data_4YC5
# 
_entry.id   4YC5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.284 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YC5         
WWPDB D_1000207184 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YC5 
_pdbx_database_status.recvd_initial_deposition_date   2015-02-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Murray, J.W.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            113 
_citation.language                  ? 
_citation.page_first                10346 
_citation.page_last                 10351 
_citation.title                     
'Synthetic beta-solenoid proteins with the fragment-free computational design of a beta-hairpin extension.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1525308113 
_citation.pdbx_database_id_PubMed   27573845 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'MacDonald, J.T.' 1 
primary 'Kabasakal, B.V.' 2 
primary 'Godding, D.'     3 
primary 'Kraatz, S.'      4 
primary 'Henderson, L.'   5 
primary 'Barber, J.'      6 
primary 'Freemont, P.S.'  7 
primary 'Murray, J.W.'    8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4YC5 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     64.570 
_cell.length_a_esd                 ? 
_cell.length_b                     64.570 
_cell.length_b_esd                 ? 
_cell.length_c                     160.400 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4YC5 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                91 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man beta1          24676.037 1   ? ? ? 'synthetic protein sequence' 
2 non-polymer syn 'CHLORIDE ION' 35.453    2   ? ? ? ?                            
3 water       nat water          18.015    273 ? ? ? ?                            
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNA
NLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGA
NLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMNVGEILRHYAAGKRNFQHINLQEIELTNASLTGADLSYANLHHANLSRANLRSADLRNA
NLSHANLSGANLEEANLEAANLRGADLHEANLSGADLQEANLTQANLKDANLSDANLEQADLAGADLQGAVLDGANLHGA
NLNNANLSEAMLTRANLEQADLSGARTTGARLDDADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  ASN n 
1 23  VAL n 
1 24  GLY n 
1 25  GLU n 
1 26  ILE n 
1 27  LEU n 
1 28  ARG n 
1 29  HIS n 
1 30  TYR n 
1 31  ALA n 
1 32  ALA n 
1 33  GLY n 
1 34  LYS n 
1 35  ARG n 
1 36  ASN n 
1 37  PHE n 
1 38  GLN n 
1 39  HIS n 
1 40  ILE n 
1 41  ASN n 
1 42  LEU n 
1 43  GLN n 
1 44  GLU n 
1 45  ILE n 
1 46  GLU n 
1 47  LEU n 
1 48  THR n 
1 49  ASN n 
1 50  ALA n 
1 51  SER n 
1 52  LEU n 
1 53  THR n 
1 54  GLY n 
1 55  ALA n 
1 56  ASP n 
1 57  LEU n 
1 58  SER n 
1 59  TYR n 
1 60  ALA n 
1 61  ASN n 
1 62  LEU n 
1 63  HIS n 
1 64  HIS n 
1 65  ALA n 
1 66  ASN n 
1 67  LEU n 
1 68  SER n 
1 69  ARG n 
1 70  ALA n 
1 71  ASN n 
1 72  LEU n 
1 73  ARG n 
1 74  SER n 
1 75  ALA n 
1 76  ASP n 
1 77  LEU n 
1 78  ARG n 
1 79  ASN n 
1 80  ALA n 
1 81  ASN n 
1 82  LEU n 
1 83  SER n 
1 84  HIS n 
1 85  ALA n 
1 86  ASN n 
1 87  LEU n 
1 88  SER n 
1 89  GLY n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  GLU n 
1 94  GLU n 
1 95  ALA n 
1 96  ASN n 
1 97  LEU n 
1 98  GLU n 
1 99  ALA n 
1 100 ALA n 
1 101 ASN n 
1 102 LEU n 
1 103 ARG n 
1 104 GLY n 
1 105 ALA n 
1 106 ASP n 
1 107 LEU n 
1 108 HIS n 
1 109 GLU n 
1 110 ALA n 
1 111 ASN n 
1 112 LEU n 
1 113 SER n 
1 114 GLY n 
1 115 ALA n 
1 116 ASP n 
1 117 LEU n 
1 118 GLN n 
1 119 GLU n 
1 120 ALA n 
1 121 ASN n 
1 122 LEU n 
1 123 THR n 
1 124 GLN n 
1 125 ALA n 
1 126 ASN n 
1 127 LEU n 
1 128 LYS n 
1 129 ASP n 
1 130 ALA n 
1 131 ASN n 
1 132 LEU n 
1 133 SER n 
1 134 ASP n 
1 135 ALA n 
1 136 ASN n 
1 137 LEU n 
1 138 GLU n 
1 139 GLN n 
1 140 ALA n 
1 141 ASP n 
1 142 LEU n 
1 143 ALA n 
1 144 GLY n 
1 145 ALA n 
1 146 ASP n 
1 147 LEU n 
1 148 GLN n 
1 149 GLY n 
1 150 ALA n 
1 151 VAL n 
1 152 LEU n 
1 153 ASP n 
1 154 GLY n 
1 155 ALA n 
1 156 ASN n 
1 157 LEU n 
1 158 HIS n 
1 159 GLY n 
1 160 ALA n 
1 161 ASN n 
1 162 LEU n 
1 163 ASN n 
1 164 ASN n 
1 165 ALA n 
1 166 ASN n 
1 167 LEU n 
1 168 SER n 
1 169 GLU n 
1 170 ALA n 
1 171 MET n 
1 172 LEU n 
1 173 THR n 
1 174 ARG n 
1 175 ALA n 
1 176 ASN n 
1 177 LEU n 
1 178 GLU n 
1 179 GLN n 
1 180 ALA n 
1 181 ASP n 
1 182 LEU n 
1 183 SER n 
1 184 GLY n 
1 185 ALA n 
1 186 ARG n 
1 187 THR n 
1 188 THR n 
1 189 GLY n 
1 190 ALA n 
1 191 ARG n 
1 192 LEU n 
1 193 ASP n 
1 194 ASP n 
1 195 ALA n 
1 196 ASP n 
1 197 LEU n 
1 198 ARG n 
1 199 GLY n 
1 200 ALA n 
1 201 THR n 
1 202 VAL n 
1 203 ASP n 
1 204 PRO n 
1 205 VAL n 
1 206 LEU n 
1 207 TRP n 
1 208 ARG n 
1 209 THR n 
1 210 ALA n 
1 211 SER n 
1 212 LEU n 
1 213 VAL n 
1 214 GLY n 
1 215 ALA n 
1 216 ARG n 
1 217 VAL n 
1 218 ASP n 
1 219 VAL n 
1 220 ASP n 
1 221 GLN n 
1 222 ALA n 
1 223 VAL n 
1 224 ALA n 
1 225 PHE n 
1 226 ALA n 
1 227 ALA n 
1 228 ALA n 
1 229 HIS n 
1 230 GLY n 
1 231 LEU n 
1 232 CYS n 
1 233 LEU n 
1 234 ALA n 
1 235 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   235 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'synthetic construct' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     32630 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               KRX 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    4YC5 
_struct_ref.pdbx_db_accession          4YC5 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4YC5 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 235 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             4YC5 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  235 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       235 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YC5 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.39 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.69 
_exptl_crystal.description                 'long rod' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Bis Tris, 3.0 M sodium chloride.' 
_exptl_crystal_grow.pdbx_pH_range   5.5 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2010-10-28 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.04030 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I02' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.04030 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I02 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4YC5 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.75 
_reflns.d_resolution_low                 64.57 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       34852 
_reflns.number_obs                       34852 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       0 
_reflns.observed_criterion_sigma_I       0 
_reflns.percent_possible_obs             99.71 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.90 
_reflns.pdbx_Rmerge_I_obs                0.099 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.099 
_reflns.pdbx_netI_over_av_sigmaI         22.3587 
_reflns.pdbx_netI_over_sigmaI            7.2971 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.75 
_reflns_shell.d_res_low                   1.80 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.01 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.85 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.83 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             14.24 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4YC5 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.755 
_refine.ls_d_res_low                             64.570 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     34786 
_refine.ls_number_reflns_R_free                  1750 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.68 
_refine.ls_percent_reflns_R_free                 5.03 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1590 
_refine.ls_R_factor_R_free                       0.1845 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1576 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          MIR 
_refine.pdbx_starting_model                      3DU1 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 16.67 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.14 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1585 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             273 
_refine_hist.number_atoms_total               1860 
_refine_hist.d_res_high                       1.755 
_refine_hist.d_res_low                        64.570 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 1616 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.981  ? 2199 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.175 ? 571  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 257  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 305  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.7549 1.8065  . . 148 2681 100.00 . . . 0.2380 . 0.1936 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8065 1.8648  . . 134 2710 100.00 . . . 0.2288 . 0.1847 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8648 1.9315  . . 140 2703 100.00 . . . 0.2388 . 0.1737 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9315 2.0088  . . 145 2712 100.00 . . . 0.1574 . 0.1508 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0088 2.1003  . . 158 2695 100.00 . . . 0.1799 . 0.1415 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1003 2.2110  . . 146 2711 100.00 . . . 0.1732 . 0.1418 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2110 2.3495  . . 140 2728 99.00  . . . 0.1620 . 0.1405 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3495 2.5309  . . 130 2759 100.00 . . . 0.1638 . 0.1528 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5309 2.7856  . . 142 2764 100.00 . . . 0.1950 . 0.1705 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7856 3.1887  . . 152 2785 100.00 . . . 0.2043 . 0.1671 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1887 4.0174  . . 177 2807 100.00 . . . 0.1764 . 0.1423 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0174 64.6137 . . 138 2981 98.00  . . . 0.1758 . 0.1661 . . . . . . . . . . 
# 
_struct.entry_id                     4YC5 
_struct.title                        'Beta1 synthetic solenoid protein' 
_struct.pdbx_descriptor              beta1 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YC5 
_struct_keywords.text            'solenoid, scaffold, structural protein' 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASN A 22  ? ALA A 32  ? ASN A 22  ALA A 32  1 ? 11 
HELX_P HELX_P2 AA2 ASP A 203 ? ALA A 210 ? ASP A 203 ALA A 210 1 ? 8  
HELX_P HELX_P3 AA3 ASP A 218 ? HIS A 229 ? ASP A 218 HIS A 229 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CL 301 ? 4 'binding site for residue CL A 301' 
AC2 Software A CL 302 ? 3 'binding site for residue CL A 302' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 ALA A 31  ? ALA A 31  . ? 1_555 ? 
2 AC1 4 PRO A 204 ? PRO A 204 . ? 4_654 ? 
3 AC1 4 VAL A 205 ? VAL A 205 . ? 4_654 ? 
4 AC1 4 HOH D .   ? HOH A 662 . ? 4_654 ? 
5 AC2 3 ASN A 111 ? ASN A 111 . ? 8_555 ? 
6 AC2 3 ASN A 131 ? ASN A 131 . ? 8_555 ? 
7 AC2 3 ARG A 191 ? ARG A 191 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YC5 
_atom_sites.fract_transf_matrix[1][1]   0.015487 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015487 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006234 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . HIS A 1 20  ? 13.741 -28.585 -17.961 1.00 38.25 ? 20  HIS A N   1 
ATOM   2    C  CA  . HIS A 1 20  ? 14.707 -28.330 -16.897 1.00 39.60 ? 20  HIS A CA  1 
ATOM   3    C  C   . HIS A 1 20  ? 15.520 -27.066 -17.180 1.00 39.22 ? 20  HIS A C   1 
ATOM   4    O  O   . HIS A 1 20  ? 16.133 -26.931 -18.241 1.00 43.64 ? 20  HIS A O   1 
ATOM   5    C  CB  . HIS A 1 20  ? 15.639 -29.532 -16.721 1.00 45.78 ? 20  HIS A CB  1 
ATOM   6    C  CG  . HIS A 1 20  ? 16.551 -29.429 -15.536 1.00 53.69 ? 20  HIS A CG  1 
ATOM   7    N  ND1 . HIS A 1 20  ? 17.710 -28.683 -15.549 1.00 57.51 ? 20  HIS A ND1 1 
ATOM   8    C  CD2 . HIS A 1 20  ? 16.478 -29.988 -14.304 1.00 52.72 ? 20  HIS A CD2 1 
ATOM   9    C  CE1 . HIS A 1 20  ? 18.310 -28.784 -14.375 1.00 56.50 ? 20  HIS A CE1 1 
ATOM   10   N  NE2 . HIS A 1 20  ? 17.583 -29.571 -13.602 1.00 49.46 ? 20  HIS A NE2 1 
ATOM   11   N  N   . MET A 1 21  ? 15.515 -26.143 -16.223 1.00 45.58 ? 21  MET A N   1 
ATOM   12   C  CA  . MET A 1 21  ? 16.288 -24.912 -16.328 1.00 36.01 ? 21  MET A CA  1 
ATOM   13   C  C   . MET A 1 21  ? 17.656 -25.107 -15.685 1.00 33.84 ? 21  MET A C   1 
ATOM   14   O  O   . MET A 1 21  ? 17.758 -25.680 -14.599 1.00 32.99 ? 21  MET A O   1 
ATOM   15   C  CB  . MET A 1 21  ? 15.532 -23.760 -15.663 1.00 33.51 ? 21  MET A CB  1 
ATOM   16   C  CG  . MET A 1 21  ? 16.226 -22.413 -15.676 1.00 30.32 ? 21  MET A CG  1 
ATOM   17   S  SD  . MET A 1 21  ? 15.177 -21.085 -15.013 1.00 31.99 ? 21  MET A SD  1 
ATOM   18   C  CE  . MET A 1 21  ? 13.933 -20.990 -16.297 1.00 35.78 ? 21  MET A CE  1 
ATOM   19   N  N   . ASN A 1 22  ? 18.708 -24.646 -16.353 1.00 24.36 ? 22  ASN A N   1 
ATOM   20   C  CA  . ASN A 1 22  ? 20.049 -24.803 -15.799 1.00 25.27 ? 22  ASN A CA  1 
ATOM   21   C  C   . ASN A 1 22  ? 20.530 -23.556 -15.063 1.00 25.37 ? 22  ASN A C   1 
ATOM   22   O  O   . ASN A 1 22  ? 19.853 -22.525 -15.040 1.00 22.86 ? 22  ASN A O   1 
ATOM   23   C  CB  . ASN A 1 22  ? 21.051 -25.202 -16.895 1.00 26.17 ? 22  ASN A CB  1 
ATOM   24   C  CG  . ASN A 1 22  ? 21.153 -24.181 -18.021 1.00 33.54 ? 22  ASN A CG  1 
ATOM   25   O  OD1 . ASN A 1 22  ? 21.210 -22.973 -17.789 1.00 31.08 ? 22  ASN A OD1 1 
ATOM   26   N  ND2 . ASN A 1 22  ? 21.198 -24.674 -19.256 1.00 36.88 ? 22  ASN A ND2 1 
ATOM   27   N  N   . VAL A 1 23  ? 21.701 -23.673 -14.448 1.00 16.87 ? 23  VAL A N   1 
ATOM   28   C  CA  . VAL A 1 23  ? 22.268 -22.612 -13.631 1.00 15.30 ? 23  VAL A CA  1 
ATOM   29   C  C   . VAL A 1 23  ? 22.368 -21.287 -14.386 1.00 17.58 ? 23  VAL A C   1 
ATOM   30   O  O   . VAL A 1 23  ? 21.909 -20.249 -13.901 1.00 15.31 ? 23  VAL A O   1 
ATOM   31   C  CB  . VAL A 1 23  ? 23.667 -23.018 -13.121 1.00 21.47 ? 23  VAL A CB  1 
ATOM   32   C  CG1 . VAL A 1 23  ? 24.390 -21.832 -12.513 1.00 17.64 ? 23  VAL A CG1 1 
ATOM   33   C  CG2 . VAL A 1 23  ? 23.551 -24.171 -12.122 1.00 22.56 ? 23  VAL A CG2 1 
ATOM   34   N  N   . GLY A 1 24  ? 22.965 -21.324 -15.571 1.00 16.90 ? 24  GLY A N   1 
ATOM   35   C  CA  . GLY A 1 24  ? 23.151 -20.110 -16.347 1.00 18.32 ? 24  GLY A CA  1 
ATOM   36   C  C   . GLY A 1 24  ? 21.827 -19.414 -16.616 1.00 19.96 ? 24  GLY A C   1 
ATOM   37   O  O   . GLY A 1 24  ? 21.717 -18.187 -16.494 1.00 18.17 ? 24  GLY A O   1 
ATOM   38   N  N   . GLU A 1 25  ? 20.811 -20.210 -16.942 1.00 18.90 ? 25  GLU A N   1 
ATOM   39   C  CA  . GLU A 1 25  ? 19.495 -19.671 -17.269 1.00 17.62 ? 25  GLU A CA  1 
ATOM   40   C  C   . GLU A 1 25  ? 18.842 -19.006 -16.061 1.00 18.08 ? 25  GLU A C   1 
ATOM   41   O  O   . GLU A 1 25  ? 18.356 -17.882 -16.162 1.00 17.78 ? 25  GLU A O   1 
ATOM   42   C  CB  . GLU A 1 25  ? 18.577 -20.774 -17.820 1.00 25.70 ? 25  GLU A CB  1 
ATOM   43   C  CG  . GLU A 1 25  ? 18.935 -21.207 -19.240 1.00 34.22 ? 25  GLU A CG  1 
ATOM   44   C  CD  . GLU A 1 25  ? 18.208 -22.466 -19.681 1.00 41.65 ? 25  GLU A CD  1 
ATOM   45   O  OE1 . GLU A 1 25  ? 17.720 -23.214 -18.808 1.00 41.57 ? 25  GLU A OE1 1 
ATOM   46   O  OE2 . GLU A 1 25  ? 18.127 -22.706 -20.906 1.00 43.82 ? 25  GLU A OE2 1 
ATOM   47   N  N   . ILE A 1 26  ? 18.833 -19.676 -14.914 1.00 15.79 ? 26  ILE A N   1 
ATOM   48   C  CA  . ILE A 1 26  ? 18.089 -19.099 -13.801 1.00 15.87 ? 26  ILE A CA  1 
ATOM   49   C  C   . ILE A 1 26  ? 18.820 -17.854 -13.296 1.00 13.69 ? 26  ILE A C   1 
ATOM   50   O  O   . ILE A 1 26  ? 18.188 -16.865 -12.943 1.00 13.49 ? 26  ILE A O   1 
ATOM   51   C  CB  . ILE A 1 26  ? 17.839 -20.118 -12.654 1.00 17.12 ? 26  ILE A CB  1 
ATOM   52   C  CG1 . ILE A 1 26  ? 16.889 -19.509 -11.615 1.00 23.39 ? 26  ILE A CG1 1 
ATOM   53   C  CG2 . ILE A 1 26  ? 19.138 -20.575 -12.006 1.00 24.73 ? 26  ILE A CG2 1 
ATOM   54   C  CD1 . ILE A 1 26  ? 16.356 -20.506 -10.601 1.00 27.58 ? 26  ILE A CD1 1 
ATOM   55   N  N   . LEU A 1 27  ? 20.153 -17.861 -13.317 1.00 13.08 ? 27  LEU A N   1 
ATOM   56   C  CA  . LEU A 1 27  ? 20.871 -16.700 -12.803 1.00 12.08 ? 27  LEU A CA  1 
ATOM   57   C  C   . LEU A 1 27  ? 20.713 -15.522 -13.767 1.00 12.41 ? 27  LEU A C   1 
ATOM   58   O  O   . LEU A 1 27  ? 20.637 -14.368 -13.336 1.00 14.82 ? 27  LEU A O   1 
ATOM   59   C  CB  . LEU A 1 27  ? 22.351 -17.013 -12.580 1.00 11.71 ? 27  LEU A CB  1 
ATOM   60   C  CG  . LEU A 1 27  ? 22.615 -18.058 -11.489 1.00 11.52 ? 27  LEU A CG  1 
ATOM   61   C  CD1 . LEU A 1 27  ? 24.126 -18.274 -11.355 1.00 14.24 ? 27  LEU A CD1 1 
ATOM   62   C  CD2 . LEU A 1 27  ? 22.002 -17.645 -10.163 1.00 18.30 ? 27  LEU A CD2 1 
ATOM   63   N  N   . ARG A 1 28  ? 20.644 -15.801 -15.066 1.00 13.47 ? 28  ARG A N   1 
ATOM   64   C  CA  . ARG A 1 28  ? 20.449 -14.706 -16.016 1.00 14.12 ? 28  ARG A CA  1 
ATOM   65   C  C   . ARG A 1 28  ? 19.050 -14.109 -15.863 1.00 15.62 ? 28  ARG A C   1 
ATOM   66   O  O   . ARG A 1 28  ? 18.880 -12.879 -15.885 1.00 14.95 ? 28  ARG A O   1 
ATOM   67   C  CB  . ARG A 1 28  ? 20.677 -15.162 -17.459 1.00 19.42 ? 28  ARG A CB  1 
ATOM   68   C  CG  . ARG A 1 28  ? 20.416 -14.040 -18.461 1.00 19.41 ? 28  ARG A CG  1 
ATOM   69   C  CD  . ARG A 1 28  ? 20.749 -14.440 -19.888 1.00 22.78 ? 28  ARG A CD  1 
ATOM   70   N  NE  . ARG A 1 28  ? 22.175 -14.284 -20.175 1.00 28.74 ? 28  ARG A NE  1 
ATOM   71   C  CZ  . ARG A 1 28  ? 22.947 -15.232 -20.696 1.00 39.73 ? 28  ARG A CZ  1 
ATOM   72   N  NH1 . ARG A 1 28  ? 22.434 -16.424 -20.984 1.00 47.70 ? 28  ARG A NH1 1 
ATOM   73   N  NH2 . ARG A 1 28  ? 24.231 -14.987 -20.929 1.00 30.54 ? 28  ARG A NH2 1 
ATOM   74   N  N   . HIS A 1 29  ? 18.050 -14.972 -15.707 1.00 15.10 ? 29  HIS A N   1 
ATOM   75   C  CA  . HIS A 1 29  ? 16.675 -14.516 -15.511 1.00 17.04 ? 29  HIS A CA  1 
ATOM   76   C  C   . HIS A 1 29  ? 16.558 -13.674 -14.240 1.00 14.45 ? 29  HIS A C   1 
ATOM   77   O  O   . HIS A 1 29  ? 15.945 -12.608 -14.239 1.00 15.34 ? 29  HIS A O   1 
ATOM   78   C  CB  . HIS A 1 29  ? 15.706 -15.701 -15.427 1.00 18.23 ? 29  HIS A CB  1 
ATOM   79   C  CG  . HIS A 1 29  ? 15.464 -16.384 -16.737 1.00 29.64 ? 29  HIS A CG  1 
ATOM   80   N  ND1 . HIS A 1 29  ? 15.289 -15.694 -17.918 1.00 37.66 ? 29  HIS A ND1 1 
ATOM   81   C  CD2 . HIS A 1 29  ? 15.355 -17.697 -17.050 1.00 32.83 ? 29  HIS A CD2 1 
ATOM   82   C  CE1 . HIS A 1 29  ? 15.087 -16.552 -18.902 1.00 39.62 ? 29  HIS A CE1 1 
ATOM   83   N  NE2 . HIS A 1 29  ? 15.123 -17.775 -18.402 1.00 37.71 ? 29  HIS A NE2 1 
ATOM   84   N  N   . TYR A 1 30  ? 17.150 -14.165 -13.156 1.00 13.39 ? 30  TYR A N   1 
ATOM   85   C  CA  . TYR A 1 30  ? 17.091 -13.440 -11.896 1.00 13.67 ? 30  TYR A CA  1 
ATOM   86   C  C   . TYR A 1 30  ? 17.779 -12.077 -12.048 1.00 13.52 ? 30  TYR A C   1 
ATOM   87   O  O   . TYR A 1 30  ? 17.280 -11.058 -11.559 1.00 14.77 ? 30  TYR A O   1 
ATOM   88   C  CB  . TYR A 1 30  ? 17.732 -14.264 -10.775 1.00 12.58 ? 30  TYR A CB  1 
ATOM   89   C  CG  . TYR A 1 30  ? 17.530 -13.636 -9.419  1.00 11.40 ? 30  TYR A CG  1 
ATOM   90   C  CD1 . TYR A 1 30  ? 18.424 -12.690 -8.936  1.00 12.84 ? 30  TYR A CD1 1 
ATOM   91   C  CD2 . TYR A 1 30  ? 16.426 -13.962 -8.635  1.00 11.97 ? 30  TYR A CD2 1 
ATOM   92   C  CE1 . TYR A 1 30  ? 18.235 -12.085 -7.706  1.00 15.77 ? 30  TYR A CE1 1 
ATOM   93   C  CE2 . TYR A 1 30  ? 16.232 -13.367 -7.400  1.00 14.25 ? 30  TYR A CE2 1 
ATOM   94   C  CZ  . TYR A 1 30  ? 17.144 -12.428 -6.945  1.00 14.76 ? 30  TYR A CZ  1 
ATOM   95   O  OH  . TYR A 1 30  ? 16.951 -11.824 -5.721  1.00 15.25 ? 30  TYR A OH  1 
ATOM   96   N  N   . ALA A 1 31  ? 18.915 -12.055 -12.744 1.00 13.98 ? 31  ALA A N   1 
ATOM   97   C  CA  . ALA A 1 31  ? 19.651 -10.807 -12.947 1.00 13.26 ? 31  ALA A CA  1 
ATOM   98   C  C   . ALA A 1 31  ? 18.830 -9.786  -13.731 1.00 20.67 ? 31  ALA A C   1 
ATOM   99   O  O   . ALA A 1 31  ? 18.981 -8.571  -13.544 1.00 16.44 ? 31  ALA A O   1 
ATOM   100  C  CB  . ALA A 1 31  ? 20.977 -11.076 -13.666 1.00 12.64 ? 31  ALA A CB  1 
ATOM   101  N  N   . ALA A 1 32  ? 17.969 -10.284 -14.617 1.00 14.91 ? 32  ALA A N   1 
ATOM   102  C  CA  . ALA A 1 32  ? 17.107 -9.422  -15.427 1.00 16.33 ? 32  ALA A CA  1 
ATOM   103  C  C   . ALA A 1 32  ? 15.909 -8.902  -14.637 1.00 19.78 ? 32  ALA A C   1 
ATOM   104  O  O   . ALA A 1 32  ? 15.136 -8.082  -15.137 1.00 19.98 ? 32  ALA A O   1 
ATOM   105  C  CB  . ALA A 1 32  ? 16.629 -10.169 -16.663 1.00 18.82 ? 32  ALA A CB  1 
ATOM   106  N  N   . GLY A 1 33  ? 15.740 -9.393  -13.412 1.00 15.74 ? 33  GLY A N   1 
ATOM   107  C  CA  . GLY A 1 33  ? 14.660 -8.936  -12.556 1.00 18.10 ? 33  GLY A CA  1 
ATOM   108  C  C   . GLY A 1 33  ? 13.500 -9.911  -12.475 1.00 22.21 ? 33  GLY A C   1 
ATOM   109  O  O   . GLY A 1 33  ? 12.500 -9.642  -11.818 1.00 19.22 ? 33  GLY A O   1 
ATOM   110  N  N   . LYS A 1 34  ? 13.625 -11.052 -13.140 1.00 17.96 ? 34  LYS A N   1 
ATOM   111  C  CA  . LYS A 1 34  ? 12.558 -12.047 -13.089 1.00 16.30 ? 34  LYS A CA  1 
ATOM   112  C  C   . LYS A 1 34  ? 12.536 -12.733 -11.728 1.00 16.33 ? 34  LYS A C   1 
ATOM   113  O  O   . LYS A 1 34  ? 13.583 -13.061 -11.169 1.00 16.42 ? 34  LYS A O   1 
ATOM   114  C  CB  . LYS A 1 34  ? 12.727 -13.075 -14.203 1.00 20.33 ? 34  LYS A CB  1 
ATOM   115  C  CG  . LYS A 1 34  ? 12.582 -12.461 -15.585 1.00 30.78 ? 34  LYS A CG  1 
ATOM   116  C  CD  . LYS A 1 34  ? 13.332 -13.256 -16.643 1.00 46.18 ? 34  LYS A CD  1 
ATOM   117  C  CE  . LYS A 1 34  ? 13.608 -12.405 -17.874 1.00 44.17 ? 34  LYS A CE  1 
ATOM   118  N  NZ  . LYS A 1 34  ? 14.823 -12.853 -18.624 1.00 41.95 ? 34  LYS A NZ  1 
ATOM   119  N  N   . ARG A 1 35  ? 11.335 -12.945 -11.198 1.00 14.35 ? 35  ARG A N   1 
ATOM   120  C  CA  . ARG A 1 35  ? 11.190 -13.605 -9.902  1.00 12.54 ? 35  ARG A CA  1 
ATOM   121  C  C   . ARG A 1 35  ? 10.205 -14.770 -9.952  1.00 17.96 ? 35  ARG A C   1 
ATOM   122  O  O   . ARG A 1 35  ? 10.097 -15.533 -8.991  1.00 18.64 ? 35  ARG A O   1 
ATOM   123  C  CB  . ARG A 1 35  ? 10.731 -12.603 -8.833  1.00 15.59 ? 35  ARG A CB  1 
ATOM   124  C  CG  . ARG A 1 35  ? 11.701 -11.455 -8.575  1.00 14.10 ? 35  ARG A CG  1 
ATOM   125  C  CD  . ARG A 1 35  ? 12.987 -11.970 -7.929  1.00 14.13 ? 35  ARG A CD  1 
ATOM   126  N  NE  . ARG A 1 35  ? 13.912 -10.890 -7.604  1.00 16.64 ? 35  ARG A NE  1 
ATOM   127  C  CZ  . ARG A 1 35  ? 14.861 -10.444 -8.422  1.00 17.69 ? 35  ARG A CZ  1 
ATOM   128  N  NH1 . ARG A 1 35  ? 15.010 -10.975 -9.633  1.00 14.48 ? 35  ARG A NH1 1 
ATOM   129  N  NH2 . ARG A 1 35  ? 15.661 -9.459  -8.030  1.00 18.74 ? 35  ARG A NH2 1 
ATOM   130  N  N   . ASN A 1 36  ? 9.474  -14.909 -11.056 1.00 19.48 ? 36  ASN A N   1 
ATOM   131  C  CA  . ASN A 1 36  ? 8.477  -15.970 -11.135 1.00 16.90 ? 36  ASN A CA  1 
ATOM   132  C  C   . ASN A 1 36  ? 9.053  -17.264 -11.696 1.00 19.11 ? 36  ASN A C   1 
ATOM   133  O  O   . ASN A 1 36  ? 9.154  -17.445 -12.912 1.00 21.17 ? 36  ASN A O   1 
ATOM   134  C  CB  . ASN A 1 36  ? 7.274  -15.535 -11.970 1.00 22.00 ? 36  ASN A CB  1 
ATOM   135  C  CG  . ASN A 1 36  ? 6.173  -16.591 -11.994 1.00 29.23 ? 36  ASN A CG  1 
ATOM   136  O  OD1 . ASN A 1 36  ? 6.242  -17.593 -11.277 1.00 23.98 ? 36  ASN A OD1 1 
ATOM   137  N  ND2 . ASN A 1 36  ? 5.144  -16.359 -12.802 1.00 32.42 ? 36  ASN A ND2 1 
ATOM   138  N  N   . PHE A 1 37  ? 9.417  -18.165 -10.795 1.00 15.83 ? 37  PHE A N   1 
ATOM   139  C  CA  . PHE A 1 37  ? 9.940  -19.462 -11.184 1.00 13.88 ? 37  PHE A CA  1 
ATOM   140  C  C   . PHE A 1 37  ? 9.030  -20.574 -10.673 1.00 14.61 ? 37  PHE A C   1 
ATOM   141  O  O   . PHE A 1 37  ? 9.489  -21.668 -10.372 1.00 15.49 ? 37  PHE A O   1 
ATOM   142  C  CB  . PHE A 1 37  ? 11.359 -19.643 -10.645 1.00 13.47 ? 37  PHE A CB  1 
ATOM   143  C  CG  . PHE A 1 37  ? 12.316 -18.582 -11.112 1.00 14.10 ? 37  PHE A CG  1 
ATOM   144  C  CD1 . PHE A 1 37  ? 12.848 -18.625 -12.386 1.00 22.02 ? 37  PHE A CD1 1 
ATOM   145  C  CD2 . PHE A 1 37  ? 12.684 -17.542 -10.271 1.00 16.11 ? 37  PHE A CD2 1 
ATOM   146  C  CE1 . PHE A 1 37  ? 13.732 -17.648 -12.820 1.00 22.02 ? 37  PHE A CE1 1 
ATOM   147  C  CE2 . PHE A 1 37  ? 13.570 -16.560 -10.705 1.00 16.72 ? 37  PHE A CE2 1 
ATOM   148  C  CZ  . PHE A 1 37  ? 14.089 -16.616 -11.973 1.00 18.21 ? 37  PHE A CZ  1 
ATOM   149  N  N   . GLN A 1 38  ? 7.737  -20.302 -10.572 1.00 14.38 ? 38  GLN A N   1 
ATOM   150  C  CA  . GLN A 1 38  ? 6.844  -21.288 -9.965  1.00 14.66 ? 38  GLN A CA  1 
ATOM   151  C  C   . GLN A 1 38  ? 6.722  -22.528 -10.867 1.00 16.29 ? 38  GLN A C   1 
ATOM   152  O  O   . GLN A 1 38  ? 6.696  -22.411 -12.097 1.00 16.46 ? 38  GLN A O   1 
ATOM   153  C  CB  . GLN A 1 38  ? 5.464  -20.666 -9.680  1.00 15.73 ? 38  GLN A CB  1 
ATOM   154  C  CG  . GLN A 1 38  ? 4.678  -20.285 -10.921 1.00 20.32 ? 38  GLN A CG  1 
ATOM   155  C  CD  . GLN A 1 38  ? 3.687  -21.360 -11.319 1.00 28.85 ? 38  GLN A CD  1 
ATOM   156  O  OE1 . GLN A 1 38  ? 3.169  -22.087 -10.464 1.00 30.40 ? 38  GLN A OE1 1 
ATOM   157  N  NE2 . GLN A 1 38  ? 3.414  -21.467 -12.619 1.00 26.75 ? 38  GLN A NE2 1 
ATOM   158  N  N   . HIS A 1 39  ? 6.707  -23.706 -10.242 1.00 15.12 ? 39  HIS A N   1 
ATOM   159  C  CA  . HIS A 1 39  ? 6.538  -25.008 -10.912 1.00 15.95 ? 39  HIS A CA  1 
ATOM   160  C  C   . HIS A 1 39  ? 7.712  -25.382 -11.813 1.00 19.36 ? 39  HIS A C   1 
ATOM   161  O  O   . HIS A 1 39  ? 7.623  -26.321 -12.603 1.00 22.27 ? 39  HIS A O   1 
ATOM   162  C  CB  . HIS A 1 39  ? 5.234  -25.051 -11.729 1.00 17.93 ? 39  HIS A CB  1 
ATOM   163  C  CG  . HIS A 1 39  ? 4.047  -25.518 -10.945 1.00 17.94 ? 39  HIS A CG  1 
ATOM   164  N  ND1 . HIS A 1 39  ? 3.087  -24.655 -10.462 1.00 19.45 ? 39  HIS A ND1 1 
ATOM   165  C  CD2 . HIS A 1 39  ? 3.670  -26.757 -10.554 1.00 21.95 ? 39  HIS A CD2 1 
ATOM   166  C  CE1 . HIS A 1 39  ? 2.168  -25.342 -9.809  1.00 19.13 ? 39  HIS A CE1 1 
ATOM   167  N  NE2 . HIS A 1 39  ? 2.493  -26.622 -9.855  1.00 23.60 ? 39  HIS A NE2 1 
ATOM   168  N  N   . ILE A 1 40  ? 8.814  -24.660 -11.689 1.00 16.72 ? 40  ILE A N   1 
ATOM   169  C  CA  . ILE A 1 40  ? 9.967  -24.946 -12.526 1.00 20.40 ? 40  ILE A CA  1 
ATOM   170  C  C   . ILE A 1 40  ? 10.680 -26.223 -12.071 1.00 20.42 ? 40  ILE A C   1 
ATOM   171  O  O   . ILE A 1 40  ? 10.705 -26.537 -10.879 1.00 19.23 ? 40  ILE A O   1 
ATOM   172  C  CB  . ILE A 1 40  ? 10.940 -23.778 -12.512 1.00 23.28 ? 40  ILE A CB  1 
ATOM   173  C  CG1 . ILE A 1 40  ? 11.996 -23.952 -13.586 1.00 29.35 ? 40  ILE A CG1 1 
ATOM   174  C  CG2 . ILE A 1 40  ? 11.603 -23.642 -11.143 1.00 31.10 ? 40  ILE A CG2 1 
ATOM   175  C  CD1 . ILE A 1 40  ? 13.070 -22.992 -13.407 1.00 35.83 ? 40  ILE A CD1 1 
ATOM   176  N  N   . ASN A 1 41  ? 11.240 -26.965 -13.025 1.00 21.25 ? 41  ASN A N   1 
ATOM   177  C  CA  . ASN A 1 41  ? 12.027 -28.154 -12.710 1.00 24.11 ? 41  ASN A CA  1 
ATOM   178  C  C   . ASN A 1 41  ? 13.505 -27.808 -12.557 1.00 28.16 ? 41  ASN A C   1 
ATOM   179  O  O   . ASN A 1 41  ? 14.168 -27.464 -13.536 1.00 24.76 ? 41  ASN A O   1 
ATOM   180  C  CB  . ASN A 1 41  ? 11.829 -29.219 -13.794 1.00 29.56 ? 41  ASN A CB  1 
ATOM   181  C  CG  . ASN A 1 41  ? 12.811 -30.378 -13.679 1.00 36.21 ? 41  ASN A CG  1 
ATOM   182  O  OD1 . ASN A 1 41  ? 13.291 -30.710 -12.591 1.00 31.01 ? 41  ASN A OD1 1 
ATOM   183  N  ND2 . ASN A 1 41  ? 13.100 -31.015 -14.814 1.00 38.37 ? 41  ASN A ND2 1 
ATOM   184  N  N   . LEU A 1 42  ? 14.007 -27.901 -11.326 1.00 19.89 ? 42  LEU A N   1 
ATOM   185  C  CA  . LEU A 1 42  ? 15.398 -27.585 -11.012 1.00 19.12 ? 42  LEU A CA  1 
ATOM   186  C  C   . LEU A 1 42  ? 16.085 -28.744 -10.293 1.00 23.08 ? 42  LEU A C   1 
ATOM   187  O  O   . LEU A 1 42  ? 17.012 -28.542 -9.512  1.00 20.23 ? 42  LEU A O   1 
ATOM   188  C  CB  . LEU A 1 42  ? 15.479 -26.332 -10.141 1.00 20.81 ? 42  LEU A CB  1 
ATOM   189  C  CG  . LEU A 1 42  ? 14.935 -25.032 -10.734 1.00 23.74 ? 42  LEU A CG  1 
ATOM   190  C  CD1 . LEU A 1 42  ? 14.781 -23.990 -9.632  1.00 27.27 ? 42  LEU A CD1 1 
ATOM   191  C  CD2 . LEU A 1 42  ? 15.850 -24.531 -11.828 1.00 25.28 ? 42  LEU A CD2 1 
ATOM   192  N  N   . GLN A 1 43  ? 15.604 -29.952 -10.555 1.00 20.57 ? 43  GLN A N   1 
ATOM   193  C  CA  . GLN A 1 43  ? 16.118 -31.168 -9.941  1.00 23.53 ? 43  GLN A CA  1 
ATOM   194  C  C   . GLN A 1 43  ? 17.639 -31.248 -10.056 1.00 25.48 ? 43  GLN A C   1 
ATOM   195  O  O   . GLN A 1 43  ? 18.188 -31.008 -11.129 1.00 20.94 ? 43  GLN A O   1 
ATOM   196  C  CB  . GLN A 1 43  ? 15.474 -32.379 -10.619 1.00 34.36 ? 43  GLN A CB  1 
ATOM   197  C  CG  . GLN A 1 43  ? 15.371 -33.627 -9.784  1.00 47.51 ? 43  GLN A CG  1 
ATOM   198  C  CD  . GLN A 1 43  ? 14.533 -34.689 -10.470 1.00 54.68 ? 43  GLN A CD  1 
ATOM   199  O  OE1 . GLN A 1 43  ? 14.584 -34.839 -11.691 1.00 55.22 ? 43  GLN A OE1 1 
ATOM   200  N  NE2 . GLN A 1 43  ? 13.752 -35.426 -9.689  1.00 58.62 ? 43  GLN A NE2 1 
ATOM   201  N  N   . GLU A 1 44  ? 18.304 -31.564 -8.945  1.00 21.10 ? 44  GLU A N   1 
ATOM   202  C  CA  . GLU A 1 44  ? 19.754 -31.790 -8.907  1.00 20.62 ? 44  GLU A CA  1 
ATOM   203  C  C   . GLU A 1 44  ? 20.601 -30.563 -9.252  1.00 24.67 ? 44  GLU A C   1 
ATOM   204  O  O   . GLU A 1 44  ? 21.802 -30.695 -9.458  1.00 23.49 ? 44  GLU A O   1 
ATOM   205  C  CB  . GLU A 1 44  ? 20.157 -32.927 -9.863  1.00 25.07 ? 44  GLU A CB  1 
ATOM   206  C  CG  . GLU A 1 44  ? 19.314 -34.186 -9.780  1.00 33.35 ? 44  GLU A CG  1 
ATOM   207  C  CD  . GLU A 1 44  ? 19.729 -35.098 -8.652  1.00 34.47 ? 44  GLU A CD  1 
ATOM   208  O  OE1 . GLU A 1 44  ? 20.846 -34.920 -8.126  1.00 32.28 ? 44  GLU A OE1 1 
ATOM   209  O  OE2 . GLU A 1 44  ? 18.939 -36.001 -8.300  1.00 36.77 ? 44  GLU A OE2 1 
ATOM   210  N  N   . ILE A 1 45  ? 20.001 -29.378 -9.310  1.00 20.95 ? 45  ILE A N   1 
ATOM   211  C  CA  . ILE A 1 45  ? 20.752 -28.197 -9.738  1.00 21.03 ? 45  ILE A CA  1 
ATOM   212  C  C   . ILE A 1 45  ? 21.842 -27.830 -8.720  1.00 25.29 ? 45  ILE A C   1 
ATOM   213  O  O   . ILE A 1 45  ? 21.693 -28.055 -7.515  1.00 22.75 ? 45  ILE A O   1 
ATOM   214  C  CB  . ILE A 1 45  ? 19.816 -26.985 -9.981  1.00 20.00 ? 45  ILE A CB  1 
ATOM   215  C  CG1 . ILE A 1 45  ? 20.524 -25.924 -10.831 1.00 22.23 ? 45  ILE A CG1 1 
ATOM   216  C  CG2 . ILE A 1 45  ? 19.296 -26.408 -8.663  1.00 18.63 ? 45  ILE A CG2 1 
ATOM   217  C  CD1 . ILE A 1 45  ? 19.595 -24.850 -11.359 1.00 23.50 ? 45  ILE A CD1 1 
ATOM   218  N  N   . GLU A 1 46  ? 22.959 -27.308 -9.222  1.00 23.98 ? 46  GLU A N   1 
ATOM   219  C  CA  . GLU A 1 46  ? 24.070 -26.883 -8.372  1.00 23.92 ? 46  GLU A CA  1 
ATOM   220  C  C   . GLU A 1 46  ? 24.052 -25.368 -8.197  1.00 24.41 ? 46  GLU A C   1 
ATOM   221  O  O   . GLU A 1 46  ? 24.471 -24.625 -9.088  1.00 21.39 ? 46  GLU A O   1 
ATOM   222  C  CB  . GLU A 1 46  ? 25.403 -27.323 -8.967  1.00 33.67 ? 46  GLU A CB  1 
ATOM   223  C  CG  . GLU A 1 46  ? 25.534 -28.824 -9.144  1.00 46.29 ? 46  GLU A CG  1 
ATOM   224  C  CD  . GLU A 1 46  ? 25.828 -29.535 -7.841  1.00 57.50 ? 46  GLU A CD  1 
ATOM   225  O  OE1 . GLU A 1 46  ? 26.241 -28.854 -6.877  1.00 59.52 ? 46  GLU A OE1 1 
ATOM   226  O  OE2 . GLU A 1 46  ? 25.652 -30.771 -7.782  1.00 61.27 ? 46  GLU A OE2 1 
ATOM   227  N  N   . LEU A 1 47  ? 23.561 -24.911 -7.054  1.00 22.57 ? 47  LEU A N   1 
ATOM   228  C  CA  . LEU A 1 47  ? 23.431 -23.480 -6.802  1.00 23.69 ? 47  LEU A CA  1 
ATOM   229  C  C   . LEU A 1 47  ? 24.062 -23.071 -5.475  1.00 21.99 ? 47  LEU A C   1 
ATOM   230  O  O   . LEU A 1 47  ? 23.511 -22.259 -4.740  1.00 20.17 ? 47  LEU A O   1 
ATOM   231  C  CB  . LEU A 1 47  ? 21.957 -23.067 -6.828  1.00 22.88 ? 47  LEU A CB  1 
ATOM   232  C  CG  . LEU A 1 47  ? 21.340 -22.976 -8.224  1.00 25.26 ? 47  LEU A CG  1 
ATOM   233  C  CD1 . LEU A 1 47  ? 19.855 -22.658 -8.123  1.00 22.78 ? 47  LEU A CD1 1 
ATOM   234  C  CD2 . LEU A 1 47  ? 22.072 -21.927 -9.051  1.00 20.92 ? 47  LEU A CD2 1 
ATOM   235  N  N   . THR A 1 48  ? 25.225 -23.636 -5.180  1.00 22.76 ? 48  THR A N   1 
ATOM   236  C  CA  . THR A 1 48  ? 25.954 -23.297 -3.964  1.00 24.00 ? 48  THR A CA  1 
ATOM   237  C  C   . THR A 1 48  ? 26.319 -21.816 -3.935  1.00 24.50 ? 48  THR A C   1 
ATOM   238  O  O   . THR A 1 48  ? 26.784 -21.273 -4.936  1.00 23.09 ? 48  THR A O   1 
ATOM   239  C  CB  . THR A 1 48  ? 27.229 -24.143 -3.843  1.00 30.73 ? 48  THR A CB  1 
ATOM   240  O  OG1 . THR A 1 48  ? 26.866 -25.529 -3.801  1.00 28.21 ? 48  THR A OG1 1 
ATOM   241  C  CG2 . THR A 1 48  ? 27.998 -23.785 -2.586  1.00 36.50 ? 48  THR A CG2 1 
ATOM   242  N  N   . ASN A 1 49  ? 26.089 -21.177 -2.788  1.00 21.84 ? 49  ASN A N   1 
ATOM   243  C  CA  . ASN A 1 49  ? 26.368 -19.750 -2.566  1.00 18.21 ? 49  ASN A CA  1 
ATOM   244  C  C   . ASN A 1 49  ? 25.561 -18.811 -3.468  1.00 17.99 ? 49  ASN A C   1 
ATOM   245  O  O   . ASN A 1 49  ? 25.891 -17.629 -3.581  1.00 24.31 ? 49  ASN A O   1 
ATOM   246  C  CB  . ASN A 1 49  ? 27.855 -19.427 -2.754  1.00 21.35 ? 49  ASN A CB  1 
ATOM   247  C  CG  . ASN A 1 49  ? 28.765 -20.221 -1.830  1.00 30.62 ? 49  ASN A CG  1 
ATOM   248  O  OD1 . ASN A 1 49  ? 29.644 -20.952 -2.291  1.00 37.05 ? 49  ASN A OD1 1 
ATOM   249  N  ND2 . ASN A 1 49  ? 28.583 -20.057 -0.525  1.00 30.84 ? 49  ASN A ND2 1 
ATOM   250  N  N   . ALA A 1 50  ? 24.520 -19.329 -4.108  1.00 17.47 ? 50  ALA A N   1 
ATOM   251  C  CA  . ALA A 1 50  ? 23.710 -18.510 -5.016  1.00 20.53 ? 50  ALA A CA  1 
ATOM   252  C  C   . ALA A 1 50  ? 22.757 -17.628 -4.228  1.00 23.68 ? 50  ALA A C   1 
ATOM   253  O  O   . ALA A 1 50  ? 22.369 -17.975 -3.119  1.00 24.11 ? 50  ALA A O   1 
ATOM   254  C  CB  . ALA A 1 50  ? 22.930 -19.385 -5.974  1.00 26.04 ? 50  ALA A CB  1 
ATOM   255  N  N   . SER A 1 51  ? 22.381 -16.488 -4.791  1.00 12.56 ? 51  SER A N   1 
ATOM   256  C  CA  . SER A 1 51  ? 21.346 -15.680 -4.155  1.00 11.99 ? 51  SER A CA  1 
ATOM   257  C  C   . SER A 1 51  ? 20.129 -15.619 -5.052  1.00 14.91 ? 51  SER A C   1 
ATOM   258  O  O   . SER A 1 51  ? 20.227 -15.206 -6.210  1.00 15.70 ? 51  SER A O   1 
ATOM   259  C  CB  . SER A 1 51  ? 21.865 -14.270 -3.853  1.00 17.37 ? 51  SER A CB  1 
ATOM   260  O  OG  . SER A 1 51  ? 20.868 -13.516 -3.189  1.00 21.18 ? 51  SER A OG  1 
ATOM   261  N  N   . LEU A 1 52  ? 18.986 -16.041 -4.513  1.00 12.25 ? 52  LEU A N   1 
ATOM   262  C  CA  . LEU A 1 52  ? 17.703 -15.946 -5.207  1.00 12.26 ? 52  LEU A CA  1 
ATOM   263  C  C   . LEU A 1 52  ? 16.665 -15.362 -4.263  1.00 13.79 ? 52  LEU A C   1 
ATOM   264  O  O   . LEU A 1 52  ? 15.522 -15.839 -4.197  1.00 12.76 ? 52  LEU A O   1 
ATOM   265  C  CB  . LEU A 1 52  ? 17.250 -17.318 -5.717  1.00 11.74 ? 52  LEU A CB  1 
ATOM   266  C  CG  . LEU A 1 52  ? 18.155 -17.977 -6.768  1.00 17.11 ? 52  LEU A CG  1 
ATOM   267  C  CD1 . LEU A 1 52  ? 17.681 -19.400 -7.071  1.00 18.44 ? 52  LEU A CD1 1 
ATOM   268  C  CD2 . LEU A 1 52  ? 18.191 -17.149 -8.048  1.00 15.61 ? 52  LEU A CD2 1 
ATOM   269  N  N   . THR A 1 53  ? 17.055 -14.326 -3.524  1.00 12.24 ? 53  THR A N   1 
ATOM   270  C  CA  . THR A 1 53  ? 16.130 -13.736 -2.554  1.00 10.96 ? 53  THR A CA  1 
ATOM   271  C  C   . THR A 1 53  ? 14.857 -13.252 -3.220  1.00 15.71 ? 53  THR A C   1 
ATOM   272  O  O   . THR A 1 53  ? 14.880 -12.685 -4.313  1.00 14.29 ? 53  THR A O   1 
ATOM   273  C  CB  . THR A 1 53  ? 16.773 -12.554 -1.786  1.00 18.51 ? 53  THR A CB  1 
ATOM   274  O  OG1 . THR A 1 53  ? 17.114 -11.499 -2.701  1.00 18.72 ? 53  THR A OG1 1 
ATOM   275  C  CG2 . THR A 1 53  ? 18.029 -13.017 -1.110  1.00 17.78 ? 53  THR A CG2 1 
ATOM   276  N  N   . GLY A 1 54  ? 13.733 -13.505 -2.558  1.00 11.11 ? 54  GLY A N   1 
ATOM   277  C  CA  . GLY A 1 54  ? 12.447 -13.047 -3.045  1.00 12.07 ? 54  GLY A CA  1 
ATOM   278  C  C   . GLY A 1 54  ? 11.894 -13.797 -4.245  1.00 15.26 ? 54  GLY A C   1 
ATOM   279  O  O   . GLY A 1 54  ? 10.850 -13.410 -4.781  1.00 15.99 ? 54  GLY A O   1 
ATOM   280  N  N   . ALA A 1 55  ? 12.572 -14.860 -4.675  1.00 12.12 ? 55  ALA A N   1 
ATOM   281  C  CA  . ALA A 1 55  ? 12.117 -15.602 -5.854  1.00 12.49 ? 55  ALA A CA  1 
ATOM   282  C  C   . ALA A 1 55  ? 10.878 -16.395 -5.498  1.00 15.92 ? 55  ALA A C   1 
ATOM   283  O  O   . ALA A 1 55  ? 10.772 -16.906 -4.383  1.00 15.67 ? 55  ALA A O   1 
ATOM   284  C  CB  . ALA A 1 55  ? 13.205 -16.529 -6.373  1.00 14.98 ? 55  ALA A CB  1 
ATOM   285  N  N   . ASP A 1 56  ? 9.941  -16.477 -6.438  1.00 12.22 ? 56  ASP A N   1 
ATOM   286  C  CA  . ASP A 1 56  ? 8.785  -17.347 -6.296  1.00 12.60 ? 56  ASP A CA  1 
ATOM   287  C  C   . ASP A 1 56  ? 9.151  -18.695 -6.891  1.00 15.21 ? 56  ASP A C   1 
ATOM   288  O  O   . ASP A 1 56  ? 9.182  -18.855 -8.112  1.00 16.33 ? 56  ASP A O   1 
ATOM   289  C  CB  . ASP A 1 56  ? 7.565  -16.755 -7.005  1.00 13.62 ? 56  ASP A CB  1 
ATOM   290  C  CG  . ASP A 1 56  ? 6.300  -17.584 -6.803  1.00 19.27 ? 56  ASP A CG  1 
ATOM   291  O  OD1 . ASP A 1 56  ? 6.366  -18.687 -6.215  1.00 15.63 ? 56  ASP A OD1 1 
ATOM   292  O  OD2 . ASP A 1 56  ? 5.229  -17.120 -7.242  1.00 23.30 ? 56  ASP A OD2 1 
ATOM   293  N  N   . LEU A 1 57  ? 9.449  -19.647 -6.016  1.00 13.02 ? 57  LEU A N   1 
ATOM   294  C  CA  . LEU A 1 57  ? 9.764  -21.007 -6.412  1.00 11.97 ? 57  LEU A CA  1 
ATOM   295  C  C   . LEU A 1 57  ? 8.675  -21.947 -5.900  1.00 12.19 ? 57  LEU A C   1 
ATOM   296  O  O   . LEU A 1 57  ? 8.947  -23.102 -5.592  1.00 11.84 ? 57  LEU A O   1 
ATOM   297  C  CB  . LEU A 1 57  ? 11.135 -21.428 -5.863  1.00 13.85 ? 57  LEU A CB  1 
ATOM   298  C  CG  . LEU A 1 57  ? 12.341 -20.758 -6.535  1.00 18.12 ? 57  LEU A CG  1 
ATOM   299  C  CD1 . LEU A 1 57  ? 13.537 -20.655 -5.581  1.00 18.02 ? 57  LEU A CD1 1 
ATOM   300  C  CD2 . LEU A 1 57  ? 12.728 -21.518 -7.793  1.00 18.23 ? 57  LEU A CD2 1 
ATOM   301  N  N   . SER A 1 58  ? 7.446  -21.447 -5.811  1.00 14.05 ? 58  SER A N   1 
ATOM   302  C  CA  . SER A 1 58  ? 6.351  -22.277 -5.312  1.00 12.33 ? 58  SER A CA  1 
ATOM   303  C  C   . SER A 1 58  ? 6.154  -23.487 -6.231  1.00 16.23 ? 58  SER A C   1 
ATOM   304  O  O   . SER A 1 58  ? 6.228  -23.364 -7.459  1.00 13.44 ? 58  SER A O   1 
ATOM   305  C  CB  . SER A 1 58  ? 5.064  -21.447 -5.184  1.00 12.43 ? 58  SER A CB  1 
ATOM   306  O  OG  . SER A 1 58  ? 4.730  -20.788 -6.401  1.00 18.10 ? 58  SER A OG  1 
ATOM   307  N  N   . TYR A 1 59  ? 5.962  -24.658 -5.626  1.00 12.57 ? 59  TYR A N   1 
ATOM   308  C  CA  . TYR A 1 59  ? 5.745  -25.912 -6.361  1.00 13.72 ? 59  TYR A CA  1 
ATOM   309  C  C   . TYR A 1 59  ? 6.925  -26.318 -7.243  1.00 15.69 ? 59  TYR A C   1 
ATOM   310  O  O   . TYR A 1 59  ? 6.776  -27.183 -8.109  1.00 15.75 ? 59  TYR A O   1 
ATOM   311  C  CB  . TYR A 1 59  ? 4.471  -25.818 -7.226  1.00 13.40 ? 59  TYR A CB  1 
ATOM   312  C  CG  . TYR A 1 59  ? 3.245  -25.491 -6.401  1.00 13.33 ? 59  TYR A CG  1 
ATOM   313  C  CD1 . TYR A 1 59  ? 2.589  -26.483 -5.686  1.00 13.29 ? 59  TYR A CD1 1 
ATOM   314  C  CD2 . TYR A 1 59  ? 2.766  -24.189 -6.314  1.00 18.07 ? 59  TYR A CD2 1 
ATOM   315  C  CE1 . TYR A 1 59  ? 1.475  -26.192 -4.921  1.00 15.86 ? 59  TYR A CE1 1 
ATOM   316  C  CE2 . TYR A 1 59  ? 1.656  -23.884 -5.536  1.00 19.48 ? 59  TYR A CE2 1 
ATOM   317  C  CZ  . TYR A 1 59  ? 1.021  -24.887 -4.842  1.00 16.76 ? 59  TYR A CZ  1 
ATOM   318  O  OH  . TYR A 1 59  ? -0.083 -24.594 -4.070  1.00 17.78 ? 59  TYR A OH  1 
ATOM   319  N  N   . ALA A 1 60  ? 8.094  -25.712 -7.038  1.00 14.46 ? 60  ALA A N   1 
ATOM   320  C  CA  . ALA A 1 60  ? 9.247  -26.067 -7.873  1.00 16.07 ? 60  ALA A CA  1 
ATOM   321  C  C   . ALA A 1 60  ? 9.758  -27.441 -7.493  1.00 16.63 ? 60  ALA A C   1 
ATOM   322  O  O   . ALA A 1 60  ? 9.563  -27.891 -6.361  1.00 16.60 ? 60  ALA A O   1 
ATOM   323  C  CB  . ALA A 1 60  ? 10.367 -25.031 -7.741  1.00 16.42 ? 60  ALA A CB  1 
ATOM   324  N  N   . ASN A 1 61  ? 10.407 -28.110 -8.441  1.00 14.19 ? 61  ASN A N   1 
ATOM   325  C  CA  . ASN A 1 61  ? 11.077 -29.366 -8.139  1.00 16.07 ? 61  ASN A CA  1 
ATOM   326  C  C   . ASN A 1 61  ? 12.557 -29.115 -7.900  1.00 16.29 ? 61  ASN A C   1 
ATOM   327  O  O   . ASN A 1 61  ? 13.332 -28.919 -8.838  1.00 18.35 ? 61  ASN A O   1 
ATOM   328  C  CB  . ASN A 1 61  ? 10.878 -30.382 -9.262  1.00 19.58 ? 61  ASN A CB  1 
ATOM   329  C  CG  . ASN A 1 61  ? 11.525 -31.720 -8.952  1.00 26.84 ? 61  ASN A CG  1 
ATOM   330  O  OD1 . ASN A 1 61  ? 12.120 -31.909 -7.887  1.00 23.39 ? 61  ASN A OD1 1 
ATOM   331  N  ND2 . ASN A 1 61  ? 11.411 -32.658 -9.885  1.00 30.12 ? 61  ASN A ND2 1 
ATOM   332  N  N   . LEU A 1 62  ? 12.935 -29.128 -6.630  1.00 13.85 ? 62  LEU A N   1 
ATOM   333  C  CA  . LEU A 1 62  ? 14.324 -28.940 -6.241  1.00 15.52 ? 62  LEU A CA  1 
ATOM   334  C  C   . LEU A 1 62  ? 14.860 -30.203 -5.563  1.00 17.43 ? 62  LEU A C   1 
ATOM   335  O  O   . LEU A 1 62  ? 15.719 -30.138 -4.678  1.00 17.40 ? 62  LEU A O   1 
ATOM   336  C  CB  . LEU A 1 62  ? 14.452 -27.721 -5.321  1.00 13.49 ? 62  LEU A CB  1 
ATOM   337  C  CG  . LEU A 1 62  ? 14.398 -26.392 -6.084  1.00 14.94 ? 62  LEU A CG  1 
ATOM   338  C  CD1 . LEU A 1 62  ? 13.955 -25.246 -5.185  1.00 16.76 ? 62  LEU A CD1 1 
ATOM   339  C  CD2 . LEU A 1 62  ? 15.767 -26.092 -6.675  1.00 20.20 ? 62  LEU A CD2 1 
ATOM   340  N  N   . HIS A 1 63  ? 14.344 -31.355 -5.981  1.00 17.18 ? 63  HIS A N   1 
ATOM   341  C  CA  . HIS A 1 63  ? 14.794 -32.633 -5.433  1.00 16.23 ? 63  HIS A CA  1 
ATOM   342  C  C   . HIS A 1 63  ? 16.308 -32.796 -5.563  1.00 19.13 ? 63  HIS A C   1 
ATOM   343  O  O   . HIS A 1 63  ? 16.856 -32.678 -6.652  1.00 18.90 ? 63  HIS A O   1 
ATOM   344  C  CB  . HIS A 1 63  ? 14.086 -33.798 -6.130  1.00 18.55 ? 63  HIS A CB  1 
ATOM   345  C  CG  . HIS A 1 63  ? 14.638 -35.143 -5.767  1.00 23.50 ? 63  HIS A CG  1 
ATOM   346  N  ND1 . HIS A 1 63  ? 14.367 -35.761 -4.563  1.00 22.63 ? 63  HIS A ND1 1 
ATOM   347  C  CD2 . HIS A 1 63  ? 15.459 -35.981 -6.444  1.00 24.97 ? 63  HIS A CD2 1 
ATOM   348  C  CE1 . HIS A 1 63  ? 14.991 -36.926 -4.519  1.00 26.03 ? 63  HIS A CE1 1 
ATOM   349  N  NE2 . HIS A 1 63  ? 15.663 -37.082 -5.646  1.00 26.78 ? 63  HIS A NE2 1 
ATOM   350  N  N   . HIS A 1 64  ? 16.963 -33.064 -4.434  1.00 18.45 ? 64  HIS A N   1 
ATOM   351  C  CA  . HIS A 1 64  ? 18.408 -33.284 -4.372  1.00 20.40 ? 64  HIS A CA  1 
ATOM   352  C  C   . HIS A 1 64  ? 19.226 -32.135 -4.970  1.00 19.62 ? 64  HIS A C   1 
ATOM   353  O  O   . HIS A 1 64  ? 20.346 -32.339 -5.447  1.00 19.79 ? 64  HIS A O   1 
ATOM   354  C  CB  . HIS A 1 64  ? 18.777 -34.604 -5.064  1.00 23.01 ? 64  HIS A CB  1 
ATOM   355  C  CG  . HIS A 1 64  ? 20.104 -35.156 -4.638  1.00 30.24 ? 64  HIS A CG  1 
ATOM   356  N  ND1 . HIS A 1 64  ? 21.160 -35.315 -5.511  1.00 40.01 ? 64  HIS A ND1 1 
ATOM   357  C  CD2 . HIS A 1 64  ? 20.552 -35.568 -3.428  1.00 36.94 ? 64  HIS A CD2 1 
ATOM   358  C  CE1 . HIS A 1 64  ? 22.197 -35.815 -4.860  1.00 42.61 ? 64  HIS A CE1 1 
ATOM   359  N  NE2 . HIS A 1 64  ? 21.855 -35.976 -3.595  1.00 42.91 ? 64  HIS A NE2 1 
ATOM   360  N  N   . ALA A 1 65  ? 18.674 -30.927 -4.932  1.00 18.96 ? 65  ALA A N   1 
ATOM   361  C  CA  . ALA A 1 65  ? 19.424 -29.752 -5.360  1.00 21.33 ? 65  ALA A CA  1 
ATOM   362  C  C   . ALA A 1 65  ? 20.533 -29.458 -4.359  1.00 19.69 ? 65  ALA A C   1 
ATOM   363  O  O   . ALA A 1 65  ? 20.396 -29.777 -3.177  1.00 18.15 ? 65  ALA A O   1 
ATOM   364  C  CB  . ALA A 1 65  ? 18.504 -28.556 -5.496  1.00 16.78 ? 65  ALA A CB  1 
ATOM   365  N  N   . ASN A 1 66  ? 21.638 -28.878 -4.827  1.00 17.46 ? 66  ASN A N   1 
ATOM   366  C  CA  . ASN A 1 66  ? 22.653 -28.369 -3.912  1.00 20.11 ? 66  ASN A CA  1 
ATOM   367  C  C   . ASN A 1 66  ? 22.492 -26.862 -3.786  1.00 21.08 ? 66  ASN A C   1 
ATOM   368  O  O   . ASN A 1 66  ? 22.860 -26.093 -4.680  1.00 19.86 ? 66  ASN A O   1 
ATOM   369  C  CB  . ASN A 1 66  ? 24.073 -28.722 -4.363  1.00 23.74 ? 66  ASN A CB  1 
ATOM   370  C  CG  . ASN A 1 66  ? 25.114 -28.474 -3.267  1.00 26.61 ? 66  ASN A CG  1 
ATOM   371  O  OD1 . ASN A 1 66  ? 24.841 -27.798 -2.277  1.00 23.62 ? 66  ASN A OD1 1 
ATOM   372  N  ND2 . ASN A 1 66  ? 26.313 -29.017 -3.450  1.00 25.81 ? 66  ASN A ND2 1 
ATOM   373  N  N   . LEU A 1 67  ? 21.921 -26.462 -2.659  1.00 17.40 ? 67  LEU A N   1 
ATOM   374  C  CA  . LEU A 1 67  ? 21.669 -25.066 -2.356  1.00 17.20 ? 67  LEU A CA  1 
ATOM   375  C  C   . LEU A 1 67  ? 22.475 -24.650 -1.129  1.00 16.62 ? 67  LEU A C   1 
ATOM   376  O  O   . LEU A 1 67  ? 22.067 -23.774 -0.374  1.00 16.16 ? 67  LEU A O   1 
ATOM   377  C  CB  . LEU A 1 67  ? 20.174 -24.848 -2.119  1.00 17.24 ? 67  LEU A CB  1 
ATOM   378  C  CG  . LEU A 1 67  ? 19.288 -25.070 -3.344  1.00 20.88 ? 67  LEU A CG  1 
ATOM   379  C  CD1 . LEU A 1 67  ? 17.828 -25.232 -2.945  1.00 20.54 ? 67  LEU A CD1 1 
ATOM   380  C  CD2 . LEU A 1 67  ? 19.444 -23.888 -4.275  1.00 25.22 ? 67  LEU A CD2 1 
ATOM   381  N  N   . SER A 1 68  ? 23.622 -25.288 -0.928  1.00 15.88 ? 68  SER A N   1 
ATOM   382  C  CA  . SER A 1 68  ? 24.438 -25.024 0.254   1.00 16.92 ? 68  SER A CA  1 
ATOM   383  C  C   . SER A 1 68  ? 24.825 -23.545 0.324   1.00 19.52 ? 68  SER A C   1 
ATOM   384  O  O   . SER A 1 68  ? 25.270 -22.970 -0.671  1.00 17.45 ? 68  SER A O   1 
ATOM   385  C  CB  . SER A 1 68  ? 25.688 -25.905 0.237   1.00 26.16 ? 68  SER A CB  1 
ATOM   386  O  OG  . SER A 1 68  ? 26.525 -25.595 1.331   1.00 44.40 ? 68  SER A OG  1 
ATOM   387  N  N   . ARG A 1 69  ? 24.604 -22.934 1.486   1.00 17.19 ? 69  ARG A N   1 
ATOM   388  C  CA  . ARG A 1 69  ? 24.923 -21.523 1.736   1.00 17.60 ? 69  ARG A CA  1 
ATOM   389  C  C   . ARG A 1 69  ? 24.242 -20.547 0.762   1.00 18.62 ? 69  ARG A C   1 
ATOM   390  O  O   . ARG A 1 69  ? 24.686 -19.406 0.610   1.00 17.74 ? 69  ARG A O   1 
ATOM   391  C  CB  . ARG A 1 69  ? 26.445 -21.317 1.701   1.00 19.05 ? 69  ARG A CB  1 
ATOM   392  C  CG  . ARG A 1 69  ? 27.178 -22.142 2.755   1.00 25.09 ? 69  ARG A CG  1 
ATOM   393  C  CD  . ARG A 1 69  ? 28.630 -21.702 2.913   1.00 41.44 ? 69  ARG A CD  1 
ATOM   394  N  NE  . ARG A 1 69  ? 29.301 -22.433 3.989   1.00 57.25 ? 69  ARG A NE  1 
ATOM   395  C  CZ  . ARG A 1 69  ? 30.447 -22.058 4.553   1.00 67.50 ? 69  ARG A CZ  1 
ATOM   396  N  NH1 . ARG A 1 69  ? 31.058 -20.951 4.151   1.00 72.55 ? 69  ARG A NH1 1 
ATOM   397  N  NH2 . ARG A 1 69  ? 30.981 -22.787 5.525   1.00 66.31 ? 69  ARG A NH2 1 
ATOM   398  N  N   . ALA A 1 70  ? 23.162 -20.982 0.119   1.00 15.97 ? 70  ALA A N   1 
ATOM   399  C  CA  . ALA A 1 70  ? 22.419 -20.096 -0.770  1.00 17.26 ? 70  ALA A CA  1 
ATOM   400  C  C   . ALA A 1 70  ? 21.673 -19.045 0.038   1.00 17.15 ? 70  ALA A C   1 
ATOM   401  O  O   . ALA A 1 70  ? 21.331 -19.276 1.196   1.00 16.16 ? 70  ALA A O   1 
ATOM   402  C  CB  . ALA A 1 70  ? 21.440 -20.881 -1.630  1.00 17.67 ? 70  ALA A CB  1 
ATOM   403  N  N   . ASN A 1 71  ? 21.442 -17.885 -0.568  1.00 11.94 ? 71  ASN A N   1 
ATOM   404  C  CA  . ASN A 1 71  ? 20.589 -16.886 0.054   1.00 12.50 ? 71  ASN A CA  1 
ATOM   405  C  C   . ASN A 1 71  ? 19.204 -16.967 -0.573  1.00 13.08 ? 71  ASN A C   1 
ATOM   406  O  O   . ASN A 1 71  ? 18.986 -16.509 -1.695  1.00 13.04 ? 71  ASN A O   1 
ATOM   407  C  CB  . ASN A 1 71  ? 21.182 -15.477 -0.093  1.00 13.39 ? 71  ASN A CB  1 
ATOM   408  C  CG  . ASN A 1 71  ? 20.435 -14.451 0.730   1.00 15.65 ? 71  ASN A CG  1 
ATOM   409  O  OD1 . ASN A 1 71  ? 19.443 -14.776 1.379   1.00 13.83 ? 71  ASN A OD1 1 
ATOM   410  N  ND2 . ASN A 1 71  ? 20.905 -13.198 0.708   1.00 15.18 ? 71  ASN A ND2 1 
ATOM   411  N  N   . LEU A 1 72  ? 18.280 -17.578 0.161   1.00 10.08 ? 72  LEU A N   1 
ATOM   412  C  CA  . LEU A 1 72  ? 16.895 -17.704 -0.271  1.00 13.50 ? 72  LEU A CA  1 
ATOM   413  C  C   . LEU A 1 72  ? 15.977 -16.921 0.654   1.00 12.17 ? 72  LEU A C   1 
ATOM   414  O  O   . LEU A 1 72  ? 14.808 -17.285 0.835   1.00 11.61 ? 72  LEU A O   1 
ATOM   415  C  CB  . LEU A 1 72  ? 16.468 -19.175 -0.299  1.00 9.82  ? 72  LEU A CB  1 
ATOM   416  C  CG  . LEU A 1 72  ? 17.177 -20.014 -1.364  1.00 23.53 ? 72  LEU A CG  1 
ATOM   417  C  CD1 . LEU A 1 72  ? 17.085 -21.497 -1.039  1.00 18.13 ? 72  LEU A CD1 1 
ATOM   418  C  CD2 . LEU A 1 72  ? 16.556 -19.728 -2.714  1.00 24.39 ? 72  LEU A CD2 1 
ATOM   419  N  N   . ARG A 1 73  ? 16.502 -15.846 1.232   1.00 11.36 ? 73  ARG A N   1 
ATOM   420  C  CA  . ARG A 1 73  ? 15.706 -15.004 2.120   1.00 10.78 ? 73  ARG A CA  1 
ATOM   421  C  C   . ARG A 1 73  ? 14.426 -14.536 1.436   1.00 11.37 ? 73  ARG A C   1 
ATOM   422  O  O   . ARG A 1 73  ? 14.454 -14.053 0.298   1.00 11.73 ? 73  ARG A O   1 
ATOM   423  C  CB  . ARG A 1 73  ? 16.518 -13.791 2.585   1.00 13.34 ? 73  ARG A CB  1 
ATOM   424  C  CG  . ARG A 1 73  ? 15.778 -12.923 3.584   1.00 15.18 ? 73  ARG A CG  1 
ATOM   425  C  CD  . ARG A 1 73  ? 16.727 -11.974 4.306   1.00 22.01 ? 73  ARG A CD  1 
ATOM   426  N  NE  . ARG A 1 73  ? 16.047 -11.316 5.418   1.00 30.22 ? 73  ARG A NE  1 
ATOM   427  C  CZ  . ARG A 1 73  ? 16.664 -10.817 6.483   1.00 35.99 ? 73  ARG A CZ  1 
ATOM   428  N  NH1 . ARG A 1 73  ? 17.986 -10.901 6.593   1.00 23.53 ? 73  ARG A NH1 1 
ATOM   429  N  NH2 . ARG A 1 73  ? 15.953 -10.232 7.440   1.00 41.11 ? 73  ARG A NH2 1 
ATOM   430  N  N   . SER A 1 74  ? 13.303 -14.698 2.133   1.00 10.42 ? 74  SER A N   1 
ATOM   431  C  CA  . SER A 1 74  ? 11.992 -14.258 1.650   1.00 12.88 ? 74  SER A CA  1 
ATOM   432  C  C   . SER A 1 74  ? 11.534 -14.963 0.363   1.00 13.60 ? 74  SER A C   1 
ATOM   433  O  O   . SER A 1 74  ? 10.596 -14.502 -0.294  1.00 14.55 ? 74  SER A O   1 
ATOM   434  C  CB  . SER A 1 74  ? 11.979 -12.733 1.435   1.00 19.74 ? 74  SER A CB  1 
ATOM   435  O  OG  . SER A 1 74  ? 12.171 -12.045 2.667   1.00 19.27 ? 74  SER A OG  1 
ATOM   436  N  N   . ALA A 1 75  ? 12.161 -16.080 0.009   1.00 11.56 ? 75  ALA A N   1 
ATOM   437  C  CA  . ALA A 1 75  ? 11.707 -16.834 -1.159  1.00 10.84 ? 75  ALA A CA  1 
ATOM   438  C  C   . ALA A 1 75  ? 10.365 -17.480 -0.858  1.00 15.45 ? 75  ALA A C   1 
ATOM   439  O  O   . ALA A 1 75  ? 10.054 -17.775 0.301   1.00 14.27 ? 75  ALA A O   1 
ATOM   440  C  CB  . ALA A 1 75  ? 12.725 -17.904 -1.570  1.00 13.07 ? 75  ALA A CB  1 
ATOM   441  N  N   . ASP A 1 76  ? 9.574  -17.689 -1.903  1.00 12.80 ? 76  ASP A N   1 
ATOM   442  C  CA  . ASP A 1 76  ? 8.339  -18.461 -1.786  1.00 11.44 ? 76  ASP A CA  1 
ATOM   443  C  C   . ASP A 1 76  ? 8.647  -19.870 -2.273  1.00 14.14 ? 76  ASP A C   1 
ATOM   444  O  O   . ASP A 1 76  ? 8.905  -20.069 -3.460  1.00 15.66 ? 76  ASP A O   1 
ATOM   445  C  CB  . ASP A 1 76  ? 7.211  -17.819 -2.610  1.00 11.74 ? 76  ASP A CB  1 
ATOM   446  C  CG  . ASP A 1 76  ? 5.837  -18.393 -2.276  1.00 19.76 ? 76  ASP A CG  1 
ATOM   447  O  OD1 . ASP A 1 76  ? 5.772  -19.486 -1.677  1.00 18.19 ? 76  ASP A OD1 1 
ATOM   448  O  OD2 . ASP A 1 76  ? 4.823  -17.755 -2.624  1.00 22.64 ? 76  ASP A OD2 1 
ATOM   449  N  N   . LEU A 1 77  ? 8.645  -20.831 -1.352  1.00 10.75 ? 77  LEU A N   1 
ATOM   450  C  CA  . LEU A 1 77  ? 8.925  -22.226 -1.665  1.00 11.40 ? 77  LEU A CA  1 
ATOM   451  C  C   . LEU A 1 77  ? 7.765  -23.112 -1.232  1.00 11.51 ? 77  LEU A C   1 
ATOM   452  O  O   . LEU A 1 77  ? 7.949  -24.290 -0.919  1.00 12.96 ? 77  LEU A O   1 
ATOM   453  C  CB  . LEU A 1 77  ? 10.215 -22.681 -0.984  1.00 13.05 ? 77  LEU A CB  1 
ATOM   454  C  CG  . LEU A 1 77  ? 11.502 -22.171 -1.638  1.00 13.47 ? 77  LEU A CG  1 
ATOM   455  C  CD1 . LEU A 1 77  ? 12.637 -22.095 -0.613  1.00 12.80 ? 77  LEU A CD1 1 
ATOM   456  C  CD2 . LEU A 1 77  ? 11.879 -23.091 -2.778  1.00 15.56 ? 77  LEU A CD2 1 
ATOM   457  N  N   . ARG A 1 78  ? 6.564  -22.547 -1.239  1.00 13.63 ? 78  ARG A N   1 
ATOM   458  C  CA  . ARG A 1 78  ? 5.418  -23.276 -0.716  1.00 14.72 ? 78  ARG A CA  1 
ATOM   459  C  C   . ARG A 1 78  ? 5.183  -24.521 -1.568  1.00 13.66 ? 78  ARG A C   1 
ATOM   460  O  O   . ARG A 1 78  ? 5.256  -24.472 -2.801  1.00 15.44 ? 78  ARG A O   1 
ATOM   461  C  CB  . ARG A 1 78  ? 4.171  -22.384 -0.655  1.00 16.09 ? 78  ARG A CB  1 
ATOM   462  C  CG  . ARG A 1 78  ? 3.513  -22.050 -1.982  1.00 16.49 ? 78  ARG A CG  1 
ATOM   463  C  CD  . ARG A 1 78  ? 2.427  -20.973 -1.791  1.00 23.52 ? 78  ARG A CD  1 
ATOM   464  N  NE  . ARG A 1 78  ? 1.578  -20.822 -2.975  1.00 26.28 ? 78  ARG A NE  1 
ATOM   465  C  CZ  . ARG A 1 78  ? 1.799  -19.950 -3.957  1.00 26.82 ? 78  ARG A CZ  1 
ATOM   466  N  NH1 . ARG A 1 78  ? 2.842  -19.129 -3.901  1.00 23.17 ? 78  ARG A NH1 1 
ATOM   467  N  NH2 . ARG A 1 78  ? 0.973  -19.893 -4.996  1.00 27.68 ? 78  ARG A NH2 1 
ATOM   468  N  N   . ASN A 1 79  ? 4.967  -25.646 -0.891  1.00 12.18 ? 79  ASN A N   1 
ATOM   469  C  CA  . ASN A 1 79  ? 4.719  -26.938 -1.542  1.00 12.70 ? 79  ASN A CA  1 
ATOM   470  C  C   . ASN A 1 79  ? 5.840  -27.372 -2.488  1.00 17.94 ? 79  ASN A C   1 
ATOM   471  O  O   . ASN A 1 79  ? 5.619  -28.220 -3.360  1.00 16.60 ? 79  ASN A O   1 
ATOM   472  C  CB  . ASN A 1 79  ? 3.405  -26.909 -2.334  1.00 14.23 ? 79  ASN A CB  1 
ATOM   473  C  CG  . ASN A 1 79  ? 2.190  -27.227 -1.489  1.00 35.51 ? 79  ASN A CG  1 
ATOM   474  O  OD1 . ASN A 1 79  ? 1.818  -28.390 -1.337  1.00 39.36 ? 79  ASN A OD1 1 
ATOM   475  N  ND2 . ASN A 1 79  ? 1.548  -26.191 -0.955  1.00 40.42 ? 79  ASN A ND2 1 
ATOM   476  N  N   . ALA A 1 80  ? 7.029  -26.796 -2.337  1.00 12.71 ? 80  ALA A N   1 
ATOM   477  C  CA  . ALA A 1 80  ? 8.141  -27.169 -3.209  1.00 15.29 ? 80  ALA A CA  1 
ATOM   478  C  C   . ALA A 1 80  ? 8.646  -28.562 -2.860  1.00 17.37 ? 80  ALA A C   1 
ATOM   479  O  O   . ALA A 1 80  ? 8.503  -29.030 -1.724  1.00 17.28 ? 80  ALA A O   1 
ATOM   480  C  CB  . ALA A 1 80  ? 9.291  -26.145 -3.115  1.00 14.30 ? 80  ALA A CB  1 
ATOM   481  N  N   . ASN A 1 81  ? 9.232  -29.233 -3.844  1.00 13.14 ? 81  ASN A N   1 
ATOM   482  C  CA  . ASN A 1 81  ? 9.887  -30.506 -3.586  1.00 14.59 ? 81  ASN A CA  1 
ATOM   483  C  C   . ASN A 1 81  ? 11.343 -30.247 -3.265  1.00 14.76 ? 81  ASN A C   1 
ATOM   484  O  O   . ASN A 1 81  ? 12.136 -30.006 -4.167  1.00 17.09 ? 81  ASN A O   1 
ATOM   485  C  CB  . ASN A 1 81  ? 9.766  -31.439 -4.792  1.00 18.78 ? 81  ASN A CB  1 
ATOM   486  C  CG  . ASN A 1 81  ? 10.346 -32.813 -4.522  1.00 19.26 ? 81  ASN A CG  1 
ATOM   487  O  OD1 . ASN A 1 81  ? 10.990 -33.045 -3.492  1.00 19.53 ? 81  ASN A OD1 1 
ATOM   488  N  ND2 . ASN A 1 81  ? 10.125 -33.733 -5.451  1.00 21.22 ? 81  ASN A ND2 1 
ATOM   489  N  N   . LEU A 1 82  ? 11.686 -30.285 -1.983  1.00 14.15 ? 82  LEU A N   1 
ATOM   490  C  CA  . LEU A 1 82  ? 13.066 -30.096 -1.552  1.00 12.02 ? 82  LEU A CA  1 
ATOM   491  C  C   . LEU A 1 82  ? 13.611 -31.378 -0.918  1.00 12.94 ? 82  LEU A C   1 
ATOM   492  O  O   . LEU A 1 82  ? 14.524 -31.330 -0.087  1.00 15.09 ? 82  LEU A O   1 
ATOM   493  C  CB  . LEU A 1 82  ? 13.164 -28.930 -0.564  1.00 13.21 ? 82  LEU A CB  1 
ATOM   494  C  CG  . LEU A 1 82  ? 13.028 -27.536 -1.199  1.00 15.18 ? 82  LEU A CG  1 
ATOM   495  C  CD1 . LEU A 1 82  ? 12.520 -26.512 -0.187  1.00 19.02 ? 82  LEU A CD1 1 
ATOM   496  C  CD2 . LEU A 1 82  ? 14.358 -27.081 -1.793  1.00 16.98 ? 82  LEU A CD2 1 
ATOM   497  N  N   . SER A 1 83  ? 13.047 -32.520 -1.310  1.00 15.39 ? 83  SER A N   1 
ATOM   498  C  CA  . SER A 1 83  ? 13.431 -33.792 -0.705  1.00 15.98 ? 83  SER A CA  1 
ATOM   499  C  C   . SER A 1 83  ? 14.910 -34.071 -0.962  1.00 17.97 ? 83  SER A C   1 
ATOM   500  O  O   . SER A 1 83  ? 15.385 -33.965 -2.093  1.00 17.87 ? 83  SER A O   1 
ATOM   501  C  CB  . SER A 1 83  ? 12.554 -34.938 -1.223  1.00 18.80 ? 83  SER A CB  1 
ATOM   502  O  OG  . SER A 1 83  ? 12.566 -35.024 -2.641  1.00 24.42 ? 83  SER A OG  1 
ATOM   503  N  N   . HIS A 1 84  ? 15.631 -34.393 0.110   1.00 13.82 ? 84  HIS A N   1 
ATOM   504  C  CA  . HIS A 1 84  ? 17.072 -34.659 0.062   1.00 14.97 ? 84  HIS A CA  1 
ATOM   505  C  C   . HIS A 1 84  ? 17.898 -33.530 -0.557  1.00 15.54 ? 84  HIS A C   1 
ATOM   506  O  O   . HIS A 1 84  ? 19.004 -33.755 -1.049  1.00 19.40 ? 84  HIS A O   1 
ATOM   507  C  CB  . HIS A 1 84  ? 17.324 -35.974 -0.673  1.00 18.84 ? 84  HIS A CB  1 
ATOM   508  C  CG  . HIS A 1 84  ? 16.702 -37.148 0.012   1.00 26.04 ? 84  HIS A CG  1 
ATOM   509  N  ND1 . HIS A 1 84  ? 17.300 -37.787 1.077   1.00 31.33 ? 84  HIS A ND1 1 
ATOM   510  C  CD2 . HIS A 1 84  ? 15.515 -37.770 -0.182  1.00 28.18 ? 84  HIS A CD2 1 
ATOM   511  C  CE1 . HIS A 1 84  ? 16.517 -38.764 1.497   1.00 31.22 ? 84  HIS A CE1 1 
ATOM   512  N  NE2 . HIS A 1 84  ? 15.427 -38.774 0.751   1.00 30.96 ? 84  HIS A NE2 1 
ATOM   513  N  N   . ALA A 1 85  ? 17.381 -32.308 -0.496  1.00 13.15 ? 85  ALA A N   1 
ATOM   514  C  CA  . ALA A 1 85  ? 18.151 -31.158 -0.958  1.00 15.65 ? 85  ALA A CA  1 
ATOM   515  C  C   . ALA A 1 85  ? 19.207 -30.792 0.068   1.00 17.23 ? 85  ALA A C   1 
ATOM   516  O  O   . ALA A 1 85  ? 19.010 -30.992 1.265   1.00 17.25 ? 85  ALA A O   1 
ATOM   517  C  CB  . ALA A 1 85  ? 17.237 -29.971 -1.222  1.00 15.65 ? 85  ALA A CB  1 
ATOM   518  N  N   . ASN A 1 86  ? 20.334 -30.268 -0.401  1.00 14.74 ? 86  ASN A N   1 
ATOM   519  C  CA  . ASN A 1 86  ? 21.353 -29.750 0.498   1.00 15.89 ? 86  ASN A CA  1 
ATOM   520  C  C   . ASN A 1 86  ? 21.117 -28.265 0.704   1.00 17.03 ? 86  ASN A C   1 
ATOM   521  O  O   . ASN A 1 86  ? 21.332 -27.458 -0.202  1.00 15.77 ? 86  ASN A O   1 
ATOM   522  C  CB  . ASN A 1 86  ? 22.758 -30.001 -0.057  1.00 17.08 ? 86  ASN A CB  1 
ATOM   523  C  CG  . ASN A 1 86  ? 23.846 -29.683 0.950   1.00 21.56 ? 86  ASN A CG  1 
ATOM   524  O  OD1 . ASN A 1 86  ? 23.590 -29.088 1.999   1.00 17.24 ? 86  ASN A OD1 1 
ATOM   525  N  ND2 . ASN A 1 86  ? 25.072 -30.073 0.631   1.00 22.57 ? 86  ASN A ND2 1 
ATOM   526  N  N   . LEU A 1 87  ? 20.658 -27.918 1.901   1.00 14.81 ? 87  LEU A N   1 
ATOM   527  C  CA  . LEU A 1 87  ? 20.393 -26.539 2.268   1.00 13.04 ? 87  LEU A CA  1 
ATOM   528  C  C   . LEU A 1 87  ? 21.278 -26.130 3.440   1.00 15.00 ? 87  LEU A C   1 
ATOM   529  O  O   . LEU A 1 87  ? 20.933 -25.237 4.209   1.00 13.53 ? 87  LEU A O   1 
ATOM   530  C  CB  . LEU A 1 87  ? 18.916 -26.360 2.627   1.00 13.80 ? 87  LEU A CB  1 
ATOM   531  C  CG  . LEU A 1 87  ? 17.980 -26.370 1.416   1.00 19.24 ? 87  LEU A CG  1 
ATOM   532  C  CD1 . LEU A 1 87  ? 16.559 -26.770 1.807   1.00 19.15 ? 87  LEU A CD1 1 
ATOM   533  C  CD2 . LEU A 1 87  ? 17.984 -24.991 0.776   1.00 20.58 ? 87  LEU A CD2 1 
ATOM   534  N  N   . SER A 1 88  ? 22.423 -26.786 3.583   1.00 14.99 ? 88  SER A N   1 
ATOM   535  C  CA  . SER A 1 88  ? 23.267 -26.528 4.741   1.00 15.69 ? 88  SER A CA  1 
ATOM   536  C  C   . SER A 1 88  ? 23.715 -25.068 4.749   1.00 16.12 ? 88  SER A C   1 
ATOM   537  O  O   . SER A 1 88  ? 24.217 -24.558 3.751   1.00 15.55 ? 88  SER A O   1 
ATOM   538  C  CB  . SER A 1 88  ? 24.476 -27.471 4.760   1.00 20.74 ? 88  SER A CB  1 
ATOM   539  O  OG  . SER A 1 88  ? 25.191 -27.420 3.549   1.00 29.25 ? 88  SER A OG  1 
ATOM   540  N  N   . GLY A 1 89  ? 23.492 -24.391 5.873   1.00 12.79 ? 89  GLY A N   1 
ATOM   541  C  CA  . GLY A 1 89  ? 23.919 -23.012 6.023   1.00 13.51 ? 89  GLY A CA  1 
ATOM   542  C  C   . GLY A 1 89  ? 23.148 -22.026 5.167   1.00 11.20 ? 89  GLY A C   1 
ATOM   543  O  O   . GLY A 1 89  ? 23.514 -20.848 5.099   1.00 12.83 ? 89  GLY A O   1 
ATOM   544  N  N   . ALA A 1 90  ? 22.077 -22.483 4.525   1.00 12.09 ? 90  ALA A N   1 
ATOM   545  C  CA  . ALA A 1 90  ? 21.325 -21.612 3.630   1.00 13.95 ? 90  ALA A CA  1 
ATOM   546  C  C   . ALA A 1 90  ? 20.537 -20.581 4.426   1.00 14.38 ? 90  ALA A C   1 
ATOM   547  O  O   . ALA A 1 90  ? 20.111 -20.841 5.554   1.00 14.30 ? 90  ALA A O   1 
ATOM   548  C  CB  . ALA A 1 90  ? 20.386 -22.427 2.742   1.00 14.48 ? 90  ALA A CB  1 
ATOM   549  N  N   . ASN A 1 91  ? 20.348 -19.405 3.844   1.00 12.44 ? 91  ASN A N   1 
ATOM   550  C  CA  . ASN A 1 91  ? 19.458 -18.429 4.453   1.00 9.97  ? 91  ASN A CA  1 
ATOM   551  C  C   . ASN A 1 91  ? 18.033 -18.608 3.951   1.00 12.09 ? 91  ASN A C   1 
ATOM   552  O  O   . ASN A 1 91  ? 17.764 -18.466 2.761   1.00 12.49 ? 91  ASN A O   1 
ATOM   553  C  CB  . ASN A 1 91  ? 19.920 -16.998 4.166   1.00 11.65 ? 91  ASN A CB  1 
ATOM   554  C  CG  . ASN A 1 91  ? 19.184 -15.988 5.018   1.00 13.37 ? 91  ASN A CG  1 
ATOM   555  O  OD1 . ASN A 1 91  ? 17.963 -15.822 4.889   1.00 12.73 ? 91  ASN A OD1 1 
ATOM   556  N  ND2 . ASN A 1 91  ? 19.912 -15.319 5.908   1.00 15.83 ? 91  ASN A ND2 1 
ATOM   557  N  N   . LEU A 1 92  ? 17.125 -18.903 4.870   1.00 10.70 ? 92  LEU A N   1 
ATOM   558  C  CA  . LEU A 1 92  ? 15.715 -19.055 4.535   1.00 9.54  ? 92  LEU A CA  1 
ATOM   559  C  C   . LEU A 1 92  ? 14.875 -18.164 5.438   1.00 10.82 ? 92  LEU A C   1 
ATOM   560  O  O   . LEU A 1 92  ? 13.729 -18.492 5.763   1.00 12.65 ? 92  LEU A O   1 
ATOM   561  C  CB  . LEU A 1 92  ? 15.295 -20.522 4.665   1.00 9.96  ? 92  LEU A CB  1 
ATOM   562  C  CG  . LEU A 1 92  ? 15.787 -21.405 3.514   1.00 13.65 ? 92  LEU A CG  1 
ATOM   563  C  CD1 . LEU A 1 92  ? 15.924 -22.851 3.971   1.00 15.31 ? 92  LEU A CD1 1 
ATOM   564  C  CD2 . LEU A 1 92  ? 14.840 -21.310 2.324   1.00 16.38 ? 92  LEU A CD2 1 
ATOM   565  N  N   . GLU A 1 93  ? 15.451 -17.041 5.861   1.00 10.14 ? 93  GLU A N   1 
ATOM   566  C  CA  . GLU A 1 93  ? 14.735 -16.134 6.759   1.00 9.33  ? 93  GLU A CA  1 
ATOM   567  C  C   . GLU A 1 93  ? 13.460 -15.641 6.105   1.00 13.38 ? 93  GLU A C   1 
ATOM   568  O  O   . GLU A 1 93  ? 13.483 -15.172 4.968   1.00 12.08 ? 93  GLU A O   1 
ATOM   569  C  CB  . GLU A 1 93  ? 15.583 -14.927 7.145   1.00 14.26 ? 93  GLU A CB  1 
ATOM   570  C  CG  . GLU A 1 93  ? 16.858 -15.253 7.879   1.00 20.26 ? 93  GLU A CG  1 
ATOM   571  C  CD  . GLU A 1 93  ? 17.534 -13.988 8.375   1.00 23.66 ? 93  GLU A CD  1 
ATOM   572  O  OE1 . GLU A 1 93  ? 18.637 -13.652 7.879   1.00 23.58 ? 93  GLU A OE1 1 
ATOM   573  O  OE2 . GLU A 1 93  ? 16.938 -13.327 9.251   1.00 17.77 ? 93  GLU A OE2 1 
ATOM   574  N  N   . GLU A 1 94  ? 12.359 -15.762 6.845   1.00 10.09 ? 94  GLU A N   1 
ATOM   575  C  CA  . GLU A 1 94  ? 11.031 -15.352 6.387   1.00 11.42 ? 94  GLU A CA  1 
ATOM   576  C  C   . GLU A 1 94  ? 10.630 -16.003 5.063   1.00 14.37 ? 94  GLU A C   1 
ATOM   577  O  O   . GLU A 1 94  ? 9.762  -15.495 4.352   1.00 14.90 ? 94  GLU A O   1 
ATOM   578  C  CB  . GLU A 1 94  ? 10.964 -13.822 6.297   1.00 16.81 ? 94  GLU A CB  1 
ATOM   579  C  CG  . GLU A 1 94  ? 11.085 -13.194 7.690   1.00 26.79 ? 94  GLU A CG  1 
ATOM   580  C  CD  . GLU A 1 94  ? 11.044 -11.684 7.690   1.00 47.37 ? 94  GLU A CD  1 
ATOM   581  O  OE1 . GLU A 1 94  ? 11.162 -11.080 6.605   1.00 54.11 ? 94  GLU A OE1 1 
ATOM   582  O  OE2 . GLU A 1 94  ? 10.888 -11.100 8.785   1.00 51.19 ? 94  GLU A OE2 1 
ATOM   583  N  N   . ALA A 1 95  ? 11.233 -17.145 4.746   1.00 11.44 ? 95  ALA A N   1 
ATOM   584  C  CA  . ALA A 1 95  ? 10.840 -17.878 3.538   1.00 11.81 ? 95  ALA A CA  1 
ATOM   585  C  C   . ALA A 1 95  ? 9.510  -18.579 3.767   1.00 13.81 ? 95  ALA A C   1 
ATOM   586  O  O   . ALA A 1 95  ? 9.187  -18.960 4.890   1.00 13.86 ? 95  ALA A O   1 
ATOM   587  C  CB  . ALA A 1 95  ? 11.907 -18.893 3.145   1.00 12.54 ? 95  ALA A CB  1 
ATOM   588  N  N   . ASN A 1 96  ? 8.730  -18.746 2.704   1.00 11.78 ? 96  ASN A N   1 
ATOM   589  C  CA  . ASN A 1 96  ? 7.506  -19.527 2.811   1.00 11.52 ? 96  ASN A CA  1 
ATOM   590  C  C   . ASN A 1 96  ? 7.814  -20.957 2.395   1.00 13.43 ? 96  ASN A C   1 
ATOM   591  O  O   . ASN A 1 96  ? 8.032  -21.234 1.217   1.00 14.39 ? 96  ASN A O   1 
ATOM   592  C  CB  . ASN A 1 96  ? 6.396  -18.932 1.944   1.00 12.08 ? 96  ASN A CB  1 
ATOM   593  C  CG  . ASN A 1 96  ? 5.068  -19.643 2.131   1.00 15.87 ? 96  ASN A CG  1 
ATOM   594  O  OD1 . ASN A 1 96  ? 4.963  -20.565 2.935   1.00 19.88 ? 96  ASN A OD1 1 
ATOM   595  N  ND2 . ASN A 1 96  ? 4.048  -19.216 1.391   1.00 17.84 ? 96  ASN A ND2 1 
ATOM   596  N  N   . LEU A 1 97  ? 7.837  -21.859 3.369   1.00 10.43 ? 97  LEU A N   1 
ATOM   597  C  CA  . LEU A 1 97  ? 8.041  -23.274 3.106   1.00 11.46 ? 97  LEU A CA  1 
ATOM   598  C  C   . LEU A 1 97  ? 6.815  -24.100 3.510   1.00 11.34 ? 97  LEU A C   1 
ATOM   599  O  O   . LEU A 1 97  ? 6.933  -25.290 3.822   1.00 12.00 ? 97  LEU A O   1 
ATOM   600  C  CB  . LEU A 1 97  ? 9.289  -23.772 3.852   1.00 11.14 ? 97  LEU A CB  1 
ATOM   601  C  CG  . LEU A 1 97  ? 10.609 -23.199 3.324   1.00 12.86 ? 97  LEU A CG  1 
ATOM   602  C  CD1 . LEU A 1 97  ? 11.642 -23.073 4.443   1.00 15.70 ? 97  LEU A CD1 1 
ATOM   603  C  CD2 . LEU A 1 97  ? 11.150 -24.093 2.223   1.00 15.28 ? 97  LEU A CD2 1 
ATOM   604  N  N   . GLU A 1 98  ? 5.635  -23.489 3.489   1.00 11.14 ? 98  GLU A N   1 
ATOM   605  C  CA  . GLU A 1 98  ? 4.456  -24.203 3.974   1.00 14.70 ? 98  GLU A CA  1 
ATOM   606  C  C   . GLU A 1 98  ? 4.199  -25.419 3.091   1.00 13.25 ? 98  GLU A C   1 
ATOM   607  O  O   . GLU A 1 98  ? 4.280  -25.339 1.860   1.00 14.10 ? 98  GLU A O   1 
ATOM   608  C  CB  . GLU A 1 98  ? 3.224  -23.289 4.045   1.00 17.32 ? 98  GLU A CB  1 
ATOM   609  C  CG  . GLU A 1 98  ? 2.764  -22.704 2.742   1.00 22.51 ? 98  GLU A CG  1 
ATOM   610  C  CD  . GLU A 1 98  ? 1.564  -21.779 2.926   1.00 34.65 ? 98  GLU A CD  1 
ATOM   611  O  OE1 . GLU A 1 98  ? 0.792  -22.002 3.887   1.00 23.00 ? 98  GLU A OE1 1 
ATOM   612  O  OE2 . GLU A 1 98  ? 1.405  -20.826 2.123   1.00 36.76 ? 98  GLU A OE2 1 
ATOM   613  N  N   . ALA A 1 99  ? 3.963  -26.552 3.747   1.00 11.73 ? 99  ALA A N   1 
ATOM   614  C  CA  . ALA A 1 99  ? 3.646  -27.823 3.087   1.00 12.23 ? 99  ALA A CA  1 
ATOM   615  C  C   . ALA A 1 99  ? 4.760  -28.303 2.156   1.00 15.62 ? 99  ALA A C   1 
ATOM   616  O  O   . ALA A 1 99  ? 4.537  -29.167 1.298   1.00 15.47 ? 99  ALA A O   1 
ATOM   617  C  CB  . ALA A 1 99  ? 2.314  -27.712 2.316   1.00 13.01 ? 99  ALA A CB  1 
ATOM   618  N  N   . ALA A 1 100 ? 5.955  -27.751 2.317   1.00 12.57 ? 100 ALA A N   1 
ATOM   619  C  CA  . ALA A 1 100 ? 7.077  -28.158 1.484   1.00 15.24 ? 100 ALA A CA  1 
ATOM   620  C  C   . ALA A 1 100 ? 7.500  -29.580 1.835   1.00 18.33 ? 100 ALA A C   1 
ATOM   621  O  O   . ALA A 1 100 ? 7.315  -30.043 2.966   1.00 17.35 ? 100 ALA A O   1 
ATOM   622  C  CB  . ALA A 1 100 ? 8.257  -27.185 1.646   1.00 14.55 ? 100 ALA A CB  1 
ATOM   623  N  N   . ASN A 1 101 ? 8.047  -30.283 0.849   1.00 14.41 ? 101 ASN A N   1 
ATOM   624  C  CA  . ASN A 1 101 ? 8.600  -31.605 1.078   1.00 13.78 ? 101 ASN A CA  1 
ATOM   625  C  C   . ASN A 1 101 ? 10.089 -31.470 1.339   1.00 17.44 ? 101 ASN A C   1 
ATOM   626  O  O   . ASN A 1 101 ? 10.867 -31.240 0.408   1.00 15.87 ? 101 ASN A O   1 
ATOM   627  C  CB  . ASN A 1 101 ? 8.326  -32.513 -0.128  1.00 14.35 ? 101 ASN A CB  1 
ATOM   628  C  CG  . ASN A 1 101 ? 8.935  -33.893 0.025   1.00 17.41 ? 101 ASN A CG  1 
ATOM   629  O  OD1 . ASN A 1 101 ? 9.425  -34.259 1.097   1.00 18.51 ? 101 ASN A OD1 1 
ATOM   630  N  ND2 . ASN A 1 101 ? 8.894  -34.673 -1.049  1.00 16.78 ? 101 ASN A ND2 1 
ATOM   631  N  N   . LEU A 1 102 ? 10.478 -31.590 2.608   1.00 13.55 ? 102 LEU A N   1 
ATOM   632  C  CA  . LEU A 1 102 ? 11.874 -31.457 3.002   1.00 11.64 ? 102 LEU A CA  1 
ATOM   633  C  C   . LEU A 1 102 ? 12.391 -32.753 3.607   1.00 12.41 ? 102 LEU A C   1 
ATOM   634  O  O   . LEU A 1 102 ? 13.334 -32.739 4.399   1.00 13.86 ? 102 LEU A O   1 
ATOM   635  C  CB  . LEU A 1 102 ? 12.052 -30.310 4.008   1.00 12.53 ? 102 LEU A CB  1 
ATOM   636  C  CG  . LEU A 1 102 ? 11.943 -28.908 3.404   1.00 15.25 ? 102 LEU A CG  1 
ATOM   637  C  CD1 . LEU A 1 102 ? 11.334 -27.950 4.421   1.00 16.47 ? 102 LEU A CD1 1 
ATOM   638  C  CD2 . LEU A 1 102 ? 13.327 -28.427 2.989   1.00 16.31 ? 102 LEU A CD2 1 
ATOM   639  N  N   . ARG A 1 103 ? 11.785 -33.871 3.224   1.00 12.82 ? 103 ARG A N   1 
ATOM   640  C  CA  . ARG A 1 103 ? 12.178 -35.147 3.815   1.00 15.11 ? 103 ARG A CA  1 
ATOM   641  C  C   . ARG A 1 103 ? 13.660 -35.409 3.534   1.00 16.21 ? 103 ARG A C   1 
ATOM   642  O  O   . ARG A 1 103 ? 14.132 -35.247 2.409   1.00 17.33 ? 103 ARG A O   1 
ATOM   643  C  CB  . ARG A 1 103 ? 11.301 -36.290 3.289   1.00 19.55 ? 103 ARG A CB  1 
ATOM   644  C  CG  . ARG A 1 103 ? 11.553 -36.684 1.845   1.00 30.57 ? 103 ARG A CG  1 
ATOM   645  C  CD  . ARG A 1 103 ? 10.556 -37.736 1.369   1.00 37.88 ? 103 ARG A CD  1 
ATOM   646  N  NE  . ARG A 1 103 ? 9.212  -37.185 1.206   1.00 34.83 ? 103 ARG A NE  1 
ATOM   647  C  CZ  . ARG A 1 103 ? 8.143  -37.912 0.903   1.00 42.92 ? 103 ARG A CZ  1 
ATOM   648  N  NH1 . ARG A 1 103 ? 8.259  -39.223 0.734   1.00 46.27 ? 103 ARG A NH1 1 
ATOM   649  N  NH2 . ARG A 1 103 ? 6.958  -37.332 0.772   1.00 45.77 ? 103 ARG A NH2 1 
ATOM   650  N  N   . GLY A 1 104 ? 14.397 -35.768 4.582   1.00 15.10 ? 104 GLY A N   1 
ATOM   651  C  CA  . GLY A 1 104 ? 15.817 -36.032 4.460   1.00 15.59 ? 104 GLY A CA  1 
ATOM   652  C  C   . GLY A 1 104 ? 16.681 -34.875 3.980   1.00 16.33 ? 104 GLY A C   1 
ATOM   653  O  O   . GLY A 1 104 ? 17.842 -35.089 3.631   1.00 17.87 ? 104 GLY A O   1 
ATOM   654  N  N   . ALA A 1 105 ? 16.151 -33.654 3.971   1.00 14.22 ? 105 ALA A N   1 
ATOM   655  C  CA  . ALA A 1 105 ? 16.960 -32.511 3.548   1.00 15.97 ? 105 ALA A CA  1 
ATOM   656  C  C   . ALA A 1 105 ? 18.037 -32.189 4.583   1.00 18.50 ? 105 ALA A C   1 
ATOM   657  O  O   . ALA A 1 105 ? 17.884 -32.481 5.771   1.00 17.60 ? 105 ALA A O   1 
ATOM   658  C  CB  . ALA A 1 105 ? 16.084 -31.285 3.296   1.00 15.59 ? 105 ALA A CB  1 
ATOM   659  N  N   . ASP A 1 106 ? 19.134 -31.599 4.122   1.00 15.13 ? 106 ASP A N   1 
ATOM   660  C  CA  . ASP A 1 106 ? 20.210 -31.177 5.012   1.00 13.71 ? 106 ASP A CA  1 
ATOM   661  C  C   . ASP A 1 106 ? 20.044 -29.689 5.276   1.00 14.23 ? 106 ASP A C   1 
ATOM   662  O  O   . ASP A 1 106 ? 20.313 -28.870 4.395   1.00 15.51 ? 106 ASP A O   1 
ATOM   663  C  CB  . ASP A 1 106 ? 21.591 -31.469 4.400   1.00 15.10 ? 106 ASP A CB  1 
ATOM   664  C  CG  . ASP A 1 106 ? 22.732 -31.209 5.374   1.00 20.28 ? 106 ASP A CG  1 
ATOM   665  O  OD1 . ASP A 1 106 ? 22.473 -30.616 6.441   1.00 18.05 ? 106 ASP A OD1 1 
ATOM   666  O  OD2 . ASP A 1 106 ? 23.891 -31.588 5.074   1.00 18.69 ? 106 ASP A OD2 1 
ATOM   667  N  N   . LEU A 1 107 ? 19.584 -29.340 6.471   1.00 11.06 ? 107 LEU A N   1 
ATOM   668  C  CA  . LEU A 1 107 ? 19.423 -27.936 6.838   1.00 10.74 ? 107 LEU A CA  1 
ATOM   669  C  C   . LEU A 1 107 ? 20.333 -27.545 7.986   1.00 12.09 ? 107 LEU A C   1 
ATOM   670  O  O   . LEU A 1 107 ? 20.052 -26.576 8.692   1.00 13.01 ? 107 LEU A O   1 
ATOM   671  C  CB  . LEU A 1 107 ? 17.969 -27.643 7.224   1.00 9.93  ? 107 LEU A CB  1 
ATOM   672  C  CG  . LEU A 1 107 ? 16.977 -27.645 6.054   1.00 17.16 ? 107 LEU A CG  1 
ATOM   673  C  CD1 . LEU A 1 107 ? 15.644 -28.239 6.470   1.00 26.23 ? 107 LEU A CD1 1 
ATOM   674  C  CD2 . LEU A 1 107 ? 16.790 -26.229 5.525   1.00 21.65 ? 107 LEU A CD2 1 
ATOM   675  N  N   . HIS A 1 108 ? 21.419 -28.283 8.197   1.00 12.15 ? 108 HIS A N   1 
ATOM   676  C  CA  . HIS A 1 108 ? 22.236 -27.988 9.365   1.00 12.19 ? 108 HIS A CA  1 
ATOM   677  C  C   . HIS A 1 108 ? 22.854 -26.588 9.226   1.00 15.28 ? 108 HIS A C   1 
ATOM   678  O  O   . HIS A 1 108 ? 23.268 -26.174 8.136   1.00 15.60 ? 108 HIS A O   1 
ATOM   679  C  CB  . HIS A 1 108 ? 23.294 -29.084 9.591   1.00 12.54 ? 108 HIS A CB  1 
ATOM   680  C  CG  . HIS A 1 108 ? 24.550 -28.925 8.788   1.00 18.06 ? 108 HIS A CG  1 
ATOM   681  N  ND1 . HIS A 1 108 ? 24.714 -29.487 7.540   1.00 21.23 ? 108 HIS A ND1 1 
ATOM   682  C  CD2 . HIS A 1 108 ? 25.734 -28.342 9.098   1.00 20.20 ? 108 HIS A CD2 1 
ATOM   683  C  CE1 . HIS A 1 108 ? 25.931 -29.220 7.096   1.00 24.37 ? 108 HIS A CE1 1 
ATOM   684  N  NE2 . HIS A 1 108 ? 26.567 -28.522 8.020   1.00 23.08 ? 108 HIS A NE2 1 
ATOM   685  N  N   . GLU A 1 109 ? 22.829 -25.850 10.335  1.00 12.62 ? 109 GLU A N   1 
ATOM   686  C  CA  . GLU A 1 109 ? 23.271 -24.452 10.416  1.00 12.37 ? 109 GLU A CA  1 
ATOM   687  C  C   . GLU A 1 109 ? 22.526 -23.462 9.517   1.00 12.27 ? 109 GLU A C   1 
ATOM   688  O  O   . GLU A 1 109 ? 22.985 -22.333 9.357   1.00 12.93 ? 109 GLU A O   1 
ATOM   689  C  CB  . GLU A 1 109 ? 24.774 -24.359 10.127  1.00 16.19 ? 109 GLU A CB  1 
ATOM   690  C  CG  . GLU A 1 109 ? 25.621 -24.833 11.313  1.00 21.86 ? 109 GLU A CG  1 
ATOM   691  C  CD  . GLU A 1 109 ? 27.050 -25.158 10.932  1.00 36.82 ? 109 GLU A CD  1 
ATOM   692  O  OE1 . GLU A 1 109 ? 27.560 -24.575 9.954   1.00 38.95 ? 109 GLU A OE1 1 
ATOM   693  O  OE2 . GLU A 1 109 ? 27.664 -26.003 11.617  1.00 44.72 ? 109 GLU A OE2 1 
ATOM   694  N  N   . ALA A 1 110 ? 21.374 -23.848 8.971   1.00 10.87 ? 110 ALA A N   1 
ATOM   695  C  CA  . ALA A 1 110 ? 20.583 -22.926 8.155   1.00 11.66 ? 110 ALA A CA  1 
ATOM   696  C  C   . ALA A 1 110 ? 19.916 -21.877 9.026   1.00 15.11 ? 110 ALA A C   1 
ATOM   697  O  O   . ALA A 1 110 ? 19.620 -22.131 10.192  1.00 13.61 ? 110 ALA A O   1 
ATOM   698  C  CB  . ALA A 1 110 ? 19.521 -23.684 7.343   1.00 11.90 ? 110 ALA A CB  1 
ATOM   699  N  N   . ASN A 1 111 ? 19.679 -20.700 8.457   1.00 10.84 ? 111 ASN A N   1 
ATOM   700  C  CA  . ASN A 1 111 ? 18.901 -19.678 9.146   1.00 9.54  ? 111 ASN A CA  1 
ATOM   701  C  C   . ASN A 1 111 ? 17.478 -19.683 8.630   1.00 12.25 ? 111 ASN A C   1 
ATOM   702  O  O   . ASN A 1 111 ? 17.203 -19.179 7.536   1.00 11.78 ? 111 ASN A O   1 
ATOM   703  C  CB  . ASN A 1 111 ? 19.522 -18.284 8.973   1.00 10.92 ? 111 ASN A CB  1 
ATOM   704  C  CG  . ASN A 1 111 ? 18.842 -17.242 9.844   1.00 17.12 ? 111 ASN A CG  1 
ATOM   705  O  OD1 . ASN A 1 111 ? 17.855 -17.544 10.514  1.00 13.88 ? 111 ASN A OD1 1 
ATOM   706  N  ND2 . ASN A 1 111 ? 19.375 -16.019 9.861   1.00 14.27 ? 111 ASN A ND2 1 
ATOM   707  N  N   . LEU A 1 112 ? 16.584 -20.273 9.416   1.00 8.68  ? 112 LEU A N   1 
ATOM   708  C  CA  . LEU A 1 112 ? 15.161 -20.313 9.079   1.00 8.99  ? 112 LEU A CA  1 
ATOM   709  C  C   . LEU A 1 112 ? 14.352 -19.382 9.972   1.00 9.23  ? 112 LEU A C   1 
ATOM   710  O  O   . LEU A 1 112 ? 13.153 -19.606 10.168  1.00 9.75  ? 112 LEU A O   1 
ATOM   711  C  CB  . LEU A 1 112 ? 14.620 -21.741 9.213   1.00 10.45 ? 112 LEU A CB  1 
ATOM   712  C  CG  . LEU A 1 112 ? 15.262 -22.764 8.274   1.00 15.51 ? 112 LEU A CG  1 
ATOM   713  C  CD1 . LEU A 1 112 ? 16.024 -23.806 9.061   1.00 19.36 ? 112 LEU A CD1 1 
ATOM   714  C  CD2 . LEU A 1 112 ? 14.220 -23.421 7.389   1.00 17.41 ? 112 LEU A CD2 1 
ATOM   715  N  N   . SER A 1 113 ? 15.002 -18.352 10.519  1.00 9.25  ? 113 SER A N   1 
ATOM   716  C  CA  . SER A 1 113 ? 14.325 -17.383 11.405  1.00 10.74 ? 113 SER A CA  1 
ATOM   717  C  C   . SER A 1 113 ? 13.076 -16.797 10.761  1.00 13.38 ? 113 SER A C   1 
ATOM   718  O  O   . SER A 1 113 ? 13.140 -16.247 9.655   1.00 12.99 ? 113 SER A O   1 
ATOM   719  C  CB  . SER A 1 113 ? 15.265 -16.221 11.778  1.00 16.13 ? 113 SER A CB  1 
ATOM   720  O  OG  . SER A 1 113 ? 16.309 -16.668 12.614  1.00 32.28 ? 113 SER A OG  1 
ATOM   721  N  N   . GLY A 1 114 ? 11.942 -16.912 11.450  1.00 11.45 ? 114 GLY A N   1 
ATOM   722  C  CA  . GLY A 1 114 ? 10.706 -16.334 10.948  1.00 13.06 ? 114 GLY A CA  1 
ATOM   723  C  C   . GLY A 1 114 ? 10.105 -17.009 9.726   1.00 12.68 ? 114 GLY A C   1 
ATOM   724  O  O   . GLY A 1 114 ? 9.121  -16.509 9.170   1.00 14.14 ? 114 GLY A O   1 
ATOM   725  N  N   . ALA A 1 115 ? 10.677 -18.136 9.311   1.00 11.28 ? 115 ALA A N   1 
ATOM   726  C  CA  . ALA A 1 115 ? 10.147 -18.867 8.160   1.00 10.21 ? 115 ALA A CA  1 
ATOM   727  C  C   . ALA A 1 115 ? 8.792  -19.485 8.475   1.00 15.46 ? 115 ALA A C   1 
ATOM   728  O  O   . ALA A 1 115 ? 8.477  -19.761 9.629   1.00 15.70 ? 115 ALA A O   1 
ATOM   729  C  CB  . ALA A 1 115 ? 11.128 -19.957 7.703   1.00 11.23 ? 115 ALA A CB  1 
ATOM   730  N  N   . ASP A 1 116 ? 8.000  -19.702 7.433   1.00 10.23 ? 116 ASP A N   1 
ATOM   731  C  CA  . ASP A 1 116 ? 6.715  -20.376 7.566   1.00 10.04 ? 116 ASP A CA  1 
ATOM   732  C  C   . ASP A 1 116 ? 6.889  -21.811 7.117   1.00 12.43 ? 116 ASP A C   1 
ATOM   733  O  O   . ASP A 1 116 ? 7.013  -22.064 5.920   1.00 14.31 ? 116 ASP A O   1 
ATOM   734  C  CB  . ASP A 1 116 ? 5.656  -19.668 6.722   1.00 12.60 ? 116 ASP A CB  1 
ATOM   735  C  CG  . ASP A 1 116 ? 4.270  -20.275 6.876   1.00 18.67 ? 116 ASP A CG  1 
ATOM   736  O  OD1 . ASP A 1 116 ? 4.101  -21.244 7.648   1.00 17.33 ? 116 ASP A OD1 1 
ATOM   737  O  OD2 . ASP A 1 116 ? 3.342  -19.754 6.224   1.00 18.34 ? 116 ASP A OD2 1 
ATOM   738  N  N   . LEU A 1 117 ? 6.923  -22.737 8.074   1.00 11.34 ? 117 LEU A N   1 
ATOM   739  C  CA  . LEU A 1 117 ? 7.067  -24.154 7.775   1.00 11.56 ? 117 LEU A CA  1 
ATOM   740  C  C   . LEU A 1 117 ? 5.847  -24.951 8.207   1.00 10.58 ? 117 LEU A C   1 
ATOM   741  O  O   . LEU A 1 117 ? 5.951  -26.151 8.466   1.00 12.63 ? 117 LEU A O   1 
ATOM   742  C  CB  . LEU A 1 117 ? 8.305  -24.729 8.468   1.00 11.96 ? 117 LEU A CB  1 
ATOM   743  C  CG  . LEU A 1 117 ? 9.644  -24.188 7.969   1.00 16.51 ? 117 LEU A CG  1 
ATOM   744  C  CD1 . LEU A 1 117 ? 10.465 -23.668 9.140   1.00 23.82 ? 117 LEU A CD1 1 
ATOM   745  C  CD2 . LEU A 1 117 ? 10.395 -25.266 7.221   1.00 19.49 ? 117 LEU A CD2 1 
ATOM   746  N  N   . GLN A 1 118 ? 4.687  -24.312 8.284   1.00 11.22 ? 118 GLN A N   1 
ATOM   747  C  CA  . GLN A 1 118 ? 3.535  -25.058 8.766   1.00 13.00 ? 118 GLN A CA  1 
ATOM   748  C  C   . GLN A 1 118 ? 3.206  -26.186 7.796   1.00 13.40 ? 118 GLN A C   1 
ATOM   749  O  O   . GLN A 1 118 ? 3.300  -26.017 6.576   1.00 14.14 ? 118 GLN A O   1 
ATOM   750  C  CB  . GLN A 1 118 ? 2.330  -24.149 8.985   1.00 14.53 ? 118 GLN A CB  1 
ATOM   751  C  CG  . GLN A 1 118 ? 1.728  -23.520 7.757   1.00 17.10 ? 118 GLN A CG  1 
ATOM   752  C  CD  . GLN A 1 118 ? 0.492  -22.708 8.119   1.00 23.75 ? 118 GLN A CD  1 
ATOM   753  O  OE1 . GLN A 1 118 ? -0.357 -23.158 8.891   1.00 22.59 ? 118 GLN A OE1 1 
ATOM   754  N  NE2 . GLN A 1 118 ? 0.403  -21.501 7.589   1.00 23.37 ? 118 GLN A NE2 1 
ATOM   755  N  N   . GLU A 1 119 ? 2.899  -27.349 8.370   1.00 13.38 ? 119 GLU A N   1 
ATOM   756  C  CA  . GLU A 1 119 ? 2.536  -28.557 7.628   1.00 12.26 ? 119 GLU A CA  1 
ATOM   757  C  C   . GLU A 1 119 ? 3.654  -29.075 6.718   1.00 14.62 ? 119 GLU A C   1 
ATOM   758  O  O   . GLU A 1 119 ? 3.408  -29.907 5.839   1.00 15.26 ? 119 GLU A O   1 
ATOM   759  C  CB  . GLU A 1 119 ? 1.268  -28.303 6.805   1.00 15.40 ? 119 GLU A CB  1 
ATOM   760  C  CG  . GLU A 1 119 ? 0.045  -27.959 7.660   1.00 18.66 ? 119 GLU A CG  1 
ATOM   761  C  CD  . GLU A 1 119 ? -0.683 -29.183 8.189   1.00 22.91 ? 119 GLU A CD  1 
ATOM   762  O  OE1 . GLU A 1 119 ? -0.213 -30.320 7.951   1.00 22.63 ? 119 GLU A OE1 1 
ATOM   763  O  OE2 . GLU A 1 119 ? -1.738 -29.008 8.840   1.00 19.24 ? 119 GLU A OE2 1 
ATOM   764  N  N   . ALA A 1 120 ? 4.878  -28.602 6.930   1.00 11.28 ? 120 ALA A N   1 
ATOM   765  C  CA  . ALA A 1 120 ? 5.997  -29.064 6.108   1.00 11.06 ? 120 ALA A CA  1 
ATOM   766  C  C   . ALA A 1 120 ? 6.389  -30.483 6.498   1.00 14.98 ? 120 ALA A C   1 
ATOM   767  O  O   . ALA A 1 120 ? 6.199  -30.894 7.646   1.00 16.97 ? 120 ALA A O   1 
ATOM   768  C  CB  . ALA A 1 120 ? 7.194  -28.124 6.241   1.00 13.81 ? 120 ALA A CB  1 
ATOM   769  N  N   . ASN A 1 121 ? 6.934  -31.228 5.542   1.00 12.78 ? 121 ASN A N   1 
ATOM   770  C  CA  . ASN A 1 121 ? 7.430  -32.576 5.801   1.00 12.32 ? 121 ASN A CA  1 
ATOM   771  C  C   . ASN A 1 121 ? 8.915  -32.500 6.055   1.00 17.26 ? 121 ASN A C   1 
ATOM   772  O  O   . ASN A 1 121 ? 9.696  -32.354 5.117   1.00 16.72 ? 121 ASN A O   1 
ATOM   773  C  CB  . ASN A 1 121 ? 7.122  -33.502 4.615   1.00 16.79 ? 121 ASN A CB  1 
ATOM   774  C  CG  . ASN A 1 121 ? 7.601  -34.930 4.834   1.00 22.93 ? 121 ASN A CG  1 
ATOM   775  O  OD1 . ASN A 1 121 ? 8.200  -35.254 5.859   1.00 18.13 ? 121 ASN A OD1 1 
ATOM   776  N  ND2 . ASN A 1 121 ? 7.324  -35.799 3.862   1.00 20.59 ? 121 ASN A ND2 1 
ATOM   777  N  N   . LEU A 1 122 ? 9.297  -32.552 7.327   1.00 14.02 ? 122 LEU A N   1 
ATOM   778  C  CA  . LEU A 1 122 ? 10.696 -32.495 7.709   1.00 10.78 ? 122 LEU A CA  1 
ATOM   779  C  C   . LEU A 1 122 ? 11.163 -33.838 8.266   1.00 12.18 ? 122 LEU A C   1 
ATOM   780  O  O   . LEU A 1 122 ? 12.125 -33.892 9.039   1.00 14.10 ? 122 LEU A O   1 
ATOM   781  C  CB  . LEU A 1 122 ? 10.927 -31.386 8.751   1.00 13.15 ? 122 LEU A CB  1 
ATOM   782  C  CG  . LEU A 1 122 ? 10.859 -29.959 8.194   1.00 15.51 ? 122 LEU A CG  1 
ATOM   783  C  CD1 . LEU A 1 122 ? 10.384 -28.993 9.272   1.00 18.69 ? 122 LEU A CD1 1 
ATOM   784  C  CD2 . LEU A 1 122 ? 12.223 -29.527 7.673   1.00 17.18 ? 122 LEU A CD2 1 
ATOM   785  N  N   . THR A 1 123 ? 10.503 -34.922 7.861   1.00 14.21 ? 123 THR A N   1 
ATOM   786  C  CA  . THR A 1 123 ? 10.854 -36.234 8.396   1.00 12.38 ? 123 THR A CA  1 
ATOM   787  C  C   . THR A 1 123 ? 12.291 -36.584 8.038   1.00 13.32 ? 123 THR A C   1 
ATOM   788  O  O   . THR A 1 123 ? 12.717 -36.397 6.907   1.00 15.60 ? 123 THR A O   1 
ATOM   789  C  CB  . THR A 1 123 ? 9.908  -37.348 7.887   1.00 21.69 ? 123 THR A CB  1 
ATOM   790  O  OG1 . THR A 1 123 ? 9.911  -37.372 6.462   1.00 23.22 ? 123 THR A OG1 1 
ATOM   791  C  CG2 . THR A 1 123 ? 8.495  -37.113 8.369   1.00 17.25 ? 123 THR A CG2 1 
ATOM   792  N  N   . GLN A 1 124 ? 13.034 -37.072 9.028   1.00 13.06 ? 124 GLN A N   1 
ATOM   793  C  CA  . GLN A 1 124 ? 14.437 -37.443 8.858   1.00 16.58 ? 124 GLN A CA  1 
ATOM   794  C  C   . GLN A 1 124 ? 15.335 -36.297 8.388   1.00 16.24 ? 124 GLN A C   1 
ATOM   795  O  O   . GLN A 1 124 ? 16.436 -36.549 7.903   1.00 16.96 ? 124 GLN A O   1 
ATOM   796  C  CB  . GLN A 1 124 ? 14.570 -38.609 7.867   1.00 20.61 ? 124 GLN A CB  1 
ATOM   797  C  CG  . GLN A 1 124 ? 13.732 -39.822 8.206   1.00 30.82 ? 124 GLN A CG  1 
ATOM   798  C  CD  . GLN A 1 124 ? 14.245 -40.547 9.419   1.00 37.36 ? 124 GLN A CD  1 
ATOM   799  O  OE1 . GLN A 1 124 ? 15.456 -40.666 9.616   1.00 40.33 ? 124 GLN A OE1 1 
ATOM   800  N  NE2 . GLN A 1 124 ? 13.330 -41.033 10.251  1.00 42.24 ? 124 GLN A NE2 1 
ATOM   801  N  N   . ALA A 1 125 ? 14.890 -35.051 8.524   1.00 13.27 ? 125 ALA A N   1 
ATOM   802  C  CA  . ALA A 1 125 ? 15.725 -33.921 8.106   1.00 12.57 ? 125 ALA A CA  1 
ATOM   803  C  C   . ALA A 1 125 ? 16.873 -33.675 9.077   1.00 15.56 ? 125 ALA A C   1 
ATOM   804  O  O   . ALA A 1 125 ? 16.772 -33.958 10.268  1.00 16.72 ? 125 ALA A O   1 
ATOM   805  C  CB  . ALA A 1 125 ? 14.878 -32.640 7.958   1.00 14.46 ? 125 ALA A CB  1 
ATOM   806  N  N   . ASN A 1 126 ? 17.975 -33.149 8.556   1.00 13.92 ? 126 ASN A N   1 
ATOM   807  C  CA  . ASN A 1 126 ? 19.086 -32.742 9.396   1.00 13.83 ? 126 ASN A CA  1 
ATOM   808  C  C   . ASN A 1 126 ? 18.926 -31.271 9.741   1.00 15.15 ? 126 ASN A C   1 
ATOM   809  O  O   . ASN A 1 126 ? 19.157 -30.408 8.893   1.00 14.23 ? 126 ASN A O   1 
ATOM   810  C  CB  . ASN A 1 126 ? 20.415 -33.009 8.678   1.00 13.78 ? 126 ASN A CB  1 
ATOM   811  C  CG  . ASN A 1 126 ? 21.635 -32.622 9.508   1.00 16.41 ? 126 ASN A CG  1 
ATOM   812  O  OD1 . ASN A 1 126 ? 21.514 -32.113 10.614  1.00 18.27 ? 126 ASN A OD1 1 
ATOM   813  N  ND2 . ASN A 1 126 ? 22.822 -32.892 8.975   1.00 16.59 ? 126 ASN A ND2 1 
ATOM   814  N  N   . LEU A 1 127 ? 18.516 -30.993 10.977  1.00 10.76 ? 127 LEU A N   1 
ATOM   815  C  CA  . LEU A 1 127 ? 18.372 -29.616 11.448  1.00 11.45 ? 127 LEU A CA  1 
ATOM   816  C  C   . LEU A 1 127 ? 19.375 -29.282 12.555  1.00 11.70 ? 127 LEU A C   1 
ATOM   817  O  O   . LEU A 1 127 ? 19.128 -28.390 13.375  1.00 11.08 ? 127 LEU A O   1 
ATOM   818  C  CB  . LEU A 1 127 ? 16.941 -29.369 11.950  1.00 11.04 ? 127 LEU A CB  1 
ATOM   819  C  CG  . LEU A 1 127 ? 15.876 -29.273 10.848  1.00 12.94 ? 127 LEU A CG  1 
ATOM   820  C  CD1 . LEU A 1 127 ? 14.499 -29.649 11.402  1.00 18.31 ? 127 LEU A CD1 1 
ATOM   821  C  CD2 . LEU A 1 127 ? 15.863 -27.871 10.252  1.00 17.57 ? 127 LEU A CD2 1 
ATOM   822  N  N   . LYS A 1 128 ? 20.503 -29.990 12.578  1.00 11.61 ? 128 LYS A N   1 
ATOM   823  C  CA  . LYS A 1 128 ? 21.525 -29.753 13.598  1.00 10.95 ? 128 LYS A CA  1 
ATOM   824  C  C   . LYS A 1 128 ? 21.969 -28.292 13.576  1.00 13.95 ? 128 LYS A C   1 
ATOM   825  O  O   . LYS A 1 128 ? 22.322 -27.769 12.517  1.00 13.58 ? 128 LYS A O   1 
ATOM   826  C  CB  . LYS A 1 128 ? 22.735 -30.666 13.387  1.00 13.55 ? 128 LYS A CB  1 
ATOM   827  C  CG  . LYS A 1 128 ? 22.425 -32.133 13.643  1.00 23.14 ? 128 LYS A CG  1 
ATOM   828  C  CD  . LYS A 1 128 ? 23.668 -32.995 13.451  1.00 32.40 ? 128 LYS A CD  1 
ATOM   829  C  CE  . LYS A 1 128 ? 24.786 -32.534 14.376  1.00 45.96 ? 128 LYS A CE  1 
ATOM   830  N  NZ  . LYS A 1 128 ? 26.070 -33.243 14.110  1.00 61.26 ? 128 LYS A NZ  1 
ATOM   831  N  N   . ASP A 1 129 ? 21.911 -27.640 14.735  1.00 11.21 ? 129 ASP A N   1 
ATOM   832  C  CA  . ASP A 1 129 ? 22.337 -26.245 14.866  1.00 11.30 ? 129 ASP A CA  1 
ATOM   833  C  C   . ASP A 1 129 ? 21.575 -25.277 13.959  1.00 12.32 ? 129 ASP A C   1 
ATOM   834  O  O   . ASP A 1 129 ? 22.062 -24.176 13.696  1.00 15.30 ? 129 ASP A O   1 
ATOM   835  C  CB  . ASP A 1 129 ? 23.836 -26.130 14.581  1.00 12.22 ? 129 ASP A CB  1 
ATOM   836  C  CG  . ASP A 1 129 ? 24.675 -26.962 15.538  1.00 24.34 ? 129 ASP A CG  1 
ATOM   837  O  OD1 . ASP A 1 129 ? 24.445 -26.892 16.765  1.00 22.57 ? 129 ASP A OD1 1 
ATOM   838  O  OD2 . ASP A 1 129 ? 25.566 -27.688 15.060  1.00 26.79 ? 129 ASP A OD2 1 
ATOM   839  N  N   . ALA A 1 130 ? 20.391 -25.667 13.489  1.00 11.40 ? 130 ALA A N   1 
ATOM   840  C  CA  . ALA A 1 130 ? 19.585 -24.763 12.663  1.00 9.20  ? 130 ALA A CA  1 
ATOM   841  C  C   . ALA A 1 130 ? 18.979 -23.669 13.517  1.00 10.68 ? 130 ALA A C   1 
ATOM   842  O  O   . ALA A 1 130 ? 18.671 -23.883 14.691  1.00 12.38 ? 130 ALA A O   1 
ATOM   843  C  CB  . ALA A 1 130 ? 18.459 -25.533 11.925  1.00 11.05 ? 130 ALA A CB  1 
ATOM   844  N  N   . ASN A 1 131 ? 18.804 -22.496 12.922  1.00 8.97  ? 131 ASN A N   1 
ATOM   845  C  CA  . ASN A 1 131 ? 18.132 -21.394 13.591  1.00 9.11  ? 131 ASN A CA  1 
ATOM   846  C  C   . ASN A 1 131 ? 16.681 -21.338 13.145  1.00 11.90 ? 131 ASN A C   1 
ATOM   847  O  O   . ASN A 1 131 ? 16.393 -20.902 12.034  1.00 11.49 ? 131 ASN A O   1 
ATOM   848  C  CB  . ASN A 1 131 ? 18.851 -20.080 13.278  1.00 9.83  ? 131 ASN A CB  1 
ATOM   849  C  CG  . ASN A 1 131 ? 18.248 -18.894 13.994  1.00 15.00 ? 131 ASN A CG  1 
ATOM   850  O  OD1 . ASN A 1 131 ? 17.316 -19.031 14.792  1.00 12.58 ? 131 ASN A OD1 1 
ATOM   851  N  ND2 . ASN A 1 131 ? 18.800 -17.712 13.728  1.00 13.07 ? 131 ASN A ND2 1 
ATOM   852  N  N   . LEU A 1 132 ? 15.781 -21.797 14.013  1.00 9.93  ? 132 LEU A N   1 
ATOM   853  C  CA  . LEU A 1 132 ? 14.350 -21.783 13.740  1.00 9.28  ? 132 LEU A CA  1 
ATOM   854  C  C   . LEU A 1 132 ? 13.638 -20.780 14.646  1.00 10.53 ? 132 LEU A C   1 
ATOM   855  O  O   . LEU A 1 132 ? 12.453 -20.933 14.932  1.00 10.51 ? 132 LEU A O   1 
ATOM   856  C  CB  . LEU A 1 132 ? 13.756 -23.183 13.933  1.00 12.49 ? 132 LEU A CB  1 
ATOM   857  C  CG  . LEU A 1 132 ? 14.164 -24.172 12.845  1.00 14.75 ? 132 LEU A CG  1 
ATOM   858  C  CD1 . LEU A 1 132 ? 14.328 -25.573 13.415  1.00 22.13 ? 132 LEU A CD1 1 
ATOM   859  C  CD2 . LEU A 1 132 ? 13.123 -24.167 11.745  1.00 17.26 ? 132 LEU A CD2 1 
ATOM   860  N  N   . SER A 1 133 ? 14.362 -19.750 15.081  1.00 10.85 ? 133 SER A N   1 
ATOM   861  C  CA  . SER A 1 133 ? 13.777 -18.736 15.960  1.00 10.83 ? 133 SER A CA  1 
ATOM   862  C  C   . SER A 1 133 ? 12.534 -18.130 15.338  1.00 11.40 ? 133 SER A C   1 
ATOM   863  O  O   . SER A 1 133 ? 12.562 -17.703 14.184  1.00 12.02 ? 133 SER A O   1 
ATOM   864  C  CB  . SER A 1 133 ? 14.778 -17.621 16.269  1.00 15.10 ? 133 SER A CB  1 
ATOM   865  O  OG  . SER A 1 133 ? 15.944 -18.137 16.882  1.00 18.05 ? 133 SER A OG  1 
ATOM   866  N  N   . ASP A 1 134 ? 11.452 -18.091 16.112  1.00 10.93 ? 134 ASP A N   1 
ATOM   867  C  CA  . ASP A 1 134 ? 10.191 -17.476 15.669  1.00 12.72 ? 134 ASP A CA  1 
ATOM   868  C  C   . ASP A 1 134 ? 9.609  -18.080 14.383  1.00 14.15 ? 134 ASP A C   1 
ATOM   869  O  O   . ASP A 1 134 ? 8.766  -17.457 13.727  1.00 13.42 ? 134 ASP A O   1 
ATOM   870  C  CB  . ASP A 1 134 ? 10.377 -15.964 15.480  1.00 13.00 ? 134 ASP A CB  1 
ATOM   871  C  CG  . ASP A 1 134 ? 10.852 -15.276 16.748  1.00 24.00 ? 134 ASP A CG  1 
ATOM   872  O  OD1 . ASP A 1 134 ? 10.343 -15.615 17.839  1.00 19.58 ? 134 ASP A OD1 1 
ATOM   873  O  OD2 . ASP A 1 134 ? 11.730 -14.393 16.656  1.00 30.80 ? 134 ASP A OD2 1 
ATOM   874  N  N   . ALA A 1 135 ? 10.017 -19.295 14.037  1.00 9.45  ? 135 ALA A N   1 
ATOM   875  C  CA  . ALA A 1 135 ? 9.479  -19.948 12.844  1.00 9.36  ? 135 ALA A CA  1 
ATOM   876  C  C   . ALA A 1 135 ? 8.109  -20.543 13.132  1.00 14.33 ? 135 ALA A C   1 
ATOM   877  O  O   . ALA A 1 135 ? 7.773  -20.850 14.279  1.00 14.73 ? 135 ALA A O   1 
ATOM   878  C  CB  . ALA A 1 135 ? 10.438 -21.046 12.334  1.00 12.99 ? 135 ALA A CB  1 
ATOM   879  N  N   . ASN A 1 136 ? 7.310  -20.700 12.087  1.00 10.84 ? 136 ASN A N   1 
ATOM   880  C  CA  . ASN A 1 136 ? 6.009  -21.342 12.248  1.00 10.22 ? 136 ASN A CA  1 
ATOM   881  C  C   . ASN A 1 136 ? 6.111  -22.800 11.828  1.00 13.71 ? 136 ASN A C   1 
ATOM   882  O  O   . ASN A 1 136 ? 6.326  -23.106 10.652  1.00 14.68 ? 136 ASN A O   1 
ATOM   883  C  CB  . ASN A 1 136 ? 4.945  -20.619 11.434  1.00 10.68 ? 136 ASN A CB  1 
ATOM   884  C  CG  . ASN A 1 136 ? 3.560  -21.228 11.617  1.00 14.38 ? 136 ASN A CG  1 
ATOM   885  O  OD1 . ASN A 1 136 ? 3.368  -22.119 12.453  1.00 14.63 ? 136 ASN A OD1 1 
ATOM   886  N  ND2 . ASN A 1 136 ? 2.588  -20.745 10.842  1.00 16.13 ? 136 ASN A ND2 1 
ATOM   887  N  N   . LEU A 1 137 ? 5.997  -23.700 12.795  1.00 11.03 ? 137 LEU A N   1 
ATOM   888  C  CA  . LEU A 1 137 ? 6.068  -25.128 12.522  1.00 11.25 ? 137 LEU A CA  1 
ATOM   889  C  C   . LEU A 1 137 ? 4.755  -25.819 12.889  1.00 11.01 ? 137 LEU A C   1 
ATOM   890  O  O   . LEU A 1 137 ? 4.745  -27.010 13.216  1.00 13.06 ? 137 LEU A O   1 
ATOM   891  C  CB  . LEU A 1 137 ? 7.245  -25.761 13.289  1.00 10.36 ? 137 LEU A CB  1 
ATOM   892  C  CG  . LEU A 1 137 ? 8.609  -25.402 12.693  1.00 13.24 ? 137 LEU A CG  1 
ATOM   893  C  CD1 . LEU A 1 137 ? 9.664  -25.366 13.799  1.00 20.20 ? 137 LEU A CD1 1 
ATOM   894  C  CD2 . LEU A 1 137 ? 9.019  -26.408 11.625  1.00 15.61 ? 137 LEU A CD2 1 
ATOM   895  N  N   . GLU A 1 138 ? 3.645  -25.083 12.811  1.00 12.30 ? 138 GLU A N   1 
ATOM   896  C  CA  . GLU A 1 138 ? 2.351  -25.667 13.171  1.00 11.84 ? 138 GLU A CA  1 
ATOM   897  C  C   . GLU A 1 138 ? 2.041  -26.916 12.335  1.00 13.91 ? 138 GLU A C   1 
ATOM   898  O  O   . GLU A 1 138 ? 2.066  -26.875 11.102  1.00 13.34 ? 138 GLU A O   1 
ATOM   899  C  CB  . GLU A 1 138 ? 1.214  -24.654 13.011  1.00 12.90 ? 138 GLU A CB  1 
ATOM   900  C  CG  . GLU A 1 138 ? -0.142 -25.281 13.362  1.00 17.00 ? 138 GLU A CG  1 
ATOM   901  C  CD  . GLU A 1 138 ? -1.218 -24.260 13.673  1.00 24.45 ? 138 GLU A CD  1 
ATOM   902  O  OE1 . GLU A 1 138 ? -0.969 -23.054 13.482  1.00 24.49 ? 138 GLU A OE1 1 
ATOM   903  O  OE2 . GLU A 1 138 ? -2.314 -24.672 14.118  1.00 24.97 ? 138 GLU A OE2 1 
ATOM   904  N  N   . GLN A 1 139 ? 1.761  -28.021 13.022  1.00 12.88 ? 139 GLN A N   1 
ATOM   905  C  CA  . GLN A 1 139 ? 1.441  -29.301 12.395  1.00 12.78 ? 139 GLN A CA  1 
ATOM   906  C  C   . GLN A 1 139 ? 2.532  -29.822 11.452  1.00 13.93 ? 139 GLN A C   1 
ATOM   907  O  O   . GLN A 1 139 ? 2.263  -30.706 10.637  1.00 17.11 ? 139 GLN A O   1 
ATOM   908  C  CB  . GLN A 1 139 ? 0.112  -29.203 11.640  1.00 13.54 ? 139 GLN A CB  1 
ATOM   909  C  CG  . GLN A 1 139 ? -1.087 -28.972 12.540  1.00 18.99 ? 139 GLN A CG  1 
ATOM   910  C  CD  . GLN A 1 139 ? -1.455 -30.199 13.350  1.00 24.58 ? 139 GLN A CD  1 
ATOM   911  O  OE1 . GLN A 1 139 ? -1.090 -31.325 13.001  1.00 28.67 ? 139 GLN A OE1 1 
ATOM   912  N  NE2 . GLN A 1 139 ? -2.195 -29.990 14.430  1.00 24.45 ? 139 GLN A NE2 1 
ATOM   913  N  N   . ALA A 1 140 ? 3.758  -29.315 11.575  1.00 11.73 ? 140 ALA A N   1 
ATOM   914  C  CA  . ALA A 1 140 ? 4.861  -29.834 10.763  1.00 13.71 ? 140 ALA A CA  1 
ATOM   915  C  C   . ALA A 1 140 ? 5.180  -31.264 11.186  1.00 15.87 ? 140 ALA A C   1 
ATOM   916  O  O   . ALA A 1 140 ? 4.988  -31.628 12.343  1.00 15.41 ? 140 ALA A O   1 
ATOM   917  C  CB  . ALA A 1 140 ? 6.106  -28.951 10.891  1.00 12.78 ? 140 ALA A CB  1 
ATOM   918  N  N   . ASP A 1 141 ? 5.654  -32.074 10.244  1.00 13.64 ? 141 ASP A N   1 
ATOM   919  C  CA  . ASP A 1 141 ? 6.047  -33.442 10.549  1.00 14.20 ? 141 ASP A CA  1 
ATOM   920  C  C   . ASP A 1 141 ? 7.562  -33.488 10.705  1.00 15.15 ? 141 ASP A C   1 
ATOM   921  O  O   . ASP A 1 141 ? 8.296  -33.454 9.707   1.00 14.32 ? 141 ASP A O   1 
ATOM   922  C  CB  . ASP A 1 141 ? 5.579  -34.401 9.444   1.00 16.40 ? 141 ASP A CB  1 
ATOM   923  C  CG  . ASP A 1 141 ? 5.764  -35.864 9.817   1.00 21.96 ? 141 ASP A CG  1 
ATOM   924  O  OD1 . ASP A 1 141 ? 6.363  -36.150 10.873  1.00 19.94 ? 141 ASP A OD1 1 
ATOM   925  O  OD2 . ASP A 1 141 ? 5.319  -36.734 9.036   1.00 24.95 ? 141 ASP A OD2 1 
ATOM   926  N  N   . LEU A 1 142 ? 8.029  -33.546 11.952  1.00 14.76 ? 142 LEU A N   1 
ATOM   927  C  CA  . LEU A 1 142 ? 9.461  -33.634 12.236  1.00 12.04 ? 142 LEU A CA  1 
ATOM   928  C  C   . LEU A 1 142 ? 9.879  -35.007 12.749  1.00 14.39 ? 142 LEU A C   1 
ATOM   929  O  O   . LEU A 1 142 ? 10.893 -35.131 13.437  1.00 14.21 ? 142 LEU A O   1 
ATOM   930  C  CB  . LEU A 1 142 ? 9.876  -32.573 13.261  1.00 14.36 ? 142 LEU A CB  1 
ATOM   931  C  CG  . LEU A 1 142 ? 9.626  -31.138 12.790  1.00 14.12 ? 142 LEU A CG  1 
ATOM   932  C  CD1 . LEU A 1 142 ? 8.417  -30.548 13.509  1.00 21.91 ? 142 LEU A CD1 1 
ATOM   933  C  CD2 . LEU A 1 142 ? 10.861 -30.270 12.987  1.00 21.24 ? 142 LEU A CD2 1 
ATOM   934  N  N   . ALA A 1 143 ? 9.112  -36.035 12.407  1.00 12.92 ? 143 ALA A N   1 
ATOM   935  C  CA  . ALA A 1 143 ? 9.411  -37.375 12.892  1.00 12.85 ? 143 ALA A CA  1 
ATOM   936  C  C   . ALA A 1 143 ? 10.814 -37.807 12.470  1.00 15.47 ? 143 ALA A C   1 
ATOM   937  O  O   . ALA A 1 143 ? 11.169 -37.746 11.296  1.00 14.99 ? 143 ALA A O   1 
ATOM   938  C  CB  . ALA A 1 143 ? 8.374  -38.370 12.395  1.00 17.47 ? 143 ALA A CB  1 
ATOM   939  N  N   . GLY A 1 144 ? 11.611 -38.212 13.450  1.00 14.35 ? 144 GLY A N   1 
ATOM   940  C  CA  . GLY A 1 144 ? 12.954 -38.694 13.191  1.00 15.13 ? 144 GLY A CA  1 
ATOM   941  C  C   . GLY A 1 144 ? 13.933 -37.624 12.760  1.00 16.74 ? 144 GLY A C   1 
ATOM   942  O  O   . GLY A 1 144 ? 15.065 -37.943 12.404  1.00 16.94 ? 144 GLY A O   1 
ATOM   943  N  N   . ALA A 1 145 ? 13.522 -36.358 12.799  1.00 13.92 ? 145 ALA A N   1 
ATOM   944  C  CA  . ALA A 1 145 ? 14.442 -35.275 12.430  1.00 14.91 ? 145 ALA A CA  1 
ATOM   945  C  C   . ALA A 1 145 ? 15.516 -35.105 13.500  1.00 15.52 ? 145 ALA A C   1 
ATOM   946  O  O   . ALA A 1 145 ? 15.288 -35.409 14.668  1.00 13.66 ? 145 ALA A O   1 
ATOM   947  C  CB  . ALA A 1 145 ? 13.691 -33.965 12.220  1.00 12.27 ? 145 ALA A CB  1 
ATOM   948  N  N   . ASP A 1 146 ? 16.686 -34.620 13.092  1.00 13.49 ? 146 ASP A N   1 
ATOM   949  C  CA  . ASP A 1 146 ? 17.796 -34.377 14.014  1.00 11.39 ? 146 ASP A CA  1 
ATOM   950  C  C   . ASP A 1 146 ? 17.890 -32.892 14.299  1.00 13.55 ? 146 ASP A C   1 
ATOM   951  O  O   . ASP A 1 146 ? 18.325 -32.134 13.439  1.00 14.70 ? 146 ASP A O   1 
ATOM   952  C  CB  . ASP A 1 146 ? 19.111 -34.889 13.412  1.00 17.07 ? 146 ASP A CB  1 
ATOM   953  C  CG  . ASP A 1 146 ? 20.274 -34.845 14.394  1.00 23.20 ? 146 ASP A CG  1 
ATOM   954  O  OD1 . ASP A 1 146 ? 20.119 -34.322 15.521  1.00 16.50 ? 146 ASP A OD1 1 
ATOM   955  O  OD2 . ASP A 1 146 ? 21.365 -35.343 14.031  1.00 24.81 ? 146 ASP A OD2 1 
ATOM   956  N  N   . LEU A 1 147 ? 17.476 -32.477 15.497  1.00 11.95 ? 147 LEU A N   1 
ATOM   957  C  CA  . LEU A 1 147 ? 17.518 -31.065 15.880  1.00 10.79 ? 147 LEU A CA  1 
ATOM   958  C  C   . LEU A 1 147 ? 18.566 -30.799 16.962  1.00 13.72 ? 147 LEU A C   1 
ATOM   959  O  O   . LEU A 1 147 ? 18.449 -29.839 17.733  1.00 13.59 ? 147 LEU A O   1 
ATOM   960  C  CB  . LEU A 1 147 ? 16.139 -30.598 16.366  1.00 9.93  ? 147 LEU A CB  1 
ATOM   961  C  CG  . LEU A 1 147 ? 15.029 -30.604 15.301  1.00 13.98 ? 147 LEU A CG  1 
ATOM   962  C  CD1 . LEU A 1 147 ? 14.292 -31.935 15.281  1.00 22.00 ? 147 LEU A CD1 1 
ATOM   963  C  CD2 . LEU A 1 147 ? 14.040 -29.481 15.559  1.00 22.49 ? 147 LEU A CD2 1 
ATOM   964  N  N   . GLN A 1 148 ? 19.594 -31.640 17.016  1.00 11.99 ? 148 GLN A N   1 
ATOM   965  C  CA  . GLN A 1 148 ? 20.629 -31.486 18.031  1.00 11.95 ? 148 GLN A CA  1 
ATOM   966  C  C   . GLN A 1 148 ? 21.233 -30.083 17.988  1.00 14.46 ? 148 GLN A C   1 
ATOM   967  O  O   . GLN A 1 148 ? 21.718 -29.638 16.943  1.00 14.49 ? 148 GLN A O   1 
ATOM   968  C  CB  . GLN A 1 148 ? 21.730 -32.526 17.852  1.00 17.19 ? 148 GLN A CB  1 
ATOM   969  C  CG  . GLN A 1 148 ? 22.863 -32.355 18.864  1.00 24.29 ? 148 GLN A CG  1 
ATOM   970  C  CD  . GLN A 1 148 ? 23.709 -33.601 19.012  1.00 37.77 ? 148 GLN A CD  1 
ATOM   971  O  OE1 . GLN A 1 148 ? 23.583 -34.545 18.235  1.00 42.99 ? 148 GLN A OE1 1 
ATOM   972  N  NE2 . GLN A 1 148 ? 24.589 -33.603 20.007  1.00 39.04 ? 148 GLN A NE2 1 
ATOM   973  N  N   . GLY A 1 149 ? 21.175 -29.383 19.115  1.00 14.89 ? 149 GLY A N   1 
ATOM   974  C  CA  . GLY A 1 149 ? 21.763 -28.054 19.207  1.00 14.41 ? 149 GLY A CA  1 
ATOM   975  C  C   . GLY A 1 149 ? 21.046 -26.969 18.420  1.00 11.48 ? 149 GLY A C   1 
ATOM   976  O  O   . GLY A 1 149 ? 21.549 -25.838 18.316  1.00 12.17 ? 149 GLY A O   1 
ATOM   977  N  N   . ALA A 1 150 ? 19.880 -27.285 17.861  1.00 10.05 ? 150 ALA A N   1 
ATOM   978  C  CA  . ALA A 1 150 ? 19.105 -26.281 17.130  1.00 12.23 ? 150 ALA A CA  1 
ATOM   979  C  C   . ALA A 1 150 ? 18.517 -25.247 18.081  1.00 12.67 ? 150 ALA A C   1 
ATOM   980  O  O   . ALA A 1 150 ? 18.386 -25.486 19.288  1.00 12.69 ? 150 ALA A O   1 
ATOM   981  C  CB  . ALA A 1 150 ? 17.987 -26.935 16.312  1.00 13.11 ? 150 ALA A CB  1 
ATOM   982  N  N   . VAL A 1 151 ? 18.161 -24.098 17.524  1.00 9.64  ? 151 VAL A N   1 
ATOM   983  C  CA  . VAL A 1 151 ? 17.560 -23.014 18.297  1.00 9.42  ? 151 VAL A CA  1 
ATOM   984  C  C   . VAL A 1 151 ? 16.170 -22.751 17.759  1.00 9.75  ? 151 VAL A C   1 
ATOM   985  O  O   . VAL A 1 151 ? 16.017 -22.370 16.597  1.00 11.51 ? 151 VAL A O   1 
ATOM   986  C  CB  . VAL A 1 151 ? 18.412 -21.740 18.220  1.00 11.29 ? 151 VAL A CB  1 
ATOM   987  C  CG1 . VAL A 1 151 ? 17.697 -20.577 18.904  1.00 12.59 ? 151 VAL A CG1 1 
ATOM   988  C  CG2 . VAL A 1 151 ? 19.757 -21.993 18.866  1.00 13.71 ? 151 VAL A CG2 1 
ATOM   989  N  N   . LEU A 1 152 ? 15.161 -23.005 18.592  1.00 9.57  ? 152 LEU A N   1 
ATOM   990  C  CA  . LEU A 1 152 ? 13.764 -22.866 18.176  1.00 10.00 ? 152 LEU A CA  1 
ATOM   991  C  C   . LEU A 1 152 ? 13.052 -21.894 19.099  1.00 10.55 ? 152 LEU A C   1 
ATOM   992  O  O   . LEU A 1 152 ? 11.851 -22.021 19.350  1.00 11.88 ? 152 LEU A O   1 
ATOM   993  C  CB  . LEU A 1 152 ? 13.048 -24.223 18.175  1.00 10.58 ? 152 LEU A CB  1 
ATOM   994  C  CG  . LEU A 1 152 ? 13.653 -25.329 17.298  1.00 11.69 ? 152 LEU A CG  1 
ATOM   995  C  CD1 . LEU A 1 152 ? 14.624 -26.189 18.100  1.00 13.62 ? 152 LEU A CD1 1 
ATOM   996  C  CD2 . LEU A 1 152 ? 12.550 -26.196 16.700  1.00 16.16 ? 152 LEU A CD2 1 
ATOM   997  N  N   A ASP A 1 153 ? 13.805 -20.919 19.605  0.54 11.87 ? 153 ASP A N   1 
ATOM   998  N  N   B ASP A 1 153 ? 13.796 -20.914 19.595  0.46 11.86 ? 153 ASP A N   1 
ATOM   999  C  CA  A ASP A 1 153 ? 13.265 -19.926 20.530  0.54 12.32 ? 153 ASP A CA  1 
ATOM   1000 C  CA  B ASP A 1 153 ? 13.247 -19.967 20.552  0.46 12.14 ? 153 ASP A CA  1 
ATOM   1001 C  C   A ASP A 1 153 ? 12.083 -19.203 19.907  0.54 12.52 ? 153 ASP A C   1 
ATOM   1002 C  C   B ASP A 1 153 ? 12.105 -19.167 19.944  0.46 12.65 ? 153 ASP A C   1 
ATOM   1003 O  O   A ASP A 1 153 ? 12.188 -18.669 18.803  0.54 12.09 ? 153 ASP A O   1 
ATOM   1004 O  O   B ASP A 1 153 ? 12.260 -18.542 18.895  0.46 12.62 ? 153 ASP A O   1 
ATOM   1005 C  CB  A ASP A 1 153 ? 14.351 -18.918 20.935  0.54 12.32 ? 153 ASP A CB  1 
ATOM   1006 C  CB  B ASP A 1 153 ? 14.347 -19.038 21.063  0.46 13.94 ? 153 ASP A CB  1 
ATOM   1007 C  CG  A ASP A 1 153 ? 13.849 -17.871 21.926  0.54 17.27 ? 153 ASP A CG  1 
ATOM   1008 C  CG  B ASP A 1 153 ? 15.432 -19.787 21.804  0.46 19.88 ? 153 ASP A CG  1 
ATOM   1009 O  OD1 A ASP A 1 153 ? 13.848 -18.151 23.143  0.54 20.53 ? 153 ASP A OD1 1 
ATOM   1010 O  OD1 B ASP A 1 153 ? 15.229 -20.991 22.087  0.46 21.66 ? 153 ASP A OD1 1 
ATOM   1011 O  OD2 A ASP A 1 153 ? 13.470 -16.760 21.492  0.54 19.83 ? 153 ASP A OD2 1 
ATOM   1012 O  OD2 B ASP A 1 153 ? 16.466 -19.175 22.137  0.46 23.57 ? 153 ASP A OD2 1 
ATOM   1013 N  N   . GLY A 1 154 ? 10.952 -19.208 20.607  1.00 10.47 ? 154 GLY A N   1 
ATOM   1014 C  CA  . GLY A 1 154 ? 9.779  -18.473 20.158  1.00 13.36 ? 154 GLY A CA  1 
ATOM   1015 C  C   . GLY A 1 154 ? 9.050  -19.122 18.994  1.00 12.84 ? 154 GLY A C   1 
ATOM   1016 O  O   . GLY A 1 154 ? 8.093  -18.551 18.476  1.00 12.94 ? 154 GLY A O   1 
ATOM   1017 N  N   . ALA A 1 155 ? 9.484  -20.312 18.581  1.00 10.40 ? 155 ALA A N   1 
ATOM   1018 C  CA  . ALA A 1 155 ? 8.847  -20.991 17.452  1.00 10.19 ? 155 ALA A CA  1 
ATOM   1019 C  C   . ALA A 1 155 ? 7.472  -21.531 17.815  1.00 13.05 ? 155 ALA A C   1 
ATOM   1020 O  O   . ALA A 1 155 ? 7.191  -21.818 18.978  1.00 13.15 ? 155 ALA A O   1 
ATOM   1021 C  CB  . ALA A 1 155 ? 9.728  -22.123 16.938  1.00 11.02 ? 155 ALA A CB  1 
ATOM   1022 N  N   . ASN A 1 156 ? 6.623  -21.673 16.802  1.00 10.43 ? 156 ASN A N   1 
ATOM   1023 C  CA  . ASN A 1 156 ? 5.302  -22.244 16.995  1.00 11.90 ? 156 ASN A CA  1 
ATOM   1024 C  C   . ASN A 1 156 ? 5.310  -23.706 16.561  1.00 15.52 ? 156 ASN A C   1 
ATOM   1025 O  O   . ASN A 1 156 ? 5.370  -23.992 15.364  1.00 14.31 ? 156 ASN A O   1 
ATOM   1026 C  CB  . ASN A 1 156 ? 4.260  -21.455 16.201  1.00 13.77 ? 156 ASN A CB  1 
ATOM   1027 C  CG  . ASN A 1 156 ? 2.882  -22.061 16.293  1.00 19.44 ? 156 ASN A CG  1 
ATOM   1028 O  OD1 . ASN A 1 156 ? 2.606  -22.859 17.186  1.00 16.71 ? 156 ASN A OD1 1 
ATOM   1029 N  ND2 . ASN A 1 156 ? 1.995  -21.669 15.378  1.00 15.70 ? 156 ASN A ND2 1 
ATOM   1030 N  N   . LEU A 1 157 ? 5.271  -24.620 17.527  1.00 10.89 ? 157 LEU A N   1 
ATOM   1031 C  CA  . LEU A 1 157 ? 5.229  -26.046 17.215  1.00 10.91 ? 157 LEU A CA  1 
ATOM   1032 C  C   . LEU A 1 157 ? 3.892  -26.661 17.595  1.00 14.01 ? 157 LEU A C   1 
ATOM   1033 O  O   . LEU A 1 157 ? 3.820  -27.845 17.923  1.00 13.83 ? 157 LEU A O   1 
ATOM   1034 C  CB  . LEU A 1 157 ? 6.365  -26.790 17.925  1.00 10.64 ? 157 LEU A CB  1 
ATOM   1035 C  CG  . LEU A 1 157 ? 7.730  -26.448 17.332  1.00 17.42 ? 157 LEU A CG  1 
ATOM   1036 C  CD1 . LEU A 1 157 ? 8.520  -25.570 18.280  1.00 20.74 ? 157 LEU A CD1 1 
ATOM   1037 C  CD2 . LEU A 1 157 ? 8.496  -27.705 16.993  1.00 26.69 ? 157 LEU A CD2 1 
ATOM   1038 N  N   . HIS A 1 158 ? 2.833  -25.860 17.538  1.00 13.10 ? 158 HIS A N   1 
ATOM   1039 C  CA  . HIS A 1 158 ? 1.499  -26.340 17.887  1.00 12.80 ? 158 HIS A CA  1 
ATOM   1040 C  C   . HIS A 1 158 ? 1.145  -27.561 17.039  1.00 15.08 ? 158 HIS A C   1 
ATOM   1041 O  O   . HIS A 1 158 ? 1.159  -27.496 15.810  1.00 13.89 ? 158 HIS A O   1 
ATOM   1042 C  CB  . HIS A 1 158 ? 0.450  -25.237 17.695  1.00 14.52 ? 158 HIS A CB  1 
ATOM   1043 C  CG  . HIS A 1 158 ? -0.947 -25.687 17.997  1.00 21.05 ? 158 HIS A CG  1 
ATOM   1044 N  ND1 . HIS A 1 158 ? -1.514 -25.563 19.246  1.00 32.89 ? 158 HIS A ND1 1 
ATOM   1045 C  CD2 . HIS A 1 158 ? -1.884 -26.272 17.215  1.00 34.64 ? 158 HIS A CD2 1 
ATOM   1046 C  CE1 . HIS A 1 158 ? -2.744 -26.046 19.220  1.00 29.48 ? 158 HIS A CE1 1 
ATOM   1047 N  NE2 . HIS A 1 158 ? -2.992 -26.486 18.000  1.00 34.43 ? 158 HIS A NE2 1 
ATOM   1048 N  N   . GLY A 1 159 ? 0.864  -28.680 17.701  1.00 13.52 ? 159 GLY A N   1 
ATOM   1049 C  CA  . GLY A 1 159 ? 0.487  -29.896 17.003  1.00 13.71 ? 159 GLY A CA  1 
ATOM   1050 C  C   . GLY A 1 159 ? 1.575  -30.531 16.152  1.00 13.66 ? 159 GLY A C   1 
ATOM   1051 O  O   . GLY A 1 159 ? 1.291  -31.414 15.345  1.00 16.68 ? 159 GLY A O   1 
ATOM   1052 N  N   . ALA A 1 160 ? 2.821  -30.110 16.328  1.00 12.82 ? 160 ALA A N   1 
ATOM   1053 C  CA  . ALA A 1 160 ? 3.907  -30.685 15.533  1.00 13.16 ? 160 ALA A CA  1 
ATOM   1054 C  C   . ALA A 1 160 ? 4.163  -32.136 15.934  1.00 12.91 ? 160 ALA A C   1 
ATOM   1055 O  O   . ALA A 1 160 ? 3.931  -32.530 17.080  1.00 14.78 ? 160 ALA A O   1 
ATOM   1056 C  CB  . ALA A 1 160 ? 5.178  -29.865 15.684  1.00 14.69 ? 160 ALA A CB  1 
ATOM   1057 N  N   . ASN A 1 161 ? 4.627  -32.927 14.970  1.00 14.11 ? 161 ASN A N   1 
ATOM   1058 C  CA  . ASN A 1 161 ? 5.001  -34.311 15.209  1.00 13.09 ? 161 ASN A CA  1 
ATOM   1059 C  C   . ASN A 1 161 ? 6.499  -34.405 15.436  1.00 15.69 ? 161 ASN A C   1 
ATOM   1060 O  O   . ASN A 1 161 ? 7.271  -34.266 14.492  1.00 15.47 ? 161 ASN A O   1 
ATOM   1061 C  CB  . ASN A 1 161 ? 4.588  -35.182 14.021  1.00 13.16 ? 161 ASN A CB  1 
ATOM   1062 C  CG  . ASN A 1 161 ? 4.875  -36.661 14.242  1.00 17.07 ? 161 ASN A CG  1 
ATOM   1063 O  OD1 . ASN A 1 161 ? 5.362  -37.062 15.295  1.00 19.09 ? 161 ASN A OD1 1 
ATOM   1064 N  ND2 . ASN A 1 161 ? 4.539  -37.484 13.247  1.00 19.27 ? 161 ASN A ND2 1 
ATOM   1065 N  N   . LEU A 1 162 ? 6.909  -34.617 16.686  1.00 12.23 ? 162 LEU A N   1 
ATOM   1066 C  CA  . LEU A 1 162 ? 8.325  -34.750 17.011  1.00 11.94 ? 162 LEU A CA  1 
ATOM   1067 C  C   . LEU A 1 162 ? 8.674  -36.184 17.429  1.00 13.63 ? 162 LEU A C   1 
ATOM   1068 O  O   . LEU A 1 162 ? 9.648  -36.410 18.151  1.00 12.70 ? 162 LEU A O   1 
ATOM   1069 C  CB  . LEU A 1 162 ? 8.713  -33.755 18.113  1.00 12.43 ? 162 LEU A CB  1 
ATOM   1070 C  CG  . LEU A 1 162 ? 8.764  -32.298 17.628  1.00 16.39 ? 162 LEU A CG  1 
ATOM   1071 C  CD1 . LEU A 1 162 ? 8.513  -31.316 18.769  1.00 21.11 ? 162 LEU A CD1 1 
ATOM   1072 C  CD2 . LEU A 1 162 ? 10.109 -32.006 16.975  1.00 19.82 ? 162 LEU A CD2 1 
ATOM   1073 N  N   . ASN A 1 163 ? 7.883  -37.144 16.963  1.00 13.13 ? 163 ASN A N   1 
ATOM   1074 C  CA  . ASN A 1 163 ? 8.146  -38.560 17.248  1.00 13.83 ? 163 ASN A CA  1 
ATOM   1075 C  C   . ASN A 1 163 ? 9.567  -38.950 16.885  1.00 14.98 ? 163 ASN A C   1 
ATOM   1076 O  O   . ASN A 1 163 ? 10.001 -38.742 15.751  1.00 15.53 ? 163 ASN A O   1 
ATOM   1077 C  CB  . ASN A 1 163 ? 7.180  -39.461 16.487  1.00 19.17 ? 163 ASN A CB  1 
ATOM   1078 C  CG  . ASN A 1 163 ? 5.968  -39.827 17.300  1.00 31.73 ? 163 ASN A CG  1 
ATOM   1079 O  OD1 . ASN A 1 163 ? 6.012  -40.745 18.119  1.00 33.34 ? 163 ASN A OD1 1 
ATOM   1080 N  ND2 . ASN A 1 163 ? 4.871  -39.108 17.084  1.00 31.65 ? 163 ASN A ND2 1 
ATOM   1081 N  N   . ASN A 1 164 ? 10.280 -39.510 17.858  1.00 16.13 ? 164 ASN A N   1 
ATOM   1082 C  CA  . ASN A 1 164 ? 11.644 -39.994 17.662  1.00 17.46 ? 164 ASN A CA  1 
ATOM   1083 C  C   . ASN A 1 164 ? 12.602 -38.942 17.115  1.00 15.87 ? 164 ASN A C   1 
ATOM   1084 O  O   . ASN A 1 164 ? 13.606 -39.283 16.493  1.00 16.83 ? 164 ASN A O   1 
ATOM   1085 C  CB  . ASN A 1 164 ? 11.641 -41.209 16.737  1.00 16.41 ? 164 ASN A CB  1 
ATOM   1086 C  CG  . ASN A 1 164 ? 10.861 -42.376 17.321  1.00 19.32 ? 164 ASN A CG  1 
ATOM   1087 O  OD1 . ASN A 1 164 ? 10.913 -42.625 18.525  1.00 20.64 ? 164 ASN A OD1 1 
ATOM   1088 N  ND2 . ASN A 1 164 ? 10.126 -43.089 16.470  1.00 31.01 ? 164 ASN A ND2 1 
ATOM   1089 N  N   . ALA A 1 165 ? 12.301 -37.667 17.344  1.00 12.92 ? 165 ALA A N   1 
ATOM   1090 C  CA  . ALA A 1 165 ? 13.223 -36.608 16.933  1.00 12.17 ? 165 ALA A CA  1 
ATOM   1091 C  C   . ALA A 1 165 ? 14.382 -36.519 17.923  1.00 14.69 ? 165 ALA A C   1 
ATOM   1092 O  O   . ALA A 1 165 ? 14.256 -36.930 19.073  1.00 18.04 ? 165 ALA A O   1 
ATOM   1093 C  CB  . ALA A 1 165 ? 12.509 -35.272 16.841  1.00 13.60 ? 165 ALA A CB  1 
ATOM   1094 N  N   . ASN A 1 166 ? 15.507 -35.972 17.480  1.00 13.28 ? 166 ASN A N   1 
ATOM   1095 C  CA  . ASN A 1 166 ? 16.615 -35.722 18.389  1.00 10.73 ? 166 ASN A CA  1 
ATOM   1096 C  C   . ASN A 1 166 ? 16.558 -34.278 18.843  1.00 10.71 ? 166 ASN A C   1 
ATOM   1097 O  O   . ASN A 1 166 ? 16.835 -33.377 18.052  1.00 14.11 ? 166 ASN A O   1 
ATOM   1098 C  CB  . ASN A 1 166 ? 17.948 -36.024 17.708  1.00 13.48 ? 166 ASN A CB  1 
ATOM   1099 C  CG  . ASN A 1 166 ? 19.124 -35.891 18.644  1.00 20.45 ? 166 ASN A CG  1 
ATOM   1100 O  OD1 . ASN A 1 166 ? 18.955 -35.668 19.842  1.00 16.73 ? 166 ASN A OD1 1 
ATOM   1101 N  ND2 . ASN A 1 166 ? 20.334 -36.046 18.104  1.00 20.90 ? 166 ASN A ND2 1 
ATOM   1102 N  N   . LEU A 1 167 ? 16.169 -34.055 20.097  1.00 10.33 ? 167 LEU A N   1 
ATOM   1103 C  CA  . LEU A 1 167 ? 16.134 -32.698 20.634  1.00 10.68 ? 167 LEU A CA  1 
ATOM   1104 C  C   . LEU A 1 167 ? 17.260 -32.465 21.637  1.00 11.50 ? 167 LEU A C   1 
ATOM   1105 O  O   . LEU A 1 167 ? 17.200 -31.517 22.432  1.00 13.75 ? 167 LEU A O   1 
ATOM   1106 C  CB  . LEU A 1 167 ? 14.777 -32.412 21.295  1.00 11.43 ? 167 LEU A CB  1 
ATOM   1107 C  CG  . LEU A 1 167 ? 13.574 -32.459 20.345  1.00 14.80 ? 167 LEU A CG  1 
ATOM   1108 C  CD1 . LEU A 1 167 ? 12.250 -32.420 21.126  1.00 13.92 ? 167 LEU A CD1 1 
ATOM   1109 C  CD2 . LEU A 1 167 ? 13.646 -31.327 19.342  1.00 20.51 ? 167 LEU A CD2 1 
ATOM   1110 N  N   . SER A 1 168 ? 18.289 -33.312 21.596  1.00 11.48 ? 168 SER A N   1 
ATOM   1111 C  CA  . SER A 1 168 ? 19.411 -33.176 22.529  1.00 12.54 ? 168 SER A CA  1 
ATOM   1112 C  C   . SER A 1 168 ? 20.020 -31.781 22.416  1.00 12.55 ? 168 SER A C   1 
ATOM   1113 O  O   . SER A 1 168 ? 20.359 -31.345 21.315  1.00 13.60 ? 168 SER A O   1 
ATOM   1114 C  CB  . SER A 1 168 ? 20.495 -34.231 22.264  1.00 17.53 ? 168 SER A CB  1 
ATOM   1115 O  OG  . SER A 1 168 ? 19.977 -35.547 22.366  1.00 30.44 ? 168 SER A OG  1 
ATOM   1116 N  N   . GLU A 1 169 ? 20.142 -31.093 23.552  1.00 12.94 ? 169 GLU A N   1 
ATOM   1117 C  CA  . GLU A 1 169 ? 20.704 -29.740 23.633  1.00 13.30 ? 169 GLU A CA  1 
ATOM   1118 C  C   . GLU A 1 169 ? 19.955 -28.705 22.791  1.00 13.74 ? 169 GLU A C   1 
ATOM   1119 O  O   . GLU A 1 169 ? 20.467 -27.609 22.571  1.00 14.18 ? 169 GLU A O   1 
ATOM   1120 C  CB  . GLU A 1 169 ? 22.186 -29.739 23.224  1.00 15.30 ? 169 GLU A CB  1 
ATOM   1121 C  CG  . GLU A 1 169 ? 23.056 -30.631 24.089  1.00 25.80 ? 169 GLU A CG  1 
ATOM   1122 C  CD  . GLU A 1 169 ? 24.343 -31.026 23.397  1.00 55.00 ? 169 GLU A CD  1 
ATOM   1123 O  OE1 . GLU A 1 169 ? 24.364 -32.087 22.736  1.00 64.28 ? 169 GLU A OE1 1 
ATOM   1124 O  OE2 . GLU A 1 169 ? 25.333 -30.272 23.513  1.00 65.08 ? 169 GLU A OE2 1 
ATOM   1125 N  N   . ALA A 1 170 ? 18.749 -29.031 22.339  1.00 11.72 ? 170 ALA A N   1 
ATOM   1126 C  CA  . ALA A 1 170 ? 17.987 -28.072 21.549  1.00 12.17 ? 170 ALA A CA  1 
ATOM   1127 C  C   . ALA A 1 170 ? 17.399 -27.023 22.470  1.00 15.34 ? 170 ALA A C   1 
ATOM   1128 O  O   . ALA A 1 170 ? 17.036 -27.329 23.609  1.00 14.15 ? 170 ALA A O   1 
ATOM   1129 C  CB  . ALA A 1 170 ? 16.880 -28.760 20.759  1.00 11.55 ? 170 ALA A CB  1 
ATOM   1130 N  N   . MET A 1 171 ? 17.314 -25.794 21.972  1.00 11.23 ? 171 MET A N   1 
ATOM   1131 C  CA  . MET A 1 171 ? 16.682 -24.703 22.707  1.00 11.35 ? 171 MET A CA  1 
ATOM   1132 C  C   . MET A 1 171 ? 15.259 -24.500 22.191  1.00 12.49 ? 171 MET A C   1 
ATOM   1133 O  O   . MET A 1 171 ? 15.046 -24.050 21.065  1.00 16.59 ? 171 MET A O   1 
ATOM   1134 C  CB  . MET A 1 171 ? 17.496 -23.419 22.568  1.00 13.89 ? 171 MET A CB  1 
ATOM   1135 C  CG  . MET A 1 171 ? 18.822 -23.496 23.321  1.00 20.16 ? 171 MET A CG  1 
ATOM   1136 S  SD  . MET A 1 171 ? 19.884 -22.055 23.126  1.00 25.04 ? 171 MET A SD  1 
ATOM   1137 C  CE  . MET A 1 171 ? 18.770 -20.757 23.601  1.00 15.37 ? 171 MET A CE  1 
ATOM   1138 N  N   . LEU A 1 172 ? 14.293 -24.858 23.018  1.00 11.87 ? 172 LEU A N   1 
ATOM   1139 C  CA  . LEU A 1 172 ? 12.883 -24.655 22.703  1.00 11.04 ? 172 LEU A CA  1 
ATOM   1140 C  C   . LEU A 1 172 ? 12.303 -23.634 23.670  1.00 11.46 ? 172 LEU A C   1 
ATOM   1141 O  O   . LEU A 1 172 ? 11.165 -23.769 24.130  1.00 14.11 ? 172 LEU A O   1 
ATOM   1142 C  CB  . LEU A 1 172 ? 12.130 -25.981 22.786  1.00 11.78 ? 172 LEU A CB  1 
ATOM   1143 C  CG  . LEU A 1 172 ? 12.406 -26.962 21.645  1.00 18.03 ? 172 LEU A CG  1 
ATOM   1144 C  CD1 . LEU A 1 172 ? 12.266 -28.394 22.127  1.00 27.12 ? 172 LEU A CD1 1 
ATOM   1145 C  CD2 . LEU A 1 172 ? 11.427 -26.717 20.517  1.00 21.58 ? 172 LEU A CD2 1 
ATOM   1146 N  N   . THR A 1 173 ? 13.096 -22.614 23.994  1.00 11.40 ? 173 THR A N   1 
ATOM   1147 C  CA  . THR A 1 173 ? 12.674 -21.634 24.986  1.00 10.83 ? 173 THR A CA  1 
ATOM   1148 C  C   . THR A 1 173 ? 11.578 -20.754 24.402  1.00 13.30 ? 173 THR A C   1 
ATOM   1149 O  O   . THR A 1 173 ? 11.633 -20.362 23.234  1.00 14.53 ? 173 THR A O   1 
ATOM   1150 C  CB  . THR A 1 173 ? 13.846 -20.767 25.485  1.00 15.23 ? 173 THR A CB  1 
ATOM   1151 O  OG1 . THR A 1 173 ? 14.457 -20.126 24.369  1.00 25.46 ? 173 THR A OG1 1 
ATOM   1152 C  CG2 . THR A 1 173 ? 14.902 -21.621 26.188  1.00 13.38 ? 173 THR A CG2 1 
ATOM   1153 N  N   . ARG A 1 174 ? 10.554 -20.495 25.211  1.00 11.95 ? 174 ARG A N   1 
ATOM   1154 C  CA  . ARG A 1 174 ? 9.424  -19.665 24.805  1.00 14.62 ? 174 ARG A CA  1 
ATOM   1155 C  C   . ARG A 1 174 ? 8.706  -20.232 23.572  1.00 14.25 ? 174 ARG A C   1 
ATOM   1156 O  O   . ARG A 1 174 ? 7.994  -19.507 22.873  1.00 17.20 ? 174 ARG A O   1 
ATOM   1157 C  CB  . ARG A 1 174 ? 9.893  -18.224 24.535  1.00 18.24 ? 174 ARG A CB  1 
ATOM   1158 C  CG  . ARG A 1 174 ? 10.745 -17.619 25.671  1.00 20.60 ? 174 ARG A CG  1 
ATOM   1159 C  CD  . ARG A 1 174 ? 11.150 -16.149 25.420  1.00 27.09 ? 174 ARG A CD  1 
ATOM   1160 N  NE  . ARG A 1 174 ? 12.179 -15.997 24.389  1.00 27.75 ? 174 ARG A NE  1 
ATOM   1161 C  CZ  . ARG A 1 174 ? 12.940 -14.911 24.238  1.00 45.38 ? 174 ARG A CZ  1 
ATOM   1162 N  NH1 . ARG A 1 174 ? 12.799 -13.871 25.053  1.00 46.65 ? 174 ARG A NH1 1 
ATOM   1163 N  NH2 . ARG A 1 174 ? 13.848 -14.862 23.268  1.00 42.45 ? 174 ARG A NH2 1 
ATOM   1164 N  N   . ALA A 1 175 ? 8.879  -21.521 23.310  1.00 11.44 ? 175 ALA A N   1 
ATOM   1165 C  CA  . ALA A 1 175 ? 8.241  -22.134 22.145  1.00 13.81 ? 175 ALA A CA  1 
ATOM   1166 C  C   . ALA A 1 175 ? 6.842  -22.630 22.493  1.00 13.13 ? 175 ALA A C   1 
ATOM   1167 O  O   . ALA A 1 175 ? 6.569  -22.993 23.638  1.00 14.77 ? 175 ALA A O   1 
ATOM   1168 C  CB  . ALA A 1 175 ? 9.091  -23.281 21.602  1.00 14.58 ? 175 ALA A CB  1 
ATOM   1169 N  N   . ASN A 1 176 ? 5.953  -22.617 21.507  1.00 11.29 ? 176 ASN A N   1 
ATOM   1170 C  CA  . ASN A 1 176 ? 4.623  -23.190 21.671  1.00 11.68 ? 176 ASN A CA  1 
ATOM   1171 C  C   . ASN A 1 176 ? 4.632  -24.671 21.302  1.00 16.53 ? 176 ASN A C   1 
ATOM   1172 O  O   . ASN A 1 176 ? 4.704  -25.013 20.127  1.00 18.17 ? 176 ASN A O   1 
ATOM   1173 C  CB  . ASN A 1 176 ? 3.615  -22.417 20.809  1.00 12.90 ? 176 ASN A CB  1 
ATOM   1174 C  CG  . ASN A 1 176 ? 2.180  -22.919 20.975  1.00 18.34 ? 176 ASN A CG  1 
ATOM   1175 O  OD1 . ASN A 1 176 ? 1.898  -23.752 21.828  1.00 16.90 ? 176 ASN A OD1 1 
ATOM   1176 N  ND2 . ASN A 1 176 ? 1.269  -22.392 20.161  1.00 24.63 ? 176 ASN A ND2 1 
ATOM   1177 N  N   . LEU A 1 177 ? 4.556  -25.543 22.305  1.00 12.43 ? 177 LEU A N   1 
ATOM   1178 C  CA  . LEU A 1 177 ? 4.538  -26.985 22.070  1.00 11.02 ? 177 LEU A CA  1 
ATOM   1179 C  C   . LEU A 1 177 ? 3.160  -27.578 22.365  1.00 11.82 ? 177 LEU A C   1 
ATOM   1180 O  O   . LEU A 1 177 ? 3.021  -28.788 22.537  1.00 13.37 ? 177 LEU A O   1 
ATOM   1181 C  CB  . LEU A 1 177 ? 5.611  -27.684 22.917  1.00 10.02 ? 177 LEU A CB  1 
ATOM   1182 C  CG  . LEU A 1 177 ? 7.054  -27.464 22.438  1.00 14.77 ? 177 LEU A CG  1 
ATOM   1183 C  CD1 . LEU A 1 177 ? 8.042  -27.850 23.540  1.00 17.83 ? 177 LEU A CD1 1 
ATOM   1184 C  CD2 . LEU A 1 177 ? 7.340  -28.268 21.185  1.00 19.18 ? 177 LEU A CD2 1 
ATOM   1185 N  N   . GLU A 1 178 ? 2.131  -26.738 22.408  1.00 13.05 ? 178 GLU A N   1 
ATOM   1186 C  CA  . GLU A 1 178 ? 0.798  -27.249 22.721  1.00 13.42 ? 178 GLU A CA  1 
ATOM   1187 C  C   . GLU A 1 178 ? 0.366  -28.316 21.716  1.00 16.46 ? 178 GLU A C   1 
ATOM   1188 O  O   . GLU A 1 178 ? 0.481  -28.120 20.507  1.00 15.84 ? 178 GLU A O   1 
ATOM   1189 C  CB  . GLU A 1 178 ? -0.225 -26.118 22.750  1.00 14.73 ? 178 GLU A CB  1 
ATOM   1190 C  CG  . GLU A 1 178 ? -0.064 -25.206 23.950  1.00 18.65 ? 178 GLU A CG  1 
ATOM   1191 C  CD  . GLU A 1 178 ? -1.146 -24.165 24.031  1.00 33.40 ? 178 GLU A CD  1 
ATOM   1192 O  OE1 . GLU A 1 178 ? -1.169 -23.264 23.170  1.00 42.96 ? 178 GLU A OE1 1 
ATOM   1193 O  OE2 . GLU A 1 178 ? -1.975 -24.255 24.952  1.00 31.58 ? 178 GLU A OE2 1 
ATOM   1194 N  N   . GLN A 1 179 ? -0.105 -29.450 22.234  1.00 14.24 ? 179 GLN A N   1 
ATOM   1195 C  CA  . GLN A 1 179 ? -0.589 -30.565 21.421  1.00 14.93 ? 179 GLN A CA  1 
ATOM   1196 C  C   . GLN A 1 179 ? 0.493  -31.227 20.568  1.00 15.07 ? 179 GLN A C   1 
ATOM   1197 O  O   . GLN A 1 179 ? 0.177  -32.068 19.732  1.00 16.57 ? 179 GLN A O   1 
ATOM   1198 C  CB  . GLN A 1 179 ? -1.746 -30.116 20.510  1.00 16.47 ? 179 GLN A CB  1 
ATOM   1199 C  CG  . GLN A 1 179 ? -2.901 -29.441 21.237  1.00 31.34 ? 179 GLN A CG  1 
ATOM   1200 C  CD  . GLN A 1 179 ? -3.655 -30.393 22.132  1.00 43.45 ? 179 GLN A CD  1 
ATOM   1201 O  OE1 . GLN A 1 179 ? -3.690 -31.600 21.886  1.00 45.23 ? 179 GLN A OE1 1 
ATOM   1202 N  NE2 . GLN A 1 179 ? -4.269 -29.858 23.181  1.00 54.19 ? 179 GLN A NE2 1 
ATOM   1203 N  N   . ALA A 1 180 ? 1.761  -30.875 20.773  1.00 12.80 ? 180 ALA A N   1 
ATOM   1204 C  CA  . ALA A 1 180 ? 2.835  -31.537 20.026  1.00 12.26 ? 180 ALA A CA  1 
ATOM   1205 C  C   . ALA A 1 180 ? 3.035  -32.958 20.537  1.00 15.37 ? 180 ALA A C   1 
ATOM   1206 O  O   . ALA A 1 180 ? 2.675  -33.272 21.673  1.00 16.86 ? 180 ALA A O   1 
ATOM   1207 C  CB  . ALA A 1 180 ? 4.144  -30.751 20.125  1.00 11.67 ? 180 ALA A CB  1 
ATOM   1208 N  N   . ASP A 1 181 ? 3.595  -33.822 19.695  1.00 13.18 ? 181 ASP A N   1 
ATOM   1209 C  CA  . ASP A 1 181 ? 3.874  -35.200 20.111  1.00 13.18 ? 181 ASP A CA  1 
ATOM   1210 C  C   . ASP A 1 181 ? 5.376  -35.406 20.200  1.00 13.12 ? 181 ASP A C   1 
ATOM   1211 O  O   . ASP A 1 181 ? 6.061  -35.435 19.183  1.00 13.50 ? 181 ASP A O   1 
ATOM   1212 C  CB  . ASP A 1 181 ? 3.258  -36.207 19.135  1.00 14.90 ? 181 ASP A CB  1 
ATOM   1213 C  CG  . ASP A 1 181 ? 3.352  -37.649 19.642  1.00 22.11 ? 181 ASP A CG  1 
ATOM   1214 O  OD1 . ASP A 1 181 ? 3.959  -37.884 20.710  1.00 17.80 ? 181 ASP A OD1 1 
ATOM   1215 O  OD2 . ASP A 1 181 ? 2.814  -38.546 18.970  1.00 21.41 ? 181 ASP A OD2 1 
ATOM   1216 N  N   . LEU A 1 182 ? 5.887  -35.545 21.418  1.00 11.72 ? 182 LEU A N   1 
ATOM   1217 C  CA  . LEU A 1 182 ? 7.320  -35.724 21.630  1.00 13.25 ? 182 LEU A CA  1 
ATOM   1218 C  C   . LEU A 1 182 ? 7.645  -37.156 22.041  1.00 12.34 ? 182 LEU A C   1 
ATOM   1219 O  O   . LEU A 1 182 ? 8.688  -37.416 22.634  1.00 14.17 ? 182 LEU A O   1 
ATOM   1220 C  CB  . LEU A 1 182 ? 7.845  -34.749 22.694  1.00 12.63 ? 182 LEU A CB  1 
ATOM   1221 C  CG  . LEU A 1 182 ? 8.065  -33.313 22.190  1.00 15.56 ? 182 LEU A CG  1 
ATOM   1222 C  CD1 . LEU A 1 182 ? 6.752  -32.609 21.942  1.00 17.73 ? 182 LEU A CD1 1 
ATOM   1223 C  CD2 . LEU A 1 182 ? 8.927  -32.514 23.167  1.00 17.84 ? 182 LEU A CD2 1 
ATOM   1224 N  N   . SER A 1 183 ? 6.745  -38.083 21.733  1.00 11.99 ? 183 SER A N   1 
ATOM   1225 C  CA  . SER A 1 183 ? 6.987  -39.491 22.051  1.00 13.91 ? 183 SER A CA  1 
ATOM   1226 C  C   . SER A 1 183 ? 8.291  -39.964 21.412  1.00 17.43 ? 183 SER A C   1 
ATOM   1227 O  O   . SER A 1 183 ? 8.495  -39.786 20.212  1.00 16.69 ? 183 SER A O   1 
ATOM   1228 C  CB  . SER A 1 183 ? 5.827  -40.359 21.572  1.00 18.11 ? 183 SER A CB  1 
ATOM   1229 O  OG  . SER A 1 183 ? 4.599  -39.974 22.182  1.00 16.81 ? 183 SER A OG  1 
ATOM   1230 N  N   . GLY A 1 184 ? 9.178  -40.543 22.217  1.00 15.68 ? 184 GLY A N   1 
ATOM   1231 C  CA  . GLY A 1 184 ? 10.426 -41.073 21.699  1.00 15.40 ? 184 GLY A CA  1 
ATOM   1232 C  C   . GLY A 1 184 ? 11.498 -40.041 21.390  1.00 15.73 ? 184 GLY A C   1 
ATOM   1233 O  O   . GLY A 1 184 ? 12.591 -40.405 20.962  1.00 15.89 ? 184 GLY A O   1 
ATOM   1234 N  N   . ALA A 1 185 ? 11.198 -38.758 21.600  1.00 12.73 ? 185 ALA A N   1 
ATOM   1235 C  CA  . ALA A 1 185 ? 12.187 -37.706 21.353  1.00 13.08 ? 185 ALA A CA  1 
ATOM   1236 C  C   . ALA A 1 185 ? 13.335 -37.803 22.352  1.00 14.10 ? 185 ALA A C   1 
ATOM   1237 O  O   . ALA A 1 185 ? 13.111 -38.096 23.530  1.00 15.98 ? 185 ALA A O   1 
ATOM   1238 C  CB  . ALA A 1 185 ? 11.538 -36.330 21.431  1.00 14.80 ? 185 ALA A CB  1 
ATOM   1239 N  N   . ARG A 1 186 ? 14.563 -37.597 21.882  1.00 12.97 ? 186 ARG A N   1 
ATOM   1240 C  CA  . ARG A 1 186 ? 15.711 -37.521 22.791  1.00 13.86 ? 186 ARG A CA  1 
ATOM   1241 C  C   . ARG A 1 186 ? 15.763 -36.127 23.394  1.00 13.33 ? 186 ARG A C   1 
ATOM   1242 O  O   . ARG A 1 186 ? 15.815 -35.148 22.666  1.00 14.46 ? 186 ARG A O   1 
ATOM   1243 C  CB  . ARG A 1 186 ? 17.013 -37.856 22.050  1.00 16.18 ? 186 ARG A CB  1 
ATOM   1244 C  CG  . ARG A 1 186 ? 17.075 -39.322 21.594  1.00 30.86 ? 186 ARG A CG  1 
ATOM   1245 C  CD  . ARG A 1 186 ? 18.025 -39.536 20.415  1.00 43.06 ? 186 ARG A CD  1 
ATOM   1246 N  NE  . ARG A 1 186 ? 19.330 -38.922 20.639  1.00 56.54 ? 186 ARG A NE  1 
ATOM   1247 C  CZ  . ARG A 1 186 ? 20.484 -39.580 20.605  1.00 63.06 ? 186 ARG A CZ  1 
ATOM   1248 N  NH1 . ARG A 1 186 ? 20.502 -40.884 20.355  1.00 66.06 ? 186 ARG A NH1 1 
ATOM   1249 N  NH2 . ARG A 1 186 ? 21.620 -38.929 20.823  1.00 59.96 ? 186 ARG A NH2 1 
ATOM   1250 N  N   . THR A 1 187 ? 15.728 -36.010 24.720  1.00 11.04 ? 187 THR A N   1 
ATOM   1251 C  CA  . THR A 1 187 ? 15.656 -34.669 25.291  1.00 9.86  ? 187 THR A CA  1 
ATOM   1252 C  C   . THR A 1 187 ? 16.739 -34.393 26.326  1.00 12.03 ? 187 THR A C   1 
ATOM   1253 O  O   . THR A 1 187 ? 16.633 -33.438 27.085  1.00 12.15 ? 187 THR A O   1 
ATOM   1254 C  CB  . THR A 1 187 ? 14.266 -34.394 25.927  1.00 14.71 ? 187 THR A CB  1 
ATOM   1255 O  OG1 . THR A 1 187 ? 13.930 -35.431 26.861  1.00 15.51 ? 187 THR A OG1 1 
ATOM   1256 C  CG2 . THR A 1 187 ? 13.189 -34.323 24.839  1.00 20.26 ? 187 THR A CG2 1 
ATOM   1257 N  N   . THR A 1 188 ? 17.787 -35.212 26.351  1.00 11.92 ? 188 THR A N   1 
ATOM   1258 C  CA  . THR A 1 188 ? 18.919 -34.911 27.233  1.00 12.12 ? 188 THR A CA  1 
ATOM   1259 C  C   . THR A 1 188 ? 19.496 -33.547 26.871  1.00 15.03 ? 188 THR A C   1 
ATOM   1260 O  O   . THR A 1 188 ? 19.811 -33.274 25.711  1.00 14.32 ? 188 THR A O   1 
ATOM   1261 C  CB  . THR A 1 188 ? 20.015 -35.991 27.158  1.00 18.98 ? 188 THR A CB  1 
ATOM   1262 O  OG1 . THR A 1 188 ? 19.516 -37.215 27.722  1.00 15.68 ? 188 THR A OG1 1 
ATOM   1263 C  CG2 . THR A 1 188 ? 21.253 -35.551 27.943  1.00 23.13 ? 188 THR A CG2 1 
ATOM   1264 N  N   . GLY A 1 189 ? 19.598 -32.673 27.866  1.00 10.52 ? 189 GLY A N   1 
ATOM   1265 C  CA  . GLY A 1 189 ? 20.108 -31.336 27.642  1.00 13.04 ? 189 GLY A CA  1 
ATOM   1266 C  C   . GLY A 1 189 ? 19.148 -30.383 26.951  1.00 14.94 ? 189 GLY A C   1 
ATOM   1267 O  O   . GLY A 1 189 ? 19.534 -29.253 26.658  1.00 12.59 ? 189 GLY A O   1 
ATOM   1268 N  N   . ALA A 1 190 ? 17.907 -30.804 26.700  1.00 11.98 ? 190 ALA A N   1 
ATOM   1269 C  CA  . ALA A 1 190 ? 16.949 -29.905 26.025  1.00 9.80  ? 190 ALA A CA  1 
ATOM   1270 C  C   . ALA A 1 190 ? 16.534 -28.761 26.943  1.00 9.75  ? 190 ALA A C   1 
ATOM   1271 O  O   . ALA A 1 190 ? 16.459 -28.923 28.167  1.00 11.07 ? 190 ALA A O   1 
ATOM   1272 C  CB  . ALA A 1 190 ? 15.715 -30.667 25.546  1.00 11.86 ? 190 ALA A CB  1 
ATOM   1273 N  N   . ARG A 1 191 ? 16.277 -27.605 26.340  1.00 9.07  ? 191 ARG A N   1 
ATOM   1274 C  CA  . ARG A 1 191 ? 16.051 -26.375 27.086  1.00 9.09  ? 191 ARG A CA  1 
ATOM   1275 C  C   . ARG A 1 191 ? 14.673 -25.825 26.762  1.00 10.40 ? 191 ARG A C   1 
ATOM   1276 O  O   . ARG A 1 191 ? 14.439 -25.285 25.669  1.00 11.18 ? 191 ARG A O   1 
ATOM   1277 C  CB  . ARG A 1 191 ? 17.164 -25.369 26.761  1.00 9.38  ? 191 ARG A CB  1 
ATOM   1278 C  CG  . ARG A 1 191 ? 18.535 -25.925 27.130  1.00 11.29 ? 191 ARG A CG  1 
ATOM   1279 C  CD  . ARG A 1 191 ? 19.661 -25.259 26.356  1.00 15.95 ? 191 ARG A CD  1 
ATOM   1280 N  NE  . ARG A 1 191 ? 19.969 -23.937 26.895  1.00 14.86 ? 191 ARG A NE  1 
ATOM   1281 C  CZ  . ARG A 1 191 ? 21.145 -23.335 26.738  1.00 15.76 ? 191 ARG A CZ  1 
ATOM   1282 N  NH1 . ARG A 1 191 ? 22.105 -23.932 26.042  1.00 14.67 ? 191 ARG A NH1 1 
ATOM   1283 N  NH2 . ARG A 1 191 ? 21.357 -22.139 27.273  1.00 10.42 ? 191 ARG A NH2 1 
ATOM   1284 N  N   . LEU A 1 192 ? 13.745 -26.015 27.700  1.00 9.11  ? 192 LEU A N   1 
ATOM   1285 C  CA  . LEU A 1 192 ? 12.352 -25.692 27.450  1.00 9.25  ? 192 LEU A CA  1 
ATOM   1286 C  C   . LEU A 1 192 ? 11.829 -24.605 28.381  1.00 10.90 ? 192 LEU A C   1 
ATOM   1287 O  O   . LEU A 1 192 ? 10.629 -24.532 28.632  1.00 12.05 ? 192 LEU A O   1 
ATOM   1288 C  CB  . LEU A 1 192 ? 11.484 -26.954 27.579  1.00 9.54  ? 192 LEU A CB  1 
ATOM   1289 C  CG  . LEU A 1 192 ? 11.348 -27.829 26.316  1.00 13.97 ? 192 LEU A CG  1 
ATOM   1290 C  CD1 . LEU A 1 192 ? 12.674 -28.464 25.857  1.00 14.76 ? 192 LEU A CD1 1 
ATOM   1291 C  CD2 . LEU A 1 192 ? 10.314 -28.928 26.545  1.00 14.26 ? 192 LEU A CD2 1 
ATOM   1292 N  N   . ASP A 1 193 ? 12.718 -23.768 28.904  1.00 10.38 ? 193 ASP A N   1 
ATOM   1293 C  CA  . ASP A 1 193 ? 12.264 -22.683 29.778  1.00 10.31 ? 193 ASP A CA  1 
ATOM   1294 C  C   . ASP A 1 193 ? 11.226 -21.830 29.065  1.00 10.70 ? 193 ASP A C   1 
ATOM   1295 O  O   . ASP A 1 193 ? 11.389 -21.518 27.890  1.00 11.12 ? 193 ASP A O   1 
ATOM   1296 C  CB  . ASP A 1 193 ? 13.424 -21.795 30.231  1.00 10.27 ? 193 ASP A CB  1 
ATOM   1297 C  CG  . ASP A 1 193 ? 14.296 -22.450 31.294  1.00 16.58 ? 193 ASP A CG  1 
ATOM   1298 O  OD1 . ASP A 1 193 ? 13.960 -23.559 31.773  1.00 14.46 ? 193 ASP A OD1 1 
ATOM   1299 O  OD2 . ASP A 1 193 ? 15.317 -21.824 31.663  1.00 15.65 ? 193 ASP A OD2 1 
ATOM   1300 N  N   . ASP A 1 194 ? 10.151 -21.498 29.780  1.00 10.17 ? 194 ASP A N   1 
ATOM   1301 C  CA  . ASP A 1 194 ? 9.040  -20.693 29.270  1.00 10.34 ? 194 ASP A CA  1 
ATOM   1302 C  C   . ASP A 1 194 ? 8.255  -21.280 28.093  1.00 12.03 ? 194 ASP A C   1 
ATOM   1303 O  O   . ASP A 1 194 ? 7.431  -20.574 27.502  1.00 12.19 ? 194 ASP A O   1 
ATOM   1304 C  CB  . ASP A 1 194 ? 9.548  -19.305 28.870  1.00 13.33 ? 194 ASP A CB  1 
ATOM   1305 C  CG  . ASP A 1 194 ? 10.258 -18.620 29.997  1.00 22.18 ? 194 ASP A CG  1 
ATOM   1306 O  OD1 . ASP A 1 194 ? 9.663  -18.524 31.091  1.00 16.11 ? 194 ASP A OD1 1 
ATOM   1307 O  OD2 . ASP A 1 194 ? 11.414 -18.208 29.796  1.00 22.41 ? 194 ASP A OD2 1 
ATOM   1308 N  N   . ALA A 1 195 ? 8.481  -22.548 27.757  1.00 11.02 ? 195 ALA A N   1 
ATOM   1309 C  CA  . ALA A 1 195 ? 7.722  -23.179 26.663  1.00 11.41 ? 195 ALA A CA  1 
ATOM   1310 C  C   . ALA A 1 195 ? 6.295  -23.475 27.113  1.00 13.07 ? 195 ALA A C   1 
ATOM   1311 O  O   . ALA A 1 195 ? 6.038  -23.631 28.305  1.00 14.53 ? 195 ALA A O   1 
ATOM   1312 C  CB  . ALA A 1 195 ? 8.415  -24.465 26.188  1.00 10.22 ? 195 ALA A CB  1 
ATOM   1313 N  N   . ASP A 1 196 ? 5.363  -23.538 26.168  1.00 11.49 ? 196 ASP A N   1 
ATOM   1314 C  CA  . ASP A 1 196 ? 3.992  -23.898 26.504  1.00 12.75 ? 196 ASP A CA  1 
ATOM   1315 C  C   . ASP A 1 196 ? 3.814  -25.358 26.153  1.00 11.26 ? 196 ASP A C   1 
ATOM   1316 O  O   . ASP A 1 196 ? 3.804  -25.710 24.973  1.00 14.06 ? 196 ASP A O   1 
ATOM   1317 C  CB  . ASP A 1 196 ? 2.991  -23.024 25.746  1.00 13.75 ? 196 ASP A CB  1 
ATOM   1318 C  CG  . ASP A 1 196 ? 1.554  -23.204 26.237  1.00 17.80 ? 196 ASP A CG  1 
ATOM   1319 O  OD1 . ASP A 1 196 ? 1.279  -24.161 26.995  1.00 13.50 ? 196 ASP A OD1 1 
ATOM   1320 O  OD2 . ASP A 1 196 ? 0.691  -22.387 25.849  1.00 18.00 ? 196 ASP A OD2 1 
ATOM   1321 N  N   . LEU A 1 197 ? 3.687  -26.211 27.169  1.00 10.41 ? 197 LEU A N   1 
ATOM   1322 C  CA  . LEU A 1 197 ? 3.605  -27.652 26.945  1.00 10.33 ? 197 LEU A CA  1 
ATOM   1323 C  C   . LEU A 1 197 ? 2.185  -28.192 27.050  1.00 10.74 ? 197 LEU A C   1 
ATOM   1324 O  O   . LEU A 1 197 ? 1.972  -29.389 26.898  1.00 13.23 ? 197 LEU A O   1 
ATOM   1325 C  CB  . LEU A 1 197 ? 4.492  -28.406 27.946  1.00 12.18 ? 197 LEU A CB  1 
ATOM   1326 C  CG  . LEU A 1 197 ? 5.977  -28.481 27.602  1.00 16.67 ? 197 LEU A CG  1 
ATOM   1327 C  CD1 . LEU A 1 197 ? 6.784  -28.915 28.818  1.00 15.83 ? 197 LEU A CD1 1 
ATOM   1328 C  CD2 . LEU A 1 197 ? 6.182  -29.475 26.451  1.00 16.22 ? 197 LEU A CD2 1 
ATOM   1329 N  N   . ARG A 1 198 ? 1.219  -27.321 27.317  1.00 13.55 ? 198 ARG A N   1 
ATOM   1330 C  CA  . ARG A 1 198 ? -0.136 -27.800 27.614  1.00 14.38 ? 198 ARG A CA  1 
ATOM   1331 C  C   . ARG A 1 198 ? -0.722 -28.658 26.493  1.00 15.73 ? 198 ARG A C   1 
ATOM   1332 O  O   . ARG A 1 198 ? -0.730 -28.255 25.334  1.00 14.28 ? 198 ARG A O   1 
ATOM   1333 C  CB  . ARG A 1 198 ? -1.052 -26.614 27.913  1.00 14.66 ? 198 ARG A CB  1 
ATOM   1334 C  CG  . ARG A 1 198 ? -0.759 -25.944 29.252  1.00 15.80 ? 198 ARG A CG  1 
ATOM   1335 C  CD  . ARG A 1 198 ? -1.608 -24.693 29.442  1.00 18.90 ? 198 ARG A CD  1 
ATOM   1336 N  NE  . ARG A 1 198 ? -1.269 -23.673 28.449  1.00 19.56 ? 198 ARG A NE  1 
ATOM   1337 C  CZ  . ARG A 1 198 ? -1.908 -22.513 28.324  1.00 29.14 ? 198 ARG A CZ  1 
ATOM   1338 N  NH1 . ARG A 1 198 ? -2.928 -22.226 29.131  1.00 26.04 ? 198 ARG A NH1 1 
ATOM   1339 N  NH2 . ARG A 1 198 ? -1.532 -21.639 27.397  1.00 24.50 ? 198 ARG A NH2 1 
ATOM   1340 N  N   . GLY A 1 199 ? -1.187 -29.858 26.849  1.00 13.27 ? 199 GLY A N   1 
ATOM   1341 C  CA  . GLY A 1 199 ? -1.763 -30.763 25.874  1.00 16.98 ? 199 GLY A CA  1 
ATOM   1342 C  C   . GLY A 1 199 ? -0.764 -31.586 25.081  1.00 15.82 ? 199 GLY A C   1 
ATOM   1343 O  O   . GLY A 1 199 ? -1.166 -32.447 24.296  1.00 16.52 ? 199 GLY A O   1 
ATOM   1344 N  N   . ALA A 1 200 ? 0.531  -31.343 25.276  1.00 12.60 ? 200 ALA A N   1 
ATOM   1345 C  CA  . ALA A 1 200 ? 1.538  -32.123 24.556  1.00 12.38 ? 200 ALA A CA  1 
ATOM   1346 C  C   . ALA A 1 200 ? 1.588  -33.562 25.076  1.00 16.76 ? 200 ALA A C   1 
ATOM   1347 O  O   . ALA A 1 200 ? 1.226  -33.845 26.223  1.00 14.42 ? 200 ALA A O   1 
ATOM   1348 C  CB  . ALA A 1 200 ? 2.922  -31.472 24.665  1.00 12.29 ? 200 ALA A CB  1 
ATOM   1349 N  N   . THR A 1 201 ? 2.039  -34.465 24.215  1.00 13.76 ? 201 THR A N   1 
ATOM   1350 C  CA  . THR A 1 201 ? 2.309  -35.845 24.606  1.00 15.22 ? 201 THR A CA  1 
ATOM   1351 C  C   . THR A 1 201 ? 3.804  -36.002 24.825  1.00 13.39 ? 201 THR A C   1 
ATOM   1352 O  O   . THR A 1 201 ? 4.577  -35.797 23.889  1.00 14.79 ? 201 THR A O   1 
ATOM   1353 C  CB  . THR A 1 201 ? 1.857  -36.830 23.529  1.00 15.88 ? 201 THR A CB  1 
ATOM   1354 O  OG1 . THR A 1 201 ? 0.447  -36.693 23.329  1.00 17.86 ? 201 THR A OG1 1 
ATOM   1355 C  CG2 . THR A 1 201 ? 2.177  -38.278 23.942  1.00 18.03 ? 201 THR A CG2 1 
ATOM   1356 N  N   . VAL A 1 202 ? 4.222  -36.334 26.047  1.00 12.61 ? 202 VAL A N   1 
ATOM   1357 C  CA  . VAL A 1 202 ? 5.656  -36.478 26.314  1.00 12.94 ? 202 VAL A CA  1 
ATOM   1358 C  C   . VAL A 1 202 ? 5.922  -37.727 27.137  1.00 14.50 ? 202 VAL A C   1 
ATOM   1359 O  O   . VAL A 1 202 ? 5.053  -38.197 27.880  1.00 17.39 ? 202 VAL A O   1 
ATOM   1360 C  CB  . VAL A 1 202 ? 6.268  -35.248 27.059  1.00 18.08 ? 202 VAL A CB  1 
ATOM   1361 C  CG1 . VAL A 1 202 ? 5.815  -33.932 26.436  1.00 18.97 ? 202 VAL A CG1 1 
ATOM   1362 C  CG2 . VAL A 1 202 ? 5.926  -35.277 28.548  1.00 19.52 ? 202 VAL A CG2 1 
ATOM   1363 N  N   . ASP A 1 203 ? 7.132  -38.260 27.000  1.00 13.41 ? 203 ASP A N   1 
ATOM   1364 C  CA  . ASP A 1 203 ? 7.579  -39.365 27.841  1.00 14.41 ? 203 ASP A CA  1 
ATOM   1365 C  C   . ASP A 1 203 ? 7.990  -38.849 29.211  1.00 14.63 ? 203 ASP A C   1 
ATOM   1366 O  O   . ASP A 1 203 ? 8.443  -37.715 29.339  1.00 14.43 ? 203 ASP A O   1 
ATOM   1367 C  CB  . ASP A 1 203 ? 8.762  -40.094 27.193  1.00 13.51 ? 203 ASP A CB  1 
ATOM   1368 C  CG  . ASP A 1 203 ? 8.404  -40.718 25.858  1.00 17.88 ? 203 ASP A CG  1 
ATOM   1369 O  OD1 . ASP A 1 203 ? 7.265  -41.208 25.710  1.00 18.64 ? 203 ASP A OD1 1 
ATOM   1370 O  OD2 . ASP A 1 203 ? 9.269  -40.728 24.963  1.00 18.52 ? 203 ASP A OD2 1 
ATOM   1371 N  N   . PRO A 1 204 ? 7.852  -39.688 30.246  1.00 12.16 ? 204 PRO A N   1 
ATOM   1372 C  CA  . PRO A 1 204 ? 8.276  -39.254 31.582  1.00 11.19 ? 204 PRO A CA  1 
ATOM   1373 C  C   . PRO A 1 204 ? 9.717  -38.729 31.607  1.00 13.53 ? 204 PRO A C   1 
ATOM   1374 O  O   . PRO A 1 204 ? 10.033 -37.811 32.376  1.00 12.77 ? 204 PRO A O   1 
ATOM   1375 C  CB  . PRO A 1 204 ? 8.136  -40.532 32.414  1.00 13.83 ? 204 PRO A CB  1 
ATOM   1376 C  CG  . PRO A 1 204 ? 6.976  -41.247 31.768  1.00 15.44 ? 204 PRO A CG  1 
ATOM   1377 C  CD  . PRO A 1 204 ? 7.150  -40.983 30.275  1.00 13.89 ? 204 PRO A CD  1 
ATOM   1378 N  N   . VAL A 1 205 ? 10.574 -39.275 30.749  1.00 10.58 ? 205 VAL A N   1 
ATOM   1379 C  CA  . VAL A 1 205 ? 11.979 -38.877 30.757  1.00 10.39 ? 205 VAL A CA  1 
ATOM   1380 C  C   . VAL A 1 205 ? 12.144 -37.380 30.411  1.00 10.22 ? 205 VAL A C   1 
ATOM   1381 O  O   . VAL A 1 205 ? 13.104 -36.747 30.824  1.00 11.00 ? 205 VAL A O   1 
ATOM   1382 C  CB  . VAL A 1 205 ? 12.812 -39.760 29.787  1.00 13.83 ? 205 VAL A CB  1 
ATOM   1383 C  CG1 . VAL A 1 205 ? 12.324 -39.606 28.346  1.00 11.38 ? 205 VAL A CG1 1 
ATOM   1384 C  CG2 . VAL A 1 205 ? 14.305 -39.435 29.904  1.00 13.83 ? 205 VAL A CG2 1 
ATOM   1385 N  N   . LEU A 1 206 ? 11.184 -36.801 29.695  1.00 10.78 ? 206 LEU A N   1 
ATOM   1386 C  CA  . LEU A 1 206 ? 11.272 -35.371 29.393  1.00 10.84 ? 206 LEU A CA  1 
ATOM   1387 C  C   . LEU A 1 206 ? 11.291 -34.570 30.694  1.00 12.14 ? 206 LEU A C   1 
ATOM   1388 O  O   . LEU A 1 206 ? 12.048 -33.606 30.832  1.00 11.55 ? 206 LEU A O   1 
ATOM   1389 C  CB  . LEU A 1 206 ? 10.110 -34.908 28.507  1.00 11.85 ? 206 LEU A CB  1 
ATOM   1390 C  CG  . LEU A 1 206 ? 10.193 -33.442 28.058  1.00 13.91 ? 206 LEU A CG  1 
ATOM   1391 C  CD1 . LEU A 1 206 ? 9.677  -33.305 26.627  1.00 18.33 ? 206 LEU A CD1 1 
ATOM   1392 C  CD2 . LEU A 1 206 ? 9.398  -32.541 28.987  1.00 14.59 ? 206 LEU A CD2 1 
ATOM   1393 N  N   . TRP A 1 207 ? 10.460 -34.976 31.648  1.00 12.06 ? 207 TRP A N   1 
ATOM   1394 C  CA  . TRP A 1 207 ? 10.364 -34.247 32.906  1.00 10.90 ? 207 TRP A CA  1 
ATOM   1395 C  C   . TRP A 1 207 ? 11.647 -34.348 33.709  1.00 14.41 ? 207 TRP A C   1 
ATOM   1396 O  O   . TRP A 1 207 ? 11.915 -33.501 34.559  1.00 12.88 ? 207 TRP A O   1 
ATOM   1397 C  CB  . TRP A 1 207 ? 9.194  -34.762 33.749  1.00 10.79 ? 207 TRP A CB  1 
ATOM   1398 C  CG  . TRP A 1 207 ? 7.871  -34.756 33.051  1.00 10.70 ? 207 TRP A CG  1 
ATOM   1399 C  CD1 . TRP A 1 207 ? 7.058  -35.838 32.847  1.00 10.91 ? 207 TRP A CD1 1 
ATOM   1400 C  CD2 . TRP A 1 207 ? 7.182  -33.625 32.484  1.00 12.14 ? 207 TRP A CD2 1 
ATOM   1401 N  NE1 . TRP A 1 207 ? 5.916  -35.456 32.186  1.00 13.04 ? 207 TRP A NE1 1 
ATOM   1402 C  CE2 . TRP A 1 207 ? 5.968  -34.104 31.948  1.00 13.27 ? 207 TRP A CE2 1 
ATOM   1403 C  CE3 . TRP A 1 207 ? 7.481  -32.258 32.369  1.00 12.07 ? 207 TRP A CE3 1 
ATOM   1404 C  CZ2 . TRP A 1 207 ? 5.048  -33.269 31.312  1.00 11.12 ? 207 TRP A CZ2 1 
ATOM   1405 C  CZ3 . TRP A 1 207 ? 6.563  -31.425 31.741  1.00 13.15 ? 207 TRP A CZ3 1 
ATOM   1406 C  CH2 . TRP A 1 207 ? 5.362  -31.934 31.217  1.00 13.02 ? 207 TRP A CH2 1 
ATOM   1407 N  N   . ARG A 1 208 ? 12.440 -35.382 33.434  1.00 10.86 ? 208 ARG A N   1 
ATOM   1408 C  CA  . ARG A 1 208 ? 13.714 -35.574 34.130  1.00 12.07 ? 208 ARG A CA  1 
ATOM   1409 C  C   . ARG A 1 208 ? 14.892 -34.914 33.427  1.00 16.15 ? 208 ARG A C   1 
ATOM   1410 O  O   . ARG A 1 208 ? 15.949 -34.733 34.028  1.00 18.77 ? 208 ARG A O   1 
ATOM   1411 C  CB  . ARG A 1 208 ? 14.028 -37.073 34.291  1.00 12.15 ? 208 ARG A CB  1 
ATOM   1412 C  CG  . ARG A 1 208 ? 13.100 -37.799 35.255  1.00 14.70 ? 208 ARG A CG  1 
ATOM   1413 C  CD  . ARG A 1 208 ? 13.564 -39.241 35.494  1.00 14.58 ? 208 ARG A CD  1 
ATOM   1414 N  NE  . ARG A 1 208 ? 13.329 -40.129 34.351  1.00 11.39 ? 208 ARG A NE  1 
ATOM   1415 C  CZ  . ARG A 1 208 ? 12.208 -40.804 34.139  1.00 15.21 ? 208 ARG A CZ  1 
ATOM   1416 N  NH1 . ARG A 1 208 ? 11.179 -40.674 34.974  1.00 13.16 ? 208 ARG A NH1 1 
ATOM   1417 N  NH2 . ARG A 1 208 ? 12.108 -41.609 33.081  1.00 12.19 ? 208 ARG A NH2 1 
ATOM   1418 N  N   . THR A 1 209 ? 14.726 -34.574 32.153  1.00 10.33 ? 209 THR A N   1 
ATOM   1419 C  CA  . THR A 1 209 ? 15.872 -34.118 31.356  1.00 9.86  ? 209 THR A CA  1 
ATOM   1420 C  C   . THR A 1 209 ? 15.827 -32.635 30.944  1.00 12.38 ? 209 THR A C   1 
ATOM   1421 O  O   . THR A 1 209 ? 16.865 -31.970 30.899  1.00 15.22 ? 209 THR A O   1 
ATOM   1422 C  CB  . THR A 1 209 ? 16.024 -34.966 30.073  1.00 12.75 ? 209 THR A CB  1 
ATOM   1423 O  OG1 . THR A 1 209 ? 14.742 -35.119 29.438  1.00 14.03 ? 209 THR A OG1 1 
ATOM   1424 C  CG2 . THR A 1 209 ? 16.584 -36.348 30.399  1.00 12.85 ? 209 THR A CG2 1 
ATOM   1425 N  N   . ALA A 1 210 ? 14.647 -32.119 30.621  1.00 11.55 ? 210 ALA A N   1 
ATOM   1426 C  CA  . ALA A 1 210 ? 14.539 -30.736 30.127  1.00 9.38  ? 210 ALA A CA  1 
ATOM   1427 C  C   . ALA A 1 210 ? 14.594 -29.700 31.244  1.00 10.84 ? 210 ALA A C   1 
ATOM   1428 O  O   . ALA A 1 210 ? 14.103 -29.943 32.351  1.00 12.28 ? 210 ALA A O   1 
ATOM   1429 C  CB  . ALA A 1 210 ? 13.244 -30.557 29.331  1.00 9.96  ? 210 ALA A CB  1 
ATOM   1430 N  N   . SER A 1 211 ? 15.175 -28.533 30.969  1.00 12.18 ? 211 SER A N   1 
ATOM   1431 C  CA  . SER A 1 211 ? 14.981 -27.405 31.883  1.00 11.20 ? 211 SER A CA  1 
ATOM   1432 C  C   . SER A 1 211 ? 13.615 -26.804 31.584  1.00 12.23 ? 211 SER A C   1 
ATOM   1433 O  O   . SER A 1 211 ? 13.228 -26.664 30.422  1.00 11.61 ? 211 SER A O   1 
ATOM   1434 C  CB  . SER A 1 211 ? 16.096 -26.351 31.769  1.00 14.62 ? 211 SER A CB  1 
ATOM   1435 O  OG  . SER A 1 211 ? 16.445 -26.065 30.427  1.00 14.71 ? 211 SER A OG  1 
ATOM   1436 N  N   . LEU A 1 212 ? 12.873 -26.481 32.638  1.00 10.39 ? 212 LEU A N   1 
ATOM   1437 C  CA  . LEU A 1 212 ? 11.445 -26.218 32.513  1.00 10.20 ? 212 LEU A CA  1 
ATOM   1438 C  C   . LEU A 1 212 ? 10.992 -25.047 33.361  1.00 11.42 ? 212 LEU A C   1 
ATOM   1439 O  O   . LEU A 1 212 ? 9.814  -24.927 33.688  1.00 10.78 ? 212 LEU A O   1 
ATOM   1440 C  CB  . LEU A 1 212 ? 10.651 -27.473 32.914  1.00 11.64 ? 212 LEU A CB  1 
ATOM   1441 C  CG  . LEU A 1 212 ? 10.771 -28.671 31.974  1.00 10.91 ? 212 LEU A CG  1 
ATOM   1442 C  CD1 . LEU A 1 212 ? 10.391 -29.964 32.705  1.00 13.54 ? 212 LEU A CD1 1 
ATOM   1443 C  CD2 . LEU A 1 212 ? 9.884  -28.438 30.759  1.00 11.67 ? 212 LEU A CD2 1 
ATOM   1444 N  N   . VAL A 1 213 ? 11.923 -24.180 33.736  1.00 10.57 ? 213 VAL A N   1 
ATOM   1445 C  CA  . VAL A 1 213 ? 11.535 -23.020 34.520  1.00 10.97 ? 213 VAL A CA  1 
ATOM   1446 C  C   . VAL A 1 213 ? 10.641 -22.123 33.674  1.00 11.93 ? 213 VAL A C   1 
ATOM   1447 O  O   . VAL A 1 213 ? 11.019 -21.715 32.572  1.00 12.81 ? 213 VAL A O   1 
ATOM   1448 C  CB  . VAL A 1 213 ? 12.756 -22.230 35.015  1.00 11.43 ? 213 VAL A CB  1 
ATOM   1449 C  CG1 . VAL A 1 213 ? 12.294 -20.955 35.731  1.00 13.61 ? 213 VAL A CG1 1 
ATOM   1450 C  CG2 . VAL A 1 213 ? 13.607 -23.104 35.935  1.00 13.67 ? 213 VAL A CG2 1 
ATOM   1451 N  N   . GLY A 1 214 ? 9.444  -21.844 34.176  1.00 11.25 ? 214 GLY A N   1 
ATOM   1452 C  CA  . GLY A 1 214 ? 8.482  -21.021 33.462  1.00 13.35 ? 214 GLY A CA  1 
ATOM   1453 C  C   . GLY A 1 214 ? 7.648  -21.785 32.440  1.00 11.30 ? 214 GLY A C   1 
ATOM   1454 O  O   . GLY A 1 214 ? 6.787  -21.196 31.777  1.00 13.02 ? 214 GLY A O   1 
ATOM   1455 N  N   . ALA A 1 215 ? 7.908  -23.080 32.286  1.00 12.37 ? 215 ALA A N   1 
ATOM   1456 C  CA  . ALA A 1 215 ? 7.185  -23.873 31.294  1.00 11.86 ? 215 ALA A CA  1 
ATOM   1457 C  C   . ALA A 1 215 ? 5.738  -24.051 31.738  1.00 16.14 ? 215 ALA A C   1 
ATOM   1458 O  O   . ALA A 1 215 ? 5.479  -24.341 32.909  1.00 15.76 ? 215 ALA A O   1 
ATOM   1459 C  CB  . ALA A 1 215 ? 7.862  -25.242 31.081  1.00 14.58 ? 215 ALA A CB  1 
ATOM   1460 N  N   . ARG A 1 216 ? 4.796  -23.868 30.812  1.00 15.09 ? 216 ARG A N   1 
ATOM   1461 C  CA  . ARG A 1 216 ? 3.384  -23.953 31.171  1.00 14.52 ? 216 ARG A CA  1 
ATOM   1462 C  C   . ARG A 1 216 ? 2.863  -25.372 30.995  1.00 18.61 ? 216 ARG A C   1 
ATOM   1463 O  O   . ARG A 1 216 ? 3.025  -25.970 29.934  1.00 16.11 ? 216 ARG A O   1 
ATOM   1464 C  CB  . ARG A 1 216 ? 2.556  -22.968 30.343  1.00 16.39 ? 216 ARG A CB  1 
ATOM   1465 C  CG  . ARG A 1 216 ? 3.081  -21.542 30.446  1.00 23.72 ? 216 ARG A CG  1 
ATOM   1466 C  CD  . ARG A 1 216 ? 2.192  -20.540 29.726  1.00 28.30 ? 216 ARG A CD  1 
ATOM   1467 N  NE  . ARG A 1 216 ? 0.897  -20.402 30.386  1.00 40.80 ? 216 ARG A NE  1 
ATOM   1468 C  CZ  . ARG A 1 216 ? -0.054 -19.564 29.984  1.00 48.34 ? 216 ARG A CZ  1 
ATOM   1469 N  NH1 . ARG A 1 216 ? 0.156  -18.786 28.929  1.00 47.15 ? 216 ARG A NH1 1 
ATOM   1470 N  NH2 . ARG A 1 216 ? -1.207 -19.499 30.639  1.00 49.28 ? 216 ARG A NH2 1 
ATOM   1471 N  N   . VAL A 1 217 ? 2.239  -25.903 32.045  1.00 14.27 ? 217 VAL A N   1 
ATOM   1472 C  CA  . VAL A 1 217 ? 1.729  -27.275 32.037  1.00 14.39 ? 217 VAL A CA  1 
ATOM   1473 C  C   . VAL A 1 217 ? 0.309  -27.356 32.584  1.00 20.42 ? 217 VAL A C   1 
ATOM   1474 O  O   . VAL A 1 217 ? -0.114 -26.457 33.314  1.00 17.95 ? 217 VAL A O   1 
ATOM   1475 C  CB  . VAL A 1 217 ? 2.638  -28.212 32.866  1.00 14.61 ? 217 VAL A CB  1 
ATOM   1476 C  CG1 . VAL A 1 217 ? 4.021  -28.293 32.241  1.00 12.66 ? 217 VAL A CG1 1 
ATOM   1477 C  CG2 . VAL A 1 217 ? 2.732  -27.725 34.326  1.00 15.65 ? 217 VAL A CG2 1 
ATOM   1478 N  N   . ASP A 1 218 ? -0.418 -28.413 32.198  1.00 17.57 ? 218 ASP A N   1 
ATOM   1479 C  CA  . ASP A 1 218 ? -1.703 -28.776 32.810  1.00 23.38 ? 218 ASP A CA  1 
ATOM   1480 C  C   . ASP A 1 218 ? -1.469 -29.416 34.174  1.00 17.71 ? 218 ASP A C   1 
ATOM   1481 O  O   . ASP A 1 218 ? -0.356 -29.870 34.479  1.00 18.04 ? 218 ASP A O   1 
ATOM   1482 C  CB  . ASP A 1 218 ? -2.493 -29.790 31.958  1.00 27.90 ? 218 ASP A CB  1 
ATOM   1483 C  CG  . ASP A 1 218 ? -2.653 -29.374 30.511  1.00 42.36 ? 218 ASP A CG  1 
ATOM   1484 O  OD1 . ASP A 1 218 ? -3.080 -28.225 30.248  1.00 42.93 ? 218 ASP A OD1 1 
ATOM   1485 O  OD2 . ASP A 1 218 ? -2.375 -30.227 29.632  1.00 43.18 ? 218 ASP A OD2 1 
ATOM   1486 N  N   . VAL A 1 219 ? -2.528 -29.513 34.976  1.00 19.42 ? 219 VAL A N   1 
ATOM   1487 C  CA  . VAL A 1 219 ? -2.428 -30.218 36.258  1.00 18.01 ? 219 VAL A CA  1 
ATOM   1488 C  C   . VAL A 1 219 ? -1.977 -31.668 36.065  1.00 16.23 ? 219 VAL A C   1 
ATOM   1489 O  O   . VAL A 1 219 ? -1.126 -32.169 36.806  1.00 16.92 ? 219 VAL A O   1 
ATOM   1490 C  CB  . VAL A 1 219 ? -3.774 -30.188 37.018  1.00 22.01 ? 219 VAL A CB  1 
ATOM   1491 C  CG1 . VAL A 1 219 ? -3.779 -31.187 38.167  1.00 23.63 ? 219 VAL A CG1 1 
ATOM   1492 C  CG2 . VAL A 1 219 ? -4.055 -28.777 37.529  1.00 27.60 ? 219 VAL A CG2 1 
ATOM   1493 N  N   . ASP A 1 220 ? -2.531 -32.343 35.062  1.00 18.78 ? 220 ASP A N   1 
ATOM   1494 C  CA  . ASP A 1 220 ? -2.140 -33.731 34.807  1.00 21.78 ? 220 ASP A CA  1 
ATOM   1495 C  C   . ASP A 1 220 ? -0.651 -33.841 34.493  1.00 17.52 ? 220 ASP A C   1 
ATOM   1496 O  O   . ASP A 1 220 ? 0.004  -34.813 34.877  1.00 16.70 ? 220 ASP A O   1 
ATOM   1497 C  CB  . ASP A 1 220 ? -2.949 -34.323 33.656  1.00 27.65 ? 220 ASP A CB  1 
ATOM   1498 C  CG  . ASP A 1 220 ? -4.395 -34.587 34.029  1.00 38.63 ? 220 ASP A CG  1 
ATOM   1499 O  OD1 . ASP A 1 220 ? -4.706 -34.642 35.238  1.00 35.27 ? 220 ASP A OD1 1 
ATOM   1500 O  OD2 . ASP A 1 220 ? -5.222 -34.740 33.105  1.00 48.06 ? 220 ASP A OD2 1 
ATOM   1501 N  N   . GLN A 1 221 ? -0.119 -32.842 33.790  1.00 16.32 ? 221 GLN A N   1 
ATOM   1502 C  CA  . GLN A 1 221 ? 1.310  -32.822 33.469  1.00 14.25 ? 221 GLN A CA  1 
ATOM   1503 C  C   . GLN A 1 221 ? 2.177  -32.538 34.687  1.00 13.79 ? 221 GLN A C   1 
ATOM   1504 O  O   . GLN A 1 221 ? 3.250  -33.118 34.833  1.00 12.91 ? 221 GLN A O   1 
ATOM   1505 C  CB  . GLN A 1 221 ? 1.597  -31.786 32.391  1.00 15.14 ? 221 GLN A CB  1 
ATOM   1506 C  CG  . GLN A 1 221 ? 0.969  -32.129 31.060  1.00 17.57 ? 221 GLN A CG  1 
ATOM   1507 C  CD  . GLN A 1 221 ? 1.195  -31.042 30.052  1.00 16.30 ? 221 GLN A CD  1 
ATOM   1508 O  OE1 . GLN A 1 221 ? 0.888  -29.884 30.309  1.00 20.52 ? 221 GLN A OE1 1 
ATOM   1509 N  NE2 . GLN A 1 221 ? 1.746  -31.404 28.893  1.00 17.57 ? 221 GLN A NE2 1 
ATOM   1510 N  N   . ALA A 1 222 ? 1.729  -31.631 35.551  1.00 12.80 ? 222 ALA A N   1 
ATOM   1511 C  CA  . ALA A 1 222 ? 2.452  -31.360 36.788  1.00 14.90 ? 222 ALA A CA  1 
ATOM   1512 C  C   . ALA A 1 222 ? 2.524  -32.615 37.646  1.00 13.96 ? 222 ALA A C   1 
ATOM   1513 O  O   . ALA A 1 222 ? 3.557  -32.912 38.247  1.00 13.37 ? 222 ALA A O   1 
ATOM   1514 C  CB  . ALA A 1 222 ? 1.791  -30.215 37.559  1.00 17.16 ? 222 ALA A CB  1 
ATOM   1515 N  N   . VAL A 1 223 ? 1.422  -33.355 37.706  1.00 14.02 ? 223 VAL A N   1 
ATOM   1516 C  CA  . VAL A 1 223 ? 1.413  -34.603 38.453  1.00 12.86 ? 223 VAL A CA  1 
ATOM   1517 C  C   . VAL A 1 223 ? 2.393  -35.593 37.812  1.00 16.65 ? 223 VAL A C   1 
ATOM   1518 O  O   . VAL A 1 223 ? 3.130  -36.297 38.505  1.00 16.61 ? 223 VAL A O   1 
ATOM   1519 C  CB  . VAL A 1 223 ? 0.002  -35.211 38.520  1.00 16.02 ? 223 VAL A CB  1 
ATOM   1520 C  CG1 . VAL A 1 223 ? 0.061  -36.629 39.088  1.00 17.39 ? 223 VAL A CG1 1 
ATOM   1521 C  CG2 . VAL A 1 223 ? -0.909 -34.338 39.377  1.00 17.33 ? 223 VAL A CG2 1 
ATOM   1522 N  N   . ALA A 1 224 ? 2.411  -35.635 36.483  1.00 14.77 ? 224 ALA A N   1 
ATOM   1523 C  CA  . ALA A 1 224 ? 3.314  -36.537 35.773  1.00 13.00 ? 224 ALA A CA  1 
ATOM   1524 C  C   . ALA A 1 224 ? 4.769  -36.156 36.017  1.00 12.56 ? 224 ALA A C   1 
ATOM   1525 O  O   . ALA A 1 224 ? 5.636  -37.026 36.091  1.00 12.95 ? 224 ALA A O   1 
ATOM   1526 C  CB  . ALA A 1 224 ? 3.006  -36.537 34.273  1.00 14.71 ? 224 ALA A CB  1 
ATOM   1527 N  N   . PHE A 1 225 ? 5.033  -34.856 36.138  1.00 11.10 ? 225 PHE A N   1 
ATOM   1528 C  CA  . PHE A 1 225 ? 6.370  -34.362 36.469  1.00 12.17 ? 225 PHE A CA  1 
ATOM   1529 C  C   . PHE A 1 225 ? 6.797  -34.916 37.838  1.00 12.35 ? 225 PHE A C   1 
ATOM   1530 O  O   . PHE A 1 225 ? 7.916  -35.420 38.000  1.00 11.16 ? 225 PHE A O   1 
ATOM   1531 C  CB  . PHE A 1 225 ? 6.381  -32.824 36.442  1.00 10.94 ? 225 PHE A CB  1 
ATOM   1532 C  CG  . PHE A 1 225 ? 7.682  -32.205 36.876  1.00 10.67 ? 225 PHE A CG  1 
ATOM   1533 C  CD1 . PHE A 1 225 ? 7.905  -31.890 38.214  1.00 13.43 ? 225 PHE A CD1 1 
ATOM   1534 C  CD2 . PHE A 1 225 ? 8.671  -31.922 35.948  1.00 10.98 ? 225 PHE A CD2 1 
ATOM   1535 C  CE1 . PHE A 1 225 ? 9.102  -31.308 38.616  1.00 13.35 ? 225 PHE A CE1 1 
ATOM   1536 C  CE2 . PHE A 1 225 ? 9.868  -31.335 36.337  1.00 12.53 ? 225 PHE A CE2 1 
ATOM   1537 C  CZ  . PHE A 1 225 ? 10.085 -31.032 37.675  1.00 13.91 ? 225 PHE A CZ  1 
ATOM   1538 N  N   . ALA A 1 226 ? 5.897  -34.847 38.815  1.00 11.04 ? 226 ALA A N   1 
ATOM   1539 C  CA  . ALA A 1 226 ? 6.181  -35.378 40.149  1.00 14.10 ? 226 ALA A CA  1 
ATOM   1540 C  C   . ALA A 1 226 ? 6.410  -36.891 40.092  1.00 11.63 ? 226 ALA A C   1 
ATOM   1541 O  O   . ALA A 1 226 ? 7.376  -37.410 40.662  1.00 12.95 ? 226 ALA A O   1 
ATOM   1542 C  CB  . ALA A 1 226 ? 5.037  -35.047 41.108  1.00 12.31 ? 226 ALA A CB  1 
ATOM   1543 N  N   . ALA A 1 227 ? 5.537  -37.597 39.382  1.00 12.14 ? 227 ALA A N   1 
ATOM   1544 C  CA  . ALA A 1 227 ? 5.670  -39.048 39.262  1.00 16.15 ? 227 ALA A CA  1 
ATOM   1545 C  C   . ALA A 1 227 ? 6.992  -39.439 38.596  1.00 16.26 ? 227 ALA A C   1 
ATOM   1546 O  O   . ALA A 1 227 ? 7.611  -40.447 38.953  1.00 14.77 ? 227 ALA A O   1 
ATOM   1547 C  CB  . ALA A 1 227 ? 4.494  -39.628 38.480  1.00 19.15 ? 227 ALA A CB  1 
ATOM   1548 N  N   . ALA A 1 228 ? 7.409  -38.643 37.619  1.00 13.67 ? 228 ALA A N   1 
ATOM   1549 C  CA  . ALA A 1 228 ? 8.650  -38.902 36.894  1.00 14.26 ? 228 ALA A CA  1 
ATOM   1550 C  C   . ALA A 1 228 ? 9.877  -38.727 37.793  1.00 12.16 ? 228 ALA A C   1 
ATOM   1551 O  O   . ALA A 1 228 ? 10.969 -39.207 37.462  1.00 15.21 ? 228 ALA A O   1 
ATOM   1552 C  CB  . ALA A 1 228 ? 8.753  -37.987 35.662  1.00 12.96 ? 228 ALA A CB  1 
ATOM   1553 N  N   . HIS A 1 229 ? 9.698  -38.073 38.939  1.00 10.88 ? 229 HIS A N   1 
ATOM   1554 C  CA  . HIS A 1 229 ? 10.785 -37.947 39.910  1.00 11.91 ? 229 HIS A CA  1 
ATOM   1555 C  C   . HIS A 1 229 ? 10.618 -38.946 41.057  1.00 16.78 ? 229 HIS A C   1 
ATOM   1556 O  O   . HIS A 1 229 ? 11.310 -38.857 42.069  1.00 15.36 ? 229 HIS A O   1 
ATOM   1557 C  CB  . HIS A 1 229 ? 10.877 -36.512 40.446  1.00 12.34 ? 229 HIS A CB  1 
ATOM   1558 C  CG  . HIS A 1 229 ? 11.405 -35.539 39.436  1.00 13.64 ? 229 HIS A CG  1 
ATOM   1559 N  ND1 . HIS A 1 229 ? 10.636 -35.051 38.401  1.00 13.57 ? 229 HIS A ND1 1 
ATOM   1560 C  CD2 . HIS A 1 229 ? 12.635 -34.994 39.278  1.00 18.35 ? 229 HIS A CD2 1 
ATOM   1561 C  CE1 . HIS A 1 229 ? 11.363 -34.232 37.659  1.00 19.24 ? 229 HIS A CE1 1 
ATOM   1562 N  NE2 . HIS A 1 229 ? 12.581 -34.180 38.170  1.00 18.57 ? 229 HIS A NE2 1 
ATOM   1563 N  N   . GLY A 1 230 ? 9.703  -39.895 40.882  1.00 13.28 ? 230 GLY A N   1 
ATOM   1564 C  CA  . GLY A 1 230 ? 9.588  -41.025 41.791  1.00 12.57 ? 230 GLY A CA  1 
ATOM   1565 C  C   . GLY A 1 230 ? 8.531  -40.866 42.866  1.00 12.96 ? 230 GLY A C   1 
ATOM   1566 O  O   . GLY A 1 230 ? 8.333  -41.776 43.678  1.00 14.04 ? 230 GLY A O   1 
ATOM   1567 N  N   . LEU A 1 231 ? 7.839  -39.726 42.878  1.00 13.64 ? 231 LEU A N   1 
ATOM   1568 C  CA  . LEU A 1 231 ? 6.794  -39.515 43.884  1.00 15.75 ? 231 LEU A CA  1 
ATOM   1569 C  C   . LEU A 1 231 ? 5.590  -40.399 43.577  1.00 16.70 ? 231 LEU A C   1 
ATOM   1570 O  O   . LEU A 1 231 ? 5.284  -40.671 42.417  1.00 15.79 ? 231 LEU A O   1 
ATOM   1571 C  CB  . LEU A 1 231 ? 6.385  -38.037 43.958  1.00 12.95 ? 231 LEU A CB  1 
ATOM   1572 C  CG  . LEU A 1 231 ? 7.337  -37.128 44.738  1.00 14.39 ? 231 LEU A CG  1 
ATOM   1573 C  CD1 . LEU A 1 231 ? 8.699  -36.984 44.043  1.00 15.92 ? 231 LEU A CD1 1 
ATOM   1574 C  CD2 . LEU A 1 231 ? 6.685  -35.765 44.952  1.00 13.91 ? 231 LEU A CD2 1 
ATOM   1575 N  N   A CYS A 1 232 ? 4.932  -40.868 44.629  0.50 12.63 ? 232 CYS A N   1 
ATOM   1576 N  N   B CYS A 1 232 ? 4.889  -40.817 44.627  0.50 12.57 ? 232 CYS A N   1 
ATOM   1577 C  CA  A CYS A 1 232 ? 3.818  -41.791 44.485  0.50 15.44 ? 232 CYS A CA  1 
ATOM   1578 C  CA  B CYS A 1 232 ? 3.839  -41.831 44.529  0.50 15.77 ? 232 CYS A CA  1 
ATOM   1579 C  C   A CYS A 1 232 ? 2.498  -41.098 44.731  0.50 18.31 ? 232 CYS A C   1 
ATOM   1580 C  C   B CYS A 1 232 ? 2.434  -41.288 44.815  0.50 18.67 ? 232 CYS A C   1 
ATOM   1581 O  O   A CYS A 1 232 ? 2.322  -40.414 45.739  0.50 14.32 ? 232 CYS A O   1 
ATOM   1582 O  O   B CYS A 1 232 ? 2.132  -40.900 45.944  0.50 15.02 ? 232 CYS A O   1 
ATOM   1583 C  CB  A CYS A 1 232 ? 3.970  -42.964 45.450  0.50 18.54 ? 232 CYS A CB  1 
ATOM   1584 C  CB  B CYS A 1 232 ? 4.156  -42.975 45.496  0.50 18.73 ? 232 CYS A CB  1 
ATOM   1585 S  SG  A CYS A 1 232 ? 5.339  -44.038 45.039  0.50 25.83 ? 232 CYS A SG  1 
ATOM   1586 S  SG  B CYS A 1 232 ? 2.846  -44.188 45.705  0.50 19.57 ? 232 CYS A SG  1 
ATOM   1587 N  N   . LEU A 1 233 ? 1.568  -41.282 43.801  1.00 17.40 ? 233 LEU A N   1 
ATOM   1588 C  CA  . LEU A 1 233 ? 0.208  -40.789 43.986  1.00 22.60 ? 233 LEU A CA  1 
ATOM   1589 C  C   . LEU A 1 233 ? -0.770 -41.936 44.238  1.00 32.69 ? 233 LEU A C   1 
ATOM   1590 O  O   . LEU A 1 233 ? -1.926 -41.706 44.594  1.00 38.10 ? 233 LEU A O   1 
ATOM   1591 C  CB  . LEU A 1 233 ? -0.234 -39.964 42.781  1.00 25.45 ? 233 LEU A CB  1 
ATOM   1592 C  CG  . LEU A 1 233 ? 0.366  -38.566 42.916  1.00 26.10 ? 233 LEU A CG  1 
ATOM   1593 C  CD1 . LEU A 1 233 ? 1.631  -38.444 42.077  1.00 20.39 ? 233 LEU A CD1 1 
ATOM   1594 C  CD2 . LEU A 1 233 ? -0.650 -37.489 42.606  1.00 30.20 ? 233 LEU A CD2 1 
ATOM   1595 N  N   . ALA A 1 234 ? -0.293 -43.162 44.049  1.00 33.01 ? 234 ALA A N   1 
ATOM   1596 C  CA  . ALA A 1 234 ? -1.056 -44.369 44.389  1.00 52.19 ? 234 ALA A CA  1 
ATOM   1597 C  C   . ALA A 1 234 ? -2.448 -44.392 43.756  1.00 64.43 ? 234 ALA A C   1 
ATOM   1598 O  O   . ALA A 1 234 ? -2.601 -44.182 42.552  1.00 70.79 ? 234 ALA A O   1 
ATOM   1599 C  CB  . ALA A 1 234 ? -1.169 -44.508 45.907  1.00 49.93 ? 234 ALA A CB  1 
HETATM 1600 CL CL  . CL  B 2 .   ? 22.092 -10.385 -10.254 1.00 16.45 ? 301 CL  A CL  1 
HETATM 1601 CL CL  . CL  C 2 .   ? 18.212 -21.747 28.261  1.00 14.09 ? 302 CL  A CL  1 
HETATM 1602 O  O   . HOH D 3 .   ? 11.786 -35.984 -8.772  1.00 43.81 ? 401 HOH A O   1 
HETATM 1603 O  O   . HOH D 3 .   ? 23.606 -25.007 18.819  1.00 21.13 ? 402 HOH A O   1 
HETATM 1604 O  O   . HOH D 3 .   ? 19.600 -11.979 -4.332  1.00 32.10 ? 403 HOH A O   1 
HETATM 1605 O  O   . HOH D 3 .   ? -2.008 -32.773 11.392  1.00 38.80 ? 404 HOH A O   1 
HETATM 1606 O  O   . HOH D 3 .   ? 0.210  -33.164 14.122  1.00 22.53 ? 405 HOH A O   1 
HETATM 1607 O  O   . HOH D 3 .   ? 23.171 -35.663 16.075  1.00 35.34 ? 406 HOH A O   1 
HETATM 1608 O  O   . HOH D 3 .   ? 4.925  -15.689 -4.058  1.00 36.73 ? 407 HOH A O   1 
HETATM 1609 O  O   . HOH D 3 .   ? 16.610 -16.467 18.661  1.00 31.75 ? 408 HOH A O   1 
HETATM 1610 O  O   . HOH D 3 .   ? -3.957 -23.294 15.476  1.00 40.55 ? 409 HOH A O   1 
HETATM 1611 O  O   . HOH D 3 .   ? 28.838 -21.907 -6.288  1.00 18.15 ? 410 HOH A O   1 
HETATM 1612 O  O   . HOH D 3 .   ? 7.722  -42.494 18.822  1.00 37.31 ? 411 HOH A O   1 
HETATM 1613 O  O   . HOH D 3 .   ? 4.888  -40.561 24.996  1.00 35.03 ? 412 HOH A O   1 
HETATM 1614 O  O   . HOH D 3 .   ? 16.444 -22.701 33.794  1.00 18.22 ? 413 HOH A O   1 
HETATM 1615 O  O   . HOH D 3 .   ? 26.458 -23.164 -9.840  1.00 30.55 ? 414 HOH A O   1 
HETATM 1616 O  O   . HOH D 3 .   ? 11.802 -40.295 24.736  1.00 29.24 ? 415 HOH A O   1 
HETATM 1617 O  O   . HOH D 3 .   ? 13.180 -15.614 19.199  1.00 33.65 ? 416 HOH A O   1 
HETATM 1618 O  O   . HOH D 3 .   ? 20.875 -7.395  -12.229 1.00 33.65 ? 417 HOH A O   1 
HETATM 1619 O  O   . HOH D 3 .   ? 3.764  -17.639 4.783   1.00 40.32 ? 418 HOH A O   1 
HETATM 1620 O  O   . HOH D 3 .   ? 23.400 -30.635 -11.517 1.00 39.52 ? 419 HOH A O   1 
HETATM 1621 O  O   . HOH D 3 .   ? 2.778  -17.637 -6.501  1.00 36.36 ? 420 HOH A O   1 
HETATM 1622 O  O   . HOH D 3 .   ? -3.054 -30.994 9.928   1.00 36.20 ? 421 HOH A O   1 
HETATM 1623 O  O   . HOH D 3 .   ? 17.242 -15.062 14.470  1.00 18.53 ? 422 HOH A O   1 
HETATM 1624 O  O   . HOH D 3 .   ? 25.920 -27.800 18.745  1.00 29.76 ? 423 HOH A O   1 
HETATM 1625 O  O   . HOH D 3 .   ? 0.145  -30.046 -0.149  0.55 30.19 ? 424 HOH A O   1 
HETATM 1626 O  O   . HOH D 3 .   ? 13.583 -31.453 34.600  1.00 19.37 ? 425 HOH A O   1 
HETATM 1627 O  O   . HOH D 3 .   ? 21.889 -28.206 27.255  1.00 27.41 ? 426 HOH A O   1 
HETATM 1628 O  O   . HOH D 3 .   ? -1.594 -23.164 20.365  1.00 31.61 ? 427 HOH A O   1 
HETATM 1629 O  O   . HOH D 3 .   ? 6.458  -17.057 12.487  1.00 35.44 ? 428 HOH A O   1 
HETATM 1630 O  O   . HOH D 3 .   ? 13.599 -37.582 42.491  1.00 35.64 ? 429 HOH A O   1 
HETATM 1631 O  O   . HOH D 3 .   ? 23.081 -19.681 9.426   1.00 18.11 ? 430 HOH A O   1 
HETATM 1632 O  O   . HOH D 3 .   ? 4.408  -31.125 -0.490  1.00 39.28 ? 431 HOH A O   1 
HETATM 1633 O  O   . HOH D 3 .   ? 13.479 -10.806 4.976   1.00 45.61 ? 432 HOH A O   1 
HETATM 1634 O  O   . HOH D 3 .   ? 3.022  -17.143 -0.768  1.00 52.57 ? 433 HOH A O   1 
HETATM 1635 O  O   . HOH D 3 .   ? 12.417 -7.730  -9.969  1.00 33.88 ? 434 HOH A O   1 
HETATM 1636 O  O   . HOH D 3 .   ? 26.163 -28.121 12.502  1.00 30.56 ? 435 HOH A O   1 
HETATM 1637 O  O   . HOH D 3 .   ? -4.298 -22.960 24.830  1.00 48.55 ? 436 HOH A O   1 
HETATM 1638 O  O   . HOH D 3 .   ? 8.371  -44.381 43.121  1.00 32.73 ? 437 HOH A O   1 
HETATM 1639 O  O   . HOH D 3 .   ? 5.596  -39.231 9.949   1.00 29.04 ? 438 HOH A O   1 
HETATM 1640 O  O   . HOH D 3 .   ? 27.746 -26.449 16.024  1.00 55.17 ? 439 HOH A O   1 
HETATM 1641 O  O   . HOH D 3 .   ? -2.273 -39.836 46.492  1.00 35.84 ? 440 HOH A O   1 
HETATM 1642 O  O   . HOH D 3 .   ? 2.452  -32.189 8.399   1.00 32.31 ? 441 HOH A O   1 
HETATM 1643 O  O   . HOH D 3 .   ? 7.838  -14.442 10.339  1.00 34.21 ? 442 HOH A O   1 
HETATM 1644 O  O   . HOH D 3 .   ? -0.735 -37.348 35.450  1.00 24.04 ? 443 HOH A O   1 
HETATM 1645 O  O   . HOH D 3 .   ? 24.220 -33.152 2.889   1.00 36.67 ? 444 HOH A O   1 
HETATM 1646 O  O   . HOH D 3 .   ? 23.145 -36.790 20.158  1.00 46.00 ? 445 HOH A O   1 
HETATM 1647 O  O   . HOH D 3 .   ? 17.751 -8.836  -10.080 1.00 18.36 ? 446 HOH A O   1 
HETATM 1648 O  O   . HOH D 3 .   ? 2.491  -34.072 28.615  1.00 30.23 ? 447 HOH A O   1 
HETATM 1649 O  O   . HOH D 3 .   ? 14.615 -32.783 37.024  1.00 29.46 ? 448 HOH A O   1 
HETATM 1650 O  O   . HOH D 3 .   ? 1.278  -20.430 24.050  1.00 33.26 ? 449 HOH A O   1 
HETATM 1651 O  O   . HOH D 3 .   ? 7.085  -17.691 31.364  1.00 50.81 ? 450 HOH A O   1 
HETATM 1652 O  O   . HOH D 3 .   ? 21.707 -33.443 -1.173  1.00 33.83 ? 451 HOH A O   1 
HETATM 1653 O  O   . HOH D 3 .   ? 4.536  -19.884 -14.531 1.00 36.73 ? 452 HOH A O   1 
HETATM 1654 O  O   . HOH D 3 .   ? 10.638 -44.600 20.385  1.00 25.93 ? 453 HOH A O   1 
HETATM 1655 O  O   . HOH D 3 .   ? 7.570  -15.880 18.651  1.00 46.03 ? 454 HOH A O   1 
HETATM 1656 O  O   . HOH D 3 .   ? 15.543 -6.521  -17.341 1.00 50.89 ? 455 HOH A O   1 
HETATM 1657 O  O   . HOH D 3 .   ? 17.719 -26.056 -20.288 1.00 50.30 ? 456 HOH A O   1 
HETATM 1658 O  O   . HOH D 3 .   ? 23.923 -34.890 22.331  1.00 46.97 ? 457 HOH A O   1 
HETATM 1659 O  O   . HOH D 3 .   ? 25.692 -32.595 6.877   1.00 34.19 ? 458 HOH A O   1 
HETATM 1660 O  O   . HOH D 3 .   ? -3.342 -27.177 14.543  1.00 26.95 ? 459 HOH A O   1 
HETATM 1661 O  O   . HOH D 3 .   ? 20.684 -37.856 23.678  1.00 16.43 ? 460 HOH A O   1 
HETATM 1662 O  O   . HOH D 3 .   ? -0.771 -34.435 22.334  1.00 35.42 ? 461 HOH A O   1 
HETATM 1663 O  O   . HOH D 3 .   ? 18.793 -28.224 -18.038 1.00 50.52 ? 462 HOH A O   1 
HETATM 1664 O  O   . HOH D 3 .   ? 5.010  -14.523 -8.139  1.00 34.37 ? 463 HOH A O   1 
HETATM 1665 O  O   . HOH D 3 .   ? -0.086 -21.698 11.216  1.00 22.06 ? 464 HOH A O   1 
HETATM 1666 O  O   . HOH D 3 .   ? 3.797  -42.103 19.061  1.00 48.77 ? 465 HOH A O   1 
HETATM 1667 O  O   . HOH D 3 .   ? 5.548  -39.378 34.641  1.00 17.50 ? 466 HOH A O   1 
HETATM 1668 O  O   . HOH D 3 .   ? 8.260  -13.852 -1.622  1.00 41.74 ? 467 HOH A O   1 
HETATM 1669 O  O   . HOH D 3 .   ? 10.161 -10.730 -4.832  1.00 41.18 ? 468 HOH A O   1 
HETATM 1670 O  O   . HOH D 3 .   ? 10.981 -15.480 21.947  1.00 46.02 ? 469 HOH A O   1 
HETATM 1671 O  O   . HOH D 3 .   ? 6.470  -42.465 40.470  1.00 27.76 ? 470 HOH A O   1 
HETATM 1672 O  O   . HOH D 3 .   ? 7.034  -20.404 -13.995 1.00 36.76 ? 471 HOH A O   1 
HETATM 1673 O  O   . HOH D 3 .   ? 5.742  -30.912 -2.658  1.00 45.61 ? 472 HOH A O   1 
HETATM 1674 O  O   . HOH D 3 .   ? 21.423 -13.472 -10.817 1.00 13.19 ? 473 HOH A O   1 
HETATM 1675 O  O   . HOH D 3 .   ? 21.892 -14.415 -8.301  1.00 13.72 ? 474 HOH A O   1 
HETATM 1676 O  O   . HOH D 3 .   ? 2.481  -20.724 -8.126  1.00 21.53 ? 475 HOH A O   1 
HETATM 1677 O  O   . HOH D 3 .   ? 10.265 -41.160 1.000   1.00 46.24 ? 476 HOH A O   1 
HETATM 1678 O  O   . HOH D 3 .   ? 19.196 -25.757 30.886  1.00 18.64 ? 477 HOH A O   1 
HETATM 1679 O  O   . HOH D 3 .   ? 5.576  -19.043 21.522  1.00 34.11 ? 478 HOH A O   1 
HETATM 1680 O  O   . HOH D 3 .   ? -3.391 -27.528 24.481  1.00 39.27 ? 479 HOH A O   1 
HETATM 1681 O  O   . HOH D 3 .   ? 6.121  -18.120 16.522  1.00 29.26 ? 480 HOH A O   1 
HETATM 1682 O  O   . HOH D 3 .   ? 29.175 -27.611 8.538   1.00 53.88 ? 481 HOH A O   1 
HETATM 1683 O  O   . HOH D 3 .   ? 7.310  -29.101 -10.096 1.00 38.48 ? 482 HOH A O   1 
HETATM 1684 O  O   . HOH D 3 .   ? 11.768 -37.041 26.046  1.00 16.47 ? 483 HOH A O   1 
HETATM 1685 O  O   . HOH D 3 .   ? 1.683  -31.226 4.040   1.00 48.77 ? 484 HOH A O   1 
HETATM 1686 O  O   . HOH D 3 .   ? 9.066  -36.936 25.426  1.00 14.33 ? 485 HOH A O   1 
HETATM 1687 O  O   . HOH D 3 .   ? 10.534 -40.607 10.288  1.00 46.11 ? 486 HOH A O   1 
HETATM 1688 O  O   . HOH D 3 .   ? 18.358 -38.273 25.365  1.00 16.57 ? 487 HOH A O   1 
HETATM 1689 O  O   . HOH D 3 .   ? 15.674 -23.708 29.061  1.00 12.25 ? 488 HOH A O   1 
HETATM 1690 O  O   . HOH D 3 .   ? 2.989  -39.989 27.125  1.00 33.00 ? 489 HOH A O   1 
HETATM 1691 O  O   . HOH D 3 .   ? 0.411  -34.159 17.822  1.00 34.11 ? 490 HOH A O   1 
HETATM 1692 O  O   . HOH D 3 .   ? 0.199  -42.130 47.631  1.00 34.55 ? 491 HOH A O   1 
HETATM 1693 O  O   . HOH D 3 .   ? 20.066 -37.859 30.440  1.00 21.17 ? 492 HOH A O   1 
HETATM 1694 O  O   . HOH D 3 .   ? 18.398 -8.990  4.521   1.00 35.86 ? 493 HOH A O   1 
HETATM 1695 O  O   . HOH D 3 .   ? 12.047 -11.843 17.890  1.00 47.82 ? 494 HOH A O   1 
HETATM 1696 O  O   . HOH D 3 .   ? 24.282 -16.763 1.616   1.00 43.83 ? 495 HOH A O   1 
HETATM 1697 O  O   . HOH D 3 .   ? 20.308 -10.798 -17.225 1.00 23.07 ? 496 HOH A O   1 
HETATM 1698 O  O   . HOH D 3 .   ? -1.208 -33.641 27.716  1.00 34.40 ? 497 HOH A O   1 
HETATM 1699 O  O   . HOH D 3 .   ? 5.327  -19.859 25.691  1.00 30.36 ? 498 HOH A O   1 
HETATM 1700 O  O   . HOH D 3 .   ? 18.481 -29.753 30.047  1.00 16.85 ? 499 HOH A O   1 
HETATM 1701 O  O   . HOH D 3 .   ? 22.230 -18.986 6.872   1.00 18.98 ? 500 HOH A O   1 
HETATM 1702 O  O   . HOH D 3 .   ? 21.097 -25.095 21.329  1.00 28.48 ? 501 HOH A O   1 
HETATM 1703 O  O   . HOH D 3 .   ? 7.119  -16.091 7.148   1.00 32.38 ? 502 HOH A O   1 
HETATM 1704 O  O   . HOH D 3 .   ? 17.660 -38.016 11.154  1.00 41.83 ? 503 HOH A O   1 
HETATM 1705 O  O   . HOH D 3 .   ? 20.435 -34.679 2.431   1.00 36.91 ? 504 HOH A O   1 
HETATM 1706 O  O   . HOH D 3 .   ? 19.392 -33.368 30.706  1.00 15.05 ? 505 HOH A O   1 
HETATM 1707 O  O   . HOH D 3 .   ? -0.392 -32.583 9.750   1.00 43.51 ? 506 HOH A O   1 
HETATM 1708 O  O   . HOH D 3 .   ? 17.840 -9.121  -5.145  1.00 32.73 ? 507 HOH A O   1 
HETATM 1709 O  O   . HOH D 3 .   ? 8.228  -13.100 -5.989  1.00 40.46 ? 508 HOH A O   1 
HETATM 1710 O  O   . HOH D 3 .   ? 15.426 -38.340 26.432  1.00 19.61 ? 509 HOH A O   1 
HETATM 1711 O  O   . HOH D 3 .   ? 13.064 -40.383 1.285   1.00 43.10 ? 510 HOH A O   1 
HETATM 1712 O  O   . HOH D 3 .   ? 22.991 -12.489 -1.191  1.00 19.05 ? 511 HOH A O   1 
HETATM 1713 O  O   . HOH D 3 .   ? 16.129 -40.647 12.544  1.00 40.62 ? 512 HOH A O   1 
HETATM 1714 O  O   . HOH D 3 .   ? 22.440 -26.151 24.136  1.00 24.45 ? 513 HOH A O   1 
HETATM 1715 O  O   . HOH D 3 .   ? 27.482 -15.476 -2.435  1.00 34.77 ? 514 HOH A O   1 
HETATM 1716 O  O   . HOH D 3 .   ? 23.931 -15.850 -7.174  1.00 13.40 ? 515 HOH A O   1 
HETATM 1717 O  O   . HOH D 3 .   ? 3.624  -17.423 -9.669  1.00 45.28 ? 516 HOH A O   1 
HETATM 1718 O  O   . HOH D 3 .   ? 15.230 -41.374 15.248  1.00 35.57 ? 517 HOH A O   1 
HETATM 1719 O  O   . HOH D 3 .   ? 13.830 -18.694 28.218  1.00 23.66 ? 518 HOH A O   1 
HETATM 1720 O  O   . HOH D 3 .   ? -5.427 -32.365 31.405  1.00 57.21 ? 519 HOH A O   1 
HETATM 1721 O  O   . HOH D 3 .   ? 24.045 -16.651 -15.593 1.00 26.16 ? 520 HOH A O   1 
HETATM 1722 O  O   . HOH D 3 .   ? 24.596 -30.173 16.667  1.00 34.29 ? 521 HOH A O   1 
HETATM 1723 O  O   . HOH D 3 .   ? 5.399  -42.805 27.338  1.00 40.36 ? 522 HOH A O   1 
HETATM 1724 O  O   . HOH D 3 .   ? 17.842 -5.888  -14.012 1.00 49.26 ? 523 HOH A O   1 
HETATM 1725 O  O   . HOH D 3 .   ? 9.725  -14.445 -13.961 1.00 47.79 ? 524 HOH A O   1 
HETATM 1726 O  O   . HOH D 3 .   ? 30.536 -20.580 -5.090  1.00 37.74 ? 525 HOH A O   1 
HETATM 1727 O  O   . HOH D 3 .   ? 15.307 -20.528 -19.478 1.00 35.82 ? 526 HOH A O   1 
HETATM 1728 O  O   . HOH D 3 .   ? 8.408  -45.367 17.264  1.00 53.17 ? 527 HOH A O   1 
HETATM 1729 O  O   . HOH D 3 .   ? 23.739 -27.842 -12.032 1.00 25.69 ? 528 HOH A O   1 
HETATM 1730 O  O   . HOH D 3 .   ? 14.766 -9.690  -2.825  1.00 32.20 ? 529 HOH A O   1 
HETATM 1731 O  O   . HOH D 3 .   ? 33.648 -23.097 6.802   1.00 51.98 ? 530 HOH A O   1 
HETATM 1732 O  O   . HOH D 3 .   ? 12.610 -37.724 44.494  1.00 32.91 ? 531 HOH A O   1 
HETATM 1733 O  O   . HOH D 3 .   ? 4.438  -37.723 30.947  1.00 25.30 ? 532 HOH A O   1 
HETATM 1734 O  O   . HOH D 3 .   ? 6.586  -23.410 -14.899 1.00 47.28 ? 533 HOH A O   1 
HETATM 1735 O  O   . HOH D 3 .   ? 25.605 -20.753 -7.625  1.00 49.06 ? 534 HOH A O   1 
HETATM 1736 O  O   . HOH D 3 .   ? 1.756  -33.252 12.106  1.00 36.03 ? 535 HOH A O   1 
HETATM 1737 O  O   . HOH D 3 .   ? 25.914 -19.429 6.210   1.00 42.87 ? 536 HOH A O   1 
HETATM 1738 O  O   . HOH D 3 .   ? 26.496 -30.765 3.791   1.00 40.98 ? 537 HOH A O   1 
HETATM 1739 O  O   . HOH D 3 .   ? 13.049 -9.549  -5.041  1.00 32.65 ? 538 HOH A O   1 
HETATM 1740 O  O   . HOH D 3 .   ? 28.524 -28.312 -1.503  1.00 44.45 ? 539 HOH A O   1 
HETATM 1741 O  O   . HOH D 3 .   ? 2.480  -42.251 41.076  1.00 37.21 ? 540 HOH A O   1 
HETATM 1742 O  O   . HOH D 3 .   ? 11.191 -13.486 27.596  1.00 41.52 ? 541 HOH A O   1 
HETATM 1743 O  O   . HOH D 3 .   ? 7.793  -43.480 23.760  1.00 26.10 ? 542 HOH A O   1 
HETATM 1744 O  O   . HOH D 3 .   ? 9.741  -32.045 -12.359 1.00 35.50 ? 543 HOH A O   1 
HETATM 1745 O  O   . HOH D 3 .   ? 1.862  -37.202 27.777  1.00 24.27 ? 544 HOH A O   1 
HETATM 1746 O  O   . HOH D 3 .   ? 7.538  -38.824 4.221   1.00 28.50 ? 545 HOH A O   1 
HETATM 1747 O  O   . HOH D 3 .   ? -5.091 -31.575 33.560  1.00 24.09 ? 546 HOH A O   1 
HETATM 1748 O  O   . HOH D 3 .   ? 24.885 -30.115 20.442  1.00 27.44 ? 547 HOH A O   1 
HETATM 1749 O  O   . HOH D 3 .   ? -3.285 -31.361 16.957  1.00 34.08 ? 548 HOH A O   1 
HETATM 1750 O  O   . HOH D 3 .   ? 27.506 -28.597 1.902   1.00 36.32 ? 549 HOH A O   1 
HETATM 1751 O  O   . HOH D 3 .   ? 2.531  -17.984 -12.940 1.00 37.39 ? 550 HOH A O   1 
HETATM 1752 O  O   . HOH D 3 .   ? 25.665 -31.985 -1.712  1.00 36.23 ? 551 HOH A O   1 
HETATM 1753 O  O   . HOH D 3 .   ? 18.085 -36.955 33.966  1.00 22.57 ? 552 HOH A O   1 
HETATM 1754 O  O   . HOH D 3 .   ? -5.110 -28.155 33.975  1.00 37.81 ? 553 HOH A O   1 
HETATM 1755 O  O   . HOH D 3 .   ? 24.711 -23.549 -16.810 1.00 31.17 ? 554 HOH A O   1 
HETATM 1756 O  O   . HOH D 3 .   ? -4.604 -28.812 27.611  1.00 47.65 ? 555 HOH A O   1 
HETATM 1757 O  O   . HOH D 3 .   ? 5.214  -40.512 13.314  1.00 25.75 ? 556 HOH A O   1 
HETATM 1758 O  O   . HOH D 3 .   ? 6.407  -17.446 10.348  1.00 37.94 ? 557 HOH A O   1 
HETATM 1759 O  O   . HOH D 3 .   ? 4.371  -35.399 6.399   1.00 33.93 ? 558 HOH A O   1 
HETATM 1760 O  O   . HOH D 3 .   ? 8.791  -12.244 -12.834 1.00 21.40 ? 559 HOH A O   1 
HETATM 1761 O  O   . HOH D 3 .   ? 9.844  -42.538 38.269  1.00 32.76 ? 560 HOH A O   1 
HETATM 1762 O  O   . HOH D 3 .   ? 22.611 -34.630 6.372   1.00 25.87 ? 561 HOH A O   1 
HETATM 1763 O  O   . HOH D 3 .   ? -1.333 -21.957 16.406  1.00 48.45 ? 562 HOH A O   1 
HETATM 1764 O  O   . HOH D 3 .   ? 17.554 -12.385 -20.152 1.00 46.60 ? 563 HOH A O   1 
HETATM 1765 O  O   . HOH D 3 .   ? 8.325  -32.636 -7.811  1.00 30.60 ? 564 HOH A O   1 
HETATM 1766 O  O   . HOH D 3 .   ? 14.762 -26.884 35.145  1.00 20.66 ? 565 HOH A O   1 
HETATM 1767 O  O   . HOH D 3 .   ? 19.336 -10.535 1.394   1.00 20.13 ? 566 HOH A O   1 
HETATM 1768 O  O   . HOH D 3 .   ? 7.114  -33.413 -3.353  1.00 18.86 ? 567 HOH A O   1 
HETATM 1769 O  O   . HOH D 3 .   ? 5.047  -16.129 0.102   1.00 33.72 ? 568 HOH A O   1 
HETATM 1770 O  O   . HOH D 3 .   ? -0.009 -23.413 -0.827  1.00 44.50 ? 569 HOH A O   1 
HETATM 1771 O  O   . HOH D 3 .   ? -1.375 -34.513 12.772  1.00 39.90 ? 570 HOH A O   1 
HETATM 1772 O  O   . HOH D 3 .   ? -1.220 -33.342 15.880  1.00 34.26 ? 571 HOH A O   1 
HETATM 1773 O  O   . HOH D 3 .   ? 25.822 -32.243 9.941   1.00 17.21 ? 572 HOH A O   1 
HETATM 1774 O  O   . HOH D 3 .   ? 11.243 -36.752 -5.326  1.00 37.43 ? 573 HOH A O   1 
HETATM 1775 O  O   . HOH D 3 .   ? 0.364  -18.277 7.473   1.00 31.84 ? 574 HOH A O   1 
HETATM 1776 O  O   . HOH D 3 .   ? 19.501 -17.754 -20.788 1.00 32.95 ? 575 HOH A O   1 
HETATM 1777 O  O   . HOH D 3 .   ? 5.685  -34.431 1.384   1.00 13.61 ? 576 HOH A O   1 
HETATM 1778 O  O   . HOH D 3 .   ? 8.047  -14.336 13.287  1.00 44.71 ? 577 HOH A O   1 
HETATM 1779 O  O   . HOH D 3 .   ? 22.563 -26.794 -14.479 1.00 28.09 ? 578 HOH A O   1 
HETATM 1780 O  O   . HOH D 3 .   ? 3.446  -18.044 9.273   1.00 15.79 ? 579 HOH A O   1 
HETATM 1781 O  O   . HOH D 3 .   ? 6.898  -30.242 -7.050  1.00 45.87 ? 580 HOH A O   1 
HETATM 1782 O  O   . HOH D 3 .   ? 10.013 -37.536 -2.073  1.00 34.71 ? 581 HOH A O   1 
HETATM 1783 O  O   . HOH D 3 .   ? 2.287  -19.606 18.852  1.00 27.47 ? 582 HOH A O   1 
HETATM 1784 O  O   . HOH D 3 .   ? 7.901  -14.618 -4.141  1.00 46.52 ? 583 HOH A O   1 
HETATM 1785 O  O   . HOH D 3 .   ? 27.630 -23.388 -7.353  1.00 46.06 ? 584 HOH A O   1 
HETATM 1786 O  O   . HOH D 3 .   ? 1.572  -17.758 11.651  1.00 35.30 ? 585 HOH A O   1 
HETATM 1787 O  O   . HOH D 3 .   ? 7.770  -15.576 1.093   1.00 35.29 ? 586 HOH A O   1 
HETATM 1788 O  O   . HOH D 3 .   ? 10.842 -40.070 4.849   1.00 42.43 ? 587 HOH A O   1 
HETATM 1789 O  O   . HOH D 3 .   ? 1.152  -29.865 -4.200  1.00 37.88 ? 588 HOH A O   1 
HETATM 1790 O  O   . HOH D 3 .   ? 8.761  -12.535 3.302   1.00 46.83 ? 589 HOH A O   1 
HETATM 1791 O  O   . HOH D 3 .   ? 24.964 -17.290 -23.174 1.00 23.66 ? 590 HOH A O   1 
HETATM 1792 O  O   . HOH D 3 .   ? 2.677  -18.954 26.793  1.00 45.09 ? 591 HOH A O   1 
HETATM 1793 O  O   . HOH D 3 .   ? 23.712 -14.305 -14.558 1.00 22.77 ? 592 HOH A O   1 
HETATM 1794 O  O   . HOH D 3 .   ? 9.483  -43.436 34.298  1.00 21.32 ? 593 HOH A O   1 
HETATM 1795 O  O   . HOH D 3 .   ? 10.471 -15.107 29.031  1.00 46.73 ? 594 HOH A O   1 
HETATM 1796 O  O   . HOH D 3 .   ? 3.798  -33.177 6.391   1.00 37.12 ? 595 HOH A O   1 
HETATM 1797 O  O   . HOH D 3 .   ? 20.253 -38.206 15.555  1.00 41.20 ? 596 HOH A O   1 
HETATM 1798 O  O   . HOH D 3 .   ? 5.493  -18.396 14.322  1.00 32.04 ? 597 HOH A O   1 
HETATM 1799 O  O   . HOH D 3 .   ? 3.133  -18.798 14.042  1.00 23.83 ? 598 HOH A O   1 
HETATM 1800 O  O   . HOH D 3 .   ? 6.621  -16.612 4.820   1.00 30.78 ? 599 HOH A O   1 
HETATM 1801 O  O   . HOH D 3 .   ? -3.259 -18.115 32.933  1.00 53.89 ? 600 HOH A O   1 
HETATM 1802 O  O   . HOH D 3 .   ? 2.613  -35.892 10.962  1.00 15.28 ? 601 HOH A O   1 
HETATM 1803 O  O   . HOH D 3 .   ? 24.790 -27.511 21.618  1.00 29.98 ? 602 HOH A O   1 
HETATM 1804 O  O   . HOH D 3 .   ? 12.826 -38.382 -2.178  1.00 33.62 ? 603 HOH A O   1 
HETATM 1805 O  O   . HOH D 3 .   ? 17.663 -38.043 14.607  1.00 37.13 ? 604 HOH A O   1 
HETATM 1806 O  O   . HOH D 3 .   ? 30.088 -23.898 12.771  1.00 50.10 ? 605 HOH A O   1 
HETATM 1807 O  O   . HOH D 3 .   ? 27.605 -22.523 6.955   1.00 38.72 ? 606 HOH A O   1 
HETATM 1808 O  O   . HOH D 3 .   ? 22.904 -32.101 -3.124  1.00 45.08 ? 607 HOH A O   1 
HETATM 1809 O  O   . HOH D 3 .   ? 6.573  -15.514 15.496  1.00 44.04 ? 608 HOH A O   1 
HETATM 1810 O  O   . HOH D 3 .   ? 21.303 -35.951 10.661  1.00 37.68 ? 609 HOH A O   1 
HETATM 1811 O  O   . HOH D 3 .   ? 2.007  -31.471 1.013   1.00 50.51 ? 610 HOH A O   1 
HETATM 1812 O  O   . HOH D 3 .   ? 4.796  -19.287 19.111  1.00 36.94 ? 611 HOH A O   1 
HETATM 1813 O  O   . HOH D 3 .   ? 18.358 -37.999 -3.664  1.00 35.74 ? 612 HOH A O   1 
HETATM 1814 O  O   . HOH D 3 .   ? 8.942  -29.511 -12.058 1.00 41.38 ? 613 HOH A O   1 
HETATM 1815 O  O   . HOH D 3 .   ? 14.019 -39.237 39.182  1.00 28.00 ? 614 HOH A O   1 
HETATM 1816 O  O   . HOH D 3 .   ? 13.546 -12.954 10.799  1.00 51.73 ? 615 HOH A O   1 
HETATM 1817 O  O   . HOH D 3 .   ? 10.502 -41.905 13.187  1.00 28.58 ? 616 HOH A O   1 
HETATM 1818 O  O   . HOH D 3 .   ? 20.716 -36.842 0.997   1.00 44.92 ? 617 HOH A O   1 
HETATM 1819 O  O   . HOH D 3 .   ? 27.403 -21.049 10.307  1.00 33.50 ? 618 HOH A O   1 
HETATM 1820 O  O   . HOH D 3 .   ? 0.016  -35.946 31.506  1.00 35.23 ? 619 HOH A O   1 
HETATM 1821 O  O   . HOH D 3 .   ? 31.784 -21.482 8.752   1.00 36.16 ? 620 HOH A O   1 
HETATM 1822 O  O   . HOH D 3 .   ? 21.834 -33.258 1.235   1.00 35.75 ? 621 HOH A O   1 
HETATM 1823 O  O   . HOH D 3 .   ? 4.057  -20.256 23.549  1.00 30.31 ? 622 HOH A O   1 
HETATM 1824 O  O   . HOH D 3 .   ? 1.513  -35.053 15.820  1.00 35.91 ? 623 HOH A O   1 
HETATM 1825 O  O   . HOH D 3 .   ? 20.290 -38.374 -1.275  1.00 50.92 ? 624 HOH A O   1 
HETATM 1826 O  O   . HOH D 3 .   ? 12.883 -12.882 19.819  0.45 29.07 ? 625 HOH A O   1 
HETATM 1827 O  O   . HOH D 3 .   ? 7.111  -13.335 -8.684  1.00 32.16 ? 626 HOH A O   1 
HETATM 1828 O  O   . HOH D 3 .   ? 25.860 -25.845 20.029  0.47 18.91 ? 627 HOH A O   1 
HETATM 1829 O  O   . HOH D 3 .   ? 14.904 -39.266 41.224  1.00 39.05 ? 628 HOH A O   1 
HETATM 1830 O  O   . HOH D 3 .   ? -3.648 -34.695 25.936  1.00 48.73 ? 629 HOH A O   1 
HETATM 1831 O  O   . HOH D 3 .   ? -0.793 -19.194 11.182  1.00 32.44 ? 630 HOH A O   1 
HETATM 1832 O  O   . HOH D 3 .   ? 6.404  -41.798 35.644  1.00 23.86 ? 631 HOH A O   1 
HETATM 1833 O  O   . HOH D 3 .   ? 27.053 -30.414 11.813  1.00 34.00 ? 632 HOH A O   1 
HETATM 1834 O  O   . HOH D 3 .   ? -4.073 -25.889 22.004  1.00 34.11 ? 633 HOH A O   1 
HETATM 1835 O  O   . HOH D 3 .   ? 16.613 -28.941 35.069  1.00 39.12 ? 634 HOH A O   1 
HETATM 1836 O  O   . HOH D 3 .   ? 2.417  -36.032 30.713  1.00 20.16 ? 635 HOH A O   1 
HETATM 1837 O  O   . HOH D 3 .   ? -1.506 -18.376 8.753   1.00 30.04 ? 636 HOH A O   1 
HETATM 1838 O  O   . HOH D 3 .   ? 13.160 -10.007 -1.060  1.00 47.83 ? 637 HOH A O   1 
HETATM 1839 O  O   . HOH D 3 .   ? 3.875  -43.712 21.535  1.00 57.76 ? 638 HOH A O   1 
HETATM 1840 O  O   . HOH D 3 .   ? 1.189  -39.298 36.354  1.00 26.96 ? 639 HOH A O   1 
HETATM 1841 O  O   . HOH D 3 .   ? 16.817 -6.430  -11.130 1.00 37.64 ? 640 HOH A O   1 
HETATM 1842 O  O   . HOH D 3 .   ? 28.768 -20.027 -8.103  1.00 25.98 ? 641 HOH A O   1 
HETATM 1843 O  O   . HOH D 3 .   ? 5.206  -43.355 37.744  1.00 43.54 ? 642 HOH A O   1 
HETATM 1844 O  O   . HOH D 3 .   ? 23.901 -36.607 9.959   1.00 60.45 ? 643 HOH A O   1 
HETATM 1845 O  O   . HOH D 3 .   ? 28.154 -28.230 21.533  1.00 46.64 ? 644 HOH A O   1 
HETATM 1846 O  O   . HOH D 3 .   ? 16.395 -9.957  0.954   1.00 30.10 ? 645 HOH A O   1 
HETATM 1847 O  O   . HOH D 3 .   ? -5.139 -29.667 11.667  1.00 41.26 ? 646 HOH A O   1 
HETATM 1848 O  O   . HOH D 3 .   ? 27.542 -24.555 -11.816 1.00 37.04 ? 647 HOH A O   1 
HETATM 1849 O  O   . HOH D 3 .   ? 6.920  -43.895 21.262  1.00 39.54 ? 648 HOH A O   1 
HETATM 1850 O  O   . HOH D 3 .   ? 25.607 -17.807 -7.890  1.00 17.73 ? 649 HOH A O   1 
HETATM 1851 O  O   . HOH D 3 .   ? 29.053 -25.446 -7.411  1.00 45.07 ? 650 HOH A O   1 
HETATM 1852 O  O   . HOH D 3 .   ? 10.355 -12.927 12.555  1.00 46.54 ? 651 HOH A O   1 
HETATM 1853 O  O   . HOH D 3 .   ? 11.284 -7.581  -7.617  1.00 61.61 ? 652 HOH A O   1 
HETATM 1854 O  O   . HOH D 3 .   ? 20.023 -9.060  -0.741  1.00 43.24 ? 653 HOH A O   1 
HETATM 1855 O  O   . HOH D 3 .   ? 15.241 -34.541 41.537  1.00 42.40 ? 654 HOH A O   1 
HETATM 1856 O  O   . HOH D 3 .   ? 9.251  -8.690  -9.095  1.00 53.97 ? 655 HOH A O   1 
HETATM 1857 O  O   . HOH D 3 .   ? 24.852 -16.713 4.764   1.00 21.96 ? 656 HOH A O   1 
HETATM 1858 O  O   . HOH D 3 .   ? 6.561  -44.853 41.059  1.00 40.70 ? 657 HOH A O   1 
HETATM 1859 O  O   . HOH D 3 .   ? 3.929  -43.898 24.160  1.00 44.91 ? 658 HOH A O   1 
HETATM 1860 O  O   . HOH D 3 .   ? 13.033 -29.646 36.688  1.00 26.80 ? 659 HOH A O   1 
HETATM 1861 O  O   . HOH D 3 .   ? 20.148 -6.055  -10.010 1.00 39.59 ? 660 HOH A O   1 
HETATM 1862 O  O   . HOH D 3 .   ? 8.387  -10.172 -6.720  1.00 50.43 ? 661 HOH A O   1 
HETATM 1863 O  O   . HOH D 3 .   ? 8.789  -44.333 31.439  1.00 23.54 ? 662 HOH A O   1 
HETATM 1864 O  O   . HOH D 3 .   ? 2.818  -40.407 34.717  1.00 41.84 ? 663 HOH A O   1 
HETATM 1865 O  O   . HOH D 3 .   ? 15.376 -37.128 40.659  1.00 36.61 ? 664 HOH A O   1 
HETATM 1866 O  O   . HOH D 3 .   ? 26.535 -27.027 -12.600 1.00 40.21 ? 665 HOH A O   1 
HETATM 1867 O  O   . HOH D 3 .   ? 7.883  -40.710 9.217   1.00 47.65 ? 666 HOH A O   1 
HETATM 1868 O  O   . HOH D 3 .   ? 3.437  -39.954 31.994  1.00 32.88 ? 667 HOH A O   1 
HETATM 1869 O  O   . HOH D 3 .   ? 0.873  -16.005 -9.082  1.00 37.30 ? 668 HOH A O   1 
HETATM 1870 O  O   . HOH D 3 .   ? 3.818  -42.479 30.512  1.00 39.76 ? 669 HOH A O   1 
HETATM 1871 O  O   . HOH D 3 .   ? 0.783  -40.627 38.941  1.00 27.78 ? 670 HOH A O   1 
HETATM 1872 O  O   . HOH D 3 .   ? -3.230 -38.879 40.377  1.00 47.78 ? 671 HOH A O   1 
HETATM 1873 O  O   . HOH D 3 .   ? -1.749 -40.238 39.187  1.00 38.06 ? 672 HOH A O   1 
HETATM 1874 O  O   . HOH D 3 .   ? 2.627  -42.887 37.048  1.00 42.96 ? 673 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
11   N N   . MET A 21  ? 0.5338 0.6272 0.5709 -0.1108 -0.0131 -0.1204 21  MET A N   
12   C CA  . MET A 21  ? 0.4164 0.5176 0.4344 -0.0907 -0.0107 -0.1047 21  MET A CA  
13   C C   . MET A 21  ? 0.4031 0.4713 0.4112 -0.0818 0.0047  -0.0939 21  MET A C   
14   O O   . MET A 21  ? 0.3942 0.4433 0.4160 -0.0878 0.0139  -0.0879 21  MET A O   
15   C CB  . MET A 21  ? 0.3679 0.5003 0.4052 -0.0872 -0.0131 -0.0894 21  MET A CB  
16   C CG  . MET A 21  ? 0.3302 0.4694 0.3525 -0.0682 -0.0106 -0.0729 21  MET A CG  
17   S SD  . MET A 21  ? 0.3324 0.5068 0.3763 -0.0634 -0.0145 -0.0583 21  MET A SD  
18   C CE  . MET A 21  ? 0.3668 0.5782 0.4142 -0.0667 -0.0350 -0.0725 21  MET A CE  
19   N N   . ASN A 22  ? 0.2928 0.3546 0.2783 -0.0669 0.0079  -0.0909 22  ASN A N   
20   C CA  . ASN A 22  ? 0.3140 0.3493 0.2969 -0.0576 0.0207  -0.0814 22  ASN A CA  
21   C C   . ASN A 22  ? 0.3093 0.3550 0.2998 -0.0462 0.0234  -0.0615 22  ASN A C   
22   O O   . ASN A 22  ? 0.2676 0.3388 0.2621 -0.0441 0.0172  -0.0546 22  ASN A O   
23   C CB  . ASN A 22  ? 0.3387 0.3571 0.2985 -0.0486 0.0264  -0.0905 22  ASN A CB  
24   C CG  . ASN A 22  ? 0.4324 0.4705 0.3715 -0.0368 0.0237  -0.0885 22  ASN A CG  
25   O OD1 . ASN A 22  ? 0.3934 0.4495 0.3379 -0.0289 0.0233  -0.0730 22  ASN A OD1 
26   N ND2 . ASN A 22  ? 0.4863 0.5172 0.3980 -0.0345 0.0225  -0.1041 22  ASN A ND2 
27   N N   . VAL A 23  ? 0.2072 0.2324 0.2013 -0.0385 0.0316  -0.0533 23  VAL A N   
28   C CA  . VAL A 23  ? 0.1824 0.2125 0.1862 -0.0290 0.0323  -0.0371 23  VAL A CA  
29   C C   . VAL A 23  ? 0.2056 0.2577 0.2046 -0.0198 0.0307  -0.0306 23  VAL A C   
30   O O   . VAL A 23  ? 0.1696 0.2369 0.1751 -0.0175 0.0264  -0.0211 23  VAL A O   
31   C CB  . VAL A 23  ? 0.2663 0.2728 0.2765 -0.0208 0.0386  -0.0324 23  VAL A CB  
32   C CG1 . VAL A 23  ? 0.2115 0.2251 0.2335 -0.0107 0.0367  -0.0187 23  VAL A CG1 
33   C CG2 . VAL A 23  ? 0.2875 0.2692 0.3006 -0.0271 0.0399  -0.0339 23  VAL A CG2 
34   N N   . GLY A 24  ? 0.2019 0.2526 0.1874 -0.0135 0.0360  -0.0352 24  GLY A N   
35   C CA  . GLY A 24  ? 0.2172 0.2837 0.1950 -0.0036 0.0378  -0.0268 24  GLY A CA  
36   C C   . GLY A 24  ? 0.2323 0.3228 0.2032 -0.0058 0.0271  -0.0262 24  GLY A C   
37   O O   . GLY A 24  ? 0.2038 0.3072 0.1791 0.0009  0.0260  -0.0139 24  GLY A O   
38   N N   . GLU A 25  ? 0.2192 0.3155 0.1832 -0.0156 0.0187  -0.0400 25  GLU A N   
39   C CA  . GLU A 25  ? 0.1946 0.3178 0.1570 -0.0176 0.0063  -0.0414 25  GLU A CA  
40   C C   . GLU A 25  ? 0.1884 0.3242 0.1745 -0.0201 0.0036  -0.0308 25  GLU A C   
41   O O   . GLU A 25  ? 0.1778 0.3326 0.1650 -0.0126 -0.0007 -0.0216 25  GLU A O   
42   C CB  . GLU A 25  ? 0.2972 0.4246 0.2546 -0.0298 -0.0039 -0.0609 25  GLU A CB  
43   C CG  . GLU A 25  ? 0.4189 0.5380 0.3434 -0.0245 -0.0051 -0.0736 25  GLU A CG  
44   C CD  . GLU A 25  ? 0.5154 0.6308 0.4363 -0.0383 -0.0157 -0.0966 25  GLU A CD  
45   O OE1 . GLU A 25  ? 0.5069 0.6184 0.4542 -0.0533 -0.0165 -0.1015 25  GLU A OE1 
46   O OE2 . GLU A 25  ? 0.5536 0.6678 0.4437 -0.0340 -0.0227 -0.1099 25  GLU A OE2 
47   N N   . ILE A 26  ? 0.1584 0.2811 0.1605 -0.0289 0.0073  -0.0312 26  ILE A N   
48   C CA  . ILE A 26  ? 0.1500 0.2836 0.1693 -0.0304 0.0064  -0.0224 26  ILE A CA  
49   C C   . ILE A 26  ? 0.1238 0.2534 0.1429 -0.0177 0.0099  -0.0077 26  ILE A C   
50   O O   . ILE A 26  ? 0.1141 0.2589 0.1395 -0.0128 0.0074  0.0000  26  ILE A O   
51   C CB  . ILE A 26  ? 0.1672 0.2847 0.1986 -0.0417 0.0116  -0.0247 26  ILE A CB  
52   C CG1 . ILE A 26  ? 0.2374 0.3684 0.2831 -0.0423 0.0130  -0.0162 26  ILE A CG1 
53   C CG2 . ILE A 26  ? 0.2759 0.3618 0.3017 -0.0379 0.0188  -0.0208 26  ILE A CG2 
54   C CD1 . ILE A 26  ? 0.2911 0.4094 0.3476 -0.0539 0.0207  -0.0174 26  ILE A CD1 
55   N N   . LEU A 27  ? 0.1240 0.2341 0.1388 -0.0121 0.0155  -0.0045 27  LEU A N   
56   C CA  . LEU A 27  ? 0.1109 0.2167 0.1314 -0.0023 0.0173  0.0076  27  LEU A CA  
57   C C   . LEU A 27  ? 0.1117 0.2337 0.1261 0.0066  0.0168  0.0142  27  LEU A C   
58   O O   . LEU A 27  ? 0.1390 0.2645 0.1595 0.0131  0.0160  0.0238  27  LEU A O   
59   C CB  . LEU A 27  ? 0.1116 0.1962 0.1373 0.0010  0.0223  0.0090  27  LEU A CB  
60   C CG  . LEU A 27  ? 0.1145 0.1792 0.1440 -0.0041 0.0218  0.0055  27  LEU A CG  
61   C CD1 . LEU A 27  ? 0.1513 0.1993 0.1904 0.0018  0.0245  0.0073  27  LEU A CD1 
62   C CD2 . LEU A 27  ? 0.2006 0.2630 0.2318 -0.0042 0.0177  0.0108  27  LEU A CD2 
63   N N   . ARG A 28  ? 0.1279 0.2568 0.1270 0.0079  0.0173  0.0092  28  ARG A N   
64   C CA  . ARG A 28  ? 0.1359 0.2775 0.1232 0.0184  0.0172  0.0174  28  ARG A CA  
65   C C   . ARG A 28  ? 0.1461 0.3106 0.1366 0.0196  0.0072  0.0194  28  ARG A C   
66   O O   . ARG A 28  ? 0.1353 0.3059 0.1268 0.0295  0.0074  0.0311  28  ARG A O   
67   C CB  . ARG A 28  ? 0.2115 0.3527 0.1736 0.0220  0.0199  0.0115  28  ARG A CB  
68   C CG  . ARG A 28  ? 0.2141 0.3660 0.1574 0.0350  0.0200  0.0220  28  ARG A CG  
69   C CD  . ARG A 28  ? 0.2696 0.4164 0.1796 0.0415  0.0246  0.0173  28  ARG A CD  
70   N NE  . ARG A 28  ? 0.3518 0.4789 0.2611 0.0472  0.0438  0.0252  28  ARG A NE  
71   C CZ  . ARG A 28  ? 0.4997 0.6125 0.3974 0.0464  0.0534  0.0163  28  ARG A CZ  
72   N NH1 . ARG A 28  ? 0.6058 0.7179 0.4886 0.0394  0.0445  -0.0021 28  ARG A NH1 
73   N NH2 . ARG A 28  ? 0.3859 0.4846 0.2899 0.0525  0.0728  0.0253  28  ARG A NH2 
74   N N   . HIS A 29  ? 0.1338 0.3107 0.1293 0.0098  -0.0007 0.0082  29  HIS A N   
75   C CA  . HIS A 29  ? 0.1459 0.3488 0.1527 0.0102  -0.0096 0.0092  29  HIS A CA  
76   C C   . HIS A 29  ? 0.1088 0.3086 0.1317 0.0139  -0.0049 0.0196  29  HIS A C   
77   O O   . HIS A 29  ? 0.1139 0.3279 0.1408 0.0235  -0.0075 0.0280  29  HIS A O   
78   C CB  . HIS A 29  ? 0.1527 0.3685 0.1714 -0.0041 -0.0166 -0.0053 29  HIS A CB  
79   C CG  . HIS A 29  ? 0.2999 0.5239 0.3023 -0.0069 -0.0265 -0.0185 29  HIS A CG  
80   N ND1 . HIS A 29  ? 0.4041 0.6413 0.3853 0.0055  -0.0347 -0.0160 29  HIS A ND1 
81   C CD2 . HIS A 29  ? 0.3427 0.5609 0.3439 -0.0199 -0.0301 -0.0351 29  HIS A CD2 
82   C CE1 . HIS A 29  ? 0.4336 0.6733 0.3983 0.0008  -0.0443 -0.0315 29  HIS A CE1 
83   N NE2 . HIS A 29  ? 0.4088 0.6370 0.3869 -0.0153 -0.0417 -0.0442 29  HIS A NE2 
84   N N   . TYR A 30  ? 0.1001 0.2790 0.1295 0.0078  0.0016  0.0188  30  TYR A N   
85   C CA  . TYR A 30  ? 0.1035 0.2747 0.1413 0.0120  0.0052  0.0265  30  TYR A CA  
86   C C   . TYR A 30  ? 0.1055 0.2688 0.1394 0.0245  0.0067  0.0371  30  TYR A C   
87   O O   . TYR A 30  ? 0.1185 0.2859 0.1569 0.0324  0.0067  0.0438  30  TYR A O   
88   C CB  . TYR A 30  ? 0.0977 0.2442 0.1360 0.0053  0.0099  0.0236  30  TYR A CB  
89   C CG  . TYR A 30  ? 0.0855 0.2222 0.1254 0.0102  0.0127  0.0294  30  TYR A CG  
90   C CD1 . TYR A 30  ? 0.1107 0.2300 0.1470 0.0190  0.0117  0.0350  30  TYR A CD1 
91   C CD2 . TYR A 30  ? 0.0883 0.2327 0.1339 0.0063  0.0169  0.0286  30  TYR A CD2 
92   C CE1 . TYR A 30  ? 0.1532 0.2604 0.1855 0.0247  0.0127  0.0380  30  TYR A CE1 
93   C CE2 . TYR A 30  ? 0.1226 0.2553 0.1634 0.0131  0.0214  0.0336  30  TYR A CE2 
94   C CZ  . TYR A 30  ? 0.1389 0.2518 0.1701 0.0228  0.0182  0.0374  30  TYR A CZ  
95   O OH  . TYR A 30  ? 0.1534 0.2514 0.1746 0.0306  0.0212  0.0401  30  TYR A OH  
96   N N   . ALA A 31  ? 0.1176 0.2686 0.1449 0.0264  0.0096  0.0388  31  ALA A N   
97   C CA  . ALA A 31  ? 0.1112 0.2529 0.1397 0.0361  0.0134  0.0495  31  ALA A CA  
98   C C   . ALA A 31  ? 0.2017 0.3600 0.2238 0.0465  0.0118  0.0578  31  ALA A C   
99   O O   . ALA A 31  ? 0.1493 0.3002 0.1753 0.0552  0.0144  0.0676  31  ALA A O   
100  C CB  . ALA A 31  ? 0.1083 0.2371 0.1350 0.0357  0.0202  0.0504  31  ALA A CB  
101  N N   . ALA A 32  ? 0.1250 0.3042 0.1372 0.0462  0.0061  0.0533  32  ALA A N   
102  C CA  . ALA A 32  ? 0.1395 0.3371 0.1437 0.0580  0.0013  0.0608  32  ALA A CA  
103  C C   . ALA A 32  ? 0.1742 0.3845 0.1929 0.0603  -0.0027 0.0612  32  ALA A C   
104  O O   . ALA A 32  ? 0.1760 0.3924 0.1907 0.0683  -0.0045 0.0652  32  ALA A O   
105  C CB  . ALA A 32  ? 0.1711 0.3859 0.1579 0.0573  -0.0067 0.0534  32  ALA A CB  
106  N N   . GLY A 33  ? 0.1194 0.3265 0.1522 0.0521  -0.0012 0.0556  33  GLY A N   
107  C CA  . GLY A 33  ? 0.1451 0.3552 0.1874 0.0533  -0.0003 0.0552  33  GLY A CA  
108  C C   . GLY A 33  ? 0.1845 0.4191 0.2403 0.0445  -0.0050 0.0463  33  GLY A C   
109  O O   . GLY A 33  ? 0.1402 0.3819 0.2081 0.0458  -0.0030 0.0463  33  GLY A O   
110  N N   . LYS A 34  ? 0.1915 0.3027 0.1881 0.0117  -0.0092 0.0730  34  LYS A N   
111  C CA  . LYS A 34  ? 0.1687 0.2882 0.1625 0.0066  -0.0187 0.0673  34  LYS A CA  
112  C C   . LYS A 34  ? 0.1580 0.2880 0.1745 0.0104  -0.0105 0.0552  34  LYS A C   
113  O O   . LYS A 34  ? 0.1610 0.2844 0.1787 0.0117  0.0015  0.0503  34  LYS A O   
114  C CB  . LYS A 34  ? 0.2408 0.3432 0.1885 -0.0064 -0.0159 0.0638  34  LYS A CB  
115  C CG  . LYS A 34  ? 0.3925 0.4763 0.3005 -0.0179 -0.0274 0.0769  34  LYS A CG  
116  C CD  . LYS A 34  ? 0.6161 0.6711 0.4675 -0.0341 -0.0094 0.0688  34  LYS A CD  
117  C CE  . LYS A 34  ? 0.6161 0.6438 0.4185 -0.0486 -0.0126 0.0821  34  LYS A CE  
118  N NZ  . LYS A 34  ? 0.6110 0.6083 0.3745 -0.0601 0.0224  0.0685  34  LYS A NZ  
119  N N   . ARG A 35  ? 0.1216 0.2655 0.1583 0.0099  -0.0181 0.0518  35  ARG A N   
120  C CA  . ARG A 35  ? 0.0934 0.2419 0.1413 0.0082  -0.0095 0.0408  35  ARG A CA  
121  C C   . ARG A 35  ? 0.1604 0.3157 0.2063 0.0014  -0.0145 0.0348  35  ARG A C   
122  O O   . ARG A 35  ? 0.1688 0.3239 0.2155 -0.0034 -0.0077 0.0267  35  ARG A O   
123  C CB  . ARG A 35  ? 0.1198 0.2746 0.1978 0.0114  -0.0036 0.0376  35  ARG A CB  
124  C CG  . ARG A 35  ? 0.1025 0.2492 0.1840 0.0168  0.0014  0.0418  35  ARG A CG  
125  C CD  . ARG A 35  ? 0.1142 0.2467 0.1760 0.0128  0.0065  0.0398  35  ARG A CD  
126  N NE  . ARG A 35  ? 0.1466 0.2706 0.2149 0.0164  0.0092  0.0439  35  ARG A NE  
127  C CZ  . ARG A 35  ? 0.1614 0.2810 0.2298 0.0221  0.0088  0.0524  35  ARG A CZ  
128  N NH1 . ARG A 35  ? 0.1252 0.2444 0.1805 0.0227  0.0088  0.0562  35  ARG A NH1 
129  N NH2 . ARG A 35  ? 0.1737 0.2861 0.2524 0.0247  0.0108  0.0558  35  ARG A NH2 
130  N N   . ASN A 36  ? 0.1803 0.3387 0.2211 -0.0016 -0.0287 0.0403  36  ASN A N   
131  C CA  . ASN A 36  ? 0.1445 0.3098 0.1879 -0.0088 -0.0359 0.0352  36  ASN A CA  
132  C C   . ASN A 36  ? 0.1899 0.3412 0.1951 -0.0164 -0.0326 0.0293  36  ASN A C   
133  O O   . ASN A 36  ? 0.2307 0.3696 0.2042 -0.0234 -0.0401 0.0326  36  ASN A O   
134  C CB  . ASN A 36  ? 0.1992 0.3734 0.2631 -0.0113 -0.0586 0.0451  36  ASN A CB  
135  C CG  . ASN A 36  ? 0.2839 0.4668 0.3598 -0.0192 -0.0678 0.0401  36  ASN A CG  
136  O OD1 . ASN A 36  ? 0.2192 0.4027 0.2893 -0.0220 -0.0542 0.0284  36  ASN A OD1 
137  N ND2 . ASN A 36  ? 0.3157 0.5042 0.4119 -0.0241 -0.0941 0.0511  36  ASN A ND2 
138  N N   . PHE A 37  ? 0.1484 0.2979 0.1553 -0.0178 -0.0212 0.0206  37  PHE A N   
139  C CA  . PHE A 37  ? 0.1350 0.2718 0.1205 -0.0242 -0.0161 0.0136  37  PHE A CA  
140  C C   . PHE A 37  ? 0.1391 0.2828 0.1333 -0.0308 -0.0197 0.0072  37  PHE A C   
141  O O   . PHE A 37  ? 0.1543 0.2892 0.1449 -0.0348 -0.0136 0.0015  37  PHE A O   
142  C CB  . PHE A 37  ? 0.1325 0.2574 0.1218 -0.0208 -0.0031 0.0123  37  PHE A CB  
143  C CG  . PHE A 37  ? 0.1438 0.2620 0.1300 -0.0147 0.0031  0.0180  37  PHE A CG  
144  C CD1 . PHE A 37  ? 0.2569 0.3605 0.2191 -0.0186 0.0113  0.0159  37  PHE A CD1 
145  C CD2 . PHE A 37  ? 0.1621 0.2848 0.1654 -0.0080 0.0029  0.0240  37  PHE A CD2 
146  C CE1 . PHE A 37  ? 0.2607 0.3562 0.2196 -0.0148 0.0199  0.0211  37  PHE A CE1 
147  C CE2 . PHE A 37  ? 0.1718 0.2883 0.1753 -0.0026 0.0084  0.0297  37  PHE A CE2 
148  C CZ  . PHE A 37  ? 0.2015 0.3055 0.1848 -0.0055 0.0171  0.0288  37  PHE A CZ  
149  N N   . GLN A 38  ? 0.1246 0.2838 0.1381 -0.0322 -0.0294 0.0088  38  GLN A N   
150  C CA  . GLN A 38  ? 0.1210 0.2875 0.1484 -0.0392 -0.0294 0.0023  38  GLN A CA  
151  C C   . GLN A 38  ? 0.1519 0.3095 0.1575 -0.0477 -0.0363 -0.0026 38  GLN A C   
152  O O   . GLN A 38  ? 0.1643 0.3140 0.1470 -0.0515 -0.0466 -0.0003 38  GLN A O   
153  C CB  . GLN A 38  ? 0.1147 0.3006 0.1824 -0.0389 -0.0347 0.0038  38  GLN A CB  
154  C CG  . GLN A 38  ? 0.1671 0.3596 0.2452 -0.0400 -0.0578 0.0120  38  GLN A CG  
155  C CD  . GLN A 38  ? 0.2714 0.4683 0.3564 -0.0502 -0.0710 0.0091  38  GLN A CD  
156  O OE1 . GLN A 38  ? 0.2820 0.4862 0.3870 -0.0538 -0.0601 0.0009  38  GLN A OE1 
157  N NE2 . GLN A 38  ? 0.2547 0.4433 0.3184 -0.0577 -0.0952 0.0161  38  GLN A NE2 
158  N N   . HIS A 39  ? 0.1377 0.2917 0.1453 -0.0533 -0.0303 -0.0092 39  HIS A N   
159  C CA  . HIS A 39  ? 0.1562 0.3008 0.1490 -0.0623 -0.0339 -0.0166 39  HIS A CA  
160  C C   . HIS A 39  ? 0.2161 0.3388 0.1807 -0.0635 -0.0252 -0.0219 39  HIS A C   
161  O O   . HIS A 39  ? 0.2636 0.3730 0.2094 -0.0730 -0.0249 -0.0309 39  HIS A O   
162  C CB  . HIS A 39  ? 0.1774 0.3310 0.1730 -0.0695 -0.0523 -0.0157 39  HIS A CB  
163  C CG  . HIS A 39  ? 0.1601 0.3305 0.1910 -0.0735 -0.0551 -0.0174 39  HIS A CG  
164  N ND1 . HIS A 39  ? 0.1589 0.3493 0.2309 -0.0702 -0.0579 -0.0127 39  HIS A ND1 
165  C CD2 . HIS A 39  ? 0.2098 0.3785 0.2458 -0.0815 -0.0521 -0.0241 39  HIS A CD2 
166  C CE1 . HIS A 39  ? 0.1421 0.3423 0.2424 -0.0767 -0.0539 -0.0176 39  HIS A CE1 
167  N NE2 . HIS A 39  ? 0.2112 0.3985 0.2871 -0.0839 -0.0520 -0.0235 39  HIS A NE2 
168  N N   . ILE A 40  ? 0.1848 0.3014 0.1490 -0.0556 -0.0152 -0.0183 40  ILE A N   
169  C CA  . ILE A 40  ? 0.2442 0.3393 0.1917 -0.0573 -0.0002 -0.0254 40  ILE A CA  
170  C C   . ILE A 40  ? 0.2406 0.3245 0.2108 -0.0588 0.0110  -0.0329 40  ILE A C   
171  O O   . ILE A 40  ? 0.2143 0.3050 0.2111 -0.0562 0.0053  -0.0266 40  ILE A O   
172  C CB  . ILE A 40  ? 0.2803 0.3735 0.2307 -0.0483 0.0076  -0.0186 40  ILE A CB  
173  C CG1 . ILE A 40  ? 0.3712 0.4406 0.3033 -0.0529 0.0281  -0.0279 40  ILE A CG1 
174  C CG2 . ILE A 40  ? 0.3657 0.4649 0.3509 -0.0401 0.0084  -0.0117 40  ILE A CG2 
175  C CD1 . ILE A 40  ? 0.4487 0.5166 0.3960 -0.0438 0.0381  -0.0217 40  ILE A CD1 
176  N N   . ASN A 41  ? 0.2478 0.3807 0.1789 0.0245  0.0006  -0.0766 41  ASN A N   
177  C CA  . ASN A 41  ? 0.2901 0.4003 0.2257 0.0199  0.0091  -0.0731 41  ASN A CA  
178  C C   . ASN A 41  ? 0.3504 0.4473 0.2724 0.0308  0.0162  -0.0665 41  ASN A C   
179  O O   . ASN A 41  ? 0.3139 0.4060 0.2210 0.0379  0.0154  -0.0682 41  ASN A O   
180  C CB  . ASN A 41  ? 0.3670 0.4556 0.3006 0.0133  0.0013  -0.0883 41  ASN A CB  
181  C CG  . ASN A 41  ? 0.4627 0.5192 0.3940 0.0153  0.0065  -0.0890 41  ASN A CG  
182  O OD1 . ASN A 41  ? 0.3935 0.4477 0.3368 0.0135  0.0172  -0.0735 41  ASN A OD1 
183  N ND2 . ASN A 41  ? 0.5039 0.5371 0.4167 0.0238  -0.0025 -0.1086 41  ASN A ND2 
184  N N   . LEU A 42  ? 0.2426 0.3411 0.1721 0.0340  0.0230  -0.0555 42  LEU A N   
185  C CA  . LEU A 42  ? 0.2374 0.3272 0.1617 0.0425  0.0266  -0.0475 42  LEU A CA  
186  C C   . LEU A 42  ? 0.2902 0.3681 0.2186 0.0428  0.0385  -0.0402 42  LEU A C   
187  O O   . LEU A 42  ? 0.2533 0.3327 0.1828 0.0505  0.0412  -0.0316 42  LEU A O   
188  C CB  . LEU A 42  ? 0.2538 0.3554 0.1816 0.0518  0.0157  -0.0448 42  LEU A CB  
189  C CG  . LEU A 42  ? 0.2894 0.3965 0.2162 0.0543  -0.0002 -0.0499 42  LEU A CG  
190  C CD1 . LEU A 42  ? 0.3316 0.4439 0.2605 0.0689  -0.0171 -0.0548 42  LEU A CD1 
191  C CD2 . LEU A 42  ? 0.3105 0.4101 0.2398 0.0520  -0.0031 -0.0398 42  LEU A CD2 
192  N N   . GLN A 43  ? 0.2609 0.3254 0.1952 0.0344  0.0419  -0.0435 43  GLN A N   
193  C CA  . GLN A 43  ? 0.3012 0.3489 0.2439 0.0338  0.0508  -0.0347 43  GLN A CA  
194  C C   . GLN A 43  ? 0.3349 0.3707 0.2625 0.0466  0.0581  -0.0319 43  GLN A C   
195  O O   . GLN A 43  ? 0.2842 0.3158 0.1956 0.0540  0.0565  -0.0391 43  GLN A O   
196  C CB  . GLN A 43  ? 0.4436 0.4649 0.3971 0.0227  0.0434  -0.0437 43  GLN A CB  
197  C CG  . GLN A 43  ? 0.6057 0.6130 0.5864 0.0144  0.0469  -0.0276 43  GLN A CG  
198  C CD  . GLN A 43  ? 0.6991 0.6759 0.7027 -0.0011 0.0289  -0.0370 43  GLN A CD  
199  O OE1 . GLN A 43  ? 0.7212 0.6718 0.7052 0.0043  0.0145  -0.0643 43  GLN A OE1 
200  N NE2 . GLN A 43  ? 0.7318 0.7154 0.7803 -0.0187 0.0269  -0.0127 43  GLN A NE2 
201  N N   . GLU A 44  ? 0.2763 0.3154 0.2101 0.0519  0.0668  -0.0181 44  GLU A N   
202  C CA  . GLU A 44  ? 0.2754 0.3079 0.2004 0.0640  0.0743  -0.0117 44  GLU A CA  
203  C C   . GLU A 44  ? 0.3218 0.3725 0.2432 0.0698  0.0695  -0.0078 44  GLU A C   
204  O O   . GLU A 44  ? 0.3066 0.3604 0.2254 0.0791  0.0753  0.0014  44  GLU A O   
205  C CB  . GLU A 44  ? 0.3455 0.3487 0.2582 0.0704  0.0771  -0.0207 44  GLU A CB  
206  C CG  . GLU A 44  ? 0.4562 0.4292 0.3817 0.0611  0.0724  -0.0258 44  GLU A CG  
207  C CD  . GLU A 44  ? 0.4685 0.4321 0.4091 0.0626  0.0816  -0.0075 44  GLU A CD  
208  O OE1 . GLU A 44  ? 0.4395 0.4153 0.3715 0.0757  0.0920  0.0026  44  GLU A OE1 
209  O OE2 . GLU A 44  ? 0.4949 0.4415 0.4609 0.0501  0.0770  0.0001  44  GLU A OE2 
210  N N   . ILE A 45  ? 0.2685 0.3326 0.1948 0.0648  0.0573  -0.0112 45  ILE A N   
211  C CA  . ILE A 45  ? 0.2625 0.3394 0.1970 0.0663  0.0475  -0.0022 45  ILE A CA  
212  C C   . ILE A 45  ? 0.3091 0.3933 0.2585 0.0712  0.0414  0.0093  45  ILE A C   
213  O O   . ILE A 45  ? 0.2774 0.3616 0.2256 0.0765  0.0401  0.0048  45  ILE A O   
214  C CB  . ILE A 45  ? 0.2459 0.3284 0.1854 0.0608  0.0309  -0.0089 45  ILE A CB  
215  C CG1 . ILE A 45  ? 0.2655 0.3587 0.2204 0.0591  0.0209  0.0074  45  ILE A CG1 
216  C CG2 . ILE A 45  ? 0.2262 0.3115 0.1700 0.0655  0.0176  -0.0170 45  ILE A CG2 
217  C CD1 . ILE A 45  ? 0.2798 0.3747 0.2385 0.0549  0.0058  0.0029  45  ILE A CD1 
218  N N   . GLU A 46  ? 0.2721 0.3572 0.2820 0.0862  0.0754  -0.0008 46  GLU A N   
219  C CA  . GLU A 46  ? 0.2569 0.3573 0.2948 0.0909  0.0744  0.0079  46  GLU A CA  
220  C C   . GLU A 46  ? 0.2562 0.3728 0.2985 0.0845  0.0692  0.0160  46  GLU A C   
221  O O   . GLU A 46  ? 0.2153 0.3421 0.2552 0.0834  0.0758  0.0173  46  GLU A O   
222  C CB  . GLU A 46  ? 0.3735 0.4797 0.4259 0.1005  0.0882  0.0063  46  GLU A CB  
223  C CG  . GLU A 46  ? 0.5394 0.6283 0.5912 0.1082  0.0947  -0.0022 46  GLU A CG  
224  C CD  . GLU A 46  ? 0.6756 0.7607 0.7485 0.1128  0.0858  0.0032  46  GLU A CD  
225  O OE1 . GLU A 46  ? 0.6906 0.7895 0.7816 0.1108  0.0772  0.0139  46  GLU A OE1 
226  O OE2 . GLU A 46  ? 0.7299 0.7976 0.8005 0.1173  0.0868  -0.0029 46  GLU A OE2 
227  N N   . LEU A 47  ? 0.2304 0.3487 0.2784 0.0793  0.0576  0.0211  47  LEU A N   
228  C CA  . LEU A 47  ? 0.2391 0.3698 0.2911 0.0728  0.0525  0.0278  47  LEU A CA  
229  C C   . LEU A 47  ? 0.2082 0.3475 0.2797 0.0714  0.0460  0.0360  47  LEU A C   
230  O O   . LEU A 47  ? 0.1845 0.3257 0.2562 0.0641  0.0385  0.0389  47  LEU A O   
231  C CB  . LEU A 47  ? 0.2366 0.3599 0.2729 0.0648  0.0452  0.0248  47  LEU A CB  
232  C CG  . LEU A 47  ? 0.2745 0.3936 0.2917 0.0625  0.0492  0.0203  47  LEU A CG  
233  C CD1 . LEU A 47  ? 0.2487 0.3613 0.2554 0.0550  0.0404  0.0188  47  LEU A CD1 
234  C CD2 . LEU A 47  ? 0.2140 0.3467 0.2343 0.0616  0.0542  0.0254  47  LEU A CD2 
235  N N   . THR A 48  ? 0.2106 0.3549 0.2993 0.0779  0.0493  0.0399  48  THR A N   
236  C CA  . THR A 48  ? 0.2191 0.3688 0.3239 0.0738  0.0415  0.0485  48  THR A CA  
237  C C   . THR A 48  ? 0.2228 0.3804 0.3278 0.0659  0.0389  0.0537  48  THR A C   
238  O O   . THR A 48  ? 0.2042 0.3665 0.3066 0.0668  0.0448  0.0533  48  THR A O   
239  C CB  . THR A 48  ? 0.2985 0.4485 0.4205 0.0800  0.0441  0.0514  48  THR A CB  
240  O OG1 . THR A 48  ? 0.2699 0.4096 0.3924 0.0877  0.0457  0.0468  48  THR A OG1 
241  C CG2 . THR A 48  ? 0.3650 0.5202 0.5015 0.0739  0.0348  0.0615  48  THR A CG2 
242  N N   . ASN A 49  ? 0.1881 0.3465 0.2952 0.0577  0.0304  0.0583  49  ASN A N   
243  C CA  . ASN A 49  ? 0.1408 0.3037 0.2474 0.0498  0.0274  0.0629  49  ASN A CA  
244  C C   . ASN A 49  ? 0.1418 0.3048 0.2370 0.0478  0.0295  0.0593  49  ASN A C   
245  O O   . ASN A 49  ? 0.2206 0.3871 0.3158 0.0430  0.0282  0.0632  49  ASN A O   
246  C CB  . ASN A 49  ? 0.1749 0.3447 0.2916 0.0507  0.0295  0.0693  49  ASN A CB  
247  C CG  . ASN A 49  ? 0.2871 0.4581 0.4184 0.0517  0.0260  0.0752  49  ASN A CG  
248  O OD1 . ASN A 49  ? 0.3641 0.5378 0.5060 0.0588  0.0308  0.0757  49  ASN A OD1 
249  N ND2 . ASN A 49  ? 0.2898 0.4593 0.4228 0.0438  0.0177  0.0799  49  ASN A ND2 
250  N N   . ALA A 50  ? 0.1393 0.2989 0.2255 0.0512  0.0320  0.0529  50  ALA A N   
251  C CA  . ALA A 50  ? 0.1806 0.3417 0.2578 0.0491  0.0330  0.0511  50  ALA A CA  
252  C C   . ALA A 50  ? 0.2213 0.3797 0.2988 0.0416  0.0263  0.0508  50  ALA A C   
253  O O   . ALA A 50  ? 0.2272 0.3818 0.3072 0.0387  0.0226  0.0492  50  ALA A O   
254  C CB  . ALA A 50  ? 0.2554 0.4129 0.3211 0.0540  0.0377  0.0447  50  ALA A CB  
255  N N   . SER A 51  ? 0.0801 0.2410 0.1563 0.0381  0.0251  0.0526  51  SER A N   
256  C CA  . SER A 51  ? 0.0734 0.2303 0.1519 0.0320  0.0200  0.0508  51  SER A CA  
257  C C   . SER A 51  ? 0.1117 0.2688 0.1861 0.0327  0.0192  0.0482  51  SER A C   
258  O O   . SER A 51  ? 0.1216 0.2826 0.1921 0.0334  0.0201  0.0515  51  SER A O   
259  C CB  . SER A 51  ? 0.1396 0.2971 0.2234 0.0266  0.0177  0.0556  51  SER A CB  
260  O OG  . SER A 51  ? 0.1880 0.3406 0.2761 0.0212  0.0145  0.0524  51  SER A OG  
261  N N   . LEU A 52  ? 0.0818 0.2302 0.1535 0.0305  0.0164  0.0420  52  LEU A N   
262  C CA  . LEU A 52  ? 0.0849 0.2287 0.1524 0.0290  0.0133  0.0392  52  LEU A CA  
263  C C   . LEU A 52  ? 0.1019 0.2425 0.1794 0.0241  0.0101  0.0356  52  LEU A C   
264  O O   . LEU A 52  ? 0.0917 0.2266 0.1668 0.0227  0.0080  0.0305  52  LEU A O   
265  C CB  . LEU A 52  ? 0.0858 0.2219 0.1385 0.0316  0.0142  0.0341  52  LEU A CB  
266  C CG  . LEU A 52  ? 0.1571 0.2944 0.1988 0.0363  0.0194  0.0354  52  LEU A CG  
267  C CD1 . LEU A 52  ? 0.1824 0.3089 0.2091 0.0383  0.0207  0.0288  52  LEU A CD1 
268  C CD2 . LEU A 52  ? 0.1376 0.2800 0.1755 0.0343  0.0191  0.0405  52  LEU A CD2 
269  N N   . THR A 53  ? 0.0773 0.2213 0.1664 0.0210  0.0103  0.0378  53  THR A N   
270  C CA  . THR A 53  ? 0.0590 0.1992 0.1582 0.0158  0.0097  0.0327  53  THR A CA  
271  C C   . THR A 53  ? 0.1169 0.2559 0.2240 0.0158  0.0065  0.0319  53  THR A C   
272  O O   . THR A 53  ? 0.0971 0.2395 0.2064 0.0175  0.0034  0.0382  53  THR A O   
273  C CB  . THR A 53  ? 0.1516 0.2922 0.2594 0.0114  0.0108  0.0346  53  THR A CB  
274  O OG1 . THR A 53  ? 0.1526 0.2946 0.2641 0.0127  0.0087  0.0409  53  THR A OG1 
275  C CG2 . THR A 53  ? 0.1443 0.2860 0.2452 0.0101  0.0123  0.0370  53  THR A CG2 
276  N N   . GLY A 54  ? 0.0585 0.1933 0.1703 0.0130  0.0068  0.0246  54  GLY A N   
277  C CA  . GLY A 54  ? 0.0665 0.2013 0.1908 0.0127  0.0035  0.0241  54  GLY A CA  
278  C C   . GLY A 54  ? 0.1102 0.2447 0.2248 0.0149  -0.0014 0.0271  54  GLY A C   
279  O O   . GLY A 54  ? 0.1153 0.2510 0.2411 0.0142  -0.0061 0.0290  54  GLY A O   
280  N N   . ALA A 55  ? 0.0777 0.2103 0.1726 0.0172  -0.0005 0.0276  55  ALA A N   
281  C CA  . ALA A 55  ? 0.0876 0.2179 0.1692 0.0178  -0.0043 0.0297  55  ALA A CA  
282  C C   . ALA A 55  ? 0.1329 0.2587 0.2134 0.0153  -0.0063 0.0237  55  ALA A C   
283  O O   . ALA A 55  ? 0.1307 0.2537 0.2110 0.0140  -0.0029 0.0170  55  ALA A O   
284  C CB  . ALA A 55  ? 0.1264 0.2546 0.1881 0.0210  -0.0008 0.0302  55  ALA A CB  
285  N N   . ASP A 56  ? 0.0865 0.2120 0.1660 0.0133  -0.0123 0.0269  56  ASP A N   
286  C CA  . ASP A 56  ? 0.0938 0.2155 0.1696 0.0103  -0.0150 0.0225  56  ASP A CA  
287  C C   . ASP A 56  ? 0.1386 0.2522 0.1871 0.0107  -0.0145 0.0208  56  ASP A C   
288  O O   . ASP A 56  ? 0.1577 0.2694 0.1933 0.0094  -0.0179 0.0255  56  ASP A O   
289  C CB  . ASP A 56  ? 0.1004 0.2262 0.1908 0.0071  -0.0230 0.0282  56  ASP A CB  
290  C CG  . ASP A 56  ? 0.1729 0.2967 0.2628 0.0033  -0.0261 0.0242  56  ASP A CG  
291  O OD1 . ASP A 56  ? 0.1338 0.2516 0.2085 0.0027  -0.0225 0.0171  56  ASP A OD1 
292  O OD2 . ASP A 56  ? 0.2168 0.3454 0.3230 0.0005  -0.0329 0.0291  56  ASP A OD2 
293  N N   . LEU A 57  ? 0.1157 0.2238 0.1553 0.0116  -0.0103 0.0139  57  LEU A N   
294  C CA  . LEU A 57  ? 0.1135 0.2118 0.1296 0.0126  -0.0092 0.0109  57  LEU A CA  
295  C C   . LEU A 57  ? 0.1200 0.2124 0.1309 0.0082  -0.0121 0.0056  57  LEU A C   
296  O O   . LEU A 57  ? 0.1235 0.2068 0.1194 0.0087  -0.0105 0.0011  57  LEU A O   
297  C CB  . LEU A 57  ? 0.1397 0.2358 0.1508 0.0175  -0.0029 0.0089  57  LEU A CB  
298  C CG  . LEU A 57  ? 0.1916 0.2932 0.2038 0.0218  0.0007  0.0142  57  LEU A CG  
299  C CD1 . LEU A 57  ? 0.1867 0.2915 0.2065 0.0255  0.0054  0.0142  57  LEU A CD1 
300  C CD2 . LEU A 57  ? 0.2018 0.2971 0.1938 0.0234  0.0029  0.0142  57  LEU A CD2 
301  N N   . SER A 58  ? 0.1370 0.2348 0.1619 0.0038  -0.0166 0.0065  58  SER A N   
302  C CA  . SER A 58  ? 0.1175 0.2116 0.1393 -0.0013 -0.0192 0.0017  58  SER A CA  
303  C C   . SER A 58  ? 0.1792 0.2623 0.1754 -0.0034 -0.0229 0.0017  58  SER A C   
304  O O   . SER A 58  ? 0.1474 0.2290 0.1343 -0.0038 -0.0258 0.0067  58  SER A O   
305  C CB  . SER A 58  ? 0.1076 0.2116 0.1532 -0.0051 -0.0229 0.0035  58  SER A CB  
306  O OG  . SER A 58  ? 0.1762 0.2843 0.2272 -0.0055 -0.0291 0.0119  58  SER A OG  
307  N N   . TYR A 59  ? 0.1401 0.2143 0.1232 -0.0056 -0.0226 -0.0041 59  TYR A N   
308  C CA  . TYR A 59  ? 0.1676 0.2285 0.1252 -0.0082 -0.0255 -0.0055 59  TYR A CA  
309  C C   . TYR A 59  ? 0.2016 0.2535 0.1409 -0.0030 -0.0213 -0.0054 59  TYR A C   
310  O O   . TYR A 59  ? 0.2136 0.2539 0.1308 -0.0056 -0.0227 -0.0066 59  TYR A O   
311  C CB  . TYR A 59  ? 0.1631 0.2263 0.1197 -0.0152 -0.0334 -0.0012 59  TYR A CB  
312  C CG  . TYR A 59  ? 0.1520 0.2251 0.1294 -0.0201 -0.0367 -0.0018 59  TYR A CG  
313  C CD1 . TYR A 59  ? 0.1559 0.2236 0.1255 -0.0253 -0.0380 -0.0069 59  TYR A CD1 
314  C CD2 . TYR A 59  ? 0.1977 0.2854 0.2035 -0.0197 -0.0377 0.0025  59  TYR A CD2 
315  C CE1 . TYR A 59  ? 0.1784 0.2564 0.1677 -0.0304 -0.0394 -0.0083 59  TYR A CE1 
316  C CE2 . TYR A 59  ? 0.2050 0.3023 0.2329 -0.0236 -0.0386 0.0007  59  TYR A CE2 
317  C CZ  . TYR A 59  ? 0.1748 0.2679 0.1940 -0.0292 -0.0388 -0.0050 59  TYR A CZ  
318  O OH  . TYR A 59  ? 0.1767 0.2806 0.2182 -0.0338 -0.0383 -0.0075 59  TYR A OH  
319  N N   . ALA A 60  ? 0.1813 0.2385 0.1295 0.0036  -0.0155 -0.0042 60  ALA A N   
320  C CA  . ALA A 60  ? 0.2087 0.2593 0.1425 0.0088  -0.0098 -0.0045 60  ALA A CA  
321  C C   . ALA A 60  ? 0.2251 0.2616 0.1451 0.0118  -0.0065 -0.0106 60  ALA A C   
322  O O   . ALA A 60  ? 0.2237 0.2581 0.1489 0.0109  -0.0084 -0.0131 60  ALA A O   
323  C CB  . ALA A 60  ? 0.2045 0.2660 0.1536 0.0147  -0.0047 -0.0009 60  ALA A CB  
324  N N   . ASN A 61  ? 0.2035 0.2296 0.1059 0.0147  -0.0015 -0.0130 61  ASN A N   
325  C CA  . ASN A 61  ? 0.2351 0.2471 0.1283 0.0195  0.0027  -0.0186 61  ASN A CA  
326  C C   . ASN A 61  ? 0.2316 0.2493 0.1379 0.0288  0.0104  -0.0175 61  ASN A C   
327  O O   . ASN A 61  ? 0.2588 0.2776 0.1608 0.0326  0.0177  -0.0176 61  ASN A O   
328  C CB  . ASN A 61  ? 0.2943 0.2891 0.1608 0.0171  0.0050  -0.0237 61  ASN A CB  
329  C CG  . ASN A 61  ? 0.3942 0.3723 0.2532 0.0227  0.0095  -0.0299 61  ASN A CG  
330  O OD1 . ASN A 61  ? 0.3447 0.3249 0.2193 0.0280  0.0095  -0.0291 61  ASN A OD1 
331  N ND2 . ASN A 61  ? 0.4496 0.4102 0.2848 0.0207  0.0129  -0.0358 61  ASN A ND2 
332  N N   . LEU A 62  ? 0.1942 0.2159 0.1162 0.0312  0.0087  -0.0160 62  LEU A N   
333  C CA  . LEU A 62  ? 0.2083 0.2361 0.1452 0.0390  0.0141  -0.0134 62  LEU A CA  
334  C C   . LEU A 62  ? 0.2366 0.2520 0.1738 0.0430  0.0140  -0.0158 62  LEU A C   
335  O O   . LEU A 62  ? 0.2290 0.2497 0.1825 0.0465  0.0136  -0.0118 62  LEU A O   
336  C CB  . LEU A 62  ? 0.1707 0.2146 0.1273 0.0370  0.0113  -0.0077 62  LEU A CB  
337  C CG  . LEU A 62  ? 0.1832 0.2398 0.1446 0.0361  0.0130  -0.0040 62  LEU A CG  
338  C CD1 . LEU A 62  ? 0.1971 0.2654 0.1744 0.0314  0.0086  -0.0005 62  LEU A CD1 
339  C CD2 . LEU A 62  ? 0.2459 0.3087 0.2128 0.0432  0.0208  -0.0013 62  LEU A CD2 
340  N N   . HIS A 63  ? 0.2451 0.2433 0.1644 0.0418  0.0134  -0.0215 63  HIS A N   
341  C CA  . HIS A 63  ? 0.2379 0.2215 0.1571 0.0457  0.0126  -0.0237 63  HIS A CA  
342  C C   . HIS A 63  ? 0.2689 0.2546 0.2035 0.0567  0.0206  -0.0222 63  HIS A C   
343  O O   . HIS A 63  ? 0.2670 0.2532 0.1980 0.0620  0.0304  -0.0252 63  HIS A O   
344  C CB  . HIS A 63  ? 0.2821 0.2450 0.1776 0.0432  0.0125  -0.0309 63  HIS A CB  
345  C CG  . HIS A 63  ? 0.3506 0.2960 0.2463 0.0485  0.0128  -0.0337 63  HIS A CG  
346  N ND1 . HIS A 63  ? 0.3402 0.2796 0.2401 0.0445  0.0033  -0.0310 63  HIS A ND1 
347  C CD2 . HIS A 63  ? 0.3743 0.3063 0.2680 0.0571  0.0216  -0.0387 63  HIS A CD2 
348  C CE1 . HIS A 63  ? 0.3884 0.3111 0.2896 0.0508  0.0047  -0.0332 63  HIS A CE1 
349  N NE2 . HIS A 63  ? 0.4003 0.3182 0.2990 0.0592  0.0164  -0.0385 63  HIS A NE2 
350  N N   . HIS A 64  ? 0.2632 0.2946 0.1433 0.0423  0.0681  0.0067  64  HIS A N   
351  C CA  . HIS A 64  ? 0.2856 0.3093 0.1803 0.0644  0.0665  0.0187  64  HIS A CA  
352  C C   . HIS A 64  ? 0.2547 0.3109 0.1799 0.0732  0.0633  0.0201  64  HIS A C   
353  O O   . HIS A 64  ? 0.2444 0.3075 0.2000 0.0831  0.0641  0.0191  64  HIS A O   
354  C CB  . HIS A 64  ? 0.3215 0.3253 0.2274 0.0690  0.0777  0.0117  64  HIS A CB  
355  C CG  . HIS A 64  ? 0.4112 0.3944 0.3436 0.0870  0.0638  0.0199  64  HIS A CG  
356  N ND1 . HIS A 64  ? 0.5137 0.5163 0.4902 0.1008  0.0689  0.0098  64  HIS A ND1 
357  C CD2 . HIS A 64  ? 0.5108 0.4596 0.4332 0.0936  0.0431  0.0354  64  HIS A CD2 
358  C CE1 . HIS A 64  ? 0.5456 0.5290 0.5445 0.1189  0.0511  0.0165  64  HIS A CE1 
359  N NE2 . HIS A 64  ? 0.5726 0.5206 0.5371 0.1156  0.0334  0.0346  64  HIS A NE2 
360  N N   . ALA A 65  ? 0.2422 0.3137 0.1644 0.0654  0.0561  0.0197  65  ALA A N   
361  C CA  . ALA A 65  ? 0.2595 0.3509 0.2002 0.0697  0.0518  0.0239  65  ALA A CA  
362  C C   . ALA A 65  ? 0.2343 0.3264 0.1875 0.0791  0.0407  0.0338  65  ALA A C   
363  O O   . ALA A 65  ? 0.2246 0.3002 0.1648 0.0788  0.0301  0.0394  65  ALA A O   
364  C CB  . ALA A 65  ? 0.2025 0.2958 0.1391 0.0604  0.0423  0.0210  65  ALA A CB  
365  N N   . ASN A 66  ? 0.1916 0.3014 0.1703 0.0820  0.0404  0.0344  66  ASN A N   
366  C CA  . ASN A 66  ? 0.2177 0.3334 0.2129 0.0861  0.0265  0.0404  66  ASN A CA  
367  C C   . ASN A 66  ? 0.2300 0.3532 0.2178 0.0777  0.0225  0.0430  66  ASN A C   
368  O O   . ASN A 66  ? 0.2088 0.3431 0.2027 0.0713  0.0291  0.0415  66  ASN A O   
369  C CB  . ASN A 66  ? 0.2444 0.3799 0.2775 0.0935  0.0283  0.0344  66  ASN A CB  
370  C CG  . ASN A 66  ? 0.2713 0.4163 0.3237 0.1003  0.0107  0.0389  66  ASN A CG  
371  O OD1 . ASN A 66  ? 0.2410 0.3800 0.2764 0.0954  -0.0006 0.0469  66  ASN A OD1 
372  N ND2 . ASN A 66  ? 0.2416 0.4064 0.3328 0.1116  0.0081  0.0304  66  ASN A ND2 
373  N N   . LEU A 67  ? 0.1917 0.3057 0.1636 0.0754  0.0121  0.0459  67  LEU A N   
374  C CA  . LEU A 67  ? 0.1902 0.3062 0.1572 0.0692  0.0071  0.0452  67  LEU A CA  
375  C C   . LEU A 67  ? 0.1775 0.3003 0.1535 0.0668  -0.0049 0.0477  67  LEU A C   
376  O O   . LEU A 67  ? 0.1749 0.2963 0.1429 0.0606  -0.0106 0.0441  67  LEU A O   
377  C CB  . LEU A 67  ? 0.2005 0.3085 0.1460 0.0671  0.0069  0.0385  67  LEU A CB  
378  C CG  . LEU A 67  ? 0.2498 0.3571 0.1864 0.0691  0.0161  0.0345  67  LEU A CG  
379  C CD1 . LEU A 67  ? 0.2495 0.3547 0.1761 0.0657  0.0151  0.0217  67  LEU A CD1 
380  C CD2 . LEU A 67  ? 0.3047 0.4100 0.2437 0.0685  0.0146  0.0381  67  LEU A CD2 
381  N N   . SER A 68  ? 0.1583 0.2916 0.1535 0.0722  -0.0095 0.0512  68  SER A N   
382  C CA  . SER A 68  ? 0.1647 0.3098 0.1686 0.0705  -0.0237 0.0538  68  SER A CA  
383  C C   . SER A 68  ? 0.1912 0.3482 0.2024 0.0595  -0.0227 0.0487  68  SER A C   
384  O O   . SER A 68  ? 0.1594 0.3219 0.1817 0.0554  -0.0130 0.0457  68  SER A O   
385  C CB  . SER A 68  ? 0.2673 0.4273 0.2994 0.0826  -0.0311 0.0555  68  SER A CB  
386  O OG  . SER A 68  ? 0.4892 0.6666 0.5312 0.0814  -0.0473 0.0577  68  SER A OG  
387  N N   . ARG A 69  ? 0.1647 0.3227 0.1657 0.0513  -0.0313 0.0468  69  ARG A N   
388  C CA  . ARG A 69  ? 0.1659 0.3303 0.1727 0.0393  -0.0306 0.0398  69  ARG A CA  
389  C C   . ARG A 69  ? 0.1883 0.3315 0.1876 0.0362  -0.0209 0.0364  69  ARG A C   
390  O O   . ARG A 69  ? 0.1771 0.3162 0.1807 0.0261  -0.0187 0.0330  69  ARG A O   
391  C CB  . ARG A 69  ? 0.1662 0.3580 0.1994 0.0358  -0.0327 0.0383  69  ARG A CB  
392  C CG  . ARG A 69  ? 0.2321 0.4462 0.2751 0.0417  -0.0489 0.0420  69  ARG A CG  
393  C CD  . ARG A 69  ? 0.4166 0.6680 0.4899 0.0367  -0.0529 0.0347  69  ARG A CD  
394  N NE  . ARG A 69  ? 0.6064 0.8802 0.6888 0.0447  -0.0741 0.0392  69  ARG A NE  
395  C CZ  . ARG A 69  ? 0.7152 1.0284 0.8212 0.0398  -0.0838 0.0318  69  ARG A CZ  
396  N NH1 . ARG A 69  ? 0.7671 1.1006 0.8888 0.0235  -0.0706 0.0178  69  ARG A NH1 
397  N NH2 . ARG A 69  ? 0.6973 1.0168 0.8052 0.0480  -0.1050 0.0373  69  ARG A NH2 
398  N N   . ALA A 70  ? 0.1645 0.2919 0.1503 0.0441  -0.0167 0.0378  70  ALA A N   
399  C CA  . ALA A 70  ? 0.1912 0.2970 0.1677 0.0444  -0.0133 0.0364  70  ALA A CA  
400  C C   . ALA A 70  ? 0.1942 0.2894 0.1679 0.0422  -0.0198 0.0250  70  ALA A C   
401  O O   . ALA A 70  ? 0.1777 0.2855 0.1507 0.0396  -0.0234 0.0159  70  ALA A O   
402  C CB  . ALA A 70  ? 0.2022 0.3018 0.1674 0.0538  -0.0088 0.0382  70  ALA A CB  
403  N N   . ASN A 71  ? 0.1148 0.1891 0.1499 -0.0019 0.0047  0.0208  71  ASN A N   
404  C CA  . ASN A 71  ? 0.1258 0.1902 0.1590 -0.0040 0.0014  0.0220  71  ASN A CA  
405  C C   . ASN A 71  ? 0.1373 0.1943 0.1655 -0.0015 -0.0001 0.0218  71  ASN A C   
406  O O   . ASN A 71  ? 0.1391 0.1943 0.1619 -0.0029 0.0001  0.0240  71  ASN A O   
407  C CB  . ASN A 71  ? 0.1387 0.2010 0.1691 -0.0104 0.0012  0.0255  71  ASN A CB  
408  C CG  . ASN A 71  ? 0.1727 0.2222 0.1996 -0.0116 -0.0016 0.0262  71  ASN A CG  
409  O OD1 . ASN A 71  ? 0.1511 0.1956 0.1788 -0.0071 -0.0030 0.0243  71  ASN A OD1 
410  N ND2 . ASN A 71  ? 0.1704 0.2139 0.1924 -0.0176 -0.0021 0.0291  71  ASN A ND2 
411  N N   . LEU A 72  ? 0.0997 0.1536 0.1298 0.0019  -0.0018 0.0198  72  LEU A N   
412  C CA  . LEU A 72  ? 0.1452 0.1952 0.1725 0.0039  -0.0039 0.0201  72  LEU A CA  
413  C C   . LEU A 72  ? 0.1297 0.1742 0.1585 0.0053  -0.0058 0.0211  72  LEU A C   
414  O O   . LEU A 72  ? 0.1221 0.1668 0.1522 0.0078  -0.0074 0.0209  72  LEU A O   
415  C CB  . LEU A 72  ? 0.0980 0.1499 0.1253 0.0060  -0.0040 0.0170  72  LEU A CB  
416  C CG  . LEU A 72  ? 0.2722 0.3267 0.2951 0.0059  -0.0016 0.0155  72  LEU A CG  
417  C CD1 . LEU A 72  ? 0.2047 0.2577 0.2264 0.0083  -0.0012 0.0120  72  LEU A CD1 
418  C CD2 . LEU A 72  ? 0.2859 0.3389 0.3019 0.0042  -0.0026 0.0173  72  LEU A CD2 
419  N N   . ARG A 73  ? 0.1213 0.1611 0.1494 0.0035  -0.0055 0.0224  73  ARG A N   
420  C CA  . ARG A 73  ? 0.1168 0.1487 0.1440 0.0057  -0.0065 0.0230  73  ARG A CA  
421  C C   . ARG A 73  ? 0.1257 0.1553 0.1508 0.0093  -0.0079 0.0257  73  ARG A C   
422  O O   . ARG A 73  ? 0.1322 0.1605 0.1531 0.0082  -0.0085 0.0286  73  ARG A O   
423  C CB  . ARG A 73  ? 0.1535 0.1772 0.1763 0.0020  -0.0062 0.0242  73  ARG A CB  
424  C CG  . ARG A 73  ? 0.1817 0.1942 0.2010 0.0049  -0.0065 0.0241  73  ARG A CG  
425  C CD  . ARG A 73  ? 0.2733 0.2762 0.2866 -0.0004 -0.0065 0.0240  73  ARG A CD  
426  N NE  . ARG A 73  ? 0.3831 0.3738 0.3914 0.0029  -0.0062 0.0227  73  ARG A NE  
427  C CZ  . ARG A 73  ? 0.4607 0.4429 0.4636 -0.0012 -0.0064 0.0211  73  ARG A CZ  
428  N NH1 . ARG A 73  ? 0.3012 0.2881 0.3047 -0.0091 -0.0075 0.0210  73  ARG A NH1 
429  N NH2 . ARG A 73  ? 0.5319 0.5016 0.5284 0.0027  -0.0055 0.0196  73  ARG A NH2 
430  N N   . SER A 74  ? 0.1125 0.1427 0.1407 0.0137  -0.0084 0.0253  74  SER A N   
431  C CA  . SER A 74  ? 0.1433 0.1744 0.1717 0.0182  -0.0099 0.0285  74  SER A CA  
432  C C   . SER A 74  ? 0.1493 0.1890 0.1783 0.0170  -0.0120 0.0300  74  SER A C   
433  O O   . SER A 74  ? 0.1609 0.2026 0.1894 0.0200  -0.0141 0.0337  74  SER A O   
434  C CB  . SER A 74  ? 0.2362 0.2556 0.2580 0.0203  -0.0098 0.0318  74  SER A CB  
435  O OG  . SER A 74  ? 0.2346 0.2438 0.2537 0.0217  -0.0081 0.0302  74  SER A OG  
436  N N   . ALA A 75  ? 0.1220 0.1662 0.1510 0.0131  -0.0117 0.0273  75  ALA A N   
437  C CA  . ALA A 75  ? 0.1116 0.1617 0.1386 0.0113  -0.0137 0.0279  75  ALA A CA  
438  C C   . ALA A 75  ? 0.1659 0.2233 0.1976 0.0126  -0.0160 0.0283  75  ALA A C   
439  O O   . ALA A 75  ? 0.1490 0.2077 0.1856 0.0141  -0.0150 0.0266  75  ALA A O   
440  C CB  . ALA A 75  ? 0.1407 0.1914 0.1646 0.0077  -0.0121 0.0244  75  ALA A CB  
441  N N   . ASP A 76  ? 0.1312 0.1941 0.1610 0.0113  -0.0192 0.0308  76  ASP A N   
442  C CA  . ASP A 76  ? 0.1094 0.1818 0.1433 0.0103  -0.0219 0.0315  76  ASP A CA  
443  C C   . ASP A 76  ? 0.1458 0.2172 0.1740 0.0043  -0.0226 0.0278  76  ASP A C   
444  O O   . ASP A 76  ? 0.1684 0.2379 0.1889 0.0013  -0.0239 0.0279  76  ASP A O   
445  C CB  . ASP A 76  ? 0.1101 0.1905 0.1454 0.0122  -0.0259 0.0371  76  ASP A CB  
446  C CG  . ASP A 76  ? 0.2047 0.2988 0.2473 0.0115  -0.0287 0.0390  76  ASP A CG  
447  O OD1 . ASP A 76  ? 0.1840 0.2796 0.2277 0.0074  -0.0281 0.0356  76  ASP A OD1 
448  O OD2 . ASP A 76  ? 0.2365 0.3403 0.2836 0.0150  -0.0315 0.0443  76  ASP A OD2 
449  N N   . LEU A 77  ? 0.1025 0.1733 0.1327 0.0028  -0.0214 0.0245  77  LEU A N   
450  C CA  . LEU A 77  ? 0.1147 0.1810 0.1377 -0.0022 -0.0217 0.0208  77  LEU A CA  
451  C C   . LEU A 77  ? 0.1134 0.1855 0.1384 -0.0064 -0.0245 0.0211  77  LEU A C   
452  O O   . LEU A 77  ? 0.1355 0.2013 0.1554 -0.0100 -0.0240 0.0178  77  LEU A O   
453  C CB  . LEU A 77  ? 0.1388 0.1966 0.1602 -0.0005 -0.0177 0.0167  77  LEU A CB  
454  C CG  . LEU A 77  ? 0.1470 0.2004 0.1645 0.0014  -0.0149 0.0160  77  LEU A CG  
455  C CD1 . LEU A 77  ? 0.1381 0.1887 0.1595 0.0044  -0.0115 0.0140  77  LEU A CD1 
456  C CD2 . LEU A 77  ? 0.1786 0.2271 0.1854 -0.0014 -0.0147 0.0136  77  LEU A CD2 
457  N N   . ARG A 78  ? 0.1339 0.2181 0.1660 -0.0060 -0.0272 0.0256  78  ARG A N   
458  C CA  . ARG A 78  ? 0.1433 0.2365 0.1795 -0.0104 -0.0295 0.0267  78  ARG A CA  
459  C C   . ARG A 78  ? 0.1346 0.2241 0.1602 -0.0194 -0.0331 0.0250  78  ARG A C   
460  O O   . ARG A 78  ? 0.1602 0.2481 0.1785 -0.0219 -0.0356 0.0256  78  ARG A O   
461  C CB  . ARG A 78  ? 0.1514 0.2614 0.1984 -0.0072 -0.0316 0.0326  78  ARG A CB  
462  C CG  . ARG A 78  ? 0.1542 0.2728 0.1997 -0.0092 -0.0367 0.0369  78  ARG A CG  
463  C CD  . ARG A 78  ? 0.2336 0.3688 0.2913 -0.0026 -0.0378 0.0432  78  ARG A CD  
464  N NE  . ARG A 78  ? 0.2645 0.4119 0.3222 -0.0053 -0.0439 0.0484  78  ARG A NE  
465  C CZ  . ARG A 78  ? 0.2735 0.4183 0.3273 -0.0016 -0.0457 0.0513  78  ARG A CZ  
466  N NH1 . ARG A 78  ? 0.2335 0.3637 0.2833 0.0044  -0.0417 0.0495  78  ARG A NH1 
467  N NH2 . ARG A 78  ? 0.2804 0.4373 0.3339 -0.0046 -0.0519 0.0564  78  ARG A NH2 
468  N N   . ASN A 79  ? 0.1180 0.2040 0.1409 -0.0246 -0.0330 0.0227  79  ASN A N   
469  C CA  . ASN A 79  ? 0.1312 0.2098 0.1414 -0.0343 -0.0363 0.0206  79  ASN A CA  
470  C C   . ASN A 79  ? 0.2082 0.2697 0.2038 -0.0341 -0.0350 0.0162  79  ASN A C   
471  O O   . ASN A 79  ? 0.1980 0.2522 0.1804 -0.0415 -0.0380 0.0145  79  ASN A O   
472  C CB  . ASN A 79  ? 0.1451 0.2386 0.1569 -0.0414 -0.0425 0.0252  79  ASN A CB  
473  C CG  . ASN A 79  ? 0.4065 0.5151 0.4277 -0.0463 -0.0444 0.0286  79  ASN A CG  
474  O OD1 . ASN A 79  ? 0.4594 0.5631 0.4729 -0.0560 -0.0464 0.0272  79  ASN A OD1 
475  N ND2 . ASN A 79  ? 0.4573 0.5840 0.4944 -0.0399 -0.0435 0.0333  79  ASN A ND2 
476  N N   . ALA A 80  ? 0.1434 0.1989 0.1406 -0.0260 -0.0303 0.0143  80  ALA A N   
477  C CA  . ALA A 80  ? 0.1848 0.2268 0.1695 -0.0248 -0.0280 0.0104  80  ALA A CA  
478  C C   . ALA A 80  ? 0.2202 0.2461 0.1937 -0.0266 -0.0261 0.0056  80  ALA A C   
479  O O   . ALA A 80  ? 0.2182 0.2426 0.1956 -0.0267 -0.0255 0.0052  80  ALA A O   
480  C CB  . ALA A 80  ? 0.1700 0.2126 0.1606 -0.0165 -0.0236 0.0105  80  ALA A CB  
481  N N   . ASN A 81  ? 0.1761 0.1889 0.1343 -0.0277 -0.0251 0.0020  81  ASN A N   
482  C CA  . ASN A 81  ? 0.2047 0.1992 0.1504 -0.0270 -0.0224 -0.0028 81  ASN A CA  
483  C C   . ASN A 81  ? 0.2065 0.1983 0.1560 -0.0168 -0.0164 -0.0046 81  ASN A C   
484  O O   . ASN A 81  ? 0.2385 0.2282 0.1828 -0.0132 -0.0134 -0.0060 81  ASN A O   
485  C CB  . ASN A 81  ? 0.2699 0.2492 0.1946 -0.0329 -0.0238 -0.0062 81  ASN A CB  
486  C CG  . ASN A 81  ? 0.2885 0.2455 0.1977 -0.0316 -0.0210 -0.0112 81  ASN A CG  
487  O OD1 . ASN A 81  ? 0.2911 0.2449 0.2059 -0.0252 -0.0178 -0.0118 81  ASN A OD1 
488  N ND2 . ASN A 81  ? 0.3261 0.2661 0.2141 -0.0377 -0.0224 -0.0146 81  ASN A ND2 
489  N N   . LEU A 82  ? 0.1953 0.1885 0.1539 -0.0126 -0.0147 -0.0042 82  LEU A N   
490  C CA  . LEU A 82  ? 0.1668 0.1596 0.1302 -0.0035 -0.0098 -0.0054 82  LEU A CA  
491  C C   . LEU A 82  ? 0.1864 0.1641 0.1413 -0.0003 -0.0078 -0.0084 82  LEU A C   
492  O O   . LEU A 82  ? 0.2107 0.1903 0.1724 0.0066  -0.0051 -0.0082 82  LEU A O   
493  C CB  . LEU A 82  ? 0.1713 0.1786 0.1520 -0.0007 -0.0097 -0.0020 82  LEU A CB  
494  C CG  . LEU A 82  ? 0.1897 0.2092 0.1779 -0.0009 -0.0102 0.0010  82  LEU A CG  
495  C CD1 . LEU A 82  ? 0.2304 0.2604 0.2320 -0.0005 -0.0116 0.0043  82  LEU A CD1 
496  C CD2 . LEU A 82  ? 0.2120 0.2331 0.2002 0.0042  -0.0061 0.0003  82  LEU A CD2 
497  N N   . SER A 83  ? 0.2280 0.1900 0.1669 -0.0055 -0.0095 -0.0109 83  SER A N   
498  C CA  . SER A 83  ? 0.2451 0.1890 0.1732 -0.0028 -0.0081 -0.0134 83  SER A CA  
499  C C   . SER A 83  ? 0.2735 0.2115 0.1979 0.0085  -0.0024 -0.0159 83  SER A C   
500  O O   . SER A 83  ? 0.2749 0.2113 0.1926 0.0110  0.0005  -0.0178 83  SER A O   
501  C CB  . SER A 83  ? 0.2936 0.2188 0.2020 -0.0118 -0.0112 -0.0158 83  SER A CB  
502  O OG  . SER A 83  ? 0.3711 0.2901 0.2666 -0.0139 -0.0107 -0.0184 83  SER A OG  
503  N N   . HIS A 84  ? 0.2197 0.1561 0.1493 0.0155  -0.0006 -0.0152 84  HIS A N   
504  C CA  . HIS A 84  ? 0.2349 0.1697 0.1643 0.0275  0.0047  -0.0164 84  HIS A CA  
505  C C   . HIS A 84  ? 0.2319 0.1856 0.1731 0.0318  0.0080  -0.0152 84  HIS A C   
506  O O   . HIS A 84  ? 0.2817 0.2352 0.2204 0.0405  0.0131  -0.0166 84  HIS A O   
507  C CB  . HIS A 84  ? 0.2994 0.2098 0.2065 0.0311  0.0075  -0.0208 84  HIS A CB  
508  C CG  . HIS A 84  ? 0.4022 0.2913 0.2959 0.0274  0.0047  -0.0218 84  HIS A CG  
509  N ND1 . HIS A 84  ? 0.4715 0.3534 0.3656 0.0348  0.0056  -0.0207 84  HIS A ND1 
510  C CD2 . HIS A 84  ? 0.4391 0.3131 0.3186 0.0160  0.0005  -0.0230 84  HIS A CD2 
511  C CE1 . HIS A 84  ? 0.4817 0.3431 0.3614 0.0284  0.0024  -0.0214 84  HIS A CE1 
512  N NE2 . HIS A 84  ? 0.4829 0.3397 0.3538 0.0165  -0.0007 -0.0228 84  HIS A NE2 
513  N N   . ALA A 85  ? 0.1919 0.1619 0.1460 0.0260  0.0053  -0.0123 85  ALA A N   
514  C CA  . ALA A 85  ? 0.2142 0.2011 0.1793 0.0287  0.0079  -0.0105 85  ALA A CA  
515  C C   . ALA A 85  ? 0.2257 0.2243 0.2045 0.0350  0.0094  -0.0082 85  ALA A C   
516  O O   . ALA A 85  ? 0.2248 0.2223 0.2083 0.0349  0.0069  -0.0070 85  ALA A O   
517  C CB  . ALA A 85  ? 0.2084 0.2058 0.1805 0.0209  0.0043  -0.0079 85  ALA A CB  
518  N N   . ASN A 86  ? 0.1883 0.1987 0.1731 0.0399  0.0135  -0.0073 86  ASN A N   
519  C CA  . ASN A 86  ? 0.1932 0.2183 0.1923 0.0441  0.0142  -0.0043 86  ASN A CA  
520  C C   . ASN A 86  ? 0.1995 0.2378 0.2098 0.0373  0.0117  -0.0012 86  ASN A C   
521  O O   . ASN A 86  ? 0.1806 0.2264 0.1922 0.0350  0.0134  -0.0003 86  ASN A O   
522  C CB  . ASN A 86  ? 0.2051 0.2384 0.2056 0.0528  0.0200  -0.0043 86  ASN A CB  
523  C CG  . ASN A 86  ? 0.2517 0.3010 0.2666 0.0571  0.0201  -0.0009 86  ASN A CG  
524  O OD1 . ASN A 86  ? 0.1925 0.2467 0.2159 0.0525  0.0157  0.0014  86  ASN A OD1 
525  N ND2 . ASN A 86  ? 0.2605 0.3188 0.2781 0.0660  0.0250  -0.0003 86  ASN A ND2 
526  N N   . LEU A 87  ? 0.1688 0.2083 0.1856 0.0343  0.0078  0.0004  87  LEU A N   
527  C CA  . LEU A 87  ? 0.1405 0.1890 0.1660 0.0287  0.0055  0.0030  87  LEU A CA  
528  C C   . LEU A 87  ? 0.1588 0.2168 0.1941 0.0300  0.0046  0.0052  87  LEU A C   
529  O O   . LEU A 87  ? 0.1379 0.1983 0.1780 0.0256  0.0019  0.0067  87  LEU A O   
530  C CB  . LEU A 87  ? 0.1533 0.1947 0.1765 0.0234  0.0018  0.0028  87  LEU A CB  
531  C CG  . LEU A 87  ? 0.2263 0.2628 0.2419 0.0199  0.0013  0.0019  87  LEU A CG  
532  C CD1 . LEU A 87  ? 0.2286 0.2582 0.2407 0.0158  -0.0021 0.0015  87  LEU A CD1 
533  C CD2 . LEU A 87  ? 0.2394 0.2837 0.2590 0.0169  0.0013  0.0043  87  LEU A CD2 
534  N N   . SER A 88  ? 0.1562 0.2195 0.1939 0.0363  0.0068  0.0055  88  SER A N   
535  C CA  . SER A 88  ? 0.1587 0.2319 0.2054 0.0373  0.0051  0.0080  88  SER A CA  
536  C C   . SER A 88  ? 0.1575 0.2431 0.2120 0.0311  0.0043  0.0107  88  SER A C   
537  O O   . SER A 88  ? 0.1472 0.2404 0.2031 0.0300  0.0071  0.0115  88  SER A O   
538  C CB  . SER A 88  ? 0.2197 0.2995 0.2688 0.0463  0.0078  0.0087  88  SER A CB  
539  O OG  . SER A 88  ? 0.3246 0.4125 0.3742 0.0494  0.0126  0.0087  88  SER A OG  
540  N N   . GLY A 89  ? 0.1143 0.1999 0.1719 0.0265  0.0006  0.0119  89  GLY A N   
541  C CA  . GLY A 89  ? 0.1191 0.2127 0.1815 0.0198  -0.0006 0.0142  89  GLY A CA  
542  C C   . GLY A 89  ? 0.0932 0.1809 0.1513 0.0148  0.0000  0.0140  89  GLY A C   
543  O O   . GLY A 89  ? 0.1120 0.2037 0.1718 0.0090  -0.0007 0.0160  89  GLY A O   
544  N N   . ALA A 90  ? 0.1098 0.1878 0.1618 0.0165  0.0007  0.0119  90  ALA A N   
545  C CA  . ALA A 90  ? 0.1361 0.2096 0.1842 0.0128  0.0009  0.0123  90  ALA A CA  
546  C C   . ALA A 90  ? 0.1439 0.2111 0.1915 0.0089  -0.0019 0.0130  90  ALA A C   
547  O O   . ALA A 90  ? 0.1440 0.2072 0.1920 0.0096  -0.0037 0.0121  90  ALA A O   
548  C CB  . ALA A 90  ? 0.1475 0.2137 0.1891 0.0151  0.0017  0.0102  90  ALA A CB  
549  N N   . ASN A 91  ? 0.1207 0.1859 0.1661 0.0052  -0.0020 0.0148  91  ASN A N   
550  C CA  . ASN A 91  ? 0.0930 0.1497 0.1360 0.0033  -0.0039 0.0153  91  ASN A CA  
551  C C   . ASN A 91  ? 0.1227 0.1740 0.1628 0.0057  -0.0043 0.0148  91  ASN A C   
552  O O   . ASN A 91  ? 0.1286 0.1801 0.1660 0.0055  -0.0038 0.0159  91  ASN A O   
553  C CB  . ASN A 91  ? 0.1160 0.1703 0.1563 -0.0017 -0.0040 0.0178  91  ASN A CB  
554  C CG  . ASN A 91  ? 0.1429 0.1860 0.1790 -0.0027 -0.0056 0.0180  91  ASN A CG  
555  O OD1 . ASN A 91  ? 0.1376 0.1745 0.1714 0.0006  -0.0058 0.0179  91  ASN A OD1 
556  N ND2 . ASN A 91  ? 0.1753 0.2160 0.2100 -0.0072 -0.0067 0.0182  91  ASN A ND2 
557  N N   . LEU A 92  ? 0.1061 0.1537 0.1466 0.0076  -0.0054 0.0137  92  LEU A N   
558  C CA  . LEU A 92  ? 0.0925 0.1380 0.1318 0.0094  -0.0061 0.0139  92  LEU A CA  
559  C C   . LEU A 92  ? 0.1104 0.1511 0.1496 0.0106  -0.0064 0.0145  92  LEU A C   
560  O O   . LEU A 92  ? 0.1329 0.1745 0.1733 0.0126  -0.0067 0.0145  92  LEU A O   
561  C CB  . LEU A 92  ? 0.0972 0.1444 0.1369 0.0105  -0.0063 0.0119  92  LEU A CB  
562  C CG  . LEU A 92  ? 0.1443 0.1932 0.1812 0.0105  -0.0056 0.0110  92  LEU A CG  
563  C CD1 . LEU A 92  ? 0.1665 0.2133 0.2018 0.0118  -0.0054 0.0086  92  LEU A CD1 
564  C CD2 . LEU A 92  ? 0.1799 0.2289 0.2134 0.0094  -0.0067 0.0121  92  LEU A CD2 
565  N N   . GLU A 93  ? 0.1044 0.1398 0.1411 0.0091  -0.0062 0.0153  93  GLU A N   
566  C CA  . GLU A 93  ? 0.0975 0.1253 0.1315 0.0110  -0.0058 0.0154  93  GLU A CA  
567  C C   . GLU A 93  ? 0.1491 0.1762 0.1829 0.0151  -0.0057 0.0175  93  GLU A C   
568  O O   . GLU A 93  ? 0.1333 0.1601 0.1654 0.0147  -0.0064 0.0198  93  GLU A O   
569  C CB  . GLU A 93  ? 0.1648 0.1837 0.1932 0.0078  -0.0059 0.0158  93  GLU A CB  
570  C CG  . GLU A 93  ? 0.2397 0.2613 0.2689 0.0032  -0.0067 0.0145  93  GLU A CG  
571  C CD  . GLU A 93  ? 0.2885 0.3001 0.3104 -0.0016 -0.0073 0.0149  93  GLU A CD  
572  O OE1 . GLU A 93  ? 0.2866 0.3011 0.3082 -0.0071 -0.0081 0.0164  93  GLU A OE1 
573  O OE2 . GLU A 93  ? 0.2198 0.2202 0.2353 -0.0001 -0.0068 0.0138  93  GLU A OE2 
574  N N   . GLU A 94  ? 0.1066 0.1347 0.1422 0.0189  -0.0049 0.0172  94  GLU A N   
575  C CA  . GLU A 94  ? 0.1218 0.1527 0.1592 0.0238  -0.0048 0.0198  94  GLU A CA  
576  C C   . GLU A 94  ? 0.1551 0.1953 0.1958 0.0227  -0.0070 0.0217  94  GLU A C   
577  O O   . GLU A 94  ? 0.1604 0.2036 0.2021 0.0260  -0.0079 0.0250  94  GLU A O   
578  C CB  . GLU A 94  ? 0.1960 0.2155 0.2273 0.0272  -0.0040 0.0217  94  GLU A CB  
579  C CG  . GLU A 94  ? 0.3278 0.3364 0.3536 0.0287  -0.0016 0.0194  94  GLU A CG  
580  C CD  . GLU A 94  ? 0.5968 0.5896 0.6133 0.0320  -0.0006 0.0208  94  GLU A CD  
581  O OE1 . GLU A 94  ? 0.6843 0.6736 0.6981 0.0319  -0.0019 0.0238  94  GLU A OE1 
582  O OE2 . GLU A 94  ? 0.6509 0.6330 0.6610 0.0346  0.0018  0.0189  94  GLU A OE2 
583  N N   . ALA A 95  ? 0.1162 0.1606 0.1579 0.0185  -0.0078 0.0198  95  ALA A N   
584  C CA  . ALA A 95  ? 0.1185 0.1696 0.1608 0.0167  -0.0098 0.0209  95  ALA A CA  
585  C C   . ALA A 95  ? 0.1395 0.1992 0.1862 0.0172  -0.0109 0.0217  95  ALA A C   
586  O O   . ALA A 95  ? 0.1388 0.1997 0.1880 0.0177  -0.0096 0.0203  95  ALA A O   
587  C CB  . ALA A 95  ? 0.1287 0.1793 0.1685 0.0129  -0.0097 0.0183  95  ALA A CB  
588  N N   . ASN A 96  ? 0.1114 0.1778 0.1586 0.0163  -0.0135 0.0242  96  ASN A N   
589  C CA  . ASN A 96  ? 0.1032 0.1800 0.1547 0.0147  -0.0152 0.0254  96  ASN A CA  
590  C C   . ASN A 96  ? 0.1292 0.2048 0.1762 0.0083  -0.0167 0.0226  96  ASN A C   
591  O O   . ASN A 96  ? 0.1436 0.2179 0.1853 0.0055  -0.0186 0.0227  96  ASN A O   
592  C CB  . ASN A 96  ? 0.1059 0.1924 0.1606 0.0168  -0.0179 0.0302  96  ASN A CB  
593  C CG  . ASN A 96  ? 0.1470 0.2479 0.2079 0.0146  -0.0199 0.0323  96  ASN A CG  
594  O OD1 . ASN A 96  ? 0.1972 0.2991 0.2591 0.0110  -0.0189 0.0300  96  ASN A OD1 
595  N ND2 . ASN A 96  ? 0.1667 0.2794 0.2318 0.0162  -0.0229 0.0372  96  ASN A ND2 
596  N N   . LEU A 97  ? 0.0916 0.1657 0.1389 0.0062  -0.0155 0.0202  97  LEU A N   
597  C CA  . LEU A 97  ? 0.1082 0.1780 0.1493 0.0007  -0.0168 0.0177  97  LEU A CA  
598  C C   . LEU A 97  ? 0.1035 0.1807 0.1467 -0.0041 -0.0186 0.0189  97  LEU A C   
599  O O   . LEU A 97  ? 0.1157 0.1867 0.1534 -0.0087 -0.0189 0.0167  97  LEU A O   
600  C CB  . LEU A 97  ? 0.1086 0.1683 0.1464 0.0018  -0.0142 0.0141  97  LEU A CB  
601  C CG  . LEU A 97  ? 0.1328 0.1873 0.1683 0.0047  -0.0127 0.0130  97  LEU A CG  
602  C CD1 . LEU A 97  ? 0.1698 0.2199 0.2068 0.0073  -0.0104 0.0114  97  LEU A CD1 
603  C CD2 . LEU A 97  ? 0.1679 0.2172 0.1954 0.0024  -0.0131 0.0111  97  LEU A CD2 
604  N N   . GLU A 98  ? 0.0940 0.1845 0.1447 -0.0032 -0.0197 0.0228  98  GLU A N   
605  C CA  . GLU A 98  ? 0.1345 0.2353 0.1889 -0.0082 -0.0210 0.0247  98  GLU A CA  
606  C C   . GLU A 98  ? 0.1196 0.2181 0.1659 -0.0175 -0.0250 0.0240  98  GLU A C   
607  O O   . GLU A 98  ? 0.1322 0.2298 0.1738 -0.0191 -0.0279 0.0244  98  GLU A O   
608  C CB  . GLU A 98  ? 0.1580 0.2769 0.2234 -0.0044 -0.0213 0.0297  98  GLU A CB  
609  C CG  . GLU A 98  ? 0.2204 0.3474 0.2874 -0.0036 -0.0250 0.0333  98  GLU A CG  
610  C CD  . GLU A 98  ? 0.3641 0.5096 0.4429 0.0024  -0.0249 0.0389  98  GLU A CD  
611  O OE1 . GLU A 98  ? 0.2106 0.3670 0.2964 0.0023  -0.0228 0.0402  98  GLU A OE1 
612  O OE2 . GLU A 98  ? 0.3890 0.5380 0.4696 0.0077  -0.0265 0.0422  98  GLU A OE2 
613  N N   . ALA A 99  ? 0.1029 0.1978 0.1452 -0.0238 -0.0252 0.0227  99  ALA A N   
614  C CA  . ALA A 99  ? 0.1144 0.2038 0.1464 -0.0340 -0.0289 0.0217  99  ALA A CA  
615  C C   . ALA A 99  ? 0.1679 0.2391 0.1866 -0.0340 -0.0292 0.0175  99  ALA A C   
616  O O   . ALA A 99  ? 0.1718 0.2365 0.1794 -0.0416 -0.0325 0.0164  99  ALA A O   
617  C CB  . ALA A 99  ? 0.1168 0.2241 0.1535 -0.0402 -0.0337 0.0264  99  ALA A CB  
618  N N   . ALA A 100 ? 0.1317 0.1951 0.1508 -0.0257 -0.0257 0.0152  100 ALA A N   
619  C CA  . ALA A 100 ? 0.1741 0.2228 0.1821 -0.0243 -0.0248 0.0115  100 ALA A CA  
620  C C   . ALA A 100 ? 0.2228 0.2550 0.2187 -0.0277 -0.0243 0.0079  100 ALA A C   
621  O O   . ALA A 100 ? 0.2104 0.2407 0.2080 -0.0288 -0.0235 0.0081  100 ALA A O   
622  C CB  . ALA A 100 ? 0.1641 0.2116 0.1771 -0.0154 -0.0211 0.0107  100 ALA A CB  
623  N N   . ASN A 101 ? 0.1821 0.2008 0.1644 -0.0291 -0.0245 0.0048  101 ASN A N   
624  C CA  . ASN A 101 ? 0.1853 0.1845 0.1538 -0.0301 -0.0233 0.0011  101 ASN A CA  
625  C C   . ASN A 101 ? 0.2337 0.2262 0.2028 -0.0199 -0.0187 -0.0013 101 ASN A C   
626  O O   . ASN A 101 ? 0.2159 0.2058 0.1812 -0.0158 -0.0168 -0.0030 101 ASN A O   
627  C CB  . ASN A 101 ? 0.2027 0.1890 0.1536 -0.0372 -0.0258 -0.0013 101 ASN A CB  
628  C CG  . ASN A 101 ? 0.2553 0.2174 0.1888 -0.0371 -0.0242 -0.0054 101 ASN A CG  
629  O OD1 . ASN A 101 ? 0.2706 0.2267 0.2059 -0.0327 -0.0220 -0.0058 101 ASN A OD1 
630  N ND2 . ASN A 101 ? 0.2587 0.2052 0.1737 -0.0419 -0.0254 -0.0085 101 ASN A ND2 
631  N N   . LEU A 102 ? 0.1831 0.1744 0.1575 -0.0162 -0.0170 -0.0009 102 LEU A N   
632  C CA  . LEU A 102 ? 0.1591 0.1472 0.1360 -0.0069 -0.0133 -0.0023 102 LEU A CA  
633  C C   . LEU A 102 ? 0.1781 0.1492 0.1443 -0.0049 -0.0124 -0.0042 102 LEU A C   
634  O O   . LEU A 102 ? 0.1951 0.1658 0.1656 0.0021  -0.0103 -0.0041 102 LEU A O   
635  C CB  . LEU A 102 ? 0.1606 0.1627 0.1529 -0.0032 -0.0125 0.0003  102 LEU A CB  
636  C CG  . LEU A 102 ? 0.1874 0.2030 0.1890 -0.0022 -0.0124 0.0021  102 LEU A CG  
637  C CD1 . LEU A 102 ? 0.1954 0.2220 0.2084 -0.0022 -0.0128 0.0049  102 LEU A CD1 
638  C CD2 . LEU A 102 ? 0.2000 0.2164 0.2033 0.0042  -0.0095 0.0012  102 LEU A CD2 
639  N N   . ARG A 103 ? 0.1932 0.1494 0.1446 -0.0111 -0.0142 -0.0058 103 ARG A N   
640  C CA  . ARG A 103 ? 0.2329 0.1694 0.1717 -0.0095 -0.0135 -0.0074 103 ARG A CA  
641  C C   . ARG A 103 ? 0.2507 0.1794 0.1857 0.0022  -0.0094 -0.0097 103 ARG A C   
642  O O   . ARG A 103 ? 0.2664 0.1946 0.1975 0.0053  -0.0074 -0.0118 103 ARG A O   
643  C CB  . ARG A 103 ? 0.3012 0.2200 0.2216 -0.0192 -0.0163 -0.0090 103 ARG A CB  
644  C CG  . ARG A 103 ? 0.4497 0.3564 0.3553 -0.0193 -0.0155 -0.0127 103 ARG A CG  
645  C CD  . ARG A 103 ? 0.5546 0.4438 0.4410 -0.0315 -0.0192 -0.0141 103 ARG A CD  
646  N NE  . ARG A 103 ? 0.5074 0.4140 0.4020 -0.0433 -0.0239 -0.0109 103 ARG A NE  
647  C CZ  . ARG A 103 ? 0.6166 0.5153 0.4987 -0.0567 -0.0283 -0.0107 103 ARG A CZ  
648  N NH1 . ARG A 103 ? 0.6765 0.5464 0.5351 -0.0606 -0.0287 -0.0139 103 ARG A NH1 
649  N NH2 . ARG A 103 ? 0.6424 0.5616 0.5350 -0.0663 -0.0325 -0.0070 103 ARG A NH2 
650  N N   . GLY A 104 ? 0.2373 0.1621 0.1742 0.0089  -0.0082 -0.0087 104 GLY A N   
651  C CA  . GLY A 104 ? 0.2453 0.1661 0.1809 0.0209  -0.0045 -0.0099 104 GLY A CA  
652  C C   . GLY A 104 ? 0.2435 0.1838 0.1933 0.0267  -0.0018 -0.0093 104 GLY A C   
653  O O   . GLY A 104 ? 0.2636 0.2032 0.2124 0.0363  0.0018  -0.0103 104 GLY A O   
654  N N   . ALA A 105 ? 0.2067 0.1643 0.1693 0.0215  -0.0034 -0.0075 105 ALA A N   
655  C CA  . ALA A 105 ? 0.2193 0.1938 0.1939 0.0257  -0.0012 -0.0065 105 ALA A CA  
656  C C   . ALA A 105 ? 0.2445 0.2284 0.2300 0.0323  -0.0003 -0.0043 105 ALA A C   
657  O O   . ALA A 105 ? 0.2334 0.2148 0.2205 0.0319  -0.0023 -0.0029 105 ALA A O   
658  C CB  . ALA A 105 ? 0.2070 0.1946 0.1905 0.0187  -0.0033 -0.0048 105 ALA A CB  
659  N N   . ASP A 106 ? 0.1955 0.1910 0.1882 0.0377  0.0026  -0.0038 106 ASP A N   
660  C CA  . ASP A 106 ? 0.1697 0.1775 0.1738 0.0427  0.0029  -0.0012 106 ASP A CA  
661  C C   . ASP A 106 ? 0.1674 0.1901 0.1833 0.0371  0.0012  0.0009  106 ASP A C   
662  O O   . ASP A 106 ? 0.1794 0.2107 0.1990 0.0359  0.0029  0.0012  106 ASP A O   
663  C CB  . ASP A 106 ? 0.1849 0.1985 0.1902 0.0520  0.0072  -0.0013 106 ASP A CB  
664  C CG  . ASP A 106 ? 0.2419 0.2695 0.2590 0.0570  0.0067  0.0020  106 ASP A CG  
665  O OD1 . ASP A 106 ? 0.2098 0.2426 0.2336 0.0523  0.0030  0.0041  106 ASP A OD1 
666  O OD2 . ASP A 106 ? 0.2188 0.2532 0.2383 0.0658  0.0101  0.0028  106 ASP A OD2 
667  N N   . LEU A 107 ? 0.1253 0.1492 0.1455 0.0336  -0.0018 0.0024  107 LEU A N   
668  C CA  . LEU A 107 ? 0.1149 0.1494 0.1439 0.0289  -0.0031 0.0041  107 LEU A CA  
669  C C   . LEU A 107 ? 0.1269 0.1695 0.1631 0.0304  -0.0045 0.0063  107 LEU A C   
670  O O   . LEU A 107 ? 0.1359 0.1823 0.1761 0.0260  -0.0062 0.0073  107 LEU A O   
671  C CB  . LEU A 107 ? 0.1068 0.1366 0.1340 0.0230  -0.0052 0.0040  107 LEU A CB  
672  C CG  . LEU A 107 ? 0.2010 0.2275 0.2235 0.0197  -0.0050 0.0028  107 LEU A CG  
673  C CD1 . LEU A 107 ? 0.3198 0.3394 0.3375 0.0153  -0.0069 0.0025  107 LEU A CD1 
674  C CD2 . LEU A 107 ? 0.2531 0.2882 0.2813 0.0172  -0.0049 0.0042  107 LEU A CD2 
675  N N   . HIS A 108 ? 0.1264 0.1717 0.1636 0.0366  -0.0038 0.0071  108 HIS A N   
676  C CA  . HIS A 108 ? 0.1219 0.1758 0.1656 0.0373  -0.0061 0.0097  108 HIS A CA  
677  C C   . HIS A 108 ? 0.1536 0.2215 0.2057 0.0329  -0.0064 0.0114  108 HIS A C   
678  O O   . HIS A 108 ? 0.1545 0.2291 0.2092 0.0331  -0.0038 0.0114  108 HIS A O   
679  C CB  . HIS A 108 ? 0.1257 0.1813 0.1696 0.0461  -0.0056 0.0111  108 HIS A CB  
680  C CG  . HIS A 108 ? 0.1883 0.2586 0.2393 0.0511  -0.0027 0.0125  108 HIS A CG  
681  N ND1 . HIS A 108 ? 0.2308 0.2981 0.2776 0.0564  0.0017  0.0106  108 HIS A ND1 
682  C CD2 . HIS A 108 ? 0.2057 0.2946 0.2674 0.0517  -0.0035 0.0158  108 HIS A CD2 
683  C CE1 . HIS A 108 ? 0.2621 0.3465 0.3174 0.0606  0.0042  0.0127  108 HIS A CE1 
684  N NE2 . HIS A 108 ? 0.2377 0.3364 0.3028 0.0574  0.0009  0.0161  108 HIS A NE2 
685  N N   . GLU A 109 ? 0.1183 0.1885 0.1727 0.0282  -0.0095 0.0127  109 GLU A N   
686  C CA  . GLU A 109 ? 0.1106 0.1895 0.1698 0.0221  -0.0105 0.0141  109 GLU A CA  
687  C C   . GLU A 109 ? 0.1113 0.1864 0.1686 0.0177  -0.0089 0.0129  109 GLU A C   
688  O O   . GLU A 109 ? 0.1170 0.1976 0.1767 0.0128  -0.0092 0.0142  109 GLU A O   
689  C CB  . GLU A 109 ? 0.1506 0.2463 0.2180 0.0238  -0.0102 0.0169  109 GLU A CB  
690  C CG  . GLU A 109 ? 0.2189 0.3219 0.2898 0.0260  -0.0136 0.0194  109 GLU A CG  
691  C CD  . GLU A 109 ? 0.3990 0.5208 0.4792 0.0309  -0.0127 0.0226  109 GLU A CD  
692  O OE1 . GLU A 109 ? 0.4209 0.5531 0.5059 0.0291  -0.0100 0.0234  109 GLU A OE1 
693  O OE2 . GLU A 109 ? 0.4965 0.6234 0.5793 0.0369  -0.0145 0.0248  109 GLU A OE2 
694  N N   . ALA A 110 ? 0.0984 0.1639 0.1507 0.0187  -0.0075 0.0108  110 ALA A N   
695  C CA  . ALA A 110 ? 0.1101 0.1724 0.1605 0.0153  -0.0065 0.0103  110 ALA A CA  
696  C C   . ALA A 110 ? 0.1560 0.2133 0.2048 0.0112  -0.0081 0.0105  110 ALA A C   
697  O O   . ALA A 110 ? 0.1388 0.1922 0.1860 0.0111  -0.0096 0.0100  110 ALA A O   
698  C CB  . ALA A 110 ? 0.1171 0.1723 0.1627 0.0172  -0.0053 0.0086  110 ALA A CB  
699  N N   . ASN A 111 ? 0.1026 0.1586 0.1505 0.0081  -0.0076 0.0112  111 ASN A N   
700  C CA  . ASN A 111 ? 0.0899 0.1382 0.1343 0.0058  -0.0084 0.0110  111 ASN A CA  
701  C C   . ASN A 111 ? 0.1264 0.1700 0.1689 0.0079  -0.0073 0.0105  111 ASN A C   
702  O O   . ASN A 111 ? 0.1206 0.1643 0.1626 0.0078  -0.0067 0.0115  111 ASN A O   
703  C CB  . ASN A 111 ? 0.1083 0.1555 0.1510 0.0011  -0.0088 0.0124  111 ASN A CB  
704  C CG  . ASN A 111 ? 0.1926 0.2287 0.2291 -0.0005 -0.0092 0.0118  111 ASN A CG  
705  O OD1 . ASN A 111 ? 0.1536 0.1852 0.1885 0.0025  -0.0087 0.0104  111 ASN A OD1 
706  N ND2 . ASN A 111 ? 0.1597 0.1908 0.1918 -0.0053 -0.0099 0.0128  111 ASN A ND2 
707  N N   . LEU A 112 ? 0.0824 0.1233 0.1241 0.0095  -0.0074 0.0094  112 LEU A N   
708  C CA  . LEU A 112 ? 0.0869 0.1264 0.1281 0.0110  -0.0067 0.0095  112 LEU A CA  
709  C C   . LEU A 112 ? 0.0922 0.1271 0.1315 0.0118  -0.0058 0.0096  112 LEU A C   
710  O O   . LEU A 112 ? 0.0980 0.1344 0.1382 0.0136  -0.0050 0.0098  112 LEU A O   
711  C CB  . LEU A 112 ? 0.1050 0.1457 0.1463 0.0115  -0.0070 0.0087  112 LEU A CB  
712  C CG  . LEU A 112 ? 0.1688 0.2110 0.2095 0.0119  -0.0072 0.0081  112 LEU A CG  
713  C CD1 . LEU A 112 ? 0.2186 0.2590 0.2581 0.0130  -0.0077 0.0073  112 LEU A CD1 
714  C CD2 . LEU A 112 ? 0.1935 0.2356 0.2323 0.0111  -0.0075 0.0080  112 LEU A CD2 
715  N N   . SER A 113 ? 0.0953 0.1249 0.1313 0.0104  -0.0059 0.0095  113 SER A N   
716  C CA  . SER A 113 ? 0.1183 0.1403 0.1496 0.0119  -0.0045 0.0089  113 SER A CA  
717  C C   . SER A 113 ? 0.1515 0.1732 0.1835 0.0161  -0.0028 0.0104  113 SER A C   
718  O O   . SER A 113 ? 0.1465 0.1680 0.1789 0.0164  -0.0034 0.0121  113 SER A O   
719  C CB  . SER A 113 ? 0.1916 0.2049 0.2165 0.0085  -0.0052 0.0087  113 SER A CB  
720  O OG  . SER A 113 ? 0.3958 0.4107 0.4200 0.0046  -0.0071 0.0078  113 SER A OG  
721  N N   . GLY A 114 ? 0.1266 0.1494 0.1591 0.0195  -0.0008 0.0101  114 GLY A N   
722  C CA  . GLY A 114 ? 0.1454 0.1708 0.1801 0.0247  0.0008  0.0121  114 GLY A CA  
723  C C   . GLY A 114 ? 0.1346 0.1710 0.1760 0.0247  -0.0009 0.0144  114 GLY A C   
724  O O   . GLY A 114 ? 0.1509 0.1915 0.1950 0.0288  -0.0004 0.0169  114 GLY A O   
725  N N   . ALA A 115 ? 0.1149 0.1555 0.1583 0.0203  -0.0029 0.0136  115 ALA A N   
726  C CA  . ALA A 115 ? 0.0973 0.1461 0.1443 0.0191  -0.0047 0.0151  115 ALA A CA  
727  C C   . ALA A 115 ? 0.1593 0.2173 0.2107 0.0196  -0.0043 0.0163  115 ALA A C   
728  O O   . ALA A 115 ? 0.1623 0.2206 0.2138 0.0198  -0.0025 0.0153  115 ALA A O   
729  C CB  . ALA A 115 ? 0.1109 0.1592 0.1565 0.0151  -0.0062 0.0135  115 ALA A CB  
730  N N   . ASP A 116 ? 0.0893 0.1556 0.1439 0.0190  -0.0062 0.0187  116 ASP A N   
731  C CA  . ASP A 116 ? 0.0813 0.1593 0.1408 0.0176  -0.0066 0.0205  116 ASP A CA  
732  C C   . ASP A 116 ? 0.1125 0.1906 0.1692 0.0107  -0.0092 0.0192  116 ASP A C   
733  O O   . ASP A 116 ? 0.1369 0.2152 0.1915 0.0083  -0.0118 0.0197  116 ASP A O   
734  C CB  . ASP A 116 ? 0.1085 0.1969 0.1732 0.0210  -0.0078 0.0247  116 ASP A CB  
735  C CG  . ASP A 116 ? 0.1778 0.2823 0.2493 0.0191  -0.0084 0.0274  116 ASP A CG  
736  O OD1 . ASP A 116 ? 0.1603 0.2665 0.2316 0.0145  -0.0077 0.0261  116 ASP A OD1 
737  O OD2 . ASP A 116 ? 0.1678 0.2840 0.2450 0.0222  -0.0098 0.0316  116 ASP A OD2 
738  N N   . LEU A 117 ? 0.1001 0.1759 0.1551 0.0075  -0.0083 0.0176  117 LEU A N   
739  C CA  . LEU A 117 ? 0.1056 0.1779 0.1556 0.0012  -0.0104 0.0163  117 LEU A CA  
740  C C   . LEU A 117 ? 0.0898 0.1705 0.1416 -0.0040 -0.0110 0.0181  117 LEU A C   
741  O O   . LEU A 117 ? 0.1198 0.1943 0.1657 -0.0094 -0.0120 0.0168  117 LEU A O   
742  C CB  . LEU A 117 ? 0.1168 0.1769 0.1609 0.0014  -0.0095 0.0132  117 LEU A CB  
743  C CG  . LEU A 117 ? 0.1772 0.2308 0.2195 0.0048  -0.0093 0.0116  117 LEU A CG  
744  C CD1 . LEU A 117 ? 0.2711 0.3203 0.3136 0.0077  -0.0075 0.0105  117 LEU A CD1 
745  C CD2 . LEU A 117 ? 0.2194 0.2659 0.2553 0.0028  -0.0105 0.0098  117 LEU A CD2 
746  N N   . GLN A 118 ? 0.0904 0.1855 0.1502 -0.0023 -0.0103 0.0214  118 GLN A N   
747  C CA  . GLN A 118 ? 0.1084 0.2144 0.1712 -0.0080 -0.0105 0.0237  118 GLN A CA  
748  C C   . GLN A 118 ? 0.1151 0.2212 0.1730 -0.0172 -0.0150 0.0241  118 GLN A C   
749  O O   . GLN A 118 ? 0.1248 0.2311 0.1813 -0.0177 -0.0180 0.0245  118 GLN A O   
750  C CB  . GLN A 118 ? 0.1180 0.2426 0.1917 -0.0035 -0.0085 0.0277  118 GLN A CB  
751  C CG  . GLN A 118 ? 0.1447 0.2808 0.2241 -0.0014 -0.0114 0.0311  118 GLN A CG  
752  C CD  . GLN A 118 ? 0.2185 0.3744 0.3095 0.0045  -0.0090 0.0356  118 GLN A CD  
753  O OE1 . GLN A 118 ? 0.1980 0.3663 0.2938 0.0015  -0.0070 0.0375  118 GLN A OE1 
754  N NE2 . GLN A 118 ? 0.2115 0.3701 0.3064 0.0133  -0.0087 0.0376  118 GLN A NE2 
755  N N   . GLU A 119 ? 0.1173 0.2206 0.1703 -0.0250 -0.0155 0.0239  119 GLU A N   
756  C CA  . GLU A 119 ? 0.1069 0.2068 0.1522 -0.0355 -0.0197 0.0241  119 GLU A CA  
757  C C   . GLU A 119 ? 0.1471 0.2279 0.1804 -0.0357 -0.0217 0.0202  119 GLU A C   
758  O O   . GLU A 119 ? 0.1597 0.2356 0.1846 -0.0434 -0.0253 0.0198  119 GLU A O   
759  C CB  . GLU A 119 ? 0.1374 0.2576 0.1903 -0.0399 -0.0230 0.0285  119 GLU A CB  
760  C CG  . GLU A 119 ? 0.1672 0.3094 0.2325 -0.0402 -0.0208 0.0330  119 GLU A CG  
761  C CD  . GLU A 119 ? 0.2213 0.3665 0.2827 -0.0525 -0.0219 0.0346  119 GLU A CD  
762  O OE1 . GLU A 119 ? 0.2286 0.3553 0.2760 -0.0606 -0.0245 0.0319  119 GLU A OE1 
763  O OE2 . GLU A 119 ? 0.1647 0.3303 0.2363 -0.0541 -0.0199 0.0388  119 GLU A OE2 
764  N N   . ALA A 120 ? 0.1087 0.1790 0.1408 -0.0275 -0.0191 0.0173  120 ALA A N   
765  C CA  . ALA A 120 ? 0.1146 0.1691 0.1366 -0.0263 -0.0199 0.0139  120 ALA A CA  
766  C C   . ALA A 120 ? 0.1741 0.2115 0.1835 -0.0308 -0.0203 0.0115  120 ALA A C   
767  O O   . ALA A 120 ? 0.1999 0.2357 0.2092 -0.0324 -0.0191 0.0122  120 ALA A O   
768  C CB  . ALA A 120 ? 0.1493 0.2006 0.1748 -0.0170 -0.0171 0.0123  120 ALA A CB  
769  N N   . ASN A 121 ? 0.1547 0.1784 0.1523 -0.0324 -0.0216 0.0088  121 ASN A N   
770  C CA  . ASN A 121 ? 0.1605 0.1640 0.1437 -0.0348 -0.0217 0.0063  121 ASN A CA  
771  C C   . ASN A 121 ? 0.2267 0.2206 0.2086 -0.0248 -0.0186 0.0039  121 ASN A C   
772  O O   . ASN A 121 ? 0.2223 0.2120 0.2010 -0.0203 -0.0178 0.0017  121 ASN A O   
773  C CB  . ASN A 121 ? 0.2259 0.2177 0.1944 -0.0422 -0.0246 0.0046  121 ASN A CB  
774  C CG  . ASN A 121 ? 0.3179 0.2848 0.2686 -0.0443 -0.0245 0.0019  121 ASN A CG  
775  O OD1 . ASN A 121 ? 0.2599 0.2192 0.2099 -0.0396 -0.0224 0.0017  121 ASN A OD1 
776  N ND2 . ASN A 121 ? 0.2983 0.2511 0.2329 -0.0514 -0.0269 -0.0002 121 ASN A ND2 
777  N N   . LEU A 122 ? 0.1851 0.1774 0.1700 -0.0215 -0.0171 0.0045  122 LEU A N   
778  C CA  . LEU A 122 ? 0.1463 0.1322 0.1312 -0.0125 -0.0149 0.0030  122 LEU A CA  
779  C C   . LEU A 122 ? 0.1745 0.1417 0.1467 -0.0120 -0.0150 0.0021  122 LEU A C   
780  O O   . LEU A 122 ? 0.1994 0.1634 0.1729 -0.0053 -0.0138 0.0022  122 LEU A O   
781  C CB  . LEU A 122 ? 0.1679 0.1664 0.1655 -0.0082 -0.0134 0.0047  122 LEU A CB  
782  C CG  . LEU A 122 ? 0.1893 0.2021 0.1977 -0.0058 -0.0127 0.0054  122 LEU A CG  
783  C CD1 . LEU A 122 ? 0.2230 0.2464 0.2406 -0.0052 -0.0117 0.0073  122 LEU A CD1 
784  C CD2 . LEU A 122 ? 0.2103 0.2222 0.2202 0.0009  -0.0113 0.0040  122 LEU A CD2 
785  N N   . THR A 123 ? 0.2090 0.1629 0.1679 -0.0192 -0.0168 0.0014  123 THR A N   
786  C CA  . THR A 123 ? 0.1978 0.1304 0.1421 -0.0192 -0.0170 0.0008  123 THR A CA  
787  C C   . THR A 123 ? 0.2154 0.1365 0.1541 -0.0080 -0.0148 -0.0016 123 THR A C   
788  O O   . THR A 123 ? 0.2448 0.1660 0.1821 -0.0046 -0.0135 -0.0039 123 THR A O   
789  C CB  . THR A 123 ? 0.3264 0.2436 0.2543 -0.0302 -0.0195 0.0002  123 THR A CB  
790  O OG1 . THR A 123 ? 0.3490 0.2626 0.2707 -0.0312 -0.0200 -0.0026 123 THR A OG1 
791  C CG2 . THR A 123 ? 0.2635 0.1944 0.1977 -0.0416 -0.0216 0.0034  123 THR A CG2 
792  N N   . GLN A 124 ? 0.2156 0.1286 0.1518 -0.0019 -0.0142 -0.0005 124 GLN A N   
793  C CA  . GLN A 124 ? 0.2641 0.1689 0.1968 0.0101  -0.0121 -0.0017 124 GLN A CA  
794  C C   . GLN A 124 ? 0.2485 0.1723 0.1962 0.0176  -0.0099 -0.0021 124 GLN A C   
795  O O   . GLN A 124 ? 0.2595 0.1798 0.2051 0.0270  -0.0075 -0.0033 124 GLN A O   
796  C CB  . GLN A 124 ? 0.3295 0.2107 0.2428 0.0112  -0.0112 -0.0049 124 GLN A CB  
797  C CG  . GLN A 124 ? 0.4725 0.3309 0.3675 0.0026  -0.0135 -0.0047 124 GLN A CG  
798  C CD  . GLN A 124 ? 0.5614 0.4073 0.4507 0.0078  -0.0139 -0.0022 124 GLN A CD  
799  O OE1 . GLN A 124 ? 0.5990 0.4433 0.4901 0.0205  -0.0120 -0.0020 124 GLN A OE1 
800  N NE2 . GLN A 124 ? 0.6279 0.4664 0.5107 -0.0022 -0.0165 0.0001  124 GLN A NE2 
801  N N   . ALA A 125 ? 0.1996 0.1430 0.1616 0.0137  -0.0104 -0.0008 125 ALA A N   
802  C CA  . ALA A 125 ? 0.1811 0.1408 0.1558 0.0193  -0.0086 -0.0008 125 ALA A CA  
803  C C   . ALA A 125 ? 0.2142 0.1806 0.1966 0.0267  -0.0083 0.0011  125 ALA A C   
804  O O   . ALA A 125 ? 0.2301 0.1935 0.2117 0.0259  -0.0100 0.0030  125 ALA A O   
805  C CB  . ALA A 125 ? 0.1961 0.1718 0.1817 0.0133  -0.0094 0.0001  125 ALA A CB  
806  N N   . ASN A 126 ? 0.1877 0.1640 0.1771 0.0332  -0.0063 0.0010  126 ASN A N   
807  C CA  . ASN A 126 ? 0.1798 0.1669 0.1786 0.0388  -0.0066 0.0034  126 ASN A CA  
808  C C   . ASN A 126 ? 0.1872 0.1903 0.1979 0.0340  -0.0076 0.0046  126 ASN A C   
809  O O   . ASN A 126 ? 0.1705 0.1831 0.1871 0.0335  -0.0061 0.0042  126 ASN A O   
810  C CB  . ASN A 126 ? 0.1775 0.1685 0.1777 0.0483  -0.0037 0.0032  126 ASN A CB  
811  C CG  . ASN A 126 ? 0.2023 0.2077 0.2133 0.0537  -0.0046 0.0065  126 ASN A CG  
812  O OD1 . ASN A 126 ? 0.2225 0.2333 0.2385 0.0499  -0.0076 0.0085  126 ASN A OD1 
813  N ND2 . ASN A 126 ? 0.2014 0.2134 0.2154 0.0627  -0.0018 0.0071  126 ASN A ND2 
814  N N   . LEU A 127 ? 0.1307 0.1348 0.1433 0.0304  -0.0098 0.0062  127 LEU A N   
815  C CA  . LEU A 127 ? 0.1326 0.1484 0.1539 0.0264  -0.0106 0.0070  127 LEU A CA  
816  C C   . LEU A 127 ? 0.1319 0.1546 0.1580 0.0285  -0.0124 0.0092  127 LEU A C   
817  O O   . LEU A 127 ? 0.1218 0.1486 0.1506 0.0244  -0.0136 0.0098  127 LEU A O   
818  C CB  . LEU A 127 ? 0.1293 0.1418 0.1484 0.0199  -0.0111 0.0068  127 LEU A CB  
819  C CG  . LEU A 127 ? 0.1542 0.1657 0.1718 0.0163  -0.0101 0.0054  127 LEU A CG  
820  C CD1 . LEU A 127 ? 0.2249 0.2323 0.2386 0.0107  -0.0107 0.0058  127 LEU A CD1 
821  C CD2 . LEU A 127 ? 0.2068 0.2287 0.2320 0.0154  -0.0093 0.0055  127 LEU A CD2 
822  N N   . LYS A 128 ? 0.1302 0.1542 0.1566 0.0351  -0.0127 0.0106  128 LYS A N   
823  C CA  . LYS A 128 ? 0.1173 0.1500 0.1487 0.0370  -0.0153 0.0134  128 LYS A CA  
824  C C   . LYS A 128 ? 0.1479 0.1944 0.1879 0.0327  -0.0158 0.0139  128 LYS A C   
825  O O   . LYS A 128 ? 0.1391 0.1929 0.1839 0.0329  -0.0137 0.0133  128 LYS A O   
826  C CB  . LYS A 128 ? 0.1488 0.1845 0.1814 0.0463  -0.0151 0.0153  128 LYS A CB  
827  C CG  . LYS A 128 ? 0.2798 0.2983 0.3012 0.0511  -0.0152 0.0153  128 LYS A CG  
828  C CD  . LYS A 128 ? 0.3959 0.4169 0.4182 0.0624  -0.0145 0.0174  128 LYS A CD  
829  C CE  . LYS A 128 ? 0.5585 0.5968 0.5908 0.0645  -0.0179 0.0217  128 LYS A CE  
830  N NZ  . LYS A 128 ? 0.7483 0.7946 0.7848 0.0766  -0.0170 0.0246  128 LYS A NZ  
831  N N   . ASP A 129 ? 0.1125 0.1608 0.1526 0.0280  -0.0186 0.0149  129 ASP A N   
832  C CA  . ASP A 129 ? 0.1088 0.1665 0.1540 0.0227  -0.0196 0.0153  129 ASP A CA  
833  C C   . ASP A 129 ? 0.1222 0.1781 0.1678 0.0189  -0.0170 0.0131  129 ASP A C   
834  O O   . ASP A 129 ? 0.1565 0.2192 0.2058 0.0152  -0.0172 0.0136  129 ASP A O   
835  C CB  . ASP A 129 ? 0.1126 0.1857 0.1661 0.0252  -0.0208 0.0181  129 ASP A CB  
836  C CG  . ASP A 129 ? 0.2644 0.3419 0.3186 0.0296  -0.0242 0.0213  129 ASP A CG  
837  O OD1 . ASP A 129 ? 0.2451 0.3180 0.2945 0.0262  -0.0274 0.0219  129 ASP A OD1 
838  O OD2 . ASP A 129 ? 0.2909 0.3766 0.3502 0.0370  -0.0234 0.0232  129 ASP A OD2 
839  N N   . ALA A 130 ? 0.1149 0.1619 0.1563 0.0192  -0.0148 0.0112  130 ALA A N   
840  C CA  . ALA A 130 ? 0.0873 0.1332 0.1292 0.0163  -0.0128 0.0098  130 ALA A CA  
841  C C   . ALA A 130 ? 0.1078 0.1505 0.1474 0.0120  -0.0133 0.0093  130 ALA A C   
842  O O   . ALA A 130 ? 0.1321 0.1705 0.1677 0.0110  -0.0144 0.0093  130 ALA A O   
843  C CB  . ALA A 130 ? 0.1141 0.1533 0.1524 0.0174  -0.0110 0.0083  130 ALA A CB  
844  N N   . ASN A 131 ? 0.0856 0.1291 0.1263 0.0097  -0.0123 0.0090  131 ASN A N   
845  C CA  . ASN A 131 ? 0.0906 0.1283 0.1273 0.0069  -0.0119 0.0083  131 ASN A CA  
846  C C   . ASN A 131 ? 0.1274 0.1616 0.1633 0.0085  -0.0095 0.0075  131 ASN A C   
847  O O   . ASN A 131 ? 0.1210 0.1566 0.1590 0.0091  -0.0085 0.0079  131 ASN A O   
848  C CB  . ASN A 131 ? 0.0994 0.1380 0.1361 0.0034  -0.0125 0.0089  131 ASN A CB  
849  C CG  . ASN A 131 ? 0.1703 0.1993 0.2002 0.0012  -0.0119 0.0078  131 ASN A CG  
850  O OD1 . ASN A 131 ? 0.1428 0.1663 0.1688 0.0027  -0.0106 0.0066  131 ASN A OD1 
851  N ND2 . ASN A 131 ? 0.1478 0.1738 0.1750 -0.0027 -0.0125 0.0083  131 ASN A ND2 
852  N N   . LEU A 132 ? 0.1045 0.1354 0.1376 0.0089  -0.0088 0.0069  132 LEU A N   
853  C CA  . LEU A 132 ? 0.0960 0.1269 0.1296 0.0101  -0.0066 0.0069  132 LEU A CA  
854  C C   . LEU A 132 ? 0.1145 0.1413 0.1444 0.0106  -0.0046 0.0062  132 LEU A C   
855  O O   . LEU A 132 ? 0.1136 0.1419 0.1437 0.0118  -0.0024 0.0064  132 LEU A O   
856  C CB  . LEU A 132 ? 0.1367 0.1682 0.1697 0.0097  -0.0067 0.0071  132 LEU A CB  
857  C CG  . LEU A 132 ? 0.1646 0.1972 0.1989 0.0101  -0.0079 0.0072  132 LEU A CG  
858  C CD1 . LEU A 132 ? 0.2608 0.2890 0.2910 0.0097  -0.0090 0.0073  132 LEU A CD1 
859  C CD2 . LEU A 132 ? 0.1946 0.2303 0.2309 0.0096  -0.0072 0.0076  132 LEU A CD2 
860  N N   . SER A 133 ? 0.1216 0.1431 0.1475 0.0094  -0.0051 0.0056  133 SER A N   
861  C CA  . SER A 133 ? 0.1261 0.1400 0.1454 0.0103  -0.0027 0.0044  133 SER A CA  
862  C C   . SER A 133 ? 0.1322 0.1471 0.1537 0.0148  0.0004  0.0050  133 SER A C   
863  O O   . SER A 133 ? 0.1384 0.1551 0.1634 0.0158  -0.0002 0.0062  133 SER A O   
864  C CB  . SER A 133 ? 0.1851 0.1908 0.1979 0.0073  -0.0042 0.0036  133 SER A CB  
865  O OG  . SER A 133 ? 0.2221 0.2297 0.2339 0.0031  -0.0076 0.0037  133 SER A OG  
866  N N   . ASP A 134 ? 0.1269 0.1418 0.1466 0.0176  0.0037  0.0046  134 ASP A N   
867  C CA  . ASP A 134 ? 0.1474 0.1656 0.1701 0.0231  0.0070  0.0058  134 ASP A CA  
868  C C   . ASP A 134 ? 0.1585 0.1884 0.1907 0.0237  0.0057  0.0083  134 ASP A C   
869  O O   . ASP A 134 ? 0.1468 0.1806 0.1825 0.0282  0.0071  0.0101  134 ASP A O   
870  C CB  . ASP A 134 ? 0.1570 0.1636 0.1732 0.0262  0.0082  0.0053  134 ASP A CB  
871  C CG  . ASP A 134 ? 0.3050 0.2977 0.3090 0.0251  0.0095  0.0024  134 ASP A CG  
872  O OD1 . ASP A 134 ? 0.2501 0.2431 0.2508 0.0260  0.0122  0.0012  134 ASP A OD1 
873  O OD2 . ASP A 134 ? 0.3976 0.3786 0.3942 0.0224  0.0078  0.0015  134 ASP A OD2 
874  N N   . ALA A 135 ? 0.0962 0.1311 0.1317 0.0194  0.0029  0.0085  135 ALA A N   
875  C CA  . ALA A 135 ? 0.0899 0.1339 0.1318 0.0187  0.0014  0.0104  135 ALA A CA  
876  C C   . ALA A 135 ? 0.1482 0.2022 0.1942 0.0187  0.0031  0.0120  135 ALA A C   
877  O O   . ALA A 135 ? 0.1539 0.2079 0.1977 0.0181  0.0052  0.0114  135 ALA A O   
878  C CB  . ALA A 135 ? 0.1363 0.1795 0.1779 0.0145  -0.0017 0.0098  135 ALA A CB  
879  N N   . ASN A 136 ? 0.0988 0.1623 0.1506 0.0188  0.0019  0.0144  136 ASN A N   
880  C CA  . ASN A 136 ? 0.0851 0.1611 0.1419 0.0171  0.0028  0.0166  136 ASN A CA  
881  C C   . ASN A 136 ? 0.1295 0.2064 0.1851 0.0098  -0.0004 0.0165  136 ASN A C   
882  O O   . ASN A 136 ? 0.1418 0.2187 0.1974 0.0076  -0.0035 0.0168  136 ASN A O   
883  C CB  . ASN A 136 ? 0.0847 0.1725 0.1487 0.0213  0.0031  0.0199  136 ASN A CB  
884  C CG  . ASN A 136 ? 0.1235 0.2284 0.1945 0.0191  0.0039  0.0230  136 ASN A CG  
885  O OD1 . ASN A 136 ? 0.1267 0.2330 0.1961 0.0143  0.0049  0.0224  136 ASN A OD1 
886  N ND2 . ASN A 136 ? 0.1386 0.2572 0.2172 0.0224  0.0033  0.0268  136 ASN A ND2 
887  N N   . LEU A 137 ? 0.0971 0.1725 0.1496 0.0058  0.0004  0.0160  137 LEU A N   
888  C CA  . LEU A 137 ? 0.1021 0.1746 0.1506 -0.0012 -0.0024 0.0159  137 LEU A CA  
889  C C   . LEU A 137 ? 0.0946 0.1781 0.1457 -0.0067 -0.0017 0.0185  137 LEU A C   
890  O O   . LEU A 137 ? 0.1242 0.2025 0.1694 -0.0132 -0.0030 0.0185  137 LEU A O   
891  C CB  . LEU A 137 ? 0.0981 0.1567 0.1388 -0.0020 -0.0029 0.0135  137 LEU A CB  
892  C CG  . LEU A 137 ? 0.1380 0.1884 0.1768 0.0014  -0.0044 0.0115  137 LEU A CG  
893  C CD1 . LEU A 137 ? 0.2303 0.2723 0.2647 0.0031  -0.0040 0.0100  137 LEU A CD1 
894  C CD2 . LEU A 137 ? 0.1709 0.2163 0.2060 -0.0014 -0.0072 0.0109  137 LEU A CD2 
895  N N   . GLU A 138 ? 0.1028 0.2019 0.1625 -0.0041 0.0003  0.0213  138 GLU A N   
896  C CA  . GLU A 138 ? 0.0907 0.2045 0.1547 -0.0096 0.0013  0.0245  138 GLU A CA  
897  C C   . GLU A 138 ? 0.1177 0.2321 0.1786 -0.0198 -0.0034 0.0257  138 GLU A C   
898  O O   . GLU A 138 ? 0.1098 0.2254 0.1716 -0.0207 -0.0070 0.0260  138 GLU A O   
899  C CB  . GLU A 138 ? 0.0938 0.2273 0.1692 -0.0038 0.0039  0.0280  138 GLU A CB  
900  C CG  . GLU A 138 ? 0.1371 0.2902 0.2188 -0.0101 0.0050  0.0321  138 GLU A CG  
901  C CD  . GLU A 138 ? 0.2208 0.3942 0.3139 -0.0020 0.0097  0.0355  138 GLU A CD  
902  O OE1 . GLU A 138 ? 0.2217 0.3921 0.3168 0.0087  0.0115  0.0347  138 GLU A OE1 
903  O OE2 . GLU A 138 ? 0.2189 0.4112 0.3185 -0.0063 0.0118  0.0392  138 GLU A OE2 
904  N N   . GLN A 139 ? 0.1075 0.2192 0.1629 -0.0279 -0.0034 0.0263  139 GLN A N   
905  C CA  . GLN A 139 ? 0.1094 0.2178 0.1585 -0.0391 -0.0078 0.0272  139 GLN A CA  
906  C C   . GLN A 139 ? 0.1337 0.2228 0.1728 -0.0395 -0.0116 0.0238  139 GLN A C   
907  O O   . GLN A 139 ? 0.1775 0.2625 0.2101 -0.0477 -0.0154 0.0240  139 GLN A O   
908  C CB  . GLN A 139 ? 0.1085 0.2390 0.1669 -0.0442 -0.0098 0.0315  139 GLN A CB  
909  C CG  . GLN A 139 ? 0.1670 0.3193 0.2352 -0.0455 -0.0059 0.0357  139 GLN A CG  
910  C CD  . GLN A 139 ? 0.2415 0.3903 0.3021 -0.0570 -0.0057 0.0370  139 GLN A CD  
911  O OE1 . GLN A 139 ? 0.3029 0.4351 0.3512 -0.0660 -0.0097 0.0356  139 GLN A OE1 
912  N NE2 . GLN A 139 ? 0.2329 0.3964 0.2997 -0.0567 -0.0007 0.0397  139 GLN A NE2 
913  N N   . ALA A 140 ? 0.1106 0.1877 0.1474 -0.0311 -0.0103 0.0206  140 ALA A N   
914  C CA  . ALA A 140 ? 0.1444 0.2046 0.1721 -0.0303 -0.0128 0.0175  140 ALA A CA  
915  C C   . ALA A 140 ? 0.1816 0.2249 0.1964 -0.0363 -0.0141 0.0164  140 ALA A C   
916  O O   . ALA A 140 ? 0.1771 0.2187 0.1897 -0.0385 -0.0125 0.0175  140 ALA A O   
917  C CB  . ALA A 140 ? 0.1339 0.1881 0.1634 -0.0206 -0.0111 0.0151  140 ALA A CB  
918  N N   . ASP A 141 ? 0.1614 0.1909 0.1660 -0.0388 -0.0168 0.0144  141 ASP A N   
919  C CA  . ASP A 141 ? 0.1801 0.1895 0.1700 -0.0430 -0.0179 0.0133  141 ASP A CA  
920  C C   . ASP A 141 ? 0.1982 0.1937 0.1838 -0.0335 -0.0167 0.0105  141 ASP A C   
921  O O   . ASP A 141 ? 0.1906 0.1802 0.1734 -0.0292 -0.0171 0.0081  141 ASP A O   
922  C CB  . ASP A 141 ? 0.2147 0.2151 0.1933 -0.0519 -0.0214 0.0126  141 ASP A CB  
923  C CG  . ASP A 141 ? 0.2988 0.2760 0.2597 -0.0577 -0.0226 0.0118  141 ASP A CG  
924  O OD1 . ASP A 141 ? 0.2772 0.2454 0.2350 -0.0535 -0.0209 0.0120  141 ASP A OD1 
925  O OD2 . ASP A 141 ? 0.3443 0.3108 0.2929 -0.0665 -0.0255 0.0112  141 ASP A OD2 
926  N N   . LEU A 142 ? 0.1946 0.1863 0.1799 -0.0302 -0.0152 0.0111  142 LEU A N   
927  C CA  . LEU A 142 ? 0.1647 0.1459 0.1469 -0.0215 -0.0146 0.0094  142 LEU A CA  
928  C C   . LEU A 142 ? 0.2061 0.1669 0.1737 -0.0225 -0.0157 0.0095  142 LEU A C   
929  O O   . LEU A 142 ? 0.2064 0.1609 0.1724 -0.0158 -0.0154 0.0096  142 LEU A O   
930  C CB  . LEU A 142 ? 0.1874 0.1789 0.1793 -0.0160 -0.0128 0.0102  142 LEU A CB  
931  C CG  . LEU A 142 ? 0.1747 0.1825 0.1791 -0.0133 -0.0115 0.0100  142 LEU A CG  
932  C CD1 . LEU A 142 ? 0.2671 0.2876 0.2778 -0.0169 -0.0098 0.0121  142 LEU A CD1 
933  C CD2 . LEU A 142 ? 0.2627 0.2721 0.2720 -0.0056 -0.0107 0.0089  142 LEU A CD2 
934  N N   . ALA A 143 ? 0.1949 0.1449 0.1512 -0.0312 -0.0173 0.0098  143 ALA A N   
935  C CA  . ALA A 143 ? 0.2071 0.1343 0.1470 -0.0328 -0.0184 0.0103  143 ALA A CA  
936  C C   . ALA A 143 ? 0.2475 0.1597 0.1806 -0.0220 -0.0181 0.0079  143 ALA A C   
937  O O   . ALA A 143 ? 0.2425 0.1527 0.1744 -0.0188 -0.0177 0.0052  143 ALA A O   
938  C CB  . ALA A 143 ? 0.2735 0.1897 0.2005 -0.0451 -0.0205 0.0106  143 ALA A CB  
939  N N   . GLY A 144 ? 0.2376 0.1409 0.1667 -0.0160 -0.0180 0.0094  144 GLY A N   
940  C CA  . GLY A 144 ? 0.2535 0.1444 0.1770 -0.0046 -0.0176 0.0081  144 GLY A CA  
941  C C   . GLY A 144 ? 0.2633 0.1711 0.2015 0.0049  -0.0160 0.0069  144 GLY A C   
942  O O   . GLY A 144 ? 0.2687 0.1705 0.2045 0.0147  -0.0150 0.0060  144 GLY A O   
943  N N   . ALA A 145 ? 0.2157 0.1445 0.1687 0.0021  -0.0154 0.0071  145 ALA A N   
944  C CA  . ALA A 145 ? 0.2188 0.1629 0.1848 0.0095  -0.0141 0.0063  145 ALA A CA  
945  C C   . ALA A 145 ? 0.2240 0.1716 0.1943 0.0165  -0.0147 0.0083  145 ALA A C   
946  O O   . ALA A 145 ? 0.2029 0.1464 0.1696 0.0142  -0.0161 0.0105  145 ALA A O   
947  C CB  . ALA A 145 ? 0.1752 0.1375 0.1536 0.0049  -0.0136 0.0062  145 ALA A CB  
948  N N   . ASP A 146 ? 0.1929 0.1490 0.1707 0.0244  -0.0139 0.0080  146 ASP A N   
949  C CA  . ASP A 146 ? 0.1621 0.1250 0.1456 0.0305  -0.0151 0.0103  146 ASP A CA  
950  C C   . ASP A 146 ? 0.1791 0.1603 0.1754 0.0281  -0.0152 0.0106  146 ASP A C   
951  O O   . ASP A 146 ? 0.1877 0.1791 0.1917 0.0298  -0.0138 0.0095  146 ASP A O   
952  C CB  . ASP A 146 ? 0.2346 0.1963 0.2179 0.0411  -0.0141 0.0104  146 ASP A CB  
953  C CG  . ASP A 146 ? 0.3078 0.2772 0.2965 0.0476  -0.0162 0.0139  146 ASP A CG  
954  O OD1 . ASP A 146 ? 0.2199 0.1952 0.2118 0.0434  -0.0186 0.0158  146 ASP A OD1 
955  O OD2 . ASP A 146 ? 0.3277 0.2979 0.3170 0.0574  -0.0153 0.0148  146 ASP A OD2 
956  N N   . LEU A 147 ? 0.1577 0.1416 0.1548 0.0237  -0.0166 0.0121  147 LEU A N   
957  C CA  . LEU A 147 ? 0.1355 0.1329 0.1417 0.0211  -0.0166 0.0120  147 LEU A CA  
958  C C   . LEU A 147 ? 0.1702 0.1728 0.1785 0.0236  -0.0193 0.0143  147 LEU A C   
959  O O   . LEU A 147 ? 0.1658 0.1742 0.1765 0.0199  -0.0199 0.0144  147 LEU A O   
960  C CB  . LEU A 147 ? 0.1251 0.1223 0.1299 0.0141  -0.0155 0.0114  147 LEU A CB  
961  C CG  . LEU A 147 ? 0.1763 0.1734 0.1815 0.0106  -0.0136 0.0098  147 LEU A CG  
962  C CD1 . LEU A 147 ? 0.2852 0.2700 0.2805 0.0073  -0.0139 0.0102  147 LEU A CD1 
963  C CD2 . LEU A 147 ? 0.2796 0.2850 0.2898 0.0066  -0.0120 0.0095  147 LEU A CD2 
964  N N   . GLN A 148 ? 0.1494 0.1499 0.1563 0.0302  -0.0209 0.0162  148 GLN A N   
965  C CA  . GLN A 148 ? 0.1458 0.1531 0.1551 0.0326  -0.0243 0.0192  148 GLN A CA  
966  C C   . GLN A 148 ? 0.1691 0.1920 0.1882 0.0300  -0.0249 0.0190  148 GLN A C   
967  O O   . GLN A 148 ? 0.1643 0.1957 0.1907 0.0319  -0.0232 0.0181  148 GLN A O   
968  C CB  . GLN A 148 ? 0.2128 0.2188 0.2215 0.0420  -0.0255 0.0218  148 GLN A CB  
969  C CG  . GLN A 148 ? 0.2978 0.3145 0.3107 0.0447  -0.0298 0.0258  148 GLN A CG  
970  C CD  . GLN A 148 ? 0.4712 0.4833 0.4807 0.0549  -0.0314 0.0293  148 GLN A CD  
971  O OE1 . GLN A 148 ? 0.5430 0.5434 0.5470 0.0608  -0.0287 0.0282  148 GLN A OE1 
972  N NE2 . GLN A 148 ? 0.4836 0.5042 0.4955 0.0573  -0.0360 0.0337  148 GLN A NE2 
973  N N   . GLY A 149 ? 0.1743 0.1995 0.1919 0.0250  -0.0272 0.0197  149 GLY A N   
974  C CA  . GLY A 149 ? 0.1623 0.1990 0.1862 0.0211  -0.0284 0.0196  149 GLY A CA  
975  C C   . GLY A 149 ? 0.1241 0.1615 0.1506 0.0170  -0.0251 0.0164  149 GLY A C   
976  O O   . GLY A 149 ? 0.1290 0.1738 0.1595 0.0136  -0.0258 0.0162  149 GLY A O   
977  N N   . ALA A 150 ? 0.1095 0.1391 0.1332 0.0169  -0.0218 0.0143  150 ALA A N   
978  C CA  . ALA A 150 ? 0.1360 0.1664 0.1621 0.0139  -0.0189 0.0120  150 ALA A CA  
979  C C   . ALA A 150 ? 0.1439 0.1715 0.1659 0.0092  -0.0186 0.0109  150 ALA A C   
980  O O   . ALA A 150 ? 0.1476 0.1709 0.1635 0.0076  -0.0199 0.0115  150 ALA A O   
981  C CB  . ALA A 150 ? 0.1496 0.1743 0.1740 0.0146  -0.0162 0.0106  150 ALA A CB  
982  N N   . VAL A 151 ? 0.1044 0.1333 0.1286 0.0074  -0.0167 0.0094  151 VAL A N   
983  C CA  . VAL A 151 ? 0.1050 0.1290 0.1239 0.0043  -0.0155 0.0080  151 VAL A CA  
984  C C   . VAL A 151 ? 0.1097 0.1315 0.1292 0.0055  -0.0116 0.0067  151 VAL A C   
985  O O   . VAL A 151 ? 0.1294 0.1541 0.1537 0.0067  -0.0105 0.0066  151 VAL A O   
986  C CB  . VAL A 151 ? 0.1282 0.1536 0.1472 0.0013  -0.0170 0.0078  151 VAL A CB  
987  C CG1 . VAL A 151 ? 0.1504 0.1668 0.1614 -0.0010 -0.0150 0.0057  151 VAL A CG1 
988  C CG2 . VAL A 151 ? 0.1570 0.1876 0.1762 -0.0008 -0.0215 0.0097  151 VAL A CG2 
989  N N   . LEU A 152 ? 0.1102 0.1283 0.1250 0.0051  -0.0096 0.0063  152 LEU A N   
990  C CA  . LEU A 152 ? 0.1146 0.1341 0.1313 0.0064  -0.0059 0.0059  152 LEU A CA  
991  C C   . LEU A 152 ? 0.1247 0.1403 0.1359 0.0066  -0.0027 0.0046  152 LEU A C   
992  O O   . LEU A 152 ? 0.1407 0.1586 0.1520 0.0076  0.0007  0.0048  152 LEU A O   
993  C CB  . LEU A 152 ? 0.1213 0.1422 0.1384 0.0056  -0.0055 0.0070  152 LEU A CB  
994  C CG  . LEU A 152 ? 0.1345 0.1557 0.1539 0.0060  -0.0081 0.0079  152 LEU A CG  
995  C CD1 . LEU A 152 ? 0.1621 0.1788 0.1768 0.0061  -0.0109 0.0089  152 LEU A CD1 
996  C CD2 . LEU A 152 ? 0.1906 0.2129 0.2107 0.0044  -0.0070 0.0085  152 LEU A CD2 
997  N N   A ASP A 153 ? 0.1452 0.1549 0.1510 0.0055  -0.0037 0.0033  153 ASP A N   
998  N N   B ASP A 153 ? 0.1450 0.1548 0.1509 0.0056  -0.0037 0.0033  153 ASP A N   
999  C CA  A ASP A 153 ? 0.1562 0.1584 0.1535 0.0061  -0.0005 0.0014  153 ASP A CA  
1000 C CA  B ASP A 153 ? 0.1539 0.1563 0.1512 0.0061  -0.0005 0.0015  153 ASP A CA  
1001 C C   A ASP A 153 ? 0.1572 0.1608 0.1576 0.0108  0.0040  0.0012  153 ASP A C   
1002 C C   B ASP A 153 ? 0.1591 0.1623 0.1591 0.0107  0.0040  0.0011  153 ASP A C   
1003 O O   A ASP A 153 ? 0.1497 0.1547 0.1550 0.0124  0.0035  0.0017  153 ASP A O   
1004 O O   B ASP A 153 ? 0.1572 0.1609 0.1614 0.0122  0.0035  0.0015  153 ASP A O   
1005 C CB  A ASP A 153 ? 0.1615 0.1553 0.1512 0.0029  -0.0030 0.0001  153 ASP A CB  
1006 C CB  B ASP A 153 ? 0.1822 0.1761 0.1714 0.0027  -0.0031 0.0001  153 ASP A CB  
1007 C CG  A ASP A 153 ? 0.2323 0.2143 0.2095 0.0034  0.0004  -0.0026 153 ASP A CG  
1008 C CG  B ASP A 153 ? 0.2578 0.2530 0.2445 -0.0015 -0.0079 0.0012  153 ASP A CG  
1009 O OD1 A ASP A 153 ? 0.2779 0.2557 0.2464 0.0014  0.0006  -0.0034 153 ASP A OD1 
1010 O OD1 B ASP A 153 ? 0.2782 0.2777 0.2671 -0.0009 -0.0084 0.0027  153 ASP A OD1 
1011 O OD2 A ASP A 153 ? 0.2678 0.2432 0.2424 0.0062  0.0031  -0.0038 153 ASP A OD2 
1012 O OD2 B ASP A 153 ? 0.3074 0.2990 0.2893 -0.0056 -0.0114 0.0009  153 ASP A OD2 
1013 N N   . GLY A 154 ? 0.1318 0.1363 0.1296 0.0133  0.0086  0.0008  154 GLY A N   
1014 C CA  . GLY A 154 ? 0.1663 0.1739 0.1674 0.0191  0.0133  0.0011  154 GLY A CA  
1015 C C   . GLY A 154 ? 0.1512 0.1722 0.1646 0.0203  0.0129  0.0038  154 GLY A C   
1016 O O   . GLY A 154 ? 0.1491 0.1755 0.1671 0.0253  0.0159  0.0049  154 GLY A O   
1017 N N   . ALA A 155 ? 0.1172 0.1430 0.1350 0.0159  0.0091  0.0050  155 ALA A N   
1018 C CA  . ALA A 155 ? 0.1079 0.1443 0.1349 0.0155  0.0081  0.0072  155 ALA A CA  
1019 C C   . ALA A 155 ? 0.1396 0.1863 0.1700 0.0154  0.0114  0.0090  155 ALA A C   
1020 O O   . ALA A 155 ? 0.1429 0.1885 0.1684 0.0141  0.0138  0.0086  155 ALA A O   
1021 C CB  . ALA A 155 ? 0.1184 0.1539 0.1463 0.0113  0.0037  0.0075  155 ALA A CB  
1022 N N   . ASN A 156 ? 0.0999 0.1577 0.1386 0.0160  0.0112  0.0112  156 ASN A N   
1023 C CA  . ASN A 156 ? 0.1123 0.1835 0.1562 0.0144  0.0136  0.0138  156 ASN A CA  
1024 C C   . ASN A 156 ? 0.1573 0.2307 0.2017 0.0066  0.0098  0.0150  156 ASN A C   
1025 O O   . ASN A 156 ? 0.1401 0.2158 0.1880 0.0049  0.0064  0.0158  156 ASN A O   
1026 C CB  . ASN A 156 ? 0.1289 0.2128 0.1816 0.0197  0.0153  0.0162  156 ASN A CB  
1027 C CG  . ASN A 156 ? 0.1921 0.2942 0.2523 0.0172  0.0173  0.0197  156 ASN A CG  
1028 O OD1 . ASN A 156 ? 0.1578 0.2619 0.2152 0.0123  0.0189  0.0200  156 ASN A OD1 
1029 N ND2 . ASN A 156 ? 0.1367 0.2533 0.2064 0.0202  0.0170  0.0229  156 ASN A ND2 
1030 N N   . LEU A 157 ? 0.1014 0.1720 0.1404 0.0018  0.0104  0.0151  157 LEU A N   
1031 C CA  . LEU A 157 ? 0.1029 0.1720 0.1395 -0.0059 0.0070  0.0164  157 LEU A CA  
1032 C C   . LEU A 157 ? 0.1371 0.2187 0.1764 -0.0114 0.0092  0.0195  157 LEU A C   
1033 O O   . LEU A 157 ? 0.1383 0.2154 0.1717 -0.0188 0.0077  0.0205  157 LEU A O   
1034 C CB  . LEU A 157 ? 0.1079 0.1617 0.1347 -0.0079 0.0049  0.0148  157 LEU A CB  
1035 C CG  . LEU A 157 ? 0.1973 0.2418 0.2229 -0.0040 0.0019  0.0126  157 LEU A CG  
1036 C CD1 . LEU A 157 ? 0.2425 0.2811 0.2644 -0.0002 0.0030  0.0108  157 LEU A CD1 
1037 C CD2 . LEU A 157 ? 0.3198 0.3545 0.3398 -0.0071 -0.0019 0.0125  157 LEU A CD2 
1038 N N   . HIS A 158 ? 0.1173 0.2150 0.1654 -0.0078 0.0129  0.0213  158 HIS A N   
1039 C CA  . HIS A 158 ? 0.1063 0.2208 0.1592 -0.0129 0.0155  0.0250  158 HIS A CA  
1040 C C   . HIS A 158 ? 0.1344 0.2515 0.1872 -0.0232 0.0106  0.0271  158 HIS A C   
1041 O O   . HIS A 158 ? 0.1171 0.2366 0.1739 -0.0234 0.0068  0.0274  158 HIS A O   
1042 C CB  . HIS A 158 ? 0.1178 0.2516 0.1823 -0.0056 0.0196  0.0272  158 HIS A CB  
1043 C CG  . HIS A 158 ? 0.1907 0.3464 0.2626 -0.0106 0.0225  0.0317  158 HIS A CG  
1044 N ND1 . HIS A 158 ? 0.3386 0.5014 0.4096 -0.0093 0.0291  0.0326  158 HIS A ND1 
1045 C CD2 . HIS A 158 ? 0.3542 0.5275 0.4343 -0.0178 0.0198  0.0359  158 HIS A CD2 
1046 C CE1 . HIS A 158 ? 0.2851 0.4705 0.3647 -0.0152 0.0306  0.0373  158 HIS A CE1 
1047 N NE2 . HIS A 158 ? 0.3434 0.5358 0.4288 -0.0208 0.0246  0.0395  158 HIS A NE2 
1048 N N   . GLY A 159 ? 0.1175 0.2321 0.1639 -0.0322 0.0105  0.0286  159 GLY A N   
1049 C CA  . GLY A 159 ? 0.1213 0.2352 0.1645 -0.0435 0.0059  0.0306  159 GLY A CA  
1050 C C   . GLY A 159 ? 0.1306 0.2238 0.1646 -0.0447 0.0005  0.0277  159 GLY A C   
1051 O O   . GLY A 159 ? 0.1711 0.2617 0.2011 -0.0531 -0.0035 0.0286  159 GLY A O   
1052 N N   . ALA A 160 ? 0.1261 0.2049 0.1560 -0.0368 0.0005  0.0242  160 ALA A N   
1053 C CA  . ALA A 160 ? 0.1389 0.2001 0.1611 -0.0364 -0.0037 0.0216  160 ALA A CA  
1054 C C   . ALA A 160 ? 0.1459 0.1902 0.1545 -0.0438 -0.0058 0.0219  160 ALA A C   
1055 O O   . ALA A 160 ? 0.1719 0.2141 0.1758 -0.0471 -0.0040 0.0234  160 ALA A O   
1056 C CB  . ALA A 160 ? 0.1610 0.2139 0.1833 -0.0266 -0.0031 0.0186  160 ALA A CB  
1057 N N   . ASN A 161 ? 0.1681 0.1992 0.1690 -0.0463 -0.0096 0.0204  161 ASN A N   
1058 C CA  . ASN A 161 ? 0.1672 0.1776 0.1527 -0.0517 -0.0118 0.0204  161 ASN A CA  
1059 C C   . ASN A 161 ? 0.2074 0.2015 0.1871 -0.0427 -0.0122 0.0178  161 ASN A C   
1060 O O   . ASN A 161 ? 0.2062 0.1954 0.1861 -0.0373 -0.0135 0.0154  161 ASN A O   
1061 C CB  . ASN A 161 ? 0.1729 0.1763 0.1509 -0.0598 -0.0153 0.0201  161 ASN A CB  
1062 C CG  . ASN A 161 ? 0.2369 0.2154 0.1961 -0.0659 -0.0175 0.0201  161 ASN A CG  
1063 O OD1 . ASN A 161 ? 0.2684 0.2359 0.2210 -0.0639 -0.0165 0.0208  161 ASN A OD1 
1064 N ND2 . ASN A 161 ? 0.2717 0.2398 0.2207 -0.0738 -0.0207 0.0194  161 ASN A ND2 
1065 N N   . LEU A 162 ? 0.1675 0.1550 0.1424 -0.0410 -0.0112 0.0188  162 LEU A N   
1066 C CA  . LEU A 162 ? 0.1697 0.1441 0.1398 -0.0326 -0.0122 0.0174  162 LEU A CA  
1067 C C   . LEU A 162 ? 0.2038 0.1564 0.1577 -0.0354 -0.0143 0.0186  162 LEU A C   
1068 O O   . LEU A 162 ? 0.1967 0.1400 0.1458 -0.0295 -0.0151 0.0191  162 LEU A O   
1069 C CB  . LEU A 162 ? 0.1709 0.1540 0.1475 -0.0273 -0.0102 0.0176  162 LEU A CB  
1070 C CG  . LEU A 162 ? 0.2114 0.2100 0.2013 -0.0219 -0.0085 0.0159  162 LEU A CG  
1071 C CD1 . LEU A 162 ? 0.2667 0.2746 0.2609 -0.0203 -0.0055 0.0163  162 LEU A CD1 
1072 C CD2 . LEU A 162 ? 0.2557 0.2499 0.2475 -0.0143 -0.0101 0.0137  162 LEU A CD2 
1073 N N   . ASN A 163 ? 0.2033 0.1473 0.1480 -0.0446 -0.0156 0.0195  163 ASN A N   
1074 C CA  . ASN A 163 ? 0.2266 0.1457 0.1529 -0.0478 -0.0177 0.0206  163 ASN A CA  
1075 C C   . ASN A 163 ? 0.2488 0.1516 0.1689 -0.0367 -0.0189 0.0186  163 ASN A C   
1076 O O   . ASN A 163 ? 0.2546 0.1578 0.1776 -0.0319 -0.0190 0.0157  163 ASN A O   
1077 C CB  . ASN A 163 ? 0.3007 0.2110 0.2167 -0.0598 -0.0193 0.0210  163 ASN A CB  
1078 C CG  . ASN A 163 ? 0.4591 0.3745 0.3721 -0.0726 -0.0188 0.0248  163 ASN A CG  
1079 O OD1 . ASN A 163 ? 0.4899 0.3882 0.3887 -0.0768 -0.0196 0.0272  163 ASN A OD1 
1080 N ND2 . ASN A 163 ? 0.4456 0.3853 0.3718 -0.0788 -0.0174 0.0259  163 ASN A ND2 
1081 N N   . ASN A 164 ? 0.2706 0.1603 0.1822 -0.0324 -0.0198 0.0206  164 ASN A N   
1082 C CA  . ASN A 164 ? 0.2943 0.1694 0.1998 -0.0208 -0.0210 0.0198  164 ASN A CA  
1083 C C   . ASN A 164 ? 0.2637 0.1547 0.1845 -0.0102 -0.0200 0.0174  164 ASN A C   
1084 O O   . ASN A 164 ? 0.2796 0.1624 0.1975 -0.0011 -0.0202 0.0160  164 ASN A O   
1085 C CB  . ASN A 164 ? 0.2948 0.1455 0.1834 -0.0222 -0.0220 0.0183  164 ASN A CB  
1086 C CG  . ASN A 164 ? 0.3445 0.1747 0.2147 -0.0329 -0.0235 0.0211  164 ASN A CG  
1087 O OD1 . ASN A 164 ? 0.3641 0.1903 0.2300 -0.0337 -0.0242 0.0246  164 ASN A OD1 
1088 N ND2 . ASN A 164 ? 0.5011 0.3178 0.3592 -0.0422 -0.0243 0.0197  164 ASN A ND2 
1089 N N   . ALA A 165 ? 0.2140 0.1272 0.1499 -0.0114 -0.0186 0.0171  165 ALA A N   
1090 C CA  . ALA A 165 ? 0.1952 0.1227 0.1445 -0.0028 -0.0180 0.0153  165 ALA A CA  
1091 C C   . ALA A 165 ? 0.2267 0.1545 0.1770 0.0048  -0.0194 0.0174  165 ALA A C   
1092 O O   . ALA A 165 ? 0.2734 0.1951 0.2169 0.0024  -0.0206 0.0201  165 ALA A O   
1093 C CB  . ALA A 165 ? 0.2021 0.1498 0.1648 -0.0065 -0.0161 0.0144  165 ALA A CB  
1094 N N   . ASN A 166 ? 0.1771 0.1580 0.1695 0.0133  0.0197  0.0021  166 ASN A N   
1095 C CA  . ASN A 166 ? 0.1488 0.1194 0.1395 0.0175  0.0093  0.0079  166 ASN A CA  
1096 C C   . ASN A 166 ? 0.1454 0.1234 0.1380 0.0139  0.0081  0.0114  166 ASN A C   
1097 O O   . ASN A 166 ? 0.1788 0.1737 0.1838 0.0140  0.0115  0.0119  166 ASN A O   
1098 C CB  . ASN A 166 ? 0.1721 0.1580 0.1822 0.0263  0.0037  0.0049  166 ASN A CB  
1099 C CG  . ASN A 166 ? 0.2607 0.2437 0.2728 0.0336  -0.0090 0.0038  166 ASN A CG  
1100 O OD1 . ASN A 166 ? 0.2253 0.1901 0.2201 0.0335  -0.0146 0.0075  166 ASN A OD1 
1101 N ND2 . ASN A 166 ? 0.2515 0.2567 0.2858 0.0408  -0.0141 -0.0044 166 ASN A ND2 
1102 N N   . LEU A 167 ? 0.1517 0.1130 0.1278 0.0103  0.0048  0.0138  167 LEU A N   
1103 C CA  . LEU A 167 ? 0.1536 0.1204 0.1319 0.0073  0.0028  0.0156  167 LEU A CA  
1104 C C   . LEU A 167 ? 0.1643 0.1278 0.1447 0.0113  -0.0081 0.0159  167 LEU A C   
1105 O O   . LEU A 167 ? 0.1934 0.1569 0.1721 0.0082  -0.0109 0.0159  167 LEU A O   
1106 C CB  . LEU A 167 ? 0.1709 0.1304 0.1330 0.0005  0.0070  0.0137  167 LEU A CB  
1107 C CG  . LEU A 167 ? 0.2086 0.1813 0.1724 -0.0010 0.0159  0.0065  167 LEU A CG  
1108 C CD1 . LEU A 167 ? 0.2022 0.1735 0.1532 -0.0093 0.0206  -0.0022 167 LEU A CD1 
1109 C CD2 . LEU A 167 ? 0.2731 0.2602 0.2461 0.0058  0.0163  0.0075  167 LEU A CD2 
1110 N N   . SER A 168 ? 0.1623 0.1261 0.1478 0.0202  -0.0155 0.0132  168 SER A N   
1111 C CA  . SER A 168 ? 0.1733 0.1408 0.1624 0.0287  -0.0289 0.0080  168 SER A CA  
1112 C C   . SER A 168 ? 0.1564 0.1492 0.1712 0.0217  -0.0267 0.0018  168 SER A C   
1113 O O   . SER A 168 ? 0.1575 0.1672 0.1921 0.0156  -0.0174 -0.0008 168 SER A O   
1114 C CB  . SER A 168 ? 0.2329 0.2048 0.2285 0.0434  -0.0389 0.0009  168 SER A CB  
1115 O OG  . SER A 168 ? 0.4170 0.3560 0.3838 0.0497  -0.0395 0.0068  168 SER A OG  
1116 N N   . GLU A 169 ? 0.1628 0.1548 0.1741 0.0214  -0.0335 -0.0011 169 GLU A N   
1117 C CA  . GLU A 169 ? 0.1534 0.1646 0.1873 0.0125  -0.0302 -0.0093 169 GLU A CA  
1118 C C   . GLU A 169 ? 0.1609 0.1660 0.1952 -0.0005 -0.0145 -0.0024 169 GLU A C   
1119 O O   . GLU A 169 ? 0.1590 0.1714 0.2082 -0.0101 -0.0071 -0.0081 169 GLU A O   
1120 C CB  . GLU A 169 ? 0.1579 0.1999 0.2235 0.0143  -0.0324 -0.0259 169 GLU A CB  
1121 C CG  . GLU A 169 ? 0.2876 0.3395 0.3530 0.0335  -0.0522 -0.0377 169 GLU A CG  
1122 C CD  . GLU A 169 ? 0.6358 0.7218 0.7323 0.0389  -0.0550 -0.0564 169 GLU A CD  
1123 O OE1 . GLU A 169 ? 0.7569 0.8375 0.8479 0.0481  -0.0570 -0.0530 169 GLU A OE1 
1124 O OE2 . GLU A 169 ? 0.7413 0.8618 0.8698 0.0328  -0.0542 -0.0774 169 GLU A OE2 
1125 N N   . ALA A 170 ? 0.1466 0.1365 0.1621 0.0000  -0.0094 0.0077  170 ALA A N   
1126 C CA  . ALA A 170 ? 0.1567 0.1392 0.1664 -0.0053 0.0015  0.0125  170 ALA A CA  
1127 C C   . ALA A 170 ? 0.2029 0.1760 0.2040 -0.0083 -0.0007 0.0119  170 ALA A C   
1128 O O   . ALA A 170 ? 0.1911 0.1623 0.1840 -0.0065 -0.0089 0.0105  170 ALA A O   
1129 C CB  . ALA A 170 ? 0.1548 0.1330 0.1510 -0.0007 0.0056  0.0172  170 ALA A CB  
1130 N N   . MET A 171 ? 0.1550 0.1181 0.1537 -0.0125 0.0073  0.0130  171 MET A N   
1131 C CA  . MET A 171 ? 0.1636 0.1149 0.1529 -0.0135 0.0053  0.0115  171 MET A CA  
1132 C C   . MET A 171 ? 0.1884 0.1295 0.1566 -0.0046 0.0062  0.0146  171 MET A C   
1133 O O   . MET A 171 ? 0.2489 0.1769 0.2047 0.0004  0.0131  0.0189  171 MET A O   
1134 C CB  . MET A 171 ? 0.1974 0.1371 0.1932 -0.0230 0.0138  0.0083  171 MET A CB  
1135 C CG  . MET A 171 ? 0.2610 0.2212 0.2836 -0.0314 0.0109  -0.0033 171 MET A CG  
1136 S SD  . MET A 171 ? 0.3213 0.2722 0.3578 -0.0496 0.0265  -0.0137 171 MET A SD  
1137 C CE  . MET A 171 ? 0.2182 0.1357 0.2301 -0.0473 0.0262  -0.0092 171 MET A CE  
1138 N N   . LEU A 172 ? 0.1801 0.1286 0.1424 -0.0019 -0.0006 0.0103  172 LEU A N   
1139 C CA  . LEU A 172 ? 0.1740 0.1235 0.1220 0.0070  -0.0014 0.0055  172 LEU A CA  
1140 C C   . LEU A 172 ? 0.1824 0.1281 0.1252 0.0081  -0.0069 -0.0015 172 LEU A C   
1141 O O   . LEU A 172 ? 0.2132 0.1717 0.1511 0.0111  -0.0103 -0.0116 172 LEU A O   
1142 C CB  . LEU A 172 ? 0.1779 0.1440 0.1258 0.0058  -0.0010 0.0003  172 LEU A CB  
1143 C CG  . LEU A 172 ? 0.2541 0.2251 0.2060 0.0078  0.0041  0.0040  172 LEU A CG  
1144 C CD1 . LEU A 172 ? 0.3671 0.3434 0.3200 0.0004  0.0059  0.0016  172 LEU A CD1 
1145 C CD2 . LEU A 172 ? 0.2993 0.2775 0.2431 0.0201  0.0058  -0.0023 172 LEU A CD2 
1146 N N   . THR A 173 ? 0.1393 0.1326 0.1612 -0.0114 0.0057  0.0427  173 THR A N   
1147 C CA  . THR A 173 ? 0.1370 0.1198 0.1545 -0.0095 0.0004  0.0375  173 THR A CA  
1148 C C   . THR A 173 ? 0.1731 0.1482 0.1839 -0.0035 0.0025  0.0396  173 THR A C   
1149 O O   . THR A 173 ? 0.1905 0.1608 0.2009 -0.0039 0.0057  0.0469  173 THR A O   
1150 C CB  . THR A 173 ? 0.1919 0.1654 0.2213 -0.0157 -0.0050 0.0352  173 THR A CB  
1151 O OG1 . THR A 173 ? 0.3192 0.2888 0.3595 -0.0204 0.0009  0.0425  173 THR A OG1 
1152 C CG2 . THR A 173 ? 0.1622 0.1441 0.2019 -0.0200 -0.0114 0.0324  173 THR A CG2 
1153 N N   . ARG A 174 ? 0.1586 0.1324 0.1631 0.0027  0.0011  0.0334  174 ARG A N   
1154 C CA  . ARG A 174 ? 0.1944 0.1629 0.1983 0.0110  0.0014  0.0337  174 ARG A CA  
1155 C C   . ARG A 174 ? 0.1865 0.1647 0.1904 0.0138  0.0022  0.0408  174 ARG A C   
1156 O O   . ARG A 174 ? 0.2260 0.1976 0.2302 0.0202  -0.0009 0.0442  174 ARG A O   
1157 C CB  . ARG A 174 ? 0.2467 0.1937 0.2525 0.0107  -0.0016 0.0356  174 ARG A CB  
1158 C CG  . ARG A 174 ? 0.2808 0.2150 0.2869 0.0060  -0.0055 0.0278  174 ARG A CG  
1159 C CD  . ARG A 174 ? 0.3701 0.2795 0.3799 0.0044  -0.0094 0.0292  174 ARG A CD  
1160 N NE  . ARG A 174 ? 0.3769 0.2827 0.3948 -0.0055 -0.0072 0.0404  174 ARG A NE  
1161 C CZ  . ARG A 174 ? 0.6046 0.4902 0.6295 -0.0127 -0.0095 0.0433  174 ARG A CZ  
1162 N NH1 . ARG A 174 ? 0.6281 0.4926 0.6518 -0.0104 -0.0167 0.0347  174 ARG A NH1 
1163 N NH2 . ARG A 174 ? 0.5649 0.4501 0.5980 -0.0228 -0.0034 0.0544  174 ARG A NH2 
1164 N N   . ALA A 175 ? 0.1471 0.1383 0.1494 0.0096  0.0041  0.0424  175 ALA A N   
1165 C CA  . ALA A 175 ? 0.1760 0.1737 0.1750 0.0114  0.0026  0.0473  175 ALA A CA  
1166 C C   . ALA A 175 ? 0.1599 0.1723 0.1665 0.0161  0.0008  0.0432  175 ALA A C   
1167 O O   . ALA A 175 ? 0.1766 0.1970 0.1875 0.0153  0.0047  0.0375  175 ALA A O   
1168 C CB  . ALA A 175 ? 0.1860 0.1880 0.1800 0.0052  0.0057  0.0496  175 ALA A CB  
1169 N N   . ASN A 176 ? 0.1351 0.1506 0.1431 0.0206  -0.0053 0.0464  176 ASN A N   
1170 C CA  . ASN A 176 ? 0.1291 0.1627 0.1519 0.0235  -0.0080 0.0429  176 ASN A CA  
1171 C C   . ASN A 176 ? 0.1889 0.2312 0.2082 0.0162  -0.0090 0.0432  176 ASN A C   
1172 O O   . ASN A 176 ? 0.2150 0.2518 0.2234 0.0154  -0.0156 0.0467  176 ASN A O   
1173 C CB  . ASN A 176 ? 0.1423 0.1752 0.1727 0.0328  -0.0186 0.0456  176 ASN A CB  
1174 C CG  . ASN A 176 ? 0.1949 0.2513 0.2507 0.0360  -0.0224 0.0412  176 ASN A CG  
1175 O OD1 . ASN A 176 ? 0.1678 0.2399 0.2343 0.0305  -0.0142 0.0366  176 ASN A OD1 
1176 N ND2 . ASN A 176 ? 0.2702 0.3287 0.3370 0.0445  -0.0355 0.0434  176 ASN A ND2 
1177 N N   . LEU A 177 ? 0.1317 0.1839 0.1568 0.0109  -0.0026 0.0395  177 LEU A N   
1178 C CA  . LEU A 177 ? 0.1129 0.1699 0.1359 0.0036  -0.0039 0.0397  177 LEU A CA  
1179 C C   . LEU A 177 ? 0.1101 0.1855 0.1534 0.0013  -0.0046 0.0373  177 LEU A C   
1180 O O   . LEU A 177 ? 0.1280 0.2070 0.1729 -0.0066 -0.0038 0.0371  177 LEU A O   
1181 C CB  . LEU A 177 ? 0.1057 0.1561 0.1190 -0.0022 0.0024  0.0393  177 LEU A CB  
1182 C CG  . LEU A 177 ? 0.1743 0.2113 0.1755 -0.0021 0.0026  0.0413  177 LEU A CG  
1183 C CD1 . LEU A 177 ? 0.2154 0.2481 0.2138 -0.0055 0.0058  0.0404  177 LEU A CD1 
1184 C CD2 . LEU A 177 ? 0.2346 0.2670 0.2272 -0.0034 -0.0005 0.0423  177 LEU A CD2 
1185 N N   . GLU A 178 ? 0.1155 0.2026 0.1778 0.0081  -0.0061 0.0355  178 GLU A N   
1186 C CA  . GLU A 178 ? 0.1033 0.2131 0.1936 0.0056  -0.0049 0.0329  178 GLU A CA  
1187 C C   . GLU A 178 ? 0.1388 0.2526 0.2340 -0.0009 -0.0173 0.0338  178 GLU A C   
1188 O O   . GLU A 178 ? 0.1376 0.2420 0.2221 0.0028  -0.0310 0.0354  178 GLU A O   
1189 C CB  . GLU A 178 ? 0.1067 0.2302 0.2226 0.0166  -0.0063 0.0299  178 GLU A CB  
1190 C CG  . GLU A 178 ? 0.1576 0.2788 0.2720 0.0224  0.0081  0.0259  178 GLU A CG  
1191 C CD  . GLU A 178 ? 0.3300 0.4653 0.4739 0.0349  0.0082  0.0212  178 GLU A CD  
1192 O OE1 . GLU A 178 ? 0.4539 0.5798 0.5984 0.0447  -0.0050 0.0232  178 GLU A OE1 
1193 O OE2 . GLU A 178 ? 0.2929 0.4479 0.4590 0.0354  0.0222  0.0158  178 GLU A OE2 
1194 N N   . GLN A 179 ? 0.1030 0.2275 0.2107 -0.0113 -0.0124 0.0331  179 GLN A N   
1195 C CA  . GLN A 179 ? 0.1084 0.2354 0.2233 -0.0196 -0.0246 0.0325  179 GLN A CA  
1196 C C   . GLN A 179 ? 0.1295 0.2318 0.2114 -0.0217 -0.0321 0.0331  179 GLN A C   
1197 O O   . GLN A 179 ? 0.1500 0.2487 0.2311 -0.0270 -0.0444 0.0309  179 GLN A O   
1198 C CB  . GLN A 179 ? 0.1139 0.2569 0.2550 -0.0144 -0.0409 0.0304  179 GLN A CB  
1199 C CG  . GLN A 179 ? 0.2789 0.4506 0.4614 -0.0099 -0.0336 0.0282  179 GLN A CG  
1200 C CD  . GLN A 179 ? 0.4159 0.6080 0.6269 -0.0227 -0.0209 0.0273  179 GLN A CD  
1201 O OE1 . GLN A 179 ? 0.4403 0.6283 0.6499 -0.0354 -0.0261 0.0281  179 GLN A OE1 
1202 N NE2 . GLN A 179 ? 0.5370 0.7492 0.7727 -0.0198 -0.0031 0.0255  179 GLN A NE2 
1203 N N   . ALA A 180 ? 0.1148 0.2004 0.1713 -0.0179 -0.0247 0.0350  180 ALA A N   
1204 C CA  . ALA A 180 ? 0.1236 0.1886 0.1535 -0.0191 -0.0280 0.0345  180 ALA A CA  
1205 C C   . ALA A 180 ? 0.1651 0.2246 0.1945 -0.0285 -0.0252 0.0336  180 ALA A C   
1206 O O   . ALA A 180 ? 0.1771 0.2445 0.2191 -0.0342 -0.0172 0.0357  180 ALA A O   
1207 C CB  . ALA A 180 ? 0.1263 0.1792 0.1379 -0.0130 -0.0203 0.0368  180 ALA A CB  
1208 N N   . ASP A 181 ? 0.1484 0.1915 0.1608 -0.0299 -0.0310 0.0306  181 ASP A N   
1209 C CA  . ASP A 181 ? 0.1527 0.1849 0.1633 -0.0375 -0.0300 0.0297  181 ASP A CA  
1210 C C   . ASP A 181 ? 0.1633 0.1793 0.1560 -0.0323 -0.0239 0.0295  181 ASP A C   
1211 O O   . ASP A 181 ? 0.1770 0.1820 0.1538 -0.0269 -0.0254 0.0254  181 ASP A O   
1212 C CB  . ASP A 181 ? 0.1775 0.2017 0.1868 -0.0432 -0.0430 0.0240  181 ASP A CB  
1213 C CG  . ASP A 181 ? 0.2728 0.2835 0.2839 -0.0524 -0.0430 0.0236  181 ASP A CG  
1214 O OD1 . ASP A 181 ? 0.2199 0.2262 0.2301 -0.0534 -0.0336 0.0287  181 ASP A OD1 
1215 O OD2 . ASP A 181 ? 0.2666 0.2685 0.2785 -0.0589 -0.0543 0.0182  181 ASP A OD2 
1216 N N   . LEU A 182 ? 0.1450 0.1599 0.1406 -0.0337 -0.0168 0.0338  182 LEU A N   
1217 C CA  . LEU A 182 ? 0.1713 0.1744 0.1577 -0.0283 -0.0134 0.0338  182 LEU A CA  
1218 C C   . LEU A 182 ? 0.1659 0.1527 0.1501 -0.0322 -0.0165 0.0340  182 LEU A C   
1219 O O   . LEU A 182 ? 0.1926 0.1709 0.1747 -0.0284 -0.0156 0.0357  182 LEU A O   
1220 C CB  . LEU A 182 ? 0.1605 0.1702 0.1492 -0.0254 -0.0075 0.0381  182 LEU A CB  
1221 C CG  . LEU A 182 ? 0.1946 0.2128 0.1836 -0.0194 -0.0044 0.0375  182 LEU A CG  
1222 C CD1 . LEU A 182 ? 0.2161 0.2463 0.2114 -0.0202 -0.0057 0.0378  182 LEU A CD1 
1223 C CD2 . LEU A 182 ? 0.2228 0.2418 0.2131 -0.0167 -0.0008 0.0398  182 LEU A CD2 
1224 N N   . SER A 183 ? 0.1627 0.1439 0.1491 -0.0400 -0.0222 0.0323  183 SER A N   
1225 C CA  . SER A 183 ? 0.1948 0.1555 0.1783 -0.0443 -0.0264 0.0328  183 SER A CA  
1226 C C   . SER A 183 ? 0.2474 0.1922 0.2225 -0.0340 -0.0276 0.0264  183 SER A C   
1227 O O   . SER A 183 ? 0.2407 0.1846 0.2088 -0.0285 -0.0275 0.0184  183 SER A O   
1228 C CB  . SER A 183 ? 0.2478 0.2036 0.2368 -0.0551 -0.0337 0.0301  183 SER A CB  
1229 O OG  . SER A 183 ? 0.2200 0.1945 0.2244 -0.0649 -0.0306 0.0357  183 SER A OG  
1230 N N   . GLY A 184 ? 0.2294 0.1616 0.2049 -0.0309 -0.0284 0.0300  184 GLY A N   
1231 C CA  . GLY A 184 ? 0.2302 0.1496 0.2054 -0.0198 -0.0290 0.0233  184 GLY A CA  
1232 C C   . GLY A 184 ? 0.2274 0.1619 0.2084 -0.0095 -0.0213 0.0208  184 GLY A C   
1233 O O   . GLY A 184 ? 0.2294 0.1582 0.2160 0.0003  -0.0188 0.0148  184 GLY A O   
1234 N N   . ALA A 185 ? 0.1827 0.1361 0.1650 -0.0117 -0.0167 0.0250  185 ALA A N   
1235 C CA  . ALA A 185 ? 0.1804 0.1468 0.1699 -0.0045 -0.0094 0.0239  185 ALA A CA  
1236 C C   . ALA A 185 ? 0.1886 0.1548 0.1922 0.0002  -0.0126 0.0270  185 ALA A C   
1237 O O   . ALA A 185 ? 0.2154 0.1753 0.2165 -0.0038 -0.0202 0.0336  185 ALA A O   
1238 C CB  . ALA A 185 ? 0.1978 0.1797 0.1850 -0.0083 -0.0059 0.0280  185 ALA A CB  
1239 N N   . ARG A 186 ? 0.1674 0.1398 0.1857 0.0085  -0.0072 0.0225  186 ARG A N   
1240 C CA  . ARG A 186 ? 0.1706 0.1472 0.2089 0.0133  -0.0128 0.0250  186 ARG A CA  
1241 C C   . ARG A 186 ? 0.1580 0.1488 0.1998 0.0091  -0.0124 0.0297  186 ARG A C   
1242 O O   . ARG A 186 ? 0.1678 0.1699 0.2117 0.0082  -0.0024 0.0282  186 ARG A O   
1243 C CB  . ARG A 186 ? 0.1906 0.1723 0.2519 0.0238  -0.0061 0.0174  186 ARG A CB  
1244 C CG  . ARG A 186 ? 0.3835 0.3468 0.4422 0.0304  -0.0081 0.0109  186 ARG A CG  
1245 C CD  . ARG A 186 ? 0.5313 0.5001 0.6046 0.0407  0.0065  -0.0001 186 ARG A CD  
1246 N NE  . ARG A 186 ? 0.6831 0.6732 0.7918 0.0464  0.0110  -0.0003 186 ARG A NE  
1247 C CZ  . ARG A 186 ? 0.7539 0.7479 0.8943 0.0584  0.0118  -0.0066 186 ARG A CZ  
1248 N NH1 . ARG A 186 ? 0.7994 0.7737 0.9368 0.0671  0.0085  -0.0135 186 ARG A NH1 
1249 N NH2 . ARG A 186 ? 0.6940 0.7116 0.8726 0.0618  0.0152  -0.0065 186 ARG A NH2 
1250 N N   . THR A 187 ? 0.1583 0.1141 0.1470 0.0006  -0.0171 0.0092  187 THR A N   
1251 C CA  . THR A 187 ? 0.1403 0.1016 0.1328 0.0006  -0.0159 0.0089  187 THR A CA  
1252 C C   . THR A 187 ? 0.1668 0.1286 0.1615 0.0025  -0.0177 0.0077  187 THR A C   
1253 O O   . THR A 187 ? 0.1671 0.1317 0.1629 0.0021  -0.0174 0.0072  187 THR A O   
1254 C CB  . THR A 187 ? 0.2021 0.1652 0.1917 -0.0019 -0.0152 0.0109  187 THR A CB  
1255 O OG1 . THR A 187 ? 0.2153 0.1744 0.1995 -0.0031 -0.0171 0.0123  187 THR A OG1 
1256 C CG2 . THR A 187 ? 0.2717 0.2365 0.2614 -0.0038 -0.0137 0.0121  187 THR A CG2 
1257 N N   . THR A 188 ? 0.1659 0.1252 0.1616 0.0046  -0.0197 0.0069  188 THR A N   
1258 C CA  . THR A 188 ? 0.1667 0.1276 0.1661 0.0064  -0.0222 0.0057  188 THR A CA  
1259 C C   . THR A 188 ? 0.1992 0.1658 0.2060 0.0066  -0.0203 0.0040  188 THR A C   
1260 O O   . THR A 188 ? 0.1881 0.1566 0.1993 0.0071  -0.0175 0.0034  188 THR A O   
1261 C CB  . THR A 188 ? 0.2539 0.2122 0.2552 0.0094  -0.0247 0.0054  188 THR A CB  
1262 O OG1 . THR A 188 ? 0.2169 0.1685 0.2105 0.0091  -0.0270 0.0072  188 THR A OG1 
1263 C CG2 . THR A 188 ? 0.3032 0.2651 0.3106 0.0113  -0.0277 0.0042  188 THR A CG2 
1264 N N   . GLY A 189 ? 0.1414 0.1098 0.1487 0.0059  -0.0217 0.0033  189 GLY A N   
1265 C CA  . GLY A 189 ? 0.1697 0.1423 0.1836 0.0055  -0.0202 0.0016  189 GLY A CA  
1266 C C   . GLY A 189 ? 0.1936 0.1671 0.2071 0.0040  -0.0162 0.0021  189 GLY A C   
1267 O O   . GLY A 189 ? 0.1613 0.1372 0.1799 0.0036  -0.0147 0.0010  189 GLY A O   
1268 N N   . ALA A 190 ? 0.1584 0.1302 0.1664 0.0032  -0.0148 0.0038  190 ALA A N   
1269 C CA  . ALA A 190 ? 0.1302 0.1036 0.1386 0.0023  -0.0115 0.0046  190 ALA A CA  
1270 C C   . ALA A 190 ? 0.1297 0.1035 0.1374 0.0019  -0.0110 0.0038  190 ALA A C   
1271 O O   . ALA A 190 ? 0.1482 0.1205 0.1518 0.0018  -0.0129 0.0032  190 ALA A O   
1272 C CB  . ALA A 190 ? 0.1581 0.1305 0.1619 0.0013  -0.0108 0.0068  190 ALA A CB  
1273 N N   . ARG A 191 ? 0.1195 0.0946 0.1304 0.0018  -0.0084 0.0037  191 ARG A N   
1274 C CA  . ARG A 191 ? 0.1200 0.0944 0.1309 0.0018  -0.0076 0.0024  191 ARG A CA  
1275 C C   . ARG A 191 ? 0.1367 0.1120 0.1465 0.0022  -0.0047 0.0041  191 ARG A C   
1276 O O   . ARG A 191 ? 0.1452 0.1215 0.1581 0.0025  -0.0027 0.0054  191 ARG A O   
1277 C CB  . ARG A 191 ? 0.1216 0.0961 0.1385 0.0015  -0.0074 0.0007  191 ARG A CB  
1278 C CG  . ARG A 191 ? 0.1447 0.1199 0.1645 0.0013  -0.0106 -0.0008 191 ARG A CG  
1279 C CD  . ARG A 191 ? 0.2003 0.1775 0.2283 0.0007  -0.0096 -0.0015 191 ARG A CD  
1280 N NE  . ARG A 191 ? 0.1862 0.1619 0.2165 -0.0006 -0.0099 -0.0034 191 ARG A NE  
1281 C CZ  . ARG A 191 ? 0.1947 0.1719 0.2323 -0.0021 -0.0105 -0.0046 191 ARG A CZ  
1282 N NH1 . ARG A 191 ? 0.1772 0.1586 0.2214 -0.0019 -0.0103 -0.0040 191 ARG A NH1 
1283 N NH2 . ARG A 191 ? 0.1275 0.1021 0.1664 -0.0037 -0.0111 -0.0065 191 ARG A NH2 
1284 N N   . LEU A 192 ? 0.1219 0.0971 0.1272 0.0024  -0.0043 0.0044  192 LEU A N   
1285 C CA  . LEU A 192 ? 0.1229 0.1004 0.1283 0.0030  -0.0016 0.0064  192 LEU A CA  
1286 C C   . LEU A 192 ? 0.1446 0.1209 0.1486 0.0044  0.0006  0.0050  192 LEU A C   
1287 O O   . LEU A 192 ? 0.1586 0.1373 0.1619 0.0052  0.0030  0.0064  192 LEU A O   
1288 C CB  . LEU A 192 ? 0.1268 0.1063 0.1292 0.0018  -0.0021 0.0087  192 LEU A CB  
1289 C CG  . LEU A 192 ? 0.1819 0.1629 0.1859 0.0006  -0.0032 0.0108  192 LEU A CG  
1290 C CD1 . LEU A 192 ? 0.1929 0.1711 0.1968 0.0003  -0.0054 0.0095  192 LEU A CD1 
1291 C CD2 . LEU A 192 ? 0.1860 0.1686 0.1873 -0.0012 -0.0035 0.0130  192 LEU A CD2 
1292 N N   . ASP A 193 ? 0.1394 0.1119 0.1430 0.0047  -0.0001 0.0020  193 ASP A N   
1293 C CA  . ASP A 193 ? 0.1404 0.1101 0.1414 0.0062  0.0021  0.0000  193 ASP A CA  
1294 C C   . ASP A 193 ? 0.1434 0.1148 0.1484 0.0082  0.0056  0.0018  193 ASP A C   
1295 O O   . ASP A 193 ? 0.1467 0.1191 0.1567 0.0082  0.0056  0.0033  193 ASP A O   
1296 C CB  . ASP A 193 ? 0.1416 0.1062 0.1423 0.0056  0.0003  -0.0036 193 ASP A CB  
1297 C CG  . ASP A 193 ? 0.2239 0.1865 0.2195 0.0042  -0.0035 -0.0057 193 ASP A CG  
1298 O OD1 . ASP A 193 ? 0.1980 0.1621 0.1893 0.0040  -0.0043 -0.0043 193 ASP A OD1 
1299 O OD2 . ASP A 193 ? 0.2131 0.1724 0.2092 0.0032  -0.0059 -0.0085 193 ASP A OD2 
1300 N N   . ASP A 194 ? 0.1372 0.1092 0.1399 0.0102  0.0086  0.0017  194 ASP A N   
1301 C CA  . ASP A 194 ? 0.1372 0.1115 0.1443 0.0130  0.0119  0.0035  194 ASP A CA  
1302 C C   . ASP A 194 ? 0.1544 0.1354 0.1671 0.0127  0.0117  0.0078  194 ASP A C   
1303 O O   . ASP A 194 ? 0.1542 0.1375 0.1715 0.0151  0.0135  0.0097  194 ASP A O   
1304 C CB  . ASP A 194 ? 0.1760 0.1448 0.1855 0.0144  0.0125  0.0019  194 ASP A CB  
1305 C CG  . ASP A 194 ? 0.2924 0.2539 0.2965 0.0143  0.0123  -0.0026 194 ASP A CG  
1306 O OD1 . ASP A 194 ? 0.2177 0.1779 0.2166 0.0159  0.0145  -0.0044 194 ASP A OD1 
1307 O OD2 . ASP A 194 ? 0.2965 0.2537 0.3013 0.0124  0.0099  -0.0044 194 ASP A OD2 
1308 N N   . ALA A 195 ? 0.1410 0.1247 0.1529 0.0100  0.0092  0.0092  195 ALA A N   
1309 C CA  . ALA A 195 ? 0.1428 0.1321 0.1586 0.0092  0.0083  0.0129  195 ALA A CA  
1310 C C   . ALA A 195 ? 0.1610 0.1565 0.1789 0.0099  0.0105  0.0151  195 ALA A C   
1311 O O   . ALA A 195 ? 0.1808 0.1761 0.1952 0.0101  0.0125  0.0139  195 ALA A O   
1312 C CB  . ALA A 195 ? 0.1286 0.1176 0.1422 0.0061  0.0051  0.0134  195 ALA A CB  
1313 N N   . ASP A 196 ? 0.1373 0.1385 0.1607 0.0101  0.0101  0.0184  196 ASP A N   
1314 C CA  . ASP A 196 ? 0.1495 0.1583 0.1768 0.0102  0.0119  0.0209  196 ASP A CA  
1315 C C   . ASP A 196 ? 0.1299 0.1415 0.1563 0.0059  0.0090  0.0228  196 ASP A C   
1316 O O   . ASP A 196 ? 0.1645 0.1771 0.1925 0.0044  0.0058  0.0246  196 ASP A O   
1317 C CB  . ASP A 196 ? 0.1577 0.1718 0.1930 0.0132  0.0128  0.0235  196 ASP A CB  
1318 C CG  . ASP A 196 ? 0.2038 0.2272 0.2453 0.0141  0.0155  0.0259  196 ASP A CG  
1319 O OD1 . ASP A 196 ? 0.1491 0.1751 0.1886 0.0114  0.0165  0.0262  196 ASP A OD1 
1320 O OD2 . ASP A 196 ? 0.2022 0.2306 0.2511 0.0176  0.0168  0.0279  196 ASP A OD2 
1321 N N   . LEU A 197 ? 0.1203 0.1321 0.1430 0.0039  0.0100  0.0226  197 LEU A N   
1322 C CA  . LEU A 197 ? 0.1197 0.1322 0.1405 -0.0005 0.0072  0.0243  197 LEU A CA  
1323 C C   . LEU A 197 ? 0.1202 0.1413 0.1466 -0.0025 0.0084  0.0277  197 LEU A C   
1324 O O   . LEU A 197 ? 0.1520 0.1736 0.1772 -0.0066 0.0061  0.0294  197 LEU A O   
1325 C CB  . LEU A 197 ? 0.1480 0.1541 0.1605 -0.0021 0.0068  0.0223  197 LEU A CB  
1326 C CG  . LEU A 197 ? 0.2089 0.2075 0.2168 -0.0019 0.0038  0.0197  197 LEU A CG  
1327 C CD1 . LEU A 197 ? 0.2026 0.1957 0.2033 -0.0022 0.0036  0.0177  197 LEU A CD1 
1328 C CD2 . LEU A 197 ? 0.2035 0.2012 0.2115 -0.0045 0.0001  0.0209  197 LEU A CD2 
1329 N N   . ARG A 198 ? 0.1514 0.1792 0.1844 0.0004  0.0120  0.0288  198 ARG A N   
1330 C CA  . ARG A 198 ? 0.1565 0.1939 0.1962 -0.0014 0.0140  0.0322  198 ARG A CA  
1331 C C   . ARG A 198 ? 0.1702 0.2125 0.2149 -0.0055 0.0093  0.0353  198 ARG A C   
1332 O O   . ARG A 198 ? 0.1505 0.1937 0.1984 -0.0046 0.0060  0.0359  198 ARG A O   
1333 C CB  . ARG A 198 ? 0.1550 0.1994 0.2025 0.0034  0.0187  0.0328  198 ARG A CB  
1334 C CG  . ARG A 198 ? 0.1728 0.2129 0.2147 0.0068  0.0242  0.0298  198 ARG A CG  
1335 C CD  . ARG A 198 ? 0.2076 0.2533 0.2571 0.0125  0.0289  0.0300  198 ARG A CD  
1336 N NE  . ARG A 198 ? 0.2160 0.2589 0.2684 0.0159  0.0264  0.0294  198 ARG A NE  
1337 C CZ  . ARG A 198 ? 0.3338 0.3800 0.3932 0.0212  0.0292  0.0298  198 ARG A CZ  
1338 N NH1 . ARG A 198 ? 0.2904 0.3437 0.3552 0.0242  0.0350  0.0305  198 ARG A NH1 
1339 N NH2 . ARG A 198 ? 0.2758 0.3182 0.3368 0.0239  0.0266  0.0296  198 ARG A NH2 
1340 N N   . GLY A 199 ? 0.1385 0.1830 0.1828 -0.0104 0.0089  0.0372  199 GLY A N   
1341 C CA  . GLY A 199 ? 0.1829 0.2311 0.2311 -0.0152 0.0041  0.0399  199 GLY A CA  
1342 C C   . GLY A 199 ? 0.1743 0.2128 0.2141 -0.0179 -0.0011 0.0382  199 GLY A C   
1343 O O   . GLY A 199 ? 0.1825 0.2218 0.2234 -0.0223 -0.0054 0.0399  199 GLY A O   
1344 N N   . ALA A 200 ? 0.1394 0.1684 0.1710 -0.0155 -0.0009 0.0349  200 ALA A N   
1345 C CA  . ALA A 200 ? 0.1421 0.1621 0.1662 -0.0174 -0.0051 0.0332  200 ALA A CA  
1346 C C   . ALA A 200 ? 0.2008 0.2163 0.2197 -0.0220 -0.0063 0.0338  200 ALA A C   
1347 O O   . ALA A 200 ? 0.1707 0.1878 0.1892 -0.0231 -0.0032 0.0349  200 ALA A O   
1348 C CB  . ALA A 200 ? 0.1453 0.1578 0.1638 -0.0135 -0.0043 0.0297  200 ALA A CB  
1349 N N   . THR A 201 ? 0.1665 0.1757 0.1807 -0.0246 -0.0105 0.0331  201 THR A N   
1350 C CA  . THR A 201 ? 0.1895 0.1915 0.1973 -0.0284 -0.0122 0.0333  201 THR A CA  
1351 C C   . THR A 201 ? 0.1722 0.1643 0.1721 -0.0256 -0.0125 0.0302  201 THR A C   
1352 O O   . THR A 201 ? 0.1919 0.1803 0.1898 -0.0236 -0.0143 0.0280  201 THR A O   
1353 C CB  . THR A 201 ? 0.1989 0.1988 0.2059 -0.0332 -0.0169 0.0342  201 THR A CB  
1354 O OG1 . THR A 201 ? 0.2174 0.2277 0.2333 -0.0362 -0.0172 0.0374  201 THR A OG1 
1355 C CG2 . THR A 201 ? 0.2316 0.2221 0.2314 -0.0370 -0.0185 0.0343  201 THR A CG2 
1356 N N   . VAL A 202 ? 0.1650 0.1534 0.1606 -0.0252 -0.0107 0.0301  202 VAL A N   
1357 C CA  . VAL A 202 ? 0.1741 0.1542 0.1634 -0.0223 -0.0116 0.0273  202 VAL A CA  
1358 C C   . VAL A 202 ? 0.1985 0.1712 0.1812 -0.0245 -0.0127 0.0283  202 VAL A C   
1359 O O   . VAL A 202 ? 0.2346 0.2091 0.2169 -0.0278 -0.0114 0.0311  202 VAL A O   
1360 C CB  . VAL A 202 ? 0.2383 0.2204 0.2284 -0.0179 -0.0088 0.0254  202 VAL A CB  
1361 C CG1 . VAL A 202 ? 0.2448 0.2341 0.2417 -0.0157 -0.0071 0.0251  202 VAL A CG1 
1362 C CG2 . VAL A 202 ? 0.2572 0.2400 0.2445 -0.0182 -0.0062 0.0266  202 VAL A CG2 
1363 N N   . ASP A 203 ? 0.1892 0.1537 0.1668 -0.0227 -0.0151 0.0263  203 ASP A N   
1364 C CA  . ASP A 203 ? 0.2068 0.1631 0.1776 -0.0236 -0.0165 0.0272  203 ASP A CA  
1365 C C   . ASP A 203 ? 0.2103 0.1671 0.1784 -0.0213 -0.0147 0.0272  203 ASP A C   
1366 O O   . ASP A 203 ? 0.2055 0.1663 0.1763 -0.0179 -0.0134 0.0250  203 ASP A O   
1367 C CB  . ASP A 203 ? 0.1994 0.1470 0.1666 -0.0216 -0.0196 0.0249  203 ASP A CB  
1368 C CG  . ASP A 203 ? 0.2557 0.2006 0.2230 -0.0240 -0.0215 0.0245  203 ASP A CG  
1369 O OD1 . ASP A 203 ? 0.2648 0.2109 0.2326 -0.0288 -0.0220 0.0268  203 ASP A OD1 
1370 O OD2 . ASP A 203 ? 0.2651 0.2066 0.2318 -0.0213 -0.0225 0.0218  203 ASP A OD2 
1371 N N   . PRO A 204 ? 0.1827 0.1346 0.1446 -0.0232 -0.0150 0.0295  204 PRO A N   
1372 C CA  . PRO A 204 ? 0.1723 0.1234 0.1295 -0.0210 -0.0138 0.0295  204 PRO A CA  
1373 C C   . PRO A 204 ? 0.2028 0.1516 0.1596 -0.0162 -0.0161 0.0261  204 PRO A C   
1374 O O   . PRO A 204 ? 0.1927 0.1439 0.1487 -0.0140 -0.0149 0.0246  204 PRO A O   
1375 C CB  . PRO A 204 ? 0.2111 0.1544 0.1602 -0.0238 -0.0150 0.0327  204 PRO A CB  
1376 C CG  . PRO A 204 ? 0.2300 0.1745 0.1820 -0.0289 -0.0143 0.0354  204 PRO A CG  
1377 C CD  . PRO A 204 ? 0.2075 0.1544 0.1660 -0.0280 -0.0160 0.0327  204 PRO A CD  
1378 N N   . VAL A 205 ? 0.1665 0.1109 0.1246 -0.0148 -0.0191 0.0246  205 VAL A N   
1379 C CA  . VAL A 205 ? 0.1641 0.1072 0.1234 -0.0105 -0.0213 0.0217  205 VAL A CA  
1380 C C   . VAL A 205 ? 0.1573 0.1079 0.1231 -0.0086 -0.0191 0.0191  205 VAL A C   
1381 O O   . VAL A 205 ? 0.1667 0.1179 0.1334 -0.0058 -0.0202 0.0170  205 VAL A O   
1382 C CB  . VAL A 205 ? 0.2092 0.1468 0.1695 -0.0090 -0.0239 0.0206  205 VAL A CB  
1383 C CG1 . VAL A 205 ? 0.1757 0.1161 0.1405 -0.0103 -0.0225 0.0196  205 VAL A CG1 
1384 C CG2 . VAL A 205 ? 0.2084 0.1457 0.1713 -0.0046 -0.0261 0.0180  205 VAL A CG2 
1385 N N   . LEU A 206 ? 0.1611 0.1173 0.1312 -0.0101 -0.0164 0.0194  206 LEU A N   
1386 C CA  . LEU A 206 ? 0.1580 0.1201 0.1336 -0.0082 -0.0143 0.0173  206 LEU A CA  
1387 C C   . LEU A 206 ? 0.1750 0.1383 0.1479 -0.0071 -0.0130 0.0167  206 LEU A C   
1388 O O   . LEU A 206 ? 0.1665 0.1309 0.1416 -0.0048 -0.0131 0.0141  206 LEU A O   
1389 C CB  . LEU A 206 ? 0.1673 0.1351 0.1477 -0.0098 -0.0118 0.0185  206 LEU A CB  
1390 C CG  . LEU A 206 ? 0.1900 0.1628 0.1759 -0.0075 -0.0098 0.0167  206 LEU A CG  
1391 C CD1 . LEU A 206 ? 0.2436 0.2193 0.2338 -0.0083 -0.0096 0.0174  206 LEU A CD1 
1392 C CD2 . LEU A 206 ? 0.1971 0.1739 0.1833 -0.0071 -0.0067 0.0171  206 LEU A CD2 
1393 N N   . TRP A 207 ? 0.1760 0.1387 0.1437 -0.0090 -0.0116 0.0189  207 TRP A N   
1394 C CA  . TRP A 207 ? 0.1627 0.1256 0.1259 -0.0080 -0.0098 0.0182  207 TRP A CA  
1395 C C   . TRP A 207 ? 0.2106 0.1682 0.1686 -0.0062 -0.0136 0.0164  207 TRP A C   
1396 O O   . TRP A 207 ? 0.1925 0.1498 0.1473 -0.0048 -0.0132 0.0145  207 TRP A O   
1397 C CB  . TRP A 207 ? 0.1629 0.1262 0.1210 -0.0106 -0.0069 0.0213  207 TRP A CB  
1398 C CG  . TRP A 207 ? 0.1575 0.1273 0.1219 -0.0128 -0.0036 0.0235  207 TRP A CG  
1399 C CD1 . TRP A 207 ? 0.1602 0.1300 0.1245 -0.0165 -0.0034 0.0269  207 TRP A CD1 
1400 C CD2 . TRP A 207 ? 0.1707 0.1479 0.1427 -0.0115 -0.0004 0.0227  207 TRP A CD2 
1401 N NE1 . TRP A 207 ? 0.1819 0.1597 0.1540 -0.0179 -0.0007 0.0282  207 TRP A NE1 
1402 C CE2 . TRP A 207 ? 0.1817 0.1641 0.1586 -0.0145 0.0012  0.0258  207 TRP A CE2 
1403 C CE3 . TRP A 207 ? 0.1680 0.1474 0.1433 -0.0082 0.0010  0.0197  207 TRP A CE3 
1404 C CZ2 . TRP A 207 ? 0.1489 0.1394 0.1343 -0.0138 0.0038  0.0262  207 TRP A CZ2 
1405 C CZ3 . TRP A 207 ? 0.1767 0.1631 0.1597 -0.0074 0.0040  0.0202  207 TRP A CZ3 
1406 C CH2 . TRP A 207 ? 0.1714 0.1636 0.1596 -0.0099 0.0052  0.0235  207 TRP A CH2 
1407 N N   . ARG A 208 ? 0.1675 0.1206 0.1246 -0.0060 -0.0175 0.0170  208 ARG A N   
1408 C CA  . ARG A 208 ? 0.1854 0.1342 0.1391 -0.0040 -0.0219 0.0158  208 ARG A CA  
1409 C C   . ARG A 208 ? 0.2336 0.1849 0.1952 -0.0015 -0.0239 0.0127  208 ARG A C   
1410 O O   . ARG A 208 ? 0.2674 0.2174 0.2284 0.0001  -0.0275 0.0111  208 ARG A O   
1411 C CB  . ARG A 208 ? 0.1902 0.1324 0.1391 -0.0043 -0.0253 0.0184  208 ARG A CB  
1412 C CG  . ARG A 208 ? 0.2269 0.1651 0.1664 -0.0070 -0.0240 0.0219  208 ARG A CG  
1413 C CD  . ARG A 208 ? 0.2300 0.1600 0.1640 -0.0070 -0.0280 0.0245  208 ARG A CD  
1414 N NE  . ARG A 208 ? 0.1889 0.1169 0.1270 -0.0082 -0.0280 0.0255  208 ARG A NE  
1415 C CZ  . ARG A 208 ? 0.2384 0.1650 0.1746 -0.0120 -0.0257 0.0283  208 ARG A CZ  
1416 N NH1 . ARG A 208 ? 0.2135 0.1415 0.1449 -0.0150 -0.0224 0.0307  208 ARG A NH1 
1417 N NH2 . ARG A 208 ? 0.2002 0.1238 0.1393 -0.0131 -0.0265 0.0286  208 ARG A NH2 
1418 N N   . THR A 209 ? 0.1561 0.1113 0.1253 -0.0015 -0.0217 0.0119  209 THR A N   
1419 C CA  . THR A 209 ? 0.1468 0.1041 0.1236 0.0005  -0.0230 0.0095  209 THR A CA  
1420 C C   . THR A 209 ? 0.1753 0.1374 0.1578 0.0007  -0.0203 0.0074  209 THR A C   
1421 O O   . THR A 209 ? 0.2091 0.1727 0.1963 0.0019  -0.0217 0.0052  209 THR A O   
1422 C CB  . THR A 209 ? 0.1826 0.1391 0.1630 0.0008  -0.0228 0.0102  209 THR A CB  
1423 O OG1 . THR A 209 ? 0.1987 0.1561 0.1781 -0.0015 -0.0199 0.0118  209 THR A OG1 
1424 C CG2 . THR A 209 ? 0.1869 0.1376 0.1635 0.0017  -0.0263 0.0114  209 THR A CG2 
1425 N N   . ALA A 210 ? 0.1639 0.1285 0.1465 -0.0005 -0.0166 0.0083  210 ALA A N   
1426 C CA  . ALA A 210 ? 0.1335 0.1016 0.1213 0.0001  -0.0140 0.0067  210 ALA A CA  
1427 C C   . ALA A 210 ? 0.1531 0.1204 0.1382 0.0006  -0.0137 0.0047  210 ALA A C   
1428 O O   . ALA A 210 ? 0.1744 0.1397 0.1524 0.0001  -0.0136 0.0052  210 ALA A O   
1429 C CB  . ALA A 210 ? 0.1392 0.1104 0.1289 -0.0008 -0.0106 0.0086  210 ALA A CB  
1430 N N   . SER A 211 ? 0.1682 0.1365 0.1581 0.0012  -0.0133 0.0024  211 SER A N   
1431 C CA  . SER A 211 ? 0.1574 0.1241 0.1442 0.0016  -0.0122 0.0002  211 SER A CA  
1432 C C   . SER A 211 ? 0.1695 0.1382 0.1568 0.0020  -0.0075 0.0014  211 SER A C   
1433 O O   . SER A 211 ? 0.1589 0.1305 0.1518 0.0022  -0.0057 0.0029  211 SER A O   
1434 C CB  . SER A 211 ? 0.1992 0.1652 0.1910 0.0016  -0.0138 -0.0027 211 SER A CB  
1435 O OG  . SER A 211 ? 0.1966 0.1654 0.1966 0.0016  -0.0125 -0.0020 211 SER A OG  
1436 N N   . LEU A 212 ? 0.1488 0.1160 0.1299 0.0025  -0.0055 0.0008  212 LEU A N   
1437 C CA  . LEU A 212 ? 0.1452 0.1155 0.1270 0.0032  -0.0008 0.0026  212 LEU A CA  
1438 C C   . LEU A 212 ? 0.1626 0.1305 0.1408 0.0050  0.0023  0.0002  212 LEU A C   
1439 O O   . LEU A 212 ? 0.1541 0.1244 0.1310 0.0060  0.0064  0.0014  212 LEU A O   
1440 C CB  . LEU A 212 ? 0.1643 0.1361 0.1418 0.0018  -0.0002 0.0057  212 LEU A CB  
1441 C CG  . LEU A 212 ? 0.1534 0.1269 0.1342 0.0001  -0.0026 0.0083  212 LEU A CG  
1442 C CD1 . LEU A 212 ? 0.1894 0.1614 0.1637 -0.0018 -0.0033 0.0106  212 LEU A CD1 
1443 C CD2 . LEU A 212 ? 0.1590 0.1376 0.1469 0.0001  -0.0004 0.0102  212 LEU A CD2 
1444 N N   . VAL A 213 ? 0.1538 0.1171 0.1305 0.0054  0.0004  -0.0033 213 VAL A N   
1445 C CA  . VAL A 213 ? 0.1617 0.1211 0.1340 0.0072  0.0033  -0.0062 213 VAL A CA  
1446 C C   . VAL A 213 ? 0.1706 0.1328 0.1500 0.0094  0.0076  -0.0052 213 VAL A C   
1447 O O   . VAL A 213 ? 0.1788 0.1421 0.1657 0.0092  0.0067  -0.0045 213 VAL A O   
1448 C CB  . VAL A 213 ? 0.1704 0.1236 0.1401 0.0066  -0.0002 -0.0104 213 VAL A CB  
1449 C CG1 . VAL A 213 ? 0.2016 0.1493 0.1663 0.0086  0.0031  -0.0139 213 VAL A CG1 
1450 C CG2 . VAL A 213 ? 0.2020 0.1528 0.1646 0.0048  -0.0052 -0.0112 213 VAL A CG2 
1451 N N   . GLY A 214 ? 0.1622 0.1257 0.1394 0.0116  0.0124  -0.0047 214 GLY A N   
1452 C CA  . GLY A 214 ? 0.1855 0.1522 0.1697 0.0143  0.0164  -0.0034 214 GLY A CA  
1453 C C   . GLY A 214 ? 0.1541 0.1293 0.1460 0.0138  0.0170  0.0014  214 GLY A C   
1454 O O   . GLY A 214 ? 0.1723 0.1514 0.1709 0.0161  0.0196  0.0031  214 GLY A O   
1455 N N   . ALA A 215 ? 0.1671 0.1449 0.1581 0.0108  0.0141  0.0034  215 ALA A N   
1456 C CA  . ALA A 215 ? 0.1562 0.1410 0.1536 0.0095  0.0138  0.0075  215 ALA A CA  
1457 C C   . ALA A 215 ? 0.2079 0.1986 0.2068 0.0104  0.0182  0.0098  215 ALA A C   
1458 O O   . ALA A 215 ? 0.2056 0.1952 0.1980 0.0103  0.0205  0.0091  215 ALA A O   
1459 C CB  . ALA A 215 ? 0.1916 0.1759 0.1866 0.0061  0.0097  0.0087  215 ALA A CB  
1460 N N   . ARG A 216 ? 0.1862 0.1982 0.1889 0.0145  0.0053  0.0775  216 ARG A N   
1461 C CA  . ARG A 216 ? 0.1665 0.2015 0.1836 0.0184  -0.0015 0.0868  216 ARG A CA  
1462 C C   . ARG A 216 ? 0.2172 0.2640 0.2259 0.0057  -0.0095 0.0860  216 ARG A C   
1463 O O   . ARG A 216 ? 0.1952 0.2347 0.1820 -0.0062 -0.0155 0.0865  216 ARG A O   
1464 C CB  . ARG A 216 ? 0.1851 0.2290 0.2087 0.0233  -0.0075 0.1039  216 ARG A CB  
1465 C CG  . ARG A 216 ? 0.2816 0.3083 0.3114 0.0350  -0.0001 0.1053  216 ARG A CG  
1466 C CD  . ARG A 216 ? 0.3338 0.3689 0.3727 0.0424  -0.0058 0.1239  216 ARG A CD  
1467 N NE  . ARG A 216 ? 0.4760 0.5353 0.5389 0.0539  -0.0076 0.1332  216 ARG A NE  
1468 C CZ  . ARG A 216 ? 0.5631 0.6338 0.6399 0.0616  -0.0109 0.1461  216 ARG A CZ  
1469 N NH1 . ARG A 216 ? 0.5550 0.6138 0.6226 0.0596  -0.0147 0.1532  216 ARG A NH1 
1470 N NH2 . ARG A 216 ? 0.5601 0.6534 0.6589 0.0700  -0.0089 0.1501  216 ARG A NH2 
1471 N N   . VAL A 217 ? 0.1521 0.2144 0.1757 0.0080  -0.0094 0.0849  217 VAL A N   
1472 C CA  . VAL A 217 ? 0.1521 0.2242 0.1703 -0.0051 -0.0174 0.0848  217 VAL A CA  
1473 C C   . VAL A 217 ? 0.2097 0.3135 0.2529 -0.0027 -0.0225 0.0983  217 VAL A C   
1474 O O   . VAL A 217 ? 0.1674 0.2830 0.2315 0.0128  -0.0151 0.1034  217 VAL A O   
1475 C CB  . VAL A 217 ? 0.1626 0.2201 0.1725 -0.0079 -0.0106 0.0691  217 VAL A CB  
1476 C CG1 . VAL A 217 ? 0.1538 0.1846 0.1427 -0.0108 -0.0051 0.0583  217 VAL A CG1 
1477 C CG2 . VAL A 217 ? 0.1685 0.2302 0.1959 0.0057  -0.0009 0.0648  217 VAL A CG2 
1478 N N   . ASP A 218 ? 0.1702 0.2867 0.2108 -0.0181 -0.0349 0.1046  218 ASP A N   
1479 C CA  . ASP A 218 ? 0.2237 0.3735 0.2912 -0.0194 -0.0396 0.1182  218 ASP A CA  
1480 C C   . ASP A 218 ? 0.1500 0.2995 0.2233 -0.0160 -0.0292 0.1092  218 ASP A C   
1481 O O   . ASP A 218 ? 0.1695 0.2925 0.2233 -0.0175 -0.0233 0.0928  218 ASP A O   
1482 C CB  . ASP A 218 ? 0.2793 0.4399 0.3409 -0.0412 -0.0591 0.1281  218 ASP A CB  
1483 C CG  . ASP A 218 ? 0.4692 0.6253 0.5152 -0.0487 -0.0726 0.1359  218 ASP A CG  
1484 O OD1 . ASP A 218 ? 0.4668 0.6348 0.5297 -0.0368 -0.0696 0.1452  218 ASP A OD1 
1485 O OD2 . ASP A 218 ? 0.4974 0.6317 0.5117 -0.0664 -0.0831 0.1291  218 ASP A OD2 
1486 N N   . VAL A 219 ? 0.1523 0.3328 0.2529 -0.0118 -0.0272 0.1217  219 VAL A N   
1487 C CA  . VAL A 219 ? 0.1328 0.3148 0.2369 -0.0103 -0.0181 0.1158  219 VAL A CA  
1488 C C   . VAL A 219 ? 0.1228 0.2873 0.2064 -0.0302 -0.0269 0.1075  219 VAL A C   
1489 O O   . VAL A 219 ? 0.1425 0.2873 0.2131 -0.0287 -0.0194 0.0942  219 VAL A O   
1490 C CB  . VAL A 219 ? 0.1587 0.3811 0.2964 -0.0044 -0.0141 0.1343  219 VAL A CB  
1491 C CG1 . VAL A 219 ? 0.1790 0.4029 0.3160 -0.0086 -0.0078 0.1310  219 VAL A CG1 
1492 C CG2 . VAL A 219 ? 0.2261 0.4495 0.3729 0.0197  0.0011  0.1358  219 VAL A CG2 
1493 N N   . ASP A 220 ? 0.1552 0.3241 0.2341 -0.0489 -0.0436 0.1155  220 ASP A N   
1494 C CA  . ASP A 220 ? 0.2088 0.3547 0.2641 -0.0678 -0.0523 0.1070  220 ASP A CA  
1495 C C   . ASP A 220 ? 0.1791 0.2843 0.2024 -0.0647 -0.0457 0.0865  220 ASP A C   
1496 O O   . ASP A 220 ? 0.1808 0.2644 0.1892 -0.0698 -0.0433 0.0759  220 ASP A O   
1497 C CB  . ASP A 220 ? 0.2838 0.4345 0.3324 -0.0894 -0.0734 0.1176  220 ASP A CB  
1498 C CG  . ASP A 220 ? 0.4020 0.5857 0.4800 -0.0951 -0.0782 0.1370  220 ASP A CG  
1499 O OD1 . ASP A 220 ? 0.3467 0.5478 0.4455 -0.0856 -0.0666 0.1414  220 ASP A OD1 
1500 O OD2 . ASP A 220 ? 0.5217 0.7075 0.5969 -0.1073 -0.0908 0.1467  220 ASP A OD2 
1501 N N   . GLN A 221 ? 0.1697 0.2655 0.1847 -0.0559 -0.0423 0.0829  221 GLN A N   
1502 C CA  . GLN A 221 ? 0.1629 0.2255 0.1532 -0.0518 -0.0341 0.0664  221 GLN A CA  
1503 C C   . GLN A 221 ? 0.1559 0.2132 0.1550 -0.0377 -0.0198 0.0569  221 GLN A C   
1504 O O   . GLN A 221 ? 0.1571 0.1916 0.1419 -0.0380 -0.0146 0.0448  221 GLN A O   
1505 C CB  . GLN A 221 ? 0.1793 0.2357 0.1604 -0.0474 -0.0342 0.0679  221 GLN A CB  
1506 C CG  . GLN A 221 ? 0.2172 0.2710 0.1794 -0.0626 -0.0497 0.0752  221 GLN A CG  
1507 C CD  . GLN A 221 ? 0.2055 0.2552 0.1587 -0.0575 -0.0494 0.0792  221 GLN A CD  
1508 O OE1 . GLN A 221 ? 0.2454 0.3129 0.2216 -0.0450 -0.0456 0.0879  221 GLN A OE1 
1509 N NE2 . GLN A 221 ? 0.2424 0.2657 0.1596 -0.0662 -0.0524 0.0731  221 GLN A NE2 
1510 N N   . ALA A 222 ? 0.1293 0.2064 0.1508 -0.0248 -0.0135 0.0626  222 ALA A N   
1511 C CA  . ALA A 222 ? 0.1567 0.2272 0.1824 -0.0129 -0.0023 0.0538  222 ALA A CA  
1512 C C   . ALA A 222 ? 0.1465 0.2146 0.1693 -0.0194 -0.0024 0.0506  222 ALA A C   
1513 O O   . ALA A 222 ? 0.1473 0.1983 0.1622 -0.0162 0.0025  0.0401  222 ALA A O   
1514 C CB  . ALA A 222 ? 0.1731 0.2614 0.2174 0.0023  0.0047  0.0605  222 ALA A CB  
1515 N N   . VAL A 223 ? 0.1385 0.2246 0.1695 -0.0291 -0.0091 0.0614  223 VAL A N   
1516 C CA  . VAL A 223 ? 0.1260 0.2086 0.1541 -0.0372 -0.0101 0.0606  223 VAL A CA  
1517 C C   . VAL A 223 ? 0.1924 0.2432 0.1968 -0.0469 -0.0143 0.0493  223 VAL A C   
1518 O O   . VAL A 223 ? 0.1992 0.2348 0.1969 -0.0458 -0.0106 0.0422  223 VAL A O   
1519 C CB  . VAL A 223 ? 0.1519 0.2610 0.1958 -0.0487 -0.0178 0.0768  223 VAL A CB  
1520 C CG1 . VAL A 223 ? 0.1748 0.2740 0.2120 -0.0607 -0.0209 0.0764  223 VAL A CG1 
1521 C CG2 . VAL A 223 ? 0.1490 0.2909 0.2185 -0.0354 -0.0089 0.0887  223 VAL A CG2 
1522 N N   . ALA A 224 ? 0.1772 0.2167 0.1673 -0.0550 -0.0215 0.0480  224 ALA A N   
1523 C CA  . ALA A 224 ? 0.1748 0.1809 0.1384 -0.0619 -0.0228 0.0369  224 ALA A CA  
1524 C C   . ALA A 224 ? 0.1759 0.1656 0.1357 -0.0486 -0.0108 0.0252  224 ALA A C   
1525 O O   . ALA A 224 ? 0.1924 0.1596 0.1401 -0.0490 -0.0075 0.0170  224 ALA A O   
1526 C CB  . ALA A 224 ? 0.2066 0.2023 0.1501 -0.0724 -0.0320 0.0379  224 ALA A CB  
1527 N N   . PHE A 225 ? 0.1497 0.1506 0.1215 -0.0371 -0.0048 0.0257  225 PHE A N   
1528 C CA  . PHE A 225 ? 0.1663 0.1562 0.1401 -0.0262 0.0046  0.0171  225 PHE A CA  
1529 C C   . PHE A 225 ? 0.1661 0.1555 0.1475 -0.0223 0.0072  0.0141  225 PHE A C   
1530 O O   . PHE A 225 ? 0.1575 0.1315 0.1352 -0.0196 0.0111  0.0075  225 PHE A O   
1531 C CB  . PHE A 225 ? 0.1430 0.1439 0.1286 -0.0168 0.0081  0.0197  225 PHE A CB  
1532 C CG  . PHE A 225 ? 0.1408 0.1326 0.1319 -0.0081 0.0152  0.0129  225 PHE A CG  
1533 C CD1 . PHE A 225 ? 0.1710 0.1669 0.1723 -0.0013 0.0167  0.0107  225 PHE A CD1 
1534 C CD2 . PHE A 225 ? 0.1509 0.1302 0.1363 -0.0076 0.0199  0.0097  225 PHE A CD2 
1535 C CE1 . PHE A 225 ? 0.1710 0.1585 0.1779 0.0039  0.0197  0.0053  225 PHE A CE1 
1536 C CE2 . PHE A 225 ? 0.1686 0.1432 0.1642 -0.0016 0.0250  0.0059  225 PHE A CE2 
1537 C CZ  . PHE A 225 ? 0.1810 0.1596 0.1880 0.0032  0.0234  0.0037  225 PHE A CZ  
1538 N N   . ALA A 226 ? 0.1402 0.1472 0.1321 -0.0213 0.0055  0.0205  226 ALA A N   
1539 C CA  . ALA A 226 ? 0.1780 0.1847 0.1730 -0.0182 0.0074  0.0192  226 ALA A CA  
1540 C C   . ALA A 226 ? 0.1551 0.1463 0.1403 -0.0272 0.0040  0.0181  226 ALA A C   
1541 O O   . ALA A 226 ? 0.1768 0.1553 0.1600 -0.0236 0.0060  0.0134  226 ALA A O   
1542 C CB  . ALA A 226 ? 0.1445 0.1735 0.1496 -0.0153 0.0086  0.0278  226 ALA A CB  
1543 N N   . ALA A 227 ? 0.1640 0.1545 0.1427 -0.0392 -0.0023 0.0229  227 ALA A N   
1544 C CA  . ALA A 227 ? 0.2260 0.1957 0.1918 -0.0489 -0.0065 0.0215  227 ALA A CA  
1545 C C   . ALA A 227 ? 0.2417 0.1828 0.1933 -0.0446 -0.0018 0.0106  227 ALA A C   
1546 O O   . ALA A 227 ? 0.2310 0.1533 0.1768 -0.0441 -0.0005 0.0076  227 ALA A O   
1547 C CB  . ALA A 227 ? 0.2660 0.2369 0.2248 -0.0652 -0.0167 0.0282  227 ALA A CB  
1548 N N   . ALA A 228 ? 0.2114 0.1498 0.1583 -0.0405 0.0019  0.0062  228 ALA A N   
1549 C CA  . ALA A 228 ? 0.2304 0.1455 0.1657 -0.0348 0.0096  -0.0025 228 ALA A CA  
1550 C C   . ALA A 228 ? 0.1976 0.1150 0.1493 -0.0226 0.0166  -0.0048 228 ALA A C   
1551 O O   . ALA A 228 ? 0.2431 0.1436 0.1913 -0.0165 0.0238  -0.0095 228 ALA A O   
1552 C CB  . ALA A 228 ? 0.2168 0.1318 0.1438 -0.0337 0.0127  -0.0041 228 ALA A CB  
1553 N N   . HIS A 229 ? 0.1690 0.1066 0.1378 -0.0188 0.0144  -0.0008 229 HIS A N   
1554 C CA  . HIS A 229 ? 0.1768 0.1165 0.1593 -0.0099 0.0168  -0.0019 229 HIS A CA  
1555 C C   . HIS A 229 ? 0.2392 0.1765 0.2218 -0.0116 0.0125  0.0016  229 HIS A C   
1556 O O   . HIS A 229 ? 0.2167 0.1581 0.2089 -0.0057 0.0113  0.0026  229 HIS A O   
1557 C CB  . HIS A 229 ? 0.1724 0.1290 0.1676 -0.0046 0.0165  -0.0013 229 HIS A CB  
1558 C CG  . HIS A 229 ? 0.1877 0.1443 0.1862 -0.0019 0.0213  -0.0036 229 HIS A CG  
1559 N ND1 . HIS A 229 ? 0.1890 0.1474 0.1792 -0.0057 0.0219  -0.0024 229 HIS A ND1 
1560 C CD2 . HIS A 229 ? 0.2438 0.1994 0.2540 0.0033  0.0254  -0.0051 229 HIS A CD2 
1561 C CE1 . HIS A 229 ? 0.2600 0.2169 0.2541 -0.0024 0.0270  -0.0034 229 HIS A CE1 
1562 N NE2 . HIS A 229 ? 0.2474 0.2033 0.2549 0.0027  0.0297  -0.0049 229 HIS A NE2 
1563 N N   . GLY A 230 ? 0.2012 0.1311 0.1724 -0.0208 0.0088  0.0045  230 GLY A N   
1564 C CA  . GLY A 230 ? 0.1953 0.1179 0.1645 -0.0238 0.0052  0.0090  230 GLY A CA  
1565 C C   . GLY A 230 ? 0.1921 0.1345 0.1657 -0.0279 0.0014  0.0173  230 GLY A C   
1566 O O   . GLY A 230 ? 0.2080 0.1461 0.1794 -0.0314 -0.0013 0.0232  230 GLY A O   
1567 N N   . LEU A 231 ? 0.1918 0.1552 0.1713 -0.0264 0.0026  0.0189  231 LEU A N   
1568 C CA  . LEU A 231 ? 0.2103 0.1941 0.1941 -0.0276 0.0025  0.0275  231 LEU A CA  
1569 C C   . LEU A 231 ? 0.2211 0.2092 0.2042 -0.0412 -0.0018 0.0366  231 LEU A C   
1570 O O   . LEU A 231 ? 0.2136 0.1940 0.1923 -0.0499 -0.0060 0.0354  231 LEU A O   
1571 C CB  . LEU A 231 ? 0.1663 0.1688 0.1568 -0.0198 0.0066  0.0269  231 LEU A CB  
1572 C CG  . LEU A 231 ? 0.1858 0.1854 0.1756 -0.0084 0.0089  0.0203  231 LEU A CG  
1573 C CD1 . LEU A 231 ? 0.2095 0.1939 0.2013 -0.0059 0.0078  0.0120  231 LEU A CD1 
1574 C CD2 . LEU A 231 ? 0.1741 0.1878 0.1666 -0.0009 0.0135  0.0206  231 LEU A CD2 
1575 N N   A CYS A 232 ? 0.1648 0.1642 0.1508 -0.0442 -0.0014 0.0466  232 CYS A N   
1576 N N   B CYS A 232 ? 0.1635 0.1641 0.1500 -0.0441 -0.0012 0.0468  232 CYS A N   
1577 C CA  A CYS A 232 ? 0.1976 0.2025 0.1865 -0.0593 -0.0063 0.0580  232 CYS A CA  
1578 C CA  B CYS A 232 ? 0.2020 0.2064 0.1906 -0.0593 -0.0063 0.0581  232 CYS A CA  
1579 C C   A CYS A 232 ? 0.2173 0.2569 0.2217 -0.0601 -0.0031 0.0696  232 CYS A C   
1580 C C   B CYS A 232 ? 0.2220 0.2610 0.2262 -0.0619 -0.0036 0.0712  232 CYS A C   
1581 O O   A CYS A 232 ? 0.1597 0.2163 0.1682 -0.0490 0.0055  0.0728  232 CYS A O   
1582 O O   B CYS A 232 ? 0.1685 0.2251 0.1772 -0.0536 0.0044  0.0773  232 CYS A O   
1583 C CB  A CYS A 232 ? 0.2424 0.2360 0.2261 -0.0638 -0.0076 0.0645  232 CYS A CB  
1584 C CB  B CYS A 232 ? 0.2462 0.2368 0.2286 -0.0624 -0.0074 0.0631  232 CYS A CB  
1585 S SG  A CYS A 232 ? 0.3536 0.3053 0.3225 -0.0636 -0.0117 0.0544  232 CYS A SG  
1586 S SG  B CYS A 232 ? 0.2530 0.2502 0.2404 -0.0821 -0.0131 0.0805  232 CYS A SG  
1587 N N   . LEU A 233 ? 0.2000 0.2491 0.2120 -0.0730 -0.0101 0.0765  233 LEU A N   
1588 C CA  . LEU A 233 ? 0.2464 0.3328 0.2795 -0.0750 -0.0078 0.0918  233 LEU A CA  
1589 C C   . LEU A 233 ? 0.3691 0.4629 0.4099 -0.0890 -0.0147 0.1039  233 LEU A C   
1590 O O   . LEU A 233 ? 0.4213 0.5454 0.4809 -0.0871 -0.0126 0.1157  233 LEU A O   
1591 C CB  . LEU A 233 ? 0.2762 0.3739 0.3169 -0.0760 -0.0126 0.0914  233 LEU A CB  
1592 C CG  . LEU A 233 ? 0.2842 0.3838 0.3237 -0.0557 -0.0027 0.0815  233 LEU A CG  
1593 C CD1 . LEU A 233 ? 0.2285 0.2967 0.2496 -0.0534 -0.0058 0.0648  233 LEU A CD1 
1594 C CD2 . LEU A 233 ? 0.3189 0.4501 0.3785 -0.0496 0.0001  0.0914  233 LEU A CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   GLY 2   2   ?   ?   ?   A . n 
A 1 3   SER 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   ?   ?   ?   A . n 
A 1 5   HIS 5   5   ?   ?   ?   A . n 
A 1 6   HIS 6   6   ?   ?   ?   A . n 
A 1 7   HIS 7   7   ?   ?   ?   A . n 
A 1 8   HIS 8   8   ?   ?   ?   A . n 
A 1 9   HIS 9   9   ?   ?   ?   A . n 
A 1 10  HIS 10  10  ?   ?   ?   A . n 
A 1 11  SER 11  11  ?   ?   ?   A . n 
A 1 12  SER 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  LEU 14  14  ?   ?   ?   A . n 
A 1 15  VAL 15  15  ?   ?   ?   A . n 
A 1 16  PRO 16  16  ?   ?   ?   A . n 
A 1 17  ARG 17  17  ?   ?   ?   A . n 
A 1 18  GLY 18  18  ?   ?   ?   A . n 
A 1 19  SER 19  19  ?   ?   ?   A . n 
A 1 20  HIS 20  20  20  HIS HIS A . n 
A 1 21  MET 21  21  21  MET MET A . n 
A 1 22  ASN 22  22  22  ASN ASN A . n 
A 1 23  VAL 23  23  23  VAL VAL A . n 
A 1 24  GLY 24  24  24  GLY GLY A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  ILE 26  26  26  ILE ILE A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  ARG 28  28  28  ARG ARG A . n 
A 1 29  HIS 29  29  29  HIS HIS A . n 
A 1 30  TYR 30  30  30  TYR TYR A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  ALA 32  32  32  ALA ALA A . n 
A 1 33  GLY 33  33  33  GLY GLY A . n 
A 1 34  LYS 34  34  34  LYS LYS A . n 
A 1 35  ARG 35  35  35  ARG ARG A . n 
A 1 36  ASN 36  36  36  ASN ASN A . n 
A 1 37  PHE 37  37  37  PHE PHE A . n 
A 1 38  GLN 38  38  38  GLN GLN A . n 
A 1 39  HIS 39  39  39  HIS HIS A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  ASN 41  41  41  ASN ASN A . n 
A 1 42  LEU 42  42  42  LEU LEU A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  GLU 46  46  46  GLU GLU A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  THR 48  48  48  THR THR A . n 
A 1 49  ASN 49  49  49  ASN ASN A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  GLY 54  54  54  GLY GLY A . n 
A 1 55  ALA 55  55  55  ALA ALA A . n 
A 1 56  ASP 56  56  56  ASP ASP A . n 
A 1 57  LEU 57  57  57  LEU LEU A . n 
A 1 58  SER 58  58  58  SER SER A . n 
A 1 59  TYR 59  59  59  TYR TYR A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  ASN 61  61  61  ASN ASN A . n 
A 1 62  LEU 62  62  62  LEU LEU A . n 
A 1 63  HIS 63  63  63  HIS HIS A . n 
A 1 64  HIS 64  64  64  HIS HIS A . n 
A 1 65  ALA 65  65  65  ALA ALA A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  SER 68  68  68  SER SER A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  ALA 70  70  70  ALA ALA A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  ARG 73  73  73  ARG ARG A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  ALA 75  75  75  ALA ALA A . n 
A 1 76  ASP 76  76  76  ASP ASP A . n 
A 1 77  LEU 77  77  77  LEU LEU A . n 
A 1 78  ARG 78  78  78  ARG ARG A . n 
A 1 79  ASN 79  79  79  ASN ASN A . n 
A 1 80  ALA 80  80  80  ALA ALA A . n 
A 1 81  ASN 81  81  81  ASN ASN A . n 
A 1 82  LEU 82  82  82  LEU LEU A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  HIS 84  84  84  HIS HIS A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  SER 88  88  88  SER SER A . n 
A 1 89  GLY 89  89  89  GLY GLY A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  ASN 91  91  91  ASN ASN A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  GLU 93  93  93  GLU GLU A . n 
A 1 94  GLU 94  94  94  GLU GLU A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  ASN 96  96  96  ASN ASN A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  ALA 99  99  99  ALA ALA A . n 
A 1 100 ALA 100 100 100 ALA ALA A . n 
A 1 101 ASN 101 101 101 ASN ASN A . n 
A 1 102 LEU 102 102 102 LEU LEU A . n 
A 1 103 ARG 103 103 103 ARG ARG A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 ALA 105 105 105 ALA ALA A . n 
A 1 106 ASP 106 106 106 ASP ASP A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 HIS 108 108 108 HIS HIS A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 ALA 110 110 110 ALA ALA A . n 
A 1 111 ASN 111 111 111 ASN ASN A . n 
A 1 112 LEU 112 112 112 LEU LEU A . n 
A 1 113 SER 113 113 113 SER SER A . n 
A 1 114 GLY 114 114 114 GLY GLY A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 ASP 116 116 116 ASP ASP A . n 
A 1 117 LEU 117 117 117 LEU LEU A . n 
A 1 118 GLN 118 118 118 GLN GLN A . n 
A 1 119 GLU 119 119 119 GLU GLU A . n 
A 1 120 ALA 120 120 120 ALA ALA A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 THR 123 123 123 THR THR A . n 
A 1 124 GLN 124 124 124 GLN GLN A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 ASN 126 126 126 ASN ASN A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 LYS 128 128 128 LYS LYS A . n 
A 1 129 ASP 129 129 129 ASP ASP A . n 
A 1 130 ALA 130 130 130 ALA ALA A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 LEU 132 132 132 LEU LEU A . n 
A 1 133 SER 133 133 133 SER SER A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 ALA 135 135 135 ALA ALA A . n 
A 1 136 ASN 136 136 136 ASN ASN A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 GLU 138 138 138 GLU GLU A . n 
A 1 139 GLN 139 139 139 GLN GLN A . n 
A 1 140 ALA 140 140 140 ALA ALA A . n 
A 1 141 ASP 141 141 141 ASP ASP A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 ALA 143 143 143 ALA ALA A . n 
A 1 144 GLY 144 144 144 GLY GLY A . n 
A 1 145 ALA 145 145 145 ALA ALA A . n 
A 1 146 ASP 146 146 146 ASP ASP A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 GLN 148 148 148 GLN GLN A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ALA 150 150 150 ALA ALA A . n 
A 1 151 VAL 151 151 151 VAL VAL A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 ASP 153 153 153 ASP ASP A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 ALA 155 155 155 ALA ALA A . n 
A 1 156 ASN 156 156 156 ASN ASN A . n 
A 1 157 LEU 157 157 157 LEU LEU A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 ALA 160 160 160 ALA ALA A . n 
A 1 161 ASN 161 161 161 ASN ASN A . n 
A 1 162 LEU 162 162 162 LEU LEU A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 ASN 164 164 164 ASN ASN A . n 
A 1 165 ALA 165 165 165 ALA ALA A . n 
A 1 166 ASN 166 166 166 ASN ASN A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 SER 168 168 168 SER SER A . n 
A 1 169 GLU 169 169 169 GLU GLU A . n 
A 1 170 ALA 170 170 170 ALA ALA A . n 
A 1 171 MET 171 171 171 MET MET A . n 
A 1 172 LEU 172 172 172 LEU LEU A . n 
A 1 173 THR 173 173 173 THR THR A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 ALA 175 175 175 ALA ALA A . n 
A 1 176 ASN 176 176 176 ASN ASN A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLU 178 178 178 GLU GLU A . n 
A 1 179 GLN 179 179 179 GLN GLN A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 GLY 184 184 184 GLY GLY A . n 
A 1 185 ALA 185 185 185 ALA ALA A . n 
A 1 186 ARG 186 186 186 ARG ARG A . n 
A 1 187 THR 187 187 187 THR THR A . n 
A 1 188 THR 188 188 188 THR THR A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ALA 190 190 190 ALA ALA A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 ASP 193 193 193 ASP ASP A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 ALA 195 195 195 ALA ALA A . n 
A 1 196 ASP 196 196 196 ASP ASP A . n 
A 1 197 LEU 197 197 197 LEU LEU A . n 
A 1 198 ARG 198 198 198 ARG ARG A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 ALA 200 200 200 ALA ALA A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 VAL 202 202 202 VAL VAL A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 PRO 204 204 204 PRO PRO A . n 
A 1 205 VAL 205 205 205 VAL VAL A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 TRP 207 207 207 TRP TRP A . n 
A 1 208 ARG 208 208 208 ARG ARG A . n 
A 1 209 THR 209 209 209 THR THR A . n 
A 1 210 ALA 210 210 210 ALA ALA A . n 
A 1 211 SER 211 211 211 SER SER A . n 
A 1 212 LEU 212 212 212 LEU LEU A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 ALA 215 215 215 ALA ALA A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 ASP 218 218 218 ASP ASP A . n 
A 1 219 VAL 219 219 219 VAL VAL A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 GLN 221 221 221 GLN GLN A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 ALA 224 224 224 ALA ALA A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 ALA 226 226 226 ALA ALA A . n 
A 1 227 ALA 227 227 227 ALA ALA A . n 
A 1 228 ALA 228 228 228 ALA ALA A . n 
A 1 229 HIS 229 229 229 HIS HIS A . n 
A 1 230 GLY 230 230 230 GLY GLY A . n 
A 1 231 LEU 231 231 231 LEU LEU A . n 
A 1 232 CYS 232 232 232 CYS CYS A . n 
A 1 233 LEU 233 233 233 LEU LEU A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 GLY 235 235 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1   301 1   CL  CL  A . 
C 2 CL  1   302 2   CL  CL  A . 
D 3 HOH 1   401 69  HOH HOH A . 
D 3 HOH 2   402 40  HOH HOH A . 
D 3 HOH 3   403 62  HOH HOH A . 
D 3 HOH 4   404 82  HOH HOH A . 
D 3 HOH 5   405 45  HOH HOH A . 
D 3 HOH 6   406 58  HOH HOH A . 
D 3 HOH 7   407 81  HOH HOH A . 
D 3 HOH 8   408 24  HOH HOH A . 
D 3 HOH 9   409 112 HOH HOH A . 
D 3 HOH 10  410 29  HOH HOH A . 
D 3 HOH 11  411 19  HOH HOH A . 
D 3 HOH 12  412 6   HOH HOH A . 
D 3 HOH 13  413 7   HOH HOH A . 
D 3 HOH 14  414 67  HOH HOH A . 
D 3 HOH 15  415 13  HOH HOH A . 
D 3 HOH 16  416 40  HOH HOH A . 
D 3 HOH 17  417 26  HOH HOH A . 
D 3 HOH 18  418 60  HOH HOH A . 
D 3 HOH 19  419 111 HOH HOH A . 
D 3 HOH 20  420 46  HOH HOH A . 
D 3 HOH 21  421 62  HOH HOH A . 
D 3 HOH 22  422 10  HOH HOH A . 
D 3 HOH 23  423 71  HOH HOH A . 
D 3 HOH 24  424 102 HOH HOH A . 
D 3 HOH 25  425 46  HOH HOH A . 
D 3 HOH 26  426 7   HOH HOH A . 
D 3 HOH 27  427 19  HOH HOH A . 
D 3 HOH 28  428 9   HOH HOH A . 
D 3 HOH 29  429 98  HOH HOH A . 
D 3 HOH 30  430 5   HOH HOH A . 
D 3 HOH 31  431 79  HOH HOH A . 
D 3 HOH 32  432 11  HOH HOH A . 
D 3 HOH 33  433 41  HOH HOH A . 
D 3 HOH 34  434 86  HOH HOH A . 
D 3 HOH 35  435 11  HOH HOH A . 
D 3 HOH 36  436 131 HOH HOH A . 
D 3 HOH 37  437 50  HOH HOH A . 
D 3 HOH 38  438 15  HOH HOH A . 
D 3 HOH 39  439 50  HOH HOH A . 
D 3 HOH 40  440 26  HOH HOH A . 
D 3 HOH 41  441 100 HOH HOH A . 
D 3 HOH 42  442 83  HOH HOH A . 
D 3 HOH 43  443 31  HOH HOH A . 
D 3 HOH 44  444 76  HOH HOH A . 
D 3 HOH 45  445 96  HOH HOH A . 
D 3 HOH 46  446 52  HOH HOH A . 
D 3 HOH 47  447 64  HOH HOH A . 
D 3 HOH 48  448 57  HOH HOH A . 
D 3 HOH 49  449 52  HOH HOH A . 
D 3 HOH 50  450 106 HOH HOH A . 
D 3 HOH 51  451 82  HOH HOH A . 
D 3 HOH 52  452 116 HOH HOH A . 
D 3 HOH 53  453 54  HOH HOH A . 
D 3 HOH 54  454 65  HOH HOH A . 
D 3 HOH 55  455 45  HOH HOH A . 
D 3 HOH 56  456 33  HOH HOH A . 
D 3 HOH 57  457 85  HOH HOH A . 
D 3 HOH 58  458 115 HOH HOH A . 
D 3 HOH 59  459 28  HOH HOH A . 
D 3 HOH 60  460 64  HOH HOH A . 
D 3 HOH 61  461 89  HOH HOH A . 
D 3 HOH 62  462 46  HOH HOH A . 
D 3 HOH 63  463 93  HOH HOH A . 
D 3 HOH 64  464 30  HOH HOH A . 
D 3 HOH 65  465 90  HOH HOH A . 
D 3 HOH 66  466 13  HOH HOH A . 
D 3 HOH 67  467 88  HOH HOH A . 
D 3 HOH 68  468 51  HOH HOH A . 
D 3 HOH 69  469 73  HOH HOH A . 
D 3 HOH 70  470 63  HOH HOH A . 
D 3 HOH 71  471 18  HOH HOH A . 
D 3 HOH 72  472 89  HOH HOH A . 
D 3 HOH 73  473 11  HOH HOH A . 
D 3 HOH 74  474 9   HOH HOH A . 
D 3 HOH 75  475 41  HOH HOH A . 
D 3 HOH 76  476 80  HOH HOH A . 
D 3 HOH 77  477 18  HOH HOH A . 
D 3 HOH 78  478 84  HOH HOH A . 
D 3 HOH 79  479 125 HOH HOH A . 
D 3 HOH 80  480 70  HOH HOH A . 
D 3 HOH 81  481 95  HOH HOH A . 
D 3 HOH 82  482 80  HOH HOH A . 
D 3 HOH 83  483 23  HOH HOH A . 
D 3 HOH 84  484 20  HOH HOH A . 
D 3 HOH 85  485 6   HOH HOH A . 
D 3 HOH 86  486 40  HOH HOH A . 
D 3 HOH 87  487 12  HOH HOH A . 
D 3 HOH 88  488 27  HOH HOH A . 
D 3 HOH 89  489 49  HOH HOH A . 
D 3 HOH 90  490 4   HOH HOH A . 
D 3 HOH 91  491 23  HOH HOH A . 
D 3 HOH 92  492 148 HOH HOH A . 
D 3 HOH 93  493 32  HOH HOH A . 
D 3 HOH 94  494 68  HOH HOH A . 
D 3 HOH 95  495 83  HOH HOH A . 
D 3 HOH 96  496 37  HOH HOH A . 
D 3 HOH 97  497 36  HOH HOH A . 
D 3 HOH 98  498 68  HOH HOH A . 
D 3 HOH 99  499 33  HOH HOH A . 
D 3 HOH 100 500 39  HOH HOH A . 
D 3 HOH 101 501 2   HOH HOH A . 
D 3 HOH 102 502 55  HOH HOH A . 
D 3 HOH 103 503 104 HOH HOH A . 
D 3 HOH 104 504 95  HOH HOH A . 
D 3 HOH 105 505 17  HOH HOH A . 
D 3 HOH 106 506 93  HOH HOH A . 
D 3 HOH 107 507 66  HOH HOH A . 
D 3 HOH 108 508 96  HOH HOH A . 
D 3 HOH 109 509 25  HOH HOH A . 
D 3 HOH 110 510 30  HOH HOH A . 
D 3 HOH 111 511 20  HOH HOH A . 
D 3 HOH 112 512 77  HOH HOH A . 
D 3 HOH 113 513 2   HOH HOH A . 
D 3 HOH 114 514 85  HOH HOH A . 
D 3 HOH 115 515 4   HOH HOH A . 
D 3 HOH 116 516 85  HOH HOH A . 
D 3 HOH 117 517 70  HOH HOH A . 
D 3 HOH 118 518 35  HOH HOH A . 
D 3 HOH 119 519 31  HOH HOH A . 
D 3 HOH 120 520 61  HOH HOH A . 
D 3 HOH 121 521 54  HOH HOH A . 
D 3 HOH 122 522 57  HOH HOH A . 
D 3 HOH 123 523 56  HOH HOH A . 
D 3 HOH 124 524 76  HOH HOH A . 
D 3 HOH 125 525 41  HOH HOH A . 
D 3 HOH 126 526 36  HOH HOH A . 
D 3 HOH 127 527 71  HOH HOH A . 
D 3 HOH 128 528 56  HOH HOH A . 
D 3 HOH 129 529 44  HOH HOH A . 
D 3 HOH 130 530 108 HOH HOH A . 
D 3 HOH 131 531 48  HOH HOH A . 
D 3 HOH 132 532 49  HOH HOH A . 
D 3 HOH 133 533 128 HOH HOH A . 
D 3 HOH 134 534 120 HOH HOH A . 
D 3 HOH 135 535 37  HOH HOH A . 
D 3 HOH 136 536 30  HOH HOH A . 
D 3 HOH 137 537 135 HOH HOH A . 
D 3 HOH 138 538 20  HOH HOH A . 
D 3 HOH 139 539 38  HOH HOH A . 
D 3 HOH 140 540 10  HOH HOH A . 
D 3 HOH 141 541 130 HOH HOH A . 
D 3 HOH 142 542 44  HOH HOH A . 
D 3 HOH 143 543 101 HOH HOH A . 
D 3 HOH 144 544 33  HOH HOH A . 
D 3 HOH 145 545 34  HOH HOH A . 
D 3 HOH 146 546 3   HOH HOH A . 
D 3 HOH 147 547 8   HOH HOH A . 
D 3 HOH 148 548 14  HOH HOH A . 
D 3 HOH 149 549 53  HOH HOH A . 
D 3 HOH 150 550 106 HOH HOH A . 
D 3 HOH 151 551 99  HOH HOH A . 
D 3 HOH 152 552 34  HOH HOH A . 
D 3 HOH 153 553 52  HOH HOH A . 
D 3 HOH 154 554 75  HOH HOH A . 
D 3 HOH 155 555 34  HOH HOH A . 
D 3 HOH 156 556 16  HOH HOH A . 
D 3 HOH 157 557 57  HOH HOH A . 
D 3 HOH 158 558 63  HOH HOH A . 
D 3 HOH 159 559 14  HOH HOH A . 
D 3 HOH 160 560 12  HOH HOH A . 
D 3 HOH 161 561 42  HOH HOH A . 
D 3 HOH 162 562 39  HOH HOH A . 
D 3 HOH 163 563 122 HOH HOH A . 
D 3 HOH 164 564 21  HOH HOH A . 
D 3 HOH 165 565 38  HOH HOH A . 
D 3 HOH 166 566 48  HOH HOH A . 
D 3 HOH 167 567 24  HOH HOH A . 
D 3 HOH 168 568 17  HOH HOH A . 
D 3 HOH 169 569 67  HOH HOH A . 
D 3 HOH 170 570 101 HOH HOH A . 
D 3 HOH 171 571 78  HOH HOH A . 
D 3 HOH 172 572 21  HOH HOH A . 
D 3 HOH 173 573 29  HOH HOH A . 
D 3 HOH 174 574 71  HOH HOH A . 
D 3 HOH 175 575 91  HOH HOH A . 
D 3 HOH 176 576 2   HOH HOH A . 
D 3 HOH 177 577 87  HOH HOH A . 
D 3 HOH 178 578 74  HOH HOH A . 
D 3 HOH 179 579 8   HOH HOH A . 
D 3 HOH 180 580 67  HOH HOH A . 
D 3 HOH 181 581 77  HOH HOH A . 
D 3 HOH 182 582 161 HOH HOH A . 
D 3 HOH 183 583 103 HOH HOH A . 
D 3 HOH 184 584 113 HOH HOH A . 
D 3 HOH 185 585 159 HOH HOH A . 
D 3 HOH 186 586 145 HOH HOH A . 
D 3 HOH 187 587 78  HOH HOH A . 
D 3 HOH 188 588 105 HOH HOH A . 
D 3 HOH 189 589 29  HOH HOH A . 
D 3 HOH 190 590 6   HOH HOH A . 
D 3 HOH 191 591 108 HOH HOH A . 
D 3 HOH 192 592 43  HOH HOH A . 
D 3 HOH 193 593 22  HOH HOH A . 
D 3 HOH 194 594 104 HOH HOH A . 
D 3 HOH 195 595 66  HOH HOH A . 
D 3 HOH 196 596 92  HOH HOH A . 
D 3 HOH 197 597 126 HOH HOH A . 
D 3 HOH 198 598 143 HOH HOH A . 
D 3 HOH 199 599 149 HOH HOH A . 
D 3 HOH 200 600 136 HOH HOH A . 
D 3 HOH 201 601 140 HOH HOH A . 
D 3 HOH 202 602 78  HOH HOH A . 
D 3 HOH 203 603 53  HOH HOH A . 
D 3 HOH 204 604 68  HOH HOH A . 
D 3 HOH 205 605 38  HOH HOH A . 
D 3 HOH 206 606 7   HOH HOH A . 
D 3 HOH 207 607 44  HOH HOH A . 
D 3 HOH 208 608 70  HOH HOH A . 
D 3 HOH 209 609 1   HOH HOH A . 
D 3 HOH 210 610 54  HOH HOH A . 
D 3 HOH 211 611 157 HOH HOH A . 
D 3 HOH 212 612 10  HOH HOH A . 
D 3 HOH 213 613 102 HOH HOH A . 
D 3 HOH 214 614 59  HOH HOH A . 
D 3 HOH 215 615 74  HOH HOH A . 
D 3 HOH 216 616 50  HOH HOH A . 
D 3 HOH 217 617 103 HOH HOH A . 
D 3 HOH 218 618 18  HOH HOH A . 
D 3 HOH 219 619 151 HOH HOH A . 
D 3 HOH 220 620 90  HOH HOH A . 
D 3 HOH 221 621 150 HOH HOH A . 
D 3 HOH 222 622 51  HOH HOH A . 
D 3 HOH 223 623 141 HOH HOH A . 
D 3 HOH 224 624 88  HOH HOH A . 
D 3 HOH 225 625 127 HOH HOH A . 
D 3 HOH 226 626 154 HOH HOH A . 
D 3 HOH 227 627 45  HOH HOH A . 
D 3 HOH 228 628 99  HOH HOH A . 
D 3 HOH 229 629 137 HOH HOH A . 
D 3 HOH 230 630 162 HOH HOH A . 
D 3 HOH 231 631 47  HOH HOH A . 
D 3 HOH 232 632 117 HOH HOH A . 
D 3 HOH 233 633 144 HOH HOH A . 
D 3 HOH 234 634 86  HOH HOH A . 
D 3 HOH 235 635 142 HOH HOH A . 
D 3 HOH 236 636 65  HOH HOH A . 
D 3 HOH 237 637 105 HOH HOH A . 
D 3 HOH 238 638 123 HOH HOH A . 
D 3 HOH 239 639 32  HOH HOH A . 
D 3 HOH 240 640 155 HOH HOH A . 
D 3 HOH 241 641 147 HOH HOH A . 
D 3 HOH 242 642 97  HOH HOH A . 
D 3 HOH 243 643 60  HOH HOH A . 
D 3 HOH 244 644 90  HOH HOH A . 
D 3 HOH 245 645 9   HOH HOH A . 
D 3 HOH 246 646 156 HOH HOH A . 
D 3 HOH 247 647 75  HOH HOH A . 
D 3 HOH 248 648 83  HOH HOH A . 
D 3 HOH 249 649 58  HOH HOH A . 
D 3 HOH 250 650 124 HOH HOH A . 
D 3 HOH 251 651 152 HOH HOH A . 
D 3 HOH 252 652 88  HOH HOH A . 
D 3 HOH 253 653 100 HOH HOH A . 
D 3 HOH 254 654 49  HOH HOH A . 
D 3 HOH 255 655 72  HOH HOH A . 
D 3 HOH 256 656 55  HOH HOH A . 
D 3 HOH 257 657 94  HOH HOH A . 
D 3 HOH 258 658 160 HOH HOH A . 
D 3 HOH 259 659 60  HOH HOH A . 
D 3 HOH 260 660 59  HOH HOH A . 
D 3 HOH 261 661 66  HOH HOH A . 
D 3 HOH 262 662 146 HOH HOH A . 
D 3 HOH 263 663 92  HOH HOH A . 
D 3 HOH 264 664 51  HOH HOH A . 
D 3 HOH 265 665 114 HOH HOH A . 
D 3 HOH 266 666 109 HOH HOH A . 
D 3 HOH 267 667 91  HOH HOH A . 
D 3 HOH 268 668 81  HOH HOH A . 
D 3 HOH 269 669 86  HOH HOH A . 
D 3 HOH 270 670 79  HOH HOH A . 
D 3 HOH 271 671 89  HOH HOH A . 
D 3 HOH 272 672 84  HOH HOH A . 
D 3 HOH 273 673 107 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1950  ? 
1 MORE         -46   ? 
1 'SSA (A^2)'  17260 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 6_545 x,-y-1,-z+1/2 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 -64.5700000000 0.0000000000 0.0000000000 -1.0000000000 80.2000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     627 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-03-09 
2 'Structure model' 1 1 2016-10-12 
3 'Structure model' 2 0 2017-08-30 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' Advisory                     
3 3 'Structure model' 'Atomic model'               
4 3 'Structure model' 'Author supporting evidence' 
5 3 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' atom_site                   
2 3 'Structure model' pdbx_audit_support          
3 3 'Structure model' pdbx_distant_solvent_atoms  
4 3 'Structure model' pdbx_validate_close_contact 
5 3 'Structure model' pdbx_validate_symm_contact  
6 3 'Structure model' struct_site_gen             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_atom_site.B_iso_or_equiv'                  
2  3 'Structure model' '_atom_site.Cartn_x'                         
3  3 'Structure model' '_atom_site.Cartn_y'                         
4  3 'Structure model' '_atom_site.Cartn_z'                         
5  3 'Structure model' '_atom_site.occupancy'                       
6  3 'Structure model' '_pdbx_audit_support.funding_organization'   
7  3 'Structure model' '_pdbx_distant_solvent_atoms.auth_seq_id'    
8  3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1' 
9  3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2' 
10 3 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_1'  
11 3 'Structure model' '_pdbx_validate_symm_contact.auth_seq_id_2'  
12 3 'Structure model' '_struct_site_gen.auth_seq_id'               
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1  'X-RAY DIFFRACTION' ? refined 18.7644 -17.2504 -14.7474 0.1337 ? -0.0101 ? 0.0058  ? 0.2791 ? -0.0085 ? 0.1384 ? 2.4438 ? 
-1.1631 ? -0.4870 ? 4.1474 ? 0.0462  ? 2.1852 ? 0.0450  ? 0.5217  ? -0.2140 ? -0.3463 ? -0.1071 ? 0.1294  ? 0.2208 ? -0.4621 ? 
0.0713  ? 
2  'X-RAY DIFFRACTION' ? refined 9.5249  -18.6277 -11.4096 0.1315 ? -0.0215 ? -0.0228 ? 0.2746 ? 0.0193  ? 0.1224 ? 3.3265 ? 
3.4391  ? -0.0325 ? 7.8838 ? -0.2183 ? 0.6096 ? -0.1072 ? 0.3544  ? 0.1224  ? -0.5417 ? 0.0783  ? 0.2977  ? 0.1184 ? -0.2921 ? 
0.0057  ? 
3  'X-RAY DIFFRACTION' ? refined 16.9152 -29.9676 -10.5289 0.2609 ? 0.0438  ? 0.0480  ? 0.3164 ? -0.0385 ? 0.1857 ? 7.5269 ? 
-4.0842 ? 3.2593  ? 2.9797 ? -2.3901 ? 4.6278 ? -0.0850 ? 0.0511  ? -0.4759 ? -0.2618 ? -0.0895 ? 0.1799  ? 0.4141 ? -0.1424 ? 
0.1488  ? 
4  'X-RAY DIFFRACTION' ? refined 15.5713 -22.6270 -5.7314  0.1207 ? 0.0358  ? 0.0145  ? 0.2158 ? 0.0114  ? 0.1238 ? 1.2640 ? 
1.3182  ? 0.1559  ? 1.6665 ? -0.3753 ? 0.9549 ? 0.0072  ? 0.2001  ? 0.0185  ? -0.2181 ? -0.0618 ? -0.1035 ? 0.2321 ? 0.0906  ? 
0.0338  ? 
5  'X-RAY DIFFRACTION' ? refined 22.9714 -26.4101 -1.6631  0.1604 ? 0.0779  ? -0.0004 ? 0.2812 ? 0.0504  ? 0.1470 ? 4.0766 ? 
2.5068  ? 0.4691  ? 2.9486 ? 2.8085  ? 4.8737 ? 0.0096  ? -0.0750 ? -0.1878 ? 0.1827  ? -0.0352 ? -0.5755 ? 0.1965 ? 0.3250  ? 
0.0246  ? 
6  'X-RAY DIFFRACTION' ? refined 12.3356 -26.3654 8.6614   0.0915 ? 0.0058  ? -0.0093 ? 0.1249 ? 0.0069  ? 0.1217 ? 0.5452 ? 
0.1979  ? -0.0050 ? 0.8575 ? -0.3742 ? 1.8741 ? 0.0062  ? 0.0407  ? -0.0128 ? -0.0227 ? 0.0199  ? 0.0180  ? 0.1450 ? -0.0742 ? 
-0.0258 ? 
7  'X-RAY DIFFRACTION' ? refined 17.6197 -29.5885 21.7322  0.1396 ? 0.0015  ? -0.0041 ? 0.1202 ? 0.0141  ? 0.1402 ? 2.0206 ? 
-0.7839 ? -0.6499 ? 2.6288 ? 3.4830  ? 4.7015 ? 0.0463  ? -0.0209 ? 0.0682  ? 0.1512  ? 0.0696  ? -0.3721 ? 0.0351 ? 0.2305  ? 
-0.1018 ? 
8  'X-RAY DIFFRACTION' ? refined 7.2215  -29.8918 22.1306  0.1039 ? -0.0101 ? 0.0001  ? 0.1399 ? 0.0401  ? 0.1004 ? 2.1771 ? 
0.0118  ? 0.5140  ? 4.3697 ? 0.2631  ? 2.2974 ? 0.0528  ? 0.0423  ? -0.0050 ? -0.1099 ? -0.0364 ? 0.1517  ? 0.0372 ? -0.1953 ? 
-0.0221 ? 
9  'X-RAY DIFFRACTION' ? refined 9.9437  -30.2565 29.1073  0.1288 ? -0.0029 ? -0.0040 ? 0.1081 ? 0.0135  ? 0.1197 ? 0.5316 ? 
0.0111  ? 0.0288  ? 0.9462 ? -0.1153 ? 0.7625 ? 0.0266  ? -0.0668 ? 0.0262  ? 0.1049  ? 0.0347  ? 0.0253  ? 0.0406 ? -0.0870 ? 
-0.0520 ? 
10 'X-RAY DIFFRACTION' ? refined 3.4520  -34.4465 37.6651  0.1247 ? -0.0329 ? -0.0059 ? 0.1650 ? 0.0400  ? 0.1263 ? 1.7879 ? 
0.0602  ? 0.1396  ? 3.1234 ? -1.5037 ? 2.6748 ? -0.0336 ? 0.0547  ? -0.0087 ? -0.2381 ? 0.2788  ? 0.2478  ? 0.2173 ? -0.4924 ? 
-0.2198 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1  'X-RAY DIFFRACTION' 1  ? ? ? ? ? ? ? ? ? '(chain A and resseq 21:33)'   
2  'X-RAY DIFFRACTION' 2  ? ? ? ? ? ? ? ? ? '(chain A and resseq 34:40)'   
3  'X-RAY DIFFRACTION' 3  ? ? ? ? ? ? ? ? ? '(chain A and resseq 41:45)'   
4  'X-RAY DIFFRACTION' 4  ? ? ? ? ? ? ? ? ? '(chain A and resseq 46:63)'   
5  'X-RAY DIFFRACTION' 5  ? ? ? ? ? ? ? ? ? '(chain A and resseq 64:70)'   
6  'X-RAY DIFFRACTION' 6  ? ? ? ? ? ? ? ? ? '(chain A and resseq 71:165)'  
7  'X-RAY DIFFRACTION' 7  ? ? ? ? ? ? ? ? ? '(chain A and resseq 166:172)' 
8  'X-RAY DIFFRACTION' 8  ? ? ? ? ? ? ? ? ? '(chain A and resseq 173:186)' 
9  'X-RAY DIFFRACTION' 9  ? ? ? ? ? ? ? ? ? '(chain A and resseq 187:215)' 
10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? '(chain A and resseq 216:233)' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? xia2   ? ? ? .                           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? xia2   ? ? ? .                           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                           4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 428 ? ? O A HOH 557 ? ? 2.17 
2 1 O A HOH 410 ? ? O A HOH 584 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 569 ? ? 1_555 O A HOH 569 ? ? 5_555 1.65 
2 1 O A HOH 495 ? ? 1_555 O A HOH 628 ? ? 4_654 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 79  ? ? 57.53 19.17 
2 1 GLN A 124 ? ? 58.75 17.82 
3 1 GLN A 139 ? ? 57.53 18.68 
4 1 GLU A 169 ? ? 58.98 14.88 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       673 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   5.87 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A GLY 2   ? A GLY 2   
3  1 Y 1 A SER 3   ? A SER 3   
4  1 Y 1 A SER 4   ? A SER 4   
5  1 Y 1 A HIS 5   ? A HIS 5   
6  1 Y 1 A HIS 6   ? A HIS 6   
7  1 Y 1 A HIS 7   ? A HIS 7   
8  1 Y 1 A HIS 8   ? A HIS 8   
9  1 Y 1 A HIS 9   ? A HIS 9   
10 1 Y 1 A HIS 10  ? A HIS 10  
11 1 Y 1 A SER 11  ? A SER 11  
12 1 Y 1 A SER 12  ? A SER 12  
13 1 Y 1 A GLY 13  ? A GLY 13  
14 1 Y 1 A LEU 14  ? A LEU 14  
15 1 Y 1 A VAL 15  ? A VAL 15  
16 1 Y 1 A PRO 16  ? A PRO 16  
17 1 Y 1 A ARG 17  ? A ARG 17  
18 1 Y 1 A GLY 18  ? A GLY 18  
19 1 Y 1 A SER 19  ? A SER 19  
20 1 Y 1 A GLY 235 ? A GLY 235 
# 
_pdbx_audit_support.funding_organization   'Biotechnology and Biological Sciences Research Council' 
_pdbx_audit_support.country                'United Kingdom' 
_pdbx_audit_support.grant_number           BB/F023308/1 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
#