.00 65.28  ? 132  HIS A CG  1 
ATOM   1774 N ND1 . HIS A 1 227 ? -14.027 -2.785  79.290 1.00 68.49  ? 132  HIS A ND1 1 
ATOM   1775 C CD2 . HIS A 1 227 ? -13.980 -2.265  77.128 1.00 66.66  ? 132  HIS A CD2 1 
ATOM   1776 C CE1 . HIS A 1 227 ? -15.037 -3.377  78.674 1.00 68.76  ? 132  HIS A CE1 1 
ATOM   1777 N NE2 . HIS A 1 227 ? -15.048 -3.095  77.371 1.00 68.06  ? 132  HIS A NE2 1 
ATOM   1778 N N   . PRO A 1 228 ? -11.145 1.758   80.707 1.00 62.30  ? 133  PRO A N   1 
ATOM   1779 C CA  . PRO A 1 228 ? -9.912  2.525   80.963 1.00 62.88  ? 133  PRO A CA  1 
ATOM   1780 C C   . PRO A 1 228 ? -8.805  1.667   81.565 1.00 70.73  ? 133  PRO A C   1 
ATOM   1781 O O   . PRO A 1 228 ? -9.062  0.743   82.353 1.00 71.69  ? 133  PRO A O   1 
ATOM   1782 C CB  . PRO A 1 228 ? -10.357 3.609   81.958 1.00 63.77  ? 133  PRO A CB  1 
ATOM   1783 C CG  . PRO A 1 228 ? -11.855 3.575   81.958 1.00 67.15  ? 133  PRO A CG  1 
ATOM   1784 C CD  . PRO A 1 228 ? -12.221 2.172   81.626 1.00 63.59  ? 133  PRO A CD  1 
ATOM   1785 N N   . MET A 1 229 ? -7.568  1.976   81.177 1.00 69.22  ? 134  MET A N   1 
ATOM   1786 C CA  . MET A 1 229 ? -6.374  1.279   81.656 1.00 72.17  ? 134  MET A CA  1 
ATOM   1787 C C   . MET A 1 229 ? -5.209  2.273   81.786 1.00 77.04  ? 134  MET A C   1 
ATOM   1788 O O   . MET A 1 229 ? -5.364  3.440   81.400 1.00 74.70  ? 134  MET A O   1 
ATOM   1789 C CB  . MET A 1 229 ? -6.015  0.094   80.738 1.00 76.25  ? 134  MET A CB  1 
ATOM   1790 C CG  . MET A 1 229 ? -6.015  0.435   79.280 1.00 79.64  ? 134  MET A CG  1 
ATOM   1791 S SD  . MET A 1 229 ? -6.365  -1.014  78.281 1.00 86.55  ? 134  MET A SD  1 
ATOM   1792 C CE  . MET A 1 229 ? -6.831  -0.218  76.735 1.00 81.68  ? 134  MET A CE  1 
ATOM   1793 N N   . LYS A 1 230 ? -4.062  1.815   82.368 1.00 76.52  ? 135  LYS A N   1 
ATOM   1794 C CA  . LYS A 1 230 ? -2.853  2.624   82.554 1.00 77.62  ? 135  LYS A CA  1 
ATOM   1795 C C   . LYS A 1 230 ? -2.436  3.197   81.197 1.00 82.61  ? 135  LYS A C   1 
ATOM   1796 O O   . LYS A 1 230 ? -2.217  2.438   80.244 1.00 83.82  ? 135  LYS A O   1 
ATOM   1797 C CB  . LYS A 1 230 ? -1.728  1.801   83.200 1.00 82.37  ? 135  LYS A CB  1 
ATOM   1798 N N   . SER A 1 231 ? -2.458  4.538   81.087 1.00 77.98  ? 136  SER A N   1 
ATOM   1799 C CA  . SER A 1 231 ? -2.157  5.251   79.850 1.00 77.65  ? 136  SER A CA  1 
ATOM   1800 C C   . SER A 1 231 ? -0.653  5.433   79.664 1.00 85.25  ? 136  SER A C   1 
ATOM   1801 O O   . SER A 1 231 ? -0.051  6.359   80.222 1.00 86.13  ? 136  SER A O   1 
ATOM   1802 C CB  . SER A 1 231 ? -2.863  6.604   79.824 1.00 79.37  ? 136  SER A CB  1 
ATOM   1803 N N   . ARG A 1 232 ? -0.049  4.519   78.888 1.00 83.82  ? 137  ARG A N   1 
ATOM   1804 C CA  . ARG A 1 232 ? 1.366   4.546   78.528 1.00 86.87  ? 137  ARG A CA  1 
ATOM   1805 C C   . ARG A 1 232 ? 1.457   5.343   77.232 1.00 90.07  ? 137  ARG A C   1 
ATOM   1806 O O   . ARG A 1 232 ? 1.508   4.767   76.141 1.00 89.47  ? 137  ARG A O   1 
ATOM   1807 C CB  . ARG A 1 232 ? 1.925   3.113   78.412 1.00 90.14  ? 137  ARG A CB  1 
ATOM   1808 N N   . LEU A 1 233 ? 1.391   6.684   77.366 1.00 86.38  ? 138  LEU A N   1 
ATOM   1809 C CA  . LEU A 1 233 ? 1.320   7.662   76.278 1.00 85.83  ? 138  LEU A CA  1 
ATOM   1810 C C   . LEU A 1 233 ? 2.399   7.461   75.205 1.00 91.34  ? 138  LEU A C   1 
ATOM   1811 O O   . LEU A 1 233 ? 2.047   7.474   74.029 1.00 89.51  ? 138  LEU A O   1 
ATOM   1812 C CB  . LEU A 1 233 ? 1.385   9.104   76.808 1.00 86.40  ? 138  LEU A CB  1 
ATOM   1813 C CG  . LEU A 1 233 ? 0.610   10.147  75.983 1.00 89.61  ? 138  LEU A CG  1 
ATOM   1814 C CD1 . LEU A 1 233 ? -0.912  9.985   76.153 1.00 86.23  ? 138  LEU A CD1 1 
ATOM   1815 C CD2 . LEU A 1 233 ? 1.025   11.556  76.366 1.00 93.77  ? 138  LEU A CD2 1 
ATOM   1816 N N   . ARG A 1 234 ? 3.674   7.240   75.596 1.00 91.22  ? 139  ARG A N   1 
ATOM   1817 C CA  . ARG A 1 234 ? 4.800   7.029   74.676 1.00 94.19  ? 139  ARG A CA  1 
ATOM   1818 C C   . ARG A 1 234 ? 4.520   5.873   73.687 1.00 97.71  ? 139  ARG A C   1 
ATOM   1819 O O   . ARG A 1 234 ? 4.836   6.007   72.505 1.00 99.22  ? 139  ARG A O   1 
ATOM   1820 C CB  . ARG A 1 234 ? 6.094   6.760   75.467 1.00 99.09  ? 139  ARG A CB  1 
ATOM   1821 C CG  . ARG A 1 234 ? 7.376   6.804   74.633 1.00 114.57 ? 139  ARG A CG  1 
ATOM   1822 C CD  . ARG A 1 234 ? 8.615   7.079   75.475 1.00 132.95 ? 139  ARG A CD  1 
ATOM   1823 N NE  . ARG A 1 234 ? 8.985   5.958   76.344 1.00 146.00 ? 139  ARG A NE  1 
ATOM   1824 C CZ  . ARG A 1 234 ? 10.060  5.939   77.129 1.00 164.97 ? 139  ARG A CZ  1 
ATOM   1825 N NH1 . ARG A 1 234 ? 10.886  6.978   77.163 1.00 155.39 ? 139  ARG A NH1 1 
ATOM   1826 N NH2 . ARG A 1 234 ? 10.320  4.878   77.881 1.00 153.40 ? 139  ARG A NH2 1 
ATOM   1827 N N   . ARG A 1 235 ? 3.907   4.770   74.162 1.00 91.96  ? 140  ARG A N   1 
ATOM   1828 C CA  . ARG A 1 235 ? 3.574   3.597   73.344 1.00 91.00  ? 140  ARG A CA  1 
ATOM   1829 C C   . ARG A 1 235 ? 2.261   3.794   72.569 1.00 88.91  ? 140  ARG A C   1 
ATOM   1830 O O   . ARG A 1 235 ? 2.163   3.332   71.430 1.00 88.08  ? 140  ARG A O   1 
ATOM   1831 C CB  . ARG A 1 235 ? 3.487   2.330   74.212 1.00 93.55  ? 140  ARG A CB  1 
ATOM   1832 C CG  . ARG A 1 235 ? 4.855   1.801   74.645 1.00 112.29 ? 140  ARG A CG  1 
ATOM   1833 C CD  . ARG A 1 235 ? 4.756   0.598   75.567 1.00 126.20 ? 140  ARG A CD  1 
ATOM   1834 N NE  . ARG A 1 235 ? 6.074   0.018   75.839 1.00 138.91 ? 140  ARG A NE  1 
ATOM   1835 C CZ  . ARG A 1 235 ? 6.288   -1.035  76.623 1.00 154.15 ? 140  ARG A CZ  1 
ATOM   1836 N NH1 . ARG A 1 235 ? 5.274   -1.636  77.233 1.00 138.59 ? 140  ARG A NH1 1 
ATOM   1837 N NH2 . ARG A 1 235 ? 7.520   -1.493  76.807 1.00 145.24 ? 140  ARG A NH2 1 
ATOM   1838 N N   . THR A 1 236 ? 1.263   4.472   73.176 1.00 81.54  ? 141  THR A N   1 
ATOM   1839 C CA  . THR A 1 236 ? -0.036  4.714   72.535 1.00 77.53  ? 141  THR A CA  1 
ATOM   1840 C C   . THR A 1 236 ? 0.105   5.753   71.419 1.00 79.68  ? 141  THR A C   1 
ATOM   1841 O O   . THR A 1 236 ? -0.610  5.660   70.422 1.00 77.66  ? 141  THR A O   1 
ATOM   1842 C CB  . THR A 1 236 ? -1.118  5.130   73.539 1.00 79.61  ? 141  THR A CB  1 
ATOM   1843 O OG1 . THR A 1 236 ? -0.726  6.331   74.195 1.00 79.42  ? 141  THR A OG1 1 
ATOM   1844 C CG2 . THR A 1 236 ? -1.436  4.042   74.556 1.00 77.01  ? 141  THR A CG2 1 
ATOM   1845 N N   . MET A 1 237 ? 1.025   6.726   71.577 1.00 76.89  ? 142  MET A N   1 
ATOM   1846 C CA  . MET A 1 237 ? 1.277   7.739   70.551 1.00 76.80  ? 142  MET A CA  1 
ATOM   1847 C C   . MET A 1 237 ? 2.023   7.101   69.389 1.00 82.07  ? 142  MET A C   1 
ATOM   1848 O O   . MET A 1 237 ? 1.752   7.431   68.236 1.00 80.24  ? 142  MET A O   1 
ATOM   1849 C CB  . MET A 1 237 ? 2.052   8.942   71.111 1.00 81.26  ? 142  MET A CB  1 
ATOM   1850 C CG  . MET A 1 237 ? 1.210   9.859   72.003 1.00 83.31  ? 142  MET A CG  1 
ATOM   1851 S SD  . MET A 1 237 ? -0.086  10.789  71.142 1.00 85.12  ? 142  MET A SD  1 
ATOM   1852 C CE  . MET A 1 237 ? 0.924   11.856  70.098 1.00 85.10  ? 142  MET A CE  1 
ATOM   1853 N N   . LEU A 1 238 ? 2.922   6.143   69.699 1.00 81.64  ? 143  LEU A N   1 
ATOM   1854 C CA  . LEU A 1 238 ? 3.693   5.389   68.714 1.00 83.72  ? 143  LEU A CA  1 
ATOM   1855 C C   . LEU A 1 238 ? 2.770   4.523   67.857 1.00 85.33  ? 143  LEU A C   1 
ATOM   1856 O O   . LEU A 1 238 ? 2.931   4.513   66.634 1.00 85.46  ? 143  LEU A O   1 
ATOM   1857 C CB  . LEU A 1 238 ? 4.767   4.514   69.399 1.00 87.10  ? 143  LEU A CB  1 
ATOM   1858 C CG  . LEU A 1 238 ? 5.597   3.579   68.488 1.00 94.70  ? 143  LEU A CG  1 
ATOM   1859 C CD1 . LEU A 1 238 ? 6.465   4.365   67.511 1.00 97.05  ? 143  LEU A CD1 1 
ATOM   1860 C CD2 . LEU A 1 238 ? 6.449   2.636   69.305 1.00 100.42 ? 143  LEU A CD2 1 
ATOM   1861 N N   . VAL A 1 239 ? 1.803   3.815   68.483 1.00 79.63  ? 144  VAL A N   1 
ATOM   1862 C CA  . VAL A 1 239 ? 0.887   2.946   67.737 1.00 78.03  ? 144  VAL A CA  1 
ATOM   1863 C C   . VAL A 1 239 ? -0.094  3.808   66.907 1.00 78.06  ? 144  VAL A C   1 
ATOM   1864 O O   . VAL A 1 239 ? -0.377  3.430   65.773 1.00 77.07  ? 144  VAL A O   1 
ATOM   1865 C CB  . VAL A 1 239 ? 0.133   1.868   68.579 1.00 81.58  ? 144  VAL A CB  1 
ATOM   1866 C CG1 . VAL A 1 239 ? 1.108   0.891   69.234 1.00 84.85  ? 144  VAL A CG1 1 
ATOM   1867 C CG2 . VAL A 1 239 ? -0.807  2.476   69.616 1.00 79.15  ? 144  VAL A CG2 1 
ATOM   1868 N N   . ALA A 1 240 ? -0.550  4.969   67.433 1.00 72.45  ? 145  ALA A N   1 
ATOM   1869 C CA  . ALA A 1 240 ? -1.478  5.862   66.725 1.00 70.08  ? 145  ALA A CA  1 
ATOM   1870 C C   . ALA A 1 240 ? -0.831  6.492   65.491 1.00 75.06  ? 145  ALA A C   1 
ATOM   1871 O O   . ALA A 1 240 ? -1.512  6.677   64.480 1.00 73.33  ? 145  ALA A O   1 
ATOM   1872 C CB  . ALA A 1 240 ? -1.984  6.958   67.652 1.00 69.59  ? 145  ALA A CB  1 
ATOM   1873 N N   . LYS A 1 241 ? 0.478   6.807   65.570 1.00 74.25  ? 146  LYS A N   1 
ATOM   1874 C CA  . LYS A 1 241 ? 1.240   7.402   64.471 1.00 75.57  ? 146  LYS A CA  1 
ATOM   1875 C C   . LYS A 1 241 ? 1.447   6.391   63.336 1.00 78.64  ? 146  LYS A C   1 
ATOM   1876 O O   . LYS A 1 241 ? 1.311   6.767   62.172 1.00 77.11  ? 146  LYS A O   1 
ATOM   1877 C CB  . LYS A 1 241 ? 2.591   7.945   64.965 1.00 81.94  ? 146  LYS A CB  1 
ATOM   1878 C CG  . LYS A 1 241 ? 2.472   9.289   65.685 1.00 98.83  ? 146  LYS A CG  1 
ATOM   1879 C CD  . LYS A 1 241 ? 3.817   9.783   66.209 1.00 115.28 ? 146  LYS A CD  1 
ATOM   1880 C CE  . LYS A 1 241 ? 3.705   11.030  67.060 1.00 128.46 ? 146  LYS A CE  1 
ATOM   1881 N NZ  . LYS A 1 241 ? 3.319   12.233  66.272 1.00 138.09 ? 146  LYS A NZ  1 
ATOM   1882 N N   . VAL A 1 242 ? 1.743   5.114   63.678 1.00 76.29  ? 147  VAL A N   1 
ATOM   1883 C CA  . VAL A 1 242 ? 1.957   4.013   62.723 1.00 77.39  ? 147  VAL A CA  1 
ATOM   1884 C C   . VAL A 1 242 ? 0.615   3.654   62.050 1.00 79.13  ? 147  VAL A C   1 
ATOM   1885 O O   . VAL A 1 242 ? 0.576   3.563   60.826 1.00 79.17  ? 147  VAL A O   1 
ATOM   1886 C CB  . VAL A 1 242 ? 2.623   2.773   63.398 1.00 83.26  ? 147  VAL A CB  1 
ATOM   1887 C CG1 . VAL A 1 242 ? 2.593   1.539   62.495 1.00 84.30  ? 147  VAL A CG1 1 
ATOM   1888 C CG2 . VAL A 1 242 ? 4.054   3.082   63.831 1.00 86.37  ? 147  VAL A CG2 1 
ATOM   1889 N N   . THR A 1 243 ? -0.472  3.482   62.843 1.00 74.17  ? 148  THR A N   1 
ATOM   1890 C CA  . THR A 1 243 ? -1.828  3.139   62.381 1.00 72.29  ? 148  THR A CA  1 
ATOM   1891 C C   . THR A 1 243 ? -2.274  4.082   61.256 1.00 76.68  ? 148  THR A C   1 
ATOM   1892 O O   . THR A 1 243 ? -2.841  3.609   60.269 1.00 76.16  ? 148  THR A O   1 
ATOM   1893 C CB  . THR A 1 243 ? -2.827  3.179   63.557 1.00 77.72  ? 148  THR A CB  1 
ATOM   1894 O OG1 . THR A 1 243 ? -2.434  2.217   64.534 1.00 79.71  ? 148  THR A OG1 1 
ATOM   1895 C CG2 . THR A 1 243 ? -4.265  2.902   63.134 1.00 73.32  ? 148  THR A CG2 1 
ATOM   1896 N N   . CYS A 1 244 ? -1.990  5.394   61.394 1.00 73.82  ? 149  CYS A N   1 
ATOM   1897 C CA  . CYS A 1 244 ? -2.359  6.408   60.409 1.00 73.12  ? 149  CYS A CA  1 
ATOM   1898 C C   . CYS A 1 244 ? -1.581  6.225   59.093 1.00 79.58  ? 149  CYS A C   1 
ATOM   1899 O O   . CYS A 1 244 ? -2.186  6.363   58.027 1.00 78.25  ? 149  CYS A O   1 
ATOM   1900 C CB  . CYS A 1 244 ? -2.171  7.806   60.979 1.00 73.32  ? 149  CYS A CB  1 
ATOM   1901 S SG  . CYS A 1 244 ? -3.455  8.288   62.159 1.00 74.62  ? 149  CYS A SG  1 
ATOM   1902 N N   . ILE A 1 245 ? -0.276  5.870   59.158 1.00 79.27  ? 150  ILE A N   1 
ATOM   1903 C CA  . ILE A 1 245 ? 0.545   5.620   57.964 1.00 81.63  ? 150  ILE A CA  1 
ATOM   1904 C C   . ILE A 1 245 ? -0.078  4.452   57.172 1.00 84.59  ? 150  ILE A C   1 
ATOM   1905 O O   . ILE A 1 245 ? -0.300  4.581   55.968 1.00 83.06  ? 150  ILE A O   1 
ATOM   1906 C CB  . ILE A 1 245 ? 2.043   5.355   58.327 1.00 88.64  ? 150  ILE A CB  1 
ATOM   1907 C CG1 . ILE A 1 245 ? 2.681   6.502   59.166 1.00 90.00  ? 150  ILE A CG1 1 
ATOM   1908 C CG2 . ILE A 1 245 ? 2.890   5.005   57.092 1.00 92.51  ? 150  ILE A CG2 1 
ATOM   1909 C CD1 . ILE A 1 245 ? 2.638   7.972   58.568 1.00 99.72  ? 150  ILE A CD1 1 
ATOM   1910 N N   . ILE A 1 246 ? -0.412  3.352   57.884 1.00 82.17  ? 151  ILE A N   1 
ATOM   1911 C CA  . ILE A 1 246 ? -1.041  2.124   57.381 1.00 82.73  ? 151  ILE A CA  1 
ATOM   1912 C C   . ILE A 1 246 ? -2.409  2.454   56.735 1.00 85.18  ? 151  ILE A C   1 
ATOM   1913 O O   . ILE A 1 246 ? -2.730  1.869   55.700 1.00 84.70  ? 151  ILE A O   1 
ATOM   1914 C CB  . ILE A 1 246 ? -1.169  1.086   58.545 1.00 86.58  ? 151  ILE A CB  1 
ATOM   1915 C CG1 . ILE A 1 246 ? 0.214   0.688   59.155 1.00 90.25  ? 151  ILE A CG1 1 
ATOM   1916 C CG2 . ILE A 1 246 ? -2.009  -0.147  58.176 1.00 87.89  ? 151  ILE A CG2 1 
ATOM   1917 C CD1 . ILE A 1 246 ? 1.304   0.076   58.189 1.00 100.90 ? 151  ILE A CD1 1 
ATOM   1918 N N   . ILE A 1 247 ? -3.187  3.403   57.330 1.00 80.75  ? 152  ILE A N   1 
ATOM   1919 C CA  . ILE A 1 247 ? -4.496  3.872   56.833 1.00 78.28  ? 152  ILE A CA  1 
ATOM   1920 C C   . ILE A 1 247 ? -4.307  4.551   55.456 1.00 82.12  ? 152  ILE A C   1 
ATOM   1921 O O   . ILE A 1 247 ? -5.031  4.207   54.517 1.00 80.81  ? 152  ILE A O   1 
ATOM   1922 C CB  . ILE A 1 247 ? -5.203  4.810   57.863 1.00 79.08  ? 152  ILE A CB  1 
ATOM   1923 C CG1 . ILE A 1 247 ? -5.854  3.990   58.991 1.00 79.14  ? 152  ILE A CG1 1 
ATOM   1924 C CG2 . ILE A 1 247 ? -6.249  5.722   57.198 1.00 78.24  ? 152  ILE A CG2 1 
ATOM   1925 C CD1 . ILE A 1 247 ? -6.139  4.783   60.288 1.00 87.52  ? 152  ILE A CD1 1 
ATOM   1926 N N   . TRP A 1 248 ? -3.326  5.486   55.341 1.00 79.72  ? 153  TRP A N   1 
ATOM   1927 C CA  . TRP A 1 248 ? -3.009  6.197   54.096 1.00 80.27  ? 153  TRP A CA  1 
ATOM   1928 C C   . TRP A 1 248 ? -2.526  5.214   53.031 1.00 86.50  ? 153  TRP A C   1 
ATOM   1929 O O   . TRP A 1 248 ? -2.794  5.430   51.850 1.00 86.62  ? 153  TRP A O   1 
ATOM   1930 C CB  . TRP A 1 248 ? -1.967  7.307   54.329 1.00 80.30  ? 153  TRP A CB  1 
ATOM   1931 C CG  . TRP A 1 248 ? -2.529  8.556   54.958 1.00 79.34  ? 153  TRP A CG  1 
ATOM   1932 C CD1 . TRP A 1 248 ? -2.965  8.702   56.241 1.00 80.82  ? 153  TRP A CD1 1 
ATOM   1933 C CD2 . TRP A 1 248 ? -2.651  9.850   54.346 1.00 78.97  ? 153  TRP A CD2 1 
ATOM   1934 N NE1 . TRP A 1 248 ? -3.386  9.992   56.457 1.00 79.29  ? 153  TRP A NE1 1 
ATOM   1935 C CE2 . TRP A 1 248 ? -3.203  10.721  55.311 1.00 81.39  ? 153  TRP A CE2 1 
ATOM   1936 C CE3 . TRP A 1 248 ? -2.334  10.365  53.076 1.00 81.27  ? 153  TRP A CE3 1 
ATOM   1937 C CZ2 . TRP A 1 248 ? -3.467  12.070  55.043 1.00 80.44  ? 153  TRP A CZ2 1 
ATOM   1938 C CZ3 . TRP A 1 248 ? -2.624  11.693  52.802 1.00 82.36  ? 153  TRP A CZ3 1 
ATOM   1939 C CH2 . TRP A 1 248 ? -3.163  12.536  53.784 1.00 81.69  ? 153  TRP A CH2 1 
ATOM   1940 N N   . LEU A 1 249 ? -1.868  4.113   53.461 1.00 84.64  ? 154  LEU A N   1 
ATOM   1941 C CA  . LEU A 1 249 ? -1.384  3.023   52.609 1.00 86.55  ? 154  LEU A CA  1 
ATOM   1942 C C   . LEU A 1 249 ? -2.564  2.156   52.126 1.00 87.96  ? 154  LEU A C   1 
ATOM   1943 O O   . LEU A 1 249 ? -2.662  1.899   50.929 1.00 88.40  ? 154  LEU A O   1 
ATOM   1944 C CB  . LEU A 1 249 ? -0.345  2.168   53.369 1.00 89.38  ? 154  LEU A CB  1 
ATOM   1945 C CG  . LEU A 1 249 ? 0.060   0.824   52.757 1.00 97.38  ? 154  LEU A CG  1 
ATOM   1946 C CD1 . LEU A 1 249 ? 0.992   1.008   51.571 1.00 100.10 ? 154  LEU A CD1 1 
ATOM   1947 C CD2 . LEU A 1 249 ? 0.720   -0.054  53.795 1.00 102.77 ? 154  LEU A CD2 1 
ATOM   1948 N N   . LEU A 1 250 ? -3.447  1.709   53.050 1.00 82.09  ? 155  LEU A N   1 
ATOM   1949 C CA  . LEU A 1 250 ? -4.625  0.891   52.735 1.00 80.42  ? 155  LEU A CA  1 
ATOM   1950 C C   . LEU A 1 250 ? -5.599  1.649   51.819 1.00 81.65  ? 155  LEU A C   1 
ATOM   1951 O O   . LEU A 1 250 ? -6.055  1.066   50.835 1.00 81.91  ? 155  LEU A O   1 
ATOM   1952 C CB  . LEU A 1 250 ? -5.354  0.419   54.007 1.00 79.16  ? 155  LEU A CB  1 
ATOM   1953 C CG  . LEU A 1 250 ? -4.724  -0.758  54.771 1.00 85.82  ? 155  LEU A CG  1 
ATOM   1954 C CD1 . LEU A 1 250 ? -5.290  -0.864  56.176 1.00 84.32  ? 155  LEU A CD1 1 
ATOM   1955 C CD2 . LEU A 1 250 ? -4.918  -2.079  54.027 1.00 90.40  ? 155  LEU A CD2 1 
ATOM   1956 N N   . ALA A 1 251 ? -5.879  2.946   52.111 1.00 75.18  ? 156  ALA A N   1 
ATOM   1957 C CA  . ALA A 1 251 ? -6.756  3.803   51.298 1.00 72.50  ? 156  ALA A CA  1 
ATOM   1958 C C   . ALA A 1 251 ? -6.122  4.093   49.922 1.00 75.85  ? 156  ALA A C   1 
ATOM   1959 O O   . ALA A 1 251 ? -6.845  4.243   48.932 1.00 74.42  ? 156  ALA A O   1 
ATOM   1960 C CB  . ALA A 1 251 ? -7.055  5.102   52.029 1.00 71.50  ? 156  ALA A CB  1 
ATOM   1961 N N   . GLY A 1 252 ? -4.787  4.138   49.879 1.00 73.22  ? 157  GLY A N   1 
ATOM   1962 C CA  . GLY A 1 252 ? -4.018  4.317   48.652 1.00 74.18  ? 157  GLY A CA  1 
ATOM   1963 C C   . GLY A 1 252 ? -4.123  3.082   47.777 1.00 78.75  ? 157  GLY A C   1 
ATOM   1964 O O   . GLY A 1 252 ? -4.385  3.192   46.576 1.00 78.28  ? 157  GLY A O   1 
ATOM   1965 N N   . LEU A 1 253 ? -3.962  1.891   48.399 1.00 76.25  ? 158  LEU A N   1 
ATOM   1966 C CA  . LEU A 1 253 ? -4.062  0.580   47.757 1.00 77.81  ? 158  LEU A CA  1 
ATOM   1967 C C   . LEU A 1 253 ? -5.515  0.247   47.388 1.00 81.04  ? 158  LEU A C   1 
ATOM   1968 O O   . LEU A 1 253 ? -5.730  -0.462  46.410 1.00 82.38  ? 158  LEU A O   1 
ATOM   1969 C CB  . LEU A 1 253 ? -3.478  -0.524  48.654 1.00 79.90  ? 158  LEU A CB  1 
ATOM   1970 C CG  . LEU A 1 253 ? -1.945  -0.649  48.685 1.00 87.12  ? 158  LEU A CG  1 
ATOM   1971 C CD1 . LEU A 1 253 ? -1.483  -1.381  49.925 1.00 88.44  ? 158  LEU A CD1 1 
ATOM   1972 C CD2 . LEU A 1 253 ? -1.410  -1.362  47.441 1.00 92.17  ? 158  LEU A CD2 1 
ATOM   1973 N N   . ALA A 1 254 ? -6.507  0.759   48.143 1.00 75.77  ? 159  ALA A N   1 
ATOM   1974 C CA  . ALA A 1 254 ? -7.930  0.536   47.843 1.00 74.26  ? 159  ALA A CA  1 
ATOM   1975 C C   . ALA A 1 254 ? -8.389  1.401   46.648 1.00 77.26  ? 159  ALA A C   1 
ATOM   1976 O O   . ALA A 1 254 ? -9.356  1.042   45.971 1.00 75.95  ? 159  ALA A O   1 
ATOM   1977 C CB  . ALA A 1 254 ? -8.788  0.836   49.068 1.00 72.73  ? 159  ALA A CB  1 
ATOM   1978 N N   . SER A 1 255 ? -7.696  2.533   46.396 1.00 74.28  ? 160  SER A N   1 
ATOM   1979 C CA  . SER A 1 255 ? -8.025  3.463   45.309 1.00 74.10  ? 160  SER A CA  1 
ATOM   1980 C C   . SER A 1 255 ? -7.169  3.198   44.033 1.00 79.95  ? 160  SER A C   1 
ATOM   1981 O O   . SER A 1 255 ? -7.267  3.947   43.058 1.00 79.46  ? 160  SER A O   1 
ATOM   1982 C CB  . SER A 1 255 ? -7.857  4.907   45.777 1.00 77.40  ? 160  SER A CB  1 
ATOM   1983 O OG  . SER A 1 255 ? -6.548  5.139   46.271 1.00 91.40  ? 160  SER A OG  1 
ATOM   1984 N N   . LEU A 1 256 ? -6.387  2.099   44.030 1.00 78.42  ? 161  LEU A N   1 
ATOM   1985 C CA  . LEU A 1 256 ? -5.551  1.658   42.911 1.00 80.31  ? 161  LEU A CA  1 
ATOM   1986 C C   . LEU A 1 256 ? -6.407  1.388   41.638 1.00 84.84  ? 161  LEU A C   1 
ATOM   1987 O O   . LEU A 1 256 ? -5.969  1.851   40.581 1.00 86.27  ? 161  LEU A O   1 
ATOM   1988 C CB  . LEU A 1 256 ? -4.738  0.413   43.301 1.00 82.89  ? 161  LEU A CB  1 
ATOM   1989 C CG  . LEU A 1 256 ? -3.393  0.211   42.606 1.00 90.79  ? 161  LEU A CG  1 
ATOM   1990 C CD1 . LEU A 1 256 ? -2.373  1.271   43.021 1.00 91.14  ? 161  LEU A CD1 1 
ATOM   1991 C CD2 . LEU A 1 256 ? -2.829  -1.148  42.937 1.00 96.74  ? 161  LEU A CD2 1 
ATOM   1992 N N   . PRO A 1 257 ? -7.638  0.770   41.682 1.00 80.02  ? 162  PRO A N   1 
ATOM   1993 C CA  . PRO A 1 257 ? -8.415  0.588   40.434 1.00 80.13  ? 162  PRO A CA  1 
ATOM   1994 C C   . PRO A 1 257 ? -8.618  1.875   39.632 1.00 81.72  ? 162  PRO A C   1 
ATOM   1995 O O   . PRO A 1 257 ? -8.518  1.826   38.410 1.00 82.07  ? 162  PRO A O   1 
ATOM   1996 C CB  . PRO A 1 257 ? -9.775  0.057   40.916 1.00 81.32  ? 162  PRO A CB  1 
ATOM   1997 C CG  . PRO A 1 257 ? -9.762  0.156   42.398 1.00 83.95  ? 162  PRO A CG  1 
ATOM   1998 C CD  . PRO A 1 257 ? -8.335  0.126   42.816 1.00 80.55  ? 162  PRO A CD  1 
ATOM   1999 N N   . ALA A 1 258 ? -8.870  3.019   40.317 1.00 76.18  ? 163  ALA A N   1 
ATOM   2000 C CA  . ALA A 1 258 ? -9.057  4.348   39.718 1.00 74.31  ? 163  ALA A CA  1 
ATOM   2001 C C   . ALA A 1 258 ? -7.813  4.803   38.961 1.00 79.37  ? 163  ALA A C   1 
ATOM   2002 O O   . ALA A 1 258 ? -7.938  5.476   37.944 1.00 78.77  ? 163  ALA A O   1 
ATOM   2003 C CB  . ALA A 1 258 ? -9.399  5.364   40.795 1.00 72.79  ? 163  ALA A CB  1 
ATOM   2004 N N   . ILE A 1 259 ? -6.619  4.431   39.448 1.00 77.74  ? 164  ILE A N   1 
ATOM   2005 C CA  . ILE A 1 259 ? -5.355  4.776   38.797 1.00 80.06  ? 164  ILE A CA  1 
ATOM   2006 C C   . ILE A 1 259 ? -5.161  3.858   37.572 1.00 85.71  ? 164  ILE A C   1 
ATOM   2007 O O   . ILE A 1 259 ? -4.545  4.277   36.591 1.00 86.45  ? 164  ILE A O   1 
ATOM   2008 C CB  . ILE A 1 259 ? -4.163  4.688   39.798 1.00 85.00  ? 164  ILE A CB  1 
ATOM   2009 C CG1 . ILE A 1 259 ? -4.440  5.516   41.073 1.00 83.75  ? 164  ILE A CG1 1 
ATOM   2010 C CG2 . ILE A 1 259 ? -2.844  5.141   39.145 1.00 88.64  ? 164  ILE A CG2 1 
ATOM   2011 C CD1 . ILE A 1 259 ? -3.792  4.991   42.379 1.00 95.08  ? 164  ILE A CD1 1 
ATOM   2012 N N   . ILE A 1 260 ? -5.735  2.634   37.614 1.00 82.48  ? 165  ILE A N   1 
ATOM   2013 C CA  . ILE A 1 260 ? -5.596  1.620   36.568 1.00 84.14  ? 165  ILE A CA  1 
ATOM   2014 C C   . ILE A 1 260 ? -6.658  1.771   35.441 1.00 86.19  ? 165  ILE A C   1 
ATOM   2015 O O   . ILE A 1 260 ? -6.259  1.941   34.290 1.00 87.50  ? 165  ILE A O   1 
ATOM   2016 C CB  . ILE A 1 260 ? -5.641  0.192   37.191 1.00 88.63  ? 165  ILE A CB  1 
ATOM   2017 C CG1 . ILE A 1 260 ? -4.497  0.020   38.221 1.00 90.29  ? 165  ILE A CG1 1 
ATOM   2018 C CG2 . ILE A 1 260 ? -5.563  -0.899  36.104 1.00 92.46  ? 165  ILE A CG2 1 
ATOM   2019 C CD1 . ILE A 1 260 ? -4.603  -1.184  39.140 1.00 101.56 ? 165  ILE A CD1 1 
ATOM   2020 N N   . HIS A 1 261 ? -7.971  1.673   35.752 1.00 80.00  ? 166  HIS A N   1 
ATOM   2021 C CA  . HIS A 1 261 ? -9.054  1.667   34.756 1.00 79.34  ? 166  HIS A CA  1 
ATOM   2022 C C   . HIS A 1 261 ? -9.669  3.055   34.409 1.00 80.88  ? 166  HIS A C   1 
ATOM   2023 O O   . HIS A 1 261 ? -10.550 3.098   33.544 1.00 80.85  ? 166  HIS A O   1 
ATOM   2024 C CB  . HIS A 1 261 ? -10.192 0.753   35.221 1.00 79.79  ? 166  HIS A CB  1 
ATOM   2025 C CG  . HIS A 1 261 ? -9.786  -0.668  35.456 1.00 85.69  ? 166  HIS A CG  1 
ATOM   2026 N ND1 . HIS A 1 261 ? -8.994  -1.025  36.536 1.00 87.65  ? 166  HIS A ND1 1 
ATOM   2027 C CD2 . HIS A 1 261 ? -10.135 -1.788  34.784 1.00 89.85  ? 166  HIS A CD2 1 
ATOM   2028 C CE1 . HIS A 1 261 ? -8.855  -2.336  36.460 1.00 89.59  ? 166  HIS A CE1 1 
ATOM   2029 N NE2 . HIS A 1 261 ? -9.523  -2.840  35.422 1.00 91.48  ? 166  HIS A NE2 1 
ATOM   2030 N N   . ARG A 1 262 ? -9.236  4.164   35.036 1.00 75.39  ? 167  ARG A N   1 
ATOM   2031 C CA  . ARG A 1 262 ? -9.781  5.470   34.642 1.00 74.03  ? 167  ARG A CA  1 
ATOM   2032 C C   . ARG A 1 262 ? -8.956  6.046   33.508 1.00 80.47  ? 167  ARG A C   1 
ATOM   2033 O O   . ARG A 1 262 ? -7.725  6.032   33.574 1.00 80.78  ? 167  ARG A O   1 
ATOM   2034 C CB  . ARG A 1 262 ? -9.851  6.471   35.808 1.00 71.83  ? 167  ARG A CB  1 
ATOM   2035 C CG  . ARG A 1 262 ? -11.061 6.308   36.713 1.00 73.36  ? 167  ARG A CG  1 
ATOM   2036 C CD  . ARG A 1 262 ? -12.201 7.229   36.323 1.00 72.43  ? 167  ARG A CD  1 
ATOM   2037 N NE  . ARG A 1 262 ? -13.367 6.998   37.172 1.00 76.96  ? 167  ARG A NE  1 
ATOM   2038 C CZ  . ARG A 1 262 ? -14.272 7.918   37.484 1.00 86.34  ? 167  ARG A CZ  1 
ATOM   2039 N NH1 . ARG A 1 262 ? -14.153 9.158   37.026 1.00 78.12  ? 167  ARG A NH1 1 
ATOM   2040 N NH2 . ARG A 1 262 ? -15.300 7.608   38.264 1.00 64.02  ? 167  ARG A NH2 1 
ATOM   2041 N N   . ASN A 1 263 ? -9.640  6.523   32.454 1.00 78.47  ? 168  ASN A N   1 
ATOM   2042 C CA  . ASN A 1 263 ? -9.039  7.122   31.258 1.00 80.15  ? 168  ASN A CA  1 
ATOM   2043 C C   . ASN A 1 263 ? -9.973  8.159   30.620 1.00 85.18  ? 168  ASN A C   1 
ATOM   2044 O O   . ASN A 1 263 ? -11.177 8.180   30.897 1.00 83.47  ? 168  ASN A O   1 
ATOM   2045 C CB  . ASN A 1 263 ? -8.680  6.050   30.219 1.00 79.87  ? 168  ASN A CB  1 
ATOM   2046 C CG  . ASN A 1 263 ? -7.412  5.280   30.482 1.00 100.72 ? 168  ASN A CG  1 
ATOM   2047 O OD1 . ASN A 1 263 ? -6.303  5.801   30.333 1.00 92.89  ? 168  ASN A OD1 1 
ATOM   2048 N ND2 . ASN A 1 263 ? -7.545  3.984   30.747 1.00 94.02  ? 168  ASN A ND2 1 
ATOM   2049 N N   . VAL A 1 264 ? -9.404  9.014   29.757 1.00 84.09  ? 169  VAL A N   1 
ATOM   2050 C CA  . VAL A 1 264 ? -10.146 10.024  29.009 1.00 83.87  ? 169  VAL A CA  1 
ATOM   2051 C C   . VAL A 1 264 ? -10.583 9.353   27.672 1.00 88.16  ? 169  VAL A C   1 
ATOM   2052 O O   . VAL A 1 264 ? -9.769  8.731   26.977 1.00 88.70  ? 169  VAL A O   1 
ATOM   2053 C CB  . VAL A 1 264 ? -9.359  11.364  28.840 1.00 88.91  ? 169  VAL A CB  1 
ATOM   2054 C CG1 . VAL A 1 264 ? -7.970  11.160  28.235 1.00 91.48  ? 169  VAL A CG1 1 
ATOM   2055 C CG2 . VAL A 1 264 ? -10.158 12.399  28.057 1.00 88.63  ? 169  VAL A CG2 1 
ATOM   2056 N N   . PHE A 1 265 ? -11.896 9.415   27.392 1.00 84.02  ? 170  PHE A N   1 
ATOM   2057 C CA  . PHE A 1 265 ? -12.536 8.808   26.230 1.00 85.01  ? 170  PHE A CA  1 
ATOM   2058 C C   . PHE A 1 265 ? -13.530 9.748   25.561 1.00 90.73  ? 170  PHE A C   1 
ATOM   2059 O O   . PHE A 1 265 ? -14.148 10.566  26.242 1.00 89.09  ? 170  PHE A O   1 
ATOM   2060 C CB  . PHE A 1 265 ? -13.286 7.531   26.647 1.00 86.15  ? 170  PHE A CB  1 
ATOM   2061 C CG  . PHE A 1 265 ? -12.480 6.391   27.216 1.00 87.95  ? 170  PHE A CG  1 
ATOM   2062 C CD1 . PHE A 1 265 ? -11.811 5.505   26.378 1.00 93.20  ? 170  PHE A CD1 1 
ATOM   2063 C CD2 . PHE A 1 265 ? -12.483 6.130   28.579 1.00 88.46  ? 170  PHE A CD2 1 
ATOM   2064 C CE1 . PHE A 1 265 ? -11.097 4.424   26.903 1.00 94.94  ? 170  PHE A CE1 1 
ATOM   2065 C CE2 . PHE A 1 265 ? -11.792 5.035   29.100 1.00 91.98  ? 170  PHE A CE2 1 
ATOM   2066 C CZ  . PHE A 1 265 ? -11.096 4.195   28.260 1.00 92.49  ? 170  PHE A CZ  1 
ATOM   2067 N N   . PHE A 1 266 ? -13.724 9.582   24.239 1.00 90.57  ? 171  PHE A N   1 
ATOM   2068 C CA  . PHE A 1 266 ? -14.676 10.331  23.413 1.00 91.71  ? 171  PHE A CA  1 
ATOM   2069 C C   . PHE A 1 266 ? -16.063 9.655   23.393 1.00 95.65  ? 171  PHE A C   1 
ATOM   2070 O O   . PHE A 1 266 ? -16.199 8.502   23.820 1.00 94.97  ? 171  PHE A O   1 
ATOM   2071 C CB  . PHE A 1 266 ? -14.155 10.443  21.970 1.00 96.18  ? 171  PHE A CB  1 
ATOM   2072 C CG  . PHE A 1 266 ? -12.912 11.267  21.748 1.00 99.45  ? 171  PHE A CG  1 
ATOM   2073 C CD1 . PHE A 1 266 ? -13.003 12.612  21.406 1.00 103.42 ? 171  PHE A CD1 1 
ATOM   2074 C CD2 . PHE A 1 266 ? -11.652 10.682  21.795 1.00 103.24 ? 171  PHE A CD2 1 
ATOM   2075 C CE1 . PHE A 1 266 ? -11.851 13.366  21.156 1.00 105.84 ? 171  PHE A CE1 1 
ATOM   2076 C CE2 . PHE A 1 266 ? -10.501 11.437  21.549 1.00 107.54 ? 171  PHE A CE2 1 
ATOM   2077 C CZ  . PHE A 1 266 ? -10.608 12.774  21.229 1.00 105.96 ? 171  PHE A CZ  1 
ATOM   2078 N N   . ILE A 1 267 ? -17.080 10.368  22.859 1.00 92.68  ? 172  ILE A N   1 
ATOM   2079 C CA  . ILE A 1 267 ? -18.457 9.881   22.703 1.00 124.21 ? 172  ILE A CA  1 
ATOM   2080 C C   . ILE A 1 267 ? -18.847 10.001  21.221 1.00 147.22 ? 172  ILE A C   1 
ATOM   2081 O O   . ILE A 1 267 ? -19.374 9.058   20.631 1.00 105.98 ? 172  ILE A O   1 
ATOM   2082 C CB  . ILE A 1 267 ? -19.465 10.627  23.631 1.00 126.26 ? 172  ILE A CB  1 
ATOM   2083 C CG1 . ILE A 1 267 ? -18.982 10.665  25.105 1.00 124.84 ? 172  ILE A CG1 1 
ATOM   2084 C CG2 . ILE A 1 267 ? -20.876 10.009  23.524 1.00 127.99 ? 172  ILE A CG2 1 
ATOM   2085 C CD1 . ILE A 1 267 ? -19.656 11.734  25.989 1.00 131.08 ? 172  ILE A CD1 1 
ATOM   2086 N N   . ILE A 1 272 ? -16.633 15.536  22.488 1.00 93.99  ? 177  ILE A N   1 
ATOM   2087 C CA  . ILE A 1 272 ? -16.766 15.741  23.928 1.00 92.30  ? 177  ILE A CA  1 
ATOM   2088 C C   . ILE A 1 272 ? -16.072 14.586  24.681 1.00 94.66  ? 177  ILE A C   1 
ATOM   2089 O O   . ILE A 1 272 ? -16.483 13.424  24.564 1.00 93.47  ? 177  ILE A O   1 
ATOM   2090 C CB  . ILE A 1 272 ? -18.254 15.886  24.333 1.00 94.88  ? 177  ILE A CB  1 
ATOM   2091 N N   . THR A 1 273 ? -14.993 14.918  25.420 1.00 90.46  ? 178  THR A N   1 
ATOM   2092 C CA  . THR A 1 273 ? -14.190 13.967  26.196 1.00 88.82  ? 178  THR A CA  1 
ATOM   2093 C C   . THR A 1 273 ? -14.772 13.787  27.597 1.00 90.75  ? 178  THR A C   1 
ATOM   2094 O O   . THR A 1 273 ? -15.262 14.752  28.184 1.00 90.30  ? 178  THR A O   1 
ATOM   2095 C CB  . THR A 1 273 ? -12.725 14.425  26.286 1.00 95.16  ? 178  THR A CB  1 
ATOM   2096 O OG1 . THR A 1 273 ? -12.672 15.760  26.788 1.00 96.55  ? 178  THR A OG1 1 
ATOM   2097 C CG2 . THR A 1 273 ? -11.990 14.333  24.960 1.00 94.09  ? 178  THR A CG2 1 
ATOM   2098 N N   . VAL A 1 274 ? -14.714 12.553  28.133 1.00 85.61  ? 179  VAL A N   1 
ATOM   2099 C CA  . VAL A 1 274 ? -15.215 12.246  29.480 1.00 83.35  ? 179  VAL A CA  1 
ATOM   2100 C C   . VAL A 1 274 ? -14.156 11.476  30.282 1.00 83.81  ? 179  VAL A C   1 
ATOM   2101 O O   . VAL A 1 274 ? -13.468 10.611  29.734 1.00 84.63  ? 179  VAL A O   1 
ATOM   2102 C CB  . VAL A 1 274 ? -16.574 11.482  29.503 1.00 87.50  ? 179  VAL A CB  1 
ATOM   2103 C CG1 . VAL A 1 274 ? -17.739 12.399  29.156 1.00 87.61  ? 179  VAL A CG1 1 
ATOM   2104 C CG2 . VAL A 1 274 ? -16.565 10.239  28.609 1.00 88.68  ? 179  VAL A CG2 1 
ATOM   2105 N N   . CYS A 1 275 ? -14.029 11.799  31.574 1.00 76.41  ? 180  CYS A N   1 
ATOM   2106 C CA  . CYS A 1 275 ? -13.121 11.094  32.475 1.00 74.53  ? 180  CYS A CA  1 
ATOM   2107 C C   . CYS A 1 275 ? -13.928 9.993   33.152 1.00 77.57  ? 180  CYS A C   1 
ATOM   2108 O O   . CYS A 1 275 ? -14.664 10.257  34.113 1.00 76.15  ? 180  CYS A O   1 
ATOM   2109 C CB  . CYS A 1 275 ? -12.481 12.055  33.472 1.00 73.35  ? 180  CYS A CB  1 
ATOM   2110 S SG  . CYS A 1 275 ? -11.482 11.250  34.746 1.00 76.37  ? 180  CYS A SG  1 
ATOM   2111 N N   . ALA A 1 276 ? -13.873 8.780   32.578 1.00 74.79  ? 181  ALA A N   1 
ATOM   2112 C CA  . ALA A 1 276 ? -14.679 7.661   33.047 1.00 74.68  ? 181  ALA A CA  1 
ATOM   2113 C C   . ALA A 1 276 ? -13.872 6.383   33.279 1.00 79.35  ? 181  ALA A C   1 
ATOM   2114 O O   . ALA A 1 276 ? -12.721 6.264   32.852 1.00 80.11  ? 181  ALA A O   1 
ATOM   2115 C CB  . ALA A 1 276 ? -15.788 7.378   32.044 1.00 76.45  ? 181  ALA A CB  1 
ATOM   2116 N N   . PHE A 1 277 ? -14.507 5.434   33.984 1.00 75.19  ? 182  PHE A N   1 
ATOM   2117 C CA  . PHE A 1 277 ? -13.975 4.123   34.324 1.00 75.93  ? 182  PHE A CA  1 
ATOM   2118 C C   . PHE A 1 277 ? -14.269 3.148   33.188 1.00 82.22  ? 182  PHE A C   1 
ATOM   2119 O O   . PHE A 1 277 ? -15.384 3.156   32.660 1.00 82.43  ? 182  PHE A O   1 
ATOM   2120 C CB  . PHE A 1 277 ? -14.621 3.652   35.641 1.00 76.58  ? 182  PHE A CB  1 
ATOM   2121 C CG  . PHE A 1 277 ? -13.938 2.496   36.327 1.00 78.79  ? 182  PHE A CG  1 
ATOM   2122 C CD1 . PHE A 1 277 ? -14.204 1.184   35.948 1.00 83.44  ? 182  PHE A CD1 1 
ATOM   2123 C CD2 . PHE A 1 277 ? -13.056 2.714   37.376 1.00 79.99  ? 182  PHE A CD2 1 
ATOM   2124 C CE1 . PHE A 1 277 ? -13.570 0.115   36.581 1.00 85.56  ? 182  PHE A CE1 1 
ATOM   2125 C CE2 . PHE A 1 277 ? -12.434 1.643   38.021 1.00 84.10  ? 182  PHE A CE2 1 
ATOM   2126 C CZ  . PHE A 1 277 ? -12.698 0.351   37.622 1.00 84.08  ? 182  PHE A CZ  1 
ATOM   2127 N N   . HIS A 1 278 ? -13.287 2.317   32.802 1.00 80.59  ? 183  HIS A N   1 
ATOM   2128 C CA  . HIS A 1 278 ? -13.493 1.331   31.739 1.00 82.72  ? 183  HIS A CA  1 
ATOM   2129 C C   . HIS A 1 278 ? -13.743 -0.040  32.347 1.00 88.66  ? 183  HIS A C   1 
ATOM   2130 O O   . HIS A 1 278 ? -12.950 -0.515  33.161 1.00 88.33  ? 183  HIS A O   1 
ATOM   2131 C CB  . HIS A 1 278 ? -12.317 1.281   30.749 1.00 85.06  ? 183  HIS A CB  1 
ATOM   2132 C CG  . HIS A 1 278 ? -12.410 0.139   29.781 1.00 90.99  ? 183  HIS A CG  1 
ATOM   2133 N ND1 . HIS A 1 278 ? -11.616 -0.986  29.916 1.00 95.17  ? 183  HIS A ND1 1 
ATOM   2134 C CD2 . HIS A 1 278 ? -13.250 -0.043  28.734 1.00 93.45  ? 183  HIS A CD2 1 
ATOM   2135 C CE1 . HIS A 1 278 ? -11.968 -1.795  28.929 1.00 96.88  ? 183  HIS A CE1 1 
ATOM   2136 N NE2 . HIS A 1 278 ? -12.948 -1.270  28.192 1.00 96.23  ? 183  HIS A NE2 1 
ATOM   2137 N N   . TYR A 1 279 ? -14.842 -0.676  31.923 1.00 87.32  ? 184  TYR A N   1 
ATOM   2138 C CA  . TYR A 1 279 ? -15.271 -1.989  32.385 1.00 89.26  ? 184  TYR A CA  1 
ATOM   2139 C C   . TYR A 1 279 ? -14.863 -3.080  31.390 1.00 96.45  ? 184  TYR A C   1 
ATOM   2140 O O   . TYR A 1 279 ? -15.117 -2.948  30.187 1.00 96.49  ? 184  TYR A O   1 
ATOM   2141 C CB  . TYR A 1 279 ? -16.793 -2.000  32.605 1.00 90.71  ? 184  TYR A CB  1 
ATOM   2142 C CG  . TYR A 1 279 ? -17.266 -1.040  33.677 1.00 90.51  ? 184  TYR A CG  1 
ATOM   2143 C CD1 . TYR A 1 279 ? -17.325 -1.429  35.014 1.00 92.23  ? 184  TYR A CD1 1 
ATOM   2144 C CD2 . TYR A 1 279 ? -17.677 0.252   33.354 1.00 89.49  ? 184  TYR A CD2 1 
ATOM   2145 C CE1 . TYR A 1 279 ? -17.759 -0.549  36.006 1.00 90.87  ? 184  TYR A CE1 1 
ATOM   2146 C CE2 . TYR A 1 279 ? -18.115 1.140   34.337 1.00 88.08  ? 184  TYR A CE2 1 
ATOM   2147 C CZ  . TYR A 1 279 ? -18.156 0.734   35.662 1.00 96.56  ? 184  TYR A CZ  1 
ATOM   2148 O OH  . TYR A 1 279 ? -18.591 1.601   36.636 1.00 97.76  ? 184  TYR A OH  1 
ATOM   2149 N N   . GLU A 1 280 ? -14.237 -4.163  31.907 1.00 95.55  ? 185  GLU A N   1 
ATOM   2150 C CA  . GLU A 1 280 ? -13.776 -5.317  31.124 1.00 128.40 ? 185  GLU A CA  1 
ATOM   2151 C C   . GLU A 1 280 ? -14.953 -6.153  30.629 1.00 143.46 ? 185  GLU A C   1 
ATOM   2152 O O   . GLU A 1 280 ? -15.462 -5.913  29.538 1.00 100.99 ? 185  GLU A O   1 
ATOM   2153 C CB  . GLU A 1 280 ? -12.831 -6.194  31.959 1.00 131.48 ? 185  GLU A CB  1 
ATOM   2154 N N   . THR A 1 285 ? -20.306 -9.339  34.772 1.00 164.07 ? 190  THR A N   1 
ATOM   2155 C CA  . THR A 1 285 ? -19.738 -10.595 35.255 1.00 167.39 ? 190  THR A CA  1 
ATOM   2156 C C   . THR A 1 285 ? -18.722 -10.290 36.380 1.00 168.70 ? 190  THR A C   1 
ATOM   2157 O O   . THR A 1 285 ? -18.906 -10.752 37.508 1.00 168.48 ? 190  THR A O   1 
ATOM   2158 C CB  . THR A 1 285 ? -19.110 -11.387 34.080 1.00 176.02 ? 190  THR A CB  1 
ATOM   2159 O OG1 . THR A 1 285 ? -20.039 -11.456 32.995 1.00 176.46 ? 190  THR A OG1 1 
ATOM   2160 C CG2 . THR A 1 285 ? -18.684 -12.801 34.475 1.00 175.53 ? 190  THR A CG2 1 
ATOM   2161 N N   . LEU A 1 286 ? -17.670 -9.505  36.063 1.00 162.61 ? 191  LEU A N   1 
ATOM   2162 C CA  . LEU A 1 286 ? -16.594 -9.112  36.982 1.00 160.13 ? 191  LEU A CA  1 
ATOM   2163 C C   . LEU A 1 286 ? -16.982 -7.918  37.908 1.00 159.77 ? 191  LEU A C   1 
ATOM   2164 O O   . LEU A 1 286 ? -16.586 -7.971  39.074 1.00 158.40 ? 191  LEU A O   1 
ATOM   2165 C CB  . LEU A 1 286 ? -15.314 -8.757  36.204 1.00 159.72 ? 191  LEU A CB  1 
ATOM   2166 C CG  . LEU A 1 286 ? -14.638 -9.906  35.463 1.00 169.15 ? 191  LEU A CG  1 
ATOM   2167 N N   . PRO A 1 287 ? -17.718 -6.851  37.473 1.00 154.54 ? 192  PRO A N   1 
ATOM   2168 C CA  . PRO A 1 287 ? -18.031 -5.752  38.410 1.00 151.07 ? 192  PRO A CA  1 
ATOM   2169 C C   . PRO A 1 287 ? -19.053 -6.133  39.489 1.00 155.86 ? 192  PRO A C   1 
ATOM   2170 O O   . PRO A 1 287 ? -19.148 -5.426  40.492 1.00 153.11 ? 192  PRO A O   1 
ATOM   2171 C CB  . PRO A 1 287 ? -18.600 -4.651  37.502 1.00 151.12 ? 192  PRO A CB  1 
ATOM   2172 C CG  . PRO A 1 287 ? -18.269 -5.067  36.098 1.00 157.50 ? 192  PRO A CG  1 
ATOM   2173 C CD  . PRO A 1 287 ? -18.270 -6.556  36.134 1.00 156.78 ? 192  PRO A CD  1 
ATOM   2174 N N   . ILE A 1 288 ? -19.812 -7.231  39.287 1.00 156.16 ? 193  ILE A N   1 
ATOM   2175 C CA  . ILE A 1 288 ? -20.800 -7.739  40.245 1.00 157.47 ? 193  ILE A CA  1 
ATOM   2176 C C   . ILE A 1 288 ? -20.071 -8.301  41.472 1.00 161.41 ? 193  ILE A C   1 
ATOM   2177 O O   . ILE A 1 288 ? -20.403 -7.933  42.600 1.00 159.74 ? 193  ILE A O   1 
ATOM   2178 C CB  . ILE A 1 288 ? -21.720 -8.801  39.587 1.00 165.17 ? 193  ILE A CB  1 
ATOM   2179 C CG1 . ILE A 1 288 ? -23.108 -8.835  40.251 1.00 166.54 ? 193  ILE A CG1 1 
ATOM   2180 N N   . GLY A 1 289 ? -19.061 -9.140  41.226 1.00 159.35 ? 194  GLY A N   1 
ATOM   2181 C CA  . GLY A 1 289 ? -18.232 -9.768  42.250 1.00 159.63 ? 194  GLY A CA  1 
ATOM   2182 C C   . GLY A 1 289 ? -17.176 -8.860  42.854 1.00 159.64 ? 194  GLY A C   1 
ATOM   2183 O O   . GLY A 1 289 ? -16.418 -9.300  43.721 1.00 159.44 ? 194  GLY A O   1 
ATOM   2184 N N   . LEU A 1 290 ? -17.111 -7.591  42.396 1.00 153.17 ? 195  LEU A N   1 
ATOM   2185 C CA  . LEU A 1 290 ? -16.181 -6.571  42.890 1.00 149.85 ? 195  LEU A CA  1 
ATOM   2186 C C   . LEU A 1 290 ? -16.960 -5.450  43.604 1.00 150.85 ? 195  LEU A C   1 
ATOM   2187 O O   . LEU A 1 290 ? -16.474 -4.912  44.602 1.00 148.42 ? 195  LEU A O   1 
ATOM   2188 C CB  . LEU A 1 290 ? -15.319 -6.002  41.744 1.00 149.34 ? 195  LEU A CB  1 
ATOM   2189 C CG  . LEU A 1 290 ? -14.155 -5.066  42.130 1.00 151.60 ? 195  LEU A CG  1 
ATOM   2190 C CD1 . LEU A 1 290 ? -13.001 -5.834  42.779 1.00 153.17 ? 195  LEU A CD1 1 
ATOM   2191 C CD2 . LEU A 1 290 ? -13.646 -4.308  40.915 1.00 153.83 ? 195  LEU A CD2 1 
ATOM   2192 N N   . GLY A 1 291 ? -18.156 -5.132  43.095 1.00 147.40 ? 196  GLY A N   1 
ATOM   2193 C CA  . GLY A 1 291 ? -19.057 -4.130  43.665 1.00 144.69 ? 196  GLY A CA  1 
ATOM   2194 C C   . GLY A 1 291 ? -19.686 -4.586  44.971 1.00 148.33 ? 196  GLY A C   1 
ATOM   2195 O O   . GLY A 1 291 ? -20.162 -3.764  45.759 1.00 145.31 ? 196  GLY A O   1 
ATOM   2196 N N   . LEU A 1 292 ? -19.696 -5.914  45.190 1.00 147.89 ? 197  LEU A N   1 
ATOM   2197 C CA  . LEU A 1 292 ? -20.189 -6.593  46.388 1.00 148.88 ? 197  LEU A CA  1 
ATOM   2198 C C   . LEU A 1 292 ? -19.077 -6.616  47.452 1.00 151.55 ? 197  LEU A C   1 
ATOM   2199 O O   . LEU A 1 292 ? -19.376 -6.638  48.647 1.00 151.00 ? 197  LEU A O   1 
ATOM   2200 C CB  . LEU A 1 292 ? -20.643 -8.032  46.011 1.00 153.39 ? 197  LEU A CB  1 
ATOM   2201 C CG  . LEU A 1 292 ? -21.679 -8.796  46.882 1.00 160.36 ? 197  LEU A CG  1 
ATOM   2202 C CD1 . LEU A 1 292 ? -21.076 -9.370  48.145 1.00 161.31 ? 197  LEU A CD1 1 
ATOM   2203 C CD2 . LEU A 1 292 ? -22.954 -7.997  47.131 1.00 161.33 ? 197  LEU A CD2 1 
ATOM   2204 N N   . THR A 1 293 ? -17.797 -6.596  47.010 1.00 146.99 ? 198  THR A N   1 
ATOM   2205 C CA  . THR A 1 293 ? -16.617 -6.620  47.880 1.00 145.47 ? 198  THR A CA  1 
ATOM   2206 C C   . THR A 1 293 ? -16.386 -5.264  48.573 1.00 143.90 ? 198  THR A C   1 
ATOM   2207 O O   . THR A 1 293 ? -15.927 -5.251  49.715 1.00 142.92 ? 198  THR A O   1 
ATOM   2208 C CB  . THR A 1 293 ? -15.376 -7.023  47.081 1.00 154.60 ? 198  THR A CB  1 
ATOM   2209 N N   . LYS A 1 294 ? -16.691 -4.135  47.891 1.00 136.66 ? 199  LYS A N   1 
ATOM   2210 C CA  . LYS A 1 294 ? -16.509 -2.781  48.436 1.00 132.28 ? 199  LYS A CA  1 
ATOM   2211 C C   . LYS A 1 294 ? -17.544 -2.446  49.521 1.00 132.82 ? 199  LYS A C   1 
ATOM   2212 O O   . LYS A 1 294 ? -17.195 -1.766  50.479 1.00 130.14 ? 199  LYS A O   1 
ATOM   2213 C CB  . LYS A 1 294 ? -16.572 -1.718  47.327 1.00 133.05 ? 199  LYS A CB  1 
ATOM   2214 C CG  . LYS A 1 294 ? -15.343 -1.693  46.434 1.00 147.44 ? 199  LYS A CG  1 
ATOM   2215 N N   . ASN A 1 295 ? -18.804 -2.899  49.362 1.00 129.64 ? 200  ASN A N   1 
ATOM   2216 C CA  . ASN A 1 295 ? -19.894 -2.649  50.314 1.00 128.61 ? 200  ASN A CA  1 
ATOM   2217 C C   . ASN A 1 295 ? -19.670 -3.407  51.630 1.00 132.57 ? 200  ASN A C   1 
ATOM   2218 O O   . ASN A 1 295 ? -19.871 -2.831  52.700 1.00 130.30 ? 200  ASN A O   1 
ATOM   2219 C CB  . ASN A 1 295 ? -21.249 -3.042  49.703 1.00 130.52 ? 200  ASN A CB  1 
ATOM   2220 C CG  . ASN A 1 295 ? -22.433 -2.919  50.640 1.00 150.74 ? 200  ASN A CG  1 
ATOM   2221 O OD1 . ASN A 1 295 ? -22.676 -1.872  51.253 1.00 145.27 ? 200  ASN A OD1 1 
ATOM   2222 N ND2 . ASN A 1 295 ? -23.209 -3.988  50.754 1.00 142.25 ? 200  ASN A ND2 1 
ATOM   2223 N N   . ILE A 1 296 ? -19.254 -4.689  51.542 1.00 131.53 ? 201  ILE A N   1 
ATOM   2224 C CA  . ILE A 1 296 ? -19.013 -5.576  52.684 1.00 132.83 ? 201  ILE A CA  1 
ATOM   2225 C C   . ILE A 1 296 ? -17.680 -5.202  53.418 1.00 134.82 ? 201  ILE A C   1 
ATOM   2226 O O   . ILE A 1 296 ? -17.392 -5.765  54.479 1.00 135.43 ? 201  ILE A O   1 
ATOM   2227 C CB  . ILE A 1 296 ? -19.029 -7.071  52.213 1.00 139.86 ? 201  ILE A CB  1 
ATOM   2228 C CG1 . ILE A 1 296 ? -19.427 -8.039  53.347 1.00 142.79 ? 201  ILE A CG1 1 
ATOM   2229 C CG2 . ILE A 1 296 ? -17.743 -7.507  51.502 1.00 141.27 ? 201  ILE A CG2 1 
ATOM   2230 N N   . LEU A 1 297 ? -16.901 -4.241  52.877 1.00 128.79 ? 202  LEU A N   1 
ATOM   2231 C CA  . LEU A 1 297 ? -15.631 -3.818  53.469 1.00 127.03 ? 202  LEU A CA  1 
ATOM   2232 C C   . LEU A 1 297 ? -15.643 -2.334  53.825 1.00 125.89 ? 202  LEU A C   1 
ATOM   2233 O O   . LEU A 1 297 ? -15.177 -1.979  54.899 1.00 124.16 ? 202  LEU A O   1 
ATOM   2234 C CB  . LEU A 1 297 ? -14.460 -4.124  52.497 1.00 128.37 ? 202  LEU A CB  1 
ATOM   2235 C CG  . LEU A 1 297 ? -12.979 -3.918  52.938 1.00 132.78 ? 202  LEU A CG  1 
ATOM   2236 C CD1 . LEU A 1 297 ? -12.474 -2.514  52.648 1.00 130.33 ? 202  LEU A CD1 1 
ATOM   2237 C CD2 . LEU A 1 297 ? -12.684 -4.406  54.359 1.00 135.88 ? 202  LEU A CD2 1 
ATOM   2238 N N   . GLY A 1 298 ? -16.091 -1.491  52.902 1.00 120.23 ? 203  GLY A N   1 
ATOM   2239 C CA  . GLY A 1 298 ? -16.094 -0.043  53.074 1.00 116.91 ? 203  GLY A CA  1 
ATOM   2240 C C   . GLY A 1 298 ? -17.340 0.623   53.613 1.00 118.22 ? 203  GLY A C   1 
ATOM   2241 O O   . GLY A 1 298 ? -17.416 1.853   53.581 1.00 115.77 ? 203  GLY A O   1 
ATOM   2242 N N   . PHE A 1 299 ? -18.329 -0.160  54.093 1.00 115.08 ? 204  PHE A N   1 
ATOM   2243 C CA  . PHE A 1 299 ? -19.593 0.384   54.595 1.00 113.82 ? 204  PHE A CA  1 
ATOM   2244 C C   . PHE A 1 299 ? -20.309 -0.581  55.539 1.00 115.27 ? 204  PHE A C   1 
ATOM   2245 O O   . PHE A 1 299 ? -20.862 -0.102  56.522 1.00 114.59 ? 204  PHE A O   1 
ATOM   2246 C CB  . PHE A 1 299 ? -20.571 0.795   53.465 1.00 116.65 ? 204  PHE A CB  1 
ATOM   2247 C CG  . PHE A 1 299 ? -21.495 1.927   53.871 1.00 118.07 ? 204  PHE A CG  1 
ATOM   2248 C CD1 . PHE A 1 299 ? -22.708 1.667   54.499 1.00 123.35 ? 204  PHE A CD1 1 
ATOM   2249 C CD2 . PHE A 1 299 ? -21.125 3.255   53.677 1.00 118.77 ? 204  PHE A CD2 1 
ATOM   2250 C CE1 . PHE A 1 299 ? -23.544 2.712   54.907 1.00 123.93 ? 204  PHE A CE1 1 
ATOM   2251 C CE2 . PHE A 1 299 ? -21.965 4.303   54.078 1.00 121.29 ? 204  PHE A CE2 1 
ATOM   2252 C CZ  . PHE A 1 299 ? -23.174 4.025   54.684 1.00 120.95 ? 204  PHE A CZ  1 
ATOM   2253 N N   . LEU A 1 300 ? -20.369 -1.895  55.242 1.00 110.48 ? 205  LEU A N   1 
ATOM   2254 C CA  . LEU A 1 300 ? -21.085 -2.811  56.145 1.00 110.59 ? 205  LEU A CA  1 
ATOM   2255 C C   . LEU A 1 300 ? -20.229 -3.214  57.356 1.00 110.21 ? 205  LEU A C   1 
ATOM   2256 O O   . LEU A 1 300 ? -20.739 -3.213  58.478 1.00 109.80 ? 205  LEU A O   1 
ATOM   2257 C CB  . LEU A 1 300 ? -21.602 -4.073  55.433 1.00 113.88 ? 205  LEU A CB  1 
ATOM   2258 C CG  . LEU A 1 300 ? -22.897 -3.894  54.654 1.00 119.46 ? 205  LEU A CG  1 
ATOM   2259 N N   . PHE A 1 301 ? -18.954 -3.559  57.135 1.00 104.09 ? 206  PHE A N   1 
ATOM   2260 C CA  . PHE A 1 301 ? -18.040 -4.000  58.191 1.00 103.07 ? 206  PHE A CA  1 
ATOM   2261 C C   . PHE A 1 301 ? -17.605 -2.849  59.129 1.00 101.63 ? 206  PHE A C   1 
ATOM   2262 O O   . PHE A 1 301 ? -17.593 -3.094  60.331 1.00 100.81 ? 206  PHE A O   1 
ATOM   2263 C CB  . PHE A 1 301 ? -16.797 -4.676  57.599 1.00 106.12 ? 206  PHE A CB  1 
ATOM   2264 N N   . PRO A 1 302 ? -17.224 -1.623  58.661 1.00 94.94  ? 207  PRO A N   1 
ATOM   2265 C CA  . PRO A 1 302 ? -16.777 -0.587  59.612 1.00 91.70  ? 207  PRO A CA  1 
ATOM   2266 C C   . PRO A 1 302 ? -17.926 0.030   60.388 1.00 91.96  ? 207  PRO A C   1 
ATOM   2267 O O   . PRO A 1 302 ? -17.782 0.217   61.592 1.00 90.99  ? 207  PRO A O   1 
ATOM   2268 C CB  . PRO A 1 302 ? -16.099 0.463   58.725 1.00 92.12  ? 207  PRO A CB  1 
ATOM   2269 C CG  . PRO A 1 302 ? -16.059 -0.118  57.361 1.00 98.28  ? 207  PRO A CG  1 
ATOM   2270 C CD  . PRO A 1 302 ? -17.151 -1.114  57.277 1.00 96.10  ? 207  PRO A CD  1 
ATOM   2271 N N   . PHE A 1 303 ? -19.069 0.314   59.715 1.00 86.71  ? 208  PHE A N   1 
ATOM   2272 C CA  . PHE A 1 303 ? -20.269 0.890   60.333 1.00 85.57  ? 208  PHE A CA  1 
ATOM   2273 C C   . PHE A 1 303 ? -20.819 -0.044  61.418 1.00 88.74  ? 208  PHE A C   1 
ATOM   2274 O O   . PHE A 1 303 ? -21.481 0.419   62.347 1.00 87.46  ? 208  PHE A O   1 
ATOM   2275 C CB  . PHE A 1 303 ? -21.344 1.176   59.276 1.00 88.23  ? 208  PHE A CB  1 
ATOM   2276 C CG  . PHE A 1 303 ? -22.479 2.051   59.752 1.00 90.13  ? 208  PHE A CG  1 
ATOM   2277 N N   . LEU A 1 304 ? -20.524 -1.355  61.299 1.00 86.30  ? 209  LEU A N   1 
ATOM   2278 C CA  . LEU A 1 304 ? -20.894 -2.386  62.266 1.00 87.64  ? 209  LEU A CA  1 
ATOM   2279 C C   . LEU A 1 304 ? -20.004 -2.240  63.509 1.00 87.34  ? 209  LEU A C   1 
ATOM   2280 O O   . LEU A 1 304 ? -20.515 -2.288  64.628 1.00 87.05  ? 209  LEU A O   1 
ATOM   2281 C CB  . LEU A 1 304 ? -20.759 -3.782  61.627 1.00 90.79  ? 209  LEU A CB  1 
ATOM   2282 C CG  . LEU A 1 304 ? -21.322 -4.969  62.410 1.00 99.53  ? 209  LEU A CG  1 
ATOM   2283 C CD1 . LEU A 1 304 ? -21.969 -5.977  61.477 1.00 103.53 ? 209  LEU A CD1 1 
ATOM   2284 C CD2 . LEU A 1 304 ? -20.242 -5.649  63.253 1.00 102.99 ? 209  LEU A CD2 1 
ATOM   2285 N N   . ILE A 1 305 ? -18.680 -2.040  63.301 1.00 80.31  ? 210  ILE A N   1 
ATOM   2286 C CA  . ILE A 1 305 ? -17.686 -1.872  64.366 1.00 78.24  ? 210  ILE A CA  1 
ATOM   2287 C C   . ILE A 1 305 ? -17.939 -0.532  65.081 1.00 77.26  ? 210  ILE A C   1 
ATOM   2288 O O   . ILE A 1 305 ? -17.979 -0.503  66.311 1.00 76.37  ? 210  ILE A O   1 
ATOM   2289 C CB  . ILE A 1 305 ? -16.233 -1.986  63.807 1.00 81.36  ? 210  ILE A CB  1 
ATOM   2290 C CG1 . ILE A 1 305 ? -15.989 -3.379  63.178 1.00 84.86  ? 210  ILE A CG1 1 
ATOM   2291 C CG2 . ILE A 1 305 ? -15.183 -1.706  64.895 1.00 81.37  ? 210  ILE A CG2 1 
ATOM   2292 C CD1 . ILE A 1 305 ? -14.775 -3.477  62.204 1.00 92.99  ? 210  ILE A CD1 1 
ATOM   2293 N N   . ILE A 1 306 ? -18.145 0.552   64.304 1.00 70.74  ? 211  ILE A N   1 
ATOM   2294 C CA  . ILE A 1 306 ? -18.401 1.921   64.763 1.00 68.04  ? 211  ILE A CA  1 
ATOM   2295 C C   . ILE A 1 306 ? -19.651 1.964   65.682 1.00 73.58  ? 211  ILE A C   1 
ATOM   2296 O O   . ILE A 1 306 ? -19.548 2.481   66.798 1.00 71.97  ? 211  ILE A O   1 
ATOM   2297 C CB  . ILE A 1 306 ? -18.531 2.856   63.524 1.00 69.57  ? 211  ILE A CB  1 
ATOM   2298 C CG1 . ILE A 1 306 ? -17.130 3.223   62.976 1.00 68.54  ? 211  ILE A CG1 1 
ATOM   2299 C CG2 . ILE A 1 306 ? -19.341 4.113   63.821 1.00 69.25  ? 211  ILE A CG2 1 
ATOM   2300 C CD1 . ILE A 1 306 ? -17.068 3.741   61.549 1.00 70.89  ? 211  ILE A CD1 1 
ATOM   2301 N N   . LEU A 1 307 ? -20.801 1.399   65.234 1.00 73.09  ? 212  LEU A N   1 
ATOM   2302 C CA  . LEU A 1 307 ? -22.054 1.378   66.002 1.00 74.57  ? 212  LEU A CA  1 
ATOM   2303 C C   . LEU A 1 307 ? -21.875 0.624   67.318 1.00 79.08  ? 212  LEU A C   1 
ATOM   2304 O O   . LEU A 1 307 ? -22.317 1.139   68.333 1.00 79.28  ? 212  LEU A O   1 
ATOM   2305 C CB  . LEU A 1 307 ? -23.218 0.764   65.191 1.00 77.39  ? 212  LEU A CB  1 
ATOM   2306 C CG  . LEU A 1 307 ? -24.621 0.831   65.833 1.00 84.38  ? 212  LEU A CG  1 
ATOM   2307 C CD1 . LEU A 1 307 ? -25.398 2.042   65.334 1.00 83.72  ? 212  LEU A CD1 1 
ATOM   2308 C CD2 . LEU A 1 307 ? -25.410 -0.438  65.560 1.00 90.30  ? 212  LEU A CD2 1 
ATOM   2309 N N   . THR A 1 308 ? -21.222 -0.563  67.311 1.00 76.29  ? 213  THR A N   1 
ATOM   2310 C CA  . THR A 1 308 ? -20.976 -1.372  68.517 1.00 77.35  ? 213  THR A CA  1 
ATOM   2311 C C   . THR A 1 308 ? -20.159 -0.546  69.554 1.00 79.16  ? 213  THR A C   1 
ATOM   2312 O O   . THR A 1 308 ? -20.504 -0.553  70.739 1.00 78.43  ? 213  THR A O   1 
ATOM   2313 C CB  . THR A 1 308 ? -20.287 -2.702  68.142 1.00 86.53  ? 213  THR A CB  1 
ATOM   2314 O OG1 . THR A 1 308 ? -21.215 -3.492  67.396 1.00 87.03  ? 213  THR A OG1 1 
ATOM   2315 C CG2 . THR A 1 308 ? -19.824 -3.506  69.363 1.00 86.82  ? 213  THR A CG2 1 
ATOM   2316 N N   . SER A 1 309 ? -19.114 0.176   69.099 1.00 74.66  ? 214  SER A N   1 
ATOM   2317 C CA  . SER A 1 309 ? -18.289 1.033   69.951 1.00 73.46  ? 214  SER A CA  1 
ATOM   2318 C C   . SER A 1 309 ? -19.125 2.142   70.581 1.00 77.57  ? 214  SER A C   1 
ATOM   2319 O O   . SER A 1 309 ? -19.116 2.271   71.799 1.00 77.34  ? 214  SER A O   1 
ATOM   2320 C CB  . SER A 1 309 ? -17.136 1.646   69.160 1.00 76.63  ? 214  SER A CB  1 
ATOM   2321 O OG  . SER A 1 309 ? -16.129 0.695   68.859 1.00 89.91  ? 214  SER A OG  1 
ATOM   2322 N N   . TYR A 1 310 ? -19.892 2.887   69.760 1.00 74.57  ? 215  TYR A N   1 
ATOM   2323 C CA  . TYR A 1 310 ? -20.713 4.003   70.208 1.00 74.10  ? 215  TYR A CA  1 
ATOM   2324 C C   . TYR A 1 310 ? -21.958 3.604   70.953 1.00 79.33  ? 215  TYR A C   1 
ATOM   2325 O O   . TYR A 1 310 ? -22.420 4.416   71.745 1.00 78.77  ? 215  TYR A O   1 
ATOM   2326 C CB  . TYR A 1 310 ? -21.124 4.902   69.057 1.00 75.52  ? 215  TYR A CB  1 
ATOM   2327 C CG  . TYR A 1 310 ? -19.958 5.603   68.410 1.00 76.50  ? 215  TYR A CG  1 
ATOM   2328 C CD1 . TYR A 1 310 ? -19.834 5.649   67.031 1.00 78.85  ? 215  TYR A CD1 1 
ATOM   2329 C CD2 . TYR A 1 310 ? -18.971 6.215   69.179 1.00 76.41  ? 215  TYR A CD2 1 
ATOM   2330 C CE1 . TYR A 1 310 ? -18.756 6.279   66.429 1.00 80.47  ? 215  TYR A CE1 1 
ATOM   2331 C CE2 . TYR A 1 310 ? -17.884 6.843   68.588 1.00 76.83  ? 215  TYR A CE2 1 
ATOM   2332 C CZ  . TYR A 1 310 ? -17.789 6.886   67.209 1.00 88.66  ? 215  TYR A CZ  1 
ATOM   2333 O OH  . TYR A 1 310 ? -16.715 7.462   66.584 1.00 93.21  ? 215  TYR A OH  1 
ATOM   2334 N N   . THR A 1 311 ? -22.521 2.403   70.721 1.00 78.68  ? 216  THR A N   1 
ATOM   2335 C CA  . THR A 1 311 ? -23.715 2.007   71.465 1.00 81.28  ? 216  THR A CA  1 
ATOM   2336 C C   . THR A 1 311 ? -23.269 1.756   72.921 1.00 85.70  ? 216  THR A C   1 
ATOM   2337 O O   . THR A 1 311 ? -23.993 2.130   73.834 1.00 86.38  ? 216  THR A O   1 
ATOM   2338 C CB  . THR A 1 311 ? -24.496 0.831   70.804 1.00 96.78  ? 216  THR A CB  1 
ATOM   2339 O OG1 . THR A 1 311 ? -25.799 0.731   71.388 1.00 103.00 ? 216  THR A OG1 1 
ATOM   2340 C CG2 . THR A 1 311 ? -23.782 -0.524  70.880 1.00 96.56  ? 216  THR A CG2 1 
ATOM   2341 N N   . LEU A 1 312 ? -22.039 1.241   73.119 1.00 81.72  ? 217  LEU A N   1 
ATOM   2342 C CA  . LEU A 1 312 ? -21.468 0.966   74.432 1.00 81.85  ? 217  LEU A CA  1 
ATOM   2343 C C   . LEU A 1 312 ? -20.960 2.221   75.124 1.00 82.99  ? 217  LEU A C   1 
ATOM   2344 O O   . LEU A 1 312 ? -21.054 2.302   76.347 1.00 82.93  ? 217  LEU A O   1 
ATOM   2345 C CB  . LEU A 1 312 ? -20.310 -0.042  74.325 1.00 82.66  ? 217  LEU A CB  1 
ATOM   2346 C CG  . LEU A 1 312 ? -20.586 -1.533  74.609 1.00 91.17  ? 217  LEU A CG  1 
ATOM   2347 C CD1 . LEU A 1 312 ? -21.005 -1.784  76.065 1.00 92.92  ? 217  LEU A CD1 1 
ATOM   2348 C CD2 . LEU A 1 312 ? -21.545 -2.163  73.586 1.00 96.57  ? 217  LEU A CD2 1 
ATOM   2349 N N   . ILE A 1 313 ? -20.395 3.174   74.371 1.00 77.84  ? 218  ILE A N   1 
ATOM   2350 C CA  . ILE A 1 313 ? -19.820 4.389   74.953 1.00 76.85  ? 218  ILE A CA  1 
ATOM   2351 C C   . ILE A 1 313 ? -20.921 5.408   75.308 1.00 80.56  ? 218  ILE A C   1 
ATOM   2352 O O   . ILE A 1 313 ? -20.864 5.964   76.406 1.00 79.76  ? 218  ILE A O   1 
ATOM   2353 C CB  . ILE A 1 313 ? -18.720 5.028   74.065 1.00 79.27  ? 218  ILE A CB  1 
ATOM   2354 C CG1 . ILE A 1 313 ? -18.251 6.353   74.652 1.00 80.10  ? 218  ILE A CG1 1 
ATOM   2355 C CG2 . ILE A 1 313 ? -19.173 5.233   72.639 1.00 80.01  ? 218  ILE A CG2 1 
ATOM   2356 C CD1 . ILE A 1 313 ? -17.248 7.035   73.909 1.00 94.64  ? 218  ILE A CD1 1 
ATOM   2357 N N   . TRP A 1 314 ? -21.892 5.661   74.405 1.00 78.48  ? 219  TRP A N   1 
ATOM   2358 C CA  . TRP A 1 314 ? -22.980 6.604   74.662 1.00 79.95  ? 219  TRP A CA  1 
ATOM   2359 C C   . TRP A 1 314 ? -23.758 6.182   75.913 1.00 83.24  ? 219  TRP A C   1 
ATOM   2360 O O   . TRP A 1 314 ? -24.046 7.039   76.748 1.00 82.95  ? 219  TRP A O   1 
ATOM   2361 C CB  . TRP A 1 314 ? -23.912 6.733   73.451 1.00 80.92  ? 219  TRP A CB  1 
ATOM   2362 C CG  . TRP A 1 314 ? -25.219 7.408   73.747 1.00 84.87  ? 219  TRP A CG  1 
ATOM   2363 C CD1 . TRP A 1 314 ? -26.434 6.806   73.898 1.00 90.41  ? 219  TRP A CD1 1 
ATOM   2364 C CD2 . TRP A 1 314 ? -25.427 8.802   74.015 1.00 85.23  ? 219  TRP A CD2 1 
ATOM   2365 N NE1 . TRP A 1 314 ? -27.394 7.742   74.200 1.00 91.70  ? 219  TRP A NE1 1 
ATOM   2366 C CE2 . TRP A 1 314 ? -26.804 8.978   74.277 1.00 91.93  ? 219  TRP A CE2 1 
ATOM   2367 C CE3 . TRP A 1 314 ? -24.583 9.926   74.042 1.00 85.66  ? 219  TRP A CE3 1 
ATOM   2368 C CZ2 . TRP A 1 314 ? -27.361 10.233  74.562 1.00 92.46  ? 219  TRP A CZ2 1 
ATOM   2369 C CZ3 . TRP A 1 314 ? -25.134 11.170  74.322 1.00 88.46  ? 219  TRP A CZ3 1 
ATOM   2370 C CH2 . TRP A 1 314 ? -26.507 11.316  74.576 1.00 91.39  ? 219  TRP A CH2 1 
ATOM   2371 N N   . LYS A 1 315 ? -24.043 4.866   76.060 1.00 79.27  ? 220  LYS A N   1 
ATOM   2372 C CA  . LYS A 1 315 ? -24.743 4.294   77.212 1.00 80.26  ? 220  LYS A CA  1 
ATOM   2373 C C   . LYS A 1 315 ? -23.990 4.540   78.525 1.00 81.30  ? 220  LYS A C   1 
ATOM   2374 O O   . LYS A 1 315 ? -24.628 4.805   79.543 1.00 81.11  ? 220  LYS A O   1 
ATOM   2375 C CB  . LYS A 1 315 ? -24.961 2.783   77.035 1.00 84.90  ? 220  LYS A CB  1 
ATOM   2376 C CG  . LYS A 1 315 ? -26.174 2.399   76.188 1.00 102.61 ? 220  LYS A CG  1 
ATOM   2377 C CD  . LYS A 1 315 ? -26.561 0.919   76.361 1.00 116.78 ? 220  LYS A CD  1 
ATOM   2378 C CE  . LYS A 1 315 ? -25.565 -0.079  75.806 1.00 128.54 ? 220  LYS A CE  1 
ATOM   2379 N NZ  . LYS A 1 315 ? -25.907 -1.472  76.198 1.00 141.99 ? 220  LYS A NZ  1 
ATOM   2380 N N   . ALA A 1 316 ? -22.643 4.448   78.498 1.00 76.05  ? 221  ALA A N   1 
ATOM   2381 C CA  . ALA A 1 316 ? -21.783 4.628   79.669 1.00 75.31  ? 221  ALA A CA  1 
ATOM   2382 C C   . ALA A 1 316 ? -21.396 6.102   79.891 1.00 80.01  ? 221  ALA A C   1 
ATOM   2383 O O   . ALA A 1 316 ? -20.646 6.374   80.826 1.00 79.41  ? 221  ALA A O   1 
ATOM   2384 C CB  . ALA A 1 316 ? -20.525 3.778   79.528 1.00 75.23  ? 221  ALA A CB  1 
ATOM   2385 N N   . LEU A 1 317 ? -21.915 7.050   79.072 1.00 77.86  ? 222  LEU A N   1 
ATOM   2386 C CA  . LEU A 1 317 ? -21.583 8.476   79.212 1.00 77.56  ? 222  LEU A CA  1 
ATOM   2387 C C   . LEU A 1 317 ? -22.848 9.381   79.274 1.00 83.71  ? 222  LEU A C   1 
ATOM   2388 O O   . LEU A 1 317 ? -22.746 10.501  79.781 1.00 83.22  ? 222  LEU A O   1 
ATOM   2389 C CB  . LEU A 1 317 ? -20.665 8.928   78.053 1.00 76.35  ? 222  LEU A CB  1 
ATOM   2390 C CG  . LEU A 1 317 ? -19.898 10.246  78.257 1.00 80.68  ? 222  LEU A CG  1 
ATOM   2391 C CD1 . LEU A 1 317 ? -18.398 10.035  78.207 1.00 79.65  ? 222  LEU A CD1 1 
ATOM   2392 C CD2 . LEU A 1 317 ? -20.344 11.304  77.260 1.00 83.66  ? 222  LEU A CD2 1 
ATOM   2393 N N   . LYS A 1 318 ? -24.031 8.887   78.826 1.00 82.39  ? 223  LYS A N   1 
ATOM   2394 C CA  . LYS A 1 318 ? -25.301 9.641   78.792 1.00 84.22  ? 223  LYS A CA  1 
ATOM   2395 C C   . LYS A 1 318 ? -25.774 10.131  80.188 1.00 90.99  ? 223  LYS A C   1 
ATOM   2396 O O   . LYS A 1 318 ? -26.813 10.793  80.265 1.00 93.66  ? 223  LYS A O   1 
ATOM   2397 C CB  . LYS A 1 318 ? -26.428 8.813   78.133 1.00 88.11  ? 223  LYS A CB  1 
ATOM   2398 C CG  . LYS A 1 318 ? -26.891 7.565   78.907 1.00 101.89 ? 223  LYS A CG  1 
ATOM   2399 C CD  . LYS A 1 318 ? -27.702 6.581   78.043 1.00 112.84 ? 223  LYS A CD  1 
ATOM   2400 C CE  . LYS A 1 318 ? -29.068 7.073   77.610 1.00 125.28 ? 223  LYS A CE  1 
ATOM   2401 N NZ  . LYS A 1 318 ? -29.713 6.128   76.660 1.00 133.86 ? 223  LYS A NZ  1 
ATOM   2402 N N   . LYS A 1 319 ? -25.020 9.836   81.266 1.00 86.67  ? 224  LYS A N   1 
ATOM   2403 C CA  . LYS A 1 319 ? -25.351 10.252  82.628 1.00 110.93 ? 224  LYS A CA  1 
ATOM   2404 C C   . LYS A 1 319 ? -24.085 10.611  83.412 1.00 124.11 ? 224  LYS A C   1 
ATOM   2405 O O   . LYS A 1 319 ? -23.293 11.445  82.973 1.00 76.39  ? 224  LYS A O   1 
ATOM   2406 C CB  . LYS A 1 319 ? -26.128 9.142   83.348 1.00 115.45 ? 224  LYS A CB  1 
ATOM   2407 N N   . ASN A 1 330 ? -12.655 14.690  76.676 1.00 83.03  ? 235  ASN A N   1 
ATOM   2408 C CA  . ASN A 1 330 ? -13.030 13.319  76.330 1.00 81.41  ? 235  ASN A CA  1 
ATOM   2409 C C   . ASN A 1 330 ? -14.493 13.235  75.864 1.00 82.85  ? 235  ASN A C   1 
ATOM   2410 O O   . ASN A 1 330 ? -14.766 12.532  74.894 1.00 81.53  ? 235  ASN A O   1 
ATOM   2411 C CB  . ASN A 1 330 ? -12.796 12.366  77.507 1.00 83.46  ? 235  ASN A CB  1 
ATOM   2412 N N   . ASP A 1 331 ? -15.425 13.928  76.560 1.00 78.88  ? 236  ASP A N   1 
ATOM   2413 C CA  . ASP A 1 331 ? -16.844 13.960  76.194 1.00 78.10  ? 236  ASP A CA  1 
ATOM   2414 C C   . ASP A 1 331 ? -17.038 14.978  75.079 1.00 79.69  ? 236  ASP A C   1 
ATOM   2415 O O   . ASP A 1 331 ? -17.765 14.700  74.122 1.00 78.51  ? 236  ASP A O   1 
ATOM   2416 C CB  . ASP A 1 331 ? -17.761 14.258  77.404 1.00 81.33  ? 236  ASP A CB  1 
ATOM   2417 C CG  . ASP A 1 331 ? -17.535 15.577  78.135 1.00 97.95  ? 236  ASP A CG  1 
ATOM   2418 O OD1 . ASP A 1 331 ? -16.399 16.100  78.088 1.00 100.07 ? 236  ASP A OD1 1 
ATOM   2419 O OD2 . ASP A 1 331 ? -18.481 16.053  78.810 1.00 106.05 ? 236  ASP A OD2 1 
ATOM   2420 N N   . ASP A 1 332 ? -16.346 16.139  75.176 1.00 75.58  ? 237  ASP A N   1 
ATOM   2421 C CA  . ASP A 1 332 ? -16.378 17.186  74.151 1.00 75.22  ? 237  ASP A CA  1 
ATOM   2422 C C   . ASP A 1 332 ? -15.816 16.613  72.845 1.00 74.63  ? 237  ASP A C   1 
ATOM   2423 O O   . ASP A 1 332 ? -16.389 16.844  71.784 1.00 73.95  ? 237  ASP A O   1 
ATOM   2424 C CB  . ASP A 1 332 ? -15.614 18.442  74.610 1.00 79.05  ? 237  ASP A CB  1 
ATOM   2425 C CG  . ASP A 1 332 ? -16.338 19.268  75.667 1.00 91.53  ? 237  ASP A CG  1 
ATOM   2426 O OD1 . ASP A 1 332 ? -17.445 19.777  75.372 1.00 92.42  ? 237  ASP A OD1 1 
ATOM   2427 O OD2 . ASP A 1 332 ? -15.768 19.461  76.765 1.00 98.07  ? 237  ASP A OD2 1 
ATOM   2428 N N   . ILE A 1 333 ? -14.761 15.778  72.951 1.00 68.14  ? 238  ILE A N   1 
ATOM   2429 C CA  . ILE A 1 333 ? -14.147 15.063  71.833 1.00 66.00  ? 238  ILE A CA  1 
ATOM   2430 C C   . ILE A 1 333 ? -15.152 14.017  71.315 1.00 66.14  ? 238  ILE A C   1 
ATOM   2431 O O   . ILE A 1 333 ? -15.369 13.960  70.112 1.00 66.29  ? 238  ILE A O   1 
ATOM   2432 C CB  . ILE A 1 333 ? -12.784 14.426  72.229 1.00 69.21  ? 238  ILE A CB  1 
ATOM   2433 C CG1 . ILE A 1 333 ? -11.849 15.467  72.891 1.00 71.72  ? 238  ILE A CG1 1 
ATOM   2434 C CG2 . ILE A 1 333 ? -12.108 13.783  71.011 1.00 68.73  ? 238  ILE A CG2 1 
ATOM   2435 C CD1 . ILE A 1 333 ? -10.695 14.867  73.765 1.00 84.86  ? 238  ILE A CD1 1 
ATOM   2436 N N   . PHE A 1 334 ? -15.797 13.238  72.217 1.00 59.77  ? 239  PHE A N   1 
ATOM   2437 C CA  . PHE A 1 334 ? -16.809 12.227  71.872 1.00 58.04  ? 239  PHE A CA  1 
ATOM   2438 C C   . PHE A 1 334 ? -17.971 12.848  71.077 1.00 60.86  ? 239  PHE A C   1 
ATOM   2439 O O   . PHE A 1 334 ? -18.465 12.206  70.149 1.00 58.88  ? 239  PHE A O   1 
ATOM   2440 C CB  . PHE A 1 334 ? -17.346 11.517  73.131 1.00 59.70  ? 239  PHE A CB  1 
ATOM   2441 C CG  . PHE A 1 334 ? -18.597 10.671  72.972 1.00 61.26  ? 239  PHE A CG  1 
ATOM   2442 C CD1 . PHE A 1 334 ? -18.595 9.536   72.168 1.00 63.65  ? 239  PHE A CD1 1 
ATOM   2443 C CD2 . PHE A 1 334 ? -19.757 10.980  73.671 1.00 64.15  ? 239  PHE A CD2 1 
ATOM   2444 C CE1 . PHE A 1 334 ? -19.745 8.755   72.034 1.00 64.88  ? 239  PHE A CE1 1 
ATOM   2445 C CE2 . PHE A 1 334 ? -20.897 10.182  73.555 1.00 67.29  ? 239  PHE A CE2 1 
ATOM   2446 C CZ  . PHE A 1 334 ? -20.882 9.077   72.737 1.00 65.08  ? 239  PHE A CZ  1 
ATOM   2447 N N   . LYS A 1 335 ? -18.381 14.095  71.430 1.00 58.28  ? 240  LYS A N   1 
ATOM   2448 C CA  . LYS A 1 335 ? -19.440 14.846  70.746 1.00 58.33  ? 240  LYS A CA  1 
ATOM   2449 C C   . LYS A 1 335 ? -19.008 15.168  69.323 1.00 61.66  ? 240  LYS A C   1 
ATOM   2450 O O   . LYS A 1 335 ? -19.801 15.026  68.391 1.00 60.58  ? 240  LYS A O   1 
ATOM   2451 C CB  . LYS A 1 335 ? -19.788 16.135  71.509 1.00 61.85  ? 240  LYS A CB  1 
ATOM   2452 C CG  . LYS A 1 335 ? -20.610 15.894  72.768 1.00 76.71  ? 240  LYS A CG  1 
ATOM   2453 C CD  . LYS A 1 335 ? -21.091 17.183  73.428 1.00 88.15  ? 240  LYS A CD  1 
ATOM   2454 C CE  . LYS A 1 335 ? -20.045 17.871  74.272 1.00 97.89  ? 240  LYS A CE  1 
ATOM   2455 N NZ  . LYS A 1 335 ? -20.585 19.092  74.923 1.00 111.21 ? 240  LYS A NZ  1 
ATOM   2456 N N   . ILE A 1 336 ? -17.731 15.568  69.164 1.00 59.17  ? 241  ILE A N   1 
ATOM   2457 C CA  . ILE A 1 336 ? -17.113 15.894  67.883 1.00 59.46  ? 241  ILE A CA  1 
ATOM   2458 C C   . ILE A 1 336 ? -17.060 14.607  67.018 1.00 63.39  ? 241  ILE A C   1 
ATOM   2459 O O   . ILE A 1 336 ? -17.560 14.619  65.893 1.00 63.00  ? 241  ILE A O   1 
ATOM   2460 C CB  . ILE A 1 336 ? -15.711 16.559  68.092 1.00 62.97  ? 241  ILE A CB  1 
ATOM   2461 C CG1 . ILE A 1 336 ? -15.867 17.983  68.685 1.00 64.71  ? 241  ILE A CG1 1 
ATOM   2462 C CG2 . ILE A 1 336 ? -14.899 16.595  66.782 1.00 64.36  ? 241  ILE A CG2 1 
ATOM   2463 C CD1 . ILE A 1 336 ? -14.577 18.707  69.124 1.00 72.40  ? 241  ILE A CD1 1 
ATOM   2464 N N   . ILE A 1 337 ? -16.506 13.507  67.567 1.00 60.07  ? 242  ILE A N   1 
ATOM   2465 C CA  . ILE A 1 337 ? -16.349 12.218  66.885 1.00 59.73  ? 242  ILE A CA  1 
ATOM   2466 C C   . ILE A 1 337 ? -17.741 11.615  66.530 1.00 64.68  ? 242  ILE A C   1 
ATOM   2467 O O   . ILE A 1 337 ? -17.882 11.052  65.446 1.00 64.07  ? 242  ILE A O   1 
ATOM   2468 C CB  . ILE A 1 337 ? -15.479 11.239  67.725 1.00 62.69  ? 242  ILE A CB  1 
ATOM   2469 C CG1 . ILE A 1 337 ? -14.095 11.854  68.027 1.00 63.81  ? 242  ILE A CG1 1 
ATOM   2470 C CG2 . ILE A 1 337 ? -15.293 9.930   66.993 1.00 62.87  ? 242  ILE A CG2 1 
ATOM   2471 C CD1 . ILE A 1 337 ? -13.166 10.989  68.886 1.00 76.92  ? 242  ILE A CD1 1 
ATOM   2472 N N   . MET A 1 338 ? -18.753 11.769  67.410 1.00 62.35  ? 243  MET A N   1 
ATOM   2473 C CA  . MET A 1 338 ? -20.121 11.287  67.176 1.00 62.67  ? 243  MET A CA  1 
ATOM   2474 C C   . MET A 1 338 ? -20.801 12.081  66.051 1.00 63.62  ? 243  MET A C   1 
ATOM   2475 O O   . MET A 1 338 ? -21.511 11.485  65.246 1.00 62.78  ? 243  MET A O   1 
ATOM   2476 C CB  . MET A 1 338 ? -20.957 11.386  68.467 1.00 66.38  ? 243  MET A CB  1 
ATOM   2477 C CG  . MET A 1 338 ? -22.310 10.705  68.404 1.00 72.30  ? 243  MET A CG  1 
ATOM   2478 S SD  . MET A 1 338 ? -22.287 9.057   69.145 1.00 78.18  ? 243  MET A SD  1 
ATOM   2479 C CE  . MET A 1 338 ? -23.989 8.966   69.792 1.00 77.12  ? 243  MET A CE  1 
ATOM   2480 N N   . ALA A 1 339 ? -20.611 13.414  66.017 1.00 59.30  ? 244  ALA A N   1 
ATOM   2481 C CA  . ALA A 1 339 ? -21.228 14.276  65.007 1.00 59.93  ? 244  ALA A CA  1 
ATOM   2482 C C   . ALA A 1 339 ? -20.627 14.033  63.616 1.00 63.70  ? 244  ALA A C   1 
ATOM   2483 O O   . ALA A 1 339 ? -21.364 14.047  62.631 1.00 63.69  ? 244  ALA A O   1 
ATOM   2484 C CB  . ALA A 1 339 ? -21.081 15.735  65.394 1.00 61.53  ? 244  ALA A CB  1 
ATOM   2485 N N   . ILE A 1 340 ? -19.305 13.781  63.539 1.00 59.77  ? 245  ILE A N   1 
ATOM   2486 C CA  . ILE A 1 340 ? -18.621 13.496  62.281 1.00 59.28  ? 245  ILE A CA  1 
ATOM   2487 C C   . ILE A 1 340 ? -19.058 12.094  61.785 1.00 65.65  ? 245  ILE A C   1 
ATOM   2488 O O   . ILE A 1 340 ? -19.248 11.919  60.586 1.00 66.35  ? 245  ILE A O   1 
ATOM   2489 C CB  . ILE A 1 340 ? -17.076 13.629  62.410 1.00 61.50  ? 245  ILE A CB  1 
ATOM   2490 C CG1 . ILE A 1 340 ? -16.671 15.062  62.826 1.00 62.15  ? 245  ILE A CG1 1 
ATOM   2491 C CG2 . ILE A 1 340 ? -16.375 13.237  61.097 1.00 62.27  ? 245  ILE A CG2 1 
ATOM   2492 C CD1 . ILE A 1 340 ? -15.239 15.195  63.381 1.00 66.36  ? 245  ILE A CD1 1 
ATOM   2493 N N   . VAL A 1 341 ? -19.249 11.124  62.701 1.00 63.17  ? 246  VAL A N   1 
ATOM   2494 C CA  . VAL A 1 341 ? -19.663 9.750   62.378 1.00 63.57  ? 246  VAL A CA  1 
ATOM   2495 C C   . VAL A 1 341 ? -21.153 9.712   61.937 1.00 69.22  ? 246  VAL A C   1 
ATOM   2496 O O   . VAL A 1 341 ? -21.454 9.062   60.933 1.00 69.56  ? 246  VAL A O   1 
ATOM   2497 C CB  . VAL A 1 341 ? -19.383 8.778   63.561 1.00 67.19  ? 246  VAL A CB  1 
ATOM   2498 C CG1 . VAL A 1 341 ? -20.324 7.578   63.556 1.00 67.99  ? 246  VAL A CG1 1 
ATOM   2499 C CG2 . VAL A 1 341 ? -17.928 8.320   63.557 1.00 66.25  ? 246  VAL A CG2 1 
ATOM   2500 N N   . LEU A 1 342 ? -22.063 10.386  62.674 1.00 66.77  ? 247  LEU A N   1 
ATOM   2501 C CA  . LEU A 1 342 ? -23.498 10.402  62.367 1.00 68.22  ? 247  LEU A CA  1 
ATOM   2502 C C   . LEU A 1 342 ? -23.787 11.087  61.032 1.00 72.75  ? 247  LEU A C   1 
ATOM   2503 O O   . LEU A 1 342 ? -24.545 10.542  60.229 1.00 73.01  ? 247  LEU A O   1 
ATOM   2504 C CB  . LEU A 1 342 ? -24.299 11.089  63.485 1.00 69.31  ? 247  LEU A CB  1 
ATOM   2505 C CG  . LEU A 1 342 ? -25.302 10.212  64.238 1.00 75.98  ? 247  LEU A CG  1 
ATOM   2506 C CD1 . LEU A 1 342 ? -24.598 9.236   65.180 1.00 75.86  ? 247  LEU A CD1 1 
ATOM   2507 C CD2 . LEU A 1 342 ? -26.254 11.065  65.048 1.00 80.38  ? 247  LEU A CD2 1 
ATOM   2508 N N   . PHE A 1 343 ? -23.168 12.256  60.779 1.00 69.42  ? 248  PHE A N   1 
ATOM   2509 C CA  . PHE A 1 343 ? -23.374 12.982  59.530 1.00 70.04  ? 248  PHE A CA  1 
ATOM   2510 C C   . PHE A 1 343 ? -22.797 12.205  58.340 1.00 74.01  ? 248  PHE A C   1 
ATOM   2511 O O   . PHE A 1 343 ? -23.483 12.102  57.325 1.00 75.06  ? 248  PHE A O   1 
ATOM   2512 C CB  . PHE A 1 343 ? -22.781 14.402  59.578 1.00 71.96  ? 248  PHE A CB  1 
ATOM   2513 C CG  . PHE A 1 343 ? -22.980 15.154  58.283 1.00 74.49  ? 248  PHE A CG  1 
ATOM   2514 C CD1 . PHE A 1 343 ? -24.217 15.704  57.963 1.00 79.48  ? 248  PHE A CD1 1 
ATOM   2515 C CD2 . PHE A 1 343 ? -21.948 15.262  57.357 1.00 76.34  ? 248  PHE A CD2 1 
ATOM   2516 C CE1 . PHE A 1 343 ? -24.416 16.355  56.743 1.00 81.70  ? 248  PHE A CE1 1 
ATOM   2517 C CE2 . PHE A 1 343 ? -22.148 15.912  56.134 1.00 80.30  ? 248  PHE A CE2 1 
ATOM   2518 C CZ  . PHE A 1 343 ? -23.379 16.458  55.837 1.00 80.17  ? 248  PHE A CZ  1 
ATOM   2519 N N   . PHE A 1 344 ? -21.557 11.671  58.463 1.00 69.20  ? 249  PHE A N   1 
ATOM   2520 C CA  . PHE A 1 344 ? -20.861 10.920  57.414 1.00 68.80  ? 249  PHE A CA  1 
ATOM   2521 C C   . PHE A 1 344 ? -21.711 9.781   56.850 1.00 75.19  ? 249  PHE A C   1 
ATOM   2522 O O   . PHE A 1 344 ? -21.790 9.653   55.632 1.00 74.66  ? 249  PHE A O   1 
ATOM   2523 C CB  . PHE A 1 344 ? -19.532 10.342  57.937 1.00 69.65  ? 249  PHE A CB  1 
ATOM   2524 C CG  . PHE A 1 344 ? -18.663 9.679   56.893 1.00 71.01  ? 249  PHE A CG  1 
ATOM   2525 C CD1 . PHE A 1 344 ? -17.724 10.415  56.176 1.00 73.99  ? 249  PHE A CD1 1 
ATOM   2526 C CD2 . PHE A 1 344 ? -18.771 8.317   56.637 1.00 73.46  ? 249  PHE A CD2 1 
ATOM   2527 C CE1 . PHE A 1 344 ? -16.922 9.803   55.204 1.00 75.06  ? 249  PHE A CE1 1 
ATOM   2528 C CE2 . PHE A 1 344 ? -17.971 7.707   55.664 1.00 76.80  ? 249  PHE A CE2 1 
ATOM   2529 C CZ  . PHE A 1 344 ? -17.043 8.452   54.962 1.00 74.65  ? 249  PHE A CZ  1 
ATOM   2530 N N   . PHE A 1 345 ? -22.336 8.964   57.718 1.00 74.28  ? 250  PHE A N   1 
ATOM   2531 C CA  . PHE A 1 345 ? -23.112 7.817   57.265 1.00 76.51  ? 250  PHE A CA  1 
ATOM   2532 C C   . PHE A 1 345 ? -24.520 8.208   56.774 1.00 81.88  ? 250  PHE A C   1 
ATOM   2533 O O   . PHE A 1 345 ? -24.988 7.583   55.825 1.00 82.68  ? 250  PHE A O   1 
ATOM   2534 C CB  . PHE A 1 345 ? -23.193 6.727   58.345 1.00 79.59  ? 250  PHE A CB  1 
ATOM   2535 C CG  . PHE A 1 345 ? -21.886 5.973   58.517 1.00 81.35  ? 250  PHE A CG  1 
ATOM   2536 C CD1 . PHE A 1 345 ? -21.339 5.237   57.463 1.00 85.35  ? 250  PHE A CD1 1 
ATOM   2537 C CD2 . PHE A 1 345 ? -21.217 5.973   59.739 1.00 83.00  ? 250  PHE A CD2 1 
ATOM   2538 C CE1 . PHE A 1 345 ? -20.132 4.544   57.619 1.00 86.00  ? 250  PHE A CE1 1 
ATOM   2539 C CE2 . PHE A 1 345 ? -20.013 5.273   59.895 1.00 85.69  ? 250  PHE A CE2 1 
ATOM   2540 C CZ  . PHE A 1 345 ? -19.478 4.567   58.832 1.00 84.50  ? 250  PHE A CZ  1 
ATOM   2541 N N   . PHE A 1 346 ? -25.167 9.244   57.347 1.00 78.91  ? 251  PHE A N   1 
ATOM   2542 C CA  . PHE A 1 346 ? -26.497 9.663   56.881 1.00 80.91  ? 251  PHE A CA  1 
ATOM   2543 C C   . PHE A 1 346 ? -26.438 10.453  55.549 1.00 85.33  ? 251  PHE A C   1 
ATOM   2544 O O   . PHE A 1 346 ? -27.488 10.652  54.928 1.00 87.10  ? 251  PHE A O   1 
ATOM   2545 C CB  . PHE A 1 346 ? -27.237 10.497  57.941 1.00 83.72  ? 251  PHE A CB  1 
ATOM   2546 C CG  . PHE A 1 346 ? -27.861 9.673   59.046 1.00 87.02  ? 251  PHE A CG  1 
ATOM   2547 C CD1 . PHE A 1 346 ? -28.836 8.722   58.763 1.00 92.57  ? 251  PHE A CD1 1 
ATOM   2548 C CD2 . PHE A 1 346 ? -27.517 9.889   60.374 1.00 89.18  ? 251  PHE A CD2 1 
ATOM   2549 C CE1 . PHE A 1 346 ? -29.407 7.958   59.783 1.00 95.12  ? 251  PHE A CE1 1 
ATOM   2550 C CE2 . PHE A 1 346 ? -28.094 9.131   61.395 1.00 93.44  ? 251  PHE A CE2 1 
ATOM   2551 C CZ  . PHE A 1 346 ? -29.040 8.174   61.093 1.00 93.70  ? 251  PHE A CZ  1 
ATOM   2552 N N   . SER A 1 347 ? -25.230 10.884  55.108 1.00 79.51  ? 252  SER A N   1 
ATOM   2553 C CA  . SER A 1 347 ? -25.032 11.642  53.864 1.00 78.58  ? 252  SER A CA  1 
ATOM   2554 C C   . SER A 1 347 ? -24.659 10.716  52.691 1.00 80.75  ? 252  SER A C   1 
ATOM   2555 O O   . SER A 1 347 ? -24.785 11.126  51.528 1.00 81.39  ? 252  SER A O   1 
ATOM   2556 C CB  . SER A 1 347 ? -23.958 12.714  54.046 1.00 80.52  ? 252  SER A CB  1 
ATOM   2557 O OG  . SER A 1 347 ? -22.659 12.169  54.221 1.00 86.38  ? 252  SER A OG  1 
ATOM   2558 N N   . TRP A 1 348 ? -24.193 9.482   52.999 1.00 74.44  ? 253  TRP A N   1 
ATOM   2559 C CA  . TRP A 1 348 ? -23.795 8.487   52.005 1.00 73.46  ? 253  TRP A CA  1 
ATOM   2560 C C   . TRP A 1 348 ? -24.976 7.592   51.580 1.00 79.53  ? 253  TRP A C   1 
ATOM   2561 O O   . TRP A 1 348 ? -24.877 6.947   50.533 1.00 79.94  ? 253  TRP A O   1 
ATOM   2562 C CB  . TRP A 1 348 ? -22.638 7.618   52.523 1.00 71.01  ? 253  TRP A CB  1 
ATOM   2563 C CG  . TRP A 1 348 ? -21.277 8.139   52.175 1.00 70.63  ? 253  TRP A CG  1 
ATOM   2564 C CD1 . TRP A 1 348 ? -20.465 8.902   52.960 1.00 72.41  ? 253  TRP A CD1 1 
ATOM   2565 C CD2 . TRP A 1 348 ? -20.566 7.930   50.946 1.00 70.65  ? 253  TRP A CD2 1 
ATOM   2566 N NE1 . TRP A 1 348 ? -19.294 9.189   52.296 1.00 71.47  ? 253  TRP A NE1 1 
ATOM   2567 C CE2 . TRP A 1 348 ? -19.337 8.620   51.050 1.00 73.54  ? 253  TRP A CE2 1 
ATOM   2568 C CE3 . TRP A 1 348 ? -20.862 7.255   49.750 1.00 72.97  ? 253  TRP A CE3 1 
ATOM   2569 C CZ2 . TRP A 1 348 ? -18.407 8.656   50.004 1.00 72.81  ? 253  TRP A CZ2 1 
ATOM   2570 C CZ3 . TRP A 1 348 ? -19.934 7.284   48.718 1.00 74.29  ? 253  TRP A CZ3 1 
ATOM   2571 C CH2 . TRP A 1 348 ? -18.717 7.963   48.856 1.00 73.91  ? 253  TRP A CH2 1 
ATOM   2572 N N   . ILE A 1 349 ? -26.082 7.554   52.368 1.00 77.62  ? 254  ILE A N   1 
ATOM   2573 C CA  . ILE A 1 349 ? -27.275 6.739   52.067 1.00 80.19  ? 254  ILE A CA  1 
ATOM   2574 C C   . ILE A 1 349 ? -27.870 7.155   50.692 1.00 86.04  ? 254  ILE A C   1 
ATOM   2575 O O   . ILE A 1 349 ? -28.008 6.253   49.865 1.00 87.39  ? 254  ILE A O   1 
ATOM   2576 C CB  . ILE A 1 349 ? -28.370 6.750   53.186 1.00 84.84  ? 254  ILE A CB  1 
ATOM   2577 C CG1 . ILE A 1 349 ? -27.809 6.263   54.543 1.00 83.97  ? 254  ILE A CG1 1 
ATOM   2578 C CG2 . ILE A 1 349 ? -29.606 5.914   52.774 1.00 88.90  ? 254  ILE A CG2 1 
ATOM   2579 C CD1 . ILE A 1 349 ? -28.645 6.642   55.763 1.00 89.47  ? 254  ILE A CD1 1 
ATOM   2580 N N   . PRO A 1 350 ? -28.197 8.448   50.378 1.00 82.74  ? 255  PRO A N   1 
ATOM   2581 C CA  . PRO A 1 350 ? -28.758 8.746   49.042 1.00 83.73  ? 255  PRO A CA  1 
ATOM   2582 C C   . PRO A 1 350 ? -27.917 8.161   47.914 1.00 86.80  ? 255  PRO A C   1 
ATOM   2583 O O   . PRO A 1 350 ? -28.469 7.445   47.080 1.00 88.16  ? 255  PRO A O   1 
ATOM   2584 C CB  . PRO A 1 350 ? -28.768 10.275  48.983 1.00 85.10  ? 255  PRO A CB  1 
ATOM   2585 C CG  . PRO A 1 350 ? -28.876 10.698  50.392 1.00 89.47  ? 255  PRO A CG  1 
ATOM   2586 C CD  . PRO A 1 350 ? -28.116 9.677   51.201 1.00 83.46  ? 255  PRO A CD  1 
ATOM   2587 N N   . HIS A 1 351 ? -26.584 8.381   47.943 1.00 81.45  ? 256  HIS A N   1 
ATOM   2588 C CA  . HIS A 1 351 ? -25.678 7.885   46.908 1.00 80.89  ? 256  HIS A CA  1 
ATOM   2589 C C   . HIS A 1 351 ? -25.626 6.353   46.898 1.00 86.84  ? 256  HIS A C   1 
ATOM   2590 O O   . HIS A 1 351 ? -25.553 5.782   45.810 1.00 87.52  ? 256  HIS A O   1 
ATOM   2591 C CB  . HIS A 1 351 ? -24.264 8.475   47.054 1.00 79.18  ? 256  HIS A CB  1 
ATOM   2592 C CG  . HIS A 1 351 ? -23.432 8.337   45.813 1.00 81.92  ? 256  HIS A CG  1 
ATOM   2593 N ND1 . HIS A 1 351 ? -23.702 9.082   44.678 1.00 83.94  ? 256  HIS A ND1 1 
ATOM   2594 C CD2 . HIS A 1 351 ? -22.358 7.549   45.571 1.00 82.99  ? 256  HIS A CD2 1 
ATOM   2595 C CE1 . HIS A 1 351 ? -22.803 8.711   43.780 1.00 82.95  ? 256  HIS A CE1 1 
ATOM   2596 N NE2 . HIS A 1 351 ? -21.972 7.793   44.270 1.00 82.84  ? 256  HIS A NE2 1 
ATOM   2597 N N   . GLN A 1 352 ? -25.733 5.696   48.072 1.00 84.16  ? 257  GLN A N   1 
ATOM   2598 C CA  . GLN A 1 352 ? -25.713 4.230   48.179 1.00 86.06  ? 257  GLN A CA  1 
ATOM   2599 C C   . GLN A 1 352 ? -26.868 3.583   47.388 1.00 93.08  ? 257  GLN A C   1 
ATOM   2600 O O   . GLN A 1 352 ? -26.641 2.590   46.693 1.00 94.34  ? 257  GLN A O   1 
ATOM   2601 C CB  . GLN A 1 352 ? -25.785 3.787   49.648 1.00 87.73  ? 257  GLN A CB  1 
ATOM   2602 C CG  . GLN A 1 352 ? -24.812 2.662   50.011 1.00 111.15 ? 257  GLN A CG  1 
ATOM   2603 C CD  . GLN A 1 352 ? -23.428 3.167   50.357 1.00 133.08 ? 257  GLN A CD  1 
ATOM   2604 O OE1 . GLN A 1 352 ? -23.254 4.149   51.093 1.00 125.96 ? 257  GLN A OE1 1 
ATOM   2605 N NE2 . GLN A 1 352 ? -22.410 2.464   49.881 1.00 127.89 ? 257  GLN A NE2 1 
ATOM   2606 N N   . ILE A 1 353 ? -28.086 4.168   47.476 1.00 90.42  ? 258  ILE A N   1 
ATOM   2607 C CA  . ILE A 1 353 ? -29.297 3.694   46.792 1.00 92.97  ? 258  ILE A CA  1 
ATOM   2608 C C   . ILE A 1 353 ? -29.125 3.807   45.267 1.00 97.53  ? 258  ILE A C   1 
ATOM   2609 O O   . ILE A 1 353 ? -29.322 2.814   44.559 1.00 99.59  ? 258  ILE A O   1 
ATOM   2610 C CB  . ILE A 1 353 ? -30.573 4.466   47.259 1.00 97.15  ? 258  ILE A CB  1 
ATOM   2611 C CG1 . ILE A 1 353 ? -30.690 4.524   48.798 1.00 97.45  ? 258  ILE A CG1 1 
ATOM   2612 C CG2 . ILE A 1 353 ? -31.846 3.869   46.622 1.00 101.17 ? 258  ILE A CG2 1 
ATOM   2613 C CD1 . ILE A 1 353 ? -31.483 5.727   49.348 1.00 104.56 ? 258  ILE A CD1 1 
ATOM   2614 N N   . PHE A 1 354 ? -28.764 5.014   44.774 1.00 91.63  ? 259  PHE A N   1 
ATOM   2615 C CA  . PHE A 1 354 ? -28.622 5.318   43.350 1.00 91.15  ? 259  PHE A CA  1 
ATOM   2616 C C   . PHE A 1 354 ? -27.418 4.622   42.699 1.00 93.73  ? 259  PHE A C   1 
ATOM   2617 O O   . PHE A 1 354 ? -27.500 4.329   41.505 1.00 94.03  ? 259  PHE A O   1 
ATOM   2618 C CB  . PHE A 1 354 ? -28.541 6.831   43.122 1.00 91.37  ? 259  PHE A CB  1 
ATOM   2619 C CG  . PHE A 1 354 ? -29.893 7.495   43.240 1.00 94.65  ? 259  PHE A CG  1 
ATOM   2620 C CD1 . PHE A 1 354 ? -30.741 7.582   42.142 1.00 99.67  ? 259  PHE A CD1 1 
ATOM   2621 C CD2 . PHE A 1 354 ? -30.331 8.009   44.455 1.00 96.63  ? 259  PHE A CD2 1 
ATOM   2622 C CE1 . PHE A 1 354 ? -32.004 8.171   42.259 1.00 102.79 ? 259  PHE A CE1 1 
ATOM   2623 C CE2 . PHE A 1 354 ? -31.590 8.605   44.569 1.00 101.53 ? 259  PHE A CE2 1 
ATOM   2624 C CZ  . PHE A 1 354 ? -32.418 8.681   43.471 1.00 101.85 ? 259  PHE A CZ  1 
ATOM   2625 N N   . THR A 1 355 ? -26.326 4.338   43.456 1.00 88.90  ? 260  THR A N   1 
ATOM   2626 C CA  . THR A 1 355 ? -25.156 3.623   42.911 1.00 88.20  ? 260  THR A CA  1 
ATOM   2627 C C   . THR A 1 355 ? -25.588 2.190   42.554 1.00 94.84  ? 260  THR A C   1 
ATOM   2628 O O   . THR A 1 355 ? -25.235 1.706   41.480 1.00 96.08  ? 260  THR A O   1 
ATOM   2629 C CB  . THR A 1 355 ? -23.955 3.646   43.878 1.00 91.95  ? 260  THR A CB  1 
ATOM   2630 O OG1 . THR A 1 355 ? -23.733 4.979   44.327 1.00 89.00  ? 260  THR A OG1 1 
ATOM   2631 C CG2 . THR A 1 355 ? -22.675 3.117   43.240 1.00 88.94  ? 260  THR A CG2 1 
ATOM   2632 N N   . PHE A 1 356 ? -26.394 1.544   43.430 1.00 92.06  ? 261  PHE A N   1 
ATOM   2633 C CA  . PHE A 1 356 ? -26.941 0.206   43.208 1.00 94.74  ? 261  PHE A CA  1 
ATOM   2634 C C   . PHE A 1 356 ? -27.904 0.230   42.021 1.00 100.81 ? 261  PHE A C   1 
ATOM   2635 O O   . PHE A 1 356 ? -27.882 -0.689  41.205 1.00 102.78 ? 261  PHE A O   1 
ATOM   2636 C CB  . PHE A 1 356 ? -27.644 -0.313  44.476 1.00 97.82  ? 261  PHE A CB  1 
ATOM   2637 C CG  . PHE A 1 356 ? -28.214 -1.709  44.357 1.00 103.09 ? 261  PHE A CG  1 
ATOM   2638 C CD1 . PHE A 1 356 ? -27.392 -2.826  44.460 1.00 106.82 ? 261  PHE A CD1 1 
ATOM   2639 C CD2 . PHE A 1 356 ? -29.577 -1.907  44.170 1.00 108.37 ? 261  PHE A CD2 1 
ATOM   2640 C CE1 . PHE A 1 356 ? -27.919 -4.115  44.349 1.00 111.66 ? 261  PHE A CE1 1 
ATOM   2641 C CE2 . PHE A 1 356 ? -30.104 -3.198  44.065 1.00 115.09 ? 261  PHE A CE2 1 
ATOM   2642 C CZ  . PHE A 1 356 ? -29.272 -4.292  44.156 1.00 113.94 ? 261  PHE A CZ  1 
ATOM   2643 N N   . LEU A 1 357 ? -28.725 1.297   41.917 1.00 96.99  ? 262  LEU A N   1 
ATOM   2644 C CA  . LEU A 1 357 ? -29.680 1.506   40.828 1.00 98.80  ? 262  LEU A CA  1 
ATOM   2645 C C   . LEU A 1 357 ? -28.948 1.727   39.496 1.00 102.44 ? 262  LEU A C   1 
ATOM   2646 O O   . LEU A 1 357 ? -29.428 1.234   38.477 1.00 104.64 ? 262  LEU A O   1 
ATOM   2647 C CB  . LEU A 1 357 ? -30.621 2.686   41.141 1.00 98.55  ? 262  LEU A CB  1 
ATOM   2648 C CG  . LEU A 1 357 ? -32.074 2.329   41.514 1.00 105.92 ? 262  LEU A CG  1 
ATOM   2649 C CD1 . LEU A 1 357 ? -32.147 1.430   42.741 1.00 106.22 ? 262  LEU A CD1 1 
ATOM   2650 C CD2 . LEU A 1 357 ? -32.902 3.578   41.748 1.00 107.31 ? 262  LEU A CD2 1 
ATOM   2651 N N   . ASP A 1 358 ? -27.776 2.415   39.507 1.00 96.39  ? 263  ASP A N   1 
ATOM   2652 C CA  . ASP A 1 358 ? -26.938 2.642   38.315 1.00 95.75  ? 263  ASP A CA  1 
ATOM   2653 C C   . ASP A 1 358 ? -26.353 1.309   37.828 1.00 103.25 ? 263  ASP A C   1 
ATOM   2654 O O   . ASP A 1 358 ? -26.233 1.101   36.618 1.00 104.11 ? 263  ASP A O   1 
ATOM   2655 C CB  . ASP A 1 358 ? -25.812 3.661   38.599 1.00 94.09  ? 263  ASP A CB  1 
ATOM   2656 C CG  . ASP A 1 358 ? -24.859 3.945   37.441 1.00 100.41 ? 263  ASP A CG  1 
ATOM   2657 O OD1 . ASP A 1 358 ? -25.346 4.215   36.318 1.00 102.10 ? 263  ASP A OD1 1 
ATOM   2658 O OD2 . ASP A 1 358 ? -23.630 3.971   37.676 1.00 102.22 ? 263  ASP A OD2 1 
ATOM   2659 N N   . VAL A 1 359 ? -26.019 0.402   38.777 1.00 101.41 ? 264  VAL A N   1 
ATOM   2660 C CA  . VAL A 1 359 ? -25.493 -0.944  38.508 1.00 103.73 ? 264  VAL A CA  1 
ATOM   2661 C C   . VAL A 1 359 ? -26.569 -1.753  37.737 1.00 111.69 ? 264  VAL A C   1 
ATOM   2662 O O   . VAL A 1 359 ? -26.234 -2.412  36.754 1.00 112.74 ? 264  VAL A O   1 
ATOM   2663 C CB  . VAL A 1 359 ? -25.035 -1.646  39.822 1.00 107.68 ? 264  VAL A CB  1 
ATOM   2664 C CG1 . VAL A 1 359 ? -24.804 -3.143  39.627 1.00 110.62 ? 264  VAL A CG1 1 
ATOM   2665 C CG2 . VAL A 1 359 ? -23.782 -0.987  40.385 1.00 104.25 ? 264  VAL A CG2 1 
ATOM   2666 N N   . LEU A 1 360 ? -27.854 -1.633  38.145 1.00 110.53 ? 265  LEU A N   1 
ATOM   2667 C CA  . LEU A 1 360 ? -29.009 -2.298  37.521 1.00 114.73 ? 265  LEU A CA  1 
ATOM   2668 C C   . LEU A 1 360 ? -29.233 -1.808  36.073 1.00 121.50 ? 265  LEU A C   1 
ATOM   2669 O O   . LEU A 1 360 ? -29.769 -2.558  35.255 1.00 124.60 ? 265  LEU A O   1 
ATOM   2670 C CB  . LEU A 1 360 ? -30.291 -2.079  38.356 1.00 115.85 ? 265  LEU A CB  1 
ATOM   2671 C CG  . LEU A 1 360 ? -30.326 -2.673  39.774 1.00 119.95 ? 265  LEU A CG  1 
ATOM   2672 C CD1 . LEU A 1 360 ? -31.432 -2.056  40.590 1.00 120.57 ? 265  LEU A CD1 1 
ATOM   2673 C CD2 . LEU A 1 360 ? -30.484 -4.182  39.750 1.00 125.47 ? 265  LEU A CD2 1 
ATOM   2674 N N   . ILE A 1 361 ? -28.812 -0.563  35.761 1.00 116.60 ? 266  ILE A N   1 
ATOM   2675 C CA  . ILE A 1 361 ? -28.906 0.011   34.413 1.00 117.37 ? 266  ILE A CA  1 
ATOM   2676 C C   . ILE A 1 361 ? -27.785 -0.597  33.552 1.00 123.61 ? 266  ILE A C   1 
ATOM   2677 O O   . ILE A 1 361 ? -28.042 -1.029  32.424 1.00 126.39 ? 266  ILE A O   1 
ATOM   2678 C CB  . ILE A 1 361 ? -28.852 1.575   34.435 1.00 117.25 ? 266  ILE A CB  1 
ATOM   2679 C CG1 . ILE A 1 361 ? -29.996 2.167   35.296 1.00 118.05 ? 266  ILE A CG1 1 
ATOM   2680 C CG2 . ILE A 1 361 ? -28.876 2.159   33.010 1.00 117.57 ? 266  ILE A CG2 1 
ATOM   2681 C CD1 . ILE A 1 361 ? -29.828 3.622   35.692 1.00 120.98 ? 266  ILE A CD1 1 
ATOM   2682 N N   . GLN A 1 362 ? -26.552 -0.649  34.110 1.00 118.21 ? 267  GLN A N   1 
ATOM   2683 C CA  . GLN A 1 362 ? -25.334 -1.159  33.468 1.00 118.11 ? 267  GLN A CA  1 
ATOM   2684 C C   . GLN A 1 362 ? -25.395 -2.670  33.158 1.00 124.59 ? 267  GLN A C   1 
ATOM   2685 O O   . GLN A 1 362 ? -24.706 -3.118  32.238 1.00 124.85 ? 267  GLN A O   1 
ATOM   2686 C CB  . GLN A 1 362 ? -24.115 -0.870  34.351 1.00 116.78 ? 267  GLN A CB  1 
ATOM   2687 C CG  . GLN A 1 362 ? -23.740 0.609   34.363 1.00 135.37 ? 267  GLN A CG  1 
ATOM   2688 C CD  . GLN A 1 362 ? -22.732 0.972   35.426 1.00 158.81 ? 267  GLN A CD  1 
ATOM   2689 O OE1 . GLN A 1 362 ? -22.722 0.425   36.539 1.00 156.62 ? 267  GLN A OE1 1 
ATOM   2690 N NE2 . GLN A 1 362 ? -21.906 1.964   35.129 1.00 149.37 ? 267  GLN A NE2 1 
ATOM   2691 N N   . LEU A 1 363 ? -26.205 -3.443  33.913 1.00 122.92 ? 268  LEU A N   1 
ATOM   2692 C CA  . LEU A 1 363 ? -26.352 -4.888  33.710 1.00 126.83 ? 268  LEU A CA  1 
ATOM   2693 C C   . LEU A 1 363 ? -27.398 -5.184  32.625 1.00 134.14 ? 268  LEU A C   1 
ATOM   2694 O O   . LEU A 1 363 ? -27.100 -5.902  31.669 1.00 136.10 ? 268  LEU A O   1 
ATOM   2695 C CB  . LEU A 1 363 ? -26.729 -5.619  35.023 1.00 128.04 ? 268  LEU A CB  1 
ATOM   2696 C CG  . LEU A 1 363 ? -25.720 -5.578  36.181 1.00 130.27 ? 268  LEU A CG  1 
ATOM   2697 C CD1 . LEU A 1 363 ? -26.379 -5.978  37.489 1.00 131.70 ? 268  LEU A CD1 1 
ATOM   2698 C CD2 . LEU A 1 363 ? -24.491 -6.435  35.900 1.00 133.67 ? 268  LEU A CD2 1 
ATOM   2699 N N   . GLY A 1 364 ? -28.596 -4.624  32.788 1.00 130.79 ? 269  GLY A N   1 
ATOM   2700 C CA  . GLY A 1 364 ? -29.720 -4.812  31.878 1.00 133.90 ? 269  GLY A CA  1 
ATOM   2701 C C   . GLY A 1 364 ? -30.993 -5.228  32.588 1.00 140.59 ? 269  GLY A C   1 
ATOM   2702 O O   . GLY A 1 364 ? -31.941 -5.690  31.946 1.00 144.06 ? 269  GLY A O   1 
ATOM   2703 N N   . ILE A 1 365 ? -31.017 -5.070  33.926 1.00 135.56 ? 270  ILE A N   1 
ATOM   2704 C CA  . ILE A 1 365 ? -32.161 -5.395  34.785 1.00 138.16 ? 270  ILE A CA  1 
ATOM   2705 C C   . ILE A 1 365 ? -33.245 -4.331  34.555 1.00 141.74 ? 270  ILE A C   1 
ATOM   2706 O O   . ILE A 1 365 ? -34.400 -4.675  34.288 1.00 145.47 ? 270  ILE A O   1 
ATOM   2707 C CB  . ILE A 1 365 ? -31.747 -5.506  36.287 1.00 139.33 ? 270  ILE A CB  1 
ATOM   2708 C CG1 . ILE A 1 365 ? -30.358 -6.196  36.512 1.00 138.69 ? 270  ILE A CG1 1 
ATOM   2709 C CG2 . ILE A 1 365 ? -32.870 -6.102  37.157 1.00 143.44 ? 270  ILE A CG2 1 
ATOM   2710 C CD1 . ILE A 1 365 ? -30.183 -7.711  36.084 1.00 150.98 ? 270  ILE A CD1 1 
ATOM   2711 N N   . ILE A 1 366 ? -32.849 -3.041  34.631 1.00 133.51 ? 271  ILE A N   1 
ATOM   2712 C CA  . ILE A 1 366 ? -33.721 -1.896  34.385 1.00 132.81 ? 271  ILE A CA  1 
ATOM   2713 C C   . ILE A 1 366 ? -33.237 -1.235  33.081 1.00 134.29 ? 271  ILE A C   1 
ATOM   2714 O O   . ILE A 1 366 ? -32.233 -0.517  33.068 1.00 129.70 ? 271  ILE A O   1 
ATOM   2715 C CB  . ILE A 1 366 ? -33.793 -0.915  35.595 1.00 133.04 ? 271  ILE A CB  1 
ATOM   2716 C CG1 . ILE A 1 366 ? -34.267 -1.650  36.872 1.00 135.15 ? 271  ILE A CG1 1 
ATOM   2717 C CG2 . ILE A 1 366 ? -34.717 0.269   35.278 1.00 134.41 ? 271  ILE A CG2 1 
ATOM   2718 C CD1 . ILE A 1 366 ? -34.123 -0.876  38.198 1.00 139.71 ? 271  ILE A CD1 1 
ATOM   2719 N N   . ARG A 1 367 ? -33.931 -1.551  31.977 1.00 133.82 ? 272  ARG A N   1 
ATOM   2720 C CA  . ARG A 1 367 ? -33.661 -1.035  30.636 1.00 132.56 ? 272  ARG A CA  1 
ATOM   2721 C C   . ARG A 1 367 ? -34.814 -0.077  30.288 1.00 136.42 ? 272  ARG A C   1 
ATOM   2722 O O   . ARG A 1 367 ? -35.778 -0.444  29.608 1.00 140.18 ? 272  ARG A O   1 
ATOM   2723 C CB  . ARG A 1 367 ? -33.480 -2.208  29.633 1.00 136.09 ? 272  ARG A CB  1 
ATOM   2724 C CG  . ARG A 1 367 ? -33.340 -1.854  28.139 1.00 148.80 ? 272  ARG A CG  1 
ATOM   2725 C CD  . ARG A 1 367 ? -32.109 -1.044  27.765 1.00 155.96 ? 272  ARG A CD  1 
ATOM   2726 N NE  . ARG A 1 367 ? -32.027 -0.843  26.315 1.00 165.31 ? 272  ARG A NE  1 
ATOM   2727 C CZ  . ARG A 1 367 ? -32.583 0.172   25.657 1.00 179.55 ? 272  ARG A CZ  1 
ATOM   2728 N NH1 . ARG A 1 367 ? -33.267 1.103   26.312 1.00 164.65 ? 272  ARG A NH1 1 
ATOM   2729 N NH2 . ARG A 1 367 ? -32.458 0.263   24.340 1.00 168.93 ? 272  ARG A NH2 1 
ATOM   2730 N N   . ASP A 1 368 ? -34.742 1.135   30.861 1.00 128.77 ? 273  ASP A N   1 
ATOM   2731 C CA  . ASP A 1 368 ? -35.727 2.203   30.696 1.00 128.77 ? 273  ASP A CA  1 
ATOM   2732 C C   . ASP A 1 368 ? -35.022 3.542   30.844 1.00 126.43 ? 273  ASP A C   1 
ATOM   2733 O O   . ASP A 1 368 ? -34.463 3.833   31.903 1.00 122.41 ? 273  ASP A O   1 
ATOM   2734 C CB  . ASP A 1 368 ? -36.884 2.051   31.714 1.00 133.38 ? 273  ASP A CB  1 
ATOM   2735 C CG  . ASP A 1 368 ? -38.087 2.974   31.540 1.00 144.75 ? 273  ASP A CG  1 
ATOM   2736 O OD1 . ASP A 1 368 ? -38.972 2.966   32.423 1.00 148.31 ? 273  ASP A OD1 1 
ATOM   2737 O OD2 . ASP A 1 368 ? -38.159 3.681   30.508 1.00 148.89 ? 273  ASP A OD2 1 
ATOM   2738 N N   . CYS A 1 369 ? -35.027 4.342   29.762 1.00 122.13 ? 274  CYS A N   1 
ATOM   2739 C CA  . CYS A 1 369 ? -34.393 5.659   29.707 1.00 118.17 ? 274  CYS A CA  1 
ATOM   2740 C C   . CYS A 1 369 ? -35.115 6.670   30.615 1.00 120.73 ? 274  CYS A C   1 
ATOM   2741 O O   . CYS A 1 369 ? -34.496 7.655   31.021 1.00 117.32 ? 274  CYS A O   1 
ATOM   2742 C CB  . CYS A 1 369 ? -34.320 6.165   28.271 1.00 118.81 ? 274  CYS A CB  1 
ATOM   2743 S SG  . CYS A 1 369 ? -33.145 5.275   27.216 1.00 122.36 ? 274  CYS A SG  1 
ATOM   2744 N N   . ARG A 1 370 ? -36.408 6.435   30.923 1.00 119.59 ? 275  ARG A N   1 
ATOM   2745 C CA  . ARG A 1 370 ? -37.176 7.303   31.811 1.00 119.44 ? 275  ARG A CA  1 
ATOM   2746 C C   . ARG A 1 370 ? -36.642 7.136   33.238 1.00 119.79 ? 275  ARG A C   1 
ATOM   2747 O O   . ARG A 1 370 ? -36.482 8.130   33.947 1.00 117.08 ? 275  ARG A O   1 
ATOM   2748 C CB  . ARG A 1 370 ? -38.688 7.001   31.717 1.00 124.52 ? 275  ARG A CB  1 
ATOM   2749 C CG  . ARG A 1 370 ? -39.593 7.914   32.565 1.00 136.26 ? 275  ARG A CG  1 
ATOM   2750 C CD  . ARG A 1 370 ? -39.642 9.358   32.080 1.00 144.49 ? 275  ARG A CD  1 
ATOM   2751 N NE  . ARG A 1 370 ? -40.334 10.235  33.028 1.00 152.72 ? 275  ARG A NE  1 
ATOM   2752 C CZ  . ARG A 1 370 ? -39.741 10.896  34.019 1.00 163.11 ? 275  ARG A CZ  1 
ATOM   2753 N NH1 . ARG A 1 370 ? -38.432 10.782  34.214 1.00 145.07 ? 275  ARG A NH1 1 
ATOM   2754 N NH2 . ARG A 1 370 ? -40.451 11.672  34.826 1.00 151.71 ? 275  ARG A NH2 1 
ATOM   2755 N N   . ILE A 1 371 ? -36.314 5.887   33.628 1.00 116.16 ? 276  ILE A N   1 
ATOM   2756 C CA  . ILE A 1 371 ? -35.749 5.572   34.945 1.00 113.63 ? 276  ILE A CA  1 
ATOM   2757 C C   . ILE A 1 371 ? -34.256 5.952   34.928 1.00 111.92 ? 276  ILE A C   1 
ATOM   2758 O O   . ILE A 1 371 ? -33.797 6.613   35.859 1.00 108.70 ? 276  ILE A O   1 
ATOM   2759 C CB  . ILE A 1 371 ? -35.996 4.085   35.360 1.00 119.18 ? 276  ILE A CB  1 
ATOM   2760 C CG1 . ILE A 1 371 ? -37.518 3.806   35.529 1.00 124.60 ? 276  ILE A CG1 1 
ATOM   2761 C CG2 . ILE A 1 371 ? -35.236 3.733   36.648 1.00 118.02 ? 276  ILE A CG2 1 
ATOM   2762 C CD1 . ILE A 1 371 ? -37.952 2.311   35.652 1.00 135.64 ? 276  ILE A CD1 1 
ATOM   2763 N N   . ALA A 1 372 ? -33.527 5.586   33.851 1.00 107.54 ? 277  ALA A N   1 
ATOM   2764 C CA  . ALA A 1 372 ? -32.101 5.881   33.673 1.00 103.69 ? 277  ALA A CA  1 
ATOM   2765 C C   . ALA A 1 372 ? -31.802 7.376   33.836 1.00 105.45 ? 277  ALA A C   1 
ATOM   2766 O O   . ALA A 1 372 ? -30.734 7.727   34.338 1.00 102.35 ? 277  ALA A O   1 
ATOM   2767 C CB  . ALA A 1 372 ? -31.630 5.409   32.308 1.00 104.87 ? 277  ALA A CB  1 
ATOM   2768 N N   . ASP A 1 373 ? -32.758 8.247   33.442 1.00 103.11 ? 278  ASP A N   1 
ATOM   2769 C CA  . ASP A 1 373 ? -32.640 9.701   33.555 1.00 101.04 ? 278  ASP A CA  1 
ATOM   2770 C C   . ASP A 1 373 ? -32.697 10.127  35.021 1.00 103.30 ? 278  ASP A C   1 
ATOM   2771 O O   . ASP A 1 373 ? -31.814 10.860  35.456 1.00 100.83 ? 278  ASP A O   1 
ATOM   2772 C CB  . ASP A 1 373 ? -33.736 10.414  32.741 1.00 105.26 ? 278  ASP A CB  1 
ATOM   2773 C CG  . ASP A 1 373 ? -33.646 11.928  32.753 1.00 109.99 ? 278  ASP A CG  1 
ATOM   2774 O OD1 . ASP A 1 373 ? -32.520 12.461  32.598 1.00 106.80 ? 278  ASP A OD1 1 
ATOM   2775 O OD2 . ASP A 1 373 ? -34.705 12.583  32.870 1.00 117.10 ? 278  ASP A OD2 1 
ATOM   2776 N N   . ILE A 1 374 ? -33.707 9.637   35.782 1.00 100.98 ? 279  ILE A N   1 
ATOM   2777 C CA  . ILE A 1 374 ? -33.927 9.922   37.213 1.00 99.71  ? 279  ILE A CA  1 
ATOM   2778 C C   . ILE A 1 374 ? -32.658 9.558   38.022 1.00 99.56  ? 279  ILE A C   1 
ATOM   2779 O O   . ILE A 1 374 ? -32.284 10.302  38.929 1.00 97.11  ? 279  ILE A O   1 
ATOM   2780 C CB  . ILE A 1 374 ? -35.196 9.175   37.745 1.00 105.83 ? 279  ILE A CB  1 
ATOM   2781 C CG1 . ILE A 1 374 ? -36.468 9.631   36.987 1.00 109.61 ? 279  ILE A CG1 1 
ATOM   2782 C CG2 . ILE A 1 374 ? -35.374 9.358   39.265 1.00 106.12 ? 279  ILE A CG2 1 
ATOM   2783 C CD1 . ILE A 1 374 ? -37.680 8.704   37.107 1.00 120.47 ? 279  ILE A CD1 1 
ATOM   2784 N N   . VAL A 1 375 ? -31.987 8.446   37.662 1.00 95.32  ? 280  VAL A N   1 
ATOM   2785 C CA  . VAL A 1 375 ? -30.771 7.981   38.330 1.00 92.39  ? 280  VAL A CA  1 
ATOM   2786 C C   . VAL A 1 375 ? -29.586 8.873   37.906 1.00 95.18  ? 280  VAL A C   1 
ATOM   2787 O O   . VAL A 1 375 ? -28.845 9.328   38.774 1.00 93.27  ? 280  VAL A O   1 
ATOM   2788 C CB  . VAL A 1 375 ? -30.497 6.471   38.065 1.00 96.38  ? 280  VAL A CB  1 
ATOM   2789 C CG1 . VAL A 1 375 ? -29.180 6.009   38.690 1.00 93.39  ? 280  VAL A CG1 1 
ATOM   2790 C CG2 . VAL A 1 375 ? -31.650 5.607   38.571 1.00 99.11  ? 280  VAL A CG2 1 
ATOM   2791 N N   . ASP A 1 376 ? -29.430 9.150   36.602 1.00 92.79  ? 281  ASP A N   1 
ATOM   2792 C CA  . ASP A 1 376 ? -28.313 9.956   36.105 1.00 91.36  ? 281  ASP A CA  1 
ATOM   2793 C C   . ASP A 1 376 ? -28.468 11.468  36.402 1.00 96.38  ? 281  ASP A C   1 
ATOM   2794 O O   . ASP A 1 376 ? -27.482 12.200  36.255 1.00 94.54  ? 281  ASP A O   1 
ATOM   2795 C CB  . ASP A 1 376 ? -28.111 9.742   34.598 1.00 94.12  ? 281  ASP A CB  1 
ATOM   2796 C CG  . ASP A 1 376 ? -27.380 8.454   34.267 1.00 102.74 ? 281  ASP A CG  1 
ATOM   2797 O OD1 . ASP A 1 376 ? -27.854 7.374   34.685 1.00 103.77 ? 281  ASP A OD1 1 
ATOM   2798 O OD2 . ASP A 1 376 ? -26.332 8.526   33.595 1.00 108.04 ? 281  ASP A OD2 1 
ATOM   2799 N N   . THR A 1 377 ? -29.665 11.932  36.832 1.00 95.34  ? 282  THR A N   1 
ATOM   2800 C CA  . THR A 1 377 ? -29.880 13.348  37.169 1.00 95.29  ? 282  THR A CA  1 
ATOM   2801 C C   . THR A 1 377 ? -29.655 13.550  38.689 1.00 96.79  ? 282  THR A C   1 
ATOM   2802 O O   . THR A 1 377 ? -29.293 14.651  39.103 1.00 95.81  ? 282  THR A O   1 
ATOM   2803 C CB  . THR A 1 377 ? -31.275 13.857  36.693 1.00 107.62 ? 282  THR A CB  1 
ATOM   2804 O OG1 . THR A 1 377 ? -31.292 15.281  36.686 1.00 107.65 ? 282  THR A OG1 1 
ATOM   2805 C CG2 . THR A 1 377 ? -32.450 13.346  37.536 1.00 108.79 ? 282  THR A CG2 1 
ATOM   2806 N N   . ALA A 1 378 ? -29.844 12.481  39.496 1.00 92.34  ? 283  ALA A N   1 
ATOM   2807 C CA  . ALA A 1 378 ? -29.714 12.500  40.953 1.00 90.67  ? 283  ALA A CA  1 
ATOM   2808 C C   . ALA A 1 378 ? -28.290 12.191  41.430 1.00 91.41  ? 283  ALA A C   1 
ATOM   2809 O O   . ALA A 1 378 ? -27.874 12.764  42.433 1.00 90.07  ? 283  ALA A O   1 
ATOM   2810 C CB  . ALA A 1 378 ? -30.677 11.508  41.570 1.00 92.97  ? 283  ALA A CB  1 
ATOM   2811 N N   . MET A 1 379 ? -27.549 11.308  40.727 1.00 86.95  ? 284  MET A N   1 
ATOM   2812 C CA  . MET A 1 379 ? -26.178 10.923  41.088 1.00 84.82  ? 284  MET A CA  1 
ATOM   2813 C C   . MET A 1 379 ? -25.223 12.144  41.260 1.00 86.19  ? 284  MET A C   1 
ATOM   2814 O O   . MET A 1 379 ? -24.507 12.129  42.263 1.00 84.10  ? 284  MET A O   1 
ATOM   2815 C CB  . MET A 1 379 ? -25.577 9.934   40.094 1.00 87.66  ? 284  MET A CB  1 
ATOM   2816 C CG  . MET A 1 379 ? -26.014 8.519   40.348 1.00 93.25  ? 284  MET A CG  1 
ATOM   2817 S SD  . MET A 1 379 ? -25.011 7.310   39.465 1.00 98.81  ? 284  MET A SD  1 
ATOM   2818 C CE  . MET A 1 379 ? -23.522 7.329   40.470 1.00 93.52  ? 284  MET A CE  1 
ATOM   2819 N N   . PRO A 1 380 ? -25.198 13.219  40.407 1.00 82.55  ? 285  PRO A N   1 
ATOM   2820 C CA  . PRO A 1 380 ? -24.297 14.359  40.706 1.00 80.83  ? 285  PRO A CA  1 
ATOM   2821 C C   . PRO A 1 380 ? -24.659 15.090  42.013 1.00 81.29  ? 285  PRO A C   1 
ATOM   2822 O O   . PRO A 1 380 ? -23.776 15.636  42.677 1.00 79.08  ? 285  PRO A O   1 
ATOM   2823 C CB  . PRO A 1 380 ? -24.481 15.290  39.501 1.00 84.00  ? 285  PRO A CB  1 
ATOM   2824 C CG  . PRO A 1 380 ? -25.801 14.932  38.935 1.00 90.49  ? 285  PRO A CG  1 
ATOM   2825 C CD  . PRO A 1 380 ? -25.944 13.457  39.151 1.00 85.75  ? 285  PRO A CD  1 
ATOM   2826 N N   . ILE A 1 381 ? -25.954 15.077  42.382 1.00 77.37  ? 286  ILE A N   1 
ATOM   2827 C CA  . ILE A 1 381 ? -26.486 15.711  43.589 1.00 76.98  ? 286  ILE A CA  1 
ATOM   2828 C C   . ILE A 1 381 ? -26.171 14.821  44.811 1.00 79.03  ? 286  ILE A C   1 
ATOM   2829 O O   . ILE A 1 381 ? -25.821 15.350  45.870 1.00 77.93  ? 286  ILE A O   1 
ATOM   2830 C CB  . ILE A 1 381 ? -28.013 15.985  43.429 1.00 82.30  ? 286  ILE A CB  1 
ATOM   2831 C CG1 . ILE A 1 381 ? -28.312 16.714  42.089 1.00 84.85  ? 286  ILE A CG1 1 
ATOM   2832 C CG2 . ILE A 1 381 ? -28.575 16.761  44.618 1.00 83.13  ? 286  ILE A CG2 1 
ATOM   2833 C CD1 . ILE A 1 381 ? -29.803 16.802  41.662 1.00 96.25  ? 286  ILE A CD1 1 
ATOM   2834 N N   . THR A 1 382 ? -26.263 13.478  44.654 1.00 74.56  ? 287  THR A N   1 
ATOM   2835 C CA  . THR A 1 382 ? -26.013 12.527  45.737 1.00 73.05  ? 287  THR A CA  1 
ATOM   2836 C C   . THR A 1 382 ? -24.508 12.392  46.046 1.00 75.82  ? 287  THR A C   1 
ATOM   2837 O O   . THR A 1 382 ? -24.163 12.194  47.206 1.00 75.09  ? 287  THR A O   1 
ATOM   2838 C CB  . THR A 1 382 ? -26.627 11.149  45.449 1.00 80.86  ? 287  THR A CB  1 
ATOM   2839 O OG1 . THR A 1 382 ? -25.983 10.529  44.343 1.00 79.83  ? 287  THR A OG1 1 
ATOM   2840 C CG2 . THR A 1 382 ? -28.138 11.192  45.246 1.00 81.72  ? 287  THR A CG2 1 
ATOM   2841 N N   . ILE A 1 383 ? -23.622 12.498  45.038 1.00 73.08  ? 288  ILE A N   1 
ATOM   2842 C CA  . ILE A 1 383 ? -22.164 12.403  45.236 1.00 72.18  ? 288  ILE A CA  1 
ATOM   2843 C C   . ILE A 1 383 ? -21.664 13.712  45.913 1.00 77.12  ? 288  ILE A C   1 
ATOM   2844 O O   . ILE A 1 383 ? -20.637 13.696  46.593 1.00 75.92  ? 288  ILE A O   1 
ATOM   2845 C CB  . ILE A 1 383 ? -21.390 12.063  43.907 1.00 75.34  ? 288  ILE A CB  1 
ATOM   2846 C CG1 . ILE A 1 383 ? -19.964 11.525  44.193 1.00 74.78  ? 288  ILE A CG1 1 
ATOM   2847 C CG2 . ILE A 1 383 ? -21.388 13.212  42.880 1.00 76.37  ? 288  ILE A CG2 1 
ATOM   2848 C CD1 . ILE A 1 383 ? -19.338 10.692  43.099 1.00 81.69  ? 288  ILE A CD1 1 
ATOM   2849 N N   . CYS A 1 384 ? -22.417 14.823  45.744 1.00 75.56  ? 289  CYS A N   1 
ATOM   2850 C CA  . CYS A 1 384 ? -22.130 16.118  46.358 1.00 76.00  ? 289  CYS A CA  1 
ATOM   2851 C C   . CYS A 1 384 ? -22.376 16.038  47.877 1.00 78.63  ? 289  CYS A C   1 
ATOM   2852 O O   . CYS A 1 384 ? -21.522 16.475  48.645 1.00 78.64  ? 289  CYS A O   1 
ATOM   2853 C CB  . CYS A 1 384 ? -22.969 17.218  45.709 1.00 78.49  ? 289  CYS A CB  1 
ATOM   2854 S SG  . CYS A 1 384 ? -22.748 18.866  46.440 1.00 83.73  ? 289  CYS A SG  1 
ATOM   2855 N N   . ILE A 1 385 ? -23.522 15.458  48.298 1.00 73.42  ? 290  ILE A N   1 
ATOM   2856 C CA  . ILE A 1 385 ? -23.915 15.303  49.707 1.00 72.09  ? 290  ILE A CA  1 
ATOM   2857 C C   . ILE A 1 385 ? -22.998 14.250  50.407 1.00 72.38  ? 290  ILE A C   1 
ATOM   2858 O O   . ILE A 1 385 ? -22.629 14.450  51.570 1.00 71.49  ? 290  ILE A O   1 
ATOM   2859 C CB  . ILE A 1 385 ? -25.431 14.943  49.811 1.00 76.48  ? 290  ILE A CB  1 
ATOM   2860 C CG1 . ILE A 1 385 ? -26.300 16.046  49.152 1.00 78.68  ? 290  ILE A CG1 1 
ATOM   2861 C CG2 . ILE A 1 385 ? -25.868 14.706  51.268 1.00 77.07  ? 290  ILE A CG2 1 
ATOM   2862 C CD1 . ILE A 1 385 ? -27.690 15.614  48.703 1.00 87.38  ? 290  ILE A CD1 1 
ATOM   2863 N N   . ALA A 1 386 ? -22.603 13.167  49.690 1.00 66.43  ? 291  ALA A N   1 
ATOM   2864 C CA  . ALA A 1 386 ? -21.725 12.106  50.211 1.00 63.79  ? 291  ALA A CA  1 
ATOM   2865 C C   . ALA A 1 386 ? -20.259 12.589  50.353 1.00 64.59  ? 291  ALA A C   1 
ATOM   2866 O O   . ALA A 1 386 ? -19.444 11.891  50.969 1.00 62.89  ? 291  ALA A O   1 
ATOM   2867 C CB  . ALA A 1 386 ? -21.789 10.881  49.313 1.00 64.55  ? 291  ALA A CB  1 
ATOM   2868 N N   . TYR A 1 387 ? -19.932 13.785  49.798 1.00 60.03  ? 292  TYR A N   1 
ATOM   2869 C CA  . TYR A 1 387 ? -18.605 14.393  49.911 1.00 58.87  ? 292  TYR A CA  1 
ATOM   2870 C C   . TYR A 1 387 ? -18.700 15.823  50.546 1.00 65.12  ? 292  TYR A C   1 
ATOM   2871 O O   . TYR A 1 387 ? -17.673 16.492  50.727 1.00 65.08  ? 292  TYR A O   1 
ATOM   2872 C CB  . TYR A 1 387 ? -17.890 14.406  48.547 1.00 59.00  ? 292  TYR A CB  1 
ATOM   2873 C CG  . TYR A 1 387 ? -17.273 13.061  48.227 1.00 58.46  ? 292  TYR A CG  1 
ATOM   2874 C CD1 . TYR A 1 387 ? -17.973 12.105  47.495 1.00 59.63  ? 292  TYR A CD1 1 
ATOM   2875 C CD2 . TYR A 1 387 ? -16.029 12.703  48.742 1.00 58.65  ? 292  TYR A CD2 1 
ATOM   2876 C CE1 . TYR A 1 387 ? -17.437 10.842  47.252 1.00 58.17  ? 292  TYR A CE1 1 
ATOM   2877 C CE2 . TYR A 1 387 ? -15.482 11.442  48.503 1.00 59.07  ? 292  TYR A CE2 1 
ATOM   2878 C CZ  . TYR A 1 387 ? -16.192 10.513  47.762 1.00 62.53  ? 292  TYR A CZ  1 
ATOM   2879 O OH  . TYR A 1 387 ? -15.661 9.271   47.521 1.00 61.46  ? 292  TYR A OH  1 
ATOM   2880 N N   . PHE A 1 388 ? -19.926 16.234  50.963 1.00 62.81  ? 293  PHE A N   1 
ATOM   2881 C CA  . PHE A 1 388 ? -20.232 17.522  51.605 1.00 63.94  ? 293  PHE A CA  1 
ATOM   2882 C C   . PHE A 1 388 ? -19.575 17.637  52.992 1.00 67.67  ? 293  PHE A C   1 
ATOM   2883 O O   . PHE A 1 388 ? -19.372 18.754  53.462 1.00 68.48  ? 293  PHE A O   1 
ATOM   2884 C CB  . PHE A 1 388 ? -21.759 17.687  51.746 1.00 66.92  ? 293  PHE A CB  1 
ATOM   2885 C CG  . PHE A 1 388 ? -22.292 19.097  51.639 1.00 70.79  ? 293  PHE A CG  1 
ATOM   2886 C CD1 . PHE A 1 388 ? -22.339 19.928  52.752 1.00 74.81  ? 293  PHE A CD1 1 
ATOM   2887 C CD2 . PHE A 1 388 ? -22.800 19.576  50.434 1.00 74.65  ? 293  PHE A CD2 1 
ATOM   2888 C CE1 . PHE A 1 388 ? -22.838 21.233  52.652 1.00 78.21  ? 293  PHE A CE1 1 
ATOM   2889 C CE2 . PHE A 1 388 ? -23.307 20.877  50.336 1.00 79.64  ? 293  PHE A CE2 1 
ATOM   2890 C CZ  . PHE A 1 388 ? -23.317 21.699  51.444 1.00 78.73  ? 293  PHE A CZ  1 
ATOM   2891 N N   . ASN A 1 389 ? -19.245 16.487  53.641 1.00 62.62  ? 294  ASN A N   1 
ATOM   2892 C CA  . ASN A 1 389 ? -18.640 16.417  54.977 1.00 61.49  ? 294  ASN A CA  1 
ATOM   2893 C C   . ASN A 1 389 ? -17.245 17.051  55.035 1.00 65.25  ? 294  ASN A C   1 
ATOM   2894 O O   . ASN A 1 389 ? -16.847 17.508  56.100 1.00 65.06  ? 294  ASN A O   1 
ATOM   2895 C CB  . ASN A 1 389 ? -18.555 14.965  55.471 1.00 59.89  ? 294  ASN A CB  1 
ATOM   2896 C CG  . ASN A 1 389 ? -17.572 14.076  54.748 1.00 67.56  ? 294  ASN A CG  1 
ATOM   2897 O OD1 . ASN A 1 389 ? -16.358 14.077  55.027 1.00 51.10  ? 294  ASN A OD1 1 
ATOM   2898 N ND2 . ASN A 1 389 ? -18.093 13.243  53.860 1.00 59.61  ? 294  ASN A ND2 1 
ATOM   2899 N N   . ASN A 1 390 ? -16.509 17.077  53.912 1.00 62.23  ? 295  ASN A N   1 
ATOM   2900 C CA  . ASN A 1 390 ? -15.155 17.630  53.852 1.00 62.90  ? 295  ASN A CA  1 
ATOM   2901 C C   . ASN A 1 390 ? -15.160 19.136  54.193 1.00 70.19  ? 295  ASN A C   1 
ATOM   2902 O O   . ASN A 1 390 ? -14.155 19.623  54.715 1.00 71.48  ? 295  ASN A O   1 
ATOM   2903 C CB  . ASN A 1 390 ? -14.507 17.364  52.488 1.00 60.40  ? 295  ASN A CB  1 
ATOM   2904 C CG  . ASN A 1 390 ? -14.317 15.883  52.184 1.00 70.85  ? 295  ASN A CG  1 
ATOM   2905 O OD1 . ASN A 1 390 ? -13.242 15.315  52.379 1.00 57.35  ? 295  ASN A OD1 1 
ATOM   2906 N ND2 . ASN A 1 390 ? -15.358 15.216  51.695 1.00 60.07  ? 295  ASN A ND2 1 
ATOM   2907 N N   . CYS A 1 391 ? -16.298 19.846  53.985 1.00 67.81  ? 296  CYS A N   1 
ATOM   2908 C CA  . CYS A 1 391 ? -16.406 21.265  54.335 1.00 69.94  ? 296  CYS A CA  1 
ATOM   2909 C C   . CYS A 1 391 ? -17.192 21.457  55.643 1.00 73.59  ? 296  CYS A C   1 
ATOM   2910 O O   . CYS A 1 391 ? -17.064 22.511  56.267 1.00 74.62  ? 296  CYS A O   1 
ATOM   2911 C CB  . CYS A 1 391 ? -17.024 22.080  53.201 1.00 71.99  ? 296  CYS A CB  1 
ATOM   2912 S SG  . CYS A 1 391 ? -18.821 21.907  53.023 1.00 75.82  ? 296  CYS A SG  1 
ATOM   2913 N N   . LEU A 1 392 ? -18.003 20.456  56.041 1.00 68.89  ? 297  LEU A N   1 
ATOM   2914 C CA  . LEU A 1 392 ? -18.850 20.521  57.234 1.00 68.88  ? 297  LEU A CA  1 
ATOM   2915 C C   . LEU A 1 392 ? -18.142 19.991  58.500 1.00 69.58  ? 297  LEU A C   1 
ATOM   2916 O O   . LEU A 1 392 ? -18.431 20.493  59.589 1.00 69.52  ? 297  LEU A O   1 
ATOM   2917 C CB  . LEU A 1 392 ? -20.160 19.745  57.017 1.00 68.79  ? 297  LEU A CB  1 
ATOM   2918 C CG  . LEU A 1 392 ? -21.325 20.185  57.910 1.00 75.36  ? 297  LEU A CG  1 
ATOM   2919 C CD1 . LEU A 1 392 ? -22.059 21.383  57.317 1.00 78.18  ? 297  LEU A CD1 1 
ATOM   2920 C CD2 . LEU A 1 392 ? -22.285 19.053  58.144 1.00 76.87  ? 297  LEU A CD2 1 
ATOM   2921 N N   . ASN A 1 393 ? -17.238 18.989  58.369 1.00 63.22  ? 298  ASN A N   1 
ATOM   2922 C CA  . ASN A 1 393 ? -16.486 18.411  59.497 1.00 61.07  ? 298  ASN A CA  1 
ATOM   2923 C C   . ASN A 1 393 ? -15.812 19.504  60.350 1.00 63.96  ? 298  ASN A C   1 
ATOM   2924 O O   . ASN A 1 393 ? -16.037 19.469  61.557 1.00 62.79  ? 298  ASN A O   1 
ATOM   2925 C CB  . ASN A 1 393 ? -15.434 17.381  59.042 1.00 58.64  ? 298  ASN A CB  1 
ATOM   2926 C CG  . ASN A 1 393 ? -15.971 16.007  58.708 1.00 75.30  ? 298  ASN A CG  1 
ATOM   2927 O OD1 . ASN A 1 393 ? -17.156 15.688  58.893 1.00 66.88  ? 298  ASN A OD1 1 
ATOM   2928 N ND2 . ASN A 1 393 ? -15.095 15.148  58.216 1.00 68.53  ? 298  ASN A ND2 1 
ATOM   2929 N N   . PRO A 1 394 ? -15.077 20.513  59.787 1.00 61.61  ? 299  PRO A N   1 
ATOM   2930 C CA  . PRO A 1 394 ? -14.453 21.535  60.659 1.00 62.69  ? 299  PRO A CA  1 
ATOM   2931 C C   . PRO A 1 394 ? -15.446 22.313  61.529 1.00 65.64  ? 299  PRO A C   1 
ATOM   2932 O O   . PRO A 1 394 ? -15.081 22.714  62.636 1.00 65.99  ? 299  PRO A O   1 
ATOM   2933 C CB  . PRO A 1 394 ? -13.763 22.488  59.675 1.00 66.66  ? 299  PRO A CB  1 
ATOM   2934 C CG  . PRO A 1 394 ? -14.271 22.137  58.315 1.00 70.69  ? 299  PRO A CG  1 
ATOM   2935 C CD  . PRO A 1 394 ? -14.678 20.711  58.371 1.00 63.77  ? 299  PRO A CD  1 
ATOM   2936 N N   . LEU A 1 395 ? -16.700 22.493  61.051 1.00 61.11  ? 300  LEU A N   1 
ATOM   2937 C CA  . LEU A 1 395 ? -17.761 23.199  61.777 1.00 61.90  ? 300  LEU A CA  1 
ATOM   2938 C C   . LEU A 1 395 ? -18.224 22.422  63.032 1.00 64.79  ? 300  LEU A C   1 
ATOM   2939 O O   . LEU A 1 395 ? -18.754 23.048  63.950 1.00 65.59  ? 300  LEU A O   1 
ATOM   2940 C CB  . LEU A 1 395 ? -18.969 23.485  60.862 1.00 62.43  ? 300  LEU A CB  1 
ATOM   2941 C CG  . LEU A 1 395 ? -18.893 24.758  60.005 1.00 69.56  ? 300  LEU A CG  1 
ATOM   2942 C CD1 . LEU A 1 395 ? -18.171 24.514  58.696 1.00 69.07  ? 300  LEU A CD1 1 
ATOM   2943 C CD2 . LEU A 1 395 ? -20.277 25.288  59.696 1.00 73.19  ? 300  LEU A CD2 1 
ATOM   2944 N N   . PHE A 1 396 ? -17.994 21.082  63.092 1.00 59.90  ? 301  PHE A N   1 
ATOM   2945 C CA  . PHE A 1 396 ? -18.380 20.236  64.228 1.00 59.03  ? 301  PHE A CA  1 
ATOM   2946 C C   . PHE A 1 396 ? -17.434 20.409  65.431 1.00 65.63  ? 301  PHE A C   1 
ATOM   2947 O O   . PHE A 1 396 ? -17.618 19.739  66.451 1.00 64.66  ? 301  PHE A O   1 
ATOM   2948 C CB  . PHE A 1 396 ? -18.441 18.750  63.838 1.00 58.64  ? 301  PHE A CB  1 
ATOM   2949 C CG  . PHE A 1 396 ? -19.590 18.316  62.959 1.00 59.98  ? 301  PHE A CG  1 
ATOM   2950 C CD1 . PHE A 1 396 ? -20.902 18.629  63.294 1.00 63.47  ? 301  PHE A CD1 1 
ATOM   2951 C CD2 . PHE A 1 396 ? -19.369 17.501  61.850 1.00 61.57  ? 301  PHE A CD2 1 
ATOM   2952 C CE1 . PHE A 1 396 ? -21.969 18.191  62.503 1.00 64.68  ? 301  PHE A CE1 1 
ATOM   2953 C CE2 . PHE A 1 396 ? -20.437 17.056  61.060 1.00 64.15  ? 301  PHE A CE2 1 
ATOM   2954 C CZ  . PHE A 1 396 ? -21.729 17.402  61.395 1.00 63.21  ? 301  PHE A CZ  1 
ATOM   2955 N N   . TYR A 1 397 ? -16.449 21.318  65.331 1.00 65.00  ? 302  TYR A N   1 
ATOM   2956 C CA  . TYR A 1 397 ? -15.511 21.595  66.423 1.00 66.02  ? 302  TYR A CA  1 
ATOM   2957 C C   . TYR A 1 397 ? -16.058 22.702  67.352 1.00 74.08  ? 302  TYR A C   1 
ATOM   2958 O O   . TYR A 1 397 ? -15.384 23.081  68.314 1.00 74.99  ? 302  TYR A O   1 
ATOM   2959 C CB  . TYR A 1 397 ? -14.129 21.964  65.861 1.00 67.49  ? 302  TYR A CB  1 
ATOM   2960 C CG  . TYR A 1 397 ? -13.342 20.759  65.391 1.00 66.32  ? 302  TYR A CG  1 
ATOM   2961 C CD1 . TYR A 1 397 ? -13.635 20.138  64.180 1.00 66.99  ? 302  TYR A CD1 1 
ATOM   2962 C CD2 . TYR A 1 397 ? -12.293 20.250  66.148 1.00 66.31  ? 302  TYR A CD2 1 
ATOM   2963 C CE1 . TYR A 1 397 ? -12.915 19.030  63.743 1.00 65.85  ? 302  TYR A CE1 1 
ATOM   2964 C CE2 . TYR A 1 397 ? -11.563 19.144  65.718 1.00 65.88  ? 302  TYR A CE2 1 
ATOM   2965 C CZ  . TYR A 1 397 ? -11.877 18.538  64.514 1.00 70.66  ? 302  TYR A CZ  1 
ATOM   2966 O OH  . TYR A 1 397 ? -11.154 17.457  64.074 1.00 69.47  ? 302  TYR A OH  1 
ATOM   2967 N N   . GLY A 1 398 ? -17.295 23.144  67.090 1.00 72.90  ? 303  GLY A N   1 
ATOM   2968 C CA  . GLY A 1 398 ? -18.017 24.146  67.868 1.00 75.67  ? 303  GLY A CA  1 
ATOM   2969 C C   . GLY A 1 398 ? -18.339 23.705  69.285 1.00 81.15  ? 303  GLY A C   1 
ATOM   2970 O O   . GLY A 1 398 ? -18.673 24.539  70.129 1.00 83.36  ? 303  GLY A O   1 
ATOM   2971 N N   . PHE A 1 399 ? -18.227 22.390  69.560 1.00 76.50  ? 304  PHE A N   1 
ATOM   2972 C CA  . PHE A 1 399 ? -18.430 21.792  70.877 1.00 76.51  ? 304  PHE A CA  1 
ATOM   2973 C C   . PHE A 1 399 ? -17.294 22.173  71.817 1.00 83.93  ? 304  PHE A C   1 
ATOM   2974 O O   . PHE A 1 399 ? -17.468 22.124  73.037 1.00 85.04  ? 304  PHE A O   1 
ATOM   2975 C CB  . PHE A 1 399 ? -18.537 20.266  70.771 1.00 75.74  ? 304  PHE A CB  1 
ATOM   2976 C CG  . PHE A 1 399 ? -19.737 19.778  69.999 1.00 76.88  ? 304  PHE A CG  1 
ATOM   2977 C CD1 . PHE A 1 399 ? -20.958 19.585  70.630 1.00 80.63  ? 304  PHE A CD1 1 
ATOM   2978 C CD2 . PHE A 1 399 ? -19.641 19.487  68.645 1.00 78.21  ? 304  PHE A CD2 1 
ATOM   2979 C CE1 . PHE A 1 399 ? -22.067 19.127  69.914 1.00 81.51  ? 304  PHE A CE1 1 
ATOM   2980 C CE2 . PHE A 1 399 ? -20.748 19.026  67.930 1.00 80.63  ? 304  PHE A CE2 1 
ATOM   2981 C CZ  . PHE A 1 399 ? -21.954 18.849  68.567 1.00 79.40  ? 304  PHE A CZ  1 
ATOM   2982 N N   . LEU A 1 400 ? -16.134 22.556  71.246 1.00 82.07  ? 305  LEU A N   1 
ATOM   2983 C CA  . LEU A 1 400 ? -14.941 22.975  71.981 1.00 83.99  ? 305  LEU A CA  1 
ATOM   2984 C C   . LEU A 1 400 ? -14.912 24.505  72.194 1.00 93.26  ? 305  LEU A C   1 
ATOM   2985 O O   . LEU A 1 400 ? -14.122 24.981  73.009 1.00 94.63  ? 305  LEU A O   1 
ATOM   2986 C CB  . LEU A 1 400 ? -13.677 22.519  71.233 1.00 83.44  ? 305  LEU A CB  1 
ATOM   2987 N N   . GLY A 1 401 ? -15.782 25.230  71.482 1.00 92.51  ? 306  GLY A N   1 
ATOM   2988 C CA  . GLY A 1 401 ? -15.919 26.688  71.488 1.00 96.39  ? 306  GLY A CA  1 
ATOM   2989 C C   . GLY A 1 401 ? -15.863 27.404  72.825 1.00 104.31 ? 306  GLY A C   1 
ATOM   2990 O O   . GLY A 1 401 ? -15.158 28.410  72.947 1.00 106.67 ? 306  GLY A O   1 
ATOM   2991 N N   . LYS A 1 402 ? -16.608 26.900  73.835 1.00 101.39 ? 307  LYS A N   1 
ATOM   2992 C CA  . LYS A 1 402 ? -16.667 27.486  75.187 1.00 103.82 ? 307  LYS A CA  1 
ATOM   2993 C C   . LYS A 1 402 ? -15.340 27.318  75.940 1.00 108.00 ? 307  LYS A C   1 
ATOM   2994 O O   . LYS A 1 402 ? -14.982 28.181  76.742 1.00 110.61 ? 307  LYS A O   1 
ATOM   2995 C CB  . LYS A 1 402 ? -17.805 26.864  76.021 1.00 105.79 ? 307  LYS A CB  1 
ATOM   2996 C CG  . LYS A 1 402 ? -19.216 27.128  75.496 1.00 127.75 ? 307  LYS A CG  1 
ATOM   2997 C CD  . LYS A 1 402 ? -20.255 26.360  76.310 1.00 139.10 ? 307  LYS A CD  1 
ATOM   2998 C CE  . LYS A 1 402 ? -21.639 26.444  75.715 1.00 153.16 ? 307  LYS A CE  1 
ATOM   2999 N NZ  . LYS A 1 402 ? -22.617 25.635  76.490 1.00 163.38 ? 307  LYS A NZ  1 
ATOM   3000 N N   . LYS A 1 403 ? -14.638 26.193  75.706 1.00 101.91 ? 308  LYS A N   1 
ATOM   3001 C CA  . LYS A 1 403 ? -13.354 25.866  76.331 1.00 101.64 ? 308  LYS A CA  1 
ATOM   3002 C C   . LYS A 1 403 ? -12.191 26.501  75.558 1.00 106.57 ? 308  LYS A C   1 
ATOM   3003 O O   . LYS A 1 403 ? -11.151 26.787  76.150 1.00 107.73 ? 308  LYS A O   1 
ATOM   3004 C CB  . LYS A 1 403 ? -13.173 24.340  76.416 1.00 100.59 ? 308  LYS A CB  1 
ATOM   3005 N N   . PHE A 1 404 ? -12.374 26.720  74.243 1.00 102.65 ? 309  PHE A N   1 
ATOM   3006 C CA  . PHE A 1 404 ? -11.379 27.327  73.359 1.00 104.28 ? 309  PHE A CA  1 
ATOM   3007 C C   . PHE A 1 404 ? -11.278 28.834  73.604 1.00 110.77 ? 309  PHE A C   1 
ATOM   3008 O O   . PHE A 1 404 ? -10.166 29.367  73.595 1.00 112.53 ? 309  PHE A O   1 
ATOM   3009 C CB  . PHE A 1 404 ? -11.711 27.046  71.882 1.00 105.05 ? 309  PHE A CB  1 
ATOM   3010 C CG  . PHE A 1 404 ? -10.794 27.727  70.894 1.00 109.42 ? 309  PHE A CG  1 
ATOM   3011 C CD1 . PHE A 1 404 ? -11.178 28.903  70.260 1.00 116.08 ? 309  PHE A CD1 1 
ATOM   3012 C CD2 . PHE A 1 404 ? -9.534  27.209  70.617 1.00 111.72 ? 309  PHE A CD2 1 
ATOM   3013 C CE1 . PHE A 1 404 ? -10.322 29.544  69.358 1.00 119.79 ? 309  PHE A CE1 1 
ATOM   3014 C CE2 . PHE A 1 404 ? -8.680  27.847  69.712 1.00 117.35 ? 309  PHE A CE2 1 
ATOM   3015 C CZ  . PHE A 1 404 ? -9.080  29.009  69.087 1.00 118.44 ? 309  PHE A CZ  1 
ATOM   3016 N N   . LYS A 1 405 ? -12.428 29.522  73.790 1.00 107.66 ? 310  LYS A N   1 
ATOM   3017 C CA  . LYS A 1 405 ? -12.455 30.963  74.053 1.00 111.57 ? 310  LYS A CA  1 
ATOM   3018 C C   . LYS A 1 405 ? -11.804 31.240  75.421 1.00 115.99 ? 310  LYS A C   1 
ATOM   3019 O O   . LYS A 1 405 ? -11.225 32.305  75.623 1.00 119.51 ? 310  LYS A O   1 
ATOM   3020 C CB  . LYS A 1 405 ? -13.886 31.544  73.970 1.00 115.50 ? 310  LYS A CB  1 
ATOM   3021 C CG  . LYS A 1 405 ? -14.841 31.109  75.084 1.00 132.67 ? 310  LYS A CG  1 
ATOM   3022 C CD  . LYS A 1 405 ? -16.113 31.953  75.125 1.00 146.95 ? 310  LYS A CD  1 
ATOM   3023 C CE  . LYS A 1 405 ? -16.812 31.905  76.471 1.00 159.30 ? 310  LYS A CE  1 
ATOM   3024 N NZ  . LYS A 1 405 ? -17.323 30.549  76.819 1.00 163.49 ? 310  LYS A NZ  1 
ATOM   3025 N N   . ARG A 1 406 ? -11.864 30.247  76.330 1.00 108.75 ? 311  ARG A N   1 
ATOM   3026 C CA  . ARG A 1 406 ? -11.274 30.281  77.663 1.00 109.03 ? 311  ARG A CA  1 
ATOM   3027 C C   . ARG A 1 406 ? -9.742  30.253  77.541 1.00 113.06 ? 311  ARG A C   1 
ATOM   3028 O O   . ARG A 1 406 ? -9.061  30.968  78.275 1.00 115.49 ? 311  ARG A O   1 
ATOM   3029 C CB  . ARG A 1 406 ? -11.802 29.093  78.483 1.00 105.15 ? 311  ARG A CB  1 
ATOM   3030 C CG  . ARG A 1 406 ? -12.009 29.380  79.964 1.00 115.95 ? 311  ARG A CG  1 
ATOM   3031 C CD  . ARG A 1 406 ? -12.737 28.235  80.656 1.00 124.02 ? 311  ARG A CD  1 
ATOM   3032 N NE  . ARG A 1 406 ? -14.172 28.212  80.350 1.00 132.18 ? 311  ARG A NE  1 
ATOM   3033 C CZ  . ARG A 1 406 ? -15.004 27.238  80.711 1.00 143.21 ? 311  ARG A CZ  1 
ATOM   3034 N NH1 . ARG A 1 406 ? -14.554 26.182  81.379 1.00 127.68 ? 311  ARG A NH1 1 
ATOM   3035 N NH2 . ARG A 1 406 ? -16.291 27.306  80.396 1.00 129.29 ? 311  ARG A NH2 1 
ATOM   3036 N N   . TYR A 1 407 ? -9.212  29.464  76.577 1.00 107.13 ? 312  TYR A N   1 
ATOM   3037 C CA  . TYR A 1 407 ? -7.777  29.338  76.300 1.00 107.77 ? 312  TYR A CA  1 
ATOM   3038 C C   . TYR A 1 407 ? -7.250  30.570  75.542 1.00 115.16 ? 312  TYR A C   1 
ATOM   3039 O O   . TYR A 1 407 ? -6.194  31.096  75.904 1.00 117.93 ? 312  TYR A O   1 
ATOM   3040 C CB  . TYR A 1 407 ? -7.482  28.054  75.504 1.00 105.02 ? 312  TYR A CB  1 
ATOM   3041 N N   . PHE A 1 408 ? -7.989  31.020  74.497 1.00 111.21 ? 313  PHE A N   1 
ATOM   3042 C CA  . PHE A 1 408 ? -7.675  32.174  73.644 1.00 114.62 ? 313  PHE A CA  1 
ATOM   3043 C C   . PHE A 1 408 ? -7.472  33.449  74.483 1.00 121.64 ? 313  PHE A C   1 
ATOM   3044 O O   . PHE A 1 408 ? -6.470  34.144  74.291 1.00 125.45 ? 313  PHE A O   1 
ATOM   3045 C CB  . PHE A 1 408 ? -8.800  32.384  72.605 1.00 115.65 ? 313  PHE A CB  1 
ATOM   3046 C CG  . PHE A 1 408 ? -8.676  33.598  71.711 1.00 121.85 ? 313  PHE A CG  1 
ATOM   3047 C CD1 . PHE A 1 408 ? -7.958  33.537  70.522 1.00 126.01 ? 313  PHE A CD1 1 
ATOM   3048 C CD2 . PHE A 1 408 ? -9.329  34.787  72.027 1.00 127.72 ? 313  PHE A CD2 1 
ATOM   3049 C CE1 . PHE A 1 408 ? -7.860  34.655  69.685 1.00 131.26 ? 313  PHE A CE1 1 
ATOM   3050 C CE2 . PHE A 1 408 ? -9.226  35.907  71.192 1.00 135.01 ? 313  PHE A CE2 1 
ATOM   3051 C CZ  . PHE A 1 408 ? -8.493  35.834  70.027 1.00 133.85 ? 313  PHE A CZ  1 
ATOM   3052 N N   . LEU A 1 409 ? -8.422  33.744  75.403 1.00 116.41 ? 314  LEU A N   1 
ATOM   3053 C CA  . LEU A 1 409 ? -8.389  34.914  76.283 1.00 120.08 ? 314  LEU A CA  1 
ATOM   3054 C C   . LEU A 1 409 ? -7.205  34.832  77.231 1.00 126.17 ? 314  LEU A C   1 
ATOM   3055 O O   . LEU A 1 409 ? -6.463  35.805  77.345 1.00 130.89 ? 314  LEU A O   1 
ATOM   3056 C CB  . LEU A 1 409 ? -9.698  35.068  77.079 1.00 118.94 ? 314  LEU A CB  1 
ATOM   3057 C CG  . LEU A 1 409 ? -10.937 35.490  76.292 1.00 122.61 ? 314  LEU A CG  1 
ATOM   3058 C CD1 . LEU A 1 409 ? -12.186 35.254  77.092 1.00 120.50 ? 314  LEU A CD1 1 
ATOM   3059 C CD2 . LEU A 1 409 ? -10.864 36.942  75.842 1.00 130.26 ? 314  LEU A CD2 1 
ATOM   3060 N N   . GLN A 1 410 ? -6.991  33.657  77.864 1.00 119.44 ? 315  GLN A N   1 
ATOM   3061 C CA  . GLN A 1 410 ? -5.874  33.394  78.788 1.00 120.73 ? 315  GLN A CA  1 
ATOM   3062 C C   . GLN A 1 410 ? -4.503  33.565  78.104 1.00 128.19 ? 315  GLN A C   1 
ATOM   3063 O O   . GLN A 1 410 ? -3.540  33.962  78.760 1.00 131.48 ? 315  GLN A O   1 
ATOM   3064 C CB  . GLN A 1 410 ? -5.978  31.976  79.356 1.00 117.16 ? 315  GLN A CB  1 
ATOM   3065 N N   . LEU A 1 411 ? -4.422  33.281  76.784 1.00 123.99 ? 316  LEU A N   1 
ATOM   3066 C CA  . LEU A 1 411 ? -3.205  33.406  75.971 1.00 127.07 ? 316  LEU A CA  1 
ATOM   3067 C C   . LEU A 1 411 ? -2.851  34.894  75.743 1.00 137.39 ? 316  LEU A C   1 
ATOM   3068 O O   . LEU A 1 411 ? -1.949  35.406  76.418 1.00 141.03 ? 316  LEU A O   1 
ATOM   3069 C CB  . LEU A 1 411 ? -3.396  32.662  74.624 1.00 123.32 ? 316  LEU A CB  1 
ATOM   3070 C CG  . LEU A 1 411 ? -2.159  32.296  73.759 1.00 130.63 ? 316  LEU A CG  1 
ATOM   3071 C CD1 . LEU A 1 411 ? -1.560  33.496  73.017 1.00 135.71 ? 316  LEU A CD1 1 
ATOM   3072 C CD2 . LEU A 1 411 ? -1.128  31.452  74.521 1.00 135.30 ? 316  LEU A CD2 1 
ATOM   3073 N N   . LEU A 1 412 ? -3.574  35.587  74.825 1.00 135.21 ? 317  LEU A N   1 
ATOM   3074 C CA  . LEU A 1 412 ? -3.379  37.013  74.500 1.00 170.26 ? 317  LEU A CA  1 
ATOM   3075 C C   . LEU A 1 412 ? -4.666  37.631  73.934 1.00 188.26 ? 317  LEU A C   1 
ATOM   3076 O O   . LEU A 1 412 ? -5.698  37.624  74.609 1.00 141.39 ? 317  LEU A O   1 
ATOM   3077 C CB  . LEU A 1 412 ? -2.228  37.201  73.500 1.00 173.88 ? 317  LEU A CB  1 
HETATM 3078 C C4  . ZD7 B 2 .   ? -16.923 14.423  41.882 1.00 61.26  ? 1201 ZD7 A C4  1 
HETATM 3079 C C3  . ZD7 B 2 .   ? -18.352 14.857  40.006 1.00 61.11  ? 1201 ZD7 A C3  1 
HETATM 3080 C C2  . ZD7 B 2 .   ? -19.350 15.798  39.371 1.00 60.76  ? 1201 ZD7 A C2  1 
HETATM 3081 C C1  . ZD7 B 2 .   ? -20.754 15.293  39.580 1.00 59.96  ? 1201 ZD7 A C1  1 
HETATM 3082 O O1  . ZD7 B 2 .   ? -17.068 9.796   37.654 1.00 52.76  ? 1201 ZD7 A O1  1 
HETATM 3083 N N1  . ZD7 B 2 .   ? -17.848 15.247  41.236 1.00 61.19  ? 1201 ZD7 A N1  1 
HETATM 3084 C C10 . ZD7 B 2 .   ? -18.455 13.136  37.967 1.00 57.97  ? 1201 ZD7 A C10 1 
HETATM 3085 C C11 . ZD7 B 2 .   ? -18.662 11.639  37.939 1.00 56.28  ? 1201 ZD7 A C11 1 
HETATM 3086 C C12 . ZD7 B 2 .   ? -17.389 10.953  38.299 1.00 55.24  ? 1201 ZD7 A C12 1 
HETATM 3087 C C13 . ZD7 B 2 .   ? -15.273 10.956  39.738 1.00 60.20  ? 1201 ZD7 A C13 1 
HETATM 3088 C C14 . ZD7 B 2 .   ? -15.285 9.813   40.750 1.00 59.84  ? 1201 ZD7 A C14 1 
HETATM 3089 C C15 . ZD7 B 2 .   ? -16.568 9.233   41.285 1.00 59.28  ? 1201 ZD7 A C15 1 
HETATM 3090 C C16 . ZD7 B 2 .   ? -16.521 8.199   42.218 1.00 59.45  ? 1201 ZD7 A C16 1 
HETATM 3091 C C17 . ZD7 B 2 .   ? -14.054 9.336   41.172 1.00 59.25  ? 1201 ZD7 A C17 1 
HETATM 3092 C C18 . ZD7 B 2 .   ? -14.005 8.228   42.198 1.00 59.04  ? 1201 ZD7 A C18 1 
HETATM 3093 C C19 . ZD7 B 2 .   ? -15.171 7.693   42.692 1.00 60.54  ? 1201 ZD7 A C19 1 
HETATM 3094 N N2  . ZD7 B 2 .   ? -16.562 11.514  39.304 1.00 59.29  ? 1201 ZD7 A N2  1 
HETATM 3095 C C20 . ZD7 B 2 .   ? -15.067 6.543   43.686 1.00 62.80  ? 1201 ZD7 A C20 1 
HETATM 3096 C C21 . ZD7 B 2 .   ? -15.522 6.712   44.973 1.00 61.33  ? 1201 ZD7 A C21 1 
HETATM 3097 C C22 . ZD7 B 2 .   ? -15.406 5.565   45.935 1.00 61.64  ? 1201 ZD7 A C22 1 
HETATM 3098 C C23 . ZD7 B 2 .   ? -14.846 4.370   45.545 1.00 62.17  ? 1201 ZD7 A C23 1 
HETATM 3099 C C24 . ZD7 B 2 .   ? -14.341 4.187   44.144 1.00 63.42  ? 1201 ZD7 A C24 1 
HETATM 3100 C C25 . ZD7 B 2 .   ? -14.446 5.227   43.253 1.00 64.43  ? 1201 ZD7 A C25 1 
HETATM 3101 C C26 . ZD7 B 2 .   ? -13.952 5.051   41.859 1.00 65.88  ? 1201 ZD7 A C26 1 
HETATM 3102 N N3  . ZD7 B 2 .   ? -14.695 5.291   40.673 1.00 66.08  ? 1201 ZD7 A N3  1 
HETATM 3103 N N4  . ZD7 B 2 .   ? -13.930 5.078   39.595 1.00 66.01  ? 1201 ZD7 A N4  1 
HETATM 3104 C C5  . ZD7 B 2 .   ? -16.393 14.832  43.228 1.00 61.35  ? 1201 ZD7 A C5  1 
HETATM 3105 N N5  . ZD7 B 2 .   ? -12.697 4.706   40.096 1.00 66.09  ? 1201 ZD7 A N5  1 
HETATM 3106 C C6  . ZD7 B 2 .   ? -17.292 14.304  44.302 1.00 61.22  ? 1201 ZD7 A C6  1 
HETATM 3107 N N6  . ZD7 B 2 .   ? -12.703 4.704   41.485 1.00 66.39  ? 1201 ZD7 A N6  1 
HETATM 3108 C C7  . ZD7 B 2 .   ? -16.469 13.205  41.302 1.00 60.93  ? 1201 ZD7 A C7  1 
HETATM 3109 C C8  . ZD7 B 2 .   ? -16.979 12.776  39.954 1.00 60.58  ? 1201 ZD7 A C8  1 
HETATM 3110 C C9  . ZD7 B 2 .   ? -17.899 13.576  39.336 1.00 59.96  ? 1201 ZD7 A C9  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 2   ? 1.8736 1.5592 1.1813 0.0555  -0.0279 -0.1321 1002 ASP A N   
2    C CA  . ASP A 2   ? 1.8621 1.5404 1.1721 0.0368  -0.0210 -0.1253 1002 ASP A CA  
3    C C   . ASP A 2   ? 1.8931 1.5905 1.2128 0.0207  -0.0128 -0.1200 1002 ASP A C   
4    O O   . ASP A 2   ? 1.8732 1.6004 1.2186 0.0151  -0.0177 -0.1162 1002 ASP A O   
5    C CB  . ASP A 2   ? 1.8675 1.5594 1.2055 0.0306  -0.0331 -0.1219 1002 ASP A CB  
6    C CG  . ASP A 2   ? 2.0009 1.6883 1.3385 0.0172  -0.0298 -0.1190 1002 ASP A CG  
7    O OD1 . ASP A 2   ? 2.0156 1.6853 1.3294 0.0131  -0.0167 -0.1229 1002 ASP A OD1 
8    O OD2 . ASP A 2   ? 2.0786 1.7791 1.4366 0.0117  -0.0404 -0.1152 1002 ASP A OD2 
9    N N   . LEU A 3   ? 1.8470 1.5272 1.1454 0.0126  0.0010  -0.1215 1003 LEU A N   
10   C CA  . LEU A 3   ? 1.8233 1.5207 1.1285 -0.0003 0.0096  -0.1192 1003 LEU A CA  
11   C C   . LEU A 3   ? 1.8269 1.5500 1.1599 -0.0119 0.0038  -0.1150 1003 LEU A C   
12   O O   . LEU A 3   ? 1.8111 1.5567 1.1596 -0.0171 0.0035  -0.1100 1003 LEU A O   
13   C CB  . LEU A 3   ? 1.8450 1.5160 1.1185 -0.0064 0.0273  -0.1266 1003 LEU A CB  
14   C CG  . LEU A 3   ? 1.9088 1.5816 1.1710 -0.0092 0.0381  -0.1273 1003 LEU A CG  
15   C CD1 . LEU A 3   ? 1.9430 1.5777 1.1655 -0.0153 0.0571  -0.1367 1003 LEU A CD1 
16   C CD2 . LEU A 3   ? 1.9114 1.6227 1.2039 -0.0201 0.0372  -0.1242 1003 LEU A CD2 
17   N N   . GLU A 4   ? 1.7629 1.4798 1.0974 -0.0135 -0.0013 -0.1176 1004 GLU A N   
18   C CA  . GLU A 4   ? 1.7385 1.4725 1.0890 -0.0192 -0.0092 -0.1159 1004 GLU A CA  
19   C C   . GLU A 4   ? 1.7740 1.5197 1.1444 -0.0186 -0.0211 -0.1059 1004 GLU A C   
20   O O   . GLU A 4   ? 1.7609 1.5175 1.1376 -0.0230 -0.0239 -0.1019 1004 GLU A O   
21   C CB  . GLU A 4   ? 1.7565 1.4796 1.1000 -0.0177 -0.0136 -0.1225 1004 GLU A CB  
22   C CG  . GLU A 4   ? 1.8435 1.5833 1.1933 -0.0206 -0.0204 -0.1265 1004 GLU A CG  
23   C CD  . GLU A 4   ? 1.9573 1.6928 1.3003 -0.0188 -0.0252 -0.1356 1004 GLU A CD  
24   O OE1 . GLU A 4   ? 1.7859 1.5389 1.1292 -0.0191 -0.0296 -0.1442 1004 GLU A OE1 
25   O OE2 . GLU A 4   ? 1.7887 1.5044 1.1240 -0.0148 -0.0250 -0.1358 1004 GLU A OE2 
26   N N   . ASP A 5   ? 1.7312 1.4733 1.1082 -0.0127 -0.0271 -0.1042 1005 ASP A N   
27   C CA  . ASP A 5   ? 1.7244 1.4787 1.1212 -0.0161 -0.0353 -0.0989 1005 ASP A CA  
28   C C   . ASP A 5   ? 1.7510 1.5234 1.1553 -0.0232 -0.0281 -0.0946 1005 ASP A C   
29   O O   . ASP A 5   ? 1.7433 1.5213 1.1554 -0.0324 -0.0291 -0.0881 1005 ASP A O   
30   C CB  . ASP A 5   ? 1.7565 1.5096 1.1601 -0.0063 -0.0425 -0.1044 1005 ASP A CB  
31   C CG  . ASP A 5   ? 1.9238 1.6931 1.3507 -0.0128 -0.0494 -0.1041 1005 ASP A CG  
32   O OD1 . ASP A 5   ? 1.9368 1.7052 1.3694 -0.0253 -0.0506 -0.0970 1005 ASP A OD1 
33   O OD2 . ASP A 5   ? 2.0169 1.7976 1.4532 -0.0045 -0.0533 -0.1131 1005 ASP A OD2 
34   N N   . ASN A 6   ? 1.7015 1.4789 1.0984 -0.0182 -0.0205 -0.0981 1006 ASN A N   
35   C CA  . ASN A 6   ? 1.6919 1.4888 1.0947 -0.0228 -0.0140 -0.0950 1006 ASN A CA  
36   C C   . ASN A 6   ? 1.7383 1.5370 1.1369 -0.0293 -0.0076 -0.0898 1006 ASN A C   
37   O O   . ASN A 6   ? 1.7263 1.5400 1.1319 -0.0346 -0.0038 -0.0844 1006 ASN A O   
38   C CB  . ASN A 6   ? 1.6944 1.4915 1.0836 -0.0119 -0.0094 -0.1014 1006 ASN A CB  
39   C CG  . ASN A 6   ? 1.9910 1.7934 1.3825 0.0001  -0.0168 -0.1099 1006 ASN A CG  
40   O OD1 . ASN A 6   ? 1.9500 1.7315 1.3185 0.0154  -0.0174 -0.1169 1006 ASN A OD1 
41   N ND2 . ASN A 6   ? 1.8771 1.7069 1.2933 -0.0059 -0.0216 -0.1117 1006 ASN A ND2 
42   N N   . TRP A 7   ? 1.7057 1.4917 1.0924 -0.0280 -0.0064 -0.0937 1007 TRP A N   
43   C CA  . TRP A 7   ? 1.7065 1.4989 1.0887 -0.0304 -0.0019 -0.0947 1007 TRP A CA  
44   C C   . TRP A 7   ? 1.7420 1.5336 1.1271 -0.0320 -0.0093 -0.0880 1007 TRP A C   
45   O O   . TRP A 7   ? 1.7346 1.5335 1.1161 -0.0314 -0.0062 -0.0853 1007 TRP A O   
46   C CB  . TRP A 7   ? 1.7015 1.4864 1.0713 -0.0294 0.0022  -0.1064 1007 TRP A CB  
47   C CG  . TRP A 7   ? 1.7170 1.5169 1.0835 -0.0309 0.0103  -0.1145 1007 TRP A CG  
48   C CD1 . TRP A 7   ? 1.7548 1.5648 1.1186 -0.0290 0.0080  -0.1245 1007 TRP A CD1 
49   C CD2 . TRP A 7   ? 1.7149 1.5258 1.0811 -0.0322 0.0206  -0.1156 1007 TRP A CD2 
50   N NE1 . TRP A 7   ? 1.7469 1.5760 1.1107 -0.0292 0.0171  -0.1339 1007 TRP A NE1 
51   C CE2 . TRP A 7   ? 1.7649 1.5934 1.1307 -0.0318 0.0250  -0.1273 1007 TRP A CE2 
52   C CE3 . TRP A 7   ? 1.7332 1.5434 1.0988 -0.0316 0.0253  -0.1098 1007 TRP A CE3 
53   C CZ2 . TRP A 7   ? 1.7543 1.5982 1.1213 -0.0323 0.0349  -0.1326 1007 TRP A CZ2 
54   C CZ3 . TRP A 7   ? 1.7507 1.5738 1.1153 -0.0319 0.0342  -0.1130 1007 TRP A CZ3 
55   C CH2 . TRP A 7   ? 1.7550 1.5942 1.1214 -0.0329 0.0393  -0.1237 1007 TRP A CH2 
56   N N   . GLU A 8   ? 1.6962 1.4751 1.0835 -0.0326 -0.0189 -0.0856 1008 GLU A N   
57   C CA  . GLU A 8   ? 1.7022 1.4696 1.0845 -0.0347 -0.0257 -0.0788 1008 GLU A CA  
58   C C   . GLU A 8   ? 1.7390 1.5093 1.1292 -0.0447 -0.0208 -0.0700 1008 GLU A C   
59   O O   . GLU A 8   ? 1.7524 1.5096 1.1301 -0.0480 -0.0198 -0.0631 1008 GLU A O   
60   C CB  . GLU A 8   ? 1.7255 1.4773 1.1070 -0.0328 -0.0375 -0.0802 1008 GLU A CB  
61   C CG  . GLU A 8   ? 1.8731 1.6171 1.2379 -0.0238 -0.0454 -0.0858 1008 GLU A CG  
62   C CD  . GLU A 8   ? 2.1647 1.8964 1.5084 -0.0194 -0.0486 -0.0816 1008 GLU A CD  
63   O OE1 . GLU A 8   ? 2.0887 1.7970 1.4225 -0.0220 -0.0548 -0.0739 1008 GLU A OE1 
64   O OE2 . GLU A 8   ? 2.0863 1.8293 1.4200 -0.0122 -0.0444 -0.0872 1008 GLU A OE2 
65   N N   . THR A 9   ? 1.6693 1.4561 1.0762 -0.0485 -0.0169 -0.0722 1009 THR A N   
66   C CA  . THR A 9   ? 1.6653 1.4657 1.0843 -0.0595 -0.0110 -0.0688 1009 THR A CA  
67   C C   . THR A 9   ? 1.7033 1.5120 1.1156 -0.0606 -0.0015 -0.0629 1009 THR A C   
68   O O   . THR A 9   ? 1.7142 1.5225 1.1260 -0.0713 0.0047  -0.0569 1009 THR A O   
69   C CB  . THR A 9   ? 1.7365 1.5586 1.1725 -0.0570 -0.0120 -0.0779 1009 THR A CB  
70   O OG1 . THR A 9   ? 1.7107 1.5231 1.1492 -0.0506 -0.0212 -0.0842 1009 THR A OG1 
71   C CG2 . THR A 9   ? 1.7227 1.5680 1.1758 -0.0696 -0.0070 -0.0802 1009 THR A CG2 
72   N N   . LEU A 10  ? 1.6361 1.4511 1.0420 -0.0503 0.0008  -0.0658 1010 LEU A N   
73   C CA  . LEU A 10  ? 1.6293 1.4549 1.0302 -0.0479 0.0085  -0.0621 1010 LEU A CA  
74   C C   . LEU A 10  ? 1.6990 1.5066 1.0801 -0.0438 0.0081  -0.0574 1010 LEU A C   
75   O O   . LEU A 10  ? 1.7078 1.5124 1.0813 -0.0466 0.0143  -0.0496 1010 LEU A O   
76   C CB  . LEU A 10  ? 1.6110 1.4487 1.0110 -0.0392 0.0118  -0.0698 1010 LEU A CB  
77   C CG  . LEU A 10  ? 1.6546 1.5030 1.0611 -0.0377 0.0133  -0.0746 1010 LEU A CG  
78   C CD1 . LEU A 10  ? 1.6497 1.4957 1.0454 -0.0314 0.0183  -0.0826 1010 LEU A CD1 
79   C CD2 . LEU A 10  ? 1.6771 1.5475 1.0940 -0.0408 0.0169  -0.0705 1010 LEU A CD2 
80   N N   . ASN A 11  ? 1.6596 1.4547 1.0287 -0.0352 0.0008  -0.0635 1011 ASN A N   
81   C CA  . ASN A 11  ? 1.6799 1.4587 1.0239 -0.0242 -0.0028 -0.0639 1011 ASN A CA  
82   C C   . ASN A 11  ? 1.7584 1.5048 1.0825 -0.0295 -0.0036 -0.0525 1011 ASN A C   
83   O O   . ASN A 11  ? 1.7807 1.5111 1.0794 -0.0218 -0.0002 -0.0478 1011 ASN A O   
84   C CB  . ASN A 11  ? 1.7043 1.4823 1.0422 -0.0147 -0.0121 -0.0763 1011 ASN A CB  
85   C CG  . ASN A 11  ? 2.0580 1.8614 1.4091 -0.0130 -0.0079 -0.0901 1011 ASN A CG  
86   O OD1 . ASN A 11  ? 1.9973 1.8152 1.3616 -0.0184 0.0008  -0.0895 1011 ASN A OD1 
87   N ND2 . ASN A 11  ? 1.9681 1.7761 1.3132 -0.0063 -0.0133 -0.1041 1011 ASN A ND2 
88   N N   . ASP A 12  ? 1.7177 1.4517 1.0498 -0.0421 -0.0070 -0.0492 1012 ASP A N   
89   C CA  . ASP A 12  ? 1.7537 1.4527 1.0659 -0.0522 -0.0055 -0.0403 1012 ASP A CA  
90   C C   . ASP A 12  ? 1.8133 1.5136 1.1275 -0.0676 0.0094  -0.0322 1012 ASP A C   
91   O O   . ASP A 12  ? 1.8525 1.5170 1.1344 -0.0712 0.0160  -0.0240 1012 ASP A O   
92   C CB  . ASP A 12  ? 1.7735 1.4655 1.0995 -0.0625 -0.0128 -0.0425 1012 ASP A CB  
93   C CG  . ASP A 12  ? 1.8683 1.5546 1.1891 -0.0486 -0.0276 -0.0495 1012 ASP A CG  
94   O OD1 . ASP A 12  ? 1.8807 1.5584 1.1772 -0.0319 -0.0332 -0.0527 1012 ASP A OD1 
95   O OD2 . ASP A 12  ? 1.9206 1.6131 1.2609 -0.0531 -0.0339 -0.0535 1012 ASP A OD2 
96   N N   . ASN A 13  ? 1.7324 1.4710 1.0793 -0.0756 0.0151  -0.0353 1013 ASN A N   
97   C CA  . ASN A 13  ? 1.7369 1.4871 1.0904 -0.0905 0.0288  -0.0306 1013 ASN A CA  
98   C C   . ASN A 13  ? 1.7950 1.5420 1.1284 -0.0791 0.0359  -0.0242 1013 ASN A C   
99   O O   . ASN A 13  ? 1.8106 1.5525 1.1358 -0.0903 0.0486  -0.0175 1013 ASN A O   
100  C CB  . ASN A 13  ? 1.7012 1.4965 1.0923 -0.0970 0.0296  -0.0389 1013 ASN A CB  
101  C CG  . ASN A 13  ? 1.9284 1.7324 1.3403 -0.1106 0.0265  -0.0472 1013 ASN A CG  
102  O OD1 . ASN A 13  ? 1.8322 1.6648 1.2650 -0.1242 0.0329  -0.0539 1013 ASN A OD1 
103  N ND2 . ASN A 13  ? 1.8064 1.5909 1.2145 -0.1059 0.0159  -0.0497 1013 ASN A ND2 
104  N N   . LEU A 14  ? 1.7374 1.4887 1.0627 -0.0573 0.0287  -0.0281 1014 LEU A N   
105  C CA  . LEU A 14  ? 1.7447 1.4951 1.0507 -0.0418 0.0333  -0.0255 1014 LEU A CA  
106  C C   . LEU A 14  ? 1.8544 1.5548 1.1130 -0.0352 0.0356  -0.0180 1014 LEU A C   
107  O O   . LEU A 14  ? 1.8791 1.5658 1.1155 -0.0315 0.0455  -0.0106 1014 LEU A O   
108  C CB  . LEU A 14  ? 1.7161 1.4901 1.0292 -0.0220 0.0255  -0.0374 1014 LEU A CB  
109  C CG  . LEU A 14  ? 1.7781 1.5636 1.0800 -0.0041 0.0297  -0.0393 1014 LEU A CG  
110  C CD1 . LEU A 14  ? 1.7588 1.5752 1.0849 -0.0114 0.0382  -0.0354 1014 LEU A CD1 
111  C CD2 . LEU A 14  ? 1.7874 1.5914 1.0907 0.0141  0.0221  -0.0560 1014 LEU A CD2 
112  N N   . LYS A 15  ? 1.8345 1.5039 1.0736 -0.0327 0.0264  -0.0198 1015 LYS A N   
113  C CA  . LYS A 15  ? 1.8958 1.5073 1.0805 -0.0245 0.0261  -0.0137 1015 LYS A CA  
114  C C   . LYS A 15  ? 1.9920 1.5693 1.1590 -0.0490 0.0432  -0.0010 1015 LYS A C   
115  O O   . LYS A 15  ? 2.0478 1.5749 1.1622 -0.0417 0.0509  0.0070  1015 LYS A O   
116  C CB  . LYS A 15  ? 1.9360 1.5284 1.1111 -0.0197 0.0111  -0.0193 1015 LYS A CB  
117  C CG  . LYS A 15  ? 2.1916 1.7219 1.3021 -0.0029 0.0063  -0.0160 1015 LYS A CG  
118  C CD  . LYS A 15  ? 2.3382 1.8480 1.4402 -0.0019 -0.0085 -0.0201 1015 LYS A CD  
119  C CE  . LYS A 15  ? 2.4290 1.9767 1.5503 0.0182  -0.0260 -0.0359 1015 LYS A CE  
120  N NZ  . LYS A 15  ? 2.5283 2.0550 1.6396 0.0194  -0.0405 -0.0388 1015 LYS A NZ  
121  N N   . VAL A 16  ? 1.9251 1.5298 1.1333 -0.0773 0.0500  -0.0014 1016 VAL A N   
122  C CA  . VAL A 16  ? 1.9561 1.5442 1.1600 -0.1074 0.0684  0.0048  1016 VAL A CA  
123  C C   . VAL A 16  ? 2.0214 1.6182 1.2172 -0.1063 0.0832  0.0113  1016 VAL A C   
124  O O   . VAL A 16  ? 2.0742 1.6266 1.2304 -0.1177 0.0998  0.0201  1016 VAL A O   
125  C CB  . VAL A 16  ? 1.9637 1.5948 1.2206 -0.1326 0.0687  -0.0043 1016 VAL A CB  
126  C CG1 . VAL A 16  ? 1.9943 1.6184 1.2514 -0.1665 0.0894  -0.0035 1016 VAL A CG1 
127  C CG2 . VAL A 16  ? 1.9506 1.5724 1.2146 -0.1308 0.0537  -0.0104 1016 VAL A CG2 
128  N N   . ILE A 17  ? 1.9313 1.5806 1.1603 -0.0920 0.0776  0.0068  1017 ILE A N   
129  C CA  . ILE A 17  ? 1.9302 1.5974 1.1584 -0.0863 0.0879  0.0116  1017 ILE A CA  
130  C C   . ILE A 17  ? 2.0336 1.6538 1.2055 -0.0599 0.0893  0.0184  1017 ILE A C   
131  O O   . ILE A 17  ? 2.0673 1.6690 1.2136 -0.0610 0.1040  0.0270  1017 ILE A O   
132  C CB  . ILE A 17  ? 1.9029 1.6343 1.1782 -0.0755 0.0788  0.0032  1017 ILE A CB  
133  C CG1 . ILE A 17  ? 1.8757 1.6488 1.1965 -0.0975 0.0784  -0.0043 1017 ILE A CG1 
134  C CG2 . ILE A 17  ? 1.9055 1.6555 1.1782 -0.0633 0.0860  0.0075  1017 ILE A CG2 
135  C CD1 . ILE A 17  ? 1.9284 1.7502 1.2851 -0.0861 0.0678  -0.0135 1017 ILE A CD1 
136  N N   . GLU A 18  ? 1.9955 1.5961 1.1450 -0.0350 0.0742  0.0129  1018 GLU A N   
137  C CA  . GLU A 18  ? 2.0399 1.5991 1.1326 -0.0028 0.0715  0.0140  1018 GLU A CA  
138  C C   . GLU A 18  ? 2.1904 1.6691 1.2156 -0.0089 0.0840  0.0260  1018 GLU A C   
139  O O   . GLU A 18  ? 2.2356 1.6718 1.2038 0.0173  0.0870  0.0295  1018 GLU A O   
140  C CB  . GLU A 18  ? 2.0368 1.6044 1.1266 0.0236  0.0509  0.0000  1018 GLU A CB  
141  C CG  . GLU A 18  ? 2.0673 1.7028 1.2075 0.0341  0.0422  -0.0137 1018 GLU A CG  
142  C CD  . GLU A 18  ? 2.2291 1.8821 1.3729 0.0546  0.0249  -0.0314 1018 GLU A CD  
143  O OE1 . GLU A 18  ? 1.9714 1.6761 1.1559 0.0567  0.0210  -0.0438 1018 GLU A OE1 
144  O OE2 . GLU A 18  ? 2.2203 1.8346 1.3242 0.0678  0.0160  -0.0342 1018 GLU A OE2 
145  N N   . LYS A 19  ? 2.1798 1.6353 1.2079 -0.0425 0.0923  0.0309  1019 LYS A N   
146  C CA  . LYS A 19  ? 2.2725 1.6459 1.2352 -0.0556 0.1075  0.0414  1019 LYS A CA  
147  C C   . LYS A 19  ? 2.3495 1.7229 1.3261 -0.0986 0.1333  0.0480  1019 LYS A C   
148  O O   . LYS A 19  ? 2.4213 1.7253 1.3445 -0.1175 0.1514  0.0558  1019 LYS A O   
149  C CB  . LYS A 19  ? 2.3270 1.6645 1.2722 -0.0591 0.0957  0.0382  1019 LYS A CB  
150  C CG  . LYS A 19  ? 2.5384 1.8519 1.4425 -0.0159 0.0738  0.0319  1019 LYS A CG  
151  C CD  . LYS A 19  ? 2.7723 2.0037 1.5828 0.0109  0.0806  0.0392  1019 LYS A CD  
152  C CE  . LYS A 19  ? 2.9350 2.1502 1.7037 0.0580  0.0569  0.0280  1019 LYS A CE  
153  N NZ  . LYS A 19  ? 3.1511 2.2824 1.8208 0.0896  0.0625  0.0335  1019 LYS A NZ  
154  N N   . ALA A 20  ? 2.2460 1.6949 1.2893 -0.1134 0.1359  0.0430  1020 ALA A N   
155  C CA  . ALA A 20  ? 2.2523 1.7202 1.3186 -0.1525 0.1582  0.0437  1020 ALA A CA  
156  C C   . ALA A 20  ? 2.3679 1.7940 1.3839 -0.1532 0.1809  0.0553  1020 ALA A C   
157  O O   . ALA A 20  ? 2.3681 1.7853 1.3577 -0.1184 0.1755  0.0607  1020 ALA A O   
158  C CB  . ALA A 20  ? 2.1762 1.7365 1.3199 -0.1580 0.1504  0.0334  1020 ALA A CB  
159  N N   . ASP A 21  ? 2.3768 1.7782 1.3789 -0.1933 0.2073  0.0573  1021 ASP A N   
160  C CA  . ASP A 21  ? 2.4449 1.8004 1.3953 -0.2012 0.2339  0.0683  1021 ASP A CA  
161  C C   . ASP A 21  ? 2.4490 1.8787 1.4546 -0.2243 0.2464  0.0628  1021 ASP A C   
162  O O   . ASP A 21  ? 2.4398 1.8801 1.4362 -0.2054 0.2504  0.0698  1021 ASP A O   
163  C CB  . ASP A 21  ? 2.5731 1.8362 1.4561 -0.2329 0.2595  0.0736  1021 ASP A CB  
164  C CG  . ASP A 21  ? 2.7737 1.9514 1.5878 -0.2085 0.2483  0.0797  1021 ASP A CG  
165  O OD1 . ASP A 21  ? 2.7801 1.9426 1.5646 -0.1601 0.2292  0.0842  1021 ASP A OD1 
166  O OD2 . ASP A 21  ? 2.9073 2.0317 1.6927 -0.2373 0.2595  0.0785  1021 ASP A OD2 
167  N N   . ASN A 22  ? 2.3735 1.8570 1.4354 -0.2624 0.2515  0.0483  1022 ASN A N   
168  C CA  . ASN A 22  ? 2.3331 1.8939 1.4488 -0.2858 0.2620  0.0380  1022 ASN A CA  
169  C C   . ASN A 22  ? 2.2781 1.9332 1.4696 -0.2672 0.2343  0.0257  1022 ASN A C   
170  O O   . ASN A 22  ? 2.2377 1.8960 1.4422 -0.2452 0.2110  0.0237  1022 ASN A O   
171  C CB  . ASN A 22  ? 2.3929 1.9546 1.5173 -0.3403 0.2880  0.0246  1022 ASN A CB  
172  C CG  . ASN A 22  ? 2.7089 2.2717 1.8555 -0.3565 0.2787  0.0116  1022 ASN A CG  
173  O OD1 . ASN A 22  ? 2.5724 2.2084 1.7828 -0.3515 0.2582  -0.0036 1022 ASN A OD1 
174  N ND2 . ASN A 22  ? 2.6934 2.1718 1.7839 -0.3762 0.2944  0.0167  1022 ASN A ND2 
175  N N   . ALA A 23  ? 2.1888 1.9167 1.4242 -0.2755 0.2379  0.0170  1023 ALA A N   
176  C CA  . ALA A 23  ? 2.0989 1.9116 1.3966 -0.2580 0.2149  0.0050  1023 ALA A CA  
177  C C   . ALA A 23  ? 2.1084 1.9621 1.4508 -0.2744 0.2047  -0.0151 1023 ALA A C   
178  O O   . ALA A 23  ? 2.0451 1.9410 1.4218 -0.2515 0.1813  -0.0221 1023 ALA A O   
179  C CB  . ALA A 23  ? 2.0875 1.9596 1.4102 -0.2636 0.2234  0.0003  1023 ALA A CB  
180  N N   . ALA A 24  ? 2.0994 1.9385 1.4387 -0.3133 0.2229  -0.0256 1024 ALA A N   
181  C CA  . ALA A 24  ? 2.0685 1.9459 1.4489 -0.3295 0.2149  -0.0475 1024 ALA A CA  
182  C C   . ALA A 24  ? 2.0974 1.9380 1.4692 -0.3070 0.1935  -0.0416 1024 ALA A C   
183  O O   . ALA A 24  ? 2.0475 1.9311 1.4587 -0.3001 0.1760  -0.0568 1024 ALA A O   
184  C CB  . ALA A 24  ? 2.1328 1.9974 1.5072 -0.3783 0.2427  -0.0608 1024 ALA A CB  
185  N N   . GLN A 25  ? 2.0890 1.8510 1.4066 -0.2931 0.1944  -0.0211 1025 GLN A N   
186  C CA  . GLN A 25  ? 2.0764 1.8017 1.3798 -0.2695 0.1743  -0.0151 1025 GLN A CA  
187  C C   . GLN A 25  ? 2.0611 1.8224 1.3869 -0.2304 0.1498  -0.0130 1025 GLN A C   
188  O O   . GLN A 25  ? 2.0295 1.7929 1.3675 -0.2147 0.1309  -0.0167 1025 GLN A O   
189  C CB  . GLN A 25  ? 2.1633 1.7955 1.3957 -0.2640 0.1829  0.0030  1025 GLN A CB  
190  C CG  . GLN A 25  ? 2.4431 2.0204 1.6425 -0.3022 0.2056  0.0012  1025 GLN A CG  
191  C CD  . GLN A 25  ? 2.7926 2.2689 1.9089 -0.2923 0.2146  0.0196  1025 GLN A CD  
192  O OE1 . GLN A 25  ? 2.8093 2.2349 1.8785 -0.3135 0.2415  0.0266  1025 GLN A OE1 
193  N NE2 . GLN A 25  ? 2.7020 2.1450 1.7939 -0.2585 0.1927  0.0265  1025 GLN A NE2 
194  N N   . VAL A 26  ? 1.9949 1.7822 1.3241 -0.2161 0.1515  -0.0076 1026 VAL A N   
195  C CA  . VAL A 26  ? 1.9372 1.7572 1.2844 -0.1824 0.1325  -0.0066 1026 VAL A CA  
196  C C   . VAL A 26  ? 1.9210 1.8118 1.3207 -0.1838 0.1218  -0.0235 1026 VAL A C   
197  O O   . VAL A 26  ? 1.8784 1.7834 1.2928 -0.1629 0.1039  -0.0276 1026 VAL A O   
198  C CB  . VAL A 26  ? 1.9982 1.8148 1.3250 -0.1659 0.1392  0.0051  1026 VAL A CB  
199  C CG1 . VAL A 26  ? 1.9465 1.7930 1.2900 -0.1330 0.1210  0.0043  1026 VAL A CG1 
200  C CG2 . VAL A 26  ? 2.0607 1.8031 1.3272 -0.1612 0.1507  0.0199  1026 VAL A CG2 
201  N N   . LYS A 27  ? 1.8715 1.8047 1.2949 -0.2075 0.1333  -0.0352 1027 LYS A N   
202  C CA  . LYS A 27  ? 1.8232 1.8259 1.2903 -0.2066 0.1236  -0.0551 1027 LYS A CA  
203  C C   . LYS A 27  ? 1.8474 1.8552 1.3323 -0.2036 0.1093  -0.0681 1027 LYS A C   
204  O O   . LYS A 27  ? 1.8038 1.8361 1.3033 -0.1799 0.0920  -0.0743 1027 LYS A O   
205  C CB  . LYS A 27  ? 1.8683 1.9146 1.3543 -0.2364 0.1407  -0.0696 1027 LYS A CB  
206  C CG  . LYS A 27  ? 2.0508 2.1223 1.5345 -0.2323 0.1488  -0.0634 1027 LYS A CG  
207  C CD  . LYS A 27  ? 2.1909 2.3059 1.6913 -0.2656 0.1687  -0.0793 1027 LYS A CD  
208  C CE  . LYS A 27  ? 2.2719 2.4676 1.8169 -0.2678 0.1585  -0.1095 1027 LYS A CE  
209  N NZ  . LYS A 27  ? 2.3828 2.6268 1.9451 -0.3018 0.1793  -0.1284 1027 LYS A NZ  
210  N N   . ASP A 28  ? 1.8293 1.8095 1.3089 -0.2267 0.1171  -0.0720 1028 ASP A N   
211  C CA  . ASP A 28  ? 1.8120 1.7952 1.3081 -0.2250 0.1044  -0.0846 1028 ASP A CA  
212  C C   . ASP A 28  ? 1.8333 1.7800 1.3131 -0.1965 0.0870  -0.0724 1028 ASP A C   
213  O O   . ASP A 28  ? 1.8035 1.7658 1.3002 -0.1832 0.0720  -0.0829 1028 ASP A O   
214  C CB  . ASP A 28  ? 1.8794 1.8346 1.3691 -0.2578 0.1186  -0.0900 1028 ASP A CB  
215  C CG  . ASP A 28  ? 2.0339 2.0336 1.5467 -0.2916 0.1372  -0.1102 1028 ASP A CG  
216  O OD1 . ASP A 28  ? 2.0524 2.0655 1.5841 -0.3126 0.1408  -0.1293 1028 ASP A OD1 
217  O OD2 . ASP A 28  ? 2.1103 2.1351 1.6239 -0.2973 0.1483  -0.1091 1028 ASP A OD2 
218  N N   . ALA A 29  ? 1.7950 1.6952 1.2407 -0.1862 0.0893  -0.0528 1029 ALA A N   
219  C CA  . ALA A 29  ? 1.7726 1.6435 1.2024 -0.1608 0.0747  -0.0444 1029 ALA A CA  
220  C C   . ALA A 29  ? 1.7609 1.6664 1.2067 -0.1367 0.0629  -0.0483 1029 ALA A C   
221  O O   . ALA A 29  ? 1.7347 1.6376 1.1846 -0.1220 0.0500  -0.0526 1029 ALA A O   
222  C CB  . ALA A 29  ? 1.8160 1.6352 1.2040 -0.1544 0.0807  -0.0277 1029 ALA A CB  
223  N N   . LEU A 30  ? 1.6958 1.6309 1.1478 -0.1335 0.0683  -0.0473 1030 LEU A N   
224  C CA  . LEU A 30  ? 1.6533 1.6174 1.1152 -0.1120 0.0591  -0.0511 1030 LEU A CA  
225  C C   . LEU A 30  ? 1.6590 1.6622 1.1444 -0.1090 0.0505  -0.0685 1030 LEU A C   
226  O O   . LEU A 30  ? 1.6332 1.6452 1.1178 -0.0891 0.0409  -0.0728 1030 LEU A O   
227  C CB  . LEU A 30  ? 1.6534 1.6358 1.1124 -0.1086 0.0669  -0.0445 1030 LEU A CB  
228  C CG  . LEU A 30  ? 1.7337 1.6827 1.1663 -0.0999 0.0724  -0.0296 1030 LEU A CG  
229  C CD1 . LEU A 30  ? 1.7444 1.7114 1.1752 -0.1026 0.0833  -0.0238 1030 LEU A CD1 
230  C CD2 . LEU A 30  ? 1.7490 1.6907 1.1755 -0.0763 0.0620  -0.0296 1030 LEU A CD2 
231  N N   . THR A 31  ? 1.6042 1.6296 1.1072 -0.1277 0.0547  -0.0808 1031 THR A N   
232  C CA  . THR A 31  ? 1.5753 1.6422 1.0997 -0.1222 0.0457  -0.1023 1031 THR A CA  
233  C C   . THR A 31  ? 1.5858 1.6284 1.1057 -0.1085 0.0332  -0.1059 1031 THR A C   
234  O O   . THR A 31  ? 1.5625 1.6190 1.0820 -0.0873 0.0220  -0.1166 1031 THR A O   
235  C CB  . THR A 31  ? 1.6842 1.7862 1.2309 -0.1486 0.0558  -0.1182 1031 THR A CB  
236  O OG1 . THR A 31  ? 1.6776 1.7986 1.2249 -0.1622 0.0694  -0.1137 1031 THR A OG1 
237  C CG2 . THR A 31  ? 1.6502 1.8044 1.2201 -0.1391 0.0452  -0.1462 1031 THR A CG2 
238  N N   . LYS A 32  ? 1.5402 1.5428 1.0516 -0.1188 0.0351  -0.0968 1032 LYS A N   
239  C CA  . LYS A 32  ? 1.5284 1.5050 1.0346 -0.1078 0.0240  -0.0984 1032 LYS A CA  
240  C C   . LYS A 32  ? 1.5568 1.5098 1.0432 -0.0859 0.0176  -0.0893 1032 LYS A C   
241  O O   . LYS A 32  ? 1.5414 1.4860 1.0235 -0.0708 0.0083  -0.0956 1032 LYS A O   
242  C CB  . LYS A 32  ? 1.5790 1.5193 1.0782 -0.1250 0.0278  -0.0909 1032 LYS A CB  
243  C CG  . LYS A 32  ? 1.7561 1.7129 1.2728 -0.1514 0.0366  -0.1023 1032 LYS A CG  
244  C CD  . LYS A 32  ? 1.8785 1.8692 1.4217 -0.1483 0.0276  -0.1255 1032 LYS A CD  
245  C CE  . LYS A 32  ? 1.9931 1.9535 1.5318 -0.1395 0.0160  -0.1249 1032 LYS A CE  
246  N NZ  . LYS A 32  ? 2.0568 2.0521 1.6211 -0.1342 0.0075  -0.1491 1032 LYS A NZ  
247  N N   . MET A 33  ? 1.5103 1.4529 0.9837 -0.0848 0.0240  -0.0766 1033 MET A N   
248  C CA  . MET A 33  ? 1.4952 1.4213 0.9523 -0.0682 0.0212  -0.0712 1033 MET A CA  
249  C C   . MET A 33  ? 1.5288 1.4754 0.9850 -0.0530 0.0179  -0.0794 1033 MET A C   
250  O O   . MET A 33  ? 1.5140 1.4426 0.9557 -0.0404 0.0147  -0.0812 1033 MET A O   
251  C CB  . MET A 33  ? 1.5307 1.4459 0.9759 -0.0698 0.0289  -0.0590 1033 MET A CB  
252  C CG  . MET A 33  ? 1.5951 1.4757 1.0251 -0.0747 0.0295  -0.0513 1033 MET A CG  
253  S SD  . MET A 33  ? 1.6642 1.5292 1.0725 -0.0722 0.0385  -0.0392 1033 MET A SD  
254  C CE  . MET A 33  ? 1.5966 1.4731 1.0022 -0.0518 0.0351  -0.0437 1033 MET A CE  
255  N N   . ARG A 34  ? 1.4901 1.4723 0.9580 -0.0544 0.0194  -0.0854 1034 ARG A N   
256  C CA  . ARG A 34  ? 1.4818 1.4831 0.9431 -0.0371 0.0148  -0.0941 1034 ARG A CA  
257  C C   . ARG A 34  ? 1.5405 1.5343 0.9931 -0.0222 0.0052  -0.1077 1034 ARG A C   
258  O O   . ARG A 34  ? 1.5402 1.5122 0.9685 -0.0055 0.0025  -0.1094 1034 ARG A O   
259  C CB  . ARG A 34  ? 1.4675 1.5144 0.9442 -0.0415 0.0171  -0.1001 1034 ARG A CB  
260  C CG  . ARG A 34  ? 1.5589 1.6222 1.0226 -0.0212 0.0119  -0.1060 1034 ARG A CG  
261  C CD  . ARG A 34  ? 1.6315 1.7463 1.1114 -0.0241 0.0124  -0.1147 1034 ARG A CD  
262  N NE  . ARG A 34  ? 1.6835 1.8103 1.1468 -0.0030 0.0065  -0.1181 1034 ARG A NE  
263  C CZ  . ARG A 34  ? 1.8296 1.9666 1.2763 0.0199  -0.0049 -0.1345 1034 ARG A CZ  
264  N NH1 . ARG A 34  ? 1.6815 1.8222 1.1288 0.0261  -0.0120 -0.1502 1034 ARG A NH1 
265  N NH2 . ARG A 34  ? 1.6052 1.7466 1.0310 0.0391  -0.0100 -0.1361 1034 ARG A NH2 
266  N N   . ALA A 35  ? 1.5048 1.5126 0.9739 -0.0285 0.0013  -0.1179 1035 ALA A N   
267  C CA  . ALA A 35  ? 1.5139 1.5169 0.9760 -0.0120 -0.0087 -0.1326 1035 ALA A CA  
268  C C   . ALA A 35  ? 1.5794 1.5341 1.0219 -0.0062 -0.0101 -0.1250 1035 ALA A C   
269  O O   . ALA A 35  ? 1.5862 1.5229 1.0075 0.0136  -0.0162 -0.1336 1035 ALA A O   
270  C CB  . ALA A 35  ? 1.5236 1.5570 1.0135 -0.0234 -0.0111 -0.1464 1035 ALA A CB  
271  N N   . ALA A 36  ? 1.5400 1.4732 0.9857 -0.0217 -0.0043 -0.1103 1036 ALA A N   
272  C CA  . ALA A 36  ? 1.5457 1.4402 0.9758 -0.0189 -0.0050 -0.1047 1036 ALA A CA  
273  C C   . ALA A 36  ? 1.6121 1.4847 1.0148 -0.0075 -0.0006 -0.1035 1036 ALA A C   
274  O O   . ALA A 36  ? 1.6310 1.4756 1.0126 0.0030  -0.0019 -0.1081 1036 ALA A O   
275  C CB  . ALA A 36  ? 1.5513 1.4346 0.9893 -0.0353 -0.0014 -0.0929 1036 ALA A CB  
276  N N   . ALA A 37  ? 1.5591 1.4428 0.9603 -0.0099 0.0058  -0.0983 1037 ALA A N   
277  C CA  . ALA A 37  ? 1.5664 1.4315 0.9432 -0.0025 0.0120  -0.0986 1037 ALA A CA  
278  C C   . ALA A 37  ? 1.6421 1.4971 0.9918 0.0162  0.0092  -0.1083 1037 ALA A C   
279  O O   . ALA A 37  ? 1.6582 1.4814 0.9769 0.0224  0.0154  -0.1106 1037 ALA A O   
280  C CB  . ALA A 37  ? 1.5650 1.4494 0.9507 -0.0085 0.0180  -0.0917 1037 ALA A CB  
281  N N   . LEU A 38  ? 1.5992 1.4800 0.9569 0.0256  0.0006  -0.1163 1038 LEU A N   
282  C CA  . LEU A 38  ? 1.6174 1.4913 0.9447 0.0497  -0.0052 -0.1285 1038 LEU A CA  
283  C C   . LEU A 38  ? 1.6803 1.5133 0.9779 0.0644  -0.0081 -0.1358 1038 LEU A C   
284  O O   . LEU A 38  ? 1.7041 1.4989 0.9560 0.0817  -0.0057 -0.1404 1038 LEU A O   
285  C CB  . LEU A 38  ? 1.6104 1.5348 0.9582 0.0567  -0.0146 -0.1400 1038 LEU A CB  
286  C CG  . LEU A 38  ? 1.6527 1.6167 1.0186 0.0492  -0.0122 -0.1363 1038 LEU A CG  
287  C CD1 . LEU A 38  ? 1.6467 1.6665 1.0407 0.0487  -0.0191 -0.1503 1038 LEU A CD1 
288  C CD2 . LEU A 38  ? 1.6961 1.6439 1.0264 0.0663  -0.0116 -0.1366 1038 LEU A CD2 
289  N N   . ASP A 39  ? 1.6213 1.4581 0.9402 0.0584  -0.0126 -0.1370 1039 ASP A N   
290  C CA  . ASP A 39  ? 1.6411 1.4409 0.9339 0.0735  -0.0159 -0.1435 1039 ASP A CA  
291  C C   . ASP A 39  ? 1.6813 1.4380 0.9585 0.0610  -0.0051 -0.1338 1039 ASP A C   
292  O O   . ASP A 39  ? 1.6950 1.4127 0.9429 0.0720  -0.0042 -0.1379 1039 ASP A O   
293  C CB  . ASP A 39  ? 1.6543 1.4804 0.9770 0.0753  -0.0268 -0.1521 1039 ASP A CB  
294  C CG  . ASP A 39  ? 1.7777 1.6314 1.1463 0.0482  -0.0261 -0.1434 1039 ASP A CG  
295  O OD1 . ASP A 39  ? 1.7775 1.6101 1.1480 0.0329  -0.0200 -0.1307 1039 ASP A OD1 
296  O OD2 . ASP A 39  ? 1.8543 1.7488 1.2535 0.0431  -0.0316 -0.1517 1039 ASP A OD2 
297  N N   . ALA A 40  ? 1.6063 1.3716 0.9007 0.0399  0.0033  -0.1235 1040 ALA A N   
298  C CA  . ALA A 40  ? 1.6018 1.3383 0.8846 0.0271  0.0142  -0.1194 1040 ALA A CA  
299  C C   . ALA A 40  ? 1.6619 1.3657 0.9039 0.0310  0.0267  -0.1227 1040 ALA A C   
300  O O   . ALA A 40  ? 1.6720 1.3425 0.8914 0.0232  0.0384  -0.1253 1040 ALA A O   
301  C CB  . ALA A 40  ? 1.5810 1.3451 0.8980 0.0077  0.0159  -0.1114 1040 ALA A CB  
302  N N   . GLN A 41  ? 1.6106 1.3247 0.8421 0.0421  0.0246  -0.1243 1041 GLN A N   
303  C CA  . GLN A 41  ? 1.6339 1.3161 0.8222 0.0492  0.0343  -0.1277 1041 GLN A CA  
304  C C   . GLN A 41  ? 1.7171 1.3448 0.8487 0.0709  0.0351  -0.1358 1041 GLN A C   
305  O O   . GLN A 41  ? 1.7550 1.3322 0.8360 0.0734  0.0481  -0.1390 1041 GLN A O   
306  C CB  . GLN A 41  ? 1.6387 1.3573 0.8389 0.0565  0.0278  -0.1264 1041 GLN A CB  
307  C CG  . GLN A 41  ? 1.8475 1.5412 1.0113 0.0602  0.0372  -0.1280 1041 GLN A CG  
308  C CD  . GLN A 41  ? 2.0559 1.7924 1.2360 0.0690  0.0280  -0.1268 1041 GLN A CD  
309  O OE1 . GLN A 41  ? 2.0256 1.7647 1.1838 0.0920  0.0176  -0.1338 1041 GLN A OE1 
310  N NE2 . GLN A 41  ? 1.9104 1.6839 1.1285 0.0530  0.0310  -0.1194 1041 GLN A NE2 
311  N N   . LYS A 42  ? 1.6564 1.2923 0.7941 0.0870  0.0219  -0.1403 1042 LYS A N   
312  C CA  . LYS A 42  ? 1.6881 1.2771 0.7750 0.1135  0.0191  -0.1493 1042 LYS A CA  
313  C C   . LYS A 42  ? 1.7463 1.2916 0.8164 0.1035  0.0299  -0.1476 1042 LYS A C   
314  O O   . LYS A 42  ? 1.8000 1.2903 0.8160 0.1228  0.0334  -0.1535 1042 LYS A O   
315  C CB  . LYS A 42  ? 1.6949 1.3236 0.8052 0.1346  -0.0005 -0.1584 1042 LYS A CB  
316  C CG  . LYS A 42  ? 1.8129 1.4868 0.9340 0.1485  -0.0117 -0.1658 1042 LYS A CG  
317  C CD  . LYS A 42  ? 1.8809 1.6044 1.0357 0.1620  -0.0285 -0.1789 1042 LYS A CD  
318  C CE  . LYS A 42  ? 1.9698 1.7483 1.1408 0.1728  -0.0389 -0.1901 1042 LYS A CE  
319  N NZ  . LYS A 42  ? 2.0440 1.8782 1.2541 0.1803  -0.0527 -0.2070 1042 LYS A NZ  
320  N N   . ALA A 43  ? 1.6479 1.2179 0.7616 0.0755  0.0344  -0.1406 1043 ALA A N   
321  C CA  . ALA A 43  ? 1.6444 1.1879 0.7531 0.0627  0.0432  -0.1403 1043 ALA A CA  
322  C C   . ALA A 43  ? 1.7104 1.2105 0.7814 0.0455  0.0663  -0.1430 1043 ALA A C   
323  O O   . ALA A 43  ? 1.7149 1.2052 0.7655 0.0434  0.0748  -0.1440 1043 ALA A O   
324  C CB  . ALA A 43  ? 1.6015 1.1945 0.7709 0.0440  0.0353  -0.1345 1043 ALA A CB  
325  N N   . THR A 44  ? 1.6746 1.1500 0.7361 0.0326  0.0769  -0.1461 1044 THR A N   
326  C CA  . THR A 44  ? 1.6990 1.1355 0.7268 0.0113  0.1018  -0.1533 1044 THR A CA  
327  C C   . THR A 44  ? 1.6875 1.1670 0.7632 -0.0151 0.1046  -0.1565 1044 THR A C   
328  O O   . THR A 44  ? 1.6624 1.1552 0.7592 -0.0139 0.0952  -0.1554 1044 THR A O   
329  C CB  . THR A 44  ? 1.8632 1.2248 0.8242 0.0224  0.1142  -0.1581 1044 THR A CB  
330  O OG1 . THR A 44  ? 1.8966 1.2208 0.8100 0.0536  0.1080  -0.1570 1044 THR A OG1 
331  C CG2 . THR A 44  ? 1.8990 1.2132 0.8181 -0.0035 0.1446  -0.1677 1044 THR A CG2 
332  N N   . PRO A 45  ? 1.6163 1.1185 0.7071 -0.0364 0.1166  -0.1628 1045 PRO A N   
333  C CA  . PRO A 45  ? 1.5708 1.1178 0.7033 -0.0564 0.1176  -0.1703 1045 PRO A CA  
334  C C   . PRO A 45  ? 1.6210 1.1439 0.7349 -0.0696 0.1308  -0.1818 1045 PRO A C   
335  O O   . PRO A 45  ? 1.6640 1.1272 0.7253 -0.0702 0.1472  -0.1856 1045 PRO A O   
336  C CB  . PRO A 45  ? 1.5906 1.1568 0.7297 -0.0726 0.1312  -0.1794 1045 PRO A CB  
337  C CG  . PRO A 45  ? 1.6980 1.2108 0.7852 -0.0684 0.1450  -0.1791 1045 PRO A CG  
338  C CD  . PRO A 45  ? 1.6521 1.1437 0.7230 -0.0402 0.1280  -0.1651 1045 PRO A CD  
339  N N   . PRO A 46  ? 1.5378 1.1043 0.6897 -0.0790 0.1237  -0.1883 1046 PRO A N   
340  C CA  . PRO A 46  ? 1.5502 1.1015 0.6883 -0.0904 0.1338  -0.2002 1046 PRO A CA  
341  C C   . PRO A 46  ? 1.6321 1.1534 0.7341 -0.1166 0.1661  -0.2202 1046 PRO A C   
342  O O   . PRO A 46  ? 1.6793 1.1634 0.7499 -0.1235 0.1792  -0.2268 1046 PRO A O   
343  C CB  . PRO A 46  ? 1.5231 1.1367 0.7103 -0.0938 0.1183  -0.2061 1046 PRO A CB  
344  C CG  . PRO A 46  ? 1.5503 1.2045 0.7686 -0.0901 0.1086  -0.2017 1046 PRO A CG  
345  C CD  . PRO A 46  ? 1.5070 1.1344 0.7108 -0.0757 0.1045  -0.1845 1046 PRO A CD  
346  N N   . LYS A 47  ? 1.5494 1.0859 0.6549 -0.1321 0.1802  -0.2312 1047 LYS A N   
347  C CA  . LYS A 47  ? 1.5756 1.0867 0.6492 -0.1617 0.2134  -0.2540 1047 LYS A CA  
348  C C   . LYS A 47  ? 1.6678 1.0961 0.6735 -0.1622 0.2345  -0.2488 1047 LYS A C   
349  O O   . LYS A 47  ? 1.7011 1.0937 0.6694 -0.1890 0.2658  -0.2669 1047 LYS A O   
350  C CB  . LYS A 47  ? 1.5742 1.1444 0.6844 -0.1792 0.2199  -0.2737 1047 LYS A CB  
351  C CG  . LYS A 47  ? 1.6533 1.2738 0.7907 -0.1994 0.2270  -0.3016 1047 LYS A CG  
352  C CD  . LYS A 47  ? 1.6931 1.3674 0.8581 -0.2170 0.2383  -0.3280 1047 LYS A CD  
353  C CE  . LYS A 47  ? 1.7718 1.4962 0.9574 -0.2384 0.2491  -0.3630 1047 LYS A CE  
354  N NZ  . LYS A 47  ? 1.8561 1.6358 1.0676 -0.2545 0.2615  -0.3941 1047 LYS A NZ  
355  N N   . LEU A 48  ? 1.6289 1.0251 0.6143 -0.1331 0.2185  -0.2267 1048 LEU A N   
356  C CA  . LEU A 48  ? 1.6943 1.0095 0.6079 -0.1262 0.2346  -0.2222 1048 LEU A CA  
357  C C   . LEU A 48  ? 1.7705 1.0284 0.6398 -0.0980 0.2259  -0.2088 1048 LEU A C   
358  O O   . LEU A 48  ? 1.7858 1.0055 0.6184 -0.0713 0.2176  -0.1977 1048 LEU A O   
359  C CB  . LEU A 48  ? 1.6825 1.0125 0.6044 -0.1126 0.2238  -0.2131 1048 LEU A CB  
360  C CG  . LEU A 48  ? 1.7080 1.0973 0.6752 -0.1325 0.2281  -0.2243 1048 LEU A CG  
361  C CD1 . LEU A 48  ? 1.7035 1.0999 0.6722 -0.1143 0.2158  -0.2125 1048 LEU A CD1 
362  C CD2 . LEU A 48  ? 1.7877 1.1515 0.7263 -0.1681 0.2635  -0.2485 1048 LEU A CD2 
363  N N   . GLU A 49  ? 1.7343 0.9870 0.6043 -0.1023 0.2278  -0.2126 1049 GLU A N   
364  C CA  . GLU A 49  ? 1.7585 0.9646 0.5931 -0.0749 0.2186  -0.2024 1049 GLU A CA  
365  C C   . GLU A 49  ? 1.9100 1.0101 0.6463 -0.0653 0.2417  -0.2028 1049 GLU A C   
366  O O   . GLU A 49  ? 1.9412 1.0006 0.6413 -0.0305 0.2291  -0.1933 1049 GLU A O   
367  C CB  . GLU A 49  ? 1.7544 0.9803 0.6117 -0.0849 0.2179  -0.2083 1049 GLU A CB  
368  C CG  . GLU A 49  ? 1.8870 1.0871 0.7162 -0.1216 0.2522  -0.2280 1049 GLU A CG  
369  C CD  . GLU A 49  ? 2.0253 1.2944 0.9063 -0.1560 0.2611  -0.2469 1049 GLU A CD  
370  O OE1 . GLU A 49  ? 1.8955 1.2122 0.8138 -0.1693 0.2582  -0.2584 1049 GLU A OE1 
371  O OE2 . GLU A 49  ? 2.0088 1.2857 0.8913 -0.1678 0.2706  -0.2522 1049 GLU A OE2 
372  N N   . ASP A 50  ? 1.9166 0.9702 0.6065 -0.0944 0.2753  -0.2155 1050 ASP A N   
373  C CA  . ASP A 50  ? 2.0209 0.9627 0.6066 -0.0868 0.3001  -0.2161 1050 ASP A CA  
374  C C   . ASP A 50  ? 2.0975 1.0178 0.6562 -0.0972 0.3135  -0.2199 1050 ASP A C   
375  O O   . ASP A 50  ? 2.1621 1.0184 0.6616 -0.1252 0.3491  -0.2323 1050 ASP A O   
376  C CB  . ASP A 50  ? 2.1173 0.9964 0.6499 -0.1139 0.3350  -0.2289 1050 ASP A CB  
377  C CG  . ASP A 50  ? 2.2190 1.1451 0.7927 -0.1656 0.3592  -0.2503 1050 ASP A CG  
378  O OD1 . ASP A 50  ? 2.2407 1.1509 0.8011 -0.1848 0.3771  -0.2606 1050 ASP A OD1 
379  O OD2 . ASP A 50  ? 2.2435 1.2251 0.8623 -0.1856 0.3600  -0.2588 1050 ASP A OD2 
380  N N   . LYS A 51  ? 2.0045 0.9786 0.6067 -0.0748 0.2851  -0.2096 1051 LYS A N   
381  C CA  . LYS A 51  ? 2.0133 0.9802 0.6000 -0.0752 0.2884  -0.2098 1051 LYS A CA  
382  C C   . LYS A 51  ? 2.0852 1.0320 0.6422 -0.0269 0.2621  -0.1959 1051 LYS A C   
383  O O   . LYS A 51  ? 2.0155 1.0268 0.6302 -0.0032 0.2305  -0.1867 1051 LYS A O   
384  C CB  . LYS A 51  ? 1.9513 1.0195 0.6295 -0.0978 0.2794  -0.2144 1051 LYS A CB  
385  C CG  . LYS A 51  ? 2.0385 1.1314 0.7418 -0.1449 0.3069  -0.2352 1051 LYS A CG  
386  C CD  . LYS A 51  ? 2.1757 1.2072 0.8193 -0.1720 0.3421  -0.2498 1051 LYS A CD  
387  C CE  . LYS A 51  ? 2.2657 1.3311 0.9389 -0.2198 0.3699  -0.2759 1051 LYS A CE  
388  N NZ  . LYS A 51  ? 2.4738 1.4757 1.0866 -0.2505 0.4078  -0.2930 1051 LYS A NZ  
389  N N   . SER A 52  ? 2.1358 0.9918 0.5992 -0.0121 0.2760  -0.1968 1052 SER A N   
390  C CA  . SER A 52  ? 2.1627 0.9917 0.5826 0.0371  0.2529  -0.1887 1052 SER A CA  
391  C C   . SER A 52  ? 2.1181 1.0475 0.6208 0.0479  0.2221  -0.1824 1052 SER A C   
392  O O   . SER A 52  ? 2.0694 1.0492 0.6228 0.0182  0.2282  -0.1848 1052 SER A O   
393  C CB  . SER A 52  ? 2.3207 1.0394 0.6277 0.0441  0.2757  -0.1930 1052 SER A CB  
394  O OG  . SER A 52  ? 2.4565 1.1481 0.7140 0.0960  0.2521  -0.1884 1052 SER A OG  
395  N N   . PRO A 53  ? 2.0430 1.0047 0.5606 0.0894  0.1902  -0.1765 1053 PRO A N   
396  C CA  . PRO A 53  ? 1.9567 1.0139 0.5525 0.0959  0.1638  -0.1715 1053 PRO A CA  
397  C C   . PRO A 53  ? 2.0189 1.0628 0.5842 0.1015  0.1654  -0.1724 1053 PRO A C   
398  O O   . PRO A 53  ? 1.9726 1.0761 0.5756 0.1203  0.1417  -0.1693 1053 PRO A O   
399  C CB  . PRO A 53  ? 1.9640 1.0459 0.5682 0.1382  0.1344  -0.1703 1053 PRO A CB  
400  C CG  . PRO A 53  ? 2.0697 1.0888 0.6254 0.1479  0.1435  -0.1730 1053 PRO A CG  
401  C CD  . PRO A 53  ? 2.1018 1.0211 0.5702 0.1315  0.1771  -0.1768 1053 PRO A CD  
402  N N   . ASP A 54  ? 2.0344 1.0026 0.5337 0.0821  0.1945  -0.1777 1054 ASP A N   
403  C CA  . ASP A 54  ? 2.0624 1.0023 0.5211 0.0835  0.2010  -0.1798 1054 ASP A CA  
404  C C   . ASP A 54  ? 2.1006 1.0356 0.5723 0.0344  0.2314  -0.1866 1054 ASP A C   
405  O O   . ASP A 54  ? 2.1087 1.0384 0.5673 0.0284  0.2368  -0.1890 1054 ASP A O   
406  C CB  . ASP A 54  ? 2.1983 1.0238 0.5321 0.1184  0.2072  -0.1830 1054 ASP A CB  
407  C CG  . ASP A 54  ? 2.3174 1.1525 0.6338 0.1727  0.1755  -0.1819 1054 ASP A CG  
408  O OD1 . ASP A 54  ? 2.3988 1.1641 0.6471 0.1974  0.1786  -0.1850 1054 ASP A OD1 
409  O OD2 . ASP A 54  ? 2.3268 1.2435 0.7005 0.1901  0.1479  -0.1799 1054 ASP A OD2 
410  N N   . SER A 55  ? 2.0338 0.9741 0.5320 0.0004  0.2505  -0.1923 1055 SER A N   
411  C CA  . SER A 55  ? 2.0256 0.9715 0.5426 -0.0483 0.2806  -0.2051 1055 SER A CA  
412  C C   . SER A 55  ? 1.9780 1.0243 0.5852 -0.0623 0.2685  -0.2060 1055 SER A C   
413  O O   . SER A 55  ? 1.8920 1.0165 0.5671 -0.0437 0.2387  -0.1956 1055 SER A O   
414  C CB  . SER A 55  ? 2.0597 1.0133 0.6005 -0.0745 0.2951  -0.2121 1055 SER A CB  
415  O OG  . SER A 55  ? 2.0769 1.1204 0.7041 -0.0649 0.2672  -0.2042 1055 SER A OG  
416  N N   . PRO A 56  ? 1.9399 0.9853 0.5482 -0.0950 0.2920  -0.2197 1056 PRO A N   
417  C CA  . PRO A 56  ? 1.8563 0.9968 0.5481 -0.1043 0.2801  -0.2219 1056 PRO A CA  
418  C C   . PRO A 56  ? 1.8119 1.0471 0.5974 -0.1141 0.2664  -0.2226 1056 PRO A C   
419  O O   . PRO A 56  ? 1.7401 1.0539 0.5923 -0.1075 0.2472  -0.2180 1056 PRO A O   
420  C CB  . PRO A 56  ? 1.9206 1.0334 0.5890 -0.1412 0.3135  -0.2424 1056 PRO A CB  
421  C CG  . PRO A 56  ? 2.0885 1.0777 0.6444 -0.1410 0.3376  -0.2444 1056 PRO A CG  
422  C CD  . PRO A 56  ? 2.0487 1.0055 0.5806 -0.1250 0.3316  -0.2355 1056 PRO A CD  
423  N N   . GLU A 57  ? 1.7689 0.9925 0.5540 -0.1277 0.2760  -0.2280 1057 GLU A N   
424  C CA  . GLU A 57  ? 1.6893 0.9914 0.5512 -0.1345 0.2628  -0.2294 1057 GLU A CA  
425  C C   . GLU A 57  ? 1.6852 1.0257 0.5817 -0.1000 0.2276  -0.2081 1057 GLU A C   
426  O O   . GLU A 57  ? 1.6012 1.0193 0.5673 -0.0975 0.2093  -0.2041 1057 GLU A O   
427  C CB  . GLU A 57  ? 1.7342 1.0071 0.5777 -0.1568 0.2828  -0.2417 1057 GLU A CB  
428  C CG  . GLU A 57  ? 1.8939 1.1392 0.7112 -0.1980 0.3210  -0.2680 1057 GLU A CG  
429  C CD  . GLU A 57  ? 2.2092 1.3437 0.9277 -0.2068 0.3506  -0.2718 1057 GLU A CD  
430  O OE1 . GLU A 57  ? 2.1356 1.2066 0.7963 -0.1751 0.3402  -0.2536 1057 GLU A OE1 
431  O OE2 . GLU A 57  ? 2.1739 1.2832 0.8691 -0.2452 0.3854  -0.2953 1057 GLU A OE2 
432  N N   . MET A 58  ? 1.6862 0.9704 0.5305 -0.0732 0.2194  -0.1965 1058 MET A N   
433  C CA  . MET A 58  ? 1.6517 0.9671 0.5213 -0.0407 0.1885  -0.1808 1058 MET A CA  
434  C C   . MET A 58  ? 1.6985 1.0536 0.5903 -0.0226 0.1702  -0.1725 1058 MET A C   
435  O O   . MET A 58  ? 1.6347 1.0540 0.5837 -0.0116 0.1476  -0.1636 1058 MET A O   
436  C CB  . MET A 58  ? 1.7390 0.9830 0.5413 -0.0149 0.1865  -0.1766 1058 MET A CB  
437  C CG  . MET A 58  ? 1.7778 1.0171 0.5893 -0.0194 0.1872  -0.1775 1058 MET A CG  
438  S SD  . MET A 58  ? 1.7324 1.0654 0.6362 -0.0106 0.1559  -0.1679 1058 MET A SD  
439  C CE  . MET A 58  ? 1.6954 1.0275 0.5831 0.0331  0.1293  -0.1588 1058 MET A CE  
440  N N   . LYS A 59  ? 1.7200 1.0351 0.5643 -0.0203 0.1808  -0.1760 1059 LYS A N   
441  C CA  . LYS A 59  ? 1.7036 1.0541 0.5639 -0.0031 0.1646  -0.1695 1059 LYS A CA  
442  C C   . LYS A 59  ? 1.6863 1.1225 0.6284 -0.0199 0.1589  -0.1691 1059 LYS A C   
443  O O   . LYS A 59  ? 1.6374 1.1261 0.6173 -0.0043 0.1388  -0.1600 1059 LYS A O   
444  C CB  . LYS A 59  ? 1.8141 1.0990 0.6024 0.0006  0.1789  -0.1748 1059 LYS A CB  
445  C CG  . LYS A 59  ? 2.1623 1.3658 0.8631 0.0318  0.1760  -0.1730 1059 LYS A CG  
446  C CD  . LYS A 59  ? 2.3824 1.5244 1.0095 0.0439  0.1833  -0.1762 1059 LYS A CD  
447  C CE  . LYS A 59  ? 2.6381 1.7130 1.1820 0.0862  0.1719  -0.1746 1059 LYS A CE  
448  N NZ  . LYS A 59  ? 2.8448 1.8529 1.3072 0.1018  0.1775  -0.1780 1059 LYS A NZ  
449  N N   . ASP A 60  ? 1.6385 1.0894 0.6056 -0.0501 0.1766  -0.1809 1060 ASP A N   
450  C CA  . ASP A 60  ? 1.5750 1.1029 0.6132 -0.0631 0.1721  -0.1844 1060 ASP A CA  
451  C C   . ASP A 60  ? 1.5616 1.1401 0.6518 -0.0548 0.1517  -0.1742 1060 ASP A C   
452  O O   . ASP A 60  ? 1.5123 1.1499 0.6523 -0.0499 0.1381  -0.1683 1060 ASP A O   
453  C CB  . ASP A 60  ? 1.6147 1.1432 0.6578 -0.0952 0.1973  -0.2061 1060 ASP A CB  
454  C CG  . ASP A 60  ? 1.7671 1.3751 0.8783 -0.1039 0.1921  -0.2145 1060 ASP A CG  
455  O OD1 . ASP A 60  ? 1.7679 1.4157 0.9069 -0.0916 0.1800  -0.2079 1060 ASP A OD1 
456  O OD2 . ASP A 60  ? 1.8440 1.4738 0.9772 -0.1211 0.2002  -0.2292 1060 ASP A OD2 
457  N N   . PHE A 61  ? 1.5237 1.0751 0.5989 -0.0530 0.1505  -0.1723 1061 PHE A N   
458  C CA  . PHE A 61  ? 1.4742 1.0643 0.5919 -0.0458 0.1321  -0.1634 1061 PHE A CA  
459  C C   . PHE A 61  ? 1.5026 1.1188 0.6369 -0.0224 0.1098  -0.1485 1061 PHE A C   
460  O O   . PHE A 61  ? 1.4467 1.1146 0.6297 -0.0213 0.0964  -0.1415 1061 PHE A O   
461  C CB  . PHE A 61  ? 1.5217 1.0710 0.6129 -0.0467 0.1360  -0.1655 1061 PHE A CB  
462  C CG  . PHE A 61  ? 1.5080 1.0846 0.6314 -0.0339 0.1151  -0.1551 1061 PHE A CG  
463  C CD1 . PHE A 61  ? 1.5041 1.1265 0.6755 -0.0438 0.1082  -0.1555 1061 PHE A CD1 
464  C CD2 . PHE A 61  ? 1.5513 1.1072 0.6539 -0.0107 0.1022  -0.1473 1061 PHE A CD2 
465  C CE1 . PHE A 61  ? 1.4899 1.1319 0.6870 -0.0336 0.0900  -0.1462 1061 PHE A CE1 
466  C CE2 . PHE A 61  ? 1.5577 1.1413 0.6926 -0.0013 0.0842  -0.1404 1061 PHE A CE2 
467  C CZ  . PHE A 61  ? 1.4917 1.1153 0.6728 -0.0143 0.0789  -0.1389 1061 PHE A CZ  
468  N N   . ARG A 62  ? 1.5051 1.0840 0.5949 -0.0035 0.1068  -0.1459 1062 ARG A N   
469  C CA  . ARG A 62  ? 1.4933 1.0988 0.5940 0.0195  0.0867  -0.1373 1062 ARG A CA  
470  C C   . ARG A 62  ? 1.5365 1.1905 0.6702 0.0186  0.0817  -0.1330 1062 ARG A C   
471  O O   . ARG A 62  ? 1.4967 1.1980 0.6681 0.0258  0.0667  -0.1256 1062 ARG A O   
472  C CB  . ARG A 62  ? 1.5367 1.0888 0.5735 0.0441  0.0845  -0.1403 1062 ARG A CB  
473  C CG  . ARG A 62  ? 1.6516 1.1562 0.6541 0.0511  0.0871  -0.1438 1062 ARG A CG  
474  C CD  . ARG A 62  ? 1.7945 1.2551 0.7368 0.0845  0.0788  -0.1476 1062 ARG A CD  
475  N NE  . ARG A 62  ? 1.9280 1.3265 0.8000 0.0922  0.0913  -0.1522 1062 ARG A NE  
476  C CZ  . ARG A 62  ? 2.1554 1.4740 0.9616 0.0862  0.1124  -0.1573 1062 ARG A CZ  
477  N NH1 . ARG A 62  ? 2.0080 1.3044 0.8140 0.0718  0.1232  -0.1589 1062 ARG A NH1 
478  N NH2 . ARG A 62  ? 2.0404 1.2984 0.7779 0.0934  0.1239  -0.1614 1062 ARG A NH2 
479  N N   . HIS A 63  ? 1.5232 1.1653 0.6428 0.0084  0.0957  -0.1387 1063 HIS A N   
480  C CA  . HIS A 63  ? 1.4976 1.1816 0.6446 0.0083  0.0929  -0.1362 1063 HIS A CA  
481  C C   . HIS A 63  ? 1.4911 1.2343 0.6996 -0.0017 0.0874  -0.1318 1063 HIS A C   
482  O O   . HIS A 63  ? 1.4587 1.2443 0.6963 0.0059  0.0770  -0.1239 1063 HIS A O   
483  C CB  . HIS A 63  ? 1.5406 1.1954 0.6589 -0.0033 0.1114  -0.1470 1063 HIS A CB  
484  C CG  . HIS A 63  ? 1.5585 1.2577 0.7072 -0.0031 0.1092  -0.1462 1063 HIS A CG  
485  N ND1 . HIS A 63  ? 1.5805 1.2932 0.7229 0.0163  0.0967  -0.1387 1063 HIS A ND1 
486  C CD2 . HIS A 63  ? 1.5559 1.2895 0.7394 -0.0177 0.1174  -0.1541 1063 HIS A CD2 
487  C CE1 . HIS A 63  ? 1.5440 1.2964 0.7181 0.0121  0.0982  -0.1399 1063 HIS A CE1 
488  N NE2 . HIS A 63  ? 1.5329 1.2987 0.7318 -0.0070 0.1104  -0.1497 1063 HIS A NE2 
489  N N   . GLY A 64  ? 1.4367 1.1795 0.6592 -0.0168 0.0945  -0.1376 1064 GLY A N   
490  C CA  . GLY A 64  ? 1.3920 1.1801 0.6608 -0.0229 0.0892  -0.1356 1064 GLY A CA  
491  C C   . GLY A 64  ? 1.4087 1.2219 0.7023 -0.0137 0.0726  -0.1216 1064 GLY A C   
492  O O   . GLY A 64  ? 1.3712 1.2207 0.6958 -0.0134 0.0672  -0.1159 1064 GLY A O   
493  N N   . PHE A 65  ? 1.3825 1.1746 0.6594 -0.0057 0.0657  -0.1178 1065 PHE A N   
494  C CA  . PHE A 65  ? 1.3654 1.1818 0.6651 0.0005  0.0518  -0.1086 1065 PHE A CA  
495  C C   . PHE A 65  ? 1.4021 1.2439 0.7062 0.0117  0.0447  -0.1039 1065 PHE A C   
496  O O   . PHE A 65  ? 1.3724 1.2475 0.7046 0.0110  0.0370  -0.0973 1065 PHE A O   
497  C CB  . PHE A 65  ? 1.4094 1.1999 0.6935 0.0057  0.0467  -0.1106 1065 PHE A CB  
498  C CG  . PHE A 65  ? 1.4271 1.2104 0.7228 -0.0058 0.0487  -0.1119 1065 PHE A CG  
499  C CD1 . PHE A 65  ? 1.4475 1.2548 0.7740 -0.0099 0.0397  -0.1054 1065 PHE A CD1 
500  C CD2 . PHE A 65  ? 1.4786 1.2312 0.7526 -0.0139 0.0606  -0.1208 1065 PHE A CD2 
501  C CE1 . PHE A 65  ? 1.4578 1.2585 0.7918 -0.0178 0.0395  -0.1070 1065 PHE A CE1 
502  C CE2 . PHE A 65  ? 1.5092 1.2616 0.7950 -0.0234 0.0612  -0.1240 1065 PHE A CE2 
503  C CZ  . PHE A 65  ? 1.4621 1.2386 0.7772 -0.0234 0.0492  -0.1167 1065 PHE A CZ  
504  N N   . ASP A 66  ? 1.3797 1.2060 0.6549 0.0208  0.0482  -0.1081 1066 ASP A N   
505  C CA  . ASP A 66  ? 1.3744 1.2280 0.6519 0.0332  0.0406  -0.1053 1066 ASP A CA  
506  C C   . ASP A 66  ? 1.3978 1.2898 0.7090 0.0259  0.0430  -0.0989 1066 ASP A C   
507  O O   . ASP A 66  ? 1.3817 1.3101 0.7121 0.0308  0.0360  -0.0934 1066 ASP A O   
508  C CB  . ASP A 66  ? 1.4339 1.2533 0.6636 0.0475  0.0427  -0.1120 1066 ASP A CB  
509  C CG  . ASP A 66  ? 1.6047 1.3888 0.7934 0.0645  0.0367  -0.1186 1066 ASP A CG  
510  O OD1 . ASP A 66  ? 1.5917 1.4022 0.7970 0.0727  0.0245  -0.1195 1066 ASP A OD1 
511  O OD2 . ASP A 66  ? 1.7496 1.4790 0.8861 0.0710  0.0445  -0.1247 1066 ASP A OD2 
512  N N   . ILE A 67  ? 1.3472 1.2327 0.6648 0.0148  0.0532  -0.1018 1067 ILE A N   
513  C CA  . ILE A 67  ? 1.3189 1.2373 0.6649 0.0115  0.0555  -0.0985 1067 ILE A CA  
514  C C   . ILE A 67  ? 1.3649 1.3023 0.7371 0.0066  0.0501  -0.0899 1067 ILE A C   
515  O O   . ILE A 67  ? 1.3535 1.3190 0.7439 0.0090  0.0474  -0.0818 1067 ILE A O   
516  C CB  . ILE A 67  ? 1.3571 1.2666 0.7000 0.0037  0.0675  -0.1106 1067 ILE A CB  
517  C CG1 . ILE A 67  ? 1.3874 1.2723 0.7000 0.0051  0.0758  -0.1198 1067 ILE A CG1 
518  C CG2 . ILE A 67  ? 1.3333 1.2791 0.7044 0.0058  0.0678  -0.1099 1067 ILE A CG2 
519  C CD1 . ILE A 67  ? 1.4890 1.3645 0.7971 -0.0077 0.0912  -0.1370 1067 ILE A CD1 
520  N N   . LEU A 68  ? 1.3331 1.2508 0.7027 -0.0003 0.0493  -0.0917 1068 LEU A N   
521  C CA  . LEU A 68  ? 1.3280 1.2535 0.7153 -0.0059 0.0447  -0.0846 1068 LEU A CA  
522  C C   . LEU A 68  ? 1.3850 1.3298 0.7833 -0.0050 0.0382  -0.0769 1068 LEU A C   
523  O O   . LEU A 68  ? 1.3809 1.3402 0.7941 -0.0101 0.0381  -0.0690 1068 LEU A O   
524  C CB  . LEU A 68  ? 1.3396 1.2389 0.7192 -0.0117 0.0439  -0.0894 1068 LEU A CB  
525  C CG  . LEU A 68  ? 1.3992 1.2999 0.7921 -0.0174 0.0392  -0.0836 1068 LEU A CG  
526  C CD1 . LEU A 68  ? 1.3968 1.3080 0.7956 -0.0161 0.0418  -0.0831 1068 LEU A CD1 
527  C CD2 . LEU A 68  ? 1.4452 1.3217 0.8301 -0.0210 0.0369  -0.0889 1068 LEU A CD2 
528  N N   . VAL A 69  ? 1.3515 1.2959 0.7389 0.0020  0.0336  -0.0812 1069 VAL A N   
529  C CA  . VAL A 69  ? 1.3468 1.3196 0.7462 0.0036  0.0273  -0.0802 1069 VAL A CA  
530  C C   . VAL A 69  ? 1.3921 1.3961 0.8027 0.0056  0.0293  -0.0745 1069 VAL A C   
531  O O   . VAL A 69  ? 1.3854 1.4144 0.8143 -0.0021 0.0300  -0.0696 1069 VAL A O   
532  C CB  . VAL A 69  ? 1.4099 1.3765 0.7897 0.0169  0.0198  -0.0909 1069 VAL A CB  
533  C CG1 . VAL A 69  ? 1.4031 1.4114 0.7948 0.0225  0.0130  -0.0956 1069 VAL A CG1 
534  C CG2 . VAL A 69  ? 1.4179 1.3604 0.7922 0.0152  0.0170  -0.0958 1069 VAL A CG2 
535  N N   . GLY A 70  ? 1.3487 1.3481 0.7469 0.0145  0.0319  -0.0757 1070 GLY A N   
536  C CA  . GLY A 70  ? 1.3360 1.3627 0.7427 0.0197  0.0332  -0.0709 1070 GLY A CA  
537  C C   . GLY A 70  ? 1.3701 1.4098 0.7956 0.0121  0.0386  -0.0613 1070 GLY A C   
538  O O   . GLY A 70  ? 1.3572 1.4244 0.7942 0.0120  0.0391  -0.0553 1070 GLY A O   
539  N N   . GLN A 71  ? 1.3262 1.3441 0.7505 0.0070  0.0428  -0.0608 1071 GLN A N   
540  C CA  . GLN A 71  ? 1.3278 1.3465 0.7585 0.0044  0.0472  -0.0532 1071 GLN A CA  
541  C C   . GLN A 71  ? 1.4128 1.4330 0.8496 -0.0079 0.0480  -0.0455 1071 GLN A C   
542  O O   . GLN A 71  ? 1.4175 1.4439 0.8555 -0.0100 0.0533  -0.0369 1071 GLN A O   
543  C CB  . GLN A 71  ? 1.3459 1.3421 0.7694 0.0050  0.0490  -0.0591 1071 GLN A CB  
544  C CG  . GLN A 71  ? 1.4765 1.4747 0.8960 0.0130  0.0518  -0.0709 1071 GLN A CG  
545  C CD  . GLN A 71  ? 1.7293 1.7118 1.1433 0.0110  0.0536  -0.0823 1071 GLN A CD  
546  O OE1 . GLN A 71  ? 1.6789 1.6711 1.0937 0.0176  0.0573  -0.0940 1071 GLN A OE1 
547  N NE2 . GLN A 71  ? 1.6080 1.5703 1.0177 0.0025  0.0508  -0.0818 1071 GLN A NE2 
548  N N   . ILE A 72  ? 1.3879 1.4008 0.8265 -0.0163 0.0440  -0.0498 1072 ILE A N   
549  C CA  . ILE A 72  ? 1.4000 1.4164 0.8468 -0.0311 0.0454  -0.0474 1072 ILE A CA  
550  C C   . ILE A 72  ? 1.4482 1.5028 0.9072 -0.0339 0.0464  -0.0489 1072 ILE A C   
551  O O   . ILE A 72  ? 1.4499 1.5134 0.9154 -0.0481 0.0537  -0.0446 1072 ILE A O   
552  C CB  . ILE A 72  ? 1.4430 1.4441 0.8897 -0.0356 0.0394  -0.0552 1072 ILE A CB  
553  C CG1 . ILE A 72  ? 1.4533 1.4200 0.8888 -0.0347 0.0388  -0.0537 1072 ILE A CG1 
554  C CG2 . ILE A 72  ? 1.4649 1.4779 0.9244 -0.0515 0.0406  -0.0575 1072 ILE A CG2 
555  C CD1 . ILE A 72  ? 1.5353 1.4842 0.9676 -0.0349 0.0326  -0.0613 1072 ILE A CD1 
556  N N   . ASP A 73  ? 1.4016 1.4768 0.8599 -0.0204 0.0401  -0.0558 1073 ASP A N   
557  C CA  . ASP A 73  ? 1.4005 1.5176 0.8684 -0.0180 0.0381  -0.0604 1073 ASP A CA  
558  C C   . ASP A 73  ? 1.4619 1.5951 0.9345 -0.0190 0.0459  -0.0497 1073 ASP A C   
559  O O   . ASP A 73  ? 1.4538 1.6224 0.9377 -0.0249 0.0483  -0.0517 1073 ASP A O   
560  C CB  . ASP A 73  ? 1.4178 1.5426 0.8732 0.0018  0.0277  -0.0702 1073 ASP A CB  
561  C CG  . ASP A 73  ? 1.5456 1.6620 0.9918 0.0073  0.0193  -0.0836 1073 ASP A CG  
562  O OD1 . ASP A 73  ? 1.5536 1.6750 1.0125 -0.0052 0.0200  -0.0882 1073 ASP A OD1 
563  O OD2 . ASP A 73  ? 1.6318 1.7354 1.0551 0.0253  0.0123  -0.0904 1073 ASP A OD2 
564  N N   . ASP A 74  ? 1.4297 1.5393 0.8931 -0.0121 0.0498  -0.0406 1074 ASP A N   
565  C CA  . ASP A 74  ? 1.4348 1.5526 0.8978 -0.0085 0.0570  -0.0306 1074 ASP A CA  
566  C C   . ASP A 74  ? 1.5188 1.6151 0.9756 -0.0240 0.0683  -0.0216 1074 ASP A C   
567  O O   . ASP A 74  ? 1.5257 1.6314 0.9806 -0.0284 0.0773  -0.0141 1074 ASP A O   
568  C CB  . ASP A 74  ? 1.4515 1.5569 0.9062 0.0095  0.0554  -0.0296 1074 ASP A CB  
569  C CG  . ASP A 74  ? 1.5834 1.7007 1.0373 0.0228  0.0474  -0.0383 1074 ASP A CG  
570  O OD1 . ASP A 74  ? 1.5924 1.7350 1.0499 0.0252  0.0418  -0.0421 1074 ASP A OD1 
571  O OD2 . ASP A 74  ? 1.6541 1.7552 1.1011 0.0311  0.0473  -0.0430 1074 ASP A OD2 
572  N N   . ALA A 75  ? 1.4957 1.5592 0.9449 -0.0322 0.0682  -0.0225 1075 ALA A N   
573  C CA  . ALA A 75  ? 1.5312 1.5627 0.9663 -0.0467 0.0780  -0.0149 1075 ALA A CA  
574  C C   . ALA A 75  ? 1.6117 1.6594 1.0578 -0.0713 0.0854  -0.0180 1075 ALA A C   
575  O O   . ALA A 75  ? 1.6377 1.6674 1.0703 -0.0860 0.0991  -0.0106 1075 ALA A O   
576  C CB  . ALA A 75  ? 1.5473 1.5430 0.9716 -0.0452 0.0728  -0.0171 1075 ALA A CB  
577  N N   . LEU A 76  ? 1.5655 1.6458 1.0326 -0.0751 0.0774  -0.0313 1076 LEU A N   
578  C CA  . LEU A 76  ? 1.5790 1.6895 1.0629 -0.0966 0.0826  -0.0419 1076 LEU A CA  
579  C C   . LEU A 76  ? 1.6555 1.8055 1.1476 -0.1015 0.0907  -0.0421 1076 LEU A C   
580  O O   . LEU A 76  ? 1.6750 1.8365 1.1721 -0.1261 0.1045  -0.0456 1076 LEU A O   
581  C CB  . LEU A 76  ? 1.5585 1.6958 1.0587 -0.0905 0.0689  -0.0595 1076 LEU A CB  
582  C CG  . LEU A 76  ? 1.6231 1.7311 1.1213 -0.0947 0.0639  -0.0638 1076 LEU A CG  
583  C CD1 . LEU A 76  ? 1.6056 1.7269 1.1073 -0.0761 0.0485  -0.0772 1076 LEU A CD1 
584  C CD2 . LEU A 76  ? 1.6769 1.7895 1.1857 -0.1224 0.0737  -0.0712 1076 LEU A CD2 
585  N N   . LYS A 77  ? 1.6014 1.7714 1.0941 -0.0794 0.0832  -0.0392 1077 LYS A N   
586  C CA  . LYS A 77  ? 1.6000 1.8092 1.0997 -0.0781 0.0879  -0.0384 1077 LYS A CA  
587  C C   . LYS A 77  ? 1.7019 1.8846 1.1848 -0.0912 0.1069  -0.0234 1077 LYS A C   
588  O O   . LYS A 77  ? 1.7096 1.9193 1.1984 -0.1079 0.1191  -0.0258 1077 LYS A O   
589  C CB  . LYS A 77  ? 1.6030 1.8260 1.1012 -0.0488 0.0747  -0.0365 1077 LYS A CB  
590  C CG  . LYS A 77  ? 1.7712 2.0385 1.2773 -0.0427 0.0759  -0.0362 1077 LYS A CG  
591  C CD  . LYS A 77  ? 1.8582 2.1310 1.3597 -0.0138 0.0634  -0.0334 1077 LYS A CD  
592  C CE  . LYS A 77  ? 1.9504 2.2662 1.4591 -0.0057 0.0633  -0.0320 1077 LYS A CE  
593  N NZ  . LYS A 77  ? 2.0263 2.3454 1.5295 0.0220  0.0511  -0.0301 1077 LYS A NZ  
594  N N   . LEU A 78  ? 1.6899 1.8187 1.1479 -0.0825 0.1099  -0.0099 1078 LEU A N   
595  C CA  . LEU A 78  ? 1.7344 1.8233 1.1633 -0.0874 0.1267  0.0048  1078 LEU A CA  
596  C C   . LEU A 78  ? 1.8419 1.9042 1.2585 -0.1205 0.1442  0.0044  1078 LEU A C   
597  O O   . LEU A 78  ? 1.8755 1.9276 1.2754 -0.1358 0.1631  0.0107  1078 LEU A O   
598  C CB  . LEU A 78  ? 1.7425 1.7842 1.1454 -0.0636 0.1215  0.0139  1078 LEU A CB  
599  C CG  . LEU A 78  ? 1.7684 1.8296 1.1777 -0.0326 0.1096  0.0140  1078 LEU A CG  
600  C CD1 . LEU A 78  ? 1.7706 1.7977 1.1642 -0.0137 0.1019  0.0134  1078 LEU A CD1 
601  C CD2 . LEU A 78  ? 1.8048 1.8760 1.2044 -0.0219 0.1181  0.0231  1078 LEU A CD2 
602  N N   . ALA A 79  ? 1.8047 1.8535 1.2275 -0.1324 0.1393  -0.0036 1079 ALA A N   
603  C CA  . ALA A 79  ? 1.8462 1.8689 1.2593 -0.1650 0.1547  -0.0068 1079 ALA A CA  
604  C C   . ALA A 79  ? 1.9066 1.9819 1.3453 -0.1939 0.1670  -0.0215 1079 ALA A C   
605  O O   . ALA A 79  ? 1.9475 2.0004 1.3698 -0.2243 0.1895  -0.0209 1079 ALA A O   
606  C CB  . ALA A 79  ? 1.8447 1.8527 1.2658 -0.1662 0.1426  -0.0144 1079 ALA A CB  
607  N N   . ASN A 80  ? 1.8225 1.9663 1.2974 -0.1840 0.1531  -0.0364 1080 ASN A N   
608  C CA  . ASN A 80  ? 1.8164 2.0253 1.3194 -0.2052 0.1605  -0.0559 1080 ASN A CA  
609  C C   . ASN A 80  ? 1.8814 2.0989 1.3727 -0.2126 0.1778  -0.0469 1080 ASN A C   
610  O O   . ASN A 80  ? 1.8995 2.1458 1.3997 -0.2439 0.1963  -0.0592 1080 ASN A O   
611  C CB  . ASN A 80  ? 1.7873 2.0603 1.3219 -0.1836 0.1372  -0.0744 1080 ASN A CB  
612  C CG  . ASN A 80  ? 2.0856 2.3570 1.6318 -0.1781 0.1221  -0.0877 1080 ASN A CG  
613  O OD1 . ASN A 80  ? 2.0422 2.2694 1.5785 -0.1915 0.1274  -0.0840 1080 ASN A OD1 
614  N ND2 . ASN A 80  ? 1.9511 2.2677 1.5141 -0.1559 0.1025  -0.1036 1080 ASN A ND2 
615  N N   . GLU A 81  ? 1.8275 2.0206 1.2986 -0.1844 0.1729  -0.0273 1081 GLU A N   
616  C CA  . GLU A 81  ? 1.8425 2.0350 1.2969 -0.1844 0.1880  -0.0155 1081 GLU A CA  
617  C C   . GLU A 81  ? 1.9580 2.0816 1.3696 -0.2091 0.2158  -0.0025 1081 GLU A C   
618  O O   . GLU A 81  ? 1.9894 2.1138 1.3866 -0.2251 0.2368  0.0014  1081 GLU A O   
619  C CB  . GLU A 81  ? 1.8323 2.0172 1.2775 -0.1437 0.1730  -0.0007 1081 GLU A CB  
620  C CG  . GLU A 81  ? 1.8946 2.1448 1.3727 -0.1209 0.1507  -0.0117 1081 GLU A CG  
621  C CD  . GLU A 81  ? 2.0829 2.3261 1.5542 -0.0833 0.1362  -0.0003 1081 GLU A CD  
622  O OE1 . GLU A 81  ? 2.0529 2.2426 1.4976 -0.0702 0.1393  0.0136  1081 GLU A OE1 
623  O OE2 . GLU A 81  ? 1.9108 2.2028 1.4021 -0.0657 0.1210  -0.0078 1081 GLU A OE2 
624  N N   . GLY A 82  ? 1.9334 1.9950 1.3206 -0.2110 0.2158  0.0037  1082 GLY A N   
625  C CA  . GLY A 82  ? 2.0021 1.9845 1.3382 -0.2306 0.2398  0.0159  1082 GLY A CA  
626  C C   . GLY A 82  ? 2.0657 1.9751 1.3561 -0.1988 0.2328  0.0345  1082 GLY A C   
627  O O   . GLY A 82  ? 2.1182 1.9555 1.3640 -0.2094 0.2451  0.0419  1082 GLY A O   
628  N N   . LYS A 83  ? 1.9722 1.9012 1.2719 -0.1591 0.2129  0.0398  1083 LYS A N   
629  C CA  . LYS A 83  ? 1.9767 1.8551 1.2411 -0.1228 0.2028  0.0515  1083 LYS A CA  
630  C C   . LYS A 83  ? 2.0138 1.8614 1.2742 -0.1211 0.1904  0.0472  1083 LYS A C   
631  O O   . LYS A 83  ? 1.9553 1.8447 1.2566 -0.1178 0.1722  0.0362  1083 LYS A O   
632  C CB  . LYS A 83  ? 1.9520 1.8771 1.2420 -0.0869 0.1838  0.0507  1083 LYS A CB  
633  C CG  . LYS A 83  ? 2.1423 2.1005 1.4372 -0.0836 0.1929  0.0553  1083 LYS A CG  
634  C CD  . LYS A 83  ? 2.2224 2.2386 1.5536 -0.0548 0.1721  0.0503  1083 LYS A CD  
635  C CE  . LYS A 83  ? 2.3874 2.4383 1.7238 -0.0490 0.1791  0.0549  1083 LYS A CE  
636  N NZ  . LYS A 83  ? 2.4603 2.5638 1.8291 -0.0205 0.1584  0.0497  1083 LYS A NZ  
637  N N   . VAL A 84  ? 2.0223 1.7932 1.2287 -0.1229 0.2007  0.0558  1084 VAL A N   
638  C CA  . VAL A 84  ? 2.0196 1.7546 1.2147 -0.1211 0.1899  0.0527  1084 VAL A CA  
639  C C   . VAL A 84  ? 2.0390 1.7544 1.2133 -0.0775 0.1720  0.0549  1084 VAL A C   
640  O O   . VAL A 84  ? 1.9883 1.7243 1.1882 -0.0667 0.1530  0.0462  1084 VAL A O   
641  C CB  . VAL A 84  ? 2.1494 1.8105 1.2940 -0.1483 0.2102  0.0583  1084 VAL A CB  
642  C CG1 . VAL A 84  ? 2.1490 1.7808 1.2879 -0.1474 0.1969  0.0538  1084 VAL A CG1 
643  C CG2 . VAL A 84  ? 2.1625 1.8470 1.3272 -0.1944 0.2322  0.0522  1084 VAL A CG2 
644  N N   . LYS A 85  ? 2.0252 1.7025 1.1521 -0.0522 0.1789  0.0643  1085 LYS A N   
645  C CA  . LYS A 85  ? 2.0154 1.6759 1.1169 -0.0076 0.1640  0.0625  1085 LYS A CA  
646  C C   . LYS A 85  ? 1.9644 1.6970 1.1219 0.0116  0.1442  0.0509  1085 LYS A C   
647  O O   . LYS A 85  ? 1.9371 1.6714 1.0936 0.0369  0.1285  0.0414  1085 LYS A O   
648  C CB  . LYS A 85  ? 2.1056 1.7221 1.1497 0.0165  0.1770  0.0729  1085 LYS A CB  
649  C CG  . LYS A 85  ? 2.3937 1.9233 1.3663 0.0000  0.2005  0.0855  1085 LYS A CG  
650  C CD  . LYS A 85  ? 2.5825 2.0404 1.4982 0.0145  0.1942  0.0846  1085 LYS A CD  
651  C CE  . LYS A 85  ? 2.8273 2.1915 1.6674 -0.0062 0.2193  0.0971  1085 LYS A CE  
652  N NZ  . LYS A 85  ? 3.0055 2.3172 1.7798 0.0143  0.2372  0.1085  1085 LYS A NZ  
653  N N   . GLU A 86  ? 1.8667 1.6574 1.0697 -0.0012 0.1460  0.0500  1086 GLU A N   
654  C CA  . GLU A 86  ? 1.7916 1.6458 1.0427 0.0134  0.1303  0.0401  1086 GLU A CA  
655  C C   . GLU A 86  ? 1.7928 1.6761 1.0837 -0.0028 0.1183  0.0295  1086 GLU A C   
656  O O   . GLU A 86  ? 1.7475 1.6570 1.0599 0.0132  0.1043  0.0194  1086 GLU A O   
657  C CB  . GLU A 86  ? 1.7879 1.6859 1.0618 0.0091  0.1368  0.0440  1086 GLU A CB  
658  C CG  . GLU A 86  ? 1.9514 1.8237 1.1869 0.0290  0.1481  0.0543  1086 GLU A CG  
659  C CD  . GLU A 86  ? 2.1480 2.0629 1.4037 0.0256  0.1550  0.0589  1086 GLU A CD  
660  O OE1 . GLU A 86  ? 1.8753 1.8473 1.1728 0.0345  0.1419  0.0515  1086 GLU A OE1 
661  O OE2 . GLU A 86  ? 2.1730 2.0603 1.3980 0.0150  0.1741  0.0697  1086 GLU A OE2 
662  N N   . ALA A 87  ? 1.7556 1.6326 1.0538 -0.0343 0.1249  0.0301  1087 ALA A N   
663  C CA  . ALA A 87  ? 1.7143 1.6140 1.0452 -0.0484 0.1143  0.0198  1087 ALA A CA  
664  C C   . ALA A 87  ? 1.7506 1.6175 1.0665 -0.0376 0.1039  0.0157  1087 ALA A C   
665  O O   . ALA A 87  ? 1.7096 1.5975 1.0508 -0.0370 0.0919  0.0061  1087 ALA A O   
666  C CB  . ALA A 87  ? 1.7411 1.6440 1.0815 -0.0827 0.1252  0.0187  1087 ALA A CB  
667  N N   . GLN A 88  ? 1.7411 1.5544 1.0115 -0.0276 0.1086  0.0221  1088 GLN A N   
668  C CA  . GLN A 88  ? 1.7434 1.5245 0.9925 -0.0135 0.0980  0.0170  1088 GLN A CA  
669  C C   . GLN A 88  ? 1.7422 1.5470 0.9982 0.0177  0.0856  0.0063  1088 GLN A C   
670  O O   . GLN A 88  ? 1.7268 1.5319 0.9868 0.0255  0.0742  -0.0043 1088 GLN A O   
671  C CB  . GLN A 88  ? 1.8315 1.5437 1.0208 -0.0099 0.1068  0.0261  1088 GLN A CB  
672  C CG  . GLN A 88  ? 2.0578 1.7384 1.2361 -0.0448 0.1207  0.0334  1088 GLN A CG  
673  C CD  . GLN A 88  ? 2.4201 2.0215 1.5291 -0.0413 0.1314  0.0430  1088 GLN A CD  
674  O OE1 . GLN A 88  ? 2.4398 2.0090 1.5210 -0.0603 0.1518  0.0527  1088 GLN A OE1 
675  N NE2 . GLN A 88  ? 2.3347 1.9000 1.4096 -0.0170 0.1187  0.0393  1088 GLN A NE2 
676  N N   . ALA A 89  ? 1.6699 1.4965 0.9277 0.0347  0.0886  0.0072  1089 ALA A N   
677  C CA  . ALA A 89  ? 1.6292 1.4845 0.8966 0.0630  0.0793  -0.0059 1089 ALA A CA  
678  C C   . ALA A 89  ? 1.6022 1.5048 0.9163 0.0541  0.0719  -0.0165 1089 ALA A C   
679  O O   . ALA A 89  ? 1.5735 1.4915 0.8963 0.0670  0.0639  -0.0319 1089 ALA A O   
680  C CB  . ALA A 89  ? 1.6476 1.5107 0.9030 0.0826  0.0856  -0.0011 1089 ALA A CB  
681  N N   . ALA A 90  ? 1.5255 1.4496 0.8653 0.0325  0.0755  -0.0103 1090 ALA A N   
682  C CA  . ALA A 90  ? 1.4746 1.4338 0.8482 0.0250  0.0693  -0.0187 1090 ALA A CA  
683  C C   . ALA A 90  ? 1.5014 1.4472 0.8800 0.0125  0.0633  -0.0251 1090 ALA A C   
684  O O   . ALA A 90  ? 1.4691 1.4306 0.8633 0.0130  0.0579  -0.0354 1090 ALA A O   
685  C CB  . ALA A 90  ? 1.4721 1.4575 0.8639 0.0113  0.0734  -0.0121 1090 ALA A CB  
686  N N   . ALA A 91  ? 1.4747 1.3879 0.8366 0.0014  0.0653  -0.0189 1091 ALA A N   
687  C CA  . ALA A 91  ? 1.4655 1.3634 0.8301 -0.0090 0.0592  -0.0238 1091 ALA A CA  
688  C C   . ALA A 91  ? 1.4918 1.3798 0.8454 0.0071  0.0517  -0.0351 1091 ALA A C   
689  O O   . ALA A 91  ? 1.4705 1.3622 0.8355 0.0026  0.0459  -0.0439 1091 ALA A O   
690  C CB  . ALA A 91  ? 1.5116 1.3767 0.8594 -0.0252 0.0643  -0.0146 1091 ALA A CB  
691  N N   . GLU A 92  ? 1.4500 1.3284 0.7805 0.0276  0.0521  -0.0371 1092 GLU A N   
692  C CA  . GLU A 92  ? 1.4378 1.3156 0.7566 0.0469  0.0448  -0.0529 1092 GLU A CA  
693  C C   . GLU A 92  ? 1.4278 1.3433 0.7736 0.0494  0.0430  -0.0701 1092 GLU A C   
694  O O   . GLU A 92  ? 1.4176 1.3409 0.7603 0.0601  0.0383  -0.0879 1092 GLU A O   
695  C CB  . GLU A 92  ? 1.4843 1.3486 0.7706 0.0730  0.0456  -0.0539 1092 GLU A CB  
696  C CG  . GLU A 92  ? 1.6474 1.4592 0.8902 0.0755  0.0471  -0.0416 1092 GLU A CG  
697  C CD  . GLU A 92  ? 1.8281 1.6133 1.0496 0.0798  0.0373  -0.0490 1092 GLU A CD  
698  O OE1 . GLU A 92  ? 1.5012 1.3124 0.7377 0.0879  0.0285  -0.0678 1092 GLU A OE1 
699  O OE2 . GLU A 92  ? 1.8482 1.5849 1.0344 0.0755  0.0393  -0.0372 1092 GLU A OE2 
700  N N   . GLN A 93  ? 1.3475 1.2853 0.7165 0.0392  0.0472  -0.0666 1093 GLN A N   
701  C CA  . GLN A 93  ? 1.3156 1.2788 0.7031 0.0382  0.0482  -0.0813 1093 GLN A CA  
702  C C   . GLN A 93  ? 1.3519 1.3043 0.7446 0.0229  0.0460  -0.0868 1093 GLN A C   
703  O O   . GLN A 93  ? 1.3376 1.3002 0.7373 0.0196  0.0489  -0.1006 1093 GLN A O   
704  C CB  . GLN A 93  ? 1.3177 1.3021 0.7193 0.0365  0.0523  -0.0753 1093 GLN A CB  
705  C CG  . GLN A 93  ? 1.4944 1.4970 0.8942 0.0552  0.0546  -0.0761 1093 GLN A CG  
706  C CD  . GLN A 93  ? 1.7257 1.7533 1.1406 0.0559  0.0571  -0.0746 1093 GLN A CD  
707  O OE1 . GLN A 93  ? 1.6412 1.6705 1.0626 0.0444  0.0570  -0.0648 1093 GLN A OE1 
708  N NE2 . GLN A 93  ? 1.6547 1.7045 1.0740 0.0719  0.0585  -0.0859 1093 GLN A NE2 
709  N N   . LEU A 94  ? 1.3137 1.2426 0.7003 0.0135  0.0422  -0.0769 1094 LEU A N   
710  C CA  . LEU A 94  ? 1.3050 1.2206 0.6938 0.0024  0.0388  -0.0811 1094 LEU A CA  
711  C C   . LEU A 94  ? 1.3442 1.2604 0.7267 0.0085  0.0366  -0.0988 1094 LEU A C   
712  O O   . LEU A 94  ? 1.3230 1.2398 0.7097 0.0010  0.0387  -0.1098 1094 LEU A O   
713  C CB  . LEU A 94  ? 1.3233 1.2167 0.7076 -0.0069 0.0348  -0.0683 1094 LEU A CB  
714  C CG  . LEU A 94  ? 1.3944 1.2706 0.7776 -0.0138 0.0288  -0.0726 1094 LEU A CG  
715  C CD1 . LEU A 94  ? 1.3853 1.2649 0.7794 -0.0218 0.0295  -0.0750 1094 LEU A CD1 
716  C CD2 . LEU A 94  ? 1.4525 1.3058 0.8273 -0.0196 0.0247  -0.0623 1094 LEU A CD2 
717  N N   . LYS A 95  ? 1.3144 1.2302 0.6831 0.0234  0.0328  -0.1033 1095 LYS A N   
718  C CA  . LYS A 95  ? 1.3166 1.2407 0.6777 0.0337  0.0285  -0.1240 1095 LYS A CA  
719  C C   . LYS A 95  ? 1.3608 1.3159 0.7365 0.0320  0.0359  -0.1467 1095 LYS A C   
720  O O   . LYS A 95  ? 1.3621 1.3264 0.7384 0.0296  0.0356  -0.1664 1095 LYS A O   
721  C CB  . LYS A 95  ? 1.3640 1.2833 0.7014 0.0570  0.0226  -0.1264 1095 LYS A CB  
722  C CG  . LYS A 95  ? 1.4960 1.3750 0.8085 0.0578  0.0163  -0.1091 1095 LYS A CG  
723  C CD  . LYS A 95  ? 1.6344 1.4986 0.9104 0.0851  0.0099  -0.1145 1095 LYS A CD  
724  C CE  . LYS A 95  ? 1.8551 1.6690 1.0971 0.0851  0.0055  -0.0973 1095 LYS A CE  
725  N NZ  . LYS A 95  ? 2.0259 1.8272 1.2674 0.0766  -0.0035 -0.1007 1095 LYS A NZ  
726  N N   . THR A 96  ? 1.3058 1.2766 0.6924 0.0315  0.0434  -0.1450 1096 THR A N   
727  C CA  . THR A 96  ? 1.2921 1.2879 0.6905 0.0269  0.0528  -0.1661 1096 THR A CA  
728  C C   . THR A 96  ? 1.3550 1.3329 0.7539 0.0054  0.0595  -0.1676 1096 THR A C   
729  O O   . THR A 96  ? 1.3492 1.3348 0.7486 -0.0032 0.0663  -0.1896 1096 THR A O   
730  C CB  . THR A 96  ? 1.3539 1.3660 0.7602 0.0340  0.0572  -0.1608 1096 THR A CB  
731  O OG1 . THR A 96  ? 1.3800 1.3995 0.7792 0.0555  0.0512  -0.1559 1096 THR A OG1 
732  C CG2 . THR A 96  ? 1.3049 1.3428 0.7219 0.0301  0.0675  -0.1848 1096 THR A CG2 
733  N N   . THR A 97  ? 1.3196 1.2737 0.7157 -0.0022 0.0581  -0.1463 1097 THR A N   
734  C CA  . THR A 97  ? 1.3245 1.2541 0.7129 -0.0164 0.0628  -0.1450 1097 THR A CA  
735  C C   . THR A 97  ? 1.3823 1.2969 0.7654 -0.0215 0.0584  -0.1493 1097 THR A C   
736  O O   . THR A 97  ? 1.3877 1.2870 0.7618 -0.0325 0.0657  -0.1592 1097 THR A O   
737  C CB  . THR A 97  ? 1.4533 1.3699 0.8401 -0.0162 0.0590  -0.1245 1097 THR A CB  
738  O OG1 . THR A 97  ? 1.4712 1.4066 0.8642 -0.0092 0.0609  -0.1202 1097 THR A OG1 
739  C CG2 . THR A 97  ? 1.4382 1.3272 0.8095 -0.0240 0.0631  -0.1250 1097 THR A CG2 
740  N N   . ARG A 98  ? 1.3379 1.2531 0.7223 -0.0133 0.0474  -0.1420 1098 ARG A N   
741  C CA  . ARG A 98  ? 1.3383 1.2409 0.7172 -0.0150 0.0403  -0.1452 1098 ARG A CA  
742  C C   . ARG A 98  ? 1.3879 1.3089 0.7659 -0.0160 0.0446  -0.1717 1098 ARG A C   
743  O O   . ARG A 98  ? 1.3906 1.3011 0.7643 -0.0252 0.0464  -0.1797 1098 ARG A O   
744  C CB  . ARG A 98  ? 1.3348 1.2298 0.7088 -0.0047 0.0282  -0.1322 1098 ARG A CB  
745  C CG  . ARG A 98  ? 1.4110 1.2888 0.7777 -0.0056 0.0187  -0.1323 1098 ARG A CG  
746  C CD  . ARG A 98  ? 1.4995 1.3628 0.8530 0.0048  0.0084  -0.1212 1098 ARG A CD  
747  N NE  . ARG A 98  ? 1.5228 1.3996 0.8626 0.0230  0.0049  -0.1338 1098 ARG A NE  
748  C CZ  . ARG A 98  ? 1.6345 1.4926 0.9508 0.0373  -0.0028 -0.1267 1098 ARG A CZ  
749  N NH1 . ARG A 98  ? 1.4930 1.3634 0.7920 0.0592  -0.0068 -0.1414 1098 ARG A NH1 
750  N NH2 . ARG A 98  ? 1.3957 1.2209 0.7025 0.0305  -0.0058 -0.1066 1098 ARG A NH2 
751  N N   . ASN A 99  ? 1.3368 1.2882 0.7193 -0.0061 0.0468  -0.1876 1099 ASN A N   
752  C CA  . ASN A 99  ? 1.3351 1.3156 0.7204 -0.0067 0.0515  -0.2193 1099 ASN A CA  
753  C C   . ASN A 99  ? 1.3851 1.3681 0.7741 -0.0272 0.0703  -0.2349 1099 ASN A C   
754  O O   . ASN A 99  ? 1.3838 1.3812 0.7733 -0.0378 0.0783  -0.2605 1099 ASN A O   
755  C CB  . ASN A 99  ? 1.3381 1.3530 0.7255 0.0149  0.0463  -0.2347 1099 ASN A CB  
756  C CG  . ASN A 99  ? 1.6551 1.6608 1.0262 0.0371  0.0293  -0.2259 1099 ASN A CG  
757  O OD1 . ASN A 99  ? 1.5423 1.5183 0.9032 0.0345  0.0208  -0.2095 1099 ASN A OD1 
758  N ND2 . ASN A 99  ? 1.5968 1.6246 0.9611 0.0611  0.0241  -0.2379 1099 ASN A ND2 
759  N N   . ALA A 100 ? 1.3391 1.3054 0.7267 -0.0333 0.0779  -0.2204 1100 ALA A N   
760  C CA  . ALA A 100 ? 1.3465 1.3015 0.7269 -0.0519 0.0965  -0.2322 1100 ALA A CA  
761  C C   . ALA A 100 ? 1.4171 1.3323 0.7787 -0.0669 0.1024  -0.2282 1100 ALA A C   
762  O O   . ALA A 100 ? 1.4338 1.3401 0.7840 -0.0849 0.1196  -0.2477 1100 ALA A O   
763  C CB  . ALA A 100 ? 1.3534 1.2990 0.7318 -0.0487 0.0993  -0.2167 1100 ALA A CB  
764  N N   . TYR A 101 ? 1.3669 1.2577 0.7237 -0.0598 0.0894  -0.2047 1101 TYR A N   
765  C CA  . TYR A 101 ? 1.3822 1.2347 0.7207 -0.0678 0.0916  -0.1986 1101 TYR A CA  
766  C C   . TYR A 101 ? 1.4252 1.2855 0.7639 -0.0751 0.0928  -0.2166 1101 TYR A C   
767  O O   . TYR A 101 ? 1.4397 1.2738 0.7596 -0.0890 0.1058  -0.2252 1101 TYR A O   
768  C CB  . TYR A 101 ? 1.3933 1.2289 0.7332 -0.0559 0.0756  -0.1725 1101 TYR A CB  
769  C CG  . TYR A 101 ? 1.4344 1.2344 0.7575 -0.0584 0.0744  -0.1669 1101 TYR A CG  
770  C CD1 . TYR A 101 ? 1.4823 1.2456 0.7794 -0.0597 0.0827  -0.1626 1101 TYR A CD1 
771  C CD2 . TYR A 101 ? 1.4423 1.2434 0.7717 -0.0558 0.0633  -0.1658 1101 TYR A CD2 
772  C CE1 . TYR A 101 ? 1.5158 1.2446 0.7935 -0.0574 0.0812  -0.1587 1101 TYR A CE1 
773  C CE2 . TYR A 101 ? 1.4692 1.2393 0.7843 -0.0557 0.0615  -0.1612 1101 TYR A CE2 
774  C CZ  . TYR A 101 ? 1.5927 1.3270 0.8820 -0.0558 0.0707  -0.1580 1101 TYR A CZ  
775  O OH  . TYR A 101 ? 1.6259 1.3278 0.8971 -0.0513 0.0685  -0.1547 1101 TYR A OH  
776  N N   . ILE A 102 ? 1.3540 1.2470 0.7091 -0.0643 0.0794  -0.2226 1102 ILE A N   
777  C CA  . ILE A 102 ? 1.3461 1.2533 0.7021 -0.0670 0.0765  -0.2408 1102 ILE A CA  
778  C C   . ILE A 102 ? 1.3818 1.3157 0.7392 -0.0833 0.0955  -0.2756 1102 ILE A C   
779  O O   . ILE A 102 ? 1.3791 1.3142 0.7309 -0.0950 0.1019  -0.2925 1102 ILE A O   
780  C CB  . ILE A 102 ? 1.3773 1.3079 0.7419 -0.0467 0.0551  -0.2390 1102 ILE A CB  
781  C CG1 . ILE A 102 ? 1.3791 1.3510 0.7532 -0.0335 0.0531  -0.2555 1102 ILE A CG1 
782  C CG2 . ILE A 102 ? 1.3909 1.2926 0.7530 -0.0360 0.0398  -0.2072 1102 ILE A CG2 
783  C CD1 . ILE A 102 ? 1.4801 1.4756 0.8510 -0.0116 0.0348  -0.2663 1102 ILE A CD1 
784  N N   . GLN A 103 ? 1.3363 1.2930 0.7017 -0.0852 0.1054  -0.2877 1103 GLN A N   
785  C CA  . GLN A 103 ? 1.3406 1.3277 0.7106 -0.1030 0.1252  -0.3247 1103 GLN A CA  
786  C C   . GLN A 103 ? 1.4101 1.3542 0.7567 -0.1301 0.1509  -0.3272 1103 GLN A C   
787  O O   . GLN A 103 ? 1.4211 1.3785 0.7648 -0.1527 0.1717  -0.3585 1103 GLN A O   
788  C CB  . GLN A 103 ? 1.3434 1.3744 0.7319 -0.0918 0.1247  -0.3390 1103 GLN A CB  
789  C CG  . GLN A 103 ? 1.6100 1.6857 1.0125 -0.0646 0.1037  -0.3488 1103 GLN A CG  
790  C CD  . GLN A 103 ? 1.9891 2.1004 1.4049 -0.0468 0.1006  -0.3576 1103 GLN A CD  
791  O OE1 . GLN A 103 ? 1.9575 2.0894 1.3826 -0.0584 0.1171  -0.3781 1103 GLN A OE1 
792  N NE2 . GLN A 103 ? 1.9101 2.0277 1.3242 -0.0174 0.0801  -0.3439 1103 GLN A NE2 
793  N N   . LYS A 104 ? 1.3669 1.2584 0.6930 -0.1275 0.1502  -0.2967 1104 LYS A N   
794  C CA  . LYS A 104 ? 1.3967 1.2344 0.6879 -0.1468 0.1727  -0.2959 1104 LYS A CA  
795  C C   . LYS A 104 ? 1.4510 1.2415 0.7146 -0.1529 0.1760  -0.2877 1104 LYS A C   
796  O O   . LYS A 104 ? 1.4837 1.2381 0.7162 -0.1748 0.2003  -0.3013 1104 LYS A O   
797  C CB  . LYS A 104 ? 1.4341 1.2411 0.7117 -0.1357 0.1693  -0.2711 1104 LYS A CB  
798  C CG  . LYS A 104 ? 1.6169 1.4528 0.9082 -0.1363 0.1755  -0.2816 1104 LYS A CG  
799  C CD  . LYS A 104 ? 1.7445 1.5509 1.0207 -0.1232 0.1697  -0.2563 1104 LYS A CD  
800  C CE  . LYS A 104 ? 1.8946 1.7332 1.1876 -0.1200 0.1723  -0.2640 1104 LYS A CE  
801  N NZ  . LYS A 104 ? 2.0357 1.8504 1.3147 -0.1056 0.1646  -0.2399 1104 LYS A NZ  
802  N N   . TYR A 105 ? 1.3771 1.1632 0.6481 -0.1343 0.1535  -0.2661 1105 TYR A N   
803  C CA  . TYR A 105 ? 1.3936 1.1342 0.6385 -0.1356 0.1547  -0.2569 1105 TYR A CA  
804  C C   . TYR A 105 ? 1.4235 1.1894 0.6870 -0.1299 0.1393  -0.2605 1105 TYR A C   
805  O O   . TYR A 105 ? 1.4428 1.1752 0.6859 -0.1323 0.1419  -0.2570 1105 TYR A O   
806  C CB  . TYR A 105 ? 1.4089 1.1101 0.6382 -0.1165 0.1420  -0.2270 1105 TYR A CB  
807  C CG  . TYR A 105 ? 1.4395 1.1191 0.6505 -0.1150 0.1507  -0.2206 1105 TYR A CG  
808  C CD1 . TYR A 105 ? 1.5137 1.1394 0.6779 -0.1274 0.1739  -0.2275 1105 TYR A CD1 
809  C CD2 . TYR A 105 ? 1.4189 1.1274 0.6542 -0.1005 0.1359  -0.2075 1105 TYR A CD2 
810  C CE1 . TYR A 105 ? 1.5445 1.1471 0.6867 -0.1237 0.1802  -0.2219 1105 TYR A CE1 
811  C CE2 . TYR A 105 ? 1.4435 1.1351 0.6620 -0.0973 0.1420  -0.2021 1105 TYR A CE2 
812  C CZ  . TYR A 105 ? 1.5830 1.2221 0.7548 -0.1079 0.1630  -0.2094 1105 TYR A CZ  
813  O OH  . TYR A 105 ? 1.6015 1.2205 0.7515 -0.1027 0.1677  -0.2046 1105 TYR A OH  
814  N N   . LEU A 106 ? 1.3391 1.1590 0.6354 -0.1199 0.1230  -0.2675 1106 LEU A N   
815  C CA  . LEU A 106 ? 1.3196 1.1599 0.6278 -0.1112 0.1061  -0.2705 1106 LEU A CA  
816  C C   . LEU A 106 ? 1.3786 1.2693 0.6996 -0.1210 0.1121  -0.3063 1106 LEU A C   
817  O O   . LEU A 106 ? 1.3762 1.2735 0.6954 -0.1230 0.1082  -0.3163 1106 LEU A O   
818  C CB  . LEU A 106 ? 1.2916 1.1450 0.6175 -0.0871 0.0788  -0.2490 1106 LEU A CB  
819  C CG  . LEU A 106 ? 1.3489 1.1629 0.6680 -0.0768 0.0690  -0.2176 1106 LEU A CG  
820  C CD1 . LEU A 106 ? 1.3260 1.1552 0.6618 -0.0597 0.0488  -0.2008 1106 LEU A CD1 
821  C CD2 . LEU A 106 ? 1.3968 1.1803 0.7030 -0.0760 0.0649  -0.2110 1106 LEU A CD2 
822  N N   . ILE A 107 ? 2.1005 0.8724 0.7854 0.0675  0.3447  -0.0391 12   ILE A N   
823  C CA  . ILE A 107 ? 2.1127 0.8699 0.7812 0.0442  0.3231  -0.0386 12   ILE A CA  
824  C C   . ILE A 107 ? 2.2153 0.9436 0.8656 0.0252  0.2941  -0.0470 12   ILE A C   
825  O O   . ILE A 107 ? 2.2713 0.9481 0.8698 0.0367  0.2849  -0.0562 12   ILE A O   
826  C CB  . ILE A 107 ? 2.2026 0.9304 0.8158 0.0558  0.3232  -0.0388 12   ILE A CB  
827  C CG1 . ILE A 107 ? 2.1894 0.9497 0.8258 0.0659  0.3504  -0.0269 12   ILE A CG1 
828  C CG2 . ILE A 107 ? 2.2226 0.9368 0.8084 0.0315  0.2947  -0.0413 12   ILE A CG2 
829  C CD1 . ILE A 107 ? 2.3308 1.0673 0.9158 0.0833  0.3567  -0.0252 12   ILE A CD1 
830  N N   . LEU A 108 ? 2.1480 0.9079 0.8375 -0.0026 0.2807  -0.0432 13   LEU A N   
831  C CA  . LEU A 108 ? 2.1613 0.9053 0.8404 -0.0282 0.2536  -0.0481 13   LEU A CA  
832  C C   . LEU A 108 ? 2.2283 0.9962 0.9053 -0.0555 0.2341  -0.0441 13   LEU A C   
833  O O   . LEU A 108 ? 2.1690 0.9880 0.8949 -0.0685 0.2324  -0.0373 13   LEU A O   
834  C CB  . LEU A 108 ? 2.1133 0.8869 0.8471 -0.0332 0.2568  -0.0468 13   LEU A CB  
835  N N   . ASN A 109 ? 2.2683 1.0029 0.8856 -0.0614 0.2199  -0.0483 14   ASN A N   
836  C CA  . ASN A 109 ? 2.2802 1.0450 0.8873 -0.0858 0.2003  -0.0450 14   ASN A CA  
837  C C   . ASN A 109 ? 2.3758 1.1313 0.9621 -0.1250 0.1703  -0.0487 14   ASN A C   
838  O O   . ASN A 109 ? 2.4495 1.1426 0.9703 -0.1380 0.1541  -0.0570 14   ASN A O   
839  C CB  . ASN A 109 ? 2.3603 1.1004 0.9131 -0.0745 0.2001  -0.0477 14   ASN A CB  
840  N N   . SER A 110 ? 2.2863 1.0998 0.9237 -0.1442 0.1630  -0.0421 15   SER A N   
841  C CA  . SER A 110 ? 2.3012 1.1216 0.9277 -0.1856 0.1359  -0.0424 15   SER A CA  
842  C C   . SER A 110 ? 2.3579 1.2266 0.9653 -0.2142 0.1144  -0.0388 15   SER A C   
843  O O   . SER A 110 ? 2.3962 1.2507 0.9633 -0.2550 0.0889  -0.0412 15   SER A O   
844  C CB  . SER A 110 ? 2.2960 1.1629 0.9869 -0.1900 0.1393  -0.0365 15   SER A CB  
845  O OG  . SER A 110 ? 2.4309 1.2580 1.1356 -0.1681 0.1556  -0.0406 15   SER A OG  
846  N N   . SER A 111 ? 2.2736 1.1993 0.9056 -0.1931 0.1247  -0.0326 16   SER A N   
847  C CA  . SER A 111 ? 2.2728 1.2616 0.8925 -0.2062 0.1092  -0.0282 16   SER A CA  
848  C C   . SER A 111 ? 2.3018 1.3487 0.9265 -0.2534 0.0811  -0.0242 16   SER A C   
849  O O   . SER A 111 ? 2.2484 1.3266 0.9181 -0.2595 0.0817  -0.0193 16   SER A O   
850  C CB  . SER A 111 ? 2.3954 1.3394 0.9495 -0.2060 0.1033  -0.0352 16   SER A CB  
851  O OG  . SER A 111 ? 2.5994 1.4716 1.0945 -0.2379 0.0850  -0.0445 16   SER A OG  
852  N N   . ASP A 112 ? 2.2980 1.3636 0.8757 -0.2879 0.0568  -0.0259 17   ASP A N   
853  C CA  . ASP A 112 ? 2.2970 1.4294 0.8695 -0.3400 0.0281  -0.0211 17   ASP A CA  
854  C C   . ASP A 112 ? 2.2511 1.5066 0.8817 -0.3233 0.0304  -0.0093 17   ASP A C   
855  O O   . ASP A 112 ? 2.2593 1.5916 0.8788 -0.3293 0.0180  -0.0055 17   ASP A O   
856  C CB  . ASP A 112 ? 2.3407 1.4272 0.9042 -0.3798 0.0159  -0.0225 17   ASP A CB  
857  C CG  . ASP A 112 ? 2.5624 1.5225 1.0503 -0.3979 0.0086  -0.0341 17   ASP A CG  
858  O OD1 . ASP A 112 ? 2.6227 1.5401 1.0565 -0.3942 0.0053  -0.0414 17   ASP A OD1 
859  O OD2 . ASP A 112 ? 2.6605 1.5620 1.1370 -0.4145 0.0051  -0.0359 17   ASP A OD2 
860  N N   . CYS A 113 ? 2.1135 1.3863 0.8010 -0.2978 0.0466  -0.0042 18   CYS A N   
861  C CA  . CYS A 113 ? 2.0354 1.4063 0.7720 -0.2706 0.0522  0.0060  18   CYS A CA  
862  C C   . CYS A 113 ? 2.0239 1.3537 0.7894 -0.2157 0.0829  0.0059  18   CYS A C   
863  O O   . CYS A 113 ? 1.9759 1.2966 0.7812 -0.2067 0.0933  0.0075  18   CYS A O   
864  C CB  . CYS A 113 ? 2.0024 1.4383 0.7739 -0.2999 0.0384  0.0130  18   CYS A CB  
865  S SG  . CYS A 113 ? 2.0953 1.5823 0.8297 -0.3750 0.0024  0.0154  18   CYS A SG  
866  N N   . PRO A 114 ? 1.9844 1.2827 0.7264 -0.1822 0.0977  0.0039  19   PRO A N   
867  C CA  . PRO A 114 ? 1.9538 1.2087 0.7168 -0.1382 0.1268  0.0049  19   PRO A CA  
868  C C   . PRO A 114 ? 1.9519 1.2699 0.7420 -0.1053 0.1336  0.0143  19   PRO A C   
869  O O   . PRO A 114 ? 1.9496 1.3444 0.7299 -0.1003 0.1200  0.0197  19   PRO A O   
870  C CB  . PRO A 114 ? 2.0190 1.2211 0.7391 -0.1191 0.1379  0.0008  19   PRO A CB  
871  C CG  . PRO A 114 ? 2.1201 1.3367 0.7960 -0.1515 0.1132  -0.0036 19   PRO A CG  
872  C CD  . PRO A 114 ? 2.0465 1.3480 0.7396 -0.1844 0.0888  0.0011  19   PRO A CD  
873  N N   . LYS A 115 ? 1.8668 1.1525 0.6864 -0.0819 0.1541  0.0159  20   LYS A N   
874  C CA  . LYS A 115 ? 1.8377 1.1582 0.6744 -0.0479 0.1627  0.0235  20   LYS A CA  
875  C C   . LYS A 115 ? 1.8503 1.2603 0.7127 -0.0603 0.1423  0.0283  20   LYS A C   
876  O O   . LYS A 115 ? 1.8366 1.3035 0.6968 -0.0301 0.1403  0.0354  20   LYS A O   
877  C CB  . LYS A 115 ? 1.8981 1.2228 0.6966 -0.0085 0.1711  0.0286  20   LYS A CB  
878  N N   . ALA A 116 ? 1.7855 1.2050 0.6675 -0.1026 0.1277  0.0250  21   ALA A N   
879  C CA  . ALA A 116 ? 1.7480 1.2502 0.6558 -0.1222 0.1090  0.0303  21   ALA A CA  
880  C C   . ALA A 116 ? 1.7603 1.2583 0.7064 -0.1020 0.1204  0.0322  21   ALA A C   
881  O O   . ALA A 116 ? 1.7511 1.1768 0.7125 -0.1020 0.1356  0.0268  21   ALA A O   
882  C CB  . ALA A 116 ? 1.7649 1.2611 0.6692 -0.1771 0.0907  0.0266  21   ALA A CB  
883  N N   . GLY A 117 ? 1.6922 1.2702 0.6502 -0.0817 0.1134  0.0398  22   GLY A N   
884  C CA  . GLY A 117 ? 1.6594 1.2371 0.6462 -0.0582 0.1221  0.0416  22   GLY A CA  
885  C C   . GLY A 117 ? 1.7172 1.2210 0.6892 -0.0172 0.1457  0.0399  22   GLY A C   
886  O O   . GLY A 117 ? 1.6907 1.1536 0.6839 -0.0103 0.1571  0.0375  22   GLY A O   
887  N N   . ARG A 118 ? 1.7122 1.1955 0.6443 0.0067  0.1530  0.0412  23   ARG A N   
888  C CA  . ARG A 118 ? 1.7415 1.1509 0.6463 0.0432  0.1751  0.0415  23   ARG A CA  
889  C C   . ARG A 118 ? 1.8294 1.2792 0.6995 0.0926  0.1731  0.0491  23   ARG A C   
890  O O   . ARG A 118 ? 1.8681 1.3167 0.6963 0.1173  0.1756  0.0522  23   ARG A O   
891  C CB  . ARG A 118 ? 1.7546 1.1008 0.6333 0.0365  0.1871  0.0381  23   ARG A CB  
892  C CG  . ARG A 118 ? 1.8326 1.1064 0.7339 0.0110  0.2014  0.0313  23   ARG A CG  
893  C CD  . ARG A 118 ? 1.9378 1.1552 0.8092 0.0116  0.2146  0.0291  23   ARG A CD  
894  N NE  . ARG A 118 ? 2.0185 1.1740 0.9090 -0.0040 0.2316  0.0239  23   ARG A NE  
895  C CZ  . ARG A 118 ? 2.2322 1.3319 1.1141 0.0094  0.2546  0.0257  23   ARG A CZ  
896  N NH1 . ARG A 118 ? 2.1116 1.1736 1.0148 -0.0070 0.2688  0.0214  23   ARG A NH1 
897  N NH2 . ARG A 118 ? 2.0680 1.1496 0.9148 0.0392  0.2636  0.0326  23   ARG A NH2 
898  N N   . HIS A 119 ? 1.7749 1.2619 0.6587 0.1104  0.1678  0.0520  24   HIS A N   
899  C CA  . HIS A 119 ? 1.8035 1.3313 0.6501 0.1646  0.1647  0.0590  24   HIS A CA  
900  C C   . HIS A 119 ? 1.8696 1.3046 0.6864 0.1989  0.1828  0.0586  24   HIS A C   
901  O O   . HIS A 119 ? 1.8436 1.2257 0.6882 0.1776  0.1908  0.0536  24   HIS A O   
902  C CB  . HIS A 119 ? 1.7845 1.4294 0.6582 0.1650  0.1442  0.0634  24   HIS A CB  
903  C CG  . HIS A 119 ? 1.8067 1.5419 0.7033 0.1233  0.1252  0.0649  24   HIS A CG  
904  N ND1 . HIS A 119 ? 1.8535 1.6660 0.7215 0.1393  0.1143  0.0701  24   HIS A ND1 
905  C CD2 . HIS A 119 ? 1.7957 1.5463 0.7337 0.0654  0.1153  0.0615  24   HIS A CD2 
906  C CE1 . HIS A 119 ? 1.8234 1.6969 0.7169 0.0858  0.0975  0.0697  24   HIS A CE1 
907  N NE2 . HIS A 119 ? 1.7958 1.6287 0.7280 0.0407  0.0975  0.0648  24   HIS A NE2 
908  N N   . ASN A 120 ? 1.8763 1.2909 0.6304 0.2518  0.1883  0.0639  25   ASN A N   
909  C CA  . ASN A 120 ? 1.9395 1.2538 0.6366 0.2918  0.2046  0.0654  25   ASN A CA  
910  C C   . ASN A 120 ? 1.9805 1.2637 0.6914 0.2931  0.2059  0.0622  25   ASN A C   
911  O O   . ASN A 120 ? 2.0075 1.1850 0.6991 0.2860  0.2220  0.0592  25   ASN A O   
912  C CB  . ASN A 120 ? 2.0281 1.3692 0.6554 0.3582  0.2006  0.0730  25   ASN A CB  
913  C CG  . ASN A 120 ? 2.3520 1.7345 0.9614 0.3627  0.1974  0.0763  25   ASN A CG  
914  O OD1 . ASN A 120 ? 2.2504 1.5541 0.8322 0.3563  0.2122  0.0760  25   ASN A OD1 
915  N ND2 . ASN A 120 ? 2.2358 1.7483 0.8598 0.3722  0.1778  0.0797  25   ASN A ND2 
916  N N   . TYR A 121 ? 1.8992 1.2759 0.6412 0.3001  0.1890  0.0631  26   TYR A N   
917  C CA  . TYR A 121 ? 1.8942 1.2526 0.6468 0.3068  0.1878  0.0600  26   TYR A CA  
918  C C   . TYR A 121 ? 1.8907 1.2124 0.7056 0.2482  0.1932  0.0521  26   TYR A C   
919  O O   . TYR A 121 ? 1.9061 1.1623 0.7139 0.2498  0.2002  0.0480  26   TYR A O   
920  C CB  . TYR A 121 ? 1.8817 1.3633 0.6514 0.3319  0.1683  0.0644  26   TYR A CB  
921  C CG  . TYR A 121 ? 1.8406 1.4446 0.6720 0.2913  0.1520  0.0667  26   TYR A CG  
922  C CD1 . TYR A 121 ? 1.8006 1.4354 0.6982 0.2416  0.1454  0.0631  26   TYR A CD1 
923  C CD2 . TYR A 121 ? 1.8583 1.5503 0.6755 0.3039  0.1418  0.0732  26   TYR A CD2 
924  C CE1 . TYR A 121 ? 1.7586 1.4954 0.7016 0.2013  0.1296  0.0662  26   TYR A CE1 
925  C CE2 . TYR A 121 ? 1.8171 1.6190 0.6831 0.2605  0.1253  0.0757  26   TYR A CE2 
926  C CZ  . TYR A 121 ? 1.8581 1.6767 0.7841 0.2079  0.1192  0.0725  26   TYR A CZ  
927  O OH  . TYR A 121 ? 1.8343 1.7488 0.7976 0.1612  0.1025  0.0758  26   TYR A OH  
928  N N   . ILE A 122 ? 1.7850 1.1462 0.6542 0.1992  0.1893  0.0499  27   ILE A N   
929  C CA  . ILE A 122 ? 1.7327 1.0694 0.6591 0.1482  0.1932  0.0427  27   ILE A CA  
930  C C   . ILE A 122 ? 1.8055 1.0286 0.7146 0.1380  0.2146  0.0381  27   ILE A C   
931  O O   . ILE A 122 ? 1.7763 0.9685 0.7123 0.1188  0.2191  0.0326  27   ILE A O   
932  C CB  . ILE A 122 ? 1.7311 1.1156 0.6967 0.1053  0.1853  0.0416  27   ILE A CB  
933  C CG1 . ILE A 122 ? 1.7105 1.2113 0.6905 0.1053  0.1633  0.0473  27   ILE A CG1 
934  C CG2 . ILE A 122 ? 1.6982 1.0531 0.7141 0.0603  0.1898  0.0343  27   ILE A CG2 
935  C CD1 . ILE A 122 ? 1.8219 1.3591 0.8126 0.0701  0.1543  0.0476  27   ILE A CD1 
936  N N   . PHE A 123 ? 1.8195 0.9862 0.6827 0.1497  0.2274  0.0409  28   PHE A N   
937  C CA  . PHE A 123 ? 1.8594 0.9253 0.7021 0.1354  0.2486  0.0388  28   PHE A CA  
938  C C   . PHE A 123 ? 1.9652 0.9577 0.7587 0.1599  0.2554  0.0392  28   PHE A C   
939  O O   . PHE A 123 ? 1.9914 0.8991 0.7637 0.1425  0.2722  0.0381  28   PHE A O   
940  C CB  . PHE A 123 ? 1.9241 0.9547 0.7265 0.1422  0.2599  0.0433  28   PHE A CB  
941  C CG  . PHE A 123 ? 1.9044 1.0012 0.7361 0.1261  0.2506  0.0430  28   PHE A CG  
942  C CD1 . PHE A 123 ? 1.8925 1.0050 0.7783 0.0833  0.2503  0.0370  28   PHE A CD1 
943  C CD2 . PHE A 123 ? 1.9558 1.0948 0.7536 0.1547  0.2416  0.0483  28   PHE A CD2 
944  C CE1 . PHE A 123 ? 1.8811 1.0397 0.7812 0.0675  0.2405  0.0360  28   PHE A CE1 
945  C CE2 . PHE A 123 ? 1.9618 1.1567 0.7805 0.1346  0.2315  0.0472  28   PHE A CE2 
946  C CZ  . PHE A 123 ? 1.8925 1.0908 0.7592 0.0901  0.2308  0.0409  28   PHE A CZ  
947  N N   . VAL A 124 ? 1.9425 0.9676 0.7145 0.1985  0.2420  0.0409  29   VAL A N   
948  C CA  . VAL A 124 ? 2.0154 0.9674 0.7284 0.2290  0.2451  0.0406  29   VAL A CA  
949  C C   . VAL A 124 ? 2.0224 1.0152 0.7782 0.2227  0.2331  0.0347  29   VAL A C   
950  O O   . VAL A 124 ? 2.0431 0.9668 0.7884 0.2090  0.2393  0.0295  29   VAL A O   
951  C CB  . VAL A 124 ? 2.1407 1.0849 0.7711 0.2948  0.2407  0.0480  29   VAL A CB  
952  C CG1 . VAL A 124 ? 2.2225 1.0813 0.7788 0.3323  0.2419  0.0470  29   VAL A CG1 
953  C CG2 . VAL A 124 ? 2.1866 1.0849 0.7702 0.3029  0.2530  0.0539  29   VAL A CG2 
954  N N   . MET A 125 ? 1.9189 1.0243 0.7201 0.2299  0.2159  0.0362  30   MET A N   
955  C CA  . MET A 125 ? 1.8752 1.0357 0.7168 0.2284  0.2030  0.0326  30   MET A CA  
956  C C   . MET A 125 ? 1.8643 1.0147 0.7731 0.1731  0.2071  0.0247  30   MET A C   
957  O O   . MET A 125 ? 1.8628 0.9947 0.7793 0.1717  0.2047  0.0194  30   MET A O   
958  C CB  . MET A 125 ? 1.8540 1.1450 0.7284 0.2405  0.1850  0.0385  30   MET A CB  
959  C CG  . MET A 125 ? 1.8687 1.2265 0.7751 0.2480  0.1713  0.0375  30   MET A CG  
960  S SD  . MET A 125 ? 1.8695 1.3899 0.8140 0.2521  0.1508  0.0467  30   MET A SD  
961  C CE  . MET A 125 ? 1.7614 1.2999 0.7729 0.1791  0.1510  0.0444  30   MET A CE  
962  N N   . ILE A 126 ? 1.7722 0.9366 0.7254 0.1318  0.2123  0.0236  31   ILE A N   
963  C CA  . ILE A 126 ? 1.7165 0.8798 0.7306 0.0853  0.2161  0.0165  31   ILE A CA  
964  C C   . ILE A 126 ? 1.8196 0.8871 0.8137 0.0691  0.2333  0.0112  31   ILE A C   
965  O O   . ILE A 126 ? 1.7869 0.8508 0.8085 0.0537  0.2315  0.0049  31   ILE A O   
966  C CB  . ILE A 126 ? 1.7044 0.9059 0.7595 0.0527  0.2159  0.0168  31   ILE A CB  
967  C CG1 . ILE A 126 ? 1.6719 0.9665 0.7425 0.0583  0.1973  0.0224  31   ILE A CG1 
968  C CG2 . ILE A 126 ? 1.6675 0.8623 0.7760 0.0127  0.2211  0.0096  31   ILE A CG2 
969  C CD1 . ILE A 126 ? 1.7075 1.0768 0.8156 0.0567  0.1804  0.0228  31   ILE A CD1 
970  N N   . PRO A 127 ? 1.8559 0.8489 0.8018 0.0695  0.2491  0.0139  32   PRO A N   
971  C CA  . PRO A 127 ? 1.9008 0.8125 0.8300 0.0444  0.2643  0.0098  32   PRO A CA  
972  C C   . PRO A 127 ? 2.0115 0.8707 0.8978 0.0615  0.2601  0.0064  32   PRO A C   
973  O O   . PRO A 127 ? 2.0146 0.8369 0.9118 0.0304  0.2662  0.0003  32   PRO A O   
974  C CB  . PRO A 127 ? 1.9843 0.8306 0.8587 0.0470  0.2804  0.0161  32   PRO A CB  
975  C CG  . PRO A 127 ? 2.0481 0.9256 0.8917 0.0880  0.2717  0.0228  32   PRO A CG  
976  C CD  . PRO A 127 ? 1.9090 0.8910 0.8151 0.0872  0.2543  0.0210  32   PRO A CD  
977  N N   . THR A 128 ? 2.0121 0.8710 0.8477 0.1113  0.2491  0.0100  33   THR A N   
978  C CA  . THR A 128 ? 2.0751 0.8786 0.8578 0.1367  0.2433  0.0065  33   THR A CA  
979  C C   . THR A 128 ? 2.0477 0.9150 0.8928 0.1254  0.2304  -0.0008 33   THR A C   
980  O O   . THR A 128 ? 2.0788 0.8927 0.9044 0.1177  0.2299  -0.0076 33   THR A O   
981  C CB  . THR A 128 ? 2.2989 1.0885 1.0034 0.2019  0.2358  0.0128  33   THR A CB  
982  O OG1 . THR A 128 ? 2.2639 1.1716 1.0110 0.2250  0.2225  0.0174  33   THR A OG1 
983  C CG2 . THR A 128 ? 2.3787 1.0775 1.0009 0.2178  0.2493  0.0195  33   THR A CG2 
984  N N   . LEU A 129 ? 1.9040 0.8802 0.8190 0.1219  0.2199  0.0008  34   LEU A N   
985  C CA  . LEU A 129 ? 1.8296 0.8723 0.8067 0.1094  0.2081  -0.0044 34   LEU A CA  
986  C C   . LEU A 129 ? 1.8263 0.8543 0.8555 0.0577  0.2167  -0.0122 34   LEU A C   
987  O O   . LEU A 129 ? 1.8096 0.8371 0.8581 0.0480  0.2119  -0.0194 34   LEU A O   
988  C CB  . LEU A 129 ? 1.7586 0.9135 0.7859 0.1143  0.1953  0.0014  34   LEU A CB  
989  C CG  . LEU A 129 ? 1.8161 1.0372 0.8310 0.1572  0.1791  0.0058  34   LEU A CG  
990  C CD1 . LEU A 129 ? 1.8948 1.0916 0.8309 0.2107  0.1789  0.0122  34   LEU A CD1 
991  C CD2 . LEU A 129 ? 1.7653 1.0987 0.8392 0.1428  0.1670  0.0115  34   LEU A CD2 
992  N N   . TYR A 130 ? 1.7564 0.7750 0.8049 0.0275  0.2294  -0.0109 35   TYR A N   
993  C CA  . TYR A 130 ? 1.7149 0.7292 0.8099 -0.0178 0.2399  -0.0169 35   TYR A CA  
994  C C   . TYR A 130 ? 1.8150 0.7490 0.8740 -0.0360 0.2497  -0.0222 35   TYR A C   
995  O O   . TYR A 130 ? 1.7844 0.7277 0.8835 -0.0713 0.2548  -0.0287 35   TYR A O   
996  C CB  . TYR A 130 ? 1.7092 0.7309 0.8184 -0.0353 0.2515  -0.0128 35   TYR A CB  
997  C CG  . TYR A 130 ? 1.6525 0.7513 0.8131 -0.0392 0.2424  -0.0114 35   TYR A CG  
998  C CD1 . TYR A 130 ? 1.6348 0.7929 0.8102 -0.0204 0.2246  -0.0092 35   TYR A CD1 
999  C CD2 . TYR A 130 ? 1.6440 0.7530 0.8298 -0.0611 0.2514  -0.0115 35   TYR A CD2 
1000 C CE1 . TYR A 130 ? 1.5900 0.8095 0.8032 -0.0307 0.2154  -0.0072 35   TYR A CE1 
1001 C CE2 . TYR A 130 ? 1.6108 0.7742 0.8299 -0.0657 0.2419  -0.0106 35   TYR A CE2 
1002 C CZ  . TYR A 130 ? 1.6667 0.8818 0.8978 -0.0535 0.2237  -0.0083 35   TYR A CZ  
1003 O OH  . TYR A 130 ? 1.6331 0.8935 0.8883 -0.0643 0.2133  -0.0066 35   TYR A OH  
1004 N N   . SER A 131 ? 1.8499 0.7048 0.8283 -0.0122 0.2517  -0.0194 36   SER A N   
1005 C CA  . SER A 131 ? 1.9221 0.6843 0.8476 -0.0309 0.2589  -0.0238 36   SER A CA  
1006 C C   . SER A 131 ? 1.9507 0.7191 0.8856 -0.0280 0.2457  -0.0328 36   SER A C   
1007 O O   . SER A 131 ? 1.9598 0.7050 0.9062 -0.0659 0.2492  -0.0403 36   SER A O   
1008 C CB  . SER A 131 ? 2.0770 0.7421 0.9004 -0.0006 0.2635  -0.0174 36   SER A CB  
1009 O OG  . SER A 131 ? 2.2110 0.8763 1.0253 0.0020  0.2745  -0.0087 36   SER A OG  
1010 N N   . ILE A 132 ? 1.8703 0.6800 0.8027 0.0168  0.2300  -0.0318 37   ILE A N   
1011 C CA  . ILE A 132 ? 1.8498 0.6749 0.7876 0.0316  0.2156  -0.0390 37   ILE A CA  
1012 C C   . ILE A 132 ? 1.7853 0.6902 0.8168 -0.0043 0.2127  -0.0453 37   ILE A C   
1013 O O   . ILE A 132 ? 1.7973 0.6786 0.8348 -0.0289 0.2118  -0.0543 37   ILE A O   
1014 C CB  . ILE A 132 ? 1.8828 0.7516 0.7980 0.0912  0.2013  -0.0335 37   ILE A CB  
1015 C CG1 . ILE A 132 ? 1.9795 0.7717 0.7967 0.1337  0.2050  -0.0268 37   ILE A CG1 
1016 C CG2 . ILE A 132 ? 1.8922 0.7788 0.8095 0.1106  0.1868  -0.0404 37   ILE A CG2 
1017 C CD1 . ILE A 132 ? 2.0432 0.9000 0.8422 0.1934  0.1938  -0.0185 37   ILE A CD1 
1018 N N   . ILE A 133 ? 1.6376 0.6299 0.7353 -0.0090 0.2115  -0.0406 38   ILE A N   
1019 C CA  . ILE A 133 ? 1.5472 0.6112 0.7260 -0.0372 0.2088  -0.0453 38   ILE A CA  
1020 C C   . ILE A 133 ? 1.6029 0.6363 0.7981 -0.0822 0.2215  -0.0527 38   ILE A C   
1021 O O   . ILE A 133 ? 1.5692 0.6364 0.8080 -0.1002 0.2173  -0.0603 38   ILE A O   
1022 C CB  . ILE A 133 ? 1.5167 0.6535 0.7433 -0.0384 0.2074  -0.0383 38   ILE A CB  
1023 C CG1 . ILE A 133 ? 1.5121 0.6923 0.7233 -0.0006 0.1942  -0.0301 38   ILE A CG1 
1024 C CG2 . ILE A 133 ? 1.4544 0.6517 0.7524 -0.0635 0.2046  -0.0431 38   ILE A CG2 
1025 C CD1 . ILE A 133 ? 1.5470 0.7897 0.7906 -0.0060 0.1910  -0.0225 38   ILE A CD1 
1026 N N   . PHE A 134 ? 1.5989 0.5725 0.7565 -0.0997 0.2365  -0.0499 39   PHE A N   
1027 C CA  . PHE A 134 ? 1.6092 0.5631 0.7789 -0.1455 0.2495  -0.0550 39   PHE A CA  
1028 C C   . PHE A 134 ? 1.7116 0.6087 0.8439 -0.1601 0.2449  -0.0636 39   PHE A C   
1029 O O   . PHE A 134 ? 1.6677 0.6065 0.8459 -0.1816 0.2406  -0.0719 39   PHE A O   
1030 C CB  . PHE A 134 ? 1.6781 0.5860 0.8135 -0.1610 0.2672  -0.0477 39   PHE A CB  
1031 C CG  . PHE A 134 ? 1.7255 0.6174 0.8664 -0.2110 0.2822  -0.0505 39   PHE A CG  
1032 C CD1 . PHE A 134 ? 1.6971 0.6667 0.9090 -0.2360 0.2888  -0.0532 39   PHE A CD1 
1033 C CD2 . PHE A 134 ? 1.8437 0.6433 0.9131 -0.2328 0.2902  -0.0492 39   PHE A CD2 
1034 C CE1 . PHE A 134 ? 1.7281 0.7001 0.9474 -0.2817 0.3031  -0.0547 39   PHE A CE1 
1035 C CE2 . PHE A 134 ? 1.9048 0.6992 0.9794 -0.2858 0.3042  -0.0502 39   PHE A CE2 
1036 C CZ  . PHE A 134 ? 1.8073 0.6960 0.9605 -0.3097 0.3108  -0.0528 39   PHE A CZ  
1037 N N   . VAL A 135 ? 1.7616 0.5614 0.8060 -0.1463 0.2447  -0.0618 40   VAL A N   
1038 C CA  . VAL A 135 ? 1.8417 0.5600 0.8263 -0.1608 0.2401  -0.0698 40   VAL A CA  
1039 C C   . VAL A 135 ? 1.8600 0.6192 0.8736 -0.1442 0.2223  -0.0793 40   VAL A C   
1040 O O   . VAL A 135 ? 1.8576 0.6119 0.8825 -0.1789 0.2198  -0.0891 40   VAL A O   
1041 C CB  . VAL A 135 ? 2.0011 0.6008 0.8728 -0.1326 0.2407  -0.0649 40   VAL A CB  
1042 C CG1 . VAL A 135 ? 2.0999 0.6004 0.8956 -0.1447 0.2335  -0.0739 40   VAL A CG1 
1043 C CG2 . VAL A 135 ? 2.0401 0.5931 0.8785 -0.1527 0.2589  -0.0553 40   VAL A CG2 
1044 N N   . VAL A 136 ? 1.7935 0.5982 0.8189 -0.0939 0.2101  -0.0761 41   VAL A N   
1045 C CA  . VAL A 136 ? 1.7658 0.6162 0.8174 -0.0721 0.1936  -0.0828 41   VAL A CA  
1046 C C   . VAL A 136 ? 1.7209 0.6638 0.8689 -0.1051 0.1934  -0.0881 41   VAL A C   
1047 O O   . VAL A 136 ? 1.7217 0.6713 0.8836 -0.1190 0.1859  -0.0982 41   VAL A O   
1048 C CB  . VAL A 136 ? 1.7953 0.6889 0.8405 -0.0137 0.1826  -0.0751 41   VAL A CB  
1049 C CG1 . VAL A 136 ? 1.7394 0.6997 0.8247 0.0051  0.1670  -0.0799 41   VAL A CG1 
1050 C CG2 . VAL A 136 ? 1.8957 0.6998 0.8382 0.0281  0.1811  -0.0712 41   VAL A CG2 
1051 N N   . GLY A 137 ? 1.5958 0.6032 0.8014 -0.1146 0.2013  -0.0817 42   GLY A N   
1052 C CA  . GLY A 137 ? 1.5100 0.5999 0.7973 -0.1381 0.2023  -0.0853 42   GLY A CA  
1053 C C   . GLY A 137 ? 1.5699 0.6551 0.8743 -0.1847 0.2109  -0.0938 42   GLY A C   
1054 O O   . GLY A 137 ? 1.5186 0.6613 0.8747 -0.1967 0.2059  -0.1010 42   GLY A O   
1055 N N   . ILE A 138 ? 1.5900 0.6127 0.8510 -0.2123 0.2241  -0.0921 43   ILE A N   
1056 C CA  . ILE A 138 ? 1.6111 0.6347 0.8836 -0.2637 0.2336  -0.0984 43   ILE A CA  
1057 C C   . ILE A 138 ? 1.7031 0.6956 0.9518 -0.2769 0.2213  -0.1101 43   ILE A C   
1058 O O   . ILE A 138 ? 1.6529 0.7074 0.9531 -0.3001 0.2186  -0.1183 43   ILE A O   
1059 C CB  . ILE A 138 ? 1.7206 0.6808 0.9439 -0.2924 0.2508  -0.0916 43   ILE A CB  
1060 C CG1 . ILE A 138 ? 1.6794 0.6883 0.9398 -0.2868 0.2643  -0.0820 43   ILE A CG1 
1061 C CG2 . ILE A 138 ? 1.7831 0.7258 0.9948 -0.3511 0.2579  -0.0977 43   ILE A CG2 
1062 C CD1 . ILE A 138 ? 1.7292 0.8430 1.0726 -0.3049 0.2713  -0.0844 43   ILE A CD1 
1063 N N   . PHE A 139 ? 1.7493 0.6477 0.9173 -0.2575 0.2131  -0.1112 44   PHE A N   
1064 C CA  . PHE A 139 ? 1.8085 0.6596 0.9376 -0.2658 0.2000  -0.1230 44   PHE A CA  
1065 C C   . PHE A 139 ? 1.7839 0.7065 0.9642 -0.2345 0.1843  -0.1290 44   PHE A C   
1066 O O   . PHE A 139 ? 1.7968 0.7256 0.9837 -0.2535 0.1754  -0.1405 44   PHE A O   
1067 C CB  . PHE A 139 ? 1.9531 0.6745 0.9695 -0.2444 0.1955  -0.1220 44   PHE A CB  
1068 C CG  . PHE A 139 ? 2.0891 0.7133 1.0354 -0.2968 0.2050  -0.1233 44   PHE A CG  
1069 C CD1 . PHE A 139 ? 2.2177 0.7777 1.1144 -0.3318 0.1964  -0.1351 44   PHE A CD1 
1070 C CD2 . PHE A 139 ? 2.1437 0.7409 1.0714 -0.3154 0.2224  -0.1123 44   PHE A CD2 
1071 C CE1 . PHE A 139 ? 2.3414 0.8079 1.1669 -0.3885 0.2047  -0.1353 44   PHE A CE1 
1072 C CE2 . PHE A 139 ? 2.2880 0.7958 1.1479 -0.3691 0.2319  -0.1117 44   PHE A CE2 
1073 C CZ  . PHE A 139 ? 2.3509 0.7926 1.1587 -0.4075 0.2228  -0.1229 44   PHE A CZ  
1074 N N   . GLY A 140 ? 1.6596 0.6376 0.8747 -0.1912 0.1812  -0.1209 45   GLY A N   
1075 C CA  . GLY A 140 ? 1.5818 0.6320 0.8453 -0.1618 0.1674  -0.1235 45   GLY A CA  
1076 C C   . GLY A 140 ? 1.5388 0.6785 0.8849 -0.1881 0.1684  -0.1290 45   GLY A C   
1077 O O   . GLY A 140 ? 1.5363 0.6929 0.8956 -0.1960 0.1587  -0.1395 45   GLY A O   
1078 N N   . ASN A 141 ? 1.4159 0.6111 0.8127 -0.1988 0.1799  -0.1223 46   ASN A N   
1079 C CA  . ASN A 141 ? 1.3338 0.6155 0.8040 -0.2153 0.1824  -0.1260 46   ASN A CA  
1080 C C   . ASN A 141 ? 1.3976 0.6867 0.8767 -0.2612 0.1875  -0.1364 46   ASN A C   
1081 O O   . ASN A 141 ? 1.3492 0.7100 0.8811 -0.2685 0.1844  -0.1429 46   ASN A O   
1082 C CB  . ASN A 141 ? 1.2631 0.5844 0.7666 -0.2120 0.1940  -0.1163 46   ASN A CB  
1083 C CG  . ASN A 141 ? 1.4212 0.7549 0.9266 -0.1746 0.1874  -0.1064 46   ASN A CG  
1084 O OD1 . ASN A 141 ? 1.3771 0.7564 0.9120 -0.1553 0.1764  -0.1061 46   ASN A OD1 
1085 N ND2 . ASN A 141 ? 1.2725 0.5701 0.7461 -0.1665 0.1942  -0.0973 46   ASN A ND2 
1086 N N   . SER A 142 ? 1.4282 0.6471 0.8540 -0.2931 0.1949  -0.1377 47   SER A N   
1087 C CA  . SER A 142 ? 1.4617 0.6918 0.8921 -0.3450 0.1990  -0.1468 47   SER A CA  
1088 C C   . SER A 142 ? 1.5313 0.7453 0.9455 -0.3499 0.1823  -0.1599 47   SER A C   
1089 O O   . SER A 142 ? 1.5046 0.7755 0.9545 -0.3815 0.1804  -0.1692 47   SER A O   
1090 C CB  . SER A 142 ? 1.6015 0.7565 0.9732 -0.3835 0.2119  -0.1427 47   SER A CB  
1091 O OG  . SER A 142 ? 1.8393 0.8800 1.1256 -0.3673 0.2056  -0.1413 47   SER A OG  
1092 N N   . LEU A 143 ? 1.5324 0.6769 0.8935 -0.3151 0.1696  -0.1607 48   LEU A N   
1093 C CA  . LEU A 143 ? 1.5637 0.6868 0.9023 -0.3099 0.1523  -0.1731 48   LEU A CA  
1094 C C   . LEU A 143 ? 1.5262 0.7531 0.9420 -0.2882 0.1436  -0.1769 48   LEU A C   
1095 O O   . LEU A 143 ? 1.5250 0.7733 0.9513 -0.3037 0.1335  -0.1891 48   LEU A O   
1096 C CB  . LEU A 143 ? 1.6292 0.6569 0.8876 -0.2677 0.1420  -0.1715 48   LEU A CB  
1097 C CG  . LEU A 143 ? 1.8164 0.7123 0.9710 -0.2871 0.1445  -0.1726 48   LEU A CG  
1098 C CD1 . LEU A 143 ? 1.8691 0.6869 0.9489 -0.2292 0.1361  -0.1684 48   LEU A CD1 
1099 C CD2 . LEU A 143 ? 1.9231 0.7701 1.0380 -0.3368 0.1369  -0.1874 48   LEU A CD2 
1100 N N   . VAL A 144 ? 1.4143 0.7014 0.8789 -0.2548 0.1474  -0.1663 49   VAL A N   
1101 C CA  . VAL A 144 ? 1.3331 0.7109 0.8644 -0.2312 0.1409  -0.1664 49   VAL A CA  
1102 C C   . VAL A 144 ? 1.3564 0.8117 0.9441 -0.2641 0.1460  -0.1741 49   VAL A C   
1103 O O   . VAL A 144 ? 1.3168 0.8250 0.9378 -0.2575 0.1361  -0.1818 49   VAL A O   
1104 C CB  . VAL A 144 ? 1.3285 0.7357 0.8838 -0.1976 0.1454  -0.1518 49   VAL A CB  
1105 C CG1 . VAL A 144 ? 1.2513 0.7421 0.8674 -0.1791 0.1401  -0.1506 49   VAL A CG1 
1106 C CG2 . VAL A 144 ? 1.3544 0.7074 0.8594 -0.1625 0.1386  -0.1444 49   VAL A CG2 
1107 N N   . VAL A 145 ? 1.3301 0.7960 0.9258 -0.2973 0.1614  -0.1716 50   VAL A N   
1108 C CA  . VAL A 145 ? 1.3050 0.8548 0.9511 -0.3274 0.1686  -0.1773 50   VAL A CA  
1109 C C   . VAL A 145 ? 1.3987 0.9503 1.0338 -0.3630 0.1586  -0.1922 50   VAL A C   
1110 O O   . VAL A 145 ? 1.3517 0.9881 1.0351 -0.3684 0.1546  -0.2001 50   VAL A O   
1111 C CB  . VAL A 145 ? 1.3744 0.9299 1.0209 -0.3551 0.1879  -0.1701 50   VAL A CB  
1112 C CG1 . VAL A 145 ? 1.3547 1.0080 1.0501 -0.3855 0.1957  -0.1757 50   VAL A CG1 
1113 C CG2 . VAL A 145 ? 1.3330 0.8879 0.9891 -0.3197 0.1961  -0.1569 50   VAL A CG2 
1114 N N   . ILE A 146 ? 1.4484 0.9026 1.0141 -0.3842 0.1533  -0.1963 51   ILE A N   
1115 C CA  . ILE A 146 ? 1.5128 0.9443 1.0495 -0.4215 0.1418  -0.2110 51   ILE A CA  
1116 C C   . ILE A 146 ? 1.5420 0.9949 1.0936 -0.3853 0.1234  -0.2194 51   ILE A C   
1117 O O   . ILE A 146 ? 1.5255 1.0363 1.1051 -0.4058 0.1155  -0.2313 51   ILE A O   
1118 C CB  . ILE A 146 ? 1.6670 0.9656 1.1078 -0.4493 0.1409  -0.2119 51   ILE A CB  
1119 C CG1 . ILE A 146 ? 1.7133 0.9877 1.1362 -0.4849 0.1603  -0.2016 51   ILE A CG1 
1120 C CG2 . ILE A 146 ? 1.7489 1.0050 1.1445 -0.4900 0.1265  -0.2279 51   ILE A CG2 
1121 C CD1 . ILE A 146 ? 1.8338 1.2021 1.3050 -0.5432 0.1725  -0.2032 51   ILE A CD1 
1122 N N   . VAL A 147 ? 1.4921 0.9082 1.0270 -0.3321 0.1171  -0.2126 52   VAL A N   
1123 C CA  . VAL A 147 ? 1.4669 0.9025 1.0122 -0.2925 0.1009  -0.2175 52   VAL A CA  
1124 C C   . VAL A 147 ? 1.4388 0.9927 1.0668 -0.2818 0.1009  -0.2183 52   VAL A C   
1125 O O   . VAL A 147 ? 1.4262 1.0162 1.0702 -0.2803 0.0887  -0.2292 52   VAL A O   
1126 C CB  . VAL A 147 ? 1.5139 0.9028 1.0285 -0.2394 0.0972  -0.2064 52   VAL A CB  
1127 C CG1 . VAL A 147 ? 1.4649 0.8981 1.0037 -0.1972 0.0831  -0.2077 52   VAL A CG1 
1128 C CG2 . VAL A 147 ? 1.6116 0.8807 1.0337 -0.2399 0.0940  -0.2078 52   VAL A CG2 
1129 N N   . ILE A 148 ? 1.3399 0.9482 1.0131 -0.2732 0.1142  -0.2075 53   ILE A N   
1130 C CA  . ILE A 148 ? 1.2660 0.9741 1.0053 -0.2564 0.1153  -0.2068 53   ILE A CA  
1131 C C   . ILE A 148 ? 1.3307 1.1081 1.1003 -0.2934 0.1153  -0.2200 53   ILE A C   
1132 O O   . ILE A 148 ? 1.2930 1.1358 1.0978 -0.2784 0.1067  -0.2266 53   ILE A O   
1133 C CB  . ILE A 148 ? 1.2611 0.9915 1.0241 -0.2396 0.1297  -0.1925 53   ILE A CB  
1134 C CG1 . ILE A 148 ? 1.2498 0.9363 0.9924 -0.2005 0.1253  -0.1802 53   ILE A CG1 
1135 C CG2 . ILE A 148 ? 1.2106 1.0364 1.0300 -0.2270 0.1337  -0.1929 53   ILE A CG2 
1136 C CD1 . ILE A 148 ? 1.3164 0.9963 1.0619 -0.1892 0.1370  -0.1665 53   ILE A CD1 
1137 N N   . TYR A 149 ? 1.3389 1.1042 1.0918 -0.3422 0.1241  -0.2234 54   TYR A N   
1138 C CA  . TYR A 149 ? 1.3515 1.1933 1.1322 -0.3838 0.1242  -0.2349 54   TYR A CA  
1139 C C   . TYR A 149 ? 1.4517 1.2705 1.2055 -0.4070 0.1064  -0.2508 54   TYR A C   
1140 O O   . TYR A 149 ? 1.4324 1.3376 1.2228 -0.4236 0.1010  -0.2613 54   TYR A O   
1141 C CB  . TYR A 149 ? 1.4119 1.2523 1.1805 -0.4348 0.1397  -0.2319 54   TYR A CB  
1142 C CG  . TYR A 149 ? 1.3911 1.3220 1.2110 -0.4245 0.1567  -0.2231 54   TYR A CG  
1143 C CD1 . TYR A 149 ? 1.3911 1.4444 1.2620 -0.4375 0.1596  -0.2294 54   TYR A CD1 
1144 C CD2 . TYR A 149 ? 1.3891 1.2845 1.2016 -0.4005 0.1695  -0.2091 54   TYR A CD2 
1145 C CE1 . TYR A 149 ? 1.3689 1.5047 1.2792 -0.4211 0.1754  -0.2215 54   TYR A CE1 
1146 C CE2 . TYR A 149 ? 1.3662 1.3367 1.2169 -0.3881 0.1847  -0.2018 54   TYR A CE2 
1147 C CZ  . TYR A 149 ? 1.4480 1.5373 1.3458 -0.3962 0.1879  -0.2080 54   TYR A CZ  
1148 O OH  . TYR A 149 ? 1.4332 1.5964 1.3618 -0.3769 0.2029  -0.2010 54   TYR A OH  
1149 N N   . PHE A 150 ? 1.4706 1.1757 1.1570 -0.4065 0.0967  -0.2532 55   PHE A N   
1150 C CA  . PHE A 150 ? 1.5314 1.1952 1.1766 -0.4297 0.0790  -0.2692 55   PHE A CA  
1151 C C   . PHE A 150 ? 1.5528 1.2013 1.1926 -0.3769 0.0626  -0.2728 55   PHE A C   
1152 O O   . PHE A 150 ? 1.5414 1.2296 1.1934 -0.3832 0.0492  -0.2861 55   PHE A O   
1153 C CB  . PHE A 150 ? 1.6651 1.1998 1.2209 -0.4677 0.0782  -0.2713 55   PHE A CB  
1154 C CG  . PHE A 150 ? 1.7350 1.2804 1.2821 -0.5391 0.0888  -0.2728 55   PHE A CG  
1155 C CD1 . PHE A 150 ? 1.7551 1.3153 1.3183 -0.5488 0.1088  -0.2589 55   PHE A CD1 
1156 C CD2 . PHE A 150 ? 1.8375 1.3760 1.3551 -0.5994 0.0783  -0.2878 55   PHE A CD2 
1157 C CE1 . PHE A 150 ? 1.8158 1.3928 1.3707 -0.6161 0.1195  -0.2587 55   PHE A CE1 
1158 C CE2 . PHE A 150 ? 1.9249 1.4790 1.4325 -0.6719 0.0883  -0.2876 55   PHE A CE2 
1159 C CZ  . PHE A 150 ? 1.8772 1.4529 1.4046 -0.6791 0.1094  -0.2725 55   PHE A CZ  
1160 N N   . TYR A 151 ? 1.5007 1.0959 1.1198 -0.3278 0.0632  -0.2612 56   TYR A N   
1161 C CA  . TYR A 151 ? 1.4840 1.0703 1.0956 -0.2780 0.0487  -0.2624 56   TYR A CA  
1162 C C   . TYR A 151 ? 1.4423 1.1352 1.1291 -0.2438 0.0492  -0.2570 56   TYR A C   
1163 O O   . TYR A 151 ? 1.4253 1.1498 1.1240 -0.2239 0.0360  -0.2646 56   TYR A O   
1164 C CB  . TYR A 151 ? 1.5265 1.0270 1.0851 -0.2394 0.0489  -0.2511 56   TYR A CB  
1165 C CG  . TYR A 151 ? 1.5306 1.0375 1.0854 -0.1857 0.0358  -0.2494 56   TYR A CG  
1166 C CD1 . TYR A 151 ? 1.6140 1.0756 1.1207 -0.1782 0.0190  -0.2629 56   TYR A CD1 
1167 C CD2 . TYR A 151 ? 1.4692 1.0257 1.0634 -0.1442 0.0399  -0.2338 56   TYR A CD2 
1168 C CE1 . TYR A 151 ? 1.6071 1.0827 1.1107 -0.1270 0.0077  -0.2605 56   TYR A CE1 
1169 C CE2 . TYR A 151 ? 1.4630 1.0348 1.0546 -0.0988 0.0286  -0.2305 56   TYR A CE2 
1170 C CZ  . TYR A 151 ? 1.6299 1.1649 1.1782 -0.0884 0.0131  -0.2435 56   TYR A CZ  
1171 O OH  . TYR A 151 ? 1.6519 1.2078 1.1968 -0.0416 0.0026  -0.2395 56   TYR A OH  
1172 N N   . MET A 152 ? 1.3423 1.0815 1.0715 -0.2348 0.0639  -0.2439 57   MET A N   
1173 C CA  . MET A 152 ? 1.2640 1.0872 1.0510 -0.2012 0.0653  -0.2372 57   MET A CA  
1174 C C   . MET A 152 ? 1.2832 1.2003 1.1199 -0.2229 0.0694  -0.2455 57   MET A C   
1175 O O   . MET A 152 ? 1.2345 1.2200 1.1094 -0.1961 0.0651  -0.2460 57   MET A O   
1176 C CB  . MET A 152 ? 1.2598 1.0740 1.0548 -0.1768 0.0771  -0.2189 57   MET A CB  
1177 C CG  . MET A 152 ? 1.3256 1.0693 1.0777 -0.1509 0.0725  -0.2096 57   MET A CG  
1178 S SD  . MET A 152 ? 1.3397 1.0826 1.1016 -0.1256 0.0833  -0.1884 57   MET A SD  
1179 C CE  . MET A 152 ? 1.3369 1.0059 1.0410 -0.1027 0.0760  -0.1817 57   MET A CE  
1180 N N   . LYS A 153 ? 1.2625 1.1853 1.0953 -0.2706 0.0777  -0.2512 58   LYS A N   
1181 C CA  . LYS A 153 ? 1.2422 1.2619 1.1171 -0.2993 0.0827  -0.2592 58   LYS A CA  
1182 C C   . LYS A 153 ? 1.2245 1.3311 1.1519 -0.2634 0.0927  -0.2504 58   LYS A C   
1183 O O   . LYS A 153 ? 1.2014 1.4046 1.1673 -0.2653 0.0923  -0.2578 58   LYS A O   
1184 C CB  . LYS A 153 ? 1.2819 1.3408 1.1618 -0.3154 0.0662  -0.2767 58   LYS A CB  
1185 C CG  . LYS A 153 ? 1.4800 1.4653 1.3044 -0.3668 0.0575  -0.2886 58   LYS A CG  
1186 C CD  . LYS A 153 ? 1.6121 1.6363 1.4391 -0.3831 0.0398  -0.3067 58   LYS A CD  
1187 C CE  . LYS A 153 ? 1.8576 1.8069 1.6224 -0.4429 0.0306  -0.3198 58   LYS A CE  
1188 N NZ  . LYS A 153 ? 2.0004 1.9849 1.7705 -0.5068 0.0425  -0.3202 58   LYS A NZ  
1189 N N   . LEU A 154 ? 1.1482 1.2187 1.0709 -0.2316 0.1016  -0.2350 59   LEU A N   
1190 C CA  . LEU A 154 ? 1.0958 1.2187 1.0492 -0.1951 0.1108  -0.2253 59   LEU A CA  
1191 C C   . LEU A 154 ? 1.1041 1.3032 1.0891 -0.1642 0.1019  -0.2310 59   LEU A C   
1192 O O   . LEU A 154 ? 1.0841 1.3678 1.0995 -0.1572 0.1081  -0.2339 59   LEU A O   
1193 C CB  . LEU A 154 ? 1.0992 1.2678 1.0680 -0.2157 0.1278  -0.2231 59   LEU A CB  
1194 C CG  . LEU A 154 ? 1.1797 1.2784 1.1199 -0.2324 0.1401  -0.2130 59   LEU A CG  
1195 C CD1 . LEU A 154 ? 1.2010 1.3511 1.1538 -0.2680 0.1548  -0.2146 59   LEU A CD1 
1196 C CD2 . LEU A 154 ? 1.1850 1.2470 1.1171 -0.1910 0.1451  -0.1985 59   LEU A CD2 
1197 N N   . LYS A 155 ? 1.0455 1.2173 1.0205 -0.1435 0.0874  -0.2324 60   LYS A N   
1198 C CA  . LYS A 155 ? 1.0140 1.2493 1.0133 -0.1138 0.0779  -0.2375 60   LYS A CA  
1199 C C   . LYS A 155 ? 1.0261 1.2392 1.0197 -0.0663 0.0771  -0.2228 60   LYS A C   
1200 O O   . LYS A 155 ? 1.0035 1.2665 1.0130 -0.0355 0.0730  -0.2234 60   LYS A O   
1201 C CB  . LYS A 155 ? 1.0646 1.2934 1.0552 -0.1275 0.0611  -0.2511 60   LYS A CB  
1202 C CG  . LYS A 155 ? 1.2465 1.5654 1.2680 -0.1145 0.0521  -0.2627 60   LYS A CG  
1203 C CD  . LYS A 155 ? 1.3884 1.7984 1.4395 -0.1438 0.0585  -0.2732 60   LYS A CD  
1204 C CE  . LYS A 155 ? 1.4967 2.0054 1.5785 -0.1263 0.0494  -0.2843 60   LYS A CE  
1205 N NZ  . LYS A 155 ? 1.5789 2.1917 1.6910 -0.1545 0.0558  -0.2935 60   LYS A NZ  
1206 N N   . THR A 156 ? 0.9766 1.1161 0.9439 -0.0621 0.0811  -0.2092 61   THR A N   
1207 C CA  . THR A 156 ? 0.9539 1.0672 0.9093 -0.0273 0.0803  -0.1937 61   THR A CA  
1208 C C   . THR A 156 ? 0.9984 1.0924 0.9451 -0.0224 0.0941  -0.1826 61   THR A C   
1209 O O   . THR A 156 ? 1.0083 1.0970 0.9553 -0.0464 0.1043  -0.1850 61   THR A O   
1210 C CB  . THR A 156 ? 1.0555 1.1098 0.9854 -0.0245 0.0715  -0.1859 61   THR A CB  
1211 O OG1 . THR A 156 ? 1.0716 1.0744 0.9811 -0.0502 0.0764  -0.1854 61   THR A OG1 
1212 C CG2 . THR A 156 ? 1.0421 1.1134 0.9745 -0.0172 0.0568  -0.1948 61   THR A CG2 
1213 N N   . VAL A 157 ? 0.9336 1.0126 0.8668 0.0076  0.0939  -0.1702 62   VAL A N   
1214 C CA  . VAL A 157 ? 0.9282 0.9762 0.8415 0.0174  0.1044  -0.1590 62   VAL A CA  
1215 C C   . VAL A 157 ? 0.9738 0.9585 0.8663 -0.0049 0.1077  -0.1503 62   VAL A C   
1216 O O   . VAL A 157 ? 0.9805 0.9480 0.8650 -0.0141 0.1189  -0.1480 62   VAL A O   
1217 C CB  . VAL A 157 ? 0.9771 1.0094 0.8683 0.0513  0.0999  -0.1478 62   VAL A CB  
1218 C CG1 . VAL A 157 ? 0.9992 0.9855 0.8577 0.0608  0.1088  -0.1369 62   VAL A CG1 
1219 C CG2 . VAL A 157 ? 0.9711 1.0653 0.8783 0.0789  0.0964  -0.1563 62   VAL A CG2 
1220 N N   . ALA A 158 ? 0.9151 0.8711 0.7977 -0.0106 0.0981  -0.1459 63   ALA A N   
1221 C CA  . ALA A 158 ? 0.9120 0.8161 0.7726 -0.0259 0.0991  -0.1377 63   ALA A CA  
1222 C C   . ALA A 158 ? 0.9506 0.8424 0.8122 -0.0525 0.1067  -0.1466 63   ALA A C   
1223 O O   . ALA A 158 ? 0.9652 0.8169 0.8079 -0.0629 0.1136  -0.1398 63   ALA A O   
1224 C CB  . ALA A 158 ? 0.9153 0.8102 0.7666 -0.0194 0.0865  -0.1329 63   ALA A CB  
1225 N N   . SER A 159 ? 0.8796 0.8040 0.7592 -0.0658 0.1051  -0.1616 64   SER A N   
1226 C CA  . SER A 159 ? 0.8863 0.7977 0.7614 -0.0980 0.1113  -0.1707 64   SER A CA  
1227 C C   . SER A 159 ? 0.9181 0.8386 0.7986 -0.1100 0.1272  -0.1685 64   SER A C   
1228 O O   . SER A 159 ? 0.9289 0.8143 0.7927 -0.1345 0.1348  -0.1683 64   SER A O   
1229 C CB  . SER A 159 ? 0.9270 0.8804 0.8195 -0.1129 0.1046  -0.1870 64   SER A CB  
1230 O OG  . SER A 159 ? 1.0663 1.0034 0.9482 -0.1510 0.1102  -0.1952 64   SER A OG  
1231 N N   . VAL A 160 ? 0.8524 0.8175 0.7506 -0.0894 0.1321  -0.1665 65   VAL A N   
1232 C CA  . VAL A 160 ? 0.8539 0.8385 0.7562 -0.0899 0.1469  -0.1643 65   VAL A CA  
1233 C C   . VAL A 160 ? 0.9240 0.8424 0.7959 -0.0864 0.1528  -0.1510 65   VAL A C   
1234 O O   . VAL A 160 ? 0.9309 0.8368 0.7959 -0.1034 0.1647  -0.1497 65   VAL A O   
1235 C CB  . VAL A 160 ? 0.8860 0.9314 0.8049 -0.0579 0.1484  -0.1660 65   VAL A CB  
1236 C CG1 . VAL A 160 ? 0.8892 0.9641 0.8098 -0.0535 0.1640  -0.1651 65   VAL A CG1 
1237 C CG2 . VAL A 160 ? 0.8720 0.9874 0.8205 -0.0588 0.1405  -0.1789 65   VAL A CG2 
1238 N N   . PHE A 161 ? 0.8820 0.7621 0.7350 -0.0673 0.1442  -0.1408 66   PHE A N   
1239 C CA  . PHE A 161 ? 0.8949 0.7183 0.7180 -0.0666 0.1474  -0.1283 66   PHE A CA  
1240 C C   . PHE A 161 ? 0.9441 0.7256 0.7516 -0.0873 0.1464  -0.1261 66   PHE A C   
1241 O O   . PHE A 161 ? 0.9489 0.6925 0.7352 -0.0934 0.1530  -0.1188 66   PHE A O   
1242 C CB  . PHE A 161 ? 0.9192 0.7212 0.7238 -0.0457 0.1380  -0.1173 66   PHE A CB  
1243 C CG  . PHE A 161 ? 0.9507 0.7736 0.7537 -0.0198 0.1385  -0.1174 66   PHE A CG  
1244 C CD1 . PHE A 161 ? 1.0140 0.8225 0.7976 -0.0080 0.1483  -0.1150 66   PHE A CD1 
1245 C CD2 . PHE A 161 ? 0.9735 0.8239 0.7862 -0.0029 0.1287  -0.1192 66   PHE A CD2 
1246 C CE1 . PHE A 161 ? 1.0437 0.8637 0.8146 0.0229  0.1485  -0.1153 66   PHE A CE1 
1247 C CE2 . PHE A 161 ? 1.0188 0.8812 0.8208 0.0259  0.1291  -0.1188 66   PHE A CE2 
1248 C CZ  . PHE A 161 ? 1.0226 0.8673 0.8011 0.0401  0.1389  -0.1169 66   PHE A CZ  
1249 N N   . LEU A 162 ? 0.8997 0.6843 0.7117 -0.0951 0.1380  -0.1328 67   LEU A N   
1250 C CA  . LEU A 162 ? 0.9153 0.6543 0.7022 -0.1079 0.1363  -0.1317 67   LEU A CA  
1251 C C   . LEU A 162 ? 1.0057 0.7298 0.7865 -0.1354 0.1483  -0.1384 67   LEU A C   
1252 O O   . LEU A 162 ? 1.0365 0.7101 0.7866 -0.1450 0.1510  -0.1352 67   LEU A O   
1253 C CB  . LEU A 162 ? 0.9116 0.6508 0.6943 -0.1017 0.1226  -0.1369 67   LEU A CB  
1254 C CG  . LEU A 162 ? 0.9393 0.6847 0.7175 -0.0775 0.1109  -0.1267 67   LEU A CG  
1255 C CD1 . LEU A 162 ? 0.9389 0.6979 0.7183 -0.0681 0.0984  -0.1340 67   LEU A CD1 
1256 C CD2 . LEU A 162 ? 0.9612 0.6712 0.7100 -0.0730 0.1109  -0.1137 67   LEU A CD2 
1257 N N   . LEU A 163 ? 0.9534 0.7250 0.7606 -0.1475 0.1557  -0.1467 68   LEU A N   
1258 C CA  . LEU A 163 ? 0.9727 0.7453 0.7778 -0.1786 0.1684  -0.1515 68   LEU A CA  
1259 C C   . LEU A 163 ? 1.0026 0.7663 0.8015 -0.1746 0.1824  -0.1424 68   LEU A C   
1260 O O   . LEU A 163 ? 1.0291 0.7550 0.8057 -0.1946 0.1916  -0.1396 68   LEU A O   
1261 C CB  . LEU A 163 ? 0.9695 0.8141 0.8076 -0.1946 0.1698  -0.1636 68   LEU A CB  
1262 C CG  . LEU A 163 ? 1.0551 0.9190 0.8947 -0.2340 0.1831  -0.1680 68   LEU A CG  
1263 C CD1 . LEU A 163 ? 1.1060 0.9076 0.9097 -0.2698 0.1798  -0.1725 68   LEU A CD1 
1264 C CD2 . LEU A 163 ? 1.0692 1.0293 0.9484 -0.2426 0.1849  -0.1776 68   LEU A CD2 
1265 N N   . ASN A 164 ? 0.9113 0.7028 0.7228 -0.1476 0.1836  -0.1378 69   ASN A N   
1266 C CA  . ASN A 164 ? 0.9097 0.6891 0.7093 -0.1387 0.1952  -0.1301 69   ASN A CA  
1267 C C   . ASN A 164 ? 0.9591 0.6698 0.7247 -0.1380 0.1937  -0.1198 69   ASN A C   
1268 O O   . ASN A 164 ? 0.9741 0.6625 0.7237 -0.1444 0.2050  -0.1152 69   ASN A O   
1269 C CB  . ASN A 164 ? 0.9088 0.7177 0.7154 -0.1067 0.1942  -0.1282 69   ASN A CB  
1270 C CG  . ASN A 164 ? 1.1374 1.0220 0.9717 -0.1022 0.2022  -0.1365 69   ASN A CG  
1271 O OD1 . ASN A 164 ? 1.0337 0.9380 0.8645 -0.0935 0.2148  -0.1349 69   ASN A OD1 
1272 N ND2 . ASN A 164 ? 0.9654 0.8999 0.8267 -0.1073 0.1952  -0.1457 69   ASN A ND2 
1273 N N   . LEU A 165 ? 0.8958 0.5800 0.6501 -0.1299 0.1802  -0.1159 70   LEU A N   
1274 C CA  . LEU A 165 ? 0.8983 0.5314 0.6214 -0.1281 0.1771  -0.1061 70   LEU A CA  
1275 C C   . LEU A 165 ? 1.0023 0.5990 0.7045 -0.1477 0.1837  -0.1079 70   LEU A C   
1276 O O   . LEU A 165 ? 1.0112 0.5705 0.6872 -0.1485 0.1888  -0.1005 70   LEU A O   
1277 C CB  . LEU A 165 ? 0.8753 0.5068 0.5939 -0.1139 0.1611  -0.1012 70   LEU A CB  
1278 C CG  . LEU A 165 ? 0.9303 0.5281 0.6189 -0.1094 0.1561  -0.0899 70   LEU A CG  
1279 C CD1 . LEU A 165 ? 0.9410 0.5265 0.6162 -0.1066 0.1585  -0.0805 70   LEU A CD1 
1280 C CD2 . LEU A 165 ? 0.9248 0.5367 0.6121 -0.0972 0.1414  -0.0860 70   LEU A CD2 
1281 N N   . ALA A 166 ? 0.9892 0.5923 0.6972 -0.1644 0.1833  -0.1177 71   ALA A N   
1282 C CA  . ALA A 166 ? 1.0386 0.5950 0.7158 -0.1865 0.1891  -0.1198 71   ALA A CA  
1283 C C   . ALA A 166 ? 1.1123 0.6695 0.7886 -0.2066 0.2067  -0.1182 71   ALA A C   
1284 O O   . ALA A 166 ? 1.1326 0.6390 0.7745 -0.2137 0.2137  -0.1126 71   ALA A O   
1285 C CB  . ALA A 166 ? 1.0680 0.6265 0.7453 -0.2037 0.1827  -0.1314 71   ALA A CB  
1286 N N   . LEU A 167 ? 1.0600 0.6784 0.7716 -0.2114 0.2140  -0.1223 72   LEU A N   
1287 C CA  . LEU A 167 ? 1.0764 0.7142 0.7920 -0.2266 0.2313  -0.1204 72   LEU A CA  
1288 C C   . LEU A 167 ? 1.1299 0.7399 0.8279 -0.2063 0.2371  -0.1102 72   LEU A C   
1289 O O   . LEU A 167 ? 1.1397 0.7222 0.8165 -0.2195 0.2493  -0.1054 72   LEU A O   
1290 C CB  . LEU A 167 ? 1.0560 0.7794 0.8131 -0.2269 0.2361  -0.1271 72   LEU A CB  
1291 C CG  . LEU A 167 ? 1.1219 0.8881 0.9000 -0.2524 0.2312  -0.1382 72   LEU A CG  
1292 C CD1 . LEU A 167 ? 1.0924 0.9498 0.9122 -0.2369 0.2313  -0.1440 72   LEU A CD1 
1293 C CD2 . LEU A 167 ? 1.2075 0.9641 0.9702 -0.2989 0.2417  -0.1400 72   LEU A CD2 
1294 N N   . ALA A 168 ? 1.0816 0.6940 0.7834 -0.1770 0.2278  -0.1064 73   ALA A N   
1295 C CA  . ALA A 168 ? 1.0896 0.6715 0.7691 -0.1603 0.2300  -0.0974 73   ALA A CA  
1296 C C   . ALA A 168 ? 1.1677 0.6903 0.8121 -0.1655 0.2281  -0.0905 73   ALA A C   
1297 O O   . ALA A 168 ? 1.1726 0.6687 0.7951 -0.1651 0.2367  -0.0847 73   ALA A O   
1298 C CB  . ALA A 168 ? 1.0777 0.6673 0.7605 -0.1355 0.2180  -0.0949 73   ALA A CB  
1299 N N   . ASP A 169 ? 1.1405 0.6441 0.7761 -0.1670 0.2171  -0.0915 74   ASP A N   
1300 C CA  . ASP A 169 ? 1.1678 0.6202 0.7655 -0.1650 0.2144  -0.0855 74   ASP A CA  
1301 C C   . ASP A 169 ? 1.2626 0.6782 0.8354 -0.1863 0.2279  -0.0866 74   ASP A C   
1302 O O   . ASP A 169 ? 1.2855 0.6617 0.8260 -0.1837 0.2336  -0.0796 74   ASP A O   
1303 C CB  . ASP A 169 ? 1.1883 0.6353 0.7789 -0.1539 0.1989  -0.0866 74   ASP A CB  
1304 C CG  . ASP A 169 ? 1.3114 0.7845 0.9123 -0.1339 0.1850  -0.0808 74   ASP A CG  
1305 O OD1 . ASP A 169 ? 1.2799 0.7759 0.8976 -0.1309 0.1852  -0.0783 74   ASP A OD1 
1306 O OD2 . ASP A 169 ? 1.4151 0.8852 1.0029 -0.1212 0.1737  -0.0785 74   ASP A OD2 
1307 N N   . LEU A 170 ? 1.2254 0.6551 0.8108 -0.2097 0.2328  -0.0948 75   LEU A N   
1308 C CA  . LEU A 170 ? 1.2718 0.6673 0.8311 -0.2394 0.2453  -0.0959 75   LEU A CA  
1309 C C   . LEU A 170 ? 1.3262 0.7311 0.8865 -0.2473 0.2626  -0.0900 75   LEU A C   
1310 O O   . LEU A 170 ? 1.3681 0.7245 0.8911 -0.2615 0.2726  -0.0852 75   LEU A O   
1311 C CB  . LEU A 170 ? 1.2799 0.7063 0.8593 -0.2677 0.2447  -0.1063 75   LEU A CB  
1312 C CG  . LEU A 170 ? 1.4019 0.7770 0.9414 -0.3053 0.2505  -0.1091 75   LEU A CG  
1313 C CD1 . LEU A 170 ? 1.4466 0.7380 0.9297 -0.2929 0.2391  -0.1091 75   LEU A CD1 
1314 C CD2 . LEU A 170 ? 1.4264 0.8514 0.9941 -0.3372 0.2491  -0.1197 75   LEU A CD2 
1315 N N   . CYS A 171 ? 1.2439 0.7057 0.8399 -0.2344 0.2659  -0.0901 76   CYS A N   
1316 C CA  . CYS A 171 ? 1.2444 0.7221 0.8413 -0.2336 0.2814  -0.0852 76   CYS A CA  
1317 C C   . CYS A 171 ? 1.2951 0.7177 0.8549 -0.2185 0.2823  -0.0763 76   CYS A C   
1318 O O   . CYS A 171 ? 1.3201 0.7211 0.8581 -0.2296 0.2963  -0.0713 76   CYS A O   
1319 C CB  . CYS A 171 ? 1.2151 0.7553 0.8467 -0.2131 0.2813  -0.0882 76   CYS A CB  
1320 S SG  . CYS A 171 ? 1.2581 0.8859 0.9328 -0.2315 0.2890  -0.0970 76   CYS A SG  
1321 N N   . PHE A 172 ? 1.2260 0.6318 0.7786 -0.1950 0.2675  -0.0737 77   PHE A N   
1322 C CA  . PHE A 172 ? 1.2368 0.6006 0.7554 -0.1810 0.2651  -0.0655 77   PHE A CA  
1323 C C   . PHE A 172 ? 1.3606 0.6700 0.8387 -0.1902 0.2699  -0.0618 77   PHE A C   
1324 O O   . PHE A 172 ? 1.3932 0.6720 0.8422 -0.1874 0.2781  -0.0554 77   PHE A O   
1325 C CB  . PHE A 172 ? 1.2271 0.5958 0.7477 -0.1614 0.2465  -0.0634 77   PHE A CB  
1326 C CG  . PHE A 172 ? 1.2567 0.5923 0.7421 -0.1500 0.2402  -0.0552 77   PHE A CG  
1327 C CD1 . PHE A 172 ? 1.3023 0.6288 0.7718 -0.1438 0.2419  -0.0499 77   PHE A CD1 
1328 C CD2 . PHE A 172 ? 1.2918 0.6086 0.7567 -0.1430 0.2316  -0.0532 77   PHE A CD2 
1329 C CE1 . PHE A 172 ? 1.3282 0.6344 0.7665 -0.1348 0.2351  -0.0426 77   PHE A CE1 
1330 C CE2 . PHE A 172 ? 1.3431 0.6428 0.7759 -0.1287 0.2257  -0.0453 77   PHE A CE2 
1331 C CZ  . PHE A 172 ? 1.3227 0.6208 0.7448 -0.1267 0.2274  -0.0401 77   PHE A CZ  
1332 N N   . LEU A 173 ? 1.3425 0.6343 0.8123 -0.1992 0.2644  -0.0660 78   LEU A N   
1333 C CA  . LEU A 173 ? 1.3993 0.6258 0.8180 -0.2047 0.2672  -0.0633 78   LEU A CA  
1334 C C   . LEU A 173 ? 1.4864 0.6866 0.8842 -0.2310 0.2864  -0.0605 78   LEU A C   
1335 O O   . LEU A 173 ? 1.5352 0.6760 0.8829 -0.2280 0.2917  -0.0542 78   LEU A O   
1336 C CB  . LEU A 173 ? 1.4187 0.6283 0.8288 -0.2110 0.2573  -0.0705 78   LEU A CB  
1337 C CG  . LEU A 173 ? 1.4433 0.6746 0.8655 -0.1836 0.2385  -0.0721 78   LEU A CG  
1338 C CD1 . LEU A 173 ? 1.4564 0.6833 0.8798 -0.1928 0.2303  -0.0814 78   LEU A CD1 
1339 C CD2 . LEU A 173 ? 1.4942 0.6935 0.8748 -0.1531 0.2311  -0.0642 78   LEU A CD2 
1340 N N   . LEU A 174 ? 1.4185 0.6674 0.8525 -0.2544 0.2971  -0.0641 79   LEU A N   
1341 C CA  . LEU A 174 ? 1.4524 0.6936 0.8724 -0.2833 0.3167  -0.0602 79   LEU A CA  
1342 C C   . LEU A 174 ? 1.4981 0.7276 0.9018 -0.2668 0.3267  -0.0515 79   LEU A C   
1343 O O   . LEU A 174 ? 1.5411 0.7407 0.9147 -0.2850 0.3420  -0.0454 79   LEU A O   
1344 C CB  . LEU A 174 ? 1.4280 0.7466 0.8963 -0.3079 0.3249  -0.0658 79   LEU A CB  
1345 C CG  . LEU A 174 ? 1.4813 0.8226 0.9691 -0.3296 0.3157  -0.0754 79   LEU A CG  
1346 C CD1 . LEU A 174 ? 1.4541 0.8893 0.9934 -0.3467 0.3235  -0.0802 79   LEU A CD1 
1347 C CD2 . LEU A 174 ? 1.5782 0.8472 1.0143 -0.3633 0.3168  -0.0756 79   LEU A CD2 
1348 N N   . THR A 175 ? 1.4103 0.6586 0.8285 -0.2348 0.3176  -0.0506 80   THR A N   
1349 C CA  . THR A 175 ? 1.4167 0.6516 0.8160 -0.2180 0.3238  -0.0437 80   THR A CA  
1350 C C   . THR A 175 ? 1.4902 0.6693 0.8453 -0.1990 0.3149  -0.0381 80   THR A C   
1351 O O   . THR A 175 ? 1.5166 0.6733 0.8449 -0.1893 0.3211  -0.0318 80   THR A O   
1352 C CB  . THR A 175 ? 1.5062 0.7878 0.9364 -0.1975 0.3187  -0.0462 80   THR A CB  
1353 O OG1 . THR A 175 ? 1.4594 0.7472 0.9007 -0.1811 0.2990  -0.0488 80   THR A OG1 
1354 C CG2 . THR A 175 ? 1.4866 0.8288 0.9543 -0.2061 0.3289  -0.0511 80   THR A CG2 
1355 N N   . LEU A 176 ? 1.4359 0.5982 0.7820 -0.1911 0.3005  -0.0402 81   LEU A N   
1356 C CA  . LEU A 176 ? 1.4555 0.5800 0.7610 -0.1670 0.2902  -0.0352 81   LEU A CA  
1357 C C   . LEU A 176 ? 1.5882 0.6475 0.8345 -0.1667 0.3023  -0.0280 81   LEU A C   
1358 O O   . LEU A 176 ? 1.5954 0.6448 0.8171 -0.1440 0.2985  -0.0221 81   LEU A O   
1359 C CB  . LEU A 176 ? 1.4556 0.5743 0.7575 -0.1588 0.2756  -0.0394 81   LEU A CB  
1360 C CG  . LEU A 176 ? 1.5285 0.6320 0.7962 -0.1265 0.2620  -0.0346 81   LEU A CG  
1361 C CD1 . LEU A 176 ? 1.4846 0.6393 0.7765 -0.1113 0.2514  -0.0308 81   LEU A CD1 
1362 C CD2 . LEU A 176 ? 1.5700 0.6710 0.8345 -0.1177 0.2495  -0.0396 81   LEU A CD2 
1363 N N   . PRO A 177 ? 1.5991 0.6138 0.8175 -0.1921 0.3162  -0.0274 82   PRO A N   
1364 C CA  . PRO A 177 ? 1.6623 0.6067 0.8157 -0.1893 0.3272  -0.0191 82   PRO A CA  
1365 C C   . PRO A 177 ? 1.6978 0.6549 0.8521 -0.1860 0.3394  -0.0126 82   PRO A C   
1366 O O   . PRO A 177 ? 1.7430 0.6499 0.8448 -0.1727 0.3450  -0.0052 82   PRO A O   
1367 C CB  . PRO A 177 ? 1.7448 0.6451 0.8733 -0.2276 0.3391  -0.0200 82   PRO A CB  
1368 C CG  . PRO A 177 ? 1.7723 0.7085 0.9409 -0.2407 0.3284  -0.0299 82   PRO A CG  
1369 C CD  . PRO A 177 ? 1.6303 0.6529 0.8678 -0.2266 0.3215  -0.0336 82   PRO A CD  
1370 N N   . LEU A 178 ? 1.5919 0.6126 0.7994 -0.1941 0.3433  -0.0157 83   LEU A N   
1371 C CA  . LEU A 178 ? 1.5782 0.6133 0.7862 -0.1873 0.3533  -0.0112 83   LEU A CA  
1372 C C   . LEU A 178 ? 1.6109 0.6457 0.8054 -0.1554 0.3393  -0.0091 83   LEU A C   
1373 O O   . LEU A 178 ? 1.6341 0.6454 0.7959 -0.1446 0.3457  -0.0031 83   LEU A O   
1374 C CB  . LEU A 178 ? 1.5342 0.6344 0.7947 -0.1976 0.3594  -0.0160 83   LEU A CB  
1375 C CG  . LEU A 178 ? 1.6161 0.7362 0.8882 -0.2291 0.3794  -0.0150 83   LEU A CG  
1376 C CD1 . LEU A 178 ? 1.6253 0.7477 0.9096 -0.2570 0.3772  -0.0196 83   LEU A CD1 
1377 C CD2 . LEU A 178 ? 1.6121 0.8004 0.9261 -0.2237 0.3853  -0.0185 83   LEU A CD2 
1378 N N   . TRP A 179 ? 1.5262 0.5907 0.7444 -0.1425 0.3199  -0.0135 84   TRP A N   
1379 C CA  . TRP A 179 ? 1.5071 0.5852 0.7164 -0.1190 0.3038  -0.0113 84   TRP A CA  
1380 C C   . TRP A 179 ? 1.5864 0.6297 0.7482 -0.0985 0.2977  -0.0060 84   TRP A C   
1381 O O   . TRP A 179 ? 1.5713 0.6261 0.7149 -0.0788 0.2878  -0.0020 84   TRP A O   
1382 C CB  . TRP A 179 ? 1.4398 0.5674 0.6913 -0.1178 0.2864  -0.0166 84   TRP A CB  
1383 C CG  . TRP A 179 ? 1.4252 0.5827 0.7125 -0.1287 0.2902  -0.0216 84   TRP A CG  
1384 C CD1 . TRP A 179 ? 1.4362 0.6216 0.7622 -0.1401 0.2917  -0.0279 84   TRP A CD1 
1385 C CD2 . TRP A 179 ? 1.4292 0.5874 0.7089 -0.1254 0.2943  -0.0209 84   TRP A CD2 
1386 N NE1 . TRP A 179 ? 1.4190 0.6251 0.7611 -0.1399 0.2963  -0.0308 84   TRP A NE1 
1387 C CE2 . TRP A 179 ? 1.4605 0.6460 0.7723 -0.1309 0.2980  -0.0268 84   TRP A CE2 
1388 C CE3 . TRP A 179 ? 1.4680 0.6057 0.7128 -0.1159 0.2945  -0.0164 84   TRP A CE3 
1389 C CZ2 . TRP A 179 ? 1.4595 0.6459 0.7639 -0.1240 0.3020  -0.0284 84   TRP A CZ2 
1390 C CZ3 . TRP A 179 ? 1.4906 0.6285 0.7307 -0.1136 0.2979  -0.0184 84   TRP A CZ3 
1391 C CH2 . TRP A 179 ? 1.4829 0.6417 0.7499 -0.1161 0.3017  -0.0243 84   TRP A CH2 
1392 N N   . ALA A 180 ? 1.5914 0.5913 0.7274 -0.1024 0.3034  -0.0059 85   ALA A N   
1393 C CA  . ALA A 180 ? 1.6417 0.5951 0.7192 -0.0771 0.2992  -0.0012 85   ALA A CA  
1394 C C   . ALA A 180 ? 1.7321 0.6353 0.7559 -0.0690 0.3126  0.0067  85   ALA A C   
1395 O O   . ALA A 180 ? 1.7489 0.6443 0.7338 -0.0376 0.3056  0.0118  85   ALA A O   
1396 C CB  . ALA A 180 ? 1.6890 0.5982 0.7463 -0.0855 0.3002  -0.0048 85   ALA A CB  
1397 N N   . VAL A 181 ? 1.7052 0.5817 0.7265 -0.0959 0.3319  0.0083  86   VAL A N   
1398 C CA  . VAL A 181 ? 1.7633 0.5904 0.7326 -0.0911 0.3468  0.0167  86   VAL A CA  
1399 C C   . VAL A 181 ? 1.7704 0.6403 0.7567 -0.0783 0.3445  0.0183  86   VAL A C   
1400 O O   . VAL A 181 ? 1.8001 0.6434 0.7405 -0.0567 0.3466  0.0247  86   VAL A O   
1401 C CB  . VAL A 181 ? 1.8618 0.6472 0.8162 -0.1268 0.3691  0.0199  86   VAL A CB  
1402 C CG1 . VAL A 181 ? 1.9248 0.6427 0.8355 -0.1405 0.3709  0.0198  86   VAL A CG1 
1403 C CG2 . VAL A 181 ? 1.8044 0.6528 0.8257 -0.1564 0.3764  0.0148  86   VAL A CG2 
1404 N N   . TYR A 182 ? 1.6620 0.5925 0.7069 -0.0899 0.3393  0.0122  87   TYR A N   
1405 C CA  . TYR A 182 ? 1.6351 0.5992 0.6912 -0.0809 0.3341  0.0120  87   TYR A CA  
1406 C C   . TYR A 182 ? 1.6956 0.6690 0.7241 -0.0529 0.3171  0.0151  87   TYR A C   
1407 O O   . TYR A 182 ? 1.7200 0.6833 0.7166 -0.0397 0.3192  0.0195  87   TYR A O   
1408 C CB  . TYR A 182 ? 1.5961 0.6122 0.7089 -0.0943 0.3267  0.0042  87   TYR A CB  
1409 C CG  . TYR A 182 ? 1.6055 0.6469 0.7220 -0.0868 0.3165  0.0025  87   TYR A CG  
1410 C CD1 . TYR A 182 ? 1.6546 0.6843 0.7566 -0.0865 0.3283  0.0034  87   TYR A CD1 
1411 C CD2 . TYR A 182 ? 1.5785 0.6544 0.7109 -0.0832 0.2949  -0.0002 87   TYR A CD2 
1412 C CE1 . TYR A 182 ? 1.6637 0.7054 0.7597 -0.0810 0.3175  0.0006  87   TYR A CE1 
1413 C CE2 . TYR A 182 ? 1.5803 0.6700 0.7074 -0.0832 0.2842  -0.0019 87   TYR A CE2 
1414 C CZ  . TYR A 182 ? 1.7195 0.7876 0.8260 -0.0816 0.2950  -0.0021 87   TYR A CZ  
1415 O OH  . TYR A 182 ? 1.7592 0.8298 0.8510 -0.0825 0.2831  -0.0048 87   TYR A OH  
1416 N N   . THR A 183 ? 1.6331 0.6279 0.6701 -0.0427 0.3013  0.0135  88   THR A N   
1417 C CA  . THR A 183 ? 1.6301 0.6512 0.6447 -0.0151 0.2843  0.0171  88   THR A CA  
1418 C C   . THR A 183 ? 1.7378 0.7071 0.6855 0.0132  0.2916  0.0242  88   THR A C   
1419 O O   . THR A 183 ? 1.7423 0.7296 0.6611 0.0370  0.2844  0.0288  88   THR A O   
1420 C CB  . THR A 183 ? 1.7109 0.7712 0.7536 -0.0117 0.2684  0.0139  88   THR A CB  
1421 O OG1 . THR A 183 ? 1.6666 0.7592 0.7650 -0.0383 0.2650  0.0075  88   THR A OG1 
1422 C CG2 . THR A 183 ? 1.6929 0.8070 0.7241 0.0129  0.2492  0.0181  88   THR A CG2 
1423 N N   . ALA A 184 ? 1.7441 0.6475 0.6624 0.0096  0.3053  0.0253  89   ALA A N   
1424 C CA  . ALA A 184 ? 1.8261 0.6587 0.6679 0.0355  0.3134  0.0322  89   ALA A CA  
1425 C C   . ALA A 184 ? 1.9415 0.7414 0.7482 0.0371  0.3281  0.0386  89   ALA A C   
1426 O O   . ALA A 184 ? 2.0059 0.7632 0.7467 0.0684  0.3308  0.0454  89   ALA A O   
1427 C CB  . ALA A 184 ? 1.8801 0.6424 0.6973 0.0197  0.3236  0.0309  89   ALA A CB  
1428 N N   . MET A 185 ? 1.8710 0.6905 0.7176 0.0076  0.3377  0.0364  90   MET A N   
1429 C CA  . MET A 185 ? 1.8988 0.6949 0.7187 0.0073  0.3522  0.0418  90   MET A CA  
1430 C C   . MET A 185 ? 1.8912 0.7436 0.7242 0.0218  0.3390  0.0405  90   MET A C   
1431 O O   . MET A 185 ? 1.8902 0.7351 0.7115 0.0196  0.3484  0.0427  90   MET A O   
1432 C CB  . MET A 185 ? 1.9237 0.7119 0.7736 -0.0301 0.3709  0.0406  90   MET A CB  
1433 C CG  . MET A 185 ? 2.0230 0.7525 0.8497 -0.0522 0.3858  0.0436  90   MET A CG  
1434 S SD  . MET A 185 ? 2.0705 0.8146 0.9363 -0.0977 0.4080  0.0435  90   MET A SD  
1435 C CE  . MET A 185 ? 2.0802 0.7917 0.8971 -0.0885 0.4264  0.0539  90   MET A CE  
1436 N N   . GLU A 186 ? 1.7990 0.7077 0.6519 0.0351  0.3170  0.0373  91   GLU A N   
1437 C CA  . GLU A 186 ? 1.7596 0.7294 0.6233 0.0426  0.2996  0.0359  91   GLU A CA  
1438 C C   . GLU A 186 ? 1.7452 0.7373 0.6528 0.0122  0.2996  0.0294  91   GLU A C   
1439 O O   . GLU A 186 ? 1.7509 0.7412 0.6439 0.0116  0.3017  0.0294  91   GLU A O   
1440 C CB  . GLU A 186 ? 1.8268 0.7844 0.6335 0.0722  0.3009  0.0426  91   GLU A CB  
1441 C CG  . GLU A 186 ? 2.0140 0.9515 0.7683 0.1113  0.2987  0.0490  91   GLU A CG  
1442 C CD  . GLU A 186 ? 2.3557 1.2780 1.0463 0.1475  0.3009  0.0562  91   GLU A CD  
1443 O OE1 . GLU A 186 ? 2.2927 1.2096 0.9754 0.1405  0.3073  0.0568  91   GLU A OE1 
1444 O OE2 . GLU A 186 ? 2.3139 1.2272 0.9576 0.1868  0.2965  0.0611  91   GLU A OE2 
1445 N N   . TYR A 187 ? 1.6468 0.6575 0.6031 -0.0095 0.2963  0.0235  92   TYR A N   
1446 C CA  . TYR A 187 ? 1.6016 0.6294 0.5975 -0.0336 0.2955  0.0166  92   TYR A CA  
1447 C C   . TYR A 187 ? 1.6866 0.6786 0.6700 -0.0393 0.3164  0.0169  92   TYR A C   
1448 O O   . TYR A 187 ? 1.6754 0.6705 0.6500 -0.0401 0.3142  0.0146  92   TYR A O   
1449 C CB  . TYR A 187 ? 1.5768 0.6482 0.5803 -0.0391 0.2734  0.0135  92   TYR A CB  
1450 C CG  . TYR A 187 ? 1.5453 0.6655 0.5659 -0.0375 0.2533  0.0144  92   TYR A CG  
1451 C CD1 . TYR A 187 ? 1.5225 0.6608 0.5840 -0.0507 0.2484  0.0106  92   TYR A CD1 
1452 C CD2 . TYR A 187 ? 1.5602 0.7172 0.5561 -0.0222 0.2389  0.0194  92   TYR A CD2 
1453 C CE1 . TYR A 187 ? 1.4845 0.6716 0.5610 -0.0485 0.2307  0.0124  92   TYR A CE1 
1454 C CE2 . TYR A 187 ? 1.5399 0.7542 0.5519 -0.0200 0.2210  0.0214  92   TYR A CE2 
1455 C CZ  . TYR A 187 ? 1.5543 0.7815 0.6062 -0.0333 0.2173  0.0181  92   TYR A CZ  
1456 O OH  . TYR A 187 ? 1.5060 0.7935 0.5729 -0.0302 0.2003  0.0211  92   TYR A OH  
1457 N N   . ARG A 188 ? 1.6853 0.6431 0.6637 -0.0445 0.3365  0.0203  93   ARG A N   
1458 C CA  . ARG A 188 ? 1.7155 0.6489 0.6851 -0.0529 0.3589  0.0226  93   ARG A CA  
1459 C C   . ARG A 188 ? 1.7595 0.7007 0.7664 -0.0758 0.3711  0.0201  93   ARG A C   
1460 O O   . ARG A 188 ? 1.7677 0.6931 0.7750 -0.0840 0.3732  0.0217  93   ARG A O   
1461 C CB  . ARG A 188 ? 1.7769 0.6618 0.6916 -0.0408 0.3735  0.0321  93   ARG A CB  
1462 C CG  . ARG A 188 ? 1.9454 0.8289 0.8224 -0.0176 0.3651  0.0344  93   ARG A CG  
1463 C CD  . ARG A 188 ? 2.2004 1.0353 1.0257 -0.0078 0.3847  0.0435  93   ARG A CD  
1464 N NE  . ARG A 188 ? 2.3924 1.2242 1.2278 -0.0229 0.4042  0.0441  93   ARG A NE  
1465 C CZ  . ARG A 188 ? 2.6739 1.4702 1.4711 -0.0206 0.4246  0.0526  93   ARG A CZ  
1466 N NH1 . ARG A 188 ? 2.5896 1.3404 1.3312 -0.0032 0.4283  0.0612  93   ARG A NH1 
1467 N NH2 . ARG A 188 ? 2.5338 1.3413 1.3444 -0.0330 0.4418  0.0532  93   ARG A NH2 
1468 N N   . TRP A 189 ? 1.6966 0.6620 0.7294 -0.0841 0.3786  0.0159  94   TRP A N   
1469 C CA  . TRP A 189 ? 1.6684 0.6593 0.7416 -0.1036 0.3877  0.0127  94   TRP A CA  
1470 C C   . TRP A 189 ? 1.7344 0.7273 0.8052 -0.1167 0.4130  0.0175  94   TRP A C   
1471 O O   . TRP A 189 ? 1.7266 0.7365 0.7968 -0.1083 0.4209  0.0166  94   TRP A O   
1472 C CB  . TRP A 189 ? 1.6098 0.6397 0.7170 -0.0994 0.3763  0.0037  94   TRP A CB  
1473 C CG  . TRP A 189 ? 1.5975 0.6645 0.7455 -0.1121 0.3848  -0.0005 94   TRP A CG  
1474 C CD1 . TRP A 189 ? 1.6398 0.7321 0.7966 -0.1109 0.4006  -0.0011 94   TRP A CD1 
1475 C CD2 . TRP A 189 ? 1.5642 0.6557 0.7499 -0.1247 0.3773  -0.0050 94   TRP A CD2 
1476 N NE1 . TRP A 189 ? 1.6076 0.7439 0.8064 -0.1221 0.4037  -0.0055 94   TRP A NE1 
1477 C CE2 . TRP A 189 ? 1.6029 0.7367 0.8203 -0.1320 0.3892  -0.0083 94   TRP A CE2 
1478 C CE3 . TRP A 189 ? 1.5609 0.6469 0.7554 -0.1281 0.3617  -0.0065 94   TRP A CE3 
1479 C CZ2 . TRP A 189 ? 1.5619 0.7313 0.8200 -0.1445 0.3854  -0.0134 94   TRP A CZ2 
1480 C CZ3 . TRP A 189 ? 1.5511 0.6667 0.7843 -0.1405 0.3583  -0.0116 94   TRP A CZ3 
1481 C CH2 . TRP A 189 ? 1.5466 0.7028 0.8117 -0.1496 0.3697  -0.0153 94   TRP A CH2 
1482 N N   . PRO A 190 ? 1.7144 0.6874 0.7770 -0.1382 0.4258  0.0232  95   PRO A N   
1483 C CA  . PRO A 190 ? 1.7495 0.7217 0.8001 -0.1570 0.4513  0.0311  95   PRO A CA  
1484 C C   . PRO A 190 ? 1.7826 0.8156 0.8801 -0.1804 0.4627  0.0283  95   PRO A C   
1485 O O   . PRO A 190 ? 1.8088 0.8554 0.8999 -0.2000 0.4842  0.0358  95   PRO A O   
1486 C CB  . PRO A 190 ? 1.8263 0.7343 0.8312 -0.1722 0.4575  0.0396  95   PRO A CB  
1487 C CG  . PRO A 190 ? 1.8586 0.7554 0.8732 -0.1681 0.4371  0.0332  95   PRO A CG  
1488 C CD  . PRO A 190 ? 1.7503 0.6816 0.7903 -0.1404 0.4168  0.0253  95   PRO A CD  
1489 N N   . PHE A 191 ? 1.6933 0.7666 0.8356 -0.1788 0.4485  0.0185  96   PHE A N   
1490 C CA  . PHE A 191 ? 1.6666 0.8032 0.8543 -0.1996 0.4569  0.0151  96   PHE A CA  
1491 C C   . PHE A 191 ? 1.6849 0.8828 0.8973 -0.1797 0.4628  0.0111  96   PHE A C   
1492 O O   . PHE A 191 ? 1.6555 0.9162 0.9086 -0.1855 0.4651  0.0061  96   PHE A O   
1493 C CB  . PHE A 191 ? 1.6538 0.8017 0.8738 -0.2071 0.4393  0.0068  96   PHE A CB  
1494 C CG  . PHE A 191 ? 1.6981 0.7817 0.8872 -0.2124 0.4284  0.0087  96   PHE A CG  
1495 C CD1 . PHE A 191 ? 1.7644 0.8272 0.9458 -0.2441 0.4329  0.0105  96   PHE A CD1 
1496 C CD2 . PHE A 191 ? 1.7221 0.7674 0.8849 -0.1847 0.4130  0.0086  96   PHE A CD2 
1497 C CE1 . PHE A 191 ? 1.8027 0.7989 0.9453 -0.2420 0.4226  0.0118  96   PHE A CE1 
1498 C CE2 . PHE A 191 ? 1.7807 0.7744 0.9116 -0.1820 0.4032  0.0106  96   PHE A CE2 
1499 C CZ  . PHE A 191 ? 1.7877 0.7526 0.9058 -0.2076 0.4082  0.0120  96   PHE A CZ  
1500 N N   . GLY A 192 ? 1.6437 0.8225 0.8265 -0.1535 0.4650  0.0129  97   GLY A N   
1501 C CA  . GLY A 192 ? 1.6355 0.8594 0.8264 -0.1284 0.4711  0.0092  97   GLY A CA  
1502 C C   . GLY A 192 ? 1.6634 0.8971 0.8694 -0.1026 0.4511  -0.0023 97   GLY A C   
1503 O O   . GLY A 192 ? 1.6478 0.8465 0.8518 -0.1011 0.4303  -0.0067 97   GLY A O   
1504 N N   . ASN A 193 ? 1.6105 0.8929 0.8269 -0.0808 0.4579  -0.0065 98   ASN A N   
1505 C CA  . ASN A 193 ? 1.5871 0.8709 0.8040 -0.0514 0.4414  -0.0169 98   ASN A CA  
1506 C C   . ASN A 193 ? 1.5820 0.9176 0.8463 -0.0592 0.4361  -0.0225 98   ASN A C   
1507 O O   . ASN A 193 ? 1.5523 0.8659 0.8181 -0.0494 0.4160  -0.0294 98   ASN A O   
1508 C CB  . ASN A 193 ? 1.6321 0.9327 0.8217 -0.0149 0.4518  -0.0187 98   ASN A CB  
1509 C CG  . ASN A 193 ? 1.9062 1.1712 1.0658 0.0197  0.4333  -0.0286 98   ASN A CG  
1510 O OD1 . ASN A 193 ? 1.8272 1.0386 0.9732 0.0145  0.4112  -0.0326 98   ASN A OD1 
1511 N ND2 . ASN A 193 ? 1.8101 1.0998 0.9496 0.0565  0.4420  -0.0320 98   ASN A ND2 
1512 N N   . TYR A 194 ? 1.5312 0.9374 0.8315 -0.0782 0.4534  -0.0191 99   TYR A N   
1513 C CA  . TYR A 194 ? 1.4984 0.9651 0.8451 -0.0867 0.4497  -0.0246 99   TYR A CA  
1514 C C   . TYR A 194 ? 1.5111 0.9419 0.8739 -0.1098 0.4312  -0.0275 99   TYR A C   
1515 O O   . TYR A 194 ? 1.4807 0.9191 0.8600 -0.0971 0.4158  -0.0351 99   TYR A O   
1516 C CB  . TYR A 194 ? 1.5235 1.0746 0.9027 -0.1135 0.4716  -0.0190 99   TYR A CB  
1517 C CG  . TYR A 194 ? 1.5713 1.2049 0.9573 -0.0830 0.4866  -0.0196 99   TYR A CG  
1518 C CD1 . TYR A 194 ? 1.5774 1.2801 0.9938 -0.0626 0.4824  -0.0272 99   TYR A CD1 
1519 C CD2 . TYR A 194 ? 1.6177 1.2668 0.9784 -0.0721 0.5059  -0.0120 99   TYR A CD2 
1520 C CE1 . TYR A 194 ? 1.6015 1.3877 1.0202 -0.0276 0.4965  -0.0275 99   TYR A CE1 
1521 C CE2 . TYR A 194 ? 1.6407 1.3739 1.0051 -0.0388 0.5204  -0.0120 99   TYR A CE2 
1522 C CZ  . TYR A 194 ? 1.7063 1.5093 1.0989 -0.0150 0.5156  -0.0199 99   TYR A CZ  
1523 O OH  . TYR A 194 ? 1.7280 1.6196 1.1198 0.0249  0.5300  -0.0198 99   TYR A OH  
1524 N N   . LEU A 195 ? 1.4691 0.8579 0.8214 -0.1402 0.4327  -0.0213 100  LEU A N   
1525 C CA  . LEU A 195 ? 1.4389 0.7928 0.7996 -0.1579 0.4161  -0.0236 100  LEU A CA  
1526 C C   . LEU A 195 ? 1.4694 0.7690 0.8071 -0.1358 0.3949  -0.0266 100  LEU A C   
1527 O O   . LEU A 195 ? 1.4430 0.7343 0.7953 -0.1399 0.3782  -0.0305 100  LEU A O   
1528 C CB  . LEU A 195 ? 1.4671 0.7854 0.8110 -0.1916 0.4244  -0.0160 100  LEU A CB  
1529 C CG  . LEU A 195 ? 1.5361 0.9022 0.9016 -0.2286 0.4411  -0.0130 100  LEU A CG  
1530 C CD1 . LEU A 195 ? 1.5846 0.8910 0.9153 -0.2609 0.4476  -0.0050 100  LEU A CD1 
1531 C CD2 . LEU A 195 ? 1.5229 0.9402 0.9333 -0.2391 0.4316  -0.0215 100  LEU A CD2 
1532 N N   . CYS A 196 ? 1.4461 0.7135 0.7474 -0.1141 0.3947  -0.0249 101  CYS A N   
1533 C CA  . CYS A 196 ? 1.4446 0.6668 0.7208 -0.0985 0.3738  -0.0276 101  CYS A CA  
1534 C C   . CYS A 196 ? 1.4700 0.7106 0.7625 -0.0843 0.3597  -0.0355 101  CYS A C   
1535 O O   . CYS A 196 ? 1.4481 0.6690 0.7406 -0.0869 0.3403  -0.0375 101  CYS A O   
1536 C CB  . CYS A 196 ? 1.4903 0.6761 0.7207 -0.0813 0.3769  -0.0251 101  CYS A CB  
1537 S SG  . CYS A 196 ? 1.5524 0.6887 0.7463 -0.0683 0.3501  -0.0290 101  CYS A SG  
1538 N N   . LYS A 197 ? 1.4232 0.7062 0.7287 -0.0690 0.3702  -0.0393 102  LYS A N   
1539 C CA  . LYS A 197 ? 1.4074 0.7073 0.7219 -0.0496 0.3595  -0.0466 102  LYS A CA  
1540 C C   . LYS A 197 ? 1.4222 0.7597 0.7837 -0.0673 0.3531  -0.0492 102  LYS A C   
1541 O O   . LYS A 197 ? 1.4027 0.7199 0.7648 -0.0663 0.3344  -0.0520 102  LYS A O   
1542 C CB  . LYS A 197 ? 1.4471 0.7871 0.7557 -0.0206 0.3745  -0.0493 102  LYS A CB  
1543 C CG  . LYS A 197 ? 1.5149 0.8125 0.7697 0.0035  0.3788  -0.0483 102  LYS A CG  
1544 C CD  . LYS A 197 ? 1.5800 0.9242 0.8265 0.0371  0.3955  -0.0503 102  LYS A CD  
1545 C CE  . LYS A 197 ? 1.7296 1.0194 0.9129 0.0668  0.3960  -0.0511 102  LYS A CE  
1546 N NZ  . LYS A 197 ? 1.8519 1.0623 0.9857 0.0819  0.3723  -0.0574 102  LYS A NZ  
1547 N N   . ILE A 198 ? 1.3674 0.7586 0.7650 -0.0865 0.3681  -0.0478 103  ILE A N   
1548 C CA  . ILE A 198 ? 1.3369 0.7678 0.7776 -0.1058 0.3637  -0.0512 103  ILE A CA  
1549 C C   . ILE A 198 ? 1.3666 0.7521 0.8053 -0.1230 0.3472  -0.0500 103  ILE A C   
1550 O O   . ILE A 198 ? 1.3285 0.7213 0.7849 -0.1203 0.3323  -0.0543 103  ILE A O   
1551 C CB  . ILE A 198 ? 1.3830 0.8718 0.8516 -0.1323 0.3833  -0.0488 103  ILE A CB  
1552 C CG1 . ILE A 198 ? 1.4077 0.9601 0.8805 -0.1124 0.4008  -0.0488 103  ILE A CG1 
1553 C CG2 . ILE A 198 ? 1.3672 0.8937 0.8758 -0.1545 0.3767  -0.0536 103  ILE A CG2 
1554 C CD1 . ILE A 198 ? 1.5579 1.1658 1.0458 -0.1428 0.4238  -0.0425 103  ILE A CD1 
1555 N N   . ALA A 199 ? 1.3524 0.6939 0.7664 -0.1367 0.3499  -0.0437 104  ALA A N   
1556 C CA  . ALA A 199 ? 1.3529 0.6567 0.7589 -0.1463 0.3353  -0.0419 104  ALA A CA  
1557 C C   . ALA A 199 ? 1.4052 0.6898 0.8005 -0.1298 0.3146  -0.0434 104  ALA A C   
1558 O O   . ALA A 199 ? 1.3884 0.6760 0.7976 -0.1340 0.3004  -0.0447 104  ALA A O   
1559 C CB  . ALA A 199 ? 1.3963 0.6555 0.7678 -0.1548 0.3426  -0.0346 104  ALA A CB  
1560 N N   . SER A 200 ? 1.3833 0.6482 0.7508 -0.1130 0.3126  -0.0430 105  SER A N   
1561 C CA  . SER A 200 ? 1.3858 0.6271 0.7343 -0.1045 0.2927  -0.0437 105  SER A CA  
1562 C C   . SER A 200 ? 1.4386 0.7029 0.8077 -0.0966 0.2840  -0.0493 105  SER A C   
1563 O O   . SER A 200 ? 1.4174 0.6748 0.7867 -0.1006 0.2664  -0.0487 105  SER A O   
1564 C CB  . SER A 200 ? 1.4677 0.6719 0.7712 -0.0919 0.2927  -0.0426 105  SER A CB  
1565 O OG  . SER A 200 ? 1.5817 0.7648 0.8639 -0.0973 0.2993  -0.0372 105  SER A OG  
1566 N N   . ALA A 201 ? 1.4093 0.7060 0.7943 -0.0844 0.2965  -0.0539 106  ALA A N   
1567 C CA  . ALA A 201 ? 1.3944 0.7162 0.7959 -0.0712 0.2900  -0.0594 106  ALA A CA  
1568 C C   . ALA A 201 ? 1.3971 0.7528 0.8415 -0.0873 0.2836  -0.0609 106  ALA A C   
1569 O O   . ALA A 201 ? 1.3922 0.7502 0.8423 -0.0814 0.2700  -0.0630 106  ALA A O   
1570 C CB  . ALA A 201 ? 1.4168 0.7777 0.8245 -0.0502 0.3063  -0.0634 106  ALA A CB  
1571 N N   . SER A 202 ? 1.3218 0.6961 0.7891 -0.1077 0.2926  -0.0596 107  SER A N   
1572 C CA  . SER A 202 ? 1.2873 0.6847 0.7869 -0.1238 0.2866  -0.0618 107  SER A CA  
1573 C C   . SER A 202 ? 1.3235 0.6928 0.8132 -0.1262 0.2675  -0.0585 107  SER A C   
1574 O O   . SER A 202 ? 1.2888 0.6785 0.8017 -0.1287 0.2574  -0.0613 107  SER A O   
1575 C CB  . SER A 202 ? 1.3393 0.7422 0.8464 -0.1466 0.3003  -0.0604 107  SER A CB  
1576 O OG  . SER A 202 ? 1.4530 0.8670 0.9813 -0.1616 0.2932  -0.0636 107  SER A OG  
1577 N N   . VAL A 203 ? 1.2908 0.6209 0.7465 -0.1251 0.2626  -0.0525 108  VAL A N   
1578 C CA  . VAL A 203 ? 1.2743 0.5903 0.7177 -0.1273 0.2448  -0.0478 108  VAL A CA  
1579 C C   . VAL A 203 ? 1.3083 0.6251 0.7472 -0.1213 0.2303  -0.0481 108  VAL A C   
1580 O O   . VAL A 203 ? 1.2811 0.6124 0.7311 -0.1249 0.2164  -0.0464 108  VAL A O   
1581 C CB  . VAL A 203 ? 1.3435 0.6276 0.7510 -0.1284 0.2449  -0.0412 108  VAL A CB  
1582 C CG1 . VAL A 203 ? 1.3310 0.6167 0.7255 -0.1301 0.2259  -0.0355 108  VAL A CG1 
1583 C CG2 . VAL A 203 ? 1.3542 0.6274 0.7576 -0.1334 0.2585  -0.0398 108  VAL A CG2 
1584 N N   . SER A 204 ? 1.2940 0.5918 0.7111 -0.1109 0.2339  -0.0501 109  SER A N   
1585 C CA  . SER A 204 ? 1.3090 0.5894 0.7059 -0.1035 0.2218  -0.0507 109  SER A CA  
1586 C C   . SER A 204 ? 1.3395 0.6546 0.7698 -0.0961 0.2198  -0.0554 109  SER A C   
1587 O O   . SER A 204 ? 1.3339 0.6469 0.7619 -0.0999 0.2049  -0.0530 109  SER A O   
1588 C CB  . SER A 204 ? 1.3965 0.6410 0.7537 -0.0875 0.2287  -0.0532 109  SER A CB  
1589 O OG  . SER A 204 ? 1.5685 0.7810 0.8929 -0.0780 0.2170  -0.0542 109  SER A OG  
1590 N N   . PHE A 205 ? 1.2720 0.6242 0.7334 -0.0881 0.2347  -0.0614 110  PHE A N   
1591 C CA  . PHE A 205 ? 1.2391 0.6365 0.7365 -0.0804 0.2355  -0.0673 110  PHE A CA  
1592 C C   . PHE A 205 ? 1.2366 0.6545 0.7626 -0.0945 0.2242  -0.0665 110  PHE A C   
1593 O O   . PHE A 205 ? 1.2038 0.6414 0.7444 -0.0871 0.2161  -0.0690 110  PHE A O   
1594 C CB  . PHE A 205 ? 1.2546 0.6971 0.7798 -0.0791 0.2546  -0.0726 110  PHE A CB  
1595 C CG  . PHE A 205 ? 1.2503 0.7525 0.8185 -0.0786 0.2564  -0.0792 110  PHE A CG  
1596 C CD1 . PHE A 205 ? 1.3008 0.8338 0.8727 -0.0531 0.2578  -0.0840 110  PHE A CD1 
1597 C CD2 . PHE A 205 ? 1.2529 0.7787 0.8520 -0.1020 0.2566  -0.0810 110  PHE A CD2 
1598 C CE1 . PHE A 205 ? 1.2869 0.8836 0.8994 -0.0525 0.2590  -0.0904 110  PHE A CE1 
1599 C CE2 . PHE A 205 ? 1.2683 0.8496 0.9046 -0.1048 0.2570  -0.0880 110  PHE A CE2 
1600 C CZ  . PHE A 205 ? 1.2459 0.8675 0.8920 -0.0809 0.2582  -0.0926 110  PHE A CZ  
1601 N N   . ASN A 206 ? 1.1884 0.6010 0.7184 -0.1108 0.2241  -0.0632 111  ASN A N   
1602 C CA  . ASN A 206 ? 1.1656 0.5943 0.7150 -0.1194 0.2141  -0.0625 111  ASN A CA  
1603 C C   . ASN A 206 ? 1.2295 0.6542 0.7689 -0.1172 0.1961  -0.0570 111  ASN A C   
1604 O O   . ASN A 206 ? 1.2062 0.6569 0.7675 -0.1164 0.1878  -0.0584 111  ASN A O   
1605 C CB  . ASN A 206 ? 1.1568 0.5679 0.6949 -0.1294 0.2172  -0.0591 111  ASN A CB  
1606 C CG  . ASN A 206 ? 1.2855 0.7083 0.8343 -0.1317 0.2075  -0.0590 111  ASN A CG  
1607 O OD1 . ASN A 206 ? 1.1847 0.6052 0.7197 -0.1283 0.1955  -0.0525 111  ASN A OD1 
1608 N ND2 . ASN A 206 ? 1.1615 0.6007 0.7323 -0.1372 0.2121  -0.0663 111  ASN A ND2 
1609 N N   . LEU A 207 ? 1.2196 0.6123 0.7234 -0.1190 0.1899  -0.0506 112  LEU A N   
1610 C CA  . LEU A 207 ? 1.2266 0.6141 0.7139 -0.1249 0.1727  -0.0436 112  LEU A CA  
1611 C C   . LEU A 207 ? 1.3087 0.6954 0.7969 -0.1147 0.1688  -0.0467 112  LEU A C   
1612 O O   . LEU A 207 ? 1.2983 0.7050 0.7984 -0.1173 0.1579  -0.0438 112  LEU A O   
1613 C CB  . LEU A 207 ? 1.2589 0.6092 0.7014 -0.1357 0.1665  -0.0365 112  LEU A CB  
1614 C CG  . LEU A 207 ? 1.3260 0.6627 0.7396 -0.1500 0.1488  -0.0284 112  LEU A CG  
1615 C CD1 . LEU A 207 ? 1.2843 0.6674 0.7188 -0.1605 0.1368  -0.0212 112  LEU A CD1 
1616 C CD2 . LEU A 207 ? 1.4012 0.6956 0.7653 -0.1639 0.1436  -0.0236 112  LEU A CD2 
1617 N N   . TYR A 208 ? 1.3003 0.6659 0.7731 -0.0995 0.1780  -0.0521 113  TYR A N   
1618 C CA  . TYR A 208 ? 1.3185 0.6767 0.7806 -0.0820 0.1749  -0.0550 113  TYR A CA  
1619 C C   . TYR A 208 ? 1.2953 0.7087 0.8061 -0.0729 0.1772  -0.0613 113  TYR A C   
1620 O O   . TYR A 208 ? 1.2741 0.6924 0.7855 -0.0704 0.1663  -0.0590 113  TYR A O   
1621 C CB  . TYR A 208 ? 1.3856 0.7125 0.8146 -0.0600 0.1853  -0.0598 113  TYR A CB  
1622 C CG  . TYR A 208 ? 1.4751 0.7341 0.8427 -0.0679 0.1785  -0.0542 113  TYR A CG  
1623 C CD1 . TYR A 208 ? 1.5534 0.7588 0.8694 -0.0707 0.1640  -0.0493 113  TYR A CD1 
1624 C CD2 . TYR A 208 ? 1.4966 0.7419 0.8537 -0.0766 0.1854  -0.0532 113  TYR A CD2 
1625 C CE1 . TYR A 208 ? 1.6326 0.7711 0.8861 -0.0847 0.1557  -0.0445 113  TYR A CE1 
1626 C CE2 . TYR A 208 ? 1.5601 0.7449 0.8596 -0.0866 0.1775  -0.0488 113  TYR A CE2 
1627 C CZ  . TYR A 208 ? 1.7019 0.8332 0.9492 -0.0924 0.1622  -0.0448 113  TYR A CZ  
1628 O OH  . TYR A 208 ? 1.7521 0.8194 0.9365 -0.1080 0.1528  -0.0409 113  TYR A OH  
1629 N N   . ALA A 209 ? 1.2113 0.6649 0.7595 -0.0718 0.1904  -0.0684 114  ALA A N   
1630 C CA  . ALA A 209 ? 1.1676 0.6757 0.7605 -0.0680 0.1923  -0.0757 114  ALA A CA  
1631 C C   . ALA A 209 ? 1.1767 0.6977 0.7863 -0.0790 0.1787  -0.0725 114  ALA A C   
1632 O O   . ALA A 209 ? 1.1637 0.7067 0.7863 -0.0692 0.1717  -0.0746 114  ALA A O   
1633 C CB  . ALA A 209 ? 1.1637 0.7036 0.7844 -0.0772 0.2071  -0.0820 114  ALA A CB  
1634 N N   . SER A 210 ? 1.1161 0.6250 0.7211 -0.0952 0.1746  -0.0670 115  SER A N   
1635 C CA  . SER A 210 ? 1.0889 0.6148 0.7051 -0.1010 0.1620  -0.0631 115  SER A CA  
1636 C C   . SER A 210 ? 1.1391 0.6606 0.7400 -0.0986 0.1482  -0.0555 115  SER A C   
1637 O O   . SER A 210 ? 1.1189 0.6686 0.7395 -0.0928 0.1414  -0.0569 115  SER A O   
1638 C CB  . SER A 210 ? 1.1305 0.6434 0.7330 -0.1114 0.1605  -0.0572 115  SER A CB  
1639 O OG  . SER A 210 ? 1.2314 0.7437 0.8439 -0.1148 0.1714  -0.0637 115  SER A OG  
1640 N N   . VAL A 211 ? 1.1187 0.6012 0.6802 -0.1048 0.1443  -0.0476 116  VAL A N   
1641 C CA  . VAL A 211 ? 1.1409 0.6044 0.6733 -0.1102 0.1312  -0.0386 116  VAL A CA  
1642 C C   . VAL A 211 ? 1.2024 0.6685 0.7389 -0.0911 0.1309  -0.0436 116  VAL A C   
1643 O O   . VAL A 211 ? 1.2028 0.6768 0.7360 -0.0933 0.1201  -0.0377 116  VAL A O   
1644 C CB  . VAL A 211 ? 1.2391 0.6471 0.7189 -0.1225 0.1286  -0.0320 116  VAL A CB  
1645 C CG1 . VAL A 211 ? 1.2800 0.6441 0.7143 -0.1251 0.1186  -0.0260 116  VAL A CG1 
1646 C CG2 . VAL A 211 ? 1.2316 0.6491 0.7038 -0.1445 0.1224  -0.0232 116  VAL A CG2 
1647 N N   . PHE A 212 ? 1.1570 0.6232 0.7003 -0.0710 0.1430  -0.0538 117  PHE A N   
1648 C CA  . PHE A 212 ? 1.1592 0.6354 0.7044 -0.0466 0.1434  -0.0591 117  PHE A CA  
1649 C C   . PHE A 212 ? 1.1409 0.6795 0.7382 -0.0426 0.1423  -0.0655 117  PHE A C   
1650 O O   . PHE A 212 ? 1.1362 0.6852 0.7337 -0.0302 0.1353  -0.0650 117  PHE A O   
1651 C CB  . PHE A 212 ? 1.2114 0.6805 0.7450 -0.0223 0.1567  -0.0674 117  PHE A CB  
1652 C CG  . PHE A 212 ? 1.2873 0.6905 0.7637 -0.0194 0.1589  -0.0636 117  PHE A CG  
1653 C CD1 . PHE A 212 ? 1.3709 0.7093 0.7917 -0.0320 0.1462  -0.0536 117  PHE A CD1 
1654 C CD2 . PHE A 212 ? 1.3320 0.7378 0.8049 -0.0041 0.1733  -0.0701 117  PHE A CD2 
1655 C CE1 . PHE A 212 ? 1.4451 0.7150 0.8055 -0.0309 0.1467  -0.0513 117  PHE A CE1 
1656 C CE2 . PHE A 212 ? 1.4270 0.7683 0.8418 0.0023  0.1748  -0.0675 117  PHE A CE2 
1657 C CZ  . PHE A 212 ? 1.4487 0.7184 0.8057 -0.0110 0.1609  -0.0588 117  PHE A CZ  
1658 N N   . LEU A 213 ? 1.0475 0.6206 0.6821 -0.0533 0.1484  -0.0714 118  LEU A N   
1659 C CA  . LEU A 213 ? 1.0004 0.6245 0.6774 -0.0527 0.1465  -0.0789 118  LEU A CA  
1660 C C   . LEU A 213 ? 1.0286 0.6591 0.7070 -0.0587 0.1323  -0.0714 118  LEU A C   
1661 O O   . LEU A 213 ? 0.9963 0.6560 0.6919 -0.0482 0.1263  -0.0744 118  LEU A O   
1662 C CB  . LEU A 213 ? 0.9813 0.6229 0.6822 -0.0664 0.1559  -0.0864 118  LEU A CB  
1663 C CG  . LEU A 213 ? 1.0454 0.7057 0.7569 -0.0625 0.1707  -0.0949 118  LEU A CG  
1664 C CD1 . LEU A 213 ? 1.0475 0.7016 0.7639 -0.0831 0.1805  -0.0972 118  LEU A CD1 
1665 C CD2 . LEU A 213 ? 1.0648 0.7816 0.8071 -0.0500 0.1716  -0.1049 118  LEU A CD2 
1666 N N   . LEU A 214 ? 1.0011 0.6104 0.6600 -0.0738 0.1269  -0.0611 119  LEU A N   
1667 C CA  . LEU A 214 ? 0.9882 0.6137 0.6455 -0.0797 0.1139  -0.0516 119  LEU A CA  
1668 C C   . LEU A 214 ? 1.0501 0.6694 0.6900 -0.0756 0.1050  -0.0440 119  LEU A C   
1669 O O   . LEU A 214 ? 1.0341 0.6844 0.6873 -0.0721 0.0965  -0.0410 119  LEU A O   
1670 C CB  . LEU A 214 ? 0.9958 0.6078 0.6309 -0.0957 0.1106  -0.0410 119  LEU A CB  
1671 C CG  . LEU A 214 ? 1.0449 0.6599 0.6886 -0.0970 0.1172  -0.0458 119  LEU A CG  
1672 C CD1 . LEU A 214 ? 1.0610 0.6589 0.6767 -0.1092 0.1158  -0.0358 119  LEU A CD1 
1673 C CD2 . LEU A 214 ? 1.0507 0.6991 0.7140 -0.0881 0.1121  -0.0492 119  LEU A CD2 
1674 N N   . THR A 215 ? 1.0326 0.6069 0.6371 -0.0739 0.1071  -0.0413 120  THR A N   
1675 C CA  . THR A 215 ? 1.0606 0.6080 0.6319 -0.0693 0.0994  -0.0339 120  THR A CA  
1676 C C   . THR A 215 ? 1.1045 0.6830 0.7010 -0.0429 0.1007  -0.0431 120  THR A C   
1677 O O   . THR A 215 ? 1.1014 0.6875 0.6917 -0.0401 0.0917  -0.0367 120  THR A O   
1678 C CB  . THR A 215 ? 1.1439 0.6224 0.6604 -0.0695 0.1022  -0.0312 120  THR A CB  
1679 O OG1 . THR A 215 ? 1.0819 0.5379 0.5765 -0.0964 0.0993  -0.0229 120  THR A OG1 
1680 C CG2 . THR A 215 ? 1.1772 0.6083 0.6430 -0.0642 0.0940  -0.0234 120  THR A CG2 
1681 N N   . CYS A 216 ? 1.0453 0.6478 0.6700 -0.0256 0.1116  -0.0574 121  CYS A N   
1682 C CA  . CYS A 216 ? 1.0248 0.6691 0.6767 -0.0014 0.1132  -0.0678 121  CYS A CA  
1683 C C   . CYS A 216 ? 1.0052 0.6992 0.6960 -0.0063 0.1057  -0.0701 121  CYS A C   
1684 O O   . CYS A 216 ? 0.9900 0.7097 0.6906 0.0103  0.1008  -0.0727 121  CYS A O   
1685 C CB  . CYS A 216 ? 1.0257 0.6969 0.7004 0.0104  0.1265  -0.0814 121  CYS A CB  
1686 S SG  . CYS A 216 ? 1.1305 0.7513 0.7563 0.0290  0.1360  -0.0804 121  CYS A SG  
1687 N N   . LEU A 217 ? 0.9283 0.6330 0.6355 -0.0254 0.1046  -0.0692 122  LEU A N   
1688 C CA  . LEU A 217 ? 0.8911 0.6344 0.6249 -0.0268 0.0970  -0.0713 122  LEU A CA  
1689 C C   . LEU A 217 ? 0.9354 0.6799 0.6521 -0.0276 0.0851  -0.0571 122  LEU A C   
1690 O O   . LEU A 217 ? 0.9226 0.7004 0.6559 -0.0166 0.0784  -0.0590 122  LEU A O   
1691 C CB  . LEU A 217 ? 0.8806 0.6241 0.6224 -0.0410 0.0992  -0.0735 122  LEU A CB  
1692 C CG  . LEU A 217 ? 0.9417 0.6897 0.7021 -0.0454 0.1097  -0.0878 122  LEU A CG  
1693 C CD1 . LEU A 217 ? 0.9480 0.6739 0.6977 -0.0589 0.1127  -0.0862 122  LEU A CD1 
1694 C CD2 . LEU A 217 ? 0.9666 0.7541 0.7562 -0.0389 0.1069  -0.1011 122  LEU A CD2 
1695 N N   . SER A 218 ? 0.8865 0.5959 0.5676 -0.0430 0.0824  -0.0425 123  SER A N   
1696 C CA  . SER A 218 ? 0.8876 0.5974 0.5456 -0.0532 0.0715  -0.0260 123  SER A CA  
1697 C C   . SER A 218 ? 0.9558 0.6582 0.6014 -0.0377 0.0679  -0.0246 123  SER A C   
1698 O O   . SER A 218 ? 0.9388 0.6727 0.5923 -0.0342 0.0601  -0.0188 123  SER A O   
1699 C CB  . SER A 218 ? 0.9542 0.6215 0.5704 -0.0780 0.0699  -0.0126 123  SER A CB  
1700 O OG  . SER A 218 ? 1.0417 0.7105 0.6661 -0.0872 0.0751  -0.0157 123  SER A OG  
1701 N N   . ILE A 219 ? 0.9297 0.5920 0.5533 -0.0239 0.0740  -0.0303 124  ILE A N   
1702 C CA  . ILE A 219 ? 0.9454 0.5906 0.5468 -0.0011 0.0722  -0.0303 124  ILE A CA  
1703 C C   . ILE A 219 ? 0.9362 0.6449 0.5855 0.0212  0.0715  -0.0424 124  ILE A C   
1704 O O   . ILE A 219 ? 0.9340 0.6523 0.5760 0.0321  0.0646  -0.0372 124  ILE A O   
1705 C CB  . ILE A 219 ? 1.0245 0.6182 0.5906 0.0161  0.0804  -0.0360 124  ILE A CB  
1706 C CG1 . ILE A 219 ? 1.0779 0.5979 0.5848 -0.0082 0.0782  -0.0232 124  ILE A CG1 
1707 C CG2 . ILE A 219 ? 1.0639 0.6458 0.6061 0.0509  0.0797  -0.0387 124  ILE A CG2 
1708 C CD1 . ILE A 219 ? 1.1989 0.6675 0.6718 0.0053  0.0873  -0.0298 124  ILE A CD1 
1709 N N   . ASP A 220 ? 0.8431 0.5925 0.5374 0.0240  0.0777  -0.0576 125  ASP A N   
1710 C CA  . ASP A 220 ? 0.8003 0.6083 0.5378 0.0385  0.0760  -0.0709 125  ASP A CA  
1711 C C   . ASP A 220 ? 0.8109 0.6461 0.5599 0.0322  0.0655  -0.0643 125  ASP A C   
1712 O O   . ASP A 220 ? 0.7938 0.6599 0.5547 0.0488  0.0597  -0.0672 125  ASP A O   
1713 C CB  . ASP A 220 ? 0.7988 0.6331 0.5710 0.0322  0.0842  -0.0869 125  ASP A CB  
1714 C CG  . ASP A 220 ? 0.9092 0.7992 0.7205 0.0393  0.0809  -0.1016 125  ASP A CG  
1715 O OD1 . ASP A 220 ? 0.9139 0.8334 0.7331 0.0607  0.0787  -0.1072 125  ASP A OD1 
1716 O OD2 . ASP A 220 ? 0.9908 0.8910 0.8193 0.0241  0.0799  -0.1079 125  ASP A OD2 
1717 N N   . ARG A 221 ? 0.7521 0.5802 0.4954 0.0115  0.0630  -0.0550 126  ARG A N   
1718 C CA  . ARG A 221 ? 0.7226 0.5835 0.4730 0.0090  0.0537  -0.0473 126  ARG A CA  
1719 C C   . ARG A 221 ? 0.7833 0.6416 0.5083 0.0087  0.0463  -0.0305 126  ARG A C   
1720 O O   . ARG A 221 ? 0.7624 0.6587 0.4985 0.0185  0.0392  -0.0277 126  ARG A O   
1721 C CB  . ARG A 221 ? 0.7193 0.5791 0.4648 -0.0081 0.0537  -0.0408 126  ARG A CB  
1722 C CG  . ARG A 221 ? 0.8796 0.7421 0.6446 -0.0064 0.0588  -0.0562 126  ARG A CG  
1723 C CD  . ARG A 221 ? 0.9723 0.8676 0.7592 0.0093  0.0536  -0.0689 126  ARG A CD  
1724 N NE  . ARG A 221 ? 1.0251 0.9320 0.8320 0.0191  0.0553  -0.0829 126  ARG A NE  
1725 C CZ  . ARG A 221 ? 1.1940 1.1310 1.0187 0.0318  0.0493  -0.0946 126  ARG A CZ  
1726 N NH1 . ARG A 221 ? 1.0596 1.0110 0.8806 0.0393  0.0413  -0.0942 126  ARG A NH1 
1727 N NH2 . ARG A 221 ? 0.9928 0.9485 0.8359 0.0394  0.0508  -0.1069 126  ARG A NH2 
1728 N N   . TYR A 222 ? 0.7795 0.5885 0.4650 -0.0027 0.0479  -0.0193 127  TYR A N   
1729 C CA  . TYR A 222 ? 0.8136 0.6036 0.4620 -0.0082 0.0412  -0.0023 127  TYR A CA  
1730 C C   . TYR A 222 ? 0.8637 0.6614 0.5160 0.0223  0.0402  -0.0097 127  TYR A C   
1731 O O   . TYR A 222 ? 0.8623 0.6804 0.5090 0.0261  0.0333  -0.0003 127  TYR A O   
1732 C CB  . TYR A 222 ? 0.8888 0.6072 0.4818 -0.0293 0.0425  0.0093  127  TYR A CB  
1733 C CG  . TYR A 222 ? 0.9721 0.6505 0.5122 -0.0370 0.0358  0.0262  127  TYR A CG  
1734 C CD1 . TYR A 222 ? 1.0155 0.7095 0.5371 -0.0681 0.0276  0.0466  127  TYR A CD1 
1735 C CD2 . TYR A 222 ? 1.0291 0.6539 0.5321 -0.0132 0.0380  0.0227  127  TYR A CD2 
1736 C CE1 . TYR A 222 ? 1.1027 0.7546 0.5693 -0.0811 0.0215  0.0637  127  TYR A CE1 
1737 C CE2 . TYR A 222 ? 1.1077 0.6816 0.5503 -0.0200 0.0318  0.0389  127  TYR A CE2 
1738 C CZ  . TYR A 222 ? 1.2553 0.8398 0.6792 -0.0572 0.0235  0.0597  127  TYR A CZ  
1739 O OH  . TYR A 222 ? 1.3824 0.9126 0.7413 -0.0700 0.0174  0.0772  127  TYR A OH  
1740 N N   . LEU A 223 ? 0.8122 0.6002 0.4737 0.0448  0.0473  -0.0260 128  LEU A N   
1741 C CA  . LEU A 223 ? 0.8103 0.6135 0.4756 0.0778  0.0469  -0.0346 128  LEU A CA  
1742 C C   . LEU A 223 ? 0.7806 0.6555 0.4977 0.0906  0.0427  -0.0470 128  LEU A C   
1743 O O   . LEU A 223 ? 0.7810 0.6765 0.4988 0.1137  0.0386  -0.0489 128  LEU A O   
1744 C CB  . LEU A 223 ? 0.8323 0.6183 0.4924 0.0996  0.0561  -0.0481 128  LEU A CB  
1745 C CG  . LEU A 223 ? 0.9508 0.6583 0.5511 0.0980  0.0605  -0.0398 128  LEU A CG  
1746 C CD1 . LEU A 223 ? 0.9545 0.6676 0.5633 0.1205  0.0710  -0.0553 128  LEU A CD1 
1747 C CD2 . LEU A 223 ? 1.0451 0.6953 0.5811 0.1102  0.0550  -0.0257 128  LEU A CD2 
1748 N N   . ALA A 224 ? 0.6791 0.5857 0.4325 0.0776  0.0432  -0.0558 129  ALA A N   
1749 C CA  . ALA A 224 ? 0.6352 0.5971 0.4273 0.0888  0.0381  -0.0692 129  ALA A CA  
1750 C C   . ALA A 224 ? 0.7022 0.6882 0.4912 0.0893  0.0285  -0.0571 129  ALA A C   
1751 O O   . ALA A 224 ? 0.6960 0.7194 0.5014 0.1080  0.0225  -0.0640 129  ALA A O   
1752 C CB  . ALA A 224 ? 0.6163 0.5882 0.4343 0.0756  0.0419  -0.0831 129  ALA A CB  
1753 N N   . ILE A 225 ? 0.6803 0.6520 0.4485 0.0690  0.0269  -0.0392 130  ILE A N   
1754 C CA  . ILE A 225 ? 0.6742 0.6808 0.4394 0.0678  0.0188  -0.0255 130  ILE A CA  
1755 C C   . ILE A 225 ? 0.7745 0.7674 0.5054 0.0629  0.0152  -0.0049 130  ILE A C   
1756 O O   . ILE A 225 ? 0.7673 0.7947 0.5017 0.0768  0.0092  -0.0003 130  ILE A O   
1757 C CB  . ILE A 225 ? 0.6991 0.7136 0.4618 0.0487  0.0188  -0.0173 130  ILE A CB  
1758 C CG1 . ILE A 225 ? 0.6716 0.6995 0.4589 0.0587  0.0198  -0.0363 130  ILE A CG1 
1759 C CG2 . ILE A 225 ? 0.7069 0.7634 0.4579 0.0434  0.0114  0.0032  130  ILE A CG2 
1760 C CD1 . ILE A 225 ? 0.6536 0.6474 0.4517 0.0537  0.0282  -0.0540 130  ILE A CD1 
1761 N N   . VAL A 226 ? 0.7776 0.7162 0.4701 0.0418  0.0185  0.0079  131  VAL A N   
1762 C CA  . VAL A 226 ? 0.8288 0.7379 0.4745 0.0288  0.0147  0.0293  131  VAL A CA  
1763 C C   . VAL A 226 ? 0.9146 0.7983 0.5436 0.0582  0.0150  0.0237  131  VAL A C   
1764 O O   . VAL A 226 ? 0.9223 0.8214 0.5382 0.0650  0.0098  0.0345  131  VAL A O   
1765 C CB  . VAL A 226 ? 0.9270 0.7754 0.5265 -0.0064 0.0165  0.0438  131  VAL A CB  
1766 C CG1 . VAL A 226 ? 0.9837 0.7934 0.5249 -0.0278 0.0113  0.0672  131  VAL A CG1 
1767 C CG2 . VAL A 226 ? 0.8963 0.7783 0.5136 -0.0314 0.0161  0.0484  131  VAL A CG2 
1768 N N   . HIS A 227 ? 0.8931 0.7447 0.5211 0.0778  0.0213  0.0078  132  HIS A N   
1769 C CA  . HIS A 227 ? 0.9312 0.7636 0.5381 0.1112  0.0217  0.0029  132  HIS A CA  
1770 C C   . HIS A 227 ? 0.9667 0.8496 0.6240 0.1434  0.0249  -0.0229 132  HIS A C   
1771 O O   . HIS A 227 ? 0.9805 0.8430 0.6318 0.1587  0.0315  -0.0339 132  HIS A O   
1772 C CB  . HIS A 227 ? 1.0139 0.7566 0.5538 0.1107  0.0256  0.0107  132  HIS A CB  
1773 C CG  . HIS A 227 ? 1.1041 0.7891 0.5874 0.0710  0.0217  0.0349  132  HIS A CG  
1774 N ND1 . HIS A 227 ? 1.1608 0.8342 0.6073 0.0599  0.0150  0.0546  132  HIS A ND1 
1775 C CD2 . HIS A 227 ? 1.1464 0.7844 0.6020 0.0381  0.0233  0.0421  132  HIS A CD2 
1776 C CE1 . HIS A 227 ? 1.1970 0.8202 0.5955 0.0165  0.0124  0.0734  132  HIS A CE1 
1777 N NE2 . HIS A 227 ? 1.1946 0.7945 0.5966 0.0029  0.0167  0.0660  132  HIS A NE2 
1778 N N   . PRO A 228 ? 0.9046 0.8550 0.6074 0.1542  0.0198  -0.0327 133  PRO A N   
1779 C CA  . PRO A 228 ? 0.8813 0.8803 0.6274 0.1773  0.0213  -0.0572 133  PRO A CA  
1780 C C   . PRO A 228 ? 0.9861 0.9863 0.7149 0.2143  0.0218  -0.0622 133  PRO A C   
1781 O O   . PRO A 228 ? 1.0205 0.9941 0.7095 0.2269  0.0182  -0.0477 133  PRO A O   
1782 C CB  . PRO A 228 ? 0.8608 0.9178 0.6444 0.1772  0.0133  -0.0636 133  PRO A CB  
1783 C CG  . PRO A 228 ? 0.9131 0.9592 0.6792 0.1551  0.0097  -0.0432 133  PRO A CG  
1784 C CD  . PRO A 228 ? 0.9047 0.8928 0.6185 0.1458  0.0120  -0.0224 133  PRO A CD  
1785 N N   . MET A 229 ? 0.9469 0.9808 0.7023 0.2317  0.0264  -0.0820 134  MET A N   
1786 C CA  . MET A 229 ? 0.9835 1.0335 0.7252 0.2728  0.0276  -0.0891 134  MET A CA  
1787 C C   . MET A 229 ? 0.9993 1.1320 0.7959 0.2834  0.0283  -0.1140 134  MET A C   
1788 O O   . MET A 229 ? 0.9469 1.1074 0.7840 0.2548  0.0285  -0.1247 134  MET A O   
1789 C CB  . MET A 229 ? 1.0770 1.0581 0.7621 0.2869  0.0354  -0.0806 134  MET A CB  
1790 C CG  . MET A 229 ? 1.1249 1.0841 0.8170 0.2627  0.0439  -0.0840 134  MET A CG  
1791 S SD  . MET A 229 ? 1.2749 1.1300 0.8836 0.2739  0.0503  -0.0697 134  MET A SD  
1792 C CE  . MET A 229 ? 1.2091 1.0529 0.8414 0.2356  0.0583  -0.0738 134  MET A CE  
1793 N N   . LYS A 230 ? 0.9807 1.1528 0.7738 0.3238  0.0281  -0.1225 135  LYS A N   
1794 C CA  . LYS A 230 ? 0.9483 1.2112 0.7896 0.3345  0.0279  -0.1453 135  LYS A CA  
1795 C C   . LYS A 230 ? 1.0009 1.2740 0.8638 0.3114  0.0377  -0.1541 135  LYS A C   
1796 O O   . LYS A 230 ? 1.0363 1.2793 0.8691 0.3272  0.0469  -0.1493 135  LYS A O   
1797 C CB  . LYS A 230 ? 1.0027 1.3020 0.8249 0.3874  0.0275  -0.1492 135  LYS A CB  
1798 N N   . SER A 231 ? 0.9175 1.2214 0.8241 0.2731  0.0356  -0.1656 136  SER A N   
1799 C CA  . SER A 231 ? 0.9047 1.2140 0.8315 0.2432  0.0445  -0.1729 136  SER A CA  
1800 C C   . SER A 231 ? 0.9617 1.3588 0.9186 0.2535  0.0491  -0.1902 136  SER A C   
1801 O O   . SER A 231 ? 0.9369 1.4048 0.9306 0.2424  0.0423  -0.2060 136  SER A O   
1802 C CB  . SER A 231 ? 0.9223 1.2210 0.8724 0.2001  0.0398  -0.1778 136  SER A CB  
1803 N N   . ARG A 232 ? 0.9512 1.3453 0.8885 0.2750  0.0604  -0.1866 137  ARG A N   
1804 C CA  . ARG A 232 ? 0.9519 1.4352 0.9136 0.2875  0.0675  -0.1998 137  ARG A CA  
1805 C C   . ARG A 232 ? 0.9880 1.4660 0.9681 0.2448  0.0773  -0.2026 137  ARG A C   
1806 O O   . ARG A 232 ? 1.0046 1.4375 0.9573 0.2526  0.0878  -0.1937 137  ARG A O   
1807 C CB  . ARG A 232 ? 1.0073 1.4903 0.9273 0.3471  0.0737  -0.1935 137  ARG A CB  
1808 N N   . LEU A 233 ? 0.9177 1.4284 0.9362 0.1984  0.0729  -0.2142 138  LEU A N   
1809 C CA  . LEU A 233 ? 0.9117 1.4060 0.9433 0.1510  0.0804  -0.2166 138  LEU A CA  
1810 C C   . LEU A 233 ? 0.9593 1.5109 1.0005 0.1548  0.0946  -0.2198 138  LEU A C   
1811 O O   . LEU A 233 ? 0.9573 1.4595 0.9844 0.1392  0.1048  -0.2124 138  LEU A O   
1812 C CB  . LEU A 233 ? 0.9002 1.4214 0.9612 0.1048  0.0714  -0.2306 138  LEU A CB  
1813 C CG  . LEU A 233 ? 0.9658 1.4193 1.0197 0.0575  0.0744  -0.2285 138  LEU A CG  
1814 C CD1 . LEU A 233 ? 0.9662 1.3215 0.9885 0.0649  0.0706  -0.2138 138  LEU A CD1 
1815 C CD2 . LEU A 233 ? 1.0045 1.4827 1.0759 0.0141  0.0655  -0.2442 138  LEU A CD2 
1816 N N   . ARG A 234 ? 0.9151 1.5735 0.9776 0.1789  0.0956  -0.2297 139  ARG A N   
1817 C CA  . ARG A 234 ? 0.9234 1.6585 0.9970 0.1879  0.1092  -0.2327 139  ARG A CA  
1818 C C   . ARG A 234 ? 1.0054 1.6744 1.0325 0.2298  0.1204  -0.2185 139  ARG A C   
1819 O O   . ARG A 234 ? 1.0185 1.7050 1.0462 0.2225  0.1335  -0.2170 139  ARG A O   
1820 C CB  . ARG A 234 ? 0.9319 1.8008 1.0322 0.2167  0.1061  -0.2446 139  ARG A CB  
1821 C CG  . ARG A 234 ? 1.0824 2.0643 1.2064 0.2154  0.1192  -0.2500 139  ARG A CG  
1822 C CD  . ARG A 234 ? 1.2514 2.3852 1.4150 0.2208  0.1135  -0.2646 139  ARG A CD  
1823 N NE  . ARG A 234 ? 1.4126 2.5782 1.5566 0.2937  0.1083  -0.2641 139  ARG A NE  
1824 C CZ  . ARG A 234 ? 1.5995 2.8979 1.7709 0.3144  0.1025  -0.2756 139  ARG A CZ  
1825 N NH1 . ARG A 234 ? 1.4220 2.8386 1.6436 0.2624  0.1004  -0.2888 139  ARG A NH1 
1826 N NH2 . ARG A 234 ? 1.4568 2.7702 1.6014 0.3859  0.0982  -0.2738 139  ARG A NH2 
1827 N N   . ARG A 235 ? 0.9746 1.5625 0.9569 0.2693  0.1150  -0.2078 140  ARG A N   
1828 C CA  . ARG A 235 ? 1.0087 1.5152 0.9336 0.3065  0.1229  -0.1945 140  ARG A CA  
1829 C C   . ARG A 235 ? 1.0288 1.4185 0.9310 0.2700  0.1234  -0.1828 140  ARG A C   
1830 O O   . ARG A 235 ? 1.0445 1.3862 0.9160 0.2758  0.1333  -0.1758 140  ARG A O   
1831 C CB  . ARG A 235 ? 1.0681 1.5417 0.9446 0.3663  0.1165  -0.1881 140  ARG A CB  
1832 C CG  . ARG A 235 ? 1.2677 1.8499 1.1490 0.4202  0.1191  -0.1972 140  ARG A CG  
1833 C CD  . ARG A 235 ? 1.4774 2.0166 1.3009 0.4831  0.1130  -0.1904 140  ARG A CD  
1834 N NE  . ARG A 235 ? 1.6020 2.2500 1.4258 0.5417  0.1161  -0.1991 140  ARG A NE  
1835 C CZ  . ARG A 235 ? 1.8182 2.4496 1.5893 0.6074  0.1121  -0.1954 140  ARG A CZ  
1836 N NH1 . ARG A 235 ? 1.6824 2.1884 1.3951 0.6179  0.1047  -0.1825 140  ARG A NH1 
1837 N NH2 . ARG A 235 ? 1.6675 2.4101 1.4407 0.6632  0.1154  -0.2040 140  ARG A NH2 
1838 N N   . THR A 236 ? 0.9447 1.2937 0.8596 0.2352  0.1128  -0.1810 141  THR A N   
1839 C CA  . THR A 236 ? 0.9329 1.1847 0.8282 0.2023  0.1122  -0.1698 141  THR A CA  
1840 C C   . THR A 236 ? 0.9484 1.2103 0.8688 0.1596  0.1213  -0.1743 141  THR A C   
1841 O O   . THR A 236 ? 0.9545 1.1467 0.8495 0.1471  0.1269  -0.1649 141  THR A O   
1842 C CB  . THR A 236 ? 0.9689 1.1873 0.8687 0.1840  0.0988  -0.1663 141  THR A CB  
1843 O OG1 . THR A 236 ? 0.9287 1.2138 0.8750 0.1594  0.0931  -0.1804 141  THR A OG1 
1844 C CG2 . THR A 236 ? 0.9569 1.1465 0.8225 0.2214  0.0905  -0.1575 141  THR A CG2 
1845 N N   . MET A 237 ? 0.8698 1.2161 0.8356 0.1351  0.1225  -0.1882 142  MET A N   
1846 C CA  . MET A 237 ? 0.8585 1.2160 0.8436 0.0917  0.1318  -0.1922 142  MET A CA  
1847 C C   . MET A 237 ? 0.9231 1.2993 0.8958 0.1106  0.1471  -0.1888 142  MET A C   
1848 O O   . MET A 237 ? 0.9190 1.2493 0.8803 0.0883  0.1558  -0.1833 142  MET A O   
1849 C CB  . MET A 237 ? 0.8727 1.3137 0.9009 0.0567  0.1281  -0.2076 142  MET A CB  
1850 C CG  . MET A 237 ? 0.9101 1.3123 0.9430 0.0258  0.1147  -0.2117 142  MET A CG  
1851 S SD  . MET A 237 ? 0.9718 1.2775 0.9850 -0.0196 0.1177  -0.2057 142  MET A SD  
1852 C CE  . MET A 237 ? 0.9445 1.3098 0.9790 -0.0638 0.1304  -0.2146 142  MET A CE  
1853 N N   . LEU A 238 ? 0.8963 1.3390 0.8665 0.1565  0.1502  -0.1919 143  LEU A N   
1854 C CA  . LEU A 238 ? 0.9187 1.3908 0.8716 0.1883  0.1642  -0.1895 143  LEU A CA  
1855 C C   . LEU A 238 ? 0.9960 1.3527 0.8934 0.2045  0.1683  -0.1761 143  LEU A C   
1856 O O   . LEU A 238 ? 1.0039 1.3496 0.8938 0.1942  0.1801  -0.1732 143  LEU A O   
1857 C CB  . LEU A 238 ? 0.9362 1.4889 0.8844 0.2471  0.1636  -0.1943 143  LEU A CB  
1858 C CG  . LEU A 238 ? 1.0334 1.6145 0.9502 0.2983  0.1770  -0.1915 143  LEU A CG  
1859 C CD1 . LEU A 238 ? 1.0190 1.6945 0.9738 0.2703  0.1911  -0.1966 143  LEU A CD1 
1860 C CD2 . LEU A 238 ? 1.0910 1.7335 0.9908 0.3646  0.1738  -0.1952 143  LEU A CD2 
1861 N N   . VAL A 239 ? 0.9657 1.2374 0.8226 0.2258  0.1581  -0.1677 144  VAL A N   
1862 C CA  . VAL A 239 ? 1.0032 1.1610 0.8006 0.2363  0.1593  -0.1547 144  VAL A CA  
1863 C C   . VAL A 239 ? 1.0195 1.1199 0.8265 0.1827  0.1598  -0.1497 144  VAL A C   
1864 O O   . VAL A 239 ? 1.0395 1.0770 0.8116 0.1816  0.1660  -0.1424 144  VAL A O   
1865 C CB  . VAL A 239 ? 1.0911 1.1728 0.8357 0.2676  0.1481  -0.1456 144  VAL A CB  
1866 C CG1 . VAL A 239 ? 1.1307 1.2479 0.8454 0.3308  0.1495  -0.1488 144  VAL A CG1 
1867 C CG2 . VAL A 239 ? 1.0542 1.1296 0.8236 0.2410  0.1346  -0.1444 144  VAL A CG2 
1868 N N   . ALA A 240 ? 0.9274 1.0490 0.7763 0.1418  0.1534  -0.1542 145  ALA A N   
1869 C CA  . ALA A 240 ? 0.9127 0.9834 0.7665 0.0969  0.1536  -0.1500 145  ALA A CA  
1870 C C   . ALA A 240 ? 0.9633 1.0582 0.8304 0.0756  0.1680  -0.1533 145  ALA A C   
1871 O O   . ALA A 240 ? 0.9676 1.0021 0.8166 0.0554  0.1721  -0.1464 145  ALA A O   
1872 C CB  . ALA A 240 ? 0.8904 0.9775 0.7761 0.0672  0.1431  -0.1553 145  ALA A CB  
1873 N N   . LYS A 241 ? 0.9116 1.1002 0.8093 0.0800  0.1758  -0.1632 146  LYS A N   
1874 C CA  . LYS A 241 ? 0.9101 1.1386 0.8225 0.0590  0.1906  -0.1658 146  LYS A CA  
1875 C C   . LYS A 241 ? 0.9708 1.1723 0.8448 0.0941  0.2018  -0.1587 146  LYS A C   
1876 O O   . LYS A 241 ? 0.9675 1.1325 0.8298 0.0748  0.2109  -0.1539 146  LYS A O   
1877 C CB  . LYS A 241 ? 0.9350 1.2859 0.8923 0.0498  0.1944  -0.1777 146  LYS A CB  
1878 C CG  . LYS A 241 ? 1.1309 1.5034 1.1208 0.0044  0.1844  -0.1863 146  LYS A CG  
1879 C CD  . LYS A 241 ? 1.2834 1.7826 1.3142 -0.0076 0.1867  -0.1982 146  LYS A CD  
1880 C CE  . LYS A 241 ? 1.4367 1.9526 1.4917 -0.0535 0.1751  -0.2084 146  LYS A CE  
1881 N NZ  . LYS A 241 ? 1.5801 2.0395 1.6273 -0.1102 0.1783  -0.2075 146  LYS A NZ  
1882 N N   . VAL A 242 ? 0.9459 1.1590 0.7937 0.1481  0.2004  -0.1582 147  VAL A N   
1883 C CA  . VAL A 242 ? 0.9877 1.1678 0.7851 0.1928  0.2089  -0.1528 147  VAL A CA  
1884 C C   . VAL A 242 ? 1.0693 1.1204 0.8167 0.1832  0.2049  -0.1418 147  VAL A C   
1885 O O   . VAL A 242 ? 1.0905 1.1084 0.8090 0.1893  0.2145  -0.1379 147  VAL A O   
1886 C CB  . VAL A 242 ? 1.0626 1.2690 0.8317 0.2560  0.2052  -0.1549 147  VAL A CB  
1887 C CG1 . VAL A 242 ? 1.1241 1.2597 0.8194 0.3062  0.2103  -0.1484 147  VAL A CG1 
1888 C CG2 . VAL A 242 ? 1.0380 1.3888 0.8548 0.2698  0.2111  -0.1656 147  VAL A CG2 
1889 N N   . THR A 243 ? 1.0311 1.0179 0.7692 0.1669  0.1907  -0.1367 148  THR A N   
1890 C CA  . THR A 243 ? 1.0583 0.9358 0.7527 0.1517  0.1845  -0.1256 148  THR A CA  
1891 C C   . THR A 243 ? 1.1139 0.9756 0.8239 0.1104  0.1919  -0.1238 148  THR A C   
1892 O O   . THR A 243 ? 1.1441 0.9370 0.8124 0.1103  0.1944  -0.1168 148  THR A O   
1893 C CB  . THR A 243 ? 1.1389 0.9813 0.8327 0.1383  0.1686  -0.1206 148  THR A CB  
1894 O OG1 . THR A 243 ? 1.1702 1.0178 0.8407 0.1788  0.1626  -0.1210 148  THR A OG1 
1895 C CG2 . THR A 243 ? 1.1290 0.8751 0.7815 0.1169  0.1614  -0.1082 148  THR A CG2 
1896 N N   . CYS A 244 ? 1.0408 0.9605 0.8036 0.0762  0.1949  -0.1302 149  CYS A N   
1897 C CA  . CYS A 244 ? 1.0347 0.9359 0.8076 0.0377  0.2020  -0.1283 149  CYS A CA  
1898 C C   . CYS A 244 ? 1.1152 1.0319 0.8764 0.0473  0.2183  -0.1283 149  CYS A C   
1899 O O   . CYS A 244 ? 1.1228 0.9870 0.8633 0.0315  0.2232  -0.1225 149  CYS A O   
1900 C CB  . CYS A 244 ? 1.0058 0.9551 0.8248 0.0010  0.2007  -0.1356 149  CYS A CB  
1901 S SG  . CYS A 244 ? 1.0325 0.9460 0.8566 -0.0139 0.1822  -0.1340 149  CYS A SG  
1902 N N   . ILE A 245 ? 1.0830 1.0744 0.8545 0.0766  0.2265  -0.1342 150  ILE A N   
1903 C CA  . ILE A 245 ? 1.1077 1.1273 0.8666 0.0937  0.2427  -0.1339 150  ILE A CA  
1904 C C   . ILE A 245 ? 1.1990 1.1236 0.8913 0.1257  0.2415  -0.1264 150  ILE A C   
1905 O O   . ILE A 245 ? 1.1981 1.0874 0.8705 0.1166  0.2501  -0.1222 150  ILE A O   
1906 C CB  . ILE A 245 ? 1.1497 1.2846 0.9335 0.1245  0.2502  -0.1416 150  ILE A CB  
1907 C CG1 . ILE A 245 ? 1.1144 1.3440 0.9612 0.0855  0.2492  -0.1498 150  ILE A CG1 
1908 C CG2 . ILE A 245 ? 1.1915 1.3652 0.9582 0.1512  0.2673  -0.1405 150  ILE A CG2 
1909 C CD1 . ILE A 245 ? 1.2228 1.4672 1.0991 0.0235  0.2577  -0.1498 150  ILE A CD1 
1910 N N   . ILE A 246 ? 1.1974 1.0735 0.8511 0.1584  0.2296  -0.1244 151  ILE A N   
1911 C CA  . ILE A 246 ? 1.2640 1.0368 0.8427 0.1856  0.2245  -0.1175 151  ILE A CA  
1912 C C   . ILE A 246 ? 1.3289 1.0167 0.8909 0.1440  0.2186  -0.1095 151  ILE A C   
1913 O O   . ILE A 246 ? 1.3642 0.9817 0.8725 0.1531  0.2202  -0.1050 151  ILE A O   
1914 C CB  . ILE A 246 ? 1.3355 1.0755 0.8786 0.2192  0.2114  -0.1164 151  ILE A CB  
1915 C CG1 . ILE A 246 ? 1.3516 1.1759 0.9016 0.2705  0.2174  -0.1243 151  ILE A CG1 
1916 C CG2 . ILE A 246 ? 1.4230 1.0368 0.8795 0.2340  0.2024  -0.1080 151  ILE A CG2 
1917 C CD1 . ILE A 246 ? 1.4929 1.3367 1.0041 0.3204  0.2315  -0.1268 151  ILE A CD1 
1918 N N   . ILE A 247 ? 1.2555 0.9529 0.8597 0.1016  0.2116  -0.1082 152  ILE A N   
1919 C CA  . ILE A 247 ? 1.2482 0.8836 0.8423 0.0647  0.2058  -0.1007 152  ILE A CA  
1920 C C   . ILE A 247 ? 1.2943 0.9329 0.8930 0.0492  0.2196  -0.1008 152  ILE A C   
1921 O O   . ILE A 247 ? 1.3138 0.8865 0.8702 0.0461  0.2190  -0.0950 152  ILE A O   
1922 C CB  . ILE A 247 ? 1.2388 0.8926 0.8733 0.0329  0.1956  -0.1001 152  ILE A CB  
1923 C CG1 . ILE A 247 ? 1.2518 0.8850 0.8702 0.0453  0.1806  -0.0965 152  ILE A CG1 
1924 C CG2 . ILE A 247 ? 1.2440 0.8552 0.8735 -0.0011 0.1932  -0.0934 152  ILE A CG2 
1925 C CD1 . ILE A 247 ? 1.3281 1.0052 0.9919 0.0285  0.1725  -0.0992 152  ILE A CD1 
1926 N N   . TRP A 248 ? 1.2229 0.9373 0.8689 0.0374  0.2317  -0.1071 153  TRP A N   
1927 C CA  . TRP A 248 ? 1.2243 0.9495 0.8761 0.0205  0.2466  -0.1065 153  TRP A CA  
1928 C C   . TRP A 248 ? 1.3235 1.0310 0.9323 0.0555  0.2563  -0.1052 153  TRP A C   
1929 O O   . TRP A 248 ? 1.3406 1.0192 0.9315 0.0459  0.2647  -0.1016 153  TRP A O   
1930 C CB  . TRP A 248 ? 1.1775 0.9910 0.8827 -0.0015 0.2568  -0.1129 153  TRP A CB  
1931 C CG  . TRP A 248 ? 1.1566 0.9673 0.8908 -0.0410 0.2492  -0.1142 153  TRP A CG  
1932 C CD1 . TRP A 248 ? 1.1708 0.9810 0.9190 -0.0434 0.2345  -0.1165 153  TRP A CD1 
1933 C CD2 . TRP A 248 ? 1.1487 0.9565 0.8953 -0.0804 0.2563  -0.1135 153  TRP A CD2 
1934 N NE1 . TRP A 248 ? 1.1475 0.9517 0.9135 -0.0788 0.2314  -0.1179 153  TRP A NE1 
1935 C CE2 . TRP A 248 ? 1.1775 0.9752 0.9396 -0.1022 0.2444  -0.1161 153  TRP A CE2 
1936 C CE3 . TRP A 248 ? 1.1800 0.9877 0.9201 -0.0982 0.2718  -0.1106 153  TRP A CE3 
1937 C CZ2 . TRP A 248 ? 1.1713 0.9496 0.9354 -0.1386 0.2467  -0.1164 153  TRP A CZ2 
1938 C CZ3 . TRP A 248 ? 1.1988 0.9875 0.9429 -0.1377 0.2745  -0.1097 153  TRP A CZ3 
1939 C CH2 . TRP A 248 ? 1.1933 0.9641 0.9464 -0.1566 0.2618  -0.1130 153  TRP A CH2 
1940 N N   . LEU A 249 ? 1.3050 1.0215 0.8895 0.0995  0.2541  -0.1081 154  LEU A N   
1941 C CA  . LEU A 249 ? 1.3569 1.0453 0.8862 0.1434  0.2608  -0.1077 154  LEU A CA  
1942 C C   . LEU A 249 ? 1.4373 1.0055 0.8992 0.1429  0.2495  -0.1011 154  LEU A C   
1943 O O   . LEU A 249 ? 1.4673 0.9960 0.8957 0.1451  0.2561  -0.0988 154  LEU A O   
1944 C CB  . LEU A 249 ? 1.3822 1.1141 0.8996 0.1945  0.2603  -0.1130 154  LEU A CB  
1945 C CG  . LEU A 249 ? 1.5201 1.2140 0.9659 0.2523  0.2652  -0.1133 154  LEU A CG  
1946 C CD1 . LEU A 249 ? 1.5256 1.2923 0.9854 0.2665  0.2851  -0.1154 154  LEU A CD1 
1947 C CD2 . LEU A 249 ? 1.5922 1.3004 1.0121 0.3035  0.2593  -0.1171 154  LEU A CD2 
1948 N N   . LEU A 250 ? 1.3880 0.9019 0.8292 0.1372  0.2322  -0.0978 155  LEU A N   
1949 C CA  . LEU A 250 ? 1.4238 0.8301 0.8018 0.1270  0.2188  -0.0906 155  LEU A CA  
1950 C C   . LEU A 250 ? 1.4437 0.8262 0.8326 0.0842  0.2189  -0.0856 155  LEU A C   
1951 O O   . LEU A 250 ? 1.4877 0.8018 0.8228 0.0843  0.2173  -0.0824 155  LEU A O   
1952 C CB  . LEU A 250 ? 1.4204 0.7976 0.7898 0.1186  0.2015  -0.0866 155  LEU A CB  
1953 C CG  . LEU A 250 ? 1.5279 0.8817 0.8514 0.1629  0.1964  -0.0884 155  LEU A CG  
1954 C CD1 . LEU A 250 ? 1.4959 0.8646 0.8432 0.1510  0.1840  -0.0857 155  LEU A CD1 
1955 C CD2 . LEU A 250 ? 1.6581 0.8957 0.8809 0.1811  0.1893  -0.0842 155  LEU A CD2 
1956 N N   . ALA A 251 ? 1.3228 0.7585 0.7750 0.0503  0.2201  -0.0854 156  ALA A N   
1957 C CA  . ALA A 251 ? 1.2901 0.7106 0.7539 0.0143  0.2208  -0.0808 156  ALA A CA  
1958 C C   . ALA A 251 ? 1.3345 0.7579 0.7897 0.0189  0.2370  -0.0821 156  ALA A C   
1959 O O   . ALA A 251 ? 1.3388 0.7182 0.7705 0.0021  0.2360  -0.0773 156  ALA A O   
1960 C CB  . ALA A 251 ? 1.2397 0.7137 0.7634 -0.0127 0.2199  -0.0819 156  ALA A CB  
1961 N N   . GLY A 252 ? 1.2760 0.7569 0.7493 0.0421  0.2515  -0.0879 157  GLY A N   
1962 C CA  . GLY A 252 ? 1.2851 0.7823 0.7510 0.0508  0.2688  -0.0886 157  GLY A CA  
1963 C C   . GLY A 252 ? 1.3899 0.8181 0.7843 0.0825  0.2677  -0.0877 157  GLY A C   
1964 O O   . GLY A 252 ? 1.4030 0.7988 0.7725 0.0770  0.2739  -0.0850 157  GLY A O   
1965 N N   . LEU A 253 ? 1.3819 0.7797 0.7357 0.1167  0.2588  -0.0899 158  LEU A N   
1966 C CA  . LEU A 253 ? 1.4579 0.7716 0.7269 0.1504  0.2544  -0.0899 158  LEU A CA  
1967 C C   . LEU A 253 ? 1.5471 0.7631 0.7691 0.1198  0.2380  -0.0839 158  LEU A C   
1968 O O   . LEU A 253 ? 1.6120 0.7533 0.7648 0.1328  0.2357  -0.0835 158  LEU A O   
1969 C CB  . LEU A 253 ? 1.5000 0.8033 0.7327 0.1958  0.2489  -0.0937 158  LEU A CB  
1970 C CG  . LEU A 253 ? 1.5530 0.9484 0.8088 0.2413  0.2649  -0.1000 158  LEU A CG  
1971 C CD1 . LEU A 253 ? 1.5725 0.9751 0.8129 0.2768  0.2570  -0.1030 158  LEU A CD1 
1972 C CD2 . LEU A 253 ? 1.6408 1.0188 0.8423 0.2831  0.2772  -0.1020 158  LEU A CD2 
1973 N N   . ALA A 254 ? 1.4672 0.6879 0.7239 0.0798  0.2264  -0.0793 159  ALA A N   
1974 C CA  . ALA A 254 ? 1.4820 0.6344 0.7050 0.0451  0.2107  -0.0723 159  ALA A CA  
1975 C C   . ALA A 254 ? 1.5116 0.6723 0.7518 0.0201  0.2177  -0.0699 159  ALA A C   
1976 O O   . ALA A 254 ? 1.5270 0.6313 0.7273 -0.0011 0.2074  -0.0652 159  ALA A O   
1977 C CB  . ALA A 254 ? 1.4461 0.6158 0.7013 0.0178  0.1968  -0.0676 159  ALA A CB  
1978 N N   . SER A 255 ? 1.4316 0.6630 0.7276 0.0209  0.2348  -0.0726 160  SER A N   
1979 C CA  . SER A 255 ? 1.4213 0.6620 0.7323 0.0010  0.2442  -0.0700 160  SER A CA  
1980 C C   . SER A 255 ? 1.5017 0.7455 0.7905 0.0280  0.2616  -0.0733 160  SER A C   
1981 O O   . SER A 255 ? 1.4794 0.7499 0.7896 0.0169  0.2751  -0.0717 160  SER A O   
1982 C CB  . SER A 255 ? 1.4186 0.7247 0.7977 -0.0228 0.2503  -0.0694 160  SER A CB  
1983 O OG  . SER A 255 ? 1.5604 0.9327 0.9799 -0.0090 0.2615  -0.0749 160  SER A OG  
1984 N N   . LEU A 256 ? 1.5100 0.7214 0.7484 0.0656  0.2609  -0.0772 161  LEU A N   
1985 C CA  . LEU A 256 ? 1.5443 0.7562 0.7507 0.1003  0.2760  -0.0804 161  LEU A CA  
1986 C C   . LEU A 256 ? 1.6458 0.7827 0.7952 0.0929  0.2727  -0.0779 161  LEU A C   
1987 O O   . LEU A 256 ? 1.6548 0.8156 0.8075 0.1015  0.2888  -0.0778 161  LEU A O   
1988 C CB  . LEU A 256 ? 1.5967 0.7943 0.7584 0.1505  0.2751  -0.0858 161  LEU A CB  
1989 C CG  . LEU A 256 ? 1.6900 0.9253 0.8343 0.1966  0.2940  -0.0896 161  LEU A CG  
1990 C CD1 . LEU A 256 ? 1.6252 0.9860 0.8515 0.1915  0.3129  -0.0899 161  LEU A CD1 
1991 C CD2 . LEU A 256 ? 1.7997 0.9971 0.8788 0.2521  0.2892  -0.0947 161  LEU A CD2 
1992 N N   . PRO A 257 ? 1.6293 0.6830 0.7281 0.0736  0.2527  -0.0754 162  PRO A N   
1993 C CA  . PRO A 257 ? 1.6693 0.6600 0.7153 0.0645  0.2492  -0.0739 162  PRO A CA  
1994 C C   . PRO A 257 ? 1.6599 0.6936 0.7514 0.0389  0.2602  -0.0696 162  PRO A C   
1995 O O   . PRO A 257 ? 1.6827 0.6931 0.7425 0.0474  0.2679  -0.0698 162  PRO A O   
1996 C CB  . PRO A 257 ? 1.7229 0.6421 0.7250 0.0349  0.2244  -0.0706 162  PRO A CB  
1997 C CG  . PRO A 257 ? 1.7250 0.6869 0.7777 0.0198  0.2174  -0.0681 162  PRO A CG  
1998 C CD  . PRO A 257 ? 1.6536 0.6697 0.7372 0.0573  0.2321  -0.0734 162  PRO A CD  
1999 N N   . ALA A 258 ? 1.5480 0.6394 0.7071 0.0109  0.2611  -0.0658 163  ALA A N   
2000 C CA  . ALA A 258 ? 1.4996 0.6264 0.6976 -0.0119 0.2713  -0.0613 163  ALA A CA  
2001 C C   . ALA A 258 ? 1.5450 0.7127 0.7581 0.0058  0.2953  -0.0624 163  ALA A C   
2002 O O   . ALA A 258 ? 1.5405 0.7038 0.7486 -0.0031 0.3045  -0.0587 163  ALA A O   
2003 C CB  . ALA A 258 ? 1.4447 0.6190 0.7020 -0.0362 0.2677  -0.0588 163  ALA A CB  
2004 N N   . ILE A 259 ? 1.5042 0.7160 0.7335 0.0314  0.3056  -0.0667 164  ILE A N   
2005 C CA  . ILE A 259 ? 1.5103 0.7771 0.7545 0.0492  0.3288  -0.0670 164  ILE A CA  
2006 C C   . ILE A 259 ? 1.6198 0.8383 0.7985 0.0806  0.3329  -0.0685 164  ILE A C   
2007 O O   . ILE A 259 ? 1.6224 0.8618 0.8006 0.0834  0.3498  -0.0655 164  ILE A O   
2008 C CB  . ILE A 259 ? 1.5356 0.8772 0.8167 0.0690  0.3365  -0.0713 164  ILE A CB  
2009 C CG1 . ILE A 259 ? 1.4892 0.8666 0.8262 0.0398  0.3281  -0.0715 164  ILE A CG1 
2010 C CG2 . ILE A 259 ? 1.5481 0.9676 0.8521 0.0805  0.3613  -0.0700 164  ILE A CG2 
2011 C CD1 . ILE A 259 ? 1.6067 1.0384 0.9677 0.0620  0.3268  -0.0771 164  ILE A CD1 
2012 N N   . ILE A 260 ? 1.6228 0.7706 0.7403 0.1030  0.3170  -0.0729 165  ILE A N   
2013 C CA  . ILE A 260 ? 1.6899 0.7765 0.7306 0.1377  0.3176  -0.0763 165  ILE A CA  
2014 C C   . ILE A 260 ? 1.7468 0.7750 0.7529 0.1154  0.3125  -0.0731 165  ILE A C   
2015 O O   . ILE A 260 ? 1.7667 0.8018 0.7562 0.1310  0.3273  -0.0723 165  ILE A O   
2016 C CB  . ILE A 260 ? 1.7934 0.8066 0.7675 0.1650  0.2997  -0.0821 165  ILE A CB  
2017 C CG1 . ILE A 260 ? 1.7844 0.8593 0.7870 0.1962  0.3061  -0.0855 165  ILE A CG1 
2018 C CG2 . ILE A 260 ? 1.9017 0.8311 0.7801 0.2007  0.2975  -0.0866 165  ILE A CG2 
2019 C CD1 . ILE A 260 ? 1.9708 0.9756 0.9126 0.2210  0.2885  -0.0899 165  ILE A CD1 
2020 N N   . HIS A 261 ? 1.6892 0.6673 0.6833 0.0810  0.2919  -0.0711 166  HIS A N   
2021 C CA  . HIS A 261 ? 1.7130 0.6354 0.6663 0.0611  0.2827  -0.0690 166  HIS A CA  
2022 C C   . HIS A 261 ? 1.7018 0.6665 0.7046 0.0297  0.2900  -0.0618 166  HIS A C   
2023 O O   . HIS A 261 ? 1.7248 0.6537 0.6934 0.0208  0.2862  -0.0601 166  HIS A O   
2024 C CB  . HIS A 261 ? 1.7562 0.6099 0.6655 0.0380  0.2553  -0.0696 166  HIS A CB  
2025 C CG  . HIS A 261 ? 1.8772 0.6623 0.7163 0.0658  0.2452  -0.0760 166  HIS A CG  
2026 N ND1 . HIS A 261 ? 1.8890 0.6953 0.7459 0.0844  0.2458  -0.0781 166  HIS A ND1 
2027 C CD2 . HIS A 261 ? 1.9928 0.6831 0.7379 0.0784  0.2336  -0.0808 166  HIS A CD2 
2028 C CE1 . HIS A 261 ? 1.9704 0.6921 0.7416 0.1107  0.2355  -0.0834 166  HIS A CE1 
2029 N NE2 . HIS A 261 ? 2.0436 0.6893 0.7428 0.1073  0.2276  -0.0855 166  HIS A NE2 
2030 N N   . ARG A 262 ? 1.5862 0.6188 0.6597 0.0142  0.2994  -0.0580 167  ARG A N   
2031 C CA  . ARG A 262 ? 1.5503 0.6074 0.6553 -0.0109 0.3062  -0.0513 167  ARG A CA  
2032 C C   . ARG A 262 ? 1.6239 0.7038 0.7297 0.0019  0.3303  -0.0487 167  ARG A C   
2033 O O   . ARG A 262 ? 1.6027 0.7317 0.7350 0.0155  0.3474  -0.0494 167  ARG A O   
2034 C CB  . ARG A 262 ? 1.4856 0.5915 0.6522 -0.0332 0.3057  -0.0484 167  ARG A CB  
2035 C CG  . ARG A 262 ? 1.5099 0.5995 0.6781 -0.0536 0.2825  -0.0472 167  ARG A CG  
2036 C CD  . ARG A 262 ? 1.4947 0.5873 0.6701 -0.0740 0.2792  -0.0407 167  ARG A CD  
2037 N NE  . ARG A 262 ? 1.5530 0.6427 0.7286 -0.0915 0.2572  -0.0386 167  ARG A NE  
2038 C CZ  . ARG A 262 ? 1.6611 0.7688 0.8506 -0.1052 0.2513  -0.0331 167  ARG A CZ  
2039 N NH1 . ARG A 262 ? 1.5500 0.6682 0.7502 -0.1035 0.2656  -0.0296 167  ARG A NH1 
2040 N NH2 . ARG A 262 ? 1.3758 0.4919 0.5649 -0.1194 0.2314  -0.0305 167  ARG A NH2 
2041 N N   . ASN A 263 ? 1.6193 0.6678 0.6943 -0.0032 0.3312  -0.0451 168  ASN A N   
2042 C CA  . ASN A 263 ? 1.6394 0.7000 0.7060 0.0064  0.3530  -0.0409 168  ASN A CA  
2043 C C   . ASN A 263 ? 1.7100 0.7549 0.7717 -0.0137 0.3529  -0.0339 168  ASN A C   
2044 O O   . ASN A 263 ? 1.7016 0.7194 0.7504 -0.0274 0.3335  -0.0338 168  ASN A O   
2045 C CB  . ASN A 263 ? 1.6678 0.6913 0.6757 0.0388  0.3550  -0.0458 168  ASN A CB  
2046 C CG  . ASN A 263 ? 1.9273 0.9695 0.9301 0.0706  0.3604  -0.0519 168  ASN A CG  
2047 O OD1 . ASN A 263 ? 1.7983 0.9017 0.8293 0.0842  0.3817  -0.0498 168  ASN A OD1 
2048 N ND2 . ASN A 263 ? 1.8759 0.8635 0.8331 0.0852  0.3415  -0.0592 168  ASN A ND2 
2049 N N   . VAL A 264 ? 1.6869 0.7521 0.7559 -0.0150 0.3749  -0.0272 169  VAL A N   
2050 C CA  . VAL A 264 ? 1.6951 0.7409 0.7508 -0.0279 0.3782  -0.0197 169  VAL A CA  
2051 C C   . VAL A 264 ? 1.7826 0.7860 0.7813 -0.0102 0.3755  -0.0208 169  VAL A C   
2052 O O   . VAL A 264 ? 1.7964 0.8002 0.7735 0.0109  0.3885  -0.0223 169  VAL A O   
2053 C CB  . VAL A 264 ? 1.7406 0.8162 0.8216 -0.0422 0.4022  -0.0110 169  VAL A CB  
2054 C CG1 . VAL A 264 ? 1.7599 0.8718 0.8443 -0.0302 0.4255  -0.0095 169  VAL A CG1 
2055 C CG2 . VAL A 264 ? 1.7566 0.7996 0.8112 -0.0502 0.4056  -0.0028 169  VAL A CG2 
2056 N N   . PHE A 265 ? 1.7490 0.7207 0.7225 -0.0179 0.3572  -0.0205 170  PHE A N   
2057 C CA  . PHE A 265 ? 1.7936 0.7247 0.7117 -0.0070 0.3493  -0.0225 170  PHE A CA  
2058 C C   . PHE A 265 ? 1.8734 0.7970 0.7770 -0.0135 0.3496  -0.0150 170  PHE A C   
2059 O O   . PHE A 265 ? 1.8379 0.7791 0.7679 -0.0267 0.3477  -0.0098 170  PHE A O   
2060 C CB  . PHE A 265 ? 1.8274 0.7280 0.7178 -0.0120 0.3216  -0.0306 170  PHE A CB  
2061 C CG  . PHE A 265 ? 1.8562 0.7450 0.7403 0.0000  0.3178  -0.0386 170  PHE A CG  
2062 C CD1 . PHE A 265 ? 1.9485 0.8059 0.7868 0.0273  0.3244  -0.0441 170  PHE A CD1 
2063 C CD2 . PHE A 265 ? 1.8473 0.7511 0.7625 -0.0124 0.3060  -0.0409 170  PHE A CD2 
2064 C CE1 . PHE A 265 ? 1.9816 0.8220 0.8034 0.0455  0.3204  -0.0516 170  PHE A CE1 
2065 C CE2 . PHE A 265 ? 1.9022 0.7891 0.8034 0.0027  0.3019  -0.0480 170  PHE A CE2 
2066 C CZ  . PHE A 265 ? 1.9360 0.7896 0.7885 0.0329  0.3090  -0.0534 170  PHE A CZ  
2067 N N   . PHE A 266 ? 1.8967 0.7919 0.7527 -0.0006 0.3510  -0.0150 171  PHE A N   
2068 C CA  . PHE A 266 ? 1.9226 0.8080 0.7538 -0.0003 0.3505  -0.0085 171  PHE A CA  
2069 C C   . PHE A 266 ? 1.9858 0.8600 0.7885 -0.0088 0.3216  -0.0131 171  PHE A C   
2070 O O   . PHE A 266 ? 1.9831 0.8468 0.7786 -0.0176 0.3033  -0.0210 171  PHE A O   
2071 C CB  . PHE A 266 ? 1.9974 0.8641 0.7927 0.0189  0.3701  -0.0052 171  PHE A CB  
2072 C CG  . PHE A 266 ? 2.0248 0.9107 0.8431 0.0213  0.4001  0.0030  171  PHE A CG  
2073 C CD1 . PHE A 266 ? 2.0750 0.9601 0.8945 0.0148  0.4142  0.0142  171  PHE A CD1 
2074 C CD2 . PHE A 266 ? 2.0621 0.9667 0.8940 0.0303  0.4142  0.0001  171  PHE A CD2 
2075 C CE1 . PHE A 266 ? 2.0957 0.9955 0.9303 0.0089  0.4415  0.0228  171  PHE A CE1 
2076 C CE2 . PHE A 266 ? 2.0991 1.0339 0.9530 0.0270  0.4418  0.0089  171  PHE A CE2 
2077 C CZ  . PHE A 266 ? 2.0802 1.0107 0.9352 0.0124  0.4552  0.0204  171  PHE A CZ  
2078 N N   . ILE A 267 ? 1.9536 0.8314 0.7366 -0.0070 0.3174  -0.0075 172  ILE A N   
2079 C CA  . ILE A 267 ? 2.3597 1.2434 1.1163 -0.0167 0.2908  -0.0102 172  ILE A CA  
2080 C C   . ILE A 267 ? 2.6752 1.5380 1.3804 -0.0020 0.2930  -0.0094 172  ILE A C   
2081 O O   . ILE A 267 ? 2.1729 1.0155 0.8383 -0.0073 0.2765  -0.0168 172  ILE A O   
2082 C CB  . ILE A 267 ? 2.3623 1.2884 1.1465 -0.0251 0.2801  -0.0041 172  ILE A CB  
2083 C CG1 . ILE A 267 ? 2.3210 1.2671 1.1554 -0.0388 0.2779  -0.0052 172  ILE A CG1 
2084 C CG2 . ILE A 267 ? 2.3848 1.3352 1.1430 -0.0364 0.2528  -0.0056 172  ILE A CG2 
2085 C CD1 . ILE A 267 ? 2.3780 1.3617 1.2407 -0.0395 0.2739  0.0015  172  ILE A CD1 
2086 N N   . ILE A 272 ? 1.9707 0.8360 0.7645 0.0102  0.3825  0.0291  177  ILE A N   
2087 C CA  . ILE A 272 ? 1.9319 0.8140 0.7612 -0.0019 0.3748  0.0286  177  ILE A CA  
2088 C C   . ILE A 272 ? 1.9378 0.8473 0.8117 -0.0170 0.3665  0.0192  177  ILE A C   
2089 O O   . ILE A 272 ? 1.9170 0.8412 0.7930 -0.0187 0.3455  0.0120  177  ILE A O   
2090 C CB  . ILE A 272 ? 1.9651 0.8602 0.7796 0.0089  0.3538  0.0297  177  ILE A CB  
2091 N N   . THR A 273 ? 1.8721 0.7879 0.7771 -0.0291 0.3831  0.0197  178  THR A N   
2092 C CA  . THR A 273 ? 1.8286 0.7718 0.7744 -0.0388 0.3794  0.0117  178  THR A CA  
2093 C C   . THR A 273 ? 1.8365 0.8001 0.8116 -0.0479 0.3576  0.0071  178  THR A C   
2094 O O   . THR A 273 ? 1.8317 0.7936 0.8056 -0.0489 0.3524  0.0114  178  THR A O   
2095 C CB  . THR A 273 ? 1.8955 0.8526 0.8675 -0.0504 0.4031  0.0150  178  THR A CB  
2096 O OG1 . THR A 273 ? 1.9140 0.8618 0.8927 -0.0644 0.4087  0.0212  178  THR A OG1 
2097 C CG2 . THR A 273 ? 1.8923 0.8426 0.8401 -0.0429 0.4256  0.0201  178  THR A CG2 
2098 N N   . VAL A 274 ? 1.7593 0.7391 0.7543 -0.0517 0.3451  -0.0012 179  VAL A N   
2099 C CA  . VAL A 274 ? 1.7141 0.7157 0.7372 -0.0619 0.3249  -0.0051 179  VAL A CA  
2100 C C   . VAL A 274 ? 1.7040 0.7216 0.7589 -0.0662 0.3263  -0.0119 179  VAL A C   
2101 O O   . VAL A 274 ? 1.7234 0.7298 0.7623 -0.0569 0.3292  -0.0165 179  VAL A O   
2102 C CB  . VAL A 274 ? 1.7741 0.7766 0.7740 -0.0639 0.2992  -0.0072 179  VAL A CB  
2103 C CG1 . VAL A 274 ? 1.7800 0.7885 0.7603 -0.0579 0.2937  -0.0003 179  VAL A CG1 
2104 C CG2 . VAL A 274 ? 1.8103 0.7866 0.7725 -0.0597 0.2937  -0.0125 179  VAL A CG2 
2105 N N   . CYS A 275 ? 1.5886 0.6311 0.6836 -0.0765 0.3238  -0.0127 180  CYS A N   
2106 C CA  . CYS A 275 ? 1.5476 0.6109 0.6734 -0.0784 0.3232  -0.0190 180  CYS A CA  
2107 C C   . CYS A 275 ? 1.5897 0.6487 0.7090 -0.0816 0.2986  -0.0234 180  CYS A C   
2108 O O   . CYS A 275 ? 1.5598 0.6360 0.6978 -0.0919 0.2848  -0.0220 180  CYS A O   
2109 C CB  . CYS A 275 ? 1.5088 0.6007 0.6775 -0.0898 0.3318  -0.0181 180  CYS A CB  
2110 S SG  . CYS A 275 ? 1.5217 0.6492 0.7308 -0.0897 0.3296  -0.0259 180  CYS A SG  
2111 N N   . ALA A 276 ? 1.5751 0.6069 0.6597 -0.0733 0.2926  -0.0279 181  ALA A N   
2112 C CA  . ALA A 276 ? 1.5875 0.6008 0.6494 -0.0818 0.2686  -0.0313 181  ALA A CA  
2113 C C   . ALA A 276 ? 1.6608 0.6493 0.7047 -0.0704 0.2664  -0.0386 181  ALA A C   
2114 O O   . ALA A 276 ? 1.6747 0.6580 0.7110 -0.0496 0.2830  -0.0415 181  ALA A O   
2115 C CB  . ALA A 276 ? 1.6347 0.6210 0.6489 -0.0862 0.2575  -0.0297 181  ALA A CB  
2116 N N   . PHE A 277 ? 1.6177 0.5906 0.6487 -0.0831 0.2453  -0.0406 182  PHE A N   
2117 C CA  . PHE A 277 ? 1.6510 0.5847 0.6493 -0.0729 0.2382  -0.0470 182  PHE A CA  
2118 C C   . PHE A 277 ? 1.7778 0.6452 0.7010 -0.0685 0.2296  -0.0508 182  PHE A C   
2119 O O   . PHE A 277 ? 1.7920 0.6485 0.6914 -0.0884 0.2177  -0.0480 182  PHE A O   
2120 C CB  . PHE A 277 ? 1.6538 0.5925 0.6634 -0.0937 0.2185  -0.0458 182  PHE A CB  
2121 C CG  . PHE A 277 ? 1.7013 0.6055 0.6867 -0.0805 0.2135  -0.0512 182  PHE A CG  
2122 C CD1 . PHE A 277 ? 1.8101 0.6394 0.7207 -0.0840 0.1973  -0.0545 182  PHE A CD1 
2123 C CD2 . PHE A 277 ? 1.6884 0.6311 0.7197 -0.0652 0.2236  -0.0530 182  PHE A CD2 
2124 C CE1 . PHE A 277 ? 1.8627 0.6487 0.7394 -0.0673 0.1926  -0.0592 182  PHE A CE1 
2125 C CE2 . PHE A 277 ? 1.7597 0.6713 0.7643 -0.0479 0.2188  -0.0577 182  PHE A CE2 
2126 C CZ  . PHE A 277 ? 1.8133 0.6432 0.7383 -0.0470 0.2036  -0.0605 182  PHE A CZ  
2127 N N   . HIS A 278 ? 1.7852 0.6099 0.6670 -0.0407 0.2352  -0.0575 183  HIS A N   
2128 C CA  . HIS A 278 ? 1.8646 0.6142 0.6641 -0.0331 0.2263  -0.0626 183  HIS A CA  
2129 C C   . HIS A 278 ? 1.9828 0.6631 0.7228 -0.0417 0.2041  -0.0670 183  HIS A C   
2130 O O   . HIS A 278 ? 1.9752 0.6559 0.7251 -0.0273 0.2055  -0.0689 183  HIS A O   
2131 C CB  . HIS A 278 ? 1.9046 0.6447 0.6825 0.0090  0.2476  -0.0669 183  HIS A CB  
2132 C CG  . HIS A 278 ? 2.0382 0.6946 0.7246 0.0220  0.2384  -0.0734 183  HIS A CG  
2133 N ND1 . HIS A 278 ? 2.1358 0.7251 0.7553 0.0511  0.2334  -0.0812 183  HIS A ND1 
2134 C CD2 . HIS A 278 ? 2.0926 0.7187 0.7392 0.0096  0.2316  -0.0735 183  HIS A CD2 
2135 C CE1 . HIS A 278 ? 2.2089 0.7243 0.7479 0.0550  0.2240  -0.0862 183  HIS A CE1 
2136 N NE2 . HIS A 278 ? 2.1878 0.7257 0.7427 0.0289  0.2224  -0.0819 183  HIS A NE2 
2137 N N   . TYR A 279 ? 2.0083 0.6274 0.6820 -0.0669 0.1833  -0.0682 184  TYR A N   
2138 C CA  . TYR A 279 ? 2.0840 0.6224 0.6852 -0.0849 0.1598  -0.0713 184  TYR A CA  
2139 C C   . TYR A 279 ? 2.2436 0.6791 0.7421 -0.0594 0.1562  -0.0806 184  TYR A C   
2140 O O   . TYR A 279 ? 2.2577 0.6793 0.7291 -0.0530 0.1600  -0.0831 184  TYR A O   
2141 C CB  . TYR A 279 ? 2.1014 0.6479 0.6972 -0.1416 0.1359  -0.0652 184  TYR A CB  
2142 C CG  . TYR A 279 ? 2.0363 0.6798 0.7229 -0.1624 0.1374  -0.0561 184  TYR A CG  
2143 C CD1 . TYR A 279 ? 2.0480 0.7014 0.7550 -0.1750 0.1295  -0.0529 184  TYR A CD1 
2144 C CD2 . TYR A 279 ? 1.9785 0.6983 0.7232 -0.1666 0.1464  -0.0508 184  TYR A CD2 
2145 C CE1 . TYR A 279 ? 1.9755 0.7161 0.7612 -0.1906 0.1306  -0.0452 184  TYR A CE1 
2146 C CE2 . TYR A 279 ? 1.9093 0.7101 0.7270 -0.1803 0.1472  -0.0432 184  TYR A CE2 
2147 C CZ  . TYR A 279 ? 2.0057 0.8183 0.8447 -0.1922 0.1392  -0.0407 184  TYR A CZ  
2148 O OH  . TYR A 279 ? 1.9722 0.8631 0.8789 -0.2024 0.1396  -0.0337 184  TYR A OH  
2149 N N   . GLU A 280 ? 2.2784 0.6378 0.7141 -0.0414 0.1488  -0.0857 185  GLU A N   
2150 C CA  . GLU A 280 ? 2.7697 1.0159 1.0929 -0.0102 0.1438  -0.0953 185  GLU A CA  
2151 C C   . GLU A 280 ? 3.0215 1.1759 1.2534 -0.0564 0.1159  -0.0973 185  GLU A C   
2152 O O   . GLU A 280 ? 2.4882 0.6433 0.7058 -0.0681 0.1141  -0.0987 185  GLU A O   
2153 C CB  . GLU A 280 ? 2.8403 1.0337 1.1217 0.0270  0.1443  -0.0994 185  GLU A CB  
2154 N N   . THR A 285 ? 3.3874 1.3917 1.4547 -0.3816 -0.0156 -0.0610 190  THR A N   
2155 C CA  . THR A 285 ? 3.5131 1.3749 1.4719 -0.3670 -0.0237 -0.0653 190  THR A CA  
2156 C C   . THR A 285 ? 3.4931 1.3982 1.5186 -0.3150 -0.0043 -0.0636 190  THR A C   
2157 O O   . THR A 285 ? 3.4998 1.3871 1.5145 -0.3384 -0.0136 -0.0561 190  THR A O   
2158 C CB  . THR A 285 ? 3.6107 1.4801 1.5970 -0.3077 -0.0232 -0.0796 190  THR A CB  
2159 O OG1 . THR A 285 ? 3.5985 1.5065 1.5996 -0.3437 -0.0384 -0.0819 190  THR A OG1 
2160 C CG2 . THR A 285 ? 3.6193 1.4503 1.5998 -0.2774 -0.0327 -0.0849 190  THR A CG2 
2161 N N   . LEU A 286 ? 3.3728 1.3391 1.4666 -0.2481 0.0222  -0.0700 191  LEU A N   
2162 C CA  . LEU A 286 ? 3.3004 1.3210 1.4626 -0.1948 0.0425  -0.0700 191  LEU A CA  
2163 C C   . LEU A 286 ? 3.2018 1.3700 1.4988 -0.2172 0.0498  -0.0598 191  LEU A C   
2164 O O   . LEU A 286 ? 3.1702 1.3547 1.4936 -0.2079 0.0519  -0.0560 191  LEU A O   
2165 C CB  . LEU A 286 ? 3.2828 1.3216 1.4642 -0.1214 0.0676  -0.0800 191  LEU A CB  
2166 C CG  . LEU A 286 ? 3.4909 1.3928 1.5432 -0.0792 0.0648  -0.0911 191  LEU A CG  
2167 N N   . PRO A 287 ? 3.0740 1.3463 1.4517 -0.2422 0.0537  -0.0554 192  PRO A N   
2168 C CA  . PRO A 287 ? 2.9491 1.3489 1.4418 -0.2555 0.0604  -0.0465 192  PRO A CA  
2169 C C   . PRO A 287 ? 3.0089 1.4175 1.4953 -0.3123 0.0395  -0.0354 192  PRO A C   
2170 O O   . PRO A 287 ? 2.9164 1.4155 1.4855 -0.3157 0.0444  -0.0286 192  PRO A O   
2171 C CB  . PRO A 287 ? 2.9020 1.3860 1.4539 -0.2645 0.0673  -0.0450 192  PRO A CB  
2172 C CG  . PRO A 287 ? 3.0286 1.4412 1.5143 -0.2410 0.0714  -0.0545 192  PRO A CG  
2173 C CD  . PRO A 287 ? 3.1042 1.3830 1.4699 -0.2533 0.0529  -0.0584 192  PRO A CD  
2174 N N   . ILE A 288 ? 3.0773 1.3928 1.4633 -0.3584 0.0162  -0.0332 193  ILE A N   
2175 C CA  . ILE A 288 ? 3.1000 1.4168 1.4664 -0.4195 -0.0047 -0.0212 193  ILE A CA  
2176 C C   . ILE A 288 ? 3.1700 1.4419 1.5211 -0.3982 -0.0025 -0.0195 193  ILE A C   
2177 O O   . ILE A 288 ? 3.1082 1.4483 1.5128 -0.4209 -0.0057 -0.0093 193  ILE A O   
2178 C CB  . ILE A 288 ? 3.2675 1.4883 1.5200 -0.4794 -0.0304 -0.0197 193  ILE A CB  
2179 C CG1 . ILE A 288 ? 3.2544 1.5473 1.5258 -0.5561 -0.0500 -0.0046 193  ILE A CG1 
2180 N N   . GLY A 289 ? 3.2044 1.3673 1.4828 -0.3499 0.0035  -0.0296 194  GLY A N   
2181 C CA  . GLY A 289 ? 3.2350 1.3445 1.4858 -0.3175 0.0067  -0.0298 194  GLY A CA  
2182 C C   . GLY A 289 ? 3.1656 1.3758 1.5242 -0.2600 0.0306  -0.0330 194  GLY A C   
2183 O O   . GLY A 289 ? 3.1725 1.3616 1.5238 -0.2323 0.0338  -0.0326 194  GLY A O   
2184 N N   . LEU A 290 ? 3.0161 1.3333 1.4703 -0.2430 0.0470  -0.0361 195  LEU A N   
2185 C CA  . LEU A 290 ? 2.9057 1.3241 1.4639 -0.1970 0.0694  -0.0392 195  LEU A CA  
2186 C C   . LEU A 290 ? 2.8417 1.3849 1.5049 -0.2294 0.0698  -0.0300 195  LEU A C   
2187 O O   . LEU A 290 ? 2.7657 1.3753 1.4982 -0.2099 0.0792  -0.0290 195  LEU A O   
2188 C CB  . LEU A 290 ? 2.8865 1.3233 1.4644 -0.1507 0.0894  -0.0492 195  LEU A CB  
2189 C CG  . LEU A 290 ? 2.8531 1.3833 1.5236 -0.1031 0.1134  -0.0534 195  LEU A CG  
2190 C CD1 . LEU A 290 ? 2.8947 1.3889 1.5362 -0.0574 0.1183  -0.0580 195  LEU A CD1 
2191 C CD2 . LEU A 290 ? 2.8657 1.4229 1.5562 -0.0737 0.1315  -0.0601 195  LEU A CD2 
2192 N N   . GLY A 291 ? 2.7858 1.3598 1.4549 -0.2758 0.0589  -0.0239 196  GLY A N   
2193 C CA  . GLY A 291 ? 2.6851 1.3736 1.4388 -0.3046 0.0570  -0.0147 196  GLY A CA  
2194 C C   . GLY A 291 ? 2.7261 1.4291 1.4808 -0.3382 0.0428  -0.0040 196  GLY A C   
2195 O O   . GLY A 291 ? 2.6293 1.4301 1.4618 -0.3436 0.0454  0.0023  196  GLY A O   
2196 N N   . LEU A 292 ? 2.7864 1.3855 1.4470 -0.3603 0.0276  -0.0016 197  LEU A N   
2197 C CA  . LEU A 292 ? 2.8103 1.3976 1.4489 -0.3948 0.0133  0.0094  197  LEU A CA  
2198 C C   . LEU A 292 ? 2.8376 1.4195 1.5009 -0.3468 0.0252  0.0056  197  LEU A C   
2199 O O   . LEU A 292 ? 2.8071 1.4302 1.5000 -0.3615 0.0206  0.0144  197  LEU A O   
2200 C CB  . LEU A 292 ? 2.9530 1.4115 1.4637 -0.4396 -0.0078 0.0130  197  LEU A CB  
2201 C CG  . LEU A 292 ? 3.0642 1.5002 1.5286 -0.5008 -0.0282 0.0281  197  LEU A CG  
2202 C CD1 . LEU A 292 ? 3.1127 1.4773 1.5389 -0.4751 -0.0266 0.0290  197  LEU A CD1 
2203 C CD2 . LEU A 292 ? 3.0024 1.5793 1.5483 -0.5457 -0.0341 0.0416  197  LEU A CD2 
2204 N N   . THR A 293 ? 2.7973 1.3377 1.4499 -0.2884 0.0407  -0.0072 198  THR A N   
2205 C CA  . THR A 293 ? 2.7711 1.3119 1.4441 -0.2366 0.0529  -0.0126 198  THR A CA  
2206 C C   . THR A 293 ? 2.6657 1.3394 1.4624 -0.2180 0.0676  -0.0132 198  THR A C   
2207 O O   . THR A 293 ? 2.6360 1.3333 1.4608 -0.1961 0.0714  -0.0131 198  THR A O   
2208 C CB  . THR A 293 ? 2.9273 1.3974 1.5495 -0.1804 0.0648  -0.0256 198  THR A CB  
2209 N N   . LYS A 294 ? 2.5252 1.2789 1.3884 -0.2257 0.0751  -0.0140 199  LYS A N   
2210 C CA  . LYS A 294 ? 2.3971 1.2633 1.3655 -0.2105 0.0880  -0.0151 199  LYS A CA  
2211 C C   . LYS A 294 ? 2.3685 1.3004 1.3779 -0.2447 0.0768  -0.0037 199  LYS A C   
2212 O O   . LYS A 294 ? 2.2923 1.2875 1.3650 -0.2270 0.0836  -0.0046 199  LYS A O   
2213 C CB  . LYS A 294 ? 2.3773 1.2908 1.3871 -0.2054 0.0995  -0.0191 199  LYS A CB  
2214 C CG  . LYS A 294 ? 2.5776 1.4551 1.5694 -0.1650 0.1155  -0.0302 199  LYS A CG  
2215 N N   . ASN A 295 ? 2.3433 1.2659 1.3163 -0.2937 0.0596  0.0070  200  ASN A N   
2216 C CA  . ASN A 295 ? 2.2965 1.2889 1.3013 -0.3292 0.0479  0.0198  200  ASN A CA  
2217 C C   . ASN A 295 ? 2.3632 1.3272 1.3466 -0.3321 0.0411  0.0253  200  ASN A C   
2218 O O   . ASN A 295 ? 2.2906 1.3295 1.3305 -0.3318 0.0412  0.0307  200  ASN A O   
2219 C CB  . ASN A 295 ? 2.3345 1.3270 1.2976 -0.3837 0.0310  0.0302  200  ASN A CB  
2220 C CG  . ASN A 295 ? 2.5542 1.6287 1.5444 -0.4230 0.0183  0.0453  200  ASN A CG  
2221 O OD1 . ASN A 295 ? 2.4267 1.6013 1.4916 -0.4090 0.0240  0.0475  200  ASN A OD1 
2222 N ND2 . ASN A 295 ? 2.4826 1.5158 1.4066 -0.4743 0.0004  0.0564  200  ASN A ND2 
2223 N N   . ILE A 296 ? 2.4168 1.2681 1.3128 -0.3319 0.0353  0.0238  201  ILE A N   
2224 C CA  . ILE A 296 ? 2.4643 1.2644 1.3182 -0.3334 0.0281  0.0295  201  ILE A CA  
2225 C C   . ILE A 296 ? 2.4682 1.2874 1.3669 -0.2730 0.0437  0.0192  201  ILE A C   
2226 O O   . ILE A 296 ? 2.4943 1.2831 1.3684 -0.2646 0.0398  0.0229  201  ILE A O   
2227 C CB  . ILE A 296 ? 2.6436 1.2997 1.3707 -0.3531 0.0155  0.0310  201  ILE A CB  
2228 C CG1 . ILE A 296 ? 2.7195 1.3205 1.3854 -0.3843 0.0010  0.0438  201  ILE A CG1 
2229 C CG2 . ILE A 296 ? 2.7059 1.2761 1.3855 -0.2979 0.0266  0.0159  201  ILE A CG2 
2230 N N   . LEU A 297 ? 2.3532 1.2252 1.3152 -0.2341 0.0606  0.0073  202  LEU A N   
2231 C CA  . LEU A 297 ? 2.3054 1.2084 1.3127 -0.1821 0.0752  -0.0028 202  LEU A CA  
2232 C C   . LEU A 297 ? 2.2171 1.2367 1.3295 -0.1749 0.0852  -0.0057 202  LEU A C   
2233 O O   . LEU A 297 ? 2.1656 1.2301 1.3220 -0.1532 0.0896  -0.0084 202  LEU A O   
2234 C CB  . LEU A 297 ? 2.3525 1.2009 1.3240 -0.1389 0.0874  -0.0154 202  LEU A CB  
2235 C CG  . LEU A 297 ? 2.3862 1.2664 1.3926 -0.0817 0.1033  -0.0267 202  LEU A CG  
2236 C CD1 . LEU A 297 ? 2.2906 1.2707 1.3906 -0.0696 0.1193  -0.0340 202  LEU A CD1 
2237 C CD2 . LEU A 297 ? 2.4282 1.3058 1.4286 -0.0662 0.0984  -0.0241 202  LEU A CD2 
2238 N N   . GLY A 298 ? 2.1214 1.1813 1.2654 -0.1898 0.0886  -0.0059 203  GLY A N   
2239 C CA  . GLY A 298 ? 2.0206 1.1726 1.2486 -0.1812 0.0983  -0.0093 203  GLY A CA  
2240 C C   . GLY A 298 ? 2.0037 1.2204 1.2677 -0.2055 0.0881  0.0008  203  GLY A C   
2241 O O   . GLY A 298 ? 1.9329 1.2106 1.2553 -0.1890 0.0935  -0.0026 203  GLY A O   
2242 N N   . PHE A 299 ? 1.9788 1.1870 1.2067 -0.2453 0.0729  0.0134  204  PHE A N   
2243 C CA  . PHE A 299 ? 1.9262 1.2119 1.1865 -0.2710 0.0639  0.0245  204  PHE A CA  
2244 C C   . PHE A 299 ? 1.9587 1.2334 1.1879 -0.2974 0.0498  0.0368  204  PHE A C   
2245 O O   . PHE A 299 ? 1.9148 1.2538 1.1854 -0.2945 0.0476  0.0417  204  PHE A O   
2246 C CB  . PHE A 299 ? 1.9570 1.2643 1.2107 -0.2919 0.0611  0.0282  204  PHE A CB  
2247 C CG  . PHE A 299 ? 1.9256 1.3308 1.2298 -0.2944 0.0589  0.0346  204  PHE A CG  
2248 C CD1 . PHE A 299 ? 1.9779 1.4351 1.2736 -0.3287 0.0441  0.0496  204  PHE A CD1 
2249 C CD2 . PHE A 299 ? 1.9045 1.3494 1.2587 -0.2617 0.0716  0.0260  204  PHE A CD2 
2250 C CE1 . PHE A 299 ? 1.9391 1.4925 1.2771 -0.3228 0.0424  0.0555  204  PHE A CE1 
2251 C CE2 . PHE A 299 ? 1.8984 1.4233 1.2870 -0.2571 0.0692  0.0314  204  PHE A CE2 
2252 C CZ  . PHE A 299 ? 1.8777 1.4593 1.2586 -0.2840 0.0548  0.0459  204  PHE A CZ  
2253 N N   . LEU A 300 ? 1.9520 1.1423 1.1036 -0.3237 0.0400  0.0421  205  LEU A N   
2254 C CA  . LEU A 300 ? 1.9727 1.1470 1.0822 -0.3615 0.0249  0.0569  205  LEU A CA  
2255 C C   . LEU A 300 ? 1.9792 1.1235 1.0848 -0.3345 0.0277  0.0548  205  LEU A C   
2256 O O   . LEU A 300 ? 1.9519 1.1434 1.0767 -0.3471 0.0217  0.0650  205  LEU A O   
2257 C CB  . LEU A 300 ? 2.0760 1.1591 1.0918 -0.4051 0.0119  0.0636  205  LEU A CB  
2258 C CG  . LEU A 300 ? 2.1336 1.2596 1.1456 -0.4472 0.0032  0.0707  205  LEU A CG  
2259 N N   . PHE A 301 ? 1.9339 1.0068 1.0144 -0.2952 0.0370  0.0420  206  PHE A N   
2260 C CA  . PHE A 301 ? 1.9331 0.9775 1.0055 -0.2618 0.0405  0.0385  206  PHE A CA  
2261 C C   . PHE A 301 ? 1.8505 0.9944 1.0163 -0.2299 0.0500  0.0321  206  PHE A C   
2262 O O   . PHE A 301 ? 1.8338 0.9914 1.0051 -0.2244 0.0463  0.0369  206  PHE A O   
2263 C CB  . PHE A 301 ? 2.0197 0.9732 1.0390 -0.2225 0.0484  0.0261  206  PHE A CB  
2264 N N   . PRO A 302 ? 1.7219 0.9301 0.9552 -0.2101 0.0616  0.0216  207  PRO A N   
2265 C CA  . PRO A 302 ? 1.6288 0.9176 0.9379 -0.1838 0.0686  0.0150  207  PRO A CA  
2266 C C   . PRO A 302 ? 1.5947 0.9590 0.9404 -0.2068 0.0601  0.0261  207  PRO A C   
2267 O O   . PRO A 302 ? 1.5588 0.9627 0.9356 -0.1925 0.0592  0.0261  207  PRO A O   
2268 C CB  . PRO A 302 ? 1.6107 0.9268 0.9628 -0.1627 0.0827  0.0017  207  PRO A CB  
2269 C CG  . PRO A 302 ? 1.7276 0.9786 1.0280 -0.1721 0.0841  0.0010  207  PRO A CG  
2270 C CD  . PRO A 302 ? 1.7363 0.9408 0.9744 -0.2109 0.0686  0.0151  207  PRO A CD  
2271 N N   . PHE A 303 ? 1.5218 0.9109 0.8620 -0.2395 0.0535  0.0357  208  PHE A N   
2272 C CA  . PHE A 303 ? 1.4699 0.9413 0.8402 -0.2587 0.0452  0.0476  208  PHE A CA  
2273 C C   . PHE A 303 ? 1.5205 0.9883 0.8630 -0.2800 0.0340  0.0616  208  PHE A C   
2274 O O   . PHE A 303 ? 1.4682 1.0084 0.8466 -0.2782 0.0305  0.0681  208  PHE A O   
2275 C CB  . PHE A 303 ? 1.4984 0.9964 0.8575 -0.2890 0.0397  0.0558  208  PHE A CB  
2276 C CG  . PHE A 303 ? 1.4790 1.0759 0.8697 -0.3014 0.0323  0.0679  208  PHE A CG  
2277 N N   . LEU A 304 ? 1.5428 0.9209 0.8155 -0.2981 0.0286  0.0663  209  LEU A N   
2278 C CA  . LEU A 304 ? 1.5834 0.9338 0.8127 -0.3207 0.0184  0.0802  209  LEU A CA  
2279 C C   . LEU A 304 ? 1.5640 0.9289 0.8254 -0.2797 0.0242  0.0733  209  LEU A C   
2280 O O   . LEU A 304 ? 1.5410 0.9515 0.8152 -0.2886 0.0183  0.0842  209  LEU A O   
2281 C CB  . LEU A 304 ? 1.6959 0.9243 0.8295 -0.3440 0.0122  0.0838  209  LEU A CB  
2282 C CG  . LEU A 304 ? 1.8465 1.0238 0.9114 -0.3808 -0.0004 0.1012  209  LEU A CG  
2283 C CD1 . LEU A 304 ? 1.9565 1.0465 0.9306 -0.4328 -0.0119 0.1104  209  LEU A CD1 
2284 C CD2 . LEU A 304 ? 1.9220 1.0330 0.9582 -0.3414 0.0037  0.0958  209  LEU A CD2 
2285 N N   . ILE A 305 ? 1.4805 0.8150 0.7560 -0.2353 0.0356  0.0557  210  ILE A N   
2286 C CA  . ILE A 305 ? 1.4373 0.7903 0.7451 -0.1935 0.0416  0.0463  210  ILE A CA  
2287 C C   . ILE A 305 ? 1.3627 0.8208 0.7522 -0.1814 0.0444  0.0422  210  ILE A C   
2288 O O   . ILE A 305 ? 1.3313 0.8270 0.7434 -0.1686 0.0419  0.0441  210  ILE A O   
2289 C CB  . ILE A 305 ? 1.4962 0.7999 0.7952 -0.1527 0.0531  0.0290  210  ILE A CB  
2290 C CG1 . ILE A 305 ? 1.6109 0.7991 0.8143 -0.1574 0.0491  0.0331  210  ILE A CG1 
2291 C CG2 . ILE A 305 ? 1.4686 0.8121 0.8110 -0.1096 0.0596  0.0176  210  ILE A CG2 
2292 C CD1 . ILE A 305 ? 1.7374 0.8759 0.9200 -0.1175 0.0602  0.0177  210  ILE A CD1 
2293 N N   . ILE A 306 ? 1.2545 0.7533 0.6799 -0.1846 0.0488  0.0371  211  ILE A N   
2294 C CA  . ILE A 306 ? 1.1713 0.7539 0.6601 -0.1710 0.0513  0.0323  211  ILE A CA  
2295 C C   . ILE A 306 ? 1.2188 0.8632 0.7137 -0.1911 0.0403  0.0489  211  ILE A C   
2296 O O   . ILE A 306 ? 1.1713 0.8632 0.7001 -0.1711 0.0395  0.0465  211  ILE A O   
2297 C CB  . ILE A 306 ? 1.1817 0.7739 0.6878 -0.1713 0.0582  0.0251  211  ILE A CB  
2298 C CG1 . ILE A 306 ? 1.1698 0.7381 0.6964 -0.1417 0.0714  0.0063  211  ILE A CG1 
2299 C CG2 . ILE A 306 ? 1.1401 0.8084 0.6825 -0.1704 0.0556  0.0284  211  ILE A CG2 
2300 C CD1 . ILE A 306 ? 1.1985 0.7606 0.7343 -0.1410 0.0805  -0.0013 211  ILE A CD1 
2301 N N   . LEU A 307 ? 1.2229 0.8705 0.6836 -0.2306 0.0315  0.0656  212  LEU A N   
2302 C CA  . LEU A 307 ? 1.2164 0.9357 0.6813 -0.2534 0.0214  0.0836  212  LEU A CA  
2303 C C   . LEU A 307 ? 1.2793 0.9928 0.7324 -0.2522 0.0169  0.0912  212  LEU A C   
2304 O O   . LEU A 307 ? 1.2464 1.0334 0.7324 -0.2413 0.0141  0.0961  212  LEU A O   
2305 C CB  . LEU A 307 ? 1.2660 0.9858 0.6886 -0.3036 0.0124  0.1006  212  LEU A CB  
2306 C CG  . LEU A 307 ? 1.3200 1.1361 0.7500 -0.3311 0.0024  0.1208  212  LEU A CG  
2307 C CD1 . LEU A 307 ? 1.2663 1.1740 0.7406 -0.3117 0.0044  0.1184  212  LEU A CD1 
2308 C CD2 . LEU A 307 ? 1.4219 1.2159 0.7933 -0.3918 -0.0085 0.1393  212  LEU A CD2 
2309 N N   . THR A 308 ? 1.2912 0.9146 0.6928 -0.2590 0.0162  0.0918  213  THR A N   
2310 C CA  . THR A 308 ? 1.3204 0.9202 0.6983 -0.2553 0.0124  0.0989  213  THR A CA  
2311 C C   . THR A 308 ? 1.3085 0.9552 0.7440 -0.2068 0.0185  0.0848  213  THR A C   
2312 O O   . THR A 308 ? 1.2813 0.9708 0.7280 -0.2031 0.0141  0.0931  213  THR A O   
2313 C CB  . THR A 308 ? 1.5014 0.9809 0.8053 -0.2594 0.0122  0.0980  213  THR A CB  
2314 O OG1 . THR A 308 ? 1.5433 0.9752 0.7884 -0.3084 0.0049  0.1103  213  THR A OG1 
2315 C CG2 . THR A 308 ? 1.5296 0.9721 0.7971 -0.2521 0.0085  0.1058  213  THR A CG2 
2316 N N   . SER A 309 ? 1.2419 0.8831 0.7119 -0.1730 0.0281  0.0641  214  SER A N   
2317 C CA  . SER A 309 ? 1.1956 0.8780 0.7176 -0.1323 0.0334  0.0485  214  SER A CA  
2318 C C   . SER A 309 ? 1.2021 0.9738 0.7715 -0.1275 0.0304  0.0501  214  SER A C   
2319 O O   . SER A 309 ? 1.1783 0.9875 0.7729 -0.1054 0.0287  0.0466  214  SER A O   
2320 C CB  . SER A 309 ? 1.2370 0.8953 0.7793 -0.1077 0.0442  0.0280  214  SER A CB  
2321 O OG  . SER A 309 ? 1.4456 1.0273 0.9432 -0.1012 0.0477  0.0249  214  SER A OG  
2322 N N   . TYR A 310 ? 1.1505 0.9558 0.7270 -0.1445 0.0292  0.0555  215  TYR A N   
2323 C CA  . TYR A 310 ? 1.1053 0.9922 0.7178 -0.1320 0.0265  0.0566  215  TYR A CA  
2324 C C   . TYR A 310 ? 1.1550 1.1022 0.7572 -0.1519 0.0170  0.0783  215  TYR A C   
2325 O O   . TYR A 310 ? 1.1158 1.1317 0.7454 -0.1311 0.0144  0.0787  215  TYR A O   
2326 C CB  . TYR A 310 ? 1.1147 1.0168 0.7379 -0.1312 0.0302  0.0516  215  TYR A CB  
2327 C CG  . TYR A 310 ? 1.1362 0.9945 0.7757 -0.1103 0.0404  0.0304  215  TYR A CG  
2328 C CD1 . TYR A 310 ? 1.1884 0.9971 0.8103 -0.1233 0.0464  0.0269  215  TYR A CD1 
2329 C CD2 . TYR A 310 ? 1.1220 0.9893 0.7920 -0.0805 0.0438  0.0143  215  TYR A CD2 
2330 C CE1 . TYR A 310 ? 1.2157 0.9901 0.8519 -0.1069 0.0567  0.0091  215  TYR A CE1 
2331 C CE2 . TYR A 310 ? 1.1342 0.9672 0.8177 -0.0683 0.0531  -0.0038 215  TYR A CE2 
2332 C CZ  . TYR A 310 ? 1.3040 1.0932 0.9715 -0.0815 0.0601  -0.0056 215  TYR A CZ  
2333 O OH  . TYR A 310 ? 1.3666 1.1282 1.0466 -0.0722 0.0702  -0.0216 215  TYR A OH  
2334 N N   . THR A 311 ? 1.1691 1.0920 0.7284 -0.1920 0.0114  0.0964  216  THR A N   
2335 C CA  . THR A 311 ? 1.1836 1.1721 0.7326 -0.2170 0.0026  0.1190  216  THR A CA  
2336 C C   . THR A 311 ? 1.2342 1.2308 0.7914 -0.1958 0.0014  0.1194  216  THR A C   
2337 O O   . THR A 311 ? 1.2091 1.2868 0.7859 -0.1884 -0.0027 0.1289  216  THR A O   
2338 C CB  . THR A 311 ? 1.4075 1.3674 0.9024 -0.2746 -0.0041 0.1392  216  THR A CB  
2339 O OG1 . THR A 311 ? 1.4586 1.5043 0.9505 -0.3013 -0.0121 0.1619  216  THR A OG1 
2340 C CG2 . THR A 311 ? 1.4602 1.3081 0.9004 -0.2907 -0.0044 0.1398  216  THR A CG2 
2341 N N   . LEU A 312 ? 1.2138 1.1335 0.7578 -0.1798 0.0053  0.1079  217  LEU A N   
2342 C CA  . LEU A 312 ? 1.2130 1.1351 0.7620 -0.1563 0.0043  0.1067  217  LEU A CA  
2343 C C   . LEU A 312 ? 1.1910 1.1666 0.7955 -0.1106 0.0072  0.0885  217  LEU A C   
2344 O O   . LEU A 312 ? 1.1711 1.1912 0.7886 -0.0946 0.0036  0.0923  217  LEU A O   
2345 C CB  . LEU A 312 ? 1.2683 1.0931 0.7792 -0.1490 0.0074  0.1000  217  LEU A CB  
2346 C CG  . LEU A 312 ? 1.4220 1.1810 0.8613 -0.1834 0.0019  0.1202  217  LEU A CG  
2347 C CD1 . LEU A 312 ? 1.4307 1.2347 0.8653 -0.1878 -0.0039 0.1369  217  LEU A CD1 
2348 C CD2 . LEU A 312 ? 1.5162 1.2423 0.9109 -0.2348 -0.0021 0.1342  217  LEU A CD2 
2349 N N   . ILE A 313 ? 1.1194 1.0867 0.7514 -0.0916 0.0132  0.0690  218  ILE A N   
2350 C CA  . ILE A 313 ? 1.0804 1.0843 0.7551 -0.0536 0.0151  0.0504  218  ILE A CA  
2351 C C   . ILE A 313 ? 1.0959 1.1780 0.7872 -0.0460 0.0104  0.0571  218  ILE A C   
2352 O O   . ILE A 313 ? 1.0654 1.1898 0.7753 -0.0193 0.0070  0.0526  218  ILE A O   
2353 C CB  . ILE A 313 ? 1.1188 1.0824 0.8107 -0.0394 0.0233  0.0278  218  ILE A CB  
2354 C CG1 . ILE A 313 ? 1.1067 1.1027 0.8340 -0.0072 0.0233  0.0092  218  ILE A CG1 
2355 C CG2 . ILE A 313 ? 1.1367 1.0842 0.8190 -0.0585 0.0269  0.0299  218  ILE A CG2 
2356 C CD1 . ILE A 313 ? 1.2958 1.2612 1.0388 0.0014  0.0306  -0.0114 218  ILE A CD1 
2357 N N   . TRP A 314 ? 1.0658 1.1688 0.7473 -0.0653 0.0100  0.0671  219  TRP A N   
2358 C CA  . TRP A 314 ? 1.0547 1.2366 0.7464 -0.0514 0.0060  0.0738  219  TRP A CA  
2359 C C   . TRP A 314 ? 1.0737 1.3251 0.7641 -0.0516 -0.0011 0.0916  219  TRP A C   
2360 O O   . TRP A 314 ? 1.0463 1.3533 0.7520 -0.0181 -0.0039 0.0880  219  TRP A O   
2361 C CB  . TRP A 314 ? 1.0656 1.2660 0.7432 -0.0737 0.0061  0.0840  219  TRP A CB  
2362 C CG  . TRP A 314 ? 1.0825 1.3783 0.7637 -0.0590 0.0011  0.0956  219  TRP A CG  
2363 C CD1 . TRP A 314 ? 1.1313 1.5029 0.8009 -0.0851 -0.0048 0.1199  219  TRP A CD1 
2364 C CD2 . TRP A 314 ? 1.0717 1.4020 0.7646 -0.0116 0.0009  0.0841  219  TRP A CD2 
2365 N NE1 . TRP A 314 ? 1.1154 1.5764 0.7926 -0.0529 -0.0079 0.1244  219  TRP A NE1 
2366 C CE2 . TRP A 314 ? 1.1250 1.5555 0.8125 -0.0049 -0.0047 0.1022  219  TRP A CE2 
2367 C CE3 . TRP A 314 ? 1.0898 1.3736 0.7913 0.0246  0.0043  0.0602  219  TRP A CE3 
2368 C CZ2 . TRP A 314 ? 1.1156 1.5956 0.8018 0.0442  -0.0066 0.0967  219  TRP A CZ2 
2369 C CZ3 . TRP A 314 ? 1.1144 1.4362 0.8107 0.0671  0.0016  0.0545  219  TRP A CZ3 
2370 C CH2 . TRP A 314 ? 1.1231 1.5393 0.8099 0.0805  -0.0037 0.0723  219  TRP A CH2 
2371 N N   . LYS A 315 ? 1.0344 1.2763 0.7010 -0.0881 -0.0039 0.1102  220  LYS A N   
2372 C CA  . LYS A 315 ? 1.0284 1.3322 0.6890 -0.0952 -0.0097 0.1298  220  LYS A CA  
2373 C C   . LYS A 315 ? 1.0358 1.3385 0.7145 -0.0571 -0.0101 0.1179  220  LYS A C   
2374 O O   . LYS A 315 ? 1.0061 1.3821 0.6936 -0.0407 -0.0142 0.1269  220  LYS A O   
2375 C CB  . LYS A 315 ? 1.1122 1.3817 0.7319 -0.1473 -0.0124 0.1512  220  LYS A CB  
2376 C CG  . LYS A 315 ? 1.3357 1.6306 0.9325 -0.1945 -0.0155 0.1692  220  LYS A CG  
2377 C CD  . LYS A 315 ? 1.5437 1.8036 1.0898 -0.2518 -0.0203 0.1924  220  LYS A CD  
2378 C CE  . LYS A 315 ? 1.7494 1.8781 1.2564 -0.2624 -0.0178 0.1839  220  LYS A CE  
2379 N NZ  . LYS A 315 ? 1.9551 2.0402 1.3998 -0.3168 -0.0236 0.2074  220  LYS A NZ  
2380 N N   . ALA A 316 ? 0.9932 1.2196 0.6765 -0.0424 -0.0059 0.0982  221  ALA A N   
2381 C CA  . ALA A 316 ? 0.9798 1.2023 0.6793 -0.0085 -0.0067 0.0850  221  ALA A CA  
2382 C C   . ALA A 316 ? 1.0226 1.2638 0.7535 0.0319  -0.0064 0.0613  221  ALA A C   
2383 O O   . ALA A 316 ? 1.0112 1.2495 0.7564 0.0588  -0.0079 0.0473  221  ALA A O   
2384 C CB  . ALA A 316 ? 1.0109 1.1516 0.6959 -0.0120 -0.0029 0.0763  221  ALA A CB  
2385 N N   . LEU A 317 ? 0.9885 1.2457 0.7240 0.0359  -0.0052 0.0570  222  LEU A N   
2386 C CA  . LEU A 317 ? 0.9794 1.2374 0.7302 0.0713  -0.0054 0.0351  222  LEU A CA  
2387 C C   . LEU A 317 ? 1.0372 1.3621 0.7813 0.0922  -0.0096 0.0429  222  LEU A C   
2388 O O   . LEU A 317 ? 1.0276 1.3610 0.7733 0.1284  -0.0129 0.0284  222  LEU A O   
2389 C CB  . LEU A 317 ? 0.9853 1.1767 0.7388 0.0640  0.0016  0.0174  222  LEU A CB  
2390 C CG  . LEU A 317 ? 1.0450 1.2120 0.8086 0.0912  0.0018  -0.0082 222  LEU A CG  
2391 C CD1 . LEU A 317 ? 1.0468 1.1569 0.8227 0.0813  0.0078  -0.0255 222  LEU A CD1 
2392 C CD2 . LEU A 317 ? 1.0878 1.2538 0.8369 0.1025  0.0026  -0.0118 222  LEU A CD2 
2393 N N   . LYS A 318 ? 1.0081 1.3821 0.7403 0.0710  -0.0103 0.0654  223  LYS A N   
2394 C CA  . LYS A 318 ? 1.0080 1.4604 0.7316 0.0925  -0.0139 0.0757  223  LYS A CA  
2395 C C   . LYS A 318 ? 1.0698 1.5920 0.7954 0.1289  -0.0201 0.0797  223  LYS A C   
2396 O O   . LYS A 318 ? 1.0829 1.6777 0.7982 0.1556  -0.0232 0.0880  223  LYS A O   
2397 C CB  . LYS A 318 ? 1.0432 1.5481 0.7564 0.0539  -0.0142 0.1016  223  LYS A CB  
2398 C CG  . LYS A 318 ? 1.2062 1.7499 0.9154 0.0179  -0.0172 0.1253  223  LYS A CG  
2399 C CD  . LYS A 318 ? 1.3427 1.9096 1.0350 -0.0357 -0.0178 0.1480  223  LYS A CD  
2400 C CE  . LYS A 318 ? 1.4661 2.1388 1.1553 -0.0326 -0.0208 0.1637  223  LYS A CE  
2401 N NZ  . LYS A 318 ? 1.5747 2.2651 1.2462 -0.0924 -0.0226 0.1843  223  LYS A NZ  
2402 N N   . LYS A 319 ? 1.0182 1.5205 0.7542 0.1341  -0.0219 0.0734  224  LYS A N   
2403 C CA  . LYS A 319 ? 1.3062 1.8652 1.0436 0.1683  -0.0277 0.0754  224  LYS A CA  
2404 C C   . LYS A 319 ? 1.4881 1.9909 1.2368 0.1841  -0.0292 0.0538  224  LYS A C   
2405 O O   . LYS A 319 ? 0.9040 1.3433 0.6552 0.1955  -0.0282 0.0294  224  LYS A O   
2406 C CB  . LYS A 319 ? 1.3384 1.9746 1.0737 0.1440  -0.0294 0.1055  224  LYS A CB  
2407 N N   . ASN A 330 ? 1.1298 1.0897 0.9352 0.0719  0.0155  -0.1414 235  ASN A N   
2408 C CA  . ASN A 330 ? 1.1003 1.0751 0.9180 0.0675  0.0221  -0.1235 235  ASN A CA  
2409 C C   . ASN A 330 ? 1.1268 1.0983 0.9227 0.0725  0.0221  -0.1048 235  ASN A C   
2410 O O   . ASN A 330 ? 1.1160 1.0727 0.9090 0.0575  0.0296  -0.0941 235  ASN A O   
2411 C CB  . ASN A 330 ? 1.1063 1.1219 0.9427 0.0800  0.0178  -0.1187 235  ASN A CB  
2412 N N   . ASP A 331 ? 1.0760 1.0663 0.8547 0.0948  0.0133  -0.1009 236  ASP A N   
2413 C CA  . ASP A 331 ? 1.0683 1.0728 0.8264 0.1031  0.0124  -0.0831 236  ASP A CA  
2414 C C   . ASP A 331 ? 1.1123 1.0705 0.8449 0.0990  0.0175  -0.0884 236  ASP A C   
2415 O O   . ASP A 331 ? 1.1002 1.0591 0.8238 0.0913  0.0221  -0.0748 236  ASP A O   
2416 C CB  . ASP A 331 ? 1.0982 1.1476 0.8444 0.1337  0.0020  -0.0771 236  ASP A CB  
2417 C CG  . ASP A 331 ? 1.3227 1.3524 1.0466 0.1589  -0.0056 -0.0953 236  ASP A CG  
2418 O OD1 . ASP A 331 ? 1.3653 1.3490 1.0881 0.1472  -0.0045 -0.1149 236  ASP A OD1 
2419 O OD2 . ASP A 331 ? 1.4209 1.4829 1.1255 0.1896  -0.0133 -0.0897 236  ASP A OD2 
2420 N N   . ASP A 332 ? 1.0797 0.9944 0.7975 0.1008  0.0165  -0.1082 237  ASP A N   
2421 C CA  . ASP A 332 ? 1.1053 0.9620 0.7909 0.0951  0.0216  -0.1148 237  ASP A CA  
2422 C C   . ASP A 332 ? 1.0988 0.9352 0.8018 0.0639  0.0339  -0.1122 237  ASP A C   
2423 O O   . ASP A 332 ? 1.1044 0.9179 0.7875 0.0608  0.0396  -0.1047 237  ASP A O   
2424 C CB  . ASP A 332 ? 1.1787 0.9862 0.8387 0.0963  0.0169  -0.1365 237  ASP A CB  
2425 C CG  . ASP A 332 ? 1.3488 1.1560 0.9728 0.1327  0.0045  -0.1408 237  ASP A CG  
2426 O OD1 . ASP A 332 ? 1.3774 1.1729 0.9613 0.1594  0.0028  -0.1331 237  ASP A OD1 
2427 O OD2 . ASP A 332 ? 1.4264 1.2425 1.0574 0.1366  -0.0036 -0.1533 237  ASP A OD2 
2428 N N   . ILE A 333 ? 1.0006 0.8500 0.7386 0.0448  0.0379  -0.1178 238  ILE A N   
2429 C CA  . ILE A 333 ? 0.9723 0.8087 0.7265 0.0203  0.0495  -0.1157 238  ILE A CA  
2430 C C   . ILE A 333 ? 0.9700 0.8209 0.7223 0.0200  0.0517  -0.0955 238  ILE A C   
2431 O O   . ILE A 333 ? 0.9845 0.8088 0.7254 0.0077  0.0595  -0.0906 238  ILE A O   
2432 C CB  . ILE A 333 ? 0.9944 0.8529 0.7823 0.0096  0.0522  -0.1252 238  ILE A CB  
2433 C CG1 . ILE A 333 ? 1.0237 0.8856 0.8158 0.0087  0.0461  -0.1445 238  ILE A CG1 
2434 C CG2 . ILE A 333 ? 0.9912 0.8325 0.7877 -0.0112 0.0651  -0.1253 238  ILE A CG2 
2435 C CD1 . ILE A 333 ? 1.1638 1.0695 0.9912 0.0065  0.0456  -0.1532 238  ILE A CD1 
2436 N N   . PHE A 334 ? 0.8730 0.7654 0.6324 0.0313  0.0444  -0.0835 239  PHE A N   
2437 C CA  . PHE A 334 ? 0.8475 0.7579 0.6001 0.0250  0.0441  -0.0631 239  PHE A CA  
2438 C C   . PHE A 334 ? 0.8921 0.8009 0.6194 0.0297  0.0438  -0.0546 239  PHE A C   
2439 O O   . PHE A 334 ? 0.8728 0.7724 0.5920 0.0136  0.0483  -0.0442 239  PHE A O   
2440 C CB  . PHE A 334 ? 0.8506 0.8074 0.6104 0.0341  0.0355  -0.0517 239  PHE A CB  
2441 C CG  . PHE A 334 ? 0.8649 0.8513 0.6115 0.0247  0.0321  -0.0288 239  PHE A CG  
2442 C CD1 . PHE A 334 ? 0.9065 0.8693 0.6426 -0.0006 0.0368  -0.0185 239  PHE A CD1 
2443 C CD2 . PHE A 334 ? 0.8846 0.9255 0.6274 0.0388  0.0236  -0.0173 239  PHE A CD2 
2444 C CE1 . PHE A 334 ? 0.9182 0.9088 0.6382 -0.0168 0.0323  0.0027  239  PHE A CE1 
2445 C CE2 . PHE A 334 ? 0.9156 0.9943 0.6467 0.0237  0.0202  0.0051  239  PHE A CE2 
2446 C CZ  . PHE A 334 ? 0.9005 0.9527 0.6197 -0.0070 0.0242  0.0148  239  PHE A CZ  
2447 N N   . LYS A 335 ? 0.8635 0.7774 0.5733 0.0539  0.0384  -0.0599 240  LYS A N   
2448 C CA  . LYS A 335 ? 0.8748 0.7881 0.5535 0.0678  0.0380  -0.0530 240  LYS A CA  
2449 C C   . LYS A 335 ? 0.9397 0.7982 0.6048 0.0520  0.0480  -0.0578 240  LYS A C   
2450 O O   . LYS A 335 ? 0.9290 0.7945 0.5782 0.0508  0.0500  -0.0463 240  LYS A O   
2451 C CB  . LYS A 335 ? 0.9293 0.8403 0.5803 0.1028  0.0308  -0.0614 240  LYS A CB  
2452 C CG  . LYS A 335 ? 1.0940 1.0730 0.7476 0.1274  0.0208  -0.0512 240  LYS A CG  
2453 C CD  . LYS A 335 ? 1.2540 1.2269 0.8684 0.1696  0.0137  -0.0588 240  LYS A CD  
2454 C CE  . LYS A 335 ? 1.3983 1.3179 1.0033 0.1755  0.0103  -0.0811 240  LYS A CE  
2455 N NZ  . LYS A 335 ? 1.5907 1.4912 1.1438 0.2188  0.0023  -0.0883 240  LYS A NZ  
2456 N N   . ILE A 336 ? 0.9222 0.7325 0.5936 0.0387  0.0542  -0.0741 241  ILE A N   
2457 C CA  . ILE A 336 ? 0.9471 0.7052 0.6069 0.0212  0.0650  -0.0794 241  ILE A CA  
2458 C C   . ILE A 336 ? 0.9880 0.7552 0.6655 -0.0009 0.0715  -0.0687 241  ILE A C   
2459 O O   . ILE A 336 ? 0.9932 0.7475 0.6530 -0.0055 0.0757  -0.0606 241  ILE A O   
2460 C CB  . ILE A 336 ? 1.0036 0.7215 0.6675 0.0079  0.0694  -0.0987 241  ILE A CB  
2461 C CG1 . ILE A 336 ? 1.0446 0.7374 0.6768 0.0273  0.0613  -0.1101 241  ILE A CG1 
2462 C CG2 . ILE A 336 ? 1.0397 0.7112 0.6943 -0.0144 0.0820  -0.1021 241  ILE A CG2 
2463 C CD1 . ILE A 336 ? 1.1517 0.8129 0.7862 0.0086  0.0620  -0.1296 241  ILE A CD1 
2464 N N   . ILE A 337 ? 0.9299 0.7167 0.6358 -0.0114 0.0713  -0.0685 242  ILE A N   
2465 C CA  . ILE A 337 ? 0.9239 0.7084 0.6372 -0.0290 0.0759  -0.0599 242  ILE A CA  
2466 C C   . ILE A 337 ? 0.9848 0.7914 0.6812 -0.0329 0.0705  -0.0410 242  ILE A C   
2467 O O   . ILE A 337 ? 0.9884 0.7740 0.6719 -0.0480 0.0754  -0.0349 242  ILE A O   
2468 C CB  . ILE A 337 ? 0.9483 0.7494 0.6844 -0.0291 0.0740  -0.0633 242  ILE A CB  
2469 C CG1 . ILE A 337 ? 0.9601 0.7498 0.7146 -0.0303 0.0805  -0.0817 242  ILE A CG1 
2470 C CG2 . ILE A 337 ? 0.9568 0.7466 0.6853 -0.0417 0.0762  -0.0526 242  ILE A CG2 
2471 C CD1 . ILE A 337 ? 1.1101 0.9254 0.8870 -0.0235 0.0782  -0.0875 242  ILE A CD1 
2472 N N   . MET A 338 ? 0.9403 0.7933 0.6353 -0.0204 0.0605  -0.0320 243  MET A N   
2473 C CA  . MET A 338 ? 0.9358 0.8289 0.6165 -0.0263 0.0541  -0.0130 243  MET A CA  
2474 C C   . MET A 338 ? 0.9576 0.8433 0.6163 -0.0231 0.0573  -0.0101 243  MET A C   
2475 O O   . MET A 338 ? 0.9472 0.8440 0.5940 -0.0413 0.0564  0.0024  243  MET A O   
2476 C CB  . MET A 338 ? 0.9613 0.9147 0.6460 -0.0072 0.0441  -0.0060 243  MET A CB  
2477 C CG  . MET A 338 ? 1.0198 1.0342 0.6930 -0.0157 0.0370  0.0152  243  MET A CG  
2478 S SD  . MET A 338 ? 1.0890 1.1176 0.7638 -0.0506 0.0322  0.0317  243  MET A SD  
2479 C CE  . MET A 338 ? 1.0483 1.1713 0.7105 -0.0588 0.0227  0.0561  243  MET A CE  
2480 N N   . ALA A 339 ? 0.9143 0.7769 0.5619 -0.0007 0.0603  -0.0218 244  ALA A N   
2481 C CA  . ALA A 339 ? 0.9364 0.7851 0.5554 0.0103  0.0634  -0.0201 244  ALA A CA  
2482 C C   . ALA A 339 ? 1.0034 0.7995 0.6174 -0.0118 0.0740  -0.0235 244  ALA A C   
2483 O O   . ALA A 339 ? 1.0081 0.8088 0.6031 -0.0145 0.0751  -0.0150 244  ALA A O   
2484 C CB  . ALA A 339 ? 0.9729 0.7953 0.5698 0.0411  0.0630  -0.0322 244  ALA A CB  
2485 N N   . ILE A 340 ? 0.9623 0.7157 0.5928 -0.0259 0.0817  -0.0356 245  ILE A N   
2486 C CA  . ILE A 340 ? 0.9722 0.6805 0.5995 -0.0447 0.0928  -0.0392 245  ILE A CA  
2487 C C   . ILE A 340 ? 1.0490 0.7691 0.6762 -0.0650 0.0909  -0.0269 245  ILE A C   
2488 O O   . ILE A 340 ? 1.0709 0.7685 0.6816 -0.0753 0.0960  -0.0234 245  ILE A O   
2489 C CB  . ILE A 340 ? 1.0043 0.6817 0.6508 -0.0526 0.1010  -0.0545 245  ILE A CB  
2490 C CG1 . ILE A 340 ? 1.0217 0.6797 0.6599 -0.0404 0.1012  -0.0670 245  ILE A CG1 
2491 C CG2 . ILE A 340 ? 1.0277 0.6678 0.6704 -0.0694 0.1134  -0.0569 245  ILE A CG2 
2492 C CD1 . ILE A 340 ? 1.0703 0.7193 0.7318 -0.0513 0.1057  -0.0816 245  ILE A CD1 
2493 N N   . VAL A 341 ? 1.0036 0.7537 0.6428 -0.0713 0.0830  -0.0201 246  VAL A N   
2494 C CA  . VAL A 341 ? 1.0120 0.7630 0.6402 -0.0941 0.0789  -0.0080 246  VAL A CA  
2495 C C   . VAL A 341 ? 1.0773 0.8670 0.6859 -0.1026 0.0713  0.0075  246  VAL A C   
2496 O O   . VAL A 341 ? 1.0946 0.8652 0.6832 -0.1227 0.0719  0.0135  246  VAL A O   
2497 C CB  . VAL A 341 ? 1.0495 0.8148 0.6885 -0.0977 0.0726  -0.0048 246  VAL A CB  
2498 C CG1 . VAL A 341 ? 1.0664 0.8356 0.6814 -0.1237 0.0646  0.0116  246  VAL A CG1 
2499 C CG2 . VAL A 341 ? 1.0453 0.7742 0.6978 -0.0920 0.0803  -0.0184 246  VAL A CG2 
2500 N N   . LEU A 342 ? 1.0254 0.8738 0.6379 -0.0863 0.0637  0.0138  247  LEU A N   
2501 C CA  . LEU A 342 ? 1.0294 0.9363 0.6263 -0.0902 0.0560  0.0292  247  LEU A CA  
2502 C C   . LEU A 342 ? 1.0997 0.9880 0.6766 -0.0852 0.0615  0.0275  247  LEU A C   
2503 O O   . LEU A 342 ? 1.1036 1.0058 0.6646 -0.1080 0.0581  0.0378  247  LEU A O   
2504 C CB  . LEU A 342 ? 1.0183 0.9933 0.6218 -0.0621 0.0489  0.0337  247  LEU A CB  
2505 C CG  . LEU A 342 ? 1.0757 1.1304 0.6806 -0.0777 0.0377  0.0526  247  LEU A CG  
2506 C CD1 . LEU A 342 ? 1.0752 1.1147 0.6926 -0.0983 0.0350  0.0545  247  LEU A CD1 
2507 C CD2 . LEU A 342 ? 1.1065 1.2348 0.7127 -0.0412 0.0323  0.0568  247  LEU A CD2 
2508 N N   . PHE A 343 ? 1.0711 0.9222 0.6443 -0.0585 0.0697  0.0145  248  PHE A N   
2509 C CA  . PHE A 343 ? 1.0957 0.9206 0.6448 -0.0498 0.0760  0.0126  248  PHE A CA  
2510 C C   . PHE A 343 ? 1.1645 0.9390 0.7084 -0.0779 0.0831  0.0108  248  PHE A C   
2511 O O   . PHE A 343 ? 1.1819 0.9645 0.7057 -0.0849 0.0824  0.0178  248  PHE A O   
2512 C CB  . PHE A 343 ? 1.1390 0.9183 0.6767 -0.0201 0.0836  -0.0011 248  PHE A CB  
2513 C CG  . PHE A 343 ? 1.1939 0.9367 0.6997 -0.0100 0.0910  -0.0024 248  PHE A CG  
2514 C CD1 . PHE A 343 ? 1.2540 1.0351 0.7307 0.0165  0.0862  0.0060  248  PHE A CD1 
2515 C CD2 . PHE A 343 ? 1.2410 0.9160 0.7437 -0.0247 0.1032  -0.0113 248  PHE A CD2 
2516 C CE1 . PHE A 343 ? 1.3054 1.0505 0.7482 0.0285  0.0930  0.0053  248  PHE A CE1 
2517 C CE2 . PHE A 343 ? 1.3136 0.9534 0.7840 -0.0161 0.1105  -0.0113 248  PHE A CE2 
2518 C CZ  . PHE A 343 ? 1.3119 0.9830 0.7513 0.0109  0.1053  -0.0032 248  PHE A CZ  
2519 N N   . PHE A 344 ? 1.1144 0.8410 0.6737 -0.0904 0.0898  0.0013  249  PHE A N   
2520 C CA  . PHE A 344 ? 1.1290 0.8050 0.6802 -0.1103 0.0975  -0.0018 249  PHE A CA  
2521 C C   . PHE A 344 ? 1.2122 0.9022 0.7427 -0.1356 0.0894  0.0111  249  PHE A C   
2522 O O   . PHE A 344 ? 1.2195 0.8879 0.7294 -0.1422 0.0931  0.0122  249  PHE A O   
2523 C CB  . PHE A 344 ? 1.1438 0.7888 0.7139 -0.1156 0.1025  -0.0110 249  PHE A CB  
2524 C CG  . PHE A 344 ? 1.1818 0.7754 0.7408 -0.1272 0.1119  -0.0157 249  PHE A CG  
2525 C CD1 . PHE A 344 ? 1.2286 0.7901 0.7928 -0.1196 0.1257  -0.0267 249  PHE A CD1 
2526 C CD2 . PHE A 344 ? 1.2260 0.8013 0.7638 -0.1460 0.1069  -0.0089 249  PHE A CD2 
2527 C CE1 . PHE A 344 ? 1.2586 0.7812 0.8121 -0.1265 0.1351  -0.0304 249  PHE A CE1 
2528 C CE2 . PHE A 344 ? 1.2911 0.8157 0.8113 -0.1506 0.1153  -0.0138 249  PHE A CE2 
2529 C CZ  . PHE A 344 ? 1.2672 0.7710 0.7982 -0.1386 0.1298  -0.0245 249  PHE A CZ  
2530 N N   . PHE A 345 ? 1.1886 0.9128 0.7208 -0.1521 0.0780  0.0210  250  PHE A N   
2531 C CA  . PHE A 345 ? 1.2226 0.9557 0.7289 -0.1850 0.0684  0.0338  250  PHE A CA  
2532 C C   . PHE A 345 ? 1.2722 1.0712 0.7675 -0.1878 0.0609  0.0453  250  PHE A C   
2533 O O   . PHE A 345 ? 1.2927 1.0867 0.7620 -0.2135 0.0564  0.0518  250  PHE A O   
2534 C CB  . PHE A 345 ? 1.2586 1.0022 0.7633 -0.2057 0.0589  0.0420  250  PHE A CB  
2535 C CG  . PHE A 345 ? 1.3061 0.9792 0.8055 -0.2072 0.0643  0.0333  250  PHE A CG  
2536 C CD1 . PHE A 345 ? 1.3909 0.9973 0.8549 -0.2247 0.0661  0.0317  250  PHE A CD1 
2537 C CD2 . PHE A 345 ? 1.3177 0.9936 0.8425 -0.1887 0.0666  0.0269  250  PHE A CD2 
2538 C CE1 . PHE A 345 ? 1.4235 0.9679 0.8762 -0.2181 0.0712  0.0238  250  PHE A CE1 
2539 C CE2 . PHE A 345 ? 1.3729 0.9926 0.8904 -0.1850 0.0714  0.0192  250  PHE A CE2 
2540 C CZ  . PHE A 345 ? 1.3916 0.9467 0.8721 -0.1975 0.0739  0.0179  250  PHE A CZ  
2541 N N   . PHE A 346 ? 1.2093 1.0695 0.7193 -0.1596 0.0590  0.0475  251  PHE A N   
2542 C CA  . PHE A 346 ? 1.2141 1.1485 0.7118 -0.1537 0.0521  0.0586  251  PHE A CA  
2543 C C   . PHE A 346 ? 1.2859 1.1913 0.7651 -0.1354 0.0602  0.0526  251  PHE A C   
2544 O O   . PHE A 346 ? 1.2940 1.2577 0.7577 -0.1304 0.0547  0.0615  251  PHE A O   
2545 C CB  . PHE A 346 ? 1.2197 1.2300 0.7312 -0.1215 0.0473  0.0632  251  PHE A CB  
2546 C CG  . PHE A 346 ? 1.2355 1.3121 0.7588 -0.1427 0.0362  0.0765  251  PHE A CG  
2547 C CD1 . PHE A 346 ? 1.2930 1.4210 0.8032 -0.1849 0.0256  0.0926  251  PHE A CD1 
2548 C CD2 . PHE A 346 ? 1.2506 1.3435 0.7944 -0.1216 0.0356  0.0738  251  PHE A CD2 
2549 C CE1 . PHE A 346 ? 1.3031 1.4913 0.8199 -0.2095 0.0157  0.1066  251  PHE A CE1 
2550 C CE2 . PHE A 346 ? 1.2808 1.4360 0.8336 -0.1412 0.0260  0.0874  251  PHE A CE2 
2551 C CZ  . PHE A 346 ? 1.2728 1.4756 0.8118 -0.1858 0.0165  0.1043  251  PHE A CZ  
2552 N N   . SER A 347 ? 1.2399 1.0619 0.7191 -0.1256 0.0733  0.0384  252  SER A N   
2553 C CA  . SER A 347 ? 1.2479 1.0314 0.7065 -0.1101 0.0828  0.0328  252  SER A CA  
2554 C C   . SER A 347 ? 1.2968 1.0317 0.7398 -0.1401 0.0858  0.0319  252  SER A C   
2555 O O   . SER A 347 ? 1.3175 1.0361 0.7390 -0.1342 0.0905  0.0313  252  SER A O   
2556 C CB  . SER A 347 ? 1.2898 1.0163 0.7532 -0.0827 0.0957  0.0192  252  SER A CB  
2557 O OG  . SER A 347 ? 1.3774 1.0470 0.8576 -0.0979 0.1038  0.0094  252  SER A OG  
2558 N N   . TRP A 348 ? 1.2245 0.9319 0.6720 -0.1686 0.0829  0.0316  253  TRP A N   
2559 C CA  . TRP A 348 ? 1.2385 0.8904 0.6624 -0.1940 0.0845  0.0299  253  TRP A CA  
2560 C C   . TRP A 348 ? 1.3127 0.9995 0.7095 -0.2276 0.0699  0.0425  253  TRP A C   
2561 O O   . TRP A 348 ? 1.3419 0.9861 0.7095 -0.2449 0.0703  0.0412  253  TRP A O   
2562 C CB  . TRP A 348 ? 1.2236 0.8215 0.6530 -0.2034 0.0878  0.0234  253  TRP A CB  
2563 C CG  . TRP A 348 ? 1.2332 0.7769 0.6735 -0.1830 0.1043  0.0097  253  TRP A CG  
2564 C CD1 . TRP A 348 ? 1.2461 0.7890 0.7164 -0.1625 0.1124  0.0011  253  TRP A CD1 
2565 C CD2 . TRP A 348 ? 1.2584 0.7477 0.6783 -0.1833 0.1145  0.0037  253  TRP A CD2 
2566 N NE1 . TRP A 348 ? 1.2490 0.7460 0.7206 -0.1536 0.1272  -0.0092 253  TRP A NE1 
2567 C CE2 . TRP A 348 ? 1.2960 0.7605 0.7376 -0.1639 0.1295  -0.0074 253  TRP A CE2 
2568 C CE3 . TRP A 348 ? 1.3091 0.7706 0.6927 -0.1990 0.1122  0.0067  253  TRP A CE3 
2569 C CZ2 . TRP A 348 ? 1.3056 0.7251 0.7359 -0.1590 0.1432  -0.0143 253  TRP A CZ2 
2570 C CZ3 . TRP A 348 ? 1.3474 0.7573 0.7180 -0.1904 0.1255  -0.0012 253  TRP A CZ3 
2571 C CH2 . TRP A 348 ? 1.3404 0.7325 0.7353 -0.1703 0.1414  -0.0110 253  TRP A CH2 
2572 N N   . ILE A 349 ? 1.2596 1.0261 0.6635 -0.2386 0.0570  0.0548  254  ILE A N   
2573 C CA  . ILE A 349 ? 1.2837 1.1002 0.6631 -0.2779 0.0416  0.0686  254  ILE A CA  
2574 C C   . ILE A 349 ? 1.3599 1.1918 0.7176 -0.2757 0.0416  0.0694  254  ILE A C   
2575 O O   . ILE A 349 ? 1.3971 1.2012 0.7221 -0.3120 0.0346  0.0720  254  ILE A O   
2576 C CB  . ILE A 349 ? 1.3022 1.2232 0.6982 -0.2844 0.0298  0.0828  254  ILE A CB  
2577 C CG1 . ILE A 349 ? 1.2898 1.1960 0.7047 -0.2869 0.0293  0.0827  254  ILE A CG1 
2578 C CG2 . ILE A 349 ? 1.3423 1.3240 0.7117 -0.3333 0.0135  0.0982  254  ILE A CG2 
2579 C CD1 . ILE A 349 ? 1.3174 1.3256 0.7564 -0.2769 0.0221  0.0940  254  ILE A CD1 
2580 N N   . PRO A 350 ? 1.3035 1.1704 0.6700 -0.2346 0.0485  0.0672  255  PRO A N   
2581 C CA  . PRO A 350 ? 1.3202 1.2000 0.6611 -0.2327 0.0479  0.0687  255  PRO A CA  
2582 C C   . PRO A 350 ? 1.3996 1.1818 0.7166 -0.2469 0.0553  0.0592  255  PRO A C   
2583 O O   . PRO A 350 ? 1.4259 1.2104 0.7134 -0.2761 0.0469  0.0630  255  PRO A O   
2584 C CB  . PRO A 350 ? 1.3278 1.2297 0.6760 -0.1778 0.0575  0.0653  255  PRO A CB  
2585 C CG  . PRO A 350 ? 1.3609 1.3030 0.7357 -0.1585 0.0560  0.0672  255  PRO A CG  
2586 C CD  . PRO A 350 ? 1.2967 1.1870 0.6874 -0.1876 0.0561  0.0634  255  PRO A CD  
2587 N N   . HIS A 351 ? 1.3552 1.0565 0.6831 -0.2289 0.0700  0.0471  256  HIS A N   
2588 C CA  . HIS A 351 ? 1.3846 0.9978 0.6910 -0.2361 0.0790  0.0380  256  HIS A CA  
2589 C C   . HIS A 351 ? 1.4814 1.0564 0.7617 -0.2780 0.0682  0.0401  256  HIS A C   
2590 O O   . HIS A 351 ? 1.5182 1.0449 0.7624 -0.2941 0.0670  0.0374  256  HIS A O   
2591 C CB  . HIS A 351 ? 1.3756 0.9302 0.7027 -0.2073 0.0973  0.0261  256  HIS A CB  
2592 C CG  . HIS A 351 ? 1.4414 0.9239 0.7475 -0.2049 0.1093  0.0179  256  HIS A CG  
2593 N ND1 . HIS A 351 ? 1.4746 0.9509 0.7637 -0.1899 0.1166  0.0172  256  HIS A ND1 
2594 C CD2 . HIS A 351 ? 1.4792 0.8975 0.7765 -0.2116 0.1155  0.0106  256  HIS A CD2 
2595 C CE1 . HIS A 351 ? 1.4892 0.9004 0.7621 -0.1912 0.1270  0.0100  256  HIS A CE1 
2596 N NE2 . HIS A 351 ? 1.4982 0.8746 0.7749 -0.2024 0.1267  0.0057  256  HIS A NE2 
2597 N N   . GLN A 352 ? 1.4375 1.0317 0.7283 -0.2959 0.0592  0.0455  257  GLN A N   
2598 C CA  . GLN A 352 ? 1.4878 1.0386 0.7435 -0.3369 0.0476  0.0491  257  GLN A CA  
2599 C C   . GLN A 352 ? 1.5821 1.1579 0.7968 -0.3799 0.0312  0.0586  257  GLN A C   
2600 O O   . GLN A 352 ? 1.6378 1.1435 0.8031 -0.4116 0.0239  0.0575  257  GLN A O   
2601 C CB  . GLN A 352 ? 1.4926 1.0730 0.7679 -0.3463 0.0410  0.0557  257  GLN A CB  
2602 C CG  . GLN A 352 ? 1.8259 1.3201 1.0771 -0.3562 0.0414  0.0511  257  GLN A CG  
2603 C CD  . GLN A 352 ? 2.1101 1.5584 1.3878 -0.3141 0.0590  0.0371  257  GLN A CD  
2604 O OE1 . GLN A 352 ? 1.9900 1.4809 1.3148 -0.2836 0.0681  0.0334  257  GLN A OE1 
2605 N NE2 . GLN A 352 ? 2.0847 1.4461 1.3283 -0.3120 0.0636  0.0293  257  GLN A NE2 
2606 N N   . ILE A 353 ? 1.5097 1.1855 0.7403 -0.3793 0.0249  0.0675  258  ILE A N   
2607 C CA  . ILE A 353 ? 1.5360 1.2620 0.7345 -0.4194 0.0088  0.0772  258  ILE A CA  
2608 C C   . ILE A 353 ? 1.6198 1.2966 0.7892 -0.4117 0.0139  0.0688  258  ILE A C   
2609 O O   . ILE A 353 ? 1.6789 1.3062 0.7991 -0.4509 0.0037  0.0685  258  ILE A O   
2610 C CB  . ILE A 353 ? 1.5326 1.3985 0.7604 -0.4130 0.0013  0.0899  258  ILE A CB  
2611 C CG1 . ILE A 353 ? 1.5090 1.4293 0.7642 -0.4208 -0.0039 0.0993  258  ILE A CG1 
2612 C CG2 . ILE A 353 ? 1.5720 1.5038 0.7682 -0.4553 -0.0154 0.0997  258  ILE A CG2 
2613 C CD1 . ILE A 353 ? 1.5427 1.5974 0.8326 -0.3938 -0.0064 0.1093  258  ILE A CD1 
2614 N N   . PHE A 354 ? 1.5344 1.2193 0.7280 -0.3620 0.0291  0.0621  259  PHE A N   
2615 C CA  . PHE A 354 ? 1.5481 1.1972 0.7179 -0.3479 0.0360  0.0554  259  PHE A CA  
2616 C C   . PHE A 354 ? 1.6303 1.1597 0.7713 -0.3498 0.0448  0.0436  259  PHE A C   
2617 O O   . PHE A 354 ? 1.6573 1.1521 0.7635 -0.3548 0.0447  0.0398  259  PHE A O   
2618 C CB  . PHE A 354 ? 1.5315 1.2111 0.7289 -0.2938 0.0509  0.0525  259  PHE A CB  
2619 C CG  . PHE A 354 ? 1.5323 1.3272 0.7367 -0.2851 0.0412  0.0634  259  PHE A CG  
2620 C CD1 . PHE A 354 ? 1.5926 1.4243 0.7699 -0.2888 0.0350  0.0664  259  PHE A CD1 
2621 C CD2 . PHE A 354 ? 1.5212 1.3938 0.7566 -0.2715 0.0376  0.0708  259  PHE A CD2 
2622 C CE1 . PHE A 354 ? 1.5912 1.5413 0.7732 -0.2769 0.0256  0.0768  259  PHE A CE1 
2623 C CE2 . PHE A 354 ? 1.5436 1.5318 0.7821 -0.2580 0.0287  0.0813  259  PHE A CE2 
2624 C CZ  . PHE A 354 ? 1.5429 1.5719 0.7550 -0.2598 0.0229  0.0844  259  PHE A CZ  
2625 N N   . THR A 355 ? 1.5850 1.0559 0.7369 -0.3433 0.0521  0.0381  260  THR A N   
2626 C CA  . THR A 355 ? 1.6219 0.9871 0.7422 -0.3401 0.0601  0.0276  260  THR A CA  
2627 C C   . THR A 355 ? 1.7426 1.0607 0.8002 -0.3882 0.0417  0.0304  260  THR A C   
2628 O O   . THR A 355 ? 1.7976 1.0437 0.8091 -0.3908 0.0428  0.0235  260  THR A O   
2629 C CB  . THR A 355 ? 1.6721 1.0006 0.8211 -0.3155 0.0728  0.0210  260  THR A CB  
2630 O OG1 . THR A 355 ? 1.6021 0.9769 0.8028 -0.2800 0.0866  0.0193  260  THR A OG1 
2631 C CG2 . THR A 355 ? 1.6753 0.9095 0.7945 -0.3010 0.0838  0.0101  260  THR A CG2 
2632 N N   . PHE A 356 ? 1.6961 1.0547 0.7472 -0.4276 0.0244  0.0412  261  PHE A N   
2633 C CA  . PHE A 356 ? 1.7664 1.0819 0.7513 -0.4831 0.0045  0.0460  261  PHE A CA  
2634 C C   . PHE A 356 ? 1.8425 1.1905 0.7973 -0.5086 -0.0065 0.0486  261  PHE A C   
2635 O O   . PHE A 356 ? 1.9151 1.1879 0.8023 -0.5408 -0.0173 0.0454  261  PHE A O   
2636 C CB  . PHE A 356 ? 1.7871 1.1518 0.7778 -0.5210 -0.0098 0.0591  261  PHE A CB  
2637 C CG  . PHE A 356 ? 1.8961 1.2096 0.8112 -0.5862 -0.0312 0.0657  261  PHE A CG  
2638 C CD1 . PHE A 356 ? 2.0079 1.1909 0.8599 -0.5956 -0.0334 0.0598  261  PHE A CD1 
2639 C CD2 . PHE A 356 ? 1.9400 1.3360 0.8415 -0.6388 -0.0498 0.0783  261  PHE A CD2 
2640 C CE1 . PHE A 356 ? 2.1184 1.2372 0.8869 -0.6583 -0.0541 0.0659  261  PHE A CE1 
2641 C CE2 . PHE A 356 ? 2.0680 1.4119 0.8930 -0.7073 -0.0706 0.0848  261  PHE A CE2 
2642 C CZ  . PHE A 356 ? 2.1253 1.3233 0.8807 -0.7177 -0.0729 0.0785  261  PHE A CZ  
2643 N N   . LEU A 357 ? 1.7433 1.1991 0.7427 -0.4910 -0.0040 0.0536  262  LEU A N   
2644 C CA  . LEU A 357 ? 1.7565 1.2622 0.7352 -0.5062 -0.0130 0.0562  262  LEU A CA  
2645 C C   . LEU A 357 ? 1.8358 1.2651 0.7912 -0.4754 -0.0002 0.0435  262  LEU A C   
2646 O O   . LEU A 357 ? 1.8824 1.3007 0.7928 -0.5001 -0.0108 0.0424  262  LEU A O   
2647 C CB  . LEU A 357 ? 1.6901 1.3343 0.7201 -0.4849 -0.0126 0.0655  262  LEU A CB  
2648 C CG  . LEU A 357 ? 1.7458 1.5037 0.7751 -0.5333 -0.0338 0.0810  262  LEU A CG  
2649 C CD1 . LEU A 357 ? 1.7469 1.5040 0.7851 -0.5616 -0.0400 0.0885  262  LEU A CD1 
2650 C CD2 . LEU A 357 ? 1.7040 1.5971 0.7761 -0.4983 -0.0316 0.0885  262  LEU A CD2 
2651 N N   . ASP A 358 ? 1.7663 1.1458 0.7501 -0.4247 0.0219  0.0345  263  ASP A N   
2652 C CA  . ASP A 358 ? 1.7882 1.0967 0.7531 -0.3934 0.0370  0.0234  263  ASP A CA  
2653 C C   . ASP A 358 ? 1.9432 1.1395 0.8403 -0.4165 0.0304  0.0159  263  ASP A C   
2654 O O   . ASP A 358 ? 1.9831 1.1315 0.8413 -0.4104 0.0328  0.0092  263  ASP A O   
2655 C CB  . ASP A 358 ? 1.7562 1.0496 0.7693 -0.3411 0.0616  0.0174  263  ASP A CB  
2656 C CG  . ASP A 358 ? 1.8609 1.0941 0.8601 -0.3085 0.0797  0.0080  263  ASP A CG  
2657 O OD1 . ASP A 358 ? 1.8824 1.1326 0.8642 -0.3042 0.0793  0.0086  263  ASP A OD1 
2658 O OD2 . ASP A 358 ? 1.8985 1.0776 0.9077 -0.2851 0.0951  0.0009  263  ASP A OD2 
2659 N N   . VAL A 359 ? 1.9419 1.0927 0.8187 -0.4404 0.0220  0.0172  264  VAL A N   
2660 C CA  . VAL A 359 ? 2.0362 1.0692 0.8360 -0.4608 0.0137  0.0109  264  VAL A CA  
2661 C C   . VAL A 359 ? 2.1631 1.1848 0.8958 -0.5152 -0.0096 0.0140  264  VAL A C   
2662 O O   . VAL A 359 ? 2.2265 1.1617 0.8953 -0.5161 -0.0119 0.0052  264  VAL A O   
2663 C CB  . VAL A 359 ? 2.1017 1.0952 0.8945 -0.4715 0.0096  0.0135  264  VAL A CB  
2664 C CG1 . VAL A 359 ? 2.2138 1.0806 0.9086 -0.4992 -0.0039 0.0092  264  VAL A CG1 
2665 C CG2 . VAL A 359 ? 2.0399 1.0325 0.8888 -0.4171 0.0322  0.0077  264  VAL A CG2 
2666 N N   . LEU A 360 ? 2.1123 1.2279 0.8596 -0.5595 -0.0265 0.0264  265  LEU A N   
2667 C CA  . LEU A 360 ? 2.1783 1.3108 0.8702 -0.6200 -0.0505 0.0314  265  LEU A CA  
2668 C C   . LEU A 360 ? 2.2624 1.4102 0.9439 -0.6033 -0.0477 0.0251  265  LEU A C   
2669 O O   . LEU A 360 ? 2.3365 1.4474 0.9503 -0.6452 -0.0652 0.0230  265  LEU A O   
2670 C CB  . LEU A 360 ? 2.1361 1.4007 0.8649 -0.6610 -0.0650 0.0475  265  LEU A CB  
2671 C CG  . LEU A 360 ? 2.1871 1.4493 0.9211 -0.6882 -0.0712 0.0567  265  LEU A CG  
2672 C CD1 . LEU A 360 ? 2.1248 1.5417 0.9147 -0.7088 -0.0789 0.0724  265  LEU A CD1 
2673 C CD2 . LEU A 360 ? 2.3267 1.4761 0.9647 -0.7495 -0.0907 0.0573  265  LEU A CD2 
2674 N N   . ILE A 361 ? 2.1642 1.3595 0.9066 -0.5440 -0.0262 0.0220  266  ILE A N   
2675 C CA  . ILE A 361 ? 2.1726 1.3787 0.9081 -0.5188 -0.0197 0.0164  266  ILE A CA  
2676 C C   . ILE A 361 ? 2.3155 1.3876 0.9936 -0.5004 -0.0116 0.0029  266  ILE A C   
2677 O O   . ILE A 361 ? 2.3823 1.4171 1.0028 -0.5178 -0.0216 -0.0022 266  ILE A O   
2678 C CB  . ILE A 361 ? 2.1188 1.4074 0.9289 -0.4619 0.0012  0.0189  266  ILE A CB  
2679 C CG1 . ILE A 361 ? 2.0681 1.4919 0.9253 -0.4736 -0.0081 0.0321  266  ILE A CG1 
2680 C CG2 . ILE A 361 ? 2.1294 1.4123 0.9254 -0.4316 0.0104  0.0132  266  ILE A CG2 
2681 C CD1 . ILE A 361 ? 2.0627 1.5479 0.9860 -0.4169 0.0115  0.0347  266  ILE A CD1 
2682 N N   . GLN A 362 ? 2.2645 1.2702 0.9569 -0.4642 0.0060  -0.0029 267  GLN A N   
2683 C CA  . GLN A 362 ? 2.3181 1.2070 0.9628 -0.4356 0.0170  -0.0151 267  GLN A CA  
2684 C C   . GLN A 362 ? 2.4692 1.2503 1.0143 -0.4771 -0.0040 -0.0198 267  GLN A C   
2685 O O   . GLN A 362 ? 2.5215 1.2162 1.0060 -0.4619 -0.0019 -0.0299 267  GLN A O   
2686 C CB  . GLN A 362 ? 2.2944 1.1607 0.9819 -0.3926 0.0379  -0.0180 267  GLN A CB  
2687 C CG  . GLN A 362 ? 2.4772 1.4200 1.2463 -0.3485 0.0610  -0.0162 267  GLN A CG  
2688 C CD  . GLN A 362 ? 2.7553 1.7029 1.5758 -0.3207 0.0764  -0.0166 267  GLN A CD  
2689 O OE1 . GLN A 362 ? 2.7323 1.6679 1.5508 -0.3386 0.0674  -0.0141 267  GLN A OE1 
2690 N NE2 . GLN A 362 ? 2.6119 1.5833 1.4802 -0.2791 0.0995  -0.0190 267  GLN A NE2 
2691 N N   . LEU A 363 ? 2.4557 1.2372 0.9777 -0.5292 -0.0243 -0.0123 268  LEU A N   
2692 C CA  . LEU A 363 ? 2.5773 1.2479 0.9938 -0.5774 -0.0468 -0.0152 268  LEU A CA  
2693 C C   . LEU A 363 ? 2.6856 1.3638 1.0473 -0.6242 -0.0673 -0.0157 268  LEU A C   
2694 O O   . LEU A 363 ? 2.7785 1.3439 1.0487 -0.6328 -0.0762 -0.0256 268  LEU A O   
2695 C CB  . LEU A 363 ? 2.5952 1.2672 1.0025 -0.6240 -0.0618 -0.0049 268  LEU A CB  
2696 C CG  . LEU A 363 ? 2.6251 1.2639 1.0607 -0.5880 -0.0474 -0.0050 268  LEU A CG  
2697 C CD1 . LEU A 363 ? 2.6341 1.3003 1.0696 -0.6387 -0.0630 0.0079  268  LEU A CD1 
2698 C CD2 . LEU A 363 ? 2.7450 1.2328 1.1010 -0.5545 -0.0418 -0.0175 268  LEU A CD2 
2699 N N   . GLY A 364 ? 2.5808 1.3933 0.9954 -0.6517 -0.0751 -0.0055 269  GLY A N   
2700 C CA  . GLY A 364 ? 2.6202 1.4720 0.9954 -0.6989 -0.0956 -0.0042 269  GLY A CA  
2701 C C   . GLY A 364 ? 2.6825 1.6097 1.0494 -0.7758 -0.1210 0.0094  269  GLY A C   
2702 O O   . GLY A 364 ? 2.7370 1.6833 1.0531 -0.8315 -0.1433 0.0107  269  GLY A O   
2703 N N   . ILE A 365 ? 2.5863 1.5616 1.0029 -0.7808 -0.1178 0.0198  270  ILE A N   
2704 C CA  . ILE A 365 ? 2.5894 1.6505 1.0094 -0.8503 -0.1385 0.0354  270  ILE A CA  
2705 C C   . ILE A 365 ? 2.5513 1.7937 1.0407 -0.8508 -0.1408 0.0447  270  ILE A C   
2706 O O   . ILE A 365 ? 2.5852 1.8966 1.0454 -0.9153 -0.1637 0.0522  270  ILE A O   
2707 C CB  . ILE A 365 ? 2.5939 1.6509 1.0491 -0.8441 -0.1312 0.0433  270  ILE A CB  
2708 C CG1 . ILE A 365 ? 2.6600 1.5468 1.0628 -0.8135 -0.1212 0.0323  270  ILE A CG1 
2709 C CG2 . ILE A 365 ? 2.6239 1.7564 1.0698 -0.9224 -0.1534 0.0605  270  ILE A CG2 
2710 C CD1 . ILE A 365 ? 2.9155 1.6364 1.1847 -0.8636 -0.1414 0.0263  270  ILE A CD1 
2711 N N   . ILE A 366 ? 2.3940 1.7100 0.9686 -0.7782 -0.1172 0.0439  271  ILE A N   
2712 C CA  . ILE A 366 ? 2.3116 1.7869 0.9477 -0.7588 -0.1154 0.0513  271  ILE A CA  
2713 C C   . ILE A 366 ? 2.3412 1.7856 0.9757 -0.7038 -0.1007 0.0393  271  ILE A C   
2714 O O   . ILE A 366 ? 2.2803 1.6927 0.9552 -0.6374 -0.0759 0.0334  271  ILE A O   
2715 C CB  . ILE A 366 ? 2.2488 1.8330 0.9731 -0.7218 -0.1022 0.0616  271  ILE A CB  
2716 C CG1 . ILE A 366 ? 2.2700 1.8732 0.9918 -0.7755 -0.1155 0.0735  271  ILE A CG1 
2717 C CG2 . ILE A 366 ? 2.1960 1.9416 0.9692 -0.6980 -0.1022 0.0695  271  ILE A CG2 
2718 C CD1 . ILE A 366 ? 2.2744 1.9589 1.0750 -0.7372 -0.1020 0.0820  271  ILE A CD1 
2719 N N   . ARG A 367 ? 2.3515 1.7998 0.9333 -0.7364 -0.1168 0.0359  272  ARG A N   
2720 C CA  . ARG A 367 ? 2.3481 1.7715 0.9173 -0.6935 -0.1067 0.0257  272  ARG A CA  
2721 C C   . ARG A 367 ? 2.3290 1.9150 0.9392 -0.6822 -0.1108 0.0342  272  ARG A C   
2722 O O   . ARG A 367 ? 2.3704 2.0122 0.9436 -0.7273 -0.1320 0.0360  272  ARG A O   
2723 C CB  . ARG A 367 ? 2.4673 1.7652 0.9385 -0.7336 -0.1221 0.0142  272  ARG A CB  
2724 C CG  . ARG A 367 ? 2.6458 1.9175 1.0904 -0.7000 -0.1161 0.0036  272  ARG A CG  
2725 C CD  . ARG A 367 ? 2.7417 1.9616 1.2224 -0.6171 -0.0842 -0.0037 272  ARG A CD  
2726 N NE  . ARG A 367 ? 2.8817 2.0719 1.3273 -0.5919 -0.0803 -0.0127 272  ARG A NE  
2727 C CZ  . ARG A 367 ? 3.0190 2.3079 1.4952 -0.5636 -0.0757 -0.0092 272  ARG A CZ  
2728 N NH1 . ARG A 367 ? 2.7639 2.1884 1.3037 -0.5536 -0.0747 0.0029  272  ARG A NH1 
2729 N NH2 . ARG A 367 ? 2.9099 2.1608 1.3481 -0.5417 -0.0722 -0.0176 272  ARG A NH2 
2730 N N   . ASP A 368 ? 2.1816 1.8458 0.8651 -0.6226 -0.0915 0.0400  273  ASP A N   
2731 C CA  . ASP A 368 ? 2.1182 1.9326 0.8419 -0.5929 -0.0912 0.0485  273  ASP A CA  
2732 C C   . ASP A 368 ? 2.0730 1.8821 0.8487 -0.5097 -0.0623 0.0472  273  ASP A C   
2733 O O   . ASP A 368 ? 2.0144 1.8072 0.8294 -0.4913 -0.0506 0.0496  273  ASP A O   
2734 C CB  . ASP A 368 ? 2.1196 2.0792 0.8692 -0.6368 -0.1099 0.0639  273  ASP A CB  
2735 C CG  . ASP A 368 ? 2.1961 2.3291 0.9747 -0.6136 -0.1153 0.0737  273  ASP A CG  
2736 O OD1 . ASP A 368 ? 2.1920 2.4555 0.9876 -0.6520 -0.1318 0.0868  273  ASP A OD1 
2737 O OD2 . ASP A 368 ? 2.2457 2.3858 1.0257 -0.5567 -0.1032 0.0690  273  ASP A OD2 
2738 N N   . CYS A 369 ? 2.0176 1.8347 0.7881 -0.4617 -0.0513 0.0433  274  CYS A N   
2739 C CA  . CYS A 369 ? 1.9614 1.7619 0.7665 -0.3858 -0.0243 0.0422  274  CYS A CA  
2740 C C   . CYS A 369 ? 1.9369 1.8599 0.7904 -0.3538 -0.0222 0.0539  274  CYS A C   
2741 O O   . CYS A 369 ? 1.8931 1.7876 0.7771 -0.3026 -0.0016 0.0536  274  CYS A O   
2742 C CB  . CYS A 369 ? 1.9874 1.7639 0.7629 -0.3491 -0.0154 0.0366  274  CYS A CB  
2743 S SG  . CYS A 369 ? 2.1032 1.7246 0.8212 -0.3686 -0.0123 0.0219  274  CYS A SG  
2744 N N   . ARG A 370 ? 1.8760 1.9353 0.7328 -0.3834 -0.0434 0.0640  275  ARG A N   
2745 C CA  . ARG A 370 ? 1.8177 2.0053 0.7150 -0.3513 -0.0433 0.0758  275  ARG A CA  
2746 C C   . ARG A 370 ? 1.8176 1.9820 0.7518 -0.3622 -0.0389 0.0787  275  ARG A C   
2747 O O   . ARG A 370 ? 1.7653 1.9508 0.7324 -0.3101 -0.0250 0.0818  275  ARG A O   
2748 C CB  . ARG A 370 ? 1.8301 2.1806 0.7205 -0.3853 -0.0680 0.0865  275  ARG A CB  
2749 C CG  . ARG A 370 ? 1.9163 2.4178 0.8432 -0.3437 -0.0685 0.0994  275  ARG A CG  
2750 C CD  . ARG A 370 ? 2.0163 2.5326 0.9410 -0.2534 -0.0511 0.0989  275  ARG A CD  
2751 N NE  . ARG A 370 ? 2.0698 2.7117 1.0212 -0.2066 -0.0507 0.1102  275  ARG A NE  
2752 C CZ  . ARG A 370 ? 2.2052 2.8097 1.1825 -0.1653 -0.0357 0.1108  275  ARG A CZ  
2753 N NH1 . ARG A 370 ? 2.0247 2.4778 1.0097 -0.1674 -0.0198 0.1012  275  ARG A NH1 
2754 N NH2 . ARG A 370 ? 2.0165 2.7381 1.0096 -0.1200 -0.0370 0.1208  275  ARG A NH2 
2755 N N   . ILE A 371 ? 1.7941 1.9038 0.7157 -0.4279 -0.0506 0.0770  276  ILE A N   
2756 C CA  . ILE A 371 ? 1.7634 1.8408 0.7131 -0.4439 -0.0478 0.0794  276  ILE A CA  
2757 C C   . ILE A 371 ? 1.7858 1.7225 0.7440 -0.4033 -0.0237 0.0677  276  ILE A C   
2758 O O   . ILE A 371 ? 1.7339 1.6659 0.7304 -0.3738 -0.0116 0.0690  276  ILE A O   
2759 C CB  . ILE A 371 ? 1.8476 1.9123 0.7685 -0.5294 -0.0700 0.0828  276  ILE A CB  
2760 C CG1 . ILE A 371 ? 1.8685 2.0860 0.7798 -0.5766 -0.0945 0.0953  276  ILE A CG1 
2761 C CG2 . ILE A 371 ? 1.8351 1.8666 0.7825 -0.5424 -0.0667 0.0862  276  ILE A CG2 
2762 C CD1 . ILE A 371 ? 2.0285 2.2313 0.8938 -0.6730 -0.1197 0.0991  276  ILE A CD1 
2763 N N   . ALA A 372 ? 1.7776 1.6086 0.6998 -0.4002 -0.0167 0.0566  277  ALA A N   
2764 C CA  . ALA A 372 ? 1.7683 1.4764 0.6951 -0.3640 0.0064  0.0461  277  ALA A CA  
2765 C C   . ALA A 372 ? 1.7726 1.4999 0.7339 -0.2965 0.0277  0.0470  277  ALA A C   
2766 O O   . ALA A 372 ? 1.7482 1.4087 0.7320 -0.2718 0.0453  0.0423  277  ALA A O   
2767 C CB  . ALA A 372 ? 1.8305 1.4459 0.7082 -0.3703 0.0086  0.0359  277  ALA A CB  
2768 N N   . ASP A 373 ? 1.7136 1.5308 0.6735 -0.2674 0.0254  0.0532  278  ASP A N   
2769 C CA  . ASP A 373 ? 1.6770 1.5087 0.6535 -0.2023 0.0431  0.0551  278  ASP A CA  
2770 C C   . ASP A 373 ? 1.6783 1.5515 0.6953 -0.1873 0.0454  0.0604  278  ASP A C   
2771 O O   . ASP A 373 ? 1.6615 1.4757 0.6937 -0.1509 0.0637  0.0566  278  ASP A O   
2772 C CB  . ASP A 373 ? 1.7072 1.6300 0.6621 -0.1733 0.0370  0.0612  278  ASP A CB  
2773 C CG  . ASP A 373 ? 1.7641 1.6943 0.7206 -0.1027 0.0537  0.0640  278  ASP A CG  
2774 O OD1 . ASP A 373 ? 1.7580 1.5860 0.7139 -0.0758 0.0746  0.0580  278  ASP A OD1 
2775 O OD2 . ASP A 373 ? 1.8200 1.8572 0.7721 -0.0740 0.0456  0.0724  278  ASP A OD2 
2776 N N   . ILE A 374 ? 1.6099 1.5850 0.6420 -0.2185 0.0263  0.0693  279  ILE A N   
2777 C CA  . ILE A 374 ? 1.5617 1.5963 0.6304 -0.2082 0.0248  0.0760  279  ILE A CA  
2778 C C   . ILE A 374 ? 1.5852 1.5208 0.6767 -0.2208 0.0351  0.0690  279  ILE A C   
2779 O O   . ILE A 374 ? 1.5458 1.4802 0.6639 -0.1882 0.0448  0.0692  279  ILE A O   
2780 C CB  . ILE A 374 ? 1.5928 1.7599 0.6681 -0.2514 0.0010  0.0881  279  ILE A CB  
2781 C CG1 . ILE A 374 ? 1.6093 1.8912 0.6642 -0.2339 -0.0090 0.0951  279  ILE A CG1 
2782 C CG2 . ILE A 374 ? 1.5625 1.7942 0.6753 -0.2412 -0.0004 0.0957  279  ILE A CG2 
2783 C CD1 . ILE A 374 ? 1.7024 2.1191 0.7557 -0.2902 -0.0342 0.1067  279  ILE A CD1 
2784 N N   . VAL A 375 ? 1.5647 1.4165 0.6405 -0.2639 0.0328  0.0625  280  VAL A N   
2785 C CA  . VAL A 375 ? 1.5525 1.3136 0.6442 -0.2736 0.0418  0.0556  280  VAL A CA  
2786 C C   . VAL A 375 ? 1.6145 1.2901 0.7119 -0.2275 0.0662  0.0463  280  VAL A C   
2787 O O   . VAL A 375 ? 1.5889 1.2393 0.7156 -0.2083 0.0772  0.0437  280  VAL A O   
2788 C CB  . VAL A 375 ? 1.6350 1.3312 0.6960 -0.3293 0.0305  0.0520  280  VAL A CB  
2789 C CG1 . VAL A 375 ? 1.6248 1.2266 0.6969 -0.3294 0.0412  0.0444  280  VAL A CG1 
2790 C CG2 . VAL A 375 ? 1.6460 1.4226 0.6971 -0.3832 0.0063  0.0626  280  VAL A CG2 
2791 N N   . ASP A 376 ? 1.6067 1.2438 0.6753 -0.2117 0.0741  0.0420  281  ASP A N   
2792 C CA  . ASP A 376 ? 1.6150 1.1732 0.6831 -0.1749 0.0973  0.0348  281  ASP A CA  
2793 C C   . ASP A 376 ? 1.6654 1.2518 0.7448 -0.1256 0.1086  0.0383  281  ASP A C   
2794 O O   . ASP A 376 ? 1.6621 1.1831 0.7467 -0.1019 0.1275  0.0333  281  ASP A O   
2795 C CB  . ASP A 376 ? 1.6792 1.1885 0.7082 -0.1745 0.1020  0.0303  281  ASP A CB  
2796 C CG  . ASP A 376 ? 1.8189 1.2565 0.8280 -0.2093 0.0988  0.0230  281  ASP A CG  
2797 O OD1 . ASP A 376 ? 1.8287 1.2836 0.8303 -0.2502 0.0803  0.0247  281  ASP A OD1 
2798 O OD2 . ASP A 376 ? 1.9157 1.2781 0.9111 -0.1951 0.1147  0.0160  281  ASP A OD2 
2799 N N   . THR A 377 ? 1.6213 1.3019 0.6993 -0.1100 0.0971  0.0469  282  THR A N   
2800 C CA  . THR A 377 ? 1.6155 1.3138 0.6912 -0.0574 0.1064  0.0501  282  THR A CA  
2801 C C   . THR A 377 ? 1.6183 1.3306 0.7288 -0.0526 0.1064  0.0505  282  THR A C   
2802 O O   . THR A 377 ? 1.6171 1.2991 0.7242 -0.0143 0.1182  0.0490  282  THR A O   
2803 C CB  . THR A 377 ? 1.7478 1.5425 0.7986 -0.0302 0.0954  0.0589  282  THR A CB  
2804 O OG1 . THR A 377 ? 1.7587 1.5413 0.7903 0.0282  0.1069  0.0605  282  THR A OG1 
2805 C CG2 . THR A 377 ? 1.7155 1.6322 0.7859 -0.0525 0.0740  0.0677  282  THR A CG2 
2806 N N   . ALA A 378 ? 1.5397 1.2913 0.6774 -0.0929 0.0927  0.0526  283  ALA A N   
2807 C CA  . ALA A 378 ? 1.4993 1.2754 0.6704 -0.0931 0.0900  0.0540  283  ALA A CA  
2808 C C   . ALA A 378 ? 1.5303 1.2189 0.7240 -0.1097 0.1009  0.0448  283  ALA A C   
2809 O O   . ALA A 378 ? 1.5059 1.1930 0.7233 -0.0959 0.1046  0.0433  283  ALA A O   
2810 C CB  . ALA A 378 ? 1.4919 1.3646 0.6760 -0.1285 0.0692  0.0632  283  ALA A CB  
2811 N N   . MET A 379 ? 1.4999 1.1199 0.6838 -0.1358 0.1055  0.0386  284  MET A N   
2812 C CA  . MET A 379 ? 1.4916 1.0373 0.6938 -0.1469 0.1161  0.0300  284  MET A CA  
2813 C C   . MET A 379 ? 1.5215 1.0192 0.7342 -0.1134 0.1356  0.0241  284  MET A C   
2814 O O   . MET A 379 ? 1.4903 0.9740 0.7311 -0.1159 0.1391  0.0202  284  MET A O   
2815 C CB  . MET A 379 ? 1.5560 1.0385 0.7364 -0.1714 0.1184  0.0245  284  MET A CB  
2816 C CG  . MET A 379 ? 1.6259 1.1208 0.7963 -0.2139 0.1002  0.0273  284  MET A CG  
2817 S SD  . MET A 379 ? 1.7402 1.1376 0.8765 -0.2349 0.1039  0.0184  284  MET A SD  
2818 C CE  . MET A 379 ? 1.6787 1.0258 0.8489 -0.2178 0.1204  0.0104  284  MET A CE  
2819 N N   . PRO A 380 ? 1.4921 0.9639 0.6805 -0.0840 0.1478  0.0238  285  PRO A N   
2820 C CA  . PRO A 380 ? 1.4858 0.9072 0.6783 -0.0609 0.1646  0.0190  285  PRO A CA  
2821 C C   . PRO A 380 ? 1.4748 0.9312 0.6826 -0.0423 0.1592  0.0206  285  PRO A C   
2822 O O   . PRO A 380 ? 1.4548 0.8731 0.6768 -0.0381 0.1685  0.0149  285  PRO A O   
2823 C CB  . PRO A 380 ? 1.5500 0.9410 0.7008 -0.0346 0.1750  0.0211  285  PRO A CB  
2824 C CG  . PRO A 380 ? 1.6184 1.0707 0.7492 -0.0320 0.1605  0.0282  285  PRO A CG  
2825 C CD  . PRO A 380 ? 1.5415 1.0236 0.6930 -0.0722 0.1467  0.0279  285  PRO A CD  
2826 N N   . ILE A 381 ? 1.4006 0.9346 0.6046 -0.0322 0.1436  0.0284  286  ILE A N   
2827 C CA  . ILE A 381 ? 1.3768 0.9576 0.5904 -0.0097 0.1363  0.0313  286  ILE A CA  
2828 C C   . ILE A 381 ? 1.3810 0.9838 0.6381 -0.0383 0.1289  0.0296  286  ILE A C   
2829 O O   . ILE A 381 ? 1.3646 0.9598 0.6365 -0.0250 0.1310  0.0260  286  ILE A O   
2830 C CB  . ILE A 381 ? 1.4209 1.0922 0.6139 0.0130  0.1227  0.0417  286  ILE A CB  
2831 C CG1 . ILE A 381 ? 1.4769 1.1246 0.6223 0.0437  0.1299  0.0435  286  ILE A CG1 
2832 C CG2 . ILE A 381 ? 1.4120 1.1369 0.6096 0.0440  0.1156  0.0452  286  ILE A CG2 
2833 C CD1 . ILE A 381 ? 1.5961 1.3416 0.7193 0.0635  0.1164  0.0537  286  ILE A CD1 
2834 N N   . THR A 382 ? 1.3133 0.9358 0.5839 -0.0769 0.1199  0.0318  287  THR A N   
2835 C CA  . THR A 382 ? 1.2787 0.9159 0.5809 -0.1048 0.1122  0.0315  287  THR A CA  
2836 C C   . THR A 382 ? 1.3318 0.8956 0.6532 -0.1105 0.1253  0.0207  287  THR A C   
2837 O O   . THR A 382 ? 1.3104 0.8844 0.6585 -0.1148 0.1225  0.0189  287  THR A O   
2838 C CB  . THR A 382 ? 1.3711 1.0344 0.6667 -0.1458 0.0985  0.0373  287  THR A CB  
2839 O OG1 . THR A 382 ? 1.3869 0.9845 0.6617 -0.1601 0.1054  0.0317  287  THR A OG1 
2840 C CG2 . THR A 382 ? 1.3548 1.1122 0.6378 -0.1491 0.0830  0.0491  287  THR A CG2 
2841 N N   . ILE A 383 ? 1.3234 0.8218 0.6316 -0.1099 0.1395  0.0142  288  ILE A N   
2842 C CA  . ILE A 383 ? 1.3248 0.7668 0.6509 -0.1143 0.1531  0.0047  288  ILE A CA  
2843 C C   . ILE A 383 ? 1.3890 0.8175 0.7236 -0.0913 0.1623  0.0003  288  ILE A C   
2844 O O   . ILE A 383 ? 1.3730 0.7803 0.7313 -0.0960 0.1691  -0.0068 288  ILE A O   
2845 C CB  . ILE A 383 ? 1.3895 0.7760 0.6971 -0.1216 0.1655  0.0004  288  ILE A CB  
2846 C CG1 . ILE A 383 ? 1.3876 0.7371 0.7166 -0.1291 0.1766  -0.0082 288  ILE A CG1 
2847 C CG2 . ILE A 383 ? 1.4202 0.7813 0.7001 -0.1019 0.1773  0.0013  288  ILE A CG2 
2848 C CD1 . ILE A 383 ? 1.4958 0.8010 0.8070 -0.1346 0.1873  -0.0120 288  ILE A CD1 
2849 N N   . CYS A 384 ? 1.3737 0.8138 0.6833 -0.0656 0.1613  0.0045  289  CYS A N   
2850 C CA  . CYS A 384 ? 1.3901 0.8067 0.6909 -0.0418 0.1674  0.0008  289  CYS A CA  
2851 C C   . CYS A 384 ? 1.3999 0.8613 0.7264 -0.0373 0.1559  0.0007  289  CYS A C   
2852 O O   . CYS A 384 ? 1.4044 0.8392 0.7442 -0.0366 0.1609  -0.0067 289  CYS A O   
2853 C CB  . CYS A 384 ? 1.4404 0.8480 0.6938 -0.0098 0.1689  0.0058  289  CYS A CB  
2854 S SG  . CYS A 384 ? 1.5339 0.8928 0.7547 0.0227  0.1744  0.0014  289  CYS A SG  
2855 N N   . ILE A 385 ? 1.3077 0.8406 0.6412 -0.0374 0.1405  0.0092  290  ILE A N   
2856 C CA  . ILE A 385 ? 1.2647 0.8529 0.6216 -0.0335 0.1286  0.0117  290  ILE A CA  
2857 C C   . ILE A 385 ? 1.2582 0.8383 0.6535 -0.0639 0.1279  0.0070  290  ILE A C   
2858 O O   . ILE A 385 ? 1.2368 0.8267 0.6529 -0.0586 0.1254  0.0033  290  ILE A O   
2859 C CB  . ILE A 385 ? 1.2932 0.9696 0.6432 -0.0292 0.1132  0.0244  290  ILE A CB  
2860 C CG1 . ILE A 385 ? 1.3308 1.0197 0.6390 0.0096  0.1142  0.0286  290  ILE A CG1 
2861 C CG2 . ILE A 385 ? 1.2707 1.0122 0.6452 -0.0269 0.1015  0.0288  290  ILE A CG2 
2862 C CD1 . ILE A 385 ? 1.4142 1.1940 0.7118 0.0109  0.1013  0.0411  290  ILE A CD1 
2863 N N   . ALA A 386 ? 1.1892 0.7472 0.5878 -0.0916 0.1301  0.0066  291  ALA A N   
2864 C CA  . ALA A 386 ? 1.1528 0.6950 0.5759 -0.1142 0.1300  0.0023  291  ALA A CA  
2865 C C   . ALA A 386 ? 1.1724 0.6690 0.6129 -0.1084 0.1438  -0.0095 291  ALA A C   
2866 O O   . ALA A 386 ? 1.1419 0.6405 0.6070 -0.1161 0.1427  -0.0138 291  ALA A O   
2867 C CB  . ALA A 386 ? 1.1754 0.6946 0.5825 -0.1384 0.1288  0.0044  291  ALA A CB  
2868 N N   . TYR A 387 ? 1.1325 0.5909 0.5573 -0.0962 0.1565  -0.0141 292  TYR A N   
2869 C CA  . TYR A 387 ? 1.1263 0.5470 0.5633 -0.0968 0.1698  -0.0242 292  TYR A CA  
2870 C C   . TYR A 387 ? 1.2136 0.6229 0.6376 -0.0781 0.1706  -0.0272 292  TYR A C   
2871 O O   . TYR A 387 ? 1.2258 0.5980 0.6489 -0.0822 0.1812  -0.0350 292  TYR A O   
2872 C CB  . TYR A 387 ? 1.1473 0.5245 0.5699 -0.1049 0.1851  -0.0266 292  TYR A CB  
2873 C CG  . TYR A 387 ? 1.1369 0.5129 0.5714 -0.1196 0.1864  -0.0279 292  TYR A CG  
2874 C CD1 . TYR A 387 ? 1.1595 0.5336 0.5727 -0.1258 0.1806  -0.0220 292  TYR A CD1 
2875 C CD2 . TYR A 387 ? 1.1297 0.5071 0.5916 -0.1255 0.1917  -0.0353 292  TYR A CD2 
2876 C CE1 . TYR A 387 ? 1.1463 0.5062 0.5577 -0.1363 0.1803  -0.0237 292  TYR A CE1 
2877 C CE2 . TYR A 387 ? 1.1365 0.5081 0.5996 -0.1311 0.1922  -0.0365 292  TYR A CE2 
2878 C CZ  . TYR A 387 ? 1.1950 0.5514 0.6292 -0.1360 0.1864  -0.0308 292  TYR A CZ  
2879 O OH  . TYR A 387 ? 1.1920 0.5285 0.6148 -0.1389 0.1861  -0.0327 292  TYR A OH  
2880 N N   . PHE A 388 ? 1.1775 0.6207 0.5883 -0.0583 0.1586  -0.0211 293  PHE A N   
2881 C CA  . PHE A 388 ? 1.2042 0.6346 0.5908 -0.0326 0.1565  -0.0233 293  PHE A CA  
2882 C C   . PHE A 388 ? 1.2402 0.6774 0.6534 -0.0352 0.1527  -0.0313 293  PHE A C   
2883 O O   . PHE A 388 ? 1.2699 0.6718 0.6601 -0.0217 0.1542  -0.0374 293  PHE A O   
2884 C CB  . PHE A 388 ? 1.2324 0.7128 0.5975 -0.0057 0.1442  -0.0133 293  PHE A CB  
2885 C CG  . PHE A 388 ? 1.3093 0.7581 0.6223 0.0308  0.1454  -0.0132 293  PHE A CG  
2886 C CD1 . PHE A 388 ? 1.3687 0.8068 0.6671 0.0537  0.1406  -0.0182 293  PHE A CD1 
2887 C CD2 . PHE A 388 ? 1.3789 0.8070 0.6505 0.0461  0.1502  -0.0079 293  PHE A CD2 
2888 C CE1 . PHE A 388 ? 1.4461 0.8426 0.6828 0.0924  0.1410  -0.0184 293  PHE A CE1 
2889 C CE2 . PHE A 388 ? 1.4739 0.8653 0.6866 0.0857  0.1511  -0.0074 293  PHE A CE2 
2890 C CZ  . PHE A 388 ? 1.4757 0.8475 0.6682 0.1094  0.1464  -0.0127 293  PHE A CZ  
2891 N N   . ASN A 389 ? 1.1490 0.6261 0.6041 -0.0520 0.1472  -0.0314 294  ASN A N   
2892 C CA  . ASN A 389 ? 1.1202 0.6120 0.6041 -0.0543 0.1429  -0.0386 294  ASN A CA  
2893 C C   . ASN A 389 ? 1.1817 0.6275 0.6698 -0.0668 0.1543  -0.0508 294  ASN A C   
2894 O O   . ASN A 389 ? 1.1803 0.6212 0.6703 -0.0616 0.1508  -0.0582 294  ASN A O   
2895 C CB  . ASN A 389 ? 1.0742 0.6077 0.5937 -0.0699 0.1365  -0.0353 294  ASN A CB  
2896 C CG  . ASN A 389 ? 1.1747 0.6891 0.7033 -0.0906 0.1448  -0.0360 294  ASN A CG  
2897 O OD1 . ASN A 389 ? 0.9637 0.4652 0.5125 -0.0998 0.1522  -0.0444 294  ASN A OD1 
2898 N ND2 . ASN A 389 ? 1.0786 0.5961 0.5901 -0.0966 0.1426  -0.0273 294  ASN A ND2 
2899 N N   . ASN A 390 ? 1.1546 0.5692 0.6404 -0.0840 0.1677  -0.0526 295  ASN A N   
2900 C CA  . ASN A 390 ? 1.1729 0.5544 0.6627 -0.1021 0.1800  -0.0623 295  ASN A CA  
2901 C C   . ASN A 390 ? 1.2914 0.6289 0.7467 -0.0967 0.1796  -0.0683 295  ASN A C   
2902 O O   . ASN A 390 ? 1.3062 0.6363 0.7736 -0.1133 0.1822  -0.0778 295  ASN A O   
2903 C CB  . ASN A 390 ? 1.1543 0.5082 0.6325 -0.1154 0.1948  -0.0599 295  ASN A CB  
2904 C CG  . ASN A 390 ? 1.2679 0.6512 0.7729 -0.1223 0.1966  -0.0572 295  ASN A CG  
2905 O OD1 . ASN A 390 ? 1.0829 0.4812 0.6148 -0.1340 0.2033  -0.0630 295  ASN A OD1 
2906 N ND2 . ASN A 390 ? 1.1325 0.5243 0.6254 -0.1143 0.1901  -0.0486 295  ASN A ND2 
2907 N N   . CYS A 391 ? 1.2865 0.5953 0.6946 -0.0724 0.1752  -0.0630 296  CYS A N   
2908 C CA  . CYS A 391 ? 1.3496 0.6005 0.7075 -0.0611 0.1736  -0.0683 296  CYS A CA  
2909 C C   . CYS A 391 ? 1.3886 0.6660 0.7416 -0.0319 0.1577  -0.0694 296  CYS A C   
2910 O O   . CYS A 391 ? 1.4298 0.6605 0.7451 -0.0235 0.1541  -0.0768 296  CYS A O   
2911 C CB  . CYS A 391 ? 1.4160 0.6076 0.7117 -0.0461 0.1801  -0.0623 296  CYS A CB  
2912 S SG  . CYS A 391 ? 1.4614 0.6889 0.7306 0.0004  0.1690  -0.0502 296  CYS A SG  
2913 N N   . LEU A 392 ? 1.2947 0.6434 0.6795 -0.0176 0.1481  -0.0617 297  LEU A N   
2914 C CA  . LEU A 392 ? 1.2818 0.6705 0.6649 0.0111  0.1337  -0.0600 297  LEU A CA  
2915 C C   . LEU A 392 ? 1.2616 0.6889 0.6931 -0.0024 0.1277  -0.0668 297  LEU A C   
2916 O O   . LEU A 392 ? 1.2593 0.7000 0.6824 0.0188  0.1175  -0.0697 297  LEU A O   
2917 C CB  . LEU A 392 ? 1.2571 0.7107 0.6457 0.0297  0.1264  -0.0460 297  LEU A CB  
2918 C CG  . LEU A 392 ? 1.3381 0.8257 0.6993 0.0710  0.1142  -0.0413 297  LEU A CG  
2919 C CD1 . LEU A 392 ? 1.4160 0.8485 0.7062 0.1052  0.1167  -0.0407 297  LEU A CD1 
2920 C CD2 . LEU A 392 ? 1.3176 0.8969 0.7062 0.0745  0.1054  -0.0276 297  LEU A CD2 
2921 N N   . ASN A 393 ? 1.1597 0.6051 0.6373 -0.0330 0.1339  -0.0693 298  ASN A N   
2922 C CA  . ASN A 393 ? 1.1056 0.5874 0.6275 -0.0444 0.1294  -0.0758 298  ASN A CA  
2923 C C   . ASN A 393 ? 1.1577 0.6064 0.6661 -0.0462 0.1272  -0.0895 298  ASN A C   
2924 O O   . ASN A 393 ? 1.1280 0.6076 0.6502 -0.0339 0.1167  -0.0926 298  ASN A O   
2925 C CB  . ASN A 393 ? 1.0567 0.5538 0.6176 -0.0710 0.1382  -0.0769 298  ASN A CB  
2926 C CG  . ASN A 393 ? 1.2532 0.7813 0.8265 -0.0719 0.1367  -0.0651 298  ASN A CG  
2927 O OD1 . ASN A 393 ? 1.1359 0.6985 0.7069 -0.0591 0.1263  -0.0556 298  ASN A OD1 
2928 N ND2 . ASN A 393 ? 1.1679 0.6849 0.7510 -0.0888 0.1469  -0.0653 298  ASN A ND2 
2929 N N   . PRO A 394 ? 1.1604 0.5445 0.6358 -0.0618 0.1358  -0.0972 299  PRO A N   
2930 C CA  . PRO A 394 ? 1.1929 0.5411 0.6480 -0.0691 0.1314  -0.1105 299  PRO A CA  
2931 C C   . PRO A 394 ? 1.2534 0.5787 0.6619 -0.0325 0.1185  -0.1116 299  PRO A C   
2932 O O   . PRO A 394 ? 1.2654 0.5771 0.6649 -0.0333 0.1106  -0.1226 299  PRO A O   
2933 C CB  . PRO A 394 ? 1.2796 0.5566 0.6965 -0.0963 0.1437  -0.1148 299  PRO A CB  
2934 C CG  . PRO A 394 ? 1.3399 0.6047 0.7415 -0.0883 0.1525  -0.1029 299  PRO A CG  
2935 C CD  . PRO A 394 ? 1.2096 0.5502 0.6634 -0.0785 0.1498  -0.0941 299  PRO A CD  
2936 N N   . LEU A 395 ? 1.2065 0.5320 0.5836 0.0012  0.1158  -0.1005 300  LEU A N   
2937 C CA  . LEU A 395 ? 1.2361 0.5508 0.5649 0.0454  0.1041  -0.0995 300  LEU A CA  
2938 C C   . LEU A 395 ? 1.2316 0.6272 0.6028 0.0623  0.0922  -0.0974 300  LEU A C   
2939 O O   . LEU A 395 ? 1.2555 0.6434 0.5933 0.0940  0.0818  -0.1012 300  LEU A O   
2940 C CB  . LEU A 395 ? 1.2591 0.5678 0.5454 0.0785  0.1055  -0.0871 300  LEU A CB  
2941 C CG  . LEU A 395 ? 1.4103 0.6166 0.6162 0.0872  0.1121  -0.0899 300  LEU A CG  
2942 C CD1 . LEU A 395 ? 1.4128 0.5815 0.6302 0.0436  0.1272  -0.0905 300  LEU A CD1 
2943 C CD2 . LEU A 395 ? 1.4690 0.6839 0.6282 0.1352  0.1094  -0.0783 300  LEU A CD2 
2944 N N   . PHE A 396 ? 1.1238 0.5903 0.5617 0.0422  0.0936  -0.0913 301  PHE A N   
2945 C CA  . PHE A 396 ? 1.0745 0.6158 0.5526 0.0525  0.0835  -0.0873 301  PHE A CA  
2946 C C   . PHE A 396 ? 1.1538 0.6905 0.6494 0.0428  0.0785  -0.1016 301  PHE A C   
2947 O O   . PHE A 396 ? 1.1105 0.7054 0.6409 0.0488  0.0711  -0.0994 301  PHE A O   
2948 C CB  . PHE A 396 ? 1.0326 0.6333 0.5621 0.0322  0.0865  -0.0761 301  PHE A CB  
2949 C CG  . PHE A 396 ? 1.0452 0.6705 0.5633 0.0396  0.0876  -0.0608 301  PHE A CG  
2950 C CD1 . PHE A 396 ? 1.0831 0.7503 0.5783 0.0722  0.0788  -0.0506 301  PHE A CD1 
2951 C CD2 . PHE A 396 ? 1.0635 0.6806 0.5954 0.0141  0.0966  -0.0561 301  PHE A CD2 
2952 C CE1 . PHE A 396 ? 1.0894 0.7920 0.5760 0.0761  0.0789  -0.0363 301  PHE A CE1 
2953 C CE2 . PHE A 396 ? 1.0914 0.7340 0.6118 0.0177  0.0961  -0.0426 301  PHE A CE2 
2954 C CZ  . PHE A 396 ? 1.0713 0.7595 0.5707 0.0467  0.0870  -0.0327 301  PHE A CZ  
2955 N N   . TYR A 397 ? 1.1776 0.6463 0.6460 0.0261  0.0821  -0.1158 302  TYR A N   
2956 C CA  . TYR A 397 ? 1.1894 0.6515 0.6675 0.0136  0.0762  -0.1309 302  TYR A CA  
2957 C C   . TYR A 397 ? 1.3248 0.7463 0.7438 0.0472  0.0640  -0.1379 302  TYR A C   
2958 O O   . TYR A 397 ? 1.3447 0.7477 0.7569 0.0393  0.0570  -0.1519 302  TYR A O   
2959 C CB  . TYR A 397 ? 1.2215 0.6407 0.7021 -0.0301 0.0858  -0.1421 302  TYR A CB  
2960 C CG  . TYR A 397 ? 1.1672 0.6411 0.7117 -0.0574 0.0954  -0.1388 302  TYR A CG  
2961 C CD1 . TYR A 397 ? 1.1730 0.6473 0.7250 -0.0651 0.1067  -0.1282 302  TYR A CD1 
2962 C CD2 . TYR A 397 ? 1.1344 0.6585 0.7266 -0.0715 0.0927  -0.1467 302  TYR A CD2 
2963 C CE1 . TYR A 397 ? 1.1278 0.6454 0.7288 -0.0842 0.1150  -0.1256 302  TYR A CE1 
2964 C CE2 . TYR A 397 ? 1.0966 0.6681 0.7385 -0.0884 0.1013  -0.1436 302  TYR A CE2 
2965 C CZ  . TYR A 397 ? 1.1585 0.7238 0.8025 -0.0938 0.1124  -0.1332 302  TYR A CZ  
2966 O OH  . TYR A 397 ? 1.1172 0.7216 0.8005 -0.1055 0.1206  -0.1308 302  TYR A OH  
2967 N N   . GLY A 398 ? 1.3263 0.7411 0.7025 0.0870  0.0609  -0.1280 303  GLY A N   
2968 C CA  . GLY A 398 ? 1.3947 0.7747 0.7059 0.1314  0.0498  -0.1322 303  GLY A CA  
2969 C C   . GLY A 398 ? 1.4338 0.8787 0.7710 0.1544  0.0377  -0.1332 303  GLY A C   
2970 O O   . GLY A 398 ? 1.4904 0.9030 0.7741 0.1892  0.0274  -0.1404 303  GLY A O   
2971 N N   . PHE A 399 ? 1.3207 0.8523 0.7338 0.1369  0.0387  -0.1258 304  PHE A N   
2972 C CA  . PHE A 399 ? 1.2870 0.8870 0.7329 0.1528  0.0288  -0.1248 304  PHE A CA  
2973 C C   . PHE A 399 ? 1.3910 0.9595 0.8386 0.1364  0.0230  -0.1440 304  PHE A C   
2974 O O   . PHE A 399 ? 1.3972 0.9917 0.8423 0.1599  0.0122  -0.1482 304  PHE A O   
2975 C CB  . PHE A 399 ? 1.2259 0.9105 0.7416 0.1341  0.0326  -0.1105 304  PHE A CB  
2976 C CG  . PHE A 399 ? 1.2258 0.9527 0.7424 0.1441  0.0361  -0.0909 304  PHE A CG  
2977 C CD1 . PHE A 399 ? 1.2494 1.0484 0.7658 0.1745  0.0285  -0.0769 304  PHE A CD1 
2978 C CD2 . PHE A 399 ? 1.2504 0.9522 0.7689 0.1208  0.0466  -0.0862 304  PHE A CD2 
2979 C CE1 . PHE A 399 ? 1.2435 1.0918 0.7616 0.1781  0.0308  -0.0585 304  PHE A CE1 
2980 C CE2 . PHE A 399 ? 1.2671 1.0109 0.7854 0.1271  0.0484  -0.0688 304  PHE A CE2 
2981 C CZ  . PHE A 399 ? 1.2266 1.0452 0.7450 0.1538  0.0402  -0.0552 304  PHE A CZ  
2982 N N   . LEU A 400 ? 1.3827 0.9012 0.8344 0.0946  0.0302  -0.1553 305  LEU A N   
2983 C CA  . LEU A 400 ? 1.4151 0.9071 0.8689 0.0684  0.0256  -0.1742 305  LEU A CA  
2984 C C   . LEU A 400 ? 1.5931 0.9885 0.9617 0.0799  0.0171  -0.1885 305  LEU A C   
2985 O O   . LEU A 400 ? 1.6198 0.9976 0.9781 0.0695  0.0078  -0.2042 305  LEU A O   
2986 C CB  . LEU A 400 ? 1.3967 0.8860 0.8878 0.0175  0.0376  -0.1783 305  LEU A CB  
2987 N N   . GLY A 401 ? 1.6264 0.9584 0.9301 0.1025  0.0198  -0.1830 306  GLY A N   
2988 C CA  . GLY A 401 ? 1.7461 0.9667 0.9496 0.1196  0.0129  -0.1940 306  GLY A CA  
2989 C C   . GLY A 401 ? 1.8708 1.0618 1.0308 0.1420  -0.0034 -0.2088 306  GLY A C   
2990 O O   . GLY A 401 ? 1.9545 1.0483 1.0502 0.1212  -0.0089 -0.2251 306  GLY A O   
2991 N N   . LYS A 402 ? 1.7973 1.0685 0.9868 0.1828  -0.0115 -0.2030 307  LYS A N   
2992 C CA  . LYS A 402 ? 1.8457 1.1016 0.9974 0.2120  -0.0274 -0.2158 307  LYS A CA  
2993 C C   . LYS A 402 ? 1.8848 1.1461 1.0728 0.1647  -0.0328 -0.2330 307  LYS A C   
2994 O O   . LYS A 402 ? 1.9603 1.1538 1.0886 0.1663  -0.0454 -0.2506 307  LYS A O   
2995 C CB  . LYS A 402 ? 1.8258 1.1837 1.0102 0.2639  -0.0326 -0.2022 307  LYS A CB  
2996 C CG  . LYS A 402 ? 2.1145 1.4832 1.2563 0.3193  -0.0306 -0.1861 307  LYS A CG  
2997 C CD  . LYS A 402 ? 2.2052 1.6918 1.3880 0.3603  -0.0352 -0.1715 307  LYS A CD  
2998 C CE  . LYS A 402 ? 2.3838 1.9050 1.5307 0.4143  -0.0336 -0.1544 307  LYS A CE  
2999 N NZ  . LYS A 402 ? 2.4546 2.1046 1.6483 0.4443  -0.0371 -0.1379 307  LYS A NZ  
3000 N N   . LYS A 403 ? 1.7489 1.0927 1.0304 0.1257  -0.0241 -0.2280 308  LYS A N   
3001 C CA  . LYS A 403 ? 1.7202 1.0933 1.0482 0.0824  -0.0274 -0.2421 308  LYS A CA  
3002 C C   . LYS A 403 ? 1.8090 1.1193 1.1207 0.0231  -0.0206 -0.2527 308  LYS A C   
3003 O O   . LYS A 403 ? 1.8219 1.1301 1.1414 -0.0148 -0.0266 -0.2687 308  LYS A O   
3004 C CB  . LYS A 403 ? 1.6344 1.1260 1.0616 0.0774  -0.0211 -0.2304 308  LYS A CB  
3005 N N   . PHE A 404 ? 1.7822 1.0471 1.0709 0.0137  -0.0083 -0.2431 309  PHE A N   
3006 C CA  . PHE A 404 ? 1.8300 1.0342 1.0979 -0.0421 0.0000  -0.2499 309  PHE A CA  
3007 C C   . PHE A 404 ? 1.9900 1.0671 1.1518 -0.0525 -0.0109 -0.2660 309  PHE A C   
3008 O O   . PHE A 404 ? 2.0271 1.0713 1.1773 -0.1093 -0.0120 -0.2790 309  PHE A O   
3009 C CB  . PHE A 404 ? 1.8419 1.0355 1.1141 -0.0449 0.0166  -0.2337 309  PHE A CB  
3010 C CG  . PHE A 404 ? 1.9306 1.0554 1.1716 -0.1003 0.0258  -0.2391 309  PHE A CG  
3011 C CD1 . PHE A 404 ? 2.0903 1.0900 1.2300 -0.0992 0.0251  -0.2415 309  PHE A CD1 
3012 C CD2 . PHE A 404 ? 1.9181 1.1025 1.2244 -0.1530 0.0347  -0.2418 309  PHE A CD2 
3013 C CE1 . PHE A 404 ? 2.1712 1.1036 1.2765 -0.1556 0.0336  -0.2455 309  PHE A CE1 
3014 C CE2 . PHE A 404 ? 2.0173 1.1471 1.2945 -0.2077 0.0436  -0.2458 309  PHE A CE2 
3015 C CZ  . PHE A 404 ? 2.1068 1.1093 1.2840 -0.2117 0.0431  -0.2472 309  PHE A CZ  
3016 N N   . LYS A 405 ? 2.0023 1.0071 1.0813 0.0015  -0.0192 -0.2648 310  LYS A N   
3017 C CA  . LYS A 405 ? 2.1380 1.0035 1.0975 0.0004  -0.0310 -0.2801 310  LYS A CA  
3018 C C   . LYS A 405 ? 2.1930 1.0639 1.1501 -0.0157 -0.0479 -0.2997 310  LYS A C   
3019 O O   . LYS A 405 ? 2.2951 1.0670 1.1785 -0.0545 -0.0566 -0.3162 310  LYS A O   
3020 C CB  . LYS A 405 ? 2.2418 1.0365 1.1103 0.0737  -0.0358 -0.2735 310  LYS A CB  
3021 C CG  . LYS A 405 ? 2.4348 1.2928 1.3132 0.1408  -0.0473 -0.2715 310  LYS A CG  
3022 C CD  . LYS A 405 ? 2.6760 1.4582 1.4491 0.2146  -0.0532 -0.2674 310  LYS A CD  
3023 C CE  . LYS A 405 ? 2.8173 1.6512 1.5841 0.2785  -0.0666 -0.2687 310  LYS A CE  
3024 N NZ  . LYS A 405 ? 2.7769 1.7742 1.6607 0.2945  -0.0607 -0.2517 310  LYS A NZ  
3025 N N   . ARG A 406 ? 2.0352 1.0234 1.0733 0.0094  -0.0522 -0.2972 311  ARG A N   
3026 C CA  . ARG A 406 ? 2.0222 1.0437 1.0766 0.0018  -0.0673 -0.3134 311  ARG A CA  
3027 C C   . ARG A 406 ? 2.0479 1.0989 1.1489 -0.0761 -0.0654 -0.3252 311  ARG A C   
3028 O O   . ARG A 406 ? 2.0903 1.1265 1.1712 -0.1003 -0.0798 -0.3437 311  ARG A O   
3029 C CB  . ARG A 406 ? 1.9032 1.0520 1.0400 0.0487  -0.0679 -0.3022 311  ARG A CB  
3030 C CG  . ARG A 406 ? 2.0359 1.2054 1.1642 0.0724  -0.0857 -0.3157 311  ARG A CG  
3031 C CD  . ARG A 406 ? 2.0764 1.3621 1.2739 0.1231  -0.0845 -0.3004 311  ARG A CD  
3032 N NE  . ARG A 406 ? 2.1960 1.4707 1.3557 0.1831  -0.0815 -0.2841 311  ARG A NE  
3033 C CZ  . ARG A 406 ? 2.2874 1.6581 1.4957 0.2262  -0.0789 -0.2667 311  ARG A CZ  
3034 N NH1 . ARG A 406 ? 2.0285 1.5020 1.3209 0.2177  -0.0786 -0.2627 311  ARG A NH1 
3035 N NH2 . ARG A 406 ? 2.1253 1.4918 1.2952 0.2774  -0.0766 -0.2523 311  ARG A NH2 
3036 N N   . TYR A 407 ? 1.9379 1.0342 1.0983 -0.1142 -0.0479 -0.3146 312  TYR A N   
3037 C CA  . TYR A 407 ? 1.9159 1.0550 1.1237 -0.1858 -0.0428 -0.3226 312  TYR A CA  
3038 C C   . TYR A 407 ? 2.0776 1.0973 1.2006 -0.2412 -0.0413 -0.3302 312  TYR A C   
3039 O O   . TYR A 407 ? 2.1195 1.1303 1.2310 -0.3009 -0.0481 -0.3454 312  TYR A O   
3040 C CB  . TYR A 407 ? 1.8084 1.0617 1.1202 -0.1924 -0.0245 -0.3066 312  TYR A CB  
3041 N N   . PHE A 408 ? 2.0786 1.0080 1.1390 -0.2225 -0.0327 -0.3191 313  PHE A N   
3042 C CA  . PHE A 408 ? 2.1958 0.9962 1.1632 -0.2680 -0.0294 -0.3226 313  PHE A CA  
3043 C C   . PHE A 408 ? 2.3642 1.0392 1.2184 -0.2843 -0.0496 -0.3428 313  PHE A C   
3044 O O   . PHE A 408 ? 2.4471 1.0624 1.2572 -0.3563 -0.0516 -0.3530 313  PHE A O   
3045 C CB  . PHE A 408 ? 2.2482 0.9793 1.1665 -0.2257 -0.0181 -0.3061 313  PHE A CB  
3046 C CG  . PHE A 408 ? 2.4143 0.9949 1.2204 -0.2618 -0.0150 -0.3081 313  PHE A CG  
3047 C CD1 . PHE A 408 ? 2.4575 1.0442 1.2860 -0.3250 0.0009  -0.3019 313  PHE A CD1 
3048 C CD2 . PHE A 408 ? 2.5839 1.0133 1.2555 -0.2294 -0.0276 -0.3153 313  PHE A CD2 
3049 C CE1 . PHE A 408 ? 2.6083 1.0512 1.3279 -0.3615 0.0042  -0.3023 313  PHE A CE1 
3050 C CE2 . PHE A 408 ? 2.7655 1.0425 1.3219 -0.2628 -0.0249 -0.3165 313  PHE A CE2 
3051 C CZ  . PHE A 408 ? 2.7399 1.0241 1.3218 -0.3309 -0.0089 -0.3096 313  PHE A CZ  
3052 N N   . LEU A 409 ? 2.3285 0.9632 1.1313 -0.2190 -0.0645 -0.3481 314  LEU A N   
3053 C CA  . LEU A 409 ? 2.4561 0.9647 1.1418 -0.2207 -0.0856 -0.3679 314  LEU A CA  
3054 C C   . LEU A 409 ? 2.5010 1.0668 1.2262 -0.2778 -0.0983 -0.3864 314  LEU A C   
3055 O O   . LEU A 409 ? 2.6226 1.0870 1.2636 -0.3353 -0.1096 -0.4025 314  LEU A O   
3056 C CB  . LEU A 409 ? 2.4678 0.9475 1.1038 -0.1271 -0.0969 -0.3673 314  LEU A CB  
3057 C CG  . LEU A 409 ? 2.5638 0.9663 1.1285 -0.0627 -0.0894 -0.3525 314  LEU A CG  
3058 C CD1 . LEU A 409 ? 2.5190 0.9711 1.0883 0.0298  -0.0963 -0.3467 314  LEU A CD1 
3059 C CD2 . LEU A 409 ? 2.7809 0.9841 1.1845 -0.0767 -0.0961 -0.3618 314  LEU A CD2 
3060 N N   . GLN A 410 ? 2.3200 1.0479 1.1702 -0.2651 -0.0963 -0.3836 315  GLN A N   
3061 C CA  . GLN A 410 ? 2.2904 1.1017 1.1951 -0.3100 -0.1072 -0.3995 315  GLN A CA  
3062 C C   . GLN A 410 ? 2.3710 1.2024 1.2974 -0.4050 -0.1001 -0.4039 315  GLN A C   
3063 O O   . GLN A 410 ? 2.4165 1.2509 1.3282 -0.4601 -0.1138 -0.4220 315  GLN A O   
3064 C CB  . GLN A 410 ? 2.1468 1.1256 1.1791 -0.2691 -0.1027 -0.3911 315  GLN A CB  
3065 N N   . LEU A 411 ? 2.2960 1.1535 1.2614 -0.4251 -0.0789 -0.3873 316  LEU A N   
3066 C CA  . LEU A 411 ? 2.3229 1.2006 1.3044 -0.5145 -0.0692 -0.3883 316  LEU A CA  
3067 C C   . LEU A 411 ? 2.5443 1.2711 1.4047 -0.5878 -0.0740 -0.3970 316  LEU A C   
3068 O O   . LEU A 411 ? 2.5815 1.3339 1.4432 -0.6668 -0.0799 -0.4088 316  LEU A O   
3069 C CB  . LEU A 411 ? 2.2155 1.1845 1.2857 -0.5077 -0.0443 -0.3672 316  LEU A CB  
3070 C CG  . LEU A 411 ? 2.2815 1.2984 1.3836 -0.5899 -0.0309 -0.3647 316  LEU A CG  
3071 C CD1 . LEU A 411 ? 2.4387 1.2974 1.4201 -0.6453 -0.0316 -0.3674 316  LEU A CD1 
3072 C CD2 . LEU A 411 ? 2.2776 1.4176 1.4456 -0.6386 -0.0391 -0.3785 316  LEU A CD2 
3073 N N   . LEU A 412 ? 2.6040 1.1764 1.3569 -0.5620 -0.0720 -0.3909 317  LEU A N   
3074 C CA  . LEU A 412 ? 3.1576 1.5478 1.7638 -0.6140 -0.0808 -0.4001 317  LEU A CA  
3075 C C   . LEU A 412 ? 3.4688 1.7114 1.9727 -0.5573 -0.0750 -0.3888 317  LEU A C   
3076 O O   . LEU A 412 ? 2.8846 1.1124 1.3750 -0.4692 -0.0796 -0.3857 317  LEU A O   
3077 C CB  . LEU A 412 ? 3.1919 1.6041 1.8107 -0.7188 -0.0705 -0.3987 317  LEU A CB  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1001 ?    ?   ?   A . n 
A 1 2   ASP 2   1002 1002 ASP ASP A . n 
A 1 3   LEU 3   1003 1003 LEU LEU A . n 
A 1 4   GLU 4   1004 1004 GLU GLU A . n 
A 1 5   ASP 5   1005 1005 ASP ASP A . n 
A 1 6   ASN 6   1006 1006 ASN ASN A . n 
A 1 7   TRP 7   1007 1007 TRP TRP A . n 
A 1 8   GLU 8   1008 1008 GLU GLU A . n 
A 1 9   THR 9   1009 1009 THR THR A . n 
A 1 10  LEU 10  1010 1010 LEU LEU A . n 
A 1 11  ASN 11  1011 1011 ASN ASN A . n 
A 1 12  ASP 12  1012 1012 ASP ASP A . n 
A 1 13  ASN 13  1013 1013 ASN ASN A . n 
A 1 14  LEU 14  1014 1014 LEU LEU A . n 
A 1 15  LYS 15  1015 1015 LYS LYS A . n 
A 1 16  VAL 16  1016 1016 VAL VAL A . n 
A 1 17  ILE 17  1017 1017 ILE ILE A . n 
A 1 18  GLU 18  1018 1018 GLU GLU A . n 
A 1 19  LYS 19  1019 1019 LYS LYS A . n 
A 1 20  ALA 20  1020 1020 ALA ALA A . n 
A 1 21  ASP 21  1021 1021 ASP ASP A . n 
A 1 22  ASN 22  1022 1022 ASN ASN A . n 
A 1 23  ALA 23  1023 1023 ALA ALA A . n 
A 1 24  ALA 24  1024 1024 ALA ALA A . n 
A 1 25  GLN 25  1025 1025 GLN GLN A . n 
A 1 26  VAL 26  1026 1026 VAL VAL A . n 
A 1 27  LYS 27  1027 1027 LYS LYS A . n 
A 1 28  ASP 28  1028 1028 ASP ASP A . n 
A 1 29  ALA 29  1029 1029 ALA ALA A . n 
A 1 30  LEU 30  1030 1030 LEU LEU A . n 
A 1 31  THR 31  1031 1031 THR THR A . n 
A 1 32  LYS 32  1032 1032 LYS LYS A . n 
A 1 33  MET 33  1033 1033 MET MET A . n 
A 1 34  ARG 34  1034 1034 ARG ARG A . n 
A 1 35  ALA 35  1035 1035 ALA ALA A . n 
A 1 36  ALA 36  1036 1036 ALA ALA A . n 
A 1 37  ALA 37  1037 1037 ALA ALA A . n 
A 1 38  LEU 38  1038 1038 LEU LEU A . n 
A 1 39  ASP 39  1039 1039 ASP ASP A . n 
A 1 40  ALA 40  1040 1040 ALA ALA A . n 
A 1 41  GLN 41  1041 1041 GLN GLN A . n 
A 1 42  LYS 42  1042 1042 LYS LYS A . n 
A 1 43  ALA 43  1043 1043 ALA ALA A . n 
A 1 44  THR 44  1044 1044 THR THR A . n 
A 1 45  PRO 45  1045 1045 PRO PRO A . n 
A 1 46  PRO 46  1046 1046 PRO PRO A . n 
A 1 47  LYS 47  1047 1047 LYS LYS A . n 
A 1 48  LEU 48  1048 1048 LEU LEU A . n 
A 1 49  GLU 49  1049 1049 GLU GLU A . n 
A 1 50  ASP 50  1050 1050 ASP ASP A . n 
A 1 51  LYS 51  1051 1051 LYS LYS A . n 
A 1 52  SER 52  1052 1052 SER SER A . n 
A 1 53  PRO 53  1053 1053 PRO PRO A . n 
A 1 54  ASP 54  1054 1054 ASP ASP A . n 
A 1 55  SER 55  1055 1055 SER SER A . n 
A 1 56  PRO 56  1056 1056 PRO PRO A . n 
A 1 57  GLU 57  1057 1057 GLU GLU A . n 
A 1 58  MET 58  1058 1058 MET MET A . n 
A 1 59  LYS 59  1059 1059 LYS LYS A . n 
A 1 60  ASP 60  1060 1060 ASP ASP A . n 
A 1 61  PHE 61  1061 1061 PHE PHE A . n 
A 1 62  ARG 62  1062 1062 ARG ARG A . n 
A 1 63  HIS 63  1063 1063 HIS HIS A . n 
A 1 64  GLY 64  1064 1064 GLY GLY A . n 
A 1 65  PHE 65  1065 1065 PHE PHE A . n 
A 1 66  ASP 66  1066 1066 ASP ASP A . n 
A 1 67  ILE 67  1067 1067 ILE ILE A . n 
A 1 68  LEU 68  1068 1068 LEU LEU A . n 
A 1 69  VAL 69  1069 1069 VAL VAL A . n 
A 1 70  GLY 70  1070 1070 GLY GLY A . n 
A 1 71  GLN 71  1071 1071 GLN GLN A . n 
A 1 72  ILE 72  1072 1072 ILE ILE A . n 
A 1 73  ASP 73  1073 1073 ASP ASP A . n 
A 1 74  ASP 74  1074 1074 ASP ASP A . n 
A 1 75  ALA 75  1075 1075 ALA ALA A . n 
A 1 76  LEU 76  1076 1076 LEU LEU A . n 
A 1 77  LYS 77  1077 1077 LYS LYS A . n 
A 1 78  LEU 78  1078 1078 LEU LEU A . n 
A 1 79  ALA 79  1079 1079 ALA ALA A . n 
A 1 80  ASN 80  1080 1080 ASN ASN A . n 
A 1 81  GLU 81  1081 1081 GLU GLU A . n 
A 1 82  GLY 82  1082 1082 GLY GLY A . n 
A 1 83  LYS 83  1083 1083 LYS LYS A . n 
A 1 84  VAL 84  1084 1084 VAL VAL A . n 
A 1 85  LYS 85  1085 1085 LYS LYS A . n 
A 1 86  GLU 86  1086 1086 GLU GLU A . n 
A 1 87  ALA 87  1087 1087 ALA ALA A . n 
A 1 88  GLN 88  1088 1088 GLN GLN A . n 
A 1 89  ALA 89  1089 1089 ALA ALA A . n 
A 1 90  ALA 90  1090 1090 ALA ALA A . n 
A 1 91  ALA 91  1091 1091 ALA ALA A . n 
A 1 92  GLU 92  1092 1092 GLU GLU A . n 
A 1 93  GLN 93  1093 1093 GLN GLN A . n 
A 1 94  LEU 94  1094 1094 LEU LEU A . n 
A 1 95  LYS 95  1095 1095 LYS LYS A . n 
A 1 96  THR 96  1096 1096 THR THR A . n 
A 1 97  THR 97  1097 1097 THR THR A . n 
A 1 98  ARG 98  1098 1098 ARG ARG A . n 
A 1 99  ASN 99  1099 1099 ASN ASN A . n 
A 1 100 ALA 100 1100 1100 ALA ALA A . n 
A 1 101 TYR 101 1101 1101 TYR TYR A . n 
A 1 102 ILE 102 1102 1102 ILE ILE A . n 
A 1 103 GLN 103 1103 1103 GLN GLN A . n 
A 1 104 LYS 104 1104 1104 LYS LYS A . n 
A 1 105 TYR 105 1105 1105 TYR TYR A . n 
A 1 106 LEU 106 1106 1106 LEU LEU A . n 
A 1 107 ILE 107 12   12   ILE ILE A . n 
A 1 108 LEU 108 13   13   LEU LEU A . n 
A 1 109 ASN 109 14   14   ASN ASN A . n 
A 1 110 SER 110 15   15   SER SER A . n 
A 1 111 SER 111 16   16   SER SER A . n 
A 1 112 ASP 112 17   17   ASP ASP A . n 
A 1 113 CYS 113 18   18   CYS CYS A . n 
A 1 114 PRO 114 19   19   PRO PRO A . n 
A 1 115 LYS 115 20   20   LYS LYS A . n 
A 1 116 ALA 116 21   21   ALA ALA A . n 
A 1 117 GLY 117 22   22   GLY GLY A . n 
A 1 118 ARG 118 23   23   ARG ARG A . n 
A 1 119 HIS 119 24   24   HIS HIS A . n 
A 1 120 ASN 120 25   25   ASN ASN A . n 
A 1 121 TYR 121 26   26   TYR TYR A . n 
A 1 122 ILE 122 27   27   ILE ILE A . n 
A 1 123 PHE 123 28   28   PHE PHE A . n 
A 1 124 VAL 124 29   29   VAL VAL A . n 
A 1 125 MET 125 30   30   MET MET A . n 
A 1 126 ILE 126 31   31   ILE ILE A . n 
A 1 127 PRO 127 32   32   PRO PRO A . n 
A 1 128 THR 128 33   33   THR THR A . n 
A 1 129 LEU 129 34   34   LEU LEU A . n 
A 1 130 TYR 130 35   35   TYR TYR A . n 
A 1 131 SER 131 36   36   SER SER A . n 
A 1 132 ILE 132 37   37   ILE ILE A . n 
A 1 133 ILE 133 38   38   ILE ILE A . n 
A 1 134 PHE 134 39   39   PHE PHE A . n 
A 1 135 VAL 135 40   40   VAL VAL A . n 
A 1 136 VAL 136 41   41   VAL VAL A . n 
A 1 137 GLY 137 42   42   GLY GLY A . n 
A 1 138 ILE 138 43   43   ILE ILE A . n 
A 1 139 PHE 139 44   44   PHE PHE A . n 
A 1 140 GLY 140 45   45   GLY GLY A . n 
A 1 141 ASN 141 46   46   ASN ASN A . n 
A 1 142 SER 142 47   47   SER SER A . n 
A 1 143 LEU 143 48   48   LEU LEU A . n 
A 1 144 VAL 144 49   49   VAL VAL A . n 
A 1 145 VAL 145 50   50   VAL VAL A . n 
A 1 146 ILE 146 51   51   ILE ILE A . n 
A 1 147 VAL 147 52   52   VAL VAL A . n 
A 1 148 ILE 148 53   53   ILE ILE A . n 
A 1 149 TYR 149 54   54   TYR TYR A . n 
A 1 150 PHE 150 55   55   PHE PHE A . n 
A 1 151 TYR 151 56   56   TYR TYR A . n 
A 1 152 MET 152 57   57   MET MET A . n 
A 1 153 LYS 153 58   58   LYS LYS A . n 
A 1 154 LEU 154 59   59   LEU LEU A . n 
A 1 155 LYS 155 60   60   LYS LYS A . n 
A 1 156 THR 156 61   61   THR THR A . n 
A 1 157 VAL 157 62   62   VAL VAL A . n 
A 1 158 ALA 158 63   63   ALA ALA A . n 
A 1 159 SER 159 64   64   SER SER A . n 
A 1 160 VAL 160 65   65   VAL VAL A . n 
A 1 161 PHE 161 66   66   PHE PHE A . n 
A 1 162 LEU 162 67   67   LEU LEU A . n 
A 1 163 LEU 163 68   68   LEU LEU A . n 
A 1 164 ASN 164 69   69   ASN ASN A . n 
A 1 165 LEU 165 70   70   LEU LEU A . n 
A 1 166 ALA 166 71   71   ALA ALA A . n 
A 1 167 LEU 167 72   72   LEU LEU A . n 
A 1 168 ALA 168 73   73   ALA ALA A . n 
A 1 169 ASP 169 74   74   ASP ASP A . n 
A 1 170 LEU 170 75   75   LEU LEU A . n 
A 1 171 CYS 171 76   76   CYS CYS A . n 
A 1 172 PHE 172 77   77   PHE PHE A . n 
A 1 173 LEU 173 78   78   LEU LEU A . n 
A 1 174 LEU 174 79   79   LEU LEU A . n 
A 1 175 THR 175 80   80   THR THR A . n 
A 1 176 LEU 176 81   81   LEU LEU A . n 
A 1 177 PRO 177 82   82   PRO PRO A . n 
A 1 178 LEU 178 83   83   LEU LEU A . n 
A 1 179 TRP 179 84   84   TRP TRP A . n 
A 1 180 ALA 180 85   85   ALA ALA A . n 
A 1 181 VAL 181 86   86   VAL VAL A . n 
A 1 182 TYR 182 87   87   TYR TYR A . n 
A 1 183 THR 183 88   88   THR THR A . n 
A 1 184 ALA 184 89   89   ALA ALA A . n 
A 1 185 MET 185 90   90   MET MET A . n 
A 1 186 GLU 186 91   91   GLU GLU A . n 
A 1 187 TYR 187 92   92   TYR TYR A . n 
A 1 188 ARG 188 93   93   ARG ARG A . n 
A 1 189 TRP 189 94   94   TRP TRP A . n 
A 1 190 PRO 190 95   95   PRO PRO A . n 
A 1 191 PHE 191 96   96   PHE PHE A . n 
A 1 192 GLY 192 97   97   GLY GLY A . n 
A 1 193 ASN 193 98   98   ASN ASN A . n 
A 1 194 TYR 194 99   99   TYR TYR A . n 
A 1 195 LEU 195 100  100  LEU LEU A . n 
A 1 196 CYS 196 101  101  CYS CYS A . n 
A 1 197 LYS 197 102  102  LYS LYS A . n 
A 1 198 ILE 198 103  103  ILE ILE A . n 
A 1 199 ALA 199 104  104  ALA ALA A . n 
A 1 200 SER 200 105  105  SER SER A . n 
A 1 201 ALA 201 106  106  ALA ALA A . n 
A 1 202 SER 202 107  107  SER SER A . n 
A 1 203 VAL 203 108  108  VAL VAL A . n 
A 1 204 SER 204 109  109  SER SER A . n 
A 1 205 PHE 205 110  110  PHE PHE A . n 
A 1 206 ASN 206 111  111  ASN ASN A . n 
A 1 207 LEU 207 112  112  LEU LEU A . n 
A 1 208 TYR 208 113  113  TYR TYR A . n 
A 1 209 ALA 209 114  114  ALA ALA A . n 
A 1 210 SER 210 115  115  SER SER A . n 
A 1 211 VAL 211 116  116  VAL VAL A . n 
A 1 212 PHE 212 117  117  PHE PHE A . n 
A 1 213 LEU 213 118  118  LEU LEU A . n 
A 1 214 LEU 214 119  119  LEU LEU A . n 
A 1 215 THR 215 120  120  THR THR A . n 
A 1 216 CYS 216 121  121  CYS CYS A . n 
A 1 217 LEU 217 122  122  LEU LEU A . n 
A 1 218 SER 218 123  123  SER SER A . n 
A 1 219 ILE 219 124  124  ILE ILE A . n 
A 1 220 ASP 220 125  125  ASP ASP A . n 
A 1 221 ARG 221 126  126  ARG ARG A . n 
A 1 222 TYR 222 127  127  TYR TYR A . n 
A 1 223 LEU 223 128  128  LEU LEU A . n 
A 1 224 ALA 224 129  129  ALA ALA A . n 
A 1 225 ILE 225 130  130  ILE ILE A . n 
A 1 226 VAL 226 131  131  VAL VAL A . n 
A 1 227 HIS 227 132  132  HIS HIS A . n 
A 1 228 PRO 228 133  133  PRO PRO A . n 
A 1 229 MET 229 134  134  MET MET A . n 
A 1 230 LYS 230 135  135  LYS LYS A . n 
A 1 231 SER 231 136  136  SER SER A . n 
A 1 232 ARG 232 137  137  ARG ARG A . n 
A 1 233 LEU 233 138  138  LEU LEU A . n 
A 1 234 ARG 234 139  139  ARG ARG A . n 
A 1 235 ARG 235 140  140  ARG ARG A . n 
A 1 236 THR 236 141  141  THR THR A . n 
A 1 237 MET 237 142  142  MET MET A . n 
A 1 238 LEU 238 143  143  LEU LEU A . n 
A 1 239 VAL 239 144  144  VAL VAL A . n 
A 1 240 ALA 240 145  145  ALA ALA A . n 
A 1 241 LYS 241 146  146  LYS LYS A . n 
A 1 242 VAL 242 147  147  VAL VAL A . n 
A 1 243 THR 243 148  148  THR THR A . n 
A 1 244 CYS 244 149  149  CYS CYS A . n 
A 1 245 ILE 245 150  150  ILE ILE A . n 
A 1 246 ILE 246 151  151  ILE ILE A . n 
A 1 247 ILE 247 152  152  ILE ILE A . n 
A 1 248 TRP 248 153  153  TRP TRP A . n 
A 1 249 LEU 249 154  154  LEU LEU A . n 
A 1 250 LEU 250 155  155  LEU LEU A . n 
A 1 251 ALA 251 156  156  ALA ALA A . n 
A 1 252 GLY 252 157  157  GLY GLY A . n 
A 1 253 LEU 253 158  158  LEU LEU A . n 
A 1 254 ALA 254 159  159  ALA ALA A . n 
A 1 255 SER 255 160  160  SER SER A . n 
A 1 256 LEU 256 161  161  LEU LEU A . n 
A 1 257 PRO 257 162  162  PRO PRO A . n 
A 1 258 ALA 258 163  163  ALA ALA A . n 
A 1 259 ILE 259 164  164  ILE ILE A . n 
A 1 260 ILE 260 165  165  ILE ILE A . n 
A 1 261 HIS 261 166  166  HIS HIS A . n 
A 1 262 ARG 262 167  167  ARG ARG A . n 
A 1 263 ASN 263 168  168  ASN ASN A . n 
A 1 264 VAL 264 169  169  VAL VAL A . n 
A 1 265 PHE 265 170  170  PHE PHE A . n 
A 1 266 PHE 266 171  171  PHE PHE A . n 
A 1 267 ILE 267 172  172  ILE ILE A . n 
A 1 268 GLU 268 173  ?    ?   ?   A . n 
A 1 269 ASN 269 174  ?    ?   ?   A . n 
A 1 270 THR 270 175  ?    ?   ?   A . n 
A 1 271 ASN 271 176  ?    ?   ?   A . n 
A 1 272 ILE 272 177  177  ILE ILE A . n 
A 1 273 THR 273 178  178  THR THR A . n 
A 1 274 VAL 274 179  179  VAL VAL A . n 
A 1 275 CYS 275 180  180  CYS CYS A . n 
A 1 276 ALA 276 181  181  ALA ALA A . n 
A 1 277 PHE 277 182  182  PHE PHE A . n 
A 1 278 HIS 278 183  183  HIS HIS A . n 
A 1 279 TYR 279 184  184  TYR TYR A . n 
A 1 280 GLU 280 185  185  GLU GLU A . n 
A 1 281 SER 281 186  ?    ?   ?   A . n 
A 1 282 GLN 282 187  ?    ?   ?   A . n 
A 1 283 ASN 283 188  ?    ?   ?   A . n 
A 1 284 SER 284 189  ?    ?   ?   A . n 
A 1 285 THR 285 190  190  THR THR A . n 
A 1 286 LEU 286 191  191  LEU LEU A . n 
A 1 287 PRO 287 192  192  PRO PRO A . n 
A 1 288 ILE 288 193  193  ILE ILE A . n 
A 1 289 GLY 289 194  194  GLY GLY A . n 
A 1 290 LEU 290 195  195  LEU LEU A . n 
A 1 291 GLY 291 196  196  GLY GLY A . n 
A 1 292 LEU 292 197  197  LEU LEU A . n 
A 1 293 THR 293 198  198  THR THR A . n 
A 1 294 LYS 294 199  199  LYS LYS A . n 
A 1 295 ASN 295 200  200  ASN ASN A . n 
A 1 296 ILE 296 201  201  ILE ILE A . n 
A 1 297 LEU 297 202  202  LEU LEU A . n 
A 1 298 GLY 298 203  203  GLY GLY A . n 
A 1 299 PHE 299 204  204  PHE PHE A . n 
A 1 300 LEU 300 205  205  LEU LEU A . n 
A 1 301 PHE 301 206  206  PHE PHE A . n 
A 1 302 PRO 302 207  207  PRO PRO A . n 
A 1 303 PHE 303 208  208  PHE PHE A . n 
A 1 304 LEU 304 209  209  LEU LEU A . n 
A 1 305 ILE 305 210  210  ILE ILE A . n 
A 1 306 ILE 306 211  211  ILE ILE A . n 
A 1 307 LEU 307 212  212  LEU LEU A . n 
A 1 308 THR 308 213  213  THR THR A . n 
A 1 309 SER 309 214  214  SER SER A . n 
A 1 310 TYR 310 215  215  TYR TYR A . n 
A 1 311 THR 311 216  216  THR THR A . n 
A 1 312 LEU 312 217  217  LEU LEU A . n 
A 1 313 ILE 313 218  218  ILE ILE A . n 
A 1 314 TRP 314 219  219  TRP TRP A . n 
A 1 315 LYS 315 220  220  LYS LYS A . n 
A 1 316 ALA 316 221  221  ALA ALA A . n 
A 1 317 LEU 317 222  222  LEU LEU A . n 
A 1 318 LYS 318 223  223  LYS LYS A . n 
A 1 319 LYS 319 224  224  LYS LYS A . n 
A 1 320 ALA 320 225  ?    ?   ?   A . n 
A 1 321 TYR 321 226  ?    ?   ?   A . n 
A 1 322 GLU 322 227  ?    ?   ?   A . n 
A 1 323 ILE 323 228  ?    ?   ?   A . n 
A 1 324 GLN 324 229  ?    ?   ?   A . n 
A 1 325 LYS 325 230  ?    ?   ?   A . n 
A 1 326 ASN 326 231  ?    ?   ?   A . n 
A 1 327 LYS 327 232  ?    ?   ?   A . n 
A 1 328 PRO 328 233  ?    ?   ?   A . n 
A 1 329 ARG 329 234  ?    ?   ?   A . n 
A 1 330 ASN 330 235  235  ASN ASN A . n 
A 1 331 ASP 331 236  236  ASP ASP A . n 
A 1 332 ASP 332 237  237  ASP ASP A . n 
A 1 333 ILE 333 238  238  ILE ILE A . n 
A 1 334 PHE 334 239  239  PHE PHE A . n 
A 1 335 LYS 335 240  240  LYS LYS A . n 
A 1 336 ILE 336 241  241  ILE ILE A . n 
A 1 337 ILE 337 242  242  ILE ILE A . n 
A 1 338 MET 338 243  243  MET MET A . n 
A 1 339 ALA 339 244  244  ALA ALA A . n 
A 1 340 ILE 340 245  245  ILE ILE A . n 
A 1 341 VAL 341 246  246  VAL VAL A . n 
A 1 342 LEU 342 247  247  LEU LEU A . n 
A 1 343 PHE 343 248  248  PHE PHE A . n 
A 1 344 PHE 344 249  249  PHE PHE A . n 
A 1 345 PHE 345 250  250  PHE PHE A . n 
A 1 346 PHE 346 251  251  PHE PHE A . n 
A 1 347 SER 347 252  252  SER SER A . n 
A 1 348 TRP 348 253  253  TRP TRP A . n 
A 1 349 ILE 349 254  254  ILE ILE A . n 
A 1 350 PRO 350 255  255  PRO PRO A . n 
A 1 351 HIS 351 256  256  HIS HIS A . n 
A 1 352 GLN 352 257  257  GLN GLN A . n 
A 1 353 ILE 353 258  258  ILE ILE A . n 
A 1 354 PHE 354 259  259  PHE PHE A . n 
A 1 355 THR 355 260  260  THR THR A . n 
A 1 356 PHE 356 261  261  PHE PHE A . n 
A 1 357 LEU 357 262  262  LEU LEU A . n 
A 1 358 ASP 358 263  263  ASP ASP A . n 
A 1 359 VAL 359 264  264  VAL VAL A . n 
A 1 360 LEU 360 265  265  LEU LEU A . n 
A 1 361 ILE 361 266  266  ILE ILE A . n 
A 1 362 GLN 362 267  267  GLN GLN A . n 
A 1 363 LEU 363 268  268  LEU LEU A . n 
A 1 364 GLY 364 269  269  GLY GLY A . n 
A 1 365 ILE 365 270  270  ILE ILE A . n 
A 1 366 ILE 366 271  271  ILE ILE A . n 
A 1 367 ARG 367 272  272  ARG ARG A . n 
A 1 368 ASP 368 273  273  ASP ASP A . n 
A 1 369 CYS 369 274  274  CYS CYS A . n 
A 1 370 ARG 370 275  275  ARG ARG A . n 
A 1 371 ILE 371 276  276  ILE ILE A . n 
A 1 372 ALA 372 277  277  ALA ALA A . n 
A 1 373 ASP 373 278  278  ASP ASP A . n 
A 1 374 ILE 374 279  279  ILE ILE A . n 
A 1 375 VAL 375 280  280  VAL VAL A . n 
A 1 376 ASP 376 281  281  ASP ASP A . n 
A 1 377 THR 377 282  282  THR THR A . n 
A 1 378 ALA 378 283  283  ALA ALA A . n 
A 1 379 MET 379 284  284  MET MET A . n 
A 1 380 PRO 380 285  285  PRO PRO A . n 
A 1 381 ILE 381 286  286  ILE ILE A . n 
A 1 382 THR 382 287  287  THR THR A . n 
A 1 383 ILE 383 288  288  ILE ILE A . n 
A 1 384 CYS 384 289  289  CYS CYS A . n 
A 1 385 ILE 385 290  290  ILE ILE A . n 
A 1 386 ALA 386 291  291  ALA ALA A . n 
A 1 387 TYR 387 292  292  TYR TYR A . n 
A 1 388 PHE 388 293  293  PHE PHE A . n 
A 1 389 ASN 389 294  294  ASN ASN A . n 
A 1 390 ASN 390 295  295  ASN ASN A . n 
A 1 391 CYS 391 296  296  CYS CYS A . n 
A 1 392 LEU 392 297  297  LEU LEU A . n 
A 1 393 ASN 393 298  298  ASN ASN A . n 
A 1 394 PRO 394 299  299  PRO PRO A . n 
A 1 395 LEU 395 300  300  LEU LEU A . n 
A 1 396 PHE 396 301  301  PHE PHE A . n 
A 1 397 TYR 397 302  302  TYR TYR A . n 
A 1 398 GLY 398 303  303  GLY GLY A . n 
A 1 399 PHE 399 304  304  PHE PHE A . n 
A 1 400 LEU 400 305  305  LEU LEU A . n 
A 1 401 GLY 401 306  306  GLY GLY A . n 
A 1 402 LYS 402 307  307  LYS LYS A . n 
A 1 403 LYS 403 308  308  LYS LYS A . n 
A 1 404 PHE 404 309  309  PHE PHE A . n 
A 1 405 LYS 405 310  310  LYS LYS A . n 
A 1 406 ARG 406 311  311  ARG ARG A . n 
A 1 407 TYR 407 312  312  TYR TYR A . n 
A 1 408 PHE 408 313  313  PHE PHE A . n 
A 1 409 LEU 409 314  314  LEU LEU A . n 
A 1 410 GLN 410 315  315  GLN GLN A . n 
A 1 411 LEU 411 316  316  LEU LEU A . n 
A 1 412 LEU 412 317  317  LEU LEU A . n 
A 1 413 LYS 413 318  ?    ?   ?   A . n 
A 1 414 TYR 414 319  ?    ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          PSI:Biology 
_pdbx_SG_project.full_name_of_center   'GPCR Network' 
_pdbx_SG_project.initial_of_center     GPCR 
# 
_pdbx_nonpoly_scheme.asym_id         B 
_pdbx_nonpoly_scheme.entity_id       2 
_pdbx_nonpoly_scheme.mon_id          ZD7 
_pdbx_nonpoly_scheme.ndb_seq_num     1 
_pdbx_nonpoly_scheme.pdb_seq_num     1201 
_pdbx_nonpoly_scheme.auth_seq_num    1 
_pdbx_nonpoly_scheme.pdb_mon_id      ZD7 
_pdbx_nonpoly_scheme.auth_mon_id     RES 
_pdbx_nonpoly_scheme.pdb_strand_id   A 
_pdbx_nonpoly_scheme.pdb_ins_code    . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-04-22 
2 'Structure model' 1 1 2015-05-06 
3 'Structure model' 1 2 2015-05-13 
4 'Structure model' 1 3 2015-05-27 
5 'Structure model' 1 4 2017-09-06 
6 'Structure model' 1 5 2017-11-22 
7 'Structure model' 1 6 2018-02-14 
8 'Structure model' 1 7 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Structure summary'          
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Database references'        
4 5 'Structure model' 'Author supporting evidence' 
5 5 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Source and taxonomy'        
7 6 'Structure model' 'Refinement description'     
8 7 'Structure model' 'Data collection'            
9 8 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 5 'Structure model' entity_src_gen        
2 5 'Structure model' pdbx_audit_support    
3 5 'Structure model' pdbx_struct_oper_list 
4 6 'Structure model' software              
5 7 'Structure model' diffrn_source         
6 8 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'      
2 5 'Structure model' '_pdbx_audit_support.funding_organization'  
3 5 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 7 'Structure model' '_diffrn_source.pdbx_synchrotron_beamline'  
5 7 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
6 8 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 2.9499   7.9948  14.0710 0.2884 0.1755  -0.3102 -0.0256 0.0301 -0.0776 0.3611 1.1373 4.5097 
-1.3570 -0.4547 2.7254  -0.0370 0.2550  0.2096 0.1181  -0.0836 -0.1595 -0.0481 0.2300  0.1206  
'X-RAY DIFFRACTION' 2 ? refined -15.3850 11.0820 52.2432 0.2481 -0.3040 -0.2207 -0.1255 0.1705 -0.0425 1.0532 0.7978 8.2475 
-0.7640 0.4085  -0.4000 0.0292  -0.1243 0.0783 -0.4931 0.1735  -0.3538 0.0270  -0.1706 -0.2026 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '{ A|1002-1106 }' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '{ A| 12- 317 }'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER   ? ? ? 2.10.0 1 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? .      3 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrystFEL ? ? ? .      4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 1053 ? ? -73.89  36.96   
2 1 ASP A 1054 ? ? -140.38 -12.85  
3 1 SER A 16   ? ? 45.59   -134.65 
4 1 ASP A 17   ? ? 65.08   -67.78  
5 1 ARG A 23   ? ? -100.79 68.78   
6 1 PHE A 204  ? ? -158.36 -42.54  
7 1 ARG A 272  ? ? -109.45 77.62   
8 1 LEU A 316  ? ? -71.27  -76.78  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 13  ? CG  ? A LEU 108 CG  
2  1 Y 1 A LEU 13  ? CD1 ? A LEU 108 CD1 
3  1 Y 1 A LEU 13  ? CD2 ? A LEU 108 CD2 
4  1 Y 1 A ASN 14  ? CG  ? A ASN 109 CG  
5  1 Y 1 A ASN 14  ? OD1 ? A ASN 109 OD1 
6  1 Y 1 A ASN 14  ? ND2 ? A ASN 109 ND2 
7  1 Y 1 A LYS 20  ? CG  ? A LYS 115 CG  
8  1 Y 1 A LYS 20  ? CD  ? A LYS 115 CD  
9  1 Y 1 A LYS 20  ? CE  ? A LYS 115 CE  
10 1 Y 1 A LYS 20  ? NZ  ? A LYS 115 NZ  
11 1 Y 1 A LYS 135 ? CG  ? A LYS 230 CG  
12 1 Y 1 A LYS 135 ? CD  ? A LYS 230 CD  
13 1 Y 1 A LYS 135 ? CE  ? A LYS 230 CE  
14 1 Y 1 A LYS 135 ? NZ  ? A LYS 230 NZ  
15 1 Y 1 A SER 136 ? OG  ? A SER 231 OG  
16 1 Y 1 A ARG 137 ? CG  ? A ARG 232 CG  
17 1 Y 1 A ARG 137 ? CD  ? A ARG 232 CD  
18 1 Y 1 A ARG 137 ? NE  ? A ARG 232 NE  
19 1 Y 1 A ARG 137 ? CZ  ? A ARG 232 CZ  
20 1 Y 1 A ARG 137 ? NH1 ? A ARG 232 NH1 
21 1 Y 1 A ARG 137 ? NH2 ? A ARG 232 NH2 
22 1 Y 1 A ILE 177 ? CG1 ? A ILE 272 CG1 
23 1 Y 1 A ILE 177 ? CG2 ? A ILE 272 CG2 
24 1 Y 1 A ILE 177 ? CD1 ? A ILE 272 CD1 
25 1 Y 1 A GLU 185 ? CG  ? A GLU 280 CG  
26 1 Y 1 A GLU 185 ? CD  ? A GLU 280 CD  
27 1 Y 1 A GLU 185 ? OE1 ? A GLU 280 OE1 
28 1 Y 1 A GLU 185 ? OE2 ? A GLU 280 OE2 
29 1 Y 1 A LEU 191 ? CD1 ? A LEU 286 CD1 
30 1 Y 1 A LEU 191 ? CD2 ? A LEU 286 CD2 
31 1 Y 1 A ILE 193 ? CG2 ? A ILE 288 CG2 
32 1 Y 1 A ILE 193 ? CD1 ? A ILE 288 CD1 
33 1 Y 1 A THR 198 ? OG1 ? A THR 293 OG1 
34 1 Y 1 A THR 198 ? CG2 ? A THR 293 CG2 
35 1 Y 1 A LYS 199 ? CD  ? A LYS 294 CD  
36 1 Y 1 A LYS 199 ? CE  ? A LYS 294 CE  
37 1 Y 1 A LYS 199 ? NZ  ? A LYS 294 NZ  
38 1 Y 1 A ILE 201 ? CD1 ? A ILE 296 CD1 
39 1 Y 1 A LEU 205 ? CD1 ? A LEU 300 CD1 
40 1 Y 1 A LEU 205 ? CD2 ? A LEU 300 CD2 
41 1 Y 1 A PHE 206 ? CG  ? A PHE 301 CG  
42 1 Y 1 A PHE 206 ? CD1 ? A PHE 301 CD1 
43 1 Y 1 A PHE 206 ? CD2 ? A PHE 301 CD2 
44 1 Y 1 A PHE 206 ? CE1 ? A PHE 301 CE1 
45 1 Y 1 A PHE 206 ? CE2 ? A PHE 301 CE2 
46 1 Y 1 A PHE 206 ? CZ  ? A PHE 301 CZ  
47 1 Y 1 A PHE 208 ? CD1 ? A PHE 303 CD1 
48 1 Y 1 A PHE 208 ? CD2 ? A PHE 303 CD2 
49 1 Y 1 A PHE 208 ? CE1 ? A PHE 303 CE1 
50 1 Y 1 A PHE 208 ? CE2 ? A PHE 303 CE2 
51 1 Y 1 A PHE 208 ? CZ  ? A PHE 303 CZ  
52 1 Y 1 A LYS 224 ? CG  ? A LYS 319 CG  
53 1 Y 1 A LYS 224 ? CD  ? A LYS 319 CD  
54 1 Y 1 A LYS 224 ? CE  ? A LYS 319 CE  
55 1 Y 1 A LYS 224 ? NZ  ? A LYS 319 NZ  
56 1 Y 1 A ASN 235 ? CG  ? A ASN 330 CG  
57 1 Y 1 A ASN 235 ? OD1 ? A ASN 330 OD1 
58 1 Y 1 A ASN 235 ? ND2 ? A ASN 330 ND2 
59 1 Y 1 A LEU 305 ? CG  ? A LEU 400 CG  
60 1 Y 1 A LEU 305 ? CD1 ? A LEU 400 CD1 
61 1 Y 1 A LEU 305 ? CD2 ? A LEU 400 CD2 
62 1 Y 1 A LYS 308 ? CG  ? A LYS 403 CG  
63 1 Y 1 A LYS 308 ? CD  ? A LYS 403 CD  
64 1 Y 1 A LYS 308 ? CE  ? A LYS 403 CE  
65 1 Y 1 A LYS 308 ? NZ  ? A LYS 403 NZ  
66 1 Y 1 A TYR 312 ? CG  ? A TYR 407 CG  
67 1 Y 1 A TYR 312 ? CD1 ? A TYR 407 CD1 
68 1 Y 1 A TYR 312 ? CD2 ? A TYR 407 CD2 
69 1 Y 1 A TYR 312 ? CE1 ? A TYR 407 CE1 
70 1 Y 1 A TYR 312 ? CE2 ? A TYR 407 CE2 
71 1 Y 1 A TYR 312 ? CZ  ? A TYR 407 CZ  
72 1 Y 1 A TYR 312 ? OH  ? A TYR 407 OH  
73 1 Y 1 A GLN 315 ? CG  ? A GLN 410 CG  
74 1 Y 1 A GLN 315 ? CD  ? A GLN 410 CD  
75 1 Y 1 A GLN 315 ? OE1 ? A GLN 410 OE1 
76 1 Y 1 A GLN 315 ? NE2 ? A GLN 410 NE2 
77 1 Y 1 A LEU 317 ? CG  ? A LEU 412 CG  
78 1 Y 1 A LEU 317 ? CD1 ? A LEU 412 CD1 
79 1 Y 1 A LEU 317 ? CD2 ? A LEU 412 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1001 ? A ALA 1   
2  1 Y 1 A GLU 173  ? A GLU 268 
3  1 Y 1 A ASN 174  ? A ASN 269 
4  1 Y 1 A THR 175  ? A THR 270 
5  1 Y 1 A ASN 176  ? A ASN 271 
6  1 Y 1 A SER 186  ? A SER 281 
7  1 Y 1 A GLN 187  ? A GLN 282 
8  1 Y 1 A ASN 188  ? A ASN 283 
9  1 Y 1 A SER 189  ? A SER 284 
10 1 Y 1 A ALA 225  ? A ALA 320 
11 1 Y 1 A TYR 226  ? A TYR 321 
12 1 Y 1 A GLU 227  ? A GLU 322 
13 1 Y 1 A ILE 228  ? A ILE 323 
14 1 Y 1 A GLN 229  ? A GLN 324 
15 1 Y 1 A LYS 230  ? A LYS 325 
16 1 Y 1 A ASN 231  ? A ASN 326 
17 1 Y 1 A LYS 232  ? A LYS 327 
18 1 Y 1 A PRO 233  ? A PRO 328 
19 1 Y 1 A ARG 234  ? A ARG 329 
20 1 Y 1 A LYS 318  ? A LYS 413 
21 1 Y 1 A TYR 319  ? A TYR 414 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'U54 GM094618' 
_pdbx_audit_support.ordinal                1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        
"5,7-diethyl-1-{[2'-(1H-tetrazol-5-yl)biphenyl-4-yl]methyl}-3,4-dihydro-1,6-naphthyridin-2(1H)-one" 
_pdbx_entity_nonpoly.comp_id     ZD7 
#