data_4YD1
# 
_entry.id   4YD1 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YD1         
WWPDB D_1000207243 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB '4YCX contains the same protein in binary complex with the same DNA substrate' 4YCX unspecified 
PDB .                                                                              4YD1 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YD1 
_pdbx_database_status.recvd_initial_deposition_date   2015-02-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Moon, A.F.'     1 
'Gosavi, R.A.'   2 
'Kunkel, T.A.'   3 
'Pedersen, L.C.' 4 
'Bebenek, K.'    5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            112 
_citation.language                  ? 
_citation.page_first                E4530 
_citation.page_last                 E4536 
_citation.title                     'Creative template-dependent synthesis by human polymerase mu.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1505798112 
_citation.pdbx_database_id_PubMed   26240373 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Moon, A.F.'     1 ? 
primary 'Gosavi, R.A.'   2 ? 
primary 'Kunkel, T.A.'   3 ? 
primary 'Pedersen, L.C.' 4 ? 
primary 'Bebenek, K.'    5 ? 
# 
_cell.entry_id           4YD1 
_cell.length_a           60.259 
_cell.length_b           69.042 
_cell.length_c           116.988 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4YD1 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'DNA-directed DNA/RNA polymerase mu'               39844.160 1   2.7.7.7 
'deletion of residues P398-P410, replaced by a single glycine (labelled G410)' ? ? 
2  polymer     syn 
;DNA (5'-D(*CP*GP*GP*CP*AP*AP*TP*AP*CP*G)-3')
;
3054.019  1   ?       ?                                                                              ? ? 
3  polymer     syn 
;DNA (5'-D(*CP*GP*TP*A)-3')
;
1190.830  1   ?       ?                                                                              ? ? 
4  polymer     syn 
;DNA (5'-D(P*GP*CP*CP*G)-3')
;
1191.818  1   ?       ?                                                                              ? ? 
5  non-polymer syn 'MAGNESIUM ION'                                    24.305    3   ?       ? ? ? 
6  non-polymer syn 1,2-ETHANEDIOL                                     62.068    2   ?       ? ? ? 
7  non-polymer syn GLYCEROL                                           92.094    2   ?       ? ? ? 
8  non-polymer syn 
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
467.157   1   ?       ?                                                                              ? ? 
9  non-polymer syn 'CHLORIDE ION'                                     35.453    4   ?       ? ? ? 
10 non-polymer syn 'SODIUM ION'                                       22.990    1   ?       ? ? ? 
11 water       nat water                                              18.015    468 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Pol Mu,Terminal transferase' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GSAAASPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEH
SSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLST
PVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHS
CCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHG
LFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
;GSAAASPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEH
SSRVVQELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLST
PVLRSDVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHS
CCESPTRLAQQSHMDAFERSFCIFRLPQPGSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKGLWLNSHG
LFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DC)(DA)(DA)(DT)(DA)(DC)(DG)' CGGCAATACG T ? 
3 polydeoxyribonucleotide no no '(DC)(DG)(DT)(DA)' CGTA P ? 
4 polydeoxyribonucleotide no no '(DG)(DC)(DC)(DG)' GCCG D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   ALA n 
1 4   ALA n 
1 5   ALA n 
1 6   SER n 
1 7   PRO n 
1 8   ALA n 
1 9   TRP n 
1 10  MET n 
1 11  PRO n 
1 12  ALA n 
1 13  TYR n 
1 14  ALA n 
1 15  CYS n 
1 16  GLN n 
1 17  ARG n 
1 18  PRO n 
1 19  THR n 
1 20  PRO n 
1 21  LEU n 
1 22  THR n 
1 23  HIS n 
1 24  HIS n 
1 25  ASN n 
1 26  THR n 
1 27  GLY n 
1 28  LEU n 
1 29  SER n 
1 30  GLU n 
1 31  ALA n 
1 32  LEU n 
1 33  GLU n 
1 34  ILE n 
1 35  LEU n 
1 36  ALA n 
1 37  GLU n 
1 38  ALA n 
1 39  ALA n 
1 40  GLY n 
1 41  PHE n 
1 42  GLU n 
1 43  GLY n 
1 44  SER n 
1 45  GLU n 
1 46  GLY n 
1 47  ARG n 
1 48  LEU n 
1 49  LEU n 
1 50  THR n 
1 51  PHE n 
1 52  CYS n 
1 53  ARG n 
1 54  ALA n 
1 55  ALA n 
1 56  SER n 
1 57  VAL n 
1 58  LEU n 
1 59  LYS n 
1 60  ALA n 
1 61  LEU n 
1 62  PRO n 
1 63  SER n 
1 64  PRO n 
1 65  VAL n 
1 66  THR n 
1 67  THR n 
1 68  LEU n 
1 69  SER n 
1 70  GLN n 
1 71  LEU n 
1 72  GLN n 
1 73  GLY n 
1 74  LEU n 
1 75  PRO n 
1 76  HIS n 
1 77  PHE n 
1 78  GLY n 
1 79  GLU n 
1 80  HIS n 
1 81  SER n 
1 82  SER n 
1 83  ARG n 
1 84  VAL n 
1 85  VAL n 
1 86  GLN n 
1 87  GLU n 
1 88  LEU n 
1 89  LEU n 
1 90  GLU n 
1 91  HIS n 
1 92  GLY n 
1 93  VAL n 
1 94  CYS n 
1 95  GLU n 
1 96  GLU n 
1 97  VAL n 
1 98  GLU n 
1 99  ARG n 
1 100 VAL n 
1 101 ARG n 
1 102 ARG n 
1 103 SER n 
1 104 GLU n 
1 105 ARG n 
1 106 TYR n 
1 107 GLN n 
1 108 THR n 
1 109 MET n 
1 110 LYS n 
1 111 LEU n 
1 112 PHE n 
1 113 THR n 
1 114 GLN n 
1 115 ILE n 
1 116 PHE n 
1 117 GLY n 
1 118 VAL n 
1 119 GLY n 
1 120 VAL n 
1 121 LYS n 
1 122 THR n 
1 123 ALA n 
1 124 ASP n 
1 125 ARG n 
1 126 TRP n 
1 127 TYR n 
1 128 ARG n 
1 129 GLU n 
1 130 GLY n 
1 131 LEU n 
1 132 ARG n 
1 133 THR n 
1 134 LEU n 
1 135 ASP n 
1 136 ASP n 
1 137 LEU n 
1 138 ARG n 
1 139 GLU n 
1 140 GLN n 
1 141 PRO n 
1 142 GLN n 
1 143 LYS n 
1 144 LEU n 
1 145 THR n 
1 146 GLN n 
1 147 GLN n 
1 148 GLN n 
1 149 LYS n 
1 150 ALA n 
1 151 GLY n 
1 152 LEU n 
1 153 GLN n 
1 154 HIS n 
1 155 HIS n 
1 156 GLN n 
1 157 ASP n 
1 158 LEU n 
1 159 SER n 
1 160 THR n 
1 161 PRO n 
1 162 VAL n 
1 163 LEU n 
1 164 ARG n 
1 165 SER n 
1 166 ASP n 
1 167 VAL n 
1 168 ASP n 
1 169 ALA n 
1 170 LEU n 
1 171 GLN n 
1 172 GLN n 
1 173 VAL n 
1 174 VAL n 
1 175 GLU n 
1 176 GLU n 
1 177 ALA n 
1 178 VAL n 
1 179 GLY n 
1 180 GLN n 
1 181 ALA n 
1 182 LEU n 
1 183 PRO n 
1 184 GLY n 
1 185 ALA n 
1 186 THR n 
1 187 VAL n 
1 188 THR n 
1 189 LEU n 
1 190 THR n 
1 191 GLY n 
1 192 GLY n 
1 193 PHE n 
1 194 ARG n 
1 195 ARG n 
1 196 GLY n 
1 197 LYS n 
1 198 LEU n 
1 199 GLN n 
1 200 GLY n 
1 201 HIS n 
1 202 ASP n 
1 203 VAL n 
1 204 ASP n 
1 205 PHE n 
1 206 LEU n 
1 207 ILE n 
1 208 THR n 
1 209 HIS n 
1 210 PRO n 
1 211 LYS n 
1 212 GLU n 
1 213 GLY n 
1 214 GLN n 
1 215 GLU n 
1 216 ALA n 
1 217 GLY n 
1 218 LEU n 
1 219 LEU n 
1 220 PRO n 
1 221 ARG n 
1 222 VAL n 
1 223 MET n 
1 224 CYS n 
1 225 ARG n 
1 226 LEU n 
1 227 GLN n 
1 228 ASP n 
1 229 GLN n 
1 230 GLY n 
1 231 LEU n 
1 232 ILE n 
1 233 LEU n 
1 234 TYR n 
1 235 HIS n 
1 236 GLN n 
1 237 HIS n 
1 238 GLN n 
1 239 HIS n 
1 240 SER n 
1 241 CYS n 
1 242 CYS n 
1 243 GLU n 
1 244 SER n 
1 245 PRO n 
1 246 THR n 
1 247 ARG n 
1 248 LEU n 
1 249 ALA n 
1 250 GLN n 
1 251 GLN n 
1 252 SER n 
1 253 HIS n 
1 254 MET n 
1 255 ASP n 
1 256 ALA n 
1 257 PHE n 
1 258 GLU n 
1 259 ARG n 
1 260 SER n 
1 261 PHE n 
1 262 CYS n 
1 263 ILE n 
1 264 PHE n 
1 265 ARG n 
1 266 LEU n 
1 267 PRO n 
1 268 GLN n 
1 269 PRO n 
1 270 GLY n 
1 271 SER n 
1 272 TRP n 
1 273 LYS n 
1 274 ALA n 
1 275 VAL n 
1 276 ARG n 
1 277 VAL n 
1 278 ASP n 
1 279 LEU n 
1 280 VAL n 
1 281 VAL n 
1 282 ALA n 
1 283 PRO n 
1 284 VAL n 
1 285 SER n 
1 286 GLN n 
1 287 PHE n 
1 288 PRO n 
1 289 PHE n 
1 290 ALA n 
1 291 LEU n 
1 292 LEU n 
1 293 GLY n 
1 294 TRP n 
1 295 THR n 
1 296 GLY n 
1 297 SER n 
1 298 LYS n 
1 299 LEU n 
1 300 PHE n 
1 301 GLN n 
1 302 ARG n 
1 303 GLU n 
1 304 LEU n 
1 305 ARG n 
1 306 ARG n 
1 307 PHE n 
1 308 SER n 
1 309 ARG n 
1 310 LYS n 
1 311 GLU n 
1 312 LYS n 
1 313 GLY n 
1 314 LEU n 
1 315 TRP n 
1 316 LEU n 
1 317 ASN n 
1 318 SER n 
1 319 HIS n 
1 320 GLY n 
1 321 LEU n 
1 322 PHE n 
1 323 ASP n 
1 324 PRO n 
1 325 GLU n 
1 326 GLN n 
1 327 LYS n 
1 328 THR n 
1 329 PHE n 
1 330 PHE n 
1 331 GLN n 
1 332 ALA n 
1 333 ALA n 
1 334 SER n 
1 335 GLU n 
1 336 GLU n 
1 337 ASP n 
1 338 ILE n 
1 339 PHE n 
1 340 ARG n 
1 341 HIS n 
1 342 LEU n 
1 343 GLY n 
1 344 LEU n 
1 345 GLU n 
1 346 TYR n 
1 347 LEU n 
1 348 PRO n 
1 349 PRO n 
1 350 GLU n 
1 351 GLN n 
1 352 ARG n 
1 353 ASN n 
1 354 ALA n 
2 1   DC  n 
2 2   DG  n 
2 3   DG  n 
2 4   DC  n 
2 5   DA  n 
2 6   DA  n 
2 7   DT  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DT  n 
3 4   DA  n 
4 1   DG  n 
4 2   DC  n 
4 3   DC  n 
4 4   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   354 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLM, polmu' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEXM 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 10 'Homo sapiens' ? 9606 ? 
3 1 sample 1 4  'Homo sapiens' ? 9606 ? 
4 1 sample 1 4  'Homo sapiens' ? 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DPOLM_HUMAN Q9NP87 ? 1 
;SPAWMPAYACQRPTPLTHHNTGLSEALEILAEAAGFEGSEGRLLTFCRAASVLKALPSPVTTLSQLQGLPHFGEHSSRVV
QELLEHGVCEEVERVRRSERYQTMKLFTQIFGVGVKTADRWYREGLRTLDDLREQPQKLTQQQKAGLQHHQDLSTPVLRS
DVDALQQVVEEAVGQALPGATVTLTGGFRRGKLQGHDVDFLITHPKEGQEAGLLPRVMCRLQDQGLILYHQHQHSCCESP
TRLAQQSHMDAFERSFCIFRLPQPPGAAVGGSTRPCPSWKAVRVDLVVAPVSQFPFALLGWTGSKLFQRELRRFSRKEKG
LWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRNA
;
134 
2 PDB 4YD1        4YD1   ? 2 ? 1   
3 PDB 4YD1        4YD1   ? 3 ? 1   
4 PDB 4YD1        4YD1   ? 4 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YD1 A 6 ? 354 ? Q9NP87 134 ? 494 ? 134 494 
2 2 4YD1 T 1 ? 10  ? 4YD1   1   ? 10  ? 1   10  
3 3 4YD1 P 1 ? 4   ? 4YD1   1   ? 4   ? 1   4   
4 4 4YD1 D 1 ? 4   ? 4YD1   1   ? 4   ? 1   4   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4YD1 GLY A 1   ? UNP Q9NP87 ?   ?   'expression tag'      129 1  
1 4YD1 SER A 2   ? UNP Q9NP87 ?   ?   'expression tag'      130 2  
1 4YD1 ALA A 3   ? UNP Q9NP87 ?   ?   'expression tag'      131 3  
1 4YD1 ALA A 4   ? UNP Q9NP87 ?   ?   'expression tag'      132 4  
1 4YD1 ALA A 5   ? UNP Q9NP87 ?   ?   'expression tag'      133 5  
1 4YD1 ?   A ?   ? UNP Q9NP87 PRO 398 deletion              ?   6  
1 4YD1 ?   A ?   ? UNP Q9NP87 GLY 399 deletion              ?   7  
1 4YD1 ?   A ?   ? UNP Q9NP87 ALA 400 deletion              ?   8  
1 4YD1 ?   A ?   ? UNP Q9NP87 ALA 401 deletion              ?   9  
1 4YD1 ?   A ?   ? UNP Q9NP87 VAL 402 deletion              ?   10 
1 4YD1 ?   A ?   ? UNP Q9NP87 GLY 403 deletion              ?   11 
1 4YD1 ?   A ?   ? UNP Q9NP87 GLY 404 deletion              ?   12 
1 4YD1 ?   A ?   ? UNP Q9NP87 SER 405 deletion              ?   13 
1 4YD1 ?   A ?   ? UNP Q9NP87 THR 406 deletion              ?   14 
1 4YD1 ?   A ?   ? UNP Q9NP87 ARG 407 deletion              ?   15 
1 4YD1 ?   A ?   ? UNP Q9NP87 PRO 408 deletion              ?   16 
1 4YD1 ?   A ?   ? UNP Q9NP87 CYS 409 deletion              ?   17 
1 4YD1 GLY A 270 ? UNP Q9NP87 PRO 410 'engineered mutation' 410 18 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                            ?                               'C3 H7 N O2'       
89.093  
ARG 'L-peptide linking' y ARGININE                                           ?                               'C6 H15 N4 O2 1'   
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                         ?                               'C4 H8 N2 O3'      
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                    ?                               'C4 H7 N O4'       
133.103 
CL  non-polymer         . 'CHLORIDE ION'                                     ?                               'Cl -1'            
35.453  
CYS 'L-peptide linking' y CYSTEINE                                           ?                               'C3 H7 N O2 S'     
121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"               ?                               'C10 H14 N5 O6 P'  
331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                ?                               'C9 H14 N3 O7 P'   
307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"               ?                               'C10 H14 N5 O7 P'  
347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                       ?                               'C10 H15 N2 O8 P'  
322.208 
DUP non-polymer         . 
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
?                               'C9 H16 N3 O13 P3' 467.157 
EDO non-polymer         . 1,2-ETHANEDIOL                                     'ETHYLENE GLYCOL'               'C2 H6 O2'         
62.068  
GLN 'L-peptide linking' y GLUTAMINE                                          ?                               'C5 H10 N2 O3'     
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                    ?                               'C5 H9 N O4'       
147.129 
GLY 'peptide linking'   y GLYCINE                                            ?                               'C2 H5 N O2'       
75.067  
GOL non-polymer         . GLYCEROL                                           'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         
92.094  
HIS 'L-peptide linking' y HISTIDINE                                          ?                               'C6 H10 N3 O2 1'   
156.162 
HOH non-polymer         . WATER                                              ?                               'H2 O'             
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                         ?                               'C6 H13 N O2'      
131.173 
LEU 'L-peptide linking' y LEUCINE                                            ?                               'C6 H13 N O2'      
131.173 
LYS 'L-peptide linking' y LYSINE                                             ?                               'C6 H15 N2 O2 1'   
147.195 
MET 'L-peptide linking' y METHIONINE                                         ?                               'C5 H11 N O2 S'    
149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                    ?                               'Mg 2'             
24.305  
NA  non-polymer         . 'SODIUM ION'                                       ?                               'Na 1'             
22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                      ?                               'C9 H11 N O2'      
165.189 
PRO 'L-peptide linking' y PROLINE                                            ?                               'C5 H9 N O2'       
115.130 
SER 'L-peptide linking' y SERINE                                             ?                               'C3 H7 N O3'       
105.093 
THR 'L-peptide linking' y THREONINE                                          ?                               'C4 H9 N O3'       
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                         ?                               'C11 H12 N2 O2'    
204.225 
TYR 'L-peptide linking' y TYROSINE                                           ?                               'C9 H11 N O3'      
181.189 
VAL 'L-peptide linking' y VALINE                                             ?                               'C5 H11 N O2'      
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YD1 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.68 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.03 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            294 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M Tris, 20% PEG8K, 0.2M MgCl2' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU SATURN 92' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-09-08 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    mirrors 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4YD1 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.750 
_reflns.number_obs                   49927 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.07700 
_reflns.pdbx_netI_over_sigmaI        26.1100 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              9.200 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.81 
_reflns_shell.percent_possible_all   99.1 
_reflns_shell.Rmerge_I_obs           0.51000 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.580 
_reflns_shell.pdbx_redundancy        4.20 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4YD1 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     49927 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             24.97 
_refine.ls_d_res_high                            1.75 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_R_factor_obs                          0.164 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.163 
_refine.ls_R_factor_R_free                       0.190 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  2497 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4YCX 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            'same as for 4YCX' 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.190 
_refine.pdbx_overall_phase_error                 18.190 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2612 
_refine_hist.pdbx_number_atoms_nucleic_acid   365 
_refine_hist.pdbx_number_atoms_ligand         56 
_refine_hist.number_atoms_solvent             468 
_refine_hist.number_atoms_total               3501 
_refine_hist.d_res_high                       1.75 
_refine_hist.d_res_low                        24.97 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 3218 'X-RAY DIFFRACTION' ? 
f_angle_d          1.238  ? ? 4449 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.016 ? ? 1034 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.059  ? ? 486  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 519  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.7489 1.7825  2543 0.2336 98.00  0.2692 . . 133 . . 
'X-RAY DIFFRACTION' . 1.7825 1.8189  2608 0.2204 100.00 0.2655 . . 137 . . 
'X-RAY DIFFRACTION' . 1.8189 1.8584  2598 0.2209 100.00 0.2729 . . 137 . . 
'X-RAY DIFFRACTION' . 1.8584 1.9017  2606 0.1999 100.00 0.2333 . . 137 . . 
'X-RAY DIFFRACTION' . 1.9017 1.9492  2626 0.1759 100.00 0.2173 . . 137 . . 
'X-RAY DIFFRACTION' . 1.9492 2.0019  2600 0.1690 100.00 0.1983 . . 137 . . 
'X-RAY DIFFRACTION' . 2.0019 2.0608  2593 0.1670 100.00 0.2048 . . 143 . . 
'X-RAY DIFFRACTION' . 2.0608 2.1272  2637 0.1650 100.00 0.1815 . . 134 . . 
'X-RAY DIFFRACTION' . 2.1272 2.2032  2609 0.1555 100.00 0.2058 . . 138 . . 
'X-RAY DIFFRACTION' . 2.2032 2.2914  2633 0.1497 100.00 0.2016 . . 137 . . 
'X-RAY DIFFRACTION' . 2.2914 2.3956  2636 0.1531 100.00 0.1520 . . 139 . . 
'X-RAY DIFFRACTION' . 2.3956 2.5218  2619 0.1676 100.00 0.2054 . . 138 . . 
'X-RAY DIFFRACTION' . 2.5218 2.6796  2616 0.1771 99.00  0.2417 . . 139 . . 
'X-RAY DIFFRACTION' . 2.6796 2.8862  2659 0.1829 99.00  0.2141 . . 140 . . 
'X-RAY DIFFRACTION' . 2.8862 3.1761  2651 0.1718 100.00 0.2034 . . 141 . . 
'X-RAY DIFFRACTION' . 3.1761 3.6345  2670 0.1435 100.00 0.1641 . . 139 . . 
'X-RAY DIFFRACTION' . 3.6345 4.5745  2697 0.1298 100.00 0.1364 . . 143 . . 
'X-RAY DIFFRACTION' . 4.5745 24.9742 2829 0.1650 100.00 0.1877 . . 148 . . 
# 
_struct.entry_id                     4YD1 
_struct.title                        
'Ternary complex of human DNA Polymerase Mu with 2-nt gapped DNA substrate and an incoming nonhydrolyzable dUMPNPP' 
_struct.pdbx_descriptor              'human DNA Polymerase mu/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YD1 
_struct_keywords.text            'polymerase, DNA repair, NHEJ, transferase-dna complex' 
_struct_keywords.pdbx_keywords   transferase/dna 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 7  ? 
J N N 6  ? 
K N N 8  ? 
L N N 9  ? 
M N N 9  ? 
N N N 9  ? 
O N N 9  ? 
P N N 10 ? 
Q N N 5  ? 
R N N 11 ? 
S N N 11 ? 
T N N 11 ? 
U N N 11 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TYR A 13  ? ARG A 17  ? TYR A 141 ARG A 145 5 ? 5  
HELX_P HELX_P2  AA2 ASN A 25  ? GLU A 42  ? ASN A 153 GLU A 170 1 ? 18 
HELX_P HELX_P3  AA3 SER A 44  ? ALA A 60  ? SER A 172 ALA A 188 1 ? 17 
HELX_P HELX_P4  AA4 THR A 67  ? GLN A 72  ? THR A 195 GLN A 200 5 ? 6  
HELX_P HELX_P5  AA5 GLY A 78  ? GLY A 92  ? GLY A 206 GLY A 220 1 ? 15 
HELX_P HELX_P6  AA6 CYS A 94  ? SER A 103 ? CYS A 222 SER A 231 1 ? 10 
HELX_P HELX_P7  AA7 SER A 103 ? GLN A 114 ? SER A 231 GLN A 242 1 ? 12 
HELX_P HELX_P8  AA8 GLY A 119 ? GLU A 129 ? GLY A 247 GLU A 257 1 ? 11 
HELX_P HELX_P9  AA9 THR A 133 ? GLU A 139 ? THR A 261 GLU A 267 1 ? 7  
HELX_P HELX_P10 AB1 GLN A 140 ? LEU A 144 ? GLN A 268 LEU A 272 5 ? 5  
HELX_P HELX_P11 AB2 THR A 145 ? HIS A 154 ? THR A 273 HIS A 282 1 ? 10 
HELX_P HELX_P12 AB3 HIS A 154 ? SER A 159 ? HIS A 282 SER A 287 1 ? 6  
HELX_P HELX_P13 AB4 ARG A 164 ? LEU A 182 ? ARG A 292 LEU A 310 1 ? 19 
HELX_P HELX_P14 AB5 THR A 190 ? ARG A 195 ? THR A 318 ARG A 323 1 ? 6  
HELX_P HELX_P15 AB6 LEU A 218 ? ASP A 228 ? LEU A 346 ASP A 356 1 ? 11 
HELX_P HELX_P16 AB7 PRO A 283 ? SER A 285 ? PRO A 423 SER A 425 5 ? 3  
HELX_P HELX_P17 AB8 GLN A 286 ? GLY A 296 ? GLN A 426 GLY A 436 1 ? 11 
HELX_P HELX_P18 AB9 SER A 297 ? GLY A 313 ? SER A 437 GLY A 453 1 ? 17 
HELX_P HELX_P19 AC1 SER A 334 ? LEU A 342 ? SER A 474 LEU A 482 1 ? 9  
HELX_P HELX_P20 AC2 PRO A 348 ? ARG A 352 ? PRO A 488 ARG A 492 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A THR 113 O     ? ? ? 1_555 P NA  . NA  ? ? A THR 241 A NA  612 1_555 ? ? ? ? ? ? ?            2.563 ? 
metalc2  metalc ? ? A ILE 115 O     ? ? ? 1_555 P NA  . NA  ? ? A ILE 243 A NA  612 1_555 ? ? ? ? ? ? ?            2.443 ? 
metalc3  metalc ? ? A VAL 118 O     ? ? ? 1_555 P NA  . NA  ? ? A VAL 246 A NA  612 1_555 ? ? ? ? ? ? ?            2.432 ? 
metalc4  metalc ? ? A ASP 202 OD1   ? ? ? 1_555 F MG  . MG  ? ? A ASP 330 A MG  602 1_555 ? ? ? ? ? ? ?            2.036 ? 
metalc5  metalc ? ? A ASP 202 OD2   ? ? ? 1_555 E MG  . MG  ? ? A ASP 330 A MG  601 1_555 ? ? ? ? ? ? ?            2.059 ? 
metalc6  metalc ? ? A ASP 204 OD1   ? ? ? 1_555 E MG  . MG  ? ? A ASP 332 A MG  601 1_555 ? ? ? ? ? ? ?            2.021 ? 
metalc7  metalc ? ? A ASP 204 OD2   ? ? ? 1_555 F MG  . MG  ? ? A ASP 332 A MG  602 1_555 ? ? ? ? ? ? ?            2.037 ? 
metalc8  metalc ? ? A ASP 278 OD2   ? ? ? 1_555 E MG  . MG  ? ? A ASP 418 A MG  601 1_555 ? ? ? ? ? ? ?            2.006 ? 
metalc9  metalc ? ? C DA  4   "O3'" ? ? ? 1_555 E MG  . MG  ? ? P DA  4   A MG  601 1_555 ? ? ? ? ? ? ?            2.219 ? 
metalc10 metalc ? ? E MG  .   MG    ? ? ? 1_555 K DUP . O1A ? ? A MG  601 A DUP 607 1_555 ? ? ? ? ? ? ?            2.306 ? 
metalc11 metalc ? ? E MG  .   MG    ? ? ? 1_555 R HOH . O   ? ? A MG  601 A HOH 770 1_555 ? ? ? ? ? ? ?            2.105 ? 
metalc12 metalc ? ? F MG  .   MG    ? ? ? 1_555 K DUP . O3G ? ? A MG  602 A DUP 607 1_555 ? ? ? ? ? ? ?            2.027 ? 
metalc13 metalc ? ? F MG  .   MG    ? ? ? 1_555 K DUP . O1A ? ? A MG  602 A DUP 607 1_555 ? ? ? ? ? ? ?            2.126 ? 
metalc14 metalc ? ? F MG  .   MG    ? ? ? 1_555 K DUP . O2B ? ? A MG  602 A DUP 607 1_555 ? ? ? ? ? ? ?            2.033 ? 
metalc15 metalc ? ? F MG  .   MG    ? ? ? 1_555 R HOH . O   ? ? A MG  602 A HOH 850 1_555 ? ? ? ? ? ? ?            2.172 ? 
metalc16 metalc ? ? P NA  .   NA    ? ? ? 1_555 R HOH . O   ? ? A NA  612 A HOH 838 1_555 ? ? ? ? ? ? ?            2.329 ? 
metalc17 metalc ? ? P NA  .   NA    ? ? ? 1_555 R HOH . O   ? ? A NA  612 A HOH 982 1_555 ? ? ? ? ? ? ?            2.383 ? 
metalc18 metalc ? ? P NA  .   NA    ? ? ? 1_555 T HOH . O   ? ? A NA  612 P HOH 114 1_555 ? ? ? ? ? ? ?            2.842 ? 
metalc19 metalc ? ? Q MG  .   MG    ? ? ? 1_555 S HOH . O   ? ? T MG  101 T HOH 216 1_555 ? ? ? ? ? ? ?            1.923 ? 
metalc20 metalc ? ? Q MG  .   MG    ? ? ? 1_555 S HOH . O   ? ? T MG  101 T HOH 207 1_555 ? ? ? ? ? ? ?            2.102 ? 
metalc21 metalc ? ? Q MG  .   MG    ? ? ? 1_555 S HOH . O   ? ? T MG  101 T HOH 223 1_555 ? ? ? ? ? ? ?            1.982 ? 
metalc22 metalc ? ? Q MG  .   MG    ? ? ? 1_555 S HOH . O   ? ? T MG  101 T HOH 255 1_555 ? ? ? ? ? ? ?            2.137 ? 
metalc23 metalc ? ? Q MG  .   MG    ? ? ? 1_555 U HOH . O   ? ? T MG  101 D HOH 116 1_555 ? ? ? ? ? ? ?            2.139 ? 
metalc24 metalc ? ? Q MG  .   MG    ? ? ? 1_555 S HOH . O   ? ? T MG  101 T HOH 247 3_544 ? ? ? ? ? ? ?            2.278 ? 
hydrog1  hydrog ? ? B DC  1   N3    ? ? ? 1_555 D DG  4 N1  ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  1   N4    ? ? ? 1_555 D DG  4 O6  ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  1   O2    ? ? ? 1_555 D DG  4 N2  ? ? T DC  1   D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  2   N1    ? ? ? 1_555 D DC  3 N3  ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  2   N2    ? ? ? 1_555 D DC  3 O2  ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  2   O6    ? ? ? 1_555 D DC  3 N4  ? ? T DG  2   D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  3   N1    ? ? ? 1_555 D DC  2 N3  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DG  3   N2    ? ? ? 1_555 D DC  2 O2  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  3   O6    ? ? ? 1_555 D DC  2 N4  ? ? T DG  3   D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  4   N3    ? ? ? 1_555 D DG  1 N1  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  4   N4    ? ? ? 1_555 D DG  1 O6  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  4   O2    ? ? ? 1_555 D DG  1 N2  ? ? T DC  4   D DG  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DT  7   N3    ? ? ? 1_555 C DA  4 N1  ? ? T DT  7   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DT  7   O4    ? ? ? 1_555 C DA  4 N6  ? ? T DT  7   P DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  3 N3  ? ? T DA  8   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  3 O4  ? ? T DA  8   P DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  9   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  9   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  9   P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  1 N3  ? ? T DG  10  P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  1 O2  ? ? T DG  10  P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  1 N4  ? ? T DG  10  P DC  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           296 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            436 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    297 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     437 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -5.12 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 162 ? LEU A 163 ? VAL A 290 LEU A 291 
AA1 2 GLN A 199 ? GLY A 200 ? GLN A 327 GLY A 328 
AA2 1 THR A 186 ? LEU A 189 ? THR A 314 LEU A 317 
AA2 2 ASP A 202 ? THR A 208 ? ASP A 330 THR A 336 
AA2 3 SER A 271 ? VAL A 281 ? SER A 411 VAL A 421 
AA2 4 GLU A 258 ? GLN A 268 ? GLU A 386 GLN A 396 
AA2 5 ILE A 232 ? GLN A 238 ? ILE A 360 GLN A 366 
AA3 1 TRP A 315 ? ASN A 317 ? TRP A 455 ASN A 457 
AA3 2 GLY A 320 ? ASP A 323 ? GLY A 460 ASP A 463 
AA3 3 THR A 328 ? PHE A 329 ? THR A 468 PHE A 469 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 162 ? N VAL A 290 O GLY A 200 ? O GLY A 328 
AA2 1 2 N THR A 188 ? N THR A 316 O LEU A 206 ? O LEU A 334 
AA2 2 3 N ILE A 207 ? N ILE A 335 O VAL A 280 ? O VAL A 420 
AA2 3 4 O VAL A 275 ? O VAL A 415 N PHE A 264 ? N PHE A 392 
AA2 4 5 O ARG A 259 ? O ARG A 387 N GLN A 238 ? N GLN A 366 
AA3 1 2 N TRP A 315 ? N TRP A 455 O PHE A 322 ? O PHE A 462 
AA3 2 3 N ASP A 323 ? N ASP A 463 O THR A 328 ? O THR A 468 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  601 ? 7  'binding site for residue MG A 601'  
AC2 Software A MG  602 ? 5  'binding site for residue MG A 602'  
AC3 Software A EDO 603 ? 4  'binding site for residue EDO A 603' 
AC4 Software A GOL 604 ? 5  'binding site for residue GOL A 604' 
AC5 Software A GOL 605 ? 2  'binding site for residue GOL A 605' 
AC6 Software A EDO 606 ? 6  'binding site for residue EDO A 606' 
AC7 Software A DUP 607 ? 27 'binding site for residue DUP A 607' 
AC8 Software A CL  608 ? 3  'binding site for residue CL A 608'  
AC9 Software A CL  609 ? 4  'binding site for residue CL A 609'  
AD1 Software A CL  610 ? 1  'binding site for residue CL A 610'  
AD2 Software A CL  611 ? 4  'binding site for residue CL A 611'  
AD3 Software A NA  612 ? 7  'binding site for residue NA A 612'  
AD4 Software T MG  101 ? 6  'binding site for residue MG T 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP A 202 ? ASP A 330 . ? 1_555 ? 
2  AC1 7  ASP A 204 ? ASP A 332 . ? 1_555 ? 
3  AC1 7  ASP A 278 ? ASP A 418 . ? 1_555 ? 
4  AC1 7  MG  F .   ? MG  A 602 . ? 1_555 ? 
5  AC1 7  DUP K .   ? DUP A 607 . ? 1_555 ? 
6  AC1 7  HOH R .   ? HOH A 770 . ? 1_555 ? 
7  AC1 7  DA  C 4   ? DA  P 4   . ? 1_555 ? 
8  AC2 5  ASP A 202 ? ASP A 330 . ? 1_555 ? 
9  AC2 5  ASP A 204 ? ASP A 332 . ? 1_555 ? 
10 AC2 5  MG  E .   ? MG  A 601 . ? 1_555 ? 
11 AC2 5  DUP K .   ? DUP A 607 . ? 1_555 ? 
12 AC2 5  HOH R .   ? HOH A 850 . ? 1_555 ? 
13 AC3 4  PRO A 62  ? PRO A 190 . ? 1_555 ? 
14 AC3 4  SER A 63  ? SER A 191 . ? 1_555 ? 
15 AC3 4  PRO A 64  ? PRO A 192 . ? 1_555 ? 
16 AC3 4  GLN A 70  ? GLN A 198 . ? 1_555 ? 
17 AC4 5  TRP A 315 ? TRP A 455 . ? 1_555 ? 
18 AC4 5  PHE A 322 ? PHE A 462 . ? 1_555 ? 
19 AC4 5  HOH R .   ? HOH A 706 . ? 1_555 ? 
20 AC4 5  HOH R .   ? HOH A 708 . ? 1_555 ? 
21 AC4 5  HOH S .   ? HOH T 202 . ? 1_555 ? 
22 AC5 2  HOH R .   ? HOH A 704 . ? 1_555 ? 
23 AC5 2  HOH R .   ? HOH A 717 . ? 1_555 ? 
24 AC6 6  GLY A 293 ? GLY A 433 . ? 1_555 ? 
25 AC6 6  ARG A 305 ? ARG A 445 . ? 1_555 ? 
26 AC6 6  SER A 318 ? SER A 458 . ? 1_555 ? 
27 AC6 6  DUP K .   ? DUP A 607 . ? 1_555 ? 
28 AC6 6  HOH R .   ? HOH A 786 . ? 1_555 ? 
29 AC6 6  DA  C 4   ? DA  P 4   . ? 1_555 ? 
30 AC7 27 GLY A 191 ? GLY A 319 . ? 1_555 ? 
31 AC7 27 GLY A 192 ? GLY A 320 . ? 1_555 ? 
32 AC7 27 ARG A 195 ? ARG A 323 . ? 1_555 ? 
33 AC7 27 LYS A 197 ? LYS A 325 . ? 1_555 ? 
34 AC7 27 GLY A 200 ? GLY A 328 . ? 1_555 ? 
35 AC7 27 HIS A 201 ? HIS A 329 . ? 1_555 ? 
36 AC7 27 ASP A 202 ? ASP A 330 . ? 1_555 ? 
37 AC7 27 ASP A 204 ? ASP A 332 . ? 1_555 ? 
38 AC7 27 GLY A 293 ? GLY A 433 . ? 1_555 ? 
39 AC7 27 TRP A 294 ? TRP A 434 . ? 1_555 ? 
40 AC7 27 GLY A 296 ? GLY A 436 . ? 1_555 ? 
41 AC7 27 MG  E .   ? MG  A 601 . ? 1_555 ? 
42 AC7 27 MG  F .   ? MG  A 602 . ? 1_555 ? 
43 AC7 27 EDO J .   ? EDO A 606 . ? 1_555 ? 
44 AC7 27 HOH R .   ? HOH A 702 . ? 1_555 ? 
45 AC7 27 HOH R .   ? HOH A 749 . ? 1_555 ? 
46 AC7 27 HOH R .   ? HOH A 770 . ? 1_555 ? 
47 AC7 27 HOH R .   ? HOH A 773 . ? 1_555 ? 
48 AC7 27 HOH R .   ? HOH A 797 . ? 1_555 ? 
49 AC7 27 HOH R .   ? HOH A 814 . ? 1_555 ? 
50 AC7 27 HOH R .   ? HOH A 834 . ? 1_555 ? 
51 AC7 27 HOH R .   ? HOH A 850 . ? 1_555 ? 
52 AC7 27 HOH R .   ? HOH A 904 . ? 1_555 ? 
53 AC7 27 HOH R .   ? HOH A 922 . ? 1_555 ? 
54 AC7 27 HOH R .   ? HOH A 932 . ? 1_555 ? 
55 AC7 27 DA  C 4   ? DA  P 4   . ? 1_555 ? 
56 AC7 27 DA  B 5   ? DA  T 5   . ? 1_555 ? 
57 AC8 3  SER A 44  ? SER A 172 . ? 1_555 ? 
58 AC8 3  GLY A 46  ? GLY A 174 . ? 1_555 ? 
59 AC8 3  ARG A 47  ? ARG A 175 . ? 1_555 ? 
60 AC9 4  SER A 334 ? SER A 474 . ? 1_555 ? 
61 AC9 4  GLU A 335 ? GLU A 475 . ? 1_555 ? 
62 AC9 4  HOH R .   ? HOH A 926 . ? 1_555 ? 
63 AC9 4  HOH R .   ? HOH A 963 . ? 1_555 ? 
64 AD1 1  LEU A 198 ? LEU A 326 . ? 1_555 ? 
65 AD2 4  PHE A 257 ? PHE A 385 . ? 1_555 ? 
66 AD2 4  ARG A 259 ? ARG A 387 . ? 1_555 ? 
67 AD2 4  TRP A 294 ? TRP A 434 . ? 1_555 ? 
68 AD2 4  HOH R .   ? HOH A 759 . ? 1_555 ? 
69 AD3 7  THR A 113 ? THR A 241 . ? 1_555 ? 
70 AD3 7  ILE A 115 ? ILE A 243 . ? 1_555 ? 
71 AD3 7  VAL A 118 ? VAL A 246 . ? 1_555 ? 
72 AD3 7  HOH R .   ? HOH A 838 . ? 1_555 ? 
73 AD3 7  HOH R .   ? HOH A 982 . ? 1_555 ? 
74 AD3 7  DT  C 3   ? DT  P 3   . ? 1_555 ? 
75 AD3 7  HOH T .   ? HOH P 114 . ? 1_555 ? 
76 AD4 6  HOH U .   ? HOH D 116 . ? 1_555 ? 
77 AD4 6  HOH S .   ? HOH T 207 . ? 1_555 ? 
78 AD4 6  HOH S .   ? HOH T 216 . ? 1_555 ? 
79 AD4 6  HOH S .   ? HOH T 223 . ? 1_555 ? 
80 AD4 6  HOH S .   ? HOH T 247 . ? 3_544 ? 
81 AD4 6  HOH S .   ? HOH T 255 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YD1 
_atom_sites.fract_transf_matrix[1][1]   0.016595 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014484 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008548 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
NA 
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . MET A 1  10  ? 0.245   -29.026 -11.301 1.00 31.60 ?  138  MET A N     1 
ATOM   2    C  CA    . MET A 1  10  ? 0.372   -27.564 -11.304 1.00 27.74 ?  138  MET A CA    1 
ATOM   3    C  C     . MET A 1  10  ? -0.499  -26.955 -12.403 1.00 24.78 ?  138  MET A C     1 
ATOM   4    O  O     . MET A 1  10  ? -0.266  -27.206 -13.586 1.00 23.69 ?  138  MET A O     1 
ATOM   5    C  CB    . MET A 1  10  ? 1.837   -27.177 -11.491 1.00 29.53 ?  138  MET A CB    1 
ATOM   6    C  CG    . MET A 1  10  ? 2.061   -25.767 -11.982 1.00 32.10 ?  138  MET A CG    1 
ATOM   7    S  SD    . MET A 1  10  ? 2.415   -24.574 -10.691 1.00 30.43 ?  138  MET A SD    1 
ATOM   8    C  CE    . MET A 1  10  ? 3.549   -25.449 -9.621  1.00 26.20 ?  138  MET A CE    1 
ATOM   9    N  N     . PRO A 1  11  ? -1.520  -26.165 -12.023 1.00 22.81 ?  139  PRO A N     1 
ATOM   10   C  CA    . PRO A 1  11  ? -2.400  -25.639 -13.075 1.00 22.20 ?  139  PRO A CA    1 
ATOM   11   C  C     . PRO A 1  11  ? -1.706  -24.595 -13.931 1.00 20.14 ?  139  PRO A C     1 
ATOM   12   O  O     . PRO A 1  11  ? -0.690  -24.022 -13.522 1.00 20.49 ?  139  PRO A O     1 
ATOM   13   C  CB    . PRO A 1  11  ? -3.579  -25.038 -12.303 1.00 26.74 ?  139  PRO A CB    1 
ATOM   14   C  CG    . PRO A 1  11  ? -3.139  -24.909 -10.919 1.00 27.25 ?  139  PRO A CG    1 
ATOM   15   C  CD    . PRO A 1  11  ? -2.059  -25.926 -10.675 1.00 24.87 ?  139  PRO A CD    1 
ATOM   16   N  N     . ALA A 1  12  ? -2.256  -24.366 -15.121 1.00 18.59 ?  140  ALA A N     1 
ATOM   17   C  CA    . ALA A 1  12  ? -1.587  -23.574 -16.153 1.00 21.48 ?  140  ALA A CA    1 
ATOM   18   C  C     . ALA A 1  12  ? -1.603  -22.067 -15.884 1.00 21.87 ?  140  ALA A C     1 
ATOM   19   O  O     . ALA A 1  12  ? -0.668  -21.350 -16.271 1.00 24.46 ?  140  ALA A O     1 
ATOM   20   C  CB    . ALA A 1  12  ? -2.220  -23.854 -17.502 1.00 23.67 ?  140  ALA A CB    1 
ATOM   21   N  N     . TYR A 1  13  ? -2.651  -21.595 -15.210 1.00 15.74 ?  141  TYR A N     1 
ATOM   22   C  CA    . TYR A 1  13  ? -2.833  -20.167 -14.961 1.00 14.33 ?  141  TYR A CA    1 
ATOM   23   C  C     . TYR A 1  13  ? -2.429  -19.796 -13.542 1.00 13.73 ?  141  TYR A C     1 
ATOM   24   O  O     . TYR A 1  13  ? -2.721  -20.547 -12.610 1.00 14.16 ?  141  TYR A O     1 
ATOM   25   C  CB    . TYR A 1  13  ? -4.298  -19.769 -15.162 1.00 15.51 ?  141  TYR A CB    1 
ATOM   26   C  CG    . TYR A 1  13  ? -4.836  -19.800 -16.573 1.00 16.09 ?  141  TYR A CG    1 
ATOM   27   C  CD1   . TYR A 1  13  ? -5.290  -20.983 -17.150 1.00 17.81 ?  141  TYR A CD1   1 
ATOM   28   C  CD2   . TYR A 1  13  ? -4.944  -18.628 -17.313 1.00 16.88 ?  141  TYR A CD2   1 
ATOM   29   C  CE1   . TYR A 1  13  ? -5.820  -21.000 -18.441 1.00 19.90 ?  141  TYR A CE1   1 
ATOM   30   C  CE2   . TYR A 1  13  ? -5.467  -18.636 -18.601 1.00 18.55 ?  141  TYR A CE2   1 
ATOM   31   C  CZ    . TYR A 1  13  ? -5.901  -19.811 -19.160 1.00 21.47 ?  141  TYR A CZ    1 
ATOM   32   O  OH    . TYR A 1  13  ? -6.424  -19.809 -20.438 1.00 23.66 ?  141  TYR A OH    1 
ATOM   33   N  N     . ALA A 1  14  ? -1.817  -18.624 -13.363 1.00 11.38 ?  142  ALA A N     1 
ATOM   34   C  CA    . ALA A 1  14  ? -1.340  -18.259 -12.030 1.00 12.42 ?  142  ALA A CA    1 
ATOM   35   C  C     . ALA A 1  14  ? -2.500  -18.035 -11.067 1.00 15.13 ?  142  ALA A C     1 
ATOM   36   O  O     . ALA A 1  14  ? -2.356  -18.173 -9.844  1.00 15.11 ?  142  ALA A O     1 
ATOM   37   C  CB    . ALA A 1  14  ? -0.468  -17.029 -12.092 1.00 14.32 ?  142  ALA A CB    1 
ATOM   38   N  N     . CYS A 1  15  ? -3.653  -17.679 -11.609 1.00 14.21 ?  143  CYS A N     1 
ATOM   39   C  CA    . CYS A 1  15  ? -4.804  -17.420 -10.748 1.00 13.19 ?  143  CYS A CA    1 
ATOM   40   C  C     . CYS A 1  15  ? -5.445  -18.704 -10.219 1.00 14.58 ?  143  CYS A C     1 
ATOM   41   O  O     . CYS A 1  15  ? -6.365  -18.650 -9.396  1.00 15.93 ?  143  CYS A O     1 
ATOM   42   C  CB    . CYS A 1  15  ? -5.837  -16.561 -11.501 1.00 12.64 ?  143  CYS A CB    1 
ATOM   43   S  SG    . CYS A 1  15  ? -6.426  -17.334 -13.053 1.00 15.33 ?  143  CYS A SG    1 
ATOM   44   N  N     . GLN A 1  16  ? -4.945  -19.861 -10.671 1.00 12.54 ?  144  GLN A N     1 
ATOM   45   C  CA    . GLN A 1  16  ? -5.463  -21.149 -10.237 1.00 12.48 ?  144  GLN A CA    1 
ATOM   46   C  C     . GLN A 1  16  ? -4.645  -21.759 -9.112  1.00 15.93 ?  144  GLN A C     1 
ATOM   47   O  O     . GLN A 1  16  ? -4.937  -22.867 -8.658  1.00 16.64 ?  144  GLN A O     1 
ATOM   48   C  CB    . GLN A 1  16  ? -5.507  -22.128 -11.410 1.00 13.86 ?  144  GLN A CB    1 
ATOM   49   C  CG    . GLN A 1  16  ? -6.606  -21.846 -12.410 1.00 16.20 ?  144  GLN A CG    1 
ATOM   50   C  CD    . GLN A 1  16  ? -6.485  -22.774 -13.605 1.00 19.28 ?  144  GLN A CD    1 
ATOM   51   O  OE1   . GLN A 1  16  ? -5.433  -22.832 -14.245 1.00 18.02 ?  144  GLN A OE1   1 
ATOM   52   N  NE2   . GLN A 1  16  ? -7.543  -23.505 -13.899 1.00 21.42 ?  144  GLN A NE2   1 
ATOM   53   N  N     . ARG A 1  17  ? -3.624  -21.048 -8.656  1.00 15.49 ?  145  ARG A N     1 
ATOM   54   C  CA    . ARG A 1  17  ? -2.736  -21.624 -7.663  1.00 18.57 ?  145  ARG A CA    1 
ATOM   55   C  C     . ARG A 1  17  ? -2.288  -20.544 -6.681  1.00 14.42 ?  145  ARG A C     1 
ATOM   56   O  O     . ARG A 1  17  ? -2.152  -19.381 -7.056  1.00 16.53 ?  145  ARG A O     1 
ATOM   57   C  CB    . ARG A 1  17  ? -1.527  -22.277 -8.352  1.00 20.87 ?  145  ARG A CB    1 
ATOM   58   C  CG    . ARG A 1  17  ? -0.674  -21.277 -9.104  1.00 21.85 ?  145  ARG A CG    1 
ATOM   59   C  CD    . ARG A 1  17  ? 0.215   -21.916 -10.182 1.00 25.47 ?  145  ARG A CD    1 
ATOM   60   N  NE    . ARG A 1  17  ? 1.028   -20.866 -10.786 1.00 23.41 ?  145  ARG A NE    1 
ATOM   61   C  CZ    . ARG A 1  17  ? 1.189   -20.687 -12.094 1.00 23.04 ?  145  ARG A CZ    1 
ATOM   62   N  NH1   . ARG A 1  17  ? 0.602   -21.494 -12.991 1.00 20.74 ?  145  ARG A NH1   1 
ATOM   63   N  NH2   . ARG A 1  17  ? 1.928   -19.671 -12.505 1.00 24.27 ?  145  ARG A NH2   1 
ATOM   64   N  N     . PRO A 1  18  ? -2.091  -20.919 -5.407  1.00 13.66 ?  146  PRO A N     1 
ATOM   65   C  CA    . PRO A 1  18  ? -1.600  -19.912 -4.465  1.00 12.18 ?  146  PRO A CA    1 
ATOM   66   C  C     . PRO A 1  18  ? -0.145  -19.624 -4.747  1.00 11.38 ?  146  PRO A C     1 
ATOM   67   O  O     . PRO A 1  18  ? 0.627   -20.572 -5.008  1.00 14.83 ?  146  PRO A O     1 
ATOM   68   C  CB    . PRO A 1  18  ? -1.761  -20.572 -3.091  1.00 15.43 ?  146  PRO A CB    1 
ATOM   69   C  CG    . PRO A 1  18  ? -2.022  -21.974 -3.336  1.00 17.51 ?  146  PRO A CG    1 
ATOM   70   C  CD    . PRO A 1  18  ? -2.561  -22.138 -4.725  1.00 15.79 ?  146  PRO A CD    1 
ATOM   71   N  N     . THR A 1  19  ? 0.215   -18.349 -4.685  1.00 11.60 ?  147  THR A N     1 
ATOM   72   C  CA    . THR A 1  19  ? 1.617   -17.951 -4.857  1.00 10.80 ?  147  THR A CA    1 
ATOM   73   C  C     . THR A 1  19  ? 1.988   -17.030 -3.705  1.00 10.71 ?  147  THR A C     1 
ATOM   74   O  O     . THR A 1  19  ? 1.551   -15.888 -3.653  1.00 10.73 ?  147  THR A O     1 
ATOM   75   C  CB    . THR A 1  19  ? 1.878   -17.233 -6.185  1.00 12.47 ?  147  THR A CB    1 
ATOM   76   O  OG1   . THR A 1  19  ? 1.198   -17.903 -7.252  1.00 13.61 ?  147  THR A OG1   1 
ATOM   77   C  CG2   . THR A 1  19  ? 3.380   -17.230 -6.482  1.00 11.84 ?  147  THR A CG2   1 
ATOM   78   N  N     . PRO A 1  20  ? 2.793   -17.534 -2.770  1.00 11.05 ?  148  PRO A N     1 
ATOM   79   C  CA    . PRO A 1  20  ? 3.084   -16.742 -1.583  1.00 10.96 ?  148  PRO A CA    1 
ATOM   80   C  C     . PRO A 1  20  ? 4.197   -15.739 -1.871  1.00 10.86 ?  148  PRO A C     1 
ATOM   81   O  O     . PRO A 1  20  ? 4.875   -15.824 -2.900  1.00 12.83 ?  148  PRO A O     1 
ATOM   82   C  CB    . PRO A 1  20  ? 3.516   -17.798 -0.564  1.00 11.19 ?  148  PRO A CB    1 
ATOM   83   C  CG    . PRO A 1  20  ? 4.240   -18.809 -1.436  1.00 11.23 ?  148  PRO A CG    1 
ATOM   84   C  CD    . PRO A 1  20  ? 3.457   -18.852 -2.739  1.00 10.88 ?  148  PRO A CD    1 
ATOM   85   N  N     . LEU A 1  21  ? 4.361   -14.778 -0.973  1.00 10.31 ?  149  LEU A N     1 
ATOM   86   C  CA    . LEU A 1  21  ? 5.380   -13.755 -1.173  1.00 10.51 ?  149  LEU A CA    1 
ATOM   87   C  C     . LEU A 1  21  ? 6.784   -14.349 -1.122  1.00 13.27 ?  149  LEU A C     1 
ATOM   88   O  O     . LEU A 1  21  ? 7.640   -13.993 -1.945  1.00 13.31 ?  149  LEU A O     1 
ATOM   89   C  CB    . LEU A 1  21  ? 5.262   -12.675 -0.124  1.00 11.15 ?  149  LEU A CB    1 
ATOM   90   C  CG    . LEU A 1  21  ? 6.294   -11.553 -0.249  1.00 15.45 ?  149  LEU A CG    1 
ATOM   91   C  CD1   . LEU A 1  21  ? 6.153   -10.832 -1.593  1.00 15.58 ?  149  LEU A CD1   1 
ATOM   92   C  CD2   . LEU A 1  21  ? 6.092   -10.592 0.899   1.00 19.61 ?  149  LEU A CD2   1 
ATOM   93   N  N     . THR A 1  22  ? 7.007   -15.229 -0.151  1.00 13.54 ?  150  THR A N     1 
ATOM   94   C  CA    . THR A 1  22  ? 8.320   -15.869 -0.044  1.00 13.53 ?  150  THR A CA    1 
ATOM   95   C  C     . THR A 1  22  ? 8.169   -17.355 -0.318  1.00 13.15 ?  150  THR A C     1 
ATOM   96   O  O     . THR A 1  22  ? 7.114   -17.947 -0.061  1.00 10.41 ?  150  THR A O     1 
ATOM   97   C  CB    . THR A 1  22  ? 8.958   -15.641 1.327   1.00 14.09 ?  150  THR A CB    1 
ATOM   98   O  OG1   . THR A 1  22  ? 8.128   -16.181 2.358   1.00 17.31 ?  150  THR A OG1   1 
ATOM   99   C  CG2   . THR A 1  22  ? 9.139   -14.140 1.571   1.00 16.27 ?  150  THR A CG2   1 
ATOM   100  N  N     . HIS A 1  23  ? 9.212   -17.973 -0.863  1.00 11.90 ?  151  HIS A N     1 
ATOM   101  C  CA    . HIS A 1  23  ? 9.001   -19.322 -1.391  1.00 11.09 ?  151  HIS A CA    1 
ATOM   102  C  C     . HIS A 1  23  ? 10.315  -20.096 -1.387  1.00 11.34 ?  151  HIS A C     1 
ATOM   103  O  O     . HIS A 1  23  ? 11.211  -19.788 -0.589  1.00 12.75 ?  151  HIS A O     1 
ATOM   104  C  CB    . HIS A 1  23  ? 8.380   -19.265 -2.803  1.00 11.32 ?  151  HIS A CB    1 
ATOM   105  C  CG    . HIS A 1  23  ? 9.166   -18.453 -3.792  1.00 11.06 ?  151  HIS A CG    1 
ATOM   106  N  ND1   . HIS A 1  23  ? 10.138  -19.005 -4.603  1.00 13.51 ?  151  HIS A ND1   1 
ATOM   107  C  CD2   . HIS A 1  23  ? 9.124   -17.132 -4.097  1.00 14.34 ?  151  HIS A CD2   1 
ATOM   108  C  CE1   . HIS A 1  23  ? 10.653  -18.058 -5.369  1.00 14.52 ?  151  HIS A CE1   1 
ATOM   109  N  NE2   . HIS A 1  23  ? 10.058  -16.910 -5.080  1.00 14.11 ?  151  HIS A NE2   1 
ATOM   110  N  N     . HIS A 1  24  ? 10.409  -21.124 -2.234  1.00 11.51 ?  152  HIS A N     1 
ATOM   111  C  CA    . HIS A 1  24  ? 11.489  -22.121 -2.105  1.00 12.30 ?  152  HIS A CA    1 
ATOM   112  C  C     . HIS A 1  24  ? 12.408  -22.180 -3.311  1.00 12.43 ?  152  HIS A C     1 
ATOM   113  O  O     . HIS A 1  24  ? 13.269  -23.072 -3.412  1.00 13.16 ?  152  HIS A O     1 
ATOM   114  C  CB    . HIS A 1  24  ? 10.861  -23.500 -1.842  1.00 13.87 ?  152  HIS A CB    1 
ATOM   115  C  CG    . HIS A 1  24  ? 9.805   -23.455 -0.785  1.00 14.64 ?  152  HIS A CG    1 
ATOM   116  N  ND1   . HIS A 1  24  ? 10.100  -23.229 0.547   1.00 13.87 ?  152  HIS A ND1   1 
ATOM   117  C  CD2   . HIS A 1  24  ? 8.450   -23.492 -0.875  1.00 12.38 ?  152  HIS A CD2   1 
ATOM   118  C  CE1   . HIS A 1  24  ? 8.973   -23.195 1.241   1.00 15.93 ?  152  HIS A CE1   1 
ATOM   119  N  NE2   . HIS A 1  24  ? 7.957   -23.330 0.399   1.00 15.04 ?  152  HIS A NE2   1 
ATOM   120  N  N     . ASN A 1  25  ? 12.245  -21.222 -4.208  1.00 12.85 ?  153  ASN A N     1 
ATOM   121  C  CA    . ASN A 1  25  ? 13.043  -21.205 -5.436  1.00 14.39 ?  153  ASN A CA    1 
ATOM   122  C  C     . ASN A 1  25  ? 13.438  -19.799 -5.822  1.00 13.39 ?  153  ASN A C     1 
ATOM   123  O  O     . ASN A 1  25  ? 13.432  -19.453 -6.998  1.00 14.04 ?  153  ASN A O     1 
ATOM   124  C  CB    . ASN A 1  25  ? 12.265  -21.874 -6.566  1.00 11.87 ?  153  ASN A CB    1 
ATOM   125  C  CG    . ASN A 1  25  ? 12.176  -23.371 -6.378  1.00 12.55 ?  153  ASN A CG    1 
ATOM   126  O  OD1   . ASN A 1  25  ? 13.143  -24.087 -6.641  1.00 13.61 ?  153  ASN A OD1   1 
ATOM   127  N  ND2   . ASN A 1  25  ? 11.024  -23.853 -5.901  1.00 13.93 ?  153  ASN A ND2   1 
ATOM   128  N  N     . THR A 1  26  ? 13.844  -19.024 -4.819  1.00 12.10 ?  154  THR A N     1 
ATOM   129  C  CA    . THR A 1  26  ? 14.071  -17.588 -4.981  1.00 13.23 ?  154  THR A CA    1 
ATOM   130  C  C     . THR A 1  26  ? 15.129  -17.303 -6.058  1.00 16.32 ?  154  THR A C     1 
ATOM   131  O  O     . THR A 1  26  ? 14.909  -16.486 -6.957  1.00 15.04 ?  154  THR A O     1 
ATOM   132  C  CB    . THR A 1  26  ? 14.476  -16.985 -3.617  1.00 13.93 ?  154  THR A CB    1 
ATOM   133  O  OG1   . THR A 1  26  ? 13.504  -17.385 -2.638  1.00 13.65 ?  154  THR A OG1   1 
ATOM   134  C  CG2   . THR A 1  26  ? 14.530  -15.462 -3.658  1.00 15.40 ?  154  THR A CG2   1 
ATOM   135  N  N     . GLY A 1  27  ? 16.270  -17.977 -5.959  1.00 17.00 ?  155  GLY A N     1 
ATOM   136  C  CA    . GLY A 1  27  ? 17.343  -17.817 -6.931  1.00 18.38 ?  155  GLY A CA    1 
ATOM   137  C  C     . GLY A 1  27  ? 16.926  -18.106 -8.363  1.00 20.47 ?  155  GLY A C     1 
ATOM   138  O  O     . GLY A 1  27  ? 17.280  -17.363 -9.282  1.00 18.71 ?  155  GLY A O     1 
ATOM   139  N  N     . LEU A 1  28  ? 16.200  -19.206 -8.569  1.00 16.47 ?  156  LEU A N     1 
ATOM   140  C  CA    . LEU A 1  28  ? 15.792  -19.576 -9.917  1.00 15.50 ?  156  LEU A CA    1 
ATOM   141  C  C     . LEU A 1  28  ? 14.807  -18.579 -10.487 1.00 18.25 ?  156  LEU A C     1 
ATOM   142  O  O     . LEU A 1  28  ? 14.911  -18.200 -11.648 1.00 17.06 ?  156  LEU A O     1 
ATOM   143  C  CB    . LEU A 1  28  ? 15.178  -20.977 -9.933  1.00 13.63 ?  156  LEU A CB    1 
ATOM   144  C  CG    . LEU A 1  28  ? 16.102  -22.102 -9.484  1.00 14.36 ?  156  LEU A CG    1 
ATOM   145  C  CD1   . LEU A 1  28  ? 15.321  -23.430 -9.433  1.00 16.30 ?  156  LEU A CD1   1 
ATOM   146  C  CD2   . LEU A 1  28  ? 17.334  -22.247 -10.419 1.00 17.76 ?  156  LEU A CD2   1 
ATOM   147  N  N     . SER A 1  29  ? 13.846  -18.148 -9.671  1.00 15.65 ?  157  SER A N     1 
ATOM   148  C  CA    A SER A 1  29  ? 12.833  -17.208 -10.140 0.72 14.61 ?  157  SER A CA    1 
ATOM   149  C  CA    B SER A 1  29  ? 12.839  -17.206 -10.139 0.28 14.74 ?  157  SER A CA    1 
ATOM   150  C  C     . SER A 1  29  ? 13.469  -15.857 -10.470 1.00 13.79 ?  157  SER A C     1 
ATOM   151  O  O     . SER A 1  29  ? 13.106  -15.217 -11.464 1.00 14.11 ?  157  SER A O     1 
ATOM   152  C  CB    A SER A 1  29  ? 11.709  -17.027 -9.104  0.72 14.94 ?  157  SER A CB    1 
ATOM   153  C  CB    B SER A 1  29  ? 11.735  -17.031 -9.097  0.28 14.77 ?  157  SER A CB    1 
ATOM   154  O  OG    A SER A 1  29  ? 12.185  -16.553 -7.851  0.72 14.64 ?  157  SER A OG    1 
ATOM   155  O  OG    B SER A 1  29  ? 11.071  -18.260 -8.864  0.28 15.26 ?  157  SER A OG    1 
ATOM   156  N  N     A GLU A 1  30  ? 14.424  -15.439 -9.643  0.47 13.91 ?  158  GLU A N     1 
ATOM   157  N  N     B GLU A 1  30  ? 14.430  -15.437 -9.657  0.53 13.93 ?  158  GLU A N     1 
ATOM   158  C  CA    A GLU A 1  30  ? 15.125  -14.173 -9.866  0.47 14.24 ?  158  GLU A CA    1 
ATOM   159  C  CA    B GLU A 1  30  ? 15.089  -14.152 -9.886  0.53 14.05 ?  158  GLU A CA    1 
ATOM   160  C  C     A GLU A 1  30  ? 15.774  -14.164 -11.241 0.47 14.23 ?  158  GLU A C     1 
ATOM   161  C  C     B GLU A 1  30  ? 15.846  -14.130 -11.211 0.53 14.18 ?  158  GLU A C     1 
ATOM   162  O  O     A GLU A 1  30  ? 15.631  -13.207 -12.004 0.47 14.13 ?  158  GLU A O     1 
ATOM   163  O  O     B GLU A 1  30  ? 15.850  -13.118 -11.916 0.53 14.32 ?  158  GLU A O     1 
ATOM   164  C  CB    A GLU A 1  30  ? 16.184  -13.931 -8.784  0.47 15.77 ?  158  GLU A CB    1 
ATOM   165  C  CB    B GLU A 1  30  ? 16.030  -13.822 -8.728  0.53 16.12 ?  158  GLU A CB    1 
ATOM   166  C  CG    A GLU A 1  30  ? 16.734  -12.503 -8.745  0.47 17.74 ?  158  GLU A CG    1 
ATOM   167  C  CG    B GLU A 1  30  ? 15.286  -13.402 -7.470  0.53 18.85 ?  158  GLU A CG    1 
ATOM   168  C  CD    A GLU A 1  30  ? 17.992  -12.322 -9.568  0.47 23.19 ?  158  GLU A CD    1 
ATOM   169  C  CD    B GLU A 1  30  ? 16.206  -13.124 -6.290  0.53 24.31 ?  158  GLU A CD    1 
ATOM   170  O  OE1   A GLU A 1  30  ? 18.560  -13.343 -10.018 0.47 24.86 ?  158  GLU A OE1   1 
ATOM   171  O  OE1   B GLU A 1  30  ? 17.398  -13.495 -6.346  0.53 24.71 ?  158  GLU A OE1   1 
ATOM   172  O  OE2   A GLU A 1  30  ? 18.425  -11.158 -9.756  0.47 23.86 ?  158  GLU A OE2   1 
ATOM   173  O  OE2   B GLU A 1  30  ? 15.722  -12.533 -5.299  0.53 26.47 ?  158  GLU A OE2   1 
ATOM   174  N  N     . ALA A 1  31  ? 16.467  -15.248 -11.565 1.00 13.73 ?  159  ALA A N     1 
ATOM   175  C  CA    . ALA A 1  31  ? 17.189  -15.333 -12.834 1.00 14.62 ?  159  ALA A CA    1 
ATOM   176  C  C     . ALA A 1  31  ? 16.214  -15.250 -14.009 1.00 15.86 ?  159  ALA A C     1 
ATOM   177  O  O     . ALA A 1  31  ? 16.448  -14.528 -14.972 1.00 16.68 ?  159  ALA A O     1 
ATOM   178  C  CB    . ALA A 1  31  ? 18.023  -16.636 -12.892 1.00 15.19 ?  159  ALA A CB    1 
ATOM   179  N  N     . LEU A 1  32  ? 15.104  -15.978 -13.928 1.00 16.57 ?  160  LEU A N     1 
ATOM   180  C  CA    . LEU A 1  32  ? 14.129  -15.928 -15.005 1.00 16.05 ?  160  LEU A CA    1 
ATOM   181  C  C     . LEU A 1  32  ? 13.518  -14.539 -15.114 1.00 15.00 ?  160  LEU A C     1 
ATOM   182  O  O     . LEU A 1  32  ? 13.193  -14.077 -16.206 1.00 17.31 ?  160  LEU A O     1 
ATOM   183  C  CB    . LEU A 1  32  ? 13.043  -16.979 -14.795 1.00 14.06 ?  160  LEU A CB    1 
ATOM   184  C  CG    . LEU A 1  32  ? 13.578  -18.408 -14.949 1.00 16.21 ?  160  LEU A CG    1 
ATOM   185  C  CD1   . LEU A 1  32  ? 12.532  -19.403 -14.485 1.00 15.10 ?  160  LEU A CD1   1 
ATOM   186  C  CD2   . LEU A 1  32  ? 13.980  -18.701 -16.404 1.00 19.76 ?  160  LEU A CD2   1 
ATOM   187  N  N     . GLU A 1  33  ? 13.393  -13.847 -13.989 1.00 14.07 ?  161  GLU A N     1 
ATOM   188  C  CA    . GLU A 1  33  ? 12.803  -12.513 -14.034 1.00 13.96 ?  161  GLU A CA    1 
ATOM   189  C  C     . GLU A 1  33  ? 13.768  -11.479 -14.646 1.00 14.45 ?  161  GLU A C     1 
ATOM   190  O  O     . GLU A 1  33  ? 13.323  -10.497 -15.239 1.00 13.27 ?  161  GLU A O     1 
ATOM   191  C  CB    . GLU A 1  33  ? 12.327  -12.117 -12.631 1.00 14.15 ?  161  GLU A CB    1 
ATOM   192  C  CG    . GLU A 1  33  ? 11.002  -12.844 -12.380 1.00 14.63 ?  161  GLU A CG    1 
ATOM   193  C  CD    . GLU A 1  33  ? 10.344  -12.567 -11.064 1.00 23.57 ?  161  GLU A CD    1 
ATOM   194  O  OE1   . GLU A 1  33  ? 11.005  -12.034 -10.153 1.00 24.74 ?  161  GLU A OE1   1 
ATOM   195  O  OE2   . GLU A 1  33  ? 9.135   -12.909 -10.962 1.00 27.27 ?  161  GLU A OE2   1 
ATOM   196  N  N     . ILE A 1  34  ? 15.074  -11.719 -14.544 1.00 15.70 ?  162  ILE A N     1 
ATOM   197  C  CA    . ILE A 1  34  ? 16.033  -10.883 -15.274 1.00 16.56 ?  162  ILE A CA    1 
ATOM   198  C  C     . ILE A 1  34  ? 15.798  -11.039 -16.768 1.00 16.97 ?  162  ILE A C     1 
ATOM   199  O  O     . ILE A 1  34  ? 15.744  -10.047 -17.510 1.00 15.27 ?  162  ILE A O     1 
ATOM   200  C  CB    . ILE A 1  34  ? 17.499  -11.243 -14.952 1.00 17.04 ?  162  ILE A CB    1 
ATOM   201  C  CG1   . ILE A 1  34  ? 17.810  -10.971 -13.481 1.00 19.93 ?  162  ILE A CG1   1 
ATOM   202  C  CG2   . ILE A 1  34  ? 18.478  -10.453 -15.850 1.00 18.82 ?  162  ILE A CG2   1 
ATOM   203  C  CD1   . ILE A 1  34  ? 17.964  -9.523  -13.151 1.00 24.24 ?  162  ILE A CD1   1 
ATOM   204  N  N     . LEU A 1  35  ? 15.653  -12.281 -17.221 1.00 16.89 ?  163  LEU A N     1 
ATOM   205  C  CA    . LEU A 1  35  ? 15.431  -12.499 -18.646 1.00 16.04 ?  163  LEU A CA    1 
ATOM   206  C  C     . LEU A 1  35  ? 14.095  -11.900 -19.104 1.00 15.52 ?  163  LEU A C     1 
ATOM   207  O  O     . LEU A 1  35  ? 13.986  -11.382 -20.221 1.00 14.38 ?  163  LEU A O     1 
ATOM   208  C  CB    . LEU A 1  35  ? 15.507  -13.993 -18.982 1.00 16.23 ?  163  LEU A CB    1 
ATOM   209  C  CG    . LEU A 1  35  ? 16.873  -14.658 -18.740 1.00 16.76 ?  163  LEU A CG    1 
ATOM   210  C  CD1   . LEU A 1  35  ? 16.805  -16.120 -19.119 1.00 17.44 ?  163  LEU A CD1   1 
ATOM   211  C  CD2   . LEU A 1  35  ? 18.026  -13.932 -19.479 1.00 16.48 ?  163  LEU A CD2   1 
ATOM   212  N  N     . ALA A 1  36  ? 13.077  -11.968 -18.250 1.00 14.88 ?  164  ALA A N     1 
ATOM   213  C  CA    . ALA A 1  36  ? 11.787  -11.342 -18.570 1.00 13.45 ?  164  ALA A CA    1 
ATOM   214  C  C     . ALA A 1  36  ? 11.944  -9.839  -18.758 1.00 15.73 ?  164  ALA A C     1 
ATOM   215  O  O     . ALA A 1  36  ? 11.489  -9.267  -19.744 1.00 13.66 ?  164  ALA A O     1 
ATOM   216  C  CB    . ALA A 1  36  ? 10.772  -11.625 -17.461 1.00 13.13 ?  164  ALA A CB    1 
ATOM   217  N  N     . GLU A 1  37  ? 12.629  -9.223  -17.800 1.00 14.51 ?  165  GLU A N     1 
ATOM   218  C  CA    . GLU A 1  37  ? 12.859  -7.787  -17.796 1.00 17.77 ?  165  GLU A CA    1 
ATOM   219  C  C     . GLU A 1  37  ? 13.636  -7.362  -19.036 1.00 17.87 ?  165  GLU A C     1 
ATOM   220  O  O     . GLU A 1  37  ? 13.294  -6.364  -19.676 1.00 18.35 ?  165  GLU A O     1 
ATOM   221  C  CB    . GLU A 1  37  ? 13.600  -7.398  -16.516 1.00 20.77 ?  165  GLU A CB    1 
ATOM   222  C  CG    . GLU A 1  37  ? 13.827  -5.921  -16.335 1.00 25.85 ?  165  GLU A CG    1 
ATOM   223  C  CD    . GLU A 1  37  ? 14.647  -5.637  -15.073 1.00 27.77 ?  165  GLU A CD    1 
ATOM   224  O  OE1   . GLU A 1  37  ? 15.321  -6.563  -14.565 1.00 25.20 ?  165  GLU A OE1   1 
ATOM   225  O  OE2   . GLU A 1  37  ? 14.610  -4.487  -14.604 1.00 31.56 ?  165  GLU A OE2   1 
ATOM   226  N  N     . ALA A 1  38  ? 14.660  -8.138  -19.398 1.00 16.71 ?  166  ALA A N     1 
ATOM   227  C  CA    . ALA A 1  38  ? 15.468  -7.844  -20.582 1.00 18.54 ?  166  ALA A CA    1 
ATOM   228  C  C     . ALA A 1  38  ? 14.667  -8.002  -21.869 1.00 18.25 ?  166  ALA A C     1 
ATOM   229  O  O     . ALA A 1  38  ? 14.831  -7.219  -22.811 1.00 19.54 ?  166  ALA A O     1 
ATOM   230  C  CB    . ALA A 1  38  ? 16.729  -8.753  -20.623 1.00 18.54 ?  166  ALA A CB    1 
ATOM   231  N  N     . ALA A 1  39  ? 13.802  -9.014  -21.910 1.00 16.71 ?  167  ALA A N     1 
ATOM   232  C  CA    . ALA A 1  39  ? 12.903  -9.211  -23.050 1.00 18.63 ?  167  ALA A CA    1 
ATOM   233  C  C     . ALA A 1  39  ? 12.020  -7.973  -23.241 1.00 18.95 ?  167  ALA A C     1 
ATOM   234  O  O     . ALA A 1  39  ? 11.836  -7.483  -24.359 1.00 18.40 ?  167  ALA A O     1 
ATOM   235  C  CB    . ALA A 1  39  ? 12.039  -10.446 -22.846 1.00 18.08 ?  167  ALA A CB    1 
ATOM   236  N  N     . GLY A 1  40  ? 11.493  -7.463  -22.133 1.00 15.06 ?  168  GLY A N     1 
ATOM   237  C  CA    . GLY A 1  40  ? 10.687  -6.254  -22.161 1.00 17.95 ?  168  GLY A CA    1 
ATOM   238  C  C     . GLY A 1  40  ? 11.454  -5.073  -22.738 1.00 20.02 ?  168  GLY A C     1 
ATOM   239  O  O     . GLY A 1  40  ? 10.919  -4.333  -23.569 1.00 20.70 ?  168  GLY A O     1 
ATOM   240  N  N     . PHE A 1  41  ? 12.718  -4.911  -22.331 1.00 17.87 ?  169  PHE A N     1 
ATOM   241  C  CA    . PHE A 1  41  ? 13.540  -3.808  -22.839 1.00 19.65 ?  169  PHE A CA    1 
ATOM   242  C  C     . PHE A 1  41  ? 13.723  -3.883  -24.355 1.00 21.89 ?  169  PHE A C     1 
ATOM   243  O  O     . PHE A 1  41  ? 13.917  -2.865  -25.028 1.00 21.86 ?  169  PHE A O     1 
ATOM   244  C  CB    . PHE A 1  41  ? 14.925  -3.794  -22.176 1.00 18.86 ?  169  PHE A CB    1 
ATOM   245  C  CG    . PHE A 1  41  ? 14.900  -3.507  -20.706 1.00 19.32 ?  169  PHE A CG    1 
ATOM   246  C  CD1   . PHE A 1  41  ? 13.822  -2.862  -20.119 1.00 19.27 ?  169  PHE A CD1   1 
ATOM   247  C  CD2   . PHE A 1  41  ? 15.976  -3.875  -19.909 1.00 20.72 ?  169  PHE A CD2   1 
ATOM   248  C  CE1   . PHE A 1  41  ? 13.810  -2.598  -18.749 1.00 21.08 ?  169  PHE A CE1   1 
ATOM   249  C  CE2   . PHE A 1  41  ? 15.972  -3.611  -18.555 1.00 20.77 ?  169  PHE A CE2   1 
ATOM   250  C  CZ    . PHE A 1  41  ? 14.884  -2.976  -17.972 1.00 20.72 ?  169  PHE A CZ    1 
ATOM   251  N  N     . GLU A 1  42  ? 13.689  -5.095  -24.895 1.00 23.57 ?  170  GLU A N     1 
ATOM   252  C  CA    . GLU A 1  42  ? 13.859  -5.270  -26.328 1.00 25.59 ?  170  GLU A CA    1 
ATOM   253  C  C     . GLU A 1  42  ? 12.531  -5.291  -27.097 1.00 26.27 ?  170  GLU A C     1 
ATOM   254  O  O     . GLU A 1  42  ? 12.515  -5.502  -28.313 1.00 28.87 ?  170  GLU A O     1 
ATOM   255  C  CB    . GLU A 1  42  ? 14.645  -6.544  -26.596 1.00 28.21 ?  170  GLU A CB    1 
ATOM   256  C  CG    . GLU A 1  42  ? 16.015  -6.529  -25.911 1.00 31.05 ?  170  GLU A CG    1 
ATOM   257  C  CD    . GLU A 1  42  ? 16.764  -5.194  -26.074 1.00 33.63 ?  170  GLU A CD    1 
ATOM   258  O  OE1   . GLU A 1  42  ? 17.053  -4.797  -27.230 1.00 39.21 ?  170  GLU A OE1   1 
ATOM   259  O  OE2   . GLU A 1  42  ? 17.081  -4.550  -25.047 1.00 28.16 ?  170  GLU A OE2   1 
ATOM   260  N  N     . GLY A 1  43  ? 11.430  -5.047  -26.394 1.00 24.61 ?  171  GLY A N     1 
ATOM   261  C  CA    . GLY A 1  43  ? 10.119  -5.015  -27.021 1.00 25.35 ?  171  GLY A CA    1 
ATOM   262  C  C     . GLY A 1  43  ? 9.534   -6.387  -27.320 1.00 25.53 ?  171  GLY A C     1 
ATOM   263  O  O     . GLY A 1  43  ? 8.642   -6.526  -28.159 1.00 25.56 ?  171  GLY A O     1 
ATOM   264  N  N     . SER A 1  44  ? 10.043  -7.398  -26.629 1.00 21.75 ?  172  SER A N     1 
ATOM   265  C  CA    . SER A 1  44  ? 9.614   -8.775  -26.820 1.00 22.57 ?  172  SER A CA    1 
ATOM   266  C  C     . SER A 1  44  ? 8.617   -9.111  -25.738 1.00 20.53 ?  172  SER A C     1 
ATOM   267  O  O     . SER A 1  44  ? 8.969   -9.751  -24.740 1.00 19.04 ?  172  SER A O     1 
ATOM   268  C  CB    . SER A 1  44  ? 10.814  -9.725  -26.759 1.00 25.22 ?  172  SER A CB    1 
ATOM   269  O  OG    . SER A 1  44  ? 11.804  -9.354  -27.707 1.00 27.69 ?  172  SER A OG    1 
ATOM   270  N  N     . GLU A 1  45  ? 7.381   -8.649  -25.903 1.00 19.52 ?  173  GLU A N     1 
ATOM   271  C  CA    . GLU A 1  45  ? 6.404   -8.803  -24.833 1.00 20.12 ?  173  GLU A CA    1 
ATOM   272  C  C     . GLU A 1  45  ? 5.938   -10.256 -24.657 1.00 17.33 ?  173  GLU A C     1 
ATOM   273  O  O     . GLU A 1  45  ? 5.566   -10.657 -23.557 1.00 17.70 ?  173  GLU A O     1 
ATOM   274  C  CB    . GLU A 1  45  ? 5.217   -7.876  -25.078 1.00 25.45 ?  173  GLU A CB    1 
ATOM   275  C  CG    . GLU A 1  45  ? 5.574   -6.396  -24.860 1.00 28.48 ?  173  GLU A CG    1 
ATOM   276  C  CD    . GLU A 1  45  ? 5.850   -6.048  -23.392 1.00 31.21 ?  173  GLU A CD    1 
ATOM   277  O  OE1   . GLU A 1  45  ? 5.172   -6.585  -22.491 1.00 28.67 ?  173  GLU A OE1   1 
ATOM   278  O  OE2   . GLU A 1  45  ? 6.753   -5.225  -23.130 1.00 34.85 ?  173  GLU A OE2   1 
ATOM   279  N  N     . GLY A 1  46  ? 6.003   -11.049 -25.723 1.00 19.27 ?  174  GLY A N     1 
ATOM   280  C  CA    . GLY A 1  46  ? 5.647   -12.453 -25.614 1.00 17.82 ?  174  GLY A CA    1 
ATOM   281  C  C     . GLY A 1  46  ? 6.667   -13.188 -24.769 1.00 17.88 ?  174  GLY A C     1 
ATOM   282  O  O     . GLY A 1  46  ? 6.325   -13.956 -23.876 1.00 18.29 ?  174  GLY A O     1 
ATOM   283  N  N     . ARG A 1  47  ? 7.938   -12.968 -25.072 1.00 17.23 ?  175  ARG A N     1 
ATOM   284  C  CA    . ARG A 1  47  ? 9.007   -13.606 -24.315 1.00 16.49 ?  175  ARG A CA    1 
ATOM   285  C  C     . ARG A 1  47  ? 8.991   -13.175 -22.846 1.00 16.00 ?  175  ARG A C     1 
ATOM   286  O  O     . ARG A 1  47  ? 9.228   -13.988 -21.953 1.00 15.34 ?  175  ARG A O     1 
ATOM   287  C  CB    . ARG A 1  47  ? 10.362  -13.279 -24.951 1.00 16.91 ?  175  ARG A CB    1 
ATOM   288  C  CG    . ARG A 1  47  ? 10.562  -13.996 -26.266 1.00 18.53 ?  175  ARG A CG    1 
ATOM   289  C  CD    . ARG A 1  47  ? 11.819  -13.562 -27.006 1.00 22.77 ?  175  ARG A CD    1 
ATOM   290  N  NE    . ARG A 1  47  ? 12.077  -14.482 -28.120 1.00 32.82 ?  175  ARG A NE    1 
ATOM   291  C  CZ    . ARG A 1  47  ? 11.360  -14.558 -29.246 1.00 36.05 ?  175  ARG A CZ    1 
ATOM   292  N  NH1   . ARG A 1  47  ? 10.315  -13.756 -29.457 1.00 37.05 ?  175  ARG A NH1   1 
ATOM   293  N  NH2   . ARG A 1  47  ? 11.688  -15.456 -30.171 1.00 35.81 ?  175  ARG A NH2   1 
ATOM   294  N  N     . LEU A 1  48  ? 8.734   -11.891 -22.605 1.00 13.83 ?  176  LEU A N     1 
ATOM   295  C  CA    . LEU A 1  48  ? 8.622   -11.386 -21.240 1.00 14.77 ?  176  LEU A CA    1 
ATOM   296  C  C     . LEU A 1  48  ? 7.552   -12.147 -20.484 1.00 13.38 ?  176  LEU A C     1 
ATOM   297  O  O     . LEU A 1  48  ? 7.742   -12.520 -19.332 1.00 13.71 ?  176  LEU A O     1 
ATOM   298  C  CB    . LEU A 1  48  ? 8.279   -9.890  -21.224 1.00 15.93 ?  176  LEU A CB    1 
ATOM   299  C  CG    . LEU A 1  48  ? 7.971   -9.239  -19.860 1.00 17.78 ?  176  LEU A CG    1 
ATOM   300  C  CD1   . LEU A 1  48  ? 8.342   -7.756  -19.908 1.00 18.77 ?  176  LEU A CD1   1 
ATOM   301  C  CD2   . LEU A 1  48  ? 6.494   -9.361  -19.460 1.00 15.89 ?  176  LEU A CD2   1 
ATOM   302  N  N     . LEU A 1  49  ? 6.403   -12.334 -21.131 1.00 12.37 ?  177  LEU A N     1 
ATOM   303  C  CA    . LEU A 1  49  ? 5.284   -13.000 -20.473 1.00 13.80 ?  177  LEU A CA    1 
ATOM   304  C  C     . LEU A 1  49  ? 5.645   -14.446 -20.121 1.00 16.54 ?  177  LEU A C     1 
ATOM   305  O  O     . LEU A 1  49  ? 5.374   -14.920 -19.011 1.00 14.87 ?  177  LEU A O     1 
ATOM   306  C  CB    . LEU A 1  49  ? 4.054   -12.939 -21.376 1.00 15.81 ?  177  LEU A CB    1 
ATOM   307  C  CG    . LEU A 1  49  ? 2.742   -13.511 -20.890 1.00 16.06 ?  177  LEU A CG    1 
ATOM   308  C  CD1   . LEU A 1  49  ? 2.342   -12.931 -19.537 1.00 14.58 ?  177  LEU A CD1   1 
ATOM   309  C  CD2   . LEU A 1  49  ? 1.694   -13.184 -21.977 1.00 16.99 ?  177  LEU A CD2   1 
ATOM   310  N  N     . THR A 1  50  ? 6.282   -15.146 -21.051 1.00 14.49 ?  178  THR A N     1 
ATOM   311  C  CA    . THR A 1  50  ? 6.643   -16.530 -20.781 1.00 14.86 ?  178  THR A CA    1 
ATOM   312  C  C     . THR A 1  50  ? 7.641   -16.628 -19.632 1.00 16.70 ?  178  THR A C     1 
ATOM   313  O  O     . THR A 1  50  ? 7.468   -17.480 -18.740 1.00 16.66 ?  178  THR A O     1 
ATOM   314  C  CB    . THR A 1  50  ? 7.193   -17.224 -22.039 1.00 14.64 ?  178  THR A CB    1 
ATOM   315  O  OG1   . THR A 1  50  ? 6.092   -17.560 -22.895 1.00 17.11 ?  178  THR A OG1   1 
ATOM   316  C  CG2   . THR A 1  50  ? 7.936   -18.502 -21.678 1.00 16.40 ?  178  THR A CG2   1 
ATOM   317  N  N     . PHE A 1  51  ? 8.661   -15.762 -19.618 1.00 14.28 ?  179  PHE A N     1 
ATOM   318  C  CA    . PHE A 1  51  ? 9.643   -15.830 -18.535 1.00 14.67 ?  179  PHE A CA    1 
ATOM   319  C  C     . PHE A 1  51  ? 9.017   -15.460 -17.196 1.00 14.75 ?  179  PHE A C     1 
ATOM   320  O  O     . PHE A 1  51  ? 9.346   -16.067 -16.176 1.00 12.35 ?  179  PHE A O     1 
ATOM   321  C  CB    . PHE A 1  51  ? 10.851  -14.936 -18.832 1.00 15.75 ?  179  PHE A CB    1 
ATOM   322  C  CG    . PHE A 1  51  ? 11.796  -15.513 -19.869 1.00 16.76 ?  179  PHE A CG    1 
ATOM   323  C  CD1   . PHE A 1  51  ? 12.273  -16.827 -19.749 1.00 16.75 ?  179  PHE A CD1   1 
ATOM   324  C  CD2   . PHE A 1  51  ? 12.224  -14.749 -20.944 1.00 19.62 ?  179  PHE A CD2   1 
ATOM   325  C  CE1   . PHE A 1  51  ? 13.152  -17.385 -20.691 1.00 19.37 ?  179  PHE A CE1   1 
ATOM   326  C  CE2   . PHE A 1  51  ? 13.113  -15.297 -21.892 1.00 19.80 ?  179  PHE A CE2   1 
ATOM   327  C  CZ    . PHE A 1  51  ? 13.566  -16.616 -21.766 1.00 19.74 ?  179  PHE A CZ    1 
ATOM   328  N  N     . CYS A 1  52  ? 8.092   -14.501 -17.200 1.00 12.80 ?  180  CYS A N     1 
ATOM   329  C  CA    . CYS A 1  52  ? 7.340   -14.159 -15.983 1.00 11.53 ?  180  CYS A CA    1 
ATOM   330  C  C     . CYS A 1  52  ? 6.514   -15.341 -15.472 1.00 13.35 ?  180  CYS A C     1 
ATOM   331  O  O     . CYS A 1  52  ? 6.485   -15.610 -14.273 1.00 11.93 ?  180  CYS A O     1 
ATOM   332  C  CB    . CYS A 1  52  ? 6.396   -12.972 -16.251 1.00 12.16 ?  180  CYS A CB    1 
ATOM   333  S  SG    . CYS A 1  52  ? 7.236   -11.381 -16.275 1.00 18.65 ?  180  CYS A SG    1 
ATOM   334  N  N     . ARG A 1  53  ? 5.816   -16.017 -16.383 1.00 12.94 ?  181  ARG A N     1 
ATOM   335  C  CA    . ARG A 1  53  ? 5.006   -17.187 -16.028 1.00 13.18 ?  181  ARG A CA    1 
ATOM   336  C  C     . ARG A 1  53  ? 5.848   -18.320 -15.473 1.00 14.88 ?  181  ARG A C     1 
ATOM   337  O  O     . ARG A 1  53  ? 5.477   -18.930 -14.469 1.00 15.06 ?  181  ARG A O     1 
ATOM   338  C  CB    . ARG A 1  53  ? 4.227   -17.699 -17.241 1.00 11.59 ?  181  ARG A CB    1 
ATOM   339  C  CG    . ARG A 1  53  ? 3.092   -16.780 -17.686 1.00 11.05 ?  181  ARG A CG    1 
ATOM   340  C  CD    . ARG A 1  53  ? 2.520   -17.297 -18.992 1.00 12.47 ?  181  ARG A CD    1 
ATOM   341  N  NE    . ARG A 1  53  ? 1.357   -16.528 -19.476 1.00 12.32 ?  181  ARG A NE    1 
ATOM   342  C  CZ    . ARG A 1  53  ? 0.945   -16.547 -20.735 1.00 13.03 ?  181  ARG A CZ    1 
ATOM   343  N  NH1   . ARG A 1  53  ? 1.613   -17.259 -21.651 1.00 15.08 ?  181  ARG A NH1   1 
ATOM   344  N  NH2   . ARG A 1  53  ? -0.118  -15.832 -21.104 1.00 14.17 ?  181  ARG A NH2   1 
ATOM   345  N  N     . ALA A 1  54  ? 6.964   -18.620 -16.140 1.00 13.56 ?  182  ALA A N     1 
ATOM   346  C  CA    . ALA A 1  54  ? 7.851   -19.684 -15.665 1.00 13.01 ?  182  ALA A CA    1 
ATOM   347  C  C     . ALA A 1  54  ? 8.397   -19.344 -14.271 1.00 14.18 ?  182  ALA A C     1 
ATOM   348  O  O     . ALA A 1  54  ? 8.448   -20.209 -13.391 1.00 13.49 ?  182  ALA A O     1 
ATOM   349  C  CB    . ALA A 1  54  ? 8.997   -19.895 -16.643 1.00 15.27 ?  182  ALA A CB    1 
ATOM   350  N  N     . ALA A 1  55  ? 8.806   -18.093 -14.069 1.00 11.82 ?  183  ALA A N     1 
ATOM   351  C  CA    . ALA A 1  55  ? 9.264   -17.700 -12.746 1.00 13.42 ?  183  ALA A CA    1 
ATOM   352  C  C     . ALA A 1  55  ? 8.139   -17.897 -11.719 1.00 12.03 ?  183  ALA A C     1 
ATOM   353  O  O     . ALA A 1  55  ? 8.373   -18.372 -10.605 1.00 12.62 ?  183  ALA A O     1 
ATOM   354  C  CB    . ALA A 1  55  ? 9.738   -16.248 -12.749 1.00 15.43 ?  183  ALA A CB    1 
ATOM   355  N  N     . SER A 1  56  ? 6.922   -17.523 -12.084 1.00 11.51 ?  184  SER A N     1 
ATOM   356  C  CA    A SER A 1  56  ? 5.802   -17.637 -11.159 0.48 10.80 ?  184  SER A CA    1 
ATOM   357  C  CA    B SER A 1  56  ? 5.803   -17.632 -11.147 0.52 10.77 ?  184  SER A CA    1 
ATOM   358  C  C     . SER A 1  56  ? 5.499   -19.091 -10.802 1.00 11.12 ?  184  SER A C     1 
ATOM   359  O  O     . SER A 1  56  ? 5.108   -19.402 -9.671  1.00 12.29 ?  184  SER A O     1 
ATOM   360  C  CB    A SER A 1  56  ? 4.569   -16.969 -11.754 0.48 11.89 ?  184  SER A CB    1 
ATOM   361  C  CB    B SER A 1  56  ? 4.553   -16.935 -11.706 0.52 11.88 ?  184  SER A CB    1 
ATOM   362  O  OG    A SER A 1  56  ? 3.598   -16.757 -10.753 0.48 13.50 ?  184  SER A OG    1 
ATOM   363  O  OG    B SER A 1  56  ? 3.833   -17.737 -12.630 0.52 13.49 ?  184  SER A OG    1 
ATOM   364  N  N     . VAL A 1  57  ? 5.670   -19.986 -11.767 1.00 12.06 ?  185  VAL A N     1 
ATOM   365  C  CA    . VAL A 1  57  ? 5.473   -21.418 -11.526 1.00 11.87 ?  185  VAL A CA    1 
ATOM   366  C  C     . VAL A 1  57  ? 6.422   -21.910 -10.417 1.00 15.20 ?  185  VAL A C     1 
ATOM   367  O  O     . VAL A 1  57  ? 6.021   -22.646 -9.504  1.00 15.06 ?  185  VAL A O     1 
ATOM   368  C  CB    . VAL A 1  57  ? 5.700   -22.236 -12.817 1.00 13.96 ?  185  VAL A CB    1 
ATOM   369  C  CG1   . VAL A 1  57  ? 5.963   -23.718 -12.503 1.00 17.31 ?  185  VAL A CG1   1 
ATOM   370  C  CG2   . VAL A 1  57  ? 4.496   -22.109 -13.754 1.00 13.79 ?  185  VAL A CG2   1 
ATOM   371  N  N     . LEU A 1  58  ? 7.665   -21.449 -10.460 1.00 12.34 ?  186  LEU A N     1 
ATOM   372  C  CA    . LEU A 1  58  ? 8.617   -21.817 -9.424  1.00 12.10 ?  186  LEU A CA    1 
ATOM   373  C  C     . LEU A 1  58  ? 8.234   -21.247 -8.052  1.00 11.85 ?  186  LEU A C     1 
ATOM   374  O  O     . LEU A 1  58  ? 8.425   -21.924 -7.028  1.00 14.76 ?  186  LEU A O     1 
ATOM   375  C  CB    . LEU A 1  58  ? 10.029  -21.348 -9.807  1.00 15.29 ?  186  LEU A CB    1 
ATOM   376  C  CG    . LEU A 1  58  ? 10.580  -21.994 -11.081 1.00 16.24 ?  186  LEU A CG    1 
ATOM   377  C  CD1   . LEU A 1  58  ? 12.007  -21.583 -11.305 1.00 17.68 ?  186  LEU A CD1   1 
ATOM   378  C  CD2   . LEU A 1  58  ? 10.473  -23.511 -11.019 1.00 15.90 ?  186  LEU A CD2   1 
ATOM   379  N  N     . LYS A 1  59  ? 7.711   -20.018 -8.032  1.00 12.52 ?  187  LYS A N     1 
ATOM   380  C  CA    . LYS A 1  59  ? 7.258   -19.409 -6.779  1.00 10.80 ?  187  LYS A CA    1 
ATOM   381  C  C     . LYS A 1  59  ? 6.141   -20.228 -6.151  1.00 11.99 ?  187  LYS A C     1 
ATOM   382  O  O     . LYS A 1  59  ? 5.982   -20.227 -4.922  1.00 13.79 ?  187  LYS A O     1 
ATOM   383  C  CB    . LYS A 1  59  ? 6.750   -17.973 -6.995  1.00 9.31  ?  187  LYS A CB    1 
ATOM   384  C  CG    . LYS A 1  59  ? 7.782   -17.041 -7.605  1.00 11.34 ?  187  LYS A CG    1 
ATOM   385  C  CD    . LYS A 1  59  ? 7.123   -15.670 -7.880  1.00 14.13 ?  187  LYS A CD    1 
ATOM   386  C  CE    . LYS A 1  59  ? 8.038   -14.839 -8.773  1.00 17.94 ?  187  LYS A CE    1 
ATOM   387  N  NZ    . LYS A 1  59  ? 7.405   -13.495 -9.050  1.00 17.86 ?  187  LYS A NZ    1 
ATOM   388  N  N     . ALA A 1  60  ? 5.349   -20.894 -6.993  1.00 11.97 ?  188  ALA A N     1 
ATOM   389  C  CA    . ALA A 1  60  ? 4.209   -21.645 -6.502  1.00 14.13 ?  188  ALA A CA    1 
ATOM   390  C  C     . ALA A 1  60  ? 4.569   -23.058 -6.072  1.00 14.95 ?  188  ALA A C     1 
ATOM   391  O  O     . ALA A 1  60  ? 3.722   -23.761 -5.521  1.00 13.94 ?  188  ALA A O     1 
ATOM   392  C  CB    . ALA A 1  60  ? 3.097   -21.697 -7.565  1.00 14.32 ?  188  ALA A CB    1 
ATOM   393  N  N     . LEU A 1  61  ? 5.806   -23.491 -6.308  1.00 13.90 ?  189  LEU A N     1 
ATOM   394  C  CA    . LEU A 1  61  ? 6.172   -24.869 -5.957  1.00 14.67 ?  189  LEU A CA    1 
ATOM   395  C  C     . LEU A 1  61  ? 6.298   -25.039 -4.444  1.00 14.96 ?  189  LEU A C     1 
ATOM   396  O  O     . LEU A 1  61  ? 6.687   -24.090 -3.749  1.00 14.00 ?  189  LEU A O     1 
ATOM   397  C  CB    . LEU A 1  61  ? 7.484   -25.263 -6.644  1.00 15.19 ?  189  LEU A CB    1 
ATOM   398  C  CG    . LEU A 1  61  ? 7.360   -25.511 -8.149  1.00 17.34 ?  189  LEU A CG    1 
ATOM   399  C  CD1   . LEU A 1  61  ? 8.733   -25.656 -8.775  1.00 18.35 ?  189  LEU A CD1   1 
ATOM   400  C  CD2   . LEU A 1  61  ? 6.528   -26.750 -8.408  1.00 20.06 ?  189  LEU A CD2   1 
ATOM   401  N  N     . PRO A 1  62  ? 6.011   -26.248 -3.932  1.00 16.31 ?  190  PRO A N     1 
ATOM   402  C  CA    . PRO A 1  62  ? 6.013   -26.458 -2.479  1.00 16.01 ?  190  PRO A CA    1 
ATOM   403  C  C     . PRO A 1  62  ? 7.414   -26.723 -1.891  1.00 15.80 ?  190  PRO A C     1 
ATOM   404  O  O     . PRO A 1  62  ? 7.537   -26.838 -0.664  1.00 15.37 ?  190  PRO A O     1 
ATOM   405  C  CB    . PRO A 1  62  ? 5.129   -27.696 -2.322  1.00 16.82 ?  190  PRO A CB    1 
ATOM   406  C  CG    . PRO A 1  62  ? 5.485   -28.517 -3.541  1.00 21.10 ?  190  PRO A CG    1 
ATOM   407  C  CD    . PRO A 1  62  ? 5.601   -27.474 -4.648  1.00 18.94 ?  190  PRO A CD    1 
ATOM   408  N  N     . SER A 1  63  ? 8.432   -26.851 -2.738  1.00 14.22 ?  191  SER A N     1 
ATOM   409  C  CA    . SER A 1  63  ? 9.784   -27.126 -2.248  1.00 14.46 ?  191  SER A CA    1 
ATOM   410  C  C     . SER A 1  63  ? 10.795  -26.765 -3.339  1.00 14.87 ?  191  SER A C     1 
ATOM   411  O  O     . SER A 1  63  ? 10.402  -26.436 -4.466  1.00 15.75 ?  191  SER A O     1 
ATOM   412  C  CB    . SER A 1  63  ? 9.922   -28.592 -1.815  1.00 19.62 ?  191  SER A CB    1 
ATOM   413  O  OG    . SER A 1  63  ? 9.753   -29.450 -2.919  1.00 20.11 ?  191  SER A OG    1 
ATOM   414  N  N     . PRO A 1  64  ? 12.093  -26.777 -3.006  1.00 14.82 ?  192  PRO A N     1 
ATOM   415  C  CA    . PRO A 1  64  ? 13.088  -26.367 -4.002  1.00 14.80 ?  192  PRO A CA    1 
ATOM   416  C  C     . PRO A 1  64  ? 13.241  -27.339 -5.156  1.00 15.40 ?  192  PRO A C     1 
ATOM   417  O  O     . PRO A 1  64  ? 13.193  -28.563 -4.951  1.00 17.49 ?  192  PRO A O     1 
ATOM   418  C  CB    . PRO A 1  64  ? 14.413  -26.328 -3.190  1.00 15.49 ?  192  PRO A CB    1 
ATOM   419  C  CG    . PRO A 1  64  ? 13.966  -26.065 -1.774  1.00 15.40 ?  192  PRO A CG    1 
ATOM   420  C  CD    . PRO A 1  64  ? 12.700  -26.906 -1.661  1.00 18.30 ?  192  PRO A CD    1 
ATOM   421  N  N     . VAL A 1  65  ? 13.444  -26.794 -6.348  1.00 15.07 ?  193  VAL A N     1 
ATOM   422  C  CA    . VAL A 1  65  ? 13.848  -27.611 -7.482  1.00 15.83 ?  193  VAL A CA    1 
ATOM   423  C  C     . VAL A 1  65  ? 15.327  -27.893 -7.336  1.00 19.48 ?  193  VAL A C     1 
ATOM   424  O  O     . VAL A 1  65  ? 16.129  -26.962 -7.260  1.00 19.49 ?  193  VAL A O     1 
ATOM   425  C  CB    . VAL A 1  65  ? 13.584  -26.898 -8.833  1.00 16.03 ?  193  VAL A CB    1 
ATOM   426  C  CG1   . VAL A 1  65  ? 14.189  -27.708 -9.977  1.00 19.52 ?  193  VAL A CG1   1 
ATOM   427  C  CG2   . VAL A 1  65  ? 12.106  -26.688 -9.045  1.00 16.50 ?  193  VAL A CG2   1 
ATOM   428  N  N     . THR A 1  66  ? 15.702  -29.168 -7.284  1.00 21.45 ?  194  THR A N     1 
ATOM   429  C  CA    . THR A 1  66  ? 17.121  -29.490 -7.229  1.00 24.96 ?  194  THR A CA    1 
ATOM   430  C  C     . THR A 1  66  ? 17.604  -30.298 -8.420  1.00 26.43 ?  194  THR A C     1 
ATOM   431  O  O     . THR A 1  66  ? 18.805  -30.503 -8.571  1.00 26.01 ?  194  THR A O     1 
ATOM   432  C  CB    . THR A 1  66  ? 17.465  -30.276 -5.975  1.00 28.57 ?  194  THR A CB    1 
ATOM   433  O  OG1   . THR A 1  66  ? 16.684  -31.469 -5.965  1.00 29.51 ?  194  THR A OG1   1 
ATOM   434  C  CG2   . THR A 1  66  ? 17.168  -29.442 -4.725  1.00 28.97 ?  194  THR A CG2   1 
ATOM   435  N  N     . THR A 1  67  ? 16.696  -30.789 -9.254  1.00 25.71 ?  195  THR A N     1 
ATOM   436  C  CA    A THR A 1  67  ? 17.129  -31.553 -10.417 0.53 28.39 ?  195  THR A CA    1 
ATOM   437  C  CA    B THR A 1  67  ? 17.091  -31.602 -10.409 0.47 28.41 ?  195  THR A CA    1 
ATOM   438  C  C     . THR A 1  67  ? 16.227  -31.273 -11.623 1.00 29.87 ?  195  THR A C     1 
ATOM   439  O  O     . THR A 1  67  ? 15.031  -30.983 -11.484 1.00 31.79 ?  195  THR A O     1 
ATOM   440  C  CB    A THR A 1  67  ? 17.182  -33.069 -10.106 0.53 30.30 ?  195  THR A CB    1 
ATOM   441  C  CB    B THR A 1  67  ? 16.992  -33.126 -10.127 0.47 30.57 ?  195  THR A CB    1 
ATOM   442  O  OG1   A THR A 1  67  ? 17.819  -33.766 -11.186 0.53 32.15 ?  195  THR A OG1   1 
ATOM   443  O  OG1   B THR A 1  67  ? 15.626  -33.500 -9.911  0.47 30.70 ?  195  THR A OG1   1 
ATOM   444  C  CG2   A THR A 1  67  ? 15.791  -33.634 -9.873  0.53 30.43 ?  195  THR A CG2   1 
ATOM   445  C  CG2   B THR A 1  67  ? 17.820  -33.524 -8.920  0.47 31.40 ?  195  THR A CG2   1 
ATOM   446  N  N     . LEU A 1  68  ? 16.828  -31.326 -12.808 1.00 31.37 ?  196  LEU A N     1 
ATOM   447  C  CA    . LEU A 1  68  ? 16.138  -30.953 -14.042 1.00 31.48 ?  196  LEU A CA    1 
ATOM   448  C  C     . LEU A 1  68  ? 14.850  -31.760 -14.257 1.00 30.73 ?  196  LEU A C     1 
ATOM   449  O  O     . LEU A 1  68  ? 13.874  -31.234 -14.791 1.00 28.58 ?  196  LEU A O     1 
ATOM   450  C  CB    . LEU A 1  68  ? 17.087  -31.116 -15.235 1.00 33.98 ?  196  LEU A CB    1 
ATOM   451  C  CG    . LEU A 1  68  ? 16.651  -30.636 -16.622 1.00 36.73 ?  196  LEU A CG    1 
ATOM   452  C  CD1   . LEU A 1  68  ? 16.404  -29.134 -16.630 1.00 36.26 ?  196  LEU A CD1   1 
ATOM   453  C  CD2   . LEU A 1  68  ? 17.709  -31.026 -17.656 1.00 38.72 ?  196  LEU A CD2   1 
ATOM   454  N  N     . SER A 1  69  ? 14.834  -33.022 -13.822 1.00 31.20 ?  197  SER A N     1 
ATOM   455  C  CA    . SER A 1  69  ? 13.643  -33.862 -13.976 1.00 34.08 ?  197  SER A CA    1 
ATOM   456  C  C     . SER A 1  69  ? 12.389  -33.275 -13.321 1.00 31.81 ?  197  SER A C     1 
ATOM   457  O  O     . SER A 1  69  ? 11.265  -33.549 -13.755 1.00 31.58 ?  197  SER A O     1 
ATOM   458  C  CB    . SER A 1  69  ? 13.893  -35.262 -13.407 1.00 39.06 ?  197  SER A CB    1 
ATOM   459  O  OG    . SER A 1  69  ? 13.943  -35.239 -11.992 1.00 40.43 ?  197  SER A OG    1 
ATOM   460  N  N     . GLN A 1  70  ? 12.570  -32.455 -12.291 1.00 29.65 ?  198  GLN A N     1 
ATOM   461  C  CA    . GLN A 1  70  ? 11.420  -31.920 -11.580 1.00 26.55 ?  198  GLN A CA    1 
ATOM   462  C  C     . GLN A 1  70  ? 10.679  -30.869 -12.415 1.00 25.03 ?  198  GLN A C     1 
ATOM   463  O  O     . GLN A 1  70  ? 9.553   -30.491 -12.084 1.00 25.36 ?  198  GLN A O     1 
ATOM   464  C  CB    . GLN A 1  70  ? 11.861  -31.358 -10.224 1.00 29.33 ?  198  GLN A CB    1 
ATOM   465  C  CG    . GLN A 1  70  ? 12.244  -32.469 -9.224  1.00 31.08 ?  198  GLN A CG    1 
ATOM   466  C  CD    . GLN A 1  70  ? 13.145  -31.986 -8.093  1.00 33.22 ?  198  GLN A CD    1 
ATOM   467  O  OE1   . GLN A 1  70  ? 13.729  -30.909 -8.166  1.00 31.31 ?  198  GLN A OE1   1 
ATOM   468  N  NE2   . GLN A 1  70  ? 13.270  -32.799 -7.045  1.00 35.50 ?  198  GLN A NE2   1 
ATOM   469  N  N     . LEU A 1  71  ? 11.284  -30.422 -13.515 1.00 25.08 ?  199  LEU A N     1 
ATOM   470  C  CA    . LEU A 1  71  ? 10.614  -29.445 -14.386 1.00 25.84 ?  199  LEU A CA    1 
ATOM   471  C  C     . LEU A 1  71  ? 9.643   -30.121 -15.343 1.00 27.75 ?  199  LEU A C     1 
ATOM   472  O  O     . LEU A 1  71  ? 8.785   -29.451 -15.940 1.00 26.72 ?  199  LEU A O     1 
ATOM   473  C  CB    . LEU A 1  71  ? 11.628  -28.627 -15.194 1.00 26.05 ?  199  LEU A CB    1 
ATOM   474  C  CG    . LEU A 1  71  ? 12.591  -27.724 -14.425 1.00 26.14 ?  199  LEU A CG    1 
ATOM   475  C  CD1   . LEU A 1  71  ? 13.438  -26.951 -15.411 1.00 28.08 ?  199  LEU A CD1   1 
ATOM   476  C  CD2   . LEU A 1  71  ? 11.850  -26.772 -13.461 1.00 24.68 ?  199  LEU A CD2   1 
ATOM   477  N  N     . GLN A 1  72  ? 9.795   -31.436 -15.492 1.00 29.99 ?  200  GLN A N     1 
ATOM   478  C  CA    . GLN A 1  72  ? 8.959   -32.210 -16.400 1.00 31.32 ?  200  GLN A CA    1 
ATOM   479  C  C     . GLN A 1  72  ? 7.497   -32.025 -16.031 1.00 31.80 ?  200  GLN A C     1 
ATOM   480  O  O     . GLN A 1  72  ? 7.103   -32.184 -14.876 1.00 33.14 ?  200  GLN A O     1 
ATOM   481  C  CB    . GLN A 1  72  ? 9.337   -33.709 -16.371 1.00 30.42 ?  200  GLN A CB    1 
ATOM   482  N  N     . GLY A 1  73  ? 6.689   -31.663 -17.014 1.00 34.15 ?  201  GLY A N     1 
ATOM   483  C  CA    . GLY A 1  73  ? 5.276   -31.477 -16.757 1.00 35.47 ?  201  GLY A CA    1 
ATOM   484  C  C     . GLY A 1  73  ? 4.894   -30.113 -16.210 1.00 34.84 ?  201  GLY A C     1 
ATOM   485  O  O     . GLY A 1  73  ? 3.707   -29.785 -16.155 1.00 36.96 ?  201  GLY A O     1 
ATOM   486  N  N     . LEU A 1  74  ? 5.871   -29.309 -15.795 1.00 31.59 ?  202  LEU A N     1 
ATOM   487  C  CA    . LEU A 1  74  ? 5.532   -27.967 -15.325 1.00 27.24 ?  202  LEU A CA    1 
ATOM   488  C  C     . LEU A 1  74  ? 5.137   -27.094 -16.509 1.00 25.27 ?  202  LEU A C     1 
ATOM   489  O  O     . LEU A 1  74  ? 5.826   -27.054 -17.530 1.00 25.12 ?  202  LEU A O     1 
ATOM   490  C  CB    . LEU A 1  74  ? 6.693   -27.329 -14.560 1.00 26.13 ?  202  LEU A CB    1 
ATOM   491  C  CG    . LEU A 1  74  ? 7.086   -27.980 -13.227 1.00 24.17 ?  202  LEU A CG    1 
ATOM   492  C  CD1   . LEU A 1  74  ? 8.167   -27.165 -12.517 1.00 19.94 ?  202  LEU A CD1   1 
ATOM   493  C  CD2   . LEU A 1  74  ? 5.877   -28.179 -12.336 1.00 25.36 ?  202  LEU A CD2   1 
ATOM   494  N  N     . PRO A 1  75  ? 4.026   -26.375 -16.377 1.00 23.46 ?  203  PRO A N     1 
ATOM   495  C  CA    . PRO A 1  75  ? 3.653   -25.478 -17.477 1.00 23.67 ?  203  PRO A CA    1 
ATOM   496  C  C     . PRO A 1  75  ? 4.661   -24.338 -17.635 1.00 22.53 ?  203  PRO A C     1 
ATOM   497  O  O     . PRO A 1  75  ? 5.261   -23.932 -16.648 1.00 20.26 ?  203  PRO A O     1 
ATOM   498  C  CB    . PRO A 1  75  ? 2.272   -24.955 -17.046 1.00 24.81 ?  203  PRO A CB    1 
ATOM   499  C  CG    . PRO A 1  75  ? 2.304   -25.014 -15.550 1.00 23.92 ?  203  PRO A CG    1 
ATOM   500  C  CD    . PRO A 1  75  ? 3.118   -26.258 -15.222 1.00 23.04 ?  203  PRO A CD    1 
ATOM   501  N  N     . HIS A 1  76  ? 4.839   -23.867 -18.870 1.00 22.50 ?  204  HIS A N     1 
ATOM   502  C  CA    . HIS A 1  76  ? 5.671   -22.706 -19.214 1.00 21.57 ?  204  HIS A CA    1 
ATOM   503  C  C     . HIS A 1  76  ? 7.165   -22.978 -19.118 1.00 21.76 ?  204  HIS A C     1 
ATOM   504  O  O     . HIS A 1  76  ? 7.983   -22.067 -19.283 1.00 20.71 ?  204  HIS A O     1 
ATOM   505  C  CB    . HIS A 1  76  ? 5.241   -21.504 -18.364 1.00 20.01 ?  204  HIS A CB    1 
ATOM   506  C  CG    . HIS A 1  76  ? 3.775   -21.242 -18.474 1.00 20.29 ?  204  HIS A CG    1 
ATOM   507  N  ND1   . HIS A 1  76  ? 3.178   -20.931 -19.677 1.00 20.94 ?  204  HIS A ND1   1 
ATOM   508  C  CD2   . HIS A 1  76  ? 2.774   -21.332 -17.567 1.00 20.91 ?  204  HIS A CD2   1 
ATOM   509  C  CE1   . HIS A 1  76  ? 1.874   -20.806 -19.499 1.00 22.95 ?  204  HIS A CE1   1 
ATOM   510  N  NE2   . HIS A 1  76  ? 1.602   -21.059 -18.231 1.00 23.35 ?  204  HIS A NE2   1 
ATOM   511  N  N     . PHE A 1  77  ? 7.536   -24.243 -18.917 1.00 21.82 ?  205  PHE A N     1 
ATOM   512  C  CA    . PHE A 1  77  ? 8.948   -24.603 -19.005 1.00 22.71 ?  205  PHE A CA    1 
ATOM   513  C  C     . PHE A 1  77  ? 9.255   -25.363 -20.273 1.00 25.58 ?  205  PHE A C     1 
ATOM   514  O  O     . PHE A 1  77  ? 8.993   -26.552 -20.371 1.00 30.41 ?  205  PHE A O     1 
ATOM   515  C  CB    . PHE A 1  77  ? 9.391   -25.401 -17.772 1.00 22.27 ?  205  PHE A CB    1 
ATOM   516  C  CG    . PHE A 1  77  ? 9.807   -24.516 -16.650 1.00 19.22 ?  205  PHE A CG    1 
ATOM   517  C  CD1   . PHE A 1  77  ? 11.122  -24.074 -16.552 1.00 18.72 ?  205  PHE A CD1   1 
ATOM   518  C  CD2   . PHE A 1  77  ? 8.872   -24.061 -15.733 1.00 18.90 ?  205  PHE A CD2   1 
ATOM   519  C  CE1   . PHE A 1  77  ? 11.497  -23.195 -15.533 1.00 19.71 ?  205  PHE A CE1   1 
ATOM   520  C  CE2   . PHE A 1  77  ? 9.240   -23.186 -14.721 1.00 17.81 ?  205  PHE A CE2   1 
ATOM   521  C  CZ    . PHE A 1  77  ? 10.553  -22.752 -14.617 1.00 17.63 ?  205  PHE A CZ    1 
ATOM   522  N  N     . GLY A 1  78  ? 9.820   -24.659 -21.242 1.00 22.11 ?  206  GLY A N     1 
ATOM   523  C  CA    . GLY A 1  78  ? 10.247  -25.268 -22.486 1.00 22.67 ?  206  GLY A CA    1 
ATOM   524  C  C     . GLY A 1  78  ? 11.761  -25.316 -22.535 1.00 24.72 ?  206  GLY A C     1 
ATOM   525  O  O     . GLY A 1  78  ? 12.419  -25.319 -21.492 1.00 25.99 ?  206  GLY A O     1 
ATOM   526  N  N     . GLU A 1  79  ? 12.318  -25.328 -23.740 1.00 21.82 ?  207  GLU A N     1 
ATOM   527  C  CA    . GLU A 1  79  ? 13.755  -25.534 -23.902 1.00 25.02 ?  207  GLU A CA    1 
ATOM   528  C  C     . GLU A 1  79  ? 14.544  -24.432 -23.220 1.00 24.38 ?  207  GLU A C     1 
ATOM   529  O  O     . GLU A 1  79  ? 15.528  -24.691 -22.520 1.00 24.17 ?  207  GLU A O     1 
ATOM   530  C  CB    . GLU A 1  79  ? 14.121  -25.592 -25.387 1.00 27.03 ?  207  GLU A CB    1 
ATOM   531  C  CG    . GLU A 1  79  ? 15.559  -26.019 -25.650 1.00 30.51 ?  207  GLU A CG    1 
ATOM   532  N  N     . HIS A 1  80  ? 14.102  -23.195 -23.414 1.00 21.20 ?  208  HIS A N     1 
ATOM   533  C  CA    . HIS A 1  80  ? 14.900  -22.063 -22.982 1.00 20.41 ?  208  HIS A CA    1 
ATOM   534  C  C     . HIS A 1  80  ? 14.911  -21.923 -21.468 1.00 19.83 ?  208  HIS A C     1 
ATOM   535  O  O     . HIS A 1  80  ? 15.979  -21.815 -20.862 1.00 20.99 ?  208  HIS A O     1 
ATOM   536  C  CB    . HIS A 1  80  ? 14.401  -20.764 -23.631 1.00 21.21 ?  208  HIS A CB    1 
ATOM   537  C  CG    . HIS A 1  80  ? 15.409  -19.658 -23.591 1.00 24.50 ?  208  HIS A CG    1 
ATOM   538  N  ND1   . HIS A 1  80  ? 15.646  -18.820 -24.660 1.00 27.15 ?  208  HIS A ND1   1 
ATOM   539  C  CD2   . HIS A 1  80  ? 16.256  -19.263 -22.610 1.00 25.70 ?  208  HIS A CD2   1 
ATOM   540  C  CE1   . HIS A 1  80  ? 16.594  -17.955 -24.338 1.00 25.78 ?  208  HIS A CE1   1 
ATOM   541  N  NE2   . HIS A 1  80  ? 16.979  -18.201 -23.098 1.00 25.66 ?  208  HIS A NE2   1 
ATOM   542  N  N     . SER A 1  81  ? 13.724  -21.905 -20.859 1.00 18.41 ?  209  SER A N     1 
ATOM   543  C  CA    . SER A 1  81  ? 13.610  -21.777 -19.423 1.00 18.55 ?  209  SER A CA    1 
ATOM   544  C  C     . SER A 1  81  ? 14.250  -22.945 -18.688 1.00 19.94 ?  209  SER A C     1 
ATOM   545  O  O     . SER A 1  81  ? 14.837  -22.763 -17.616 1.00 20.25 ?  209  SER A O     1 
ATOM   546  C  CB    . SER A 1  81  ? 12.145  -21.656 -19.021 1.00 21.24 ?  209  SER A CB    1 
ATOM   547  O  OG    . SER A 1  81  ? 11.612  -20.432 -19.512 1.00 22.72 ?  209  SER A OG    1 
ATOM   548  N  N     . SER A 1  82  ? 14.119  -24.147 -19.242 1.00 17.83 ?  210  SER A N     1 
ATOM   549  C  CA    . SER A 1  82  ? 14.696  -25.316 -18.596 1.00 18.48 ?  210  SER A CA    1 
ATOM   550  C  C     . SER A 1  82  ? 16.216  -25.268 -18.626 1.00 21.87 ?  210  SER A C     1 
ATOM   551  O  O     . SER A 1  82  ? 16.859  -25.657 -17.653 1.00 21.29 ?  210  SER A O     1 
ATOM   552  C  CB    . SER A 1  82  ? 14.190  -26.603 -19.254 1.00 21.94 ?  210  SER A CB    1 
ATOM   553  O  OG    . SER A 1  82  ? 12.780  -26.661 -19.101 1.00 24.51 ?  210  SER A OG    1 
ATOM   554  N  N     . ARG A 1  83  ? 16.786  -24.784 -19.728 1.00 22.66 ?  211  ARG A N     1 
ATOM   555  C  CA    . ARG A 1  83  ? 18.234  -24.638 -19.832 1.00 25.63 ?  211  ARG A CA    1 
ATOM   556  C  C     . ARG A 1  83  ? 18.766  -23.681 -18.773 1.00 24.75 ?  211  ARG A C     1 
ATOM   557  O  O     . ARG A 1  83  ? 19.819  -23.914 -18.181 1.00 25.05 ?  211  ARG A O     1 
ATOM   558  C  CB    . ARG A 1  83  ? 18.638  -24.130 -21.219 1.00 28.04 ?  211  ARG A CB    1 
ATOM   559  C  CG    . ARG A 1  83  ? 20.149  -23.897 -21.364 1.00 33.57 ?  211  ARG A CG    1 
ATOM   560  C  CD    . ARG A 1  83  ? 20.518  -23.427 -22.759 1.00 36.76 ?  211  ARG A CD    1 
ATOM   561  N  N     . VAL A 1  84  ? 18.047  -22.583 -18.564 1.00 22.32 ?  212  VAL A N     1 
ATOM   562  C  CA    . VAL A 1  84  ? 18.455  -21.600 -17.577 1.00 20.81 ?  212  VAL A CA    1 
ATOM   563  C  C     . VAL A 1  84  ? 18.518  -22.256 -16.203 1.00 22.02 ?  212  VAL A C     1 
ATOM   564  O  O     . VAL A 1  84  ? 19.510  -22.115 -15.497 1.00 20.81 ?  212  VAL A O     1 
ATOM   565  C  CB    . VAL A 1  84  ? 17.504  -20.389 -17.565 1.00 21.38 ?  212  VAL A CB    1 
ATOM   566  C  CG1   . VAL A 1  84  ? 17.847  -19.436 -16.435 1.00 20.19 ?  212  VAL A CG1   1 
ATOM   567  C  CG2   . VAL A 1  84  ? 17.576  -19.691 -18.917 1.00 21.99 ?  212  VAL A CG2   1 
ATOM   568  N  N     . VAL A 1  85  ? 17.465  -22.987 -15.840 1.00 19.16 ?  213  VAL A N     1 
ATOM   569  C  CA    . VAL A 1  85  ? 17.440  -23.657 -14.551 1.00 20.63 ?  213  VAL A CA    1 
ATOM   570  C  C     . VAL A 1  85  ? 18.518  -24.750 -14.484 1.00 21.72 ?  213  VAL A C     1 
ATOM   571  O  O     . VAL A 1  85  ? 19.176  -24.911 -13.450 1.00 20.63 ?  213  VAL A O     1 
ATOM   572  C  CB    . VAL A 1  85  ? 16.043  -24.252 -14.260 1.00 20.78 ?  213  VAL A CB    1 
ATOM   573  C  CG1   . VAL A 1  85  ? 16.082  -25.120 -13.000 1.00 21.29 ?  213  VAL A CG1   1 
ATOM   574  C  CG2   . VAL A 1  85  ? 15.013  -23.127 -14.104 1.00 18.24 ?  213  VAL A CG2   1 
ATOM   575  N  N     . GLN A 1  86  ? 18.728  -25.481 -15.582 1.00 20.97 ?  214  GLN A N     1 
ATOM   576  C  CA    . GLN A 1  86  ? 19.763  -26.524 -15.604 1.00 21.69 ?  214  GLN A CA    1 
ATOM   577  C  C     . GLN A 1  86  ? 21.138  -25.943 -15.282 1.00 22.22 ?  214  GLN A C     1 
ATOM   578  O  O     . GLN A 1  86  ? 21.908  -26.514 -14.496 1.00 25.15 ?  214  GLN A O     1 
ATOM   579  C  CB    . GLN A 1  86  ? 19.803  -27.222 -16.967 1.00 23.83 ?  214  GLN A CB    1 
ATOM   580  C  CG    . GLN A 1  86  ? 20.879  -28.308 -17.096 1.00 28.06 ?  214  GLN A CG    1 
ATOM   581  N  N     . GLU A 1  87  ? 21.446  -24.799 -15.884 1.00 22.52 ?  215  GLU A N     1 
ATOM   582  C  CA    . GLU A 1  87  ? 22.747  -24.176 -15.677 1.00 24.85 ?  215  GLU A CA    1 
ATOM   583  C  C     . GLU A 1  87  ? 22.902  -23.683 -14.248 1.00 23.50 ?  215  GLU A C     1 
ATOM   584  O  O     . GLU A 1  87  ? 23.958  -23.867 -13.625 1.00 24.25 ?  215  GLU A O     1 
ATOM   585  C  CB    . GLU A 1  87  ? 22.957  -23.024 -16.665 1.00 27.66 ?  215  GLU A CB    1 
ATOM   586  C  CG    . GLU A 1  87  ? 23.047  -23.501 -18.097 1.00 33.51 ?  215  GLU A CG    1 
ATOM   587  C  CD    . GLU A 1  87  ? 23.439  -22.405 -19.069 1.00 39.20 ?  215  GLU A CD    1 
ATOM   588  O  OE1   . GLU A 1  87  ? 23.765  -21.286 -18.616 1.00 39.72 ?  215  GLU A OE1   1 
ATOM   589  O  OE2   . GLU A 1  87  ? 23.415  -22.671 -20.294 1.00 42.46 ?  215  GLU A OE2   1 
ATOM   590  N  N     . LEU A 1  88  ? 21.857  -23.046 -13.726 1.00 22.35 ?  216  LEU A N     1 
ATOM   591  C  CA    . LEU A 1  88  ? 21.888  -22.618 -12.337 1.00 22.81 ?  216  LEU A CA    1 
ATOM   592  C  C     . LEU A 1  88  ? 22.095  -23.802 -11.394 1.00 24.56 ?  216  LEU A C     1 
ATOM   593  O  O     . LEU A 1  88  ? 22.874  -23.715 -10.453 1.00 26.93 ?  216  LEU A O     1 
ATOM   594  C  CB    . LEU A 1  88  ? 20.603  -21.872 -11.984 1.00 20.67 ?  216  LEU A CB    1 
ATOM   595  C  CG    . LEU A 1  88  ? 20.515  -20.518 -12.696 1.00 21.63 ?  216  LEU A CG    1 
ATOM   596  C  CD1   . LEU A 1  88  ? 19.080  -19.977 -12.682 1.00 21.14 ?  216  LEU A CD1   1 
ATOM   597  C  CD2   . LEU A 1  88  ? 21.464  -19.521 -12.042 1.00 24.65 ?  216  LEU A CD2   1 
ATOM   598  N  N     . LEU A 1  89  ? 21.409  -24.913 -11.644 1.00 23.77 ?  217  LEU A N     1 
ATOM   599  C  CA    . LEU A 1  89  ? 21.568  -26.088 -10.788 1.00 22.98 ?  217  LEU A CA    1 
ATOM   600  C  C     . LEU A 1  89  ? 22.976  -26.690 -10.867 1.00 28.64 ?  217  LEU A C     1 
ATOM   601  O  O     . LEU A 1  89  ? 23.536  -27.144 -9.856  1.00 31.39 ?  217  LEU A O     1 
ATOM   602  C  CB    . LEU A 1  89  ? 20.542  -27.157 -11.159 1.00 20.78 ?  217  LEU A CB    1 
ATOM   603  C  CG    . LEU A 1  89  ? 19.066  -26.846 -10.956 1.00 22.64 ?  217  LEU A CG    1 
ATOM   604  C  CD1   . LEU A 1  89  ? 18.209  -27.983 -11.506 1.00 24.24 ?  217  LEU A CD1   1 
ATOM   605  C  CD2   . LEU A 1  89  ? 18.784  -26.609 -9.473  1.00 24.78 ?  217  LEU A CD2   1 
ATOM   606  N  N     . GLU A 1  90  ? 23.550  -26.701 -12.064 1.00 27.33 ?  218  GLU A N     1 
ATOM   607  C  CA    . GLU A 1  90  ? 24.834  -27.370 -12.278 1.00 32.49 ?  218  GLU A CA    1 
ATOM   608  C  C     . GLU A 1  90  ? 26.030  -26.474 -11.928 1.00 32.66 ?  218  GLU A C     1 
ATOM   609  O  O     . GLU A 1  90  ? 27.035  -26.962 -11.412 1.00 35.03 ?  218  GLU A O     1 
ATOM   610  C  CB    . GLU A 1  90  ? 24.929  -27.857 -13.727 1.00 36.84 ?  218  GLU A CB    1 
ATOM   611  C  CG    . GLU A 1  90  ? 26.232  -28.560 -14.092 1.00 45.92 ?  218  GLU A CG    1 
ATOM   612  C  CD    . GLU A 1  90  ? 26.226  -29.106 -15.517 1.00 51.47 ?  218  GLU A CD    1 
ATOM   613  O  OE1   . GLU A 1  90  ? 27.303  -29.524 -15.997 1.00 55.59 ?  218  GLU A OE1   1 
ATOM   614  O  OE2   . GLU A 1  90  ? 25.148  -29.125 -16.156 1.00 52.32 ?  218  GLU A OE2   1 
ATOM   615  N  N     . HIS A 1  91  ? 25.913  -25.170 -12.172 1.00 30.57 ?  219  HIS A N     1 
ATOM   616  C  CA    . HIS A 1  91  ? 27.057  -24.260 -12.039 1.00 32.43 ?  219  HIS A CA    1 
ATOM   617  C  C     . HIS A 1  91  ? 26.836  -23.079 -11.114 1.00 32.74 ?  219  HIS A C     1 
ATOM   618  O  O     . HIS A 1  91  ? 27.766  -22.322 -10.855 1.00 33.72 ?  219  HIS A O     1 
ATOM   619  C  CB    . HIS A 1  91  ? 27.459  -23.712 -13.406 1.00 34.29 ?  219  HIS A CB    1 
ATOM   620  C  CG    . HIS A 1  91  ? 27.817  -24.771 -14.397 1.00 38.93 ?  219  HIS A CG    1 
ATOM   621  N  ND1   . HIS A 1  91  ? 26.981  -25.138 -15.430 1.00 41.07 ?  219  HIS A ND1   1 
ATOM   622  C  CD2   . HIS A 1  91  ? 28.914  -25.553 -14.502 1.00 39.77 ?  219  HIS A CD2   1 
ATOM   623  C  CE1   . HIS A 1  91  ? 27.556  -26.094 -16.137 1.00 42.74 ?  219  HIS A CE1   1 
ATOM   624  N  NE2   . HIS A 1  91  ? 28.728  -26.366 -15.593 1.00 43.20 ?  219  HIS A NE2   1 
ATOM   625  N  N     . GLY A 1  92  ? 25.606  -22.883 -10.656 1.00 29.46 ?  220  GLY A N     1 
ATOM   626  C  CA    . GLY A 1  92  ? 25.319  -21.797 -9.740  1.00 28.52 ?  220  GLY A CA    1 
ATOM   627  C  C     . GLY A 1  92  ? 25.105  -20.471 -10.436 1.00 28.55 ?  220  GLY A C     1 
ATOM   628  O  O     . GLY A 1  92  ? 24.738  -19.495 -9.803  1.00 28.86 ?  220  GLY A O     1 
ATOM   629  N  N     . VAL A 1  93  ? 25.353  -20.438 -11.741 1.00 28.59 ?  221  VAL A N     1 
ATOM   630  C  CA    . VAL A 1  93  ? 25.096  -19.254 -12.547 1.00 29.23 ?  221  VAL A CA    1 
ATOM   631  C  C     . VAL A 1  93  ? 24.661  -19.655 -13.933 1.00 27.04 ?  221  VAL A C     1 
ATOM   632  O  O     . VAL A 1  93  ? 24.996  -20.733 -14.420 1.00 24.84 ?  221  VAL A O     1 
ATOM   633  C  CB    . VAL A 1  93  ? 26.340  -18.349 -12.705 1.00 33.93 ?  221  VAL A CB    1 
ATOM   634  C  CG1   . VAL A 1  93  ? 26.670  -17.622 -11.406 1.00 38.48 ?  221  VAL A CG1   1 
ATOM   635  C  CG2   . VAL A 1  93  ? 27.508  -19.164 -13.198 1.00 34.70 ?  221  VAL A CG2   1 
ATOM   636  N  N     . CYS A 1  94  ? 23.931  -18.763 -14.584 1.00 25.57 ?  222  CYS A N     1 
ATOM   637  C  CA    . CYS A 1  94  ? 23.539  -18.983 -15.963 1.00 25.89 ?  222  CYS A CA    1 
ATOM   638  C  C     . CYS A 1  94  ? 24.237  -17.934 -16.796 1.00 26.11 ?  222  CYS A C     1 
ATOM   639  O  O     . CYS A 1  94  ? 24.027  -16.741 -16.578 1.00 23.06 ?  222  CYS A O     1 
ATOM   640  C  CB    . CYS A 1  94  ? 22.024  -18.897 -16.118 1.00 23.58 ?  222  CYS A CB    1 
ATOM   641  S  SG    . CYS A 1  94  ? 21.487  -18.789 -17.826 1.00 25.93 ?  222  CYS A SG    1 
ATOM   642  N  N     . GLU A 1  95  ? 25.078  -18.369 -17.732 1.00 25.12 ?  223  GLU A N     1 
ATOM   643  C  CA    . GLU A 1  95  ? 25.893  -17.422 -18.474 1.00 28.06 ?  223  GLU A CA    1 
ATOM   644  C  C     . GLU A 1  95  ? 25.060  -16.366 -19.204 1.00 25.31 ?  223  GLU A C     1 
ATOM   645  O  O     . GLU A 1  95  ? 25.475  -15.205 -19.285 1.00 25.31 ?  223  GLU A O     1 
ATOM   646  C  CB    . GLU A 1  95  ? 26.794  -18.136 -19.473 1.00 34.24 ?  223  GLU A CB    1 
ATOM   647  C  CG    . GLU A 1  95  ? 27.910  -17.233 -19.985 1.00 42.40 ?  223  GLU A CG    1 
ATOM   648  C  CD    . GLU A 1  95  ? 28.454  -16.298 -18.896 1.00 48.46 ?  223  GLU A CD    1 
ATOM   649  O  OE1   . GLU A 1  95  ? 28.922  -16.808 -17.847 1.00 49.45 ?  223  GLU A OE1   1 
ATOM   650  O  OE2   . GLU A 1  95  ? 28.396  -15.052 -19.084 1.00 49.52 ?  223  GLU A OE2   1 
ATOM   651  N  N     . GLU A 1  96  ? 23.895  -16.748 -19.725 1.00 23.39 ?  224  GLU A N     1 
ATOM   652  C  CA    . GLU A 1  96  ? 23.053  -15.774 -20.420 1.00 22.16 ?  224  GLU A CA    1 
ATOM   653  C  C     . GLU A 1  96  ? 22.595  -14.667 -19.468 1.00 21.40 ?  224  GLU A C     1 
ATOM   654  O  O     . GLU A 1  96  ? 22.631  -13.480 -19.806 1.00 22.60 ?  224  GLU A O     1 
ATOM   655  C  CB    . GLU A 1  96  ? 21.812  -16.430 -21.051 1.00 23.40 ?  224  GLU A CB    1 
ATOM   656  C  CG    . GLU A 1  96  ? 20.931  -15.416 -21.786 1.00 25.52 ?  224  GLU A CG    1 
ATOM   657  C  CD    . GLU A 1  96  ? 19.648  -16.015 -22.366 1.00 28.05 ?  224  GLU A CD    1 
ATOM   658  O  OE1   . GLU A 1  96  ? 19.345  -17.199 -22.091 1.00 27.70 ?  224  GLU A OE1   1 
ATOM   659  O  OE2   . GLU A 1  96  ? 18.940  -15.291 -23.102 1.00 29.09 ?  224  GLU A OE2   1 
ATOM   660  N  N     . VAL A 1  97  ? 22.157  -15.073 -18.284 1.00 19.36 ?  225  VAL A N     1 
ATOM   661  C  CA    . VAL A 1  97  ? 21.679  -14.132 -17.279 1.00 19.29 ?  225  VAL A CA    1 
ATOM   662  C  C     . VAL A 1  97  ? 22.810  -13.175 -16.891 1.00 20.83 ?  225  VAL A C     1 
ATOM   663  O  O     . VAL A 1  97  ? 22.624  -11.961 -16.756 1.00 19.85 ?  225  VAL A O     1 
ATOM   664  C  CB    . VAL A 1  97  ? 21.153  -14.880 -16.046 1.00 18.82 ?  225  VAL A CB    1 
ATOM   665  C  CG1   . VAL A 1  97  ? 20.796  -13.915 -14.927 1.00 18.88 ?  225  VAL A CG1   1 
ATOM   666  C  CG2   . VAL A 1  97  ? 19.924  -15.692 -16.419 1.00 19.36 ?  225  VAL A CG2   1 
ATOM   667  N  N     . GLU A 1  98  ? 24.001  -13.725 -16.735 1.00 19.39 ?  226  GLU A N     1 
ATOM   668  C  CA    . GLU A 1  98  ? 25.129  -12.905 -16.299 1.00 20.69 ?  226  GLU A CA    1 
ATOM   669  C  C     . GLU A 1  98  ? 25.533  -11.906 -17.379 1.00 23.34 ?  226  GLU A C     1 
ATOM   670  O  O     . GLU A 1  98  ? 25.865  -10.762 -17.081 1.00 25.94 ?  226  GLU A O     1 
ATOM   671  C  CB    . GLU A 1  98  ? 26.306  -13.805 -15.903 1.00 25.10 ?  226  GLU A CB    1 
ATOM   672  C  CG    . GLU A 1  98  ? 26.000  -14.635 -14.665 1.00 26.86 ?  226  GLU A CG    1 
ATOM   673  C  CD    . GLU A 1  98  ? 25.537  -13.772 -13.509 1.00 32.30 ?  226  GLU A CD    1 
ATOM   674  O  OE1   . GLU A 1  98  ? 26.289  -12.847 -13.130 1.00 37.21 ?  226  GLU A OE1   1 
ATOM   675  O  OE2   . GLU A 1  98  ? 24.422  -14.002 -12.996 1.00 31.01 ?  226  GLU A OE2   1 
ATOM   676  N  N     . ARG A 1  99  ? 25.496  -12.334 -18.635 1.00 22.31 ?  227  ARG A N     1 
ATOM   677  C  CA    . ARG A 1  99  ? 25.791  -11.441 -19.748 1.00 23.52 ?  227  ARG A CA    1 
ATOM   678  C  C     . ARG A 1  99  ? 24.765  -10.312 -19.843 1.00 23.64 ?  227  ARG A C     1 
ATOM   679  O  O     . ARG A 1  99  ? 25.111  -9.183  -20.193 1.00 23.67 ?  227  ARG A O     1 
ATOM   680  C  CB    . ARG A 1  99  ? 25.828  -12.217 -21.065 1.00 26.87 ?  227  ARG A CB    1 
ATOM   681  C  CG    . ARG A 1  99  ? 26.204  -11.384 -22.272 1.00 32.59 ?  227  ARG A CG    1 
ATOM   682  N  N     . VAL A 1  100 ? 23.500  -10.629 -19.565 1.00 20.55 ?  228  VAL A N     1 
ATOM   683  C  CA    . VAL A 1  100 ? 22.475  -9.584  -19.530 1.00 21.83 ?  228  VAL A CA    1 
ATOM   684  C  C     . VAL A 1  100 ? 22.772  -8.584  -18.407 1.00 22.23 ?  228  VAL A C     1 
ATOM   685  O  O     . VAL A 1  100 ? 22.815  -7.385  -18.655 1.00 22.66 ?  228  VAL A O     1 
ATOM   686  C  CB    . VAL A 1  100 ? 21.061  -10.160 -19.364 1.00 22.76 ?  228  VAL A CB    1 
ATOM   687  C  CG1   . VAL A 1  100 ? 20.060  -9.030  -19.035 1.00 21.19 ?  228  VAL A CG1   1 
ATOM   688  C  CG2   . VAL A 1  100 ? 20.652  -10.872 -20.636 1.00 23.66 ?  228  VAL A CG2   1 
ATOM   689  N  N     A ARG A 1  101 ? 23.009  -9.086  -17.198 0.39 23.72 ?  229  ARG A N     1 
ATOM   690  N  N     B ARG A 1  101 ? 22.993  -9.091  -17.196 0.61 23.56 ?  229  ARG A N     1 
ATOM   691  C  CA    A ARG A 1  101 ? 23.281  -8.234  -16.037 0.39 25.14 ?  229  ARG A CA    1 
ATOM   692  C  CA    B ARG A 1  101 ? 23.309  -8.256  -16.035 0.61 25.57 ?  229  ARG A CA    1 
ATOM   693  C  C     A ARG A 1  101 ? 24.418  -7.239  -16.255 0.39 26.00 ?  229  ARG A C     1 
ATOM   694  C  C     B ARG A 1  101 ? 24.391  -7.227  -16.303 0.61 26.04 ?  229  ARG A C     1 
ATOM   695  O  O     A ARG A 1  101 ? 24.350  -6.101  -15.785 0.39 26.08 ?  229  ARG A O     1 
ATOM   696  O  O     B ARG A 1  101 ? 24.265  -6.063  -15.911 0.61 26.03 ?  229  ARG A O     1 
ATOM   697  C  CB    A ARG A 1  101 ? 23.616  -9.084  -14.808 0.39 27.68 ?  229  ARG A CB    1 
ATOM   698  C  CB    B ARG A 1  101 ? 23.777  -9.109  -14.855 0.61 27.79 ?  229  ARG A CB    1 
ATOM   699  C  CG    A ARG A 1  101 ? 22.438  -9.768  -14.158 0.39 29.28 ?  229  ARG A CG    1 
ATOM   700  C  CG    B ARG A 1  101 ? 22.705  -9.744  -14.032 0.61 29.31 ?  229  ARG A CG    1 
ATOM   701  C  CD    A ARG A 1  101 ? 22.826  -10.277 -12.771 0.39 29.77 ?  229  ARG A CD    1 
ATOM   702  C  CD    B ARG A 1  101 ? 23.311  -10.186 -12.710 0.61 29.53 ?  229  ARG A CD    1 
ATOM   703  N  NE    A ARG A 1  101 ? 21.700  -10.916 -12.101 0.39 30.04 ?  229  ARG A NE    1 
ATOM   704  N  NE    B ARG A 1  101 ? 22.942  -11.550 -12.361 0.61 29.96 ?  229  ARG A NE    1 
ATOM   705  C  CZ    A ARG A 1  101 ? 21.739  -12.136 -11.574 0.39 30.75 ?  229  ARG A CZ    1 
ATOM   706  C  CZ    B ARG A 1  101 ? 21.848  -11.865 -11.676 0.61 30.68 ?  229  ARG A CZ    1 
ATOM   707  N  NH1   A ARG A 1  101 ? 22.859  -12.850 -11.624 0.39 30.98 ?  229  ARG A NH1   1 
ATOM   708  N  NH1   B ARG A 1  101 ? 21.018  -10.906 -11.278 0.61 29.40 ?  229  ARG A NH1   1 
ATOM   709  N  NH2   A ARG A 1  101 ? 20.658  -12.640 -10.990 0.39 29.55 ?  229  ARG A NH2   1 
ATOM   710  N  NH2   B ARG A 1  101 ? 21.580  -13.137 -11.392 0.61 31.07 ?  229  ARG A NH2   1 
ATOM   711  N  N     . ARG A 1  102 ? 25.461  -7.671  -16.959 1.00 25.25 ?  230  ARG A N     1 
ATOM   712  C  CA    . ARG A 1  102 ? 26.643  -6.842  -17.155 1.00 26.58 ?  230  ARG A CA    1 
ATOM   713  C  C     . ARG A 1  102 ? 26.519  -5.896  -18.313 1.00 25.09 ?  230  ARG A C     1 
ATOM   714  O  O     . ARG A 1  102 ? 27.380  -5.044  -18.495 1.00 27.89 ?  230  ARG A O     1 
ATOM   715  C  CB    . ARG A 1  102 ? 27.900  -7.703  -17.404 1.00 27.68 ?  230  ARG A CB    1 
ATOM   716  C  CG    . ARG A 1  102 ? 28.184  -8.761  -16.377 1.00 31.28 ?  230  ARG A CG    1 
ATOM   717  C  CD    . ARG A 1  102 ? 29.544  -9.400  -16.633 1.00 35.79 ?  230  ARG A CD    1 
ATOM   718  N  NE    . ARG A 1  102 ? 29.645  -10.011 -17.962 1.00 38.04 ?  230  ARG A NE    1 
ATOM   719  C  CZ    . ARG A 1  102 ? 29.471  -11.309 -18.190 1.00 38.27 ?  230  ARG A CZ    1 
ATOM   720  N  NH1   . ARG A 1  102 ? 29.191  -12.124 -17.185 1.00 37.95 ?  230  ARG A NH1   1 
ATOM   721  N  NH2   . ARG A 1  102 ? 29.580  -11.793 -19.415 1.00 39.95 ?  230  ARG A NH2   1 
ATOM   722  N  N     . SER A 1  103 ? 25.490  -6.067  -19.135 1.00 22.55 ?  231  SER A N     1 
ATOM   723  C  CA    . SER A 1  103 ? 25.473  -5.351  -20.387 1.00 25.17 ?  231  SER A CA    1 
ATOM   724  C  C     . SER A 1  103 ? 25.074  -3.889  -20.200 1.00 24.50 ?  231  SER A C     1 
ATOM   725  O  O     . SER A 1  103 ? 24.235  -3.564  -19.369 1.00 23.97 ?  231  SER A O     1 
ATOM   726  C  CB    . SER A 1  103 ? 24.551  -6.046  -21.390 1.00 27.06 ?  231  SER A CB    1 
ATOM   727  O  OG    . SER A 1  103 ? 23.193  -5.771  -21.155 1.00 27.49 ?  231  SER A OG    1 
ATOM   728  N  N     . GLU A 1  104 ? 25.716  -3.020  -20.973 1.00 25.48 ?  232  GLU A N     1 
ATOM   729  C  CA    . GLU A 1  104 ? 25.423  -1.593  -20.934 1.00 26.08 ?  232  GLU A CA    1 
ATOM   730  C  C     . GLU A 1  104 ? 23.955  -1.341  -21.280 1.00 24.97 ?  232  GLU A C     1 
ATOM   731  O  O     . GLU A 1  104 ? 23.290  -0.490  -20.670 1.00 23.28 ?  232  GLU A O     1 
ATOM   732  C  CB    . GLU A 1  104 ? 26.348  -0.837  -21.900 1.00 29.55 ?  232  GLU A CB    1 
ATOM   733  C  CG    . GLU A 1  104 ? 26.086  0.660   -21.974 1.00 30.42 ?  232  GLU A CG    1 
ATOM   734  C  CD    . GLU A 1  104 ? 27.026  1.398   -22.921 1.00 34.52 ?  232  GLU A CD    1 
ATOM   735  O  OE1   . GLU A 1  104 ? 27.672  0.760   -23.781 1.00 36.39 ?  232  GLU A OE1   1 
ATOM   736  O  OE2   . GLU A 1  104 ? 27.125  2.634   -22.800 1.00 35.08 ?  232  GLU A OE2   1 
ATOM   737  N  N     . ARG A 1  105 ? 23.445  -2.090  -22.253 1.00 24.47 ?  233  ARG A N     1 
ATOM   738  C  CA    . ARG A 1  105 ? 22.053  -1.920  -22.686 1.00 22.22 ?  233  ARG A CA    1 
ATOM   739  C  C     . ARG A 1  105 ? 21.071  -2.229  -21.545 1.00 22.95 ?  233  ARG A C     1 
ATOM   740  O  O     . ARG A 1  105 ? 20.193  -1.436  -21.262 1.00 21.96 ?  233  ARG A O     1 
ATOM   741  C  CB    . ARG A 1  105 ? 21.768  -2.801  -23.905 1.00 23.54 ?  233  ARG A CB    1 
ATOM   742  C  CG    . ARG A 1  105 ? 20.269  -2.979  -24.256 1.00 25.80 ?  233  ARG A CG    1 
ATOM   743  C  CD    . ARG A 1  105 ? 19.683  -1.757  -24.940 1.00 26.09 ?  233  ARG A CD    1 
ATOM   744  N  NE    . ARG A 1  105 ? 18.272  -1.958  -25.257 1.00 25.10 ?  233  ARG A NE    1 
ATOM   745  C  CZ    . ARG A 1  105 ? 17.525  -1.080  -25.918 1.00 25.13 ?  233  ARG A CZ    1 
ATOM   746  N  NH1   . ARG A 1  105 ? 18.058  0.066   -26.339 1.00 25.65 ?  233  ARG A NH1   1 
ATOM   747  N  NH2   . ARG A 1  105 ? 16.247  -1.343  -26.155 1.00 22.61 ?  233  ARG A NH2   1 
ATOM   748  N  N     . TYR A 1  106 ? 21.244  -3.370  -20.886 1.00 22.75 ?  234  TYR A N     1 
ATOM   749  C  CA    . TYR A 1  106 ? 20.358  -3.740  -19.783 1.00 22.40 ?  234  TYR A CA    1 
ATOM   750  C  C     . TYR A 1  106 ? 20.446  -2.726  -18.650 1.00 21.72 ?  234  TYR A C     1 
ATOM   751  O  O     . TYR A 1  106 ? 19.438  -2.260  -18.153 1.00 20.24 ?  234  TYR A O     1 
ATOM   752  C  CB    . TYR A 1  106 ? 20.689  -5.156  -19.262 1.00 22.23 ?  234  TYR A CB    1 
ATOM   753  C  CG    . TYR A 1  106 ? 19.919  -5.527  -17.993 1.00 21.25 ?  234  TYR A CG    1 
ATOM   754  C  CD1   . TYR A 1  106 ? 18.609  -6.012  -18.051 1.00 21.50 ?  234  TYR A CD1   1 
ATOM   755  C  CD2   . TYR A 1  106 ? 20.509  -5.394  -16.741 1.00 21.79 ?  234  TYR A CD2   1 
ATOM   756  C  CE1   . TYR A 1  106 ? 17.908  -6.338  -16.876 1.00 20.81 ?  234  TYR A CE1   1 
ATOM   757  C  CE2   . TYR A 1  106 ? 19.826  -5.706  -15.575 1.00 23.03 ?  234  TYR A CE2   1 
ATOM   758  C  CZ    . TYR A 1  106 ? 18.528  -6.178  -15.645 1.00 23.50 ?  234  TYR A CZ    1 
ATOM   759  O  OH    . TYR A 1  106 ? 17.870  -6.490  -14.467 1.00 24.67 ?  234  TYR A OH    1 
ATOM   760  N  N     . GLN A 1  107 ? 21.664  -2.360  -18.250 1.00 22.74 ?  235  GLN A N     1 
ATOM   761  C  CA    . GLN A 1  107 ? 21.793  -1.494  -17.084 1.00 21.58 ?  235  GLN A CA    1 
ATOM   762  C  C     . GLN A 1  107 ? 21.216  -0.113  -17.358 1.00 21.87 ?  235  GLN A C     1 
ATOM   763  O  O     . GLN A 1  107 ? 20.632  0.497   -16.477 1.00 21.52 ?  235  GLN A O     1 
ATOM   764  C  CB    . GLN A 1  107 ? 23.254  -1.373  -16.645 1.00 21.58 ?  235  GLN A CB    1 
ATOM   765  C  CG    . GLN A 1  107 ? 23.849  -2.688  -16.190 1.00 24.69 ?  235  GLN A CG    1 
ATOM   766  C  CD    . GLN A 1  107 ? 25.316  -2.558  -15.825 1.00 33.09 ?  235  GLN A CD    1 
ATOM   767  O  OE1   . GLN A 1  107 ? 25.917  -1.495  -16.000 1.00 35.33 ?  235  GLN A OE1   1 
ATOM   768  N  NE2   . GLN A 1  107 ? 25.912  -3.653  -15.347 1.00 34.79 ?  235  GLN A NE2   1 
ATOM   769  N  N     . THR A 1  108 ? 21.385  0.378   -18.577 1.00 21.30 ?  236  THR A N     1 
ATOM   770  C  CA    . THR A 1  108 ? 20.876  1.691   -18.922 1.00 20.88 ?  236  THR A CA    1 
ATOM   771  C  C     . THR A 1  108 ? 19.352  1.686   -19.063 1.00 19.77 ?  236  THR A C     1 
ATOM   772  O  O     . THR A 1  108 ? 18.672  2.594   -18.588 1.00 19.03 ?  236  THR A O     1 
ATOM   773  C  CB    . THR A 1  108 ? 21.512  2.201   -20.217 1.00 22.61 ?  236  THR A CB    1 
ATOM   774  O  OG1   . THR A 1  108 ? 22.938  2.128   -20.095 1.00 25.33 ?  236  THR A OG1   1 
ATOM   775  C  CG2   . THR A 1  108 ? 21.095  3.650   -20.470 1.00 22.78 ?  236  THR A CG2   1 
ATOM   776  N  N     . MET A 1  109 ? 18.809  0.643   -19.681 1.00 20.30 ?  237  MET A N     1 
ATOM   777  C  CA    . MET A 1  109 ? 17.357  0.558   -19.798 1.00 18.31 ?  237  MET A CA    1 
ATOM   778  C  C     . MET A 1  109 ? 16.720  0.412   -18.420 1.00 20.61 ?  237  MET A C     1 
ATOM   779  O  O     . MET A 1  109 ? 15.653  0.968   -18.161 1.00 18.52 ?  237  MET A O     1 
ATOM   780  C  CB    . MET A 1  109 ? 16.944  -0.610  -20.700 1.00 17.51 ?  237  MET A CB    1 
ATOM   781  C  CG    . MET A 1  109 ? 17.268  -0.402  -22.181 1.00 19.07 ?  237  MET A CG    1 
ATOM   782  S  SD    . MET A 1  109 ? 16.304  0.966   -22.908 1.00 21.86 ?  237  MET A SD    1 
ATOM   783  C  CE    . MET A 1  109 ? 14.658  0.248   -22.968 1.00 22.45 ?  237  MET A CE    1 
ATOM   784  N  N     . LYS A 1  110 ? 17.374  -0.341  -17.540 1.00 19.46 ?  238  LYS A N     1 
ATOM   785  C  CA    . LYS A 1  110 ? 16.839  -0.517  -16.197 1.00 19.20 ?  238  LYS A CA    1 
ATOM   786  C  C     . LYS A 1  110 ? 16.837  0.835   -15.473 1.00 20.52 ?  238  LYS A C     1 
ATOM   787  O  O     . LYS A 1  110 ? 15.855  1.206   -14.834 1.00 22.31 ?  238  LYS A O     1 
ATOM   788  C  CB    . LYS A 1  110 ? 17.645  -1.567  -15.413 1.00 17.10 ?  238  LYS A CB    1 
ATOM   789  C  CG    . LYS A 1  110 ? 17.021  -1.932  -14.081 1.00 22.73 ?  238  LYS A CG    1 
ATOM   790  C  CD    . LYS A 1  110 ? 17.652  -3.195  -13.487 1.00 26.99 ?  238  LYS A CD    1 
ATOM   791  C  CE    . LYS A 1  110 ? 16.978  -3.583  -12.163 1.00 29.21 ?  238  LYS A CE    1 
ATOM   792  N  NZ    . LYS A 1  110 ? 15.479  -3.777  -12.254 1.00 29.44 ?  238  LYS A NZ    1 
ATOM   793  N  N     . LEU A 1  111 ? 17.940  1.563   -15.576 1.00 18.77 ?  239  LEU A N     1 
ATOM   794  C  CA    . LEU A 1  111 ? 18.038  2.891   -14.997 1.00 20.69 ?  239  LEU A CA    1 
ATOM   795  C  C     . LEU A 1  111 ? 16.937  3.841   -15.504 1.00 21.74 ?  239  LEU A C     1 
ATOM   796  O  O     . LEU A 1  111 ? 16.246  4.509   -14.730 1.00 22.97 ?  239  LEU A O     1 
ATOM   797  C  CB    . LEU A 1  111 ? 19.415  3.495   -15.320 1.00 22.77 ?  239  LEU A CB    1 
ATOM   798  C  CG    . LEU A 1  111 ? 19.640  4.922   -14.811 1.00 25.73 ?  239  LEU A CG    1 
ATOM   799  C  CD1   . LEU A 1  111 ? 19.682  4.951   -13.289 1.00 27.20 ?  239  LEU A CD1   1 
ATOM   800  C  CD2   . LEU A 1  111 ? 20.909  5.548   -15.396 1.00 27.78 ?  239  LEU A CD2   1 
ATOM   801  N  N     . PHE A 1  112 ? 16.789  3.911   -16.821 1.00 19.56 ?  240  PHE A N     1 
ATOM   802  C  CA    . PHE A 1  112 ? 15.868  4.872   -17.415 1.00 18.14 ?  240  PHE A CA    1 
ATOM   803  C  C     . PHE A 1  112 ? 14.400  4.487   -17.145 1.00 17.59 ?  240  PHE A C     1 
ATOM   804  O  O     . PHE A 1  112 ? 13.584  5.351   -16.812 1.00 17.32 ?  240  PHE A O     1 
ATOM   805  C  CB    . PHE A 1  112 ? 16.127  4.990   -18.921 1.00 19.08 ?  240  PHE A CB    1 
ATOM   806  C  CG    . PHE A 1  112 ? 17.372  5.762   -19.275 1.00 23.01 ?  240  PHE A CG    1 
ATOM   807  C  CD1   . PHE A 1  112 ? 18.041  6.511   -18.323 1.00 21.86 ?  240  PHE A CD1   1 
ATOM   808  C  CD2   . PHE A 1  112 ? 17.867  5.734   -20.572 1.00 23.63 ?  240  PHE A CD2   1 
ATOM   809  C  CE1   . PHE A 1  112 ? 19.181  7.224   -18.660 1.00 25.82 ?  240  PHE A CE1   1 
ATOM   810  C  CE2   . PHE A 1  112 ? 19.003  6.441   -20.910 1.00 23.99 ?  240  PHE A CE2   1 
ATOM   811  C  CZ    . PHE A 1  112 ? 19.663  7.179   -19.949 1.00 25.51 ?  240  PHE A CZ    1 
ATOM   812  N  N     . THR A 1  113 ? 14.070  3.200   -17.267 1.00 17.71 ?  241  THR A N     1 
ATOM   813  C  CA    . THR A 1  113 ? 12.674  2.773   -17.165 1.00 18.81 ?  241  THR A CA    1 
ATOM   814  C  C     . THR A 1  113 ? 12.206  2.821   -15.740 1.00 21.89 ?  241  THR A C     1 
ATOM   815  O  O     . THR A 1  113 ? 11.007  2.744   -15.478 1.00 23.45 ?  241  THR A O     1 
ATOM   816  C  CB    . THR A 1  113 ? 12.412  1.328   -17.706 1.00 17.06 ?  241  THR A CB    1 
ATOM   817  O  OG1   . THR A 1  113 ? 13.206  0.366   -16.982 1.00 17.23 ?  241  THR A OG1   1 
ATOM   818  C  CG2   . THR A 1  113 ? 12.696  1.224   -19.204 1.00 19.43 ?  241  THR A CG2   1 
ATOM   819  N  N     . GLN A 1  114 ? 13.130  2.954   -14.799 1.00 23.05 ?  242  GLN A N     1 
ATOM   820  C  CA    . GLN A 1  114 ? 12.691  2.995   -13.417 1.00 25.56 ?  242  GLN A CA    1 
ATOM   821  C  C     . GLN A 1  114 ? 12.399  4.430   -12.992 1.00 23.99 ?  242  GLN A C     1 
ATOM   822  O  O     . GLN A 1  114 ? 11.892  4.668   -11.896 1.00 20.98 ?  242  GLN A O     1 
ATOM   823  C  CB    . GLN A 1  114 ? 13.709  2.306   -12.508 1.00 30.92 ?  242  GLN A CB    1 
ATOM   824  C  CG    . GLN A 1  114 ? 13.531  0.797   -12.597 1.00 35.67 ?  242  GLN A CG    1 
ATOM   825  C  CD    . GLN A 1  114 ? 14.576  -0.003  -11.839 1.00 39.92 ?  242  GLN A CD    1 
ATOM   826  O  OE1   . GLN A 1  114 ? 14.409  -1.208  -11.648 1.00 39.57 ?  242  GLN A OE1   1 
ATOM   827  N  NE2   . GLN A 1  114 ? 15.664  0.654   -11.419 1.00 42.17 ?  242  GLN A NE2   1 
ATOM   828  N  N     . ILE A 1  115 ? 12.655  5.382   -13.893 1.00 20.75 ?  243  ILE A N     1 
ATOM   829  C  CA    . ILE A 1  115 ? 12.220  6.756   -13.679 1.00 17.59 ?  243  ILE A CA    1 
ATOM   830  C  C     . ILE A 1  115 ? 10.702  6.894   -13.890 1.00 17.37 ?  243  ILE A C     1 
ATOM   831  O  O     . ILE A 1  115 ? 10.164  6.421   -14.879 1.00 16.41 ?  243  ILE A O     1 
ATOM   832  C  CB    . ILE A 1  115 ? 12.943  7.739   -14.631 1.00 19.29 ?  243  ILE A CB    1 
ATOM   833  C  CG1   . ILE A 1  115 ? 14.461  7.586   -14.504 1.00 21.53 ?  243  ILE A CG1   1 
ATOM   834  C  CG2   . ILE A 1  115 ? 12.534  9.171   -14.338 1.00 18.70 ?  243  ILE A CG2   1 
ATOM   835  C  CD1   . ILE A 1  115 ? 15.210  8.222   -15.654 1.00 24.14 ?  243  ILE A CD1   1 
ATOM   836  N  N     . PHE A 1  116 ? 10.023  7.532   -12.939 1.00 17.83 ?  244  PHE A N     1 
ATOM   837  C  CA    . PHE A 1  116 ? 8.597   7.837   -13.066 1.00 16.25 ?  244  PHE A CA    1 
ATOM   838  C  C     . PHE A 1  116 ? 8.375   8.729   -14.290 1.00 16.48 ?  244  PHE A C     1 
ATOM   839  O  O     . PHE A 1  116 ? 8.973   9.807   -14.406 1.00 16.15 ?  244  PHE A O     1 
ATOM   840  C  CB    . PHE A 1  116 ? 8.114   8.517   -11.768 1.00 17.95 ?  244  PHE A CB    1 
ATOM   841  C  CG    . PHE A 1  116 ? 6.651   8.885   -11.740 1.00 18.17 ?  244  PHE A CG    1 
ATOM   842  C  CD1   . PHE A 1  116 ? 5.664   7.944   -12.004 1.00 17.21 ?  244  PHE A CD1   1 
ATOM   843  C  CD2   . PHE A 1  116 ? 6.267   10.172  -11.376 1.00 21.57 ?  244  PHE A CD2   1 
ATOM   844  C  CE1   . PHE A 1  116 ? 4.310   8.305   -11.956 1.00 18.15 ?  244  PHE A CE1   1 
ATOM   845  C  CE2   . PHE A 1  116 ? 4.909   10.529  -11.296 1.00 21.90 ?  244  PHE A CE2   1 
ATOM   846  C  CZ    . PHE A 1  116 ? 3.943   9.599   -11.592 1.00 19.86 ?  244  PHE A CZ    1 
ATOM   847  N  N     . GLY A 1  117 ? 7.531   8.265   -15.213 1.00 15.38 ?  245  GLY A N     1 
ATOM   848  C  CA    . GLY A 1  117 ? 7.209   9.022   -16.410 1.00 16.57 ?  245  GLY A CA    1 
ATOM   849  C  C     . GLY A 1  117 ? 7.960   8.512   -17.630 1.00 16.86 ?  245  GLY A C     1 
ATOM   850  O  O     . GLY A 1  117 ? 7.794   9.028   -18.731 1.00 16.62 ?  245  GLY A O     1 
ATOM   851  N  N     . VAL A 1  118 ? 8.763   7.474   -17.437 1.00 15.25 ?  246  VAL A N     1 
ATOM   852  C  CA    . VAL A 1  118 ? 9.535   6.894   -18.524 1.00 16.52 ?  246  VAL A CA    1 
ATOM   853  C  C     . VAL A 1  118 ? 9.159   5.431   -18.725 1.00 17.61 ?  246  VAL A C     1 
ATOM   854  O  O     . VAL A 1  118 ? 9.195   4.638   -17.779 1.00 19.31 ?  246  VAL A O     1 
ATOM   855  C  CB    . VAL A 1  118 ? 11.041  7.000   -18.253 1.00 17.56 ?  246  VAL A CB    1 
ATOM   856  C  CG1   . VAL A 1  118 ? 11.838  6.341   -19.408 1.00 18.44 ?  246  VAL A CG1   1 
ATOM   857  C  CG2   . VAL A 1  118 ? 11.434  8.473   -18.078 1.00 19.08 ?  246  VAL A CG2   1 
ATOM   858  N  N     . GLY A 1  119 ? 8.802   5.064   -19.951 1.00 19.43 ?  247  GLY A N     1 
ATOM   859  C  CA    . GLY A 1  119 ? 8.541   3.674   -20.271 1.00 18.35 ?  247  GLY A CA    1 
ATOM   860  C  C     . GLY A 1  119 ? 9.628   3.114   -21.167 1.00 18.42 ?  247  GLY A C     1 
ATOM   861  O  O     . GLY A 1  119 ? 10.614  3.789   -21.476 1.00 17.21 ?  247  GLY A O     1 
ATOM   862  N  N     . VAL A 1  120 ? 9.457   1.859   -21.577 1.00 15.33 ?  248  VAL A N     1 
ATOM   863  C  CA    . VAL A 1  120 ? 10.434  1.220   -22.452 1.00 16.06 ?  248  VAL A CA    1 
ATOM   864  C  C     . VAL A 1  120 ? 10.691  2.011   -23.742 1.00 19.79 ?  248  VAL A C     1 
ATOM   865  O  O     . VAL A 1  120 ? 11.842  2.164   -24.152 1.00 19.97 ?  248  VAL A O     1 
ATOM   866  C  CB    . VAL A 1  120 ? 9.988   -0.203  -22.794 1.00 21.06 ?  248  VAL A CB    1 
ATOM   867  C  CG1   . VAL A 1  120 ? 10.857  -0.788  -23.890 1.00 22.94 ?  248  VAL A CG1   1 
ATOM   868  C  CG2   . VAL A 1  120 ? 10.078  -1.072  -21.536 1.00 21.93 ?  248  VAL A CG2   1 
ATOM   869  N  N     . LYS A 1  121 ? 9.643   2.529   -24.384 1.00 18.58 ?  249  LYS A N     1 
ATOM   870  C  CA    . LYS A 1  121 ? 9.879   3.204   -25.660 1.00 21.29 ?  249  LYS A CA    1 
ATOM   871  C  C     . LYS A 1  121 ? 10.713  4.471   -25.489 1.00 21.74 ?  249  LYS A C     1 
ATOM   872  O  O     . LYS A 1  121 ? 11.609  4.745   -26.297 1.00 24.58 ?  249  LYS A O     1 
ATOM   873  C  CB    . LYS A 1  121 ? 8.556   3.520   -26.366 1.00 24.11 ?  249  LYS A CB    1 
ATOM   874  C  CG    . LYS A 1  121 ? 7.863   2.265   -26.857 1.00 27.32 ?  249  LYS A CG    1 
ATOM   875  C  CD    . LYS A 1  121 ? 6.624   2.577   -27.672 1.00 33.80 ?  249  LYS A CD    1 
ATOM   876  C  CE    . LYS A 1  121 ? 6.246   1.385   -28.544 1.00 38.68 ?  249  LYS A CE    1 
ATOM   877  N  NZ    . LYS A 1  121 ? 4.796   1.064   -28.458 1.00 43.13 ?  249  LYS A NZ    1 
ATOM   878  N  N     . THR A 1  122 ? 10.445  5.233   -24.440 1.00 20.19 ?  250  THR A N     1 
ATOM   879  C  CA    . THR A 1  122 ? 11.223  6.449   -24.195 1.00 20.48 ?  250  THR A CA    1 
ATOM   880  C  C     . THR A 1  122 ? 12.663  6.098   -23.806 1.00 20.49 ?  250  THR A C     1 
ATOM   881  O  O     . THR A 1  122 ? 13.599  6.691   -24.316 1.00 21.58 ?  250  THR A O     1 
ATOM   882  C  CB    . THR A 1  122 ? 10.584  7.328   -23.103 1.00 20.90 ?  250  THR A CB    1 
ATOM   883  O  OG1   . THR A 1  122 ? 9.301   7.785   -23.565 1.00 20.63 ?  250  THR A OG1   1 
ATOM   884  C  CG2   . THR A 1  122 ? 11.455  8.543   -22.820 1.00 22.52 ?  250  THR A CG2   1 
ATOM   885  N  N     . ALA A 1  123 ? 12.839  5.127   -22.919 1.00 17.29 ?  251  ALA A N     1 
ATOM   886  C  CA    . ALA A 1  123 ? 14.188  4.714   -22.520 1.00 17.31 ?  251  ALA A CA    1 
ATOM   887  C  C     . ALA A 1  123 ? 15.002  4.245   -23.723 1.00 21.38 ?  251  ALA A C     1 
ATOM   888  O  O     . ALA A 1  123 ? 16.189  4.571   -23.849 1.00 22.05 ?  251  ALA A O     1 
ATOM   889  C  CB    . ALA A 1  123 ? 14.125  3.622   -21.470 1.00 17.78 ?  251  ALA A CB    1 
ATOM   890  N  N     . ASP A 1  124 ? 14.363  3.480   -24.605 1.00 22.63 ?  252  ASP A N     1 
ATOM   891  C  CA    . ASP A 1  124 ? 15.018  2.984   -25.815 1.00 23.58 ?  252  ASP A CA    1 
ATOM   892  C  C     . ASP A 1  124 ? 15.444  4.107   -26.757 1.00 25.05 ?  252  ASP A C     1 
ATOM   893  O  O     . ASP A 1  124 ? 16.550  4.097   -27.291 1.00 28.53 ?  252  ASP A O     1 
ATOM   894  C  CB    . ASP A 1  124 ? 14.095  2.011   -26.563 1.00 23.60 ?  252  ASP A CB    1 
ATOM   895  C  CG    . ASP A 1  124 ? 14.675  1.560   -27.880 1.00 27.43 ?  252  ASP A CG    1 
ATOM   896  O  OD1   . ASP A 1  124 ? 15.693  0.824   -27.862 1.00 26.29 ?  252  ASP A OD1   1 
ATOM   897  O  OD2   . ASP A 1  124 ? 14.123  1.943   -28.941 1.00 27.07 ?  252  ASP A OD2   1 
ATOM   898  N  N     . ARG A 1  125 ? 14.563  5.077   -26.964 1.00 26.74 ?  253  ARG A N     1 
ATOM   899  C  CA    . ARG A 1  125 ? 14.895  6.227   -27.807 1.00 27.84 ?  253  ARG A CA    1 
ATOM   900  C  C     . ARG A 1  125 ? 16.086  6.978   -27.225 1.00 26.07 ?  253  ARG A C     1 
ATOM   901  O  O     . ARG A 1  125 ? 17.037  7.297   -27.935 1.00 28.04 ?  253  ARG A O     1 
ATOM   902  C  CB    . ARG A 1  125 ? 13.690  7.168   -27.951 1.00 28.16 ?  253  ARG A CB    1 
ATOM   903  C  CG    . ARG A 1  125 ? 13.997  8.405   -28.783 1.00 31.98 ?  253  ARG A CG    1 
ATOM   904  C  CD    . ARG A 1  125 ? 12.730  9.158   -29.157 1.00 32.53 ?  253  ARG A CD    1 
ATOM   905  N  NE    . ARG A 1  125 ? 11.961  9.561   -27.982 1.00 31.48 ?  253  ARG A NE    1 
ATOM   906  C  CZ    . ARG A 1  125 ? 12.308  10.560  -27.180 1.00 31.86 ?  253  ARG A CZ    1 
ATOM   907  N  NH1   . ARG A 1  125 ? 13.422  11.254  -27.420 1.00 32.58 ?  253  ARG A NH1   1 
ATOM   908  N  NH2   . ARG A 1  125 ? 11.550  10.865  -26.139 1.00 32.01 ?  253  ARG A NH2   1 
ATOM   909  N  N     . TRP A 1  126 ? 16.040  7.243   -25.924 1.00 24.70 ?  254  TRP A N     1 
ATOM   910  C  CA    . TRP A 1  126 ? 17.155  7.917   -25.252 1.00 25.82 ?  254  TRP A CA    1 
ATOM   911  C  C     . TRP A 1  126 ? 18.459  7.153   -25.401 1.00 26.89 ?  254  TRP A C     1 
ATOM   912  O  O     . TRP A 1  126 ? 19.502  7.731   -25.710 1.00 27.15 ?  254  TRP A O     1 
ATOM   913  C  CB    . TRP A 1  126 ? 16.850  8.110   -23.771 1.00 24.70 ?  254  TRP A CB    1 
ATOM   914  C  CG    . TRP A 1  126 ? 15.854  9.177   -23.512 1.00 25.73 ?  254  TRP A CG    1 
ATOM   915  C  CD1   . TRP A 1  126 ? 15.417  10.117  -24.389 1.00 28.12 ?  254  TRP A CD1   1 
ATOM   916  C  CD2   . TRP A 1  126 ? 15.161  9.416   -22.279 1.00 24.45 ?  254  TRP A CD2   1 
ATOM   917  N  NE1   . TRP A 1  126 ? 14.496  10.939  -23.780 1.00 28.60 ?  254  TRP A NE1   1 
ATOM   918  C  CE2   . TRP A 1  126 ? 14.324  10.528  -22.482 1.00 24.07 ?  254  TRP A CE2   1 
ATOM   919  C  CE3   . TRP A 1  126 ? 15.178  8.796   -21.019 1.00 23.47 ?  254  TRP A CE3   1 
ATOM   920  C  CZ2   . TRP A 1  126 ? 13.493  11.033  -21.478 1.00 23.48 ?  254  TRP A CZ2   1 
ATOM   921  C  CZ3   . TRP A 1  126 ? 14.356  9.301   -20.015 1.00 24.01 ?  254  TRP A CZ3   1 
ATOM   922  C  CH2   . TRP A 1  126 ? 13.531  10.413  -20.253 1.00 22.50 ?  254  TRP A CH2   1 
ATOM   923  N  N     . TYR A 1  127 ? 18.391  5.850   -25.181 1.00 25.49 ?  255  TYR A N     1 
ATOM   924  C  CA    . TYR A 1  127 ? 19.557  5.002   -25.364 1.00 26.07 ?  255  TYR A CA    1 
ATOM   925  C  C     . TYR A 1  127 ? 20.137  5.116   -26.777 1.00 27.59 ?  255  TYR A C     1 
ATOM   926  O  O     . TYR A 1  127 ? 21.360  5.282   -26.963 1.00 26.91 ?  255  TYR A O     1 
ATOM   927  C  CB    . TYR A 1  127 ? 19.191  3.544   -25.068 1.00 24.52 ?  255  TYR A CB    1 
ATOM   928  C  CG    . TYR A 1  127 ? 20.401  2.664   -25.014 1.00 25.57 ?  255  TYR A CG    1 
ATOM   929  C  CD1   . TYR A 1  127 ? 21.104  2.512   -23.832 1.00 26.10 ?  255  TYR A CD1   1 
ATOM   930  C  CD2   . TYR A 1  127 ? 20.879  2.022   -26.158 1.00 27.21 ?  255  TYR A CD2   1 
ATOM   931  C  CE1   . TYR A 1  127 ? 22.243  1.723   -23.773 1.00 27.69 ?  255  TYR A CE1   1 
ATOM   932  C  CE2   . TYR A 1  127 ? 22.007  1.232   -26.107 1.00 28.32 ?  255  TYR A CE2   1 
ATOM   933  C  CZ    . TYR A 1  127 ? 22.685  1.084   -24.908 1.00 29.20 ?  255  TYR A CZ    1 
ATOM   934  O  OH    . TYR A 1  127 ? 23.816  0.301   -24.847 1.00 31.73 ?  255  TYR A OH    1 
ATOM   935  N  N     . ARG A 1  128 ? 19.261  5.014   -27.774 1.00 27.21 ?  256  ARG A N     1 
ATOM   936  C  CA    . ARG A 1  128 ? 19.674  5.101   -29.175 1.00 28.89 ?  256  ARG A CA    1 
ATOM   937  C  C     . ARG A 1  128 ? 20.236  6.480   -29.510 1.00 31.19 ?  256  ARG A C     1 
ATOM   938  O  O     . ARG A 1  128 ? 21.057  6.628   -30.421 1.00 33.76 ?  256  ARG A O     1 
ATOM   939  C  CB    . ARG A 1  128 ? 18.497  4.785   -30.099 1.00 31.56 ?  256  ARG A CB    1 
ATOM   940  C  CG    . ARG A 1  128 ? 18.035  3.345   -30.071 1.00 31.78 ?  256  ARG A CG    1 
ATOM   941  C  CD    . ARG A 1  128 ? 16.995  3.096   -31.149 1.00 35.87 ?  256  ARG A CD    1 
ATOM   942  N  NE    . ARG A 1  128 ? 15.646  3.481   -30.738 1.00 38.07 ?  256  ARG A NE    1 
ATOM   943  C  CZ    . ARG A 1  128 ? 14.974  4.535   -31.194 1.00 40.75 ?  256  ARG A CZ    1 
ATOM   944  N  NH1   . ARG A 1  128 ? 15.516  5.345   -32.091 1.00 42.83 ?  256  ARG A NH1   1 
ATOM   945  N  NH2   . ARG A 1  128 ? 13.748  4.779   -30.741 1.00 42.40 ?  256  ARG A NH2   1 
ATOM   946  N  N     . GLU A 1  129 ? 19.792  7.487   -28.768 1.00 29.80 ?  257  GLU A N     1 
ATOM   947  C  CA    . GLU A 1  129 ? 20.289  8.849   -28.942 1.00 33.68 ?  257  GLU A CA    1 
ATOM   948  C  C     . GLU A 1  129 ? 21.645  9.010   -28.280 1.00 33.17 ?  257  GLU A C     1 
ATOM   949  O  O     . GLU A 1  129 ? 22.304  10.035  -28.444 1.00 37.34 ?  257  GLU A O     1 
ATOM   950  C  CB    . GLU A 1  129 ? 19.299  9.861   -28.369 1.00 34.64 ?  257  GLU A CB    1 
ATOM   951  C  CG    . GLU A 1  129 ? 18.089  10.139  -29.264 1.00 36.84 ?  257  GLU A CG    1 
ATOM   952  C  CD    . GLU A 1  129 ? 16.993  10.887  -28.524 1.00 37.29 ?  257  GLU A CD    1 
ATOM   953  O  OE1   . GLU A 1  129 ? 17.254  11.313  -27.385 1.00 36.44 ?  257  GLU A OE1   1 
ATOM   954  O  OE2   . GLU A 1  129 ? 15.875  11.036  -29.065 1.00 36.79 ?  257  GLU A OE2   1 
ATOM   955  N  N     . GLY A 1  130 ? 22.060  7.995   -27.530 1.00 31.19 ?  258  GLY A N     1 
ATOM   956  C  CA    . GLY A 1  130 ? 23.385  7.981   -26.936 1.00 31.89 ?  258  GLY A CA    1 
ATOM   957  C  C     . GLY A 1  130 ? 23.429  8.338   -25.465 1.00 31.45 ?  258  GLY A C     1 
ATOM   958  O  O     . GLY A 1  130 ? 24.500  8.384   -24.867 1.00 32.15 ?  258  GLY A O     1 
ATOM   959  N  N     . LEU A 1  131 ? 22.263  8.587   -24.876 1.00 29.47 ?  259  LEU A N     1 
ATOM   960  C  CA    . LEU A 1  131 ? 22.186  9.010   -23.482 1.00 30.03 ?  259  LEU A CA    1 
ATOM   961  C  C     . LEU A 1  131 ? 22.390  7.800   -22.591 1.00 28.01 ?  259  LEU A C     1 
ATOM   962  O  O     . LEU A 1  131 ? 21.983  6.705   -22.955 1.00 25.28 ?  259  LEU A O     1 
ATOM   963  C  CB    . LEU A 1  131 ? 20.843  9.679   -23.196 1.00 29.35 ?  259  LEU A CB    1 
ATOM   964  C  CG    . LEU A 1  131 ? 20.551  10.901  -24.076 1.00 31.64 ?  259  LEU A CG    1 
ATOM   965  C  CD1   . LEU A 1  131 ? 19.092  11.304  -23.978 1.00 31.37 ?  259  LEU A CD1   1 
ATOM   966  C  CD2   . LEU A 1  131 ? 21.456  12.050  -23.691 1.00 35.15 ?  259  LEU A CD2   1 
ATOM   967  N  N     . ARG A 1  132 ? 23.034  7.987   -21.443 1.00 26.08 ?  260  ARG A N     1 
ATOM   968  C  CA    . ARG A 1  132 ? 23.413  6.846   -20.615 1.00 26.35 ?  260  ARG A CA    1 
ATOM   969  C  C     . ARG A 1  132 ? 23.158  7.059   -19.122 1.00 26.85 ?  260  ARG A C     1 
ATOM   970  O  O     . ARG A 1  132 ? 22.975  6.102   -18.375 1.00 27.80 ?  260  ARG A O     1 
ATOM   971  C  CB    . ARG A 1  132 ? 24.898  6.517   -20.847 1.00 28.73 ?  260  ARG A CB    1 
ATOM   972  C  CG    . ARG A 1  132 ? 25.220  5.979   -22.235 1.00 29.26 ?  260  ARG A CG    1 
ATOM   973  C  CD    . ARG A 1  132 ? 24.535  4.638   -22.480 1.00 27.62 ?  260  ARG A CD    1 
ATOM   974  N  NE    . ARG A 1  132 ? 24.952  4.010   -23.733 1.00 28.12 ?  260  ARG A NE    1 
ATOM   975  C  CZ    . ARG A 1  132 ? 24.340  4.193   -24.902 1.00 29.99 ?  260  ARG A CZ    1 
ATOM   976  N  NH1   . ARG A 1  132 ? 23.278  4.993   -24.990 1.00 29.00 ?  260  ARG A NH1   1 
ATOM   977  N  NH2   . ARG A 1  132 ? 24.780  3.570   -25.986 1.00 29.86 ?  260  ARG A NH2   1 
ATOM   978  N  N     . THR A 1  133 ? 23.142  8.305   -18.671 1.00 26.27 ?  261  THR A N     1 
ATOM   979  C  CA    . THR A 1  133 ? 23.058  8.551   -17.238 1.00 27.09 ?  261  THR A CA    1 
ATOM   980  C  C     . THR A 1  133 ? 21.927  9.511   -16.892 1.00 26.38 ?  261  THR A C     1 
ATOM   981  O  O     . THR A 1  133 ? 21.391  10.185  -17.770 1.00 26.91 ?  261  THR A O     1 
ATOM   982  C  CB    . THR A 1  133 ? 24.354  9.140   -16.698 1.00 29.24 ?  261  THR A CB    1 
ATOM   983  O  OG1   . THR A 1  133 ? 24.480  10.487  -17.168 1.00 31.29 ?  261  THR A OG1   1 
ATOM   984  C  CG2   . THR A 1  133 ? 25.561  8.331   -17.167 1.00 31.25 ?  261  THR A CG2   1 
ATOM   985  N  N     . LEU A 1  134 ? 21.588  9.598   -15.611 1.00 25.94 ?  262  LEU A N     1 
ATOM   986  C  CA    . LEU A 1  134 ? 20.568  10.556  -15.174 1.00 27.31 ?  262  LEU A CA    1 
ATOM   987  C  C     . LEU A 1  134 ? 21.020  11.988  -15.459 1.00 30.60 ?  262  LEU A C     1 
ATOM   988  O  O     . LEU A 1  134 ? 20.225  12.852  -15.831 1.00 33.05 ?  262  LEU A O     1 
ATOM   989  C  CB    . LEU A 1  134 ? 20.272  10.393  -13.685 1.00 28.81 ?  262  LEU A CB    1 
ATOM   990  C  CG    . LEU A 1  134 ? 19.724  9.035   -13.243 1.00 28.85 ?  262  LEU A CG    1 
ATOM   991  C  CD1   . LEU A 1  134 ? 19.334  9.084   -11.762 1.00 28.92 ?  262  LEU A CD1   1 
ATOM   992  C  CD2   . LEU A 1  134 ? 18.552  8.614   -14.106 1.00 26.73 ?  262  LEU A CD2   1 
ATOM   993  N  N     . ASP A 1  135 ? 22.308  12.240  -15.286 1.00 32.26 ?  263  ASP A N     1 
ATOM   994  C  CA    . ASP A 1  135 ? 22.818  13.579  -15.542 1.00 34.35 ?  263  ASP A CA    1 
ATOM   995  C  C     . ASP A 1  135 ? 22.732  13.934  -17.015 1.00 34.19 ?  263  ASP A C     1 
ATOM   996  O  O     . ASP A 1  135 ? 22.529  15.097  -17.351 1.00 38.43 ?  263  ASP A O     1 
ATOM   997  C  CB    . ASP A 1  135 ? 24.243  13.718  -15.025 1.00 37.35 ?  263  ASP A CB    1 
ATOM   998  C  CG    . ASP A 1  135 ? 24.278  13.959  -13.527 1.00 41.44 ?  263  ASP A CG    1 
ATOM   999  O  OD1   . ASP A 1  135 ? 23.215  14.311  -12.948 1.00 42.71 ?  263  ASP A OD1   1 
ATOM   1000 O  OD2   . ASP A 1  135 ? 25.346  13.790  -12.924 1.00 41.18 ?  263  ASP A OD2   1 
ATOM   1001 N  N     . ASP A 1  136 ? 22.844  12.945  -17.895 1.00 32.17 ?  264  ASP A N     1 
ATOM   1002 C  CA    . ASP A 1  136 ? 22.624  13.200  -19.318 1.00 31.31 ?  264  ASP A CA    1 
ATOM   1003 C  C     . ASP A 1  136 ? 21.213  13.744  -19.552 1.00 32.11 ?  264  ASP A C     1 
ATOM   1004 O  O     . ASP A 1  136 ? 21.022  14.676  -20.333 1.00 33.33 ?  264  ASP A O     1 
ATOM   1005 C  CB    . ASP A 1  136 ? 22.828  11.936  -20.151 1.00 31.45 ?  264  ASP A CB    1 
ATOM   1006 C  CG    . ASP A 1  136 ? 24.287  11.486  -20.208 1.00 35.18 ?  264  ASP A CG    1 
ATOM   1007 O  OD1   . ASP A 1  136 ? 25.189  12.281  -19.855 1.00 36.89 ?  264  ASP A OD1   1 
ATOM   1008 O  OD2   . ASP A 1  136 ? 24.520  10.326  -20.623 1.00 32.45 ?  264  ASP A OD2   1 
ATOM   1009 N  N     . LEU A 1  137 ? 20.228  13.156  -18.874 1.00 30.18 ?  265  LEU A N     1 
ATOM   1010 C  CA    . LEU A 1  137 ? 18.845  13.604  -19.005 1.00 29.66 ?  265  LEU A CA    1 
ATOM   1011 C  C     . LEU A 1  137 ? 18.667  14.991  -18.401 1.00 31.38 ?  265  LEU A C     1 
ATOM   1012 O  O     . LEU A 1  137 ? 17.952  15.828  -18.949 1.00 34.35 ?  265  LEU A O     1 
ATOM   1013 C  CB    . LEU A 1  137 ? 17.874  12.611  -18.332 1.00 28.67 ?  265  LEU A CB    1 
ATOM   1014 C  CG    . LEU A 1  137 ? 18.080  11.147  -18.707 1.00 26.17 ?  265  LEU A CG    1 
ATOM   1015 C  CD1   . LEU A 1  137 ? 17.227  10.199  -17.846 1.00 22.70 ?  265  LEU A CD1   1 
ATOM   1016 C  CD2   . LEU A 1  137 ? 17.790  10.944  -20.185 1.00 24.79 ?  265  LEU A CD2   1 
ATOM   1017 N  N     . ARG A 1  138 ? 19.323  15.239  -17.276 1.00 31.66 ?  266  ARG A N     1 
ATOM   1018 C  CA    . ARG A 1  138 ? 19.172  16.510  -16.580 1.00 32.90 ?  266  ARG A CA    1 
ATOM   1019 C  C     . ARG A 1  138 ? 19.743  17.678  -17.373 1.00 36.04 ?  266  ARG A C     1 
ATOM   1020 O  O     . ARG A 1  138 ? 19.379  18.834  -17.142 1.00 35.81 ?  266  ARG A O     1 
ATOM   1021 C  CB    . ARG A 1  138 ? 19.833  16.441  -15.212 1.00 33.73 ?  266  ARG A CB    1 
ATOM   1022 C  CG    . ARG A 1  138 ? 19.162  15.433  -14.302 1.00 33.41 ?  266  ARG A CG    1 
ATOM   1023 C  CD    . ARG A 1  138 ? 19.639  15.571  -12.886 1.00 33.99 ?  266  ARG A CD    1 
ATOM   1024 N  NE    . ARG A 1  138 ? 18.830  14.723  -12.019 1.00 34.68 ?  266  ARG A NE    1 
ATOM   1025 C  CZ    . ARG A 1  138 ? 19.279  13.621  -11.436 1.00 36.08 ?  266  ARG A CZ    1 
ATOM   1026 N  NH1   . ARG A 1  138 ? 20.547  13.240  -11.608 1.00 36.45 ?  266  ARG A NH1   1 
ATOM   1027 N  NH2   . ARG A 1  138 ? 18.466  12.917  -10.661 1.00 34.48 ?  266  ARG A NH2   1 
ATOM   1028 N  N     . GLU A 1  139 ? 20.640  17.375  -18.301 1.00 37.04 ?  267  GLU A N     1 
ATOM   1029 C  CA    . GLU A 1  139 ? 21.237  18.408  -19.144 1.00 41.44 ?  267  GLU A CA    1 
ATOM   1030 C  C     . GLU A 1  139 ? 20.359  18.775  -20.344 1.00 45.02 ?  267  GLU A C     1 
ATOM   1031 O  O     . GLU A 1  139 ? 20.671  19.709  -21.074 1.00 49.24 ?  267  GLU A O     1 
ATOM   1032 C  CB    . GLU A 1  139 ? 22.617  17.963  -19.622 1.00 44.13 ?  267  GLU A CB    1 
ATOM   1033 C  CG    . GLU A 1  139 ? 23.706  18.065  -18.557 1.00 46.81 ?  267  GLU A CG    1 
ATOM   1034 N  N     . GLN A 1  140 ? 19.260  18.052  -20.545 1.00 46.08 ?  268  GLN A N     1 
ATOM   1035 C  CA    . GLN A 1  140 ? 18.313  18.384  -21.616 1.00 47.98 ?  268  GLN A CA    1 
ATOM   1036 C  C     . GLN A 1  140 ? 16.887  18.593  -21.096 1.00 46.77 ?  268  GLN A C     1 
ATOM   1037 O  O     . GLN A 1  140 ? 15.959  17.913  -21.538 1.00 45.68 ?  268  GLN A O     1 
ATOM   1038 C  CB    . GLN A 1  140 ? 18.309  17.282  -22.676 1.00 47.52 ?  268  GLN A CB    1 
ATOM   1039 N  N     . PRO A 1  141 ? 16.703  19.553  -20.175 1.00 46.03 ?  269  PRO A N     1 
ATOM   1040 C  CA    . PRO A 1  141 ? 15.449  19.654  -19.413 1.00 44.81 ?  269  PRO A CA    1 
ATOM   1041 C  C     . PRO A 1  141 ? 14.218  19.971  -20.268 1.00 44.58 ?  269  PRO A C     1 
ATOM   1042 O  O     . PRO A 1  141 ? 13.118  19.513  -19.948 1.00 41.72 ?  269  PRO A O     1 
ATOM   1043 C  CB    . PRO A 1  141 ? 15.718  20.811  -18.436 1.00 46.59 ?  269  PRO A CB    1 
ATOM   1044 C  CG    . PRO A 1  141 ? 17.186  21.136  -18.560 1.00 46.76 ?  269  PRO A CG    1 
ATOM   1045 C  CD    . PRO A 1  141 ? 17.593  20.695  -19.919 1.00 47.72 ?  269  PRO A CD    1 
ATOM   1046 N  N     . GLN A 1  142 ? 14.404  20.737  -21.338 1.00 44.27 ?  270  GLN A N     1 
ATOM   1047 C  CA    . GLN A 1  142 ? 13.276  21.220  -22.132 1.00 46.68 ?  270  GLN A CA    1 
ATOM   1048 C  C     . GLN A 1  142 ? 12.589  20.093  -22.896 1.00 45.93 ?  270  GLN A C     1 
ATOM   1049 O  O     . GLN A 1  142 ? 11.480  20.258  -23.401 1.00 50.05 ?  270  GLN A O     1 
ATOM   1050 C  CB    . GLN A 1  142 ? 13.732  22.311  -23.111 1.00 48.90 ?  270  GLN A CB    1 
ATOM   1051 N  N     . LYS A 1  143 ? 13.255  18.952  -22.986 1.00 40.01 ?  271  LYS A N     1 
ATOM   1052 C  CA    . LYS A 1  143 ? 12.697  17.806  -23.679 1.00 37.20 ?  271  LYS A CA    1 
ATOM   1053 C  C     . LYS A 1  143 ? 11.835  16.945  -22.739 1.00 35.98 ?  271  LYS A C     1 
ATOM   1054 O  O     . LYS A 1  143 ? 10.987  16.180  -23.193 1.00 39.24 ?  271  LYS A O     1 
ATOM   1055 C  CB    . LYS A 1  143 ? 13.824  16.971  -24.291 1.00 35.98 ?  271  LYS A CB    1 
ATOM   1056 N  N     . LEU A 1  144 ? 12.037  17.087  -21.433 1.00 31.30 ?  272  LEU A N     1 
ATOM   1057 C  CA    . LEU A 1  144 ? 11.344  16.245  -20.447 1.00 26.12 ?  272  LEU A CA    1 
ATOM   1058 C  C     . LEU A 1  144 ? 9.895   16.682  -20.203 1.00 23.32 ?  272  LEU A C     1 
ATOM   1059 O  O     . LEU A 1  144 ? 9.594   17.869  -20.196 1.00 23.80 ?  272  LEU A O     1 
ATOM   1060 C  CB    . LEU A 1  144 ? 12.098  16.264  -19.121 1.00 25.95 ?  272  LEU A CB    1 
ATOM   1061 C  CG    . LEU A 1  144 ? 13.583  15.877  -19.133 1.00 27.18 ?  272  LEU A CG    1 
ATOM   1062 C  CD1   . LEU A 1  144 ? 14.184  16.146  -17.765 1.00 26.98 ?  272  LEU A CD1   1 
ATOM   1063 C  CD2   . LEU A 1  144 ? 13.769  14.419  -19.528 1.00 25.83 ?  272  LEU A CD2   1 
ATOM   1064 N  N     . THR A 1  145 ? 8.997   15.727  -20.010 1.00 22.78 ?  273  THR A N     1 
ATOM   1065 C  CA    . THR A 1  145 ? 7.644   16.038  -19.553 1.00 23.08 ?  273  THR A CA    1 
ATOM   1066 C  C     . THR A 1  145 ? 7.684   16.464  -18.080 1.00 21.99 ?  273  THR A C     1 
ATOM   1067 O  O     . THR A 1  145 ? 8.651   16.165  -17.374 1.00 19.97 ?  273  THR A O     1 
ATOM   1068 C  CB    . THR A 1  145 ? 6.705   14.808  -19.676 1.00 20.69 ?  273  THR A CB    1 
ATOM   1069 O  OG1   . THR A 1  145 ? 7.182   13.771  -18.814 1.00 18.81 ?  273  THR A OG1   1 
ATOM   1070 C  CG2   . THR A 1  145 ? 6.685   14.279  -21.097 1.00 20.64 ?  273  THR A CG2   1 
ATOM   1071 N  N     . GLN A 1  146 ? 6.631   17.120  -17.604 1.00 22.75 ?  274  GLN A N     1 
ATOM   1072 C  CA    . GLN A 1  146 ? 6.556   17.484  -16.184 1.00 22.67 ?  274  GLN A CA    1 
ATOM   1073 C  C     . GLN A 1  146 ? 6.658   16.268  -15.275 1.00 21.40 ?  274  GLN A C     1 
ATOM   1074 O  O     . GLN A 1  146 ? 7.287   16.324  -14.217 1.00 22.20 ?  274  GLN A O     1 
ATOM   1075 C  CB    . GLN A 1  146 ? 5.266   18.251  -15.888 1.00 24.57 ?  274  GLN A CB    1 
ATOM   1076 C  CG    . GLN A 1  146 ? 5.190   19.566  -16.643 1.00 29.03 ?  274  GLN A CG    1 
ATOM   1077 C  CD    . GLN A 1  146 ? 6.394   20.451  -16.364 1.00 37.01 ?  274  GLN A CD    1 
ATOM   1078 O  OE1   . GLN A 1  146 ? 7.168   20.775  -17.270 1.00 41.87 ?  274  GLN A OE1   1 
ATOM   1079 N  NE2   . GLN A 1  146 ? 6.565   20.835  -15.102 1.00 39.82 ?  274  GLN A NE2   1 
ATOM   1080 N  N     . GLN A 1  147 ? 6.062   15.158  -15.694 1.00 20.22 ?  275  GLN A N     1 
ATOM   1081 C  CA    . GLN A 1  147 ? 6.150   13.924  -14.922 1.00 18.28 ?  275  GLN A CA    1 
ATOM   1082 C  C     . GLN A 1  147 ? 7.577   13.396  -14.845 1.00 17.40 ?  275  GLN A C     1 
ATOM   1083 O  O     . GLN A 1  147 ? 8.045   13.001  -13.784 1.00 17.16 ?  275  GLN A O     1 
ATOM   1084 C  CB    . GLN A 1  147 ? 5.241   12.866  -15.527 1.00 20.97 ?  275  GLN A CB    1 
ATOM   1085 C  CG    . GLN A 1  147 ? 4.979   11.685  -14.600 1.00 17.70 ?  275  GLN A CG    1 
ATOM   1086 C  CD    . GLN A 1  147 ? 3.771   10.902  -15.057 1.00 23.65 ?  275  GLN A CD    1 
ATOM   1087 O  OE1   . GLN A 1  147 ? 3.875   10.051  -15.932 1.00 24.95 ?  275  GLN A OE1   1 
ATOM   1088 N  NE2   . GLN A 1  147 ? 2.611   11.222  -14.498 1.00 26.22 ?  275  GLN A NE2   1 
ATOM   1089 N  N     . GLN A 1  148 ? 8.267   13.388  -15.979 1.00 17.90 ?  276  GLN A N     1 
ATOM   1090 C  CA    . GLN A 1  148 ? 9.665   12.969  -16.021 1.00 18.22 ?  276  GLN A CA    1 
ATOM   1091 C  C     . GLN A 1  148 ? 10.550  13.915  -15.196 1.00 17.58 ?  276  GLN A C     1 
ATOM   1092 O  O     . GLN A 1  148 ? 11.467  13.473  -14.509 1.00 19.47 ?  276  GLN A O     1 
ATOM   1093 C  CB    . GLN A 1  148 ? 10.144  12.911  -17.470 1.00 18.29 ?  276  GLN A CB    1 
ATOM   1094 C  CG    . GLN A 1  148 ? 9.618   11.700  -18.228 1.00 19.33 ?  276  GLN A CG    1 
ATOM   1095 C  CD    . GLN A 1  148 ? 9.697   11.866  -19.740 1.00 20.49 ?  276  GLN A CD    1 
ATOM   1096 O  OE1   . GLN A 1  148 ? 10.113  12.908  -20.240 1.00 19.96 ?  276  GLN A OE1   1 
ATOM   1097 N  NE2   . GLN A 1  148 ? 9.274   10.833  -20.475 1.00 20.80 ?  276  GLN A NE2   1 
ATOM   1098 N  N     . LYS A 1  149 ? 10.287  15.213  -15.288 1.00 18.17 ?  277  LYS A N     1 
ATOM   1099 C  CA    . LYS A 1  149 ? 11.028  16.184  -14.486 1.00 19.04 ?  277  LYS A CA    1 
ATOM   1100 C  C     . LYS A 1  149 ? 10.868  15.852  -13.015 1.00 18.58 ?  277  LYS A C     1 
ATOM   1101 O  O     . LYS A 1  149 ? 11.845  15.893  -12.261 1.00 17.86 ?  277  LYS A O     1 
ATOM   1102 C  CB    . LYS A 1  149 ? 10.559  17.607  -14.751 1.00 22.05 ?  277  LYS A CB    1 
ATOM   1103 C  CG    . LYS A 1  149 ? 10.960  18.150  -16.097 1.00 26.99 ?  277  LYS A CG    1 
ATOM   1104 C  CD    . LYS A 1  149 ? 10.467  19.596  -16.244 1.00 34.00 ?  277  LYS A CD    1 
ATOM   1105 C  CE    . LYS A 1  149 ? 10.238  19.978  -17.706 1.00 39.69 ?  277  LYS A CE    1 
ATOM   1106 N  NZ    . LYS A 1  149 ? 11.478  20.387  -18.391 1.00 46.01 ?  277  LYS A NZ    1 
ATOM   1107 N  N     . ALA A 1  150 ? 9.646   15.493  -12.612 1.00 19.67 ?  278  ALA A N     1 
ATOM   1108 C  CA    . ALA A 1  150 ? 9.404   15.140  -11.212 1.00 18.05 ?  278  ALA A CA    1 
ATOM   1109 C  C     . ALA A 1  150 ? 10.093  13.832  -10.862 1.00 16.58 ?  278  ALA A C     1 
ATOM   1110 O  O     . ALA A 1  150 ? 10.650  13.703  -9.777  1.00 16.51 ?  278  ALA A O     1 
ATOM   1111 C  CB    . ALA A 1  150 ? 7.910   15.040  -10.910 1.00 17.30 ?  278  ALA A CB    1 
ATOM   1112 N  N     . GLY A 1  151 ? 10.034  12.845  -11.762 1.00 16.50 ?  279  GLY A N     1 
ATOM   1113 C  CA    . GLY A 1  151 ? 10.671  11.563  -11.496 1.00 15.04 ?  279  GLY A CA    1 
ATOM   1114 C  C     . GLY A 1  151 ? 12.172  11.716  -11.319 1.00 17.08 ?  279  GLY A C     1 
ATOM   1115 O  O     . GLY A 1  151 ? 12.786  11.020  -10.514 1.00 16.95 ?  279  GLY A O     1 
ATOM   1116 N  N     . LEU A 1  152 ? 12.767  12.622  -12.082 1.00 16.72 ?  280  LEU A N     1 
ATOM   1117 C  CA    . LEU A 1  152 ? 14.206  12.829  -11.992 1.00 18.62 ?  280  LEU A CA    1 
ATOM   1118 C  C     . LEU A 1  152 ? 14.551  13.641  -10.756 1.00 20.61 ?  280  LEU A C     1 
ATOM   1119 O  O     . LEU A 1  152 ? 15.520  13.345  -10.064 1.00 19.19 ?  280  LEU A O     1 
ATOM   1120 C  CB    . LEU A 1  152 ? 14.739  13.541  -13.241 1.00 22.70 ?  280  LEU A CB    1 
ATOM   1121 C  CG    . LEU A 1  152 ? 14.995  12.655  -14.454 1.00 28.72 ?  280  LEU A CG    1 
ATOM   1122 C  CD1   . LEU A 1  152 ? 15.277  13.531  -15.651 1.00 32.95 ?  280  LEU A CD1   1 
ATOM   1123 C  CD2   . LEU A 1  152 ? 16.184  11.726  -14.183 1.00 30.27 ?  280  LEU A CD2   1 
ATOM   1124 N  N     . GLN A 1  153 ? 13.760  14.682  -10.502 1.00 20.36 ?  281  GLN A N     1 
ATOM   1125 C  CA    . GLN A 1  153 ? 13.949  15.522  -9.333  1.00 21.10 ?  281  GLN A CA    1 
ATOM   1126 C  C     . GLN A 1  153 ? 13.999  14.686  -8.066  1.00 18.96 ?  281  GLN A C     1 
ATOM   1127 O  O     . GLN A 1  153 ? 14.814  14.940  -7.190  1.00 19.37 ?  281  GLN A O     1 
ATOM   1128 C  CB    . GLN A 1  153 ? 12.825  16.548  -9.235  1.00 22.58 ?  281  GLN A CB    1 
ATOM   1129 C  CG    . GLN A 1  153 ? 12.836  17.350  -7.977  1.00 24.24 ?  281  GLN A CG    1 
ATOM   1130 C  CD    . GLN A 1  153 ? 14.012  18.306  -7.905  1.00 28.07 ?  281  GLN A CD    1 
ATOM   1131 O  OE1   . GLN A 1  153 ? 14.481  18.825  -8.926  1.00 27.71 ?  281  GLN A OE1   1 
ATOM   1132 N  NE2   . GLN A 1  153 ? 14.494  18.550  -6.691  1.00 29.46 ?  281  GLN A NE2   1 
ATOM   1133 N  N     . HIS A 1  154 ? 13.126  13.683  -7.996  1.00 15.50 ?  282  HIS A N     1 
ATOM   1134 C  CA    . HIS A 1  154 ? 12.934  12.912  -6.776  1.00 15.42 ?  282  HIS A CA    1 
ATOM   1135 C  C     . HIS A 1  154 ? 13.480  11.495  -6.895  1.00 15.98 ?  282  HIS A C     1 
ATOM   1136 O  O     . HIS A 1  154 ? 13.159  10.625  -6.091  1.00 15.09 ?  282  HIS A O     1 
ATOM   1137 C  CB    . HIS A 1  154 ? 11.451  12.890  -6.422  1.00 14.77 ?  282  HIS A CB    1 
ATOM   1138 C  CG    . HIS A 1  154 ? 10.934  14.247  -6.087  1.00 14.49 ?  282  HIS A CG    1 
ATOM   1139 N  ND1   . HIS A 1  154 ? 11.386  14.948  -4.992  1.00 15.40 ?  282  HIS A ND1   1 
ATOM   1140 C  CD2   . HIS A 1  154 ? 10.087  15.074  -6.747  1.00 14.86 ?  282  HIS A CD2   1 
ATOM   1141 C  CE1   . HIS A 1  154 ? 10.806  16.138  -4.965  1.00 16.69 ?  282  HIS A CE1   1 
ATOM   1142 N  NE2   . HIS A 1  154 ? 10.013  16.242  -6.020  1.00 15.51 ?  282  HIS A NE2   1 
ATOM   1143 N  N     . HIS A 1  155 ? 14.377  11.298  -7.858  1.00 18.45 ?  283  HIS A N     1 
ATOM   1144 C  CA    . HIS A 1  155 ? 14.779  9.937   -8.222  1.00 17.53 ?  283  HIS A CA    1 
ATOM   1145 C  C     . HIS A 1  155 ? 15.411  9.185   -7.057  1.00 15.65 ?  283  HIS A C     1 
ATOM   1146 O  O     . HIS A 1  155 ? 15.116  8.007   -6.850  1.00 15.14 ?  283  HIS A O     1 
ATOM   1147 C  CB    . HIS A 1  155 ? 15.774  9.971   -9.379  1.00 19.65 ?  283  HIS A CB    1 
ATOM   1148 C  CG    . HIS A 1  155 ? 16.201  8.610   -9.819  1.00 22.99 ?  283  HIS A CG    1 
ATOM   1149 N  ND1   . HIS A 1  155 ? 17.312  7.979   -9.304  1.00 25.13 ?  283  HIS A ND1   1 
ATOM   1150 C  CD2   . HIS A 1  155 ? 15.644  7.741   -10.693 1.00 25.98 ?  283  HIS A CD2   1 
ATOM   1151 C  CE1   . HIS A 1  155 ? 17.436  6.789   -9.862  1.00 27.45 ?  283  HIS A CE1   1 
ATOM   1152 N  NE2   . HIS A 1  155 ? 16.433  6.617   -10.703 1.00 27.68 ?  283  HIS A NE2   1 
ATOM   1153 N  N     . GLN A 1  156 ? 16.321  9.850   -6.337  1.00 15.83 ?  284  GLN A N     1 
ATOM   1154 C  CA    . GLN A 1  156 ? 17.018  9.157   -5.252  1.00 19.62 ?  284  GLN A CA    1 
ATOM   1155 C  C     . GLN A 1  156 ? 16.018  8.669   -4.219  1.00 18.81 ?  284  GLN A C     1 
ATOM   1156 O  O     . GLN A 1  156 ? 16.039  7.504   -3.823  1.00 19.72 ?  284  GLN A O     1 
ATOM   1157 C  CB    . GLN A 1  156 ? 18.066  10.044  -4.587  1.00 21.27 ?  284  GLN A CB    1 
ATOM   1158 C  CG    . GLN A 1  156 ? 18.650  9.427   -3.330  1.00 24.73 ?  284  GLN A CG    1 
ATOM   1159 C  CD    . GLN A 1  156 ? 19.718  10.308  -2.687  1.00 36.97 ?  284  GLN A CD    1 
ATOM   1160 O  OE1   . GLN A 1  156 ? 20.246  11.222  -3.315  1.00 40.24 ?  284  GLN A OE1   1 
ATOM   1161 N  NE2   . GLN A 1  156 ? 20.033  10.032  -1.424  1.00 43.08 ?  284  GLN A NE2   1 
ATOM   1162 N  N     . ASP A 1  157 ? 15.104  9.540   -3.802  1.00 15.16 ?  285  ASP A N     1 
ATOM   1163 C  CA    . ASP A 1  157 ? 14.067  9.101   -2.856  1.00 14.42 ?  285  ASP A CA    1 
ATOM   1164 C  C     . ASP A 1  157 ? 13.159  8.026   -3.430  1.00 14.21 ?  285  ASP A C     1 
ATOM   1165 O  O     . ASP A 1  157 ? 12.798  7.081   -2.731  1.00 15.82 ?  285  ASP A O     1 
ATOM   1166 C  CB    . ASP A 1  157 ? 13.192  10.266  -2.398  1.00 14.27 ?  285  ASP A CB    1 
ATOM   1167 C  CG    . ASP A 1  157 ? 13.886  11.171  -1.381  1.00 17.42 ?  285  ASP A CG    1 
ATOM   1168 O  OD1   . ASP A 1  157 ? 14.988  10.836  -0.857  1.00 18.50 ?  285  ASP A OD1   1 
ATOM   1169 O  OD2   . ASP A 1  157 ? 13.302  12.240  -1.101  1.00 17.27 ?  285  ASP A OD2   1 
ATOM   1170 N  N     . LEU A 1  158 ? 12.756  8.166   -4.684  1.00 13.82 ?  286  LEU A N     1 
ATOM   1171 C  CA    . LEU A 1  158 ? 11.820  7.197   -5.256  1.00 13.46 ?  286  LEU A CA    1 
ATOM   1172 C  C     . LEU A 1  158 ? 12.497  5.846   -5.466  1.00 15.37 ?  286  LEU A C     1 
ATOM   1173 O  O     . LEU A 1  158 ? 11.814  4.830   -5.617  1.00 17.19 ?  286  LEU A O     1 
ATOM   1174 C  CB    . LEU A 1  158 ? 11.246  7.697   -6.567  1.00 14.64 ?  286  LEU A CB    1 
ATOM   1175 C  CG    . LEU A 1  158 ? 10.375  8.962   -6.479  1.00 18.38 ?  286  LEU A CG    1 
ATOM   1176 C  CD1   . LEU A 1  158 ? 9.587   9.193   -7.782  1.00 18.52 ?  286  LEU A CD1   1 
ATOM   1177 C  CD2   . LEU A 1  158 ? 9.494   9.013   -5.240  1.00 17.19 ?  286  LEU A CD2   1 
ATOM   1178 N  N     . SER A 1  159 ? 13.827  5.836   -5.434  1.00 13.77 ?  287  SER A N     1 
ATOM   1179 C  CA    A SER A 1  159 ? 14.574  4.582   -5.543  0.39 15.76 ?  287  SER A CA    1 
ATOM   1180 C  CA    B SER A 1  159 ? 14.622  4.608   -5.540  0.61 16.08 ?  287  SER A CA    1 
ATOM   1181 C  C     . SER A 1  159 ? 14.807  3.923   -4.196  1.00 16.68 ?  287  SER A C     1 
ATOM   1182 O  O     . SER A 1  159 ? 15.336  2.812   -4.114  1.00 19.01 ?  287  SER A O     1 
ATOM   1183 C  CB    A SER A 1  159 ? 15.916  4.825   -6.234  0.39 17.04 ?  287  SER A CB    1 
ATOM   1184 C  CB    B SER A 1  159 ? 16.010  4.911   -6.128  0.61 17.58 ?  287  SER A CB    1 
ATOM   1185 O  OG    A SER A 1  159 ? 15.683  5.302   -7.537  0.39 17.61 ?  287  SER A OG    1 
ATOM   1186 O  OG    B SER A 1  159 ? 16.918  5.216   -5.082  0.61 21.83 ?  287  SER A OG    1 
ATOM   1187 N  N     . THR A 1  160 ? 14.414  4.602   -3.136  1.00 14.44 ?  288  THR A N     1 
ATOM   1188 C  CA    . THR A 1  160 ? 14.581  4.091   -1.785  1.00 16.35 ?  288  THR A CA    1 
ATOM   1189 C  C     . THR A 1  160 ? 13.355  3.250   -1.452  1.00 13.90 ?  288  THR A C     1 
ATOM   1190 O  O     . THR A 1  160 ? 12.250  3.732   -1.611  1.00 13.89 ?  288  THR A O     1 
ATOM   1191 C  CB    . THR A 1  160 ? 14.711  5.247   -0.780  1.00 20.05 ?  288  THR A CB    1 
ATOM   1192 O  OG1   . THR A 1  160 ? 15.859  6.045   -1.124  1.00 19.99 ?  288  THR A OG1   1 
ATOM   1193 C  CG2   . THR A 1  160 ? 14.845  4.723   0.632   1.00 21.81 ?  288  THR A CG2   1 
ATOM   1194 N  N     . PRO A 1  161 ? 13.540  2.008   -0.980  1.00 14.49 ?  289  PRO A N     1 
ATOM   1195 C  CA    . PRO A 1  161 ? 12.318  1.233   -0.690  1.00 15.47 ?  289  PRO A CA    1 
ATOM   1196 C  C     . PRO A 1  161 ? 11.364  1.890   0.302   1.00 14.43 ?  289  PRO A C     1 
ATOM   1197 O  O     . PRO A 1  161 ? 11.783  2.340   1.386   1.00 14.43 ?  289  PRO A O     1 
ATOM   1198 C  CB    . PRO A 1  161 ? 12.868  -0.079  -0.098  1.00 17.81 ?  289  PRO A CB    1 
ATOM   1199 C  CG    . PRO A 1  161 ? 14.243  -0.207  -0.725  1.00 20.99 ?  289  PRO A CG    1 
ATOM   1200 C  CD    . PRO A 1  161 ? 14.770  1.218   -0.800  1.00 17.98 ?  289  PRO A CD    1 
ATOM   1201 N  N     . VAL A 1  162 ? 10.080  1.882   -0.047  1.00 12.65 ?  290  VAL A N     1 
ATOM   1202 C  CA    . VAL A 1  162 ? 9.028   2.307   0.876   1.00 12.73 ?  290  VAL A CA    1 
ATOM   1203 C  C     . VAL A 1  162 ? 8.834   1.208   1.924   1.00 13.60 ?  290  VAL A C     1 
ATOM   1204 O  O     . VAL A 1  162 ? 8.698   0.051   1.565   1.00 11.79 ?  290  VAL A O     1 
ATOM   1205 C  CB    . VAL A 1  162 ? 7.695   2.560   0.140   1.00 12.48 ?  290  VAL A CB    1 
ATOM   1206 C  CG1   . VAL A 1  162 ? 6.666   3.095   1.125   1.00 11.54 ?  290  VAL A CG1   1 
ATOM   1207 C  CG2   . VAL A 1  162 ? 7.928   3.539   -1.032  1.00 12.52 ?  290  VAL A CG2   1 
ATOM   1208 N  N     . LEU A 1  163 ? 8.841   1.575   3.205   1.00 13.49 ?  291  LEU A N     1 
ATOM   1209 C  CA    . LEU A 1  163 ? 8.725   0.594   4.285   1.00 13.94 ?  291  LEU A CA    1 
ATOM   1210 C  C     . LEU A 1  163 ? 7.342   0.597   4.901   1.00 15.52 ?  291  LEU A C     1 
ATOM   1211 O  O     . LEU A 1  163 ? 6.569   1.535   4.717   1.00 13.52 ?  291  LEU A O     1 
ATOM   1212 C  CB    . LEU A 1  163 ? 9.748   0.881   5.384   1.00 15.10 ?  291  LEU A CB    1 
ATOM   1213 C  CG    . LEU A 1  163 ? 11.194  0.963   4.878   1.00 21.19 ?  291  LEU A CG    1 
ATOM   1214 C  CD1   . LEU A 1  163 ? 12.156  1.157   6.023   1.00 24.44 ?  291  LEU A CD1   1 
ATOM   1215 C  CD2   . LEU A 1  163 ? 11.534  -0.286  4.072   1.00 20.12 ?  291  LEU A CD2   1 
ATOM   1216 N  N     . ARG A 1  164 ? 7.036   -0.423  5.696   1.00 16.83 ?  292  ARG A N     1 
ATOM   1217 C  CA    A ARG A 1  164 ? 5.726   -0.477  6.337   0.54 18.12 ?  292  ARG A CA    1 
ATOM   1218 C  CA    B ARG A 1  164 ? 5.717   -0.479  6.329   0.46 18.18 ?  292  ARG A CA    1 
ATOM   1219 C  C     . ARG A 1  164 ? 5.460   0.724   7.249   1.00 18.05 ?  292  ARG A C     1 
ATOM   1220 O  O     . ARG A 1  164 ? 4.328   1.187   7.377   1.00 16.08 ?  292  ARG A O     1 
ATOM   1221 C  CB    A ARG A 1  164 ? 5.591   -1.773  7.133   0.54 21.12 ?  292  ARG A CB    1 
ATOM   1222 C  CB    B ARG A 1  164 ? 5.552   -1.780  7.122   0.46 21.87 ?  292  ARG A CB    1 
ATOM   1223 C  CG    A ARG A 1  164 ? 5.268   -2.966  6.278   0.54 22.33 ?  292  ARG A CG    1 
ATOM   1224 C  CG    B ARG A 1  164 ? 4.158   -1.947  7.717   0.46 26.22 ?  292  ARG A CG    1 
ATOM   1225 C  CD    A ARG A 1  164 ? 3.835   -2.911  5.767   0.54 27.24 ?  292  ARG A CD    1 
ATOM   1226 C  CD    B ARG A 1  164 ? 3.133   -2.228  6.628   0.46 29.41 ?  292  ARG A CD    1 
ATOM   1227 N  NE    A ARG A 1  164 ? 2.966   -2.086  6.606   0.54 30.59 ?  292  ARG A NE    1 
ATOM   1228 N  NE    B ARG A 1  164 ? 1.761   -1.937  7.049   0.46 30.34 ?  292  ARG A NE    1 
ATOM   1229 C  CZ    A ARG A 1  164 ? 1.650   -1.981  6.438   0.54 29.91 ?  292  ARG A CZ    1 
ATOM   1230 C  CZ    B ARG A 1  164 ? 0.685   -2.532  6.540   0.46 30.27 ?  292  ARG A CZ    1 
ATOM   1231 N  NH1   A ARG A 1  164 ? 1.048   -2.670  5.476   0.54 29.63 ?  292  ARG A NH1   1 
ATOM   1232 N  NH1   B ARG A 1  164 ? 0.821   -3.464  5.600   0.46 29.06 ?  292  ARG A NH1   1 
ATOM   1233 N  NH2   A ARG A 1  164 ? 0.934   -1.207  7.241   0.54 30.16 ?  292  ARG A NH2   1 
ATOM   1234 N  NH2   B ARG A 1  164 ? -0.526  -2.210  6.983   0.46 29.35 ?  292  ARG A NH2   1 
ATOM   1235 N  N     . SER A 1  165 ? 6.499   1.229   7.906   1.00 19.05 ?  293  SER A N     1 
ATOM   1236 C  CA    . SER A 1  165 ? 6.296   2.396   8.776   1.00 20.24 ?  293  SER A CA    1 
ATOM   1237 C  C     . SER A 1  165 ? 5.874   3.615   7.949   1.00 19.41 ?  293  SER A C     1 
ATOM   1238 O  O     . SER A 1  165 ? 5.092   4.461   8.420   1.00 17.67 ?  293  SER A O     1 
ATOM   1239 C  CB    . SER A 1  165 ? 7.560   2.705   9.572   1.00 24.21 ?  293  SER A CB    1 
ATOM   1240 O  OG    . SER A 1  165 ? 8.658   2.923   8.705   1.00 25.83 ?  293  SER A OG    1 
ATOM   1241 N  N     . ASP A 1  166 ? 6.404   3.710   6.729   1.00 17.31 ?  294  ASP A N     1 
ATOM   1242 C  CA    . ASP A 1  166 ? 6.047   4.791   5.803   1.00 15.52 ?  294  ASP A CA    1 
ATOM   1243 C  C     . ASP A 1  166 ? 4.586   4.635   5.409   1.00 16.23 ?  294  ASP A C     1 
ATOM   1244 O  O     . ASP A 1  166 ? 3.826   5.608   5.331   1.00 14.50 ?  294  ASP A O     1 
ATOM   1245 C  CB    . ASP A 1  166 ? 6.910   4.765   4.537   1.00 15.73 ?  294  ASP A CB    1 
ATOM   1246 C  CG    . ASP A 1  166 ? 8.408   4.904   4.821   1.00 19.23 ?  294  ASP A CG    1 
ATOM   1247 O  OD1   . ASP A 1  166 ? 8.802   5.633   5.768   1.00 19.94 ?  294  ASP A OD1   1 
ATOM   1248 O  OD2   . ASP A 1  166 ? 9.210   4.302   4.065   1.00 18.77 ?  294  ASP A OD2   1 
ATOM   1249 N  N     . VAL A 1  167 ? 4.206   3.393   5.124   1.00 15.75 ?  295  VAL A N     1 
ATOM   1250 C  CA    . VAL A 1  167 ? 2.824   3.109   4.741   1.00 14.83 ?  295  VAL A CA    1 
ATOM   1251 C  C     . VAL A 1  167 ? 1.879   3.540   5.843   1.00 15.43 ?  295  VAL A C     1 
ATOM   1252 O  O     . VAL A 1  167 ? 0.862   4.194   5.589   1.00 16.75 ?  295  VAL A O     1 
ATOM   1253 C  CB    . VAL A 1  167 ? 2.624   1.600   4.456   1.00 12.83 ?  295  VAL A CB    1 
ATOM   1254 C  CG1   . VAL A 1  167 ? 1.136   1.272   4.252   1.00 14.99 ?  295  VAL A CG1   1 
ATOM   1255 C  CG2   . VAL A 1  167 ? 3.441   1.211   3.226   1.00 12.85 ?  295  VAL A CG2   1 
ATOM   1256 N  N     . ASP A 1  168 ? 2.205   3.157   7.075   1.00 15.52 ?  296  ASP A N     1 
ATOM   1257 C  CA    . ASP A 1  168 ? 1.327   3.467   8.208   1.00 18.15 ?  296  ASP A CA    1 
ATOM   1258 C  C     . ASP A 1  168 ? 1.162   4.970   8.355   1.00 18.65 ?  296  ASP A C     1 
ATOM   1259 O  O     . ASP A 1  168 ? 0.042   5.465   8.549   1.00 17.16 ?  296  ASP A O     1 
ATOM   1260 C  CB    . ASP A 1  168 ? 1.866   2.875   9.516   1.00 22.25 ?  296  ASP A CB    1 
ATOM   1261 C  CG    . ASP A 1  168 ? 1.849   1.349   9.524   1.00 30.12 ?  296  ASP A CG    1 
ATOM   1262 O  OD1   . ASP A 1  168 ? 1.117   0.753   8.696   1.00 29.18 ?  296  ASP A OD1   1 
ATOM   1263 O  OD2   . ASP A 1  168 ? 2.563   0.756   10.369  1.00 34.52 ?  296  ASP A OD2   1 
ATOM   1264 N  N     . ALA A 1  169 ? 2.270   5.705   8.236   1.00 18.35 ?  297  ALA A N     1 
ATOM   1265 C  CA    . ALA A 1  169 ? 2.213   7.160   8.352   1.00 17.98 ?  297  ALA A CA    1 
ATOM   1266 C  C     . ALA A 1  169 ? 1.392   7.774   7.226   1.00 16.84 ?  297  ALA A C     1 
ATOM   1267 O  O     . ALA A 1  169 ? 0.591   8.681   7.469   1.00 17.67 ?  297  ALA A O     1 
ATOM   1268 C  CB    . ALA A 1  169 ? 3.630   7.769   8.360   1.00 19.16 ?  297  ALA A CB    1 
ATOM   1269 N  N     . LEU A 1  170 ? 1.615   7.305   5.999   1.00 13.68 ?  298  LEU A N     1 
ATOM   1270 C  CA    . LEU A 1  170 ? 0.926   7.863   4.843   1.00 15.33 ?  298  LEU A CA    1 
ATOM   1271 C  C     . LEU A 1  170 ? -0.560  7.508   4.893   1.00 16.67 ?  298  LEU A C     1 
ATOM   1272 O  O     . LEU A 1  170 ? -1.406  8.303   4.493   1.00 15.70 ?  298  LEU A O     1 
ATOM   1273 C  CB    . LEU A 1  170 ? 1.558   7.374   3.536   1.00 12.21 ?  298  LEU A CB    1 
ATOM   1274 C  CG    . LEU A 1  170 ? 2.925   8.040   3.285   1.00 14.66 ?  298  LEU A CG    1 
ATOM   1275 C  CD1   . LEU A 1  170 ? 3.750   7.227   2.291   1.00 14.72 ?  298  LEU A CD1   1 
ATOM   1276 C  CD2   . LEU A 1  170 ? 2.686   9.474   2.764   1.00 14.17 ?  298  LEU A CD2   1 
ATOM   1277 N  N     . GLN A 1  171 ? -0.877  6.316   5.396   1.00 14.82 ?  299  GLN A N     1 
ATOM   1278 C  CA    . GLN A 1  171 ? -2.285  5.952   5.514   1.00 15.53 ?  299  GLN A CA    1 
ATOM   1279 C  C     . GLN A 1  171 ? -3.011  6.902   6.475   1.00 17.47 ?  299  GLN A C     1 
ATOM   1280 O  O     . GLN A 1  171 ? -4.160  7.326   6.218   1.00 18.05 ?  299  GLN A O     1 
ATOM   1281 C  CB    . GLN A 1  171 ? -2.452  4.496   5.970   1.00 16.60 ?  299  GLN A CB    1 
ATOM   1282 C  CG    . GLN A 1  171 ? -3.934  4.143   6.043   1.00 19.20 ?  299  GLN A CG    1 
ATOM   1283 C  CD    . GLN A 1  171 ? -4.273  2.708   5.769   1.00 25.10 ?  299  GLN A CD    1 
ATOM   1284 O  OE1   . GLN A 1  171 ? -3.408  1.853   5.597   1.00 22.96 ?  299  GLN A OE1   1 
ATOM   1285 N  NE2   . GLN A 1  171 ? -5.572  2.431   5.725   1.00 30.53 ?  299  GLN A NE2   1 
ATOM   1286 N  N     . GLN A 1  172 ? -2.374  7.251   7.586   1.00 15.99 ?  300  GLN A N     1 
ATOM   1287 C  CA    . GLN A 1  172 ? -3.016  8.182   8.502   1.00 18.26 ?  300  GLN A CA    1 
ATOM   1288 C  C     . GLN A 1  172 ? -3.256  9.546   7.826   1.00 19.42 ?  300  GLN A C     1 
ATOM   1289 O  O     . GLN A 1  172 ? -4.306  10.152  7.995   1.00 19.45 ?  300  GLN A O     1 
ATOM   1290 C  CB    . GLN A 1  172 ? -2.180  8.356   9.777   1.00 22.06 ?  300  GLN A CB    1 
ATOM   1291 C  CG    . GLN A 1  172 ? -2.754  9.353   10.771  1.00 27.36 ?  300  GLN A CG    1 
ATOM   1292 N  N     . VAL A 1  173 ? -2.277  10.014  7.063   1.00 16.58 ?  301  VAL A N     1 
ATOM   1293 C  CA    . VAL A 1  173 ? -2.382  11.290  6.360   1.00 17.36 ?  301  VAL A CA    1 
ATOM   1294 C  C     . VAL A 1  173 ? -3.544  11.301  5.345   1.00 16.18 ?  301  VAL A C     1 
ATOM   1295 O  O     . VAL A 1  173 ? -4.348  12.257  5.285   1.00 16.61 ?  301  VAL A O     1 
ATOM   1296 C  CB    . VAL A 1  173 ? -1.044  11.601  5.628   1.00 24.46 ?  301  VAL A CB    1 
ATOM   1297 C  CG1   . VAL A 1  173 ? -1.245  12.614  4.516   1.00 24.95 ?  301  VAL A CG1   1 
ATOM   1298 C  CG2   . VAL A 1  173 ? -0.015  12.086  6.641   1.00 24.49 ?  301  VAL A CG2   1 
ATOM   1299 N  N     . VAL A 1  174 ? -3.619  10.229  4.568   1.00 15.72 ?  302  VAL A N     1 
ATOM   1300 C  CA    . VAL A 1  174 ? -4.636  10.105  3.536   1.00 15.22 ?  302  VAL A CA    1 
ATOM   1301 C  C     . VAL A 1  174 ? -6.001  9.923   4.195   1.00 16.83 ?  302  VAL A C     1 
ATOM   1302 O  O     . VAL A 1  174 ? -6.961  10.580  3.803   1.00 16.00 ?  302  VAL A O     1 
ATOM   1303 C  CB    . VAL A 1  174 ? -4.301  8.960   2.565   1.00 16.76 ?  302  VAL A CB    1 
ATOM   1304 C  CG1   . VAL A 1  174 ? -5.470  8.677   1.594   1.00 15.34 ?  302  VAL A CG1   1 
ATOM   1305 C  CG2   . VAL A 1  174 ? -3.037  9.313   1.775   1.00 18.04 ?  302  VAL A CG2   1 
ATOM   1306 N  N     . GLU A 1  175 ? -6.092  9.065   5.209   1.00 17.80 ?  303  GLU A N     1 
ATOM   1307 C  CA    . GLU A 1  175 ? -7.354  8.952   5.950   1.00 19.75 ?  303  GLU A CA    1 
ATOM   1308 C  C     . GLU A 1  175 ? -7.826  10.288  6.516   1.00 19.31 ?  303  GLU A C     1 
ATOM   1309 O  O     . GLU A 1  175 ? -9.020  10.612  6.448   1.00 19.85 ?  303  GLU A O     1 
ATOM   1310 C  CB    . GLU A 1  175 ? -7.226  7.931   7.083   1.00 19.70 ?  303  GLU A CB    1 
ATOM   1311 C  CG    . GLU A 1  175 ? -7.203  6.512   6.570   1.00 22.00 ?  303  GLU A CG    1 
ATOM   1312 C  CD    . GLU A 1  175 ? -6.954  5.502   7.668   1.00 27.27 ?  303  GLU A CD    1 
ATOM   1313 O  OE1   . GLU A 1  175 ? -6.622  5.911   8.797   1.00 31.26 ?  303  GLU A OE1   1 
ATOM   1314 O  OE2   . GLU A 1  175 ? -7.064  4.299   7.385   1.00 27.06 ?  303  GLU A OE2   1 
ATOM   1315 N  N     . GLU A 1  176 ? -6.916  11.079  7.079   1.00 19.74 ?  304  GLU A N     1 
ATOM   1316 C  CA    . GLU A 1  176 ? -7.325  12.382  7.613   1.00 21.02 ?  304  GLU A CA    1 
ATOM   1317 C  C     . GLU A 1  176 ? -7.865  13.307  6.513   1.00 21.27 ?  304  GLU A C     1 
ATOM   1318 O  O     . GLU A 1  176 ? -8.909  13.954  6.677   1.00 20.13 ?  304  GLU A O     1 
ATOM   1319 C  CB    . GLU A 1  176 ? -6.160  13.066  8.342   1.00 22.07 ?  304  GLU A CB    1 
ATOM   1320 C  CG    . GLU A 1  176 ? -6.524  14.422  8.953   1.00 25.83 ?  304  GLU A CG    1 
ATOM   1321 N  N     . ALA A 1  177 ? -7.164  13.349  5.388   1.00 18.01 ?  305  ALA A N     1 
ATOM   1322 C  CA    . ALA A 1  177 ? -7.551  14.235  4.298   1.00 17.71 ?  305  ALA A CA    1 
ATOM   1323 C  C     . ALA A 1  177 ? -8.851  13.767  3.657   1.00 17.26 ?  305  ALA A C     1 
ATOM   1324 O  O     . ALA A 1  177 ? -9.718  14.566  3.357   1.00 20.04 ?  305  ALA A O     1 
ATOM   1325 C  CB    . ALA A 1  177 ? -6.436  14.311  3.244   1.00 16.98 ?  305  ALA A CB    1 
ATOM   1326 N  N     . VAL A 1  178 ? -8.961  12.471  3.409   1.00 16.63 ?  306  VAL A N     1 
ATOM   1327 C  CA    . VAL A 1  178 ? -10.196 11.930  2.847   1.00 15.11 ?  306  VAL A CA    1 
ATOM   1328 C  C     . VAL A 1  178 ? -11.369 12.177  3.789   1.00 16.66 ?  306  VAL A C     1 
ATOM   1329 O  O     . VAL A 1  178 ? -12.452 12.568  3.355   1.00 17.39 ?  306  VAL A O     1 
ATOM   1330 C  CB    . VAL A 1  178 ? -10.031 10.412  2.540   1.00 16.07 ?  306  VAL A CB    1 
ATOM   1331 C  CG1   . VAL A 1  178 ? -11.394 9.759   2.208   1.00 16.30 ?  306  VAL A CG1   1 
ATOM   1332 C  CG2   . VAL A 1  178 ? -9.090  10.226  1.394   1.00 15.21 ?  306  VAL A CG2   1 
ATOM   1333 N  N     . GLY A 1  179 ? -11.178 11.963  5.092   1.00 16.44 ?  307  GLY A N     1 
ATOM   1334 C  CA    . GLY A 1  179 ? -12.244 12.210  6.049   1.00 18.10 ?  307  GLY A CA    1 
ATOM   1335 C  C     . GLY A 1  179 ? -12.651 13.673  6.145   1.00 22.13 ?  307  GLY A C     1 
ATOM   1336 O  O     . GLY A 1  179 ? -13.805 13.992  6.409   1.00 23.42 ?  307  GLY A O     1 
ATOM   1337 N  N     . GLN A 1  180 ? -11.693 14.576  5.933   1.00 23.37 ?  308  GLN A N     1 
ATOM   1338 C  CA    . GLN A 1  180 ? -12.004 15.998  5.842   1.00 24.36 ?  308  GLN A CA    1 
ATOM   1339 C  C     . GLN A 1  180 ? -12.788 16.368  4.570   1.00 21.66 ?  308  GLN A C     1 
ATOM   1340 O  O     . GLN A 1  180 ? -13.609 17.295  4.585   1.00 23.09 ?  308  GLN A O     1 
ATOM   1341 C  CB    . GLN A 1  180 ? -10.711 16.824  5.895   1.00 31.00 ?  308  GLN A CB    1 
ATOM   1342 C  CG    . GLN A 1  180 ? -10.041 16.867  7.260   1.00 36.42 ?  308  GLN A CG    1 
ATOM   1343 C  CD    . GLN A 1  180 ? -8.695  17.591  7.236   1.00 40.97 ?  308  GLN A CD    1 
ATOM   1344 O  OE1   . GLN A 1  180 ? -8.039  17.694  6.193   1.00 41.88 ?  308  GLN A OE1   1 
ATOM   1345 N  NE2   . GLN A 1  180 ? -8.280  18.094  8.392   1.00 43.88 ?  308  GLN A NE2   1 
ATOM   1346 N  N     . ALA A 1  181 ? -12.506 15.666  3.474   1.00 20.61 ?  309  ALA A N     1 
ATOM   1347 C  CA    . ALA A 1  181 ? -13.094 15.967  2.161   1.00 17.27 ?  309  ALA A CA    1 
ATOM   1348 C  C     . ALA A 1  181 ? -14.496 15.388  1.961   1.00 18.53 ?  309  ALA A C     1 
ATOM   1349 O  O     . ALA A 1  181 ? -15.325 15.937  1.229   1.00 18.97 ?  309  ALA A O     1 
ATOM   1350 C  CB    . ALA A 1  181 ? -12.157 15.437  1.052   1.00 15.82 ?  309  ALA A CB    1 
ATOM   1351 N  N     . LEU A 1  182 ? -14.766 14.261  2.601   1.00 17.83 ?  310  LEU A N     1 
ATOM   1352 C  CA    . LEU A 1  182 ? -16.071 13.633  2.429   1.00 17.75 ?  310  LEU A CA    1 
ATOM   1353 C  C     . LEU A 1  182 ? -16.427 12.777  3.643   1.00 18.14 ?  310  LEU A C     1 
ATOM   1354 O  O     . LEU A 1  182 ? -15.864 11.679  3.811   1.00 17.16 ?  310  LEU A O     1 
ATOM   1355 C  CB    . LEU A 1  182 ? -16.044 12.754  1.158   1.00 17.42 ?  310  LEU A CB    1 
ATOM   1356 C  CG    . LEU A 1  182 ? -17.326 11.947  0.912   1.00 19.47 ?  310  LEU A CG    1 
ATOM   1357 C  CD1   . LEU A 1  182 ? -18.472 12.909  0.665   1.00 20.28 ?  310  LEU A CD1   1 
ATOM   1358 C  CD2   . LEU A 1  182 ? -17.127 10.996  -0.288  1.00 20.47 ?  310  LEU A CD2   1 
ATOM   1359 N  N     . PRO A 1  183 ? -17.356 13.251  4.480   1.00 20.31 ?  311  PRO A N     1 
ATOM   1360 C  CA    . PRO A 1  183 ? -17.762 12.472  5.652   1.00 22.83 ?  311  PRO A CA    1 
ATOM   1361 C  C     . PRO A 1  183 ? -18.217 11.077  5.266   1.00 22.08 ?  311  PRO A C     1 
ATOM   1362 O  O     . PRO A 1  183 ? -19.049 10.933  4.372   1.00 22.29 ?  311  PRO A O     1 
ATOM   1363 C  CB    . PRO A 1  183 ? -18.929 13.282  6.225   1.00 28.32 ?  311  PRO A CB    1 
ATOM   1364 C  CG    . PRO A 1  183 ? -18.614 14.692  5.820   1.00 28.54 ?  311  PRO A CG    1 
ATOM   1365 C  CD    . PRO A 1  183 ? -17.996 14.587  4.455   1.00 21.18 ?  311  PRO A CD    1 
ATOM   1366 N  N     . GLY A 1  184 ? -17.645 10.063  5.914   1.00 21.58 ?  312  GLY A N     1 
ATOM   1367 C  CA    . GLY A 1  184 ? -18.067 8.690   5.695   1.00 20.80 ?  312  GLY A CA    1 
ATOM   1368 C  C     . GLY A 1  184 ? -17.256 7.959   4.646   1.00 20.27 ?  312  GLY A C     1 
ATOM   1369 O  O     . GLY A 1  184 ? -17.451 6.759   4.447   1.00 18.79 ?  312  GLY A O     1 
ATOM   1370 N  N     . ALA A 1  185 ? -16.366 8.673   3.951   1.00 17.94 ?  313  ALA A N     1 
ATOM   1371 C  CA    . ALA A 1  185 ? -15.537 8.028   2.932   1.00 17.68 ?  313  ALA A CA    1 
ATOM   1372 C  C     . ALA A 1  185 ? -14.570 7.067   3.616   1.00 19.33 ?  313  ALA A C     1 
ATOM   1373 O  O     . ALA A 1  185 ? -14.179 7.297   4.753   1.00 21.79 ?  313  ALA A O     1 
ATOM   1374 C  CB    . ALA A 1  185 ? -14.775 9.065   2.110   1.00 16.77 ?  313  ALA A CB    1 
ATOM   1375 N  N     . THR A 1  186 ? -14.210 5.984   2.936   1.00 16.95 ?  314  THR A N     1 
ATOM   1376 C  CA    . THR A 1  186 ? -13.267 5.012   3.505   1.00 16.12 ?  314  THR A CA    1 
ATOM   1377 C  C     . THR A 1  186 ? -11.995 4.932   2.671   1.00 14.93 ?  314  THR A C     1 
ATOM   1378 O  O     . THR A 1  186 ? -12.004 5.233   1.481   1.00 14.64 ?  314  THR A O     1 
ATOM   1379 C  CB    . THR A 1  186 ? -13.887 3.630   3.592   1.00 18.08 ?  314  THR A CB    1 
ATOM   1380 O  OG1   . THR A 1  186 ? -14.184 3.171   2.274   1.00 18.26 ?  314  THR A OG1   1 
ATOM   1381 C  CG2   . THR A 1  186 ? -15.182 3.683   4.438   1.00 20.96 ?  314  THR A CG2   1 
ATOM   1382 N  N     . VAL A 1  187 ? -10.904 4.529   3.305   1.00 11.99 ?  315  VAL A N     1 
ATOM   1383 C  CA    . VAL A 1  187 ? -9.619  4.372   2.623   1.00 11.87 ?  315  VAL A CA    1 
ATOM   1384 C  C     . VAL A 1  187 ? -9.130  2.939   2.826   1.00 12.24 ?  315  VAL A C     1 
ATOM   1385 O  O     . VAL A 1  187 ? -9.061  2.458   3.968   1.00 13.62 ?  315  VAL A O     1 
ATOM   1386 C  CB    . VAL A 1  187 ? -8.562  5.354   3.164   1.00 14.87 ?  315  VAL A CB    1 
ATOM   1387 C  CG1   . VAL A 1  187 ? -7.183  5.079   2.550   1.00 16.10 ?  315  VAL A CG1   1 
ATOM   1388 C  CG2   . VAL A 1  187 ? -8.987  6.793   2.879   1.00 13.73 ?  315  VAL A CG2   1 
ATOM   1389 N  N     . THR A 1  188 ? -8.814  2.262   1.735   1.00 10.35 ?  316  THR A N     1 
ATOM   1390 C  CA    . THR A 1  188 ? -8.346  0.872   1.826   1.00 9.76  ?  316  THR A CA    1 
ATOM   1391 C  C     . THR A 1  188 ? -6.937  0.769   1.235   1.00 10.06 ?  316  THR A C     1 
ATOM   1392 O  O     . THR A 1  188 ? -6.720  1.147   0.086   1.00 11.02 ?  316  THR A O     1 
ATOM   1393 C  CB    . THR A 1  188 ? -9.295  -0.083  1.074   1.00 10.33 ?  316  THR A CB    1 
ATOM   1394 O  OG1   . THR A 1  188 ? -10.601 -0.054  1.677   1.00 14.78 ?  316  THR A OG1   1 
ATOM   1395 C  CG2   . THR A 1  188 ? -8.776  -1.534  1.116   1.00 10.71 ?  316  THR A CG2   1 
ATOM   1396 N  N     . LEU A 1  189 ? -5.987  0.249   2.008   1.00 9.52  ?  317  LEU A N     1 
ATOM   1397 C  CA    . LEU A 1  189 ? -4.654  -0.007  1.454   1.00 9.41  ?  317  LEU A CA    1 
ATOM   1398 C  C     . LEU A 1  189 ? -4.747  -1.109  0.412   1.00 10.88 ?  317  LEU A C     1 
ATOM   1399 O  O     . LEU A 1  189 ? -5.329  -2.176  0.679   1.00 11.38 ?  317  LEU A O     1 
ATOM   1400 C  CB    . LEU A 1  189 ? -3.681  -0.414  2.577   1.00 10.92 ?  317  LEU A CB    1 
ATOM   1401 C  CG    . LEU A 1  189 ? -2.256  -0.811  2.180   1.00 11.80 ?  317  LEU A CG    1 
ATOM   1402 C  CD1   . LEU A 1  189 ? -1.520  0.380   1.580   1.00 11.33 ?  317  LEU A CD1   1 
ATOM   1403 C  CD2   . LEU A 1  189 ? -1.521  -1.389  3.408   1.00 14.29 ?  317  LEU A CD2   1 
ATOM   1404 N  N     . THR A 1  190 ? -4.199  -0.861  -0.770  1.00 9.26  ?  318  THR A N     1 
ATOM   1405 C  CA    . THR A 1  190 ? -4.214  -1.883  -1.801  1.00 8.39  ?  318  THR A CA    1 
ATOM   1406 C  C     . THR A 1  190 ? -2.773  -2.076  -2.338  1.00 8.83  ?  318  THR A C     1 
ATOM   1407 O  O     . THR A 1  190 ? -1.817  -1.913  -1.583  1.00 9.74  ?  318  THR A O     1 
ATOM   1408 C  CB    . THR A 1  190 ? -5.279  -1.534  -2.879  1.00 10.59 ?  318  THR A CB    1 
ATOM   1409 O  OG1   . THR A 1  190 ? -5.354  -2.561  -3.868  1.00 11.64 ?  318  THR A OG1   1 
ATOM   1410 C  CG2   . THR A 1  190 ? -4.993  -0.203  -3.564  1.00 9.62  ?  318  THR A CG2   1 
ATOM   1411 N  N     . GLY A 1  191 ? -2.628  -2.501  -3.583  1.00 8.52  ?  319  GLY A N     1 
ATOM   1412 C  CA    . GLY A 1  191 ? -1.308  -2.786  -4.146  1.00 9.49  ?  319  GLY A CA    1 
ATOM   1413 C  C     . GLY A 1  191 ? -0.479  -3.787  -3.341  1.00 9.68  ?  319  GLY A C     1 
ATOM   1414 O  O     . GLY A 1  191 ? -1.014  -4.642  -2.605  1.00 10.67 ?  319  GLY A O     1 
ATOM   1415 N  N     . GLY A 1  192 ? 0.837   -3.692  -3.484  1.00 9.90  ?  320  GLY A N     1 
ATOM   1416 C  CA    . GLY A 1  192 ? 1.713   -4.738  -2.974  1.00 10.30 ?  320  GLY A CA    1 
ATOM   1417 C  C     . GLY A 1  192 ? 1.671   -4.885  -1.456  1.00 9.97  ?  320  GLY A C     1 
ATOM   1418 O  O     . GLY A 1  192 ? 1.796   -5.989  -0.941  1.00 10.15 ?  320  GLY A O     1 
ATOM   1419 N  N     . PHE A 1  193 ? 1.484   -3.784  -0.726  1.00 9.48  ?  321  PHE A N     1 
ATOM   1420 C  CA    . PHE A 1  193 ? 1.427   -3.911  0.728   1.00 11.06 ?  321  PHE A CA    1 
ATOM   1421 C  C     . PHE A 1  193 ? 0.207   -4.710  1.178   1.00 11.34 ?  321  PHE A C     1 
ATOM   1422 O  O     . PHE A 1  193 ? 0.262   -5.389  2.208   1.00 12.75 ?  321  PHE A O     1 
ATOM   1423 C  CB    . PHE A 1  193 ? 1.478   -2.515  1.372   1.00 10.62 ?  321  PHE A CB    1 
ATOM   1424 C  CG    . PHE A 1  193 ? 2.849   -1.900  1.294   1.00 10.73 ?  321  PHE A CG    1 
ATOM   1425 C  CD1   . PHE A 1  193 ? 3.864   -2.393  2.101   1.00 11.79 ?  321  PHE A CD1   1 
ATOM   1426 C  CD2   . PHE A 1  193 ? 3.147   -0.883  0.388   1.00 11.33 ?  321  PHE A CD2   1 
ATOM   1427 C  CE1   . PHE A 1  193 ? 5.163   -1.849  2.023   1.00 13.21 ?  321  PHE A CE1   1 
ATOM   1428 C  CE2   . PHE A 1  193 ? 4.423   -0.331  0.299   1.00 13.03 ?  321  PHE A CE2   1 
ATOM   1429 C  CZ    . PHE A 1  193 ? 5.444   -0.816  1.117   1.00 13.15 ?  321  PHE A CZ    1 
ATOM   1430 N  N     . ARG A 1  194 ? -0.896  -4.660  0.426   1.00 10.95 ?  322  ARG A N     1 
ATOM   1431 C  CA    . ARG A 1  194 ? -2.032  -5.500  0.801   1.00 9.63  ?  322  ARG A CA    1 
ATOM   1432 C  C     . ARG A 1  194 ? -1.710  -6.990  0.612   1.00 10.37 ?  322  ARG A C     1 
ATOM   1433 O  O     . ARG A 1  194 ? -2.292  -7.863  1.280   1.00 11.32 ?  322  ARG A O     1 
ATOM   1434 C  CB    . ARG A 1  194 ? -3.292  -5.108  -0.004  1.00 9.35  ?  322  ARG A CB    1 
ATOM   1435 C  CG    . ARG A 1  194 ? -4.543  -5.948  0.397   1.00 10.05 ?  322  ARG A CG    1 
ATOM   1436 C  CD    . ARG A 1  194 ? -5.863  -5.419  -0.245  1.00 9.92  ?  322  ARG A CD    1 
ATOM   1437 N  NE    . ARG A 1  194 ? -6.972  -6.240  0.229   1.00 10.75 ?  322  ARG A NE    1 
ATOM   1438 C  CZ    . ARG A 1  194 ? -7.718  -7.033  -0.537  1.00 12.79 ?  322  ARG A CZ    1 
ATOM   1439 N  NH1   . ARG A 1  194 ? -7.523  -7.093  -1.855  1.00 12.22 ?  322  ARG A NH1   1 
ATOM   1440 N  NH2   . ARG A 1  194 ? -8.658  -7.774  0.024   1.00 12.17 ?  322  ARG A NH2   1 
ATOM   1441 N  N     . ARG A 1  195 ? -0.787  -7.288  -0.298  1.00 10.32 ?  323  ARG A N     1 
ATOM   1442 C  CA    . ARG A 1  195 ? -0.374  -8.674  -0.522  1.00 11.18 ?  323  ARG A CA    1 
ATOM   1443 C  C     . ARG A 1  195 ? 0.677   -9.120  0.485   1.00 12.17 ?  323  ARG A C     1 
ATOM   1444 O  O     . ARG A 1  195 ? 1.193   -10.216 0.377   1.00 12.60 ?  323  ARG A O     1 
ATOM   1445 C  CB    . ARG A 1  195 ? 0.193   -8.873  -1.943  1.00 12.36 ?  323  ARG A CB    1 
ATOM   1446 C  CG    . ARG A 1  195 ? -0.772  -8.471  -3.092  1.00 12.39 ?  323  ARG A CG    1 
ATOM   1447 C  CD    . ARG A 1  195 ? -0.259  -9.078  -4.423  1.00 11.51 ?  323  ARG A CD    1 
ATOM   1448 N  NE    . ARG A 1  195 ? 1.130   -8.731  -4.725  1.00 11.41 ?  323  ARG A NE    1 
ATOM   1449 C  CZ    . ARG A 1  195 ? 1.538   -7.588  -5.309  1.00 11.40 ?  323  ARG A CZ    1 
ATOM   1450 N  NH1   . ARG A 1  195 ? 2.839   -7.374  -5.543  1.00 11.14 ?  323  ARG A NH1   1 
ATOM   1451 N  NH2   . ARG A 1  195 ? 0.659   -6.642  -5.671  1.00 10.70 ?  323  ARG A NH2   1 
ATOM   1452 N  N     . GLY A 1  196 ? 1.012   -8.260  1.445   1.00 12.10 ?  324  GLY A N     1 
ATOM   1453 C  CA    . GLY A 1  196 ? 1.917   -8.667  2.518   1.00 12.89 ?  324  GLY A CA    1 
ATOM   1454 C  C     . GLY A 1  196 ? 3.367   -8.219  2.344   1.00 12.96 ?  324  GLY A C     1 
ATOM   1455 O  O     . GLY A 1  196 ? 4.247   -8.586  3.142   1.00 13.50 ?  324  GLY A O     1 
ATOM   1456 N  N     . LYS A 1  197 ? 3.640   -7.500  1.266   1.00 11.77 ?  325  LYS A N     1 
ATOM   1457 C  CA    . LYS A 1  197 ? 4.993   -6.997  0.999   1.00 12.59 ?  325  LYS A CA    1 
ATOM   1458 C  C     . LYS A 1  197 ? 5.525   -6.159  2.152   1.00 16.08 ?  325  LYS A C     1 
ATOM   1459 O  O     . LYS A 1  197 ? 4.788   -5.395  2.751   1.00 15.36 ?  325  LYS A O     1 
ATOM   1460 C  CB    . LYS A 1  197 ? 5.028   -6.167  -0.291  1.00 12.52 ?  325  LYS A CB    1 
ATOM   1461 C  CG    . LYS A 1  197 ? 4.918   -7.041  -1.562  1.00 14.69 ?  325  LYS A CG    1 
ATOM   1462 C  CD    . LYS A 1  197 ? 5.130   -6.196  -2.828  1.00 20.42 ?  325  LYS A CD    1 
ATOM   1463 C  CE    . LYS A 1  197 ? 6.581   -5.857  -3.089  1.00 23.54 ?  325  LYS A CE    1 
ATOM   1464 N  NZ    . LYS A 1  197 ? 6.721   -4.999  -4.317  1.00 27.68 ?  325  LYS A NZ    1 
ATOM   1465 N  N     . LEU A 1  198 ? 6.815   -6.295  2.431   1.00 14.62 ?  326  LEU A N     1 
ATOM   1466 C  CA    . LEU A 1  198 ? 7.435   -5.538  3.513   1.00 17.15 ?  326  LEU A CA    1 
ATOM   1467 C  C     . LEU A 1  198 ? 7.997   -4.224  3.001   1.00 17.94 ?  326  LEU A C     1 
ATOM   1468 O  O     . LEU A 1  198 ? 8.282   -3.312  3.783   1.00 19.32 ?  326  LEU A O     1 
ATOM   1469 C  CB    . LEU A 1  198 ? 8.539   -6.362  4.173   1.00 22.58 ?  326  LEU A CB    1 
ATOM   1470 C  CG    . LEU A 1  198 ? 8.032   -7.645  4.841   1.00 25.99 ?  326  LEU A CG    1 
ATOM   1471 C  CD1   . LEU A 1  198 ? 9.150   -8.315  5.626   1.00 30.39 ?  326  LEU A CD1   1 
ATOM   1472 C  CD2   . LEU A 1  198 ? 6.830   -7.356  5.735   1.00 26.55 ?  326  LEU A CD2   1 
ATOM   1473 N  N     . GLN A 1  199 ? 8.211   -4.152  1.694   1.00 15.56 ?  327  GLN A N     1 
ATOM   1474 C  CA    . GLN A 1  199 ? 8.707   -2.936  1.081   1.00 16.82 ?  327  GLN A CA    1 
ATOM   1475 C  C     . GLN A 1  199 ? 8.061   -2.777  -0.289  1.00 17.50 ?  327  GLN A C     1 
ATOM   1476 O  O     . GLN A 1  199 ? 7.474   -3.731  -0.819  1.00 20.14 ?  327  GLN A O     1 
ATOM   1477 C  CB    . GLN A 1  199 ? 10.238  -2.940  0.991   1.00 21.39 ?  327  GLN A CB    1 
ATOM   1478 C  CG    . GLN A 1  199 ? 10.863  -3.927  0.025   1.00 30.60 ?  327  GLN A CG    1 
ATOM   1479 C  CD    . GLN A 1  199 ? 12.358  -3.681  -0.110  1.00 39.49 ?  327  GLN A CD    1 
ATOM   1480 O  OE1   . GLN A 1  199 ? 13.083  -3.627  0.888   1.00 42.53 ?  327  GLN A OE1   1 
ATOM   1481 N  NE2   . GLN A 1  199 ? 12.818  -3.479  -1.344  1.00 41.45 ?  327  GLN A NE2   1 
ATOM   1482 N  N     . GLY A 1  200 ? 8.099   -1.571  -0.839  1.00 14.85 ?  328  GLY A N     1 
ATOM   1483 C  CA    . GLY A 1  200 ? 7.464   -1.344  -2.122  1.00 13.16 ?  328  GLY A CA    1 
ATOM   1484 C  C     . GLY A 1  200 ? 8.014   -0.115  -2.808  1.00 11.89 ?  328  GLY A C     1 
ATOM   1485 O  O     . GLY A 1  200 ? 8.895   0.569   -2.270  1.00 14.47 ?  328  GLY A O     1 
ATOM   1486 N  N     A HIS A 1  201 ? 7.510   0.160   -4.004  0.62 9.76  ?  329  HIS A N     1 
ATOM   1487 N  N     B HIS A 1  201 ? 7.495   0.163   -4.001  0.38 10.30 ?  329  HIS A N     1 
ATOM   1488 C  CA    A HIS A 1  201 ? 7.946   1.329   -4.767  0.62 11.69 ?  329  HIS A CA    1 
ATOM   1489 C  CA    B HIS A 1  201 ? 7.937   1.307   -4.800  0.38 11.95 ?  329  HIS A CA    1 
ATOM   1490 C  C     A HIS A 1  201 ? 7.057   2.529   -4.491  0.62 12.00 ?  329  HIS A C     1 
ATOM   1491 C  C     B HIS A 1  201 ? 7.014   2.504   -4.604  0.38 11.93 ?  329  HIS A C     1 
ATOM   1492 O  O     A HIS A 1  201 ? 7.452   3.684   -4.731  0.62 12.04 ?  329  HIS A O     1 
ATOM   1493 O  O     B HIS A 1  201 ? 7.355   3.635   -4.984  0.38 11.80 ?  329  HIS A O     1 
ATOM   1494 C  CB    A HIS A 1  201 ? 7.953   1.031   -6.269  0.62 13.57 ?  329  HIS A CB    1 
ATOM   1495 C  CB    B HIS A 1  201 ? 8.017   0.925   -6.288  0.38 14.11 ?  329  HIS A CB    1 
ATOM   1496 C  CG    A HIS A 1  201 ? 8.953   -0.005  -6.669  0.62 15.05 ?  329  HIS A CG    1 
ATOM   1497 C  CG    B HIS A 1  201 ? 7.022   1.627   -7.164  0.38 16.49 ?  329  HIS A CG    1 
ATOM   1498 N  ND1   A HIS A 1  201 ? 8.586   -1.255  -7.124  0.62 19.11 ?  329  HIS A ND1   1 
ATOM   1499 N  ND1   B HIS A 1  201 ? 5.693   1.263   -7.225  0.38 20.67 ?  329  HIS A ND1   1 
ATOM   1500 C  CD2   A HIS A 1  201 ? 10.309  0.008   -6.661  0.62 19.30 ?  329  HIS A CD2   1 
ATOM   1501 C  CD2   B HIS A 1  201 ? 7.172   2.647   -8.044  0.38 19.33 ?  329  HIS A CD2   1 
ATOM   1502 C  CE1   A HIS A 1  201 ? 9.671   -1.958  -7.400  0.62 20.18 ?  329  HIS A CE1   1 
ATOM   1503 C  CE1   B HIS A 1  201 ? 5.065   2.041   -8.090  0.38 22.26 ?  329  HIS A CE1   1 
ATOM   1504 N  NE2   A HIS A 1  201 ? 10.730  -1.219  -7.119  0.62 17.25 ?  329  HIS A NE2   1 
ATOM   1505 N  NE2   B HIS A 1  201 ? 5.939   2.888   -8.602  0.38 21.49 ?  329  HIS A NE2   1 
ATOM   1506 N  N     . ASP A 1  202 ? 5.857   2.255   -3.999  1.00 12.01 ?  330  ASP A N     1 
ATOM   1507 C  CA    . ASP A 1  202 ? 4.871   3.311   -3.721  1.00 10.17 ?  330  ASP A CA    1 
ATOM   1508 C  C     . ASP A 1  202 ? 3.855   2.811   -2.731  1.00 8.96  ?  330  ASP A C     1 
ATOM   1509 O  O     . ASP A 1  202 ? 3.958   1.668   -2.264  1.00 10.80 ?  330  ASP A O     1 
ATOM   1510 C  CB    . ASP A 1  202 ? 4.171   3.798   -5.017  1.00 8.51  ?  330  ASP A CB    1 
ATOM   1511 C  CG    . ASP A 1  202 ? 3.149   2.803   -5.577  1.00 14.00 ?  330  ASP A CG    1 
ATOM   1512 O  OD1   . ASP A 1  202 ? 2.923   1.723   -4.981  1.00 12.26 ?  330  ASP A OD1   1 
ATOM   1513 O  OD2   . ASP A 1  202 ? 2.541   3.130   -6.630  1.00 11.26 ?  330  ASP A OD2   1 
ATOM   1514 N  N     . VAL A 1  203 ? 2.845   3.630   -2.435  1.00 8.10  ?  331  VAL A N     1 
ATOM   1515 C  CA    . VAL A 1  203 ? 1.702   3.155   -1.638  1.00 7.21  ?  331  VAL A CA    1 
ATOM   1516 C  C     . VAL A 1  203 ? 0.439   3.428   -2.423  1.00 11.58 ?  331  VAL A C     1 
ATOM   1517 O  O     . VAL A 1  203 ? 0.268   4.519   -2.954  1.00 10.14 ?  331  VAL A O     1 
ATOM   1518 C  CB    . VAL A 1  203 ? 1.616   3.837   -0.269  1.00 10.96 ?  331  VAL A CB    1 
ATOM   1519 C  CG1   . VAL A 1  203 ? 0.630   3.088   0.621   1.00 11.89 ?  331  VAL A CG1   1 
ATOM   1520 C  CG2   . VAL A 1  203 ? 3.015   3.847   0.401   1.00 12.67 ?  331  VAL A CG2   1 
ATOM   1521 N  N     . ASP A 1  204 ? -0.408  2.409   -2.539  1.00 7.95  ?  332  ASP A N     1 
ATOM   1522 C  CA    . ASP A 1  204 ? -1.651  2.532   -3.320  1.00 8.54  ?  332  ASP A CA    1 
ATOM   1523 C  C     . ASP A 1  204 ? -2.866  2.527   -2.422  1.00 8.93  ?  332  ASP A C     1 
ATOM   1524 O  O     . ASP A 1  204 ? -3.007  1.629   -1.584  1.00 9.12  ?  332  ASP A O     1 
ATOM   1525 C  CB    . ASP A 1  204 ? -1.768  1.379   -4.330  1.00 8.51  ?  332  ASP A CB    1 
ATOM   1526 C  CG    . ASP A 1  204 ? -0.520  1.216   -5.179  1.00 10.01 ?  332  ASP A CG    1 
ATOM   1527 O  OD1   . ASP A 1  204 ? -0.378  1.996   -6.144  1.00 8.62  ?  332  ASP A OD1   1 
ATOM   1528 O  OD2   . ASP A 1  204 ? 0.317   0.322   -4.892  1.00 9.88  ?  332  ASP A OD2   1 
ATOM   1529 N  N     . PHE A 1  205 ? -3.757  3.511   -2.586  1.00 8.11  ?  333  PHE A N     1 
ATOM   1530 C  CA    . PHE A 1  205 ? -4.963  3.536   -1.758  1.00 8.54  ?  333  PHE A CA    1 
ATOM   1531 C  C     . PHE A 1  205 ? -6.224  3.588   -2.613  1.00 11.40 ?  333  PHE A C     1 
ATOM   1532 O  O     . PHE A 1  205 ? -6.298  4.394   -3.545  1.00 11.70 ?  333  PHE A O     1 
ATOM   1533 C  CB    . PHE A 1  205 ? -4.983  4.756   -0.833  1.00 11.05 ?  333  PHE A CB    1 
ATOM   1534 C  CG    . PHE A 1  205 ? -3.927  4.740   0.229   1.00 13.46 ?  333  PHE A CG    1 
ATOM   1535 C  CD1   . PHE A 1  205 ? -4.017  3.868   1.307   1.00 11.94 ?  333  PHE A CD1   1 
ATOM   1536 C  CD2   . PHE A 1  205 ? -2.849  5.625   0.158   1.00 12.62 ?  333  PHE A CD2   1 
ATOM   1537 C  CE1   . PHE A 1  205 ? -3.051  3.875   2.320   1.00 11.24 ?  333  PHE A CE1   1 
ATOM   1538 C  CE2   . PHE A 1  205 ? -1.879  5.631   1.163   1.00 12.64 ?  333  PHE A CE2   1 
ATOM   1539 C  CZ    . PHE A 1  205 ? -1.967  4.765   2.224   1.00 10.80 ?  333  PHE A CZ    1 
ATOM   1540 N  N     . LEU A 1  206 ? -7.224  2.782   -2.245  1.00 9.08  ?  334  LEU A N     1 
ATOM   1541 C  CA    . LEU A 1  206 ? -8.539  2.798   -2.873  1.00 8.51  ?  334  LEU A CA    1 
ATOM   1542 C  C     . LEU A 1  206 ? -9.566  3.426   -1.924  1.00 11.72 ?  334  LEU A C     1 
ATOM   1543 O  O     . LEU A 1  206 ? -9.694  3.014   -0.759  1.00 12.42 ?  334  LEU A O     1 
ATOM   1544 C  CB    . LEU A 1  206 ? -8.967  1.354   -3.237  1.00 8.76  ?  334  LEU A CB    1 
ATOM   1545 C  CG    . LEU A 1  206 ? -10.391 1.115   -3.709  1.00 9.83  ?  334  LEU A CG    1 
ATOM   1546 C  CD1   . LEU A 1  206 ? -10.756 1.906   -4.952  1.00 12.35 ?  334  LEU A CD1   1 
ATOM   1547 C  CD2   . LEU A 1  206 ? -10.514 -0.401  -4.006  1.00 9.78  ?  334  LEU A CD2   1 
ATOM   1548 N  N     . ILE A 1  207 ? -10.308 4.409   -2.446  1.00 10.68 ?  335  ILE A N     1 
ATOM   1549 C  CA    . ILE A 1  207 ? -11.230 5.206   -1.658  1.00 9.97  ?  335  ILE A CA    1 
ATOM   1550 C  C     . ILE A 1  207 ? -12.664 4.973   -2.141  1.00 12.22 ?  335  ILE A C     1 
ATOM   1551 O  O     . ILE A 1  207 ? -12.915 4.893   -3.347  1.00 11.95 ?  335  ILE A O     1 
ATOM   1552 C  CB    . ILE A 1  207 ? -10.886 6.718   -1.774  1.00 10.07 ?  335  ILE A CB    1 
ATOM   1553 C  CG1   . ILE A 1  207 ? -9.470  6.958   -1.268  1.00 13.80 ?  335  ILE A CG1   1 
ATOM   1554 C  CG2   . ILE A 1  207 ? -11.918 7.593   -0.984  1.00 13.48 ?  335  ILE A CG2   1 
ATOM   1555 C  CD1   . ILE A 1  207 ? -8.854  8.259   -1.762  1.00 15.68 ?  335  ILE A CD1   1 
ATOM   1556 N  N     . THR A 1  208 ? -13.610 4.865   -1.220  1.00 11.36 ?  336  THR A N     1 
ATOM   1557 C  CA    . THR A 1  208 ? -14.997 4.793   -1.661  1.00 13.66 ?  336  THR A CA    1 
ATOM   1558 C  C     . THR A 1  208 ? -15.887 5.411   -0.595  1.00 16.57 ?  336  THR A C     1 
ATOM   1559 O  O     . THR A 1  208 ? -15.393 6.008   0.359   1.00 15.16 ?  336  THR A O     1 
ATOM   1560 C  CB    . THR A 1  208 ? -15.427 3.326   -1.996  1.00 15.68 ?  336  THR A CB    1 
ATOM   1561 O  OG1   . THR A 1  208 ? -16.682 3.329   -2.694  1.00 16.07 ?  336  THR A OG1   1 
ATOM   1562 C  CG2   . THR A 1  208 ? -15.547 2.473   -0.739  1.00 17.93 ?  336  THR A CG2   1 
ATOM   1563 N  N     . HIS A 1  209 ? -17.198 5.315   -0.802  1.00 15.00 ?  337  HIS A N     1 
ATOM   1564 C  CA    . HIS A 1  209 ? -18.187 5.807   0.143   1.00 15.99 ?  337  HIS A CA    1 
ATOM   1565 C  C     . HIS A 1  209 ? -19.400 4.878   0.077   1.00 17.74 ?  337  HIS A C     1 
ATOM   1566 O  O     . HIS A 1  209 ? -19.787 4.459   -1.001  1.00 20.26 ?  337  HIS A O     1 
ATOM   1567 C  CB    . HIS A 1  209 ? -18.599 7.253   -0.183  1.00 16.94 ?  337  HIS A CB    1 
ATOM   1568 C  CG    . HIS A 1  209 ? -19.446 7.881   0.875   1.00 18.27 ?  337  HIS A CG    1 
ATOM   1569 N  ND1   . HIS A 1  209 ? -20.788 7.600   1.018   1.00 20.10 ?  337  HIS A ND1   1 
ATOM   1570 C  CD2   . HIS A 1  209 ? -19.139 8.768   1.852   1.00 19.05 ?  337  HIS A CD2   1 
ATOM   1571 C  CE1   . HIS A 1  209 ? -21.266 8.278   2.046   1.00 22.50 ?  337  HIS A CE1   1 
ATOM   1572 N  NE2   . HIS A 1  209 ? -20.289 8.999   2.565   1.00 22.59 ?  337  HIS A NE2   1 
ATOM   1573 N  N     . PRO A 1  210 ? -19.998 4.554   1.234   1.00 21.82 ?  338  PRO A N     1 
ATOM   1574 C  CA    . PRO A 1  210 ? -21.090 3.571   1.287   1.00 22.65 ?  338  PRO A CA    1 
ATOM   1575 C  C     . PRO A 1  210 ? -22.357 3.988   0.534   1.00 24.12 ?  338  PRO A C     1 
ATOM   1576 O  O     . PRO A 1  210 ? -23.144 3.106   0.159   1.00 26.17 ?  338  PRO A O     1 
ATOM   1577 C  CB    . PRO A 1  210 ? -21.378 3.450   2.784   1.00 25.20 ?  338  PRO A CB    1 
ATOM   1578 C  CG    . PRO A 1  210 ? -20.813 4.720   3.401   1.00 23.46 ?  338  PRO A CG    1 
ATOM   1579 C  CD    . PRO A 1  210 ? -19.570 4.974   2.579   1.00 21.04 ?  338  PRO A CD    1 
ATOM   1580 N  N     . LYS A 1  211 ? -22.557 5.287   0.310   1.00 25.29 ?  339  LYS A N     1 
ATOM   1581 C  CA    . LYS A 1  211 ? -23.719 5.757   -0.441  1.00 26.11 ?  339  LYS A CA    1 
ATOM   1582 C  C     . LYS A 1  211 ? -23.314 6.036   -1.875  1.00 27.16 ?  339  LYS A C     1 
ATOM   1583 O  O     . LYS A 1  211 ? -22.588 6.998   -2.148  1.00 26.47 ?  339  LYS A O     1 
ATOM   1584 C  CB    . LYS A 1  211 ? -24.330 7.017   0.191   1.00 27.56 ?  339  LYS A CB    1 
ATOM   1585 N  N     . GLU A 1  212 ? -23.768 5.180   -2.783  1.00 26.43 ?  340  GLU A N     1 
ATOM   1586 C  CA    . GLU A 1  212 ? -23.374 5.265   -4.186  1.00 24.12 ?  340  GLU A CA    1 
ATOM   1587 C  C     . GLU A 1  212 ? -23.598 6.661   -4.753  1.00 22.85 ?  340  GLU A C     1 
ATOM   1588 O  O     . GLU A 1  212 ? -24.682 7.239   -4.599  1.00 22.12 ?  340  GLU A O     1 
ATOM   1589 C  CB    . GLU A 1  212 ? -24.154 4.243   -5.015  1.00 28.54 ?  340  GLU A CB    1 
ATOM   1590 C  CG    . GLU A 1  212 ? -23.763 4.214   -6.477  1.00 28.90 ?  340  GLU A CG    1 
ATOM   1591 C  CD    . GLU A 1  212 ? -22.874 3.038   -6.808  1.00 27.65 ?  340  GLU A CD    1 
ATOM   1592 O  OE1   . GLU A 1  212 ? -22.541 2.277   -5.876  1.00 24.63 ?  340  GLU A OE1   1 
ATOM   1593 O  OE2   . GLU A 1  212 ? -22.523 2.874   -7.993  1.00 28.86 ?  340  GLU A OE2   1 
ATOM   1594 N  N     . GLY A 1  213 ? -22.564 7.204   -5.384  1.00 22.89 ?  341  GLY A N     1 
ATOM   1595 C  CA    . GLY A 1  213 ? -22.638 8.515   -5.998  1.00 25.00 ?  341  GLY A CA    1 
ATOM   1596 C  C     . GLY A 1  213 ? -21.966 9.595   -5.171  1.00 23.87 ?  341  GLY A C     1 
ATOM   1597 O  O     . GLY A 1  213 ? -21.497 10.597  -5.717  1.00 23.70 ?  341  GLY A O     1 
ATOM   1598 N  N     . GLN A 1  214 ? -21.916 9.411   -3.855  1.00 21.56 ?  342  GLN A N     1 
ATOM   1599 C  CA    . GLN A 1  214 ? -21.326 10.447  -2.999  1.00 22.19 ?  342  GLN A CA    1 
ATOM   1600 C  C     . GLN A 1  214 ? -19.820 10.559  -3.186  1.00 20.12 ?  342  GLN A C     1 
ATOM   1601 O  O     . GLN A 1  214 ? -19.221 11.564  -2.828  1.00 20.19 ?  342  GLN A O     1 
ATOM   1602 C  CB    . GLN A 1  214 ? -21.651 10.184  -1.527  1.00 24.26 ?  342  GLN A CB    1 
ATOM   1603 C  CG    . GLN A 1  214 ? -23.136 10.384  -1.167  1.00 24.29 ?  342  GLN A CG    1 
ATOM   1604 C  CD    . GLN A 1  214 ? -23.702 11.720  -1.625  1.00 33.90 ?  342  GLN A CD    1 
ATOM   1605 O  OE1   . GLN A 1  214 ? -24.428 11.791  -2.617  1.00 37.16 ?  342  GLN A OE1   1 
ATOM   1606 N  NE2   . GLN A 1  214 ? -23.381 12.784  -0.898  1.00 33.25 ?  342  GLN A NE2   1 
ATOM   1607 N  N     . GLU A 1  215 ? -19.204 9.524   -3.753  1.00 16.93 ?  343  GLU A N     1 
ATOM   1608 C  CA    . GLU A 1  215 ? -17.765 9.553   -3.977  1.00 15.67 ?  343  GLU A CA    1 
ATOM   1609 C  C     . GLU A 1  215 ? -17.373 10.423  -5.187  1.00 15.89 ?  343  GLU A C     1 
ATOM   1610 O  O     . GLU A 1  215 ? -16.202 10.674  -5.406  1.00 18.08 ?  343  GLU A O     1 
ATOM   1611 C  CB    . GLU A 1  215 ? -17.222 8.114   -4.157  1.00 15.94 ?  343  GLU A CB    1 
ATOM   1612 C  CG    . GLU A 1  215 ? -17.411 7.552   -5.550  1.00 17.77 ?  343  GLU A CG    1 
ATOM   1613 C  CD    . GLU A 1  215 ? -18.854 7.344   -5.945  1.00 20.53 ?  343  GLU A CD    1 
ATOM   1614 O  OE1   . GLU A 1  215 ? -19.723 7.212   -5.061  1.00 19.85 ?  343  GLU A OE1   1 
ATOM   1615 O  OE2   . GLU A 1  215 ? -19.131 7.337   -7.164  1.00 24.10 ?  343  GLU A OE2   1 
ATOM   1616 N  N     . ALA A 1  216 ? -18.344 10.861  -5.973  1.00 17.12 ?  344  ALA A N     1 
ATOM   1617 C  CA    . ALA A 1  216 ? -18.056 11.661  -7.160  1.00 19.02 ?  344  ALA A CA    1 
ATOM   1618 C  C     . ALA A 1  216 ? -17.378 12.979  -6.761  1.00 21.31 ?  344  ALA A C     1 
ATOM   1619 O  O     . ALA A 1  216 ? -17.771 13.595  -5.774  1.00 20.62 ?  344  ALA A O     1 
ATOM   1620 C  CB    . ALA A 1  216 ? -19.330 11.953  -7.930  1.00 21.78 ?  344  ALA A CB    1 
ATOM   1621 N  N     . GLY A 1  217 ? -16.376 13.408  -7.529  1.00 19.85 ?  345  GLY A N     1 
ATOM   1622 C  CA    . GLY A 1  217 ? -15.835 14.749  -7.347  1.00 21.24 ?  345  GLY A CA    1 
ATOM   1623 C  C     . GLY A 1  217 ? -14.987 14.867  -6.090  1.00 19.98 ?  345  GLY A C     1 
ATOM   1624 O  O     . GLY A 1  217 ? -14.808 15.950  -5.539  1.00 21.03 ?  345  GLY A O     1 
ATOM   1625 N  N     . LEU A 1  218 ? -14.444 13.743  -5.648  1.00 17.43 ?  346  LEU A N     1 
ATOM   1626 C  CA    . LEU A 1  218 ? -13.707 13.685  -4.383  1.00 17.01 ?  346  LEU A CA    1 
ATOM   1627 C  C     . LEU A 1  218 ? -12.246 14.131  -4.438  1.00 16.84 ?  346  LEU A C     1 
ATOM   1628 O  O     . LEU A 1  218 ? -11.790 14.892  -3.585  1.00 15.75 ?  346  LEU A O     1 
ATOM   1629 C  CB    . LEU A 1  218 ? -13.750 12.254  -3.838  1.00 15.74 ?  346  LEU A CB    1 
ATOM   1630 C  CG    . LEU A 1  218 ? -13.041 12.079  -2.496  1.00 18.08 ?  346  LEU A CG    1 
ATOM   1631 C  CD1   . LEU A 1  218 ? -13.566 13.054  -1.448  1.00 18.17 ?  346  LEU A CD1   1 
ATOM   1632 C  CD2   . LEU A 1  218 ? -13.263 10.663  -2.026  1.00 19.59 ?  346  LEU A CD2   1 
ATOM   1633 N  N     . LEU A 1  219 ? -11.481 13.655  -5.414  1.00 17.16 ?  347  LEU A N     1 
ATOM   1634 C  CA    . LEU A 1  219 ? -10.040 13.909  -5.335  1.00 18.88 ?  347  LEU A CA    1 
ATOM   1635 C  C     . LEU A 1  219 ? -9.610  15.368  -5.401  1.00 18.85 ?  347  LEU A C     1 
ATOM   1636 O  O     . LEU A 1  219 ? -8.634  15.715  -4.751  1.00 20.46 ?  347  LEU A O     1 
ATOM   1637 C  CB    . LEU A 1  219 ? -9.276  13.116  -6.410  1.00 18.71 ?  347  LEU A CB    1 
ATOM   1638 C  CG    . LEU A 1  219 ? -9.241  11.624  -6.104  1.00 18.28 ?  347  LEU A CG    1 
ATOM   1639 C  CD1   . LEU A 1  219 ? -8.387  10.906  -7.116  1.00 16.40 ?  347  LEU A CD1   1 
ATOM   1640 C  CD2   . LEU A 1  219 ? -8.710  11.329  -4.680  1.00 15.74 ?  347  LEU A CD2   1 
ATOM   1641 N  N     . PRO A 1  220 ? -10.321 16.246  -6.148  1.00 20.54 ?  348  PRO A N     1 
ATOM   1642 C  CA    . PRO A 1  220 ? -9.801  17.607  -6.028  1.00 19.62 ?  348  PRO A CA    1 
ATOM   1643 C  C     . PRO A 1  220 ? -9.890  18.127  -4.597  1.00 21.15 ?  348  PRO A C     1 
ATOM   1644 O  O     . PRO A 1  220 ? -9.052  18.928  -4.198  1.00 21.17 ?  348  PRO A O     1 
ATOM   1645 C  CB    . PRO A 1  220 ? -10.711 18.428  -6.960  1.00 21.56 ?  348  PRO A CB    1 
ATOM   1646 C  CG    . PRO A 1  220 ? -11.263 17.420  -7.920  1.00 21.28 ?  348  PRO A CG    1 
ATOM   1647 C  CD    . PRO A 1  220 ? -11.413 16.156  -7.137  1.00 19.94 ?  348  PRO A CD    1 
ATOM   1648 N  N     . ARG A 1  221 ? -10.899 17.683  -3.846  1.00 18.86 ?  349  ARG A N     1 
ATOM   1649 C  CA    . ARG A 1  221 ? -11.055 18.155  -2.474  1.00 19.56 ?  349  ARG A CA    1 
ATOM   1650 C  C     . ARG A 1  221 ? -9.958  17.550  -1.586  1.00 18.33 ?  349  ARG A C     1 
ATOM   1651 O  O     . ARG A 1  221 ? -9.375  18.238  -0.734  1.00 20.21 ?  349  ARG A O     1 
ATOM   1652 C  CB    . ARG A 1  221 ? -12.449 17.814  -1.950  1.00 18.54 ?  349  ARG A CB    1 
ATOM   1653 C  CG    . ARG A 1  221 ? -13.572 18.677  -2.545  1.00 18.66 ?  349  ARG A CG    1 
ATOM   1654 C  CD    . ARG A 1  221 ? -14.943 18.115  -2.180  1.00 21.13 ?  349  ARG A CD    1 
ATOM   1655 N  NE    . ARG A 1  221 ? -15.120 18.032  -0.732  1.00 20.28 ?  349  ARG A NE    1 
ATOM   1656 C  CZ    . ARG A 1  221 ? -15.450 19.071  0.029   1.00 20.83 ?  349  ARG A CZ    1 
ATOM   1657 N  NH1   . ARG A 1  221 ? -15.665 20.267  -0.528  1.00 22.06 ?  349  ARG A NH1   1 
ATOM   1658 N  NH2   . ARG A 1  221 ? -15.575 18.912  1.340   1.00 21.24 ?  349  ARG A NH2   1 
ATOM   1659 N  N     . VAL A 1  222 ? -9.663  16.276  -1.813  1.00 18.61 ?  350  VAL A N     1 
ATOM   1660 C  CA    . VAL A 1  222 ? -8.631  15.585  -1.067  1.00 17.77 ?  350  VAL A CA    1 
ATOM   1661 C  C     . VAL A 1  222 ? -7.283  16.247  -1.374  1.00 21.32 ?  350  VAL A C     1 
ATOM   1662 O  O     . VAL A 1  222 ? -6.524  16.586  -0.465  1.00 21.50 ?  350  VAL A O     1 
ATOM   1663 C  CB    . VAL A 1  222 ? -8.600  14.080  -1.421  1.00 17.54 ?  350  VAL A CB    1 
ATOM   1664 C  CG1   . VAL A 1  222 ? -7.411  13.398  -0.803  1.00 17.03 ?  350  VAL A CG1   1 
ATOM   1665 C  CG2   . VAL A 1  222 ? -9.886  13.390  -0.925  1.00 16.10 ?  350  VAL A CG2   1 
ATOM   1666 N  N     . MET A 1  223 ? -7.005  16.462  -2.658  1.00 19.31 ?  351  MET A N     1 
ATOM   1667 C  CA    . MET A 1  223 ? -5.716  17.022  -3.052  1.00 20.52 ?  351  MET A CA    1 
ATOM   1668 C  C     . MET A 1  223 ? -5.535  18.440  -2.516  1.00 21.99 ?  351  MET A C     1 
ATOM   1669 O  O     . MET A 1  223 ? -4.434  18.804  -2.088  1.00 22.89 ?  351  MET A O     1 
ATOM   1670 C  CB    . MET A 1  223 ? -5.548  17.003  -4.579  1.00 18.78 ?  351  MET A CB    1 
ATOM   1671 C  CG    . MET A 1  223 ? -5.524  15.593  -5.201  1.00 19.90 ?  351  MET A CG    1 
ATOM   1672 S  SD    . MET A 1  223 ? -4.345  14.468  -4.420  1.00 25.78 ?  351  MET A SD    1 
ATOM   1673 C  CE    . MET A 1  223 ? -2.879  15.485  -4.419  1.00 17.87 ?  351  MET A CE    1 
ATOM   1674 N  N     . CYS A 1  224 ? -6.598  19.254  -2.527  1.00 21.90 ?  352  CYS A N     1 
ATOM   1675 C  CA    A CYS A 1  224 ? -6.538  20.599  -1.963  0.60 23.11 ?  352  CYS A CA    1 
ATOM   1676 C  CA    B CYS A 1  224 ? -6.496  20.595  -1.975  0.40 23.08 ?  352  CYS A CA    1 
ATOM   1677 C  C     . CYS A 1  224 ? -6.142  20.560  -0.489  1.00 23.83 ?  352  CYS A C     1 
ATOM   1678 O  O     . CYS A 1  224 ? -5.327  21.355  -0.019  1.00 29.16 ?  352  CYS A O     1 
ATOM   1679 C  CB    A CYS A 1  224 ? -7.893  21.313  -2.114  0.60 24.42 ?  352  CYS A CB    1 
ATOM   1680 C  CB    B CYS A 1  224 ? -7.802  21.362  -2.195  0.40 24.47 ?  352  CYS A CB    1 
ATOM   1681 S  SG    A CYS A 1  224 ? -7.997  22.917  -1.267  0.60 40.25 ?  352  CYS A SG    1 
ATOM   1682 S  SG    B CYS A 1  224 ? -8.032  21.846  -3.911  0.40 27.63 ?  352  CYS A SG    1 
ATOM   1683 N  N     . ARG A 1  225 ? -6.747  19.639  0.244   1.00 23.31 ?  353  ARG A N     1 
ATOM   1684 C  CA    . ARG A 1  225 ? -6.502  19.536  1.677   1.00 26.85 ?  353  ARG A CA    1 
ATOM   1685 C  C     . ARG A 1  225 ? -5.079  19.034  1.971   1.00 26.36 ?  353  ARG A C     1 
ATOM   1686 O  O     . ARG A 1  225 ? -4.462  19.459  2.948   1.00 29.66 ?  353  ARG A O     1 
ATOM   1687 C  CB    . ARG A 1  225 ? -7.575  18.643  2.323   1.00 28.21 ?  353  ARG A CB    1 
ATOM   1688 C  CG    . ARG A 1  225 ? -8.850  19.463  2.689   1.00 36.51 ?  353  ARG A CG    1 
ATOM   1689 C  CD    . ARG A 1  225 ? -10.199 18.768  2.431   1.00 37.45 ?  353  ARG A CD    1 
ATOM   1690 N  NE    . ARG A 1  225 ? -11.314 19.708  2.635   1.00 36.36 ?  353  ARG A NE    1 
ATOM   1691 C  CZ    . ARG A 1  225 ? -11.880 20.434  1.667   1.00 35.26 ?  353  ARG A CZ    1 
ATOM   1692 N  NH1   . ARG A 1  225 ? -11.441 20.330  0.417   1.00 35.57 ?  353  ARG A NH1   1 
ATOM   1693 N  NH2   . ARG A 1  225 ? -12.869 21.292  1.945   1.00 32.92 ?  353  ARG A NH2   1 
ATOM   1694 N  N     . LEU A 1  226 ? -4.548  18.171  1.111   1.00 22.19 ?  354  LEU A N     1 
ATOM   1695 C  CA    . LEU A 1  226 ? -3.165  17.700  1.269   1.00 22.58 ?  354  LEU A CA    1 
ATOM   1696 C  C     . LEU A 1  226 ? -2.147  18.787  0.919   1.00 23.50 ?  354  LEU A C     1 
ATOM   1697 O  O     . LEU A 1  226 ? -1.096  18.936  1.579   1.00 24.94 ?  354  LEU A O     1 
ATOM   1698 C  CB    . LEU A 1  226 ? -2.940  16.454  0.415   1.00 19.95 ?  354  LEU A CB    1 
ATOM   1699 C  CG    . LEU A 1  226 ? -3.693  15.197  0.858   1.00 21.87 ?  354  LEU A CG    1 
ATOM   1700 C  CD1   . LEU A 1  226 ? -3.668  14.148  -0.227  1.00 19.11 ?  354  LEU A CD1   1 
ATOM   1701 C  CD2   . LEU A 1  226 ? -3.076  14.652  2.144   1.00 23.88 ?  354  LEU A CD2   1 
ATOM   1702 N  N     . GLN A 1  227 ? -2.444  19.558  -0.119  1.00 23.54 ?  355  GLN A N     1 
ATOM   1703 C  CA    . GLN A 1  227 ? -1.577  20.662  -0.515  1.00 26.44 ?  355  GLN A CA    1 
ATOM   1704 C  C     . GLN A 1  227 ? -1.552  21.740  0.560   1.00 28.18 ?  355  GLN A C     1 
ATOM   1705 O  O     . GLN A 1  227 ? -0.530  22.358  0.802   1.00 27.83 ?  355  GLN A O     1 
ATOM   1706 C  CB    . GLN A 1  227 ? -2.027  21.257  -1.847  1.00 30.01 ?  355  GLN A CB    1 
ATOM   1707 C  CG    . GLN A 1  227 ? -1.779  20.342  -3.022  1.00 34.31 ?  355  GLN A CG    1 
ATOM   1708 C  CD    . GLN A 1  227 ? -2.391  20.858  -4.303  1.00 41.40 ?  355  GLN A CD    1 
ATOM   1709 O  OE1   . GLN A 1  227 ? -3.534  21.337  -4.316  1.00 43.89 ?  355  GLN A OE1   1 
ATOM   1710 N  NE2   . GLN A 1  227 ? -1.634  20.769  -5.395  1.00 42.95 ?  355  GLN A NE2   1 
ATOM   1711 N  N     . ASP A 1  228 ? -2.680  21.944  1.226   1.00 31.10 ?  356  ASP A N     1 
ATOM   1712 C  CA    . ASP A 1  228 ? -2.722  22.931  2.297   1.00 37.69 ?  356  ASP A CA    1 
ATOM   1713 C  C     . ASP A 1  228 ? -1.904  22.508  3.511   1.00 38.10 ?  356  ASP A C     1 
ATOM   1714 O  O     . ASP A 1  228 ? -1.633  23.316  4.400   1.00 40.86 ?  356  ASP A O     1 
ATOM   1715 C  CB    . ASP A 1  228 ? -4.162  23.208  2.702   1.00 42.89 ?  356  ASP A CB    1 
ATOM   1716 C  CG    . ASP A 1  228 ? -4.902  24.007  1.656   1.00 49.57 ?  356  ASP A CG    1 
ATOM   1717 O  OD1   . ASP A 1  228 ? -4.231  24.478  0.704   1.00 52.90 ?  356  ASP A OD1   1 
ATOM   1718 O  OD2   . ASP A 1  228 ? -6.136  24.167  1.781   1.00 52.13 ?  356  ASP A OD2   1 
ATOM   1719 N  N     . GLN A 1  229 ? -1.497  21.248  3.551   1.00 36.36 ?  357  GLN A N     1 
ATOM   1720 C  CA    . GLN A 1  229 ? -0.597  20.815  4.604   1.00 36.65 ?  357  GLN A CA    1 
ATOM   1721 C  C     . GLN A 1  229 ? 0.846   20.742  4.102   1.00 33.14 ?  357  GLN A C     1 
ATOM   1722 O  O     . GLN A 1  229 ? 1.746   20.323  4.838   1.00 33.61 ?  357  GLN A O     1 
ATOM   1723 C  CB    . GLN A 1  229 ? -1.061  19.479  5.158   1.00 38.85 ?  357  GLN A CB    1 
ATOM   1724 C  CG    . GLN A 1  229 ? -2.480  19.557  5.646   1.00 44.76 ?  357  GLN A CG    1 
ATOM   1725 C  CD    . GLN A 1  229 ? -2.986  18.247  6.163   1.00 49.97 ?  357  GLN A CD    1 
ATOM   1726 O  OE1   . GLN A 1  229 ? -3.097  17.273  5.414   1.00 51.20 ?  357  GLN A OE1   1 
ATOM   1727 N  NE2   . GLN A 1  229 ? -3.308  18.205  7.454   1.00 54.32 ?  357  GLN A NE2   1 
ATOM   1728 N  N     . GLY A 1  230 ? 1.060   21.171  2.857   1.00 27.14 ?  358  GLY A N     1 
ATOM   1729 C  CA    . GLY A 1  230 ? 2.389   21.218  2.270   1.00 24.81 ?  358  GLY A CA    1 
ATOM   1730 C  C     . GLY A 1  230 ? 2.951   19.843  1.963   1.00 22.73 ?  358  GLY A C     1 
ATOM   1731 O  O     . GLY A 1  230 ? 4.171   19.668  1.911   1.00 24.15 ?  358  GLY A O     1 
ATOM   1732 N  N     . LEU A 1  231 ? 2.066   18.873  1.743   1.00 18.34 ?  359  LEU A N     1 
ATOM   1733 C  CA    . LEU A 1  231 ? 2.483   17.466  1.630   1.00 18.94 ?  359  LEU A CA    1 
ATOM   1734 C  C     . LEU A 1  231 ? 2.656   16.984  0.201   1.00 17.95 ?  359  LEU A C     1 
ATOM   1735 O  O     . LEU A 1  231 ? 3.144   15.871  -0.017  1.00 18.72 ?  359  LEU A O     1 
ATOM   1736 C  CB    . LEU A 1  231 ? 1.472   16.551  2.325   1.00 20.10 ?  359  LEU A CB    1 
ATOM   1737 C  CG    . LEU A 1  231 ? 1.267   16.872  3.806   1.00 27.71 ?  359  LEU A CG    1 
ATOM   1738 C  CD1   . LEU A 1  231 ? 0.316   15.863  4.428   1.00 27.83 ?  359  LEU A CD1   1 
ATOM   1739 C  CD2   . LEU A 1  231 ? 2.616   16.892  4.517   1.00 31.89 ?  359  LEU A CD2   1 
ATOM   1740 N  N     . ILE A 1  232 ? 2.246   17.786  -0.767  1.00 17.09 ?  360  ILE A N     1 
ATOM   1741 C  CA    . ILE A 1  232 ? 2.224   17.314  -2.151  1.00 16.54 ?  360  ILE A CA    1 
ATOM   1742 C  C     . ILE A 1  232 ? 3.327   17.954  -2.979  1.00 16.88 ?  360  ILE A C     1 
ATOM   1743 O  O     . ILE A 1  232 ? 3.323   19.171  -3.192  1.00 21.65 ?  360  ILE A O     1 
ATOM   1744 C  CB    . ILE A 1  232 ? 0.846   17.615  -2.822  1.00 17.34 ?  360  ILE A CB    1 
ATOM   1745 C  CG1   . ILE A 1  232 ? -0.306  16.981  -2.028  1.00 16.22 ?  360  ILE A CG1   1 
ATOM   1746 C  CG2   . ILE A 1  232 ? 0.856   17.208  -4.293  1.00 17.09 ?  360  ILE A CG2   1 
ATOM   1747 C  CD1   . ILE A 1  232 ? -0.242  15.463  -1.889  1.00 15.16 ?  360  ILE A CD1   1 
ATOM   1748 N  N     . LEU A 1  233 ? 4.273   17.138  -3.446  1.00 13.90 ?  361  LEU A N     1 
ATOM   1749 C  CA    . LEU A 1  233 ? 5.350   17.635  -4.314  1.00 16.78 ?  361  LEU A CA    1 
ATOM   1750 C  C     . LEU A 1  233 ? 4.972   17.600  -5.788  1.00 18.95 ?  361  LEU A C     1 
ATOM   1751 O  O     . LEU A 1  233 ? 5.462   18.394  -6.591  1.00 22.39 ?  361  LEU A O     1 
ATOM   1752 C  CB    . LEU A 1  233 ? 6.614   16.804  -4.099  1.00 16.17 ?  361  LEU A CB    1 
ATOM   1753 C  CG    . LEU A 1  233 ? 7.203   16.945  -2.705  1.00 15.56 ?  361  LEU A CG    1 
ATOM   1754 C  CD1   . LEU A 1  233 ? 8.078   15.737  -2.381  1.00 14.47 ?  361  LEU A CD1   1 
ATOM   1755 C  CD2   . LEU A 1  233 ? 8.043   18.195  -2.638  1.00 19.10 ?  361  LEU A CD2   1 
ATOM   1756 N  N     . TYR A 1  234 ? 4.121   16.644  -6.143  1.00 17.30 ?  362  TYR A N     1 
ATOM   1757 C  CA    . TYR A 1  234 ? 3.722   16.446  -7.523  1.00 18.69 ?  362  TYR A CA    1 
ATOM   1758 C  C     . TYR A 1  234 ? 2.377   15.758  -7.535  1.00 15.44 ?  362  TYR A C     1 
ATOM   1759 O  O     . TYR A 1  234 ? 2.135   14.865  -6.715  1.00 14.66 ?  362  TYR A O     1 
ATOM   1760 C  CB    . TYR A 1  234 ? 4.742   15.581  -8.295  1.00 17.99 ?  362  TYR A CB    1 
ATOM   1761 C  CG    . TYR A 1  234 ? 4.215   15.138  -9.661  1.00 16.20 ?  362  TYR A CG    1 
ATOM   1762 C  CD1   . TYR A 1  234 ? 4.378   15.937  -10.774 1.00 18.14 ?  362  TYR A CD1   1 
ATOM   1763 C  CD2   . TYR A 1  234 ? 3.513   13.934  -9.806  1.00 19.64 ?  362  TYR A CD2   1 
ATOM   1764 C  CE1   . TYR A 1  234 ? 3.876   15.566  -12.000 1.00 20.88 ?  362  TYR A CE1   1 
ATOM   1765 C  CE2   . TYR A 1  234 ? 3.005   13.545  -11.027 1.00 18.33 ?  362  TYR A CE2   1 
ATOM   1766 C  CZ    . TYR A 1  234 ? 3.191   14.363  -12.121 1.00 19.66 ?  362  TYR A CZ    1 
ATOM   1767 O  OH    . TYR A 1  234 ? 2.693   13.982  -13.341 1.00 20.35 ?  362  TYR A OH    1 
ATOM   1768 N  N     . HIS A 1  235 ? 1.494   16.135  -8.456  1.00 16.86 ?  363  HIS A N     1 
ATOM   1769 C  CA    . HIS A 1  235 ? 0.459   15.155  -8.756  1.00 19.73 ?  363  HIS A CA    1 
ATOM   1770 C  C     . HIS A 1  235 ? -0.180  15.331  -10.114 1.00 18.61 ?  363  HIS A C     1 
ATOM   1771 O  O     . HIS A 1  235 ? -0.119  16.383  -10.742 1.00 20.55 ?  363  HIS A O     1 
ATOM   1772 C  CB    . HIS A 1  235 ? -0.615  15.148  -7.665  1.00 23.93 ?  363  HIS A CB    1 
ATOM   1773 C  CG    . HIS A 1  235 ? -1.656  16.194  -7.845  1.00 27.76 ?  363  HIS A CG    1 
ATOM   1774 N  ND1   . HIS A 1  235 ? -1.411  17.530  -7.626  1.00 30.45 ?  363  HIS A ND1   1 
ATOM   1775 C  CD2   . HIS A 1  235 ? -2.958  16.098  -8.206  1.00 29.88 ?  363  HIS A CD2   1 
ATOM   1776 C  CE1   . HIS A 1  235 ? -2.516  18.218  -7.863  1.00 31.92 ?  363  HIS A CE1   1 
ATOM   1777 N  NE2   . HIS A 1  235 ? -3.469  17.370  -8.211  1.00 29.04 ?  363  HIS A NE2   1 
ATOM   1778 N  N     . GLN A 1  236 ? -0.767  14.235  -10.569 1.00 19.41 ?  364  GLN A N     1 
ATOM   1779 C  CA    . GLN A 1  236 ? -1.440  14.184  -11.839 1.00 20.11 ?  364  GLN A CA    1 
ATOM   1780 C  C     . GLN A 1  236 ? -2.790  13.560  -11.587 1.00 17.54 ?  364  GLN A C     1 
ATOM   1781 O  O     . GLN A 1  236 ? -2.846  12.423  -11.145 1.00 16.51 ?  364  GLN A O     1 
ATOM   1782 C  CB    . GLN A 1  236 ? -0.670  13.352  -12.843 1.00 21.61 ?  364  GLN A CB    1 
ATOM   1783 C  CG    . GLN A 1  236 ? -1.427  13.181  -14.130 1.00 27.55 ?  364  GLN A CG    1 
ATOM   1784 C  CD    . GLN A 1  236 ? -0.591  12.524  -15.189 1.00 35.38 ?  364  GLN A CD    1 
ATOM   1785 O  OE1   . GLN A 1  236 ? -0.253  11.340  -15.080 1.00 36.91 ?  364  GLN A OE1   1 
ATOM   1786 N  NE2   . GLN A 1  236 ? -0.224  13.290  -16.217 1.00 37.65 ?  364  GLN A NE2   1 
ATOM   1787 N  N     . HIS A 1  237 ? -3.841  14.308  -11.893 1.00 20.59 ?  365  HIS A N     1 
ATOM   1788 C  CA    . HIS A 1  237 ? -5.216  13.900  -11.618 1.00 20.10 ?  365  HIS A CA    1 
ATOM   1789 C  C     . HIS A 1  237 ? -5.881  13.428  -12.913 1.00 20.34 ?  365  HIS A C     1 
ATOM   1790 O  O     . HIS A 1  237 ? -5.631  13.981  -13.982 1.00 23.01 ?  365  HIS A O     1 
ATOM   1791 C  CB    . HIS A 1  237 ? -5.978  15.087  -11.002 1.00 23.70 ?  365  HIS A CB    1 
ATOM   1792 C  CG    . HIS A 1  237 ? -7.442  14.843  -10.777 1.00 22.78 ?  365  HIS A CG    1 
ATOM   1793 N  ND1   . HIS A 1  237 ? -8.421  15.508  -11.482 1.00 25.61 ?  365  HIS A ND1   1 
ATOM   1794 C  CD2   . HIS A 1  237 ? -8.092  14.028  -9.913  1.00 22.84 ?  365  HIS A CD2   1 
ATOM   1795 C  CE1   . HIS A 1  237 ? -9.610  15.103  -11.073 1.00 27.13 ?  365  HIS A CE1   1 
ATOM   1796 N  NE2   . HIS A 1  237 ? -9.437  14.207  -10.119 1.00 24.04 ?  365  HIS A NE2   1 
ATOM   1797 N  N     . GLN A 1  238 ? -6.705  12.385  -12.813 1.00 18.44 ?  366  GLN A N     1 
ATOM   1798 C  CA    . GLN A 1  238 ? -7.493  11.915  -13.944 1.00 20.14 ?  366  GLN A CA    1 
ATOM   1799 C  C     . GLN A 1  238 ? -8.925  11.848  -13.471 1.00 20.37 ?  366  GLN A C     1 
ATOM   1800 O  O     . GLN A 1  238 ? -9.209  11.187  -12.468 1.00 19.20 ?  366  GLN A O     1 
ATOM   1801 C  CB    . GLN A 1  238 ? -7.021  10.538  -14.447 1.00 22.44 ?  366  GLN A CB    1 
ATOM   1802 C  CG    . GLN A 1  238 ? -5.554  10.494  -14.909 1.00 25.45 ?  366  GLN A CG    1 
ATOM   1803 C  CD    . GLN A 1  238 ? -5.137  9.117   -15.451 1.00 26.63 ?  366  GLN A CD    1 
ATOM   1804 O  OE1   . GLN A 1  238 ? -5.659  8.078   -15.031 1.00 26.06 ?  366  GLN A OE1   1 
ATOM   1805 N  NE2   . GLN A 1  238 ? -4.195  9.113   -16.391 1.00 24.63 ?  366  GLN A NE2   1 
ATOM   1806 N  N     . HIS A 1  239 ? -9.813  12.567  -14.150 1.00 21.65 ?  367  HIS A N     1 
ATOM   1807 C  CA    . HIS A 1  239 ? -11.234 12.539  -13.808 1.00 25.77 ?  367  HIS A CA    1 
ATOM   1808 C  C     . HIS A 1  239 ? -11.844 11.164  -14.079 1.00 28.09 ?  367  HIS A C     1 
ATOM   1809 O  O     . HIS A 1  239 ? -11.340 10.390  -14.904 1.00 27.73 ?  367  HIS A O     1 
ATOM   1810 C  CB    . HIS A 1  239 ? -12.009 13.594  -14.605 1.00 29.60 ?  367  HIS A CB    1 
ATOM   1811 C  CG    . HIS A 1  239 ? -11.739 15.002  -14.179 1.00 34.68 ?  367  HIS A CG    1 
ATOM   1812 N  ND1   . HIS A 1  239 ? -10.650 15.722  -14.628 1.00 38.97 ?  367  HIS A ND1   1 
ATOM   1813 C  CD2   . HIS A 1  239 ? -12.422 15.831  -13.354 1.00 36.89 ?  367  HIS A CD2   1 
ATOM   1814 C  CE1   . HIS A 1  239 ? -10.674 16.933  -14.097 1.00 39.26 ?  367  HIS A CE1   1 
ATOM   1815 N  NE2   . HIS A 1  239 ? -11.742 17.026  -13.322 1.00 38.09 ?  367  HIS A NE2   1 
ATOM   1816 N  N     . SER A 1  240 ? -12.948 10.877  -13.397 1.00 27.01 ?  368  SER A N     1 
ATOM   1817 C  CA    . SER A 1  240 ? -13.719 9.677   -13.682 1.00 28.34 ?  368  SER A CA    1 
ATOM   1818 C  C     . SER A 1  240 ? -14.457 9.859   -15.002 1.00 30.06 ?  368  SER A C     1 
ATOM   1819 O  O     . SER A 1  240 ? -14.473 10.959  -15.583 1.00 32.47 ?  368  SER A O     1 
ATOM   1820 C  CB    . SER A 1  240 ? -14.723 9.388   -12.564 1.00 27.54 ?  368  SER A CB    1 
ATOM   1821 O  OG    . SER A 1  240 ? -15.843 10.248  -12.727 1.00 30.09 ?  368  SER A OG    1 
ATOM   1822 N  N     . CYS A 1  241 ? -15.091 8.795   -15.474 1.00 31.35 ?  369  CYS A N     1 
ATOM   1823 C  CA    . CYS A 1  241 ? -15.789 8.856   -16.765 1.00 37.00 ?  369  CYS A CA    1 
ATOM   1824 C  C     . CYS A 1  241 ? -16.988 9.816   -16.768 1.00 42.86 ?  369  CYS A C     1 
ATOM   1825 O  O     . CYS A 1  241 ? -17.667 9.979   -15.753 1.00 45.54 ?  369  CYS A O     1 
ATOM   1826 C  CB    . CYS A 1  241 ? -16.255 7.462   -17.172 1.00 38.10 ?  369  CYS A CB    1 
ATOM   1827 S  SG    . CYS A 1  241 ? -17.263 6.648   -15.919 1.00 38.54 ?  369  CYS A SG    1 
ATOM   1828 N  N     . HIS A 1  253 ? -23.058 2.008   -14.749 1.00 38.04 ?  381  HIS A N     1 
ATOM   1829 C  CA    . HIS A 1  253 ? -21.693 1.481   -14.797 1.00 37.44 ?  381  HIS A CA    1 
ATOM   1830 C  C     . HIS A 1  253 ? -20.653 2.560   -15.136 1.00 33.32 ?  381  HIS A C     1 
ATOM   1831 O  O     . HIS A 1  253 ? -20.779 3.260   -16.131 1.00 36.33 ?  381  HIS A O     1 
ATOM   1832 C  CB    . HIS A 1  253 ? -21.603 0.339   -15.819 1.00 39.81 ?  381  HIS A CB    1 
ATOM   1833 C  CG    . HIS A 1  253 ? -20.225 -0.227  -15.968 1.00 39.68 ?  381  HIS A CG    1 
ATOM   1834 N  ND1   . HIS A 1  253 ? -19.675 -1.101  -15.054 1.00 38.07 ?  381  HIS A ND1   1 
ATOM   1835 C  CD2   . HIS A 1  253 ? -19.275 -0.025  -16.912 1.00 40.15 ?  381  HIS A CD2   1 
ATOM   1836 C  CE1   . HIS A 1  253 ? -18.449 -1.419  -15.434 1.00 37.57 ?  381  HIS A CE1   1 
ATOM   1837 N  NE2   . HIS A 1  253 ? -18.183 -0.780  -16.561 1.00 38.26 ?  381  HIS A NE2   1 
ATOM   1838 N  N     . MET A 1  254 ? -19.621 2.675   -14.317 1.00 28.43 ?  382  MET A N     1 
ATOM   1839 C  CA    . MET A 1  254 ? -18.486 3.545   -14.641 1.00 30.90 ?  382  MET A CA    1 
ATOM   1840 C  C     . MET A 1  254 ? -17.322 2.767   -15.279 1.00 30.80 ?  382  MET A C     1 
ATOM   1841 O  O     . MET A 1  254 ? -16.895 1.742   -14.740 1.00 28.19 ?  382  MET A O     1 
ATOM   1842 C  CB    . MET A 1  254 ? -17.995 4.259   -13.387 1.00 32.29 ?  382  MET A CB    1 
ATOM   1843 C  CG    . MET A 1  254 ? -19.058 5.112   -12.732 1.00 35.70 ?  382  MET A CG    1 
ATOM   1844 S  SD    . MET A 1  254 ? -18.378 5.859   -11.250 1.00 40.19 ?  382  MET A SD    1 
ATOM   1845 C  CE    . MET A 1  254 ? -16.947 6.710   -11.918 1.00 50.73 ?  382  MET A CE    1 
ATOM   1846 N  N     . ASP A 1  255 ? -16.799 3.261   -16.407 1.00 30.42 ?  383  ASP A N     1 
ATOM   1847 C  CA    . ASP A 1  255 ? -15.663 2.596   -17.062 1.00 27.98 ?  383  ASP A CA    1 
ATOM   1848 C  C     . ASP A 1  255 ? -14.314 3.311   -16.870 1.00 25.98 ?  383  ASP A C     1 
ATOM   1849 O  O     . ASP A 1  255 ? -13.309 2.921   -17.473 1.00 24.24 ?  383  ASP A O     1 
ATOM   1850 C  CB    . ASP A 1  255 ? -15.947 2.404   -18.566 1.00 29.20 ?  383  ASP A CB    1 
ATOM   1851 C  CG    . ASP A 1  255 ? -16.146 3.716   -19.314 1.00 31.79 ?  383  ASP A CG    1 
ATOM   1852 O  OD1   . ASP A 1  255 ? -15.884 4.804   -18.753 1.00 31.89 ?  383  ASP A OD1   1 
ATOM   1853 O  OD2   . ASP A 1  255 ? -16.553 3.650   -20.489 1.00 33.63 ?  383  ASP A OD2   1 
ATOM   1854 N  N     . ALA A 1  256 ? -14.298 4.349   -16.035 1.00 24.41 ?  384  ALA A N     1 
ATOM   1855 C  CA    . ALA A 1  256 ? -13.054 4.971   -15.578 1.00 23.22 ?  384  ALA A CA    1 
ATOM   1856 C  C     . ALA A 1  256 ? -13.272 5.547   -14.187 1.00 20.25 ?  384  ALA A C     1 
ATOM   1857 O  O     . ALA A 1  256 ? -14.288 6.218   -13.934 1.00 23.20 ?  384  ALA A O     1 
ATOM   1858 C  CB    . ALA A 1  256 ? -12.597 6.061   -16.537 1.00 24.50 ?  384  ALA A CB    1 
ATOM   1859 N  N     . PHE A 1  257 ? -12.341 5.271   -13.286 1.00 16.47 ?  385  PHE A N     1 
ATOM   1860 C  CA    . PHE A 1  257 ? -12.406 5.799   -11.916 1.00 14.57 ?  385  PHE A CA    1 
ATOM   1861 C  C     . PHE A 1  257 ? -11.595 7.069   -11.817 1.00 16.87 ?  385  PHE A C     1 
ATOM   1862 O  O     . PHE A 1  257 ? -10.644 7.244   -12.552 1.00 19.73 ?  385  PHE A O     1 
ATOM   1863 C  CB    . PHE A 1  257 ? -11.845 4.799   -10.907 1.00 13.13 ?  385  PHE A CB    1 
ATOM   1864 C  CG    . PHE A 1  257 ? -12.583 3.488   -10.877 1.00 16.57 ?  385  PHE A CG    1 
ATOM   1865 C  CD1   . PHE A 1  257 ? -13.960 3.466   -10.946 1.00 18.75 ?  385  PHE A CD1   1 
ATOM   1866 C  CD2   . PHE A 1  257 ? -11.894 2.290   -10.758 1.00 16.74 ?  385  PHE A CD2   1 
ATOM   1867 C  CE1   . PHE A 1  257 ? -14.659 2.272   -10.918 1.00 22.03 ?  385  PHE A CE1   1 
ATOM   1868 C  CE2   . PHE A 1  257 ? -12.593 1.078   -10.728 1.00 18.05 ?  385  PHE A CE2   1 
ATOM   1869 C  CZ    . PHE A 1  257 ? -13.956 1.068   -10.803 1.00 18.40 ?  385  PHE A CZ    1 
ATOM   1870 N  N     . GLU A 1  258 ? -11.937 7.944   -10.884 1.00 17.22 ?  386  GLU A N     1 
ATOM   1871 C  CA    . GLU A 1  258 ? -11.062 9.091   -10.610 1.00 16.44 ?  386  GLU A CA    1 
ATOM   1872 C  C     . GLU A 1  258 ? -9.743  8.620   -9.982  1.00 14.76 ?  386  GLU A C     1 
ATOM   1873 O  O     . GLU A 1  258 ? -9.750  7.764   -9.103  1.00 12.66 ?  386  GLU A O     1 
ATOM   1874 C  CB    . GLU A 1  258 ? -11.799 10.080  -9.707  1.00 21.56 ?  386  GLU A CB    1 
ATOM   1875 C  CG    . GLU A 1  258 ? -11.083 11.384  -9.504  1.00 25.00 ?  386  GLU A CG    1 
ATOM   1876 C  CD    . GLU A 1  258 ? -11.837 12.327  -8.566  1.00 27.14 ?  386  GLU A CD    1 
ATOM   1877 O  OE1   . GLU A 1  258 ? -12.623 11.864  -7.692  1.00 25.19 ?  386  GLU A OE1   1 
ATOM   1878 O  OE2   . GLU A 1  258 ? -11.633 13.537  -8.722  1.00 31.81 ?  386  GLU A OE2   1 
ATOM   1879 N  N     . ARG A 1  259 ? -8.610  9.155   -10.452 1.00 14.15 ?  387  ARG A N     1 
ATOM   1880 C  CA    . ARG A 1  259 ? -7.293  8.735   -9.974  1.00 14.32 ?  387  ARG A CA    1 
ATOM   1881 C  C     . ARG A 1  259 ? -6.362  9.926   -9.796  1.00 14.27 ?  387  ARG A C     1 
ATOM   1882 O  O     . ARG A 1  259 ? -6.484  10.903  -10.525 1.00 16.05 ?  387  ARG A O     1 
ATOM   1883 C  CB    . ARG A 1  259 ? -6.599  7.781   -10.971 1.00 18.92 ?  387  ARG A CB    1 
ATOM   1884 C  CG    . ARG A 1  259 ? -7.061  6.352   -10.972 1.00 23.25 ?  387  ARG A CG    1 
ATOM   1885 C  CD    . ARG A 1  259 ? -7.558  5.916   -12.340 1.00 22.88 ?  387  ARG A CD    1 
ATOM   1886 N  NE    . ARG A 1  259 ? -6.620  6.078   -13.458 1.00 22.22 ?  387  ARG A NE    1 
ATOM   1887 C  CZ    . ARG A 1  259 ? -5.846  5.100   -13.949 1.00 22.16 ?  387  ARG A CZ    1 
ATOM   1888 N  NH1   . ARG A 1  259 ? -5.857  3.880   -13.390 1.00 19.04 ?  387  ARG A NH1   1 
ATOM   1889 N  NH2   . ARG A 1  259 ? -5.035  5.345   -14.983 1.00 18.22 ?  387  ARG A NH2   1 
ATOM   1890 N  N     . SER A 1  260 ? -5.419  9.808   -8.865  1.00 13.87 ?  388  SER A N     1 
ATOM   1891 C  CA    A SER A 1  260 ? -4.362  10.803  -8.708  0.50 14.43 ?  388  SER A CA    1 
ATOM   1892 C  CA    B SER A 1  260 ? -4.349  10.796  -8.731  0.50 14.16 ?  388  SER A CA    1 
ATOM   1893 C  C     . SER A 1  260 ? -3.037  10.090  -8.451  1.00 13.49 ?  388  SER A C     1 
ATOM   1894 O  O     . SER A 1  260 ? -2.938  9.316   -7.498  1.00 15.82 ?  388  SER A O     1 
ATOM   1895 C  CB    A SER A 1  260 ? -4.684  11.762  -7.555  0.50 15.69 ?  388  SER A CB    1 
ATOM   1896 C  CB    B SER A 1  260 ? -4.641  11.792  -7.609  0.50 15.50 ?  388  SER A CB    1 
ATOM   1897 O  OG    A SER A 1  260 ? -5.731  12.671  -7.892  0.50 15.86 ?  388  SER A OG    1 
ATOM   1898 O  OG    B SER A 1  260 ? -3.647  12.809  -7.560  0.50 15.02 ?  388  SER A OG    1 
ATOM   1899 N  N     . PHE A 1  261 ? -2.039  10.345  -9.298  1.00 13.63 ?  389  PHE A N     1 
ATOM   1900 C  CA    . PHE A 1  261 ? -0.711  9.789   -9.118  1.00 14.04 ?  389  PHE A CA    1 
ATOM   1901 C  C     . PHE A 1  261 ? 0.156   10.880  -8.509  1.00 15.38 ?  389  PHE A C     1 
ATOM   1902 O  O     . PHE A 1  261 ? 0.393   11.910  -9.142  1.00 17.76 ?  389  PHE A O     1 
ATOM   1903 C  CB    . PHE A 1  261 ? -0.105  9.317   -10.443 1.00 13.88 ?  389  PHE A CB    1 
ATOM   1904 C  CG    . PHE A 1  261 ? -1.056  8.525   -11.282 1.00 15.69 ?  389  PHE A CG    1 
ATOM   1905 C  CD1   . PHE A 1  261 ? -1.769  7.475   -10.729 1.00 14.31 ?  389  PHE A CD1   1 
ATOM   1906 C  CD2   . PHE A 1  261 ? -1.288  8.882   -12.600 1.00 17.63 ?  389  PHE A CD2   1 
ATOM   1907 C  CE1   . PHE A 1  261 ? -2.668  6.750   -11.504 1.00 14.72 ?  389  PHE A CE1   1 
ATOM   1908 C  CE2   . PHE A 1  261 ? -2.185  8.170   -13.372 1.00 20.98 ?  389  PHE A CE2   1 
ATOM   1909 C  CZ    . PHE A 1  261 ? -2.864  7.103   -12.820 1.00 16.53 ?  389  PHE A CZ    1 
ATOM   1910 N  N     . CYS A 1  262 ? 0.625   10.660  -7.286  1.00 12.30 ?  390  CYS A N     1 
ATOM   1911 C  CA    . CYS A 1  262 ? 1.159   11.760  -6.479  1.00 10.11 ?  390  CYS A CA    1 
ATOM   1912 C  C     . CYS A 1  262 ? 2.591   11.454  -6.063  1.00 13.89 ?  390  CYS A C     1 
ATOM   1913 O  O     . CYS A 1  262 ? 3.002   10.295  -6.047  1.00 13.18 ?  390  CYS A O     1 
ATOM   1914 C  CB    . CYS A 1  262 ? 0.358   11.962  -5.202  1.00 11.92 ?  390  CYS A CB    1 
ATOM   1915 S  SG    . CYS A 1  262 ? -1.423  12.121  -5.442  1.00 19.11 ?  390  CYS A SG    1 
ATOM   1916 N  N     . ILE A 1  263 ? 3.308   12.501  -5.660  1.00 12.03 ?  391  ILE A N     1 
ATOM   1917 C  CA    . ILE A 1  263 ? 4.543   12.335  -4.883  1.00 12.51 ?  391  ILE A CA    1 
ATOM   1918 C  C     . ILE A 1  263 ? 4.324   13.137  -3.616  1.00 12.87 ?  391  ILE A C     1 
ATOM   1919 O  O     . ILE A 1  263 ? 4.069   14.329  -3.688  1.00 13.85 ?  391  ILE A O     1 
ATOM   1920 C  CB    . ILE A 1  263 ? 5.790   12.824  -5.617  1.00 13.71 ?  391  ILE A CB    1 
ATOM   1921 C  CG1   . ILE A 1  263 ? 5.998   12.020  -6.903  1.00 15.48 ?  391  ILE A CG1   1 
ATOM   1922 C  CG2   . ILE A 1  263 ? 7.045   12.657  -4.729  1.00 15.30 ?  391  ILE A CG2   1 
ATOM   1923 C  CD1   . ILE A 1  263 ? 7.098   12.581  -7.801  1.00 16.56 ?  391  ILE A CD1   1 
ATOM   1924 N  N     . PHE A 1  264 ? 4.309   12.450  -2.477  1.00 10.51 ?  392  PHE A N     1 
ATOM   1925 C  CA    . PHE A 1  264 ? 4.124   13.078  -1.175  1.00 11.19 ?  392  PHE A CA    1 
ATOM   1926 C  C     . PHE A 1  264 ? 5.458   13.442  -0.566  1.00 13.05 ?  392  PHE A C     1 
ATOM   1927 O  O     . PHE A 1  264 ? 6.454   12.740  -0.753  1.00 13.65 ?  392  PHE A O     1 
ATOM   1928 C  CB    . PHE A 1  264 ? 3.428   12.149  -0.166  1.00 12.76 ?  392  PHE A CB    1 
ATOM   1929 C  CG    . PHE A 1  264 ? 1.923   12.060  -0.312  1.00 13.53 ?  392  PHE A CG    1 
ATOM   1930 C  CD1   . PHE A 1  264 ? 1.326   11.968  -1.560  1.00 13.22 ?  392  PHE A CD1   1 
ATOM   1931 C  CD2   . PHE A 1  264 ? 1.115   12.086  0.821   1.00 16.99 ?  392  PHE A CD2   1 
ATOM   1932 C  CE1   . PHE A 1  264 ? -0.079  11.849  -1.676  1.00 13.70 ?  392  PHE A CE1   1 
ATOM   1933 C  CE2   . PHE A 1  264 ? -0.273  11.959  0.711   1.00 17.78 ?  392  PHE A CE2   1 
ATOM   1934 C  CZ    . PHE A 1  264 ? -0.858  11.853  -0.540  1.00 15.07 ?  392  PHE A CZ    1 
ATOM   1935 N  N     . ARG A 1  265 ? 5.442   14.509  0.212   1.00 13.24 ?  393  ARG A N     1 
ATOM   1936 C  CA    . ARG A 1  265 ? 6.520   14.826  1.127   1.00 15.06 ?  393  ARG A CA    1 
ATOM   1937 C  C     . ARG A 1  265 ? 6.267   14.130  2.458   1.00 17.81 ?  393  ARG A C     1 
ATOM   1938 O  O     . ARG A 1  265 ? 5.349   14.518  3.185   1.00 20.63 ?  393  ARG A O     1 
ATOM   1939 C  CB    . ARG A 1  265 ? 6.597   16.330  1.324   1.00 14.66 ?  393  ARG A CB    1 
ATOM   1940 C  CG    . ARG A 1  265 ? 7.611   16.736  2.323   1.00 16.11 ?  393  ARG A CG    1 
ATOM   1941 C  CD    . ARG A 1  265 ? 7.793   18.247  2.284   1.00 18.22 ?  393  ARG A CD    1 
ATOM   1942 N  NE    . ARG A 1  265 ? 8.542   18.708  3.440   1.00 21.05 ?  393  ARG A NE    1 
ATOM   1943 C  CZ    . ARG A 1  265 ? 9.255   19.828  3.456   1.00 20.17 ?  393  ARG A CZ    1 
ATOM   1944 N  NH1   . ARG A 1  265 ? 9.331   20.570  2.363   1.00 21.55 ?  393  ARG A NH1   1 
ATOM   1945 N  NH2   . ARG A 1  265 ? 9.911   20.184  4.551   1.00 21.83 ?  393  ARG A NH2   1 
ATOM   1946 N  N     . LEU A 1  266 ? 7.043   13.092  2.767   1.00 15.19 ?  394  LEU A N     1 
ATOM   1947 C  CA    . LEU A 1  266 ? 6.864   12.372  4.025   1.00 17.12 ?  394  LEU A CA    1 
ATOM   1948 C  C     . LEU A 1  266 ? 7.868   12.778  5.083   1.00 18.80 ?  394  LEU A C     1 
ATOM   1949 O  O     . LEU A 1  266 ? 9.081   12.587  4.906   1.00 19.13 ?  394  LEU A O     1 
ATOM   1950 C  CB    . LEU A 1  266 ? 6.963   10.855  3.794   1.00 15.71 ?  394  LEU A CB    1 
ATOM   1951 C  CG    . LEU A 1  266 ? 6.787   9.991   5.052   1.00 19.92 ?  394  LEU A CG    1 
ATOM   1952 C  CD1   . LEU A 1  266 ? 5.349   10.078  5.574   1.00 19.69 ?  394  LEU A CD1   1 
ATOM   1953 C  CD2   . LEU A 1  266 ? 7.140   8.566   4.730   1.00 21.18 ?  394  LEU A CD2   1 
ATOM   1954 N  N     . PRO A 1  267 ? 7.378   13.339  6.197   1.00 22.31 ?  395  PRO A N     1 
ATOM   1955 C  CA    . PRO A 1  267 ? 8.290   13.746  7.268   1.00 26.41 ?  395  PRO A CA    1 
ATOM   1956 C  C     . PRO A 1  267 ? 9.093   12.577  7.813   1.00 26.04 ?  395  PRO A C     1 
ATOM   1957 O  O     . PRO A 1  267 ? 8.574   11.470  7.950   1.00 27.99 ?  395  PRO A O     1 
ATOM   1958 C  CB    . PRO A 1  267 ? 7.349   14.317  8.333   1.00 29.74 ?  395  PRO A CB    1 
ATOM   1959 C  CG    . PRO A 1  267 ? 6.151   14.779  7.548   1.00 29.33 ?  395  PRO A CG    1 
ATOM   1960 C  CD    . PRO A 1  267 ? 5.989   13.751  6.468   1.00 26.23 ?  395  PRO A CD    1 
ATOM   1961 N  N     . GLN A 1  268 ? 10.375  12.822  8.054   1.00 26.12 ?  396  GLN A N     1 
ATOM   1962 C  CA    . GLN A 1  268 ? 11.267  11.866  8.703   1.00 28.84 ?  396  GLN A CA    1 
ATOM   1963 C  C     . GLN A 1  268 ? 11.938  12.645  9.826   1.00 32.80 ?  396  GLN A C     1 
ATOM   1964 O  O     . GLN A 1  268 ? 11.848  13.872  9.847   1.00 34.49 ?  396  GLN A O     1 
ATOM   1965 C  CB    . GLN A 1  268 ? 12.299  11.291  7.718   1.00 29.59 ?  396  GLN A CB    1 
ATOM   1966 C  CG    . GLN A 1  268 ? 11.712  10.634  6.480   1.00 30.24 ?  396  GLN A CG    1 
ATOM   1967 C  CD    . GLN A 1  268 ? 11.205  9.217   6.740   1.00 36.73 ?  396  GLN A CD    1 
ATOM   1968 O  OE1   . GLN A 1  268 ? 11.942  8.244   6.568   1.00 38.49 ?  396  GLN A OE1   1 
ATOM   1969 N  NE2   . GLN A 1  268 ? 9.941   9.098   7.148   1.00 38.72 ?  396  GLN A NE2   1 
ATOM   1970 N  N     . PRO A 1  269 ? 12.598  11.952  10.770  1.00 35.49 ?  397  PRO A N     1 
ATOM   1971 C  CA    . PRO A 1  269 ? 13.267  12.689  11.850  1.00 37.76 ?  397  PRO A CA    1 
ATOM   1972 C  C     . PRO A 1  269 ? 14.245  13.745  11.333  1.00 35.31 ?  397  PRO A C     1 
ATOM   1973 O  O     . PRO A 1  269 ? 15.275  13.403  10.755  1.00 35.89 ?  397  PRO A O     1 
ATOM   1974 C  CB    . PRO A 1  269 ? 14.009  11.591  12.627  1.00 41.30 ?  397  PRO A CB    1 
ATOM   1975 C  CG    . PRO A 1  269 ? 13.943  10.359  11.768  1.00 40.49 ?  397  PRO A CG    1 
ATOM   1976 C  CD    . PRO A 1  269 ? 12.700  10.495  10.954  1.00 37.46 ?  397  PRO A CD    1 
ATOM   1977 N  N     . GLY A 1  270 ? 13.898  15.016  11.512  1.00 32.91 ?  410  GLY A N     1 
ATOM   1978 C  CA    . GLY A 1  270 ? 14.784  16.106  11.137  1.00 32.63 ?  410  GLY A CA    1 
ATOM   1979 C  C     . GLY A 1  270 ? 14.872  16.391  9.644   1.00 29.67 ?  410  GLY A C     1 
ATOM   1980 O  O     . GLY A 1  270 ? 15.646  17.252  9.215   1.00 27.08 ?  410  GLY A O     1 
ATOM   1981 N  N     . SER A 1  271 ? 14.069  15.688  8.853   1.00 25.93 ?  411  SER A N     1 
ATOM   1982 C  CA    . SER A 1  271 ? 14.112  15.823  7.402   1.00 25.07 ?  411  SER A CA    1 
ATOM   1983 C  C     . SER A 1  271 ? 12.824  15.279  6.761   1.00 24.91 ?  411  SER A C     1 
ATOM   1984 O  O     . SER A 1  271 ? 11.760  15.288  7.388   1.00 23.82 ?  411  SER A O     1 
ATOM   1985 C  CB    . SER A 1  271 ? 15.348  15.110  6.865   1.00 30.19 ?  411  SER A CB    1 
ATOM   1986 O  OG    . SER A 1  271 ? 15.517  15.345  5.486   1.00 34.56 ?  411  SER A OG    1 
ATOM   1987 N  N     . TRP A 1  272 ? 12.917  14.798  5.522   1.00 19.41 ?  412  TRP A N     1 
ATOM   1988 C  CA    . TRP A 1  272 ? 11.760  14.263  4.833   1.00 17.98 ?  412  TRP A CA    1 
ATOM   1989 C  C     . TRP A 1  272 ? 12.233  13.463  3.633   1.00 18.53 ?  412  TRP A C     1 
ATOM   1990 O  O     . TRP A 1  272 ? 13.386  13.579  3.223   1.00 17.28 ?  412  TRP A O     1 
ATOM   1991 C  CB    . TRP A 1  272 ? 10.797  15.374  4.406   1.00 18.92 ?  412  TRP A CB    1 
ATOM   1992 C  CG    . TRP A 1  272 ? 11.345  16.420  3.471   1.00 18.18 ?  412  TRP A CG    1 
ATOM   1993 C  CD1   . TRP A 1  272 ? 11.900  17.620  3.826   1.00 19.78 ?  412  TRP A CD1   1 
ATOM   1994 C  CD2   . TRP A 1  272 ? 11.314  16.403  2.035   1.00 17.34 ?  412  TRP A CD2   1 
ATOM   1995 N  NE1   . TRP A 1  272 ? 12.255  18.328  2.708   1.00 22.19 ?  412  TRP A NE1   1 
ATOM   1996 C  CE2   . TRP A 1  272 ? 11.894  17.610  1.594   1.00 18.51 ?  412  TRP A CE2   1 
ATOM   1997 C  CE3   . TRP A 1  272 ? 10.870  15.477  1.082   1.00 15.91 ?  412  TRP A CE3   1 
ATOM   1998 C  CZ2   . TRP A 1  272 ? 12.046  17.922  0.241   1.00 22.26 ?  412  TRP A CZ2   1 
ATOM   1999 C  CZ3   . TRP A 1  272 ? 11.012  15.785  -0.264  1.00 18.81 ?  412  TRP A CZ3   1 
ATOM   2000 C  CH2   . TRP A 1  272 ? 11.613  17.000  -0.674  1.00 20.39 ?  412  TRP A CH2   1 
ATOM   2001 N  N     . LYS A 1  273 ? 11.362  12.626  3.101   1.00 15.28 ?  413  LYS A N     1 
ATOM   2002 C  CA    . LYS A 1  273 ? 11.650  11.973  1.839   1.00 14.42 ?  413  LYS A CA    1 
ATOM   2003 C  C     . LYS A 1  273 ? 10.411  11.958  0.966   1.00 15.61 ?  413  LYS A C     1 
ATOM   2004 O  O     . LYS A 1  273 ? 9.284   11.922  1.449   1.00 15.11 ?  413  LYS A O     1 
ATOM   2005 C  CB    . LYS A 1  273 ? 12.184  10.555  2.062   1.00 17.80 ?  413  LYS A CB    1 
ATOM   2006 C  CG    . LYS A 1  273 ? 11.182  9.562   2.542   1.00 18.35 ?  413  LYS A CG    1 
ATOM   2007 C  CD    . LYS A 1  273 ? 11.730  8.131   2.369   1.00 16.07 ?  413  LYS A CD    1 
ATOM   2008 C  CE    . LYS A 1  273 ? 10.786  7.131   3.019   1.00 17.79 ?  413  LYS A CE    1 
ATOM   2009 N  NZ    . LYS A 1  273 ? 11.358  5.727   3.048   1.00 17.32 ?  413  LYS A NZ    1 
ATOM   2010 N  N     . ALA A 1  274 ? 10.633  12.005  -0.340  1.00 14.85 ?  414  ALA A N     1 
ATOM   2011 C  CA    . ALA A 1  274 ? 9.548   11.904  -1.298  1.00 12.17 ?  414  ALA A CA    1 
ATOM   2012 C  C     . ALA A 1  274 ? 9.080   10.462  -1.428  1.00 11.20 ?  414  ALA A C     1 
ATOM   2013 O  O     . ALA A 1  274 ? 9.898   9.559   -1.536  1.00 11.22 ?  414  ALA A O     1 
ATOM   2014 C  CB    . ALA A 1  274 ? 10.015  12.432  -2.656  1.00 14.00 ?  414  ALA A CB    1 
ATOM   2015 N  N     . VAL A 1  275 ? 7.766   10.258  -1.460  1.00 10.51 ?  415  VAL A N     1 
ATOM   2016 C  CA    . VAL A 1  275 ? 7.180   8.910   -1.642  1.00 11.81 ?  415  VAL A CA    1 
ATOM   2017 C  C     . VAL A 1  275 ? 6.068   8.960   -2.689  1.00 13.47 ?  415  VAL A C     1 
ATOM   2018 O  O     . VAL A 1  275 ? 5.179   9.812   -2.627  1.00 12.38 ?  415  VAL A O     1 
ATOM   2019 C  CB    . VAL A 1  275 ? 6.604   8.342   -0.341  1.00 11.05 ?  415  VAL A CB    1 
ATOM   2020 C  CG1   . VAL A 1  275 ? 6.047   6.923   -0.579  1.00 11.79 ?  415  VAL A CG1   1 
ATOM   2021 C  CG2   . VAL A 1  275 ? 7.693   8.304   0.756   1.00 13.51 ?  415  VAL A CG2   1 
ATOM   2022 N  N     . ARG A 1  276 ? 6.108   8.034   -3.635  1.00 10.64 ?  416  ARG A N     1 
ATOM   2023 C  CA    . ARG A 1  276 ? 5.006   7.898   -4.598  1.00 12.22 ?  416  ARG A CA    1 
ATOM   2024 C  C     . ARG A 1  276 ? 3.755   7.354   -3.893  1.00 10.84 ?  416  ARG A C     1 
ATOM   2025 O  O     . ARG A 1  276 ? 3.830   6.367   -3.154  1.00 10.60 ?  416  ARG A O     1 
ATOM   2026 C  CB    . ARG A 1  276 ? 5.422   6.964   -5.741  1.00 9.85  ?  416  ARG A CB    1 
ATOM   2027 C  CG    . ARG A 1  276 ? 6.264   7.690   -6.827  1.00 11.35 ?  416  ARG A CG    1 
ATOM   2028 C  CD    . ARG A 1  276 ? 5.345   8.413   -7.854  1.00 12.96 ?  416  ARG A CD    1 
ATOM   2029 N  NE    . ARG A 1  276 ? 4.578   7.436   -8.651  1.00 13.45 ?  416  ARG A NE    1 
ATOM   2030 C  CZ    . ARG A 1  276 ? 3.264   7.216   -8.537  1.00 13.06 ?  416  ARG A CZ    1 
ATOM   2031 N  NH1   . ARG A 1  276 ? 2.517   7.914   -7.680  1.00 11.88 ?  416  ARG A NH1   1 
ATOM   2032 N  NH2   . ARG A 1  276 ? 2.687   6.275   -9.278  1.00 11.62 ?  416  ARG A NH2   1 
ATOM   2033 N  N     . VAL A 1  277 ? 2.616   8.015   -4.105  1.00 9.80  ?  417  VAL A N     1 
ATOM   2034 C  CA    . VAL A 1  277 ? 1.338   7.560   -3.551  1.00 10.42 ?  417  VAL A CA    1 
ATOM   2035 C  C     . VAL A 1  277 ? 0.326   7.610   -4.677  1.00 10.00 ?  417  VAL A C     1 
ATOM   2036 O  O     . VAL A 1  277 ? 0.215   8.639   -5.342  1.00 10.23 ?  417  VAL A O     1 
ATOM   2037 C  CB    . VAL A 1  277 ? 0.840   8.460   -2.366  1.00 12.01 ?  417  VAL A CB    1 
ATOM   2038 C  CG1   . VAL A 1  277 ? -0.541  8.002   -1.863  1.00 10.86 ?  417  VAL A CG1   1 
ATOM   2039 C  CG2   . VAL A 1  277 ? 1.830   8.463   -1.212  1.00 12.13 ?  417  VAL A CG2   1 
ATOM   2040 N  N     . ASP A 1  278 ? -0.418  6.524   -4.886  1.00 9.97  ?  418  ASP A N     1 
ATOM   2041 C  CA    . ASP A 1  278 ? -1.494  6.498   -5.872  1.00 9.98  ?  418  ASP A CA    1 
ATOM   2042 C  C     . ASP A 1  278 ? -2.835  6.472   -5.158  1.00 10.67 ?  418  ASP A C     1 
ATOM   2043 O  O     . ASP A 1  278 ? -3.024  5.686   -4.228  1.00 10.58 ?  418  ASP A O     1 
ATOM   2044 C  CB    . ASP A 1  278 ? -1.381  5.244   -6.763  1.00 10.57 ?  418  ASP A CB    1 
ATOM   2045 C  CG    . ASP A 1  278 ? -0.236  5.319   -7.708  1.00 11.94 ?  418  ASP A CG    1 
ATOM   2046 O  OD1   . ASP A 1  278 ? 0.086   6.444   -8.152  1.00 11.35 ?  418  ASP A OD1   1 
ATOM   2047 O  OD2   . ASP A 1  278 ? 0.336   4.254   -8.029  1.00 10.39 ?  418  ASP A OD2   1 
ATOM   2048 N  N     . LEU A 1  279 ? -3.765  7.313   -5.597  1.00 10.26 ?  419  LEU A N     1 
ATOM   2049 C  CA    . LEU A 1  279 ? -5.123  7.331   -5.044  1.00 10.90 ?  419  LEU A CA    1 
ATOM   2050 C  C     . LEU A 1  279 ? -6.113  6.985   -6.127  1.00 10.50 ?  419  LEU A C     1 
ATOM   2051 O  O     . LEU A 1  279 ? -6.044  7.517   -7.239  1.00 11.64 ?  419  LEU A O     1 
ATOM   2052 C  CB    . LEU A 1  279 ? -5.466  8.728   -4.484  1.00 11.72 ?  419  LEU A CB    1 
ATOM   2053 C  CG    . LEU A 1  279 ? -4.457  9.311   -3.492  1.00 11.38 ?  419  LEU A CG    1 
ATOM   2054 C  CD1   . LEU A 1  279 ? -4.935  10.725  -3.129  1.00 12.74 ?  419  LEU A CD1   1 
ATOM   2055 C  CD2   . LEU A 1  279 ? -4.330  8.411   -2.254  1.00 10.23 ?  419  LEU A CD2   1 
ATOM   2056 N  N     . VAL A 1  280 ? -7.065  6.106   -5.828  1.00 9.43  ?  420  VAL A N     1 
ATOM   2057 C  CA    . VAL A 1  280 ? -8.107  5.842   -6.809  1.00 9.30  ?  420  VAL A CA    1 
ATOM   2058 C  C     . VAL A 1  280 ? -9.442  5.796   -6.082  1.00 9.60  ?  420  VAL A C     1 
ATOM   2059 O  O     . VAL A 1  280 ? -9.522  5.330   -4.941  1.00 9.95  ?  420  VAL A O     1 
ATOM   2060 C  CB    . VAL A 1  280 ? -7.845  4.515   -7.588  1.00 11.21 ?  420  VAL A CB    1 
ATOM   2061 C  CG1   . VAL A 1  280 ? -7.573  3.363   -6.599  1.00 12.57 ?  420  VAL A CG1   1 
ATOM   2062 C  CG2   . VAL A 1  280 ? -9.014  4.173   -8.502  1.00 11.10 ?  420  VAL A CG2   1 
ATOM   2063 N  N     . VAL A 1  281 ? -10.483 6.349   -6.713  1.00 10.39 ?  421  VAL A N     1 
ATOM   2064 C  CA    . VAL A 1  281 ? -11.790 6.393   -6.081  1.00 10.89 ?  421  VAL A CA    1 
ATOM   2065 C  C     . VAL A 1  281 ? -12.763 5.590   -6.904  1.00 11.70 ?  421  VAL A C     1 
ATOM   2066 O  O     . VAL A 1  281 ? -12.895 5.830   -8.097  1.00 15.17 ?  421  VAL A O     1 
ATOM   2067 C  CB    . VAL A 1  281 ? -12.338 7.845   -5.958  1.00 11.52 ?  421  VAL A CB    1 
ATOM   2068 C  CG1   . VAL A 1  281 ? -13.703 7.840   -5.220  1.00 13.42 ?  421  VAL A CG1   1 
ATOM   2069 C  CG2   . VAL A 1  281 ? -11.332 8.762   -5.220  1.00 11.07 ?  421  VAL A CG2   1 
ATOM   2070 N  N     . ALA A 1  282 ? -13.484 4.662   -6.273  1.00 11.86 ?  422  ALA A N     1 
ATOM   2071 C  CA    . ALA A 1  282 ? -14.490 3.891   -7.008  1.00 14.17 ?  422  ALA A CA    1 
ATOM   2072 C  C     . ALA A 1  282 ? -15.830 3.984   -6.310  1.00 13.66 ?  422  ALA A C     1 
ATOM   2073 O  O     . ALA A 1  282 ? -15.854 4.034   -5.086  1.00 13.37 ?  422  ALA A O     1 
ATOM   2074 C  CB    . ALA A 1  282 ? -14.061 2.417   -7.118  1.00 16.35 ?  422  ALA A CB    1 
ATOM   2075 N  N     . PRO A 1  283 ? -16.936 3.958   -7.079  1.00 14.46 ?  423  PRO A N     1 
ATOM   2076 C  CA    . PRO A 1  283 ? -18.279 3.800   -6.486  1.00 15.38 ?  423  PRO A CA    1 
ATOM   2077 C  C     . PRO A 1  283 ? -18.393 2.458   -5.760  1.00 16.74 ?  423  PRO A C     1 
ATOM   2078 O  O     . PRO A 1  283 ? -17.766 1.489   -6.191  1.00 15.80 ?  423  PRO A O     1 
ATOM   2079 C  CB    . PRO A 1  283 ? -19.218 3.838   -7.690  1.00 23.63 ?  423  PRO A CB    1 
ATOM   2080 C  CG    . PRO A 1  283 ? -18.398 3.412   -8.834  1.00 24.30 ?  423  PRO A CG    1 
ATOM   2081 C  CD    . PRO A 1  283 ? -16.967 3.876   -8.545  1.00 17.32 ?  423  PRO A CD    1 
ATOM   2082 N  N     . VAL A 1  284 ? -19.151 2.393   -4.677  1.00 15.00 ?  424  VAL A N     1 
ATOM   2083 C  CA    . VAL A 1  284 ? -19.100 1.192   -3.855  1.00 15.19 ?  424  VAL A CA    1 
ATOM   2084 C  C     . VAL A 1  284 ? -19.565 -0.055  -4.655  1.00 15.75 ?  424  VAL A C     1 
ATOM   2085 O  O     . VAL A 1  284 ? -19.085 -1.160  -4.438  1.00 14.86 ?  424  VAL A O     1 
ATOM   2086 C  CB    . VAL A 1  284 ? -19.911 1.397   -2.550  1.00 18.84 ?  424  VAL A CB    1 
ATOM   2087 C  CG1   . VAL A 1  284 ? -21.425 1.631   -2.812  1.00 19.34 ?  424  VAL A CG1   1 
ATOM   2088 C  CG2   . VAL A 1  284 ? -19.654 0.243   -1.568  1.00 22.24 ?  424  VAL A CG2   1 
ATOM   2089 N  N     . SER A 1  285 ? -20.454 0.147   -5.623  1.00 18.06 ?  425  SER A N     1 
ATOM   2090 C  CA    . SER A 1  285 ? -20.902 -0.961  -6.472  1.00 17.11 ?  425  SER A CA    1 
ATOM   2091 C  C     . SER A 1  285 ? -19.765 -1.632  -7.248  1.00 20.10 ?  425  SER A C     1 
ATOM   2092 O  O     . SER A 1  285 ? -19.847 -2.821  -7.559  1.00 19.17 ?  425  SER A O     1 
ATOM   2093 C  CB    . SER A 1  285 ? -21.991 -0.475  -7.448  1.00 21.20 ?  425  SER A CB    1 
ATOM   2094 O  OG    . SER A 1  285 ? -21.466 0.434   -8.404  1.00 23.66 ?  425  SER A OG    1 
ATOM   2095 N  N     . GLN A 1  286 ? -18.698 -0.885  -7.543  1.00 14.17 ?  426  GLN A N     1 
ATOM   2096 C  CA    . GLN A 1  286 ? -17.600 -1.396  -8.340  1.00 14.81 ?  426  GLN A CA    1 
ATOM   2097 C  C     . GLN A 1  286 ? -16.352 -1.575  -7.510  1.00 14.28 ?  426  GLN A C     1 
ATOM   2098 O  O     . GLN A 1  286 ? -15.316 -2.005  -8.022  1.00 12.61 ?  426  GLN A O     1 
ATOM   2099 C  CB    . GLN A 1  286 ? -17.319 -0.470  -9.522  1.00 17.23 ?  426  GLN A CB    1 
ATOM   2100 C  CG    . GLN A 1  286 ? -18.552 -0.365  -10.409 1.00 19.56 ?  426  GLN A CG    1 
ATOM   2101 C  CD    . GLN A 1  286 ? -18.371 0.570   -11.571 1.00 24.44 ?  426  GLN A CD    1 
ATOM   2102 O  OE1   . GLN A 1  286 ? -19.108 1.559   -11.711 1.00 27.15 ?  426  GLN A OE1   1 
ATOM   2103 N  NE2   . GLN A 1  286 ? -17.408 0.266   -12.425 1.00 23.20 ?  426  GLN A NE2   1 
ATOM   2104 N  N     . PHE A 1  287 ? -16.460 -1.248  -6.225  1.00 12.63 ?  427  PHE A N     1 
ATOM   2105 C  CA    . PHE A 1  287 ? -15.313 -1.370  -5.326  1.00 12.62 ?  427  PHE A CA    1 
ATOM   2106 C  C     . PHE A 1  287 ? -14.620 -2.738  -5.365  1.00 11.63 ?  427  PHE A C     1 
ATOM   2107 O  O     . PHE A 1  287 ? -13.386 -2.796  -5.398  1.00 10.35 ?  427  PHE A O     1 
ATOM   2108 C  CB    . PHE A 1  287 ? -15.752 -1.004  -3.903  1.00 12.69 ?  427  PHE A CB    1 
ATOM   2109 C  CG    . PHE A 1  287 ? -14.702 -1.247  -2.863  1.00 13.58 ?  427  PHE A CG    1 
ATOM   2110 C  CD1   . PHE A 1  287 ? -14.612 -2.478  -2.243  1.00 12.38 ?  427  PHE A CD1   1 
ATOM   2111 C  CD2   . PHE A 1  287 ? -13.830 -0.221  -2.477  1.00 15.81 ?  427  PHE A CD2   1 
ATOM   2112 C  CE1   . PHE A 1  287 ? -13.658 -2.722  -1.275  1.00 15.93 ?  427  PHE A CE1   1 
ATOM   2113 C  CE2   . PHE A 1  287 ? -12.864 -0.452  -1.490  1.00 16.32 ?  427  PHE A CE2   1 
ATOM   2114 C  CZ    . PHE A 1  287 ? -12.774 -1.713  -0.897  1.00 15.47 ?  427  PHE A CZ    1 
ATOM   2115 N  N     . PRO A 1  288 ? -15.378 -3.858  -5.382  1.00 11.76 ?  428  PRO A N     1 
ATOM   2116 C  CA    . PRO A 1  288 ? -14.643 -5.135  -5.392  1.00 10.40 ?  428  PRO A CA    1 
ATOM   2117 C  C     . PRO A 1  288 ? -13.761 -5.349  -6.623  1.00 8.57  ?  428  PRO A C     1 
ATOM   2118 O  O     . PRO A 1  288 ? -12.680 -5.964  -6.514  1.00 11.55 ?  428  PRO A O     1 
ATOM   2119 C  CB    . PRO A 1  288 ? -15.774 -6.179  -5.356  1.00 10.60 ?  428  PRO A CB    1 
ATOM   2120 C  CG    . PRO A 1  288 ? -16.927 -5.440  -4.660  1.00 12.91 ?  428  PRO A CG    1 
ATOM   2121 C  CD    . PRO A 1  288 ? -16.844 -4.057  -5.248  1.00 11.84 ?  428  PRO A CD    1 
ATOM   2122 N  N     . PHE A 1  289 ? -14.201 -4.839  -7.777  1.00 9.22  ?  429  PHE A N     1 
ATOM   2123 C  CA    . PHE A 1  289 ? -13.434 -4.995  -9.011  1.00 8.31  ?  429  PHE A CA    1 
ATOM   2124 C  C     . PHE A 1  289 ? -12.186 -4.126  -8.947  1.00 9.37  ?  429  PHE A C     1 
ATOM   2125 O  O     . PHE A 1  289 ? -11.100 -4.523  -9.393  1.00 8.76  ?  429  PHE A O     1 
ATOM   2126 C  CB    . PHE A 1  289 ? -14.299 -4.623  -10.223 1.00 10.60 ?  429  PHE A CB    1 
ATOM   2127 C  CG    . PHE A 1  289 ? -15.438 -5.576  -10.441 1.00 12.13 ?  429  PHE A CG    1 
ATOM   2128 C  CD1   . PHE A 1  289 ? -15.194 -6.845  -10.980 1.00 14.75 ?  429  PHE A CD1   1 
ATOM   2129 C  CD2   . PHE A 1  289 ? -16.741 -5.227  -10.091 1.00 14.83 ?  429  PHE A CD2   1 
ATOM   2130 C  CE1   . PHE A 1  289 ? -16.261 -7.740  -11.191 1.00 13.37 ?  429  PHE A CE1   1 
ATOM   2131 C  CE2   . PHE A 1  289 ? -17.805 -6.135  -10.308 1.00 16.30 ?  429  PHE A CE2   1 
ATOM   2132 C  CZ    . PHE A 1  289 ? -17.547 -7.372  -10.835 1.00 13.82 ?  429  PHE A CZ    1 
ATOM   2133 N  N     . ALA A 1  290 ? -12.354 -2.935  -8.390  1.00 10.69 ?  430  ALA A N     1 
ATOM   2134 C  CA    . ALA A 1  290 ? -11.224 -2.028  -8.271  1.00 10.80 ?  430  ALA A CA    1 
ATOM   2135 C  C     . ALA A 1  290 ? -10.214 -2.609  -7.303  1.00 10.52 ?  430  ALA A C     1 
ATOM   2136 O  O     . ALA A 1  290 ? -9.014  -2.557  -7.558  1.00 10.99 ?  430  ALA A O     1 
ATOM   2137 C  CB    . ALA A 1  290 ? -11.676 -0.653  -7.801  1.00 11.58 ?  430  ALA A CB    1 
ATOM   2138 N  N     . LEU A 1  291 ? -10.699 -3.109  -6.166  1.00 9.09  ?  431  LEU A N     1 
ATOM   2139 C  CA    . LEU A 1  291 ? -9.814  -3.712  -5.167  1.00 8.63  ?  431  LEU A CA    1 
ATOM   2140 C  C     . LEU A 1  291 ? -9.074  -4.902  -5.758  1.00 9.13  ?  431  LEU A C     1 
ATOM   2141 O  O     . LEU A 1  291 ? -7.864  -5.075  -5.538  1.00 8.84  ?  431  LEU A O     1 
ATOM   2142 C  CB    . LEU A 1  291 ? -10.622 -4.158  -3.939  1.00 10.42 ?  431  LEU A CB    1 
ATOM   2143 C  CG    . LEU A 1  291 ? -9.810  -4.756  -2.786  1.00 9.07  ?  431  LEU A CG    1 
ATOM   2144 C  CD1   . LEU A 1  291 ? -8.818  -3.699  -2.221  1.00 11.55 ?  431  LEU A CD1   1 
ATOM   2145 C  CD2   . LEU A 1  291 ? -10.756 -5.244  -1.705  1.00 11.69 ?  431  LEU A CD2   1 
ATOM   2146 N  N     . LEU A 1  292 ? -9.789  -5.755  -6.491  1.00 9.26  ?  432  LEU A N     1 
ATOM   2147 C  CA    . LEU A 1  292 ? -9.125  -6.924  -7.099  1.00 10.27 ?  432  LEU A CA    1 
ATOM   2148 C  C     . LEU A 1  292 ? -8.002  -6.485  -8.048  1.00 10.02 ?  432  LEU A C     1 
ATOM   2149 O  O     . LEU A 1  292 ? -6.847  -6.971  -7.980  1.00 9.75  ?  432  LEU A O     1 
ATOM   2150 C  CB    . LEU A 1  292 ? -10.164 -7.774  -7.848  1.00 10.06 ?  432  LEU A CB    1 
ATOM   2151 C  CG    . LEU A 1  292 ? -9.672  -9.048  -8.536  1.00 10.12 ?  432  LEU A CG    1 
ATOM   2152 C  CD1   . LEU A 1  292 ? -9.042  -10.007 -7.545  1.00 13.97 ?  432  LEU A CD1   1 
ATOM   2153 C  CD2   . LEU A 1  292 ? -10.876 -9.700  -9.244  1.00 9.13  ?  432  LEU A CD2   1 
ATOM   2154 N  N     . GLY A 1  293 ? -8.329  -5.554  -8.938  1.00 9.04  ?  433  GLY A N     1 
ATOM   2155 C  CA    . GLY A 1  293 ? -7.333  -5.126  -9.905  1.00 10.43 ?  433  GLY A CA    1 
ATOM   2156 C  C     . GLY A 1  293 ? -6.145  -4.432  -9.256  1.00 10.23 ?  433  GLY A C     1 
ATOM   2157 O  O     . GLY A 1  293 ? -4.999  -4.677  -9.615  1.00 10.80 ?  433  GLY A O     1 
ATOM   2158 N  N     . TRP A 1  294 ? -6.417  -3.514  -8.329  1.00 8.36  ?  434  TRP A N     1 
ATOM   2159 C  CA    . TRP A 1  294 ? -5.335  -2.721  -7.733  1.00 8.87  ?  434  TRP A CA    1 
ATOM   2160 C  C     . TRP A 1  294 ? -4.509  -3.489  -6.706  1.00 8.70  ?  434  TRP A C     1 
ATOM   2161 O  O     . TRP A 1  294 ? -3.462  -3.012  -6.278  1.00 11.44 ?  434  TRP A O     1 
ATOM   2162 C  CB    . TRP A 1  294 ? -5.915  -1.473  -7.080  1.00 9.00  ?  434  TRP A CB    1 
ATOM   2163 C  CG    . TRP A 1  294 ? -6.113  -0.345  -8.058  1.00 11.27 ?  434  TRP A CG    1 
ATOM   2164 C  CD1   . TRP A 1  294 ? -7.089  -0.248  -9.025  1.00 11.37 ?  434  TRP A CD1   1 
ATOM   2165 C  CD2   . TRP A 1  294 ? -5.318  0.836   -8.169  1.00 10.66 ?  434  TRP A CD2   1 
ATOM   2166 N  NE1   . TRP A 1  294 ? -6.937  0.931   -9.733  1.00 11.67 ?  434  TRP A NE1   1 
ATOM   2167 C  CE2   . TRP A 1  294 ? -5.866  1.618   -9.214  1.00 11.89 ?  434  TRP A CE2   1 
ATOM   2168 C  CE3   . TRP A 1  294 ? -4.213  1.333   -7.464  1.00 9.63  ?  434  TRP A CE3   1 
ATOM   2169 C  CZ2   . TRP A 1  294 ? -5.327  2.847   -9.584  1.00 12.84 ?  434  TRP A CZ2   1 
ATOM   2170 C  CZ3   . TRP A 1  294 ? -3.697  2.563   -7.816  1.00 10.31 ?  434  TRP A CZ3   1 
ATOM   2171 C  CH2   . TRP A 1  294 ? -4.248  3.312   -8.873  1.00 13.59 ?  434  TRP A CH2   1 
ATOM   2172 N  N     . THR A 1  295 ? -4.978  -4.662  -6.308  1.00 9.01  ?  435  THR A N     1 
ATOM   2173 C  CA    . THR A 1  295 ? -4.224  -5.460  -5.330  1.00 9.60  ?  435  THR A CA    1 
ATOM   2174 C  C     . THR A 1  295 ? -3.181  -6.332  -6.036  1.00 9.14  ?  435  THR A C     1 
ATOM   2175 O  O     . THR A 1  295 ? -2.184  -6.702  -5.435  1.00 10.27 ?  435  THR A O     1 
ATOM   2176 C  CB    . THR A 1  295 ? -5.173  -6.303  -4.474  1.00 10.08 ?  435  THR A CB    1 
ATOM   2177 O  OG1   . THR A 1  295 ? -6.003  -5.422  -3.692  1.00 8.93  ?  435  THR A OG1   1 
ATOM   2178 C  CG2   . THR A 1  295 ? -4.407  -7.226  -3.490  1.00 11.55 ?  435  THR A CG2   1 
ATOM   2179 N  N     . GLY A 1  296 ? -3.412  -6.641  -7.309  1.00 8.22  ?  436  GLY A N     1 
ATOM   2180 C  CA    . GLY A 1  296 ? -2.403  -7.319  -8.100  1.00 9.41  ?  436  GLY A CA    1 
ATOM   2181 C  C     . GLY A 1  296 ? -2.201  -8.767  -7.669  1.00 10.00 ?  436  GLY A C     1 
ATOM   2182 O  O     . GLY A 1  296 ? -3.135  -9.391  -7.156  1.00 9.77  ?  436  GLY A O     1 
ATOM   2183 N  N     . SER A 1  297 ? -1.003  -9.324  -7.878  1.00 9.26  ?  437  SER A N     1 
ATOM   2184 C  CA    . SER A 1  297 ? 0.114   -8.689  -8.589  1.00 8.88  ?  437  SER A CA    1 
ATOM   2185 C  C     . SER A 1  297 ? -0.220  -8.384  -10.039 1.00 8.94  ?  437  SER A C     1 
ATOM   2186 O  O     . SER A 1  297 ? -1.247  -8.837  -10.538 1.00 9.35  ?  437  SER A O     1 
ATOM   2187 C  CB    . SER A 1  297 ? 1.354   -9.621  -8.561  1.00 9.27  ?  437  SER A CB    1 
ATOM   2188 O  OG    . SER A 1  297 ? 1.109   -10.798 -9.338  1.00 11.21 ?  437  SER A OG    1 
ATOM   2189 N  N     . LYS A 1  298 ? 0.659   -7.663  -10.723 1.00 8.22  ?  438  LYS A N     1 
ATOM   2190 C  CA    . LYS A 1  298 ? 0.445   -7.420  -12.152 1.00 7.99  ?  438  LYS A CA    1 
ATOM   2191 C  C     . LYS A 1  298 ? 0.290   -8.734  -12.913 1.00 10.03 ?  438  LYS A C     1 
ATOM   2192 O  O     . LYS A 1  298 ? -0.657  -8.923  -13.678 1.00 10.65 ?  438  LYS A O     1 
ATOM   2193 C  CB    . LYS A 1  298 ? 1.587   -6.598  -12.727 1.00 9.90  ?  438  LYS A CB    1 
ATOM   2194 C  CG    . LYS A 1  298 ? 1.607   -6.443  -14.236 1.00 14.23 ?  438  LYS A CG    1 
ATOM   2195 C  CD    . LYS A 1  298 ? 2.852   -5.602  -14.584 1.00 20.61 ?  438  LYS A CD    1 
ATOM   2196 C  CE    . LYS A 1  298 ? 3.150   -5.536  -16.063 1.00 28.73 ?  438  LYS A CE    1 
ATOM   2197 N  NZ    . LYS A 1  298 ? 4.400   -4.712  -16.258 1.00 33.59 ?  438  LYS A NZ    1 
ATOM   2198 N  N     . LEU A 1  299 ? 1.220   -9.660  -12.703 1.00 8.50  ?  439  LEU A N     1 
ATOM   2199 C  CA    . LEU A 1  299 ? 1.061   -10.943 -13.396 1.00 8.49  ?  439  LEU A CA    1 
ATOM   2200 C  C     . LEU A 1  299 ? -0.233  -11.667 -12.973 1.00 11.75 ?  439  LEU A C     1 
ATOM   2201 O  O     . LEU A 1  299 ? -0.895  -12.279 -13.809 1.00 12.39 ?  439  LEU A O     1 
ATOM   2202 C  CB    . LEU A 1  299 ? 2.291   -11.830 -13.157 1.00 12.54 ?  439  LEU A CB    1 
ATOM   2203 C  CG    . LEU A 1  299 ? 2.178   -13.209 -13.823 1.00 12.04 ?  439  LEU A CG    1 
ATOM   2204 C  CD1   . LEU A 1  299 ? 2.159   -13.057 -15.348 1.00 11.30 ?  439  LEU A CD1   1 
ATOM   2205 C  CD2   . LEU A 1  299 ? 3.354   -14.115 -13.424 1.00 11.11 ?  439  LEU A CD2   1 
ATOM   2206 N  N     . PHE A 1  300 ? -0.592  -11.606 -11.690 1.00 11.30 ?  440  PHE A N     1 
ATOM   2207 C  CA    . PHE A 1  300 ? -1.820  -12.250 -11.243 1.00 9.86  ?  440  PHE A CA    1 
ATOM   2208 C  C     . PHE A 1  300 ? -3.027  -11.707 -12.004 1.00 10.47 ?  440  PHE A C     1 
ATOM   2209 O  O     . PHE A 1  300 ? -3.886  -12.460 -12.433 1.00 9.04  ?  440  PHE A O     1 
ATOM   2210 C  CB    . PHE A 1  300 ? -2.041  -12.055 -9.744  1.00 8.22  ?  440  PHE A CB    1 
ATOM   2211 C  CG    . PHE A 1  300 ? -3.167  -12.926 -9.190  1.00 9.36  ?  440  PHE A CG    1 
ATOM   2212 C  CD1   . PHE A 1  300 ? -2.913  -14.209 -8.730  1.00 10.95 ?  440  PHE A CD1   1 
ATOM   2213 C  CD2   . PHE A 1  300 ? -4.473  -12.451 -9.166  1.00 12.58 ?  440  PHE A CD2   1 
ATOM   2214 C  CE1   . PHE A 1  300 ? -3.950  -15.011 -8.202  1.00 11.47 ?  440  PHE A CE1   1 
ATOM   2215 C  CE2   . PHE A 1  300 ? -5.498  -13.239 -8.647  1.00 11.60 ?  440  PHE A CE2   1 
ATOM   2216 C  CZ    . PHE A 1  300 ? -5.229  -14.522 -8.182  1.00 11.70 ?  440  PHE A CZ    1 
ATOM   2217 N  N     . GLN A 1  301 ? -3.091  -10.393 -12.182 1.00 10.31 ?  441  GLN A N     1 
ATOM   2218 C  CA    . GLN A 1  301 ? -4.256  -9.817  -12.869 1.00 9.73  ?  441  GLN A CA    1 
ATOM   2219 C  C     . GLN A 1  301 ? -4.267  -10.166 -14.351 1.00 9.93  ?  441  GLN A C     1 
ATOM   2220 O  O     . GLN A 1  301 ? -5.331  -10.411 -14.893 1.00 11.71 ?  441  GLN A O     1 
ATOM   2221 C  CB    . GLN A 1  301 ? -4.303  -8.293  -12.694 1.00 10.69 ?  441  GLN A CB    1 
ATOM   2222 C  CG    . GLN A 1  301 ? -4.471  -7.899  -11.250 1.00 13.49 ?  441  GLN A CG    1 
ATOM   2223 C  CD    . GLN A 1  301 ? -5.722  -8.467  -10.648 1.00 15.66 ?  441  GLN A CD    1 
ATOM   2224 O  OE1   . GLN A 1  301 ? -6.819  -8.301  -11.197 1.00 14.54 ?  441  GLN A OE1   1 
ATOM   2225 N  NE2   . GLN A 1  301 ? -5.580  -9.163  -9.529  1.00 16.99 ?  441  GLN A NE2   1 
ATOM   2226 N  N     . ARG A 1  302 ? -3.112  -10.157 -15.016 1.00 11.11 ?  442  ARG A N     1 
ATOM   2227 C  CA    . ARG A 1  302 ? -3.058  -10.544 -16.432 1.00 9.46  ?  442  ARG A CA    1 
ATOM   2228 C  C     . ARG A 1  302 ? -3.543  -11.982 -16.571 1.00 9.13  ?  442  ARG A C     1 
ATOM   2229 O  O     . ARG A 1  302 ? -4.336  -12.316 -17.459 1.00 11.73 ?  442  ARG A O     1 
ATOM   2230 C  CB    . ARG A 1  302 ? -1.639  -10.451 -16.993 1.00 12.40 ?  442  ARG A CB    1 
ATOM   2231 C  CG    . ARG A 1  302 ? -0.979  -9.109  -16.941 1.00 18.01 ?  442  ARG A CG    1 
ATOM   2232 C  CD    . ARG A 1  302 ? 0.482   -9.335  -17.334 1.00 18.88 ?  442  ARG A CD    1 
ATOM   2233 N  NE    . ARG A 1  302 ? 0.581   -9.505  -18.780 1.00 15.04 ?  442  ARG A NE    1 
ATOM   2234 C  CZ    . ARG A 1  302 ? 1.652   -9.160  -19.477 1.00 16.17 ?  442  ARG A CZ    1 
ATOM   2235 N  NH1   . ARG A 1  302 ? 2.722   -8.691  -18.834 1.00 18.00 ?  442  ARG A NH1   1 
ATOM   2236 N  NH2   . ARG A 1  302 ? 1.668   -9.295  -20.794 1.00 16.02 ?  442  ARG A NH2   1 
ATOM   2237 N  N     . GLU A 1  303 ? -3.073  -12.838 -15.672 1.00 10.21 ?  443  GLU A N     1 
ATOM   2238 C  CA    . GLU A 1  303 ? -3.467  -14.243 -15.700 1.00 12.46 ?  443  GLU A CA    1 
ATOM   2239 C  C     . GLU A 1  303 ? -4.959  -14.445 -15.424 1.00 13.62 ?  443  GLU A C     1 
ATOM   2240 O  O     . GLU A 1  303 ? -5.627  -15.229 -16.109 1.00 12.66 ?  443  GLU A O     1 
ATOM   2241 C  CB    . GLU A 1  303 ? -2.620  -15.027 -14.696 1.00 12.28 ?  443  GLU A CB    1 
ATOM   2242 C  CG    . GLU A 1  303 ? -1.169  -15.109 -15.147 1.00 11.75 ?  443  GLU A CG    1 
ATOM   2243 C  CD    . GLU A 1  303 ? -0.958  -16.168 -16.213 1.00 15.26 ?  443  GLU A CD    1 
ATOM   2244 O  OE1   . GLU A 1  303 ? -1.009  -17.383 -15.892 1.00 15.02 ?  443  GLU A OE1   1 
ATOM   2245 O  OE2   . GLU A 1  303 ? -0.722  -15.801 -17.376 1.00 15.90 ?  443  GLU A OE2   1 
ATOM   2246 N  N     . LEU A 1  304 ? -5.466  -13.726 -14.427 1.00 10.76 ?  444  LEU A N     1 
ATOM   2247 C  CA    . LEU A 1  304 ? -6.871  -13.802 -14.066 1.00 12.06 ?  444  LEU A CA    1 
ATOM   2248 C  C     . LEU A 1  304 ? -7.759  -13.337 -15.242 1.00 13.00 ?  444  LEU A C     1 
ATOM   2249 O  O     . LEU A 1  304 ? -8.801  -13.940 -15.546 1.00 12.92 ?  444  LEU A O     1 
ATOM   2250 C  CB    . LEU A 1  304 ? -7.117  -12.946 -12.814 1.00 11.75 ?  444  LEU A CB    1 
ATOM   2251 C  CG    . LEU A 1  304 ? -8.527  -12.964 -12.225 1.00 11.77 ?  444  LEU A CG    1 
ATOM   2252 C  CD1   . LEU A 1  304 ? -8.803  -14.336 -11.639 1.00 13.12 ?  444  LEU A CD1   1 
ATOM   2253 C  CD2   . LEU A 1  304 ? -8.645  -11.886 -11.170 1.00 14.09 ?  444  LEU A CD2   1 
ATOM   2254 N  N     . ARG A 1  305 ? -7.356  -12.247 -15.896 1.00 10.03 ?  445  ARG A N     1 
ATOM   2255 C  CA    . ARG A 1  305 ? -8.136  -11.740 -17.020 1.00 11.31 ?  445  ARG A CA    1 
ATOM   2256 C  C     . ARG A 1  305 ? -8.054  -12.667 -18.233 1.00 13.47 ?  445  ARG A C     1 
ATOM   2257 O  O     . ARG A 1  305 ? -9.026  -12.832 -18.980 1.00 13.05 ?  445  ARG A O     1 
ATOM   2258 C  CB    . ARG A 1  305 ? -7.678  -10.316 -17.371 1.00 10.47 ?  445  ARG A CB    1 
ATOM   2259 C  CG    . ARG A 1  305 ? -7.990  -9.373  -16.182 1.00 9.26  ?  445  ARG A CG    1 
ATOM   2260 C  CD    . ARG A 1  305 ? -7.258  -8.044  -16.315 1.00 10.75 ?  445  ARG A CD    1 
ATOM   2261 N  NE    . ARG A 1  305 ? -7.593  -7.207  -15.157 1.00 11.45 ?  445  ARG A NE    1 
ATOM   2262 C  CZ    . ARG A 1  305 ? -7.147  -5.966  -14.967 1.00 14.41 ?  445  ARG A CZ    1 
ATOM   2263 N  NH1   . ARG A 1  305 ? -6.343  -5.400  -15.857 1.00 15.77 ?  445  ARG A NH1   1 
ATOM   2264 N  NH2   . ARG A 1  305 ? -7.512  -5.283  -13.879 1.00 12.80 ?  445  ARG A NH2   1 
ATOM   2265 N  N     . ARG A 1  306 ? -6.894  -13.294 -18.422 1.00 13.14 ?  446  ARG A N     1 
ATOM   2266 C  CA    . ARG A 1  306 ? -6.730  -14.262 -19.501 1.00 13.68 ?  446  ARG A CA    1 
ATOM   2267 C  C     . ARG A 1  306 ? -7.623  -15.470 -19.252 1.00 13.03 ?  446  ARG A C     1 
ATOM   2268 O  O     . ARG A 1  306 ? -8.294  -15.983 -20.154 1.00 13.41 ?  446  ARG A O     1 
ATOM   2269 C  CB    . ARG A 1  306 ? -5.261  -14.710 -19.595 1.00 12.21 ?  446  ARG A CB    1 
ATOM   2270 C  CG    . ARG A 1  306 ? -5.003  -15.599 -20.787 1.00 16.03 ?  446  ARG A CG    1 
ATOM   2271 C  CD    . ARG A 1  306 ? -3.517  -15.789 -21.008 1.00 19.58 ?  446  ARG A CD    1 
ATOM   2272 N  NE    . ARG A 1  306 ? -2.834  -16.484 -19.915 1.00 17.12 ?  446  ARG A NE    1 
ATOM   2273 C  CZ    . ARG A 1  306 ? -2.513  -17.777 -19.937 1.00 20.89 ?  446  ARG A CZ    1 
ATOM   2274 N  NH1   . ARG A 1  306 ? -2.901  -18.559 -20.954 1.00 20.16 ?  446  ARG A NH1   1 
ATOM   2275 N  NH2   . ARG A 1  306 ? -1.834  -18.308 -18.923 1.00 19.49 ?  446  ARG A NH2   1 
ATOM   2276 N  N     . PHE A 1  307 ? -7.614  -15.927 -18.003 1.00 12.51 ?  447  PHE A N     1 
ATOM   2277 C  CA    . PHE A 1  307 ? -8.428  -17.078 -17.620 1.00 11.83 ?  447  PHE A CA    1 
ATOM   2278 C  C     . PHE A 1  307 ? -9.920  -16.786 -17.828 1.00 12.63 ?  447  PHE A C     1 
ATOM   2279 O  O     . PHE A 1  307 ? -10.671 -17.587 -18.407 1.00 13.48 ?  447  PHE A O     1 
ATOM   2280 C  CB    . PHE A 1  307 ? -8.164  -17.434 -16.153 1.00 11.55 ?  447  PHE A CB    1 
ATOM   2281 C  CG    . PHE A 1  307 ? -9.062  -18.534 -15.635 1.00 15.33 ?  447  PHE A CG    1 
ATOM   2282 C  CD1   . PHE A 1  307 ? -8.701  -19.854 -15.794 1.00 14.82 ?  447  PHE A CD1   1 
ATOM   2283 C  CD2   . PHE A 1  307 ? -10.274 -18.236 -15.016 1.00 13.61 ?  447  PHE A CD2   1 
ATOM   2284 C  CE1   . PHE A 1  307 ? -9.533  -20.895 -15.338 1.00 17.36 ?  447  PHE A CE1   1 
ATOM   2285 C  CE2   . PHE A 1  307 ? -11.112 -19.274 -14.559 1.00 15.11 ?  447  PHE A CE2   1 
ATOM   2286 C  CZ    . PHE A 1  307 ? -10.724 -20.591 -14.714 1.00 18.04 ?  447  PHE A CZ    1 
ATOM   2287 N  N     . SER A 1  308 ? -10.355 -15.638 -17.316 1.00 13.75 ?  448  SER A N     1 
ATOM   2288 C  CA    . SER A 1  308 ? -11.736 -15.213 -17.467 1.00 13.26 ?  448  SER A CA    1 
ATOM   2289 C  C     . SER A 1  308 ? -12.176 -15.272 -18.935 1.00 13.42 ?  448  SER A C     1 
ATOM   2290 O  O     . SER A 1  308 ? -13.191 -15.889 -19.289 1.00 14.59 ?  448  SER A O     1 
ATOM   2291 C  CB    . SER A 1  308 ? -11.881 -13.784 -16.904 1.00 13.87 ?  448  SER A CB    1 
ATOM   2292 O  OG    . SER A 1  308 ? -13.230 -13.350 -16.894 1.00 20.18 ?  448  SER A OG    1 
ATOM   2293 N  N     . ARG A 1  309 ? -11.389 -14.654 -19.806 1.00 14.10 ?  449  ARG A N     1 
ATOM   2294 C  CA    . ARG A 1  309 ? -11.768 -14.537 -21.205 1.00 16.03 ?  449  ARG A CA    1 
ATOM   2295 C  C     . ARG A 1  309 ? -11.665 -15.865 -21.923 1.00 15.32 ?  449  ARG A C     1 
ATOM   2296 O  O     . ARG A 1  309 ? -12.587 -16.300 -22.611 1.00 17.02 ?  449  ARG A O     1 
ATOM   2297 C  CB    . ARG A 1  309 ? -10.887 -13.496 -21.910 1.00 15.96 ?  449  ARG A CB    1 
ATOM   2298 C  CG    . ARG A 1  309 ? -11.149 -13.363 -23.390 1.00 18.32 ?  449  ARG A CG    1 
ATOM   2299 C  CD    . ARG A 1  309 ? -10.302 -12.221 -23.989 1.00 21.90 ?  449  ARG A CD    1 
ATOM   2300 N  NE    . ARG A 1  309 ? -10.795 -10.892 -23.618 1.00 20.97 ?  449  ARG A NE    1 
ATOM   2301 C  CZ    . ARG A 1  309 ? -11.667 -10.193 -24.338 1.00 28.55 ?  449  ARG A CZ    1 
ATOM   2302 N  NH1   . ARG A 1  309 ? -12.164 -10.696 -25.455 1.00 31.28 ?  449  ARG A NH1   1 
ATOM   2303 N  NH2   . ARG A 1  309 ? -12.049 -8.990  -23.938 1.00 33.45 ?  449  ARG A NH2   1 
ATOM   2304 N  N     . LYS A 1  310 ? -10.530 -16.522 -21.768 1.00 16.26 ?  450  LYS A N     1 
ATOM   2305 C  CA    . LYS A 1  310 ? -10.256 -17.686 -22.599 1.00 18.59 ?  450  LYS A CA    1 
ATOM   2306 C  C     . LYS A 1  310 ? -10.932 -18.943 -22.062 1.00 19.72 ?  450  LYS A C     1 
ATOM   2307 O  O     . LYS A 1  310 ? -11.378 -19.790 -22.840 1.00 22.27 ?  450  LYS A O     1 
ATOM   2308 C  CB    . LYS A 1  310 ? -8.741  -17.900 -22.717 1.00 20.69 ?  450  LYS A CB    1 
ATOM   2309 C  CG    . LYS A 1  310 ? -7.971  -16.677 -23.239 1.00 26.32 ?  450  LYS A CG    1 
ATOM   2310 C  CD    . LYS A 1  310 ? -8.434  -16.259 -24.649 1.00 29.76 ?  450  LYS A CD    1 
ATOM   2311 C  CE    . LYS A 1  310 ? -7.602  -15.075 -25.181 1.00 29.11 ?  450  LYS A CE    1 
ATOM   2312 N  NZ    . LYS A 1  310 ? -7.974  -14.711 -26.592 1.00 28.58 ?  450  LYS A NZ    1 
ATOM   2313 N  N     . GLU A 1  311 ? -11.014 -19.080 -20.746 1.00 17.29 ?  451  GLU A N     1 
ATOM   2314 C  CA    . GLU A 1  311 ? -11.625 -20.280 -20.173 1.00 18.68 ?  451  GLU A CA    1 
ATOM   2315 C  C     . GLU A 1  311 ? -13.120 -20.104 -19.868 1.00 19.39 ?  451  GLU A C     1 
ATOM   2316 O  O     . GLU A 1  311 ? -13.875 -21.056 -19.983 1.00 19.92 ?  451  GLU A O     1 
ATOM   2317 C  CB    . GLU A 1  311 ? -10.886 -20.705 -18.890 1.00 20.23 ?  451  GLU A CB    1 
ATOM   2318 C  CG    . GLU A 1  311 ? -9.378  -20.976 -19.092 1.00 19.09 ?  451  GLU A CG    1 
ATOM   2319 C  CD    . GLU A 1  311 ? -9.093  -22.032 -20.141 1.00 23.06 ?  451  GLU A CD    1 
ATOM   2320 O  OE1   . GLU A 1  311 ? -8.056  -21.912 -20.823 1.00 23.50 ?  451  GLU A OE1   1 
ATOM   2321 O  OE2   . GLU A 1  311 ? -9.894  -22.983 -20.298 1.00 22.75 ?  451  GLU A OE2   1 
ATOM   2322 N  N     . LYS A 1  312 ? -13.548 -18.910 -19.462 1.00 19.43 ?  452  LYS A N     1 
ATOM   2323 C  CA    . LYS A 1  312 ? -14.943 -18.744 -19.011 1.00 18.27 ?  452  LYS A CA    1 
ATOM   2324 C  C     . LYS A 1  312 ? -15.788 -17.891 -19.952 1.00 19.58 ?  452  LYS A C     1 
ATOM   2325 O  O     . LYS A 1  312 ? -17.007 -17.807 -19.798 1.00 21.63 ?  452  LYS A O     1 
ATOM   2326 C  CB    . LYS A 1  312 ? -14.964 -18.148 -17.591 1.00 18.90 ?  452  LYS A CB    1 
ATOM   2327 C  CG    . LYS A 1  312 ? -14.229 -19.022 -16.559 1.00 18.00 ?  452  LYS A CG    1 
ATOM   2328 C  CD    . LYS A 1  312 ? -14.925 -20.387 -16.447 1.00 21.31 ?  452  LYS A CD    1 
ATOM   2329 C  CE    . LYS A 1  312 ? -14.209 -21.297 -15.444 1.00 21.59 ?  452  LYS A CE    1 
ATOM   2330 N  NZ    . LYS A 1  312 ? -14.980 -22.567 -15.295 1.00 24.39 ?  452  LYS A NZ    1 
ATOM   2331 N  N     . GLY A 1  313 ? -15.147 -17.292 -20.947 1.00 16.77 ?  453  GLY A N     1 
ATOM   2332 C  CA    . GLY A 1  313 ? -15.816 -16.455 -21.925 1.00 18.22 ?  453  GLY A CA    1 
ATOM   2333 C  C     . GLY A 1  313 ? -16.390 -15.175 -21.338 1.00 17.95 ?  453  GLY A C     1 
ATOM   2334 O  O     . GLY A 1  313 ? -17.391 -14.653 -21.845 1.00 20.56 ?  453  GLY A O     1 
ATOM   2335 N  N     . LEU A 1  314 ? -15.781 -14.707 -20.254 1.00 15.30 ?  454  LEU A N     1 
ATOM   2336 C  CA    . LEU A 1  314 ? -16.202 -13.487 -19.573 1.00 16.11 ?  454  LEU A CA    1 
ATOM   2337 C  C     . LEU A 1  314 ? -15.072 -12.468 -19.629 1.00 16.27 ?  454  LEU A C     1 
ATOM   2338 O  O     . LEU A 1  314 ? -13.897 -12.829 -19.552 1.00 15.47 ?  454  LEU A O     1 
ATOM   2339 C  CB    . LEU A 1  314 ? -16.574 -13.764 -18.115 1.00 15.53 ?  454  LEU A CB    1 
ATOM   2340 C  CG    . LEU A 1  314 ? -17.656 -14.834 -17.933 1.00 17.75 ?  454  LEU A CG    1 
ATOM   2341 C  CD1   . LEU A 1  314 ? -17.855 -15.145 -16.463 1.00 17.28 ?  454  LEU A CD1   1 
ATOM   2342 C  CD2   . LEU A 1  314 ? -18.961 -14.348 -18.579 1.00 18.02 ?  454  LEU A CD2   1 
ATOM   2343 N  N     . TRP A 1  315 ? -15.425 -11.193 -19.727 1.00 16.13 ?  455  TRP A N     1 
ATOM   2344 C  CA    . TRP A 1  315 ? -14.416 -10.149 -19.868 1.00 13.82 ?  455  TRP A CA    1 
ATOM   2345 C  C     . TRP A 1  315 ? -14.274 -9.378  -18.565 1.00 14.09 ?  455  TRP A C     1 
ATOM   2346 O  O     . TRP A 1  315 ? -15.234 -8.740  -18.099 1.00 13.78 ?  455  TRP A O     1 
ATOM   2347 C  CB    . TRP A 1  315 ? -14.787 -9.192  -21.017 1.00 15.97 ?  455  TRP A CB    1 
ATOM   2348 C  CG    . TRP A 1  315 ? -15.010 -9.892  -22.326 1.00 19.28 ?  455  TRP A CG    1 
ATOM   2349 C  CD1   . TRP A 1  315 ? -14.622 -11.156 -22.665 1.00 19.84 ?  455  TRP A CD1   1 
ATOM   2350 C  CD2   . TRP A 1  315 ? -15.689 -9.361  -23.462 1.00 19.67 ?  455  TRP A CD2   1 
ATOM   2351 N  NE1   . TRP A 1  315 ? -15.025 -11.448 -23.955 1.00 20.89 ?  455  TRP A NE1   1 
ATOM   2352 C  CE2   . TRP A 1  315 ? -15.673 -10.353 -24.465 1.00 21.78 ?  455  TRP A CE2   1 
ATOM   2353 C  CE3   . TRP A 1  315 ? -16.300 -8.134  -23.736 1.00 21.74 ?  455  TRP A CE3   1 
ATOM   2354 C  CZ2   . TRP A 1  315 ? -16.257 -10.160 -25.712 1.00 25.43 ?  455  TRP A CZ2   1 
ATOM   2355 C  CZ3   . TRP A 1  315 ? -16.880 -7.944  -24.974 1.00 25.18 ?  455  TRP A CZ3   1 
ATOM   2356 C  CH2   . TRP A 1  315 ? -16.850 -8.952  -25.948 1.00 26.95 ?  455  TRP A CH2   1 
ATOM   2357 N  N     . LEU A 1  316 ? -13.071 -9.436  -18.008 1.00 12.73 ?  456  LEU A N     1 
ATOM   2358 C  CA    . LEU A 1  316 ? -12.740 -8.839  -16.722 1.00 10.09 ?  456  LEU A CA    1 
ATOM   2359 C  C     . LEU A 1  316 ? -11.833 -7.617  -16.852 1.00 11.68 ?  456  LEU A C     1 
ATOM   2360 O  O     . LEU A 1  316 ? -10.813 -7.670  -17.546 1.00 14.27 ?  456  LEU A O     1 
ATOM   2361 C  CB    . LEU A 1  316 ? -12.046 -9.878  -15.839 1.00 10.21 ?  456  LEU A CB    1 
ATOM   2362 C  CG    . LEU A 1  316 ? -11.629 -9.439  -14.423 1.00 11.07 ?  456  LEU A CG    1 
ATOM   2363 C  CD1   . LEU A 1  316 ? -12.857 -9.082  -13.569 1.00 11.87 ?  456  LEU A CD1   1 
ATOM   2364 C  CD2   . LEU A 1  316 ? -10.794 -10.556 -13.763 1.00 9.91  ?  456  LEU A CD2   1 
ATOM   2365 N  N     . ASN A 1  317 ? -12.185 -6.534  -16.163 1.00 12.78 ?  457  ASN A N     1 
ATOM   2366 C  CA    . ASN A 1  317 ? -11.229 -5.443  -16.001 1.00 12.35 ?  457  ASN A CA    1 
ATOM   2367 C  C     . ASN A 1  317 ? -11.373 -4.809  -14.616 1.00 12.87 ?  457  ASN A C     1 
ATOM   2368 O  O     . ASN A 1  317 ? -12.050 -5.351  -13.732 1.00 11.36 ?  457  ASN A O     1 
ATOM   2369 C  CB    . ASN A 1  317 ? -11.377 -4.409  -17.127 1.00 12.55 ?  457  ASN A CB    1 
ATOM   2370 C  CG    . ASN A 1  317 ? -12.758 -3.759  -17.168 1.00 13.78 ?  457  ASN A CG    1 
ATOM   2371 O  OD1   . ASN A 1  317 ? -13.454 -3.701  -16.163 1.00 15.39 ?  457  ASN A OD1   1 
ATOM   2372 N  ND2   . ASN A 1  317 ? -13.147 -3.253  -18.340 1.00 15.44 ?  457  ASN A ND2   1 
ATOM   2373 N  N     . SER A 1  318 ? -10.722 -3.663  -14.403 1.00 14.12 ?  458  SER A N     1 
ATOM   2374 C  CA    . SER A 1  318 ? -10.758 -3.047  -13.077 1.00 15.07 ?  458  SER A CA    1 
ATOM   2375 C  C     . SER A 1  318 ? -12.129 -2.546  -12.661 1.00 14.09 ?  458  SER A C     1 
ATOM   2376 O  O     . SER A 1  318 ? -12.336 -2.189  -11.489 1.00 13.53 ?  458  SER A O     1 
ATOM   2377 C  CB    . SER A 1  318 ? -9.765  -1.869  -13.026 1.00 21.29 ?  458  SER A CB    1 
ATOM   2378 O  OG    . SER A 1  318 ? -8.459  -2.406  -12.972 1.00 28.09 ?  458  SER A OG    1 
ATOM   2379 N  N     . HIS A 1  319 ? -13.060 -2.512  -13.610 1.00 13.20 ?  459  HIS A N     1 
ATOM   2380 C  CA    . HIS A 1  319 ? -14.337 -1.876  -13.386 1.00 14.75 ?  459  HIS A CA    1 
ATOM   2381 C  C     . HIS A 1  319 ? -15.475 -2.881  -13.317 1.00 14.52 ?  459  HIS A C     1 
ATOM   2382 O  O     . HIS A 1  319 ? -16.551 -2.551  -12.842 1.00 17.11 ?  459  HIS A O     1 
ATOM   2383 C  CB    . HIS A 1  319 ? -14.614 -0.830  -14.486 1.00 18.25 ?  459  HIS A CB    1 
ATOM   2384 C  CG    . HIS A 1  319 ? -13.501 0.155   -14.643 1.00 20.85 ?  459  HIS A CG    1 
ATOM   2385 N  ND1   . HIS A 1  319 ? -12.409 -0.082  -15.452 1.00 26.56 ?  459  HIS A ND1   1 
ATOM   2386 C  CD2   . HIS A 1  319 ? -13.264 1.336   -14.025 1.00 21.75 ?  459  HIS A CD2   1 
ATOM   2387 C  CE1   . HIS A 1  319 ? -11.563 0.930   -15.355 1.00 24.54 ?  459  HIS A CE1   1 
ATOM   2388 N  NE2   . HIS A 1  319 ? -12.057 1.802   -14.493 1.00 24.49 ?  459  HIS A NE2   1 
ATOM   2389 N  N     . GLY A 1  320 ? -15.255 -4.105  -13.793 1.00 12.88 ?  460  GLY A N     1 
ATOM   2390 C  CA    . GLY A 1  320 ? -16.367 -5.050  -13.819 1.00 12.87 ?  460  GLY A CA    1 
ATOM   2391 C  C     . GLY A 1  320 ? -16.074 -6.338  -14.545 1.00 14.27 ?  460  GLY A C     1 
ATOM   2392 O  O     . GLY A 1  320 ? -14.970 -6.553  -14.990 1.00 11.46 ?  460  GLY A O     1 
ATOM   2393 N  N     . LEU A 1  321 ? -17.096 -7.174  -14.668 1.00 14.30 ?  461  LEU A N     1 
ATOM   2394 C  CA    . LEU A 1  321 ? -16.967 -8.483  -15.285 1.00 14.81 ?  461  LEU A CA    1 
ATOM   2395 C  C     . LEU A 1  321 ? -18.170 -8.636  -16.184 1.00 15.72 ?  461  LEU A C     1 
ATOM   2396 O  O     . LEU A 1  321 ? -19.306 -8.621  -15.707 1.00 15.71 ?  461  LEU A O     1 
ATOM   2397 C  CB    . LEU A 1  321 ? -16.920 -9.588  -14.232 1.00 14.12 ?  461  LEU A CB    1 
ATOM   2398 C  CG    . LEU A 1  321 ? -16.811 -11.032 -14.739 1.00 14.94 ?  461  LEU A CG    1 
ATOM   2399 C  CD1   . LEU A 1  321 ? -15.517 -11.256 -15.517 1.00 13.34 ?  461  LEU A CD1   1 
ATOM   2400 C  CD2   . LEU A 1  321 ? -16.884 -11.967 -13.532 1.00 16.17 ?  461  LEU A CD2   1 
ATOM   2401 N  N     . PHE A 1  322 ? -17.925 -8.783  -17.480 1.00 15.31 ?  462  PHE A N     1 
ATOM   2402 C  CA    . PHE A 1  322 ? -18.995 -8.693  -18.469 1.00 15.86 ?  462  PHE A CA    1 
ATOM   2403 C  C     . PHE A 1  322 ? -19.241 -10.032 -19.147 1.00 16.43 ?  462  PHE A C     1 
ATOM   2404 O  O     . PHE A 1  322 ? -18.305 -10.694 -19.588 1.00 18.59 ?  462  PHE A O     1 
ATOM   2405 C  CB    . PHE A 1  322 ? -18.639 -7.625  -19.507 1.00 16.53 ?  462  PHE A CB    1 
ATOM   2406 C  CG    . PHE A 1  322 ? -19.728 -7.345  -20.503 1.00 20.31 ?  462  PHE A CG    1 
ATOM   2407 C  CD1   . PHE A 1  322 ? -20.855 -6.627  -20.137 1.00 21.76 ?  462  PHE A CD1   1 
ATOM   2408 C  CD2   . PHE A 1  322 ? -19.597 -7.759  -21.827 1.00 20.69 ?  462  PHE A CD2   1 
ATOM   2409 C  CE1   . PHE A 1  322 ? -21.850 -6.345  -21.080 1.00 24.23 ?  462  PHE A CE1   1 
ATOM   2410 C  CE2   . PHE A 1  322 ? -20.570 -7.489  -22.752 1.00 23.79 ?  462  PHE A CE2   1 
ATOM   2411 C  CZ    . PHE A 1  322 ? -21.699 -6.779  -22.380 1.00 26.47 ?  462  PHE A CZ    1 
ATOM   2412 N  N     . ASP A 1  323 ? -20.507 -10.436 -19.201 1.00 16.66 ?  463  ASP A N     1 
ATOM   2413 C  CA    . ASP A 1  323 ? -20.914 -11.617 -19.955 1.00 20.92 ?  463  ASP A CA    1 
ATOM   2414 C  C     . ASP A 1  323 ? -21.338 -11.165 -21.345 1.00 22.09 ?  463  ASP A C     1 
ATOM   2415 O  O     . ASP A 1  323 ? -22.410 -10.588 -21.496 1.00 24.56 ?  463  ASP A O     1 
ATOM   2416 C  CB    . ASP A 1  323 ? -22.068 -12.336 -19.246 1.00 22.88 ?  463  ASP A CB    1 
ATOM   2417 C  CG    . ASP A 1  323 ? -22.534 -13.597 -19.981 1.00 30.20 ?  463  ASP A CG    1 
ATOM   2418 O  OD1   . ASP A 1  323 ? -22.220 -13.790 -21.175 1.00 32.09 ?  463  ASP A OD1   1 
ATOM   2419 O  OD2   . ASP A 1  323 ? -23.239 -14.399 -19.343 1.00 32.38 ?  463  ASP A OD2   1 
ATOM   2420 N  N     . PRO A 1  324 ? -20.504 -11.421 -22.362 1.00 22.10 ?  464  PRO A N     1 
ATOM   2421 C  CA    . PRO A 1  324 ? -20.790 -10.914 -23.708 1.00 25.05 ?  464  PRO A CA    1 
ATOM   2422 C  C     . PRO A 1  324 ? -21.947 -11.612 -24.394 1.00 29.70 ?  464  PRO A C     1 
ATOM   2423 O  O     . PRO A 1  324 ? -22.473 -11.074 -25.368 1.00 33.36 ?  464  PRO A O     1 
ATOM   2424 C  CB    . PRO A 1  324 ? -19.485 -11.179 -24.471 1.00 24.54 ?  464  PRO A CB    1 
ATOM   2425 C  CG    . PRO A 1  324 ? -18.852 -12.308 -23.746 1.00 23.62 ?  464  PRO A CG    1 
ATOM   2426 C  CD    . PRO A 1  324 ? -19.194 -12.093 -22.296 1.00 21.08 ?  464  PRO A CD    1 
ATOM   2427 N  N     . GLU A 1  325 ? -22.324 -12.796 -23.927 1.00 31.26 ?  465  GLU A N     1 
ATOM   2428 C  CA    . GLU A 1  325 ? -23.438 -13.503 -24.548 1.00 34.76 ?  465  GLU A CA    1 
ATOM   2429 C  C     . GLU A 1  325 ? -24.757 -12.890 -24.080 1.00 36.07 ?  465  GLU A C     1 
ATOM   2430 O  O     . GLU A 1  325 ? -25.654 -12.588 -24.888 1.00 38.29 ?  465  GLU A O     1 
ATOM   2431 C  CB    . GLU A 1  325 ? -23.384 -15.004 -24.222 1.00 35.63 ?  465  GLU A CB    1 
ATOM   2432 N  N     . GLN A 1  326 ? -24.859 -12.696 -22.772 1.00 33.77 ?  466  GLN A N     1 
ATOM   2433 C  CA    . GLN A 1  326 ? -26.044 -12.125 -22.142 1.00 34.01 ?  466  GLN A CA    1 
ATOM   2434 C  C     . GLN A 1  326 ? -26.019 -10.594 -22.197 1.00 31.96 ?  466  GLN A C     1 
ATOM   2435 O  O     . GLN A 1  326 ? -27.053 -9.937  -22.047 1.00 31.57 ?  466  GLN A O     1 
ATOM   2436 C  CB    . GLN A 1  326 ? -26.135 -12.627 -20.695 1.00 36.56 ?  466  GLN A CB    1 
ATOM   2437 C  CG    . GLN A 1  326 ? -27.379 -12.241 -19.915 1.00 41.88 ?  466  GLN A CG    1 
ATOM   2438 C  CD    . GLN A 1  326 ? -27.448 -12.948 -18.562 1.00 44.50 ?  466  GLN A CD    1 
ATOM   2439 O  OE1   . GLN A 1  326 ? -26.964 -12.433 -17.542 1.00 42.55 ?  466  GLN A OE1   1 
ATOM   2440 N  NE2   . GLN A 1  326 ? -28.049 -14.141 -18.548 1.00 47.16 ?  466  GLN A NE2   1 
ATOM   2441 N  N     . LYS A 1  327 ? -24.836 -10.038 -22.445 1.00 27.49 ?  467  LYS A N     1 
ATOM   2442 C  CA    . LYS A 1  327 ? -24.608 -8.592  -22.439 1.00 27.79 ?  467  LYS A CA    1 
ATOM   2443 C  C     . LYS A 1  327 ? -25.017 -7.988  -21.099 1.00 26.99 ?  467  LYS A C     1 
ATOM   2444 O  O     . LYS A 1  327 ? -25.758 -7.011  -21.040 1.00 26.81 ?  467  LYS A O     1 
ATOM   2445 C  CB    . LYS A 1  327 ? -25.346 -7.915  -23.598 1.00 32.38 ?  467  LYS A CB    1 
ATOM   2446 C  CG    . LYS A 1  327 ? -24.719 -8.218  -24.950 1.00 34.16 ?  467  LYS A CG    1 
ATOM   2447 N  N     . THR A 1  328 ? -24.532 -8.599  -20.022 1.00 26.06 ?  468  THR A N     1 
ATOM   2448 C  CA    . THR A 1  328 ? -24.795 -8.128  -18.664 1.00 25.46 ?  468  THR A CA    1 
ATOM   2449 C  C     . THR A 1  328 ? -23.523 -8.046  -17.852 1.00 23.31 ?  468  THR A C     1 
ATOM   2450 O  O     . THR A 1  328 ? -22.612 -8.838  -18.062 1.00 22.35 ?  468  THR A O     1 
ATOM   2451 C  CB    . THR A 1  328 ? -25.756 -9.050  -17.912 1.00 26.45 ?  468  THR A CB    1 
ATOM   2452 O  OG1   . THR A 1  328 ? -25.263 -10.394 -17.979 1.00 27.85 ?  468  THR A OG1   1 
ATOM   2453 C  CG2   . THR A 1  328 ? -27.149 -8.986  -18.523 1.00 29.20 ?  468  THR A CG2   1 
ATOM   2454 N  N     . PHE A 1  329 ? -23.466 -7.101  -16.915 1.00 22.51 ?  469  PHE A N     1 
ATOM   2455 C  CA    . PHE A 1  329 ? -22.363 -7.065  -15.962 1.00 20.78 ?  469  PHE A CA    1 
ATOM   2456 C  C     . PHE A 1  329 ? -22.742 -7.842  -14.710 1.00 21.12 ?  469  PHE A C     1 
ATOM   2457 O  O     . PHE A 1  329 ? -23.891 -7.769  -14.248 1.00 23.47 ?  469  PHE A O     1 
ATOM   2458 C  CB    . PHE A 1  329 ? -22.004 -5.624  -15.586 1.00 21.93 ?  469  PHE A CB    1 
ATOM   2459 C  CG    . PHE A 1  329 ? -21.342 -4.858  -16.692 1.00 23.67 ?  469  PHE A CG    1 
ATOM   2460 C  CD1   . PHE A 1  329 ? -19.970 -4.901  -16.848 1.00 22.61 ?  469  PHE A CD1   1 
ATOM   2461 C  CD2   . PHE A 1  329 ? -22.090 -4.108  -17.576 1.00 26.84 ?  469  PHE A CD2   1 
ATOM   2462 C  CE1   . PHE A 1  329 ? -19.345 -4.199  -17.867 1.00 24.88 ?  469  PHE A CE1   1 
ATOM   2463 C  CE2   . PHE A 1  329 ? -21.474 -3.407  -18.596 1.00 27.96 ?  469  PHE A CE2   1 
ATOM   2464 C  CZ    . PHE A 1  329 ? -20.098 -3.443  -18.732 1.00 25.85 ?  469  PHE A CZ    1 
ATOM   2465 N  N     . PHE A 1  330 ? -21.779 -8.567  -14.151 1.00 18.35 ?  470  PHE A N     1 
ATOM   2466 C  CA    . PHE A 1  330 ? -21.973 -9.252  -12.873 1.00 19.06 ?  470  PHE A CA    1 
ATOM   2467 C  C     . PHE A 1  330 ? -21.936 -8.228  -11.753 1.00 21.03 ?  470  PHE A C     1 
ATOM   2468 O  O     . PHE A 1  330 ? -21.051 -7.366  -11.722 1.00 23.72 ?  470  PHE A O     1 
ATOM   2469 C  CB    . PHE A 1  330 ? -20.879 -10.301 -12.614 1.00 19.50 ?  470  PHE A CB    1 
ATOM   2470 C  CG    . PHE A 1  330 ? -20.948 -11.502 -13.501 1.00 27.07 ?  470  PHE A CG    1 
ATOM   2471 C  CD1   . PHE A 1  330 ? -20.524 -11.434 -14.827 1.00 29.25 ?  470  PHE A CD1   1 
ATOM   2472 C  CD2   . PHE A 1  330 ? -21.416 -12.717 -13.006 1.00 30.67 ?  470  PHE A CD2   1 
ATOM   2473 C  CE1   . PHE A 1  330 ? -20.575 -12.543 -15.637 1.00 31.78 ?  470  PHE A CE1   1 
ATOM   2474 C  CE2   . PHE A 1  330 ? -21.464 -13.848 -13.813 1.00 31.28 ?  470  PHE A CE2   1 
ATOM   2475 C  CZ    . PHE A 1  330 ? -21.050 -13.759 -15.135 1.00 32.67 ?  470  PHE A CZ    1 
ATOM   2476 N  N     . GLN A 1  331 ? -22.888 -8.305  -10.836 1.00 18.30 ?  471  GLN A N     1 
ATOM   2477 C  CA    . GLN A 1  331 ? -22.761 -7.552  -9.597  1.00 17.54 ?  471  GLN A CA    1 
ATOM   2478 C  C     . GLN A 1  331 ? -21.817 -8.323  -8.670  1.00 21.65 ?  471  GLN A C     1 
ATOM   2479 O  O     . GLN A 1  331 ? -21.728 -9.554  -8.714  1.00 25.37 ?  471  GLN A O     1 
ATOM   2480 C  CB    . GLN A 1  331 ? -24.132 -7.341  -8.960  1.00 22.11 ?  471  GLN A CB    1 
ATOM   2481 C  CG    . GLN A 1  331 ? -25.072 -6.600  -9.880  1.00 26.97 ?  471  GLN A CG    1 
ATOM   2482 N  N     . ALA A 1  332 ? -21.051 -7.600  -7.877  1.00 18.45 ?  472  ALA A N     1 
ATOM   2483 C  CA    . ALA A 1  332 ? -20.156 -8.238  -6.924  1.00 16.01 ?  472  ALA A CA    1 
ATOM   2484 C  C     . ALA A 1  332 ? -20.176 -7.407  -5.675  1.00 16.52 ?  472  ALA A C     1 
ATOM   2485 O  O     . ALA A 1  332 ? -20.134 -6.183  -5.755  1.00 16.67 ?  472  ALA A O     1 
ATOM   2486 C  CB    . ALA A 1  332 ? -18.746 -8.344  -7.476  1.00 14.59 ?  472  ALA A CB    1 
ATOM   2487 N  N     . ALA A 1  333 ? -20.260 -8.060  -4.523  1.00 15.69 ?  473  ALA A N     1 
ATOM   2488 C  CA    . ALA A 1  333 ? -20.237 -7.364  -3.249  1.00 15.61 ?  473  ALA A CA    1 
ATOM   2489 C  C     . ALA A 1  333 ? -18.917 -7.608  -2.540  1.00 14.99 ?  473  ALA A C     1 
ATOM   2490 O  O     . ALA A 1  333 ? -18.672 -7.039  -1.485  1.00 15.39 ?  473  ALA A O     1 
ATOM   2491 C  CB    . ALA A 1  333 ? -21.421 -7.818  -2.363  1.00 17.32 ?  473  ALA A CB    1 
ATOM   2492 N  N     . SER A 1  334 ? -18.067 -8.439  -3.138  1.00 13.67 ?  474  SER A N     1 
ATOM   2493 C  CA    . SER A 1  334 ? -16.798 -8.834  -2.523  1.00 13.69 ?  474  SER A CA    1 
ATOM   2494 C  C     . SER A 1  334 ? -15.882 -9.437  -3.558  1.00 12.49 ?  474  SER A C     1 
ATOM   2495 O  O     . SER A 1  334 ? -16.352 -9.880  -4.604  1.00 11.66 ?  474  SER A O     1 
ATOM   2496 C  CB    . SER A 1  334 ? -17.053 -9.857  -1.404  1.00 13.98 ?  474  SER A CB    1 
ATOM   2497 O  OG    . SER A 1  334 ? -17.613 -11.053 -1.941  1.00 14.07 ?  474  SER A OG    1 
ATOM   2498 N  N     . GLU A 1  335 ? -14.586 -9.518  -3.244  1.00 9.97  ?  475  GLU A N     1 
ATOM   2499 C  CA    . GLU A 1  335 ? -13.692 -10.289 -4.074  1.00 10.13 ?  475  GLU A CA    1 
ATOM   2500 C  C     . GLU A 1  335 ? -14.111 -11.744 -4.088  1.00 10.07 ?  475  GLU A C     1 
ATOM   2501 O  O     . GLU A 1  335 ? -13.988 -12.398 -5.115  1.00 10.73 ?  475  GLU A O     1 
ATOM   2502 C  CB    . GLU A 1  335 ? -12.244 -10.167 -3.593  1.00 9.73  ?  475  GLU A CB    1 
ATOM   2503 C  CG    . GLU A 1  335 ? -11.658 -8.756  -3.778  1.00 11.95 ?  475  GLU A CG    1 
ATOM   2504 C  CD    . GLU A 1  335 ? -10.225 -8.687  -3.277  1.00 12.41 ?  475  GLU A CD    1 
ATOM   2505 O  OE1   . GLU A 1  335 ? -9.961  -9.214  -2.173  1.00 13.80 ?  475  GLU A OE1   1 
ATOM   2506 O  OE2   . GLU A 1  335 ? -9.369  -8.161  -4.012  1.00 11.57 ?  475  GLU A OE2   1 
ATOM   2507 N  N     . GLU A 1  336 ? -14.613 -12.256 -2.966  1.00 10.35 ?  476  GLU A N     1 
ATOM   2508 C  CA    . GLU A 1  336 ? -15.075 -13.645 -2.941  1.00 12.87 ?  476  GLU A CA    1 
ATOM   2509 C  C     . GLU A 1  336 ? -16.148 -13.892 -4.013  1.00 14.92 ?  476  GLU A C     1 
ATOM   2510 O  O     . GLU A 1  336 ? -16.159 -14.949 -4.656  1.00 13.28 ?  476  GLU A O     1 
ATOM   2511 C  CB    . GLU A 1  336 ? -15.630 -14.034 -1.569  1.00 13.70 ?  476  GLU A CB    1 
ATOM   2512 C  CG    . GLU A 1  336 ? -14.569 -14.168 -0.459  1.00 13.98 ?  476  GLU A CG    1 
ATOM   2513 C  CD    . GLU A 1  336 ? -15.124 -14.838 0.782   1.00 16.61 ?  476  GLU A CD    1 
ATOM   2514 O  OE1   . GLU A 1  336 ? -15.040 -14.234 1.883   1.00 16.56 ?  476  GLU A OE1   1 
ATOM   2515 O  OE2   . GLU A 1  336 ? -15.642 -15.977 0.659   1.00 15.69 ?  476  GLU A OE2   1 
ATOM   2516 N  N     . ASP A 1  337 ? -17.054 -12.930 -4.200  1.00 11.29 ?  477  ASP A N     1 
ATOM   2517 C  CA    . ASP A 1  337 ? -18.036 -13.033 -5.287  1.00 12.98 ?  477  ASP A CA    1 
ATOM   2518 C  C     . ASP A 1  337 ? -17.381 -13.213 -6.639  1.00 11.05 ?  477  ASP A C     1 
ATOM   2519 O  O     . ASP A 1  337 ? -17.863 -13.991 -7.470  1.00 14.43 ?  477  ASP A O     1 
ATOM   2520 C  CB    . ASP A 1  337 ? -18.904 -11.770 -5.384  1.00 13.69 ?  477  ASP A CB    1 
ATOM   2521 C  CG    . ASP A 1  337 ? -20.211 -11.862 -4.634  1.00 16.03 ?  477  ASP A CG    1 
ATOM   2522 O  OD1   . ASP A 1  337 ? -20.663 -12.960 -4.219  1.00 16.90 ?  477  ASP A OD1   1 
ATOM   2523 O  OD2   . ASP A 1  337 ? -20.837 -10.775 -4.455  1.00 18.45 ?  477  ASP A OD2   1 
ATOM   2524 N  N     . ILE A 1  338 ? -16.328 -12.434 -6.897  1.00 9.60  ?  478  ILE A N     1 
ATOM   2525 C  CA    . ILE A 1  338 ? -15.713 -12.428 -8.220  1.00 10.36 ?  478  ILE A CA    1 
ATOM   2526 C  C     . ILE A 1  338 ? -15.037 -13.768 -8.495  1.00 12.21 ?  478  ILE A C     1 
ATOM   2527 O  O     . ILE A 1  338 ? -15.199 -14.332 -9.577  1.00 12.07 ?  478  ILE A O     1 
ATOM   2528 C  CB    . ILE A 1  338 ? -14.690 -11.282 -8.378  1.00 9.09  ?  478  ILE A CB    1 
ATOM   2529 C  CG1   . ILE A 1  338 ? -15.396 -9.937  -8.149  1.00 9.88  ?  478  ILE A CG1   1 
ATOM   2530 C  CG2   . ILE A 1  338 ? -14.038 -11.345 -9.774  1.00 11.09 ?  478  ILE A CG2   1 
ATOM   2531 C  CD1   . ILE A 1  338 ? -14.416 -8.728  -8.027  1.00 9.59  ?  478  ILE A CD1   1 
ATOM   2532 N  N     . PHE A 1  339 ? -14.289 -14.281 -7.525  1.00 10.87 ?  479  PHE A N     1 
ATOM   2533 C  CA    . PHE A 1  339 ? -13.706 -15.610 -7.700  1.00 11.26 ?  479  PHE A CA    1 
ATOM   2534 C  C     . PHE A 1  339 ? -14.797 -16.640 -7.944  1.00 11.61 ?  479  PHE A C     1 
ATOM   2535 O  O     . PHE A 1  339 ? -14.646 -17.525 -8.817  1.00 11.54 ?  479  PHE A O     1 
ATOM   2536 C  CB    . PHE A 1  339 ? -12.841 -16.008 -6.483  1.00 10.78 ?  479  PHE A CB    1 
ATOM   2537 C  CG    . PHE A 1  339 ? -11.477 -15.379 -6.472  1.00 12.13 ?  479  PHE A CG    1 
ATOM   2538 C  CD1   . PHE A 1  339 ? -11.296 -14.107 -5.958  1.00 10.34 ?  479  PHE A CD1   1 
ATOM   2539 C  CD2   . PHE A 1  339 ? -10.368 -16.073 -6.953  1.00 12.73 ?  479  PHE A CD2   1 
ATOM   2540 C  CE1   . PHE A 1  339 ? -10.028 -13.521 -5.926  1.00 12.57 ?  479  PHE A CE1   1 
ATOM   2541 C  CE2   . PHE A 1  339 ? -9.107  -15.497 -6.942  1.00 11.77 ?  479  PHE A CE2   1 
ATOM   2542 C  CZ    . PHE A 1  339 ? -8.921  -14.220 -6.436  1.00 10.92 ?  479  PHE A CZ    1 
ATOM   2543 N  N     . ARG A 1  340 ? -15.918 -16.537 -7.222  1.00 12.72 ?  480  ARG A N     1 
ATOM   2544 C  CA    . ARG A 1  340 ? -16.994 -17.483 -7.449  1.00 14.14 ?  480  ARG A CA    1 
ATOM   2545 C  C     . ARG A 1  340 ? -17.600 -17.387 -8.867  1.00 15.09 ?  480  ARG A C     1 
ATOM   2546 O  O     . ARG A 1  340 ? -17.897 -18.434 -9.477  1.00 15.80 ?  480  ARG A O     1 
ATOM   2547 C  CB    . ARG A 1  340 ? -18.110 -17.309 -6.393  1.00 16.57 ?  480  ARG A CB    1 
ATOM   2548 C  CG    . ARG A 1  340 ? -17.752 -17.929 -5.032  1.00 15.51 ?  480  ARG A CG    1 
ATOM   2549 C  CD    . ARG A 1  340 ? -18.922 -17.885 -4.031  1.00 17.03 ?  480  ARG A CD    1 
ATOM   2550 N  NE    . ARG A 1  340 ? -19.335 -16.521 -3.666  1.00 16.09 ?  480  ARG A NE    1 
ATOM   2551 C  CZ    . ARG A 1  340 ? -19.037 -15.910 -2.520  1.00 17.48 ?  480  ARG A CZ    1 
ATOM   2552 N  NH1   . ARG A 1  340 ? -18.284 -16.503 -1.604  1.00 13.65 ?  480  ARG A NH1   1 
ATOM   2553 N  NH2   . ARG A 1  340 ? -19.489 -14.676 -2.290  1.00 16.07 ?  480  ARG A NH2   1 
ATOM   2554 N  N     . HIS A 1  341 ? -17.811 -16.165 -9.361  1.00 15.78 ?  481  HIS A N     1 
ATOM   2555 C  CA    . HIS A 1  341 ? -18.346 -15.949 -10.723 1.00 17.21 ?  481  HIS A CA    1 
ATOM   2556 C  C     . HIS A 1  341 ? -17.430 -16.623 -11.762 1.00 18.18 ?  481  HIS A C     1 
ATOM   2557 O  O     . HIS A 1  341 ? -17.900 -17.086 -12.815 1.00 18.42 ?  481  HIS A O     1 
ATOM   2558 C  CB    . HIS A 1  341 ? -18.457 -14.450 -11.103 1.00 19.57 ?  481  HIS A CB    1 
ATOM   2559 C  CG    . HIS A 1  341 ? -19.446 -13.640 -10.308 1.00 24.37 ?  481  HIS A CG    1 
ATOM   2560 N  ND1   . HIS A 1  341 ? -20.677 -14.118 -9.915  1.00 27.40 ?  481  HIS A ND1   1 
ATOM   2561 C  CD2   . HIS A 1  341 ? -19.399 -12.342 -9.895  1.00 23.21 ?  481  HIS A CD2   1 
ATOM   2562 C  CE1   . HIS A 1  341 ? -21.330 -13.164 -9.266  1.00 28.79 ?  481  HIS A CE1   1 
ATOM   2563 N  NE2   . HIS A 1  341 ? -20.571 -12.081 -9.229  1.00 22.59 ?  481  HIS A NE2   1 
ATOM   2564 N  N     . LEU A 1  342 ? -16.132 -16.657 -11.467 1.00 15.41 ?  482  LEU A N     1 
ATOM   2565 C  CA    . LEU A 1  342 ? -15.138 -17.196 -12.391 1.00 13.35 ?  482  LEU A CA    1 
ATOM   2566 C  C     . LEU A 1  342 ? -14.877 -18.688 -12.171 1.00 16.94 ?  482  LEU A C     1 
ATOM   2567 O  O     . LEU A 1  342 ? -14.081 -19.301 -12.900 1.00 16.81 ?  482  LEU A O     1 
ATOM   2568 C  CB    . LEU A 1  342 ? -13.827 -16.426 -12.265 1.00 16.76 ?  482  LEU A CB    1 
ATOM   2569 C  CG    . LEU A 1  342 ? -13.896 -14.965 -12.722 1.00 15.37 ?  482  LEU A CG    1 
ATOM   2570 C  CD1   . LEU A 1  342 ? -12.539 -14.325 -12.458 1.00 12.80 ?  482  LEU A CD1   1 
ATOM   2571 C  CD2   . LEU A 1  342 ? -14.252 -14.911 -14.212 1.00 16.54 ?  482  LEU A CD2   1 
ATOM   2572 N  N     . GLY A 1  343 ? -15.543 -19.276 -11.183 1.00 15.84 ?  483  GLY A N     1 
ATOM   2573 C  CA    . GLY A 1  343 ? -15.336 -20.697 -10.882 1.00 17.48 ?  483  GLY A CA    1 
ATOM   2574 C  C     . GLY A 1  343 ? -13.927 -21.007 -10.385 1.00 16.16 ?  483  GLY A C     1 
ATOM   2575 O  O     . GLY A 1  343 ? -13.402 -22.110 -10.620 1.00 16.96 ?  483  GLY A O     1 
ATOM   2576 N  N     . LEU A 1  344 ? -13.317 -20.056 -9.680  1.00 15.42 ?  484  LEU A N     1 
ATOM   2577 C  CA    . LEU A 1  344 ? -11.956 -20.218 -9.121  1.00 12.80 ?  484  LEU A CA    1 
ATOM   2578 C  C     . LEU A 1  344 ? -11.984 -20.326 -7.608  1.00 16.14 ?  484  LEU A C     1 
ATOM   2579 O  O     . LEU A 1  344 ? -12.748 -19.616 -6.978  1.00 16.30 ?  484  LEU A O     1 
ATOM   2580 C  CB    . LEU A 1  344 ? -11.083 -19.023 -9.478  1.00 12.18 ?  484  LEU A CB    1 
ATOM   2581 C  CG    . LEU A 1  344 ? -10.663 -18.852 -10.926 1.00 14.78 ?  484  LEU A CG    1 
ATOM   2582 C  CD1   . LEU A 1  344 ? -10.149 -17.421 -11.109 1.00 14.63 ?  484  LEU A CD1   1 
ATOM   2583 C  CD2   . LEU A 1  344 ? -9.582  -19.887 -11.250 1.00 13.84 ?  484  LEU A CD2   1 
ATOM   2584 N  N     . GLU A 1  345 ? -11.157 -21.186 -7.015  1.00 14.75 ?  485  GLU A N     1 
ATOM   2585 C  CA    B GLU A 1  345 ? -11.020 -21.181 -5.566  0.55 15.53 ?  485  GLU A CA    1 
ATOM   2586 C  CA    C GLU A 1  345 ? -10.991 -21.191 -5.565  0.45 16.27 ?  485  GLU A CA    1 
ATOM   2587 C  C     . GLU A 1  345 ? -10.504 -19.825 -5.107  1.00 15.78 ?  485  GLU A C     1 
ATOM   2588 O  O     . GLU A 1  345 ? -9.631  -19.226 -5.745  1.00 13.75 ?  485  GLU A O     1 
ATOM   2589 C  CB    B GLU A 1  345 ? -10.090 -22.305 -5.107  0.55 19.64 ?  485  GLU A CB    1 
ATOM   2590 C  CB    C GLU A 1  345 ? -10.004 -22.283 -5.133  0.45 19.72 ?  485  GLU A CB    1 
ATOM   2591 C  CG    B GLU A 1  345 ? -10.667 -23.685 -5.373  0.55 23.19 ?  485  GLU A CG    1 
ATOM   2592 C  CG    C GLU A 1  345 ? -9.742  -22.339 -3.633  0.45 21.38 ?  485  GLU A CG    1 
ATOM   2593 C  CD    B GLU A 1  345 ? -9.764  -24.814 -4.904  0.55 30.45 ?  485  GLU A CD    1 
ATOM   2594 C  CD    C GLU A 1  345 ? -9.009  -23.601 -3.211  0.45 25.94 ?  485  GLU A CD    1 
ATOM   2595 O  OE1   B GLU A 1  345 ? -8.617  -24.915 -5.392  0.55 32.53 ?  485  GLU A OE1   1 
ATOM   2596 O  OE1   C GLU A 1  345 ? -9.030  -24.591 -3.975  0.45 30.27 ?  485  GLU A OE1   1 
ATOM   2597 O  OE2   B GLU A 1  345 ? -10.207 -25.607 -4.046  0.55 33.42 ?  485  GLU A OE2   1 
ATOM   2598 O  OE2   C GLU A 1  345 ? -8.415  -23.606 -2.113  0.45 25.38 ?  485  GLU A OE2   1 
ATOM   2599 N  N     . TYR A 1  346 ? -11.069 -19.323 -4.009  1.00 12.87 ?  486  TYR A N     1 
ATOM   2600 C  CA    . TYR A 1  346 ? -10.655 -18.015 -3.516  1.00 11.41 ?  486  TYR A CA    1 
ATOM   2601 C  C     . TYR A 1  346 ? -9.184  -18.005 -3.088  1.00 12.23 ?  486  TYR A C     1 
ATOM   2602 O  O     . TYR A 1  346 ? -8.722  -18.922 -2.409  1.00 12.87 ?  486  TYR A O     1 
ATOM   2603 C  CB    . TYR A 1  346 ? -11.527 -17.596 -2.334  1.00 13.52 ?  486  TYR A CB    1 
ATOM   2604 C  CG    . TYR A 1  346 ? -11.103 -16.255 -1.786  1.00 11.39 ?  486  TYR A CG    1 
ATOM   2605 C  CD1   . TYR A 1  346 ? -11.380 -15.087 -2.493  1.00 13.33 ?  486  TYR A CD1   1 
ATOM   2606 C  CD2   . TYR A 1  346 ? -10.409 -16.163 -0.581  1.00 14.67 ?  486  TYR A CD2   1 
ATOM   2607 C  CE1   . TYR A 1  346 ? -10.991 -13.852 -2.003  1.00 16.40 ?  486  TYR A CE1   1 
ATOM   2608 C  CE2   . TYR A 1  346 ? -10.021 -14.929 -0.084  1.00 16.16 ?  486  TYR A CE2   1 
ATOM   2609 C  CZ    . TYR A 1  346 ? -10.303 -13.788 -0.800  1.00 18.88 ?  486  TYR A CZ    1 
ATOM   2610 O  OH    . TYR A 1  346 ? -9.895  -12.557 -0.306  1.00 20.04 ?  486  TYR A OH    1 
ATOM   2611 N  N     . LEU A 1  347 ? -8.479  -16.951 -3.483  1.00 9.70  ?  487  LEU A N     1 
ATOM   2612 C  CA    . LEU A 1  347 ? -7.121  -16.700 -2.992  1.00 12.04 ?  487  LEU A CA    1 
ATOM   2613 C  C     . LEU A 1  347 ? -7.059  -15.362 -2.263  1.00 9.26  ?  487  LEU A C     1 
ATOM   2614 O  O     . LEU A 1  347 ? -7.400  -14.330 -2.844  1.00 10.94 ?  487  LEU A O     1 
ATOM   2615 C  CB    . LEU A 1  347 ? -6.117  -16.701 -4.158  1.00 12.59 ?  487  LEU A CB    1 
ATOM   2616 C  CG    . LEU A 1  347 ? -5.921  -18.053 -4.841  1.00 12.82 ?  487  LEU A CG    1 
ATOM   2617 C  CD1   . LEU A 1  347 ? -5.064  -17.875 -6.094  1.00 16.68 ?  487  LEU A CD1   1 
ATOM   2618 C  CD2   . LEU A 1  347 ? -5.243  -19.016 -3.876  1.00 14.30 ?  487  LEU A CD2   1 
ATOM   2619 N  N     . PRO A 1  348 ? -6.615  -15.372 -0.997  1.00 11.80 ?  488  PRO A N     1 
ATOM   2620 C  CA    . PRO A 1  348 ? -6.447  -14.087 -0.305  1.00 11.34 ?  488  PRO A CA    1 
ATOM   2621 C  C     . PRO A 1  348 ? -5.283  -13.326 -0.950  1.00 10.07 ?  488  PRO A C     1 
ATOM   2622 O  O     . PRO A 1  348 ? -4.477  -13.921 -1.663  1.00 10.06 ?  488  PRO A O     1 
ATOM   2623 C  CB    . PRO A 1  348 ? -6.158  -14.499 1.132   1.00 14.86 ?  488  PRO A CB    1 
ATOM   2624 C  CG    . PRO A 1  348 ? -5.449  -15.825 0.989   1.00 17.67 ?  488  PRO A CG    1 
ATOM   2625 C  CD    . PRO A 1  348 ? -6.129  -16.505 -0.184  1.00 15.94 ?  488  PRO A CD    1 
ATOM   2626 N  N     A PRO A 1  349 ? -5.192  -12.015 -0.687  0.30 10.62 ?  489  PRO A N     1 
ATOM   2627 N  N     B PRO A 1  349 ? -5.203  -12.014 -0.721  0.70 10.65 ?  489  PRO A N     1 
ATOM   2628 C  CA    A PRO A 1  349 ? -4.208  -11.190 -1.399  0.30 10.18 ?  489  PRO A CA    1 
ATOM   2629 C  CA    B PRO A 1  349 ? -4.182  -11.188 -1.387  0.70 9.91  ?  489  PRO A CA    1 
ATOM   2630 C  C     A PRO A 1  349 ? -2.766  -11.647 -1.186  0.30 10.30 ?  489  PRO A C     1 
ATOM   2631 C  C     B PRO A 1  349 ? -2.752  -11.717 -1.221  0.70 10.20 ?  489  PRO A C     1 
ATOM   2632 O  O     A PRO A 1  349 ? -1.938  -11.456 -2.076  0.30 10.83 ?  489  PRO A O     1 
ATOM   2633 O  O     B PRO A 1  349 ? -1.939  -11.663 -2.149  0.70 11.54 ?  489  PRO A O     1 
ATOM   2634 C  CB    A PRO A 1  349 ? -4.436  -9.785  -0.812  0.30 10.84 ?  489  PRO A CB    1 
ATOM   2635 C  CB    B PRO A 1  349 ? -4.350  -9.826  -0.695  0.70 11.47 ?  489  PRO A CB    1 
ATOM   2636 C  CG    A PRO A 1  349 ? -5.113  -10.010 0.494   0.30 10.97 ?  489  PRO A CG    1 
ATOM   2637 C  CG    B PRO A 1  349 ? -5.809  -9.776  -0.370  0.70 10.26 ?  489  PRO A CG    1 
ATOM   2638 C  CD    A PRO A 1  349 ? -5.964  -11.235 0.298   0.30 11.32 ?  489  PRO A CD    1 
ATOM   2639 C  CD    B PRO A 1  349 ? -6.170  -11.202 0.042   0.70 11.61 ?  489  PRO A CD    1 
ATOM   2640 N  N     . GLU A 1  350 ? -2.468  -12.261 -0.044  1.00 9.43  ?  490  GLU A N     1 
ATOM   2641 C  CA    A GLU A 1  350 ? -1.105  -12.707 0.207   0.49 11.19 ?  490  GLU A CA    1 
ATOM   2642 C  CA    B GLU A 1  350 ? -1.147  -12.790 0.285   0.51 11.67 ?  490  GLU A CA    1 
ATOM   2643 C  C     . GLU A 1  350 ? -0.757  -13.963 -0.600  1.00 12.67 ?  490  GLU A C     1 
ATOM   2644 O  O     . GLU A 1  350 ? 0.415   -14.359 -0.648  1.00 14.40 ?  490  GLU A O     1 
ATOM   2645 C  CB    A GLU A 1  350 ? -0.886  -12.948 1.706   0.49 13.99 ?  490  GLU A CB    1 
ATOM   2646 C  CB    B GLU A 1  350 ? -1.098  -13.228 1.755   0.51 14.44 ?  490  GLU A CB    1 
ATOM   2647 C  CG    A GLU A 1  350 ? -1.679  -14.107 2.279   0.49 15.22 ?  490  GLU A CG    1 
ATOM   2648 C  CG    B GLU A 1  350 ? -1.214  -12.092 2.767   0.51 14.88 ?  490  GLU A CG    1 
ATOM   2649 C  CD    A GLU A 1  350 ? -3.033  -13.724 2.871   0.49 16.88 ?  490  GLU A CD    1 
ATOM   2650 C  CD    B GLU A 1  350 ? -2.664  -11.696 3.104   0.51 17.71 ?  490  GLU A CD    1 
ATOM   2651 O  OE1   A GLU A 1  350 ? -3.549  -12.616 2.577   0.49 16.50 ?  490  GLU A OE1   1 
ATOM   2652 O  OE1   B GLU A 1  350 ? -3.616  -12.242 2.503   0.51 15.45 ?  490  GLU A OE1   1 
ATOM   2653 O  OE2   A GLU A 1  350 ? -3.586  -14.557 3.638   0.49 14.42 ?  490  GLU A OE2   1 
ATOM   2654 O  OE2   B GLU A 1  350 ? -2.842  -10.817 3.977   0.51 19.42 ?  490  GLU A OE2   1 
ATOM   2655 N  N     . GLN A 1  351 ? -1.750  -14.576 -1.257  1.00 9.77  ?  491  GLN A N     1 
ATOM   2656 C  CA    . GLN A 1  351 ? -1.447  -15.689 -2.148  1.00 9.83  ?  491  GLN A CA    1 
ATOM   2657 C  C     . GLN A 1  351 ? -1.604  -15.289 -3.607  1.00 10.33 ?  491  GLN A C     1 
ATOM   2658 O  O     . GLN A 1  351 ? -1.657  -16.153 -4.485  1.00 10.00 ?  491  GLN A O     1 
ATOM   2659 C  CB    . GLN A 1  351 ? -2.335  -16.913 -1.828  1.00 12.34 ?  491  GLN A CB    1 
ATOM   2660 C  CG    . GLN A 1  351 ? -2.136  -17.416 -0.398  1.00 16.00 ?  491  GLN A CG    1 
ATOM   2661 C  CD    . GLN A 1  351 ? -0.719  -17.924 -0.138  1.00 18.19 ?  491  GLN A CD    1 
ATOM   2662 O  OE1   . GLN A 1  351 ? -0.048  -18.416 -1.049  1.00 18.30 ?  491  GLN A OE1   1 
ATOM   2663 N  NE2   . GLN A 1  351 ? -0.260  -17.815 1.110   1.00 20.01 ?  491  GLN A NE2   1 
ATOM   2664 N  N     . ARG A 1  352 ? -1.645  -13.976 -3.871  1.00 9.89  ?  492  ARG A N     1 
ATOM   2665 C  CA    . ARG A 1  352 ? -1.709  -13.460 -5.234  1.00 8.88  ?  492  ARG A CA    1 
ATOM   2666 C  C     . ARG A 1  352 ? -0.370  -12.888 -5.679  1.00 11.99 ?  492  ARG A C     1 
ATOM   2667 O  O     . ARG A 1  352 ? -0.321  -12.043 -6.578  1.00 10.38 ?  492  ARG A O     1 
ATOM   2668 C  CB    . ARG A 1  352 ? -2.793  -12.372 -5.344  1.00 7.47  ?  492  ARG A CB    1 
ATOM   2669 C  CG    . ARG A 1  352 ? -4.153  -12.904 -4.914  1.00 8.77  ?  492  ARG A CG    1 
ATOM   2670 C  CD    . ARG A 1  352 ? -5.232  -11.819 -5.093  1.00 8.55  ?  492  ARG A CD    1 
ATOM   2671 N  NE    . ARG A 1  352 ? -6.380  -12.119 -4.241  1.00 8.77  ?  492  ARG A NE    1 
ATOM   2672 C  CZ    . ARG A 1  352 ? -7.277  -11.211 -3.847  1.00 9.54  ?  492  ARG A CZ    1 
ATOM   2673 N  NH1   . ARG A 1  352 ? -7.169  -9.948  -4.261  1.00 10.10 ?  492  ARG A NH1   1 
ATOM   2674 N  NH2   . ARG A 1  352 ? -8.275  -11.583 -3.039  1.00 9.37  ?  492  ARG A NH2   1 
ATOM   2675 N  N     . ASN A 1  353 ? 0.721   -13.382 -5.086  1.00 11.36 ?  493  ASN A N     1 
ATOM   2676 C  CA    . ASN A 1  353 ? 2.037   -12.835 -5.398  1.00 12.81 ?  493  ASN A CA    1 
ATOM   2677 C  C     . ASN A 1  353 ? 2.681   -13.527 -6.588  1.00 11.72 ?  493  ASN A C     1 
ATOM   2678 O  O     . ASN A 1  353 ? 3.823   -13.960 -6.534  1.00 13.29 ?  493  ASN A O     1 
ATOM   2679 C  CB    . ASN A 1  353 ? 2.926   -12.910 -4.155  1.00 10.57 ?  493  ASN A CB    1 
ATOM   2680 C  CG    . ASN A 1  353 ? 2.556   -11.837 -3.145  1.00 10.93 ?  493  ASN A CG    1 
ATOM   2681 O  OD1   . ASN A 1  353 ? 2.792   -10.658 -3.385  1.00 12.36 ?  493  ASN A OD1   1 
ATOM   2682 N  ND2   . ASN A 1  353 ? 1.982   -12.234 -2.014  1.00 12.32 ?  493  ASN A ND2   1 
ATOM   2683 N  N     . ALA A 1  354 ? 1.915   -13.655 -7.666  1.00 11.51 ?  494  ALA A N     1 
ATOM   2684 C  CA    . ALA A 1  354 ? 2.420   -14.300 -8.871  1.00 14.04 ?  494  ALA A CA    1 
ATOM   2685 C  C     . ALA A 1  354 ? 3.556   -13.486 -9.465  1.00 16.96 ?  494  ALA A C     1 
ATOM   2686 O  O     . ALA A 1  354 ? 3.505   -12.236 -9.510  1.00 15.44 ?  494  ALA A O     1 
ATOM   2687 C  CB    . ALA A 1  354 ? 1.310   -14.481 -9.897  1.00 11.33 ?  494  ALA A CB    1 
ATOM   2688 O  OXT   . ALA A 1  354 ? 4.553   -14.062 -9.929  1.00 18.18 ?  494  ALA A OXT   1 
ATOM   2689 O  "O5'" . DC  B 2  1   ? 1.882   -16.933 -39.343 1.00 46.79 ?  1    DC  T "O5'" 1 
ATOM   2690 C  "C5'" . DC  B 2  1   ? 1.335   -18.127 -39.930 1.00 43.86 ?  1    DC  T "C5'" 1 
ATOM   2691 C  "C4'" . DC  B 2  1   ? 0.030   -18.510 -39.255 1.00 37.88 ?  1    DC  T "C4'" 1 
ATOM   2692 O  "O4'" . DC  B 2  1   ? 0.259   -19.492 -38.216 1.00 33.80 ?  1    DC  T "O4'" 1 
ATOM   2693 C  "C3'" . DC  B 2  1   ? -0.700  -17.382 -38.580 1.00 33.25 ?  1    DC  T "C3'" 1 
ATOM   2694 O  "O3'" . DC  B 2  1   ? -2.068  -17.642 -38.728 1.00 32.99 ?  1    DC  T "O3'" 1 
ATOM   2695 C  "C2'" . DC  B 2  1   ? -0.238  -17.502 -37.118 1.00 31.58 ?  1    DC  T "C2'" 1 
ATOM   2696 C  "C1'" . DC  B 2  1   ? -0.174  -19.008 -36.970 1.00 30.89 ?  1    DC  T "C1'" 1 
ATOM   2697 N  N1    . DC  B 2  1   ? 0.790   -19.552 -35.973 1.00 29.83 ?  1    DC  T N1    1 
ATOM   2698 C  C2    . DC  B 2  1   ? 0.334   -20.433 -34.986 1.00 27.08 ?  1    DC  T C2    1 
ATOM   2699 O  O2    . DC  B 2  1   ? -0.876  -20.659 -34.894 1.00 27.35 ?  1    DC  T O2    1 
ATOM   2700 N  N3    . DC  B 2  1   ? 1.231   -20.992 -34.141 1.00 26.83 ?  1    DC  T N3    1 
ATOM   2701 C  C4    . DC  B 2  1   ? 2.531   -20.717 -34.266 1.00 28.96 ?  1    DC  T C4    1 
ATOM   2702 N  N4    . DC  B 2  1   ? 3.384   -21.300 -33.408 1.00 28.52 ?  1    DC  T N4    1 
ATOM   2703 C  C5    . DC  B 2  1   ? 3.018   -19.840 -35.277 1.00 28.51 ?  1    DC  T C5    1 
ATOM   2704 C  C6    . DC  B 2  1   ? 2.124   -19.297 -36.110 1.00 29.88 ?  1    DC  T C6    1 
ATOM   2705 P  P     . DG  B 2  2   ? -3.111  -16.435 -38.715 1.00 33.42 ?  2    DG  T P     1 
ATOM   2706 O  OP1   . DG  B 2  2   ? -4.327  -16.892 -39.429 1.00 31.55 ?  2    DG  T OP1   1 
ATOM   2707 O  OP2   . DG  B 2  2   ? -2.357  -15.224 -39.140 1.00 37.65 ?  2    DG  T OP2   1 
ATOM   2708 O  "O5'" . DG  B 2  2   ? -3.434  -16.266 -37.176 1.00 30.42 ?  2    DG  T "O5'" 1 
ATOM   2709 C  "C5'" . DG  B 2  2   ? -4.230  -17.226 -36.531 1.00 30.08 ?  2    DG  T "C5'" 1 
ATOM   2710 C  "C4'" . DG  B 2  2   ? -4.324  -16.898 -35.063 1.00 27.22 ?  2    DG  T "C4'" 1 
ATOM   2711 O  "O4'" . DG  B 2  2   ? -3.192  -17.468 -34.369 1.00 28.19 ?  2    DG  T "O4'" 1 
ATOM   2712 C  "C3'" . DG  B 2  2   ? -4.315  -15.398 -34.737 1.00 28.85 ?  2    DG  T "C3'" 1 
ATOM   2713 O  "O3'" . DG  B 2  2   ? -5.398  -15.119 -33.851 1.00 31.84 ?  2    DG  T "O3'" 1 
ATOM   2714 C  "C2'" . DG  B 2  2   ? -2.941  -15.169 -34.078 1.00 27.60 ?  2    DG  T "C2'" 1 
ATOM   2715 C  "C1'" . DG  B 2  2   ? -2.689  -16.521 -33.435 1.00 24.68 ?  2    DG  T "C1'" 1 
ATOM   2716 N  N9    . DG  B 2  2   ? -1.282  -16.856 -33.223 1.00 23.98 ?  2    DG  T N9    1 
ATOM   2717 C  C8    . DG  B 2  2   ? -0.185  -16.421 -33.939 1.00 23.38 ?  2    DG  T C8    1 
ATOM   2718 N  N7    . DG  B 2  2   ? 0.939   -16.974 -33.543 1.00 23.20 ?  2    DG  T N7    1 
ATOM   2719 C  C5    . DG  B 2  2   ? 0.542   -17.841 -32.521 1.00 22.80 ?  2    DG  T C5    1 
ATOM   2720 C  C6    . DG  B 2  2   ? 1.299   -18.714 -31.703 1.00 26.13 ?  2    DG  T C6    1 
ATOM   2721 O  O6    . DG  B 2  2   ? 2.519   -18.914 -31.711 1.00 22.77 ?  2    DG  T O6    1 
ATOM   2722 N  N1    . DG  B 2  2   ? 0.491   -19.409 -30.800 1.00 22.42 ?  2    DG  T N1    1 
ATOM   2723 C  C2    . DG  B 2  2   ? -0.869  -19.277 -30.702 1.00 22.40 ?  2    DG  T C2    1 
ATOM   2724 N  N2    . DG  B 2  2   ? -1.478  -20.014 -29.759 1.00 22.37 ?  2    DG  T N2    1 
ATOM   2725 N  N3    . DG  B 2  2   ? -1.581  -18.466 -31.450 1.00 22.62 ?  2    DG  T N3    1 
ATOM   2726 C  C4    . DG  B 2  2   ? -0.817  -17.784 -32.337 1.00 22.75 ?  2    DG  T C4    1 
ATOM   2727 P  P     . DG  B 2  3   ? -5.605  -13.657 -33.206 1.00 36.09 ?  3    DG  T P     1 
ATOM   2728 O  OP1   . DG  B 2  3   ? -7.063  -13.521 -33.040 1.00 36.10 ?  3    DG  T OP1   1 
ATOM   2729 O  OP2   . DG  B 2  3   ? -4.793  -12.656 -33.931 1.00 38.84 ?  3    DG  T OP2   1 
ATOM   2730 O  "O5'" . DG  B 2  3   ? -4.978  -13.801 -31.738 1.00 29.33 ?  3    DG  T "O5'" 1 
ATOM   2731 C  "C5'" . DG  B 2  3   ? -5.444  -14.860 -30.909 1.00 25.95 ?  3    DG  T "C5'" 1 
ATOM   2732 C  "C4'" . DG  B 2  3   ? -4.554  -15.033 -29.712 1.00 24.70 ?  3    DG  T "C4'" 1 
ATOM   2733 O  "O4'" . DG  B 2  3   ? -3.280  -15.560 -30.109 1.00 23.96 ?  3    DG  T "O4'" 1 
ATOM   2734 C  "C3'" . DG  B 2  3   ? -4.229  -13.742 -28.974 1.00 20.77 ?  3    DG  T "C3'" 1 
ATOM   2735 O  "O3'" . DG  B 2  3   ? -5.081  -13.630 -27.860 1.00 18.48 ?  3    DG  T "O3'" 1 
ATOM   2736 C  "C2'" . DG  B 2  3   ? -2.761  -13.915 -28.540 1.00 22.72 ?  3    DG  T "C2'" 1 
ATOM   2737 C  "C1'" . DG  B 2  3   ? -2.412  -15.321 -29.045 1.00 21.74 ?  3    DG  T "C1'" 1 
ATOM   2738 N  N9    . DG  B 2  3   ? -1.050  -15.411 -29.525 1.00 21.76 ?  3    DG  T N9    1 
ATOM   2739 C  C8    . DG  B 2  3   ? -0.501  -14.728 -30.578 1.00 20.26 ?  3    DG  T C8    1 
ATOM   2740 N  N7    . DG  B 2  3   ? 0.756   -14.992 -30.761 1.00 20.51 ?  3    DG  T N7    1 
ATOM   2741 C  C5    . DG  B 2  3   ? 1.057   -15.912 -29.766 1.00 19.31 ?  3    DG  T C5    1 
ATOM   2742 C  C6    . DG  B 2  3   ? 2.274   -16.558 -29.468 1.00 23.21 ?  3    DG  T C6    1 
ATOM   2743 O  O6    . DG  B 2  3   ? 3.355   -16.444 -30.047 1.00 23.61 ?  3    DG  T O6    1 
ATOM   2744 N  N1    . DG  B 2  3   ? 2.154   -17.404 -28.368 1.00 19.13 ?  3    DG  T N1    1 
ATOM   2745 C  C2    . DG  B 2  3   ? 0.993   -17.605 -27.661 1.00 18.91 ?  3    DG  T C2    1 
ATOM   2746 N  N2    . DG  B 2  3   ? 1.060   -18.475 -26.643 1.00 20.63 ?  3    DG  T N2    1 
ATOM   2747 N  N3    . DG  B 2  3   ? -0.164  -17.005 -27.944 1.00 18.65 ?  3    DG  T N3    1 
ATOM   2748 C  C4    . DG  B 2  3   ? -0.046  -16.171 -28.993 1.00 18.91 ?  3    DG  T C4    1 
ATOM   2749 P  P     . DC  B 2  4   ? -5.163  -12.256 -27.037 1.00 21.05 ?  4    DC  T P     1 
ATOM   2750 O  OP1   . DC  B 2  4   ? -6.452  -12.324 -26.330 1.00 22.81 ?  4    DC  T OP1   1 
ATOM   2751 O  OP2   . DC  B 2  4   ? -4.867  -11.128 -27.956 1.00 20.40 ?  4    DC  T OP2   1 
ATOM   2752 O  "O5'" . DC  B 2  4   ? -3.960  -12.363 -25.993 1.00 19.43 ?  4    DC  T "O5'" 1 
ATOM   2753 C  "C5'" . DC  B 2  4   ? -3.930  -13.423 -25.020 1.00 15.54 ?  4    DC  T "C5'" 1 
ATOM   2754 C  "C4'" . DC  B 2  4   ? -2.566  -13.467 -24.376 1.00 14.90 ?  4    DC  T "C4'" 1 
ATOM   2755 O  "O4'" . DC  B 2  4   ? -1.594  -13.861 -25.388 1.00 16.38 ?  4    DC  T "O4'" 1 
ATOM   2756 C  "C3'" . DC  B 2  4   ? -2.080  -12.114 -23.835 1.00 16.02 ?  4    DC  T "C3'" 1 
ATOM   2757 O  "O3'" . DC  B 2  4   ? -1.698  -12.245 -22.476 1.00 15.29 ?  4    DC  T "O3'" 1 
ATOM   2758 C  "C2'" . DC  B 2  4   ? -0.875  -11.779 -24.730 1.00 14.31 ?  4    DC  T "C2'" 1 
ATOM   2759 C  "C1'" . DC  B 2  4   ? -0.424  -13.187 -25.119 1.00 16.11 ?  4    DC  T "C1'" 1 
ATOM   2760 N  N1    . DC  B 2  4   ? 0.511   -13.217 -26.293 1.00 16.60 ?  4    DC  T N1    1 
ATOM   2761 C  C2    . DC  B 2  4   ? 1.619   -14.049 -26.232 1.00 15.95 ?  4    DC  T C2    1 
ATOM   2762 O  O2    . DC  B 2  4   ? 1.737   -14.794 -25.259 1.00 15.70 ?  4    DC  T O2    1 
ATOM   2763 N  N3    . DC  B 2  4   ? 2.520   -14.027 -27.243 1.00 16.65 ?  4    DC  T N3    1 
ATOM   2764 C  C4    . DC  B 2  4   ? 2.332   -13.214 -28.294 1.00 18.30 ?  4    DC  T C4    1 
ATOM   2765 N  N4    . DC  B 2  4   ? 3.245   -13.230 -29.279 1.00 17.89 ?  4    DC  T N4    1 
ATOM   2766 C  C5    . DC  B 2  4   ? 1.201   -12.349 -28.376 1.00 17.87 ?  4    DC  T C5    1 
ATOM   2767 C  C6    . DC  B 2  4   ? 0.322   -12.379 -27.360 1.00 17.29 ?  4    DC  T C6    1 
ATOM   2768 P  P     . DA  B 2  5   ? -1.589  -10.947 -21.536 1.00 13.01 ?  5    DA  T P     1 
ATOM   2769 O  OP1   . DA  B 2  5   ? -0.890  -9.850  -22.235 1.00 12.90 ?  5    DA  T OP1   1 
ATOM   2770 O  OP2   . DA  B 2  5   ? -1.095  -11.450 -20.242 1.00 13.06 ?  5    DA  T OP2   1 
ATOM   2771 O  "O5'" . DA  B 2  5   ? -3.110  -10.458 -21.411 1.00 12.56 ?  5    DA  T "O5'" 1 
ATOM   2772 C  "C5'" . DA  B 2  5   ? -4.060  -11.258 -20.677 1.00 12.64 ?  5    DA  T "C5'" 1 
ATOM   2773 C  "C4'" . DA  B 2  5   ? -5.189  -10.383 -20.170 1.00 13.05 ?  5    DA  T "C4'" 1 
ATOM   2774 O  "O4'" . DA  B 2  5   ? -4.661  -9.390  -19.240 1.00 13.89 ?  5    DA  T "O4'" 1 
ATOM   2775 C  "C3'" . DA  B 2  5   ? -5.921  -9.603  -21.249 1.00 13.00 ?  5    DA  T "C3'" 1 
ATOM   2776 O  "O3'" . DA  B 2  5   ? -7.302  -9.522  -20.882 1.00 13.33 ?  5    DA  T "O3'" 1 
ATOM   2777 C  "C2'" . DA  B 2  5   ? -5.224  -8.227  -21.234 1.00 12.62 ?  5    DA  T "C2'" 1 
ATOM   2778 C  "C1'" . DA  B 2  5   ? -4.803  -8.075  -19.768 1.00 12.51 ?  5    DA  T "C1'" 1 
ATOM   2779 N  N9    . DA  B 2  5   ? -3.516  -7.408  -19.579 1.00 11.86 ?  5    DA  T N9    1 
ATOM   2780 C  C8    . DA  B 2  5   ? -2.443  -7.393  -20.435 1.00 13.94 ?  5    DA  T C8    1 
ATOM   2781 N  N7    . DA  B 2  5   ? -1.401  -6.740  -19.965 1.00 13.44 ?  5    DA  T N7    1 
ATOM   2782 C  C5    . DA  B 2  5   ? -1.814  -6.320  -18.704 1.00 14.02 ?  5    DA  T C5    1 
ATOM   2783 C  C6    . DA  B 2  5   ? -1.174  -5.581  -17.683 1.00 15.74 ?  5    DA  T C6    1 
ATOM   2784 N  N6    . DA  B 2  5   ? 0.080   -5.113  -17.779 1.00 13.36 ?  5    DA  T N6    1 
ATOM   2785 N  N1    . DA  B 2  5   ? -1.869  -5.351  -16.545 1.00 16.24 ?  5    DA  T N1    1 
ATOM   2786 C  C2    . DA  B 2  5   ? -3.125  -5.805  -16.449 1.00 15.05 ?  5    DA  T C2    1 
ATOM   2787 N  N3    . DA  B 2  5   ? -3.832  -6.507  -17.341 1.00 13.96 ?  5    DA  T N3    1 
ATOM   2788 C  C4    . DA  B 2  5   ? -3.109  -6.733  -18.452 1.00 12.74 ?  5    DA  T C4    1 
ATOM   2789 P  P     . DA  B 2  6   ? -8.339  -8.707  -21.771 1.00 14.73 ?  6    DA  T P     1 
ATOM   2790 O  OP1   . DA  B 2  6   ? -9.668  -9.297  -21.511 1.00 14.63 ?  6    DA  T OP1   1 
ATOM   2791 O  OP2   . DA  B 2  6   ? -7.890  -8.602  -23.195 1.00 14.58 ?  6    DA  T OP2   1 
ATOM   2792 O  "O5'" . DA  B 2  6   ? -8.254  -7.246  -21.159 1.00 14.87 ?  6    DA  T "O5'" 1 
ATOM   2793 C  "C5'" . DA  B 2  6   ? -8.689  -7.046  -19.839 1.00 14.41 ?  6    DA  T "C5'" 1 
ATOM   2794 C  "C4'" . DA  B 2  6   ? -8.371  -5.640  -19.374 1.00 14.38 ?  6    DA  T "C4'" 1 
ATOM   2795 O  "O4'" . DA  B 2  6   ? -6.963  -5.517  -19.128 1.00 14.24 ?  6    DA  T "O4'" 1 
ATOM   2796 C  "C3'" . DA  B 2  6   ? -8.688  -4.551  -20.382 1.00 14.34 ?  6    DA  T "C3'" 1 
ATOM   2797 O  "O3'" . DA  B 2  6   ? -10.068 -4.234  -20.281 1.00 16.12 ?  6    DA  T "O3'" 1 
ATOM   2798 C  "C2'" . DA  B 2  6   ? -7.788  -3.400  -19.911 1.00 14.03 ?  6    DA  T "C2'" 1 
ATOM   2799 C  "C1'" . DA  B 2  6   ? -6.587  -4.140  -19.261 1.00 15.36 ?  6    DA  T "C1'" 1 
ATOM   2800 N  N9    . DA  B 2  6   ? -5.344  -4.092  -20.029 1.00 15.50 ?  6    DA  T N9    1 
ATOM   2801 C  C8    . DA  B 2  6   ? -5.132  -4.580  -21.283 1.00 15.60 ?  6    DA  T C8    1 
ATOM   2802 N  N7    . DA  B 2  6   ? -3.891  -4.431  -21.705 1.00 17.62 ?  6    DA  T N7    1 
ATOM   2803 C  C5    . DA  B 2  6   ? -3.254  -3.801  -20.656 1.00 16.94 ?  6    DA  T C5    1 
ATOM   2804 C  C6    . DA  B 2  6   ? -1.932  -3.351  -20.487 1.00 21.33 ?  6    DA  T C6    1 
ATOM   2805 N  N6    . DA  B 2  6   ? -0.982  -3.495  -21.420 1.00 23.93 ?  6    DA  T N6    1 
ATOM   2806 N  N1    . DA  B 2  6   ? -1.619  -2.769  -19.315 1.00 20.52 ?  6    DA  T N1    1 
ATOM   2807 C  C2    . DA  B 2  6   ? -2.574  -2.625  -18.384 1.00 18.44 ?  6    DA  T C2    1 
ATOM   2808 N  N3    . DA  B 2  6   ? -3.852  -2.994  -18.437 1.00 16.19 ?  6    DA  T N3    1 
ATOM   2809 C  C4    . DA  B 2  6   ? -4.125  -3.590  -19.608 1.00 15.81 ?  6    DA  T C4    1 
ATOM   2810 P  P     . DT  B 2  7   ? -10.841 -3.524  -21.472 1.00 18.27 ?  7    DT  T P     1 
ATOM   2811 O  OP1   . DT  B 2  7   ? -12.282 -3.607  -21.173 1.00 16.01 ?  7    DT  T OP1   1 
ATOM   2812 O  OP2   . DT  B 2  7   ? -10.330 -4.015  -22.778 1.00 17.05 ?  7    DT  T OP2   1 
ATOM   2813 O  "O5'" . DT  B 2  7   ? -10.347 -2.010  -21.392 1.00 20.39 ?  7    DT  T "O5'" 1 
ATOM   2814 C  "C5'" . DT  B 2  7   ? -10.786 -1.191  -20.358 1.00 20.56 ?  7    DT  T "C5'" 1 
ATOM   2815 C  "C4'" . DT  B 2  7   ? -10.158 0.166   -20.507 1.00 19.10 ?  7    DT  T "C4'" 1 
ATOM   2816 O  "O4'" . DT  B 2  7   ? -8.783  0.103   -20.077 1.00 17.22 ?  7    DT  T "O4'" 1 
ATOM   2817 C  "C3'" . DT  B 2  7   ? -10.118 0.699   -21.950 1.00 20.66 ?  7    DT  T "C3'" 1 
ATOM   2818 O  "O3'" . DT  B 2  7   ? -10.568 2.051   -21.939 1.00 23.28 ?  7    DT  T "O3'" 1 
ATOM   2819 C  "C2'" . DT  B 2  7   ? -8.635  0.633   -22.316 1.00 18.75 ?  7    DT  T "C2'" 1 
ATOM   2820 C  "C1'" . DT  B 2  7   ? -8.046  0.911   -20.946 1.00 16.80 ?  7    DT  T "C1'" 1 
ATOM   2821 N  N1    . DT  B 2  7   ? -6.611  0.641   -20.801 1.00 16.80 ?  7    DT  T N1    1 
ATOM   2822 C  C2    . DT  B 2  7   ? -5.973  1.123   -19.681 1.00 17.38 ?  7    DT  T C2    1 
ATOM   2823 O  O2    . DT  B 2  7   ? -6.560  1.716   -18.790 1.00 19.18 ?  7    DT  T O2    1 
ATOM   2824 N  N3    . DT  B 2  7   ? -4.634  0.865   -19.619 1.00 15.61 ?  7    DT  T N3    1 
ATOM   2825 C  C4    . DT  B 2  7   ? -3.865  0.213   -20.564 1.00 16.90 ?  7    DT  T C4    1 
ATOM   2826 O  O4    . DT  B 2  7   ? -2.656  0.053   -20.430 1.00 18.17 ?  7    DT  T O4    1 
ATOM   2827 C  C5    . DT  B 2  7   ? -4.585  -0.251  -21.737 1.00 17.91 ?  7    DT  T C5    1 
ATOM   2828 C  C7    . DT  B 2  7   ? -3.851  -0.979  -22.821 1.00 20.04 ?  7    DT  T C7    1 
ATOM   2829 C  C6    . DT  B 2  7   ? -5.916  -0.032  -21.796 1.00 17.35 ?  7    DT  T C6    1 
ATOM   2830 P  P     . DA  B 2  8   ? -11.664 2.584   -22.977 1.00 24.98 ?  8    DA  T P     1 
ATOM   2831 O  OP1   . DA  B 2  8   ? -12.811 1.660   -23.033 1.00 27.25 ?  8    DA  T OP1   1 
ATOM   2832 O  OP2   . DA  B 2  8   ? -10.973 2.963   -24.231 1.00 26.32 ?  8    DA  T OP2   1 
ATOM   2833 O  "O5'" . DA  B 2  8   ? -12.158 3.920   -22.268 1.00 24.42 ?  8    DA  T "O5'" 1 
ATOM   2834 C  "C5'" . DA  B 2  8   ? -12.689 3.856   -20.969 1.00 23.00 ?  8    DA  T "C5'" 1 
ATOM   2835 C  "C4'" . DA  B 2  8   ? -12.133 4.980   -20.115 1.00 22.27 ?  8    DA  T "C4'" 1 
ATOM   2836 O  "O4'" . DA  B 2  8   ? -10.752 4.699   -19.798 1.00 22.76 ?  8    DA  T "O4'" 1 
ATOM   2837 C  "C3'" . DA  B 2  8   ? -12.162 6.362   -20.760 1.00 24.37 ?  8    DA  T "C3'" 1 
ATOM   2838 O  "O3'" . DA  B 2  8   ? -12.551 7.319   -19.782 1.00 24.92 ?  8    DA  T "O3'" 1 
ATOM   2839 C  "C2'" . DA  B 2  8   ? -10.719 6.568   -21.239 1.00 21.36 ?  8    DA  T "C2'" 1 
ATOM   2840 C  "C1'" . DA  B 2  8   ? -9.918  5.757   -20.221 1.00 21.86 ?  8    DA  T "C1'" 1 
ATOM   2841 N  N9    . DA  B 2  8   ? -8.695  5.163   -20.769 1.00 21.07 ?  8    DA  T N9    1 
ATOM   2842 C  C8    . DA  B 2  8   ? -8.547  4.531   -21.976 1.00 20.53 ?  8    DA  T C8    1 
ATOM   2843 N  N7    . DA  B 2  8   ? -7.325  4.068   -22.185 1.00 19.67 ?  8    DA  T N7    1 
ATOM   2844 C  C5    . DA  B 2  8   ? -6.630  4.424   -21.040 1.00 19.67 ?  8    DA  T C5    1 
ATOM   2845 C  C6    . DA  B 2  8   ? -5.289  4.241   -20.645 1.00 18.51 ?  8    DA  T C6    1 
ATOM   2846 N  N6    . DA  B 2  8   ? -4.377  3.627   -21.393 1.00 18.29 ?  8    DA  T N6    1 
ATOM   2847 N  N1    . DA  B 2  8   ? -4.921  4.717   -19.444 1.00 17.52 ?  8    DA  T N1    1 
ATOM   2848 C  C2    . DA  B 2  8   ? -5.834  5.327   -18.687 1.00 20.70 ?  8    DA  T C2    1 
ATOM   2849 N  N3    . DA  B 2  8   ? -7.117  5.576   -18.952 1.00 20.76 ?  8    DA  T N3    1 
ATOM   2850 C  C4    . DA  B 2  8   ? -7.455  5.094   -20.155 1.00 20.86 ?  8    DA  T C4    1 
ATOM   2851 P  P     . DC  B 2  9   ? -12.629 8.881   -20.137 1.00 29.57 ?  9    DC  T P     1 
ATOM   2852 O  OP1   . DC  B 2  9   ? -13.749 9.446   -19.363 1.00 32.21 ?  9    DC  T OP1   1 
ATOM   2853 O  OP2   . DC  B 2  9   ? -12.573 9.101   -21.603 1.00 30.26 ?  9    DC  T OP2   1 
ATOM   2854 O  "O5'" . DC  B 2  9   ? -11.240 9.458   -19.610 1.00 24.45 ?  9    DC  T "O5'" 1 
ATOM   2855 C  "C5'" . DC  B 2  9   ? -10.840 9.249   -18.261 1.00 25.26 ?  9    DC  T "C5'" 1 
ATOM   2856 C  "C4'" . DC  B 2  9   ? -9.404  9.705   -18.078 1.00 25.61 ?  9    DC  T "C4'" 1 
ATOM   2857 O  "O4'" . DC  B 2  9   ? -8.531  8.810   -18.788 1.00 26.90 ?  9    DC  T "O4'" 1 
ATOM   2858 C  "C3'" . DC  B 2  9   ? -9.108  11.110  -18.623 1.00 28.95 ?  9    DC  T "C3'" 1 
ATOM   2859 O  "O3'" . DC  B 2  9   ? -8.775  11.963  -17.536 1.00 25.82 ?  9    DC  T "O3'" 1 
ATOM   2860 C  "C2'" . DC  B 2  9   ? -7.929  10.908  -19.600 1.00 29.03 ?  9    DC  T "C2'" 1 
ATOM   2861 C  "C1'" . DC  B 2  9   ? -7.406  9.529   -19.223 1.00 27.07 ?  9    DC  T "C1'" 1 
ATOM   2862 N  N1    . DC  B 2  9   ? -6.800  8.763   -20.353 1.00 27.73 ?  9    DC  T N1    1 
ATOM   2863 C  C2    . DC  B 2  9   ? -5.463  8.357   -20.279 1.00 30.45 ?  9    DC  T C2    1 
ATOM   2864 O  O2    . DC  B 2  9   ? -4.793  8.669   -19.289 1.00 35.16 ?  9    DC  T O2    1 
ATOM   2865 N  N3    . DC  B 2  9   ? -4.933  7.640   -21.300 1.00 26.64 ?  9    DC  T N3    1 
ATOM   2866 C  C4    . DC  B 2  9   ? -5.681  7.327   -22.358 1.00 25.44 ?  9    DC  T C4    1 
ATOM   2867 N  N4    . DC  B 2  9   ? -5.107  6.626   -23.342 1.00 23.27 ?  9    DC  T N4    1 
ATOM   2868 C  C5    . DC  B 2  9   ? -7.052  7.716   -22.450 1.00 26.34 ?  9    DC  T C5    1 
ATOM   2869 C  C6    . DC  B 2  9   ? -7.566  8.421   -21.432 1.00 28.12 ?  9    DC  T C6    1 
ATOM   2870 P  P     . DG  B 2  10  ? -8.742  13.547  -17.693 1.00 30.66 ?  10   DG  T P     1 
ATOM   2871 O  OP1   . DG  B 2  10  ? -8.872  14.153  -16.346 1.00 28.95 ?  10   DG  T OP1   1 
ATOM   2872 O  OP2   . DG  B 2  10  ? -9.720  13.998  -18.722 1.00 34.05 ?  10   DG  T OP2   1 
ATOM   2873 O  "O5'" . DG  B 2  10  ? -7.289  13.827  -18.264 1.00 40.91 ?  10   DG  T "O5'" 1 
ATOM   2874 C  "C5'" . DG  B 2  10  ? -6.171  13.793  -17.402 1.00 42.93 ?  10   DG  T "C5'" 1 
ATOM   2875 C  "C4'" . DG  B 2  10  ? -4.957  14.240  -18.165 1.00 47.03 ?  10   DG  T "C4'" 1 
ATOM   2876 O  "O4'" . DG  B 2  10  ? -4.489  13.121  -18.969 1.00 47.30 ?  10   DG  T "O4'" 1 
ATOM   2877 C  "C3'" . DG  B 2  10  ? -5.247  15.384  -19.150 1.00 51.27 ?  10   DG  T "C3'" 1 
ATOM   2878 O  "O3'" . DG  B 2  10  ? -4.252  16.385  -19.071 1.00 53.48 ?  10   DG  T "O3'" 1 
ATOM   2879 C  "C2'" . DG  B 2  10  ? -5.241  14.698  -20.508 1.00 50.55 ?  10   DG  T "C2'" 1 
ATOM   2880 C  "C1'" . DG  B 2  10  ? -4.239  13.585  -20.265 1.00 48.06 ?  10   DG  T "C1'" 1 
ATOM   2881 N  N9    . DG  B 2  10  ? -4.350  12.501  -21.235 1.00 43.61 ?  10   DG  T N9    1 
ATOM   2882 C  C8    . DG  B 2  10  ? -5.481  12.114  -21.912 1.00 42.48 ?  10   DG  T C8    1 
ATOM   2883 N  N7    . DG  B 2  10  ? -5.271  11.157  -22.766 1.00 38.99 ?  10   DG  T N7    1 
ATOM   2884 C  C5    . DG  B 2  10  ? -3.905  10.912  -22.661 1.00 36.23 ?  10   DG  T C5    1 
ATOM   2885 C  C6    . DG  B 2  10  ? -3.100  9.985   -23.346 1.00 28.24 ?  10   DG  T C6    1 
ATOM   2886 O  O6    . DG  B 2  10  ? -3.449  9.177   -24.198 1.00 28.48 ?  10   DG  T O6    1 
ATOM   2887 N  N1    . DG  B 2  10  ? -1.764  10.059  -22.953 1.00 27.47 ?  10   DG  T N1    1 
ATOM   2888 C  C2    . DG  B 2  10  ? -1.278  10.921  -22.013 1.00 30.52 ?  10   DG  T C2    1 
ATOM   2889 N  N2    . DG  B 2  10  ? 0.036   10.855  -21.773 1.00 29.59 ?  10   DG  T N2    1 
ATOM   2890 N  N3    . DG  B 2  10  ? -2.028  11.801  -21.356 1.00 35.99 ?  10   DG  T N3    1 
ATOM   2891 C  C4    . DG  B 2  10  ? -3.325  11.738  -21.735 1.00 38.59 ?  10   DG  T C4    1 
ATOM   2892 O  "O5'" . DC  C 3  1   ? 4.476   5.477   -27.379 1.00 26.29 ?  1    DC  P "O5'" 1 
ATOM   2893 C  "C5'" . DC  C 3  1   ? 5.573   6.381   -27.415 1.00 26.73 ?  1    DC  P "C5'" 1 
ATOM   2894 C  "C4'" . DC  C 3  1   ? 5.433   7.444   -26.333 1.00 27.95 ?  1    DC  P "C4'" 1 
ATOM   2895 O  "O4'" . DC  C 3  1   ? 4.294   8.288   -26.622 1.00 29.96 ?  1    DC  P "O4'" 1 
ATOM   2896 C  "C3'" . DC  C 3  1   ? 5.175   6.906   -24.935 1.00 26.55 ?  1    DC  P "C3'" 1 
ATOM   2897 O  "O3'" . DC  C 3  1   ? 6.404   6.664   -24.299 1.00 22.16 ?  1    DC  P "O3'" 1 
ATOM   2898 C  "C2'" . DC  C 3  1   ? 4.447   8.063   -24.257 1.00 27.62 ?  1    DC  P "C2'" 1 
ATOM   2899 C  "C1'" . DC  C 3  1   ? 3.687   8.702   -25.411 1.00 27.53 ?  1    DC  P "C1'" 1 
ATOM   2900 N  N1    . DC  C 3  1   ? 2.249   8.335   -25.440 1.00 25.99 ?  1    DC  P N1    1 
ATOM   2901 C  C2    . DC  C 3  1   ? 1.372   9.024   -24.605 1.00 25.04 ?  1    DC  P C2    1 
ATOM   2902 O  O2    . DC  C 3  1   ? 1.825   9.908   -23.876 1.00 25.64 ?  1    DC  P O2    1 
ATOM   2903 N  N3    . DC  C 3  1   ? 0.055   8.723   -24.638 1.00 23.93 ?  1    DC  P N3    1 
ATOM   2904 C  C4    . DC  C 3  1   ? -0.385  7.763   -25.447 1.00 24.54 ?  1    DC  P C4    1 
ATOM   2905 N  N4    . DC  C 3  1   ? -1.696  7.511   -25.452 1.00 23.97 ?  1    DC  P N4    1 
ATOM   2906 C  C5    . DC  C 3  1   ? 0.505   7.020   -26.296 1.00 24.19 ?  1    DC  P C5    1 
ATOM   2907 C  C6    . DC  C 3  1   ? 1.803   7.342   -26.262 1.00 24.48 ?  1    DC  P C6    1 
ATOM   2908 P  P     . DG  C 3  2   ? 6.518   5.555   -23.159 1.00 20.49 ?  2    DG  P P     1 
ATOM   2909 O  OP1   . DG  C 3  2   ? 7.962   5.594   -22.814 1.00 20.98 ?  2    DG  P OP1   1 
ATOM   2910 O  OP2   . DG  C 3  2   ? 5.775   4.329   -23.535 1.00 19.98 ?  2    DG  P OP2   1 
ATOM   2911 O  "O5'" . DG  C 3  2   ? 5.676   6.152   -21.921 1.00 22.03 ?  2    DG  P "O5'" 1 
ATOM   2912 C  "C5'" . DG  C 3  2   ? 6.097   7.359   -21.290 1.00 24.85 ?  2    DG  P "C5'" 1 
ATOM   2913 C  "C4'" . DG  C 3  2   ? 5.178   7.637   -20.132 1.00 27.71 ?  2    DG  P "C4'" 1 
ATOM   2914 O  "O4'" . DG  C 3  2   ? 3.883   7.988   -20.679 1.00 29.52 ?  2    DG  P "O4'" 1 
ATOM   2915 C  "C3'" . DG  C 3  2   ? 4.971   6.410   -19.248 1.00 26.81 ?  2    DG  P "C3'" 1 
ATOM   2916 O  "O3'" . DG  C 3  2   ? 5.359   6.664   -17.915 1.00 22.13 ?  2    DG  P "O3'" 1 
ATOM   2917 C  "C2'" . DG  C 3  2   ? 3.485   6.094   -19.341 1.00 29.28 ?  2    DG  P "C2'" 1 
ATOM   2918 C  "C1'" . DG  C 3  2   ? 2.868   7.325   -19.981 1.00 30.09 ?  2    DG  P "C1'" 1 
ATOM   2919 N  N9    . DG  C 3  2   ? 1.831   6.909   -20.914 1.00 29.28 ?  2    DG  P N9    1 
ATOM   2920 C  C8    . DG  C 3  2   ? 1.981   6.090   -22.012 1.00 27.57 ?  2    DG  P C8    1 
ATOM   2921 N  N7    . DG  C 3  2   ? 0.854   5.820   -22.606 1.00 26.18 ?  2    DG  P N7    1 
ATOM   2922 C  C5    . DG  C 3  2   ? -0.101  6.480   -21.838 1.00 23.56 ?  2    DG  P C5    1 
ATOM   2923 C  C6    . DG  C 3  2   ? -1.498  6.552   -21.998 1.00 22.66 ?  2    DG  P C6    1 
ATOM   2924 O  O6    . DG  C 3  2   ? -2.180  6.024   -22.873 1.00 22.53 ?  2    DG  P O6    1 
ATOM   2925 N  N1    . DG  C 3  2   ? -2.098  7.331   -21.004 1.00 22.18 ?  2    DG  P N1    1 
ATOM   2926 C  C2    . DG  C 3  2   ? -1.411  7.958   -19.982 1.00 23.68 ?  2    DG  P C2    1 
ATOM   2927 N  N2    . DG  C 3  2   ? -2.138  8.673   -19.110 1.00 23.95 ?  2    DG  P N2    1 
ATOM   2928 N  N3    . DG  C 3  2   ? -0.094  7.891   -19.832 1.00 22.48 ?  2    DG  P N3    1 
ATOM   2929 C  C4    . DG  C 3  2   ? 0.486   7.141   -20.790 1.00 25.75 ?  2    DG  P C4    1 
ATOM   2930 P  P     . DT  C 3  3   ? 5.164   5.522   -16.808 1.00 21.61 ?  3    DT  P P     1 
ATOM   2931 O  OP1   . DT  C 3  3   ? 6.140   5.851   -15.764 1.00 22.76 ?  3    DT  P OP1   1 
ATOM   2932 O  OP2   . DT  C 3  3   ? 5.195   4.185   -17.453 1.00 21.24 ?  3    DT  P OP2   1 
ATOM   2933 O  "O5'" . DT  C 3  3   ? 3.648   5.732   -16.305 1.00 20.28 ?  3    DT  P "O5'" 1 
ATOM   2934 C  "C5'" . DT  C 3  3   ? 3.315   6.900   -15.601 1.00 17.62 ?  3    DT  P "C5'" 1 
ATOM   2935 C  "C4'" . DT  C 3  3   ? 1.918   6.784   -15.049 1.00 17.24 ?  3    DT  P "C4'" 1 
ATOM   2936 O  "O4'" . DT  C 3  3   ? 0.968   6.918   -16.124 1.00 20.43 ?  3    DT  P "O4'" 1 
ATOM   2937 C  "C3'" . DT  C 3  3   ? 1.602   5.425   -14.464 1.00 16.25 ?  3    DT  P "C3'" 1 
ATOM   2938 O  "O3'" . DT  C 3  3   ? 2.108   5.365   -13.146 1.00 16.38 ?  3    DT  P "O3'" 1 
ATOM   2939 C  "C2'" . DT  C 3  3   ? 0.065   5.400   -14.515 1.00 16.47 ?  3    DT  P "C2'" 1 
ATOM   2940 C  "C1'" . DT  C 3  3   ? -0.220  6.220   -15.791 1.00 18.02 ?  3    DT  P "C1'" 1 
ATOM   2941 N  N1    . DT  C 3  3   ? -0.602  5.424   -16.974 1.00 18.95 ?  3    DT  P N1    1 
ATOM   2942 C  C2    . DT  C 3  3   ? -1.909  5.427   -17.377 1.00 18.60 ?  3    DT  P C2    1 
ATOM   2943 O  O2    . DT  C 3  3   ? -2.780  6.021   -16.777 1.00 21.41 ?  3    DT  P O2    1 
ATOM   2944 N  N3    . DT  C 3  3   ? -2.165  4.710   -18.510 1.00 17.55 ?  3    DT  P N3    1 
ATOM   2945 C  C4    . DT  C 3  3   ? -1.270  4.016   -19.277 1.00 17.09 ?  3    DT  P C4    1 
ATOM   2946 O  O4    . DT  C 3  3   ? -1.611  3.414   -20.292 1.00 17.25 ?  3    DT  P O4    1 
ATOM   2947 C  C5    . DT  C 3  3   ? 0.100   4.053   -18.806 1.00 20.19 ?  3    DT  P C5    1 
ATOM   2948 C  C7    . DT  C 3  3   ? 1.187   3.326   -19.551 1.00 19.55 ?  3    DT  P C7    1 
ATOM   2949 C  C6    . DT  C 3  3   ? 0.362   4.767   -17.692 1.00 18.82 ?  3    DT  P C6    1 
ATOM   2950 P  P     . DA  C 3  4   ? 2.261   3.934   -12.424 1.00 14.72 ?  4    DA  P P     1 
ATOM   2951 O  OP1   . DA  C 3  4   ? 3.018   4.190   -11.178 1.00 14.67 ?  4    DA  P OP1   1 
ATOM   2952 O  OP2   . DA  C 3  4   ? 2.838   3.000   -13.435 1.00 13.88 ?  4    DA  P OP2   1 
ATOM   2953 O  "O5'" . DA  C 3  4   ? 0.755   3.521   -12.128 1.00 13.69 ?  4    DA  P "O5'" 1 
ATOM   2954 C  "C5'" . DA  C 3  4   ? -0.002  4.219   -11.147 1.00 14.05 ?  4    DA  P "C5'" 1 
ATOM   2955 C  "C4'" . DA  C 3  4   ? -1.213  3.405   -10.746 1.00 13.71 ?  4    DA  P "C4'" 1 
ATOM   2956 O  "O4'" . DA  C 3  4   ? -2.132  3.357   -11.867 1.00 14.05 ?  4    DA  P "O4'" 1 
ATOM   2957 C  "C3'" . DA  C 3  4   ? -0.890  1.943   -10.397 1.00 12.44 ?  4    DA  P "C3'" 1 
ATOM   2958 O  "O3'" . DA  C 3  4   ? -0.770  1.786   -8.962  1.00 12.45 ?  4    DA  P "O3'" 1 
ATOM   2959 C  "C2'" . DA  C 3  4   ? -2.095  1.174   -10.926 1.00 11.96 ?  4    DA  P "C2'" 1 
ATOM   2960 C  "C1'" . DA  C 3  4   ? -2.548  2.025   -12.124 1.00 12.48 ?  4    DA  P "C1'" 1 
ATOM   2961 N  N9    . DA  C 3  4   ? -1.985  1.613   -13.407 1.00 12.35 ?  4    DA  P N9    1 
ATOM   2962 C  C8    . DA  C 3  4   ? -0.721  1.119   -13.644 1.00 12.84 ?  4    DA  P C8    1 
ATOM   2963 N  N7    . DA  C 3  4   ? -0.484  0.864   -14.912 1.00 14.13 ?  4    DA  P N7    1 
ATOM   2964 C  C5    . DA  C 3  4   ? -1.665  1.240   -15.555 1.00 14.84 ?  4    DA  P C5    1 
ATOM   2965 C  C6    . DA  C 3  4   ? -2.057  1.208   -16.913 1.00 17.11 ?  4    DA  P C6    1 
ATOM   2966 N  N6    . DA  C 3  4   ? -1.251  0.773   -17.903 1.00 16.53 ?  4    DA  P N6    1 
ATOM   2967 N  N1    . DA  C 3  4   ? -3.299  1.655   -17.223 1.00 19.76 ?  4    DA  P N1    1 
ATOM   2968 C  C2    . DA  C 3  4   ? -4.096  2.098   -16.231 1.00 17.10 ?  4    DA  P C2    1 
ATOM   2969 N  N3    . DA  C 3  4   ? -3.830  2.176   -14.917 1.00 16.50 ?  4    DA  P N3    1 
ATOM   2970 C  C4    . DA  C 3  4   ? -2.587  1.719   -14.646 1.00 14.41 ?  4    DA  P C4    1 
ATOM   2971 O  OP3   . DG  D 4  1   ? 13.885  -18.869 -26.816 1.00 27.29 ?  1    DG  D OP3   1 
ATOM   2972 P  P     . DG  D 4  1   ? 13.220  -17.639 -27.308 1.00 27.22 ?  1    DG  D P     1 
ATOM   2973 O  OP1   . DG  D 4  1   ? 14.200  -16.523 -27.174 1.00 26.52 ?  1    DG  D OP1   1 
ATOM   2974 O  OP2   . DG  D 4  1   ? 12.643  -17.897 -28.652 1.00 26.16 ?  1    DG  D OP2   1 
ATOM   2975 O  "O5'" . DG  D 4  1   ? 11.993  -17.358 -26.345 1.00 24.12 ?  1    DG  D "O5'" 1 
ATOM   2976 C  "C5'" . DG  D 4  1   ? 12.182  -17.236 -24.947 1.00 21.94 ?  1    DG  D "C5'" 1 
ATOM   2977 C  "C4'" . DG  D 4  1   ? 11.082  -17.963 -24.191 1.00 19.62 ?  1    DG  D "C4'" 1 
ATOM   2978 O  "O4'" . DG  D 4  1   ? 9.787   -17.335 -24.441 1.00 19.02 ?  1    DG  D "O4'" 1 
ATOM   2979 C  "C3'" . DG  D 4  1   ? 10.922  -19.421 -24.571 1.00 20.78 ?  1    DG  D "C3'" 1 
ATOM   2980 O  "O3'" . DG  D 4  1   ? 10.574  -20.166 -23.412 1.00 21.24 ?  1    DG  D "O3'" 1 
ATOM   2981 C  "C2'" . DG  D 4  1   ? 9.802   -19.399 -25.633 1.00 20.64 ?  1    DG  D "C2'" 1 
ATOM   2982 C  "C1'" . DG  D 4  1   ? 8.948   -18.209 -25.205 1.00 19.99 ?  1    DG  D "C1'" 1 
ATOM   2983 N  N9    . DG  D 4  1   ? 8.406   -17.410 -26.301 1.00 19.11 ?  1    DG  D N9    1 
ATOM   2984 C  C8    . DG  D 4  1   ? 9.056   -17.005 -27.456 1.00 20.91 ?  1    DG  D C8    1 
ATOM   2985 N  N7    . DG  D 4  1   ? 8.319   -16.232 -28.216 1.00 20.76 ?  1    DG  D N7    1 
ATOM   2986 C  C5    . DG  D 4  1   ? 7.115   -16.120 -27.518 1.00 19.86 ?  1    DG  D C5    1 
ATOM   2987 C  C6    . DG  D 4  1   ? 5.926   -15.400 -27.833 1.00 21.45 ?  1    DG  D C6    1 
ATOM   2988 O  O6    . DG  D 4  1   ? 5.684   -14.703 -28.832 1.00 20.74 ?  1    DG  D O6    1 
ATOM   2989 N  N1    . DG  D 4  1   ? 4.956   -15.557 -26.841 1.00 17.41 ?  1    DG  D N1    1 
ATOM   2990 C  C2    . DG  D 4  1   ? 5.118   -16.294 -25.697 1.00 17.14 ?  1    DG  D C2    1 
ATOM   2991 N  N2    . DG  D 4  1   ? 4.073   -16.332 -24.859 1.00 17.84 ?  1    DG  D N2    1 
ATOM   2992 N  N3    . DG  D 4  1   ? 6.222   -16.963 -25.390 1.00 17.62 ?  1    DG  D N3    1 
ATOM   2993 C  C4    . DG  D 4  1   ? 7.172   -16.824 -26.333 1.00 18.98 ?  1    DG  D C4    1 
ATOM   2994 P  P     . DC  D 4  2   ? 10.719  -21.762 -23.390 1.00 21.96 ?  2    DC  D P     1 
ATOM   2995 O  OP1   . DC  D 4  2   ? 11.068  -22.159 -22.002 1.00 24.10 ?  2    DC  D OP1   1 
ATOM   2996 O  OP2   . DC  D 4  2   ? 11.537  -22.191 -24.539 1.00 23.64 ?  2    DC  D OP2   1 
ATOM   2997 O  "O5'" . DC  D 4  2   ? 9.214   -22.238 -23.626 1.00 23.95 ?  2    DC  D "O5'" 1 
ATOM   2998 C  "C5'" . DC  D 4  2   ? 8.282   -21.934 -22.616 1.00 21.30 ?  2    DC  D "C5'" 1 
ATOM   2999 C  "C4'" . DC  D 4  2   ? 6.881   -21.780 -23.159 1.00 22.84 ?  2    DC  D "C4'" 1 
ATOM   3000 O  "O4'" . DC  D 4  2   ? 6.816   -20.857 -24.256 1.00 20.02 ?  2    DC  D "O4'" 1 
ATOM   3001 C  "C3'" . DC  D 4  2   ? 6.228   -23.057 -23.657 1.00 25.18 ?  2    DC  D "C3'" 1 
ATOM   3002 O  "O3'" . DC  D 4  2   ? 5.431   -23.553 -22.584 1.00 23.78 ?  2    DC  D "O3'" 1 
ATOM   3003 C  "C2'" . DC  D 4  2   ? 5.373   -22.583 -24.875 1.00 23.10 ?  2    DC  D "C2'" 1 
ATOM   3004 C  "C1'" . DC  D 4  2   ? 5.561   -21.063 -24.848 1.00 20.17 ?  2    DC  D "C1'" 1 
ATOM   3005 N  N1    . DC  D 4  2   ? 5.569   -20.386 -26.150 1.00 20.30 ?  2    DC  D N1    1 
ATOM   3006 C  C2    . DC  D 4  2   ? 4.475   -19.582 -26.512 1.00 19.67 ?  2    DC  D C2    1 
ATOM   3007 O  O2    . DC  D 4  2   ? 3.488   -19.519 -25.755 1.00 19.05 ?  2    DC  D O2    1 
ATOM   3008 N  N3    . DC  D 4  2   ? 4.506   -18.935 -27.698 1.00 19.93 ?  2    DC  D N3    1 
ATOM   3009 C  C4    . DC  D 4  2   ? 5.571   -19.026 -28.483 1.00 20.72 ?  2    DC  D C4    1 
ATOM   3010 N  N4    . DC  D 4  2   ? 5.549   -18.348 -29.636 1.00 21.07 ?  2    DC  D N4    1 
ATOM   3011 C  C5    . DC  D 4  2   ? 6.708   -19.828 -28.132 1.00 23.76 ?  2    DC  D C5    1 
ATOM   3012 C  C6    . DC  D 4  2   ? 6.669   -20.475 -26.960 1.00 22.50 ?  2    DC  D C6    1 
ATOM   3013 P  P     . DC  D 4  3   ? 4.619   -24.932 -22.692 1.00 26.69 ?  3    DC  D P     1 
ATOM   3014 O  OP1   . DC  D 4  3   ? 4.283   -25.333 -21.299 1.00 25.74 ?  3    DC  D OP1   1 
ATOM   3015 O  OP2   . DC  D 4  3   ? 5.329   -25.823 -23.642 1.00 27.69 ?  3    DC  D OP2   1 
ATOM   3016 O  "O5'" . DC  D 4  3   ? 3.283   -24.538 -23.452 1.00 24.45 ?  3    DC  D "O5'" 1 
ATOM   3017 C  "C5'" . DC  D 4  3   ? 2.415   -23.613 -22.882 1.00 25.11 ?  3    DC  D "C5'" 1 
ATOM   3018 C  "C4'" . DC  D 4  3   ? 1.192   -23.470 -23.752 1.00 27.74 ?  3    DC  D "C4'" 1 
ATOM   3019 O  "O4'" . DC  D 4  3   ? 1.515   -22.649 -24.890 1.00 26.88 ?  3    DC  D "O4'" 1 
ATOM   3020 C  "C3'" . DC  D 4  3   ? 0.641   -24.783 -24.305 1.00 31.53 ?  3    DC  D "C3'" 1 
ATOM   3021 O  "O3'" . DC  D 4  3   ? -0.719  -24.894 -23.913 1.00 33.72 ?  3    DC  D "O3'" 1 
ATOM   3022 C  "C2'" . DC  D 4  3   ? 0.803   -24.654 -25.836 1.00 31.88 ?  3    DC  D "C2'" 1 
ATOM   3023 C  "C1'" . DC  D 4  3   ? 0.844   -23.143 -26.024 1.00 28.34 ?  3    DC  D "C1'" 1 
ATOM   3024 N  N1    . DC  D 4  3   ? 1.619   -22.659 -27.213 1.00 22.62 ?  3    DC  D N1    1 
ATOM   3025 C  C2    . DC  D 4  3   ? 1.039   -21.728 -28.078 1.00 22.31 ?  3    DC  D C2    1 
ATOM   3026 O  O2    . DC  D 4  3   ? -0.139  -21.371 -27.879 1.00 21.94 ?  3    DC  D O2    1 
ATOM   3027 N  N3    . DC  D 4  3   ? 1.762   -21.258 -29.120 1.00 22.59 ?  3    DC  D N3    1 
ATOM   3028 C  C4    . DC  D 4  3   ? 3.025   -21.660 -29.296 1.00 23.10 ?  3    DC  D C4    1 
ATOM   3029 N  N4    . DC  D 4  3   ? 3.705   -21.161 -30.343 1.00 23.49 ?  3    DC  D N4    1 
ATOM   3030 C  C5    . DC  D 4  3   ? 3.639   -22.611 -28.421 1.00 23.43 ?  3    DC  D C5    1 
ATOM   3031 C  C6    . DC  D 4  3   ? 2.914   -23.066 -27.394 1.00 23.47 ?  3    DC  D C6    1 
ATOM   3032 P  P     . DG  D 4  4   ? -1.495  -26.299 -23.994 1.00 41.76 ?  4    DG  D P     1 
ATOM   3033 O  OP1   . DG  D 4  4   ? -2.513  -26.276 -22.917 1.00 42.97 ?  4    DG  D OP1   1 
ATOM   3034 O  OP2   . DG  D 4  4   ? -0.531  -27.406 -24.135 1.00 38.92 ?  4    DG  D OP2   1 
ATOM   3035 O  "O5'" . DG  D 4  4   ? -2.304  -26.180 -25.355 1.00 34.00 ?  4    DG  D "O5'" 1 
ATOM   3036 C  "C5'" . DG  D 4  4   ? -3.246  -25.148 -25.505 1.00 30.42 ?  4    DG  D "C5'" 1 
ATOM   3037 C  "C4'" . DG  D 4  4   ? -3.831  -25.199 -26.894 1.00 33.48 ?  4    DG  D "C4'" 1 
ATOM   3038 O  "O4'" . DG  D 4  4   ? -2.912  -24.558 -27.819 1.00 30.97 ?  4    DG  D "O4'" 1 
ATOM   3039 C  "C3'" . DG  D 4  4   ? -4.041  -26.620 -27.421 1.00 38.27 ?  4    DG  D "C3'" 1 
ATOM   3040 O  "O3'" . DG  D 4  4   ? -5.270  -26.700 -28.129 1.00 42.68 ?  4    DG  D "O3'" 1 
ATOM   3041 C  "C2'" . DG  D 4  4   ? -2.840  -26.840 -28.342 1.00 36.40 ?  4    DG  D "C2'" 1 
ATOM   3042 C  "C1'" . DG  D 4  4   ? -2.640  -25.439 -28.888 1.00 33.63 ?  4    DG  D "C1'" 1 
ATOM   3043 N  N9    . DG  D 4  4   ? -1.294  -25.174 -29.401 1.00 30.12 ?  4    DG  D N9    1 
ATOM   3044 C  C8    . DG  D 4  4   ? -0.114  -25.778 -29.028 1.00 30.40 ?  4    DG  D C8    1 
ATOM   3045 N  N7    . DG  D 4  4   ? 0.924   -25.339 -29.694 1.00 27.25 ?  4    DG  D N7    1 
ATOM   3046 C  C5    . DG  D 4  4   ? 0.391   -24.386 -30.557 1.00 26.87 ?  4    DG  D C5    1 
ATOM   3047 C  C6    . DG  D 4  4   ? 1.027   -23.566 -31.525 1.00 26.72 ?  4    DG  D C6    1 
ATOM   3048 O  O6    . DG  D 4  4   ? 2.232   -23.514 -31.812 1.00 26.85 ?  4    DG  D O6    1 
ATOM   3049 N  N1    . DG  D 4  4   ? 0.112   -22.750 -32.196 1.00 26.56 ?  4    DG  D N1    1 
ATOM   3050 C  C2    . DG  D 4  4   ? -1.246  -22.731 -31.956 1.00 28.28 ?  4    DG  D C2    1 
ATOM   3051 N  N2    . DG  D 4  4   ? -1.976  -21.874 -32.687 1.00 26.53 ?  4    DG  D N2    1 
ATOM   3052 N  N3    . DG  D 4  4   ? -1.846  -23.483 -31.046 1.00 26.67 ?  4    DG  D N3    1 
ATOM   3053 C  C4    . DG  D 4  4   ? -0.970  -24.283 -30.388 1.00 28.68 ?  4    DG  D C4    1 
HETATM 3054 MG MG    . MG  E 5  .   ? 0.919   2.373   -7.648  1.00 11.22 2  601  MG  A MG    1 
HETATM 3055 MG MG    . MG  F 5  .   ? 2.220   -0.126  -5.463  1.00 9.47  2  602  MG  A MG    1 
HETATM 3056 C  C1    . EDO G 6  .   ? 9.646   -28.777 -6.448  1.00 28.59 ?  603  EDO A C1    1 
HETATM 3057 O  O1    . EDO G 6  .   ? 8.576   -29.048 -5.528  1.00 26.40 ?  603  EDO A O1    1 
HETATM 3058 C  C2    . EDO G 6  .   ? 10.492  -30.036 -6.668  1.00 33.10 ?  603  EDO A C2    1 
HETATM 3059 O  O2    . EDO G 6  .   ? 9.631   -31.029 -7.245  1.00 37.84 ?  603  EDO A O2    1 
HETATM 3060 C  C1    . GOL H 7  .   ? -16.882 -5.344  -21.638 1.00 63.25 ?  604  GOL A C1    1 
HETATM 3061 O  O1    . GOL H 7  .   ? -15.793 -5.129  -20.772 1.00 62.38 ?  604  GOL A O1    1 
HETATM 3062 C  C2    . GOL H 7  .   ? -17.756 -4.100  -21.683 1.00 63.62 ?  604  GOL A C2    1 
HETATM 3063 O  O2    . GOL H 7  .   ? -16.930 -2.958  -21.668 1.00 64.26 ?  604  GOL A O2    1 
HETATM 3064 C  C3    . GOL H 7  .   ? -18.578 -4.125  -22.965 1.00 63.24 ?  604  GOL A C3    1 
HETATM 3065 O  O3    . GOL H 7  .   ? -19.403 -2.986  -23.004 1.00 64.16 ?  604  GOL A O3    1 
HETATM 3066 C  C1    . GOL I 7  .   ? 3.428   23.249  6.859   1.00 62.96 ?  605  GOL A C1    1 
HETATM 3067 O  O1    . GOL I 7  .   ? 2.960   23.877  5.685   1.00 61.20 ?  605  GOL A O1    1 
HETATM 3068 C  C2    . GOL I 7  .   ? 2.250   22.808  7.725   1.00 64.85 ?  605  GOL A C2    1 
HETATM 3069 O  O2    . GOL I 7  .   ? 1.088   23.543  7.395   1.00 64.37 ?  605  GOL A O2    1 
HETATM 3070 C  C3    . GOL I 7  .   ? 2.597   23.036  9.191   1.00 66.66 ?  605  GOL A C3    1 
HETATM 3071 O  O3    . GOL I 7  .   ? 3.108   21.846  9.749   1.00 67.62 ?  605  GOL A O3    1 
HETATM 3072 C  C1    . EDO J 6  .   ? -5.579  -2.139  -11.959 1.00 28.80 ?  606  EDO A C1    1 
HETATM 3073 O  O1    . EDO J 6  .   ? -5.606  -3.255  -12.859 1.00 27.95 ?  606  EDO A O1    1 
HETATM 3074 C  C2    . EDO J 6  .   ? -4.674  -1.065  -12.541 1.00 30.18 ?  606  EDO A C2    1 
HETATM 3075 O  O2    . EDO J 6  .   ? -4.993  -0.898  -13.926 1.00 33.76 ?  606  EDO A O2    1 
HETATM 3076 O  O4    . DUP K 8  .   ? 0.499   -2.906  -15.599 1.00 17.72 ?  607  DUP A O4    1 
HETATM 3077 C  C4    . DUP K 8  .   ? -0.108  -2.969  -14.531 1.00 16.59 ?  607  DUP A C4    1 
HETATM 3078 C  C5    . DUP K 8  .   ? 0.316   -2.233  -13.386 1.00 12.69 ?  607  DUP A C5    1 
HETATM 3079 C  C6    . DUP K 8  .   ? -0.378  -2.383  -12.231 1.00 12.74 ?  607  DUP A C6    1 
HETATM 3080 N  N3    . DUP K 8  .   ? -1.191  -3.769  -14.419 1.00 14.19 ?  607  DUP A N3    1 
HETATM 3081 C  C2    . DUP K 8  .   ? -1.869  -3.890  -13.253 1.00 15.19 ?  607  DUP A C2    1 
HETATM 3082 O  O2    . DUP K 8  .   ? -2.843  -4.618  -13.150 1.00 15.47 ?  607  DUP A O2    1 
HETATM 3083 N  N1    . DUP K 8  .   ? -1.491  -3.208  -12.169 1.00 12.40 ?  607  DUP A N1    1 
HETATM 3084 C  "C1'" . DUP K 8  .   ? -2.260  -3.384  -10.922 1.00 10.36 ?  607  DUP A "C1'" 1 
HETATM 3085 C  "C2'" . DUP K 8  .   ? -1.659  -4.548  -10.101 1.00 9.30  ?  607  DUP A "C2'" 1 
HETATM 3086 C  "C3'" . DUP K 8  .   ? -0.641  -3.830  -9.174  1.00 10.79 ?  607  DUP A "C3'" 1 
HETATM 3087 O  "O3'" . DUP K 8  .   ? -0.431  -4.620  -8.007  1.00 11.44 ?  607  DUP A "O3'" 1 
HETATM 3088 O  "O4'" . DUP K 8  .   ? -2.077  -2.219  -10.098 1.00 9.17  ?  607  DUP A "O4'" 1 
HETATM 3089 C  "C4'" . DUP K 8  .   ? -1.482  -2.590  -8.817  1.00 9.53  ?  607  DUP A "C4'" 1 
HETATM 3090 C  "C5'" . DUP K 8  .   ? -0.619  -1.453  -8.230  1.00 9.82  ?  607  DUP A "C5'" 1 
HETATM 3091 O  "O5'" . DUP K 8  .   ? 0.334   -1.017  -9.211  1.00 10.22 ?  607  DUP A "O5'" 1 
HETATM 3092 P  PA    . DUP K 8  .   ? 1.804   -0.753  -8.635  1.00 9.70  ?  607  DUP A PA    1 
HETATM 3093 O  O1A   . DUP K 8  .   ? 1.682   0.202   -7.493  1.00 10.53 ?  607  DUP A O1A   1 
HETATM 3094 O  O2A   . DUP K 8  .   ? 2.624   -0.186  -9.870  1.00 11.02 ?  607  DUP A O2A   1 
HETATM 3095 N  N3A   . DUP K 8  .   ? 2.492   -2.231  -8.211  1.00 7.79  ?  607  DUP A N3A   1 
HETATM 3096 P  PB    . DUP K 8  .   ? 2.488   -2.922  -6.680  1.00 10.30 ?  607  DUP A PB    1 
HETATM 3097 O  O1B   . DUP K 8  .   ? 1.973   -4.305  -6.826  1.00 10.15 ?  607  DUP A O1B   1 
HETATM 3098 O  O2B   . DUP K 8  .   ? 1.743   -2.097  -5.603  1.00 8.64  ?  607  DUP A O2B   1 
HETATM 3099 O  O3B   . DUP K 8  .   ? 4.028   -3.058  -6.271  1.00 8.61  ?  607  DUP A O3B   1 
HETATM 3100 P  PG    . DUP K 8  .   ? 5.032   -1.806  -6.075  1.00 12.19 ?  607  DUP A PG    1 
HETATM 3101 O  O2G   . DUP K 8  .   ? 5.819   -2.109  -4.746  1.00 13.19 ?  607  DUP A O2G   1 
HETATM 3102 O  O1G   . DUP K 8  .   ? 5.930   -1.829  -7.273  1.00 13.16 ?  607  DUP A O1G   1 
HETATM 3103 O  O3G   . DUP K 8  .   ? 4.134   -0.528  -5.994  1.00 10.72 ?  607  DUP A O3G   1 
HETATM 3104 CL CL    . CL  L 9  .   ? 8.168   -11.575 -28.108 1.00 30.79 -1 608  CL  A CL    1 
HETATM 3105 CL CL    . CL  M 9  .   ? -13.973 -7.157  -1.238  1.00 26.44 -1 609  CL  A CL    1 
HETATM 3106 CL CL    . CL  N 9  .   ? 8.647   -7.581  0.208   0.73 20.01 -1 610  CL  A CL    1 
HETATM 3107 CL CL    . CL  O 9  .   ? -8.446  2.356   -12.059 1.00 22.01 -1 611  CL  A CL    1 
HETATM 3108 NA NA    . NA  P 10 .   ? 8.998   4.332   -15.374 1.00 29.73 1  612  NA  A NA    1 
HETATM 3109 MG MG    . MG  Q 5  .   ? 5.066   -16.156 -33.673 1.00 32.62 2  101  MG  T MG    1 
HETATM 3110 O  O     . HOH R 11 .   ? -21.903 13.789  0.278   1.00 32.55 ?  701  HOH A O     1 
HETATM 3111 O  O     . HOH R 11 .   ? 8.090   -3.560  -5.186  1.00 34.75 ?  702  HOH A O     1 
HETATM 3112 O  O     . HOH R 11 .   ? 3.700   10.509  -18.055 1.00 42.11 ?  703  HOH A O     1 
HETATM 3113 O  O     . HOH R 11 .   ? 4.606   20.864  11.070  1.00 62.41 ?  704  HOH A O     1 
HETATM 3114 O  O     . HOH R 11 .   ? -7.183  22.762  3.334   1.00 42.03 ?  705  HOH A O     1 
HETATM 3115 O  O     . HOH R 11 .   ? -15.535 -5.992  -18.607 1.00 19.09 ?  706  HOH A O     1 
HETATM 3116 O  O     . HOH R 11 .   ? 12.898  -10.772 -9.577  1.00 34.87 ?  707  HOH A O     1 
HETATM 3117 O  O     . HOH R 11 .   ? -13.718 -5.819  -21.634 1.00 43.50 ?  708  HOH A O     1 
HETATM 3118 O  O     . HOH R 11 .   ? -5.547  -15.349 4.750   1.00 37.72 ?  709  HOH A O     1 
HETATM 3119 O  O     . HOH R 11 .   ? 12.955  -1.800  -7.789  1.00 43.51 ?  710  HOH A O     1 
HETATM 3120 O  O     . HOH R 11 .   ? 8.348   -4.000  -24.436 1.00 21.70 ?  711  HOH A O     1 
HETATM 3121 O  O     . HOH R 11 .   ? 4.132   -10.337 4.793   1.00 40.87 ?  712  HOH A O     1 
HETATM 3122 O  O     . HOH R 11 .   ? 18.641  -14.766 -4.694  1.00 44.89 ?  713  HOH A O     1 
HETATM 3123 O  O     . HOH R 11 .   ? 27.217  1.946   -25.882 1.00 46.37 ?  714  HOH A O     1 
HETATM 3124 O  O     . HOH R 11 .   ? -0.802  -9.671  4.740   1.00 41.54 ?  715  HOH A O     1 
HETATM 3125 O  O     . HOH R 11 .   ? 12.077  16.115  12.757  1.00 44.01 ?  716  HOH A O     1 
HETATM 3126 O  O     . HOH R 11 .   ? 4.590   24.523  3.932   1.00 29.27 ?  717  HOH A O     1 
HETATM 3127 O  O     . HOH R 11 .   ? -3.850  14.974  5.982   1.00 29.03 ?  718  HOH A O     1 
HETATM 3128 O  O     . HOH R 11 .   ? -11.117 -10.393 -0.166  1.00 24.46 ?  719  HOH A O     1 
HETATM 3129 O  O     . HOH R 11 .   ? 16.814  -9.283  -9.421  1.00 39.88 ?  720  HOH A O     1 
HETATM 3130 O  O     . HOH R 11 .   ? -13.810 9.422   6.028   1.00 37.51 ?  721  HOH A O     1 
HETATM 3131 O  O     . HOH R 11 .   ? 17.914  -25.909 -5.850  1.00 48.29 ?  722  HOH A O     1 
HETATM 3132 O  O     . HOH R 11 .   ? -23.999 -14.067 -16.972 1.00 40.89 ?  723  HOH A O     1 
HETATM 3133 O  O     . HOH R 11 .   ? 16.202  4.406   -12.220 1.00 31.15 ?  724  HOH A O     1 
HETATM 3134 O  O     . HOH R 11 .   ? 7.205   -18.224 3.504   1.00 48.43 ?  725  HOH A O     1 
HETATM 3135 O  O     . HOH R 11 .   ? 6.038   -27.404 -20.017 1.00 44.04 ?  726  HOH A O     1 
HETATM 3136 O  O     . HOH R 11 .   ? -16.094 17.587  4.265   1.00 26.79 ?  727  HOH A O     1 
HETATM 3137 O  O     . HOH R 11 .   ? -19.934 4.883   -3.486  1.00 17.54 ?  728  HOH A O     1 
HETATM 3138 O  O     . HOH R 11 .   ? -5.663  16.791  6.217   1.00 47.50 ?  729  HOH A O     1 
HETATM 3139 O  O     . HOH R 11 .   ? -6.762  7.787   10.512  1.00 45.82 ?  730  HOH A O     1 
HETATM 3140 O  O     . HOH R 11 .   ? 2.162   -18.868 -9.683  1.00 17.29 ?  731  HOH A O     1 
HETATM 3141 O  O     . HOH R 11 .   ? 9.443   -12.184 -1.920  1.00 30.24 ?  732  HOH A O     1 
HETATM 3142 O  O     . HOH R 11 .   ? 17.459  -6.011  -22.979 1.00 33.29 ?  733  HOH A O     1 
HETATM 3143 O  O     . HOH R 11 .   ? -18.434 4.975   6.008   1.00 23.23 ?  734  HOH A O     1 
HETATM 3144 O  O     . HOH R 11 .   ? -11.344 18.679  -11.399 1.00 43.24 ?  735  HOH A O     1 
HETATM 3145 O  O     . HOH R 11 .   ? 17.352  -34.615 -13.578 1.00 38.06 ?  736  HOH A O     1 
HETATM 3146 O  O     . HOH R 11 .   ? 8.749   -2.804  6.270   1.00 22.41 ?  737  HOH A O     1 
HETATM 3147 O  O     . HOH R 11 .   ? -21.189 6.896   -8.671  1.00 27.19 ?  738  HOH A O     1 
HETATM 3148 O  O     . HOH R 11 .   ? -11.637 -2.085  2.904   1.00 24.20 ?  739  HOH A O     1 
HETATM 3149 O  O     . HOH R 11 .   ? -4.407  23.976  -1.831  1.00 49.66 ?  740  HOH A O     1 
HETATM 3150 O  O     . HOH R 11 .   ? -17.713 8.296   -9.124  1.00 44.81 ?  741  HOH A O     1 
HETATM 3151 O  O     . HOH R 11 .   ? 4.127   -6.452  -20.110 1.00 34.16 ?  742  HOH A O     1 
HETATM 3152 O  O     . HOH R 11 .   ? 27.261  -8.352  -21.411 1.00 27.99 ?  743  HOH A O     1 
HETATM 3153 O  O     . HOH R 11 .   ? 11.354  6.092   -9.779  1.00 36.47 ?  744  HOH A O     1 
HETATM 3154 O  O     . HOH R 11 .   ? 1.080   -20.720 -0.549  1.00 19.94 ?  745  HOH A O     1 
HETATM 3155 O  O     . HOH R 11 .   ? -23.176 -13.507 -3.749  1.00 29.55 ?  746  HOH A O     1 
HETATM 3156 O  O     . HOH R 11 .   ? -9.693  8.103   -14.842 1.00 21.08 ?  747  HOH A O     1 
HETATM 3157 O  O     . HOH R 11 .   ? 11.319  5.474   6.494   1.00 30.55 ?  748  HOH A O     1 
HETATM 3158 O  O     . HOH R 11 .   ? 4.223   -2.689  -2.743  1.00 13.71 ?  749  HOH A O     1 
HETATM 3159 O  O     . HOH R 11 .   ? -9.635  -20.338 -0.388  1.00 45.84 ?  750  HOH A O     1 
HETATM 3160 O  O     . HOH R 11 .   ? -13.226 -14.865 3.682   1.00 23.36 ?  751  HOH A O     1 
HETATM 3161 O  O     . HOH R 11 .   ? 24.255  3.957   -17.546 1.00 46.52 ?  752  HOH A O     1 
HETATM 3162 O  O     . HOH R 11 .   ? 20.947  -0.023  -13.915 1.00 28.59 ?  753  HOH A O     1 
HETATM 3163 O  O     . HOH R 11 .   ? -14.466 -11.675 2.121   1.00 14.14 ?  754  HOH A O     1 
HETATM 3164 O  O     . HOH R 11 .   ? 0.970   -19.119 -15.780 1.00 23.24 ?  755  HOH A O     1 
HETATM 3165 O  O     . HOH R 11 .   ? -4.020  -8.071  3.259   1.00 35.28 ?  756  HOH A O     1 
HETATM 3166 O  O     . HOH R 11 .   ? 16.911  -0.166  -29.980 1.00 42.76 ?  757  HOH A O     1 
HETATM 3167 O  O     . HOH R 11 .   ? 1.038   -23.178 -5.054  1.00 17.75 ?  758  HOH A O     1 
HETATM 3168 O  O     . HOH R 11 .   ? -10.166 3.595   -14.048 1.00 22.66 ?  759  HOH A O     1 
HETATM 3169 O  O     . HOH R 11 .   ? 5.558   -26.269 0.994   1.00 21.72 ?  760  HOH A O     1 
HETATM 3170 O  O     . HOH R 11 .   ? 3.937   -8.935  -22.104 1.00 32.82 ?  761  HOH A O     1 
HETATM 3171 O  O     . HOH R 11 .   ? 16.849  19.402  10.180  1.00 27.13 ?  762  HOH A O     1 
HETATM 3172 O  O     . HOH R 11 .   ? 15.556  12.180  3.807   1.00 37.24 ?  763  HOH A O     1 
HETATM 3173 O  O     . HOH R 11 .   ? 19.569  -15.700 -9.351  1.00 24.12 ?  764  HOH A O     1 
HETATM 3174 O  O     . HOH R 11 .   ? -21.395 -8.974  -26.572 1.00 44.65 ?  765  HOH A O     1 
HETATM 3175 O  O     . HOH R 11 .   ? -6.054  -3.384  2.934   1.00 15.79 ?  766  HOH A O     1 
HETATM 3176 O  O     . HOH R 11 .   ? -22.886 0.603   1.022   1.00 33.50 ?  767  HOH A O     1 
HETATM 3177 O  O     . HOH R 11 .   ? 14.105  2.095   2.665   1.00 26.36 ?  768  HOH A O     1 
HETATM 3178 O  O     . HOH R 11 .   ? 10.692  13.491  -22.774 1.00 31.63 ?  769  HOH A O     1 
HETATM 3179 O  O     . HOH R 11 .   ? 2.154   2.385   -9.353  1.00 10.80 ?  770  HOH A O     1 
HETATM 3180 O  O     . HOH R 11 .   ? -5.848  -11.758 3.882   1.00 33.06 ?  771  HOH A O     1 
HETATM 3181 O  O     . HOH R 11 .   ? -1.237  -16.831 -7.483  1.00 12.88 ?  772  HOH A O     1 
HETATM 3182 O  O     . HOH R 11 .   ? 2.315   0.261   -12.486 1.00 14.88 ?  773  HOH A O     1 
HETATM 3183 O  O     . HOH R 11 .   ? 2.311   15.696  -15.355 1.00 24.63 ?  774  HOH A O     1 
HETATM 3184 O  O     . HOH R 11 .   ? -21.646 -4.761  -7.964  1.00 28.57 ?  775  HOH A O     1 
HETATM 3185 O  O     . HOH R 11 .   ? 8.453   10.303  -23.228 1.00 26.49 ?  776  HOH A O     1 
HETATM 3186 O  O     . HOH R 11 .   ? -8.964  -7.422  -12.542 1.00 12.96 ?  777  HOH A O     1 
HETATM 3187 O  O     . HOH R 11 .   ? 15.890  8.548   0.212   1.00 40.13 ?  778  HOH A O     1 
HETATM 3188 O  O     . HOH R 11 .   ? -23.460 -10.296 -4.744  1.00 40.77 ?  779  HOH A O     1 
HETATM 3189 O  O     . HOH R 11 .   ? -19.413 -6.068  -13.411 1.00 15.58 ?  780  HOH A O     1 
HETATM 3190 O  O     . HOH R 11 .   ? -10.633 2.972   -17.717 1.00 28.37 ?  781  HOH A O     1 
HETATM 3191 O  O     . HOH R 11 .   ? 11.096  2.791   -3.849  1.00 19.43 ?  782  HOH A O     1 
HETATM 3192 O  O     . HOH R 11 .   ? 4.587   4.903   11.024  1.00 31.40 ?  783  HOH A O     1 
HETATM 3193 O  O     . HOH R 11 .   ? 5.802   5.185   -9.994  1.00 20.98 ?  784  HOH A O     1 
HETATM 3194 O  O     . HOH R 11 .   ? 13.162  -1.397  -27.155 1.00 31.17 ?  785  HOH A O     1 
HETATM 3195 O  O     . HOH R 11 .   ? -5.523  -2.682  -15.872 1.00 28.31 ?  786  HOH A O     1 
HETATM 3196 O  O     . HOH R 11 .   ? -9.168  -12.233 2.267   1.00 32.52 ?  787  HOH A O     1 
HETATM 3197 O  O     . HOH R 11 .   ? 14.337  -8.134  -12.611 1.00 32.88 ?  788  HOH A O     1 
HETATM 3198 O  O     . HOH R 11 .   ? 16.318  -14.670 -23.045 1.00 22.43 ?  789  HOH A O     1 
HETATM 3199 O  O     . HOH R 11 .   ? -15.822 1.626   -22.115 1.00 43.31 ?  790  HOH A O     1 
HETATM 3200 O  O     . HOH R 11 .   ? 8.187   6.039   -3.638  1.00 12.20 ?  791  HOH A O     1 
HETATM 3201 O  O     . HOH R 11 .   ? -5.717  -8.955  -6.502  1.00 9.06  ?  792  HOH A O     1 
HETATM 3202 O  O     . HOH R 11 .   ? -15.000 -17.935 -1.086  1.00 15.77 ?  793  HOH A O     1 
HETATM 3203 O  O     . HOH R 11 .   ? -14.493 7.577   -9.396  1.00 23.86 ?  794  HOH A O     1 
HETATM 3204 O  O     . HOH R 11 .   ? 4.675   -9.643  -5.036  1.00 14.38 ?  795  HOH A O     1 
HETATM 3205 O  O     . HOH R 11 .   ? 7.435   18.445  -12.549 1.00 31.28 ?  796  HOH A O     1 
HETATM 3206 O  O     . HOH R 11 .   ? 5.990   -4.108  -8.724  1.00 29.24 ?  797  HOH A O     1 
HETATM 3207 O  O     . HOH R 11 .   ? 15.795  -23.982 -6.127  1.00 22.64 ?  798  HOH A O     1 
HETATM 3208 O  O     . HOH R 11 .   ? -14.690 -17.022 -3.729  1.00 15.09 ?  799  HOH A O     1 
HETATM 3209 O  O     . HOH R 11 .   ? 16.803  -27.073 -22.394 1.00 34.05 ?  800  HOH A O     1 
HETATM 3210 O  O     . HOH R 11 .   ? 5.277   -21.942 -2.895  1.00 14.51 ?  801  HOH A O     1 
HETATM 3211 O  O     . HOH R 11 .   ? -21.175 -2.008  -12.990 1.00 36.94 ?  802  HOH A O     1 
HETATM 3212 O  O     . HOH R 11 .   ? -24.250 0.737   -4.438  1.00 32.97 ?  803  HOH A O     1 
HETATM 3213 O  O     . HOH R 11 .   ? -20.018 -3.667  -3.974  1.00 18.18 ?  804  HOH A O     1 
HETATM 3214 O  O     . HOH R 11 .   ? -17.461 -18.803 -14.878 1.00 28.75 ?  805  HOH A O     1 
HETATM 3215 O  O     . HOH R 11 .   ? 8.228   6.640   8.230   1.00 35.71 ?  806  HOH A O     1 
HETATM 3216 O  O     . HOH R 11 .   ? 13.706  5.271   4.348   1.00 27.17 ?  807  HOH A O     1 
HETATM 3217 O  O     . HOH R 11 .   ? 6.007   -19.976 1.378   1.00 24.94 ?  808  HOH A O     1 
HETATM 3218 O  O     . HOH R 11 .   ? -14.679 10.078  -7.612  1.00 23.46 ?  809  HOH A O     1 
HETATM 3219 O  O     . HOH R 11 .   ? 10.889  5.324   0.392   1.00 16.33 ?  810  HOH A O     1 
HETATM 3220 O  O     . HOH R 11 .   ? -25.133 2.871   -1.692  1.00 38.64 ?  811  HOH A O     1 
HETATM 3221 O  O     . HOH R 11 .   ? -16.077 -3.871  -16.907 1.00 21.83 ?  812  HOH A O     1 
HETATM 3222 O  O     . HOH R 11 .   ? -13.464 -23.562 -12.935 1.00 46.43 ?  813  HOH A O     1 
HETATM 3223 O  O     . HOH R 11 .   ? 5.237   -0.987  -9.810  1.00 25.76 ?  814  HOH A O     1 
HETATM 3224 O  O     . HOH R 11 .   ? 11.947  3.598   -28.899 1.00 34.91 ?  815  HOH A O     1 
HETATM 3225 O  O     . HOH R 11 .   ? 11.674  -29.136 -18.737 1.00 38.39 ?  816  HOH A O     1 
HETATM 3226 O  O     . HOH R 11 .   ? -18.334 -20.903 -8.381  1.00 26.49 ?  817  HOH A O     1 
HETATM 3227 O  O     . HOH R 11 .   ? 13.314  13.890  -3.285  1.00 18.16 ?  818  HOH A O     1 
HETATM 3228 O  O     . HOH R 11 .   ? 11.413  -16.029 -1.504  1.00 13.53 ?  819  HOH A O     1 
HETATM 3229 O  O     . HOH R 11 .   ? 19.528  8.708   -7.865  1.00 28.32 ?  820  HOH A O     1 
HETATM 3230 O  O     . HOH R 11 .   ? 6.153   -14.314 -4.801  1.00 16.22 ?  821  HOH A O     1 
HETATM 3231 O  O     . HOH R 11 .   ? -22.900 11.728  -7.788  1.00 39.34 ?  822  HOH A O     1 
HETATM 3232 O  O     . HOH R 11 .   ? 8.787   -22.339 -4.338  1.00 12.77 ?  823  HOH A O     1 
HETATM 3233 O  O     . HOH R 11 .   ? -21.957 -16.222 -11.130 1.00 38.15 ?  824  HOH A O     1 
HETATM 3234 O  O     . HOH R 11 .   ? 19.912  -12.786 -23.672 1.00 30.56 ?  825  HOH A O     1 
HETATM 3235 O  O     . HOH R 11 .   ? 27.036  9.807   -21.597 1.00 47.47 ?  826  HOH A O     1 
HETATM 3236 O  O     . HOH R 11 .   ? 10.232  6.837   -1.780  1.00 13.03 ?  827  HOH A O     1 
HETATM 3237 O  O     . HOH R 11 .   ? 6.006   11.309  -19.148 1.00 21.17 ?  828  HOH A O     1 
HETATM 3238 O  O     . HOH R 11 .   ? -14.645 -19.401 -4.993  1.00 17.28 ?  829  HOH A O     1 
HETATM 3239 O  O     . HOH R 11 .   ? 6.895   -13.364 -12.501 1.00 23.51 ?  830  HOH A O     1 
HETATM 3240 O  O     . HOH R 11 .   ? -21.377 -15.741 -5.345  1.00 29.90 ?  831  HOH A O     1 
HETATM 3241 O  O     . HOH R 11 .   ? 2.377   -5.317  4.085   1.00 18.77 ?  832  HOH A O     1 
HETATM 3242 O  O     . HOH R 11 .   ? 26.346  14.396  -18.518 1.00 46.65 ?  833  HOH A O     1 
HETATM 3243 O  O     . HOH R 11 .   ? 3.096   -2.179  -16.175 1.00 50.77 ?  834  HOH A O     1 
HETATM 3244 O  O     . HOH R 11 .   ? -21.979 4.735   -9.956  1.00 29.56 ?  835  HOH A O     1 
HETATM 3245 O  O     . HOH R 11 .   ? 12.376  -30.540 -3.208  1.00 29.41 ?  836  HOH A O     1 
HETATM 3246 O  O     . HOH R 11 .   ? 5.483   -11.484 -11.281 1.00 21.56 ?  837  HOH A O     1 
HETATM 3247 O  O     . HOH R 11 .   ? 8.093   2.480   -16.458 1.00 35.98 ?  838  HOH A O     1 
HETATM 3248 O  O     . HOH R 11 .   ? -15.217 12.565  8.303   1.00 34.95 ?  839  HOH A O     1 
HETATM 3249 O  O     . HOH R 11 .   ? 19.142  -6.413  -12.018 1.00 31.12 ?  840  HOH A O     1 
HETATM 3250 O  O     . HOH R 11 .   ? -27.146 6.641   -3.503  1.00 41.28 ?  841  HOH A O     1 
HETATM 3251 O  O     . HOH R 11 .   ? -17.806 10.116  -10.785 1.00 31.01 ?  842  HOH A O     1 
HETATM 3252 O  O     . HOH R 11 .   ? -15.776 7.134   -20.237 1.00 44.86 ?  843  HOH A O     1 
HETATM 3253 O  O     . HOH R 11 .   ? -18.464 -18.673 -17.608 1.00 26.98 ?  844  HOH A O     1 
HETATM 3254 O  O     . HOH R 11 .   ? -2.399  -17.013 3.157   1.00 29.69 ?  845  HOH A O     1 
HETATM 3255 O  O     . HOH R 11 .   ? -11.272 -6.570  -11.368 1.00 10.83 ?  846  HOH A O     1 
HETATM 3256 O  O     . HOH R 11 .   ? 13.896  0.265   -31.135 1.00 45.67 ?  847  HOH A O     1 
HETATM 3257 O  O     . HOH R 11 .   ? -7.430  20.078  -6.129  1.00 33.18 ?  848  HOH A O     1 
HETATM 3258 O  O     . HOH R 11 .   ? 0.393   -0.239  -1.626  1.00 9.88  ?  849  HOH A O     1 
HETATM 3259 O  O     . HOH R 11 .   ? 2.682   -0.528  -3.379  1.00 10.48 ?  850  HOH A O     1 
HETATM 3260 O  O     . HOH R 11 .   ? -11.996 2.177   0.796   1.00 13.20 ?  851  HOH A O     1 
HETATM 3261 O  O     . HOH R 11 .   ? -5.142  -18.772 -22.673 1.00 25.95 ?  852  HOH A O     1 
HETATM 3262 O  O     . HOH R 11 .   ? -1.877  3.892   9.799   1.00 28.64 ?  853  HOH A O     1 
HETATM 3263 O  O     . HOH R 11 .   ? -4.829  -25.321 -15.557 1.00 31.46 ?  854  HOH A O     1 
HETATM 3264 O  O     . HOH R 11 .   ? -20.595 -17.426 -13.405 1.00 28.74 ?  855  HOH A O     1 
HETATM 3265 O  O     . HOH R 11 .   ? -7.706  -20.215 -7.529  1.00 13.87 ?  856  HOH A O     1 
HETATM 3266 O  O     . HOH R 11 .   ? 22.968  -16.363 -13.242 1.00 22.92 ?  857  HOH A O     1 
HETATM 3267 O  O     . HOH R 11 .   ? -19.111 -3.564  -12.410 1.00 20.83 ?  858  HOH A O     1 
HETATM 3268 O  O     . HOH R 11 .   ? 2.455   -14.627 1.235   1.00 14.78 ?  859  HOH A O     1 
HETATM 3269 O  O     . HOH R 11 .   ? -15.544 0.736   2.385   1.00 26.93 ?  860  HOH A O     1 
HETATM 3270 O  O     . HOH R 11 .   ? -21.168 -16.358 -21.481 1.00 40.34 ?  861  HOH A O     1 
HETATM 3271 O  O     . HOH R 11 .   ? -23.645 -11.257 -15.869 1.00 27.03 ?  862  HOH A O     1 
HETATM 3272 O  O     . HOH R 11 .   ? 9.293   4.475   -6.820  1.00 18.96 ?  863  HOH A O     1 
HETATM 3273 O  O     . HOH R 11 .   ? -13.154 0.402   -18.697 1.00 31.21 ?  864  HOH A O     1 
HETATM 3274 O  O     . HOH R 11 .   ? 1.781   19.223  7.418   1.00 51.95 ?  865  HOH A O     1 
HETATM 3275 O  O     . HOH R 11 .   ? 7.274   -4.084  -20.619 1.00 41.20 ?  866  HOH A O     1 
HETATM 3276 O  O     . HOH R 11 .   ? -13.794 12.045  -18.084 1.00 34.16 ?  867  HOH A O     1 
HETATM 3277 O  O     . HOH R 11 .   ? 1.264   10.356  9.628   1.00 25.24 ?  868  HOH A O     1 
HETATM 3278 O  O     . HOH R 11 .   ? 15.228  -10.526 -11.011 1.00 24.76 ?  869  HOH A O     1 
HETATM 3279 O  O     . HOH R 11 .   ? 15.832  11.575  1.726   1.00 44.03 ?  870  HOH A O     1 
HETATM 3280 O  O     . HOH R 11 .   ? 21.753  -15.926 -10.997 1.00 34.89 ?  871  HOH A O     1 
HETATM 3281 O  O     . HOH R 11 .   ? 11.795  -1.731  -15.723 1.00 44.82 ?  872  HOH A O     1 
HETATM 3282 O  O     . HOH R 11 .   ? 11.748  -13.766 -8.024  1.00 30.84 ?  873  HOH A O     1 
HETATM 3283 O  O     . HOH R 11 .   ? -16.125 -25.146 -15.133 1.00 53.75 ?  874  HOH A O     1 
HETATM 3284 O  O     . HOH R 11 .   ? 23.379  -19.494 -20.774 1.00 28.63 ?  875  HOH A O     1 
HETATM 3285 O  O     . HOH R 11 .   ? -1.450  -4.958  4.804   1.00 35.36 ?  876  HOH A O     1 
HETATM 3286 O  O     . HOH R 11 .   ? -17.065 13.437  -3.035  1.00 14.97 ?  877  HOH A O     1 
HETATM 3287 O  O     . HOH R 11 .   ? 15.616  -12.071 -22.434 1.00 18.63 ?  878  HOH A O     1 
HETATM 3288 O  O     . HOH R 11 .   ? 15.622  -3.660  -1.739  1.00 41.45 ?  879  HOH A O     1 
HETATM 3289 O  O     . HOH R 11 .   ? 14.220  17.283  -12.960 1.00 21.89 ?  880  HOH A O     1 
HETATM 3290 O  O     . HOH R 11 .   ? 15.511  -5.928  -10.397 1.00 48.23 ?  881  HOH A O     1 
HETATM 3291 O  O     . HOH R 11 .   ? 5.961   10.818  8.860   1.00 44.10 ?  882  HOH A O     1 
HETATM 3292 O  O     . HOH R 11 .   ? -15.714 11.860  -9.821  1.00 27.12 ?  883  HOH A O     1 
HETATM 3293 O  O     . HOH R 11 .   ? 8.619   -28.995 -18.962 1.00 48.35 ?  884  HOH A O     1 
HETATM 3294 O  O     . HOH R 11 .   ? 23.586  4.256   -28.477 1.00 41.87 ?  885  HOH A O     1 
HETATM 3295 O  O     . HOH R 11 .   ? -13.144 -15.961 -25.384 1.00 50.98 ?  886  HOH A O     1 
HETATM 3296 O  O     . HOH R 11 .   ? -10.587 13.463  8.931   1.00 28.24 ?  887  HOH A O     1 
HETATM 3297 O  O     . HOH R 11 .   ? 21.469  -7.254  -22.886 1.00 51.97 ?  888  HOH A O     1 
HETATM 3298 O  O     . HOH R 11 .   ? 10.894  -9.164  -14.531 1.00 35.29 ?  889  HOH A O     1 
HETATM 3299 O  O     . HOH R 11 .   ? 10.976  -4.790  -19.103 1.00 22.27 ?  890  HOH A O     1 
HETATM 3300 O  O     . HOH R 11 .   ? 3.720   -9.342  -11.335 1.00 16.85 ?  891  HOH A O     1 
HETATM 3301 O  O     . HOH R 11 .   ? 3.932   -19.076 -21.771 1.00 17.55 ?  892  HOH A O     1 
HETATM 3302 O  O     . HOH R 11 .   ? -9.139  -7.811  2.852   1.00 35.79 ?  893  HOH A O     1 
HETATM 3303 O  O     . HOH R 11 .   ? 9.122   8.821   -26.237 1.00 37.59 ?  894  HOH A O     1 
HETATM 3304 O  O     . HOH R 11 .   ? 4.927   -10.661 -7.575  1.00 19.14 ?  895  HOH A O     1 
HETATM 3305 O  O     . HOH R 11 .   ? 16.707  16.606  -11.538 1.00 24.82 ?  896  HOH A O     1 
HETATM 3306 O  O     . HOH R 11 .   ? 9.367   -10.519 -8.333  1.00 33.54 ?  897  HOH A O     1 
HETATM 3307 O  O     . HOH R 11 .   ? -19.070 4.822   -17.845 1.00 43.90 ?  898  HOH A O     1 
HETATM 3308 O  O     . HOH R 11 .   ? -10.934 4.624   6.186   1.00 28.12 ?  899  HOH A O     1 
HETATM 3309 O  O     . HOH R 11 .   ? -3.279  17.005  -12.748 1.00 30.90 ?  900  HOH A O     1 
HETATM 3310 O  O     . HOH R 11 .   ? -13.992 12.908  -11.622 1.00 24.93 ?  901  HOH A O     1 
HETATM 3311 O  O     . HOH R 11 .   ? -14.640 22.059  4.103   1.00 15.85 ?  902  HOH A O     1 
HETATM 3312 O  O     . HOH R 11 .   ? -24.410 14.989  0.671   1.00 25.52 ?  903  HOH A O     1 
HETATM 3313 O  O     . HOH R 11 .   ? 5.100   -5.933  -6.638  1.00 18.32 ?  904  HOH A O     1 
HETATM 3314 O  O     . HOH R 11 .   ? -15.439 10.354  7.769   1.00 39.44 ?  905  HOH A O     1 
HETATM 3315 O  O     . HOH R 11 .   ? 12.976  -31.337 -17.544 1.00 35.44 ?  906  HOH A O     1 
HETATM 3316 O  O     . HOH R 11 .   ? 11.616  8.372   -10.663 1.00 20.18 ?  907  HOH A O     1 
HETATM 3317 O  O     . HOH R 11 .   ? 23.850  10.701  -13.372 1.00 32.61 ?  908  HOH A O     1 
HETATM 3318 O  O     . HOH R 11 .   ? -12.870 20.057  5.071   1.00 39.97 ?  909  HOH A O     1 
HETATM 3319 O  O     . HOH R 11 .   ? -15.024 -13.952 -25.423 1.00 39.63 ?  910  HOH A O     1 
HETATM 3320 O  O     . HOH R 11 .   ? 7.022   0.619   -20.586 1.00 23.39 ?  911  HOH A O     1 
HETATM 3321 O  O     . HOH R 11 .   ? 22.913  -5.158  -13.438 1.00 45.98 ?  912  HOH A O     1 
HETATM 3322 O  O     . HOH R 11 .   ? -11.004 8.491   6.224   1.00 37.83 ?  913  HOH A O     1 
HETATM 3323 O  O     . HOH R 11 .   ? 10.456  -14.111 -5.798  1.00 23.14 ?  914  HOH A O     1 
HETATM 3324 O  O     . HOH R 11 .   ? -12.748 -21.105 -2.420  1.00 29.49 ?  915  HOH A O     1 
HETATM 3325 O  O     . HOH R 11 .   ? 17.248  12.552  -6.941  1.00 26.77 ?  916  HOH A O     1 
HETATM 3326 O  O     . HOH R 11 .   ? 14.357  -10.294 -26.646 1.00 29.19 ?  917  HOH A O     1 
HETATM 3327 O  O     . HOH R 11 .   ? 12.769  13.120  -24.739 1.00 34.93 ?  918  HOH A O     1 
HETATM 3328 O  O     . HOH R 11 .   ? 19.802  11.460  -8.508  1.00 35.92 ?  919  HOH A O     1 
HETATM 3329 O  O     . HOH R 11 .   ? 5.244   -15.715 2.199   1.00 25.11 ?  920  HOH A O     1 
HETATM 3330 O  O     . HOH R 11 .   ? 10.289  16.348  9.811   1.00 46.79 ?  921  HOH A O     1 
HETATM 3331 O  O     . HOH R 11 .   ? 2.623   -6.276  -9.055  1.00 14.35 ?  922  HOH A O     1 
HETATM 3332 O  O     . HOH R 11 .   ? 10.620  -25.440 -26.123 1.00 40.42 ?  923  HOH A O     1 
HETATM 3333 O  O     . HOH R 11 .   ? 17.673  5.027   -34.048 1.00 44.19 ?  924  HOH A O     1 
HETATM 3334 O  O     . HOH R 11 .   ? -8.996  -22.482 -8.512  1.00 19.71 ?  925  HOH A O     1 
HETATM 3335 O  O     . HOH R 11 .   ? -16.342 -5.356  -0.894  1.00 25.06 ?  926  HOH A O     1 
HETATM 3336 O  O     . HOH R 11 .   ? -19.702 -4.295  -1.282  1.00 38.33 ?  927  HOH A O     1 
HETATM 3337 O  O     . HOH R 11 .   ? -15.992 -1.468  -18.394 1.00 22.19 ?  928  HOH A O     1 
HETATM 3338 O  O     . HOH R 11 .   ? 20.681  -29.119 -6.773  1.00 46.92 ?  929  HOH A O     1 
HETATM 3339 O  O     . HOH R 11 .   ? -7.851  -5.327  2.894   1.00 23.96 ?  930  HOH A O     1 
HETATM 3340 O  O     . HOH R 11 .   ? 8.442   18.520  -7.047  1.00 26.14 ?  931  HOH A O     1 
HETATM 3341 O  O     . HOH R 11 .   ? 3.077   -3.863  -10.600 1.00 13.75 ?  932  HOH A O     1 
HETATM 3342 O  O     . HOH R 11 .   ? 5.122   21.441  -2.623  1.00 39.05 ?  933  HOH A O     1 
HETATM 3343 O  O     . HOH R 11 .   ? 27.968  -4.026  -22.610 1.00 31.80 ?  934  HOH A O     1 
HETATM 3344 O  O     . HOH R 11 .   ? 1.883   20.731  -1.119  1.00 21.18 ?  935  HOH A O     1 
HETATM 3345 O  O     . HOH R 11 .   ? 8.434   17.586  6.186   1.00 27.72 ?  936  HOH A O     1 
HETATM 3346 O  O     . HOH R 11 .   ? -6.733  -0.924  4.631   1.00 14.31 ?  937  HOH A O     1 
HETATM 3347 O  O     . HOH R 11 .   ? 5.222   -22.226 -0.042  1.00 20.88 ?  938  HOH A O     1 
HETATM 3348 O  O     . HOH R 11 .   ? 25.086  -3.649  -24.197 1.00 27.76 ?  939  HOH A O     1 
HETATM 3349 O  O     . HOH R 11 .   ? 6.001   -8.005  -28.481 1.00 36.34 ?  940  HOH A O     1 
HETATM 3350 O  O     . HOH R 11 .   ? 19.694  13.326  -5.376  1.00 42.11 ?  941  HOH A O     1 
HETATM 3351 O  O     . HOH R 11 .   ? 13.648  -12.066 -3.185  1.00 39.20 ?  942  HOH A O     1 
HETATM 3352 O  O     A HOH R 11 .   ? -10.377 -23.982 -13.044 0.40 20.56 ?  943  HOH A O     1 
HETATM 3353 O  O     B HOH R 11 .   ? -9.309  -23.714 -11.107 0.60 21.19 ?  943  HOH A O     1 
HETATM 3354 O  O     . HOH R 11 .   ? -25.763 -5.166  -16.802 1.00 25.13 ?  944  HOH A O     1 
HETATM 3355 O  O     . HOH R 11 .   ? -21.895 9.412   5.089   1.00 34.91 ?  945  HOH A O     1 
HETATM 3356 O  O     . HOH R 11 .   ? -17.388 -19.341 -1.082  1.00 14.15 ?  946  HOH A O     1 
HETATM 3357 O  O     . HOH R 11 .   ? 8.873   -0.455  8.727   1.00 23.06 ?  947  HOH A O     1 
HETATM 3358 O  O     . HOH R 11 .   ? 5.519   -23.743 2.143   1.00 36.75 ?  948  HOH A O     1 
HETATM 3359 O  O     . HOH R 11 .   ? 18.102  14.190  10.008  1.00 42.42 ?  949  HOH A O     1 
HETATM 3360 O  O     A HOH R 11 .   ? 4.961   1.801   -7.883  0.37 14.53 ?  950  HOH A O     1 
HETATM 3361 O  O     . HOH R 11 .   ? 1.427   20.807  -4.903  1.00 37.60 ?  951  HOH A O     1 
HETATM 3362 O  O     . HOH R 11 .   ? 2.209   18.761  -9.799  1.00 20.81 ?  952  HOH A O     1 
HETATM 3363 O  O     . HOH R 11 .   ? -13.860 -10.740 -0.430  1.00 12.13 ?  953  HOH A O     1 
HETATM 3364 O  O     . HOH R 11 .   ? -4.585  -0.884  6.277   1.00 38.94 ?  954  HOH A O     1 
HETATM 3365 O  O     . HOH R 11 .   ? -24.750 -10.723 -11.001 1.00 31.31 ?  955  HOH A O     1 
HETATM 3366 O  O     . HOH R 11 .   ? -10.942 -14.015 -26.863 1.00 30.35 ?  956  HOH A O     1 
HETATM 3367 O  O     . HOH R 11 .   ? 16.337  -34.467 -5.447  1.00 43.58 ?  957  HOH A O     1 
HETATM 3368 O  O     . HOH R 11 .   ? -23.802 -11.277 -7.243  1.00 46.87 ?  958  HOH A O     1 
HETATM 3369 O  O     . HOH R 11 .   ? 2.609   -12.179 2.300   1.00 28.18 ?  959  HOH A O     1 
HETATM 3370 O  O     . HOH R 11 .   ? -8.532  -2.534  -16.272 1.00 17.68 ?  960  HOH A O     1 
HETATM 3371 O  O     . HOH R 11 .   ? -5.087  -24.600 -6.097  1.00 48.96 ?  961  HOH A O     1 
HETATM 3372 O  O     . HOH R 11 .   ? 23.187  7.936   -13.542 1.00 25.01 ?  962  HOH A O     1 
HETATM 3373 O  O     . HOH R 11 .   ? -12.337 -8.624  -0.266  1.00 45.13 ?  963  HOH A O     1 
HETATM 3374 O  O     . HOH R 11 .   ? 16.403  -21.190 -6.184  1.00 18.74 ?  964  HOH A O     1 
HETATM 3375 O  O     . HOH R 11 .   ? -13.543 -7.549  -26.283 1.00 41.77 ?  965  HOH A O     1 
HETATM 3376 O  O     . HOH R 11 .   ? 16.782  21.152  -23.353 1.00 43.01 ?  966  HOH A O     1 
HETATM 3377 O  O     . HOH R 11 .   ? -6.578  17.923  -8.242  1.00 37.80 ?  967  HOH A O     1 
HETATM 3378 O  O     . HOH R 11 .   ? 1.828   -19.944 2.167   1.00 46.81 ?  968  HOH A O     1 
HETATM 3379 O  O     . HOH R 11 .   ? 3.913   -9.439  -15.994 1.00 22.61 ?  969  HOH A O     1 
HETATM 3380 O  O     . HOH R 11 .   ? 11.534  -32.812 -4.365  1.00 35.21 ?  970  HOH A O     1 
HETATM 3381 O  O     . HOH R 11 .   ? -1.457  -21.273 -20.083 1.00 26.51 ?  971  HOH A O     1 
HETATM 3382 O  O     . HOH R 11 .   ? 14.011  8.103   -32.713 1.00 47.41 ?  972  HOH A O     1 
HETATM 3383 O  O     . HOH R 11 .   ? -12.036 22.275  -2.072  1.00 36.95 ?  973  HOH A O     1 
HETATM 3384 O  O     . HOH R 11 .   ? 20.254  -0.708  -28.613 1.00 50.02 ?  974  HOH A O     1 
HETATM 3385 O  O     . HOH R 11 .   ? -6.126  -21.791 -5.820  1.00 20.34 ?  975  HOH A O     1 
HETATM 3386 O  O     . HOH R 11 .   ? -5.569  -22.083 -1.462  1.00 41.48 ?  976  HOH A O     1 
HETATM 3387 O  O     . HOH R 11 .   ? -2.096  25.041  -1.746  1.00 51.99 ?  977  HOH A O     1 
HETATM 3388 O  O     . HOH R 11 .   ? -17.580 -21.291 -13.715 1.00 31.36 ?  978  HOH A O     1 
HETATM 3389 O  O     . HOH R 11 .   ? -7.669  -24.831 -16.946 1.00 48.63 ?  979  HOH A O     1 
HETATM 3390 O  O     . HOH R 11 .   ? 7.224   8.682   9.179   1.00 43.63 ?  980  HOH A O     1 
HETATM 3391 O  O     . HOH R 11 .   ? 21.377  -7.568  -11.964 1.00 46.90 ?  981  HOH A O     1 
HETATM 3392 O  O     . HOH R 11 .   ? 8.740   3.589   -13.125 1.00 33.07 ?  982  HOH A O     1 
HETATM 3393 O  O     . HOH R 11 .   ? 2.200   6.101   11.599  1.00 37.12 ?  983  HOH A O     1 
HETATM 3394 O  O     . HOH R 11 .   ? 5.494   -10.119 -28.951 1.00 41.87 ?  984  HOH A O     1 
HETATM 3395 O  O     . HOH R 11 .   ? -11.368 0.305   5.247   1.00 55.41 ?  985  HOH A O     1 
HETATM 3396 O  O     . HOH R 11 .   ? 19.025  0.785   -11.990 1.00 36.12 ?  986  HOH A O     1 
HETATM 3397 O  O     . HOH R 11 .   ? 18.135  -17.173 -3.191  1.00 38.15 ?  987  HOH A O     1 
HETATM 3398 O  O     . HOH R 11 .   ? 10.405  18.472  7.537   1.00 55.85 ?  988  HOH A O     1 
HETATM 3399 O  O     . HOH R 11 .   ? 7.505   -9.894  -10.442 1.00 40.01 ?  989  HOH A O     1 
HETATM 3400 O  O     . HOH R 11 .   ? -0.655  -20.507 -22.737 1.00 27.88 ?  990  HOH A O     1 
HETATM 3401 O  O     . HOH R 11 .   ? -7.923  -9.692  2.829   1.00 45.52 ?  991  HOH A O     1 
HETATM 3402 O  O     . HOH R 11 .   ? 2.618   -16.747 2.769   1.00 34.41 ?  992  HOH A O     1 
HETATM 3403 O  O     . HOH R 11 .   ? 18.131  13.111  4.883   1.00 37.62 ?  993  HOH A O     1 
HETATM 3404 O  O     . HOH R 11 .   ? 6.522   -7.448  -15.786 1.00 43.24 ?  994  HOH A O     1 
HETATM 3405 O  O     . HOH R 11 .   ? 10.858  2.835   -8.329  1.00 44.20 ?  995  HOH A O     1 
HETATM 3406 O  O     . HOH R 11 .   ? 10.507  -2.437  -3.765  1.00 27.96 ?  996  HOH A O     1 
HETATM 3407 O  O     . HOH R 11 .   ? 2.587   -24.858 -2.370  1.00 37.98 ?  997  HOH A O     1 
HETATM 3408 O  O     . HOH R 11 .   ? 9.458   7.119   -28.437 1.00 34.94 ?  998  HOH A O     1 
HETATM 3409 O  O     . HOH R 11 .   ? 12.088  0.258   -4.214  1.00 37.08 ?  999  HOH A O     1 
HETATM 3410 O  O     . HOH R 11 .   ? -9.848  5.712   10.221  1.00 52.69 ?  1000 HOH A O     1 
HETATM 3411 O  O     A HOH R 11 .   ? -23.274 11.256  2.312   0.47 28.20 ?  1001 HOH A O     1 
HETATM 3412 O  O     B HOH R 11 .   ? -20.960 12.773  3.004   0.53 18.92 ?  1001 HOH A O     1 
HETATM 3413 O  O     . HOH R 11 .   ? -18.305 1.682   2.570   1.00 42.17 ?  1002 HOH A O     1 
HETATM 3414 O  O     . HOH R 11 .   ? 17.443  -28.333 -20.009 1.00 38.79 ?  1003 HOH A O     1 
HETATM 3415 O  O     A HOH R 11 .   ? -15.972 -21.247 -6.850  0.45 22.64 ?  1004 HOH A O     1 
HETATM 3416 O  O     B HOH R 11 .   ? -15.195 -23.084 -6.994  0.55 36.16 ?  1004 HOH A O     1 
HETATM 3417 O  O     . HOH R 11 .   ? -7.121  -25.772 -11.074 1.00 35.06 ?  1005 HOH A O     1 
HETATM 3418 O  O     . HOH R 11 .   ? -10.793 -6.893  -26.646 1.00 39.64 ?  1006 HOH A O     1 
HETATM 3419 O  O     . HOH R 11 .   ? 7.777   20.984  -5.439  1.00 42.82 ?  1007 HOH A O     1 
HETATM 3420 O  O     . HOH R 11 .   ? -21.429 11.028  7.151   1.00 49.20 ?  1008 HOH A O     1 
HETATM 3421 O  O     . HOH R 11 .   ? 2.398   -22.347 -2.327  1.00 24.72 ?  1009 HOH A O     1 
HETATM 3422 O  O     . HOH R 11 .   ? 11.236  -13.775 -2.664  1.00 34.71 ?  1010 HOH A O     1 
HETATM 3423 O  O     A HOH R 11 .   ? 8.097   -12.676 -5.524  0.55 20.62 ?  1011 HOH A O     1 
HETATM 3424 O  O     B HOH R 11 .   ? 7.036   -11.900 -6.872  0.45 18.77 ?  1011 HOH A O     1 
HETATM 3425 O  O     . HOH R 11 .   ? 22.443  -12.332 -23.357 1.00 50.17 ?  1012 HOH A O     1 
HETATM 3426 O  O     . HOH R 11 .   ? 20.149  -32.742 -5.239  1.00 50.30 ?  1013 HOH A O     1 
HETATM 3427 O  O     . HOH R 11 .   ? -6.388  -27.068 -13.437 1.00 47.60 ?  1014 HOH A O     1 
HETATM 3428 O  O     . HOH R 11 .   ? 15.491  -33.225 -2.769  1.00 49.73 ?  1015 HOH A O     1 
HETATM 3429 O  O     . HOH R 11 .   ? 8.784   0.683   -17.857 1.00 38.69 ?  1016 HOH A O     1 
HETATM 3430 O  O     . HOH R 11 .   ? -18.208 -21.276 -18.526 1.00 46.43 ?  1017 HOH A O     1 
HETATM 3431 O  O     . HOH R 11 .   ? 2.385   -6.977  6.220   1.00 38.19 ?  1018 HOH A O     1 
HETATM 3432 O  O     . HOH R 11 .   ? 7.195   -8.861  -4.749  1.00 24.24 ?  1019 HOH A O     1 
HETATM 3433 O  O     . HOH R 11 .   ? 19.398  -21.029 -7.187  1.00 35.26 ?  1020 HOH A O     1 
HETATM 3434 O  O     . HOH R 11 .   ? 4.862   -8.751  -13.956 1.00 29.30 ?  1021 HOH A O     1 
HETATM 3435 O  O     . HOH R 11 .   ? 23.902  2.503   -15.448 1.00 49.57 ?  1022 HOH A O     1 
HETATM 3436 O  O     . HOH R 11 .   ? 9.051   -8.129  -16.455 1.00 36.65 ?  1023 HOH A O     1 
HETATM 3437 O  O     . HOH R 11 .   ? 4.358   -1.554  -13.828 1.00 48.80 ?  1024 HOH A O     1 
HETATM 3438 O  O     . HOH R 11 .   ? -4.156  -16.839 -24.329 1.00 34.96 ?  1025 HOH A O     1 
HETATM 3439 O  O     . HOH R 11 .   ? 5.741   -0.139  -24.755 1.00 33.54 ?  1026 HOH A O     1 
HETATM 3440 O  O     . HOH R 11 .   ? -25.108 -11.582 -13.848 1.00 39.18 ?  1027 HOH A O     1 
HETATM 3441 O  O     . HOH R 11 .   ? 4.944   -8.012  -8.915  1.00 26.67 ?  1028 HOH A O     1 
HETATM 3442 O  O     . HOH R 11 .   ? 23.167  -9.904  -23.645 1.00 43.89 ?  1029 HOH A O     1 
HETATM 3443 O  O     . HOH R 11 .   ? 24.596  -18.998 -23.024 1.00 44.20 ?  1030 HOH A O     1 
HETATM 3444 O  O     . HOH R 11 .   ? -16.953 5.162   8.159   1.00 53.12 ?  1031 HOH A O     1 
HETATM 3445 O  O     . HOH R 11 .   ? 8.896   5.652   -9.160  1.00 25.76 ?  1032 HOH A O     1 
HETATM 3446 O  O     . HOH R 11 .   ? -23.382 -2.291  -4.008  1.00 50.62 ?  1033 HOH A O     1 
HETATM 3447 O  O     . HOH R 11 .   ? 5.170   -28.210 2.451   1.00 44.21 ?  1034 HOH A O     1 
HETATM 3448 O  O     . HOH R 11 .   ? -0.830  11.928  10.465  1.00 42.21 ?  1035 HOH A O     1 
HETATM 3449 O  O     . HOH R 11 .   ? -0.885  -22.301 0.226   1.00 42.17 ?  1036 HOH A O     1 
HETATM 3450 O  O     . HOH R 11 .   ? 4.994   -2.950  -11.977 1.00 41.72 ?  1037 HOH A O     1 
HETATM 3451 O  O     . HOH R 11 .   ? 9.347   18.638  -9.824  1.00 47.76 ?  1038 HOH A O     1 
HETATM 3452 O  O     . HOH R 11 .   ? 20.616  -19.226 -7.451  1.00 36.32 ?  1039 HOH A O     1 
HETATM 3453 O  O     . HOH R 11 .   ? -20.530 6.069   7.298   1.00 38.46 ?  1040 HOH A O     1 
HETATM 3454 O  O     . HOH R 11 .   ? -10.989 -4.299  1.709   1.00 24.03 ?  1041 HOH A O     1 
HETATM 3455 O  O     . HOH R 11 .   ? 17.704  -6.962  -10.001 1.00 42.52 ?  1042 HOH A O     1 
HETATM 3456 O  O     . HOH R 11 .   ? 19.185  -7.890  -23.371 1.00 35.00 ?  1043 HOH A O     1 
HETATM 3457 O  O     . HOH R 11 .   ? 17.510  -23.785 -3.389  1.00 40.10 ?  1044 HOH A O     1 
HETATM 3458 O  O     . HOH R 11 .   ? -7.823  -15.186 4.088   1.00 45.98 ?  1045 HOH A O     1 
HETATM 3459 O  O     . HOH R 11 .   ? 14.191  -12.494 -24.905 1.00 30.90 ?  1046 HOH A O     1 
HETATM 3460 O  O     . HOH R 11 .   ? -4.647  -20.699 -24.296 1.00 53.78 ?  1047 HOH A O     1 
HETATM 3461 O  O     . HOH R 11 .   ? -11.475 -17.313 -26.883 1.00 46.55 ?  1048 HOH A O     1 
HETATM 3462 O  O     . HOH R 11 .   ? -1.033  -21.643 3.118   1.00 56.26 ?  1049 HOH A O     1 
HETATM 3463 O  O     . HOH R 11 .   ? -4.261  -19.164 2.333   1.00 38.49 ?  1050 HOH A O     1 
HETATM 3464 O  O     . HOH R 11 .   ? -12.577 -6.294  1.400   1.00 30.50 ?  1051 HOH A O     1 
HETATM 3465 O  O     . HOH R 11 .   ? 3.762   -24.463 -0.470  1.00 39.16 ?  1052 HOH A O     1 
HETATM 3466 O  O     . HOH R 11 .   ? -11.695 -8.477  3.184   1.00 35.90 ?  1053 HOH A O     1 
HETATM 3467 O  O     . HOH R 11 .   ? 9.774   -5.918  -16.921 1.00 36.45 ?  1054 HOH A O     1 
HETATM 3468 O  O     . HOH R 11 .   ? -10.918 6.553   7.706   1.00 41.29 ?  1055 HOH A O     1 
HETATM 3469 O  O     . HOH R 11 .   ? -13.582 -19.881 -0.044  1.00 25.00 ?  1056 HOH A O     1 
HETATM 3470 O  O     . HOH R 11 .   ? 2.369   8.933   11.563  1.00 45.06 ?  1057 HOH A O     1 
HETATM 3471 O  O     . HOH R 11 .   ? -3.851  -4.757  4.151   1.00 21.78 ?  1058 HOH A O     1 
HETATM 3472 O  O     . HOH R 11 .   ? 3.456   11.995  8.533   1.00 32.26 ?  1059 HOH A O     1 
HETATM 3473 O  O     . HOH R 11 .   ? -18.549 2.429   5.253   1.00 28.94 ?  1060 HOH A O     1 
HETATM 3474 O  O     . HOH R 11 .   ? 14.958  -12.630 -0.806  1.00 33.77 ?  1061 HOH A O     1 
HETATM 3475 O  O     . HOH R 11 .   ? -0.109  -24.938 -3.337  1.00 38.91 ?  1062 HOH A O     1 
HETATM 3476 O  O     . HOH R 11 .   ? 5.642   -11.152 6.657   1.00 48.49 ?  1063 HOH A O     1 
HETATM 3477 O  O     . HOH R 11 .   ? -3.281  -21.394 0.271   1.00 48.19 ?  1064 HOH A O     1 
HETATM 3478 O  O     . HOH R 11 .   ? 17.923  -10.817 -23.294 1.00 31.81 ?  1065 HOH A O     1 
HETATM 3479 O  O     . HOH R 11 .   ? 14.539  18.837  -15.338 1.00 34.35 ?  1066 HOH A O     1 
HETATM 3480 O  O     . HOH R 11 .   ? 9.159   -10.240 2.625   1.00 37.94 ?  1067 HOH A O     1 
HETATM 3481 O  O     . HOH R 11 .   ? 10.136  -0.763  -27.551 1.00 37.04 ?  1068 HOH A O     1 
HETATM 3482 O  O     . HOH R 11 .   ? 21.708  -2.784  -13.414 1.00 40.23 ?  1069 HOH A O     1 
HETATM 3483 O  O     . HOH R 11 .   ? 7.813   -1.874  -26.149 1.00 32.12 ?  1070 HOH A O     1 
HETATM 3484 O  O     . HOH R 11 .   ? 7.556   -11.691 4.127   1.00 35.44 ?  1071 HOH A O     1 
HETATM 3485 O  O     . HOH R 11 .   ? -4.724  -19.816 -0.021  1.00 34.55 ?  1072 HOH A O     1 
HETATM 3486 O  O     . HOH R 11 .   ? -24.912 8.605   3.598   1.00 48.79 ?  1073 HOH A O     1 
HETATM 3487 O  O     . HOH R 11 .   ? 9.870   -10.444 0.321   1.00 48.03 ?  1074 HOH A O     1 
HETATM 3488 O  O     . HOH R 11 .   ? 11.177  -10.063 -5.806  1.00 40.66 ?  1075 HOH A O     1 
HETATM 3489 O  O     . HOH R 11 .   ? -20.243 -0.305  1.947   1.00 34.68 ?  1076 HOH A O     1 
HETATM 3490 O  O     . HOH R 11 .   ? -16.205 -1.013  0.736   1.00 42.08 ?  1077 HOH A O     1 
HETATM 3491 O  O     . HOH R 11 .   ? 9.046   -35.861 -5.930  1.00 42.23 ?  1078 HOH A O     1 
HETATM 3492 O  O     . HOH R 11 .   ? 18.242  -15.218 -1.658  1.00 44.32 ?  1079 HOH A O     1 
HETATM 3493 O  O     . HOH R 11 .   ? 22.489  7.505   -11.081 1.00 48.60 ?  1080 HOH A O     1 
HETATM 3494 O  O     . HOH R 11 .   ? -17.513 -21.636 -2.155  1.00 35.76 ?  1081 HOH A O     1 
HETATM 3495 O  O     . HOH S 11 .   ? -3.273  11.753  -17.468 1.00 35.31 ?  201  HOH T O     1 
HETATM 3496 O  O     . HOH S 11 .   ? -14.102 -2.236  -22.299 1.00 30.51 ?  202  HOH T O     1 
HETATM 3497 O  O     . HOH S 11 .   ? -6.609  -10.835 -24.265 1.00 32.30 ?  203  HOH T O     1 
HETATM 3498 O  O     . HOH S 11 .   ? -8.022  2.452   -16.741 1.00 45.67 ?  204  HOH T O     1 
HETATM 3499 O  O     . HOH S 11 .   ? -7.879  -3.838  -23.738 1.00 39.12 ?  205  HOH T O     1 
HETATM 3500 O  O     . HOH S 11 .   ? -0.421  0.039   -21.863 1.00 36.60 ?  206  HOH T O     1 
HETATM 3501 O  O     . HOH S 11 .   ? 4.537   -15.035 -31.975 1.00 30.07 ?  207  HOH T O     1 
HETATM 3502 O  O     . HOH S 11 .   ? -9.000  2.092   -25.818 1.00 44.01 ?  208  HOH T O     1 
HETATM 3503 O  O     . HOH S 11 .   ? -1.326  -13.936 -19.238 1.00 16.64 ?  209  HOH T O     1 
HETATM 3504 O  O     . HOH S 11 .   ? 1.914   -13.533 -32.705 1.00 31.76 ?  210  HOH T O     1 
HETATM 3505 O  O     . HOH S 11 .   ? 3.634   -16.299 -37.399 1.00 41.77 ?  211  HOH T O     1 
HETATM 3506 O  O     . HOH S 11 .   ? -3.197  -20.781 -36.275 1.00 33.08 ?  212  HOH T O     1 
HETATM 3507 O  O     . HOH S 11 .   ? -2.227  -8.248  -23.980 1.00 28.11 ?  213  HOH T O     1 
HETATM 3508 O  O     . HOH S 11 .   ? -6.699  -6.284  -23.975 1.00 28.19 ?  214  HOH T O     1 
HETATM 3509 O  O     . HOH S 11 .   ? -9.111  -8.478  -25.626 1.00 30.72 ?  215  HOH T O     1 
HETATM 3510 O  O     . HOH S 11 .   ? 4.809   -17.808 -32.723 1.00 23.03 ?  216  HOH T O     1 
HETATM 3511 O  O     . HOH S 11 .   ? -3.622  -5.662  -24.145 1.00 54.34 ?  217  HOH T O     1 
HETATM 3512 O  O     . HOH S 11 .   ? -6.482  3.170   -24.647 1.00 47.67 ?  218  HOH T O     1 
HETATM 3513 O  O     . HOH S 11 .   ? -14.396 0.138   -21.373 1.00 39.65 ?  219  HOH T O     1 
HETATM 3514 O  O     . HOH S 11 .   ? -0.088  -16.376 -23.908 1.00 16.74 ?  220  HOH T O     1 
HETATM 3515 O  O     . HOH S 11 .   ? -4.345  -18.705 -31.582 1.00 33.15 ?  221  HOH T O     1 
HETATM 3516 O  O     . HOH S 11 .   ? -2.237  -10.210 -28.086 1.00 27.91 ?  222  HOH T O     1 
HETATM 3517 O  O     . HOH S 11 .   ? 3.327   -16.008 -34.613 1.00 26.86 ?  223  HOH T O     1 
HETATM 3518 O  O     . HOH S 11 .   ? -10.911 -10.747 -19.458 1.00 14.58 ?  224  HOH T O     1 
HETATM 3519 O  O     . HOH S 11 .   ? -9.027  0.222   -17.281 1.00 32.55 ?  225  HOH T O     1 
HETATM 3520 O  O     . HOH S 11 .   ? -3.813  -19.283 -40.812 1.00 21.70 ?  226  HOH T O     1 
HETATM 3521 O  O     . HOH S 11 .   ? 0.912   -1.639  -18.680 1.00 34.78 ?  227  HOH T O     1 
HETATM 3522 O  O     . HOH S 11 .   ? -8.833  -11.073 -27.273 1.00 36.29 ?  228  HOH T O     1 
HETATM 3523 O  O     . HOH S 11 .   ? -2.558  -17.868 -26.592 1.00 36.33 ?  229  HOH T O     1 
HETATM 3524 O  O     . HOH S 11 .   ? -6.783  5.777   -25.544 1.00 42.09 ?  230  HOH T O     1 
HETATM 3525 O  O     . HOH S 11 .   ? -12.608 14.213  -18.366 1.00 41.42 ?  231  HOH T O     1 
HETATM 3526 O  O     . HOH S 11 .   ? 6.186   -20.349 -33.391 1.00 25.13 ?  232  HOH T O     1 
HETATM 3527 O  O     . HOH S 11 .   ? 2.906   -11.247 -31.484 1.00 36.22 ?  233  HOH T O     1 
HETATM 3528 O  O     . HOH S 11 .   ? 1.356   -5.742  -20.529 1.00 31.63 ?  234  HOH T O     1 
HETATM 3529 O  O     . HOH S 11 .   ? -8.689  6.413   -16.534 1.00 29.23 ?  235  HOH T O     1 
HETATM 3530 O  O     . HOH S 11 .   ? -1.508  -5.388  -23.767 1.00 51.74 ?  236  HOH T O     1 
HETATM 3531 O  O     . HOH S 11 .   ? -1.459  -18.589 -24.704 1.00 42.58 ?  237  HOH T O     1 
HETATM 3532 O  O     . HOH S 11 .   ? -8.536  -12.742 -30.267 1.00 43.73 ?  238  HOH T O     1 
HETATM 3533 O  O     . HOH S 11 .   ? -12.872 -5.664  -24.005 1.00 57.35 ?  239  HOH T O     1 
HETATM 3534 O  O     . HOH S 11 .   ? -11.293 -1.761  -25.048 1.00 52.58 ?  240  HOH T O     1 
HETATM 3535 O  O     . HOH S 11 .   ? -0.491  -13.883 -36.630 1.00 41.80 ?  241  HOH T O     1 
HETATM 3536 O  O     . HOH S 11 .   ? -7.048  -12.510 -22.615 1.00 37.69 ?  242  HOH T O     1 
HETATM 3537 O  O     . HOH S 11 .   ? -3.026  -21.189 -39.253 1.00 28.02 ?  243  HOH T O     1 
HETATM 3538 O  O     . HOH S 11 .   ? -4.363  -8.658  -24.880 1.00 38.11 ?  244  HOH T O     1 
HETATM 3539 O  O     . HOH S 11 .   ? -9.092  4.148   -15.888 1.00 43.73 ?  245  HOH T O     1 
HETATM 3540 O  O     . HOH S 11 .   ? -5.542  -6.893  -25.838 1.00 58.90 ?  246  HOH T O     1 
HETATM 3541 O  O     . HOH S 11 .   ? -5.856  17.407  -22.911 1.00 31.27 ?  247  HOH T O     1 
HETATM 3542 O  O     . HOH S 11 .   ? 2.100   -0.374  -20.832 1.00 40.50 ?  248  HOH T O     1 
HETATM 3543 O  O     . HOH S 11 .   ? 0.376   -12.493 -34.394 1.00 47.19 ?  249  HOH T O     1 
HETATM 3544 O  O     . HOH S 11 .   ? -7.014  -1.678  -24.836 1.00 31.62 ?  250  HOH T O     1 
HETATM 3545 O  O     . HOH S 11 .   ? -1.041  -8.482  -26.614 1.00 37.69 ?  251  HOH T O     1 
HETATM 3546 O  O     . HOH S 11 .   ? -8.877  -0.939  -25.975 1.00 51.79 ?  252  HOH T O     1 
HETATM 3547 O  O     . HOH S 11 .   ? -1.002  -10.362 -30.620 1.00 42.19 ?  253  HOH T O     1 
HETATM 3548 O  O     . HOH S 11 .   ? 1.316   -9.106  -30.746 1.00 49.11 ?  254  HOH T O     1 
HETATM 3549 O  O     . HOH S 11 .   ? 5.715   -14.226 -34.323 1.00 33.17 ?  255  HOH T O     1 
HETATM 3550 O  O     . HOH T 11 .   ? 4.149   4.258   -29.641 1.00 34.37 ?  101  HOH P O     1 
HETATM 3551 O  O     . HOH T 11 .   ? 1.722   0.571   -16.311 1.00 45.57 ?  102  HOH P O     1 
HETATM 3552 O  O     . HOH T 11 .   ? -1.965  3.940   -24.528 1.00 36.15 ?  103  HOH P O     1 
HETATM 3553 O  O     . HOH T 11 .   ? 6.915   1.902   -23.536 1.00 24.27 ?  104  HOH P O     1 
HETATM 3554 O  O     . HOH T 11 .   ? 3.990   3.259   -21.838 1.00 36.03 ?  105  HOH P O     1 
HETATM 3555 O  O     . HOH T 11 .   ? -0.570  2.318   -22.515 1.00 35.23 ?  106  HOH P O     1 
HETATM 3556 O  O     . HOH T 11 .   ? 3.069   2.569   -16.093 1.00 49.10 ?  107  HOH P O     1 
HETATM 3557 O  O     . HOH T 11 .   ? 5.123   2.397   -19.494 1.00 28.46 ?  108  HOH P O     1 
HETATM 3558 O  O     . HOH T 11 .   ? 4.008   11.434  -23.147 1.00 30.60 ?  109  HOH P O     1 
HETATM 3559 O  O     . HOH T 11 .   ? 1.195   3.834   -24.520 1.00 31.63 ?  110  HOH P O     1 
HETATM 3560 O  O     . HOH T 11 .   ? 3.883   3.547   -25.461 1.00 31.55 ?  111  HOH P O     1 
HETATM 3561 O  O     . HOH T 11 .   ? 6.043   4.584   -13.169 1.00 35.92 ?  112  HOH P O     1 
HETATM 3562 O  O     . HOH T 11 .   ? 5.924   10.680  -21.742 1.00 22.20 ?  113  HOH P O     1 
HETATM 3563 O  O     . HOH T 11 .   ? 7.108   2.520   -14.270 1.00 55.08 ?  114  HOH P O     1 
HETATM 3564 O  O     . HOH T 11 .   ? 4.475   0.155   -16.392 1.00 51.99 ?  115  HOH P O     1 
HETATM 3565 O  O     . HOH T 11 .   ? 3.390   0.143   -18.775 1.00 43.79 ?  116  HOH P O     1 
HETATM 3566 O  O     . HOH U 11 .   ? 0.040   -28.094 -26.482 1.00 42.99 ?  101  HOH D O     1 
HETATM 3567 O  O     . HOH U 11 .   ? 4.729   -25.746 -26.106 1.00 41.76 ?  102  HOH D O     1 
HETATM 3568 O  O     . HOH U 11 .   ? 15.124  -14.843 -25.384 1.00 28.64 ?  103  HOH D O     1 
HETATM 3569 O  O     . HOH U 11 .   ? 12.517  -21.757 -26.942 1.00 38.86 ?  104  HOH D O     1 
HETATM 3570 O  O     . HOH U 11 .   ? 4.475   -24.794 -31.128 1.00 35.45 ?  105  HOH D O     1 
HETATM 3571 O  O     . HOH U 11 .   ? -4.204  -22.543 -30.034 1.00 44.23 ?  106  HOH D O     1 
HETATM 3572 O  O     . HOH U 11 .   ? 6.706   -13.378 -31.010 1.00 45.98 ?  107  HOH D O     1 
HETATM 3573 O  O     . HOH U 11 .   ? 16.800  -17.400 -27.420 1.00 41.87 ?  108  HOH D O     1 
HETATM 3574 O  O     . HOH U 11 .   ? 1.928   -26.578 -20.426 1.00 31.59 ?  109  HOH D O     1 
HETATM 3575 O  O     . HOH U 11 .   ? 10.677  -19.764 -29.483 1.00 40.68 ?  110  HOH D O     1 
HETATM 3576 O  O     . HOH U 11 .   ? 3.451   -26.621 -29.569 1.00 32.75 ?  111  HOH D O     1 
HETATM 3577 O  O     . HOH U 11 .   ? 6.287   -22.239 -30.955 1.00 30.37 ?  112  HOH D O     1 
HETATM 3578 O  O     . HOH U 11 .   ? 1.927   -20.077 -23.379 1.00 26.78 ?  113  HOH D O     1 
HETATM 3579 O  O     . HOH U 11 .   ? 8.192   -18.071 -31.151 1.00 37.62 ?  114  HOH D O     1 
HETATM 3580 O  O     . HOH U 11 .   ? 8.472   -23.385 -26.758 1.00 44.39 ?  115  HOH D O     1 
HETATM 3581 O  O     . HOH U 11 .   ? 7.050   -16.197 -32.875 1.00 40.65 ?  116  HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . MET A 10  ? 0.4402 0.2887 0.4719 0.0156  -0.0305 -0.0472 138 MET A N     
2    C CA    . MET A 10  ? 0.3865 0.2514 0.4163 0.0172  -0.0304 -0.0457 138 MET A CA    
3    C C     . MET A 10  ? 0.3462 0.2199 0.3757 0.0125  -0.0355 -0.0525 138 MET A C     
4    O O     . MET A 10  ? 0.3359 0.2067 0.3575 0.0153  -0.0393 -0.0622 138 MET A O     
5    C CB    . MET A 10  ? 0.4105 0.2816 0.4301 0.0271  -0.0274 -0.0460 138 MET A CB    
6    C CG    . MET A 10  ? 0.4387 0.3282 0.4526 0.0281  -0.0270 -0.0460 138 MET A CG    
7    S SD    . MET A 10  ? 0.4127 0.3156 0.4277 0.0276  -0.0223 -0.0347 138 MET A SD    
8    C CE    . MET A 10  ? 0.3618 0.2569 0.3767 0.0336  -0.0192 -0.0287 138 MET A CE    
9    N N     . PRO A 11  ? 0.3147 0.1996 0.3524 0.0060  -0.0355 -0.0473 139 PRO A N     
10   C CA    . PRO A 11  ? 0.3035 0.1975 0.3424 0.0020  -0.0414 -0.0529 139 PRO A CA    
11   C C     . PRO A 11  ? 0.2776 0.1834 0.3042 0.0081  -0.0415 -0.0556 139 PRO A C     
12   O O     . PRO A 11  ? 0.2826 0.1931 0.3030 0.0138  -0.0364 -0.0514 139 PRO A O     
13   C CB    . PRO A 11  ? 0.3532 0.2572 0.4056 -0.0048 -0.0398 -0.0449 139 PRO A CB    
14   C CG    . PRO A 11  ? 0.3598 0.2625 0.4131 -0.0029 -0.0321 -0.0355 139 PRO A CG    
15   C CD    . PRO A 11  ? 0.3366 0.2247 0.3835 0.0019  -0.0307 -0.0367 139 PRO A CD    
16   N N     . ALA A 12  ? 0.2573 0.1683 0.2807 0.0064  -0.0478 -0.0623 140 ALA A N     
17   C CA    . ALA A 12  ? 0.2954 0.2155 0.3052 0.0123  -0.0484 -0.0657 140 ALA A CA    
18   C C     . ALA A 12  ? 0.2950 0.2306 0.3054 0.0132  -0.0451 -0.0575 140 ALA A C     
19   O O     . ALA A 12  ? 0.3290 0.2709 0.3294 0.0187  -0.0421 -0.0565 140 ALA A O     
20   C CB    . ALA A 12  ? 0.3251 0.2451 0.3293 0.0102  -0.0569 -0.0751 140 ALA A CB    
21   N N     . TYR A 13  ? 0.2113 0.1525 0.2342 0.0079  -0.0450 -0.0515 141 TYR A N     
22   C CA    . TYR A 13  ? 0.1890 0.1425 0.2131 0.0088  -0.0421 -0.0445 141 TYR A CA    
23   C C     . TYR A 13  ? 0.1807 0.1328 0.2080 0.0094  -0.0345 -0.0371 141 TYR A C     
24   O O     . TYR A 13  ? 0.1860 0.1313 0.2207 0.0065  -0.0324 -0.0349 141 TYR A O     
25   C CB    . TYR A 13  ? 0.1971 0.1593 0.2331 0.0040  -0.0464 -0.0427 141 TYR A CB    
26   C CG    . TYR A 13  ? 0.2038 0.1714 0.2362 0.0031  -0.0552 -0.0486 141 TYR A CG    
27   C CD1   . TYR A 13  ? 0.2272 0.1880 0.2613 -0.0011 -0.0624 -0.0566 141 TYR A CD1   
28   C CD2   . TYR A 13  ? 0.2118 0.1907 0.2390 0.0062  -0.0570 -0.0460 141 TYR A CD2   
29   C CE1   . TYR A 13  ? 0.2535 0.2198 0.2829 -0.0023 -0.0717 -0.0627 141 TYR A CE1   
30   C CE2   . TYR A 13  ? 0.2325 0.2174 0.2551 0.0057  -0.0658 -0.0507 141 TYR A CE2   
31   C CZ    . TYR A 13  ? 0.2712 0.2505 0.2943 0.0014  -0.0734 -0.0593 141 TYR A CZ    
32   O OH    . TYR A 13  ? 0.2989 0.2845 0.3155 0.0007  -0.0832 -0.0646 141 TYR A OH    
33   N N     . ALA A 14  ? 0.1508 0.1091 0.1723 0.0126  -0.0307 -0.0329 142 ALA A N     
34   C CA    . ALA A 14  ? 0.1645 0.1209 0.1864 0.0130  -0.0246 -0.0271 142 ALA A CA    
35   C C     . ALA A 14  ? 0.1950 0.1524 0.2273 0.0093  -0.0219 -0.0224 142 ALA A C     
36   O O     . ALA A 14  ? 0.1960 0.1494 0.2290 0.0087  -0.0171 -0.0183 142 ALA A O     
37   C CB    . ALA A 14  ? 0.1894 0.1513 0.2034 0.0160  -0.0220 -0.0244 142 ALA A CB    
38   N N     . CYS A 15  ? 0.1785 0.1426 0.2189 0.0073  -0.0248 -0.0224 143 CYS A N     
39   C CA    . CYS A 15  ? 0.1604 0.1281 0.2126 0.0046  -0.0212 -0.0175 143 CYS A CA    
40   C C     . CYS A 15  ? 0.1761 0.1390 0.2387 -0.0003 -0.0212 -0.0170 143 CYS A C     
41   O O     . CYS A 15  ? 0.1886 0.1548 0.2619 -0.0027 -0.0169 -0.0121 143 CYS A O     
42   C CB    . CYS A 15  ? 0.1473 0.1259 0.2071 0.0048  -0.0244 -0.0166 143 CYS A CB    
43   S SG    . CYS A 15  ? 0.1786 0.1615 0.2425 0.0019  -0.0352 -0.0229 143 CYS A SG    
44   N N     . GLN A 16  ? 0.1542 0.1086 0.2138 -0.0014 -0.0252 -0.0219 144 GLN A N     
45   C CA    . GLN A 16  ? 0.1527 0.0995 0.2219 -0.0065 -0.0256 -0.0214 144 GLN A CA    
46   C C     . GLN A 16  ? 0.2018 0.1380 0.2655 -0.0050 -0.0201 -0.0176 144 GLN A C     
47   O O     . GLN A 16  ? 0.2114 0.1390 0.2819 -0.0087 -0.0196 -0.0159 144 GLN A O     
48   C CB    . GLN A 16  ? 0.1722 0.1131 0.2415 -0.0088 -0.0339 -0.0297 144 GLN A CB    
49   C CG    . GLN A 16  ? 0.1954 0.1466 0.2733 -0.0126 -0.0410 -0.0329 144 GLN A CG    
50   C CD    . GLN A 16  ? 0.2386 0.1823 0.3117 -0.0143 -0.0497 -0.0428 144 GLN A CD    
51   O OE1   . GLN A 16  ? 0.2296 0.1679 0.2872 -0.0089 -0.0507 -0.0483 144 GLN A OE1   
52   N NE2   . GLN A 16  ? 0.2614 0.2049 0.3476 -0.0220 -0.0559 -0.0453 144 GLN A NE2   
53   N N     . ARG A 17  ? 0.1998 0.1368 0.2518 0.0002  -0.0164 -0.0157 145 ARG A N     
54   C CA    . ARG A 17  ? 0.2437 0.1722 0.2895 0.0023  -0.0128 -0.0120 145 ARG A CA    
55   C C     . ARG A 17  ? 0.1922 0.1255 0.2301 0.0049  -0.0075 -0.0071 145 ARG A C     
56   O O     . ARG A 17  ? 0.2180 0.1584 0.2517 0.0067  -0.0077 -0.0087 145 ARG A O     
57   C CB    . ARG A 17  ? 0.2778 0.1995 0.3155 0.0066  -0.0163 -0.0172 145 ARG A CB    
58   C CG    . ARG A 17  ? 0.2907 0.2204 0.3192 0.0111  -0.0176 -0.0205 145 ARG A CG    
59   C CD    . ARG A 17  ? 0.3397 0.2656 0.3625 0.0153  -0.0212 -0.0272 145 ARG A CD    
60   N NE    . ARG A 17  ? 0.3130 0.2485 0.3278 0.0190  -0.0210 -0.0283 145 ARG A NE    
61   C CZ    . ARG A 17  ? 0.3087 0.2480 0.3188 0.0211  -0.0240 -0.0340 145 ARG A CZ    
62   N NH1   . ARG A 17  ? 0.2810 0.2150 0.2920 0.0200  -0.0284 -0.0406 145 ARG A NH1   
63   N NH2   . ARG A 17  ? 0.3233 0.2718 0.3271 0.0238  -0.0227 -0.0329 145 ARG A NH2   
64   N N     . PRO A 18  ? 0.1852 0.1135 0.2202 0.0049  -0.0030 -0.0011 146 PRO A N     
65   C CA    . PRO A 18  ? 0.1687 0.1004 0.1936 0.0071  0.0010  0.0021  146 PRO A CA    
66   C C     . PRO A 18  ? 0.1617 0.0940 0.1767 0.0111  -0.0022 -0.0004 146 PRO A C     
67   O O     . PRO A 18  ? 0.2072 0.1348 0.2215 0.0133  -0.0049 -0.0012 146 PRO A O     
68   C CB    . PRO A 18  ? 0.2123 0.1386 0.2354 0.0062  0.0059  0.0094  146 PRO A CB    
69   C CG    . PRO A 18  ? 0.2383 0.1567 0.2701 0.0041  0.0041  0.0104  146 PRO A CG    
70   C CD    . PRO A 18  ? 0.2128 0.1329 0.2543 0.0019  -0.0009 0.0036  146 PRO A CD    
71   N N     . THR A 19  ? 0.1648 0.1028 0.1732 0.0120  -0.0016 -0.0013 147 THR A N     
72   C CA    . THR A 19  ? 0.1564 0.0970 0.1570 0.0146  -0.0043 -0.0026 147 THR A CA    
73   C C     . THR A 19  ? 0.1580 0.0994 0.1493 0.0140  -0.0020 0.0000  147 THR A C     
74   O O     . THR A 19  ? 0.1586 0.1016 0.1476 0.0127  -0.0001 -0.0012 147 THR A O     
75   C CB    . THR A 19  ? 0.1752 0.1218 0.1768 0.0154  -0.0071 -0.0072 147 THR A CB    
76   O OG1   . THR A 19  ? 0.1876 0.1334 0.1962 0.0153  -0.0093 -0.0106 147 THR A OG1   
77   C CG2   . THR A 19  ? 0.1675 0.1179 0.1645 0.0182  -0.0095 -0.0078 147 THR A CG2   
78   N N     . PRO A 20  ? 0.1651 0.1046 0.1502 0.0151  -0.0026 0.0035  148 PRO A N     
79   C CA    . PRO A 20  ? 0.1677 0.1071 0.1418 0.0140  -0.0013 0.0055  148 PRO A CA    
80   C C     . PRO A 20  ? 0.1661 0.1109 0.1357 0.0134  -0.0051 0.0028  148 PRO A C     
81   O O     . PRO A 20  ? 0.1875 0.1374 0.1627 0.0146  -0.0081 0.0009  148 PRO A O     
82   C CB    . PRO A 20  ? 0.1731 0.1093 0.1428 0.0156  -0.0016 0.0111  148 PRO A CB    
83   C CG    . PRO A 20  ? 0.1707 0.1078 0.1482 0.0186  -0.0054 0.0108  148 PRO A CG    
84   C CD    . PRO A 20  ? 0.1631 0.0999 0.1504 0.0179  -0.0048 0.0059  148 PRO A CD    
85   N N     . LEU A 21  ? 0.1629 0.1065 0.1224 0.0112  -0.0046 0.0024  149 LEU A N     
86   C CA    . LEU A 21  ? 0.1651 0.1129 0.1212 0.0090  -0.0086 0.0000  149 LEU A CA    
87   C C     . LEU A 21  ? 0.1971 0.1524 0.1545 0.0100  -0.0140 0.0025  149 LEU A C     
88   O O     . LEU A 21  ? 0.1933 0.1561 0.1564 0.0094  -0.0169 0.0014  149 LEU A O     
89   C CB    . LEU A 21  ? 0.1791 0.1216 0.1228 0.0060  -0.0076 -0.0019 149 LEU A CB    
90   C CG    . LEU A 21  ? 0.2338 0.1788 0.1743 0.0020  -0.0122 -0.0046 149 LEU A CG    
91   C CD1   . LEU A 21  ? 0.2318 0.1785 0.1816 0.0012  -0.0115 -0.0066 149 LEU A CD1   
92   C CD2   . LEU A 21  ? 0.2942 0.2307 0.2201 -0.0009 -0.0114 -0.0077 149 LEU A CD2   
93   N N     . THR A 22  ? 0.2025 0.1567 0.1553 0.0119  -0.0150 0.0066  150 THR A N     
94   C CA    . THR A 22  ? 0.1988 0.1612 0.1542 0.0142  -0.0203 0.0100  150 THR A CA    
95   C C     . THR A 22  ? 0.1924 0.1523 0.1549 0.0196  -0.0190 0.0135  150 THR A C     
96   O O     . THR A 22  ? 0.1609 0.1119 0.1226 0.0201  -0.0148 0.0148  150 THR A O     
97   C CB    . THR A 22  ? 0.2092 0.1732 0.1528 0.0124  -0.0245 0.0128  150 THR A CB    
98   O OG1   . THR A 22  ? 0.2561 0.2115 0.1902 0.0136  -0.0210 0.0160  150 THR A OG1   
99   C CG2   . THR A 22  ? 0.2394 0.2033 0.1755 0.0063  -0.0264 0.0079  150 THR A CG2   
100  N N     . HIS A 23  ? 0.1716 0.1388 0.1418 0.0236  -0.0221 0.0150  151 HIS A N     
101  C CA    . HIS A 23  ? 0.1605 0.1225 0.1382 0.0291  -0.0203 0.0163  151 HIS A CA    
102  C C     . HIS A 23  ? 0.1594 0.1290 0.1424 0.0352  -0.0240 0.0202  151 HIS A C     
103  O O     . HIS A 23  ? 0.1755 0.1537 0.1553 0.0348  -0.0284 0.0241  151 HIS A O     
104  C CB    . HIS A 23  ? 0.1618 0.1217 0.1464 0.0291  -0.0176 0.0102  151 HIS A CB    
105  C CG    . HIS A 23  ? 0.1536 0.1245 0.1420 0.0288  -0.0189 0.0069  151 HIS A CG    
106  N ND1   . HIS A 23  ? 0.1800 0.1581 0.1752 0.0343  -0.0197 0.0065  151 HIS A ND1   
107  C CD2   . HIS A 23  ? 0.1944 0.1699 0.1807 0.0240  -0.0188 0.0043  151 HIS A CD2   
108  C CE1   . HIS A 23  ? 0.1887 0.1768 0.1860 0.0323  -0.0197 0.0044  151 HIS A CE1   
109  N NE2   . HIS A 23  ? 0.1859 0.1720 0.1781 0.0258  -0.0195 0.0033  151 HIS A NE2   
110  N N     . HIS A 24  ? 0.1600 0.1261 0.1511 0.0410  -0.0225 0.0191  152 HIS A N     
111  C CA    . HIS A 24  ? 0.1669 0.1369 0.1635 0.0489  -0.0248 0.0238  152 HIS A CA    
112  C C     . HIS A 24  ? 0.1621 0.1423 0.1679 0.0542  -0.0244 0.0203  152 HIS A C     
113  O O     . HIS A 24  ? 0.1681 0.1513 0.1805 0.0625  -0.0251 0.0233  152 HIS A O     
114  C CB    . HIS A 24  ? 0.1919 0.1457 0.1892 0.0530  -0.0228 0.0268  152 HIS A CB    
115  C CG    . HIS A 24  ? 0.2077 0.1518 0.1966 0.0475  -0.0212 0.0305  152 HIS A CG    
116  N ND1   . HIS A 24  ? 0.1998 0.1473 0.1800 0.0463  -0.0238 0.0375  152 HIS A ND1   
117  C CD2   . HIS A 24  ? 0.1832 0.1164 0.1708 0.0427  -0.0173 0.0281  152 HIS A CD2   
118  C CE1   . HIS A 24  ? 0.2315 0.1695 0.2044 0.0418  -0.0203 0.0394  152 HIS A CE1   
119  N NE2   . HIS A 24  ? 0.2209 0.1511 0.1996 0.0393  -0.0162 0.0340  152 HIS A NE2   
120  N N     . ASN A 25  ? 0.1653 0.1511 0.1716 0.0500  -0.0229 0.0147  153 ASN A N     
121  C CA    . ASN A 25  ? 0.1790 0.1752 0.1925 0.0547  -0.0211 0.0114  153 ASN A CA    
122  C C     . ASN A 25  ? 0.1617 0.1714 0.1758 0.0487  -0.0216 0.0104  153 ASN A C     
123  O O     . ASN A 25  ? 0.1681 0.1816 0.1838 0.0491  -0.0186 0.0062  153 ASN A O     
124  C CB    . ASN A 25  ? 0.1513 0.1356 0.1643 0.0578  -0.0174 0.0047  153 ASN A CB    
125  C CG    . ASN A 25  ? 0.1636 0.1347 0.1786 0.0650  -0.0169 0.0055  153 ASN A CG    
126  O OD1   . ASN A 25  ? 0.1738 0.1490 0.1945 0.0738  -0.0162 0.0066  153 ASN A OD1   
127  N ND2   . ASN A 25  ? 0.1877 0.1426 0.1989 0.0614  -0.0168 0.0054  153 ASN A ND2   
128  N N     . THR A 26  ? 0.1436 0.1603 0.1558 0.0431  -0.0256 0.0144  154 THR A N     
129  C CA    . THR A 26  ? 0.1553 0.1807 0.1668 0.0353  -0.0267 0.0134  154 THR A CA    
130  C C     . THR A 26  ? 0.1855 0.2274 0.2072 0.0376  -0.0249 0.0138  154 THR A C     
131  O O     . THR A 26  ? 0.1687 0.2125 0.1901 0.0340  -0.0221 0.0111  154 THR A O     
132  C CB    . THR A 26  ? 0.1643 0.1935 0.1716 0.0294  -0.0325 0.0172  154 THR A CB    
133  O OG1   . THR A 26  ? 0.1691 0.1835 0.1660 0.0288  -0.0326 0.0175  154 THR A OG1   
134  C CG2   . THR A 26  ? 0.1824 0.2152 0.1874 0.0200  -0.0339 0.0152  154 THR A CG2   
135  N N     . GLY A 27  ? 0.1866 0.2414 0.2177 0.0440  -0.0262 0.0180  155 GLY A N     
136  C CA    . GLY A 27  ? 0.1944 0.2673 0.2368 0.0474  -0.0234 0.0193  155 GLY A CA    
137  C C     . GLY A 27  ? 0.2228 0.2914 0.2635 0.0524  -0.0165 0.0140  155 GLY A C     
138  O O     . GLY A 27  ? 0.1961 0.2751 0.2398 0.0503  -0.0131 0.0139  155 GLY A O     
139  N N     . LEU A 28  ? 0.1791 0.2321 0.2145 0.0590  -0.0145 0.0099  156 LEU A N     
140  C CA    . LEU A 28  ? 0.1699 0.2175 0.2016 0.0639  -0.0090 0.0037  156 LEU A CA    
141  C C     . LEU A 28  ? 0.2094 0.2510 0.2329 0.0560  -0.0083 0.0002  156 LEU A C     
142  O O     . LEU A 28  ? 0.1928 0.2404 0.2148 0.0571  -0.0044 -0.0020 156 LEU A O     
143  C CB    . LEU A 28  ? 0.1534 0.1832 0.1813 0.0712  -0.0084 -0.0005 156 LEU A CB    
144  C CG    . LEU A 28  ? 0.1590 0.1917 0.1948 0.0812  -0.0084 0.0030  156 LEU A CG    
145  C CD1   . LEU A 28  ? 0.1926 0.2029 0.2237 0.0865  -0.0081 -0.0012 156 LEU A CD1   
146  C CD2   . LEU A 28  ? 0.1935 0.2438 0.2376 0.0902  -0.0034 0.0032  156 LEU A CD2   
147  N N     . SER A 29  ? 0.1821 0.2124 0.2000 0.0487  -0.0116 0.0002  157 SER A N     
148  C CA    A SER A 29  ? 0.1732 0.1974 0.1845 0.0422  -0.0111 -0.0026 157 SER A CA    
149  C CA    B SER A 29  ? 0.1748 0.1991 0.1861 0.0422  -0.0111 -0.0026 157 SER A CA    
150  C C     . SER A 29  ? 0.1577 0.1949 0.1716 0.0366  -0.0104 0.0008  157 SER A C     
151  O O     . SER A 29  ? 0.1626 0.2004 0.1731 0.0350  -0.0080 -0.0006 157 SER A O     
152  C CB    A SER A 29  ? 0.1837 0.1943 0.1897 0.0366  -0.0138 -0.0028 157 SER A CB    
153  C CB    B SER A 29  ? 0.1813 0.1922 0.1875 0.0367  -0.0138 -0.0028 157 SER A CB    
154  O OG    A SER A 29  ? 0.1785 0.1925 0.1852 0.0323  -0.0170 0.0016  157 SER A OG    
155  O OG    B SER A 29  ? 0.1922 0.1907 0.1970 0.0407  -0.0139 -0.0051 157 SER A OG    
156  N N     A GLU A 30  ? 0.1537 0.2012 0.1738 0.0333  -0.0131 0.0057  158 GLU A N     
157  N N     B GLU A 30  ? 0.1538 0.2014 0.1740 0.0334  -0.0131 0.0057  158 GLU A N     
158  C CA    A GLU A 30  ? 0.1522 0.2118 0.1769 0.0266  -0.0131 0.0095  158 GLU A CA    
159  C CA    B GLU A 30  ? 0.1501 0.2093 0.1745 0.0265  -0.0131 0.0094  158 GLU A CA    
160  C C     A GLU A 30  ? 0.1463 0.2188 0.1756 0.0309  -0.0076 0.0105  158 GLU A C     
161  C C     B GLU A 30  ? 0.1451 0.2186 0.1750 0.0307  -0.0077 0.0108  158 GLU A C     
162  O O     A GLU A 30  ? 0.1450 0.2196 0.1724 0.0266  -0.0051 0.0116  158 GLU A O     
163  O O     B GLU A 30  ? 0.1458 0.2232 0.1751 0.0259  -0.0054 0.0127  158 GLU A O     
164  C CB    A GLU A 30  ? 0.1653 0.2361 0.1977 0.0227  -0.0180 0.0143  158 GLU A CB    
165  C CB    B GLU A 30  ? 0.1709 0.2396 0.2019 0.0218  -0.0182 0.0139  158 GLU A CB    
166  C CG    A GLU A 30  ? 0.1862 0.2652 0.2228 0.0126  -0.0197 0.0176  158 GLU A CG    
167  C CG    B GLU A 30  ? 0.2130 0.2679 0.2353 0.0155  -0.0230 0.0125  158 GLU A CG    
168  C CD    A GLU A 30  ? 0.2435 0.3442 0.2933 0.0135  -0.0167 0.0226  158 GLU A CD    
169  C CD    B GLU A 30  ? 0.2780 0.3416 0.3041 0.0107  -0.0294 0.0161  158 GLU A CD    
170  O OE1   A GLU A 30  ? 0.2593 0.3702 0.3153 0.0230  -0.0135 0.0234  158 GLU A OE1   
171  O OE1   B GLU A 30  ? 0.2734 0.3545 0.3109 0.0135  -0.0308 0.0203  158 GLU A OE1   
172  O OE2   A GLU A 30  ? 0.2482 0.3556 0.3028 0.0048  -0.0170 0.0259  158 GLU A OE2   
173  O OE2   B GLU A 30  ? 0.3117 0.3651 0.3291 0.0044  -0.0332 0.0145  158 GLU A OE2   
174  N N     . ALA A 31  ? 0.1356 0.2161 0.1701 0.0402  -0.0051 0.0103  159 ALA A N     
175  C CA    . ALA A 31  ? 0.1409 0.2354 0.1792 0.0459  0.0014  0.0112  159 ALA A CA    
176  C C     . ALA A 31  ? 0.1640 0.2483 0.1901 0.0475  0.0050  0.0061  159 ALA A C     
177  O O     . ALA A 31  ? 0.1720 0.2650 0.1969 0.0460  0.0092  0.0084  159 ALA A O     
178  C CB    . ALA A 31  ? 0.1432 0.2455 0.1885 0.0575  0.0039  0.0108  159 ALA A CB    
179  N N     . LEU A 32  ? 0.1820 0.2485 0.1991 0.0501  0.0030  -0.0003 160 LEU A N     
180  C CA    . LEU A 32  ? 0.1821 0.2397 0.1879 0.0511  0.0046  -0.0053 160 LEU A CA    
181  C C     . LEU A 32  ? 0.1706 0.2265 0.1731 0.0421  0.0033  -0.0022 160 LEU A C     
182  O O     . LEU A 32  ? 0.2016 0.2589 0.1973 0.0424  0.0058  -0.0025 160 LEU A O     
183  C CB    . LEU A 32  ? 0.1650 0.2046 0.1646 0.0539  0.0017  -0.0123 160 LEU A CB    
184  C CG    . LEU A 32  ? 0.1924 0.2301 0.1935 0.0640  0.0037  -0.0164 160 LEU A CG    
185  C CD1   . LEU A 32  ? 0.1860 0.2043 0.1834 0.0646  0.0000  -0.0219 160 LEU A CD1   
186  C CD2   . LEU A 32  ? 0.2374 0.2813 0.2321 0.0717  0.0093  -0.0206 160 LEU A CD2   
187  N N     . GLU A 33  ? 0.1585 0.2110 0.1650 0.0346  -0.0005 0.0011  161 GLU A N     
188  C CA    . GLU A 33  ? 0.1596 0.2078 0.1631 0.0268  -0.0014 0.0037  161 GLU A CA    
189  C C     . GLU A 33  ? 0.1595 0.2217 0.1677 0.0231  0.0019  0.0103  161 GLU A C     
190  O O     . GLU A 33  ? 0.1468 0.2063 0.1509 0.0193  0.0029  0.0129  161 GLU A O     
191  C CB    . GLU A 33  ? 0.1651 0.2033 0.1694 0.0206  -0.0060 0.0039  161 GLU A CB    
192  C CG    . GLU A 33  ? 0.1780 0.2016 0.1763 0.0232  -0.0076 -0.0015 161 GLU A CG    
193  C CD    . GLU A 33  ? 0.2951 0.3082 0.2922 0.0186  -0.0105 -0.0017 161 GLU A CD    
194  O OE1   . GLU A 33  ? 0.3082 0.3240 0.3077 0.0141  -0.0123 0.0010  161 GLU A OE1   
195  O OE2   . GLU A 33  ? 0.3467 0.3493 0.3403 0.0194  -0.0110 -0.0049 161 GLU A OE2   
196  N N     . ILE A 34  ? 0.1670 0.2448 0.1848 0.0245  0.0037  0.0138  162 ILE A N     
197  C CA    . ILE A 34  ? 0.1705 0.2642 0.1946 0.0215  0.0081  0.0208  162 ILE A CA    
198  C C     . ILE A 34  ? 0.1776 0.2742 0.1929 0.0277  0.0140  0.0201  162 ILE A C     
199  O O     . ILE A 34  ? 0.1562 0.2553 0.1687 0.0237  0.0168  0.0252  162 ILE A O     
200  C CB    . ILE A 34  ? 0.1652 0.2786 0.2037 0.0229  0.0094  0.0250  162 ILE A CB    
201  C CG1   . ILE A 34  ? 0.1996 0.3118 0.2457 0.0157  0.0022  0.0263  162 ILE A CG1   
202  C CG2   . ILE A 34  ? 0.1789 0.3109 0.2252 0.0201  0.0154  0.0330  162 ILE A CG2   
203  C CD1   . ILE A 34  ? 0.2534 0.3649 0.3030 0.0034  -0.0003 0.0309  162 ILE A CD1   
204  N N     . LEU A 35  ? 0.1790 0.2742 0.1887 0.0375  0.0159  0.0138  163 LEU A N     
205  C CA    . LEU A 35  ? 0.1711 0.2686 0.1697 0.0439  0.0210  0.0118  163 LEU A CA    
206  C C     . LEU A 35  ? 0.1732 0.2569 0.1596 0.0405  0.0179  0.0102  163 LEU A C     
207  O O     . LEU A 35  ? 0.1602 0.2480 0.1383 0.0414  0.0214  0.0130  163 LEU A O     
208  C CB    . LEU A 35  ? 0.1758 0.2713 0.1697 0.0551  0.0229  0.0036  163 LEU A CB    
209  C CG    . LEU A 35  ? 0.1732 0.2842 0.1793 0.0613  0.0272  0.0057  163 LEU A CG    
210  C CD1   . LEU A 35  ? 0.1862 0.2905 0.1857 0.0731  0.0291  -0.0032 163 LEU A CD1   
211  C CD2   . LEU A 35  ? 0.1599 0.2934 0.1728 0.0611  0.0350  0.0142  163 LEU A CD2   
212  N N     . ALA A 36  ? 0.1704 0.2388 0.1560 0.0371  0.0117  0.0063  164 ALA A N     
213  C CA    . ALA A 36  ? 0.1590 0.2159 0.1362 0.0341  0.0084  0.0057  164 ALA A CA    
214  C C     . ALA A 36  ? 0.1861 0.2462 0.1653 0.0272  0.0099  0.0145  164 ALA A C     
215  O O     . ALA A 36  ? 0.1626 0.2226 0.1337 0.0277  0.0111  0.0174  164 ALA A O     
216  C CB    . ALA A 36  ? 0.1591 0.2015 0.1383 0.0314  0.0027  0.0013  164 ALA A CB    
217  N N     . GLU A 37  ? 0.1664 0.2288 0.1561 0.0207  0.0094  0.0189  165 GLU A N     
218  C CA    . GLU A 37  ? 0.2065 0.2691 0.1998 0.0127  0.0102  0.0269  165 GLU A CA    
219  C C     . GLU A 37  ? 0.2034 0.2800 0.1956 0.0137  0.0166  0.0341  165 GLU A C     
220  O O     . GLU A 37  ? 0.2120 0.2855 0.1998 0.0108  0.0180  0.0403  165 GLU A O     
221  C CB    . GLU A 37  ? 0.2404 0.3038 0.2449 0.0054  0.0077  0.0286  165 GLU A CB    
222  C CG    . GLU A 37  ? 0.3044 0.3644 0.3132 -0.0042 0.0075  0.0354  165 GLU A CG    
223  C CD    . GLU A 37  ? 0.3247 0.3865 0.3438 -0.0119 0.0038  0.0357  165 GLU A CD    
224  O OE1   . GLU A 37  ? 0.2869 0.3588 0.3117 -0.0091 0.0026  0.0332  165 GLU A OE1   
225  O OE2   . GLU A 37  ? 0.3751 0.4278 0.3961 -0.0205 0.0017  0.0384  165 GLU A OE2   
226  N N     . ALA A 38  ? 0.1823 0.2745 0.1782 0.0187  0.0211  0.0340  166 ALA A N     
227  C CA    . ALA A 38  ? 0.2005 0.3086 0.1953 0.0207  0.0288  0.0411  166 ALA A CA    
228  C C     . ALA A 38  ? 0.2038 0.3085 0.1812 0.0273  0.0308  0.0395  166 ALA A C     
229  O O     . ALA A 38  ? 0.2198 0.3305 0.1922 0.0261  0.0355  0.0476  166 ALA A O     
230  C CB    . ALA A 38  ? 0.1914 0.3180 0.1951 0.0264  0.0339  0.0405  166 ALA A CB    
231  N N     . ALA A 39  ? 0.1906 0.2857 0.1586 0.0338  0.0269  0.0293  167 ALA A N     
232  C CA    . ALA A 39  ? 0.2221 0.3127 0.1728 0.0393  0.0264  0.0262  167 ALA A CA    
233  C C     . ALA A 39  ? 0.2304 0.3124 0.1774 0.0337  0.0232  0.0329  167 ALA A C     
234  O O     . ALA A 39  ? 0.2258 0.3116 0.1617 0.0356  0.0256  0.0382  167 ALA A O     
235  C CB    . ALA A 39  ? 0.2209 0.3005 0.1654 0.0447  0.0209  0.0140  167 ALA A CB    
236  N N     . GLY A 40  ? 0.1819 0.2524 0.1378 0.0274  0.0180  0.0329  168 GLY A N     
237  C CA    . GLY A 40  ? 0.2222 0.2829 0.1768 0.0227  0.0154  0.0391  168 GLY A CA    
238  C C     . GLY A 40  ? 0.2456 0.3132 0.2020 0.0181  0.0209  0.0515  168 GLY A C     
239  O O     . GLY A 40  ? 0.2578 0.3227 0.2059 0.0187  0.0212  0.0581  168 GLY A O     
240  N N     . PHE A 41  ? 0.2113 0.2887 0.1791 0.0136  0.0252  0.0554  169 PHE A N     
241  C CA    . PHE A 41  ? 0.2297 0.3148 0.2020 0.0078  0.0309  0.0680  169 PHE A CA    
242  C C     . PHE A 41  ? 0.2584 0.3553 0.2178 0.0140  0.0373  0.0737  169 PHE A C     
243  O O     . PHE A 41  ? 0.2580 0.3569 0.2156 0.0104  0.0414  0.0854  169 PHE A O     
244  C CB    . PHE A 41  ? 0.2101 0.3076 0.1988 0.0018  0.0340  0.0707  169 PHE A CB    
245  C CG    . PHE A 41  ? 0.2157 0.3025 0.2158 -0.0058 0.0277  0.0669  169 PHE A CG    
246  C CD1   . PHE A 41  ? 0.2230 0.2894 0.2196 -0.0089 0.0221  0.0647  169 PHE A CD1   
247  C CD2   . PHE A 41  ? 0.2252 0.3231 0.2390 -0.0093 0.0275  0.0656  169 PHE A CD2   
248  C CE1   . PHE A 41  ? 0.2468 0.3029 0.2513 -0.0154 0.0169  0.0604  169 PHE A CE1   
249  C CE2   . PHE A 41  ? 0.2264 0.3148 0.2481 -0.0163 0.0211  0.0619  169 PHE A CE2   
250  C CZ    . PHE A 41  ? 0.2348 0.3016 0.2507 -0.0193 0.0161  0.0588  169 PHE A CZ    
251  N N     . GLU A 42  ? 0.2806 0.3847 0.2302 0.0232  0.0386  0.0655  170 GLU A N     
252  C CA    . GLU A 42  ? 0.3077 0.4228 0.2418 0.0302  0.0447  0.0691  170 GLU A CA    
253  C C     . GLU A 42  ? 0.3259 0.4310 0.2414 0.0351  0.0392  0.0663  170 GLU A C     
254  O O     . GLU A 42  ? 0.3619 0.4746 0.2605 0.0415  0.0428  0.0678  170 GLU A O     
255  C CB    . GLU A 42  ? 0.3371 0.4655 0.2692 0.0383  0.0499  0.0614  170 GLU A CB    
256  C CG    . GLU A 42  ? 0.3618 0.5039 0.3139 0.0342  0.0553  0.0655  170 GLU A CG    
257  C CD    . GLU A 42  ? 0.3881 0.5390 0.3507 0.0250  0.0607  0.0810  170 GLU A CD    
258  O OE1   . GLU A 42  ? 0.4585 0.6195 0.4117 0.0273  0.0684  0.0898  170 GLU A OE1   
259  O OE2   . GLU A 42  ? 0.3143 0.4617 0.2941 0.0151  0.0574  0.0844  170 GLU A OE2   
260  N N     . GLY A 43  ? 0.3091 0.3983 0.2276 0.0323  0.0306  0.0627  171 GLY A N     
261  C CA    . GLY A 43  ? 0.3257 0.4070 0.2305 0.0363  0.0242  0.0608  171 GLY A CA    
262  C C     . GLY A 43  ? 0.3318 0.4127 0.2256 0.0436  0.0196  0.0471  171 GLY A C     
263  O O     . GLY A 43  ? 0.3376 0.4169 0.2168 0.0479  0.0148  0.0452  171 GLY A O     
264  N N     . SER A 44  ? 0.2812 0.3630 0.1824 0.0447  0.0205  0.0377  172 SER A N     
265  C CA    . SER A 44  ? 0.2952 0.3744 0.1878 0.0510  0.0167  0.0242  172 SER A CA    
266  C C     . SER A 44  ? 0.2706 0.3364 0.1730 0.0478  0.0084  0.0172  172 SER A C     
267  O O     . SER A 44  ? 0.2491 0.3118 0.1625 0.0466  0.0085  0.0118  172 SER A O     
268  C CB    . SER A 44  ? 0.3251 0.4130 0.2200 0.0555  0.0236  0.0190  172 SER A CB    
269  O OG    . SER A 44  ? 0.3539 0.4565 0.2419 0.0584  0.0330  0.0266  172 SER A OG    
270  N N     . GLU A 45  ? 0.2612 0.3201 0.1604 0.0465  0.0015  0.0184  173 GLU A N     
271  C CA    . GLU A 45  ? 0.2687 0.3166 0.1792 0.0430  -0.0051 0.0138  173 GLU A CA    
272  C C     . GLU A 45  ? 0.2354 0.2787 0.1443 0.0458  -0.0097 0.0008  173 GLU A C     
273  O O     . GLU A 45  ? 0.2389 0.2746 0.1592 0.0430  -0.0123 -0.0034 173 GLU A O     
274  C CB    . GLU A 45  ? 0.3378 0.3815 0.2476 0.0417  -0.0106 0.0197  173 GLU A CB    
275  C CG    . GLU A 45  ? 0.3747 0.4171 0.2905 0.0377  -0.0064 0.0324  173 GLU A CG    
276  C CD    . GLU A 45  ? 0.4066 0.4410 0.3383 0.0320  -0.0048 0.0324  173 GLU A CD    
277  O OE1   . GLU A 45  ? 0.3743 0.4018 0.3132 0.0312  -0.0087 0.0253  173 GLU A OE1   
278  O OE2   . GLU A 45  ? 0.4507 0.4858 0.3875 0.0278  0.0004  0.0397  173 GLU A OE2   
279  N N     . GLY A 46  ? 0.2637 0.3108 0.1576 0.0512  -0.0104 -0.0056 174 GLY A N     
280  C CA    . GLY A 46  ? 0.2483 0.2888 0.1401 0.0535  -0.0146 -0.0185 174 GLY A CA    
281  C C     . GLY A 46  ? 0.2465 0.2855 0.1473 0.0546  -0.0090 -0.0221 174 GLY A C     
282  O O     . GLY A 46  ? 0.2516 0.2818 0.1614 0.0530  -0.0121 -0.0280 174 GLY A O     
283  N N     . ARG A 47  ? 0.2358 0.2845 0.1345 0.0576  -0.0007 -0.0177 175 ARG A N     
284  C CA    . ARG A 47  ? 0.2226 0.2728 0.1311 0.0594  0.0046  -0.0196 175 ARG A CA    
285  C C     . ARG A 47  ? 0.2118 0.2579 0.1382 0.0528  0.0031  -0.0150 175 ARG A C     
286  O O     . ARG A 47  ? 0.2024 0.2435 0.1371 0.0533  0.0026  -0.0194 175 ARG A O     
287  C CB    . ARG A 47  ? 0.2240 0.2891 0.1296 0.0634  0.0142  -0.0137 175 ARG A CB    
288  C CG    . ARG A 47  ? 0.2495 0.3182 0.1362 0.0720  0.0173  -0.0205 175 ARG A CG    
289  C CD    . ARG A 47  ? 0.2988 0.3845 0.1818 0.0762  0.0281  -0.0131 175 ARG A CD    
290  N NE    . ARG A 47  ? 0.4317 0.5193 0.2959 0.0862  0.0321  -0.0221 175 ARG A NE    
291  C CZ    . ARG A 47  ? 0.4809 0.5654 0.3233 0.0891  0.0289  -0.0268 175 ARG A CZ    
292  N NH1   . ARG A 47  ? 0.4963 0.5773 0.3343 0.0832  0.0213  -0.0222 175 ARG A NH1   
293  N NH2   . ARG A 47  ? 0.4823 0.5644 0.3139 0.0952  0.0314  -0.0349 175 ARG A NH2   
294  N N     . LEU A 48  ? 0.1824 0.2295 0.1134 0.0469  0.0026  -0.0061 176 LEU A N     
295  C CA    . LEU A 48  ? 0.1916 0.2331 0.1365 0.0405  0.0009  -0.0027 176 LEU A CA    
296  C C     . LEU A 48  ? 0.1768 0.2064 0.1251 0.0397  -0.0051 -0.0098 176 LEU A C     
297  O O     . LEU A 48  ? 0.1795 0.2047 0.1368 0.0377  -0.0054 -0.0112 176 LEU A O     
298  C CB    . LEU A 48  ? 0.2059 0.2465 0.1528 0.0351  0.0006  0.0065  176 LEU A CB    
299  C CG    . LEU A 48  ? 0.2284 0.2605 0.1866 0.0288  -0.0014 0.0089  176 LEU A CG    
300  C CD1   . LEU A 48  ? 0.2397 0.2729 0.2006 0.0237  0.0012  0.0187  176 LEU A CD1   
301  C CD2   . LEU A 48  ? 0.2077 0.2292 0.1667 0.0283  -0.0070 0.0050  176 LEU A CD2   
302  N N     . LEU A 49  ? 0.1677 0.1930 0.1092 0.0407  -0.0101 -0.0136 177 LEU A N     
303  C CA    . LEU A 49  ? 0.1874 0.2029 0.1341 0.0389  -0.0157 -0.0193 177 LEU A CA    
304  C C     . LEU A 49  ? 0.2233 0.2338 0.1712 0.0418  -0.0156 -0.0274 177 LEU A C     
305  O O     . LEU A 49  ? 0.2015 0.2049 0.1584 0.0394  -0.0168 -0.0288 177 LEU A O     
306  C CB    . LEU A 49  ? 0.2152 0.2301 0.1555 0.0393  -0.0218 -0.0215 177 LEU A CB    
307  C CG    . LEU A 49  ? 0.2184 0.2260 0.1657 0.0366  -0.0281 -0.0262 177 LEU A CG    
308  C CD1   . LEU A 49  ? 0.1967 0.2000 0.1573 0.0323  -0.0268 -0.0214 177 LEU A CD1   
309  C CD2   . LEU A 49  ? 0.2310 0.2426 0.1719 0.0371  -0.0345 -0.0262 177 LEU A CD2   
310  N N     . THR A 50  ? 0.1996 0.2133 0.1378 0.0475  -0.0136 -0.0323 178 THR A N     
311  C CA    . THR A 50  ? 0.2063 0.2132 0.1453 0.0513  -0.0132 -0.0402 178 THR A CA    
312  C C     . THR A 50  ? 0.2253 0.2339 0.1753 0.0514  -0.0088 -0.0360 178 THR A C     
313  O O     . THR A 50  ? 0.2256 0.2251 0.1822 0.0510  -0.0105 -0.0389 178 THR A O     
314  C CB    . THR A 50  ? 0.2073 0.2166 0.1322 0.0588  -0.0108 -0.0470 178 THR A CB    
315  O OG1   . THR A 50  ? 0.2439 0.2476 0.1587 0.0582  -0.0175 -0.0540 178 THR A OG1   
316  C CG2   . THR A 50  ? 0.2308 0.2340 0.1582 0.0644  -0.0079 -0.0532 178 THR A CG2   
317  N N     . PHE A 51  ? 0.1900 0.2102 0.1425 0.0513  -0.0038 -0.0286 179 PHE A N     
318  C CA    . PHE A 51  ? 0.1901 0.2139 0.1535 0.0509  -0.0011 -0.0245 179 PHE A CA    
319  C C     . PHE A 51  ? 0.1908 0.2072 0.1625 0.0441  -0.0047 -0.0216 179 PHE A C     
320  O O     . PHE A 51  ? 0.1593 0.1723 0.1376 0.0444  -0.0051 -0.0216 179 PHE A O     
321  C CB    . PHE A 51  ? 0.1976 0.2370 0.1638 0.0507  0.0045  -0.0169 179 PHE A CB    
322  C CG    . PHE A 51  ? 0.2090 0.2581 0.1697 0.0591  0.0103  -0.0192 179 PHE A CG    
323  C CD1   . PHE A 51  ? 0.2094 0.2556 0.1713 0.0667  0.0118  -0.0253 179 PHE A CD1   
324  C CD2   . PHE A 51  ? 0.2434 0.3043 0.1978 0.0599  0.0151  -0.0147 179 PHE A CD2   
325  C CE1   . PHE A 51  ? 0.2416 0.2963 0.1981 0.0758  0.0183  -0.0281 179 PHE A CE1   
326  C CE2   . PHE A 51  ? 0.2444 0.3153 0.1929 0.0685  0.0219  -0.0167 179 PHE A CE2   
327  C CZ    . PHE A 51  ? 0.2443 0.3121 0.1938 0.0768  0.0237  -0.0240 179 PHE A CZ    
328  N N     . CYS A 52  ? 0.1673 0.1810 0.1381 0.0389  -0.0071 -0.0189 180 CYS A N     
329  C CA    . CYS A 52  ? 0.1519 0.1576 0.1288 0.0335  -0.0097 -0.0171 180 CYS A CA    
330  C C     . CYS A 52  ? 0.1777 0.1729 0.1565 0.0343  -0.0127 -0.0226 180 CYS A C     
331  O O     . CYS A 52  ? 0.1596 0.1499 0.1438 0.0323  -0.0129 -0.0213 180 CYS A O     
332  C CB    . CYS A 52  ? 0.1607 0.1650 0.1361 0.0296  -0.0112 -0.0138 180 CYS A CB    
333  S SG    . CYS A 52  ? 0.2404 0.2515 0.2168 0.0258  -0.0080 -0.0054 180 CYS A SG    
334  N N     . ARG A 53  ? 0.1753 0.1670 0.1493 0.0366  -0.0152 -0.0284 181 ARG A N     
335  C CA    . ARG A 53  ? 0.1809 0.1620 0.1578 0.0363  -0.0184 -0.0338 181 ARG A CA    
336  C C     . ARG A 53  ? 0.2033 0.1797 0.1825 0.0401  -0.0166 -0.0357 181 ARG A C     
337  O O     . ARG A 53  ? 0.2063 0.1746 0.1913 0.0382  -0.0175 -0.0351 181 ARG A O     
338  C CB    . ARG A 53  ? 0.1638 0.1423 0.1343 0.0375  -0.0225 -0.0407 181 ARG A CB    
339  C CG    . ARG A 53  ? 0.1557 0.1378 0.1262 0.0337  -0.0261 -0.0385 181 ARG A CG    
340  C CD    . ARG A 53  ? 0.1766 0.1584 0.1387 0.0353  -0.0312 -0.0456 181 ARG A CD    
341  N NE    . ARG A 53  ? 0.1728 0.1593 0.1358 0.0322  -0.0360 -0.0433 181 ARG A NE    
342  C CZ    . ARG A 53  ? 0.1838 0.1740 0.1372 0.0337  -0.0409 -0.0471 181 ARG A CZ    
343  N NH1   . ARG A 53  ? 0.2146 0.2036 0.1549 0.0381  -0.0408 -0.0541 181 ARG A NH1   
344  N NH2   . ARG A 53  ? 0.1955 0.1913 0.1514 0.0313  -0.0459 -0.0438 181 ARG A NH2   
345  N N     . ALA A 54  ? 0.1862 0.1682 0.1610 0.0461  -0.0136 -0.0375 182 ALA A N     
346  C CA    . ALA A 54  ? 0.1792 0.1578 0.1572 0.0515  -0.0115 -0.0387 182 ALA A CA    
347  C C     . ALA A 54  ? 0.1903 0.1720 0.1764 0.0491  -0.0106 -0.0311 182 ALA A C     
348  O O     . ALA A 54  ? 0.1827 0.1566 0.1731 0.0503  -0.0112 -0.0305 182 ALA A O     
349  C CB    . ALA A 54  ? 0.2068 0.1938 0.1796 0.0593  -0.0073 -0.0409 182 ALA A CB    
350  N N     . ALA A 55  ? 0.1565 0.1488 0.1439 0.0454  -0.0094 -0.0253 183 ALA A N     
351  C CA    . ALA A 55  ? 0.1740 0.1688 0.1672 0.0422  -0.0097 -0.0192 183 ALA A CA    
352  C C     . ALA A 55  ? 0.1600 0.1430 0.1542 0.0377  -0.0121 -0.0190 183 ALA A C     
353  O O     . ALA A 55  ? 0.1677 0.1471 0.1647 0.0378  -0.0127 -0.0161 183 ALA A O     
354  C CB    . ALA A 55  ? 0.1957 0.2010 0.1895 0.0374  -0.0087 -0.0142 183 ALA A CB    
355  N N     . SER A 56  ? 0.1556 0.1337 0.1479 0.0342  -0.0133 -0.0211 184 SER A N     
356  C CA    A SER A 56  ? 0.1488 0.1181 0.1435 0.0300  -0.0144 -0.0202 184 SER A CA    
357  C CA    B SER A 56  ? 0.1484 0.1177 0.1431 0.0300  -0.0144 -0.0201 184 SER A CA    
358  C C     . SER A 56  ? 0.1554 0.1145 0.1528 0.0320  -0.0152 -0.0223 184 SER A C     
359  O O     . SER A 56  ? 0.1713 0.1245 0.1712 0.0298  -0.0148 -0.0190 184 SER A O     
360  C CB    A SER A 56  ? 0.1628 0.1315 0.1573 0.0267  -0.0156 -0.0217 184 SER A CB    
361  C CB    B SER A 56  ? 0.1627 0.1314 0.1573 0.0266  -0.0155 -0.0215 184 SER A CB    
362  O OG    A SER A 56  ? 0.1838 0.1475 0.1818 0.0228  -0.0151 -0.0192 184 SER A OG    
363  O OG    B SER A 56  ? 0.1844 0.1492 0.1791 0.0277  -0.0181 -0.0269 184 SER A OG    
364  N N     . VAL A 57  ? 0.1687 0.1247 0.1647 0.0362  -0.0161 -0.0278 185 VAL A N     
365  C CA    . VAL A 57  ? 0.1696 0.1133 0.1682 0.0384  -0.0169 -0.0303 185 VAL A CA    
366  C C     . VAL A 57  ? 0.2113 0.1540 0.2123 0.0417  -0.0153 -0.0248 185 VAL A C     
367  O O     . VAL A 57  ? 0.2116 0.1446 0.2158 0.0404  -0.0155 -0.0218 185 VAL A O     
368  C CB    . VAL A 57  ? 0.1988 0.1384 0.1932 0.0435  -0.0179 -0.0384 185 VAL A CB    
369  C CG1   . VAL A 57  ? 0.2451 0.1709 0.2419 0.0478  -0.0179 -0.0405 185 VAL A CG1   
370  C CG2   . VAL A 57  ? 0.1982 0.1354 0.1905 0.0393  -0.0215 -0.0442 185 VAL A CG2   
371  N N     . LEU A 58  ? 0.1716 0.1255 0.1717 0.0455  -0.0139 -0.0223 186 LEU A N     
372  C CA    . LEU A 58  ? 0.1669 0.1228 0.1699 0.0487  -0.0136 -0.0164 186 LEU A CA    
373  C C     . LEU A 58  ? 0.1640 0.1196 0.1665 0.0429  -0.0144 -0.0102 186 LEU A C     
374  O O     . LEU A 58  ? 0.2023 0.1528 0.2057 0.0443  -0.0148 -0.0054 186 LEU A O     
375  C CB    . LEU A 58  ? 0.2017 0.1730 0.2061 0.0532  -0.0123 -0.0148 186 LEU A CB    
376  C CG    . LEU A 58  ? 0.2136 0.1862 0.2173 0.0610  -0.0100 -0.0205 186 LEU A CG    
377  C CD1   . LEU A 58  ? 0.2246 0.2148 0.2324 0.0656  -0.0077 -0.0171 186 LEU A CD1   
378  C CD2   . LEU A 58  ? 0.2140 0.1715 0.2188 0.0672  -0.0100 -0.0235 186 LEU A CD2   
379  N N     . LYS A 59  ? 0.1717 0.1321 0.1717 0.0369  -0.0143 -0.0101 187 LYS A N     
380  C CA    . LYS A 59  ? 0.1515 0.1102 0.1489 0.0318  -0.0142 -0.0057 187 LYS A CA    
381  C C     . LYS A 59  ? 0.1701 0.1168 0.1685 0.0302  -0.0132 -0.0045 187 LYS A C     
382  O O     . LYS A 59  ? 0.1948 0.1387 0.1903 0.0283  -0.0125 0.0005  187 LYS A O     
383  C CB    . LYS A 59  ? 0.1320 0.0950 0.1268 0.0267  -0.0136 -0.0068 187 LYS A CB    
384  C CG    . LYS A 59  ? 0.1540 0.1283 0.1485 0.0267  -0.0142 -0.0068 187 LYS A CG    
385  C CD    . LYS A 59  ? 0.1899 0.1648 0.1821 0.0218  -0.0134 -0.0076 187 LYS A CD    
386  C CE    . LYS A 59  ? 0.2346 0.2196 0.2274 0.0216  -0.0134 -0.0072 187 LYS A CE    
387  N NZ    . LYS A 59  ? 0.2348 0.2184 0.2254 0.0173  -0.0126 -0.0071 187 LYS A NZ    
388  N N     . ALA A 60  ? 0.1709 0.1109 0.1731 0.0303  -0.0133 -0.0089 188 ALA A N     
389  C CA    . ALA A 60  ? 0.2005 0.1300 0.2062 0.0272  -0.0124 -0.0075 188 ALA A CA    
390  C C     . ALA A 60  ? 0.2136 0.1329 0.2215 0.0308  -0.0125 -0.0049 188 ALA A C     
391  O O     . ALA A 60  ? 0.2029 0.1126 0.2143 0.0278  -0.0113 -0.0020 188 ALA A O     
392  C CB    . ALA A 60  ? 0.2022 0.1295 0.2125 0.0242  -0.0136 -0.0133 188 ALA A CB    
393  N N     . LEU A 61  ? 0.2000 0.1211 0.2069 0.0373  -0.0136 -0.0052 189 LEU A N     
394  C CA    . LEU A 61  ? 0.2128 0.1225 0.2222 0.0421  -0.0137 -0.0025 189 LEU A CA    
395  C C     . LEU A 61  ? 0.2177 0.1258 0.2250 0.0416  -0.0129 0.0073  189 LEU A C     
396  O O     . LEU A 61  ? 0.2037 0.1223 0.2058 0.0401  -0.0131 0.0108  189 LEU A O     
397  C CB    . LEU A 61  ? 0.2179 0.1315 0.2277 0.0508  -0.0144 -0.0052 189 LEU A CB    
398  C CG    . LEU A 61  ? 0.2460 0.1569 0.2560 0.0531  -0.0147 -0.0151 189 LEU A CG    
399  C CD1   . LEU A 61  ? 0.2563 0.1751 0.2660 0.0622  -0.0137 -0.0170 189 LEU A CD1   
400  C CD2   . LEU A 61  ? 0.2860 0.1777 0.2986 0.0522  -0.0154 -0.0190 189 LEU A CD2   
401  N N     . PRO A 62  ? 0.2385 0.1326 0.2486 0.0428  -0.0122 0.0116  190 PRO A N     
402  C CA    . PRO A 62  ? 0.2368 0.1285 0.2430 0.0421  -0.0110 0.0220  190 PRO A CA    
403  C C     . PRO A 62  ? 0.2332 0.1302 0.2367 0.0498  -0.0134 0.0281  190 PRO A C     
404  O O     . PRO A 62  ? 0.2297 0.1265 0.2279 0.0499  -0.0134 0.0371  190 PRO A O     
405  C CB    . PRO A 62  ? 0.2510 0.1250 0.2629 0.0401  -0.0092 0.0248  190 PRO A CB    
406  C CG    . PRO A 62  ? 0.3064 0.1715 0.3237 0.0449  -0.0111 0.0169  190 PRO A CG    
407  C CD    . PRO A 62  ? 0.2752 0.1533 0.2911 0.0441  -0.0124 0.0074  190 PRO A CD    
408  N N     . SER A 63  ? 0.2103 0.1127 0.2174 0.0566  -0.0152 0.0237  191 SER A N     
409  C CA    . SER A 63  ? 0.2105 0.1206 0.2182 0.0645  -0.0177 0.0298  191 SER A CA    
410  C C     . SER A 63  ? 0.2099 0.1328 0.2221 0.0699  -0.0185 0.0234  191 SER A C     
411  O O     . SER A 63  ? 0.2209 0.1437 0.2340 0.0678  -0.0169 0.0146  191 SER A O     
412  C CB    . SER A 63  ? 0.2801 0.1745 0.2910 0.0711  -0.0174 0.0362  191 SER A CB    
413  O OG    . SER A 63  ? 0.2887 0.1700 0.3055 0.0749  -0.0158 0.0288  191 SER A OG    
414  N N     . PRO A 64  ? 0.2041 0.1397 0.2193 0.0766  -0.0209 0.0285  192 PRO A N     
415  C CA    . PRO A 64  ? 0.1969 0.1477 0.2179 0.0814  -0.0206 0.0237  192 PRO A CA    
416  C C     . PRO A 64  ? 0.2060 0.1473 0.2318 0.0898  -0.0173 0.0172  192 PRO A C     
417  O O     . PRO A 64  ? 0.2370 0.1626 0.2650 0.0961  -0.0167 0.0195  192 PRO A O     
418  C CB    . PRO A 64  ? 0.1987 0.1657 0.2241 0.0868  -0.0245 0.0326  192 PRO A CB    
419  C CG    . PRO A 64  ? 0.2013 0.1655 0.2183 0.0805  -0.0278 0.0400  192 PRO A CG    
420  C CD    . PRO A 64  ? 0.2471 0.1880 0.2600 0.0786  -0.0245 0.0394  192 PRO A CD    
421  N N     . VAL A 65  ? 0.1987 0.1487 0.2252 0.0902  -0.0150 0.0094  193 VAL A N     
422  C CA    . VAL A 65  ? 0.2091 0.1537 0.2385 0.0999  -0.0115 0.0026  193 VAL A CA    
423  C C     . VAL A 65  ? 0.2474 0.2070 0.2857 0.1108  -0.0110 0.0082  193 VAL A C     
424  O O     . VAL A 65  ? 0.2387 0.2208 0.2812 0.1093  -0.0119 0.0117  193 VAL A O     
425  C CB    . VAL A 65  ? 0.2111 0.1615 0.2364 0.0971  -0.0088 -0.0070 193 VAL A CB    
426  C CG1   . VAL A 65  ? 0.2562 0.2033 0.2824 0.1085  -0.0046 -0.0141 193 VAL A CG1   
427  C CG2   . VAL A 65  ? 0.2240 0.1607 0.2423 0.0873  -0.0100 -0.0124 193 VAL A CG2   
428  N N     . THR A 66  ? 0.2743 0.2231 0.3175 0.1186  -0.0095 0.0094  194 THR A N     
429  C CA    . THR A 66  ? 0.3099 0.2747 0.3639 0.1271  -0.0086 0.0142  194 THR A CA    
430  C C     . THR A 66  ? 0.3287 0.2895 0.3860 0.1346  -0.0027 0.0063  194 THR A C     
431  O O     . THR A 66  ? 0.3153 0.2909 0.3821 0.1422  -0.0009 0.0091  194 THR A O     
432  C CB    . THR A 66  ? 0.3554 0.3158 0.4144 0.1298  -0.0126 0.0245  194 THR A CB    
433  O OG1   . THR A 66  ? 0.3769 0.3109 0.4336 0.1299  -0.0113 0.0219  194 THR A OG1   
434  C CG2   . THR A 66  ? 0.3597 0.3270 0.4138 0.1230  -0.0184 0.0333  194 THR A CG2   
435  N N     . THR A 67  ? 0.3287 0.2700 0.3783 0.1324  0.0001  -0.0035 195 THR A N     
436  C CA    A THR A 67  ? 0.3640 0.3005 0.4141 0.1395  0.0058  -0.0119 195 THR A CA    
437  C CA    B THR A 67  ? 0.3647 0.3000 0.4147 0.1394  0.0058  -0.0120 195 THR A CA    
438  C C     . THR A 67  ? 0.3898 0.3176 0.4277 0.1345  0.0081  -0.0238 195 THR A C     
439  O O     . THR A 67  ? 0.4202 0.3368 0.4508 0.1255  0.0049  -0.0262 195 THR A O     
440  C CB    A THR A 67  ? 0.3931 0.3096 0.4486 0.1447  0.0063  -0.0112 195 THR A CB    
441  C CB    B THR A 67  ? 0.3980 0.3112 0.4523 0.1436  0.0062  -0.0121 195 THR A CB    
442  O OG1   A THR A 67  ? 0.4167 0.3311 0.4736 0.1532  0.0121  -0.0190 195 THR A OG1   
443  O OG1   B THR A 67  ? 0.4093 0.2999 0.4571 0.1351  0.0041  -0.0148 195 THR A OG1   
444  C CG2   A THR A 67  ? 0.4052 0.2961 0.4547 0.1366  0.0043  -0.0141 195 THR A CG2   
445  C CG2   B THR A 67  ? 0.4026 0.3224 0.4681 0.1488  0.0027  -0.0001 195 THR A CG2   
446  N N     . LEU A 68  ? 0.4073 0.3418 0.4429 0.1404  0.0135  -0.0307 196 LEU A N     
447  C CA    . LEU A 68  ? 0.4144 0.3448 0.4369 0.1365  0.0152  -0.0415 196 LEU A CA    
448  C C     . LEU A 68  ? 0.4166 0.3201 0.4311 0.1303  0.0128  -0.0491 196 LEU A C     
449  O O     . LEU A 68  ? 0.3938 0.2935 0.3985 0.1226  0.0104  -0.0550 196 LEU A O     
450  C CB    . LEU A 68  ? 0.4434 0.3836 0.4640 0.1452  0.0222  -0.0470 196 LEU A CB    
451  C CG    . LEU A 68  ? 0.4829 0.4240 0.4888 0.1430  0.0247  -0.0570 196 LEU A CG    
452  C CD1   . LEU A 68  ? 0.4720 0.4309 0.4750 0.1366  0.0227  -0.0534 196 LEU A CD1   
453  C CD2   . LEU A 68  ? 0.5058 0.4550 0.5106 0.1532  0.0325  -0.0612 196 LEU A CD2   
454  N N     . SER A 69  ? 0.4265 0.3123 0.4465 0.1331  0.0132  -0.0484 197 SER A N     
455  C CA    . SER A 69  ? 0.4733 0.3336 0.4878 0.1265  0.0112  -0.0547 197 SER A CA    
456  C C     . SER A 69  ? 0.4469 0.3029 0.4589 0.1145  0.0056  -0.0517 197 SER A C     
457  O O     . SER A 69  ? 0.4509 0.2924 0.4564 0.1067  0.0033  -0.0584 197 SER A O     
458  C CB    . SER A 69  ? 0.5394 0.3821 0.5627 0.1314  0.0128  -0.0518 197 SER A CB    
459  O OG    . SER A 69  ? 0.5528 0.3974 0.5859 0.1301  0.0097  -0.0392 197 SER A OG    
460  N N     . GLN A 70  ? 0.4133 0.2826 0.4308 0.1128  0.0031  -0.0416 198 GLN A N     
461  C CA    . GLN A 70  ? 0.3759 0.2410 0.3918 0.1023  -0.0015 -0.0382 198 GLN A CA    
462  C C     . GLN A 70  ? 0.3571 0.2294 0.3645 0.0955  -0.0037 -0.0454 198 GLN A C     
463  O O     . GLN A 70  ? 0.3633 0.2308 0.3695 0.0861  -0.0074 -0.0449 198 GLN A O     
464  C CB    . GLN A 70  ? 0.4052 0.2816 0.4275 0.1030  -0.0035 -0.0258 198 GLN A CB    
465  C CG    . GLN A 70  ? 0.4281 0.2942 0.4585 0.1073  -0.0031 -0.0172 198 GLN A CG    
466  C CD    . GLN A 70  ? 0.4480 0.3301 0.4841 0.1114  -0.0053 -0.0053 198 GLN A CD    
467  O OE1   . GLN A 70  ? 0.4174 0.3195 0.4526 0.1127  -0.0061 -0.0041 198 GLN A OE1   
468  N NE2   . GLN A 70  ? 0.4777 0.3514 0.5196 0.1132  -0.0067 0.0038  198 GLN A NE2   
469  N N     . LEU A 71  ? 0.3557 0.2396 0.3576 0.1004  -0.0011 -0.0515 199 LEU A N     
470  C CA    . LEU A 71  ? 0.3659 0.2568 0.3591 0.0948  -0.0032 -0.0578 199 LEU A CA    
471  C C     . LEU A 71  ? 0.3979 0.2732 0.3833 0.0900  -0.0052 -0.0681 199 LEU A C     
472  O O     . LEU A 71  ? 0.3860 0.2641 0.3651 0.0835  -0.0088 -0.0727 199 LEU A O     
473  C CB    . LEU A 71  ? 0.3631 0.2741 0.3526 0.1016  0.0007  -0.0589 199 LEU A CB    
474  C CG    . LEU A 71  ? 0.3549 0.2860 0.3523 0.1052  0.0021  -0.0492 199 LEU A CG    
475  C CD1   . LEU A 71  ? 0.3741 0.3249 0.3680 0.1103  0.0068  -0.0508 199 LEU A CD1   
476  C CD2   . LEU A 71  ? 0.3346 0.2687 0.3344 0.0965  -0.0027 -0.0433 199 LEU A CD2   
477  N N     . GLN A 72  ? 0.4314 0.2906 0.4174 0.0933  -0.0031 -0.0716 200 GLN A N     
478  C CA    . GLN A 72  ? 0.4563 0.2993 0.4346 0.0890  -0.0052 -0.0820 200 GLN A CA    
479  C C     . GLN A 72  ? 0.4639 0.3001 0.4442 0.0766  -0.0115 -0.0815 200 GLN A C     
480  O O     . GLN A 72  ? 0.4797 0.3107 0.4689 0.0723  -0.0126 -0.0735 200 GLN A O     
481  C CB    . GLN A 72  ? 0.4504 0.2744 0.4312 0.0942  -0.0017 -0.0845 200 GLN A CB    
482  N N     . GLY A 73  ? 0.4960 0.3335 0.4681 0.0710  -0.0158 -0.0895 201 GLY A N     
483  C CA    . GLY A 73  ? 0.5127 0.3464 0.4887 0.0593  -0.0221 -0.0892 201 GLY A CA    
484  C C     . GLY A 73  ? 0.4979 0.3474 0.4783 0.0551  -0.0243 -0.0826 201 GLY A C     
485  O O     . GLY A 73  ? 0.5234 0.3733 0.5075 0.0459  -0.0295 -0.0828 201 GLY A O     
486  N N     . LEU A 74  ? 0.4520 0.3150 0.4332 0.0615  -0.0206 -0.0766 202 LEU A N     
487  C CA    . LEU A 74  ? 0.3914 0.2681 0.3756 0.0578  -0.0224 -0.0713 202 LEU A CA    
488  C C     . LEU A 74  ? 0.3661 0.2527 0.3413 0.0563  -0.0253 -0.0777 202 LEU A C     
489  O O     . LEU A 74  ? 0.3659 0.2576 0.3310 0.0625  -0.0230 -0.0828 202 LEU A O     
490  C CB    . LEU A 74  ? 0.3724 0.2607 0.3596 0.0646  -0.0182 -0.0634 202 LEU A CB    
491  C CG    . LEU A 74  ? 0.3470 0.2284 0.3428 0.0662  -0.0164 -0.0548 202 LEU A CG    
492  C CD1   . LEU A 74  ? 0.2873 0.1846 0.2859 0.0712  -0.0137 -0.0465 202 LEU A CD1   
493  C CD2   . LEU A 74  ? 0.3631 0.2349 0.3656 0.0568  -0.0193 -0.0506 202 LEU A CD2   
494  N N     . PRO A 75  ? 0.3409 0.2309 0.3195 0.0483  -0.0300 -0.0767 203 PRO A N     
495  C CA    . PRO A 75  ? 0.3427 0.2438 0.3127 0.0471  -0.0330 -0.0810 203 PRO A CA    
496  C C     . PRO A 75  ? 0.3238 0.2429 0.2893 0.0520  -0.0276 -0.0750 203 PRO A C     
497  O O     . PRO A 75  ? 0.2907 0.2158 0.2632 0.0526  -0.0236 -0.0664 203 PRO A O     
498  C CB    . PRO A 75  ? 0.3530 0.2573 0.3323 0.0367  -0.0376 -0.0768 203 PRO A CB    
499  C CG    . PRO A 75  ? 0.3386 0.2407 0.3296 0.0343  -0.0341 -0.0673 203 PRO A CG    
500  C CD    . PRO A 75  ? 0.3323 0.2199 0.3231 0.0403  -0.0316 -0.0695 203 PRO A CD    
501  N N     . HIS A 76  ? 0.3247 0.2518 0.2783 0.0550  -0.0278 -0.0797 204 HIS A N     
502  C CA    . HIS A 76  ? 0.3086 0.2533 0.2578 0.0583  -0.0230 -0.0737 204 HIS A CA    
503  C C     . HIS A 76  ? 0.3096 0.2589 0.2583 0.0672  -0.0158 -0.0721 204 HIS A C     
504  O O     . HIS A 76  ? 0.2914 0.2561 0.2394 0.0693  -0.0111 -0.0660 204 HIS A O     
505  C CB    . HIS A 76  ? 0.2826 0.2366 0.2411 0.0513  -0.0233 -0.0634 204 HIS A CB    
506  C CG    . HIS A 76  ? 0.2861 0.2377 0.2472 0.0439  -0.0296 -0.0644 204 HIS A CG    
507  N ND1   . HIS A 76  ? 0.2960 0.2516 0.2478 0.0432  -0.0340 -0.0688 204 HIS A ND1   
508  C CD2   . HIS A 76  ? 0.2920 0.2384 0.2642 0.0372  -0.0325 -0.0615 204 HIS A CD2   
509  C CE1   . HIS A 76  ? 0.3197 0.2738 0.2786 0.0364  -0.0399 -0.0684 204 HIS A CE1   
510  N NE2   . HIS A 76  ? 0.3223 0.2709 0.2940 0.0327  -0.0385 -0.0641 204 HIS A NE2   
511  N N     . PHE A 77  ? 0.3144 0.2505 0.2641 0.0727  -0.0147 -0.0774 205 PHE A N     
512  C CA    . PHE A 77  ? 0.3241 0.2654 0.2734 0.0831  -0.0078 -0.0768 205 PHE A CA    
513  C C     . PHE A 77  ? 0.3658 0.3028 0.3032 0.0886  -0.0055 -0.0854 205 PHE A C     
514  O O     . PHE A 77  ? 0.4325 0.3536 0.3694 0.0884  -0.0069 -0.0909 205 PHE A O     
515  C CB    . PHE A 77  ? 0.3172 0.2502 0.2786 0.0856  -0.0067 -0.0724 205 PHE A CB    
516  C CG    . PHE A 77  ? 0.2706 0.2170 0.2428 0.0816  -0.0056 -0.0602 205 PHE A CG    
517  C CD1   . PHE A 77  ? 0.2572 0.2205 0.2337 0.0872  -0.0004 -0.0542 205 PHE A CD1   
518  C CD2   . PHE A 77  ? 0.2655 0.2091 0.2435 0.0719  -0.0098 -0.0551 205 PHE A CD2   
519  C CE1   . PHE A 77  ? 0.2626 0.2381 0.2483 0.0823  -0.0007 -0.0439 205 PHE A CE1   
520  C CE2   . PHE A 77  ? 0.2455 0.2004 0.2308 0.0681  -0.0090 -0.0452 205 PHE A CE2   
521  C CZ    . PHE A 77  ? 0.2370 0.2071 0.2256 0.0728  -0.0051 -0.0400 205 PHE A CZ    
522  N N     . GLY A 78  ? 0.3202 0.2717 0.2481 0.0929  -0.0012 -0.0856 206 GLY A N     
523  C CA    . GLY A 78  ? 0.3320 0.2820 0.2476 0.0985  0.0023  -0.0924 206 GLY A CA    
524  C C     . GLY A 78  ? 0.3522 0.3150 0.2719 0.1080  0.0118  -0.0880 206 GLY A C     
525  O O     . GLY A 78  ? 0.3621 0.3296 0.2958 0.1103  0.0141  -0.0810 206 GLY A O     
526  N N     . GLU A 79  ? 0.3171 0.2868 0.2250 0.1135  0.0171  -0.0913 207 GLU A N     
527  C CA    . GLU A 79  ? 0.3521 0.3337 0.2647 0.1229  0.0267  -0.0878 207 GLU A CA    
528  C C     . GLU A 79  ? 0.3325 0.3361 0.2579 0.1233  0.0306  -0.0759 207 GLU A C     
529  O O     . GLU A 79  ? 0.3226 0.3335 0.2622 0.1281  0.0347  -0.0702 207 GLU A O     
530  C CB    . GLU A 79  ? 0.3814 0.3678 0.2778 0.1280  0.0321  -0.0930 207 GLU A CB    
531  C CG    . GLU A 79  ? 0.4205 0.4170 0.3219 0.1383  0.0423  -0.0909 207 GLU A CG    
532  N N     . HIS A 80  ? 0.2900 0.3044 0.2111 0.1178  0.0291  -0.0717 208 HIS A N     
533  C CA    . HIS A 80  ? 0.2689 0.3058 0.2008 0.1175  0.0340  -0.0604 208 HIS A CA    
534  C C     . HIS A 80  ? 0.2558 0.2925 0.2053 0.1135  0.0300  -0.0541 208 HIS A C     
535  O O     . HIS A 80  ? 0.2609 0.3117 0.2250 0.1163  0.0339  -0.0464 208 HIS A O     
536  C CB    . HIS A 80  ? 0.2788 0.3261 0.2009 0.1121  0.0338  -0.0568 208 HIS A CB    
537  C CG    . HIS A 80  ? 0.3092 0.3801 0.2416 0.1100  0.0403  -0.0441 208 HIS A CG    
538  N ND1   . HIS A 80  ? 0.3415 0.4261 0.2639 0.1101  0.0458  -0.0399 208 HIS A ND1   
539  C CD2   . HIS A 80  ? 0.3135 0.3971 0.2657 0.1072  0.0418  -0.0343 208 HIS A CD2   
540  C CE1   . HIS A 80  ? 0.3127 0.4169 0.2497 0.1070  0.0509  -0.0278 208 HIS A CE1   
541  N NE2   . HIS A 80  ? 0.3052 0.4094 0.2605 0.1049  0.0481  -0.0248 208 HIS A NE2   
542  N N     . SER A 81  ? 0.2429 0.2643 0.1922 0.1046  0.0214  -0.0558 209 SER A N     
543  C CA    . SER A 81  ? 0.2406 0.2595 0.2046 0.0981  0.0168  -0.0489 209 SER A CA    
544  C C     . SER A 81  ? 0.2574 0.2700 0.2303 0.1060  0.0180  -0.0498 209 SER A C     
545  O O     . SER A 81  ? 0.2542 0.2745 0.2407 0.1044  0.0173  -0.0415 209 SER A O     
546  C CB    . SER A 81  ? 0.2808 0.2843 0.2417 0.0886  0.0088  -0.0513 209 SER A CB    
547  O OG    . SER A 81  ? 0.2988 0.3099 0.2545 0.0814  0.0074  -0.0480 209 SER A OG    
548  N N     . SER A 82  ? 0.2382 0.2357 0.2035 0.1135  0.0190  -0.0595 210 SER A N     
549  C CA    . SER A 82  ? 0.2462 0.2353 0.2206 0.1186  0.0198  -0.0585 210 SER A CA    
550  C C     . SER A 82  ? 0.2793 0.2882 0.2636 0.1266  0.0269  -0.0521 210 SER A C     
551  O O     . SER A 82  ? 0.2664 0.2782 0.2641 0.1295  0.0265  -0.0458 210 SER A O     
552  C CB    . SER A 82  ? 0.3004 0.2677 0.2656 0.1201  0.0190  -0.0687 210 SER A CB    
553  O OG    . SER A 82  ? 0.3401 0.2912 0.2999 0.1113  0.0116  -0.0732 210 SER A OG    
554  N N     . ARG A 83  ? 0.2863 0.3098 0.2647 0.1298  0.0332  -0.0527 211 ARG A N     
555  C CA    . ARG A 83  ? 0.3130 0.3582 0.3025 0.1363  0.0405  -0.0458 211 ARG A CA    
556  C C     . ARG A 83  ? 0.2897 0.3548 0.2958 0.1324  0.0388  -0.0341 211 ARG A C     
557  O O     . ARG A 83  ? 0.2844 0.3618 0.3056 0.1362  0.0405  -0.0272 211 ARG A O     
558  C CB    . ARG A 83  ? 0.3427 0.4007 0.3220 0.1387  0.0477  -0.0473 211 ARG A CB    
559  C CG    . ARG A 83  ? 0.4000 0.4828 0.3926 0.1443  0.0558  -0.0391 211 ARG A CG    
560  C CD    . ARG A 83  ? 0.4402 0.5346 0.4217 0.1465  0.0636  -0.0399 211 ARG A CD    
561  N N     . VAL A 84  ? 0.2586 0.3273 0.2620 0.1241  0.0352  -0.0318 212 VAL A N     
562  C CA    . VAL A 84  ? 0.2298 0.3135 0.2473 0.1147  0.0317  -0.0206 212 VAL A CA    
563  C C     . VAL A 84  ? 0.2442 0.3203 0.2720 0.1151  0.0258  -0.0175 212 VAL A C     
564  O O     . VAL A 84  ? 0.2184 0.3110 0.2612 0.1162  0.0255  -0.0092 212 VAL A O     
565  C CB    . VAL A 84  ? 0.2404 0.3207 0.2511 0.1010  0.0270  -0.0187 212 VAL A CB    
566  C CG1   . VAL A 84  ? 0.2175 0.3086 0.2411 0.0910  0.0225  -0.0090 212 VAL A CG1   
567  C CG2   . VAL A 84  ? 0.2481 0.3383 0.2493 0.1012  0.0331  -0.0194 212 VAL A CG2   
568  N N     . VAL A 85  ? 0.2188 0.2705 0.2386 0.1139  0.0209  -0.0235 213 VAL A N     
569  C CA    . VAL A 85  ? 0.2379 0.2806 0.2654 0.1143  0.0158  -0.0198 213 VAL A CA    
570  C C     . VAL A 85  ? 0.2474 0.2937 0.2840 0.1276  0.0196  -0.0185 213 VAL A C     
571  O O     . VAL A 85  ? 0.2269 0.2810 0.2757 0.1287  0.0167  -0.0104 213 VAL A O     
572  C CB    . VAL A 85  ? 0.2520 0.2677 0.2699 0.1098  0.0108  -0.0259 213 VAL A CB    
573  C CG1   . VAL A 85  ? 0.2596 0.2648 0.2845 0.1121  0.0070  -0.0214 213 VAL A CG1   
574  C CG2   . VAL A 85  ? 0.2223 0.2364 0.2345 0.0963  0.0067  -0.0251 213 VAL A CG2   
575  N N     . GLN A 86  ? 0.2422 0.2822 0.2723 0.1337  0.0254  -0.0257 214 GLN A N     
576  C CA    . GLN A 86  ? 0.2480 0.2896 0.2865 0.1429  0.0293  -0.0245 214 GLN A CA    
577  C C     . GLN A 86  ? 0.2395 0.3102 0.2946 0.1452  0.0316  -0.0143 214 GLN A C     
578  O O     . GLN A 86  ? 0.2708 0.3462 0.3386 0.1495  0.0299  -0.0083 214 GLN A O     
579  C CB    . GLN A 86  ? 0.2817 0.3142 0.3094 0.1490  0.0358  -0.0345 214 GLN A CB    
580  C CG    . GLN A 86  ? 0.3321 0.3656 0.3684 0.1598  0.0408  -0.0343 214 GLN A CG    
581  N N     . GLU A 87  ? 0.2364 0.3273 0.2919 0.1416  0.0350  -0.0118 215 GLU A N     
582  C CA    . GLU A 87  ? 0.2506 0.3706 0.3231 0.1416  0.0372  -0.0020 215 GLU A CA    
583  C C     . GLU A 87  ? 0.2262 0.3554 0.3112 0.1352  0.0288  0.0072  215 GLU A C     
584  O O     . GLU A 87  ? 0.2255 0.3698 0.3260 0.1374  0.0272  0.0146  215 GLU A O     
585  C CB    . GLU A 87  ? 0.2809 0.4190 0.3509 0.1375  0.0430  -0.0006 215 GLU A CB    
586  C CG    . GLU A 87  ? 0.3609 0.4939 0.4185 0.1445  0.0516  -0.0083 215 GLU A CG    
587  C CD    . GLU A 87  ? 0.4268 0.5798 0.4828 0.1411  0.0582  -0.0047 215 GLU A CD    
588  O OE1   . GLU A 87  ? 0.4231 0.5954 0.4907 0.1328  0.0564  0.0045  215 GLU A OE1   
589  O OE2   . GLU A 87  ? 0.4740 0.6228 0.5167 0.1460  0.0650  -0.0108 215 GLU A OE2   
590  N N     . LEU A 88  ? 0.2169 0.3375 0.2949 0.1272  0.0229  0.0067  216 LEU A N     
591  C CA    . LEU A 88  ? 0.2181 0.3442 0.3044 0.1204  0.0142  0.0145  216 LEU A CA    
592  C C     . LEU A 88  ? 0.2427 0.3575 0.3329 0.1264  0.0101  0.0167  216 LEU A C     
593  O O     . LEU A 88  ? 0.2642 0.3927 0.3664 0.1249  0.0050  0.0250  216 LEU A O     
594  C CB    . LEU A 88  ? 0.2012 0.3102 0.2739 0.1064  0.0087  0.0115  216 LEU A CB    
595  C CG    . LEU A 88  ? 0.2107 0.3304 0.2807 0.0966  0.0109  0.0118  216 LEU A CG    
596  C CD1   . LEU A 88  ? 0.2165 0.3157 0.2711 0.0866  0.0076  0.0067  216 LEU A CD1   
597  C CD2   . LEU A 88  ? 0.2364 0.3793 0.3207 0.0886  0.0074  0.0211  216 LEU A CD2   
598  N N     . LEU A 89  ? 0.2445 0.3339 0.3246 0.1320  0.0117  0.0096  217 LEU A N     
599  C CA    . LEU A 89  ? 0.2375 0.3142 0.3213 0.1372  0.0084  0.0123  217 LEU A CA    
600  C C     . LEU A 89  ? 0.2995 0.3913 0.3976 0.1458  0.0114  0.0166  217 LEU A C     
601  O O     . LEU A 89  ? 0.3300 0.4255 0.4373 0.1480  0.0064  0.0239  217 LEU A O     
602  C CB    . LEU A 89  ? 0.2240 0.2701 0.2955 0.1400  0.0101  0.0034  217 LEU A CB    
603  C CG    . LEU A 89  ? 0.2582 0.2853 0.3166 0.1321  0.0064  -0.0009 217 LEU A CG    
604  C CD1   . LEU A 89  ? 0.2910 0.2901 0.3399 0.1340  0.0084  -0.0101 217 LEU A CD1   
605  C CD2   . LEU A 89  ? 0.2850 0.3110 0.3456 0.1270  -0.0012 0.0077  217 LEU A CD2   
606  N N     . GLU A 90  ? 0.2794 0.3802 0.3788 0.1509  0.0196  0.0123  218 GLU A N     
607  C CA    . GLU A 90  ? 0.3363 0.4495 0.4485 0.1604  0.0238  0.0152  218 GLU A CA    
608  C C     . GLU A 90  ? 0.3220 0.4679 0.4512 0.1572  0.0223  0.0250  218 GLU A C     
609  O O     . GLU A 90  ? 0.3435 0.5009 0.4867 0.1627  0.0207  0.0311  218 GLU A O     
610  C CB    . GLU A 90  ? 0.3959 0.5032 0.5008 0.1678  0.0337  0.0060  218 GLU A CB    
611  C CG    . GLU A 90  ? 0.5025 0.6223 0.6201 0.1790  0.0396  0.0079  218 GLU A CG    
612  C CD    . GLU A 90  ? 0.5792 0.6900 0.6864 0.1866  0.0494  -0.0023 218 GLU A CD    
613  O OE1   . GLU A 90  ? 0.6241 0.7475 0.7407 0.1958  0.0559  -0.0013 218 GLU A OE1   
614  O OE2   . GLU A 90  ? 0.6023 0.6938 0.6918 0.1833  0.0503  -0.0114 218 GLU A OE2   
615  N N     . HIS A 91  ? 0.2907 0.4515 0.4194 0.1478  0.0222  0.0268  219 HIS A N     
616  C CA    . HIS A 91  ? 0.2984 0.4903 0.4437 0.1431  0.0217  0.0354  219 HIS A CA    
617  C C     . HIS A 91  ? 0.2978 0.4999 0.4462 0.1297  0.0127  0.0414  219 HIS A C     
618  O O     . HIS A 91  ? 0.2973 0.5237 0.4602 0.1236  0.0103  0.0485  219 HIS A O     
619  C CB    . HIS A 91  ? 0.3175 0.5228 0.4626 0.1438  0.0318  0.0332  219 HIS A CB    
620  C CG    . HIS A 91  ? 0.3798 0.5780 0.5214 0.1566  0.0411  0.0271  219 HIS A CG    
621  N ND1   . HIS A 91  ? 0.4197 0.5981 0.5428 0.1604  0.0470  0.0169  219 HIS A ND1   
622  C CD2   . HIS A 91  ? 0.3831 0.5909 0.5370 0.1667  0.0450  0.0295  219 HIS A CD2   
623  C CE1   . HIS A 91  ? 0.4416 0.6172 0.5651 0.1718  0.0543  0.0128  219 HIS A CE1   
624  N NE2   . HIS A 91  ? 0.4352 0.6285 0.5777 0.1763  0.0536  0.0204  219 HIS A NE2   
625  N N     . GLY A 92  ? 0.2669 0.4505 0.4020 0.1244  0.0078  0.0382  220 GLY A N     
626  C CA    . GLY A 92  ? 0.2522 0.4430 0.3884 0.1118  -0.0010 0.0429  220 GLY A CA    
627  C C     . GLY A 92  ? 0.2491 0.4511 0.3846 0.1024  0.0018  0.0426  220 GLY A C     
628  O O     . GLY A 92  ? 0.2526 0.4570 0.3868 0.0906  -0.0050 0.0450  220 GLY A O     
629  N N     . VAL A 93  ? 0.2481 0.4554 0.3829 0.1068  0.0119  0.0395  221 VAL A N     
630  C CA    . VAL A 93  ? 0.2540 0.4701 0.3865 0.0989  0.0160  0.0395  221 VAL A CA    
631  C C     . VAL A 93  ? 0.2341 0.4399 0.3534 0.1069  0.0263  0.0319  221 VAL A C     
632  O O     . VAL A 93  ? 0.2092 0.4084 0.3261 0.1179  0.0315  0.0278  221 VAL A O     
633  C CB    . VAL A 93  ? 0.2982 0.5426 0.4482 0.0915  0.0174  0.0479  221 VAL A CB    
634  C CG1   . VAL A 93  ? 0.3491 0.6033 0.5097 0.0794  0.0058  0.0544  221 VAL A CG1   
635  C CG2   . VAL A 93  ? 0.3010 0.5567 0.4609 0.1019  0.0239  0.0495  221 VAL A CG2   
636  N N     . CYS A 94  ? 0.2205 0.4218 0.3291 0.0994  0.0284  0.0294  222 CYS A N     
637  C CA    . CYS A 94  ? 0.2314 0.4261 0.3262 0.1062  0.0377  0.0228  222 CYS A CA    
638  C C     . CYS A 94  ? 0.2241 0.4421 0.3259 0.1014  0.0446  0.0294  222 CYS A C     
639  O O     . CYS A 94  ? 0.1844 0.4046 0.2870 0.0875  0.0407  0.0339  222 CYS A O     
640  C CB    . CYS A 94  ? 0.2190 0.3848 0.2922 0.1006  0.0339  0.0144  222 CYS A CB    
641  S SG    . CYS A 94  ? 0.2568 0.4172 0.3113 0.1048  0.0428  0.0075  222 CYS A SG    
642  N N     . GLU A 95  ? 0.2087 0.4348 0.3111 0.1089  0.0532  0.0293  223 GLU A N     
643  C CA    . GLU A 95  ? 0.2360 0.4839 0.3462 0.1036  0.0598  0.0371  223 GLU A CA    
644  C C     . GLU A 95  ? 0.2066 0.4514 0.3039 0.0961  0.0624  0.0373  223 GLU A C     
645  O O     . GLU A 95  ? 0.1981 0.4586 0.3049 0.0855  0.0634  0.0463  223 GLU A O     
646  C CB    . GLU A 95  ? 0.3121 0.5670 0.4218 0.1145  0.0696  0.0358  223 GLU A CB    
647  C CG    . GLU A 95  ? 0.4021 0.6831 0.5257 0.1089  0.0757  0.0461  223 GLU A CG    
648  C CD    . GLU A 95  ? 0.4662 0.7638 0.6113 0.0958  0.0679  0.0561  223 GLU A CD    
649  O OE1   . GLU A 95  ? 0.4732 0.7742 0.6314 0.0971  0.0611  0.0574  223 GLU A OE1   
650  O OE2   . GLU A 95  ? 0.4760 0.7816 0.6238 0.0837  0.0681  0.0625  223 GLU A OE2   
651  N N     . GLU A 96  ? 0.1963 0.4201 0.2721 0.1007  0.0630  0.0279  224 GLU A N     
652  C CA    . GLU A 96  ? 0.1880 0.4048 0.2491 0.0927  0.0638  0.0280  224 GLU A CA    
653  C C     . GLU A 96  ? 0.1790 0.3891 0.2451 0.0763  0.0540  0.0330  224 GLU A C     
654  O O     . GLU A 96  ? 0.1917 0.4081 0.2589 0.0664  0.0554  0.0400  224 GLU A O     
655  C CB    . GLU A 96  ? 0.2207 0.4117 0.2567 0.0984  0.0628  0.0160  224 GLU A CB    
656  C CG    . GLU A 96  ? 0.2554 0.4385 0.2758 0.0900  0.0622  0.0170  224 GLU A CG    
657  C CD    . GLU A 96  ? 0.3031 0.4623 0.3002 0.0942  0.0591  0.0054  224 GLU A CD    
658  O OE1   . GLU A 96  ? 0.3045 0.4501 0.2977 0.1018  0.0565  -0.0040 224 GLU A OE1   
659  O OE2   . GLU A 96  ? 0.3226 0.4769 0.3059 0.0895  0.0589  0.0061  224 GLU A OE2   
660  N N     . VAL A 97  ? 0.1571 0.3531 0.2253 0.0739  0.0446  0.0293  225 VAL A N     
661  C CA    . VAL A 97  ? 0.1584 0.3457 0.2291 0.0598  0.0353  0.0322  225 VAL A CA    
662  C C     . VAL A 97  ? 0.1636 0.3738 0.2542 0.0506  0.0349  0.0429  225 VAL A C     
663  O O     . VAL A 97  ? 0.1515 0.3597 0.2429 0.0380  0.0321  0.0474  225 VAL A O     
664  C CB    . VAL A 97  ? 0.1582 0.3292 0.2277 0.0607  0.0265  0.0271  225 VAL A CB    
665  C CG1   . VAL A 97  ? 0.1606 0.3245 0.2324 0.0470  0.0176  0.0299  225 VAL A CG1   
666  C CG2   . VAL A 97  ? 0.1791 0.3263 0.2302 0.0669  0.0261  0.0171  225 VAL A CG2   
667  N N     . GLU A 98  ? 0.1321 0.3644 0.2400 0.0569  0.0378  0.0471  226 GLU A N     
668  C CA    . GLU A 98  ? 0.1331 0.3897 0.2631 0.0476  0.0362  0.0574  226 GLU A CA    
669  C C     . GLU A 98  ? 0.1608 0.4318 0.2941 0.0420  0.0449  0.0649  226 GLU A C     
670  O O     . GLU A 98  ? 0.1879 0.4660 0.3316 0.0281  0.0416  0.0721  226 GLU A O     
671  C CB    . GLU A 98  ? 0.1749 0.4542 0.3246 0.0571  0.0372  0.0608  226 GLU A CB    
672  C CG    . GLU A 98  ? 0.2021 0.4682 0.3503 0.0603  0.0273  0.0562  226 GLU A CG    
673  C CD    . GLU A 98  ? 0.2756 0.5300 0.4217 0.0451  0.0154  0.0566  226 GLU A CD    
674  O OE1   . GLU A 98  ? 0.3271 0.5985 0.4884 0.0336  0.0116  0.0639  226 GLU A OE1   
675  O OE2   . GLU A 98  ? 0.2736 0.5018 0.4027 0.0442  0.0102  0.0496  226 GLU A OE2   
676  N N     . ARG A 99  ? 0.1499 0.4242 0.2735 0.0527  0.0559  0.0632  227 ARG A N     
677  C CA    . ARG A 99  ? 0.1615 0.4476 0.2844 0.0486  0.0650  0.0707  227 ARG A CA    
678  C C     . ARG A 99  ? 0.1744 0.4403 0.2834 0.0364  0.0607  0.0712  227 ARG A C     
679  O O     . ARG A 99  ? 0.1696 0.4445 0.2853 0.0260  0.0635  0.0807  227 ARG A O     
680  C CB    . ARG A 99  ? 0.2103 0.4936 0.3169 0.0624  0.0751  0.0658  227 ARG A CB    
681  C CG    . ARG A 99  ? 0.2814 0.5730 0.3836 0.0589  0.0838  0.0732  227 ARG A CG    
682  N N     . VAL A 100 ? 0.1508 0.3891 0.2409 0.0379  0.0541  0.0615  228 VAL A N     
683  C CA    . VAL A 100 ? 0.1776 0.3958 0.2559 0.0273  0.0492  0.0617  228 VAL A CA    
684  C C     . VAL A 100 ? 0.1781 0.3960 0.2707 0.0123  0.0410  0.0669  228 VAL A C     
685  O O     . VAL A 100 ? 0.1828 0.4005 0.2779 0.0017  0.0418  0.0741  228 VAL A O     
686  C CB    . VAL A 100 ? 0.2051 0.3961 0.2635 0.0319  0.0435  0.0506  228 VAL A CB    
687  C CG1   . VAL A 100 ? 0.1943 0.3658 0.2451 0.0207  0.0372  0.0515  228 VAL A CG1   
688  C CG2   . VAL A 100 ? 0.2229 0.4116 0.2642 0.0438  0.0506  0.0455  228 VAL A CG2   
689  N N     A ARG A 101 ? 0.1940 0.4116 0.2954 0.0117  0.0332  0.0634  229 ARG A N     
690  N N     B ARG A 101 ? 0.1922 0.4095 0.2934 0.0117  0.0331  0.0632  229 ARG A N     
691  C CA    A ARG A 101 ? 0.2088 0.4250 0.3213 -0.0022 0.0241  0.0663  229 ARG A CA    
692  C CA    B ARG A 101 ? 0.2139 0.4307 0.3268 -0.0020 0.0241  0.0664  229 ARG A CA    
693  C C     A ARG A 101 ? 0.2060 0.4440 0.3379 -0.0129 0.0267  0.0775  229 ARG A C     
694  C C     B ARG A 101 ? 0.2068 0.4444 0.3382 -0.0128 0.0270  0.0775  229 ARG A C     
695  O O     A ARG A 101 ? 0.2085 0.4386 0.3436 -0.0269 0.0213  0.0805  229 ARG A O     
696  O O     B ARG A 101 ? 0.2089 0.4377 0.3423 -0.0265 0.0221  0.0806  229 ARG A O     
697  C CB    A ARG A 101 ? 0.2375 0.4566 0.3575 0.0008  0.0162  0.0623  229 ARG A CB    
698  C CB    B ARG A 101 ? 0.2370 0.4597 0.3593 0.0011  0.0168  0.0632  229 ARG A CB    
699  C CG    A ARG A 101 ? 0.2719 0.4659 0.3748 0.0058  0.0106  0.0525  229 ARG A CG    
700  C CG    B ARG A 101 ? 0.2693 0.4679 0.3764 0.0049  0.0100  0.0538  229 ARG A CG    
701  C CD    A ARG A 101 ? 0.2747 0.4712 0.3852 0.0050  0.0016  0.0511  229 ARG A CD    
702  C CD    B ARG A 101 ? 0.2661 0.4718 0.3840 0.0035  0.0013  0.0538  229 ARG A CD    
703  N NE    A ARG A 101 ? 0.2913 0.4641 0.3859 0.0091  -0.0030 0.0430  229 ARG A NE    
704  N NE    B ARG A 101 ? 0.2764 0.4744 0.3875 0.0159  0.0004  0.0480  229 ARG A NE    
705  C CZ    A ARG A 101 ? 0.3006 0.4726 0.3950 0.0186  -0.0050 0.0400  229 ARG A CZ    
706  C CZ    B ARG A 101 ? 0.2984 0.4729 0.3945 0.0164  -0.0046 0.0412  229 ARG A CZ    
707  N NH1   A ARG A 101 ? 0.2914 0.4848 0.4008 0.0259  -0.0032 0.0441  229 ARG A NH1   
708  N NH1   B ARG A 101 ? 0.2913 0.4483 0.3773 0.0063  -0.0087 0.0389  229 ARG A NH1   
709  N NH2   A ARG A 101 ? 0.2974 0.4475 0.3778 0.0210  -0.0085 0.0336  229 ARG A NH2   
710  N NH2   B ARG A 101 ? 0.3069 0.4748 0.3986 0.0272  -0.0050 0.0371  229 ARG A NH2   
711  N N     . ARG A 102 ? 0.1830 0.4480 0.3285 -0.0065 0.0352  0.0837  230 ARG A N     
712  C CA    . ARG A 102 ? 0.1839 0.4741 0.3519 -0.0165 0.0384  0.0954  230 ARG A CA    
713  C C     . ARG A 102 ? 0.1667 0.4568 0.3298 -0.0214 0.0473  0.1031  230 ARG A C     
714  O O     . ARG A 102 ? 0.1953 0.4938 0.3705 -0.0310 0.0483  0.1109  230 ARG A O     
715  C CB    . ARG A 102 ? 0.1850 0.4996 0.3673 -0.0066 0.0435  0.0980  230 ARG A CB    
716  C CG    . ARG A 102 ? 0.2269 0.5455 0.4159 0.0005  0.0362  0.0926  230 ARG A CG    
717  C CD    . ARG A 102 ? 0.2724 0.6118 0.4757 0.0084  0.0408  0.0961  230 ARG A CD    
718  N NE    . ARG A 102 ? 0.3026 0.6457 0.4969 0.0220  0.0540  0.0954  230 ARG A NE    
719  C CZ    . ARG A 102 ? 0.3100 0.6488 0.4953 0.0383  0.0578  0.0883  230 ARG A CZ    
720  N NH1   . ARG A 102 ? 0.3083 0.6396 0.4939 0.0431  0.0498  0.0825  230 ARG A NH1   
721  N NH2   . ARG A 102 ? 0.3343 0.6744 0.5094 0.0494  0.0692  0.0867  230 ARG A NH2   
722  N N     . SER A 103 ? 0.1484 0.4204 0.2880 -0.0136 0.0521  0.0985  231 SER A N     
723  C CA    . SER A 103 ? 0.1822 0.4581 0.3161 -0.0151 0.0621  0.1069  231 SER A CA    
724  C C     . SER A 103 ? 0.1793 0.4389 0.3126 -0.0310 0.0575  0.1127  231 SER A C     
725  O O     . SER A 103 ? 0.1834 0.4187 0.3086 -0.0364 0.0477  0.1059  231 SER A O     
726  C CB    . SER A 103 ? 0.2187 0.4825 0.3269 -0.0010 0.0680  0.1003  231 SER A CB    
727  O OG    . SER A 103 ? 0.2404 0.4743 0.3298 -0.0029 0.0606  0.0933  231 SER A OG    
728  N N     . GLU A 104 ? 0.2061 0.3965 0.3654 0.0455  0.1280  0.0176  232 GLU A N     
729  C CA    . GLU A 104 ? 0.2143 0.4046 0.3719 0.0293  0.1239  0.0201  232 GLU A CA    
730  C C     . GLU A 104 ? 0.2216 0.3803 0.3469 0.0234  0.1202  0.0241  232 GLU A C     
731  O O     . GLU A 104 ? 0.2044 0.3558 0.3242 0.0167  0.1101  0.0273  232 GLU A O     
732  C CB    . GLU A 104 ? 0.2493 0.4548 0.4187 0.0181  0.1382  0.0179  232 GLU A CB    
733  C CG    . GLU A 104 ? 0.2639 0.4632 0.4288 0.0012  0.1380  0.0212  232 GLU A CG    
734  C CD    . GLU A 104 ? 0.3087 0.5192 0.4837 -0.0109 0.1554  0.0194  232 GLU A CD    
735  O OE1   . GLU A 104 ? 0.3305 0.5471 0.5050 -0.0073 0.1646  0.0156  232 GLU A OE1   
736  O OE2   . GLU A 104 ? 0.3152 0.5243 0.4935 -0.0249 0.1568  0.0206  232 GLU A OE2   
737  N N     . ARG A 105 ? 0.2276 0.3698 0.3323 0.0261  0.1282  0.0227  233 ARG A N     
738  C CA    . ARG A 105 ? 0.2170 0.3350 0.2922 0.0214  0.1246  0.0243  233 ARG A CA    
739  C C     . ARG A 105 ? 0.2320 0.3382 0.3016 0.0254  0.1108  0.0248  233 ARG A C     
740  O O     . ARG A 105 ? 0.2260 0.3233 0.2850 0.0193  0.1022  0.0276  233 ARG A O     
741  C CB    . ARG A 105 ? 0.2435 0.3510 0.2999 0.0238  0.1358  0.0195  233 ARG A CB    
742  C CG    . ARG A 105 ? 0.2883 0.3757 0.3163 0.0215  0.1306  0.0173  233 ARG A CG    
743  C CD    . ARG A 105 ? 0.2994 0.3824 0.3093 0.0132  0.1287  0.0223  233 ARG A CD    
744  N NE    . ARG A 105 ? 0.2992 0.3697 0.2847 0.0128  0.1224  0.0186  233 ARG A NE    
745  C CZ    . ARG A 105 ? 0.3081 0.3740 0.2727 0.0094  0.1192  0.0222  233 ARG A CZ    
746  N NH1   . ARG A 105 ? 0.3152 0.3820 0.2775 0.0055  0.1237  0.0310  233 ARG A NH1   
747  N NH2   . ARG A 105 ? 0.2843 0.3446 0.2300 0.0102  0.1124  0.0168  233 ARG A NH2   
748  N N     . TYR A 106 ? 0.2278 0.3328 0.3038 0.0365  0.1100  0.0223  234 TYR A N     
749  C CA    . TYR A 106 ? 0.2301 0.3217 0.2993 0.0404  0.0995  0.0231  234 TYR A CA    
750  C C     . TYR A 106 ? 0.2141 0.3163 0.2951 0.0372  0.0867  0.0275  234 TYR A C     
751  O O     . TYR A 106 ? 0.2027 0.2936 0.2727 0.0323  0.0781  0.0287  234 TYR A O     
752  C CB    . TYR A 106 ? 0.2288 0.3143 0.3015 0.0547  0.1036  0.0215  234 TYR A CB    
753  C CG    . TYR A 106 ? 0.2237 0.2945 0.2892 0.0595  0.0945  0.0237  234 TYR A CG    
754  C CD1   . TYR A 106 ? 0.2419 0.2884 0.2868 0.0552  0.0955  0.0200  234 TYR A CD1   
755  C CD2   . TYR A 106 ? 0.2218 0.3050 0.3010 0.0679  0.0853  0.0285  234 TYR A CD2   
756  C CE1   . TYR A 106 ? 0.2403 0.2723 0.2782 0.0585  0.0893  0.0219  234 TYR A CE1   
757  C CE2   . TYR A 106 ? 0.2454 0.3143 0.3152 0.0725  0.0780  0.0313  234 TYR A CE2   
758  C CZ    . TYR A 106 ? 0.2674 0.3092 0.3163 0.0675  0.0808  0.0284  234 TYR A CZ    
759  O OH    . TYR A 106 ? 0.2904 0.3171 0.3297 0.0713  0.0755  0.0311  234 TYR A OH    
760  N N     . GLN A 107 ? 0.2111 0.3374 0.3157 0.0393  0.0859  0.0282  235 GLN A N     
761  C CA    . GLN A 107 ? 0.1883 0.3267 0.3051 0.0363  0.0738  0.0299  235 GLN A CA    
762  C C     . GLN A 107 ? 0.1964 0.3285 0.3062 0.0214  0.0713  0.0314  235 GLN A C     
763  O O     . GLN A 107 ? 0.1941 0.3218 0.3015 0.0179  0.0611  0.0326  235 GLN A O     
764  C CB    . GLN A 107 ? 0.1676 0.3386 0.3135 0.0408  0.0734  0.0276  235 GLN A CB    
765  C CG    . GLN A 107 ? 0.2023 0.3807 0.3551 0.0596  0.0739  0.0274  235 GLN A CG    
766  C CD    . GLN A 107 ? 0.2854 0.5026 0.4692 0.0656  0.0726  0.0238  235 GLN A CD    
767  O OE1   . GLN A 107 ? 0.3006 0.5394 0.5024 0.0529  0.0735  0.0198  235 GLN A OE1   
768  N NE2   . GLN A 107 ? 0.3016 0.5282 0.4922 0.0854  0.0718  0.0245  235 GLN A NE2   
769  N N     . THR A 108 ? 0.1914 0.3213 0.2965 0.0136  0.0818  0.0319  236 THR A N     
770  C CA    . THR A 108 ? 0.1926 0.3126 0.2880 0.0017  0.0816  0.0351  236 THR A CA    
771  C C     . THR A 108 ? 0.1952 0.2917 0.2642 0.0022  0.0758  0.0372  236 THR A C     
772  O O     . THR A 108 ? 0.1905 0.2787 0.2539 -0.0028 0.0685  0.0396  236 THR A O     
773  C CB    . THR A 108 ? 0.2143 0.3363 0.3084 -0.0053 0.0962  0.0364  236 THR A CB    
774  O OG1   . THR A 108 ? 0.2309 0.3786 0.3528 -0.0061 0.1026  0.0324  236 THR A OG1   
775  C CG2   . THR A 108 ? 0.2245 0.3331 0.3081 -0.0163 0.0975  0.0414  236 THR A CG2   
776  N N     . MET A 109 ? 0.2098 0.2972 0.2641 0.0081  0.0792  0.0349  237 MET A N     
777  C CA    . MET A 109 ? 0.1975 0.2683 0.2300 0.0081  0.0734  0.0340  237 MET A CA    
778  C C     . MET A 109 ? 0.2268 0.2935 0.2627 0.0103  0.0619  0.0330  237 MET A C     
779  O O     . MET A 109 ? 0.2070 0.2648 0.2321 0.0074  0.0547  0.0335  237 MET A O     
780  C CB    . MET A 109 ? 0.1941 0.2586 0.2125 0.0122  0.0804  0.0284  237 MET A CB    
781  C CG    . MET A 109 ? 0.2170 0.2831 0.2243 0.0098  0.0911  0.0288  237 MET A CG    
782  S SD    . MET A 109 ? 0.2629 0.3205 0.2473 0.0050  0.0872  0.0345  237 MET A SD    
783  C CE    . MET A 109 ? 0.2787 0.3298 0.2446 0.0079  0.0790  0.0262  237 MET A CE    
784  N N     . LYS A 110 ? 0.2054 0.2791 0.2551 0.0167  0.0606  0.0320  238 LYS A N     
785  C CA    . LYS A 110 ? 0.2035 0.2724 0.2537 0.0197  0.0509  0.0319  238 LYS A CA    
786  C C     . LYS A 110 ? 0.2157 0.2906 0.2733 0.0130  0.0421  0.0344  238 LYS A C     
787  O O     . LYS A 110 ? 0.2443 0.3097 0.2937 0.0107  0.0347  0.0342  238 LYS A O     
788  C CB    . LYS A 110 ? 0.1713 0.2463 0.2320 0.0308  0.0516  0.0320  238 LYS A CB    
789  C CG    . LYS A 110 ? 0.2477 0.3133 0.3028 0.0354  0.0436  0.0328  238 LYS A CG    
790  C CD    . LYS A 110 ? 0.3012 0.3654 0.3588 0.0497  0.0469  0.0344  238 LYS A CD    
791  C CE    . LYS A 110 ? 0.3374 0.3881 0.3844 0.0548  0.0408  0.0365  238 LYS A CE    
792  N NZ    . LYS A 110 ? 0.3542 0.3815 0.3829 0.0471  0.0430  0.0329  238 LYS A NZ    
793  N N     . LEU A 111 ? 0.1828 0.2736 0.2568 0.0090  0.0444  0.0355  239 LEU A N     
794  C CA    . LEU A 111 ? 0.2030 0.2982 0.2850 0.0005  0.0390  0.0360  239 LEU A CA    
795  C C     . LEU A 111 ? 0.2282 0.3049 0.2929 -0.0060 0.0386  0.0387  239 LEU A C     
796  O O     . LEU A 111 ? 0.2471 0.3169 0.3086 -0.0088 0.0309  0.0386  239 LEU A O     
797  C CB    . LEU A 111 ? 0.2159 0.3306 0.3185 -0.0055 0.0458  0.0348  239 LEU A CB    
798  C CG    . LEU A 111 ? 0.2489 0.3672 0.3616 -0.0171 0.0435  0.0334  239 LEU A CG    
799  C CD1   . LEU A 111 ? 0.2602 0.3902 0.3833 -0.0151 0.0309  0.0292  239 LEU A CD1   
800  C CD2   . LEU A 111 ? 0.2633 0.3976 0.3947 -0.0262 0.0546  0.0309  239 LEU A CD2   
801  N N     . PHE A 112 ? 0.2071 0.2764 0.2596 -0.0071 0.0471  0.0412  240 PHE A N     
802  C CA    . PHE A 112 ? 0.2004 0.2539 0.2351 -0.0103 0.0472  0.0451  240 PHE A CA    
803  C C     . PHE A 112 ? 0.2018 0.2455 0.2211 -0.0055 0.0387  0.0429  240 PHE A C     
804  O O     . PHE A 112 ? 0.2036 0.2384 0.2161 -0.0068 0.0330  0.0445  240 PHE A O     
805  C CB    . PHE A 112 ? 0.2176 0.2672 0.2401 -0.0108 0.0586  0.0488  240 PHE A CB    
806  C CG    . PHE A 112 ? 0.2616 0.3164 0.2963 -0.0184 0.0693  0.0515  240 PHE A CG    
807  C CD1   . PHE A 112 ? 0.2379 0.2999 0.2928 -0.0258 0.0676  0.0497  240 PHE A CD1   
808  C CD2   . PHE A 112 ? 0.2729 0.3262 0.2989 -0.0192 0.0820  0.0546  240 PHE A CD2   
809  C CE1   . PHE A 112 ? 0.2815 0.3498 0.3498 -0.0352 0.0792  0.0499  240 PHE A CE1   
810  C CE2   . PHE A 112 ? 0.2722 0.3297 0.3098 -0.0278 0.0942  0.0563  240 PHE A CE2   
811  C CZ    . PHE A 112 ? 0.2812 0.3467 0.3414 -0.0364 0.0931  0.0534  240 PHE A CZ    
812  N N     . THR A 113 ? 0.2043 0.2494 0.2192 -0.0003 0.0389  0.0383  241 THR A N     
813  C CA    . THR A 113 ? 0.2250 0.2630 0.2266 0.0022  0.0333  0.0338  241 THR A CA    
814  C C     . THR A 113 ? 0.2627 0.2984 0.2705 0.0018  0.0249  0.0320  241 THR A C     
815  O O     . THR A 113 ? 0.2871 0.3176 0.2864 0.0022  0.0200  0.0280  241 THR A O     
816  C CB    . THR A 113 ? 0.2051 0.2430 0.2002 0.0055  0.0386  0.0272  241 THR A CB    
817  O OG1   . THR A 113 ? 0.2027 0.2422 0.2097 0.0086  0.0414  0.0261  241 THR A OG1   
818  C CG2   . THR A 113 ? 0.2376 0.2780 0.2226 0.0059  0.0469  0.0272  241 THR A CG2   
819  N N     . GLN A 114 ? 0.2704 0.3122 0.2931 0.0012  0.0230  0.0338  242 GLN A N     
820  C CA    . GLN A 114 ? 0.3019 0.3416 0.3276 0.0014  0.0150  0.0320  242 GLN A CA    
821  C C     . GLN A 114 ? 0.2823 0.3195 0.3096 -0.0039 0.0096  0.0336  242 GLN A C     
822  O O     . GLN A 114 ? 0.2448 0.2795 0.2728 -0.0046 0.0030  0.0314  242 GLN A O     
823  C CB    . GLN A 114 ? 0.3627 0.4115 0.4005 0.0057  0.0142  0.0322  242 GLN A CB    
824  C CG    . GLN A 114 ? 0.4275 0.4697 0.4582 0.0127  0.0193  0.0303  242 GLN A CG    
825  C CD    . GLN A 114 ? 0.4758 0.5254 0.5154 0.0212  0.0197  0.0323  242 GLN A CD    
826  O OE1   . GLN A 114 ? 0.4773 0.5166 0.5094 0.0282  0.0243  0.0318  242 GLN A OE1   
827  N NE2   . GLN A 114 ? 0.4930 0.5608 0.5486 0.0212  0.0155  0.0339  242 GLN A NE2   
828  N N     . ILE A 115 ? 0.2426 0.2775 0.2683 -0.0073 0.0139  0.0374  243 ILE A N     
829  C CA    . ILE A 115 ? 0.2064 0.2325 0.2296 -0.0113 0.0114  0.0394  243 ILE A CA    
830  C C     . ILE A 115 ? 0.2119 0.2286 0.2194 -0.0069 0.0069  0.0385  243 ILE A C     
831  O O     . ILE A 115 ? 0.2037 0.2202 0.1995 -0.0026 0.0090  0.0383  243 ILE A O     
832  C CB    . ILE A 115 ? 0.2296 0.2510 0.2524 -0.0157 0.0202  0.0450  243 ILE A CB    
833  C CG1   . ILE A 115 ? 0.2468 0.2826 0.2885 -0.0210 0.0256  0.0438  243 ILE A CG1   
834  C CG2   . ILE A 115 ? 0.2280 0.2352 0.2474 -0.0194 0.0197  0.0474  243 ILE A CG2   
835  C CD1   . ILE A 115 ? 0.2817 0.3135 0.3220 -0.0257 0.0378  0.0486  243 ILE A CD1   
836  N N     . PHE A 116 ? 0.2192 0.2307 0.2275 -0.0079 0.0007  0.0363  244 PHE A N     
837  C CA    . PHE A 116 ? 0.2051 0.2106 0.2017 -0.0033 -0.0037 0.0346  244 PHE A CA    
838  C C     . PHE A 116 ? 0.2150 0.2123 0.1990 0.0009  0.0000  0.0413  244 PHE A C     
839  O O     . PHE A 116 ? 0.2140 0.2008 0.1987 -0.0020 0.0047  0.0472  244 PHE A O     
840  C CB    . PHE A 116 ? 0.2265 0.2274 0.2281 -0.0056 -0.0094 0.0314  244 PHE A CB    
841  C CG    . PHE A 116 ? 0.2334 0.2306 0.2264 -0.0002 -0.0141 0.0284  244 PHE A CG    
842  C CD1   . PHE A 116 ? 0.2201 0.2258 0.2080 0.0035  -0.0163 0.0224  244 PHE A CD1   
843  C CD2   . PHE A 116 ? 0.2805 0.2669 0.2722 0.0006  -0.0155 0.0301  244 PHE A CD2   
844  C CE1   . PHE A 116 ? 0.2329 0.2405 0.2161 0.0085  -0.0209 0.0178  244 PHE A CE1   
845  C CE2   . PHE A 116 ? 0.2870 0.2725 0.2727 0.0073  -0.0200 0.0268  244 PHE A CE2   
846  C CZ    . PHE A 116 ? 0.2580 0.2563 0.2404 0.0114  -0.0232 0.0204  244 PHE A CZ    
847  N N     . GLY A 117 ? 0.2037 0.2057 0.1751 0.0077  -0.0013 0.0399  245 GLY A N     
848  C CA    . GLY A 117 ? 0.2264 0.2221 0.1812 0.0149  0.0011  0.0468  245 GLY A CA    
849  C C     . GLY A 117 ? 0.2314 0.2304 0.1786 0.0152  0.0085  0.0504  245 GLY A C     
850  O O     . GLY A 117 ? 0.2358 0.2298 0.1658 0.0219  0.0116  0.0569  245 GLY A O     
851  N N     . VAL A 118 ? 0.2045 0.2119 0.1632 0.0093  0.0118  0.0462  246 VAL A N     
852  C CA    . VAL A 118 ? 0.2208 0.2324 0.1745 0.0091  0.0199  0.0480  246 VAL A CA    
853  C C     . VAL A 118 ? 0.2306 0.2541 0.1843 0.0100  0.0188  0.0383  246 VAL A C     
854  O O     . VAL A 118 ? 0.2471 0.2737 0.2130 0.0068  0.0169  0.0323  246 VAL A O     
855  C CB    . VAL A 118 ? 0.2292 0.2400 0.1980 0.0017  0.0277  0.0516  246 VAL A CB    
856  C CG1   . VAL A 118 ? 0.2400 0.2562 0.2044 0.0019  0.0373  0.0526  246 VAL A CG1   
857  C CG2   . VAL A 118 ? 0.2526 0.2499 0.2223 -0.0020 0.0313  0.0591  246 VAL A CG2   
858  N N     . GLY A 119 ? 0.2570 0.2859 0.1953 0.0143  0.0211  0.0364  247 GLY A N     
859  C CA    . GLY A 119 ? 0.2402 0.2788 0.1781 0.0133  0.0229  0.0255  247 GLY A CA    
860  C C     . GLY A 119 ? 0.2414 0.2812 0.1773 0.0121  0.0334  0.0271  247 GLY A C     
861  O O     . GLY A 119 ? 0.2276 0.2622 0.1643 0.0112  0.0394  0.0364  247 GLY A O     
862  N N     . VAL A 120 ? 0.2008 0.2468 0.1349 0.0112  0.0371  0.0168  248 VAL A N     
863  C CA    . VAL A 120 ? 0.2103 0.2577 0.1423 0.0106  0.0479  0.0166  248 VAL A CA    
864  C C     . VAL A 120 ? 0.2632 0.3114 0.1772 0.0140  0.0519  0.0239  248 VAL A C     
865  O O     . VAL A 120 ? 0.2655 0.3109 0.1822 0.0126  0.0614  0.0302  248 VAL A O     
866  C CB    . VAL A 120 ? 0.2729 0.3249 0.2022 0.0090  0.0519  0.0024  248 VAL A CB    
867  C CG1   . VAL A 120 ? 0.2981 0.3519 0.2215 0.0093  0.0634  0.0010  248 VAL A CG1   
868  C CG2   . VAL A 120 ? 0.2810 0.3259 0.2265 0.0063  0.0528  -0.0018 248 VAL A CG2   
869  N N     . LYS A 121 ? 0.2529 0.3054 0.1479 0.0193  0.0454  0.0233  249 LYS A N     
870  C CA    . LYS A 121 ? 0.2950 0.3462 0.1678 0.0246  0.0502  0.0314  249 LYS A CA    
871  C C     . LYS A 121 ? 0.3054 0.3413 0.1793 0.0241  0.0554  0.0471  249 LYS A C     
872  O O     . LYS A 121 ? 0.3460 0.3765 0.2116 0.0234  0.0666  0.0543  249 LYS A O     
873  C CB    . LYS A 121 ? 0.3348 0.3960 0.1851 0.0335  0.0407  0.0279  249 LYS A CB    
874  C CG    . LYS A 121 ? 0.3706 0.4500 0.2176 0.0320  0.0387  0.0099  249 LYS A CG    
875  C CD    . LYS A 121 ? 0.4543 0.5506 0.2794 0.0415  0.0287  0.0047  249 LYS A CD    
876  C CE    . LYS A 121 ? 0.5124 0.6278 0.3297 0.0387  0.0305  -0.0137 249 LYS A CE    
877  N NZ    . LYS A 121 ? 0.5605 0.6973 0.3808 0.0395  0.0184  -0.0300 249 LYS A NZ    
878  N N     . THR A 122 ? 0.2847 0.3131 0.1694 0.0233  0.0488  0.0515  250 THR A N     
879  C CA    . THR A 122 ? 0.2926 0.3052 0.1805 0.0205  0.0550  0.0641  250 THR A CA    
880  C C     . THR A 122 ? 0.2847 0.2989 0.1950 0.0109  0.0648  0.0637  250 THR A C     
881  O O     . THR A 122 ? 0.3016 0.3085 0.2100 0.0072  0.0764  0.0712  250 THR A O     
882  C CB    . THR A 122 ? 0.2983 0.3026 0.1933 0.0212  0.0460  0.0667  250 THR A CB    
883  O OG1   . THR A 122 ? 0.3020 0.3062 0.1759 0.0323  0.0377  0.0681  250 THR A OG1   
884  C CG2   . THR A 122 ? 0.3230 0.3098 0.2230 0.0157  0.0546  0.0772  250 THR A CG2   
885  N N     . ALA A 123 ? 0.2339 0.2582 0.1649 0.0074  0.0608  0.0548  251 ALA A N     
886  C CA    . ALA A 123 ? 0.2247 0.2551 0.1779 0.0014  0.0683  0.0537  251 ALA A CA    
887  C C     . ALA A 123 ? 0.2769 0.3115 0.2238 0.0013  0.0812  0.0539  251 ALA A C     
888  O O     . ALA A 123 ? 0.2808 0.3175 0.2395 -0.0039 0.0915  0.0574  251 ALA A O     
889  C CB    . ALA A 123 ? 0.2221 0.2608 0.1926 0.0017  0.0620  0.0452  251 ALA A CB    
890  N N     . ASP A 124 ? 0.2978 0.3354 0.2269 0.0062  0.0813  0.0487  252 ASP A N     
891  C CA    . ASP A 124 ? 0.3117 0.3531 0.2312 0.0067  0.0937  0.0475  252 ASP A CA    
892  C C     . ASP A 124 ? 0.3392 0.3712 0.2415 0.0060  0.1035  0.0587  252 ASP A C     
893  O O     . ASP A 124 ? 0.3811 0.4148 0.2881 0.0020  0.1171  0.0608  252 ASP A O     
894  C CB    . ASP A 124 ? 0.3161 0.3631 0.2176 0.0113  0.0908  0.0376  252 ASP A CB    
895  C CG    . ASP A 124 ? 0.3681 0.4185 0.2557 0.0120  0.1035  0.0356  252 ASP A CG    
896  O OD1   . ASP A 124 ? 0.3469 0.4017 0.2505 0.0094  0.1133  0.0319  252 ASP A OD1   
897  O OD2   . ASP A 124 ? 0.3730 0.4226 0.2328 0.0164  0.1039  0.0379  252 ASP A OD2   
898  N N     . ARG A 125 ? 0.3711 0.3923 0.2528 0.0105  0.0977  0.0660  253 ARG A N     
899  C CA    . ARG A 125 ? 0.3969 0.4028 0.2580 0.0113  0.1083  0.0789  253 ARG A CA    
900  C C     . ARG A 125 ? 0.3696 0.3683 0.2526 0.0007  0.1188  0.0843  253 ARG A C     
901  O O     . ARG A 125 ? 0.3973 0.3912 0.2768 -0.0042 0.1349  0.0892  253 ARG A O     
902  C CB    . ARG A 125 ? 0.4135 0.4071 0.2496 0.0207  0.0992  0.0866  253 ARG A CB    
903  C CG    . ARG A 125 ? 0.4764 0.4485 0.2902 0.0225  0.1096  0.1003  253 ARG A CG    
904  C CD    . ARG A 125 ? 0.4948 0.4579 0.2832 0.0356  0.0981  0.1056  253 ARG A CD    
905  N NE    . ARG A 125 ? 0.4792 0.4395 0.2772 0.0383  0.0874  0.1063  253 ARG A NE    
906  C CZ    . ARG A 125 ? 0.4862 0.4282 0.2961 0.0326  0.0916  0.1129  253 ARG A CZ    
907  N NH1   . ARG A 125 ? 0.4988 0.4253 0.3138 0.0228  0.1062  0.1184  253 ARG A NH1   
908  N NH2   . ARG A 125 ? 0.4855 0.4263 0.3043 0.0352  0.0808  0.1118  253 ARG A NH2   
909  N N     . TRP A 126 ? 0.3442 0.3440 0.2504 -0.0036 0.1103  0.0819  254 TRP A N     
910  C CA    . TRP A 126 ? 0.3507 0.3490 0.2814 -0.0150 0.1186  0.0834  254 TRP A CA    
911  C C     . TRP A 126 ? 0.3508 0.3672 0.3036 -0.0211 0.1289  0.0771  254 TRP A C     
912  O O     . TRP A 126 ? 0.3519 0.3669 0.3129 -0.0299 0.1439  0.0798  254 TRP A O     
913  C CB    . TRP A 126 ? 0.3282 0.3300 0.2804 -0.0176 0.1056  0.0790  254 TRP A CB    
914  C CG    . TRP A 126 ? 0.3530 0.3353 0.2892 -0.0141 0.0994  0.0857  254 TRP A CG    
915  C CD1   . TRP A 126 ? 0.4001 0.3606 0.3077 -0.0092 0.1061  0.0967  254 TRP A CD1   
916  C CD2   . TRP A 126 ? 0.3335 0.3153 0.2804 -0.0137 0.0859  0.0822  254 TRP A CD2   
917  N NE1   . TRP A 126 ? 0.4130 0.3595 0.3140 -0.0049 0.0975  0.1002  254 TRP A NE1   
918  C CE2   . TRP A 126 ? 0.3431 0.3030 0.2687 -0.0085 0.0852  0.0907  254 TRP A CE2   
919  C CE3   . TRP A 126 ? 0.3080 0.3050 0.2786 -0.0162 0.0751  0.0731  254 TRP A CE3   
920  C CZ2   . TRP A 126 ? 0.3362 0.2902 0.2658 -0.0065 0.0742  0.0892  254 TRP A CZ2   
921  C CZ3   . TRP A 126 ? 0.3162 0.3070 0.2890 -0.0151 0.0643  0.0718  254 TRP A CZ3   
922  C CH2   . TRP A 126 ? 0.3104 0.2805 0.2640 -0.0108 0.0641  0.0792  254 TRP A CH2   
923  N N     . TYR A 127 ? 0.3242 0.3572 0.2869 -0.0162 0.1221  0.0682  255 TYR A N     
924  C CA    . TYR A 127 ? 0.3191 0.3697 0.3015 -0.0185 0.1314  0.0620  255 TYR A CA    
925  C C     . TYR A 127 ? 0.3450 0.3919 0.3113 -0.0203 0.1489  0.0656  255 TYR A C     
926  O O     . TYR A 127 ? 0.3276 0.3835 0.3113 -0.0276 0.1620  0.0644  255 TYR A O     
927  C CB    . TYR A 127 ? 0.2944 0.3556 0.2817 -0.0107 0.1230  0.0530  255 TYR A CB    
928  C CG    . TYR A 127 ? 0.2938 0.3730 0.3048 -0.0104 0.1310  0.0468  255 TYR A CG    
929  C CD1   . TYR A 127 ? 0.2854 0.3797 0.3267 -0.0110 0.1259  0.0433  255 TYR A CD1   
930  C CD2   . TYR A 127 ? 0.3160 0.3987 0.3190 -0.0085 0.1440  0.0442  255 TYR A CD2   
931  C CE1   . TYR A 127 ? 0.2914 0.4051 0.3555 -0.0080 0.1328  0.0378  255 TYR A CE1   
932  C CE2   . TYR A 127 ? 0.3167 0.4166 0.3428 -0.0067 0.1521  0.0382  255 TYR A CE2   
933  C CZ    . TYR A 127 ? 0.3121 0.4281 0.3694 -0.0057 0.1461  0.0354  255 TYR A CZ    
934  O OH    . TYR A 127 ? 0.3296 0.4654 0.4106 -0.0012 0.1533  0.0296  255 TYR A OH    
935  N N     . ARG A 128 ? 0.3550 0.3908 0.2879 -0.0134 0.1486  0.0689  256 ARG A N     
936  C CA    . ARG A 128 ? 0.3845 0.4158 0.2973 -0.0140 0.1600  0.0707  256 ARG A CA    
937  C C     . ARG A 128 ? 0.4201 0.4366 0.3284 -0.0216 0.1683  0.0794  256 ARG A C     
938  O O     . ARG A 128 ? 0.4538 0.4704 0.3583 -0.0259 0.1799  0.0798  256 ARG A O     
939  C CB    . ARG A 128 ? 0.4321 0.4574 0.3097 -0.0043 0.1536  0.0709  256 ARG A CB    
940  C CG    . ARG A 128 ? 0.4298 0.4689 0.3089 0.0013  0.1487  0.0593  256 ARG A CG    
941  C CD    . ARG A 128 ? 0.4934 0.5309 0.3385 0.0085  0.1433  0.0565  256 ARG A CD    
942  N NE    . ARG A 128 ? 0.5272 0.5612 0.3581 0.0154  0.1291  0.0589  256 ARG A NE    
943  C CZ    . ARG A 128 ? 0.5729 0.5955 0.3801 0.0205  0.1234  0.0680  256 ARG A CZ    
944  N NH1   . ARG A 128 ? 0.6080 0.6186 0.4008 0.0191  0.1319  0.0767  256 ARG A NH1   
945  N NH2   . ARG A 128 ? 0.5962 0.6198 0.3949 0.0277  0.1092  0.0680  256 ARG A NH2   
946  N N     . GLU A 129 ? 0.4069 0.4097 0.3156 -0.0235 0.1633  0.0858  257 GLU A N     
947  C CA    . GLU A 129 ? 0.4628 0.4481 0.3688 -0.0315 0.1719  0.0929  257 GLU A CA    
948  C C     . GLU A 129 ? 0.4393 0.4389 0.3822 -0.0449 0.1802  0.0864  257 GLU A C     
949  O O     . GLU A 129 ? 0.4945 0.4835 0.4405 -0.0541 0.1900  0.0892  257 GLU A O     
950  C CB    . GLU A 129 ? 0.4860 0.4504 0.3796 -0.0280 0.1636  0.1006  257 GLU A CB    
951  C CG    . GLU A 129 ? 0.5325 0.4807 0.3867 -0.0144 0.1571  0.1087  257 GLU A CG    
952  C CD    . GLU A 129 ? 0.5455 0.4791 0.3921 -0.0080 0.1458  0.1140  257 GLU A CD    
953  O OE1   . GLU A 129 ? 0.5277 0.4596 0.3974 -0.0161 0.1452  0.1122  257 GLU A OE1   
954  O OE2   . GLU A 129 ? 0.5509 0.4773 0.3698 0.0053  0.1368  0.1187  257 GLU A OE2   
955  N N     . GLY A 130 ? 0.3963 0.4213 0.3677 -0.0452 0.1762  0.0770  258 GLY A N     
956  C CA    . GLY A 130 ? 0.3854 0.4323 0.3939 -0.0555 0.1819  0.0687  258 GLY A CA    
957  C C     . GLY A 130 ? 0.3677 0.4236 0.4037 -0.0609 0.1739  0.0646  258 GLY A C     
958  O O     . GLY A 130 ? 0.3584 0.4367 0.4267 -0.0690 0.1762  0.0562  258 GLY A O     
959  N N     . LEU A 131 ? 0.3518 0.3927 0.3751 -0.0560 0.1637  0.0697  259 LEU A N     
960  C CA    . LEU A 131 ? 0.3494 0.3963 0.3954 -0.0613 0.1551  0.0659  259 LEU A CA    
961  C C     . LEU A 131 ? 0.3062 0.3817 0.3764 -0.0544 0.1408  0.0562  259 LEU A C     
962  O O     . LEU A 131 ? 0.2739 0.3528 0.3338 -0.0434 0.1358  0.0557  259 LEU A O     
963  C CB    . LEU A 131 ? 0.3576 0.3784 0.3793 -0.0560 0.1445  0.0732  259 LEU A CB    
964  C CG    . LEU A 131 ? 0.4068 0.3957 0.3997 -0.0582 0.1552  0.0838  259 LEU A CG    
965  C CD1   . LEU A 131 ? 0.4201 0.3861 0.3858 -0.0477 0.1456  0.0924  259 LEU A CD1   
966  C CD2   . LEU A 131 ? 0.4469 0.4314 0.4574 -0.0731 0.1634  0.0800  259 LEU A CD2   
967  N N     . ARG A 132 ? 0.2648 0.3603 0.3657 -0.0606 0.1352  0.0482  260 ARG A N     
968  C CA    . ARG A 132 ? 0.2514 0.3750 0.3746 -0.0523 0.1236  0.0402  260 ARG A CA    
969  C C     . ARG A 132 ? 0.2503 0.3824 0.3877 -0.0524 0.1074  0.0355  260 ARG A C     
970  O O     . ARG A 132 ? 0.2565 0.4004 0.3993 -0.0415 0.0947  0.0326  260 ARG A O     
971  C CB    . ARG A 132 ? 0.2617 0.4156 0.4141 -0.0564 0.1348  0.0326  260 ARG A CB    
972  C CG    . ARG A 132 ? 0.2737 0.4241 0.4141 -0.0535 0.1500  0.0355  260 ARG A CG    
973  C CD    . ARG A 132 ? 0.2599 0.4057 0.3838 -0.0376 0.1422  0.0369  260 ARG A CD    
974  N NE    . ARG A 132 ? 0.2688 0.4155 0.3842 -0.0346 0.1566  0.0369  260 ARG A NE    
975  C CZ    . ARG A 132 ? 0.3108 0.4346 0.3942 -0.0350 0.1648  0.0434  260 ARG A CZ    
976  N NH1   . ARG A 132 ? 0.3152 0.4140 0.3728 -0.0367 0.1598  0.0511  260 ARG A NH1   
977  N NH2   . ARG A 132 ? 0.3114 0.4374 0.3857 -0.0320 0.1734  0.0409  260 ARG A NH2   
978  N N     . THR A 133 ? 0.2443 0.3682 0.3858 -0.0644 0.1089  0.0347  261 THR A N     
979  C CA    . THR A 133 ? 0.2455 0.3812 0.4025 -0.0661 0.0947  0.0281  261 THR A CA    
980  C C     . THR A 133 ? 0.2529 0.3590 0.3902 -0.0694 0.0900  0.0329  261 THR A C     
981  O O     . THR A 133 ? 0.2766 0.3544 0.3915 -0.0718 0.0994  0.0412  261 THR A O     
982  C CB    . THR A 133 ? 0.2518 0.4165 0.4429 -0.0793 0.0998  0.0166  261 THR A CB    
983  O OG1   . THR A 133 ? 0.2855 0.4302 0.4732 -0.0960 0.1150  0.0176  261 THR A OG1   
984  C CG2   . THR A 133 ? 0.2593 0.4556 0.4724 -0.0765 0.1070  0.0113  261 THR A CG2   
985  N N     . LEU A 134 ? 0.2425 0.3555 0.3875 -0.0684 0.0759  0.0277  262 LEU A N     
986  C CA    . LEU A 134 ? 0.2738 0.3606 0.4033 -0.0717 0.0718  0.0306  262 LEU A CA    
987  C C     . LEU A 134 ? 0.3188 0.3913 0.4525 -0.0881 0.0866  0.0295  262 LEU A C     
988  O O     . LEU A 134 ? 0.3679 0.4077 0.4801 -0.0892 0.0918  0.0371  262 LEU A O     
989  C CB    . LEU A 134 ? 0.2854 0.3851 0.4243 -0.0691 0.0553  0.0235  262 LEU A CB    
990  C CG    . LEU A 134 ? 0.2855 0.3931 0.4173 -0.0534 0.0421  0.0251  262 LEU A CG    
991  C CD1   . LEU A 134 ? 0.2829 0.3973 0.4188 -0.0518 0.0279  0.0195  262 LEU A CD1   
992  C CD2   . LEU A 134 ? 0.2762 0.3591 0.3804 -0.0445 0.0430  0.0342  262 LEU A CD2   
993  N N     . ASP A 135 ? 0.3224 0.4193 0.4841 -0.1004 0.0944  0.0197  263 ASP A N     
994  C CA    . ASP A 135 ? 0.3517 0.4341 0.5194 -0.1188 0.1116  0.0167  263 ASP A CA    
995  C C     . ASP A 135 ? 0.3681 0.4206 0.5102 -0.1176 0.1277  0.0290  263 ASP A C     
996  O O     . ASP A 135 ? 0.4378 0.4590 0.5634 -0.1231 0.1364  0.0332  263 ASP A O     
997  C CB    . ASP A 135 ? 0.3676 0.4853 0.5663 -0.1284 0.1110  0.0019  263 ASP A CB    
998  C CG    . ASP A 135 ? 0.4072 0.5443 0.6230 -0.1319 0.0963  -0.0105 263 ASP A CG    
999  O OD1   . ASP A 135 ? 0.4345 0.5510 0.6372 -0.1306 0.0899  -0.0080 263 ASP A OD1   
1000 O OD2   . ASP A 135 ? 0.3837 0.5564 0.6244 -0.1347 0.0906  -0.0228 263 ASP A OD2   
1001 N N     . ASP A 136 ? 0.3417 0.4024 0.4781 -0.1088 0.1311  0.0347  264 ASP A N     
1002 C CA    . ASP A 136 ? 0.3502 0.3827 0.4567 -0.1049 0.1437  0.0469  264 ASP A CA    
1003 C C     . ASP A 136 ? 0.3844 0.3788 0.4570 -0.0966 0.1415  0.0593  264 ASP A C     
1004 O O     . ASP A 136 ? 0.4176 0.3821 0.4666 -0.0967 0.1506  0.0672  264 ASP A O     
1005 C CB    . ASP A 136 ? 0.3478 0.3959 0.4513 -0.0950 0.1456  0.0498  264 ASP A CB    
1006 C CG    . ASP A 136 ? 0.3737 0.4564 0.5067 -0.1010 0.1503  0.0392  264 ASP A CG    
1007 O OD1   . ASP A 136 ? 0.3862 0.4778 0.5378 -0.1136 0.1544  0.0308  264 ASP A OD1   
1008 O OD2   . ASP A 136 ? 0.3318 0.4326 0.4686 -0.0920 0.1500  0.0389  264 ASP A OD2   
1009 N N     . LEU A 137 ? 0.3603 0.3585 0.4280 -0.0852 0.1235  0.0595  265 LEU A N     
1010 C CA    . LEU A 137 ? 0.3735 0.3421 0.4114 -0.0747 0.1174  0.0691  265 LEU A CA    
1011 C C     . LEU A 137 ? 0.4032 0.3480 0.4411 -0.0840 0.1226  0.0688  265 LEU A C     
1012 O O     . LEU A 137 ? 0.4609 0.3721 0.4722 -0.0790 0.1292  0.0795  265 LEU A O     
1013 C CB    . LEU A 137 ? 0.3572 0.3391 0.3930 -0.0616 0.0962  0.0662  265 LEU A CB    
1014 C CG    . LEU A 137 ? 0.3167 0.3217 0.3559 -0.0535 0.0911  0.0638  265 LEU A CG    
1015 C CD1   . LEU A 137 ? 0.2686 0.2847 0.3090 -0.0437 0.0729  0.0593  265 LEU A CD1   
1016 C CD2   . LEU A 137 ? 0.3123 0.3044 0.3251 -0.0463 0.0999  0.0729  265 LEU A CD2   
1017 N N     . ARG A 138 ? 0.3912 0.3536 0.4582 -0.0966 0.1198  0.0561  266 ARG A N     
1018 C CA    . ARG A 138 ? 0.4130 0.3551 0.4821 -0.1063 0.1236  0.0524  266 ARG A CA    
1019 C C     . ARG A 138 ? 0.4643 0.3826 0.5225 -0.1128 0.1393  0.0550  266 ARG A C     
1020 O O     . ARG A 138 ? 0.4738 0.3648 0.5220 -0.1151 0.1434  0.0557  266 ARG A O     
1021 C CB    . ARG A 138 ? 0.4021 0.3748 0.5048 -0.1179 0.1152  0.0354  266 ARG A CB    
1022 C CG    . ARG A 138 ? 0.3900 0.3840 0.4955 -0.1054 0.0925  0.0320  266 ARG A CG    
1023 C CD    . ARG A 138 ? 0.3803 0.3992 0.5118 -0.1147 0.0833  0.0165  266 ARG A CD    
1024 N NE    . ARG A 138 ? 0.3866 0.4174 0.5136 -0.1014 0.0632  0.0157  266 ARG A NE    
1025 C CZ    . ARG A 138 ? 0.3885 0.4528 0.5298 -0.0955 0.0513  0.0100  266 ARG A CZ    
1026 N NH1   . ARG A 138 ? 0.3759 0.4694 0.5397 -0.1009 0.0557  0.0037  266 ARG A NH1   
1027 N NH2   . ARG A 138 ? 0.3696 0.4378 0.5027 -0.0839 0.0359  0.0105  266 ARG A NH2   
1028 N N     . GLU A 139 ? 0.4729 0.4011 0.5334 -0.1156 0.1492  0.0560  267 GLU A N     
1029 C CA    . GLU A 139 ? 0.5396 0.4451 0.5897 -0.1220 0.1661  0.0588  267 GLU A CA    
1030 C C     . GLU A 139 ? 0.6102 0.4798 0.6206 -0.1077 0.1719  0.0758  267 GLU A C     
1031 O O     . GLU A 139 ? 0.6766 0.5213 0.6730 -0.1105 0.1864  0.0802  267 GLU A O     
1032 C CB    . GLU A 139 ? 0.5581 0.4903 0.6283 -0.1313 0.1747  0.0516  267 GLU A CB    
1033 C CG    . GLU A 139 ? 0.5685 0.5330 0.6769 -0.1465 0.1724  0.0333  267 GLU A CG    
1034 N N     . GLN A 140 ? 0.6303 0.4982 0.6222 -0.0918 0.1606  0.0848  268 GLN A N     
1035 C CA    . GLN A 140 ? 0.6767 0.5159 0.6304 -0.0754 0.1623  0.0998  268 GLN A CA    
1036 C C     . GLN A 140 ? 0.6713 0.4961 0.6097 -0.0619 0.1496  0.1050  268 GLN A C     
1037 O O     . GLN A 140 ? 0.6627 0.4906 0.5823 -0.0462 0.1397  0.1121  268 GLN A O     
1038 C CB    . GLN A 140 ? 0.6704 0.5239 0.6113 -0.0661 0.1611  0.1054  268 GLN A CB    
1039 N N     . PRO A 141 ? 0.6642 0.4742 0.6104 -0.0677 0.1498  0.1004  269 PRO A N     
1040 C CA    . PRO A 141 ? 0.6537 0.4560 0.5931 -0.0571 0.1367  0.1019  269 PRO A CA    
1041 C C     . PRO A 141 ? 0.6694 0.4504 0.5739 -0.0354 0.1329  0.1153  269 PRO A C     
1042 O O     . PRO A 141 ? 0.6337 0.4204 0.5312 -0.0224 0.1188  0.1173  269 PRO A O     
1043 C CB    . PRO A 141 ? 0.6762 0.4642 0.6298 -0.0695 0.1422  0.0932  269 PRO A CB    
1044 C CG    . PRO A 141 ? 0.6696 0.4650 0.6421 -0.0881 0.1562  0.0848  269 PRO A CG    
1045 C CD    . PRO A 141 ? 0.6861 0.4827 0.6442 -0.0831 0.1638  0.0935  269 PRO A CD    
1046 N N     . GLN A 142 ? 0.6798 0.4387 0.5636 -0.0309 0.1450  0.1236  270 GLN A N     
1047 C CA    . GLN A 142 ? 0.7275 0.4668 0.5791 -0.0096 0.1418  0.1355  270 GLN A CA    
1048 C C     . GLN A 142 ? 0.7162 0.4763 0.5526 0.0058  0.1293  0.1402  270 GLN A C     
1049 O O     . GLN A 142 ? 0.7776 0.5325 0.5914 0.0251  0.1212  0.1470  270 GLN A O     
1050 C CB    . GLN A 142 ? 0.7720 0.4817 0.6044 -0.0088 0.1597  0.1433  270 GLN A CB    
1051 N N     . LYS A 143 ? 0.6283 0.4138 0.4780 -0.0025 0.1279  0.1353  271 LYS A N     
1052 C CA    . LYS A 143 ? 0.5898 0.3967 0.4268 0.0099  0.1173  0.1372  271 LYS A CA    
1053 C C     . LYS A 143 ? 0.5641 0.3914 0.4116 0.0149  0.1004  0.1313  271 LYS A C     
1054 O O     . LYS A 143 ? 0.6044 0.4476 0.4389 0.0284  0.0889  0.1317  271 LYS A O     
1055 C CB    . LYS A 143 ? 0.5663 0.3897 0.4112 -0.0004 0.1257  0.1345  271 LYS A CB    
1056 N N     . LEU A 144 ? 0.4968 0.3246 0.3679 0.0038  0.0991  0.1247  272 LEU A N     
1057 C CA    . LEU A 144 ? 0.4196 0.2684 0.3044 0.0064  0.0833  0.1171  272 LEU A CA    
1058 C C     . LEU A 144 ? 0.3917 0.2326 0.2620 0.0229  0.0716  0.1197  272 LEU A C     
1059 O O     . LEU A 144 ? 0.4093 0.2252 0.2697 0.0271  0.0764  0.1247  272 LEU A O     
1060 C CB    . LEU A 144 ? 0.4031 0.2616 0.3213 -0.0113 0.0826  0.1051  272 LEU A CB    
1061 C CG    . LEU A 144 ? 0.4068 0.2794 0.3466 -0.0280 0.0927  0.0995  272 LEU A CG    
1062 C CD1   . LEU A 144 ? 0.3912 0.2728 0.3609 -0.0431 0.0908  0.0875  272 LEU A CD1   
1063 C CD2   . LEU A 144 ? 0.3779 0.2806 0.3231 -0.0245 0.0853  0.0950  272 LEU A CD2   
1064 N N     . THR A 145 ? 0.3749 0.2423 0.2484 0.0311  0.0549  0.1120  273 THR A N     
1065 C CA    . THR A 145 ? 0.3805 0.2480 0.2485 0.0443  0.0427  0.1103  273 THR A CA    
1066 C C     . THR A 145 ? 0.3605 0.2237 0.2513 0.0338  0.0403  0.1020  273 THR A C     
1067 O O     . THR A 145 ? 0.3252 0.1958 0.2380 0.0173  0.0433  0.0948  273 THR A O     
1068 C CB    . THR A 145 ? 0.3386 0.2392 0.2082 0.0524  0.0270  0.1009  273 THR A CB    
1069 O OG1   . THR A 145 ? 0.2993 0.2205 0.1948 0.0383  0.0226  0.0885  273 THR A OG1   
1070 C CG2   . THR A 145 ? 0.3422 0.2517 0.1904 0.0613  0.0284  0.1059  273 THR A CG2   
1071 N N     . GLN A 146 ? 0.3748 0.2289 0.2605 0.0442  0.0343  0.1020  274 GLN A N     
1072 C CA    . GLN A 146 ? 0.3681 0.2196 0.2738 0.0349  0.0313  0.0928  274 GLN A CA    
1073 C C     . GLN A 146 ? 0.3340 0.2165 0.2626 0.0249  0.0206  0.0790  274 GLN A C     
1074 O O     . GLN A 146 ? 0.3373 0.2215 0.2846 0.0111  0.0215  0.0715  274 GLN A O     
1075 C CB    . GLN A 146 ? 0.3990 0.2395 0.2951 0.0503  0.0257  0.0941  274 GLN A CB    
1076 C CG    . GLN A 146 ? 0.4759 0.2793 0.3476 0.0619  0.0379  0.1091  274 GLN A CG    
1077 C CD    . GLN A 146 ? 0.5843 0.3597 0.4624 0.0445  0.0550  0.1108  274 GLN A CD    
1078 O OE1   . GLN A 146 ? 0.6519 0.4175 0.5216 0.0404  0.0662  0.1170  274 GLN A OE1   
1079 N NE2   . GLN A 146 ? 0.6156 0.3850 0.5124 0.0322  0.0560  0.1012  274 GLN A NE2   
1080 N N     . GLN A 147 ? 0.3120 0.2185 0.2379 0.0318  0.0113  0.0753  275 GLN A N     
1081 C CA    . GLN A 147 ? 0.2732 0.2043 0.2171 0.0234  0.0037  0.0637  275 GLN A CA    
1082 C C     . GLN A 147 ? 0.2560 0.1925 0.2126 0.0100  0.0099  0.0627  275 GLN A C     
1083 O O     . GLN A 147 ? 0.2441 0.1899 0.2181 0.0006  0.0071  0.0552  275 GLN A O     
1084 C CB    . GLN A 147 ? 0.3023 0.2548 0.2395 0.0323  -0.0045 0.0592  275 GLN A CB    
1085 C CG    . GLN A 147 ? 0.2492 0.2213 0.2020 0.0256  -0.0113 0.0469  275 GLN A CG    
1086 C CD    . GLN A 147 ? 0.3203 0.3111 0.2674 0.0338  -0.0184 0.0397  275 GLN A CD    
1087 O OE1   . GLN A 147 ? 0.3347 0.3370 0.2764 0.0347  -0.0175 0.0381  275 GLN A OE1   
1088 N NE2   . GLN A 147 ? 0.3508 0.3460 0.2997 0.0394  -0.0249 0.0339  275 GLN A NE2   
1089 N N     . GLN A 148 ? 0.2668 0.1991 0.2143 0.0104  0.0185  0.0702  276 GLN A N     
1090 C CA    . GLN A 148 ? 0.2642 0.2033 0.2249 -0.0014 0.0258  0.0693  276 GLN A CA    
1091 C C     . GLN A 148 ? 0.2548 0.1830 0.2302 -0.0140 0.0325  0.0677  276 GLN A C     
1092 O O     . GLN A 148 ? 0.2671 0.2104 0.2623 -0.0242 0.0321  0.0608  276 GLN A O     
1093 C CB    . GLN A 148 ? 0.2717 0.2061 0.2172 0.0018  0.0355  0.0778  276 GLN A CB    
1094 C CG    . GLN A 148 ? 0.2819 0.2341 0.2183 0.0100  0.0297  0.0752  276 GLN A CG    
1095 C CD    . GLN A 148 ? 0.3068 0.2519 0.2200 0.0173  0.0376  0.0844  276 GLN A CD    
1096 O OE1   . GLN A 148 ? 0.3109 0.2347 0.2126 0.0173  0.0483  0.0945  276 GLN A OE1   
1097 N NE2   . GLN A 148 ? 0.3080 0.2697 0.2125 0.0235  0.0332  0.0804  276 GLN A NE2   
1098 N N     . LYS A 149 ? 0.2741 0.1767 0.2394 -0.0128 0.0392  0.0734  277 LYS A N     
1099 C CA    . LYS A 149 ? 0.2845 0.1751 0.2636 -0.0263 0.0468  0.0695  277 LYS A CA    
1100 C C     . LYS A 149 ? 0.2671 0.1742 0.2645 -0.0316 0.0353  0.0573  277 LYS A C     
1101 O O     . LYS A 149 ? 0.2479 0.1659 0.2648 -0.0447 0.0370  0.0493  277 LYS A O     
1102 C CB    . LYS A 149 ? 0.3399 0.1954 0.3026 -0.0222 0.0562  0.0774  277 LYS A CB    
1103 C CG    . LYS A 149 ? 0.4165 0.2495 0.3595 -0.0193 0.0716  0.0905  277 LYS A CG    
1104 C CD    . LYS A 149 ? 0.5248 0.3177 0.4494 -0.0135 0.0823  0.0992  277 LYS A CD    
1105 C CE    . LYS A 149 ? 0.6116 0.3888 0.5078 0.0003  0.0890  0.1126  277 LYS A CE    
1106 N NZ    . LYS A 149 ? 0.6937 0.4631 0.5915 -0.0121 0.1048  0.1139  277 LYS A NZ    
1107 N N     . ALA A 150 ? 0.2817 0.1931 0.2727 -0.0212 0.0238  0.0553  278 ALA A N     
1108 C CA    . ALA A 150 ? 0.2521 0.1772 0.2566 -0.0253 0.0139  0.0445  278 ALA A CA    
1109 C C     . ALA A 150 ? 0.2203 0.1720 0.2377 -0.0292 0.0084  0.0392  278 ALA A C     
1110 O O     . ALA A 150 ? 0.2107 0.1743 0.2424 -0.0369 0.0046  0.0313  278 ALA A O     
1111 C CB    . ALA A 150 ? 0.2461 0.1700 0.2411 -0.0138 0.0050  0.0430  278 ALA A CB    
1112 N N     . GLY A 151 ? 0.2183 0.1793 0.2293 -0.0228 0.0078  0.0432  279 GLY A N     
1113 C CA    . GLY A 151 ? 0.1893 0.1716 0.2106 -0.0244 0.0043  0.0392  279 GLY A CA    
1114 C C     . GLY A 151 ? 0.2063 0.1984 0.2444 -0.0344 0.0097  0.0372  279 GLY A C     
1115 O O     . GLY A 151 ? 0.1942 0.2047 0.2453 -0.0365 0.0048  0.0315  279 GLY A O     
1116 N N     . LEU A 152 ? 0.2057 0.1863 0.2432 -0.0400 0.0207  0.0416  280 LEU A N     
1117 C CA    . LEU A 152 ? 0.2195 0.2122 0.2757 -0.0514 0.0277  0.0377  280 LEU A CA    
1118 C C     . LEU A 152 ? 0.2389 0.2345 0.3098 -0.0618 0.0255  0.0283  280 LEU A C     
1119 O O     . LEU A 152 ? 0.2065 0.2259 0.2967 -0.0683 0.0226  0.0200  280 LEU A O     
1120 C CB    . LEU A 152 ? 0.2784 0.2558 0.3284 -0.0558 0.0431  0.0449  280 LEU A CB    
1121 C CG    . LEU A 152 ? 0.3551 0.3388 0.3973 -0.0494 0.0476  0.0511  280 LEU A CG    
1122 C CD1   . LEU A 152 ? 0.4203 0.3824 0.4494 -0.0524 0.0634  0.0599  280 LEU A CD1   
1123 C CD2   . LEU A 152 ? 0.3575 0.3706 0.4219 -0.0534 0.0468  0.0444  280 LEU A CD2   
1124 N N     . GLN A 153 ? 0.2467 0.2190 0.3079 -0.0627 0.0270  0.0290  281 GLN A N     
1125 C CA    . GLN A 153 ? 0.2524 0.2242 0.3250 -0.0730 0.0257  0.0188  281 GLN A CA    
1126 C C     . GLN A 153 ? 0.2132 0.2112 0.2959 -0.0714 0.0115  0.0099  281 GLN A C     
1127 O O     . GLN A 153 ? 0.2071 0.2223 0.3066 -0.0813 0.0095  -0.0008 281 GLN A O     
1128 C CB    . GLN A 153 ? 0.2865 0.2279 0.3437 -0.0696 0.0280  0.0217  281 GLN A CB    
1129 C CG    . GLN A 153 ? 0.3050 0.2442 0.3717 -0.0791 0.0262  0.0101  281 GLN A CG    
1130 C CD    . GLN A 153 ? 0.3492 0.2858 0.4315 -0.0971 0.0387  0.0023  281 GLN A CD    
1131 O OE1   . GLN A 153 ? 0.3513 0.2711 0.4305 -0.1016 0.0533  0.0089  281 GLN A OE1   
1132 N NE2   . GLN A 153 ? 0.3558 0.3093 0.4544 -0.1082 0.0340  -0.0126 281 GLN A NE2   
1133 N N     . HIS A 154 ? 0.1721 0.1732 0.2434 -0.0589 0.0025  0.0140  282 HIS A N     
1134 C CA    . HIS A 154 ? 0.1645 0.1826 0.2387 -0.0554 -0.0093 0.0078  282 HIS A CA    
1135 C C     . HIS A 154 ? 0.1635 0.2024 0.2412 -0.0484 -0.0134 0.0099  282 HIS A C     
1136 O O     . HIS A 154 ? 0.1508 0.1980 0.2245 -0.0418 -0.0215 0.0083  282 HIS A O     
1137 C CB    . HIS A 154 ? 0.1665 0.1695 0.2251 -0.0477 -0.0143 0.0091  282 HIS A CB    
1138 C CG    . HIS A 154 ? 0.1703 0.1540 0.2263 -0.0528 -0.0109 0.0058  282 HIS A CG    
1139 N ND1   . HIS A 154 ? 0.1771 0.1652 0.2429 -0.0626 -0.0123 -0.0045 282 HIS A ND1   
1140 C CD2   . HIS A 154 ? 0.1868 0.1463 0.2314 -0.0489 -0.0053 0.0112  282 HIS A CD2   
1141 C CE1   . HIS A 154 ? 0.2029 0.1676 0.2637 -0.0655 -0.0066 -0.0057 282 HIS A CE1   
1142 N NE2   . HIS A 154 ? 0.1984 0.1448 0.2460 -0.0561 -0.0023 0.0046  282 HIS A NE2   
1143 N N     . HIS A 155 ? 0.1900 0.2360 0.2752 -0.0501 -0.0064 0.0133  283 HIS A N     
1144 C CA    . HIS A 155 ? 0.1732 0.2336 0.2592 -0.0415 -0.0079 0.0167  283 HIS A CA    
1145 C C     . HIS A 155 ? 0.1384 0.2224 0.2340 -0.0377 -0.0169 0.0112  283 HIS A C     
1146 O O     . HIS A 155 ? 0.1340 0.2199 0.2214 -0.0271 -0.0208 0.0143  283 HIS A O     
1147 C CB    . HIS A 155 ? 0.1952 0.2615 0.2900 -0.0451 0.0023  0.0196  283 HIS A CB    
1148 C CG    . HIS A 155 ? 0.2327 0.3122 0.3286 -0.0358 0.0023  0.0225  283 HIS A CG    
1149 N ND1   . HIS A 155 ? 0.2455 0.3513 0.3581 -0.0334 -0.0009 0.0182  283 HIS A ND1   
1150 C CD2   . HIS A 155 ? 0.2783 0.3484 0.3605 -0.0277 0.0051  0.0283  283 HIS A CD2   
1151 C CE1   . HIS A 155 ? 0.2753 0.3841 0.3838 -0.0235 0.0012  0.0225  283 HIS A CE1   
1152 N NE2   . HIS A 155 ? 0.2915 0.3784 0.3817 -0.0211 0.0052  0.0279  283 HIS A NE2   
1153 N N     . GLN A 156 ? 0.1290 0.2312 0.2414 -0.0459 -0.0192 0.0027  284 GLN A N     
1154 C CA    . GLN A 156 ? 0.1650 0.2944 0.2859 -0.0400 -0.0290 -0.0025 284 GLN A CA    
1155 C C     . GLN A 156 ? 0.1639 0.2837 0.2672 -0.0319 -0.0375 -0.0014 284 GLN A C     
1156 O O     . GLN A 156 ? 0.1758 0.3015 0.2718 -0.0196 -0.0420 0.0024  284 GLN A O     
1157 C CB    . GLN A 156 ? 0.1705 0.3249 0.3128 -0.0514 -0.0312 -0.0148 284 GLN A CB    
1158 C CG    . GLN A 156 ? 0.2025 0.3870 0.3501 -0.0433 -0.0440 -0.0208 284 GLN A CG    
1159 C CD    . GLN A 156 ? 0.3392 0.5550 0.5104 -0.0555 -0.0471 -0.0361 284 GLN A CD    
1160 O OE1   . GLN A 156 ? 0.3749 0.5919 0.5622 -0.0706 -0.0374 -0.0421 284 GLN A OE1   
1161 N NE2   . GLN A 156 ? 0.4077 0.6491 0.5800 -0.0493 -0.0600 -0.0433 284 GLN A NE2   
1162 N N     . ASP A 157 ? 0.1261 0.2286 0.2213 -0.0383 -0.0382 -0.0043 285 ASP A N     
1163 C CA    . ASP A 157 ? 0.1259 0.2181 0.2039 -0.0316 -0.0444 -0.0037 285 ASP A CA    
1164 C C     . ASP A 157 ? 0.1340 0.2095 0.1963 -0.0220 -0.0412 0.0049  285 ASP A C     
1165 O O     . ASP A 157 ? 0.1588 0.2329 0.2095 -0.0135 -0.0445 0.0069  285 ASP A O     
1166 C CB    . ASP A 157 ? 0.1310 0.2071 0.2042 -0.0398 -0.0442 -0.0090 285 ASP A CB    
1167 C CG    . ASP A 157 ? 0.1617 0.2538 0.2463 -0.0492 -0.0488 -0.0208 285 ASP A CG    
1168 O OD1   . ASP A 157 ? 0.1624 0.2826 0.2581 -0.0482 -0.0546 -0.0257 285 ASP A OD1   
1169 O OD2   . ASP A 157 ? 0.1654 0.2427 0.2480 -0.0572 -0.0465 -0.0261 285 ASP A OD2   
1170 N N     . LEU A 158 ? 0.1343 0.1963 0.1946 -0.0235 -0.0339 0.0095  286 LEU A N     
1171 C CA    . LEU A 158 ? 0.1388 0.1874 0.1854 -0.0163 -0.0307 0.0147  286 LEU A CA    
1172 C C     . LEU A 158 ? 0.1601 0.2172 0.2068 -0.0078 -0.0291 0.0185  286 LEU A C     
1173 O O     . LEU A 158 ? 0.1905 0.2370 0.2255 -0.0020 -0.0262 0.0209  286 LEU A O     
1174 C CB    . LEU A 158 ? 0.1590 0.1950 0.2022 -0.0187 -0.0245 0.0178  286 LEU A CB    
1175 C CG    . LEU A 158 ? 0.2121 0.2348 0.2516 -0.0234 -0.0249 0.0157  286 LEU A CG    
1176 C CD1   . LEU A 158 ? 0.2208 0.2314 0.2515 -0.0205 -0.0201 0.0202  286 LEU A CD1   
1177 C CD2   . LEU A 158 ? 0.2003 0.2192 0.2338 -0.0229 -0.0304 0.0105  286 LEU A CD2   
1178 N N     . SER A 159 ? 0.1286 0.2050 0.1894 -0.0073 -0.0302 0.0180  287 SER A N     
1179 C CA    A SER A 159 ? 0.1502 0.2362 0.2124 0.0032  -0.0288 0.0217  287 SER A CA    
1180 C CA    B SER A 159 ? 0.1538 0.2406 0.2167 0.0031  -0.0289 0.0216  287 SER A CA    
1181 C C     . SER A 159 ? 0.1612 0.2549 0.2176 0.0127  -0.0360 0.0217  287 SER A C     
1182 O O     . SER A 159 ? 0.1901 0.2881 0.2439 0.0246  -0.0348 0.0260  287 SER A O     
1183 C CB    A SER A 159 ? 0.1532 0.2595 0.2347 0.0010  -0.0259 0.0208  287 SER A CB    
1184 C CB    B SER A 159 ? 0.1586 0.2674 0.2418 0.0006  -0.0268 0.0201  287 SER A CB    
1185 O OG    A SER A 159 ? 0.1639 0.2595 0.2457 -0.0059 -0.0176 0.0227  287 SER A OG    
1186 O OG    B SER A 159 ? 0.2000 0.3336 0.2957 0.0011  -0.0349 0.0146  287 SER A OG    
1187 N N     . THR A 160 ? 0.1339 0.2283 0.1865 0.0086  -0.0427 0.0173  288 THR A N     
1188 C CA    . THR A 160 ? 0.1587 0.2603 0.2021 0.0178  -0.0499 0.0173  288 THR A CA    
1189 C C     . THR A 160 ? 0.1444 0.2191 0.1647 0.0229  -0.0455 0.0219  288 THR A C     
1190 O O     . THR A 160 ? 0.1514 0.2101 0.1661 0.0146  -0.0426 0.0193  288 THR A O     
1191 C CB    . THR A 160 ? 0.1993 0.3144 0.2482 0.0098  -0.0585 0.0086  288 THR A CB    
1192 O OG1   . THR A 160 ? 0.1823 0.3226 0.2548 0.0023  -0.0604 0.0022  288 THR A OG1   
1193 C CG2   . THR A 160 ? 0.2232 0.3467 0.2587 0.0204  -0.0665 0.0088  288 THR A CG2   
1194 N N     . PRO A 161 ? 0.1581 0.2274 0.1650 0.0366  -0.0438 0.0282  289 PRO A N     
1195 C CA    . PRO A 161 ? 0.1874 0.2280 0.1725 0.0385  -0.0363 0.0312  289 PRO A CA    
1196 C C     . PRO A 161 ? 0.1801 0.2133 0.1549 0.0318  -0.0396 0.0265  289 PRO A C     
1197 O O     . PRO A 161 ? 0.1764 0.2231 0.1488 0.0342  -0.0484 0.0244  289 PRO A O     
1198 C CB    . PRO A 161 ? 0.2236 0.2590 0.1939 0.0558  -0.0340 0.0395  289 PRO A CB    
1199 C CG    . PRO A 161 ? 0.2501 0.3089 0.2385 0.0629  -0.0370 0.0412  289 PRO A CG    
1200 C CD    . PRO A 161 ? 0.1956 0.2816 0.2059 0.0513  -0.0464 0.0329  289 PRO A CD    
1201 N N     . VAL A 162 ? 0.1451 0.1384 0.1970 -0.0172 -0.0235 0.0101  290 VAL A N     
1202 C CA    . VAL A 162 ? 0.1555 0.1452 0.1832 -0.0192 -0.0282 0.0080  290 VAL A CA    
1203 C C     . VAL A 162 ? 0.1666 0.1592 0.1909 -0.0196 -0.0358 0.0142  290 VAL A C     
1204 O O     . VAL A 162 ? 0.1404 0.1335 0.1740 -0.0168 -0.0327 0.0178  290 VAL A O     
1205 C CB    . VAL A 162 ? 0.1595 0.1440 0.1707 -0.0166 -0.0193 0.0034  290 VAL A CB    
1206 C CG1   . VAL A 162 ? 0.1555 0.1370 0.1458 -0.0184 -0.0225 0.0007  290 VAL A CG1   
1207 C CG2   . VAL A 162 ? 0.1593 0.1418 0.1747 -0.0156 -0.0115 0.0006  290 VAL A CG2   
1208 N N     . LEU A 163 ? 0.1689 0.1632 0.1802 -0.0233 -0.0455 0.0154  291 LEU A N     
1209 C CA    . LEU A 163 ? 0.1752 0.1735 0.1810 -0.0240 -0.0533 0.0242  291 LEU A CA    
1210 C C     . LEU A 163 ? 0.2049 0.2006 0.1843 -0.0242 -0.0498 0.0231  291 LEU A C     
1211 O O     . LEU A 163 ? 0.1858 0.1770 0.1508 -0.0243 -0.0439 0.0144  291 LEU A O     
1212 C CB    . LEU A 163 ? 0.1874 0.1920 0.1943 -0.0282 -0.0679 0.0277  291 LEU A CB    
1213 C CG    . LEU A 163 ? 0.2527 0.2615 0.2908 -0.0285 -0.0722 0.0292  291 LEU A CG    
1214 C CD1   . LEU A 163 ? 0.2905 0.3069 0.3314 -0.0330 -0.0895 0.0334  291 LEU A CD1   
1215 C CD2   . LEU A 163 ? 0.2300 0.2401 0.2941 -0.0240 -0.0664 0.0361  291 LEU A CD2   
1216 N N     . ARG A 164 ? 0.2219 0.2208 0.1967 -0.0244 -0.0533 0.0332  292 ARG A N     
1217 C CA    A ARG A 164 ? 0.2463 0.2441 0.1980 -0.0247 -0.0483 0.0337  292 ARG A CA    
1218 C CA    B ARG A 164 ? 0.2471 0.2449 0.1988 -0.0246 -0.0482 0.0337  292 ARG A CA    
1219 C C     . ARG A 164 ? 0.2544 0.2525 0.1792 -0.0278 -0.0506 0.0257  292 ARG A C     
1220 O O     . ARG A 164 ? 0.2357 0.2309 0.1443 -0.0272 -0.0423 0.0197  292 ARG A O     
1221 C CB    A ARG A 164 ? 0.2824 0.2846 0.2354 -0.0248 -0.0519 0.0489  292 ARG A CB    
1222 C CB    B ARG A 164 ? 0.2920 0.2941 0.2448 -0.0248 -0.0516 0.0488  292 ARG A CB    
1223 C CG    A ARG A 164 ? 0.2907 0.2901 0.2676 -0.0216 -0.0456 0.0539  292 ARG A CG    
1224 C CG    B ARG A 164 ? 0.3538 0.3557 0.2867 -0.0250 -0.0438 0.0512  292 ARG A CG    
1225 C CD    A ARG A 164 ? 0.3567 0.3517 0.3268 -0.0202 -0.0341 0.0477  292 ARG A CD    
1226 C CD    B ARG A 164 ? 0.3920 0.3885 0.3368 -0.0221 -0.0323 0.0461  292 ARG A CD    
1227 N NE    A ARG A 164 ? 0.4080 0.4041 0.3503 -0.0220 -0.0310 0.0444  292 ARG A NE    
1228 N NE    B ARG A 164 ? 0.4097 0.4061 0.3371 -0.0223 -0.0235 0.0438  292 ARG A NE    
1229 C CZ    A ARG A 164 ? 0.4021 0.3963 0.3382 -0.0211 -0.0213 0.0408  292 ARG A CZ    
1230 C CZ    B ARG A 164 ? 0.4059 0.4005 0.3438 -0.0207 -0.0152 0.0449  292 ARG A CZ    
1231 N NH1   A ARG A 164 ? 0.3932 0.3845 0.3479 -0.0189 -0.0159 0.0400  292 ARG A NH1   
1232 N NH1   B ARG A 164 ? 0.3830 0.3750 0.3462 -0.0189 -0.0152 0.0467  292 ARG A NH1   
1233 N NH2   A ARG A 164 ? 0.4124 0.4082 0.3253 -0.0223 -0.0173 0.0370  292 ARG A NH2   
1234 N NH2   B ARG A 164 ? 0.3981 0.3940 0.3232 -0.0209 -0.0069 0.0433  292 ARG A NH2   
1235 N N     . SER A 165 ? 0.2668 0.2686 0.1885 -0.0311 -0.0623 0.0245  293 SER A N     
1236 C CA    . SER A 165 ? 0.2904 0.2918 0.1870 -0.0343 -0.0651 0.0136  293 SER A CA    
1237 C C     . SER A 165 ? 0.2813 0.2746 0.1815 -0.0333 -0.0562 -0.0007 293 SER A C     
1238 O O     . SER A 165 ? 0.2667 0.2567 0.1479 -0.0339 -0.0514 -0.0108 293 SER A O     
1239 C CB    . SER A 165 ? 0.3390 0.3462 0.2347 -0.0387 -0.0815 0.0137  293 SER A CB    
1240 O OG    . SER A 165 ? 0.3496 0.3563 0.2756 -0.0388 -0.0855 0.0126  293 SER A OG    
1241 N N     . ASP A 166 ? 0.2474 0.2378 0.1725 -0.0314 -0.0536 -0.0009 294 ASP A N     
1242 C CA    . ASP A 166 ? 0.2251 0.2083 0.1563 -0.0300 -0.0453 -0.0105 294 ASP A CA    
1243 C C     . ASP A 166 ? 0.2382 0.2180 0.1606 -0.0264 -0.0337 -0.0114 294 ASP A C     
1244 O O     . ASP A 166 ? 0.2200 0.1948 0.1360 -0.0256 -0.0277 -0.0199 294 ASP A O     
1245 C CB    . ASP A 166 ? 0.2192 0.2018 0.1766 -0.0286 -0.0435 -0.0077 294 ASP A CB    
1246 C CG    . ASP A 166 ? 0.2565 0.2437 0.2303 -0.0321 -0.0543 -0.0060 294 ASP A CG    
1247 O OD1   . ASP A 166 ? 0.2678 0.2558 0.2341 -0.0364 -0.0636 -0.0119 294 ASP A OD1   
1248 O OD2   . ASP A 166 ? 0.2423 0.2326 0.2383 -0.0305 -0.0535 0.0003  294 ASP A OD2   
1249 N N     . VAL A 167 ? 0.2297 0.2123 0.1564 -0.0241 -0.0308 -0.0026 295 VAL A N     
1250 C CA    . VAL A 167 ? 0.2201 0.2008 0.1427 -0.0211 -0.0212 -0.0027 295 VAL A CA    
1251 C C     . VAL A 167 ? 0.2344 0.2155 0.1362 -0.0221 -0.0179 -0.0066 295 VAL A C     
1252 O O     . VAL A 167 ? 0.2532 0.2311 0.1523 -0.0201 -0.0100 -0.0129 295 VAL A O     
1253 C CB    . VAL A 167 ? 0.1905 0.1740 0.1232 -0.0195 -0.0202 0.0070  295 VAL A CB    
1254 C CG1   . VAL A 167 ? 0.2188 0.2017 0.1490 -0.0175 -0.0117 0.0069  295 VAL A CG1   
1255 C CG2   . VAL A 167 ? 0.1841 0.1668 0.1374 -0.0177 -0.0206 0.0077  295 VAL A CG2   
1256 N N     . ASP A 168 ? 0.2389 0.2248 0.1260 -0.0249 -0.0236 -0.0023 296 ASP A N     
1257 C CA    . ASP A 168 ? 0.2795 0.2674 0.1428 -0.0258 -0.0187 -0.0058 296 ASP A CA    
1258 C C     . ASP A 168 ? 0.2902 0.2727 0.1457 -0.0263 -0.0162 -0.0215 296 ASP A C     
1259 O O     . ASP A 168 ? 0.2743 0.2551 0.1226 -0.0244 -0.0061 -0.0280 296 ASP A O     
1260 C CB    . ASP A 168 ? 0.3352 0.3302 0.1799 -0.0292 -0.0269 0.0022  296 ASP A CB    
1261 C CG    . ASP A 168 ? 0.4301 0.4298 0.2843 -0.0285 -0.0279 0.0197  296 ASP A CG    
1262 O OD1   . ASP A 168 ? 0.4134 0.4109 0.2844 -0.0257 -0.0200 0.0232  296 ASP A OD1   
1263 O OD2   . ASP A 168 ? 0.4865 0.4923 0.3328 -0.0309 -0.0374 0.0300  296 ASP A OD2   
1264 N N     . ALA A 169 ? 0.2853 0.2653 0.1467 -0.0286 -0.0250 -0.0276 297 ALA A N     
1265 C CA    . ALA A 169 ? 0.2834 0.2570 0.1427 -0.0295 -0.0235 -0.0430 297 ALA A CA    
1266 C C     . ALA A 169 ? 0.2656 0.2325 0.1416 -0.0253 -0.0134 -0.0462 297 ALA A C     
1267 O O     . ALA A 169 ? 0.2790 0.2413 0.1511 -0.0239 -0.0062 -0.0565 297 ALA A O     
1268 C CB    . ALA A 169 ? 0.2956 0.2678 0.1645 -0.0334 -0.0357 -0.0476 297 ALA A CB    
1269 N N     . LEU A 170 ? 0.2195 0.1861 0.1142 -0.0232 -0.0131 -0.0376 298 LEU A N     
1270 C CA    . LEU A 170 ? 0.2372 0.1989 0.1464 -0.0193 -0.0058 -0.0385 298 LEU A CA    
1271 C C     . LEU A 170 ? 0.2551 0.2185 0.1597 -0.0160 0.0033  -0.0375 298 LEU A C     
1272 O O     . LEU A 170 ? 0.2418 0.2013 0.1535 -0.0131 0.0095  -0.0420 298 LEU A O     
1273 C CB    . LEU A 170 ? 0.1920 0.1545 0.1174 -0.0181 -0.0076 -0.0301 298 LEU A CB    
1274 C CG    . LEU A 170 ? 0.2199 0.1802 0.1568 -0.0209 -0.0135 -0.0315 298 LEU A CG    
1275 C CD1   . LEU A 170 ? 0.2152 0.1792 0.1650 -0.0201 -0.0147 -0.0228 298 LEU A CD1   
1276 C CD2   . LEU A 170 ? 0.2129 0.1657 0.1599 -0.0199 -0.0094 -0.0372 298 LEU A CD2   
1277 N N     . GLN A 171 ? 0.2325 0.2020 0.1287 -0.0164 0.0038  -0.0304 299 GLN A N     
1278 C CA    . GLN A 171 ? 0.2409 0.2131 0.1362 -0.0139 0.0129  -0.0288 299 GLN A CA    
1279 C C     . GLN A 171 ? 0.2698 0.2405 0.1537 -0.0135 0.0203  -0.0392 299 GLN A C     
1280 O O     . GLN A 171 ? 0.2744 0.2443 0.1670 -0.0101 0.0289  -0.0424 299 GLN A O     
1281 C CB    . GLN A 171 ? 0.2537 0.2324 0.1448 -0.0150 0.0127  -0.0181 299 GLN A CB    
1282 C CG    . GLN A 171 ? 0.2840 0.2660 0.1794 -0.0128 0.0228  -0.0160 299 GLN A CG    
1283 C CD    . GLN A 171 ? 0.3537 0.3401 0.2597 -0.0131 0.0228  -0.0048 299 GLN A CD    
1284 O OE1   . GLN A 171 ? 0.3252 0.3122 0.2348 -0.0146 0.0158  0.0020  299 GLN A OE1   
1285 N NE2   . GLN A 171 ? 0.4183 0.4080 0.3336 -0.0115 0.0309  -0.0030 299 GLN A NE2   
1286 N N     . GLN A 172 ? 0.2571 0.2280 0.1224 -0.0167 0.0169  -0.0455 300 GLN A N     
1287 C CA    . GLN A 172 ? 0.2896 0.2594 0.1449 -0.0155 0.0243  -0.0575 300 GLN A CA    
1288 C C     . GLN A 172 ? 0.3015 0.2623 0.1742 -0.0131 0.0273  -0.0682 300 GLN A C     
1289 O O     . GLN A 172 ? 0.3001 0.2599 0.1793 -0.0092 0.0367  -0.0740 300 GLN A O     
1290 C CB    . GLN A 172 ? 0.3427 0.3157 0.1796 -0.0176 0.0166  -0.0616 300 GLN A CB    
1291 C CG    . GLN A 172 ? 0.4132 0.3848 0.2415 -0.0146 0.0226  -0.0743 300 GLN A CG    
1292 N N     . VAL A 173 ? 0.2638 0.2186 0.1477 -0.0148 0.0193  -0.0689 301 VAL A N     
1293 C CA    . VAL A 173 ? 0.2699 0.2160 0.1739 -0.0126 0.0213  -0.0756 301 VAL A CA    
1294 C C     . VAL A 173 ? 0.2488 0.1950 0.1710 -0.0072 0.0284  -0.0689 301 VAL A C     
1295 O O     . VAL A 173 ? 0.2516 0.1930 0.1864 -0.0038 0.0354  -0.0757 301 VAL A O     
1296 C CB    . VAL A 173 ? 0.3570 0.2992 0.2731 -0.0153 0.0114  -0.0722 301 VAL A CB    
1297 C CG1   . VAL A 173 ? 0.3576 0.2925 0.2981 -0.0123 0.0141  -0.0710 301 VAL A CG1   
1298 C CG2   . VAL A 173 ? 0.3616 0.3018 0.2673 -0.0206 0.0038  -0.0831 301 VAL A CG2   
1299 N N     . VAL A 174 ? 0.2401 0.1920 0.1652 -0.0064 0.0259  -0.0562 302 VAL A N     
1300 C CA    . VAL A 174 ? 0.2279 0.1816 0.1690 -0.0020 0.0294  -0.0495 302 VAL A CA    
1301 C C     . VAL A 174 ? 0.2468 0.2049 0.1879 0.0005  0.0390  -0.0522 302 VAL A C     
1302 O O     . VAL A 174 ? 0.2310 0.1879 0.1889 0.0046  0.0442  -0.0537 302 VAL A O     
1303 C CB    . VAL A 174 ? 0.2451 0.2038 0.1880 -0.0024 0.0235  -0.0382 302 VAL A CB    
1304 C CG1   . VAL A 174 ? 0.2213 0.1838 0.1779 0.0015  0.0254  -0.0324 302 VAL A CG1   
1305 C CG2   . VAL A 174 ? 0.2612 0.2160 0.2080 -0.0039 0.0169  -0.0355 302 VAL A CG2   
1306 N N     . GLU A 175 ? 0.2627 0.2265 0.1869 -0.0019 0.0420  -0.0519 303 GLU A N     
1307 C CA    . GLU A 175 ? 0.2859 0.2546 0.2099 0.0002  0.0538  -0.0545 303 GLU A CA    
1308 C C     . GLU A 175 ? 0.2810 0.2443 0.2083 0.0027  0.0624  -0.0684 303 GLU A C     
1309 O O     . GLU A 175 ? 0.2816 0.2470 0.2254 0.0069  0.0719  -0.0702 303 GLU A O     
1310 C CB    . GLU A 175 ? 0.2904 0.2658 0.1921 -0.0033 0.0564  -0.0509 303 GLU A CB    
1311 C CG    . GLU A 175 ? 0.3159 0.2970 0.2229 -0.0046 0.0516  -0.0368 303 GLU A CG    
1312 C CD    . GLU A 175 ? 0.3871 0.3743 0.2746 -0.0081 0.0529  -0.0300 303 GLU A CD    
1313 O OE1   . GLU A 175 ? 0.4452 0.4328 0.3098 -0.0099 0.0554  -0.0362 303 GLU A OE1   
1314 O OE2   . GLU A 175 ? 0.3806 0.3720 0.2757 -0.0091 0.0508  -0.0183 303 GLU A OE2   
1315 N N     . GLU A 176 ? 0.2920 0.2495 0.2085 0.0005  0.0579  -0.0778 304 GLU A N     
1316 C CA    . GLU A 176 ? 0.3070 0.2600 0.2316 0.0036  0.0626  -0.0893 304 GLU A CA    
1317 C C     . GLU A 176 ? 0.3022 0.2485 0.2575 0.0078  0.0649  -0.0897 304 GLU A C     
1318 O O     . GLU A 176 ? 0.2824 0.2289 0.2536 0.0122  0.0731  -0.0936 304 GLU A O     
1319 C CB    . GLU A 176 ? 0.3266 0.2743 0.2376 0.0005  0.0545  -0.0983 304 GLU A CB    
1320 C CG    . GLU A 176 ? 0.3739 0.3152 0.2922 0.0032  0.0592  -0.1117 304 GLU A CG    
1321 N N     . ALA A 177 ? 0.2597 0.2004 0.2242 0.0068  0.0576  -0.0843 305 ALA A N     
1322 C CA    . ALA A 177 ? 0.2481 0.1834 0.2415 0.0112  0.0567  -0.0800 305 ALA A CA    
1323 C C     . ALA A 177 ? 0.2344 0.1774 0.2439 0.0159  0.0603  -0.0704 305 ALA A C     
1324 O O     . ALA A 177 ? 0.2622 0.2031 0.2961 0.0208  0.0650  -0.0713 305 ALA A O     
1325 C CB    . ALA A 177 ? 0.2388 0.1706 0.2358 0.0089  0.0454  -0.0704 305 ALA A CB    
1326 N N     . VAL A 178 ? 0.2268 0.1789 0.2262 0.0142  0.0569  -0.0608 306 VAL A N     
1327 C CA    . VAL A 178 ? 0.1992 0.1597 0.2153 0.0177  0.0589  -0.0527 306 VAL A CA    
1328 C C     . VAL A 178 ? 0.2147 0.1785 0.2399 0.0207  0.0727  -0.0605 306 VAL A C     
1329 O O     . VAL A 178 ? 0.2141 0.1808 0.2659 0.0256  0.0762  -0.0580 306 VAL A O     
1330 C CB    . VAL A 178 ? 0.2126 0.1811 0.2168 0.0144  0.0530  -0.0434 306 VAL A CB    
1331 C CG1   . VAL A 178 ? 0.2062 0.1843 0.2289 0.0169  0.0557  -0.0374 306 VAL A CG1   
1332 C CG2   . VAL A 178 ? 0.2036 0.1699 0.2045 0.0130  0.0413  -0.0361 306 VAL A CG2   
1333 N N     . GLY A 179 ? 0.2187 0.1833 0.2224 0.0181  0.0811  -0.0695 307 GLY A N     
1334 C CA    . GLY A 179 ? 0.2364 0.2060 0.2454 0.0205  0.0940  -0.0756 307 GLY A CA    
1335 C C     . GLY A 179 ? 0.2832 0.2466 0.3110 0.0244  0.0967  -0.0837 307 GLY A C     
1336 O O     . GLY A 179 ? 0.2921 0.2598 0.3381 0.0280  0.1054  -0.0849 307 GLY A O     
1337 N N     . GLN A 180 ? 0.3031 0.2560 0.3289 0.0233  0.0895  -0.0887 308 GLN A N     
1338 C CA    . GLN A 180 ? 0.3103 0.2561 0.3590 0.0266  0.0910  -0.0946 308 GLN A CA    
1339 C C     . GLN A 180 ? 0.2642 0.2103 0.3485 0.0317  0.0888  -0.0841 308 GLN A C     
1340 O O     . GLN A 180 ? 0.2745 0.2195 0.3835 0.0354  0.0932  -0.0861 308 GLN A O     
1341 C CB    . GLN A 180 ? 0.4008 0.3357 0.4414 0.0234  0.0832  -0.1010 308 GLN A CB    
1342 C CG    . GLN A 180 ? 0.4795 0.4136 0.4908 0.0196  0.0839  -0.1133 308 GLN A CG    
1343 C CD    . GLN A 180 ? 0.5420 0.4661 0.5487 0.0158  0.0743  -0.1187 308 GLN A CD    
1344 O OE1   . GLN A 180 ? 0.5513 0.4707 0.5694 0.0147  0.0668  -0.1110 308 GLN A OE1   
1345 N NE2   . GLN A 180 ? 0.5853 0.5064 0.5756 0.0138  0.0747  -0.1318 308 GLN A NE2   
1346 N N     . ALA A 181 ? 0.2495 0.1972 0.3364 0.0320  0.0810  -0.0728 309 ALA A N     
1347 C CA    . ALA A 181 ? 0.1968 0.1455 0.3140 0.0370  0.0750  -0.0604 309 ALA A CA    
1348 C C     . ALA A 181 ? 0.2020 0.1629 0.3390 0.0406  0.0784  -0.0540 309 ALA A C     
1349 O O     . ALA A 181 ? 0.1970 0.1606 0.3632 0.0449  0.0747  -0.0459 309 ALA A O     
1350 C CB    . ALA A 181 ? 0.1826 0.1307 0.2877 0.0344  0.0615  -0.0484 309 ALA A CB    
1351 N N     . LEU A 182 ? 0.1953 0.1644 0.3177 0.0383  0.0845  -0.0561 310 LEU A N     
1352 C CA    . LEU A 182 ? 0.1830 0.1646 0.3269 0.0407  0.0874  -0.0495 310 LEU A CA    
1353 C C     . LEU A 182 ? 0.1910 0.1797 0.3185 0.0373  0.0993  -0.0546 310 LEU A C     
1354 O O     . LEU A 182 ? 0.1850 0.1767 0.2903 0.0332  0.0981  -0.0523 310 LEU A O     
1355 C CB    . LEU A 182 ? 0.1758 0.1643 0.3219 0.0394  0.0718  -0.0354 310 LEU A CB    
1356 C CG    . LEU A 182 ? 0.1893 0.1916 0.3590 0.0406  0.0717  -0.0287 310 LEU A CG    
1357 C CD1   . LEU A 182 ? 0.1855 0.1907 0.3943 0.0470  0.0744  -0.0270 310 LEU A CD1   
1358 C CD2   . LEU A 182 ? 0.2021 0.2101 0.3658 0.0375  0.0542  -0.0179 310 LEU A CD2   
1359 N N     . PRO A 183 ? 0.2142 0.2058 0.3516 0.0387  0.1101  -0.0598 311 PRO A N     
1360 C CA    . PRO A 183 ? 0.2489 0.2479 0.3708 0.0361  0.1221  -0.0624 311 PRO A CA    
1361 C C     . PRO A 183 ? 0.2331 0.2432 0.3627 0.0343  0.1209  -0.0514 311 PRO A C     
1362 O O     . PRO A 183 ? 0.2230 0.2395 0.3845 0.0368  0.1155  -0.0435 311 PRO A O     
1363 C CB    . PRO A 183 ? 0.3106 0.3117 0.4539 0.0396  0.1328  -0.0674 311 PRO A CB    
1364 C CG    . PRO A 183 ? 0.3131 0.3034 0.4679 0.0424  0.1278  -0.0730 311 PRO A CG    
1365 C CD    . PRO A 183 ? 0.2185 0.2057 0.3805 0.0427  0.1126  -0.0636 311 PRO A CD    
1366 N N     . GLY A 184 ? 0.2351 0.2478 0.3370 0.0296  0.1241  -0.0501 312 GLY A N     
1367 C CA    . GLY A 184 ? 0.2188 0.2420 0.3295 0.0269  0.1242  -0.0394 312 GLY A CA    
1368 C C     . GLY A 184 ? 0.2148 0.2360 0.3193 0.0239  0.1075  -0.0322 312 GLY A C     
1369 O O     . GLY A 184 ? 0.1925 0.2203 0.3012 0.0203  0.1035  -0.0235 312 GLY A O     
1370 N N     . ALA A 185 ? 0.1919 0.2034 0.2866 0.0247  0.0956  -0.0350 313 ALA A N     
1371 C CA    . ALA A 185 ? 0.1928 0.2018 0.2771 0.0214  0.0783  -0.0282 313 ALA A CA    
1372 C C     . ALA A 185 ? 0.2242 0.2317 0.2784 0.0158  0.0785  -0.0270 313 ALA A C     
1373 O O     . ALA A 185 ? 0.2631 0.2680 0.2968 0.0147  0.0880  -0.0326 313 ALA A O     
1374 C CB    . ALA A 185 ? 0.1857 0.1854 0.2662 0.0235  0.0683  -0.0302 313 ALA A CB    
1375 N N     . THR A 186 ? 0.1941 0.2035 0.2464 0.0125  0.0677  -0.0199 314 THR A N     
1376 C CA    . THR A 186 ? 0.1919 0.1998 0.2208 0.0076  0.0665  -0.0168 314 THR A CA    
1377 C C     . THR A 186 ? 0.1837 0.1848 0.1987 0.0061  0.0530  -0.0166 314 THR A C     
1378 O O     . THR A 186 ? 0.1773 0.1771 0.2019 0.0080  0.0439  -0.0163 314 THR A O     
1379 C CB    . THR A 186 ? 0.2097 0.2254 0.2519 0.0047  0.0679  -0.0086 314 THR A CB    
1380 O OG1   . THR A 186 ? 0.2049 0.2225 0.2664 0.0048  0.0556  -0.0063 314 THR A OG1   
1381 C CG2   . THR A 186 ? 0.2379 0.2619 0.2968 0.0061  0.0835  -0.0074 314 THR A CG2   
1382 N N     . VAL A 187 ? 0.1551 0.1528 0.1478 0.0028  0.0521  -0.0160 315 VAL A N     
1383 C CA    . VAL A 187 ? 0.1590 0.1512 0.1407 0.0012  0.0411  -0.0155 315 VAL A CA    
1384 C C     . VAL A 187 ? 0.1643 0.1586 0.1423 -0.0025 0.0380  -0.0087 315 VAL A C     
1385 O O     . VAL A 187 ? 0.1843 0.1810 0.1524 -0.0047 0.0437  -0.0050 315 VAL A O     
1386 C CB    . VAL A 187 ? 0.2056 0.1910 0.1686 0.0007  0.0410  -0.0214 315 VAL A CB    
1387 C CG1   . VAL A 187 ? 0.2251 0.2065 0.1800 -0.0013 0.0311  -0.0195 315 VAL A CG1   
1388 C CG2   . VAL A 187 ? 0.1896 0.1710 0.1612 0.0044  0.0437  -0.0280 315 VAL A CG2   
1389 N N     . THR A 188 ? 0.1377 0.1316 0.1238 -0.0029 0.0294  -0.0070 316 THR A N     
1390 C CA    . THR A 188 ? 0.1292 0.1239 0.1176 -0.0059 0.0263  -0.0014 316 THR A CA    
1391 C C     . THR A 188 ? 0.1376 0.1274 0.1171 -0.0064 0.0186  -0.0028 316 THR A C     
1392 O O     . THR A 188 ? 0.1498 0.1378 0.1312 -0.0047 0.0136  -0.0070 316 THR A O     
1393 C CB    . THR A 188 ? 0.1275 0.1263 0.1388 -0.0063 0.0238  0.0001  316 THR A CB    
1394 O OG1   . THR A 188 ? 0.1775 0.1822 0.2018 -0.0061 0.0319  0.0027  316 THR A OG1   
1395 C CG2   . THR A 188 ? 0.1302 0.1281 0.1486 -0.0093 0.0206  0.0049  316 THR A CG2   
1396 N N     . LEU A 189 ? 0.1341 0.1227 0.1048 -0.0087 0.0178  0.0016  317 LEU A N     
1397 C CA    . LEU A 189 ? 0.1347 0.1199 0.1031 -0.0091 0.0112  0.0010  317 LEU A CA    
1398 C C     . LEU A 189 ? 0.1478 0.1331 0.1324 -0.0089 0.0077  0.0003  317 LEU A C     
1399 O O     . LEU A 189 ? 0.1491 0.1363 0.1469 -0.0103 0.0088  0.0046  317 LEU A O     
1400 C CB    . LEU A 189 ? 0.1567 0.1421 0.1162 -0.0116 0.0097  0.0073  317 LEU A CB    
1401 C CG    . LEU A 189 ? 0.1675 0.1506 0.1301 -0.0120 0.0033  0.0083  317 LEU A CG    
1402 C CD1   . LEU A 189 ? 0.1648 0.1451 0.1206 -0.0109 0.0014  0.0015  317 LEU A CD1   
1403 C CD2   . LEU A 189 ? 0.2000 0.1853 0.1576 -0.0144 0.0003  0.0175  317 LEU A CD2   
1404 N N     . THR A 190 ? 0.1281 0.1114 0.1122 -0.0073 0.0040  -0.0054 318 THR A N     
1405 C CA    . THR A 190 ? 0.1130 0.0962 0.1095 -0.0070 0.0008  -0.0091 318 THR A CA    
1406 C C     . THR A 190 ? 0.1202 0.1008 0.1145 -0.0063 -0.0008 -0.0113 318 THR A C     
1407 O O     . THR A 190 ? 0.1334 0.1129 0.1237 -0.0072 -0.0006 -0.0067 318 THR A O     
1408 C CB    . THR A 190 ? 0.1392 0.1250 0.1382 -0.0054 -0.0014 -0.0151 318 THR A CB    
1409 O OG1   . THR A 190 ? 0.1490 0.1350 0.1582 -0.0056 -0.0054 -0.0213 318 THR A OG1   
1410 C CG2   . THR A 190 ? 0.1318 0.1170 0.1168 -0.0029 -0.0020 -0.0172 318 THR A CG2   
1411 N N     . GLY A 191 ? 0.1151 0.0954 0.1131 -0.0050 -0.0024 -0.0185 319 GLY A N     
1412 C CA    . GLY A 191 ? 0.1277 0.1064 0.1265 -0.0040 -0.0016 -0.0214 319 GLY A CA    
1413 C C     . GLY A 191 ? 0.1259 0.1028 0.1392 -0.0051 -0.0016 -0.0163 319 GLY A C     
1414 O O     . GLY A 191 ? 0.1346 0.1110 0.1599 -0.0067 -0.0026 -0.0115 319 GLY A O     
1415 N N     . GLY A 192 ? 0.1282 0.1048 0.1431 -0.0042 -0.0005 -0.0159 320 GLY A N     
1416 C CA    . GLY A 192 ? 0.1275 0.1029 0.1610 -0.0044 -0.0014 -0.0116 320 GLY A CA    
1417 C C     . GLY A 192 ? 0.1224 0.0987 0.1576 -0.0068 -0.0049 0.0008  320 GLY A C     
1418 O O     . GLY A 192 ? 0.1192 0.0946 0.1719 -0.0073 -0.0065 0.0070  320 GLY A O     
1419 N N     . PHE A 193 ? 0.1217 0.0998 0.1387 -0.0082 -0.0059 0.0045  321 PHE A N     
1420 C CA    . PHE A 193 ? 0.1424 0.1224 0.1556 -0.0106 -0.0089 0.0153  321 PHE A CA    
1421 C C     . PHE A 193 ? 0.1441 0.1241 0.1626 -0.0117 -0.0069 0.0201  321 PHE A C     
1422 O O     . PHE A 193 ? 0.1598 0.1415 0.1830 -0.0133 -0.0086 0.0315  321 PHE A O     
1423 C CB    . PHE A 193 ? 0.1435 0.1248 0.1351 -0.0119 -0.0098 0.0148  321 PHE A CB    
1424 C CG    . PHE A 193 ? 0.1446 0.1265 0.1367 -0.0121 -0.0134 0.0138  321 PHE A CG    
1425 C CD1   . PHE A 193 ? 0.1545 0.1392 0.1542 -0.0135 -0.0197 0.0219  321 PHE A CD1   
1426 C CD2   . PHE A 193 ? 0.1538 0.1343 0.1422 -0.0110 -0.0108 0.0063  321 PHE A CD2   
1427 C CE1   . PHE A 193 ? 0.1700 0.1565 0.1754 -0.0140 -0.0238 0.0211  321 PHE A CE1   
1428 C CE2   . PHE A 193 ? 0.1733 0.1549 0.1668 -0.0116 -0.0133 0.0062  321 PHE A CE2   
1429 C CZ    . PHE A 193 ? 0.1705 0.1553 0.1737 -0.0132 -0.0199 0.0129  321 PHE A CZ    
1430 N N     . ARG A 194 ? 0.1390 0.1183 0.1588 -0.0110 -0.0037 0.0128  322 ARG A N     
1431 C CA    . ARG A 194 ? 0.1182 0.0982 0.1497 -0.0125 -0.0016 0.0175  322 ARG A CA    
1432 C C     . ARG A 194 ? 0.1196 0.0967 0.1776 -0.0127 -0.0032 0.0207  322 ARG A C     
1433 O O     . ARG A 194 ? 0.1268 0.1042 0.1991 -0.0146 -0.0020 0.0302  322 ARG A O     
1434 C CB    . ARG A 194 ? 0.1144 0.0953 0.1454 -0.0119 0.0005  0.0087  322 ARG A CB    
1435 C CG    . ARG A 194 ? 0.1170 0.0997 0.1650 -0.0139 0.0030  0.0137  322 ARG A CG    
1436 C CD    . ARG A 194 ? 0.1140 0.0996 0.1632 -0.0135 0.0039  0.0063  322 ARG A CD    
1437 N NE    . ARG A 194 ? 0.1168 0.1050 0.1865 -0.0159 0.0069  0.0123  322 ARG A NE    
1438 C CZ    . ARG A 194 ? 0.1349 0.1231 0.2278 -0.0171 0.0039  0.0066  322 ARG A CZ    
1439 N NH1   . ARG A 194 ? 0.1281 0.1142 0.2221 -0.0158 -0.0025 -0.0067 322 ARG A NH1   
1440 N NH2   . ARG A 194 ? 0.1189 0.1097 0.2338 -0.0199 0.0074  0.0140  322 ARG A NH2   
1441 N N     . ARG A 195 ? 0.1170 0.0912 0.1840 -0.0107 -0.0048 0.0129  323 ARG A N     
1442 C CA    . ARG A 195 ? 0.1196 0.0900 0.2152 -0.0103 -0.0057 0.0138  323 ARG A CA    
1443 C C     . ARG A 195 ? 0.1290 0.1000 0.2336 -0.0104 -0.0086 0.0282  323 ARG A C     
1444 O O     . ARG A 195 ? 0.1266 0.0942 0.2581 -0.0094 -0.0095 0.0307  323 ARG A O     
1445 C CB    . ARG A 195 ? 0.1332 0.1006 0.2357 -0.0076 -0.0047 -0.0022 323 ARG A CB    
1446 C CG    . ARG A 195 ? 0.1370 0.1049 0.2288 -0.0073 -0.0039 -0.0167 323 ARG A CG    
1447 C CD    . ARG A 195 ? 0.1237 0.0886 0.2251 -0.0050 -0.0025 -0.0326 323 ARG A CD    
1448 N NE    . ARG A 195 ? 0.1237 0.0892 0.2207 -0.0022 0.0007  -0.0340 323 ARG A NE    
1449 C CZ    . ARG A 195 ? 0.1302 0.0992 0.2039 -0.0008 0.0030  -0.0376 323 ARG A CZ    
1450 N NH1   . ARG A 195 ? 0.1259 0.0959 0.2015 0.0014  0.0069  -0.0378 323 ARG A NH1   
1451 N NH2   . ARG A 195 ? 0.1277 0.0994 0.1793 -0.0014 0.0017  -0.0399 323 ARG A NH2   
1452 N N     . GLY A 196 ? 0.1337 0.1092 0.2170 -0.0115 -0.0107 0.0370  324 GLY A N     
1453 C CA    . GLY A 196 ? 0.1409 0.1188 0.2302 -0.0121 -0.0159 0.0524  324 GLY A CA    
1454 C C     . GLY A 196 ? 0.1411 0.1206 0.2309 -0.0105 -0.0202 0.0504  324 GLY A C     
1455 O O     . GLY A 196 ? 0.1439 0.1263 0.2426 -0.0108 -0.0265 0.0631  324 GLY A O     
1456 N N     . LYS A 197 ? 0.1284 0.1067 0.2121 -0.0088 -0.0169 0.0359  325 LYS A N     
1457 C CA    . LYS A 197 ? 0.1368 0.1175 0.2239 -0.0074 -0.0191 0.0336  325 LYS A CA    
1458 C C     . LYS A 197 ? 0.1849 0.1707 0.2555 -0.0100 -0.0263 0.0425  325 LYS A C     
1459 O O     . LYS A 197 ? 0.1836 0.1704 0.2296 -0.0122 -0.0266 0.0429  325 LYS A O     
1460 C CB    . LYS A 197 ? 0.1396 0.1191 0.2170 -0.0057 -0.0129 0.0185  325 LYS A CB    
1461 C CG    . LYS A 197 ? 0.1627 0.1384 0.2572 -0.0028 -0.0067 0.0073  325 LYS A CG    
1462 C CD    . LYS A 197 ? 0.2394 0.2157 0.3209 -0.0010 -0.0006 -0.0053 325 LYS A CD    
1463 C CE    . LYS A 197 ? 0.2745 0.2540 0.3659 0.0005  0.0016  -0.0050 325 LYS A CE    
1464 N NZ    . LYS A 197 ? 0.3313 0.3121 0.4082 0.0020  0.0091  -0.0148 325 LYS A NZ    
1465 N N     . LEU A 198 ? 0.1601 0.1494 0.2459 -0.0096 -0.0323 0.0484  326 LEU A N     
1466 C CA    . LEU A 198 ? 0.1949 0.1899 0.2669 -0.0125 -0.0418 0.0556  326 LEU A CA    
1467 C C     . LEU A 198 ? 0.2076 0.2034 0.2705 -0.0132 -0.0407 0.0450  326 LEU A C     
1468 O O     . LEU A 198 ? 0.2294 0.2285 0.2764 -0.0163 -0.0476 0.0460  326 LEU A O     
1469 C CB    . LEU A 198 ? 0.2540 0.2538 0.3501 -0.0122 -0.0514 0.0694  326 LEU A CB    
1470 C CG    . LEU A 198 ? 0.2939 0.2930 0.4006 -0.0119 -0.0536 0.0840  326 LEU A CG    
1471 C CD1   . LEU A 198 ? 0.3402 0.3453 0.4691 -0.0116 -0.0655 0.1006  326 LEU A CD1   
1472 C CD2   . LEU A 198 ? 0.3115 0.3111 0.3863 -0.0150 -0.0528 0.0887  326 LEU A CD2   
1473 N N     . GLN A 199 ? 0.1746 0.1677 0.2489 -0.0104 -0.0322 0.0352  327 GLN A N     
1474 C CA    . GLN A 199 ? 0.1923 0.1861 0.2608 -0.0109 -0.0292 0.0271  327 GLN A CA    
1475 C C     . GLN A 199 ? 0.2041 0.1936 0.2673 -0.0083 -0.0177 0.0164  327 GLN A C     
1476 O O     . GLN A 199 ? 0.2365 0.2232 0.3056 -0.0060 -0.0132 0.0137  327 GLN A O     
1477 C CB    . GLN A 199 ? 0.2399 0.2389 0.3339 -0.0106 -0.0326 0.0301  327 GLN A CB    
1478 C CG    . GLN A 199 ? 0.3468 0.3460 0.4698 -0.0063 -0.0251 0.0282  327 GLN A CG    
1479 C CD    . GLN A 199 ? 0.4486 0.4542 0.5978 -0.0061 -0.0266 0.0305  327 GLN A CD    
1480 O OE1   . GLN A 199 ? 0.4817 0.4928 0.6413 -0.0085 -0.0388 0.0396  327 GLN A OE1   
1481 N NE2   . GLN A 199 ? 0.4699 0.4758 0.6293 -0.0034 -0.0143 0.0226  327 GLN A NE2   
1482 N N     . GLY A 200 ? 0.1745 0.1636 0.2261 -0.0088 -0.0139 0.0107  328 GLY A N     
1483 C CA    . GLY A 200 ? 0.1570 0.1433 0.1998 -0.0064 -0.0045 0.0026  328 GLY A CA    
1484 C C     . GLY A 200 ? 0.1417 0.1289 0.1812 -0.0067 0.0002  0.0003  328 GLY A C     
1485 O O     . GLY A 200 ? 0.1710 0.1605 0.2181 -0.0091 -0.0039 0.0038  328 GLY A O     
1486 N N     A HIS A 201 ? 0.1185 0.1045 0.1480 -0.0044 0.0081  -0.0050 329 HIS A N     
1487 N N     B HIS A 201 ? 0.1253 0.1113 0.1546 -0.0044 0.0081  -0.0050 329 HIS A N     
1488 C CA    A HIS A 201 ? 0.1438 0.1307 0.1698 -0.0045 0.0139  -0.0047 329 HIS A CA    
1489 C CA    B HIS A 201 ? 0.1471 0.1340 0.1730 -0.0044 0.0141  -0.0049 329 HIS A CA    
1490 C C     A HIS A 201 ? 0.1545 0.1378 0.1637 -0.0061 0.0112  -0.0039 329 HIS A C     
1491 C C     B HIS A 201 ? 0.1538 0.1371 0.1623 -0.0058 0.0119  -0.0042 329 HIS A C     
1492 O O     A HIS A 201 ? 0.1549 0.1377 0.1651 -0.0073 0.0135  -0.0014 329 HIS A O     
1493 O O     B HIS A 201 ? 0.1524 0.1353 0.1607 -0.0066 0.0150  -0.0018 329 HIS A O     
1494 C CB    A HIS A 201 ? 0.1683 0.1571 0.1903 -0.0010 0.0244  -0.0094 329 HIS A CB    
1495 C CB    B HIS A 201 ? 0.1746 0.1636 0.1980 -0.0008 0.0246  -0.0096 329 HIS A CB    
1496 C CG    A HIS A 201 ? 0.1793 0.1716 0.2207 0.0012  0.0300  -0.0121 329 HIS A CG    
1497 C CG    B HIS A 201 ? 0.2125 0.2003 0.2139 0.0003  0.0277  -0.0112 329 HIS A CG    
1498 N ND1   A HIS A 201 ? 0.2305 0.2219 0.2737 0.0039  0.0324  -0.0196 329 HIS A ND1   
1499 N ND1   B HIS A 201 ? 0.2707 0.2562 0.2583 0.0011  0.0237  -0.0151 329 HIS A ND1   
1500 C CD2   A HIS A 201 ? 0.2244 0.2210 0.2880 0.0012  0.0338  -0.0090 329 HIS A CD2   
1501 C CD2   B HIS A 201 ? 0.2508 0.2399 0.2438 0.0009  0.0339  -0.0078 329 HIS A CD2   
1502 C CE1   A HIS A 201 ? 0.2357 0.2302 0.3010 0.0059  0.0384  -0.0216 329 HIS A CE1   
1503 C CE1   B HIS A 201 ? 0.2962 0.2821 0.2677 0.0023  0.0260  -0.0144 329 HIS A CE1   
1504 N NE2   A HIS A 201 ? 0.1929 0.1913 0.2714 0.0045  0.0395  -0.0146 329 HIS A NE2   
1505 N NE2   B HIS A 201 ? 0.2851 0.2730 0.2585 0.0023  0.0324  -0.0093 329 HIS A NE2   
1506 N N     . ASP A 202 ? 0.1595 0.1402 0.1567 -0.0061 0.0072  -0.0057 330 ASP A N     
1507 C CA    . ASP A 202 ? 0.1417 0.1189 0.1257 -0.0068 0.0057  -0.0059 330 ASP A CA    
1508 C C     . ASP A 202 ? 0.1290 0.1051 0.1062 -0.0075 0.0012  -0.0068 330 ASP A C     
1509 O O     . ASP A 202 ? 0.1500 0.1277 0.1328 -0.0078 -0.0012 -0.0056 330 ASP A O     
1510 C CB    . ASP A 202 ? 0.1239 0.1010 0.0983 -0.0040 0.0109  -0.0066 330 ASP A CB    
1511 C CG    . ASP A 202 ? 0.1954 0.1737 0.1630 -0.0018 0.0108  -0.0106 330 ASP A CG    
1512 O OD1   . ASP A 202 ? 0.1716 0.1501 0.1442 -0.0024 0.0079  -0.0126 330 ASP A OD1   
1513 O OD2   . ASP A 202 ? 0.1634 0.1429 0.1215 0.0003  0.0128  -0.0112 330 ASP A OD2   
1514 N N     . VAL A 203 ? 0.1222 0.0958 0.0897 -0.0075 0.0010  -0.0080 331 VAL A N     
1515 C CA    . VAL A 203 ? 0.1130 0.0865 0.0745 -0.0077 -0.0004 -0.0087 331 VAL A CA    
1516 C C     . VAL A 203 ? 0.1698 0.1430 0.1274 -0.0052 0.0022  -0.0106 331 VAL A C     
1517 O O     . VAL A 203 ? 0.1528 0.1243 0.1084 -0.0040 0.0037  -0.0106 331 VAL A O     
1518 C CB    . VAL A 203 ? 0.1632 0.1353 0.1179 -0.0102 -0.0028 -0.0094 331 VAL A CB    
1519 C CG1   . VAL A 203 ? 0.1763 0.1502 0.1252 -0.0106 -0.0025 -0.0081 331 VAL A CG1   
1520 C CG2   . VAL A 203 ? 0.1832 0.1563 0.1419 -0.0132 -0.0080 -0.0078 331 VAL A CG2   
1521 N N     . ASP A 204 ? 0.1223 0.0977 0.0820 -0.0045 0.0019  -0.0112 332 ASP A N     
1522 C CA    . ASP A 204 ? 0.1296 0.1064 0.0885 -0.0023 0.0022  -0.0130 332 ASP A CA    
1523 C C     . ASP A 204 ? 0.1337 0.1115 0.0943 -0.0027 0.0031  -0.0126 332 ASP A C     
1524 O O     . ASP A 204 ? 0.1346 0.1135 0.0985 -0.0045 0.0034  -0.0108 332 ASP A O     
1525 C CB    . ASP A 204 ? 0.1270 0.1063 0.0901 -0.0014 0.0008  -0.0162 332 ASP A CB    
1526 C CG    . ASP A 204 ? 0.1464 0.1257 0.1083 -0.0007 0.0025  -0.0177 332 ASP A CG    
1527 O OD1   . ASP A 204 ? 0.1310 0.1112 0.0853 0.0009  0.0039  -0.0174 332 ASP A OD1   
1528 O OD2   . ASP A 204 ? 0.1421 0.1211 0.1120 -0.0016 0.0030  -0.0181 332 ASP A OD2   
1529 N N     . PHE A 205 ? 0.1234 0.1011 0.0838 -0.0009 0.0042  -0.0131 333 PHE A N     
1530 C CA    . PHE A 205 ? 0.1267 0.1062 0.0915 -0.0008 0.0071  -0.0132 333 PHE A CA    
1531 C C     . PHE A 205 ? 0.1585 0.1419 0.1327 0.0016  0.0053  -0.0134 333 PHE A C     
1532 O O     . PHE A 205 ? 0.1625 0.1457 0.1362 0.0040  0.0028  -0.0128 333 PHE A O     
1533 C CB    . PHE A 205 ? 0.1612 0.1374 0.1214 -0.0005 0.0112  -0.0149 333 PHE A CB    
1534 C CG    . PHE A 205 ? 0.1957 0.1696 0.1460 -0.0035 0.0115  -0.0156 333 PHE A CG    
1535 C CD1   . PHE A 205 ? 0.1771 0.1537 0.1227 -0.0057 0.0130  -0.0134 333 PHE A CD1   
1536 C CD2   . PHE A 205 ? 0.1878 0.1572 0.1345 -0.0043 0.0095  -0.0175 333 PHE A CD2   
1537 C CE1   . PHE A 205 ? 0.1723 0.1481 0.1069 -0.0086 0.0111  -0.0132 333 PHE A CE1   
1538 C CE2   . PHE A 205 ? 0.1910 0.1594 0.1299 -0.0074 0.0075  -0.0188 333 PHE A CE2   
1539 C CZ    . PHE A 205 ? 0.1691 0.1409 0.1005 -0.0095 0.0075  -0.0167 333 PHE A CZ    
1540 N N     . LEU A 206 ? 0.1244 0.1120 0.1088 0.0009  0.0063  -0.0130 334 LEU A N     
1541 C CA    . LEU A 206 ? 0.1108 0.1036 0.1089 0.0027  0.0037  -0.0132 334 LEU A CA    
1542 C C     . LEU A 206 ? 0.1477 0.1425 0.1551 0.0039  0.0108  -0.0122 334 LEU A C     
1543 O O     . LEU A 206 ? 0.1565 0.1519 0.1636 0.0020  0.0177  -0.0112 334 LEU A O     
1544 C CB    . LEU A 206 ? 0.1089 0.1057 0.1183 0.0005  -0.0003 -0.0144 334 LEU A CB    
1545 C CG    . LEU A 206 ? 0.1139 0.1175 0.1423 0.0010  -0.0042 -0.0150 334 LEU A CG    
1546 C CD1   . LEU A 206 ? 0.1453 0.1518 0.1723 0.0040  -0.0122 -0.0160 334 LEU A CD1   
1547 C CD2   . LEU A 206 ? 0.1088 0.1140 0.1488 -0.0022 -0.0085 -0.0180 334 LEU A CD2   
1548 N N     . ILE A 207 ? 0.1310 0.1275 0.1473 0.0073  0.0094  -0.0119 335 ILE A N     
1549 C CA    . ILE A 207 ? 0.1177 0.1155 0.1455 0.0096  0.0173  -0.0124 335 ILE A CA    
1550 C C     . ILE A 207 ? 0.1353 0.1417 0.1874 0.0113  0.0144  -0.0103 335 ILE A C     
1551 O O     . ILE A 207 ? 0.1290 0.1388 0.1865 0.0123  0.0039  -0.0087 335 ILE A O     
1552 C CB    . ILE A 207 ? 0.1220 0.1138 0.1467 0.0128  0.0185  -0.0134 335 ILE A CB    
1553 C CG1   . ILE A 207 ? 0.1785 0.1626 0.1831 0.0104  0.0203  -0.0160 335 ILE A CG1   
1554 C CG2   . ILE A 207 ? 0.1595 0.1522 0.2003 0.0160  0.0279  -0.0159 335 ILE A CG2   
1555 C CD1   . ILE A 207 ? 0.2049 0.1824 0.2083 0.0124  0.0185  -0.0157 335 ILE A CD1   
1556 N N     . THR A 208 ? 0.1180 0.1289 0.1849 0.0115  0.0237  -0.0103 336 THR A N     
1557 C CA    . THR A 208 ? 0.1344 0.1543 0.2301 0.0134  0.0211  -0.0081 336 THR A CA    
1558 C C     . THR A 208 ? 0.1652 0.1880 0.2765 0.0160  0.0353  -0.0090 336 THR A C     
1559 O O     . THR A 208 ? 0.1543 0.1712 0.2506 0.0166  0.0457  -0.0128 336 THR A O     
1560 C CB    . THR A 208 ? 0.1539 0.1802 0.2615 0.0094  0.0152  -0.0067 336 THR A CB    
1561 O OG1   . THR A 208 ? 0.1462 0.1819 0.2827 0.0110  0.0081  -0.0051 336 THR A OG1   
1562 C CG2   . THR A 208 ? 0.1813 0.2089 0.2910 0.0061  0.0273  -0.0049 336 THR A CG2   
1563 N N     . HIS A 209 ? 0.1318 0.1640 0.2742 0.0177  0.0353  -0.0065 337 HIS A N     
1564 C CA    . HIS A 209 ? 0.1358 0.1729 0.2989 0.0206  0.0504  -0.0074 337 HIS A CA    
1565 C C     . HIS A 209 ? 0.1430 0.1924 0.3385 0.0188  0.0506  -0.0030 337 HIS A C     
1566 O O     . HIS A 209 ? 0.1680 0.2227 0.3791 0.0180  0.0355  -0.0005 337 HIS A O     
1567 C CB    . HIS A 209 ? 0.1433 0.1788 0.3217 0.0269  0.0505  -0.0088 337 HIS A CB    
1568 C CG    . HIS A 209 ? 0.1528 0.1913 0.3500 0.0306  0.0688  -0.0126 337 HIS A CG    
1569 N ND1   . HIS A 209 ? 0.1599 0.2104 0.3935 0.0321  0.0747  -0.0095 337 HIS A ND1   
1570 C CD2   . HIS A 209 ? 0.1690 0.2004 0.3545 0.0329  0.0832  -0.0205 337 HIS A CD2   
1571 C CE1   . HIS A 209 ? 0.1892 0.2385 0.4272 0.0347  0.0919  -0.0146 337 HIS A CE1   
1572 N NE2   . HIS A 209 ? 0.2033 0.2416 0.4134 0.0357  0.0977  -0.0224 337 HIS A NE2   
1573 N N     . PRO A 210 ? 0.1896 0.2441 0.3952 0.0180  0.0678  -0.0022 338 PRO A N     
1574 C CA    . PRO A 210 ? 0.1852 0.2514 0.4240 0.0153  0.0699  0.0032  338 PRO A CA    
1575 C C     . PRO A 210 ? 0.1860 0.2627 0.4678 0.0189  0.0632  0.0050  338 PRO A C     
1576 O O     . PRO A 210 ? 0.2012 0.2852 0.5080 0.0154  0.0561  0.0088  338 PRO A O     
1577 C CB    . PRO A 210 ? 0.2174 0.2865 0.4535 0.0148  0.0934  0.0044  338 PRO A CB    
1578 C CG    . PRO A 210 ? 0.2067 0.2674 0.4174 0.0192  0.1030  -0.0034 338 PRO A CG    
1579 C CD    . PRO A 210 ? 0.1891 0.2386 0.3717 0.0185  0.0859  -0.0061 338 PRO A CD    
1580 N N     . LYS A 211 ? 0.1996 0.2742 0.4872 0.0251  0.0632  0.0026  339 LYS A N     
1581 C CA    . LYS A 211 ? 0.1982 0.2778 0.5160 0.0274  0.0528  0.0059  339 LYS A CA    
1582 C C     . LYS A 211 ? 0.2115 0.2920 0.5284 0.0292  0.0303  0.0077  339 LYS A C     
1583 O O     . LYS A 211 ? 0.2102 0.2837 0.5118 0.0335  0.0281  0.0067  339 LYS A O     
1584 C CB    . LYS A 211 ? 0.2153 0.2907 0.5411 0.0323  0.0657  0.0037  339 LYS A CB    
1585 N N     . GLU A 212 ? 0.1956 0.2832 0.5254 0.0255  0.0134  0.0104  340 GLU A N     
1586 C CA    . GLU A 212 ? 0.1683 0.2578 0.4904 0.0261  -0.0097 0.0118  340 GLU A CA    
1587 C C     . GLU A 212 ? 0.1517 0.2390 0.4774 0.0323  -0.0155 0.0165  340 GLU A C     
1588 O O     . GLU A 212 ? 0.1338 0.2232 0.4836 0.0342  -0.0118 0.0196  340 GLU A O     
1589 C CB    . GLU A 212 ? 0.2168 0.3138 0.5538 0.0209  -0.0262 0.0121  340 GLU A CB    
1590 C CG    . GLU A 212 ? 0.2259 0.3250 0.5472 0.0206  -0.0502 0.0119  340 GLU A CG    
1591 C CD    . GLU A 212 ? 0.2176 0.3150 0.5181 0.0150  -0.0577 0.0050  340 GLU A CD    
1592 O OE1   . GLU A 212 ? 0.1824 0.2746 0.4788 0.0113  -0.0436 0.0020  340 GLU A OE1   
1593 O OE2   . GLU A 212 ? 0.2389 0.3371 0.5207 0.0140  -0.0762 0.0027  340 GLU A OE2   
1594 N N     . GLY A 213 ? 0.1628 0.2441 0.4630 0.0347  -0.0237 0.0177  341 GLY A N     
1595 C CA    . GLY A 213 ? 0.1890 0.2678 0.4932 0.0405  -0.0301 0.0245  341 GLY A CA    
1596 C C     . GLY A 213 ? 0.1818 0.2484 0.4769 0.0448  -0.0134 0.0223  341 GLY A C     
1597 O O     . GLY A 213 ? 0.1844 0.2446 0.4716 0.0485  -0.0187 0.0276  341 GLY A O     
1598 N N     . GLN A 214 ? 0.1543 0.2169 0.4480 0.0436  0.0068  0.0144  342 GLN A N     
1599 C CA    . GLN A 214 ? 0.1700 0.2203 0.4529 0.0468  0.0227  0.0091  342 GLN A CA    
1600 C C     . GLN A 214 ? 0.1625 0.1998 0.4022 0.0439  0.0194  0.0070  342 GLN A C     
1601 O O     . GLN A 214 ? 0.1696 0.1962 0.4015 0.0464  0.0265  0.0040  342 GLN A O     
1602 C CB    . GLN A 214 ? 0.1964 0.2459 0.4796 0.0450  0.0444  0.0006  342 GLN A CB    
1603 C CG    . GLN A 214 ? 0.1844 0.2402 0.4982 0.0453  0.0506  0.0021  342 GLN A CG    
1604 C CD    . GLN A 214 ? 0.3005 0.3531 0.6346 0.0497  0.0466  0.0058  342 GLN A CD    
1605 O OE1   . GLN A 214 ? 0.3324 0.3919 0.6877 0.0505  0.0317  0.0144  342 GLN A OE1   
1606 N NE2   . GLN A 214 ? 0.2978 0.3399 0.6256 0.0521  0.0592  -0.0010 342 GLN A NE2   
1607 N N     . GLU A 215 ? 0.1300 0.1685 0.3449 0.0385  0.0088  0.0079  343 GLU A N     
1608 C CA    . GLU A 215 ? 0.1301 0.1579 0.3075 0.0358  0.0061  0.0064  343 GLU A CA    
1609 C C     . GLU A 215 ? 0.1353 0.1603 0.3082 0.0388  -0.0067 0.0148  343 GLU A C     
1610 O O     . GLU A 215 ? 0.1746 0.1909 0.3214 0.0373  -0.0074 0.0149  343 GLU A O     
1611 C CB    . GLU A 215 ? 0.1402 0.1700 0.2954 0.0295  0.0008  0.0039  343 GLU A CB    
1612 C CG    . GLU A 215 ? 0.1611 0.1983 0.3157 0.0284  -0.0177 0.0083  343 GLU A CG    
1613 C CD    . GLU A 215 ? 0.1802 0.2304 0.3695 0.0299  -0.0256 0.0118  343 GLU A CD    
1614 O OE1   . GLU A 215 ? 0.1613 0.2162 0.3766 0.0304  -0.0151 0.0101  343 GLU A OE1   
1615 O OE2   . GLU A 215 ? 0.2226 0.2794 0.4138 0.0306  -0.0427 0.0166  343 GLU A OE2   
1616 N N     . ALA A 216 ? 0.1393 0.1727 0.3385 0.0429  -0.0169 0.0233  344 ALA A N     
1617 C CA    . ALA A 216 ? 0.1651 0.1976 0.3601 0.0459  -0.0297 0.0345  344 ALA A CA    
1618 C C     . ALA A 216 ? 0.1985 0.2177 0.3934 0.0491  -0.0200 0.0357  344 ALA A C     
1619 O O     . ALA A 216 ? 0.1842 0.1990 0.4002 0.0519  -0.0068 0.0299  344 ALA A O     
1620 C CB    . ALA A 216 ? 0.1849 0.2298 0.4127 0.0502  -0.0427 0.0445  344 ALA A CB    
1621 N N     . GLY A 217 ? 0.1894 0.2026 0.3624 0.0485  -0.0258 0.0428  345 GLY A N     
1622 C CA    . GLY A 217 ? 0.2084 0.2097 0.3890 0.0516  -0.0192 0.0465  345 GLY A CA    
1623 C C     . GLY A 217 ? 0.2004 0.1897 0.3692 0.0487  -0.0037 0.0324  345 GLY A C     
1624 O O     . GLY A 217 ? 0.2122 0.1912 0.3957 0.0512  0.0048  0.0296  345 GLY A O     
1625 N N     . LEU A 218 ? 0.1764 0.1667 0.3190 0.0432  -0.0010 0.0234  346 LEU A N     
1626 C CA    . LEU A 218 ? 0.1786 0.1601 0.3076 0.0399  0.0118  0.0103  346 LEU A CA    
1627 C C     . LEU A 218 ? 0.1867 0.1577 0.2954 0.0370  0.0126  0.0098  346 LEU A C     
1628 O O     . LEU A 218 ? 0.1752 0.1363 0.2870 0.0368  0.0212  0.0018  346 LEU A O     
1629 C CB    . LEU A 218 ? 0.1658 0.1537 0.2786 0.0354  0.0139  0.0032  346 LEU A CB    
1630 C CG    . LEU A 218 ? 0.2033 0.1843 0.2993 0.0318  0.0255  -0.0086 346 LEU A CG    
1631 C CD1   . LEU A 218 ? 0.2003 0.1764 0.3137 0.0351  0.0381  -0.0170 346 LEU A CD1   
1632 C CD2   . LEU A 218 ? 0.2234 0.2118 0.3091 0.0280  0.0271  -0.0116 346 LEU A CD2   
1633 N N     . LEU A 219 ? 0.1968 0.1699 0.2854 0.0345  0.0041  0.0171  347 LEU A N     
1634 C CA    . LEU A 219 ? 0.2272 0.1918 0.2983 0.0310  0.0065  0.0157  347 LEU A CA    
1635 C C     . LEU A 219 ? 0.2251 0.1794 0.3116 0.0330  0.0093  0.0200  347 LEU A C     
1636 O O     . LEU A 219 ? 0.2503 0.1959 0.3311 0.0299  0.0146  0.0129  347 LEU A O     
1637 C CB    . LEU A 219 ? 0.2311 0.2007 0.2791 0.0284  -0.0010 0.0224  347 LEU A CB    
1638 C CG    . LEU A 219 ? 0.2290 0.2047 0.2607 0.0248  -0.0017 0.0146  347 LEU A CG    
1639 C CD1   . LEU A 219 ? 0.2112 0.1903 0.2218 0.0226  -0.0071 0.0184  347 LEU A CD1   
1640 C CD2   . LEU A 219 ? 0.2008 0.1709 0.2264 0.0214  0.0068  0.0030  347 LEU A CD2   
1641 N N     . PRO A 220 ? 0.2389 0.1938 0.3477 0.0381  0.0053  0.0319  348 PRO A N     
1642 C CA    . PRO A 220 ? 0.2253 0.1682 0.3520 0.0393  0.0096  0.0346  348 PRO A CA    
1643 C C     . PRO A 220 ? 0.2435 0.1770 0.3831 0.0391  0.0202  0.0171  348 PRO A C     
1644 O O     . PRO A 220 ? 0.2457 0.1679 0.3906 0.0371  0.0244  0.0123  348 PRO A O     
1645 C CB    . PRO A 220 ? 0.2402 0.1858 0.3931 0.0455  0.0035  0.0512  348 PRO A CB    
1646 C CG    . PRO A 220 ? 0.2371 0.1973 0.3741 0.0459  -0.0072 0.0599  348 PRO A CG    
1647 C CD    . PRO A 220 ? 0.2240 0.1893 0.3442 0.0424  -0.0042 0.0443  348 PRO A CD    
1648 N N     . ARG A 221 ? 0.2110 0.1495 0.3561 0.0409  0.0248  0.0073  349 ARG A N     
1649 C CA    . ARG A 221 ? 0.2196 0.1505 0.3732 0.0410  0.0363  -0.0105 349 ARG A CA    
1650 C C     . ARG A 221 ? 0.2151 0.1431 0.3383 0.0344  0.0393  -0.0231 349 ARG A C     
1651 O O     . ARG A 221 ? 0.2420 0.1599 0.3662 0.0324  0.0449  -0.0358 349 ARG A O     
1652 C CB    . ARG A 221 ? 0.1992 0.1381 0.3672 0.0450  0.0423  -0.0158 349 ARG A CB    
1653 C CG    . ARG A 221 ? 0.1882 0.1309 0.3900 0.0503  0.0398  -0.0060 349 ARG A CG    
1654 C CD    . ARG A 221 ? 0.2113 0.1657 0.4257 0.0526  0.0437  -0.0087 349 ARG A CD    
1655 N NE    . ARG A 221 ? 0.2038 0.1567 0.4099 0.0503  0.0576  -0.0265 349 ARG A NE    
1656 C CZ    . ARG A 221 ? 0.2082 0.1564 0.4269 0.0504  0.0660  -0.0359 349 ARG A CZ    
1657 N NH1   . ARG A 221 ? 0.2166 0.1607 0.4608 0.0526  0.0625  -0.0291 349 ARG A NH1   
1658 N NH2   . ARG A 221 ? 0.2178 0.1658 0.4233 0.0483  0.0777  -0.0513 349 ARG A NH2   
1659 N N     . VAL A 222 ? 0.2241 0.1608 0.3221 0.0308  0.0345  -0.0197 350 VAL A N     
1660 C CA    . VAL A 222 ? 0.2228 0.1584 0.2939 0.0249  0.0355  -0.0284 350 VAL A CA    
1661 C C     . VAL A 222 ? 0.2715 0.1984 0.3403 0.0217  0.0320  -0.0264 350 VAL A C     
1662 O O     . VAL A 222 ? 0.2780 0.1981 0.3409 0.0181  0.0347  -0.0380 350 VAL A O     
1663 C CB    . VAL A 222 ? 0.2232 0.1694 0.2740 0.0224  0.0304  -0.0230 350 VAL A CB    
1664 C CG1   . VAL A 222 ? 0.2250 0.1700 0.2520 0.0167  0.0297  -0.0285 350 VAL A CG1   
1665 C CG2   . VAL A 222 ? 0.2005 0.1551 0.2563 0.0244  0.0350  -0.0259 350 VAL A CG2   
1666 N N     . MET A 223 ? 0.2438 0.1717 0.3182 0.0229  0.0260  -0.0114 351 MET A N     
1667 C CA    . MET A 223 ? 0.2613 0.1826 0.3359 0.0197  0.0239  -0.0069 351 MET A CA    
1668 C C     . MET A 223 ? 0.2762 0.1847 0.3746 0.0201  0.0281  -0.0137 351 MET A C     
1669 O O     . MET A 223 ? 0.2901 0.1919 0.3876 0.0154  0.0282  -0.0199 351 MET A O     
1670 C CB    . MET A 223 ? 0.2376 0.1637 0.3121 0.0214  0.0184  0.0120  351 MET A CB    
1671 C CG    . MET A 223 ? 0.2561 0.1938 0.3061 0.0203  0.0139  0.0162  351 MET A CG    
1672 S SD    . MET A 223 ? 0.3378 0.2769 0.3647 0.0142  0.0148  0.0054  351 MET A SD    
1673 C CE    . MET A 223 ? 0.2376 0.1676 0.2739 0.0106  0.0166  0.0072  351 MET A CE    
1674 N N     . CYS A 224 ? 0.2679 0.1729 0.3911 0.0255  0.0313  -0.0131 352 CYS A N     
1675 C CA    A CYS A 224 ? 0.2789 0.1732 0.4261 0.0257  0.0356  -0.0215 352 CYS A CA    
1676 C CA    B CYS A 224 ? 0.2786 0.1727 0.4255 0.0256  0.0355  -0.0214 352 CYS A CA    
1677 C C     . CYS A 224 ? 0.2936 0.1854 0.4265 0.0211  0.0396  -0.0435 352 CYS A C     
1678 O O     . CYS A 224 ? 0.3615 0.2476 0.4990 0.0171  0.0389  -0.0509 352 CYS A O     
1679 C CB    A CYS A 224 ? 0.2863 0.1842 0.4575 0.0313  0.0379  -0.0179 352 CYS A CB    
1680 C CB    B CYS A 224 ? 0.2869 0.1844 0.4586 0.0311  0.0374  -0.0167 352 CYS A CB    
1681 S SG    A CYS A 224 ? 0.4808 0.3722 0.6765 0.0302  0.0433  -0.0305 352 CYS A SG    
1682 S SG    B CYS A 224 ? 0.3198 0.2210 0.5090 0.0350  0.0301  0.0108  352 CYS A SG    
1683 N N     . ARG A 225 ? 0.2910 0.1885 0.4061 0.0218  0.0434  -0.0530 353 ARG A N     
1684 C CA    . ARG A 225 ? 0.3420 0.2400 0.4382 0.0178  0.0467  -0.0714 353 ARG A CA    
1685 C C     . ARG A 225 ? 0.3434 0.2394 0.4185 0.0111  0.0410  -0.0754 353 ARG A C     
1686 O O     . ARG A 225 ? 0.3889 0.2825 0.4557 0.0071  0.0396  -0.0877 353 ARG A O     
1687 C CB    . ARG A 225 ? 0.3608 0.2677 0.4435 0.0202  0.0531  -0.0765 353 ARG A CB    
1688 C CG    . ARG A 225 ? 0.4585 0.3668 0.5620 0.0249  0.0605  -0.0806 353 ARG A CG    
1689 C CD    . ARG A 225 ? 0.4647 0.3826 0.5757 0.0297  0.0652  -0.0744 353 ARG A CD    
1690 N NE    . ARG A 225 ? 0.4420 0.3606 0.5790 0.0339  0.0714  -0.0768 353 ARG A NE    
1691 C CZ    . ARG A 225 ? 0.4180 0.3360 0.5857 0.0380  0.0684  -0.0652 353 ARG A CZ    
1692 N NH1   . ARG A 225 ? 0.4204 0.3372 0.5938 0.0389  0.0592  -0.0496 353 ARG A NH1   
1693 N NH2   . ARG A 225 ? 0.3798 0.2985 0.5723 0.0412  0.0745  -0.0684 353 ARG A NH2   
1694 N N     . LEU A 226 ? 0.2923 0.1923 0.3585 0.0098  0.0359  -0.0629 354 LEU A N     
1695 C CA    . LEU A 226 ? 0.3023 0.2034 0.3524 0.0034  0.0295  -0.0633 354 LEU A CA    
1696 C C     . LEU A 226 ? 0.3101 0.2015 0.3811 0.0006  0.0265  -0.0622 354 LEU A C     
1697 O O     . LEU A 226 ? 0.3308 0.2192 0.3977 -0.0051 0.0224  -0.0715 354 LEU A O     
1698 C CB    . LEU A 226 ? 0.2705 0.1822 0.3053 0.0032  0.0252  -0.0486 354 LEU A CB    
1699 C CG    . LEU A 226 ? 0.2982 0.2197 0.3131 0.0042  0.0267  -0.0499 354 LEU A CG    
1700 C CD1   . LEU A 226 ? 0.2627 0.1928 0.2706 0.0050  0.0228  -0.0360 354 LEU A CD1   
1701 C CD2   . LEU A 226 ? 0.3300 0.2531 0.3241 -0.0007 0.0254  -0.0611 354 LEU A CD2   
1702 N N     . GLN A 227 ? 0.3040 0.1911 0.3991 0.0043  0.0279  -0.0494 355 GLN A N     
1703 C CA    . GLN A 227 ? 0.3355 0.2163 0.4527 0.0017  0.0259  -0.0443 355 GLN A CA    
1704 C C     . GLN A 227 ? 0.3557 0.2326 0.4823 0.0000  0.0266  -0.0602 355 GLN A C     
1705 O O     . GLN A 227 ? 0.3493 0.2232 0.4848 -0.0047 0.0231  -0.0639 355 GLN A O     
1706 C CB    . GLN A 227 ? 0.3739 0.2544 0.5119 0.0065  0.0272  -0.0242 355 GLN A CB    
1707 C CG    . GLN A 227 ? 0.4305 0.3181 0.5552 0.0073  0.0252  -0.0061 355 GLN A CG    
1708 C CD    . GLN A 227 ? 0.5149 0.4035 0.6546 0.0126  0.0254  0.0145  355 GLN A CD    
1709 O OE1   . GLN A 227 ? 0.5421 0.4305 0.6949 0.0177  0.0264  0.0153  355 GLN A OE1   
1710 N NE2   . GLN A 227 ? 0.5342 0.4270 0.6705 0.0114  0.0244  0.0319  355 GLN A NE2   
1711 N N     . ASP A 228 ? 0.3929 0.2705 0.5182 0.0037  0.0314  -0.0699 356 ASP A N     
1712 C CA    . ASP A 228 ? 0.4755 0.3491 0.6076 0.0024  0.0330  -0.0862 356 ASP A CA    
1713 C C     . ASP A 228 ? 0.4889 0.3633 0.5955 -0.0033 0.0288  -0.1019 356 ASP A C     
1714 O O     . ASP A 228 ? 0.5242 0.3943 0.6338 -0.0056 0.0281  -0.1157 356 ASP A O     
1715 C CB    . ASP A 228 ? 0.5391 0.4142 0.6764 0.0080  0.0406  -0.0920 356 ASP A CB    
1716 C CG    . ASP A 228 ? 0.6133 0.4873 0.7827 0.0130  0.0430  -0.0779 356 ASP A CG    
1717 O OD1   . ASP A 228 ? 0.6508 0.5222 0.8369 0.0119  0.0392  -0.0642 356 ASP A OD1   
1718 O OD2   . ASP A 228 ? 0.6419 0.5185 0.8203 0.0179  0.0487  -0.0792 356 ASP A OD2   
1719 N N     . GLN A 229 ? 0.4733 0.3532 0.5552 -0.0056 0.0253  -0.0994 357 GLN A N     
1720 C CA    . GLN A 229 ? 0.4840 0.3660 0.5427 -0.0113 0.0190  -0.1106 357 GLN A CA    
1721 C C     . GLN A 229 ? 0.4370 0.3185 0.5036 -0.0169 0.0108  -0.1040 357 GLN A C     
1722 O O     . GLN A 229 ? 0.4473 0.3316 0.4981 -0.0222 0.0034  -0.1106 357 GLN A O     
1723 C CB    . GLN A 229 ? 0.5194 0.4098 0.5467 -0.0107 0.0201  -0.1123 357 GLN A CB    
1724 C CG    . GLN A 229 ? 0.5950 0.4875 0.6180 -0.0052 0.0294  -0.1175 357 GLN A CG    
1725 C CD    . GLN A 229 ? 0.6672 0.5693 0.6622 -0.0045 0.0318  -0.1166 357 GLN A CD    
1726 O OE1   . GLN A 229 ? 0.6822 0.5893 0.6741 -0.0038 0.0318  -0.1058 357 GLN A OE1   
1727 N NE2   . GLN A 229 ? 0.7281 0.6330 0.7027 -0.0045 0.0343  -0.1275 357 GLN A NE2   
1728 N N     . GLY A 230 ? 0.3535 0.2322 0.4454 -0.0157 0.0122  -0.0896 358 GLY A N     
1729 C CA    . GLY A 230 ? 0.3197 0.1988 0.4243 -0.0204 0.0068  -0.0810 358 GLY A CA    
1730 C C     . GLY A 230 ? 0.2968 0.1825 0.3845 -0.0228 0.0034  -0.0744 358 GLY A C     
1731 O O     . GLY A 230 ? 0.3121 0.2005 0.4048 -0.0279 -0.0025 -0.0718 358 GLY A O     
1732 N N     . LEU A 231 ? 0.2458 0.1347 0.3165 -0.0190 0.0072  -0.0715 359 LEU A N     
1733 C CA    . LEU A 231 ? 0.2569 0.1574 0.3052 -0.0201 0.0036  -0.0641 359 LEU A CA    
1734 C C     . LEU A 231 ? 0.2411 0.1474 0.2936 -0.0175 0.0062  -0.0444 359 LEU A C     
1735 O O     . LEU A 231 ? 0.2524 0.1677 0.2913 -0.0183 0.0038  -0.0384 359 LEU A O     
1736 C CB    . LEU A 231 ? 0.2785 0.1851 0.3002 -0.0174 0.0058  -0.0696 359 LEU A CB    
1737 C CG    . LEU A 231 ? 0.3801 0.2834 0.3895 -0.0198 0.0047  -0.0893 359 LEU A CG    
1738 C CD1   . LEU A 231 ? 0.3877 0.2989 0.3710 -0.0173 0.0085  -0.0909 359 LEU A CD1   
1739 C CD2   . LEU A 231 ? 0.4337 0.3384 0.4396 -0.0266 -0.0056 -0.0957 359 LEU A CD2   
1740 N N     . ILE A 232 ? 0.2258 0.1272 0.2963 -0.0140 0.0110  -0.0343 360 ILE A N     
1741 C CA    . ILE A 232 ? 0.2173 0.1254 0.2856 -0.0109 0.0138  -0.0160 360 ILE A CA    
1742 C C     . ILE A 232 ? 0.2155 0.1216 0.3041 -0.0135 0.0154  -0.0044 360 ILE A C     
1743 O O     . ILE A 232 ? 0.2708 0.1680 0.3839 -0.0135 0.0176  -0.0011 360 ILE A O     
1744 C CB    . ILE A 232 ? 0.2271 0.1343 0.2975 -0.0044 0.0176  -0.0085 360 ILE A CB    
1745 C CG1   . ILE A 232 ? 0.2171 0.1274 0.2717 -0.0018 0.0177  -0.0191 360 ILE A CG1   
1746 C CG2   . ILE A 232 ? 0.2231 0.1378 0.2882 -0.0015 0.0191  0.0099  360 ILE A CG2   
1747 C CD1   . ILE A 232 ? 0.2087 0.1292 0.2381 -0.0026 0.0154  -0.0196 360 ILE A CD1   
1748 N N     . LEU A 233 ? 0.1773 0.0918 0.2588 -0.0155 0.0152  0.0022  361 LEU A N     
1749 C CA    . LEU A 233 ? 0.2072 0.1223 0.3079 -0.0178 0.0191  0.0150  361 LEU A CA    
1750 C C     . LEU A 233 ? 0.2350 0.1547 0.3303 -0.0131 0.0257  0.0334  361 LEU A C     
1751 O O     . LEU A 233 ? 0.2732 0.1911 0.3864 -0.0136 0.0309  0.0472  361 LEU A O     
1752 C CB    . LEU A 233 ? 0.1975 0.1202 0.2966 -0.0220 0.0169  0.0129  361 LEU A CB    
1753 C CG    . LEU A 233 ? 0.1884 0.1079 0.2949 -0.0276 0.0083  -0.0031 361 LEU A CG    
1754 C CD1   . LEU A 233 ? 0.1743 0.1039 0.2717 -0.0299 0.0039  -0.0051 361 LEU A CD1   
1755 C CD2   . LEU A 233 ? 0.2246 0.1367 0.3644 -0.0326 0.0078  -0.0028 361 LEU A CD2   
1756 N N     . TYR A 234 ? 0.2203 0.1468 0.2904 -0.0088 0.0252  0.0340  362 TYR A N     
1757 C CA    . TYR A 234 ? 0.2396 0.1724 0.2982 -0.0045 0.0294  0.0492  362 TYR A CA    
1758 C C     . TYR A 234 ? 0.2038 0.1402 0.2426 -0.0001 0.0255  0.0450  362 TYR A C     
1759 O O     . TYR A 234 ? 0.1971 0.1355 0.2244 -0.0009 0.0219  0.0323  362 TYR A O     
1760 C CB    . TYR A 234 ? 0.2310 0.1735 0.2792 -0.0056 0.0344  0.0549  362 TYR A CB    
1761 C CG    . TYR A 234 ? 0.2126 0.1632 0.2397 -0.0010 0.0378  0.0665  362 TYR A CG    
1762 C CD1   . TYR A 234 ? 0.2353 0.1872 0.2667 0.0004  0.0437  0.0844  362 TYR A CD1   
1763 C CD2   . TYR A 234 ? 0.2620 0.2191 0.2649 0.0016  0.0342  0.0593  362 TYR A CD2   
1764 C CE1   . TYR A 234 ? 0.2750 0.2353 0.2832 0.0044  0.0454  0.0945  362 TYR A CE1   
1765 C CE2   . TYR A 234 ? 0.2497 0.2145 0.2324 0.0053  0.0354  0.0673  362 TYR A CE2   
1766 C CZ    . TYR A 234 ? 0.2657 0.2325 0.2489 0.0067  0.0407  0.0846  362 TYR A CZ    
1767 O OH    . TYR A 234 ? 0.2796 0.2552 0.2384 0.0102  0.0407  0.0924  362 TYR A OH    
1768 N N     . HIS A 235 ? 0.2222 0.1602 0.2582 0.0043  0.0255  0.0567  363 HIS A N     
1769 C CA    . HIS A 235 ? 0.2631 0.2085 0.2781 0.0078  0.0214  0.0539  363 HIS A CA    
1770 C C     . HIS A 235 ? 0.2498 0.2014 0.2559 0.0120  0.0203  0.0692  363 HIS A C     
1771 O O     . HIS A 235 ? 0.2713 0.2201 0.2894 0.0133  0.0224  0.0840  363 HIS A O     
1772 C CB    . HIS A 235 ? 0.3160 0.2574 0.3359 0.0089  0.0174  0.0418  363 HIS A CB    
1773 C CG    . HIS A 235 ? 0.3605 0.2975 0.3966 0.0129  0.0161  0.0484  363 HIS A CG    
1774 N ND1   . HIS A 235 ? 0.3897 0.3167 0.4507 0.0126  0.0188  0.0522  363 HIS A ND1   
1775 C CD2   . HIS A 235 ? 0.3863 0.3276 0.4213 0.0175  0.0120  0.0519  363 HIS A CD2   
1776 C CE1   . HIS A 235 ? 0.4043 0.3293 0.4792 0.0173  0.0169  0.0585  363 HIS A CE1   
1777 N NE2   . HIS A 235 ? 0.3699 0.3040 0.4293 0.0203  0.0125  0.0587  363 HIS A NE2   
1778 N N     . GLN A 236 ? 0.2642 0.2244 0.2488 0.0138  0.0164  0.0658  364 GLN A N     
1779 C CA    . GLN A 236 ? 0.2752 0.2434 0.2456 0.0174  0.0127  0.0775  364 GLN A CA    
1780 C C     . GLN A 236 ? 0.2426 0.2146 0.2093 0.0197  0.0044  0.0695  364 GLN A C     
1781 O O     . GLN A 236 ? 0.2318 0.2065 0.1889 0.0181  0.0032  0.0564  364 GLN A O     
1782 C CB    . GLN A 236 ? 0.2993 0.2762 0.2455 0.0167  0.0165  0.0796  364 GLN A CB    
1783 C CG    . GLN A 236 ? 0.3781 0.3647 0.3038 0.0201  0.0109  0.0890  364 GLN A CG    
1784 C CD    . GLN A 236 ? 0.4830 0.4780 0.3832 0.0196  0.0169  0.0908  364 GLN A CD    
1785 O OE1   . GLN A 236 ? 0.5054 0.5033 0.3938 0.0182  0.0185  0.0762  364 GLN A OE1   
1786 N NE2   . GLN A 236 ? 0.5131 0.5116 0.4060 0.0208  0.0214  0.1086  364 GLN A NE2   
1787 N N     . HIS A 237 ? 0.2775 0.2499 0.2549 0.0235  -0.0011 0.0789  365 HIS A N     
1788 C CA    . HIS A 237 ? 0.2685 0.2449 0.2504 0.0259  -0.0089 0.0729  365 HIS A CA    
1789 C C     . HIS A 237 ? 0.2735 0.2618 0.2373 0.0283  -0.0181 0.0808  365 HIS A C     
1790 O O     . HIS A 237 ? 0.3092 0.3011 0.2641 0.0299  -0.0193 0.0964  365 HIS A O     
1791 C CB    . HIS A 237 ? 0.3066 0.2757 0.3182 0.0288  -0.0090 0.0767  365 HIS A CB    
1792 C CG    . HIS A 237 ? 0.2896 0.2638 0.3122 0.0320  -0.0158 0.0732  365 HIS A CG    
1793 N ND1   . HIS A 237 ? 0.3194 0.2980 0.3557 0.0367  -0.0234 0.0868  365 HIS A ND1   
1794 C CD2   . HIS A 237 ? 0.2889 0.2650 0.3140 0.0311  -0.0159 0.0589  365 HIS A CD2   
1795 C CE1   . HIS A 237 ? 0.3330 0.3165 0.3812 0.0386  -0.0279 0.0800  365 HIS A CE1   
1796 N NE2   . HIS A 237 ? 0.2967 0.2787 0.3382 0.0351  -0.0227 0.0631  365 HIS A NE2   
1797 N N     . GLN A 238 ? 0.2493 0.2440 0.2074 0.0281  -0.0248 0.0702  366 GLN A N     
1798 C CA    . GLN A 238 ? 0.2717 0.2783 0.2153 0.0300  -0.0363 0.0747  366 GLN A CA    
1799 C C     . GLN A 238 ? 0.2664 0.2761 0.2316 0.0320  -0.0444 0.0713  366 GLN A C     
1800 O O     . GLN A 238 ? 0.2490 0.2563 0.2240 0.0301  -0.0414 0.0577  366 GLN A O     
1801 C CB    . GLN A 238 ? 0.3078 0.3203 0.2244 0.0271  -0.0371 0.0628  366 GLN A CB    
1802 C CG    . GLN A 238 ? 0.3530 0.3637 0.2501 0.0253  -0.0269 0.0647  366 GLN A CG    
1803 C CD    . GLN A 238 ? 0.3741 0.3906 0.2472 0.0232  -0.0268 0.0513  366 GLN A CD    
1804 O OE1   . GLN A 238 ? 0.3653 0.3829 0.2419 0.0217  -0.0314 0.0372  366 GLN A OE1   
1805 N NE2   . GLN A 238 ? 0.3551 0.3751 0.2058 0.0232  -0.0207 0.0559  366 GLN A NE2   
1806 N N     . HIS A 239 ? 0.2774 0.2929 0.2524 0.0359  -0.0540 0.0851  367 HIS A N     
1807 C CA    . HIS A 239 ? 0.3195 0.3401 0.3195 0.0384  -0.0623 0.0834  367 HIS A CA    
1808 C C     . HIS A 239 ? 0.3490 0.3797 0.3385 0.0359  -0.0716 0.0713  367 HIS A C     
1809 O O     . HIS A 239 ? 0.3525 0.3882 0.3128 0.0335  -0.0755 0.0674  367 HIS A O     
1810 C CB    . HIS A 239 ? 0.3615 0.3875 0.3759 0.0434  -0.0726 0.1031  367 HIS A CB    
1811 C CG    . HIS A 239 ? 0.4214 0.4366 0.4597 0.0465  -0.0642 0.1144  367 HIS A CG    
1812 N ND1   . HIS A 239 ? 0.4816 0.4905 0.5085 0.0461  -0.0579 0.1261  367 HIS A ND1   
1813 C CD2   . HIS A 239 ? 0.4390 0.4479 0.5146 0.0499  -0.0605 0.1150  367 HIS A CD2   
1814 C CE1   . HIS A 239 ? 0.4789 0.4774 0.5352 0.0481  -0.0510 0.1312  367 HIS A CE1   
1815 N NE2   . HIS A 239 ? 0.4545 0.4527 0.5401 0.0509  -0.0526 0.1247  367 HIS A NE2   
1816 N N     . SER A 240 ? 0.3257 0.3593 0.3411 0.0364  -0.0746 0.0649  368 SER A N     
1817 C CA    . SER A 240 ? 0.3395 0.3833 0.3538 0.0341  -0.0852 0.0551  368 SER A CA    
1818 C C     . SER A 240 ? 0.3587 0.4155 0.3679 0.0363  -0.1037 0.0658  368 SER A C     
1819 O O     . SER A 240 ? 0.3885 0.4464 0.3988 0.0403  -0.1075 0.0829  368 SER A O     
1820 C CB    . SER A 240 ? 0.3182 0.3626 0.3658 0.0340  -0.0818 0.0474  368 SER A CB    
1821 O OG    . SER A 240 ? 0.3386 0.3892 0.4154 0.0387  -0.0893 0.0585  368 SER A OG    
1822 N N     . CYS A 241 ? 0.3729 0.4399 0.3782 0.0336  -0.1162 0.0564  369 CYS A N     
1823 C CA    . CYS A 241 ? 0.4430 0.5236 0.4392 0.0351  -0.1349 0.0636  369 CYS A CA    
1824 C C     . CYS A 241 ? 0.5043 0.5901 0.5340 0.0400  -0.1399 0.0757  369 CYS A C     
1825 O O     . CYS A 241 ? 0.5266 0.6103 0.5933 0.0409  -0.1356 0.0746  369 CYS A O     
1826 C CB    . CYS A 241 ? 0.4562 0.5460 0.4455 0.0304  -0.1444 0.0465  369 CYS A CB    
1827 S SG    . CYS A 241 ? 0.4471 0.5368 0.4805 0.0276  -0.1444 0.0346  369 CYS A SG    
1828 N N     . HIS A 253 ? 0.3775 0.5003 0.5674 0.0072  -0.1680 -0.0090 381 HIS A N     
1829 C CA    . HIS A 253 ? 0.3843 0.4979 0.5402 0.0051  -0.1628 -0.0179 381 HIS A CA    
1830 C C     . HIS A 253 ? 0.3444 0.4545 0.4672 0.0101  -0.1607 -0.0090 381 HIS A C     
1831 O O     . HIS A 253 ? 0.3858 0.5031 0.4917 0.0128  -0.1703 -0.0010 381 HIS A O     
1832 C CB    . HIS A 253 ? 0.4202 0.5361 0.5563 -0.0006 -0.1730 -0.0318 381 HIS A CB    
1833 C CG    . HIS A 253 ? 0.4333 0.5392 0.5351 -0.0025 -0.1664 -0.0417 381 HIS A CG    
1834 N ND1   . HIS A 253 ? 0.4137 0.5088 0.5242 -0.0051 -0.1546 -0.0503 381 HIS A ND1   
1835 C CD2   . HIS A 253 ? 0.4536 0.5587 0.5133 -0.0021 -0.1683 -0.0432 381 HIS A CD2   
1836 C CE1   . HIS A 253 ? 0.4210 0.5086 0.4979 -0.0057 -0.1501 -0.0577 381 HIS A CE1   
1837 N NE2   . HIS A 253 ? 0.4385 0.5316 0.4837 -0.0041 -0.1574 -0.0538 381 HIS A NE2   
1838 N N     . MET A 254 ? 0.2890 0.3883 0.4029 0.0114  -0.1481 -0.0097 382 MET A N     
1839 C CA    . MET A 254 ? 0.3334 0.4267 0.4138 0.0154  -0.1451 -0.0026 382 MET A CA    
1840 C C     . MET A 254 ? 0.3473 0.4352 0.3880 0.0122  -0.1439 -0.0141 382 MET A C     
1841 O O     . MET A 254 ? 0.3155 0.3970 0.3585 0.0085  -0.1372 -0.0268 382 MET A O     
1842 C CB    . MET A 254 ? 0.3518 0.4340 0.4410 0.0182  -0.1250 0.0039  382 MET A CB    
1843 C CG    . MET A 254 ? 0.3807 0.4672 0.5084 0.0222  -0.1225 0.0140  382 MET A CG    
1844 S SD    . MET A 254 ? 0.4415 0.5135 0.5721 0.0246  -0.0969 0.0169  382 MET A SD    
1845 C CE    . MET A 254 ? 0.5917 0.6546 0.6812 0.0268  -0.0946 0.0234  382 MET A CE    
1846 N N     . ASP A 255 ? 0.3529 0.4437 0.3592 0.0135  -0.1479 -0.0089 383 ASP A N     
1847 C CA    . ASP A 255 ? 0.3358 0.4219 0.3052 0.0105  -0.1430 -0.0190 383 ASP A CA    
1848 C C     . ASP A 255 ? 0.3222 0.3985 0.2663 0.0142  -0.1307 -0.0124 383 ASP A C     
1849 O O     . ASP A 255 ? 0.3113 0.3839 0.2258 0.0120  -0.1240 -0.0184 383 ASP A O     
1850 C CB    . ASP A 255 ? 0.3552 0.4526 0.3015 0.0070  -0.1540 -0.0200 383 ASP A CB    
1851 C CG    . ASP A 255 ? 0.3885 0.4961 0.3232 0.0114  -0.1601 -0.0009 383 ASP A CG    
1852 O OD1   . ASP A 255 ? 0.3892 0.4921 0.3305 0.0177  -0.1540 0.0129  383 ASP A OD1   
1853 O OD2   . ASP A 255 ? 0.4127 0.5332 0.3319 0.0086  -0.1710 0.0005  383 ASP A OD2   
1854 N N     . ALA A 256 ? 0.2989 0.3698 0.2588 0.0182  -0.1226 0.0006  384 ALA A N     
1855 C CA    . ALA A 256 ? 0.2922 0.3519 0.2381 0.0197  -0.1055 0.0064  384 ALA A CA    
1856 C C     . ALA A 256 ? 0.2473 0.2994 0.2227 0.0210  -0.0939 0.0114  384 ALA A C     
1857 O O     . ALA A 256 ? 0.2748 0.3311 0.2756 0.0236  -0.0985 0.0196  384 ALA A O     
1858 C CB    . ALA A 256 ? 0.3154 0.3777 0.2378 0.0233  -0.1078 0.0215  384 ALA A CB    
1859 N N     . PHE A 257 ? 0.2038 0.2455 0.1764 0.0192  -0.0791 0.0059  385 PHE A N     
1860 C CA    . PHE A 257 ? 0.1751 0.2094 0.1691 0.0200  -0.0671 0.0087  385 PHE A CA    
1861 C C     . PHE A 257 ? 0.2092 0.2362 0.1955 0.0227  -0.0590 0.0189  385 PHE A C     
1862 O O     . PHE A 257 ? 0.2537 0.2792 0.2168 0.0228  -0.0580 0.0219  385 PHE A O     
1863 C CB    . PHE A 257 ? 0.1586 0.1863 0.1541 0.0162  -0.0570 -0.0019 385 PHE A CB    
1864 C CG    . PHE A 257 ? 0.1962 0.2292 0.2044 0.0129  -0.0632 -0.0117 385 PHE A CG    
1865 C CD1   . PHE A 257 ? 0.2127 0.2544 0.2452 0.0133  -0.0719 -0.0103 385 PHE A CD1   
1866 C CD2   . PHE A 257 ? 0.2021 0.2313 0.2026 0.0093  -0.0600 -0.0218 385 PHE A CD2   
1867 C CE1   . PHE A 257 ? 0.2472 0.2937 0.2962 0.0096  -0.0778 -0.0190 385 PHE A CE1   
1868 C CE2   . PHE A 257 ? 0.2119 0.2450 0.2290 0.0058  -0.0657 -0.0306 385 PHE A CE2   
1869 C CZ    . PHE A 257 ? 0.2056 0.2472 0.2466 0.0057  -0.0744 -0.0293 385 PHE A CZ    
1870 N N     . GLU A 258 ? 0.2083 0.2305 0.2154 0.0249  -0.0521 0.0232  386 GLU A N     
1871 C CA    . GLU A 258 ? 0.2027 0.2158 0.2063 0.0265  -0.0432 0.0301  386 GLU A CA    
1872 C C     . GLU A 258 ? 0.1892 0.1942 0.1775 0.0229  -0.0330 0.0224  386 GLU A C     
1873 O O     . GLU A 258 ? 0.1620 0.1656 0.1535 0.0202  -0.0287 0.0130  386 GLU A O     
1874 C CB    . GLU A 258 ? 0.2594 0.2687 0.2910 0.0296  -0.0380 0.0331  386 GLU A CB    
1875 C CG    . GLU A 258 ? 0.3052 0.3049 0.3397 0.0315  -0.0309 0.0398  386 GLU A CG    
1876 C CD    . GLU A 258 ? 0.3241 0.3191 0.3880 0.0348  -0.0246 0.0393  386 GLU A CD    
1877 O OE1   . GLU A 258 ? 0.2941 0.2916 0.3715 0.0346  -0.0206 0.0308  386 GLU A OE1   
1878 O OE2   . GLU A 258 ? 0.3817 0.3706 0.4564 0.0377  -0.0227 0.0476  386 GLU A OE2   
1879 N N     . ARG A 259 ? 0.1878 0.1885 0.1613 0.0228  -0.0294 0.0278  387 ARG A N     
1880 C CA    . ARG A 259 ? 0.1959 0.1904 0.1577 0.0196  -0.0211 0.0218  387 ARG A CA    
1881 C C     . ARG A 259 ? 0.1971 0.1838 0.1612 0.0199  -0.0142 0.0288  387 ARG A C     
1882 O O     . ARG A 259 ? 0.2186 0.2058 0.1854 0.0226  -0.0163 0.0404  387 ARG A O     
1883 C CB    . ARG A 259 ? 0.2599 0.2592 0.1998 0.0180  -0.0232 0.0186  387 ARG A CB    
1884 C CG    . ARG A 259 ? 0.3139 0.3178 0.2518 0.0160  -0.0277 0.0074  387 ARG A CG    
1885 C CD    . ARG A 259 ? 0.3106 0.3236 0.2349 0.0170  -0.0377 0.0069  387 ARG A CD    
1886 N NE    . ARG A 259 ? 0.3096 0.3248 0.2099 0.0176  -0.0358 0.0105  387 ARG A NE    
1887 C CZ    . ARG A 259 ? 0.3137 0.3300 0.1982 0.0160  -0.0328 0.0009  387 ARG A CZ    
1888 N NH1   . ARG A 259 ? 0.2721 0.2865 0.1648 0.0135  -0.0323 -0.0123 387 ARG A NH1   
1889 N NH2   . ARG A 259 ? 0.2702 0.2896 0.1326 0.0170  -0.0290 0.0049  387 ARG A NH2   
1890 N N     . SER A 260 ? 0.1942 0.1744 0.1584 0.0170  -0.0071 0.0225  388 SER A N     
1891 C CA    A SER A 260 ? 0.2025 0.1756 0.1703 0.0161  -0.0012 0.0272  388 SER A CA    
1892 C CA    B SER A 260 ? 0.1991 0.1723 0.1666 0.0161  -0.0013 0.0273  388 SER A CA    
1893 C C     . SER A 260 ? 0.1941 0.1661 0.1524 0.0125  0.0031  0.0217  388 SER A C     
1894 O O     . SER A 260 ? 0.2239 0.1950 0.1823 0.0102  0.0038  0.0125  388 SER A O     
1895 C CB    A SER A 260 ? 0.2149 0.1801 0.2012 0.0164  0.0021  0.0242  388 SER A CB    
1896 C CB    B SER A 260 ? 0.2126 0.1777 0.1987 0.0164  0.0021  0.0247  388 SER A CB    
1897 O OG    A SER A 260 ? 0.2121 0.1773 0.2133 0.0205  -0.0006 0.0314  388 SER A OG    
1898 O OG    B SER A 260 ? 0.2065 0.1644 0.1998 0.0152  0.0064  0.0291  388 SER A OG    
1899 N N     . PHE A 261 ? 0.1978 0.1706 0.1496 0.0121  0.0063  0.0285  389 PHE A N     
1900 C CA    . PHE A 261 ? 0.2043 0.1767 0.1525 0.0091  0.0112  0.0246  389 PHE A CA    
1901 C C     . PHE A 261 ? 0.2187 0.1839 0.1818 0.0069  0.0152  0.0277  389 PHE A C     
1902 O O     . PHE A 261 ? 0.2474 0.2108 0.2166 0.0078  0.0179  0.0383  389 PHE A O     
1903 C CB    . PHE A 261 ? 0.2050 0.1841 0.1382 0.0100  0.0142  0.0289  389 PHE A CB    
1904 C CG    . PHE A 261 ? 0.2307 0.2168 0.1487 0.0122  0.0086  0.0263  389 PHE A CG    
1905 C CD1   . PHE A 261 ? 0.2126 0.1997 0.1315 0.0116  0.0036  0.0155  389 PHE A CD1   
1906 C CD2   . PHE A 261 ? 0.2580 0.2500 0.1619 0.0147  0.0075  0.0353  389 PHE A CD2   
1907 C CE1   . PHE A 261 ? 0.2190 0.2127 0.1275 0.0130  -0.0029 0.0119  389 PHE A CE1   
1908 C CE2   . PHE A 261 ? 0.3029 0.3021 0.1921 0.0162  0.0000  0.0315  389 PHE A CE2   
1909 C CZ    . PHE A 261 ? 0.2451 0.2449 0.1382 0.0152  -0.0054 0.0188  389 PHE A CZ    
1910 N N     . CYS A 262 ? 0.1787 0.1401 0.1484 0.0038  0.0151  0.0190  390 CYS A N     
1911 C CA    . CYS A 262 ? 0.1484 0.1021 0.1337 0.0014  0.0162  0.0181  390 CYS A CA    
1912 C C     . CYS A 262 ? 0.1945 0.1486 0.1847 -0.0027 0.0175  0.0153  390 CYS A C     
1913 O O     . CYS A 262 ? 0.1864 0.1457 0.1688 -0.0033 0.0171  0.0120  390 CYS A O     
1914 C CB    . CYS A 262 ? 0.1716 0.1207 0.1605 0.0010  0.0135  0.0085  390 CYS A CB    
1915 S SG    . CYS A 262 ? 0.2624 0.2127 0.2510 0.0059  0.0120  0.0098  390 CYS A SG    
1916 N N     . ILE A 263 ? 0.1673 0.1157 0.1739 -0.0055 0.0183  0.0160  391 ILE A N     
1917 C CA    . ILE A 263 ? 0.1704 0.1187 0.1860 -0.0102 0.0164  0.0109  391 ILE A CA    
1918 C C     . ILE A 263 ? 0.1751 0.1157 0.1983 -0.0128 0.0118  0.0012  391 ILE A C     
1919 O O     . ILE A 263 ? 0.1854 0.1190 0.2218 -0.0126 0.0133  0.0025  391 ILE A O     
1920 C CB    . ILE A 263 ? 0.1799 0.1296 0.2113 -0.0122 0.0215  0.0196  391 ILE A CB    
1921 C CG1   . ILE A 263 ? 0.2033 0.1612 0.2236 -0.0092 0.0280  0.0276  391 ILE A CG1   
1922 C CG2   . ILE A 263 ? 0.1951 0.1458 0.2404 -0.0172 0.0174  0.0138  391 ILE A CG2   
1923 C CD1   . ILE A 263 ? 0.2113 0.1719 0.2459 -0.0104 0.0363  0.0387  391 ILE A CD1   
1924 N N     . PHE A 264 ? 0.1478 0.0899 0.1615 -0.0147 0.0066  -0.0085 392 PHE A N     
1925 C CA    . PHE A 264 ? 0.1580 0.0943 0.1728 -0.0174 0.0023  -0.0201 392 PHE A CA    
1926 C C     . PHE A 264 ? 0.1775 0.1129 0.2054 -0.0231 -0.0033 -0.0244 392 PHE A C     
1927 O O     . PHE A 264 ? 0.1817 0.1236 0.2132 -0.0249 -0.0054 -0.0199 392 PHE A O     
1928 C CB    . PHE A 264 ? 0.1835 0.1232 0.1783 -0.0170 -0.0005 -0.0274 392 PHE A CB    
1929 C CG    . PHE A 264 ? 0.1962 0.1354 0.1825 -0.0124 0.0040  -0.0277 392 PHE A CG    
1930 C CD1   . PHE A 264 ? 0.1909 0.1319 0.1795 -0.0083 0.0078  -0.0185 392 PHE A CD1   
1931 C CD2   . PHE A 264 ? 0.2439 0.1818 0.2200 -0.0124 0.0044  -0.0372 392 PHE A CD2   
1932 C CE1   . PHE A 264 ? 0.1981 0.1401 0.1823 -0.0043 0.0103  -0.0185 392 PHE A CE1   
1933 C CE2   . PHE A 264 ? 0.2547 0.1935 0.2273 -0.0082 0.0093  -0.0369 392 PHE A CE2   
1934 C CZ    . PHE A 264 ? 0.2176 0.1585 0.1963 -0.0042 0.0114  -0.0275 392 PHE A CZ    
1935 N N     . ARG A 265 ? 0.1796 0.1073 0.2160 -0.0258 -0.0061 -0.0344 393 ARG A N     
1936 C CA    . ARG A 265 ? 0.2000 0.1270 0.2453 -0.0320 -0.0146 -0.0431 393 ARG A CA    
1937 C C     . ARG A 265 ? 0.2415 0.1723 0.2630 -0.0336 -0.0216 -0.0536 393 ARG A C     
1938 O O     . ARG A 265 ? 0.2828 0.2090 0.2920 -0.0326 -0.0201 -0.0642 393 ARG A O     
1939 C CB    . ARG A 265 ? 0.1915 0.1077 0.2580 -0.0346 -0.0147 -0.0508 393 ARG A CB    
1940 C CG    . ARG A 265 ? 0.2070 0.1221 0.2831 -0.0416 -0.0251 -0.0628 393 ARG A CG    
1941 C CD    . ARG A 265 ? 0.2286 0.1350 0.3289 -0.0430 -0.0235 -0.0667 393 ARG A CD    
1942 N NE    . ARG A 265 ? 0.2640 0.1716 0.3640 -0.0480 -0.0332 -0.0792 393 ARG A NE    
1943 C CZ    . ARG A 265 ? 0.2457 0.1503 0.3703 -0.0506 -0.0348 -0.0809 393 ARG A CZ    
1944 N NH1   . ARG A 265 ? 0.2555 0.1568 0.4065 -0.0484 -0.0270 -0.0692 393 ARG A NH1   
1945 N NH2   . ARG A 265 ? 0.2670 0.1727 0.3896 -0.0556 -0.0446 -0.0935 393 ARG A NH2   
1946 N N     . LEU A 266 ? 0.2073 0.1470 0.2227 -0.0357 -0.0282 -0.0499 394 LEU A N     
1947 C CA    . LEU A 266 ? 0.2381 0.1825 0.2299 -0.0373 -0.0354 -0.0564 394 LEU A CA    
1948 C C     . LEU A 266 ? 0.2579 0.2036 0.2528 -0.0438 -0.0483 -0.0660 394 LEU A C     
1949 O O     . LEU A 266 ? 0.2543 0.2051 0.2673 -0.0470 -0.0554 -0.0608 394 LEU A O     
1950 C CB    . LEU A 266 ? 0.2201 0.1738 0.2032 -0.0350 -0.0357 -0.0449 394 LEU A CB    
1951 C CG    . LEU A 266 ? 0.2791 0.2388 0.2389 -0.0364 -0.0428 -0.0470 394 LEU A CG    
1952 C CD1   . LEU A 266 ? 0.2847 0.2413 0.2222 -0.0337 -0.0357 -0.0531 394 LEU A CD1   
1953 C CD2   . LEU A 266 ? 0.2919 0.2596 0.2534 -0.0347 -0.0441 -0.0345 394 LEU A CD2   
1954 N N     . PRO A 267 ? 0.3093 0.2511 0.2873 -0.0458 -0.0516 -0.0809 395 PRO A N     
1955 C CA    . PRO A 267 ? 0.3609 0.3052 0.3375 -0.0524 -0.0644 -0.0909 395 PRO A CA    
1956 C C     . PRO A 267 ? 0.3550 0.3119 0.3227 -0.0546 -0.0763 -0.0832 395 PRO A C     
1957 O O     . PRO A 267 ? 0.3846 0.3464 0.3326 -0.0516 -0.0749 -0.0752 395 PRO A O     
1958 C CB    . PRO A 267 ? 0.4136 0.3527 0.3638 -0.0523 -0.0600 -0.1034 395 PRO A CB    
1959 C CG    . PRO A 267 ? 0.4095 0.3395 0.3655 -0.0459 -0.0462 -0.1038 395 PRO A CG    
1960 C CD    . PRO A 267 ? 0.3663 0.3019 0.3283 -0.0421 -0.0418 -0.0892 395 PRO A CD    
1961 N N     . GLN A 268 ? 0.3479 0.3104 0.3340 -0.0595 -0.0864 -0.0829 396 GLN A N     
1962 C CA    . GLN A 268 ? 0.3791 0.3550 0.3617 -0.0615 -0.0990 -0.0756 396 GLN A CA    
1963 C C     . GLN A 268 ? 0.4287 0.4091 0.4084 -0.0674 -0.1084 -0.0872 396 GLN A C     
1964 O O     . GLN A 268 ? 0.4509 0.4220 0.4374 -0.0703 -0.1047 -0.0985 396 GLN A O     
1965 C CB    . GLN A 268 ? 0.3765 0.3563 0.3914 -0.0612 -0.1019 -0.0617 396 GLN A CB    
1966 C CG    . GLN A 268 ? 0.3841 0.3606 0.4042 -0.0557 -0.0892 -0.0505 396 GLN A CG    
1967 C CD    . GLN A 268 ? 0.4713 0.4542 0.4700 -0.0517 -0.0882 -0.0404 396 GLN A CD    
1968 O OE1   . GLN A 268 ? 0.4864 0.4774 0.4985 -0.0510 -0.0926 -0.0291 396 GLN A OE1   
1969 N NE2   . GLN A 268 ? 0.5075 0.4868 0.4769 -0.0491 -0.0817 -0.0442 396 GLN A NE2   
1970 N N     . PRO A 269 ? 0.4615 0.4556 0.4314 -0.0693 -0.1209 -0.0840 397 PRO A N     
1971 C CA    . PRO A 269 ? 0.4897 0.4894 0.4556 -0.0759 -0.1312 -0.0960 397 PRO A CA    
1972 C C     . PRO A 269 ? 0.4491 0.4423 0.4502 -0.0802 -0.1340 -0.0998 397 PRO A C     
1973 O O     . PRO A 269 ? 0.4450 0.4429 0.4758 -0.0798 -0.1391 -0.0891 397 PRO A O     
1974 C CB    . PRO A 269 ? 0.5312 0.5477 0.4904 -0.0753 -0.1452 -0.0864 397 PRO A CB    
1975 C CG    . PRO A 269 ? 0.5178 0.5342 0.4865 -0.0693 -0.1419 -0.0676 397 PRO A CG    
1976 C CD    . PRO A 269 ? 0.4862 0.4903 0.4468 -0.0656 -0.1262 -0.0691 397 PRO A CD    
1977 N N     . GLY A 270 ? 0.4232 0.4046 0.4227 -0.0836 -0.1294 -0.1139 410 GLY A N     
1978 C CA    . GLY A 270 ? 0.4104 0.3856 0.4438 -0.0870 -0.1321 -0.1180 410 GLY A CA    
1979 C C     . GLY A 270 ? 0.3639 0.3314 0.4320 -0.0825 -0.1210 -0.1079 410 GLY A C     
1980 O O     . GLY A 270 ? 0.3216 0.2855 0.4219 -0.0844 -0.1215 -0.1082 410 GLY A O     
1981 N N     . SER A 271 ? 0.3195 0.2849 0.3808 -0.0767 -0.1107 -0.0986 411 SER A N     
1982 C CA    . SER A 271 ? 0.3007 0.2610 0.3908 -0.0727 -0.0996 -0.0875 411 SER A CA    
1983 C C     . SER A 271 ? 0.3063 0.2613 0.3788 -0.0670 -0.0880 -0.0831 411 SER A C     
1984 O O     . SER A 271 ? 0.3037 0.2545 0.3467 -0.0657 -0.0855 -0.0917 411 SER A O     
1985 C CB    . SER A 271 ? 0.3530 0.3240 0.4700 -0.0728 -0.1042 -0.0739 411 SER A CB    
1986 O OG    . SER A 271 ? 0.4003 0.3677 0.5451 -0.0699 -0.0920 -0.0631 411 SER A OG    
1987 N N     . TRP A 272 ? 0.2304 0.1861 0.3209 -0.0636 -0.0802 -0.0697 412 TRP A N     
1988 C CA    . TRP A 272 ? 0.2186 0.1695 0.2951 -0.0586 -0.0702 -0.0653 412 TRP A CA    
1989 C C     . TRP A 272 ? 0.2179 0.1746 0.3117 -0.0558 -0.0634 -0.0489 412 TRP A C     
1990 O O     . TRP A 272 ? 0.1906 0.1522 0.3137 -0.0585 -0.0653 -0.0429 412 TRP A O     
1991 C CB    . TRP A 272 ? 0.2342 0.1727 0.3120 -0.0561 -0.0591 -0.0704 412 TRP A CB    
1992 C CG    . TRP A 272 ? 0.2153 0.1493 0.3261 -0.0564 -0.0521 -0.0640 412 TRP A CG    
1993 C CD1   . TRP A 272 ? 0.2311 0.1615 0.3591 -0.0594 -0.0549 -0.0704 412 TRP A CD1   
1994 C CD2   . TRP A 272 ? 0.1992 0.1319 0.3276 -0.0533 -0.0403 -0.0493 412 TRP A CD2   
1995 N NE1   . TRP A 272 ? 0.2527 0.1805 0.4097 -0.0580 -0.0460 -0.0595 412 TRP A NE1   
1996 C CE2   . TRP A 272 ? 0.2060 0.1356 0.3617 -0.0542 -0.0365 -0.0459 412 TRP A CE2   
1997 C CE3   . TRP A 272 ? 0.1831 0.1196 0.3018 -0.0483 -0.0314 -0.0370 412 TRP A CE3   
1998 C CZ2   . TRP A 272 ? 0.2473 0.1766 0.4219 -0.0515 -0.0246 -0.0304 412 TRP A CZ2   
1999 C CZ3   . TRP A 272 ? 0.2144 0.1504 0.3498 -0.0457 -0.0195 -0.0229 412 TRP A CZ3   
2000 C CH2   . TRP A 272 ? 0.2260 0.1579 0.3907 -0.0481 -0.0164 -0.0192 412 TRP A CH2   
2001 N N     . LYS A 273 ? 0.1829 0.1408 0.2569 -0.0496 -0.0538 -0.0415 413 LYS A N     
2002 C CA    . LYS A 273 ? 0.1666 0.1292 0.2522 -0.0455 -0.0435 -0.0277 413 LYS A CA    
2003 C C     . LYS A 273 ? 0.1885 0.1461 0.2584 -0.0395 -0.0305 -0.0239 413 LYS A C     
2004 O O     . LYS A 273 ? 0.1911 0.1447 0.2383 -0.0374 -0.0301 -0.0297 413 LYS A O     
2005 C CB    . LYS A 273 ? 0.2068 0.1800 0.2897 -0.0444 -0.0485 -0.0214 413 LYS A CB    
2006 C CG    . LYS A 273 ? 0.2234 0.1976 0.2763 -0.0409 -0.0489 -0.0216 413 LYS A CG    
2007 C CD    . LYS A 273 ? 0.1895 0.1728 0.2482 -0.0386 -0.0502 -0.0123 413 LYS A CD    
2008 C CE    . LYS A 273 ? 0.2198 0.2040 0.2522 -0.0362 -0.0521 -0.0115 413 LYS A CE    
2009 N NZ    . LYS A 273 ? 0.2081 0.2003 0.2498 -0.0344 -0.0555 -0.0023 413 LYS A NZ    
2010 N N     . ALA A 274 ? 0.1743 0.1329 0.2570 -0.0368 -0.0198 -0.0137 414 ALA A N     
2011 C CA    . ALA A 274 ? 0.1462 0.1021 0.2141 -0.0311 -0.0092 -0.0086 414 ALA A CA    
2012 C C     . ALA A 274 ? 0.1383 0.1002 0.1872 -0.0272 -0.0080 -0.0066 414 ALA A C     
2013 O O     . ALA A 274 ? 0.1337 0.1027 0.1901 -0.0273 -0.0089 -0.0031 414 ALA A O     
2014 C CB    . ALA A 274 ? 0.1635 0.1199 0.2484 -0.0299 0.0015  0.0023  414 ALA A CB    
2015 N N     . VAL A 275 ? 0.1372 0.0962 0.1658 -0.0236 -0.0055 -0.0086 415 VAL A N     
2016 C CA    . VAL A 275 ? 0.1573 0.1209 0.1706 -0.0201 -0.0041 -0.0071 415 VAL A CA    
2017 C C     . VAL A 275 ? 0.1822 0.1442 0.1852 -0.0156 0.0033  -0.0040 415 VAL A C     
2018 O O     . VAL A 275 ? 0.1716 0.1283 0.1705 -0.0146 0.0042  -0.0058 415 VAL A O     
2019 C CB    . VAL A 275 ? 0.1524 0.1164 0.1510 -0.0212 -0.0112 -0.0128 415 VAL A CB    
2020 C CG1   . VAL A 275 ? 0.1636 0.1319 0.1526 -0.0181 -0.0093 -0.0098 415 VAL A CG1   
2021 C CG2   . VAL A 275 ? 0.1803 0.1471 0.1860 -0.0260 -0.0212 -0.0153 415 VAL A CG2   
2022 N N     . ARG A 276 ? 0.1458 0.1128 0.1455 -0.0127 0.0079  -0.0002 416 ARG A N     
2023 C CA    . ARG A 276 ? 0.1700 0.1370 0.1571 -0.0086 0.0122  0.0016  416 ARG A CA    
2024 C C     . ARG A 276 ? 0.1568 0.1229 0.1323 -0.0076 0.0083  -0.0033 416 ARG A C     
2025 O O     . ARG A 276 ? 0.1536 0.1219 0.1273 -0.0086 0.0048  -0.0059 416 ARG A O     
2026 C CB    . ARG A 276 ? 0.1388 0.1117 0.1238 -0.0062 0.0177  0.0039  416 ARG A CB    
2027 C CG    . ARG A 276 ? 0.1548 0.1296 0.1468 -0.0059 0.0256  0.0111  416 ARG A CG    
2028 C CD    . ARG A 276 ? 0.1795 0.1535 0.1594 -0.0030 0.0287  0.0168  416 ARG A CD    
2029 N NE    . ARG A 276 ? 0.1901 0.1684 0.1527 0.0003  0.0291  0.0137  416 ARG A NE    
2030 C CZ    . ARG A 276 ? 0.1888 0.1661 0.1413 0.0019  0.0235  0.0105  416 ARG A CZ    
2031 N NH1   . ARG A 276 ? 0.1741 0.1464 0.1309 0.0012  0.0188  0.0103  416 ARG A NH1   
2032 N NH2   . ARG A 276 ? 0.1732 0.1549 0.1132 0.0041  0.0228  0.0064  416 ARG A NH2   
2033 N N     . VAL A 277 ? 0.1462 0.1095 0.1166 -0.0055 0.0091  -0.0030 417 VAL A N     
2034 C CA    . VAL A 277 ? 0.1565 0.1200 0.1193 -0.0043 0.0071  -0.0068 417 VAL A CA    
2035 C C     . VAL A 277 ? 0.1519 0.1174 0.1108 -0.0006 0.0084  -0.0037 417 VAL A C     
2036 O O     . VAL A 277 ? 0.1543 0.1179 0.1163 0.0009  0.0100  0.0012  417 VAL A O     
2037 C CB    . VAL A 277 ? 0.1780 0.1366 0.1418 -0.0055 0.0062  -0.0117 417 VAL A CB    
2038 C CG1   . VAL A 277 ? 0.1648 0.1249 0.1227 -0.0038 0.0068  -0.0145 417 VAL A CG1   
2039 C CG2   . VAL A 277 ? 0.1798 0.1372 0.1440 -0.0097 0.0027  -0.0158 417 VAL A CG2   
2040 N N     . ASP A 278 ? 0.1518 0.1214 0.1057 0.0006  0.0068  -0.0057 418 ASP A N     
2041 C CA    . ASP A 278 ? 0.1519 0.1248 0.1026 0.0035  0.0054  -0.0040 418 ASP A CA    
2042 C C     . ASP A 278 ? 0.1592 0.1323 0.1141 0.0043  0.0038  -0.0064 418 ASP A C     
2043 O O     . ASP A 278 ? 0.1574 0.1311 0.1134 0.0025  0.0040  -0.0100 418 ASP A O     
2044 C CB    . ASP A 278 ? 0.1597 0.1375 0.1045 0.0040  0.0042  -0.0065 418 ASP A CB    
2045 C CG    . ASP A 278 ? 0.1782 0.1574 0.1181 0.0044  0.0080  -0.0042 418 ASP A CG    
2046 O OD1   . ASP A 278 ? 0.1713 0.1492 0.1106 0.0051  0.0104  0.0024  418 ASP A OD1   
2047 O OD2   . ASP A 278 ? 0.1581 0.1397 0.0968 0.0041  0.0094  -0.0087 418 ASP A OD2   
2048 N N     . LEU A 279 ? 0.1525 0.1259 0.1116 0.0070  0.0027  -0.0031 419 LEU A N     
2049 C CA    . LEU A 279 ? 0.1572 0.1323 0.1246 0.0083  0.0023  -0.0050 419 LEU A CA    
2050 C C     . LEU A 279 ? 0.1493 0.1310 0.1188 0.0107  -0.0034 -0.0025 419 LEU A C     
2051 O O     . LEU A 279 ? 0.1644 0.1477 0.1300 0.0127  -0.0067 0.0032  419 LEU A O     
2052 C CB    . LEU A 279 ? 0.1661 0.1360 0.1431 0.0100  0.0056  -0.0043 419 LEU A CB    
2053 C CG    . LEU A 279 ? 0.1648 0.1278 0.1399 0.0074  0.0095  -0.0084 419 LEU A CG    
2054 C CD1   . LEU A 279 ? 0.1798 0.1369 0.1675 0.0095  0.0127  -0.0096 419 LEU A CD1   
2055 C CD2   . LEU A 279 ? 0.1522 0.1163 0.1202 0.0044  0.0113  -0.0146 419 LEU A CD2   
2056 N N     . VAL A 280 ? 0.1319 0.1181 0.1081 0.0102  -0.0052 -0.0059 420 VAL A N     
2057 C CA    . VAL A 280 ? 0.1262 0.1195 0.1076 0.0120  -0.0126 -0.0045 420 VAL A CA    
2058 C C     . VAL A 280 ? 0.1227 0.1194 0.1227 0.0127  -0.0116 -0.0054 420 VAL A C     
2059 O O     . VAL A 280 ? 0.1262 0.1215 0.1304 0.0108  -0.0053 -0.0086 420 VAL A O     
2060 C CB    . VAL A 280 ? 0.1519 0.1491 0.1250 0.0100  -0.0177 -0.0094 420 VAL A CB    
2061 C CG1   . VAL A 280 ? 0.1684 0.1635 0.1459 0.0067  -0.0136 -0.0147 420 VAL A CG1   
2062 C CG2   . VAL A 280 ? 0.1456 0.1509 0.1250 0.0110  -0.0274 -0.0101 420 VAL A CG2   
2063 N N     . VAL A 281 ? 0.1269 0.1289 0.1390 0.0158  -0.0173 -0.0012 421 VAL A N     
2064 C CA    . VAL A 281 ? 0.1242 0.1306 0.1589 0.0170  -0.0154 -0.0015 421 VAL A CA    
2065 C C     . VAL A 281 ? 0.1276 0.1437 0.1732 0.0166  -0.0260 -0.0018 421 VAL A C     
2066 O O     . VAL A 281 ? 0.1717 0.1922 0.2125 0.0182  -0.0365 0.0018  421 VAL A O     
2067 C CB    . VAL A 281 ? 0.1279 0.1327 0.1773 0.0216  -0.0129 0.0036  421 VAL A CB    
2068 C CG1   . VAL A 281 ? 0.1411 0.1515 0.2172 0.0232  -0.0083 0.0023  421 VAL A CG1   
2069 C CG2   . VAL A 281 ? 0.1288 0.1230 0.1690 0.0217  -0.0037 0.0022  421 VAL A CG2   
2070 N N     . ALA A 282 ? 0.1232 0.1434 0.1842 0.0142  -0.0237 -0.0056 422 ALA A N     
2071 C CA    . ALA A 282 ? 0.1438 0.1737 0.2208 0.0131  -0.0348 -0.0070 422 ALA A CA    
2072 C C     . ALA A 282 ? 0.1246 0.1611 0.2334 0.0141  -0.0308 -0.0050 422 ALA A C     
2073 O O     . ALA A 282 ? 0.1203 0.1536 0.2342 0.0137  -0.0172 -0.0052 422 ALA A O     
2074 C CB    . ALA A 282 ? 0.1737 0.2028 0.2446 0.0083  -0.0372 -0.0142 422 ALA A CB    
2075 N N     . PRO A 283 ? 0.1242 0.1709 0.2543 0.0151  -0.0426 -0.0031 423 PRO A N     
2076 C CA    . PRO A 283 ? 0.1208 0.1760 0.2875 0.0153  -0.0392 -0.0016 423 PRO A CA    
2077 C C     . PRO A 283 ? 0.1347 0.1906 0.3106 0.0100  -0.0328 -0.0060 423 PRO A C     
2078 O O     . PRO A 283 ? 0.1286 0.1815 0.2904 0.0061  -0.0388 -0.0111 423 PRO A O     
2079 C CB    . PRO A 283 ? 0.2156 0.2822 0.4000 0.0164  -0.0578 0.0006  423 PRO A CB    
2080 C CG    . PRO A 283 ? 0.2348 0.2995 0.3891 0.0144  -0.0707 -0.0034 423 PRO A CG    
2081 C CD    . PRO A 283 ? 0.1617 0.2138 0.2824 0.0153  -0.0602 -0.0031 423 PRO A CD    
2082 N N     . VAL A 284 ? 0.1495 0.1546 0.2658 0.0746  0.0151  -0.0358 424 VAL A N     
2083 C CA    . VAL A 284 ? 0.1469 0.1684 0.2618 0.0645  0.0234  -0.0402 424 VAL A CA    
2084 C C     . VAL A 284 ? 0.1458 0.1863 0.2663 0.0580  0.0199  -0.0341 424 VAL A C     
2085 O O     . VAL A 284 ? 0.1368 0.1800 0.2478 0.0463  0.0229  -0.0318 424 VAL A O     
2086 C CB    . VAL A 284 ? 0.1868 0.2224 0.3067 0.0672  0.0331  -0.0505 424 VAL A CB    
2087 C CG1   . VAL A 284 ? 0.1797 0.2366 0.3186 0.0760  0.0320  -0.0518 424 VAL A CG1   
2088 C CG2   . VAL A 284 ? 0.2282 0.2757 0.3411 0.0557  0.0429  -0.0534 424 VAL A CG2   
2089 N N     . SER A 285 ? 0.1664 0.2181 0.3019 0.0660  0.0122  -0.0318 425 SER A N     
2090 C CA    . SER A 285 ? 0.1466 0.2157 0.2877 0.0598  0.0069  -0.0277 425 SER A CA    
2091 C C     . SER A 285 ? 0.1961 0.2502 0.3173 0.0505  0.0022  -0.0197 425 SER A C     
2092 O O     . SER A 285 ? 0.1811 0.2454 0.3020 0.0414  0.0014  -0.0189 425 SER A O     
2093 C CB    . SER A 285 ? 0.1875 0.2710 0.3470 0.0717  -0.0031 -0.0268 425 SER A CB    
2094 O OG    . SER A 285 ? 0.2293 0.2916 0.3781 0.0797  -0.0125 -0.0186 425 SER A OG    
2095 N N     . GLN A 286 ? 0.1344 0.1642 0.2399 0.0522  -0.0002 -0.0144 426 GLN A N     
2096 C CA    . GLN A 286 ? 0.1523 0.1701 0.2402 0.0449  -0.0038 -0.0072 426 GLN A CA    
2097 C C     . GLN A 286 ? 0.1550 0.1586 0.2289 0.0367  0.0029  -0.0079 426 GLN A C     
2098 O O     . GLN A 286 ? 0.1412 0.1360 0.2019 0.0307  0.0014  -0.0031 426 GLN A O     
2099 C CB    . GLN A 286 ? 0.1896 0.1940 0.2709 0.0520  -0.0122 0.0013  426 GLN A CB    
2100 C CG    . GLN A 286 ? 0.2097 0.2300 0.3036 0.0610  -0.0211 0.0026  426 GLN A CG    
2101 C CD    . GLN A 286 ? 0.2789 0.2856 0.3640 0.0692  -0.0300 0.0129  426 GLN A CD    
2102 O OE1   . GLN A 286 ? 0.3104 0.3154 0.4056 0.0817  -0.0349 0.0146  426 GLN A OE1   
2103 N NE2   . GLN A 286 ? 0.2727 0.2699 0.3387 0.0630  -0.0320 0.0204  426 GLN A NE2   
2104 N N     . PHE A 287 ? 0.1332 0.1365 0.2101 0.0372  0.0102  -0.0147 427 PHE A N     
2105 C CA    . PHE A 287 ? 0.1414 0.1332 0.2049 0.0302  0.0153  -0.0163 427 PHE A CA    
2106 C C     . PHE A 287 ? 0.1311 0.1257 0.1851 0.0202  0.0160  -0.0132 427 PHE A C     
2107 O O     . PHE A 287 ? 0.1226 0.1057 0.1650 0.0159  0.0153  -0.0105 427 PHE A O     
2108 C CB    . PHE A 287 ? 0.1397 0.1358 0.2067 0.0323  0.0230  -0.0254 427 PHE A CB    
2109 C CG    . PHE A 287 ? 0.1584 0.1467 0.2108 0.0253  0.0273  -0.0279 427 PHE A CG    
2110 C CD1   . PHE A 287 ? 0.1423 0.1397 0.1883 0.0177  0.0314  -0.0270 427 PHE A CD1   
2111 C CD2   . PHE A 287 ? 0.1946 0.1660 0.2400 0.0263  0.0264  -0.0312 427 PHE A CD2   
2112 C CE1   . PHE A 287 ? 0.1942 0.1855 0.2258 0.0125  0.0339  -0.0285 427 PHE A CE1   
2113 C CE2   . PHE A 287 ? 0.2069 0.1740 0.2393 0.0201  0.0288  -0.0344 427 PHE A CE2   
2114 C CZ    . PHE A 287 ? 0.1951 0.1728 0.2200 0.0139  0.0321  -0.0326 427 PHE A CZ    
2115 N N     . PRO A 288 ? 0.1257 0.1351 0.1859 0.0165  0.0173  -0.0137 428 PRO A N     
2116 C CA    . PRO A 288 ? 0.1125 0.1196 0.1632 0.0079  0.0176  -0.0109 428 PRO A CA    
2117 C C     . PRO A 288 ? 0.0945 0.0936 0.1373 0.0071  0.0114  -0.0060 428 PRO A C     
2118 O O     . PRO A 288 ? 0.1381 0.1300 0.1708 0.0026  0.0119  -0.0043 428 PRO A O     
2119 C CB    . PRO A 288 ? 0.1060 0.1288 0.1677 0.0037  0.0193  -0.0123 428 PRO A CB    
2120 C CG    . PRO A 288 ? 0.1265 0.1623 0.2017 0.0087  0.0242  -0.0174 428 PRO A CG    
2121 C CD    . PRO A 288 ? 0.1148 0.1434 0.1918 0.0188  0.0192  -0.0175 428 PRO A CD    
2122 N N     . PHE A 289 ? 0.1007 0.1021 0.1476 0.0122  0.0055  -0.0038 429 PHE A N     
2123 C CA    . PHE A 289 ? 0.0942 0.0901 0.1315 0.0117  0.0006  0.0008  429 PHE A CA    
2124 C C     . PHE A 289 ? 0.1154 0.0972 0.1433 0.0118  0.0022  0.0044  429 PHE A C     
2125 O O     . PHE A 289 ? 0.1121 0.0898 0.1309 0.0082  0.0023  0.0068  429 PHE A O     
2126 C CB    . PHE A 289 ? 0.1195 0.1224 0.1610 0.0176  -0.0066 0.0031  429 PHE A CB    
2127 C CG    . PHE A 289 ? 0.1298 0.1490 0.1822 0.0158  -0.0097 -0.0014 429 PHE A CG    
2128 C CD1   . PHE A 289 ? 0.1638 0.1854 0.2112 0.0097  -0.0117 -0.0035 429 PHE A CD1   
2129 C CD2   . PHE A 289 ? 0.1538 0.1865 0.2230 0.0200  -0.0103 -0.0046 429 PHE A CD2   
2130 C CE1   . PHE A 289 ? 0.1376 0.1734 0.1968 0.0063  -0.0150 -0.0086 429 PHE A CE1   
2131 C CE2   . PHE A 289 ? 0.1621 0.2127 0.2445 0.0165  -0.0131 -0.0093 429 PHE A CE2   
2132 C CZ    . PHE A 289 ? 0.1323 0.1833 0.2094 0.0089  -0.0155 -0.0111 429 PHE A CZ    
2133 N N     . ALA A 290 ? 0.1331 0.1082 0.1649 0.0157  0.0037  0.0038  430 ALA A N     
2134 C CA    . ALA A 290 ? 0.1413 0.1022 0.1667 0.0141  0.0050  0.0064  430 ALA A CA    
2135 C C     . ALA A 290 ? 0.1397 0.0998 0.1602 0.0077  0.0089  0.0028  430 ALA A C     
2136 O O     . ALA A 290 ? 0.1491 0.1044 0.1640 0.0036  0.0091  0.0054  430 ALA A O     
2137 C CB    . ALA A 290 ? 0.1524 0.1036 0.1838 0.0198  0.0053  0.0047  430 ALA A CB    
2138 N N     . LEU A 291 ? 0.1188 0.0847 0.1417 0.0069  0.0120  -0.0027 431 LEU A N     
2139 C CA    . LEU A 291 ? 0.1154 0.0809 0.1318 0.0020  0.0144  -0.0052 431 LEU A CA    
2140 C C     . LEU A 291 ? 0.1223 0.0907 0.1340 -0.0015 0.0128  -0.0018 431 LEU A C     
2141 O O     . LEU A 291 ? 0.1210 0.0870 0.1280 -0.0042 0.0125  -0.0014 431 LEU A O     
2142 C CB    . LEU A 291 ? 0.1355 0.1077 0.1526 0.0018  0.0186  -0.0098 431 LEU A CB    
2143 C CG    . LEU A 291 ? 0.1218 0.0934 0.1293 -0.0023 0.0204  -0.0112 431 LEU A CG    
2144 C CD1   . LEU A 291 ? 0.1572 0.1211 0.1604 -0.0027 0.0192  -0.0151 431 LEU A CD1   
2145 C CD2   . LEU A 291 ? 0.1530 0.1321 0.1591 -0.0029 0.0257  -0.0137 431 LEU A CD2   
2146 N N     . LEU A 292 ? 0.1211 0.0953 0.1352 -0.0010 0.0114  -0.0005 432 LEU A N     
2147 C CA    . LEU A 292 ? 0.1351 0.1102 0.1449 -0.0032 0.0097  0.0008  432 LEU A CA    
2148 C C     . LEU A 292 ? 0.1341 0.1068 0.1397 -0.0029 0.0085  0.0036  432 LEU A C     
2149 O O     . LEU A 292 ? 0.1318 0.1045 0.1342 -0.0044 0.0090  0.0034  432 LEU A O     
2150 C CB    . LEU A 292 ? 0.1292 0.1102 0.1430 -0.0033 0.0075  0.0000  432 LEU A CB    
2151 C CG    . LEU A 292 ? 0.1315 0.1117 0.1413 -0.0049 0.0054  -0.0010 432 LEU A CG    
2152 C CD1   . LEU A 292 ? 0.1831 0.1578 0.1900 -0.0074 0.0074  -0.0012 432 LEU A CD1   
2153 C CD2   . LEU A 292 ? 0.1151 0.1013 0.1306 -0.0060 0.0022  -0.0037 432 LEU A CD2   
2154 N N     . GLY A 293 ? 0.1220 0.0936 0.1279 -0.0006 0.0071  0.0067  433 GLY A N     
2155 C CA    . GLY A 293 ? 0.1418 0.1119 0.1425 -0.0014 0.0074  0.0108  433 GLY A CA    
2156 C C     . GLY A 293 ? 0.1404 0.1062 0.1422 -0.0050 0.0101  0.0112  433 GLY A C     
2157 O O     . GLY A 293 ? 0.1468 0.1164 0.1470 -0.0075 0.0117  0.0121  433 GLY A O     
2158 N N     . TRP A 294 ? 0.1176 0.0767 0.1233 -0.0053 0.0105  0.0095  434 TRP A N     
2159 C CA    . TRP A 294 ? 0.1250 0.0794 0.1327 -0.0097 0.0118  0.0085  434 TRP A CA    
2160 C C     . TRP A 294 ? 0.1207 0.0813 0.1284 -0.0121 0.0116  0.0036  434 TRP A C     
2161 O O     . TRP A 294 ? 0.1544 0.1153 0.1650 -0.0163 0.0116  0.0019  434 TRP A O     
2162 C CB    . TRP A 294 ? 0.1291 0.0725 0.1402 -0.0086 0.0116  0.0063  434 TRP A CB    
2163 C CG    . TRP A 294 ? 0.1613 0.0940 0.1729 -0.0077 0.0112  0.0130  434 TRP A CG    
2164 C CD1   . TRP A 294 ? 0.1634 0.0952 0.1732 -0.0020 0.0092  0.0185  434 TRP A CD1   
2165 C CD2   . TRP A 294 ? 0.1568 0.0775 0.1707 -0.0129 0.0122  0.0159  434 TRP A CD2   
2166 N NE1   . TRP A 294 ? 0.1721 0.0906 0.1809 -0.0023 0.0088  0.0260  434 TRP A NE1   
2167 C CE2   . TRP A 294 ? 0.1766 0.0869 0.1883 -0.0096 0.0113  0.0247  434 TRP A CE2   
2168 C CE3   . TRP A 294 ? 0.1435 0.0609 0.1616 -0.0204 0.0132  0.0118  434 TRP A CE3   
2169 C CZ2   . TRP A 294 ? 0.1936 0.0877 0.2064 -0.0142 0.0123  0.0309  434 TRP A CZ2   
2170 C CZ3   . TRP A 294 ? 0.1558 0.0588 0.1772 -0.0259 0.0141  0.0162  434 TRP A CZ3   
2171 C CH2   . TRP A 294 ? 0.2025 0.0944 0.2196 -0.0228 0.0134  0.0258  434 TRP A CH2   
2172 N N     . THR A 295 ? 0.1240 0.0893 0.1291 -0.0096 0.0110  0.0017  435 THR A N     
2173 C CA    . THR A 295 ? 0.1307 0.1002 0.1340 -0.0105 0.0098  -0.0010 435 THR A CA    
2174 C C     . THR A 295 ? 0.1222 0.0986 0.1266 -0.0100 0.0091  0.0004  435 THR A C     
2175 O O     . THR A 295 ? 0.1344 0.1157 0.1402 -0.0102 0.0072  -0.0013 435 THR A O     
2176 C CB    . THR A 295 ? 0.1384 0.1073 0.1374 -0.0086 0.0100  -0.0022 435 THR A CB    
2177 O OG1   . THR A 295 ? 0.1249 0.0907 0.1237 -0.0085 0.0118  -0.0053 435 THR A OG1   
2178 C CG2   . THR A 295 ? 0.1578 0.1290 0.1521 -0.0085 0.0079  -0.0027 435 THR A CG2   
2179 N N     . GLY A 296 ? 0.1102 0.0881 0.1140 -0.0085 0.0103  0.0027  436 GLY A N     
2180 C CA    . GLY A 296 ? 0.1223 0.1079 0.1273 -0.0074 0.0110  0.0026  436 GLY A CA    
2181 C C     . GLY A 296 ? 0.1299 0.1162 0.1340 -0.0035 0.0087  0.0000  436 GLY A C     
2182 O O     . GLY A 296 ? 0.1302 0.1099 0.1310 -0.0026 0.0073  -0.0001 436 GLY A O     
2183 N N     . SER A 297 ? 0.1164 0.1107 0.1245 -0.0010 0.0086  -0.0018 437 SER A N     
2184 C CA    . SER A 297 ? 0.1059 0.1117 0.1199 -0.0029 0.0118  -0.0018 437 SER A CA    
2185 C C     . SER A 297 ? 0.1076 0.1150 0.1170 -0.0037 0.0160  0.0002  437 SER A C     
2186 O O     . SER A 297 ? 0.1173 0.1182 0.1196 -0.0016 0.0150  0.0000  437 SER A O     
2187 C CB    . SER A 297 ? 0.1048 0.1217 0.1258 0.0021  0.0110  -0.0054 437 SER A CB    
2188 O OG    . SER A 297 ? 0.1314 0.1460 0.1485 0.0081  0.0114  -0.0083 437 SER A OG    
2189 N N     . LYS A 298 ? 0.0941 0.1111 0.1070 -0.0072 0.0207  0.0023  438 LYS A N     
2190 C CA    . LYS A 298 ? 0.0930 0.1127 0.0980 -0.0076 0.0251  0.0054  438 LYS A CA    
2191 C C     . LYS A 298 ? 0.1197 0.1427 0.1187 -0.0008 0.0249  -0.0002 438 LYS A C     
2192 O O     . LYS A 298 ? 0.1326 0.1505 0.1215 0.0009  0.0236  0.0000  438 LYS A O     
2193 C CB    . LYS A 298 ? 0.1115 0.1430 0.1216 -0.0132 0.0318  0.0091  438 LYS A CB    
2194 C CG    . LYS A 298 ? 0.1679 0.2053 0.1673 -0.0136 0.0378  0.0130  438 LYS A CG    
2195 C CD    . LYS A 298 ? 0.2418 0.2922 0.2491 -0.0213 0.0459  0.0176  438 LYS A CD    
2196 C CE    . LYS A 298 ? 0.3448 0.4057 0.3410 -0.0221 0.0542  0.0217  438 LYS A CE    
2197 N NZ    . LYS A 298 ? 0.3982 0.4731 0.4052 -0.0317 0.0632  0.0268  438 LYS A NZ    
2198 N N     . LEU A 299 ? 0.0952 0.1267 0.1013 0.0038  0.0253  -0.0061 439 LEU A N     
2199 C CA    . LEU A 299 ? 0.0968 0.1282 0.0977 0.0109  0.0247  -0.0132 439 LEU A CA    
2200 C C     . LEU A 299 ? 0.1452 0.1600 0.1410 0.0124  0.0182  -0.0149 439 LEU A C     
2201 O O     . LEU A 299 ? 0.1571 0.1684 0.1450 0.0147  0.0171  -0.0192 439 LEU A O     
2202 C CB    . LEU A 299 ? 0.1410 0.1828 0.1525 0.0175  0.0256  -0.0196 439 LEU A CB    
2203 C CG    . LEU A 299 ? 0.1374 0.1758 0.1444 0.0260  0.0247  -0.0287 439 LEU A CG    
2204 C CD1   . LEU A 299 ? 0.1283 0.1763 0.1245 0.0262  0.0309  -0.0317 439 LEU A CD1   
2205 C CD2   . LEU A 299 ? 0.1188 0.1649 0.1385 0.0348  0.0241  -0.0350 439 LEU A CD2   
2206 N N     . PHE A 300 ? 0.1411 0.1471 0.1413 0.0106  0.0143  -0.0121 440 PHE A N     
2207 C CA    . PHE A 300 ? 0.1285 0.1209 0.1253 0.0103  0.0099  -0.0127 440 PHE A CA    
2208 C C     . PHE A 300 ? 0.1390 0.1295 0.1293 0.0071  0.0095  -0.0111 440 PHE A C     
2209 O O     . PHE A 300 ? 0.1236 0.1091 0.1108 0.0077  0.0066  -0.0150 440 PHE A O     
2210 C CB    . PHE A 300 ? 0.1089 0.0946 0.1089 0.0079  0.0074  -0.0087 440 PHE A CB    
2211 C CG    . PHE A 300 ? 0.1282 0.1014 0.1260 0.0071  0.0045  -0.0088 440 PHE A CG    
2212 C CD1   . PHE A 300 ? 0.1511 0.1155 0.1494 0.0106  0.0019  -0.0103 440 PHE A CD1   
2213 C CD2   . PHE A 300 ? 0.1704 0.1409 0.1667 0.0027  0.0045  -0.0069 440 PHE A CD2   
2214 C CE1   . PHE A 300 ? 0.1625 0.1141 0.1591 0.0077  0.0002  -0.0090 440 PHE A CE1   
2215 C CE2   . PHE A 300 ? 0.1607 0.1227 0.1574 0.0002  0.0030  -0.0068 440 PHE A CE2   
2216 C CZ    . PHE A 300 ? 0.1654 0.1174 0.1618 0.0018  0.0013  -0.0075 440 PHE A CZ    
2217 N N     . GLN A 301 ? 0.1361 0.1303 0.1252 0.0038  0.0115  -0.0055 441 GLN A N     
2218 C CA    . GLN A 301 ? 0.1312 0.1238 0.1147 0.0026  0.0097  -0.0029 441 GLN A CA    
2219 C C     . GLN A 301 ? 0.1349 0.1335 0.1088 0.0050  0.0099  -0.0057 441 GLN A C     
2220 O O     . GLN A 301 ? 0.1593 0.1568 0.1290 0.0056  0.0056  -0.0077 441 GLN A O     
2221 C CB    . GLN A 301 ? 0.1434 0.1349 0.1278 -0.0004 0.0114  0.0045  441 GLN A CB    
2222 C CG    . GLN A 301 ? 0.1784 0.1639 0.1702 -0.0024 0.0107  0.0052  441 GLN A CG    
2223 C CD    . GLN A 301 ? 0.2066 0.1878 0.2005 -0.0018 0.0076  0.0028  441 GLN A CD    
2224 O OE1   . GLN A 301 ? 0.1926 0.1743 0.1857 -0.0009 0.0053  0.0033  441 GLN A OE1   
2225 N NE2   . GLN A 301 ? 0.2236 0.2018 0.2203 -0.0024 0.0075  0.0006  441 GLN A NE2   
2226 N N     . ARG A 302 ? 0.1481 0.1553 0.1187 0.0063  0.0149  -0.0064 442 ARG A N     
2227 C CA    . ARG A 302 ? 0.1288 0.1434 0.0874 0.0092  0.0160  -0.0103 442 ARG A CA    
2228 C C     . ARG A 302 ? 0.1262 0.1363 0.0842 0.0127  0.0114  -0.0212 442 ARG A C     
2229 O O     . ARG A 302 ? 0.1620 0.1728 0.1108 0.0137  0.0074  -0.0256 442 ARG A O     
2230 C CB    . ARG A 302 ? 0.1623 0.1894 0.1194 0.0101  0.0240  -0.0108 442 ARG A CB    
2231 C CG    . ARG A 302 ? 0.2311 0.2630 0.1903 0.0047  0.0297  -0.0004 442 ARG A CG    
2232 C CD    . ARG A 302 ? 0.2355 0.2834 0.1986 0.0055  0.0381  -0.0035 442 ARG A CD    
2233 N NE    . ARG A 302 ? 0.1888 0.2467 0.1359 0.0077  0.0428  -0.0052 442 ARG A NE    
2234 C CZ    . ARG A 302 ? 0.1983 0.2724 0.1435 0.0058  0.0528  -0.0030 442 ARG A CZ    
2235 N NH1   . ARG A 302 ? 0.2132 0.2958 0.1748 0.0014  0.0581  0.0000  442 ARG A NH1   
2236 N NH2   . ARG A 302 ? 0.1993 0.2829 0.1264 0.0079  0.0576  -0.0042 442 ARG A NH2   
2237 N N     . GLU A 303 ? 0.1385 0.1430 0.1063 0.0145  0.0112  -0.0256 443 GLU A N     
2238 C CA    . GLU A 303 ? 0.1696 0.1653 0.1384 0.0173  0.0069  -0.0353 443 GLU A CA    
2239 C C     . GLU A 303 ? 0.1868 0.1736 0.1570 0.0128  0.0007  -0.0352 443 GLU A C     
2240 O O     . GLU A 303 ? 0.1769 0.1608 0.1433 0.0128  -0.0036 -0.0434 443 GLU A O     
2241 C CB    . GLU A 303 ? 0.1662 0.1555 0.1450 0.0207  0.0075  -0.0371 443 GLU A CB    
2242 C CG    . GLU A 303 ? 0.1548 0.1564 0.1351 0.0267  0.0130  -0.0407 443 GLU A CG    
2243 C CD    . GLU A 303 ? 0.2011 0.2032 0.1756 0.0332  0.0135  -0.0533 443 GLU A CD    
2244 O OE1   . GLU A 303 ? 0.2011 0.1896 0.1800 0.0376  0.0096  -0.0605 443 GLU A OE1   
2245 O OE2   . GLU A 303 ? 0.2081 0.2232 0.1728 0.0342  0.0179  -0.0562 443 GLU A OE2   
2246 N N     . LEU A 304 ? 0.1494 0.1335 0.1260 0.0087  0.0003  -0.0270 444 LEU A N     
2247 C CA    . LEU A 304 ? 0.1657 0.1455 0.1468 0.0043  -0.0041 -0.0264 444 LEU A CA    
2248 C C     . LEU A 304 ? 0.1769 0.1652 0.1516 0.0041  -0.0081 -0.0278 444 LEU A C     
2249 O O     . LEU A 304 ? 0.1752 0.1632 0.1524 0.0017  -0.0135 -0.0333 444 LEU A O     
2250 C CB    . LEU A 304 ? 0.1601 0.1384 0.1479 0.0015  -0.0021 -0.0181 444 LEU A CB    
2251 C CG    . LEU A 304 ? 0.1583 0.1353 0.1535 -0.0030 -0.0045 -0.0171 444 LEU A CG    
2252 C CD1   . LEU A 304 ? 0.1771 0.1442 0.1770 -0.0062 -0.0054 -0.0208 444 LEU A CD1   
2253 C CD2   . LEU A 304 ? 0.1861 0.1640 0.1852 -0.0039 -0.0014 -0.0103 444 LEU A CD2   
2254 N N     . ARG A 305 ? 0.1396 0.1355 0.1061 0.0063  -0.0060 -0.0221 445 ARG A N     
2255 C CA    . ARG A 305 ? 0.1562 0.1598 0.1139 0.0074  -0.0107 -0.0213 445 ARG A CA    
2256 C C     . ARG A 305 ? 0.1858 0.1937 0.1322 0.0096  -0.0136 -0.0316 445 ARG A C     
2257 O O     . ARG A 305 ? 0.1803 0.1933 0.1224 0.0095  -0.0209 -0.0359 445 ARG A O     
2258 C CB    . ARG A 305 ? 0.1467 0.1540 0.0971 0.0088  -0.0072 -0.0104 445 ARG A CB    
2259 C CG    . ARG A 305 ? 0.1294 0.1309 0.0915 0.0068  -0.0060 -0.0027 445 ARG A CG    
2260 C CD    . ARG A 305 ? 0.1503 0.1503 0.1077 0.0067  -0.0013 0.0073  445 ARG A CD    
2261 N NE    . ARG A 305 ? 0.1579 0.1509 0.1264 0.0054  -0.0008 0.0117  445 ARG A NE    
2262 C CZ    . ARG A 305 ? 0.1971 0.1847 0.1657 0.0043  0.0023  0.0195  445 ARG A CZ    
2263 N NH1   . ARG A 305 ? 0.2173 0.2059 0.1760 0.0032  0.0058  0.0259  445 ARG A NH1   
2264 N NH2   . ARG A 305 ? 0.1758 0.1564 0.1543 0.0037  0.0023  0.0207  445 ARG A NH2   
2265 N N     . ARG A 306 ? 0.1834 0.1903 0.1257 0.0122  -0.0083 -0.0369 446 ARG A N     
2266 C CA    . ARG A 306 ? 0.1927 0.2026 0.1244 0.0153  -0.0101 -0.0494 446 ARG A CA    
2267 C C     . ARG A 306 ? 0.1848 0.1853 0.1249 0.0125  -0.0172 -0.0601 446 ARG A C     
2268 O O     . ARG A 306 ? 0.1910 0.1946 0.1240 0.0122  -0.0238 -0.0698 446 ARG A O     
2269 C CB    . ARG A 306 ? 0.1743 0.1856 0.1039 0.0199  -0.0021 -0.0537 446 ARG A CB    
2270 C CG    . ARG A 306 ? 0.2255 0.2412 0.1422 0.0246  -0.0025 -0.0678 446 ARG A CG    
2271 C CD    . ARG A 306 ? 0.2687 0.2916 0.1837 0.0303  0.0071  -0.0712 446 ARG A CD    
2272 N NE    . ARG A 306 ? 0.2350 0.2483 0.1671 0.0328  0.0089  -0.0733 446 ARG A NE    
2273 C CZ    . ARG A 306 ? 0.2844 0.2885 0.2208 0.0380  0.0077  -0.0857 446 ARG A CZ    
2274 N NH1   . ARG A 306 ? 0.2787 0.2801 0.2070 0.0383  0.0045  -0.0950 446 ARG A NH1   
2275 N NH2   . ARG A 306 ? 0.2647 0.2602 0.2155 0.0414  0.0088  -0.0852 446 ARG A NH2   
2276 N N     . PHE A 307 ? 0.1773 0.1661 0.1321 0.0098  -0.0159 -0.0581 447 PHE A N     
2277 C CA    . PHE A 307 ? 0.1693 0.1464 0.1337 0.0052  -0.0212 -0.0659 447 PHE A CA    
2278 C C     . PHE A 307 ? 0.1755 0.1597 0.1447 -0.0006 -0.0284 -0.0658 447 PHE A C     
2279 O O     . PHE A 307 ? 0.1861 0.1695 0.1565 -0.0039 -0.0353 -0.0767 447 PHE A O     
2280 C CB    . PHE A 307 ? 0.1660 0.1299 0.1429 0.0029  -0.0178 -0.0598 447 PHE A CB    
2281 C CG    . PHE A 307 ? 0.2150 0.1653 0.2023 -0.0038 -0.0219 -0.0644 447 PHE A CG    
2282 C CD1   . PHE A 307 ? 0.2136 0.1482 0.2014 -0.0025 -0.0235 -0.0742 447 PHE A CD1   
2283 C CD2   . PHE A 307 ? 0.1887 0.1422 0.1863 -0.0117 -0.0236 -0.0591 447 PHE A CD2   
2284 C CE1   . PHE A 307 ? 0.2474 0.1676 0.2446 -0.0105 -0.0263 -0.0762 447 PHE A CE1   
2285 C CE2   . PHE A 307 ? 0.2078 0.1499 0.2163 -0.0200 -0.0262 -0.0627 447 PHE A CE2   
2286 C CZ    . PHE A 307 ? 0.2512 0.1752 0.2591 -0.0200 -0.0277 -0.0708 447 PHE A CZ    
2287 N N     . SER A 308 ? 0.1857 0.1773 0.1595 -0.0017 -0.0273 -0.0544 448 SER A N     
2288 C CA    . SER A 308 ? 0.1737 0.1754 0.1546 -0.0052 -0.0338 -0.0534 448 SER A CA    
2289 C C     . SER A 308 ? 0.1760 0.1888 0.1452 -0.0029 -0.0421 -0.0613 448 SER A C     
2290 O O     . SER A 308 ? 0.1870 0.2044 0.1629 -0.0074 -0.0502 -0.0702 448 SER A O     
2291 C CB    . SER A 308 ? 0.1785 0.1862 0.1625 -0.0030 -0.0307 -0.0404 448 SER A CB    
2292 O OG    . SER A 308 ? 0.2513 0.2697 0.2459 -0.0048 -0.0367 -0.0394 448 SER A OG    
2293 N N     . ARG A 309 ? 0.1889 0.2069 0.1399 0.0034  -0.0400 -0.0584 449 ARG A N     
2294 C CA    . ARG A 309 ? 0.2147 0.2447 0.1497 0.0065  -0.0476 -0.0636 449 ARG A CA    
2295 C C     . ARG A 309 ? 0.2089 0.2358 0.1373 0.0056  -0.0515 -0.0810 449 ARG A C     
2296 O O     . ARG A 309 ? 0.2284 0.2611 0.1574 0.0029  -0.0600 -0.0883 449 ARG A O     
2297 C CB    . ARG A 309 ? 0.2187 0.2541 0.1338 0.0127  -0.0425 -0.0538 449 ARG A CB    
2298 C CG    . ARG A 309 ? 0.2518 0.2994 0.1448 0.0166  -0.0494 -0.0576 449 ARG A CG    
2299 C CD    . ARG A 309 ? 0.3024 0.3541 0.1758 0.0212  -0.0426 -0.0440 449 ARG A CD    
2300 N NE    . ARG A 309 ? 0.2889 0.3404 0.1674 0.0222  -0.0442 -0.0275 449 ARG A NE    
2301 C CZ    . ARG A 309 ? 0.3853 0.4449 0.2546 0.0259  -0.0538 -0.0212 449 ARG A CZ    
2302 N NH1   . ARG A 309 ? 0.4210 0.4885 0.2790 0.0265  -0.0613 -0.0288 449 ARG A NH1   
2303 N NH2   . ARG A 309 ? 0.4463 0.5027 0.3220 0.0281  -0.0547 -0.0066 449 ARG A NH2   
2304 N N     . LYS A 310 ? 0.2255 0.2419 0.1505 0.0078  -0.0438 -0.0859 450 LYS A N     
2305 C CA    . LYS A 310 ? 0.2588 0.2699 0.1776 0.0083  -0.0440 -0.0981 450 LYS A CA    
2306 C C     . LYS A 310 ? 0.2721 0.2691 0.2080 0.0013  -0.0478 -0.1061 450 LYS A C     
2307 O O     . LYS A 310 ? 0.3058 0.3011 0.2391 -0.0011 -0.0526 -0.1158 450 LYS A O     
2308 C CB    . LYS A 310 ? 0.2895 0.2965 0.2000 0.0147  -0.0337 -0.0992 450 LYS A CB    
2309 C CG    . LYS A 310 ? 0.3616 0.3826 0.2559 0.0198  -0.0273 -0.0894 450 LYS A CG    
2310 C CD    . LYS A 310 ? 0.4073 0.4406 0.2828 0.0207  -0.0317 -0.0887 450 LYS A CD    
2311 C CE    . LYS A 310 ? 0.4009 0.4450 0.2600 0.0243  -0.0237 -0.0763 450 LYS A CE    
2312 N NZ    . LYS A 310 ? 0.3978 0.4514 0.2365 0.0253  -0.0275 -0.0744 450 LYS A NZ    
2313 N N     . GLU A 311 ? 0.2393 0.2257 0.1918 -0.0027 -0.0455 -0.1015 451 GLU A N     
2314 C CA    . GLU A 311 ? 0.2569 0.2283 0.2245 -0.0105 -0.0473 -0.1058 451 GLU A CA    
2315 C C     . GLU A 311 ? 0.2584 0.2379 0.2406 -0.0196 -0.0539 -0.1038 451 GLU A C     
2316 O O     . GLU A 311 ? 0.2643 0.2381 0.2545 -0.0269 -0.0576 -0.1096 451 GLU A O     
2317 C CB    . GLU A 311 ? 0.2795 0.2331 0.2562 -0.0104 -0.0404 -0.1002 451 GLU A CB    
2318 C CG    . GLU A 311 ? 0.2704 0.2177 0.2373 -0.0007 -0.0339 -0.1022 451 GLU A CG    
2319 C CD    . GLU A 311 ? 0.3251 0.2672 0.2840 0.0021  -0.0350 -0.1141 451 GLU A CD    
2320 O OE1   . GLU A 311 ? 0.3325 0.2805 0.2801 0.0105  -0.0305 -0.1174 451 GLU A OE1   
2321 O OE2   . GLU A 311 ? 0.3227 0.2552 0.2867 -0.0045 -0.0398 -0.1203 451 GLU A OE2   
2322 N N     . LYS A 312 ? 0.2526 0.2459 0.2397 -0.0193 -0.0550 -0.0956 452 LYS A N     
2323 C CA    . LYS A 312 ? 0.2283 0.2317 0.2340 -0.0273 -0.0597 -0.0930 452 LYS A CA    
2324 C C     . LYS A 312 ? 0.2386 0.2645 0.2408 -0.0245 -0.0684 -0.0931 452 LYS A C     
2325 O O     . LYS A 312 ? 0.2551 0.2931 0.2734 -0.0299 -0.0733 -0.0925 452 LYS A O     
2326 C CB    . LYS A 312 ? 0.2325 0.2339 0.2516 -0.0296 -0.0532 -0.0822 452 LYS A CB    
2327 C CG    . LYS A 312 ? 0.2276 0.2062 0.2502 -0.0326 -0.0454 -0.0800 452 LYS A CG    
2328 C CD    . LYS A 312 ? 0.2703 0.2379 0.3016 -0.0421 -0.0464 -0.0842 452 LYS A CD    
2329 C CE    . LYS A 312 ? 0.2819 0.2252 0.3131 -0.0437 -0.0393 -0.0792 452 LYS A CE    
2330 N NZ    . LYS A 312 ? 0.3187 0.2506 0.3574 -0.0539 -0.0405 -0.0816 452 LYS A NZ    
2331 N N     . GLY A 313 ? 0.2082 0.2401 0.1890 -0.0157 -0.0699 -0.0928 453 GLY A N     
2332 C CA    . GLY A 313 ? 0.2231 0.2737 0.1957 -0.0113 -0.0782 -0.0901 453 GLY A CA    
2333 C C     . GLY A 313 ? 0.2119 0.2754 0.1948 -0.0082 -0.0803 -0.0790 453 GLY A C     
2334 O O     . GLY A 313 ? 0.2383 0.3174 0.2254 -0.0064 -0.0884 -0.0765 453 GLY A O     
2335 N N     . LEU A 314 ? 0.1798 0.2334 0.1680 -0.0075 -0.0700 -0.0690 454 LEU A N     
2336 C CA    . LEU A 314 ? 0.1848 0.2445 0.1829 -0.0041 -0.0676 -0.0560 454 LEU A CA    
2337 C C     . LEU A 314 ? 0.1950 0.2470 0.1760 0.0031  -0.0602 -0.0442 454 LEU A C     
2338 O O     . LEU A 314 ? 0.1924 0.2326 0.1629 0.0031  -0.0526 -0.0447 454 LEU A O     
2339 C CB    . LEU A 314 ? 0.1716 0.2262 0.1921 -0.0110 -0.0606 -0.0539 454 LEU A CB    
2340 C CG    . LEU A 314 ? 0.1910 0.2521 0.2312 -0.0211 -0.0657 -0.0645 454 LEU A CG    
2341 C CD1   . LEU A 314 ? 0.1815 0.2357 0.2394 -0.0284 -0.0562 -0.0604 454 LEU A CD1   
2342 C CD2   . LEU A 314 ? 0.1827 0.2680 0.2340 -0.0193 -0.0772 -0.0671 454 LEU A CD2   
2343 N N     . TRP A 315 ? 0.1914 0.2498 0.1716 0.0093  -0.0623 -0.0335 455 TRP A N     
2344 C CA    . TRP A 315 ? 0.1701 0.2203 0.1347 0.0147  -0.0559 -0.0216 455 TRP A CA    
2345 C C     . TRP A 315 ? 0.1718 0.2137 0.1499 0.0144  -0.0480 -0.0133 455 TRP A C     
2346 O O     . TRP A 315 ? 0.1612 0.2089 0.1537 0.0168  -0.0511 -0.0102 455 TRP A O     
2347 C CB    . TRP A 315 ? 0.1995 0.2581 0.1492 0.0223  -0.0641 -0.0140 455 TRP A CB    
2348 C CG    . TRP A 315 ? 0.2432 0.3123 0.1769 0.0231  -0.0733 -0.0229 455 TRP A CG    
2349 C CD1   . TRP A 315 ? 0.2525 0.3208 0.1805 0.0184  -0.0727 -0.0366 455 TRP A CD1   
2350 C CD2   . TRP A 315 ? 0.2484 0.3300 0.1690 0.0296  -0.0852 -0.0194 455 TRP A CD2   
2351 N NE1   . TRP A 315 ? 0.2674 0.3464 0.1798 0.0206  -0.0823 -0.0429 455 TRP A NE1   
2352 C CE2   . TRP A 315 ? 0.2778 0.3639 0.1860 0.0264  -0.0888 -0.0311 455 TRP A CE2   
2353 C CE3   . TRP A 315 ? 0.2737 0.3589 0.1933 0.0372  -0.0913 -0.0064 455 TRP A CE3   
2354 C CZ2   . TRP A 315 ? 0.3255 0.4196 0.2210 0.0290  -0.0972 -0.0295 455 TRP A CZ2   
2355 C CZ3   . TRP A 315 ? 0.3189 0.4112 0.2265 0.0397  -0.0999 -0.0042 455 TRP A CZ3   
2356 C CH2   . TRP A 315 ? 0.3438 0.4414 0.2387 0.0355  -0.1030 -0.0157 455 TRP A CH2   
2357 N N     . LEU A 316 ? 0.1601 0.1900 0.1335 0.0122  -0.0382 -0.0110 456 LEU A N     
2358 C CA    . LEU A 316 ? 0.1262 0.1474 0.1097 0.0111  -0.0306 -0.0054 456 LEU A CA    
2359 C C     . LEU A 316 ? 0.1523 0.1659 0.1256 0.0142  -0.0259 0.0052  456 LEU A C     
2360 O O     . LEU A 316 ? 0.1906 0.2023 0.1494 0.0140  -0.0227 0.0071  456 LEU A O     
2361 C CB    . LEU A 316 ? 0.1288 0.1425 0.1168 0.0056  -0.0243 -0.0109 456 LEU A CB    
2362 C CG    . LEU A 316 ? 0.1396 0.1453 0.1357 0.0039  -0.0170 -0.0067 456 LEU A CG    
2363 C CD1   . LEU A 316 ? 0.1430 0.1535 0.1545 0.0034  -0.0179 -0.0064 456 LEU A CD1   
2364 C CD2   . LEU A 316 ? 0.1273 0.1255 0.1236 0.0000  -0.0125 -0.0110 456 LEU A CD2   
2365 N N     . ASN A 317 ? 0.1648 0.1740 0.1466 0.0165  -0.0248 0.0115  457 ASN A N     
2366 C CA    . ASN A 317 ? 0.1652 0.1633 0.1409 0.0169  -0.0192 0.0203  457 ASN A CA    
2367 C C     . ASN A 317 ? 0.1696 0.1605 0.1591 0.0164  -0.0153 0.0205  457 ASN A C     
2368 O O     . ASN A 317 ? 0.1448 0.1402 0.1465 0.0152  -0.0150 0.0140  457 ASN A O     
2369 C CB    . ASN A 317 ? 0.1724 0.1685 0.1359 0.0221  -0.0235 0.0306  457 ASN A CB    
2370 C CG    . ASN A 317 ? 0.1838 0.1834 0.1564 0.0293  -0.0318 0.0329  457 ASN A CG    
2371 O OD1   . ASN A 317 ? 0.1980 0.1990 0.1877 0.0302  -0.0315 0.0282  457 ASN A OD1   
2372 N ND2   . ASN A 317 ? 0.2080 0.2099 0.1686 0.0351  -0.0391 0.0403  457 ASN A ND2   
2373 N N     . SER A 318 ? 0.1901 0.1695 0.1771 0.0166  -0.0117 0.0274  458 SER A N     
2374 C CA    . SER A 318 ? 0.2009 0.1727 0.1989 0.0161  -0.0080 0.0254  458 SER A CA    
2375 C C     . SER A 318 ? 0.1836 0.1581 0.1937 0.0224  -0.0118 0.0235  458 SER A C     
2376 O O     . SER A 318 ? 0.1744 0.1456 0.1939 0.0227  -0.0083 0.0192  458 SER A O     
2377 C CB    . SER A 318 ? 0.2860 0.2435 0.2796 0.0140  -0.0043 0.0323  458 SER A CB    
2378 O OG    . SER A 318 ? 0.3732 0.3322 0.3619 0.0073  0.0008  0.0312  458 SER A OG    
2379 N N     . HIS A 319 ? 0.1697 0.1521 0.1799 0.0282  -0.0190 0.0260  459 HIS A N     
2380 C CA    . HIS A 319 ? 0.1834 0.1702 0.2068 0.0363  -0.0235 0.0251  459 HIS A CA    
2381 C C     . HIS A 319 ? 0.1697 0.1766 0.2055 0.0362  -0.0271 0.0172  459 HIS A C     
2382 O O     . HIS A 319 ? 0.1942 0.2099 0.2460 0.0416  -0.0286 0.0137  459 HIS A O     
2383 C CB    . HIS A 319 ? 0.2323 0.2125 0.2488 0.0446  -0.0308 0.0355  459 HIS A CB    
2384 C CG    . HIS A 319 ? 0.2761 0.2353 0.2808 0.0426  -0.0268 0.0447  459 HIS A CG    
2385 N ND1   . HIS A 319 ? 0.3553 0.3109 0.3429 0.0365  -0.0243 0.0509  459 HIS A ND1   
2386 C CD2   . HIS A 319 ? 0.2921 0.2332 0.3012 0.0447  -0.0239 0.0476  459 HIS A CD2   
2387 C CE1   . HIS A 319 ? 0.3373 0.2747 0.3203 0.0338  -0.0199 0.0584  459 HIS A CE1   
2388 N NE2   . HIS A 319 ? 0.3360 0.2627 0.3317 0.0385  -0.0201 0.0564  459 HIS A NE2   
2389 N N     . GLY A 320 ? 0.1483 0.1629 0.1783 0.0299  -0.0282 0.0135  460 GLY A N     
2390 C CA    . GLY A 320 ? 0.1378 0.1704 0.1807 0.0282  -0.0323 0.0059  460 GLY A CA    
2391 C C     . GLY A 320 ? 0.1569 0.1941 0.1914 0.0218  -0.0350 0.0014  460 GLY A C     
2392 O O     . GLY A 320 ? 0.1298 0.1574 0.1482 0.0195  -0.0327 0.0037  460 GLY A O     
2393 N N     . LEU A 321 ? 0.1479 0.2006 0.1950 0.0189  -0.0398 -0.0058 461 LEU A N     
2394 C CA    . LEU A 321 ? 0.1550 0.2108 0.1969 0.0122  -0.0430 -0.0127 461 LEU A CA    
2395 C C     . LEU A 321 ? 0.1574 0.2321 0.2077 0.0145  -0.0547 -0.0172 461 LEU A C     
2396 O O     . LEU A 321 ? 0.1452 0.2349 0.2170 0.0141  -0.0564 -0.0206 461 LEU A O     
2397 C CB    . LEU A 321 ? 0.1442 0.1968 0.1956 0.0026  -0.0358 -0.0184 461 LEU A CB    
2398 C CG    . LEU A 321 ? 0.1560 0.2075 0.2044 -0.0049 -0.0388 -0.0265 461 LEU A CG    
2399 C CD1   . LEU A 321 ? 0.1470 0.1864 0.1736 -0.0028 -0.0385 -0.0262 461 LEU A CD1   
2400 C CD2   . LEU A 321 ? 0.1699 0.2155 0.2290 -0.0140 -0.0313 -0.0290 461 LEU A CD2   
2401 N N     . PHE A 322 ? 0.1572 0.2336 0.1909 0.0171  -0.0626 -0.0178 462 PHE A N     
2402 C CA    . PHE A 322 ? 0.1566 0.2517 0.1942 0.0216  -0.0761 -0.0207 462 PHE A CA    
2403 C C     . PHE A 322 ? 0.1616 0.2648 0.1980 0.0140  -0.0827 -0.0332 462 PHE A C     
2404 O O     . PHE A 322 ? 0.1987 0.2906 0.2171 0.0107  -0.0800 -0.0366 462 PHE A O     
2405 C CB    . PHE A 322 ? 0.1735 0.2649 0.1898 0.0319  -0.0819 -0.0102 462 PHE A CB    
2406 C CG    . PHE A 322 ? 0.2142 0.3249 0.2325 0.0392  -0.0973 -0.0108 462 PHE A CG    
2407 C CD1   . PHE A 322 ? 0.2208 0.3446 0.2613 0.0461  -0.1027 -0.0085 462 PHE A CD1   
2408 C CD2   . PHE A 322 ? 0.2247 0.3396 0.2218 0.0393  -0.1054 -0.0132 462 PHE A CD2   
2409 C CE1   . PHE A 322 ? 0.2474 0.3841 0.2892 0.0504  -0.1130 -0.0066 462 PHE A CE1   
2410 C CE2   . PHE A 322 ? 0.2599 0.3869 0.2573 0.0430  -0.1157 -0.0115 462 PHE A CE2   
2411 C CZ    . PHE A 322 ? 0.2826 0.4207 0.3026 0.0487  -0.1201 -0.0078 462 PHE A CZ    
2412 N N     . ASP A 323 ? 0.1507 0.2740 0.2082 0.0110  -0.0911 -0.0411 463 ASP A N     
2413 C CA    . ASP A 323 ? 0.2027 0.3326 0.2598 0.0032  -0.0982 -0.0530 463 ASP A CA    
2414 C C     . ASP A 323 ? 0.2195 0.3583 0.2616 0.0104  -0.1091 -0.0504 463 ASP A C     
2415 O O     . ASP A 323 ? 0.2411 0.3952 0.2967 0.0147  -0.1155 -0.0471 463 ASP A O     
2416 C CB    . ASP A 323 ? 0.2139 0.3552 0.3003 -0.0070 -0.0965 -0.0594 463 ASP A CB    
2417 C CG    . ASP A 323 ? 0.3063 0.4490 0.3922 -0.0165 -0.1019 -0.0701 463 ASP A CG    
2418 O OD1   . ASP A 323 ? 0.3381 0.4781 0.4031 -0.0136 -0.1089 -0.0734 463 ASP A OD1   
2419 O OD2   . ASP A 323 ? 0.3258 0.4721 0.4323 -0.0272 -0.0985 -0.0749 463 ASP A OD2   
2420 N N     . PRO A 324 ? 0.2320 0.3615 0.2461 0.0119  -0.1108 -0.0516 464 PRO A N     
2421 C CA    . PRO A 324 ? 0.2732 0.4096 0.2690 0.0187  -0.1202 -0.0473 464 PRO A CA    
2422 C C     . PRO A 324 ? 0.3238 0.4753 0.3293 0.0138  -0.1305 -0.0568 464 PRO A C     
2423 O O     . PRO A 324 ? 0.3700 0.5311 0.3664 0.0199  -0.1402 -0.0525 464 PRO A O     
2424 C CB    . PRO A 324 ? 0.2819 0.4043 0.2462 0.0195  -0.1158 -0.0477 464 PRO A CB    
2425 C CG    . PRO A 324 ? 0.2718 0.3834 0.2423 0.0109  -0.1076 -0.0583 464 PRO A CG    
2426 C CD    . PRO A 324 ? 0.2304 0.3428 0.2276 0.0083  -0.1029 -0.0559 464 PRO A CD    
2427 N N     . GLU A 325 ? 0.3376 0.4900 0.3604 0.0027  -0.1288 -0.0688 465 GLU A N     
2428 C CA    . GLU A 325 ? 0.3737 0.5402 0.4071 -0.0033 -0.1386 -0.0783 465 GLU A CA    
2429 C C     . GLU A 325 ? 0.3740 0.5611 0.4354 -0.0014 -0.1433 -0.0741 465 GLU A C     
2430 O O     . GLU A 325 ? 0.3958 0.5994 0.4594 0.0024  -0.1549 -0.0739 465 GLU A O     
2431 C CB    . GLU A 325 ? 0.3848 0.5421 0.4268 -0.0167 -0.1345 -0.0915 465 GLU A CB    
2432 N N     . GLN A 326 ? 0.3378 0.5245 0.4206 -0.0036 -0.1340 -0.0708 466 GLN A N     
2433 C CA    . GLN A 326 ? 0.3248 0.5310 0.4363 -0.0016 -0.1351 -0.0674 466 GLN A CA    
2434 C C     . GLN A 326 ? 0.2996 0.5085 0.4064 0.0138  -0.1371 -0.0544 466 GLN A C     
2435 O O     . GLN A 326 ? 0.2823 0.5085 0.4086 0.0194  -0.1411 -0.0510 466 GLN A O     
2436 C CB    . GLN A 326 ? 0.3505 0.5540 0.4847 -0.0112 -0.1224 -0.0696 466 GLN A CB    
2437 C CG    . GLN A 326 ? 0.4003 0.6250 0.5659 -0.0114 -0.1204 -0.0679 466 GLN A CG    
2438 C CD    . GLN A 326 ? 0.4286 0.6496 0.6125 -0.0235 -0.1068 -0.0701 466 GLN A CD    
2439 O OE1   . GLN A 326 ? 0.4056 0.6192 0.5918 -0.0206 -0.0960 -0.0644 466 GLN A OE1   
2440 N NE2   . GLN A 326 ? 0.4571 0.6820 0.6530 -0.0376 -0.1072 -0.0777 466 GLN A NE2   
2441 N N     . LYS A 327 ? 0.2577 0.4485 0.3385 0.0205  -0.1341 -0.0470 467 LYS A N     
2442 C CA    . LYS A 327 ? 0.2655 0.4516 0.3388 0.0342  -0.1342 -0.0331 467 LYS A CA    
2443 C C     . LYS A 327 ? 0.2454 0.4354 0.3448 0.0370  -0.1261 -0.0300 467 LYS A C     
2444 O O     . LYS A 327 ? 0.2363 0.4350 0.3474 0.0467  -0.1295 -0.0235 467 LYS A O     
2445 C CB    . LYS A 327 ? 0.3222 0.5194 0.3888 0.0430  -0.1475 -0.0272 467 LYS A CB    
2446 C CG    . LYS A 327 ? 0.3581 0.5479 0.3919 0.0426  -0.1538 -0.0272 467 LYS A CG    
2447 N N     . THR A 328 ? 0.2331 0.4160 0.3410 0.0285  -0.1150 -0.0351 468 THR A N     
2448 C CA    . THR A 328 ? 0.2173 0.4027 0.3473 0.0299  -0.1051 -0.0333 468 THR A CA    
2449 C C     . THR A 328 ? 0.2000 0.3656 0.3200 0.0288  -0.0948 -0.0307 468 THR A C     
2450 O O     . THR A 328 ? 0.1970 0.3507 0.3014 0.0218  -0.0933 -0.0344 468 THR A O     
2451 C CB    . THR A 328 ? 0.2154 0.4168 0.3727 0.0180  -0.1003 -0.0423 468 THR A CB    
2452 O OG1   . THR A 328 ? 0.2383 0.4309 0.3888 0.0043  -0.0980 -0.0501 468 THR A OG1   
2453 C CG2   . THR A 328 ? 0.2371 0.4619 0.4106 0.0200  -0.1100 -0.0446 468 THR A CG2   
2454 N N     . PHE A 329 ? 0.1881 0.3498 0.3174 0.0359  -0.0876 -0.0253 469 PHE A N     
2455 C CA    . PHE A 329 ? 0.1769 0.3163 0.2963 0.0319  -0.0741 -0.0221 469 PHE A CA    
2456 C C     . PHE A 329 ? 0.1725 0.3184 0.3118 0.0209  -0.0632 -0.0287 469 PHE A C     
2457 O O     . PHE A 329 ? 0.1858 0.3542 0.3516 0.0214  -0.0632 -0.0332 469 PHE A O     
2458 C CB    . PHE A 329 ? 0.1979 0.3235 0.3120 0.0437  -0.0701 -0.0124 469 PHE A CB    
2459 C CG    . PHE A 329 ? 0.2327 0.3442 0.3222 0.0521  -0.0773 -0.0025 469 PHE A CG    
2460 C CD1   . PHE A 329 ? 0.2351 0.3241 0.2998 0.0478  -0.0710 0.0027  469 PHE A CD1   
2461 C CD2   . PHE A 329 ? 0.2688 0.3908 0.3602 0.0642  -0.0903 0.0021  469 PHE A CD2   
2462 C CE1   . PHE A 329 ? 0.2755 0.3526 0.3171 0.0540  -0.0758 0.0129  469 PHE A CE1   
2463 C CE2   . PHE A 329 ? 0.2967 0.4035 0.3623 0.0703  -0.0952 0.0136  469 PHE A CE2   
2464 C CZ    . PHE A 329 ? 0.2854 0.3706 0.3263 0.0655  -0.0881 0.0189  469 PHE A CZ    
2465 N N     . PHE A 330 ? 0.1477 0.2750 0.2745 0.0114  -0.0535 -0.0287 470 PHE A N     
2466 C CA    . PHE A 330 ? 0.1520 0.2805 0.2919 0.0011  -0.0419 -0.0318 470 PHE A CA    
2467 C C     . PHE A 330 ? 0.1765 0.3018 0.3205 0.0075  -0.0322 -0.0276 470 PHE A C     
2468 O O     . PHE A 330 ? 0.2221 0.3296 0.3496 0.0147  -0.0304 -0.0216 470 PHE A O     
2469 C CB    . PHE A 330 ? 0.1703 0.2773 0.2933 -0.0089 -0.0359 -0.0318 470 PHE A CB    
2470 C CG    . PHE A 330 ? 0.2665 0.3746 0.3876 -0.0169 -0.0434 -0.0387 470 PHE A CG    
2471 C CD1   . PHE A 330 ? 0.3006 0.4056 0.4051 -0.0116 -0.0535 -0.0399 470 PHE A CD1   
2472 C CD2   . PHE A 330 ? 0.3067 0.4172 0.4412 -0.0302 -0.0400 -0.0442 470 PHE A CD2   
2473 C CE1   . PHE A 330 ? 0.3336 0.4390 0.4350 -0.0185 -0.0605 -0.0486 470 PHE A CE1   
2474 C CE2   . PHE A 330 ? 0.3157 0.4240 0.4490 -0.0380 -0.0473 -0.0522 470 PHE A CE2   
2475 C CZ    . PHE A 330 ? 0.3394 0.4456 0.4561 -0.0317 -0.0579 -0.0556 470 PHE A CZ    
2476 N N     . GLN A 331 ? 0.1288 0.2717 0.2950 0.0045  -0.0255 -0.0314 471 GLN A N     
2477 C CA    . GLN A 331 ? 0.1202 0.2586 0.2875 0.0086  -0.0140 -0.0296 471 GLN A CA    
2478 C C     . GLN A 331 ? 0.1837 0.3036 0.3354 -0.0020 -0.0035 -0.0273 471 GLN A C     
2479 O O     . GLN A 331 ? 0.2319 0.3494 0.3825 -0.0137 -0.0028 -0.0283 471 GLN A O     
2480 C CB    . GLN A 331 ? 0.1590 0.3260 0.3552 0.0100  -0.0094 -0.0351 471 GLN A CB    
2481 C CG    . GLN A 331 ? 0.2107 0.3941 0.4197 0.0217  -0.0209 -0.0360 471 GLN A CG    
2482 N N     . ALA A 332 ? 0.1525 0.2572 0.2912 0.0025  0.0034  -0.0242 472 ALA A N     
2483 C CA    . ALA A 332 ? 0.1320 0.2208 0.2556 -0.0057 0.0121  -0.0216 472 ALA A CA    
2484 C C     . ALA A 332 ? 0.1385 0.2276 0.2614 -0.0013 0.0217  -0.0226 472 ALA A C     
2485 O O     . ALA A 332 ? 0.1413 0.2276 0.2644 0.0095  0.0198  -0.0236 472 ALA A O     
2486 C CB    . ALA A 332 ? 0.1290 0.1949 0.2305 -0.0053 0.0077  -0.0174 472 ALA A CB    
2487 N N     . ALA A 333 ? 0.1278 0.2191 0.2490 -0.0096 0.0319  -0.0224 473 ALA A N     
2488 C CA    . ALA A 333 ? 0.1281 0.2202 0.2448 -0.0062 0.0418  -0.0245 473 ALA A CA    
2489 C C     . ALA A 333 ? 0.1356 0.2062 0.2278 -0.0097 0.0445  -0.0204 473 ALA A C     
2490 O O     . ALA A 333 ? 0.1445 0.2126 0.2278 -0.0070 0.0512  -0.0225 473 ALA A O     
2491 C CB    . ALA A 333 ? 0.1368 0.2520 0.2691 -0.0123 0.0528  -0.0273 473 ALA A CB    
2492 N N     . SER A 334 ? 0.1273 0.1834 0.2089 -0.0148 0.0387  -0.0155 474 SER A N     
2493 C CA    . SER A 334 ? 0.1404 0.1784 0.2013 -0.0178 0.0399  -0.0112 474 SER A CA    
2494 C C     . SER A 334 ? 0.1320 0.1565 0.1860 -0.0189 0.0315  -0.0080 474 SER A C     
2495 O O     . SER A 334 ? 0.1168 0.1461 0.1802 -0.0204 0.0262  -0.0090 474 SER A O     
2496 C CB    . SER A 334 ? 0.1451 0.1850 0.2011 -0.0270 0.0485  -0.0075 474 SER A CB    
2497 O OG    . SER A 334 ? 0.1421 0.1847 0.2079 -0.0357 0.0473  -0.0050 474 SER A OG    
2498 N N     . GLU A 335 ? 0.1104 0.1200 0.1483 -0.0183 0.0303  -0.0052 475 GLU A N     
2499 C CA    . GLU A 335 ? 0.1181 0.1168 0.1499 -0.0196 0.0242  -0.0028 475 GLU A CA    
2500 C C     . GLU A 335 ? 0.1171 0.1136 0.1519 -0.0274 0.0250  -0.0008 475 GLU A C     
2501 O O     . GLU A 335 ? 0.1259 0.1186 0.1631 -0.0285 0.0194  -0.0022 475 GLU A O     
2502 C CB    . GLU A 335 ? 0.1219 0.1086 0.1392 -0.0174 0.0233  -0.0005 475 GLU A CB    
2503 C CG    . GLU A 335 ? 0.1509 0.1368 0.1663 -0.0115 0.0214  -0.0027 475 GLU A CG    
2504 C CD    . GLU A 335 ? 0.1633 0.1408 0.1675 -0.0109 0.0200  -0.0015 475 GLU A CD    
2505 O OE1   . GLU A 335 ? 0.1843 0.1595 0.1804 -0.0130 0.0222  0.0002  475 GLU A OE1   
2506 O OE2   . GLU A 335 ? 0.1538 0.1282 0.1574 -0.0085 0.0165  -0.0016 475 GLU A OE2   
2507 N N     . GLU A 336 ? 0.1203 0.1185 0.1543 -0.0333 0.0320  0.0023  476 GLU A N     
2508 C CA    . GLU A 336 ? 0.1524 0.1461 0.1904 -0.0426 0.0333  0.0053  476 GLU A CA    
2509 C C     . GLU A 336 ? 0.1684 0.1735 0.2248 -0.0462 0.0298  0.0000  476 GLU A C     
2510 O O     . GLU A 336 ? 0.1494 0.1464 0.2088 -0.0515 0.0256  -0.0008 476 GLU A O     
2511 C CB    . GLU A 336 ? 0.1632 0.1595 0.1979 -0.0496 0.0431  0.0108  476 GLU A CB    
2512 C CG    . GLU A 336 ? 0.1783 0.1613 0.1917 -0.0475 0.0450  0.0174  476 GLU A CG    
2513 C CD    . GLU A 336 ? 0.2137 0.1968 0.2206 -0.0560 0.0545  0.0251  476 GLU A CD    
2514 O OE1   . GLU A 336 ? 0.2152 0.2040 0.2100 -0.0537 0.0604  0.0265  476 GLU A OE1   
2515 O OE2   . GLU A 336 ? 0.2015 0.1798 0.2147 -0.0633 0.0540  0.0296  476 GLU A OE2   
2516 N N     . ASP A 337 ? 0.1119 0.1360 0.1812 -0.0428 0.0307  -0.0043 477 ASP A N     
2517 C CA    . ASP A 337 ? 0.1225 0.1607 0.2098 -0.0444 0.0250  -0.0099 477 ASP A CA    
2518 C C     . ASP A 337 ? 0.1031 0.1323 0.1845 -0.0405 0.0146  -0.0128 477 ASP A C     
2519 O O     . ASP A 337 ? 0.1422 0.1742 0.2320 -0.0457 0.0091  -0.0170 477 ASP A O     
2520 C CB    . ASP A 337 ? 0.1202 0.1790 0.2209 -0.0370 0.0254  -0.0139 477 ASP A CB    
2521 C CG    . ASP A 337 ? 0.1366 0.2166 0.2558 -0.0429 0.0336  -0.0155 477 ASP A CG    
2522 O OD1   . ASP A 337 ? 0.1453 0.2267 0.2704 -0.0551 0.0386  -0.0135 477 ASP A OD1   
2523 O OD2   . ASP A 337 ? 0.1585 0.2546 0.2880 -0.0349 0.0357  -0.0190 477 ASP A OD2   
2524 N N     . ILE A 338 ? 0.0922 0.1126 0.1600 -0.0317 0.0121  -0.0113 478 ILE A N     
2525 C CA    . ILE A 338 ? 0.1057 0.1211 0.1668 -0.0272 0.0038  -0.0137 478 ILE A CA    
2526 C C     . ILE A 338 ? 0.1365 0.1371 0.1904 -0.0319 0.0019  -0.0148 478 ILE A C     
2527 O O     . ILE A 338 ? 0.1340 0.1351 0.1895 -0.0330 -0.0046 -0.0202 478 ILE A O     
2528 C CB    . ILE A 338 ? 0.0955 0.1052 0.1447 -0.0184 0.0032  -0.0108 478 ILE A CB    
2529 C CG1   . ILE A 338 ? 0.0993 0.1199 0.1563 -0.0127 0.0044  -0.0104 478 ILE A CG1   
2530 C CG2   . ILE A 338 ? 0.1249 0.1310 0.1655 -0.0147 -0.0036 -0.0124 478 ILE A CG2   
2531 C CD1   . ILE A 338 ? 0.1021 0.1137 0.1486 -0.0060 0.0053  -0.0073 478 ILE A CD1   
2532 N N     . PHE A 339 ? 0.1268 0.1138 0.1723 -0.0339 0.0067  -0.0102 479 PHE A N     
2533 C CA    . PHE A 339 ? 0.1388 0.1095 0.1793 -0.0373 0.0047  -0.0110 479 PHE A CA    
2534 C C     . PHE A 339 ? 0.1388 0.1104 0.1918 -0.0471 0.0033  -0.0148 479 PHE A C     
2535 O O     . PHE A 339 ? 0.1409 0.1039 0.1938 -0.0488 -0.0023 -0.0209 479 PHE A O     
2536 C CB    . PHE A 339 ? 0.1410 0.0974 0.1712 -0.0372 0.0094  -0.0039 479 PHE A CB    
2537 C CG    . PHE A 339 ? 0.1630 0.1159 0.1818 -0.0284 0.0082  -0.0025 479 PHE A CG    
2538 C CD1   . PHE A 339 ? 0.1384 0.0999 0.1546 -0.0246 0.0109  -0.0003 479 PHE A CD1   
2539 C CD2   . PHE A 339 ? 0.1766 0.1179 0.1891 -0.0241 0.0046  -0.0041 479 PHE A CD2   
2540 C CE1   . PHE A 339 ? 0.1702 0.1293 0.1782 -0.0184 0.0097  0.0006  479 PHE A CE1   
2541 C CE2   . PHE A 339 ? 0.1666 0.1085 0.1719 -0.0168 0.0040  -0.0032 479 PHE A CE2   
2542 C CZ    . PHE A 339 ? 0.1535 0.1044 0.1569 -0.0148 0.0064  -0.0006 479 PHE A CZ    
2543 N N     . ARG A 340 ? 0.1450 0.1282 0.2101 -0.0542 0.0085  -0.0125 480 ARG A N     
2544 C CA    . ARG A 340 ? 0.1567 0.1434 0.2372 -0.0656 0.0076  -0.0163 480 ARG A CA    
2545 C C     . ARG A 340 ? 0.1610 0.1610 0.2514 -0.0647 -0.0020 -0.0266 480 ARG A C     
2546 O O     . ARG A 340 ? 0.1710 0.1645 0.2647 -0.0709 -0.0072 -0.0320 480 ARG A O     
2547 C CB    . ARG A 340 ? 0.1785 0.1803 0.2706 -0.0727 0.0160  -0.0115 480 ARG A CB    
2548 C CG    . ARG A 340 ? 0.1743 0.1613 0.2539 -0.0762 0.0235  -0.0007 480 ARG A CG    
2549 C CD    . ARG A 340 ? 0.1848 0.1883 0.2739 -0.0831 0.0319  0.0041  480 ARG A CD    
2550 N NE    . ARG A 340 ? 0.1637 0.1888 0.2589 -0.0776 0.0376  0.0018  480 ARG A NE    
2551 C CZ    . ARG A 340 ? 0.1844 0.2108 0.2689 -0.0742 0.0459  0.0068  480 ARG A CZ    
2552 N NH1   . ARG A 340 ? 0.1481 0.1565 0.2142 -0.0755 0.0489  0.0155  480 ARG A NH1   
2553 N NH2   . ARG A 340 ? 0.1576 0.2035 0.2494 -0.0683 0.0505  0.0024  480 ARG A NH2   
2554 N N     . HIS A 341 ? 0.1636 0.1808 0.2553 -0.0560 -0.0051 -0.0281 481 HIS A N     
2555 C CA    . HIS A 341 ? 0.1751 0.2062 0.2727 -0.0532 -0.0154 -0.0363 481 HIS A CA    
2556 C C     . HIS A 341 ? 0.1975 0.2131 0.2802 -0.0506 -0.0221 -0.0420 481 HIS A C     
2557 O O     . HIS A 341 ? 0.1972 0.2188 0.2838 -0.0530 -0.0308 -0.0512 481 HIS A O     
2558 C CB    . HIS A 341 ? 0.2005 0.2466 0.2965 -0.0416 -0.0180 -0.0343 481 HIS A CB    
2559 C CG    . HIS A 341 ? 0.2497 0.3142 0.3619 -0.0409 -0.0130 -0.0316 481 HIS A CG    
2560 N ND1   . HIS A 341 ? 0.2752 0.3564 0.4095 -0.0501 -0.0108 -0.0347 481 HIS A ND1   
2561 C CD2   . HIS A 341 ? 0.2338 0.3036 0.3446 -0.0315 -0.0098 -0.0273 481 HIS A CD2   
2562 C CE1   . HIS A 341 ? 0.2835 0.3813 0.4292 -0.0454 -0.0057 -0.0327 481 HIS A CE1   
2563 N NE2   . HIS A 341 ? 0.2126 0.3021 0.3437 -0.0338 -0.0053 -0.0286 481 HIS A NE2   
2564 N N     . LEU A 342 ? 0.1738 0.1718 0.2400 -0.0453 -0.0183 -0.0376 482 LEU A N     
2565 C CA    . LEU A 342 ? 0.1566 0.1420 0.2088 -0.0407 -0.0227 -0.0432 482 LEU A CA    
2566 C C     . LEU A 342 ? 0.2086 0.1735 0.2615 -0.0474 -0.0224 -0.0471 482 LEU A C     
2567 O O     . LEU A 342 ? 0.2141 0.1673 0.2571 -0.0433 -0.0258 -0.0538 482 LEU A O     
2568 C CB    . LEU A 342 ? 0.2065 0.1866 0.2435 -0.0310 -0.0189 -0.0372 482 LEU A CB    
2569 C CG    . LEU A 342 ? 0.1853 0.1802 0.2187 -0.0238 -0.0201 -0.0335 482 LEU A CG    
2570 C CD1   . LEU A 342 ? 0.1592 0.1469 0.1801 -0.0171 -0.0154 -0.0276 482 LEU A CD1   
2571 C CD2   . LEU A 342 ? 0.1983 0.2031 0.2272 -0.0211 -0.0287 -0.0406 482 LEU A CD2   
2572 N N     . GLY A 343 ? 0.1925 0.1524 0.2569 -0.0575 -0.0180 -0.0430 483 GLY A N     
2573 C CA    . GLY A 343 ? 0.2223 0.1603 0.2814 -0.0620 -0.0171 -0.0416 483 GLY A CA    
2574 C C     . GLY A 343 ? 0.2171 0.1347 0.2623 -0.0546 -0.0141 -0.0368 483 GLY A C     
2575 O O     . GLY A 343 ? 0.2358 0.1348 0.2738 -0.0534 -0.0158 -0.0396 483 GLY A O     
2576 N N     . LEU A 344 ? 0.2075 0.1288 0.2497 -0.0494 -0.0095 -0.0298 484 LEU A N     
2577 C CA    . LEU A 344 ? 0.1832 0.0894 0.2137 -0.0414 -0.0074 -0.0244 484 LEU A CA    
2578 C C     . LEU A 344 ? 0.2288 0.1282 0.2564 -0.0449 -0.0014 -0.0119 484 LEU A C     
2579 O O     . LEU A 344 ? 0.2246 0.1372 0.2575 -0.0498 0.0034  -0.0073 484 LEU A O     
2580 C CB    . LEU A 344 ? 0.1738 0.0932 0.1960 -0.0309 -0.0073 -0.0241 484 LEU A CB    
2581 C CG    . LEU A 344 ? 0.2059 0.1319 0.2236 -0.0246 -0.0119 -0.0338 484 LEU A CG    
2582 C CD1   . LEU A 344 ? 0.2008 0.1424 0.2128 -0.0181 -0.0100 -0.0300 484 LEU A CD1   
2583 C CD2   . LEU A 344 ? 0.2015 0.1109 0.2136 -0.0187 -0.0136 -0.0391 484 LEU A CD2   
2584 N N     . GLU A 345 ? 0.2208 0.1010 0.2385 -0.0416 -0.0015 -0.0066 485 GLU A N     
2585 C CA    B GLU A 345 ? 0.2336 0.1097 0.2467 -0.0428 0.0019  0.0062  485 GLU A CA    
2586 C CA    C GLU A 345 ? 0.2432 0.1190 0.2561 -0.0426 0.0018  0.0062  485 GLU A CA    
2587 C C     . GLU A 345 ? 0.2342 0.1230 0.2423 -0.0374 0.0062  0.0089  485 GLU A C     
2588 O O     . GLU A 345 ? 0.2071 0.1029 0.2124 -0.0285 0.0031  0.0039  485 GLU A O     
2589 C CB    B GLU A 345 ? 0.2927 0.1508 0.3028 -0.0364 0.0038  0.0100  485 GLU A CB    
2590 C CB    C GLU A 345 ? 0.2940 0.1518 0.3035 -0.0356 0.0036  0.0097  485 GLU A CB    
2591 C CG    B GLU A 345 ? 0.3439 0.1847 0.3527 -0.0430 0.0050  0.0071  485 GLU A CG    
2592 C CG    C GLU A 345 ? 0.3182 0.1724 0.3219 -0.0352 0.0054  0.0239  485 GLU A CG    
2593 C CD    B GLU A 345 ? 0.4433 0.2637 0.4500 -0.0362 0.0046  0.0123  485 GLU A CD    
2594 C CD    C GLU A 345 ? 0.3841 0.2178 0.3836 -0.0300 0.0048  0.0290  485 GLU A CD    
2595 O OE1   B GLU A 345 ? 0.4726 0.2877 0.4756 -0.0253 0.0002  0.0080  485 GLU A OE1   
2596 O OE1   C GLU A 345 ? 0.4424 0.2626 0.4453 -0.0300 0.0042  0.0221  485 GLU A OE1   
2597 O OE2   B GLU A 345 ? 0.4834 0.2939 0.4923 -0.0415 0.0084  0.0212  485 GLU A OE2   
2598 O OE2   C GLU A 345 ? 0.3815 0.2119 0.3711 -0.0259 0.0044  0.0396  485 GLU A OE2   
2599 N N     . TYR A 346 ? 0.1954 0.0923 0.2013 -0.0421 0.0121  0.0164  486 TYR A N     
2600 C CA    . TYR A 346 ? 0.1741 0.0854 0.1740 -0.0364 0.0142  0.0176  486 TYR A CA    
2601 C C     . TYR A 346 ? 0.1908 0.0946 0.1791 -0.0272 0.0107  0.0208  486 TYR A C     
2602 O O     . TYR A 346 ? 0.2067 0.0946 0.1875 -0.0264 0.0094  0.0278  486 TYR A O     
2603 C CB    . TYR A 346 ? 0.1986 0.1185 0.1967 -0.0428 0.0219  0.0236  486 TYR A CB    
2604 C CG    . TYR A 346 ? 0.1695 0.1024 0.1611 -0.0367 0.0235  0.0229  486 TYR A CG    
2605 C CD1   . TYR A 346 ? 0.1863 0.1342 0.1860 -0.0334 0.0229  0.0156  486 TYR A CD1   
2606 C CD2   . TYR A 346 ? 0.2173 0.1459 0.1940 -0.0340 0.0247  0.0292  486 TYR A CD2   
2607 C CE1   . TYR A 346 ? 0.2241 0.1802 0.2188 -0.0284 0.0241  0.0141  486 TYR A CE1   
2608 C CE2   . TYR A 346 ? 0.2344 0.1741 0.2057 -0.0293 0.0254  0.0264  486 TYR A CE2   
2609 C CZ    . TYR A 346 ? 0.2614 0.2134 0.2424 -0.0268 0.0253  0.0186  486 TYR A CZ    
2610 O OH    . TYR A 346 ? 0.2752 0.2346 0.2515 -0.0227 0.0257  0.0153  486 TYR A OH    
2611 N N     . LEU A 347 ? 0.1548 0.0707 0.1429 -0.0205 0.0088  0.0162  487 LEU A N     
2612 C CA    . LEU A 347 ? 0.1873 0.1026 0.1677 -0.0128 0.0057  0.0183  487 LEU A CA    
2613 C C     . LEU A 347 ? 0.1489 0.0775 0.1253 -0.0126 0.0081  0.0185  487 LEU A C     
2614 O O     . LEU A 347 ? 0.1645 0.1042 0.1469 -0.0130 0.0097  0.0135  487 LEU A O     
2615 C CB    . LEU A 347 ? 0.1918 0.1096 0.1770 -0.0057 0.0014  0.0115  487 LEU A CB    
2616 C CG    . LEU A 347 ? 0.1987 0.1019 0.1865 -0.0034 -0.0018 0.0089  487 LEU A CG    
2617 C CD1   . LEU A 347 ? 0.2436 0.1543 0.2357 0.0035  -0.0039 0.0004  487 LEU A CD1   
2618 C CD2   . LEU A 347 ? 0.2247 0.1124 0.2062 0.0008  -0.0048 0.0162  487 LEU A CD2   
2619 N N     . PRO A 348 ? 0.1855 0.1119 0.1509 -0.0115 0.0079  0.0242  488 PRO A N     
2620 C CA    . PRO A 348 ? 0.1772 0.1154 0.1383 -0.0109 0.0093  0.0220  488 PRO A CA    
2621 C C     . PRO A 348 ? 0.1569 0.1024 0.1235 -0.0057 0.0047  0.0163  488 PRO A C     
2622 O O     . PRO A 348 ? 0.1561 0.0990 0.1273 -0.0015 0.0008  0.0155  488 PRO A O     
2623 C CB    . PRO A 348 ? 0.2285 0.1619 0.1742 -0.0105 0.0086  0.0292  488 PRO A CB    
2624 C CG    . PRO A 348 ? 0.2693 0.1889 0.2131 -0.0065 0.0031  0.0349  488 PRO A CG    
2625 C CD    . PRO A 348 ? 0.2459 0.1583 0.2014 -0.0096 0.0050  0.0325  488 PRO A CD    
2626 N N     A PRO A 349 ? 0.1607 0.1153 0.1276 -0.0063 0.0058  0.0121  489 PRO A N     
2627 N N     B PRO A 349 ? 0.1609 0.1156 0.1281 -0.0063 0.0058  0.0120  489 PRO A N     
2628 C CA    A PRO A 349 ? 0.1503 0.1119 0.1246 -0.0040 0.0030  0.0073  489 PRO A CA    
2629 C CA    B PRO A 349 ? 0.1468 0.1085 0.1211 -0.0040 0.0029  0.0073  489 PRO A CA    
2630 C C     A PRO A 349 ? 0.1510 0.1150 0.1252 0.0005  -0.0030 0.0080  489 PRO A C     
2631 C C     B PRO A 349 ? 0.1498 0.1136 0.1242 0.0007  -0.0031 0.0082  489 PRO A C     
2632 O O     A PRO A 349 ? 0.1527 0.1229 0.1360 0.0025  -0.0044 0.0051  489 PRO A O     
2633 O O     B PRO A 349 ? 0.1620 0.1311 0.1453 0.0031  -0.0045 0.0055  489 PRO A O     
2634 C CB    A PRO A 349 ? 0.1575 0.1242 0.1304 -0.0064 0.0049  0.0032  489 PRO A CB    
2635 C CB    B PRO A 349 ? 0.1657 0.1324 0.1377 -0.0063 0.0045  0.0033  489 PRO A CB    
2636 C CG    A PRO A 349 ? 0.1635 0.1283 0.1249 -0.0078 0.0073  0.0052  489 PRO A CG    
2637 C CG    B PRO A 349 ? 0.1518 0.1167 0.1214 -0.0089 0.0103  0.0039  489 PRO A CG    
2638 C CD    A PRO A 349 ? 0.1703 0.1287 0.1309 -0.0093 0.0102  0.0110  489 PRO A CD    
2639 C CD    B PRO A 349 ? 0.1731 0.1317 0.1364 -0.0098 0.0109  0.0105  489 PRO A CD    
2640 N N     . GLU A 350 ? 0.1444 0.1051 0.1086 0.0026  -0.0065 0.0122  490 GLU A N     
2641 C CA    A GLU A 350 ? 0.1649 0.1299 0.1305 0.0086  -0.0137 0.0129  490 GLU A CA    
2642 C CA    B GLU A 350 ? 0.1716 0.1357 0.1361 0.0087  -0.0138 0.0135  490 GLU A CA    
2643 C C     . GLU A 350 ? 0.1839 0.1420 0.1554 0.0142  -0.0155 0.0150  490 GLU A C     
2644 O O     . GLU A 350 ? 0.2021 0.1658 0.1792 0.0210  -0.0212 0.0143  490 GLU A O     
2645 C CB    A GLU A 350 ? 0.2058 0.1694 0.1565 0.0103  -0.0184 0.0175  490 GLU A CB    
2646 C CB    B GLU A 350 ? 0.2134 0.1734 0.1619 0.0103  -0.0178 0.0195  490 GLU A CB    
2647 C CG    A GLU A 350 ? 0.2306 0.1791 0.1685 0.0103  -0.0167 0.0269  490 GLU A CG    
2648 C CG    B GLU A 350 ? 0.2193 0.1872 0.1589 0.0065  -0.0176 0.0156  490 GLU A CG    
2649 C CD    A GLU A 350 ? 0.2558 0.2017 0.1839 0.0030  -0.0088 0.0284  490 GLU A CD    
2650 C CD    B GLU A 350 ? 0.2592 0.2226 0.1911 0.0006  -0.0089 0.0157  490 GLU A CD    
2651 O OE1   A GLU A 350 ? 0.2466 0.2001 0.1804 -0.0010 -0.0041 0.0213  490 GLU A OE1   
2652 O OE1   B GLU A 350 ? 0.2318 0.1878 0.1674 -0.0018 -0.0032 0.0189  490 GLU A OE1   
2653 O OE2   A GLU A 350 ? 0.2323 0.1683 0.1473 0.0016  -0.0069 0.0372  490 GLU A OE2   
2654 O OE2   B GLU A 350 ? 0.2820 0.2508 0.2053 -0.0016 -0.0080 0.0113  490 GLU A OE2   
2655 N N     . GLN A 351 ? 0.1506 0.0979 0.1226 0.0118  -0.0111 0.0162  491 GLN A N     
2656 C CA    . GLN A 351 ? 0.1519 0.0916 0.1300 0.0169  -0.0127 0.0153  491 GLN A CA    
2657 C C     . GLN A 351 ? 0.1529 0.0991 0.1404 0.0155  -0.0089 0.0082  491 GLN A C     
2658 O O     . GLN A 351 ? 0.1498 0.0892 0.1408 0.0184  -0.0089 0.0053  491 GLN A O     
2659 C CB    . GLN A 351 ? 0.1925 0.1124 0.1637 0.0152  -0.0120 0.0215  491 GLN A CB    
2660 C CG    . GLN A 351 ? 0.2460 0.1576 0.2045 0.0170  -0.0157 0.0310  491 GLN A CG    
2661 C CD    . GLN A 351 ? 0.2728 0.1854 0.2328 0.0281  -0.0242 0.0322  491 GLN A CD    
2662 O OE1   . GLN A 351 ? 0.2705 0.1833 0.2416 0.0349  -0.0263 0.0270  491 GLN A OE1   
2663 N NE2   . GLN A 351 ? 0.2988 0.2138 0.2477 0.0306  -0.0292 0.0385  491 GLN A NE2   
2664 N N     . ARG A 352 ? 0.1424 0.1007 0.1328 0.0115  -0.0060 0.0053  492 ARG A N     
2665 C CA    . ARG A 352 ? 0.1252 0.0905 0.1218 0.0103  -0.0026 0.0006  492 ARG A CA    
2666 C C     . ARG A 352 ? 0.1572 0.1369 0.1615 0.0129  -0.0028 -0.0025 492 ARG A C     
2667 O O     . ARG A 352 ? 0.1332 0.1207 0.1407 0.0100  0.0009  -0.0043 492 ARG A O     
2668 C CB    . ARG A 352 ? 0.1075 0.0740 0.1025 0.0039  0.0010  0.0010  492 ARG A CB    
2669 C CG    . ARG A 352 ? 0.1285 0.0855 0.1193 0.0005  0.0023  0.0034  492 ARG A CG    
2670 C CD    . ARG A 352 ? 0.1239 0.0849 0.1162 -0.0037 0.0055  0.0027  492 ARG A CD    
2671 N NE    . ARG A 352 ? 0.1287 0.0857 0.1186 -0.0074 0.0077  0.0051  492 ARG A NE    
2672 C CZ    . ARG A 352 ? 0.1366 0.0981 0.1277 -0.0097 0.0109  0.0044  492 ARG A CZ    
2673 N NH1   . ARG A 352 ? 0.1410 0.1075 0.1353 -0.0085 0.0111  0.0021  492 ARG A NH1   
2674 N NH2   . ARG A 352 ? 0.1352 0.0958 0.1249 -0.0133 0.0143  0.0064  492 ARG A NH2   
2675 N N     . ASN A 353 ? 0.1465 0.1307 0.1543 0.0185  -0.0071 -0.0025 493 ASN A N     
2676 C CA    . ASN A 353 ? 0.1553 0.1574 0.1740 0.0202  -0.0071 -0.0058 493 ASN A CA    
2677 C C     . ASN A 353 ? 0.1368 0.1456 0.1628 0.0264  -0.0047 -0.0105 493 ASN A C     
2678 O O     . ASN A 353 ? 0.1498 0.1698 0.1854 0.0332  -0.0071 -0.0132 493 ASN A O     
2679 C CB    . ASN A 353 ? 0.1240 0.1323 0.1451 0.0235  -0.0140 -0.0046 493 ASN A CB    
2680 C CG    . ASN A 353 ? 0.1308 0.1389 0.1458 0.0162  -0.0152 -0.0031 493 ASN A CG    
2681 O OD1   . ASN A 353 ? 0.1440 0.1608 0.1648 0.0098  -0.0126 -0.0057 493 ASN A OD1   
2682 N ND2   . ASN A 353 ? 0.1561 0.1533 0.1588 0.0169  -0.0188 0.0010  493 ASN A ND2   
2683 N N     . ALA A 354 ? 0.1376 0.1407 0.1590 0.0247  -0.0002 -0.0123 494 ALA A N     
2684 C CA    . ALA A 354 ? 0.1663 0.1756 0.1914 0.0306  0.0030  -0.0185 494 ALA A CA    
2685 C C     . ALA A 354 ? 0.1926 0.2245 0.2274 0.0296  0.0079  -0.0206 494 ALA A C     
2686 O O     . ALA A 354 ? 0.1711 0.2093 0.2062 0.0211  0.0110  -0.0169 494 ALA A O     
2687 C CB    . ALA A 354 ? 0.1381 0.1383 0.1539 0.0280  0.0058  -0.0206 494 ALA A CB    
2688 O OXT   . ALA A 354 ? 0.2009 0.2452 0.2446 0.0370  0.0095  -0.0260 494 ALA A OXT   
2689 O "O5'" . DC  B 1   ? 0.6439 0.7349 0.3990 0.0665  -0.0107 -0.1136 1   DC  T "O5'" 
2690 C "C5'" . DC  B 1   ? 0.6103 0.6950 0.3612 0.0652  -0.0168 -0.1322 1   DC  T "C5'" 
2691 C "C4'" . DC  B 1   ? 0.5334 0.6107 0.2949 0.0559  -0.0273 -0.1393 1   DC  T "C4'" 
2692 O "O4'" . DC  B 1   ? 0.4845 0.5421 0.2576 0.0527  -0.0262 -0.1482 1   DC  T "O4'" 
2693 C "C3'" . DC  B 1   ? 0.4696 0.5548 0.2391 0.0518  -0.0314 -0.1250 1   DC  T "C3'" 
2694 O "O3'" . DC  B 1   ? 0.4638 0.5525 0.2372 0.0450  -0.0422 -0.1327 1   DC  T "O3'" 
2695 C "C2'" . DC  B 1   ? 0.4478 0.5206 0.2314 0.0494  -0.0277 -0.1215 1   DC  T "C2'" 
2696 C "C1'" . DC  B 1   ? 0.4441 0.4990 0.2307 0.0471  -0.0287 -0.1398 1   DC  T "C1'" 
2697 N N1    . DC  B 1   ? 0.4332 0.4726 0.2276 0.0503  -0.0218 -0.1408 1   DC  T N1    
2698 C C2    . DC  B 1   ? 0.4009 0.4210 0.2070 0.0439  -0.0254 -0.1498 1   DC  T C2    
2699 O O2    . DC  B 1   ? 0.4029 0.4215 0.2148 0.0338  -0.0339 -0.1556 1   DC  T O2    
2700 N N3    . DC  B 1   ? 0.4003 0.4031 0.2159 0.0474  -0.0184 -0.1468 1   DC  T N3    
2701 C C4    . DC  B 1   ? 0.4266 0.4356 0.2382 0.0581  -0.0093 -0.1403 1   DC  T C4    
2702 N N4    . DC  B 1   ? 0.4223 0.4166 0.2446 0.0624  -0.0033 -0.1373 1   DC  T N4    
2703 C C5    . DC  B 1   ? 0.4182 0.4497 0.2155 0.0645  -0.0056 -0.1354 1   DC  T C5    
2704 C C6    . DC  B 1   ? 0.4339 0.4775 0.2240 0.0597  -0.0117 -0.1341 1   DC  T C6    
2705 P P     . DG  B 2   ? 0.4632 0.5674 0.2394 0.0438  -0.0486 -0.1200 2   DG  T P     
2706 O OP1   . DG  B 2   ? 0.4367 0.5499 0.2121 0.0397  -0.0587 -0.1313 2   DG  T OP1   
2707 O OP2   . DG  B 2   ? 0.5177 0.6295 0.2835 0.0520  -0.0414 -0.1030 2   DG  T OP2   
2708 O "O5'" . DG  B 2   ? 0.4217 0.5184 0.2159 0.0371  -0.0499 -0.1150 2   DG  T "O5'" 
2709 C "C5'" . DG  B 2   ? 0.4156 0.5044 0.2230 0.0273  -0.0561 -0.1276 2   DG  T "C5'" 
2710 C "C4'" . DG  B 2   ? 0.3761 0.4593 0.1988 0.0225  -0.0554 -0.1201 2   DG  T "C4'" 
2711 O "O4'" . DG  B 2   ? 0.3935 0.4601 0.2176 0.0242  -0.0479 -0.1224 2   DG  T "O4'" 
2712 C "C3'" . DG  B 2   ? 0.3930 0.4870 0.2160 0.0273  -0.0537 -0.1011 2   DG  T "C3'" 
2713 O "O3'" . DG  B 2   ? 0.4241 0.5230 0.2626 0.0204  -0.0599 -0.0986 2   DG  T "O3'" 
2714 C "C2'" . DG  B 2   ? 0.3810 0.4655 0.2024 0.0316  -0.0437 -0.0934 2   DG  T "C2'" 
2715 C "C1'" . DG  B 2   ? 0.3465 0.4127 0.1785 0.0259  -0.0423 -0.1051 2   DG  T "C1'" 
2716 N N9    . DG  B 2   ? 0.3418 0.3963 0.1730 0.0312  -0.0322 -0.1026 2   DG  T N9    
2717 C C8    . DG  B 2   ? 0.3364 0.3978 0.1539 0.0405  -0.0248 -0.0980 2   DG  T C8    
2718 N N7    . DG  B 2   ? 0.3362 0.3872 0.1582 0.0440  -0.0169 -0.0984 2   DG  T N7    
2719 C C5    . DG  B 2   ? 0.3317 0.3654 0.1694 0.0372  -0.0196 -0.1029 2   DG  T C5    
2720 C C6    . DG  B 2   ? 0.3762 0.3927 0.2238 0.0388  -0.0145 -0.1041 2   DG  T C6    
2721 O O6    . DG  B 2   ? 0.3347 0.3499 0.1806 0.0471  -0.0068 -0.1026 2   DG  T O6    
2722 N N1    . DG  B 2   ? 0.3302 0.3309 0.1907 0.0299  -0.0190 -0.1071 2   DG  T N1    
2723 C C2    . DG  B 2   ? 0.3272 0.3313 0.1925 0.0199  -0.0270 -0.1095 2   DG  T C2    
2724 N N2    . DG  B 2   ? 0.3276 0.3160 0.2062 0.0111  -0.0290 -0.1114 2   DG  T N2    
2725 N N3    . DG  B 2   ? 0.3262 0.3492 0.1841 0.0192  -0.0325 -0.1093 2   DG  T N3    
2726 C C4    . DG  B 2   ? 0.3285 0.3641 0.1718 0.0285  -0.0285 -0.1055 2   DG  T C4    
2727 P P     . DG  B 3   ? 0.4739 0.5805 0.3170 0.0238  -0.0590 -0.0806 3   DG  T P     
2728 O OP1   . DG  B 3   ? 0.4660 0.5846 0.3210 0.0191  -0.0677 -0.0825 3   DG  T OP1   
2729 O OP2   . DG  B 3   ? 0.5132 0.6215 0.3410 0.0335  -0.0527 -0.0680 3   DG  T OP2   
2730 O "O5'" . DG  B 3   ? 0.3882 0.4793 0.2468 0.0186  -0.0525 -0.0749 3   DG  T "O5'" 
2731 C "C5'" . DG  B 3   ? 0.3432 0.4248 0.2180 0.0084  -0.0546 -0.0837 3   DG  T "C5'" 
2732 C "C4'" . DG  B 3   ? 0.3294 0.3938 0.2155 0.0062  -0.0462 -0.0758 3   DG  T "C4'" 
2733 O "O4'" . DG  B 3   ? 0.3266 0.3804 0.2036 0.0116  -0.0394 -0.0785 3   DG  T "O4'" 
2734 C "C3'" . DG  B 3   ? 0.2769 0.3442 0.1680 0.0092  -0.0419 -0.0593 3   DG  T "C3'" 
2735 O "O3'" . DG  B 3   ? 0.2421 0.3104 0.1496 0.0023  -0.0445 -0.0562 3   DG  T "O3'" 
2736 C "C2'" . DG  B 3   ? 0.3056 0.3605 0.1970 0.0120  -0.0325 -0.0543 3   DG  T "C2'" 
2737 C "C1'" . DG  B 3   ? 0.2982 0.3431 0.1847 0.0120  -0.0322 -0.0678 3   DG  T "C1'" 
2738 N N9    . DG  B 3   ? 0.3026 0.3446 0.1798 0.0197  -0.0247 -0.0670 3   DG  T N9    
2739 C C8    . DG  B 3   ? 0.2850 0.3376 0.1469 0.0269  -0.0218 -0.0642 3   DG  T C8    
2740 N N7    . DG  B 3   ? 0.2904 0.3405 0.1484 0.0324  -0.0141 -0.0641 3   DG  T N7    
2741 C C5    . DG  B 3   ? 0.2756 0.3118 0.1465 0.0301  -0.0126 -0.0669 3   DG  T C5    
2742 C C6    . DG  B 3   ? 0.3262 0.3557 0.1999 0.0357  -0.0057 -0.0680 3   DG  T C6    
2743 O O6    . DG  B 3   ? 0.3313 0.3681 0.1978 0.0431  0.0008  -0.0676 3   DG  T O6    
2744 N N1    . DG  B 3   ? 0.2756 0.2896 0.1619 0.0325  -0.0066 -0.0690 3   DG  T N1    
2745 C C2    . DG  B 3   ? 0.2722 0.2787 0.1674 0.0235  -0.0126 -0.0692 3   DG  T C2    
2746 N N2    . DG  B 3   ? 0.2961 0.2866 0.2011 0.0215  -0.0116 -0.0689 3   DG  T N2    
2747 N N3    . DG  B 3   ? 0.2662 0.2816 0.1606 0.0175  -0.0188 -0.0693 3   DG  T N3    
2748 C C4    . DG  B 3   ? 0.2690 0.2988 0.1509 0.0220  -0.0188 -0.0680 3   DG  T C4    
2749 P P     . DC  B 4   ? 0.2709 0.3440 0.1851 0.0044  -0.0423 -0.0420 4   DC  T P     
2750 O OP1   . DC  B 4   ? 0.2859 0.3668 0.2139 -0.0019 -0.0477 -0.0440 4   DC  T OP1   
2751 O OP2   . DC  B 4   ? 0.2653 0.3450 0.1648 0.0131  -0.0414 -0.0350 4   DC  T OP2   
2752 O "O5'" . DC  B 4   ? 0.2525 0.3122 0.1736 0.0033  -0.0338 -0.0355 4   DC  T "O5'" 
2753 C "C5'" . DC  B 4   ? 0.2029 0.2523 0.1354 -0.0030 -0.0325 -0.0389 4   DC  T "C5'" 
2754 C "C4'" . DC  B 4   ? 0.1971 0.2376 0.1313 -0.0002 -0.0250 -0.0329 4   DC  T "C4'" 
2755 O "O4'" . DC  B 4   ? 0.2209 0.2585 0.1432 0.0057  -0.0218 -0.0372 4   DC  T "O4'" 
2756 C "C3'" . DC  B 4   ? 0.2086 0.2547 0.1453 0.0021  -0.0212 -0.0219 4   DC  T "C3'" 
2757 O "O3'" . DC  B 4   ? 0.1971 0.2391 0.1450 -0.0007 -0.0182 -0.0174 4   DC  T "O3'" 
2758 C "C2'" . DC  B 4   ? 0.1903 0.2375 0.1159 0.0081  -0.0160 -0.0201 4   DC  T "C2'" 
2759 C "C1'" . DC  B 4   ? 0.2167 0.2563 0.1390 0.0097  -0.0153 -0.0292 4   DC  T "C1'" 
2760 N N1    . DC  B 4   ? 0.2263 0.2688 0.1355 0.0163  -0.0113 -0.0318 4   DC  T N1    
2761 C C2    . DC  B 4   ? 0.2197 0.2572 0.1291 0.0204  -0.0063 -0.0350 4   DC  T C2    
2762 O O2    . DC  B 4   ? 0.2162 0.2449 0.1353 0.0191  -0.0061 -0.0356 4   DC  T O2    
2763 N N3    . DC  B 4   ? 0.2303 0.2734 0.1289 0.0268  -0.0015 -0.0372 4   DC  T N3    
2764 C C4    . DC  B 4   ? 0.2524 0.3045 0.1386 0.0284  -0.0015 -0.0352 4   DC  T C4    
2765 N N4    . DC  B 4   ? 0.2487 0.3075 0.1235 0.0344  0.0043  -0.0369 4   DC  T N4    
2766 C C5    . DC  B 4   ? 0.2463 0.3017 0.1308 0.0248  -0.0070 -0.0308 4   DC  T C5    
2767 C C6    . DC  B 4   ? 0.2363 0.2874 0.1332 0.0192  -0.0119 -0.0297 4   DC  T C6    
2768 P P     . DA  B 5   ? 0.1641 0.2116 0.1186 -0.0014 -0.0160 -0.0085 5   DA  T P     
2769 O OP1   . DA  B 5   ? 0.1642 0.2148 0.1109 0.0023  -0.0125 -0.0040 5   DA  T OP1   
2770 O OP2   . DA  B 5   ? 0.1627 0.2070 0.1265 -0.0035 -0.0134 -0.0063 5   DA  T OP2   
2771 O "O5'" . DA  B 5   ? 0.1551 0.2088 0.1133 -0.0040 -0.0216 -0.0089 5   DA  T "O5'" 
2772 C "C5'" . DA  B 5   ? 0.1527 0.2070 0.1204 -0.0096 -0.0247 -0.0122 5   DA  T "C5'" 
2773 C "C4'" . DA  B 5   ? 0.1523 0.2168 0.1266 -0.0107 -0.0276 -0.0098 5   DA  T "C4'" 
2774 O "O4'" . DA  B 5   ? 0.1620 0.2262 0.1397 -0.0091 -0.0237 -0.0031 5   DA  T "O4'" 
2775 C "C3'" . DA  B 5   ? 0.1513 0.2241 0.1188 -0.0060 -0.0322 -0.0107 5   DA  T "C3'" 
2776 O "O3'" . DA  B 5   ? 0.1484 0.2333 0.1249 -0.0083 -0.0369 -0.0130 5   DA  T "O3'" 
2777 C "C2'" . DA  B 5   ? 0.1492 0.2188 0.1114 -0.0005 -0.0284 -0.0029 5   DA  T "C2'" 
2778 C "C1'" . DA  B 5   ? 0.1454 0.2122 0.1176 -0.0040 -0.0242 0.0003  5   DA  T "C1'" 
2779 N N9    . DA  B 5   ? 0.1405 0.2008 0.1096 -0.0028 -0.0185 0.0049  5   DA  T N9    
2780 C C8    . DA  B 5   ? 0.1710 0.2269 0.1315 -0.0008 -0.0151 0.0061  5   DA  T C8    
2781 N N7    . DA  B 5   ? 0.1651 0.2186 0.1272 -0.0019 -0.0098 0.0098  5   DA  T N7    
2782 C C5    . DA  B 5   ? 0.1687 0.2241 0.1400 -0.0043 -0.0103 0.0105  5   DA  T C5    
2783 C C6    . DA  B 5   ? 0.1885 0.2440 0.1656 -0.0068 -0.0068 0.0122  5   DA  T C6    
2784 N N6    . DA  B 5   ? 0.1591 0.2133 0.1352 -0.0086 -0.0018 0.0139  5   DA  T N6    
2785 N N1    . DA  B 5   ? 0.1912 0.2501 0.1757 -0.0080 -0.0084 0.0113  5   DA  T N1    
2786 C C2    . DA  B 5   ? 0.1739 0.2369 0.1609 -0.0072 -0.0127 0.0096  5   DA  T C2    
2787 N N3    . DA  B 5   ? 0.1608 0.2251 0.1446 -0.0060 -0.0163 0.0078  5   DA  T N3    
2788 C C4    . DA  B 5   ? 0.1496 0.2093 0.1250 -0.0044 -0.0152 0.0079  5   DA  T C4    
2789 P P     . DA  B 6   ? 0.1630 0.2614 0.1354 -0.0020 -0.0431 -0.0137 6   DA  T P     
2790 O OP1   . DA  B 6   ? 0.1528 0.2664 0.1369 -0.0075 -0.0483 -0.0201 6   DA  T OP1   
2791 O OP2   . DA  B 6   ? 0.1670 0.2631 0.1238 0.0037  -0.0448 -0.0145 6   DA  T OP2   
2792 O "O5'" . DA  B 6   ? 0.1651 0.2618 0.1380 0.0042  -0.0402 -0.0054 6   DA  T "O5'" 
2793 C "C5'" . DA  B 6   ? 0.1538 0.2545 0.1391 0.0013  -0.0385 -0.0043 6   DA  T "C5'" 
2794 C "C4'" . DA  B 6   ? 0.1564 0.2508 0.1394 0.0074  -0.0350 0.0021  6   DA  T "C4'" 
2795 O "O4'" . DA  B 6   ? 0.1608 0.2409 0.1394 0.0052  -0.0290 0.0055  6   DA  T "O4'" 
2796 C "C3'" . DA  B 6   ? 0.1595 0.2532 0.1321 0.0176  -0.0376 0.0059  6   DA  T "C3'" 
2797 O "O3'" . DA  B 6   ? 0.1746 0.2842 0.1538 0.0226  -0.0429 0.0039  6   DA  T "O3'" 
2798 C "C2'" . DA  B 6   ? 0.1623 0.2400 0.1309 0.0198  -0.0312 0.0122  6   DA  T "C2'" 
2799 C "C1'" . DA  B 6   ? 0.1801 0.2513 0.1522 0.0109  -0.0261 0.0109  6   DA  T "C1'" 
2800 N N9    . DA  B 6   ? 0.1888 0.2494 0.1508 0.0103  -0.0221 0.0140  6   DA  T N9    
2801 C C8    . DA  B 6   ? 0.1933 0.2542 0.1453 0.0121  -0.0235 0.0136  6   DA  T C8    
2802 N N7    . DA  B 6   ? 0.2240 0.2767 0.1689 0.0109  -0.0179 0.0167  6   DA  T N7    
2803 C C5    . DA  B 6   ? 0.2149 0.2620 0.1668 0.0073  -0.0131 0.0189  6   DA  T C5    
2804 C C6    . DA  B 6   ? 0.2729 0.3133 0.2241 0.0034  -0.0062 0.0217  6   DA  T C6    
2805 N N6    . DA  B 6   ? 0.3091 0.3478 0.2523 0.0031  -0.0022 0.0238  6   DA  T N6    
2806 N N1    . DA  B 6   ? 0.2605 0.2987 0.2204 -0.0005 -0.0036 0.0214  6   DA  T N1    
2807 C C2    . DA  B 6   ? 0.2306 0.2721 0.1978 0.0005  -0.0071 0.0190  6   DA  T C2    
2808 N N3    . DA  B 6   ? 0.1993 0.2476 0.1682 0.0043  -0.0127 0.0170  6   DA  T N3    
2809 C C4    . DA  B 6   ? 0.1961 0.2471 0.1577 0.0071  -0.0157 0.0170  6   DA  T C4    
2810 P P     . DT  B 7   ? 0.2024 0.3197 0.1722 0.0344  -0.0489 0.0060  7   DT  T P     
2811 O OP1   . DT  B 7   ? 0.1619 0.3025 0.1440 0.0370  -0.0548 0.0012  7   DT  T OP1   
2812 O OP2   . DT  B 7   ? 0.1924 0.3068 0.1487 0.0347  -0.0507 0.0057  7   DT  T OP2   
2813 O "O5'" . DT  B 7   ? 0.2384 0.3372 0.1991 0.0433  -0.0441 0.0150  7   DT  T "O5'" 
2814 C "C5'" . DT  B 7   ? 0.2382 0.3359 0.2070 0.0470  -0.0421 0.0157  7   DT  T "C5'" 
2815 C "C4'" . DT  B 7   ? 0.2312 0.3059 0.1887 0.0540  -0.0371 0.0237  7   DT  T "C4'" 
2816 O "O4'" . DT  B 7   ? 0.2134 0.2715 0.1695 0.0441  -0.0299 0.0248  7   DT  T "O4'" 
2817 C "C3'" . DT  B 7   ? 0.2592 0.3268 0.1991 0.0637  -0.0390 0.0311  7   DT  T "C3'" 
2818 O "O3'" . DT  B 7   ? 0.2982 0.3541 0.2324 0.0763  -0.0382 0.0374  7   DT  T "O3'" 
2819 C "C2'" . DT  B 7   ? 0.2442 0.2933 0.1747 0.0557  -0.0320 0.0352  7   DT  T "C2'" 
2820 C "C1'" . DT  B 7   ? 0.2191 0.2585 0.1605 0.0478  -0.0260 0.0327  7   DT  T "C1'" 
2821 N N1    . DT  B 7   ? 0.2231 0.2518 0.1633 0.0370  -0.0193 0.0332  7   DT  T N1    
2822 C C2    . DT  B 7   ? 0.2313 0.2505 0.1787 0.0309  -0.0139 0.0315  7   DT  T C2    
2823 O O2    . DT  B 7   ? 0.2521 0.2704 0.2061 0.0338  -0.0143 0.0291  7   DT  T O2    
2824 N N3    . DT  B 7   ? 0.2108 0.2244 0.1580 0.0215  -0.0084 0.0317  7   DT  T N3    
2825 C C4    . DT  B 7   ? 0.2289 0.2442 0.1692 0.0185  -0.0069 0.0338  7   DT  T C4    
2826 O O4    . DT  B 7   ? 0.2453 0.2579 0.1871 0.0109  -0.0015 0.0336  7   DT  T O4    
2827 C C5    . DT  B 7   ? 0.2421 0.2651 0.1732 0.0256  -0.0122 0.0353  7   DT  T C5    
2828 C C7    . DT  B 7   ? 0.2712 0.2971 0.1930 0.0238  -0.0108 0.0362  7   DT  T C7    
2829 C C6    . DT  B 7   ? 0.2325 0.2624 0.1642 0.0340  -0.0185 0.0347  7   DT  T C6    
2830 P P     . DA  B 8   ? 0.3198 0.3852 0.2442 0.0936  -0.0455 0.0423  8   DA  T P     
2831 O OP1   . DA  B 8   ? 0.3336 0.4323 0.2696 0.0943  -0.0545 0.0338  8   DA  T OP1   
2832 O OP2   . DA  B 8   ? 0.3490 0.3985 0.2525 0.0978  -0.0432 0.0521  8   DA  T OP2   
2833 O "O5'" . DA  B 8   ? 0.3166 0.3684 0.2426 0.1052  -0.0430 0.0457  8   DA  T "O5'" 
2834 C "C5'" . DA  B 8   ? 0.2894 0.3516 0.2328 0.1027  -0.0427 0.0376  8   DA  T "C5'" 
2835 C "C4'" . DA  B 8   ? 0.2901 0.3241 0.2322 0.1033  -0.0348 0.0396  8   DA  T "C4'" 
2836 O "O4'" . DA  B 8   ? 0.3019 0.3199 0.2430 0.0873  -0.0278 0.0391  8   DA  T "O4'" 
2837 C "C3'" . DA  B 8   ? 0.3309 0.3381 0.2567 0.1182  -0.0324 0.0499  8   DA  T "C3'" 
2838 O "O3'" . DA  B 8   ? 0.3402 0.3355 0.2713 0.1255  -0.0294 0.0470  8   DA  T "O3'" 
2839 C "C2'" . DA  B 8   ? 0.3062 0.2858 0.2194 0.1075  -0.0247 0.0568  8   DA  T "C2'" 
2840 C "C1'" . DA  B 8   ? 0.3058 0.2920 0.2329 0.0889  -0.0212 0.0476  8   DA  T "C1'" 
2841 N N9    . DA  B 8   ? 0.2994 0.2804 0.2208 0.0761  -0.0174 0.0502  8   DA  T N9    
2842 C C8    . DA  B 8   ? 0.2930 0.2822 0.2046 0.0767  -0.0201 0.0546  8   DA  T C8    
2843 N N7    . DA  B 8   ? 0.2847 0.2685 0.1940 0.0644  -0.0149 0.0552  8   DA  T N7    
2844 C C5    . DA  B 8   ? 0.2854 0.2579 0.2041 0.0549  -0.0089 0.0511  8   DA  T C5    
2845 C C6    . DA  B 8   ? 0.2717 0.2376 0.1941 0.0409  -0.0022 0.0492  8   DA  T C6    
2846 N N6    . DA  B 8   ? 0.2696 0.2385 0.1867 0.0343  0.0005  0.0517  8   DA  T N6    
2847 N N1    . DA  B 8   ? 0.2584 0.2168 0.1905 0.0345  0.0015  0.0438  8   DA  T N1    
2848 C C2    . DA  B 8   ? 0.2979 0.2538 0.2347 0.0418  -0.0007 0.0403  8   DA  T C2    
2849 N N3    . DA  B 8   ? 0.2978 0.2588 0.2322 0.0558  -0.0062 0.0419  8   DA  T N3    
2850 C C4    . DA  B 8   ? 0.2990 0.2690 0.2246 0.0616  -0.0104 0.0476  8   DA  T C4    
2851 P P     . DC  B 9   ? 0.4156 0.3764 0.3315 0.1415  -0.0255 0.0564  9   DC  T P     
2852 O OP1   . DC  B 9   ? 0.4433 0.4123 0.3682 0.1560  -0.0280 0.0507  9   DC  T OP1   
2853 O OP2   . DC  B 9   ? 0.4335 0.3857 0.3305 0.1506  -0.0275 0.0694  9   DC  T OP2   
2854 O "O5'" . DC  B 9   ? 0.3638 0.2894 0.2759 0.1268  -0.0149 0.0568  9   DC  T "O5'" 
2855 C "C5'" . DC  B 9   ? 0.3681 0.2969 0.2946 0.1140  -0.0115 0.0451  9   DC  T "C5'" 
2856 C "C4'" . DC  B 9   ? 0.3841 0.2835 0.3056 0.0989  -0.0025 0.0464  9   DC  T "C4'" 
2857 O "O4'" . DC  B 9   ? 0.3984 0.3064 0.3172 0.0864  -0.0020 0.0503  9   DC  T "O4'" 
2858 C "C3'" . DC  B 9   ? 0.4456 0.3035 0.3511 0.1061  0.0039  0.0561  9   DC  T "C3'" 
2859 O "O3'" . DC  B 9   ? 0.4117 0.2474 0.3218 0.1015  0.0099  0.0480  9   DC  T "O3'" 
2860 C "C2'" . DC  B 9   ? 0.4539 0.3003 0.3489 0.0940  0.0089  0.0656  9   DC  T "C2'" 
2861 C "C1'" . DC  B 9   ? 0.4143 0.2918 0.3224 0.0787  0.0063  0.0573  9   DC  T "C1'" 
2862 N N1    . DC  B 9   ? 0.4222 0.3088 0.3225 0.0730  0.0061  0.0646  9   DC  T N1    
2863 C C2    . DC  B 9   ? 0.4560 0.3415 0.3594 0.0555  0.0119  0.0631  9   DC  T C2    
2864 O O2    . DC  B 9   ? 0.5153 0.3927 0.4277 0.0445  0.0166  0.0559  9   DC  T O2    
2865 N N3    . DC  B 9   ? 0.4069 0.3021 0.3033 0.0516  0.0121  0.0687  9   DC  T N3    
2866 C C4    . DC  B 9   ? 0.3919 0.2970 0.2776 0.0637  0.0065  0.0751  9   DC  T C4    
2867 N N4    . DC  B 9   ? 0.3640 0.2784 0.2418 0.0597  0.0071  0.0793  9   DC  T N4    
2868 C C5    . DC  B 9   ? 0.4031 0.3115 0.2860 0.0811  -0.0004 0.0767  9   DC  T C5    
2869 C C6    . DC  B 9   ? 0.4261 0.3254 0.3171 0.0854  -0.0001 0.0715  9   DC  T C6    
2870 P P     . DG  B 10  ? 0.4930 0.2822 0.3899 0.1107  0.0167  0.0540  10  DG  T P     
2871 O OP1   . DG  B 10  ? 0.4714 0.2510 0.3774 0.1099  0.0193  0.0402  10  DG  T OP1   
2872 O OP2   . DG  B 10  ? 0.5426 0.3251 0.4258 0.1332  0.0130  0.0665  10  DG  T OP2   
2873 O "O5'" . DG  B 10  ? 0.6344 0.3973 0.5227 0.0930  0.0257  0.0614  10  DG  T "O5'" 
2874 C "C5'" . DG  B 10  ? 0.6578 0.4170 0.5561 0.0720  0.0312  0.0512  10  DG  T "C5'" 
2875 C "C4'" . DG  B 10  ? 0.7218 0.4549 0.6104 0.0584  0.0403  0.0608  10  DG  T "C4'" 
2876 O "O4'" . DG  B 10  ? 0.7164 0.4763 0.6046 0.0518  0.0380  0.0668  10  DG  T "O4'" 
2877 C "C3'" . DG  B 10  ? 0.7955 0.4886 0.6641 0.0712  0.0455  0.0764  10  DG  T "C3'" 
2878 O "O3'" . DG  B 10  ? 0.8378 0.4922 0.7021 0.0571  0.0567  0.0780  10  DG  T "O3'" 
2879 C "C2'" . DG  B 10  ? 0.7848 0.4936 0.6422 0.0756  0.0430  0.0907  10  DG  T "C2'" 
2880 C "C1'" . DG  B 10  ? 0.7390 0.4776 0.6095 0.0553  0.0431  0.0832  10  DG  T "C1'" 
2881 N N9    . DG  B 10  ? 0.6745 0.4419 0.5406 0.0587  0.0377  0.0898  10  DG  T N9    
2882 C C8    . DG  B 10  ? 0.6571 0.4408 0.5159 0.0772  0.0291  0.0952  10  DG  T C8    
2883 N N7    . DG  B 10  ? 0.6066 0.4133 0.4615 0.0752  0.0262  0.0992  10  DG  T N7    
2884 C C5    . DG  B 10  ? 0.5706 0.3756 0.4302 0.0552  0.0338  0.0972  10  DG  T C5    
2885 C C6    . DG  B 10  ? 0.4635 0.2875 0.3218 0.0458  0.0352  0.0991  10  DG  T C6    
2886 O O6    . DG  B 10  ? 0.4621 0.3066 0.3136 0.0527  0.0296  0.1024  10  DG  T O6    
2887 N N1    . DG  B 10  ? 0.4531 0.2716 0.3192 0.0267  0.0438  0.0956  10  DG  T N1    
2888 C C2    . DG  B 10  ? 0.4958 0.2936 0.3702 0.0167  0.0499  0.0901  10  DG  T C2    
2889 N N2    . DG  B 10  ? 0.4806 0.2804 0.3632 -0.0021 0.0574  0.0865  10  DG  T N2    
2890 N N3    . DG  B 10  ? 0.5718 0.3493 0.4465 0.0248  0.0487  0.0874  10  DG  T N3    
2891 C C4    . DG  B 10  ? 0.6056 0.3879 0.4727 0.0447  0.0408  0.0916  10  DG  T C4    
2892 O "O5'" . DC  C 1   ? 0.4055 0.3325 0.2609 -0.0204 0.0732  0.1046  1   DC  P "O5'" 
2893 C "C5'" . DC  C 1   ? 0.4144 0.3295 0.2718 -0.0346 0.0864  0.1106  1   DC  P "C5'" 
2894 C "C4'" . DC  C 1   ? 0.4341 0.3261 0.3017 -0.0419 0.0877  0.1083  1   DC  P "C4'" 
2895 O "O4'" . DC  C 1   ? 0.4740 0.3385 0.3259 -0.0298 0.0849  0.1176  1   DC  P "O4'" 
2896 C "C3'" . DC  C 1   ? 0.4052 0.3103 0.2933 -0.0433 0.0784  0.0929  1   DC  P "C3'" 
2897 O "O3'" . DC  C 1   ? 0.3381 0.2600 0.2440 -0.0582 0.0832  0.0846  1   DC  P "O3'" 
2898 C "C2'" . DC  C 1   ? 0.4286 0.3045 0.3161 -0.0418 0.0775  0.0938  1   DC  P "C2'" 
2899 C "C1'" . DC  C 1   ? 0.4429 0.2965 0.3068 -0.0293 0.0792  0.1091  1   DC  P "C1'" 
2900 N N1    . DC  C 1   ? 0.4243 0.2811 0.2819 -0.0111 0.0670  0.1082  1   DC  P N1    
2901 C C2    . DC  C 1   ? 0.4168 0.2565 0.2782 -0.0052 0.0626  0.1049  1   DC  P C2    
2902 O O2    . DC  C 1   ? 0.4285 0.2487 0.2972 -0.0153 0.0687  0.1023  1   DC  P O2    
2903 N N3    . DC  C 1   ? 0.4020 0.2479 0.2593 0.0112  0.0520  0.1039  1   DC  P N3    
2904 C C4    . DC  C 1   ? 0.4048 0.2725 0.2550 0.0202  0.0454  0.1052  1   DC  P C4    
2905 N N4    . DC  C 1   ? 0.3956 0.2715 0.2437 0.0350  0.0350  0.1034  1   DC  P N4    
2906 C C5    . DC  C 1   ? 0.3968 0.2803 0.2421 0.0143  0.0495  0.1075  1   DC  P C5    
2907 C C6    . DC  C 1   ? 0.4011 0.2787 0.2502 -0.0007 0.0605  0.1093  1   DC  P C6    
2908 P P     . DG  C 2   ? 0.3015 0.2506 0.2266 -0.0586 0.0742  0.0695  2   DG  P P     
2909 O OP1   . DG  C 2   ? 0.2975 0.2622 0.2374 -0.0741 0.0820  0.0647  2   DG  P OP1   
2910 O OP2   . DG  C 2   ? 0.2916 0.2560 0.2114 -0.0449 0.0650  0.0677  2   DG  P OP2   
2911 O "O5'" . DG  C 2   ? 0.3235 0.2579 0.2558 -0.0573 0.0680  0.0630  2   DG  P "O5'" 
2912 C "C5'" . DG  C 2   ? 0.3635 0.2791 0.3017 -0.0692 0.0743  0.0612  2   DG  P "C5'" 
2913 C "C4'" . DG  C 2   ? 0.4006 0.3079 0.3445 -0.0642 0.0666  0.0529  2   DG  P "C4'" 
2914 O "O4'" . DG  C 2   ? 0.4352 0.3229 0.3637 -0.0492 0.0629  0.0609  2   DG  P "O4'" 
2915 C "C3'" . DG  C 2   ? 0.3755 0.3117 0.3314 -0.0600 0.0569  0.0423  2   DG  P "C3'" 
2916 O "O3'" . DG  C 2   ? 0.3095 0.2516 0.2799 -0.0687 0.0558  0.0308  2   DG  P "O3'" 
2917 C "C2'" . DG  C 2   ? 0.4111 0.3428 0.3587 -0.0439 0.0483  0.0444  2   DG  P "C2'" 
2918 C "C1'" . DG  C 2   ? 0.4367 0.3367 0.3700 -0.0387 0.0523  0.0539  2   DG  P "C1'" 
2919 N N9    . DG  C 2   ? 0.4306 0.3313 0.3506 -0.0236 0.0469  0.0615  2   DG  P N9    
2920 C C8    . DG  C 2   ? 0.4073 0.3213 0.3189 -0.0196 0.0464  0.0671  2   DG  P C8    
2921 N N7    . DG  C 2   ? 0.3927 0.3078 0.2941 -0.0057 0.0397  0.0711  2   DG  P N7    
2922 C C5    . DG  C 2   ? 0.3625 0.2657 0.2668 0.0005  0.0357  0.0684  2   DG  P C5    
2923 C C6    . DG  C 2   ? 0.3535 0.2558 0.2519 0.0156  0.0281  0.0702  2   DG  P C6    
2924 O O6    . DG  C 2   ? 0.3513 0.2640 0.2407 0.0258  0.0226  0.0742  2   DG  P O6    
2925 N N1    . DG  C 2   ? 0.3493 0.2393 0.2540 0.0186  0.0269  0.0656  2   DG  P N1    
2926 C C2    . DG  C 2   ? 0.3690 0.2476 0.2832 0.0075  0.0322  0.0591  2   DG  P C2    
2927 N N2    . DG  C 2   ? 0.3749 0.2423 0.2929 0.0130  0.0304  0.0540  2   DG  P N2    
2928 N N3    . DG  C 2   ? 0.3512 0.2316 0.2713 -0.0077 0.0387  0.0569  2   DG  P N3    
2929 C C4    . DG  C 2   ? 0.3900 0.2833 0.3051 -0.0100 0.0402  0.0622  2   DG  P C4    
2930 P P     . DT  C 3   ? 0.2898 0.2593 0.2718 -0.0646 0.0465  0.0206  3   DT  P P     
2931 O OP1   . DT  C 3   ? 0.2963 0.2763 0.2921 -0.0775 0.0485  0.0105  3   DT  P OP1   
2932 O OP2   . DT  C 3   ? 0.2795 0.2684 0.2592 -0.0576 0.0432  0.0241  3   DT  P OP2   
2933 O "O5'" . DT  C 3   ? 0.2787 0.2360 0.2557 -0.0527 0.0397  0.0193  3   DT  P "O5'" 
2934 C "C5'" . DT  C 3   ? 0.2514 0.1891 0.2291 -0.0550 0.0413  0.0147  3   DT  P "C5'" 
2935 C "C4'" . DT  C 3   ? 0.2477 0.1842 0.2232 -0.0422 0.0341  0.0122  3   DT  P "C4'" 
2936 O "O4'" . DT  C 3   ? 0.2969 0.2198 0.2597 -0.0302 0.0331  0.0224  3   DT  P "O4'" 
2937 C "C3'" . DT  C 3   ? 0.2235 0.1882 0.2058 -0.0377 0.0268  0.0080  3   DT  P "C3'" 
2938 O "O3'" . DT  C 3   ? 0.2170 0.1952 0.2100 -0.0446 0.0256  -0.0025 3   DT  P "O3'" 
2939 C "C2'" . DT  C 3   ? 0.2296 0.1898 0.2065 -0.0240 0.0215  0.0102  3   DT  P "C2'" 
2940 C "C1'" . DT  C 3   ? 0.2615 0.1978 0.2254 -0.0188 0.0251  0.0204  3   DT  P "C1'" 
2941 N N1    . DT  C 3   ? 0.2734 0.2172 0.2296 -0.0115 0.0223  0.0287  3   DT  P N1    
2942 C C2    . DT  C 3   ? 0.2715 0.2138 0.2215 0.0016  0.0172  0.0322  3   DT  P C2    
2943 O O2    . DT  C 3   ? 0.3087 0.2448 0.2601 0.0084  0.0151  0.0291  3   DT  P O2    
2944 N N3    . DT  C 3   ? 0.2580 0.2085 0.2004 0.0069  0.0144  0.0384  3   DT  P N3    
2945 C C4    . DT  C 3   ? 0.2506 0.2086 0.1900 0.0014  0.0168  0.0414  3   DT  P C4    
2946 O O4    . DT  C 3   ? 0.2531 0.2179 0.1843 0.0073  0.0139  0.0457  3   DT  P O4    
2947 C C5    . DT  C 3   ? 0.2870 0.2464 0.2337 -0.0115 0.0229  0.0381  3   DT  P C5    
2948 C C7    . DT  C 3   ? 0.2758 0.2458 0.2210 -0.0173 0.0265  0.0404  3   DT  P C7    
2949 C C6    . DT  C 3   ? 0.2691 0.2219 0.2240 -0.0176 0.0251  0.0320  3   DT  P C6    
2950 P P     . DA  C 4   ? 0.1835 0.1916 0.1842 -0.0433 0.0200  -0.0061 4   DA  P P     
2951 O OP1   . DA  C 4   ? 0.1761 0.1957 0.1857 -0.0516 0.0200  -0.0163 4   DA  P OP1   
2952 O OP2   . DA  C 4   ? 0.1704 0.1874 0.1694 -0.0433 0.0207  0.0006  4   DA  P OP2   
2953 O "O5'" . DA  C 4   ? 0.1707 0.1808 0.1686 -0.0317 0.0143  -0.0054 4   DA  P "O5'" 
2954 C "C5'" . DA  C 4   ? 0.1764 0.1819 0.1755 -0.0286 0.0131  -0.0120 4   DA  P "C5'" 
2955 C "C4'" . DA  C 4   ? 0.1673 0.1862 0.1673 -0.0196 0.0079  -0.0115 4   DA  P "C4'" 
2956 O "O4'" . DA  C 4   ? 0.1765 0.1871 0.1702 -0.0113 0.0065  -0.0040 4   DA  P "O4'" 
2957 C "C3'" . DA  C 4   ? 0.1423 0.1835 0.1469 -0.0214 0.0049  -0.0105 4   DA  P "C3'" 
2958 O "O3'" . DA  C 4   ? 0.1358 0.1916 0.1455 -0.0234 0.0037  -0.0175 4   DA  P "O3'" 
2959 C "C2'" . DA  C 4   ? 0.1355 0.1807 0.1381 -0.0136 0.0014  -0.0054 4   DA  P "C2'" 
2960 C "C1'" . DA  C 4   ? 0.1506 0.1774 0.1460 -0.0088 0.0025  -0.0007 4   DA  P "C1'" 
2961 N N9    . DA  C 4   ? 0.1522 0.1748 0.1423 -0.0101 0.0035  0.0057  4   DA  P N9    
2962 C C8    . DA  C 4   ? 0.1564 0.1835 0.1478 -0.0170 0.0059  0.0065  4   DA  P C8    
2963 N N7    . DA  C 4   ? 0.1766 0.1990 0.1613 -0.0158 0.0070  0.0123  4   DA  P N7    
2964 C C5    . DA  C 4   ? 0.1904 0.2048 0.1686 -0.0076 0.0045  0.0158  4   DA  P C5    
2965 C C6    . DA  C 4   ? 0.2244 0.2332 0.1926 -0.0018 0.0035  0.0221  4   DA  P C6    
2966 N N6    . DA  C 4   ? 0.2188 0.2279 0.1813 -0.0042 0.0060  0.0258  4   DA  P N6    
2967 N N1    . DA  C 4   ? 0.2606 0.2657 0.2247 0.0073  -0.0001 0.0241  4   DA  P N1    
2968 C C2    . DA  C 4   ? 0.2243 0.2308 0.1945 0.0106  -0.0019 0.0198  4   DA  P C2    
2969 N N3    . DA  C 4   ? 0.2124 0.2233 0.1914 0.0055  -0.0006 0.0134  4   DA  P N3    
2970 C C4    . DA  C 4   ? 0.1836 0.1983 0.1658 -0.0037 0.0023  0.0119  4   DA  P C4    
2971 O OP3   . DG  D 1   ? 0.3308 0.4446 0.2615 0.1147  0.0509  -0.0564 1   DG  D OP3   
2972 P P     . DG  D 1   ? 0.3298 0.4489 0.2555 0.0995  0.0507  -0.0515 1   DG  D P     
2973 O OP1   . DG  D 1   ? 0.3069 0.4573 0.2436 0.0946  0.0572  -0.0441 1   DG  D OP1   
2974 O OP2   . DG  D 1   ? 0.3258 0.4349 0.2331 0.1004  0.0511  -0.0600 1   DG  D OP2   
2975 O "O5'" . DG  D 1   ? 0.2958 0.3953 0.2252 0.0879  0.0423  -0.0454 1   DG  D "O5'" 
2976 C "C5'" . DG  D 1   ? 0.2625 0.3648 0.2063 0.0861  0.0396  -0.0381 1   DG  D "C5'" 
2977 C "C4'" . DG  D 1   ? 0.2429 0.3170 0.1855 0.0840  0.0322  -0.0379 1   DG  D "C4'" 
2978 O "O4'" . DG  D 1   ? 0.2408 0.3044 0.1775 0.0712  0.0278  -0.0366 1   DG  D "O4'" 
2979 C "C3'" . DG  D 1   ? 0.2683 0.3190 0.2021 0.0945  0.0313  -0.0470 1   DG  D "C3'" 
2980 O "O3'" . DG  D 1   ? 0.2787 0.3107 0.2176 0.0963  0.0273  -0.0432 1   DG  D "O3'" 
2981 C "C2'" . DG  D 1   ? 0.2757 0.3125 0.1962 0.0869  0.0285  -0.0541 1   DG  D "C2'" 
2982 C "C1'" . DG  D 1   ? 0.2642 0.3064 0.1889 0.0724  0.0248  -0.0457 1   DG  D "C1'" 
2983 N N9    . DG  D 1   ? 0.2542 0.3029 0.1689 0.0659  0.0246  -0.0475 1   DG  D N9    
2984 C C8    . DG  D 1   ? 0.2747 0.3390 0.1806 0.0697  0.0303  -0.0501 1   DG  D C8    
2985 N N7    . DG  D 1   ? 0.2752 0.3420 0.1717 0.0629  0.0286  -0.0490 1   DG  D N7    
2986 C C5    . DG  D 1   ? 0.2668 0.3202 0.1675 0.0544  0.0211  -0.0463 1   DG  D C5    
2987 C C6    . DG  D 1   ? 0.2894 0.3409 0.1848 0.0463  0.0159  -0.0441 1   DG  D C6    
2988 O O6    . DG  D 1   ? 0.2815 0.3410 0.1653 0.0455  0.0164  -0.0433 1   DG  D O6    
2989 N N1    . DG  D 1   ? 0.2391 0.2791 0.1434 0.0397  0.0097  -0.0422 1   DG  D N1    
2990 C C2    . DG  D 1   ? 0.2353 0.2655 0.1506 0.0403  0.0091  -0.0414 1   DG  D C2    
2991 N N2    . DG  D 1   ? 0.2449 0.2661 0.1669 0.0329  0.0038  -0.0389 1   DG  D N2    
2992 N N3    . DG  D 1   ? 0.2401 0.2703 0.1590 0.0486  0.0135  -0.0424 1   DG  D N3    
2993 C C4    . DG  D 1   ? 0.2554 0.2982 0.1675 0.0554  0.0192  -0.0452 1   DG  D C4    
2994 P P     . DC  D 2   ? 0.2986 0.3039 0.2318 0.1097  0.0275  -0.0496 2   DC  D P     
2995 O OP1   . DC  D 2   ? 0.3240 0.3257 0.2659 0.1157  0.0262  -0.0404 2   DC  D OP1   
2996 O OP2   . DC  D 2   ? 0.3203 0.3318 0.2462 0.1218  0.0327  -0.0598 2   DC  D OP2   
2997 O "O5'" . DC  D 2   ? 0.3366 0.3116 0.2617 0.0986  0.0226  -0.0546 2   DC  D "O5'" 
2998 C "C5'" . DC  D 2   ? 0.3034 0.2712 0.2345 0.0868  0.0181  -0.0462 2   DC  D "C5'" 
2999 C "C4'" . DC  D 2   ? 0.3285 0.2848 0.2543 0.0728  0.0138  -0.0515 2   DC  D "C4'" 
3000 O "O4'" . DC  D 2   ? 0.2883 0.2634 0.2089 0.0688  0.0140  -0.0556 2   DC  D "O4'" 
3001 C "C3'" . DC  D 2   ? 0.3712 0.2968 0.2886 0.0726  0.0124  -0.0624 2   DC  D "C3'" 
3002 O "O3'" . DC  D 2   ? 0.3583 0.2641 0.2810 0.0653  0.0101  -0.0564 2   DC  D "O3'" 
3003 C "C2'" . DC  D 2   ? 0.3453 0.2772 0.2550 0.0633  0.0091  -0.0720 2   DC  D "C2'" 
3004 C "C1'" . DC  D 2   ? 0.2967 0.2589 0.2109 0.0593  0.0093  -0.0630 2   DC  D "C1'" 
3005 N N1    . DC  D 2   ? 0.2962 0.2743 0.2008 0.0589  0.0096  -0.0687 2   DC  D N1    
3006 C C2    . DC  D 2   ? 0.2866 0.2718 0.1889 0.0482  0.0047  -0.0681 2   DC  D C2    
3007 O O2    . DC  D 2   ? 0.2786 0.2569 0.1882 0.0388  0.0003  -0.0644 2   DC  D O2    
3008 N N3    . DC  D 2   ? 0.2886 0.2885 0.1803 0.0492  0.0052  -0.0715 2   DC  D N3    
3009 C C4    . DC  D 2   ? 0.2982 0.3069 0.1821 0.0590  0.0110  -0.0752 2   DC  D C4    
3010 N N4    . DC  D 2   ? 0.3018 0.3252 0.1736 0.0596  0.0120  -0.0771 2   DC  D N4    
3011 C C5    . DC  D 2   ? 0.3371 0.3411 0.2247 0.0698  0.0164  -0.0769 2   DC  D C5    
3012 C C6    . DC  D 2   ? 0.3228 0.3113 0.2207 0.0700  0.0151  -0.0733 2   DC  D C6    
3013 P P     . DC  D 3   ? 0.4094 0.2779 0.3267 0.0611  0.0091  -0.0648 3   DC  D P     
3014 O OP1   . DC  D 3   ? 0.4003 0.2536 0.3242 0.0576  0.0095  -0.0529 3   DC  D OP1   
3015 O OP2   . DC  D 3   ? 0.4300 0.2847 0.3374 0.0736  0.0121  -0.0772 3   DC  D OP2   
3016 O "O5'" . DC  D 3   ? 0.3803 0.2526 0.2959 0.0449  0.0039  -0.0734 3   DC  D "O5'" 
3017 C "C5'" . DC  D 3   ? 0.3808 0.2686 0.3045 0.0326  0.0004  -0.0654 3   DC  D "C5'" 
3018 C "C4'" . DC  D 3   ? 0.4141 0.3046 0.3353 0.0202  -0.0049 -0.0760 3   DC  D "C4'" 
3019 O "O4'" . DC  D 3   ? 0.3982 0.3109 0.3121 0.0246  -0.0060 -0.0811 3   DC  D "O4'" 
3020 C "C3'" . DC  D 3   ? 0.4732 0.3359 0.3890 0.0157  -0.0059 -0.0903 3   DC  D "C3'" 
3021 O "O3'" . DC  D 3   ? 0.4997 0.3583 0.4231 -0.0009 -0.0097 -0.0910 3   DC  D "O3'" 
3022 C "C2'" . DC  D 3   ? 0.4781 0.3511 0.3821 0.0199  -0.0080 -0.1049 3   DC  D "C2'" 
3023 C "C1'" . DC  D 3   ? 0.4215 0.3283 0.3269 0.0202  -0.0097 -0.0966 3   DC  D "C1'" 
3024 N N1    . DC  D 3   ? 0.3474 0.2710 0.2411 0.0302  -0.0082 -0.1019 3   DC  D N1    
3025 C C2    . DC  D 3   ? 0.3380 0.2835 0.2261 0.0262  -0.0126 -0.1041 3   DC  D C2    
3026 O O2    . DC  D 3   ? 0.3296 0.2806 0.2232 0.0152  -0.0183 -0.1032 3   DC  D O2    
3027 N N3    . DC  D 3   ? 0.3404 0.3012 0.2166 0.0352  -0.0101 -0.1069 3   DC  D N3    
3028 C C4    . DC  D 3   ? 0.3494 0.3071 0.2213 0.0473  -0.0034 -0.1082 3   DC  D C4    
3029 N N4    . DC  D 3   ? 0.3524 0.3277 0.2126 0.0552  -0.0001 -0.1105 3   DC  D N4    
3030 C C5    . DC  D 3   ? 0.3581 0.2951 0.2368 0.0526  0.0005  -0.1068 3   DC  D C5    
3031 C C6    . DC  D 3   ? 0.3611 0.2808 0.2499 0.0441  -0.0021 -0.1030 3   DC  D C6    
3032 P P     . DG  D 4   ? 0.6126 0.4383 0.5356 -0.0114 -0.0098 -0.1024 4   DG  D P     
3033 O OP1   . DG  D 4   ? 0.6244 0.4485 0.5596 -0.0259 -0.0102 -0.0934 4   DG  D OP1   
3034 O OP2   . DG  D 4   ? 0.5895 0.3853 0.5039 0.0006  -0.0047 -0.1071 4   DG  D OP2   
3035 O "O5'" . DG  D 4   ? 0.5118 0.3501 0.4298 -0.0192 -0.0165 -0.1203 4   DG  D "O5'" 
3036 C "C5'" . DG  D 4   ? 0.4545 0.3229 0.3785 -0.0282 -0.0224 -0.1186 4   DG  D "C5'" 
3037 C "C4'" . DG  D 4   ? 0.4923 0.3715 0.4085 -0.0321 -0.0289 -0.1367 4   DG  D "C4'" 
3038 O "O4'" . DG  D 4   ? 0.4595 0.3545 0.3627 -0.0175 -0.0285 -0.1380 4   DG  D "O4'" 
3039 C "C3'" . DG  D 4   ? 0.5644 0.4140 0.4756 -0.0379 -0.0289 -0.1548 4   DG  D "C3'" 
3040 O "O3'" . DG  D 4   ? 0.6154 0.4775 0.5288 -0.0519 -0.0366 -0.1696 4   DG  D "O3'" 
3041 C "C2'" . DG  D 4   ? 0.5480 0.3920 0.4431 -0.0210 -0.0260 -0.1625 4   DG  D "C2'" 
3042 C "C1'" . DG  D 4   ? 0.5020 0.3834 0.3926 -0.0138 -0.0289 -0.1559 4   DG  D "C1'" 
3043 N N9    . DG  D 4   ? 0.4598 0.3460 0.3387 0.0037  -0.0238 -0.1538 4   DG  D N9    
3044 C C8    . DG  D 4   ? 0.4705 0.3374 0.3472 0.0159  -0.0164 -0.1505 4   DG  D C8    
3045 N N7    . DG  D 4   ? 0.4289 0.3105 0.2958 0.0298  -0.0129 -0.1502 4   DG  D N7    
3046 C C5    . DG  D 4   ? 0.4169 0.3264 0.2777 0.0264  -0.0180 -0.1524 4   DG  D C5    
3047 C C6    . DG  D 4   ? 0.4108 0.3448 0.2595 0.0361  -0.0164 -0.1518 4   DG  D C6    
3048 O O6    . DG  D 4   ? 0.4131 0.3514 0.2555 0.0491  -0.0096 -0.1499 4   DG  D O6    
3049 N N1    . DG  D 4   ? 0.4029 0.3592 0.2469 0.0297  -0.0232 -0.1532 4   DG  D N1    
3050 C C2    . DG  D 4   ? 0.4216 0.3795 0.2735 0.0160  -0.0311 -0.1559 4   DG  D C2    
3051 N N2    . DG  D 4   ? 0.3931 0.3760 0.2388 0.0138  -0.0375 -0.1564 4   DG  D N2    
3052 N N3    . DG  D 4   ? 0.4036 0.3413 0.2686 0.0057  -0.0323 -0.1572 4   DG  D N3    
3053 C C4    . DG  D 4   ? 0.4363 0.3491 0.3043 0.0114  -0.0253 -0.1548 4   DG  D C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   129 ?   ?   ?   A . n 
A 1 2   SER 2   130 ?   ?   ?   A . n 
A 1 3   ALA 3   131 ?   ?   ?   A . n 
A 1 4   ALA 4   132 ?   ?   ?   A . n 
A 1 5   ALA 5   133 ?   ?   ?   A . n 
A 1 6   SER 6   134 ?   ?   ?   A . n 
A 1 7   PRO 7   135 ?   ?   ?   A . n 
A 1 8   ALA 8   136 ?   ?   ?   A . n 
A 1 9   TRP 9   137 ?   ?   ?   A . n 
A 1 10  MET 10  138 138 MET MET A . n 
A 1 11  PRO 11  139 139 PRO PRO A . n 
A 1 12  ALA 12  140 140 ALA ALA A . n 
A 1 13  TYR 13  141 141 TYR TYR A . n 
A 1 14  ALA 14  142 142 ALA ALA A . n 
A 1 15  CYS 15  143 143 CYS CYS A . n 
A 1 16  GLN 16  144 144 GLN GLN A . n 
A 1 17  ARG 17  145 145 ARG ARG A . n 
A 1 18  PRO 18  146 146 PRO PRO A . n 
A 1 19  THR 19  147 147 THR THR A . n 
A 1 20  PRO 20  148 148 PRO PRO A . n 
A 1 21  LEU 21  149 149 LEU LEU A . n 
A 1 22  THR 22  150 150 THR THR A . n 
A 1 23  HIS 23  151 151 HIS HIS A . n 
A 1 24  HIS 24  152 152 HIS HIS A . n 
A 1 25  ASN 25  153 153 ASN ASN A . n 
A 1 26  THR 26  154 154 THR THR A . n 
A 1 27  GLY 27  155 155 GLY GLY A . n 
A 1 28  LEU 28  156 156 LEU LEU A . n 
A 1 29  SER 29  157 157 SER SER A . n 
A 1 30  GLU 30  158 158 GLU GLU A . n 
A 1 31  ALA 31  159 159 ALA ALA A . n 
A 1 32  LEU 32  160 160 LEU LEU A . n 
A 1 33  GLU 33  161 161 GLU GLU A . n 
A 1 34  ILE 34  162 162 ILE ILE A . n 
A 1 35  LEU 35  163 163 LEU LEU A . n 
A 1 36  ALA 36  164 164 ALA ALA A . n 
A 1 37  GLU 37  165 165 GLU GLU A . n 
A 1 38  ALA 38  166 166 ALA ALA A . n 
A 1 39  ALA 39  167 167 ALA ALA A . n 
A 1 40  GLY 40  168 168 GLY GLY A . n 
A 1 41  PHE 41  169 169 PHE PHE A . n 
A 1 42  GLU 42  170 170 GLU GLU A . n 
A 1 43  GLY 43  171 171 GLY GLY A . n 
A 1 44  SER 44  172 172 SER SER A . n 
A 1 45  GLU 45  173 173 GLU GLU A . n 
A 1 46  GLY 46  174 174 GLY GLY A . n 
A 1 47  ARG 47  175 175 ARG ARG A . n 
A 1 48  LEU 48  176 176 LEU LEU A . n 
A 1 49  LEU 49  177 177 LEU LEU A . n 
A 1 50  THR 50  178 178 THR THR A . n 
A 1 51  PHE 51  179 179 PHE PHE A . n 
A 1 52  CYS 52  180 180 CYS CYS A . n 
A 1 53  ARG 53  181 181 ARG ARG A . n 
A 1 54  ALA 54  182 182 ALA ALA A . n 
A 1 55  ALA 55  183 183 ALA ALA A . n 
A 1 56  SER 56  184 184 SER SER A . n 
A 1 57  VAL 57  185 185 VAL VAL A . n 
A 1 58  LEU 58  186 186 LEU LEU A . n 
A 1 59  LYS 59  187 187 LYS LYS A . n 
A 1 60  ALA 60  188 188 ALA ALA A . n 
A 1 61  LEU 61  189 189 LEU LEU A . n 
A 1 62  PRO 62  190 190 PRO PRO A . n 
A 1 63  SER 63  191 191 SER SER A . n 
A 1 64  PRO 64  192 192 PRO PRO A . n 
A 1 65  VAL 65  193 193 VAL VAL A . n 
A 1 66  THR 66  194 194 THR THR A . n 
A 1 67  THR 67  195 195 THR THR A . n 
A 1 68  LEU 68  196 196 LEU LEU A . n 
A 1 69  SER 69  197 197 SER SER A . n 
A 1 70  GLN 70  198 198 GLN GLN A . n 
A 1 71  LEU 71  199 199 LEU LEU A . n 
A 1 72  GLN 72  200 200 GLN GLN A . n 
A 1 73  GLY 73  201 201 GLY GLY A . n 
A 1 74  LEU 74  202 202 LEU LEU A . n 
A 1 75  PRO 75  203 203 PRO PRO A . n 
A 1 76  HIS 76  204 204 HIS HIS A . n 
A 1 77  PHE 77  205 205 PHE PHE A . n 
A 1 78  GLY 78  206 206 GLY GLY A . n 
A 1 79  GLU 79  207 207 GLU GLU A . n 
A 1 80  HIS 80  208 208 HIS HIS A . n 
A 1 81  SER 81  209 209 SER SER A . n 
A 1 82  SER 82  210 210 SER SER A . n 
A 1 83  ARG 83  211 211 ARG ARG A . n 
A 1 84  VAL 84  212 212 VAL VAL A . n 
A 1 85  VAL 85  213 213 VAL VAL A . n 
A 1 86  GLN 86  214 214 GLN GLN A . n 
A 1 87  GLU 87  215 215 GLU GLU A . n 
A 1 88  LEU 88  216 216 LEU LEU A . n 
A 1 89  LEU 89  217 217 LEU LEU A . n 
A 1 90  GLU 90  218 218 GLU GLU A . n 
A 1 91  HIS 91  219 219 HIS HIS A . n 
A 1 92  GLY 92  220 220 GLY GLY A . n 
A 1 93  VAL 93  221 221 VAL VAL A . n 
A 1 94  CYS 94  222 222 CYS CYS A . n 
A 1 95  GLU 95  223 223 GLU GLU A . n 
A 1 96  GLU 96  224 224 GLU GLU A . n 
A 1 97  VAL 97  225 225 VAL VAL A . n 
A 1 98  GLU 98  226 226 GLU GLU A . n 
A 1 99  ARG 99  227 227 ARG ARG A . n 
A 1 100 VAL 100 228 228 VAL VAL A . n 
A 1 101 ARG 101 229 229 ARG ARG A . n 
A 1 102 ARG 102 230 230 ARG ARG A . n 
A 1 103 SER 103 231 231 SER SER A . n 
A 1 104 GLU 104 232 232 GLU GLU A . n 
A 1 105 ARG 105 233 233 ARG ARG A . n 
A 1 106 TYR 106 234 234 TYR TYR A . n 
A 1 107 GLN 107 235 235 GLN GLN A . n 
A 1 108 THR 108 236 236 THR THR A . n 
A 1 109 MET 109 237 237 MET MET A . n 
A 1 110 LYS 110 238 238 LYS LYS A . n 
A 1 111 LEU 111 239 239 LEU LEU A . n 
A 1 112 PHE 112 240 240 PHE PHE A . n 
A 1 113 THR 113 241 241 THR THR A . n 
A 1 114 GLN 114 242 242 GLN GLN A . n 
A 1 115 ILE 115 243 243 ILE ILE A . n 
A 1 116 PHE 116 244 244 PHE PHE A . n 
A 1 117 GLY 117 245 245 GLY GLY A . n 
A 1 118 VAL 118 246 246 VAL VAL A . n 
A 1 119 GLY 119 247 247 GLY GLY A . n 
A 1 120 VAL 120 248 248 VAL VAL A . n 
A 1 121 LYS 121 249 249 LYS LYS A . n 
A 1 122 THR 122 250 250 THR THR A . n 
A 1 123 ALA 123 251 251 ALA ALA A . n 
A 1 124 ASP 124 252 252 ASP ASP A . n 
A 1 125 ARG 125 253 253 ARG ARG A . n 
A 1 126 TRP 126 254 254 TRP TRP A . n 
A 1 127 TYR 127 255 255 TYR TYR A . n 
A 1 128 ARG 128 256 256 ARG ARG A . n 
A 1 129 GLU 129 257 257 GLU GLU A . n 
A 1 130 GLY 130 258 258 GLY GLY A . n 
A 1 131 LEU 131 259 259 LEU LEU A . n 
A 1 132 ARG 132 260 260 ARG ARG A . n 
A 1 133 THR 133 261 261 THR THR A . n 
A 1 134 LEU 134 262 262 LEU LEU A . n 
A 1 135 ASP 135 263 263 ASP ASP A . n 
A 1 136 ASP 136 264 264 ASP ASP A . n 
A 1 137 LEU 137 265 265 LEU LEU A . n 
A 1 138 ARG 138 266 266 ARG ARG A . n 
A 1 139 GLU 139 267 267 GLU GLU A . n 
A 1 140 GLN 140 268 268 GLN GLN A . n 
A 1 141 PRO 141 269 269 PRO PRO A . n 
A 1 142 GLN 142 270 270 GLN GLN A . n 
A 1 143 LYS 143 271 271 LYS LYS A . n 
A 1 144 LEU 144 272 272 LEU LEU A . n 
A 1 145 THR 145 273 273 THR THR A . n 
A 1 146 GLN 146 274 274 GLN GLN A . n 
A 1 147 GLN 147 275 275 GLN GLN A . n 
A 1 148 GLN 148 276 276 GLN GLN A . n 
A 1 149 LYS 149 277 277 LYS LYS A . n 
A 1 150 ALA 150 278 278 ALA ALA A . n 
A 1 151 GLY 151 279 279 GLY GLY A . n 
A 1 152 LEU 152 280 280 LEU LEU A . n 
A 1 153 GLN 153 281 281 GLN GLN A . n 
A 1 154 HIS 154 282 282 HIS HIS A . n 
A 1 155 HIS 155 283 283 HIS HIS A . n 
A 1 156 GLN 156 284 284 GLN GLN A . n 
A 1 157 ASP 157 285 285 ASP ASP A . n 
A 1 158 LEU 158 286 286 LEU LEU A . n 
A 1 159 SER 159 287 287 SER SER A . n 
A 1 160 THR 160 288 288 THR THR A . n 
A 1 161 PRO 161 289 289 PRO PRO A . n 
A 1 162 VAL 162 290 290 VAL VAL A . n 
A 1 163 LEU 163 291 291 LEU LEU A . n 
A 1 164 ARG 164 292 292 ARG ARG A . n 
A 1 165 SER 165 293 293 SER SER A . n 
A 1 166 ASP 166 294 294 ASP ASP A . n 
A 1 167 VAL 167 295 295 VAL VAL A . n 
A 1 168 ASP 168 296 296 ASP ASP A . n 
A 1 169 ALA 169 297 297 ALA ALA A . n 
A 1 170 LEU 170 298 298 LEU LEU A . n 
A 1 171 GLN 171 299 299 GLN GLN A . n 
A 1 172 GLN 172 300 300 GLN GLN A . n 
A 1 173 VAL 173 301 301 VAL VAL A . n 
A 1 174 VAL 174 302 302 VAL VAL A . n 
A 1 175 GLU 175 303 303 GLU GLU A . n 
A 1 176 GLU 176 304 304 GLU GLU A . n 
A 1 177 ALA 177 305 305 ALA ALA A . n 
A 1 178 VAL 178 306 306 VAL VAL A . n 
A 1 179 GLY 179 307 307 GLY GLY A . n 
A 1 180 GLN 180 308 308 GLN GLN A . n 
A 1 181 ALA 181 309 309 ALA ALA A . n 
A 1 182 LEU 182 310 310 LEU LEU A . n 
A 1 183 PRO 183 311 311 PRO PRO A . n 
A 1 184 GLY 184 312 312 GLY GLY A . n 
A 1 185 ALA 185 313 313 ALA ALA A . n 
A 1 186 THR 186 314 314 THR THR A . n 
A 1 187 VAL 187 315 315 VAL VAL A . n 
A 1 188 THR 188 316 316 THR THR A . n 
A 1 189 LEU 189 317 317 LEU LEU A . n 
A 1 190 THR 190 318 318 THR THR A . n 
A 1 191 GLY 191 319 319 GLY GLY A . n 
A 1 192 GLY 192 320 320 GLY GLY A . n 
A 1 193 PHE 193 321 321 PHE PHE A . n 
A 1 194 ARG 194 322 322 ARG ARG A . n 
A 1 195 ARG 195 323 323 ARG ARG A . n 
A 1 196 GLY 196 324 324 GLY GLY A . n 
A 1 197 LYS 197 325 325 LYS LYS A . n 
A 1 198 LEU 198 326 326 LEU LEU A . n 
A 1 199 GLN 199 327 327 GLN GLN A . n 
A 1 200 GLY 200 328 328 GLY GLY A . n 
A 1 201 HIS 201 329 329 HIS HIS A . n 
A 1 202 ASP 202 330 330 ASP ASP A . n 
A 1 203 VAL 203 331 331 VAL VAL A . n 
A 1 204 ASP 204 332 332 ASP ASP A . n 
A 1 205 PHE 205 333 333 PHE PHE A . n 
A 1 206 LEU 206 334 334 LEU LEU A . n 
A 1 207 ILE 207 335 335 ILE ILE A . n 
A 1 208 THR 208 336 336 THR THR A . n 
A 1 209 HIS 209 337 337 HIS HIS A . n 
A 1 210 PRO 210 338 338 PRO PRO A . n 
A 1 211 LYS 211 339 339 LYS LYS A . n 
A 1 212 GLU 212 340 340 GLU GLU A . n 
A 1 213 GLY 213 341 341 GLY GLY A . n 
A 1 214 GLN 214 342 342 GLN GLN A . n 
A 1 215 GLU 215 343 343 GLU GLU A . n 
A 1 216 ALA 216 344 344 ALA ALA A . n 
A 1 217 GLY 217 345 345 GLY GLY A . n 
A 1 218 LEU 218 346 346 LEU LEU A . n 
A 1 219 LEU 219 347 347 LEU LEU A . n 
A 1 220 PRO 220 348 348 PRO PRO A . n 
A 1 221 ARG 221 349 349 ARG ARG A . n 
A 1 222 VAL 222 350 350 VAL VAL A . n 
A 1 223 MET 223 351 351 MET MET A . n 
A 1 224 CYS 224 352 352 CYS CYS A . n 
A 1 225 ARG 225 353 353 ARG ARG A . n 
A 1 226 LEU 226 354 354 LEU LEU A . n 
A 1 227 GLN 227 355 355 GLN GLN A . n 
A 1 228 ASP 228 356 356 ASP ASP A . n 
A 1 229 GLN 229 357 357 GLN GLN A . n 
A 1 230 GLY 230 358 358 GLY GLY A . n 
A 1 231 LEU 231 359 359 LEU LEU A . n 
A 1 232 ILE 232 360 360 ILE ILE A . n 
A 1 233 LEU 233 361 361 LEU LEU A . n 
A 1 234 TYR 234 362 362 TYR TYR A . n 
A 1 235 HIS 235 363 363 HIS HIS A . n 
A 1 236 GLN 236 364 364 GLN GLN A . n 
A 1 237 HIS 237 365 365 HIS HIS A . n 
A 1 238 GLN 238 366 366 GLN GLN A . n 
A 1 239 HIS 239 367 367 HIS HIS A . n 
A 1 240 SER 240 368 368 SER SER A . n 
A 1 241 CYS 241 369 369 CYS CYS A . n 
A 1 242 CYS 242 370 ?   ?   ?   A . n 
A 1 243 GLU 243 371 ?   ?   ?   A . n 
A 1 244 SER 244 372 ?   ?   ?   A . n 
A 1 245 PRO 245 373 ?   ?   ?   A . n 
A 1 246 THR 246 374 ?   ?   ?   A . n 
A 1 247 ARG 247 375 ?   ?   ?   A . n 
A 1 248 LEU 248 376 ?   ?   ?   A . n 
A 1 249 ALA 249 377 ?   ?   ?   A . n 
A 1 250 GLN 250 378 ?   ?   ?   A . n 
A 1 251 GLN 251 379 ?   ?   ?   A . n 
A 1 252 SER 252 380 ?   ?   ?   A . n 
A 1 253 HIS 253 381 381 HIS HIS A . n 
A 1 254 MET 254 382 382 MET MET A . n 
A 1 255 ASP 255 383 383 ASP ASP A . n 
A 1 256 ALA 256 384 384 ALA ALA A . n 
A 1 257 PHE 257 385 385 PHE PHE A . n 
A 1 258 GLU 258 386 386 GLU GLU A . n 
A 1 259 ARG 259 387 387 ARG ARG A . n 
A 1 260 SER 260 388 388 SER SER A . n 
A 1 261 PHE 261 389 389 PHE PHE A . n 
A 1 262 CYS 262 390 390 CYS CYS A . n 
A 1 263 ILE 263 391 391 ILE ILE A . n 
A 1 264 PHE 264 392 392 PHE PHE A . n 
A 1 265 ARG 265 393 393 ARG ARG A . n 
A 1 266 LEU 266 394 394 LEU LEU A . n 
A 1 267 PRO 267 395 395 PRO PRO A . n 
A 1 268 GLN 268 396 396 GLN GLN A . n 
A 1 269 PRO 269 397 397 PRO PRO A . n 
A 1 270 GLY 270 410 410 GLY GLY A . n 
A 1 271 SER 271 411 411 SER SER A . n 
A 1 272 TRP 272 412 412 TRP TRP A . n 
A 1 273 LYS 273 413 413 LYS LYS A . n 
A 1 274 ALA 274 414 414 ALA ALA A . n 
A 1 275 VAL 275 415 415 VAL VAL A . n 
A 1 276 ARG 276 416 416 ARG ARG A . n 
A 1 277 VAL 277 417 417 VAL VAL A . n 
A 1 278 ASP 278 418 418 ASP ASP A . n 
A 1 279 LEU 279 419 419 LEU LEU A . n 
A 1 280 VAL 280 420 420 VAL VAL A . n 
A 1 281 VAL 281 421 421 VAL VAL A . n 
A 1 282 ALA 282 422 422 ALA ALA A . n 
A 1 283 PRO 283 423 423 PRO PRO A . n 
A 1 284 VAL 284 424 424 VAL VAL A . n 
A 1 285 SER 285 425 425 SER SER A . n 
A 1 286 GLN 286 426 426 GLN GLN A . n 
A 1 287 PHE 287 427 427 PHE PHE A . n 
A 1 288 PRO 288 428 428 PRO PRO A . n 
A 1 289 PHE 289 429 429 PHE PHE A . n 
A 1 290 ALA 290 430 430 ALA ALA A . n 
A 1 291 LEU 291 431 431 LEU LEU A . n 
A 1 292 LEU 292 432 432 LEU LEU A . n 
A 1 293 GLY 293 433 433 GLY GLY A . n 
A 1 294 TRP 294 434 434 TRP TRP A . n 
A 1 295 THR 295 435 435 THR THR A . n 
A 1 296 GLY 296 436 436 GLY GLY A . n 
A 1 297 SER 297 437 437 SER SER A . n 
A 1 298 LYS 298 438 438 LYS LYS A . n 
A 1 299 LEU 299 439 439 LEU LEU A . n 
A 1 300 PHE 300 440 440 PHE PHE A . n 
A 1 301 GLN 301 441 441 GLN GLN A . n 
A 1 302 ARG 302 442 442 ARG ARG A . n 
A 1 303 GLU 303 443 443 GLU GLU A . n 
A 1 304 LEU 304 444 444 LEU LEU A . n 
A 1 305 ARG 305 445 445 ARG ARG A . n 
A 1 306 ARG 306 446 446 ARG ARG A . n 
A 1 307 PHE 307 447 447 PHE PHE A . n 
A 1 308 SER 308 448 448 SER SER A . n 
A 1 309 ARG 309 449 449 ARG ARG A . n 
A 1 310 LYS 310 450 450 LYS LYS A . n 
A 1 311 GLU 311 451 451 GLU GLU A . n 
A 1 312 LYS 312 452 452 LYS LYS A . n 
A 1 313 GLY 313 453 453 GLY GLY A . n 
A 1 314 LEU 314 454 454 LEU LEU A . n 
A 1 315 TRP 315 455 455 TRP TRP A . n 
A 1 316 LEU 316 456 456 LEU LEU A . n 
A 1 317 ASN 317 457 457 ASN ASN A . n 
A 1 318 SER 318 458 458 SER SER A . n 
A 1 319 HIS 319 459 459 HIS HIS A . n 
A 1 320 GLY 320 460 460 GLY GLY A . n 
A 1 321 LEU 321 461 461 LEU LEU A . n 
A 1 322 PHE 322 462 462 PHE PHE A . n 
A 1 323 ASP 323 463 463 ASP ASP A . n 
A 1 324 PRO 324 464 464 PRO PRO A . n 
A 1 325 GLU 325 465 465 GLU GLU A . n 
A 1 326 GLN 326 466 466 GLN GLN A . n 
A 1 327 LYS 327 467 467 LYS LYS A . n 
A 1 328 THR 328 468 468 THR THR A . n 
A 1 329 PHE 329 469 469 PHE PHE A . n 
A 1 330 PHE 330 470 470 PHE PHE A . n 
A 1 331 GLN 331 471 471 GLN GLN A . n 
A 1 332 ALA 332 472 472 ALA ALA A . n 
A 1 333 ALA 333 473 473 ALA ALA A . n 
A 1 334 SER 334 474 474 SER SER A . n 
A 1 335 GLU 335 475 475 GLU GLU A . n 
A 1 336 GLU 336 476 476 GLU GLU A . n 
A 1 337 ASP 337 477 477 ASP ASP A . n 
A 1 338 ILE 338 478 478 ILE ILE A . n 
A 1 339 PHE 339 479 479 PHE PHE A . n 
A 1 340 ARG 340 480 480 ARG ARG A . n 
A 1 341 HIS 341 481 481 HIS HIS A . n 
A 1 342 LEU 342 482 482 LEU LEU A . n 
A 1 343 GLY 343 483 483 GLY GLY A . n 
A 1 344 LEU 344 484 484 LEU LEU A . n 
A 1 345 GLU 345 485 485 GLU GLU A . n 
A 1 346 TYR 346 486 486 TYR TYR A . n 
A 1 347 LEU 347 487 487 LEU LEU A . n 
A 1 348 PRO 348 488 488 PRO PRO A . n 
A 1 349 PRO 349 489 489 PRO PRO A . n 
A 1 350 GLU 350 490 490 GLU GLU A . n 
A 1 351 GLN 351 491 491 GLN GLN A . n 
A 1 352 ARG 352 492 492 ARG ARG A . n 
A 1 353 ASN 353 493 493 ASN ASN A . n 
A 1 354 ALA 354 494 494 ALA ALA A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DG  2   2   2   DG  DG  T . n 
B 2 3   DG  3   3   3   DG  DG  T . n 
B 2 4   DC  4   4   4   DC  DC  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DA  6   6   6   DA  DA  T . n 
B 2 7   DT  7   7   7   DT  DT  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
C 3 1   DC  1   1   1   DC  DC  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DT  3   3   3   DT  DT  P . n 
C 3 4   DA  4   4   4   DA  DA  P . n 
D 4 1   DG  1   1   1   DG  DG  D . n 
D 4 2   DC  2   2   2   DC  DC  D . n 
D 4 3   DC  3   3   3   DC  DC  D . n 
D 4 4   DG  4   4   4   DG  DG  D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5  MG  1   601  601  MG  MG  A . 
F 5  MG  1   602  602  MG  MG  A . 
G 6  EDO 1   603  603  EDO EDO A . 
H 7  GOL 1   604  604  GOL GOL A . 
I 7  GOL 1   605  605  GOL GOL A . 
J 6  EDO 1   606  606  EDO EDO A . 
K 8  DUP 1   607  607  DUP DUP A . 
L 9  CL  1   608  608  CL  CL  A . 
M 9  CL  1   609  609  CL  CL  A . 
N 9  CL  1   610  610  CL  CL  A . 
O 9  CL  1   611  611  CL  CL  A . 
P 10 NA  1   612  612  NA  NA  A . 
Q 5  MG  1   101  101  MG  MG  T . 
R 11 HOH 1   701  701  HOH HOH A . 
R 11 HOH 2   702  779  HOH HOH A . 
R 11 HOH 3   703  918  HOH HOH A . 
R 11 HOH 4   704  1041 HOH HOH A . 
R 11 HOH 5   705  702  HOH HOH A . 
R 11 HOH 6   706  814  HOH HOH A . 
R 11 HOH 7   707  857  HOH HOH A . 
R 11 HOH 8   708  1063 HOH HOH A . 
R 11 HOH 9   709  703  HOH HOH A . 
R 11 HOH 10  710  1008 HOH HOH A . 
R 11 HOH 11  711  822  HOH HOH A . 
R 11 HOH 12  712  1001 HOH HOH A . 
R 11 HOH 13  713  1004 HOH HOH A . 
R 11 HOH 14  714  937  HOH HOH A . 
R 11 HOH 15  715  1068 HOH HOH A . 
R 11 HOH 16  716  990  HOH HOH A . 
R 11 HOH 17  717  704  HOH HOH A . 
R 11 HOH 18  718  866  HOH HOH A . 
R 11 HOH 19  719  867  HOH HOH A . 
R 11 HOH 20  720  922  HOH HOH A . 
R 11 HOH 21  721  915  HOH HOH A . 
R 11 HOH 22  722  1029 HOH HOH A . 
R 11 HOH 23  723  993  HOH HOH A . 
R 11 HOH 24  724  900  HOH HOH A . 
R 11 HOH 25  725  705  HOH HOH A . 
R 11 HOH 26  726  1018 HOH HOH A . 
R 11 HOH 27  727  706  HOH HOH A . 
R 11 HOH 28  728  802  HOH HOH A . 
R 11 HOH 29  729  935  HOH HOH A . 
R 11 HOH 30  730  955  HOH HOH A . 
R 11 HOH 31  731  787  HOH HOH A . 
R 11 HOH 32  732  951  HOH HOH A . 
R 11 HOH 33  733  869  HOH HOH A . 
R 11 HOH 34  734  826  HOH HOH A . 
R 11 HOH 35  735  707  HOH HOH A . 
R 11 HOH 36  736  975  HOH HOH A . 
R 11 HOH 37  737  840  HOH HOH A . 
R 11 HOH 38  738  883  HOH HOH A . 
R 11 HOH 39  739  708  HOH HOH A . 
R 11 HOH 40  740  966  HOH HOH A . 
R 11 HOH 41  741  903  HOH HOH A . 
R 11 HOH 42  742  977  HOH HOH A . 
R 11 HOH 43  743  914  HOH HOH A . 
R 11 HOH 44  744  984  HOH HOH A . 
R 11 HOH 45  745  823  HOH HOH A . 
R 11 HOH 46  746  709  HOH HOH A . 
R 11 HOH 47  747  868  HOH HOH A . 
R 11 HOH 48  748  878  HOH HOH A . 
R 11 HOH 49  749  778  HOH HOH A . 
R 11 HOH 50  750  1034 HOH HOH A . 
R 11 HOH 51  751  710  HOH HOH A . 
R 11 HOH 52  752  1017 HOH HOH A . 
R 11 HOH 53  753  912  HOH HOH A . 
R 11 HOH 54  754  711  HOH HOH A . 
R 11 HOH 55  755  880  HOH HOH A . 
R 11 HOH 56  756  964  HOH HOH A . 
R 11 HOH 57  757  992  HOH HOH A . 
R 11 HOH 58  758  799  HOH HOH A . 
R 11 HOH 59  759  983  HOH HOH A . 
R 11 HOH 60  760  712  HOH HOH A . 
R 11 HOH 61  761  929  HOH HOH A . 
R 11 HOH 62  762  713  HOH HOH A . 
R 11 HOH 63  763  714  HOH HOH A . 
R 11 HOH 64  764  831  HOH HOH A . 
R 11 HOH 65  765  1033 HOH HOH A . 
R 11 HOH 66  766  794  HOH HOH A . 
R 11 HOH 67  767  965  HOH HOH A . 
R 11 HOH 68  768  891  HOH HOH A . 
R 11 HOH 69  769  856  HOH HOH A . 
R 11 HOH 70  770  775  HOH HOH A . 
R 11 HOH 71  771  864  HOH HOH A . 
R 11 HOH 72  772  789  HOH HOH A . 
R 11 HOH 73  773  792  HOH HOH A . 
R 11 HOH 74  774  715  HOH HOH A . 
R 11 HOH 75  775  841  HOH HOH A . 
R 11 HOH 76  776  829  HOH HOH A . 
R 11 HOH 77  777  785  HOH HOH A . 
R 11 HOH 78  778  716  HOH HOH A . 
R 11 HOH 79  779  717  HOH HOH A . 
R 11 HOH 80  780  788  HOH HOH A . 
R 11 HOH 81  781  901  HOH HOH A . 
R 11 HOH 82  782  855  HOH HOH A . 
R 11 HOH 83  783  865  HOH HOH A . 
R 11 HOH 84  784  819  HOH HOH A . 
R 11 HOH 85  785  863  HOH HOH A . 
R 11 HOH 86  786  875  HOH HOH A . 
R 11 HOH 87  787  859  HOH HOH A . 
R 11 HOH 88  788  909  HOH HOH A . 
R 11 HOH 89  789  850  HOH HOH A . 
R 11 HOH 90  790  1052 HOH HOH A . 
R 11 HOH 91  791  800  HOH HOH A . 
R 11 HOH 92  792  780  HOH HOH A . 
R 11 HOH 93  793  718  HOH HOH A . 
R 11 HOH 94  794  827  HOH HOH A . 
R 11 HOH 95  795  790  HOH HOH A . 
R 11 HOH 96  796  969  HOH HOH A . 
R 11 HOH 97  797  904  HOH HOH A . 
R 11 HOH 98  798  719  HOH HOH A . 
R 11 HOH 99  799  806  HOH HOH A . 
R 11 HOH 100 800  926  HOH HOH A . 
R 11 HOH 101 801  782  HOH HOH A . 
R 11 HOH 102 802  910  HOH HOH A . 
R 11 HOH 103 803  953  HOH HOH A . 
R 11 HOH 104 804  795  HOH HOH A . 
R 11 HOH 105 805  933  HOH HOH A . 
R 11 HOH 106 806  893  HOH HOH A . 
R 11 HOH 107 807  845  HOH HOH A . 
R 11 HOH 108 808  720  HOH HOH A . 
R 11 HOH 109 809  813  HOH HOH A . 
R 11 HOH 110 810  807  HOH HOH A . 
R 11 HOH 111 811  930  HOH HOH A . 
R 11 HOH 112 812  842  HOH HOH A . 
R 11 HOH 113 813  1020 HOH HOH A . 
R 11 HOH 114 814  832  HOH HOH A . 
R 11 HOH 115 815  884  HOH HOH A . 
R 11 HOH 116 816  1012 HOH HOH A . 
R 11 HOH 117 817  989  HOH HOH A . 
R 11 HOH 118 818  721  HOH HOH A . 
R 11 HOH 119 819  722  HOH HOH A . 
R 11 HOH 120 820  882  HOH HOH A . 
R 11 HOH 121 821  811  HOH HOH A . 
R 11 HOH 122 822  723  HOH HOH A . 
R 11 HOH 123 823  783  HOH HOH A . 
R 11 HOH 124 824  997  HOH HOH A . 
R 11 HOH 125 825  889  HOH HOH A . 
R 11 HOH 126 826  1009 HOH HOH A . 
R 11 HOH 127 827  786  HOH HOH A . 
R 11 HOH 128 828  815  HOH HOH A . 
R 11 HOH 129 829  804  HOH HOH A . 
R 11 HOH 130 830  818  HOH HOH A . 
R 11 HOH 131 831  724  HOH HOH A . 
R 11 HOH 132 832  816  HOH HOH A . 
R 11 HOH 133 833  1010 HOH HOH A . 
R 11 HOH 134 834  1062 HOH HOH A . 
R 11 HOH 135 835  928  HOH HOH A . 
R 11 HOH 136 836  725  HOH HOH A . 
R 11 HOH 137 837  862  HOH HOH A . 
R 11 HOH 138 838  890  HOH HOH A . 
R 11 HOH 139 839  726  HOH HOH A . 
R 11 HOH 140 840  894  HOH HOH A . 
R 11 HOH 141 841  727  HOH HOH A . 
R 11 HOH 142 842  963  HOH HOH A . 
R 11 HOH 143 843  949  HOH HOH A . 
R 11 HOH 144 844  848  HOH HOH A . 
R 11 HOH 145 845  881  HOH HOH A . 
R 11 HOH 146 846  781  HOH HOH A . 
R 11 HOH 147 847  958  HOH HOH A . 
R 11 HOH 148 848  986  HOH HOH A . 
R 11 HOH 149 849  777  HOH HOH A . 
R 11 HOH 150 850  776  HOH HOH A . 
R 11 HOH 151 851  798  HOH HOH A . 
R 11 HOH 152 852  897  HOH HOH A . 
R 11 HOH 153 853  907  HOH HOH A . 
R 11 HOH 154 854  870  HOH HOH A . 
R 11 HOH 155 855  876  HOH HOH A . 
R 11 HOH 156 856  793  HOH HOH A . 
R 11 HOH 157 857  830  HOH HOH A . 
R 11 HOH 158 858  839  HOH HOH A . 
R 11 HOH 159 859  791  HOH HOH A . 
R 11 HOH 160 860  728  HOH HOH A . 
R 11 HOH 161 861  1028 HOH HOH A . 
R 11 HOH 162 862  892  HOH HOH A . 
R 11 HOH 163 863  817  HOH HOH A . 
R 11 HOH 164 864  877  HOH HOH A . 
R 11 HOH 165 865  1014 HOH HOH A . 
R 11 HOH 166 866  970  HOH HOH A . 
R 11 HOH 167 867  1053 HOH HOH A . 
R 11 HOH 168 868  837  HOH HOH A . 
R 11 HOH 169 869  849  HOH HOH A . 
R 11 HOH 170 870  729  HOH HOH A . 
R 11 HOH 171 871  927  HOH HOH A . 
R 11 HOH 172 872  1002 HOH HOH A . 
R 11 HOH 173 873  879  HOH HOH A . 
R 11 HOH 174 874  1049 HOH HOH A . 
R 11 HOH 175 875  895  HOH HOH A . 
R 11 HOH 176 876  1067 HOH HOH A . 
R 11 HOH 177 877  730  HOH HOH A . 
R 11 HOH 178 878  805  HOH HOH A . 
R 11 HOH 179 879  1021 HOH HOH A . 
R 11 HOH 180 880  834  HOH HOH A . 
R 11 HOH 181 881  1032 HOH HOH A . 
R 11 HOH 182 882  1000 HOH HOH A . 
R 11 HOH 183 883  731  HOH HOH A . 
R 11 HOH 184 884  995  HOH HOH A . 
R 11 HOH 185 885  976  HOH HOH A . 
R 11 HOH 186 886  1042 HOH HOH A . 
R 11 HOH 187 887  732  HOH HOH A . 
R 11 HOH 188 888  944  HOH HOH A . 
R 11 HOH 189 889  1005 HOH HOH A . 
R 11 HOH 190 890  853  HOH HOH A . 
R 11 HOH 191 891  801  HOH HOH A . 
R 11 HOH 192 892  810  HOH HOH A . 
R 11 HOH 193 893  920  HOH HOH A . 
R 11 HOH 194 894  733  HOH HOH A . 
R 11 HOH 195 895  803  HOH HOH A . 
R 11 HOH 196 896  812  HOH HOH A . 
R 11 HOH 197 897  919  HOH HOH A . 
R 11 HOH 198 898  1060 HOH HOH A . 
R 11 HOH 199 899  887  HOH HOH A . 
R 11 HOH 200 900  1050 HOH HOH A . 
R 11 HOH 201 901  734  HOH HOH A . 
R 11 HOH 202 902  735  HOH HOH A . 
R 11 HOH 203 903  736  HOH HOH A . 
R 11 HOH 204 904  809  HOH HOH A . 
R 11 HOH 205 905  737  HOH HOH A . 
R 11 HOH 206 906  996  HOH HOH A . 
R 11 HOH 207 907  825  HOH HOH A . 
R 11 HOH 208 908  940  HOH HOH A . 
R 11 HOH 209 909  738  HOH HOH A . 
R 11 HOH 210 910  943  HOH HOH A . 
R 11 HOH 211 911  843  HOH HOH A . 
R 11 HOH 212 912  1025 HOH HOH A . 
R 11 HOH 213 913  971  HOH HOH A . 
R 11 HOH 214 914  833  HOH HOH A . 
R 11 HOH 215 915  921  HOH HOH A . 
R 11 HOH 216 916  739  HOH HOH A . 
R 11 HOH 217 917  852  HOH HOH A . 
R 11 HOH 218 918  917  HOH HOH A . 
R 11 HOH 219 919  740  HOH HOH A . 
R 11 HOH 220 920  874  HOH HOH A . 
R 11 HOH 221 921  1046 HOH HOH A . 
R 11 HOH 222 922  797  HOH HOH A . 
R 11 HOH 223 923  968  HOH HOH A . 
R 11 HOH 224 924  1051 HOH HOH A . 
R 11 HOH 225 925  808  HOH HOH A . 
R 11 HOH 226 926  741  HOH HOH A . 
R 11 HOH 227 927  742  HOH HOH A . 
R 11 HOH 228 928  1072 HOH HOH A . 
R 11 HOH 229 929  979  HOH HOH A . 
R 11 HOH 230 930  858  HOH HOH A . 
R 11 HOH 231 931  743  HOH HOH A . 
R 11 HOH 232 932  784  HOH HOH A . 
R 11 HOH 233 933  744  HOH HOH A . 
R 11 HOH 234 934  872  HOH HOH A . 
R 11 HOH 235 935  745  HOH HOH A . 
R 11 HOH 236 936  746  HOH HOH A . 
R 11 HOH 237 937  796  HOH HOH A . 
R 11 HOH 238 938  828  HOH HOH A . 
R 11 HOH 239 939  851  HOH HOH A . 
R 11 HOH 240 940  952  HOH HOH A . 
R 11 HOH 241 941  747  HOH HOH A . 
R 11 HOH 242 942  913  HOH HOH A . 
R 11 HOH 243 943  888  HOH HOH A . 
R 11 HOH 244 944  844  HOH HOH A . 
R 11 HOH 245 945  985  HOH HOH A . 
R 11 HOH 246 946  748  HOH HOH A . 
R 11 HOH 247 947  854  HOH HOH A . 
R 11 HOH 248 948  749  HOH HOH A . 
R 11 HOH 249 949  750  HOH HOH A . 
R 11 HOH 250 950  1079 HOH HOH A . 
R 11 HOH 251 951  1070 HOH HOH A . 
R 11 HOH 252 952  821  HOH HOH A . 
R 11 HOH 253 953  751  HOH HOH A . 
R 11 HOH 254 954  950  HOH HOH A . 
R 11 HOH 255 955  836  HOH HOH A . 
R 11 HOH 256 956  991  HOH HOH A . 
R 11 HOH 257 957  752  HOH HOH A . 
R 11 HOH 258 958  1064 HOH HOH A . 
R 11 HOH 259 959  936  HOH HOH A . 
R 11 HOH 260 960  820  HOH HOH A . 
R 11 HOH 261 961  1080 HOH HOH A . 
R 11 HOH 262 962  835  HOH HOH A . 
R 11 HOH 263 963  1061 HOH HOH A . 
R 11 HOH 264 964  753  HOH HOH A . 
R 11 HOH 265 965  1013 HOH HOH A . 
R 11 HOH 266 966  1081 HOH HOH A . 
R 11 HOH 267 967  1069 HOH HOH A . 
R 11 HOH 268 968  980  HOH HOH A . 
R 11 HOH 269 969  871  HOH HOH A . 
R 11 HOH 270 970  938  HOH HOH A . 
R 11 HOH 271 971  899  HOH HOH A . 
R 11 HOH 272 972  1019 HOH HOH A . 
R 11 HOH 273 973  754  HOH HOH A . 
R 11 HOH 274 974  1057 HOH HOH A . 
R 11 HOH 275 975  846  HOH HOH A . 
R 11 HOH 276 976  947  HOH HOH A . 
R 11 HOH 277 977  1071 HOH HOH A . 
R 11 HOH 278 978  886  HOH HOH A . 
R 11 HOH 279 979  1076 HOH HOH A . 
R 11 HOH 280 980  924  HOH HOH A . 
R 11 HOH 281 981  1055 HOH HOH A . 
R 11 HOH 282 982  987  HOH HOH A . 
R 11 HOH 283 983  905  HOH HOH A . 
R 11 HOH 284 984  999  HOH HOH A . 
R 11 HOH 285 985  755  HOH HOH A . 
R 11 HOH 286 986  998  HOH HOH A . 
R 11 HOH 287 987  756  HOH HOH A . 
R 11 HOH 288 988  757  HOH HOH A . 
R 11 HOH 289 989  1027 HOH HOH A . 
R 11 HOH 290 990  861  HOH HOH A . 
R 11 HOH 291 991  1075 HOH HOH A . 
R 11 HOH 292 992  916  HOH HOH A . 
R 11 HOH 293 993  758  HOH HOH A . 
R 11 HOH 294 994  1011 HOH HOH A . 
R 11 HOH 295 995  1006 HOH HOH A . 
R 11 HOH 296 996  860  HOH HOH A . 
R 11 HOH 297 997  978  HOH HOH A . 
R 11 HOH 298 998  759  HOH HOH A . 
R 11 HOH 299 999  994  HOH HOH A . 
R 11 HOH 300 1000 1078 HOH HOH A . 
R 11 HOH 301 1001 760  HOH HOH A . 
R 11 HOH 302 1002 1045 HOH HOH A . 
R 11 HOH 303 1003 939  HOH HOH A . 
R 11 HOH 304 1004 1074 HOH HOH A . 
R 11 HOH 305 1005 934  HOH HOH A . 
R 11 HOH 306 1006 960  HOH HOH A . 
R 11 HOH 307 1007 761  HOH HOH A . 
R 11 HOH 308 1008 1059 HOH HOH A . 
R 11 HOH 309 1009 898  HOH HOH A . 
R 11 HOH 310 1010 906  HOH HOH A . 
R 11 HOH 311 1011 1054 HOH HOH A . 
R 11 HOH 312 1012 1026 HOH HOH A . 
R 11 HOH 313 1013 762  HOH HOH A . 
R 11 HOH 314 1014 1023 HOH HOH A . 
R 11 HOH 315 1015 763  HOH HOH A . 
R 11 HOH 316 1016 988  HOH HOH A . 
R 11 HOH 317 1017 1040 HOH HOH A . 
R 11 HOH 318 1018 1031 HOH HOH A . 
R 11 HOH 319 1019 847  HOH HOH A . 
R 11 HOH 320 1020 902  HOH HOH A . 
R 11 HOH 321 1021 896  HOH HOH A . 
R 11 HOH 322 1022 1044 HOH HOH A . 
R 11 HOH 323 1023 1003 HOH HOH A . 
R 11 HOH 324 1024 1022 HOH HOH A . 
R 11 HOH 325 1025 1066 HOH HOH A . 
R 11 HOH 326 1026 931  HOH HOH A . 
R 11 HOH 327 1027 946  HOH HOH A . 
R 11 HOH 328 1028 824  HOH HOH A . 
R 11 HOH 329 1029 1035 HOH HOH A . 
R 11 HOH 330 1030 967  HOH HOH A . 
R 11 HOH 331 1031 1077 HOH HOH A . 
R 11 HOH 332 1032 873  HOH HOH A . 
R 11 HOH 333 1033 1030 HOH HOH A . 
R 11 HOH 334 1034 764  HOH HOH A . 
R 11 HOH 335 1035 948  HOH HOH A . 
R 11 HOH 336 1036 957  HOH HOH A . 
R 11 HOH 337 1037 923  HOH HOH A . 
R 11 HOH 338 1038 1058 HOH HOH A . 
R 11 HOH 339 1039 972  HOH HOH A . 
R 11 HOH 340 1040 954  HOH HOH A . 
R 11 HOH 341 1041 765  HOH HOH A . 
R 11 HOH 342 1042 942  HOH HOH A . 
R 11 HOH 343 1043 1056 HOH HOH A . 
R 11 HOH 344 1044 766  HOH HOH A . 
R 11 HOH 345 1045 1039 HOH HOH A . 
R 11 HOH 346 1046 911  HOH HOH A . 
R 11 HOH 347 1047 1073 HOH HOH A . 
R 11 HOH 348 1048 1024 HOH HOH A . 
R 11 HOH 349 1049 1037 HOH HOH A . 
R 11 HOH 350 1050 961  HOH HOH A . 
R 11 HOH 351 1051 767  HOH HOH A . 
R 11 HOH 352 1052 1007 HOH HOH A . 
R 11 HOH 353 1053 768  HOH HOH A . 
R 11 HOH 354 1054 945  HOH HOH A . 
R 11 HOH 355 1055 973  HOH HOH A . 
R 11 HOH 356 1056 769  HOH HOH A . 
R 11 HOH 357 1057 962  HOH HOH A . 
R 11 HOH 358 1058 838  HOH HOH A . 
R 11 HOH 359 1059 932  HOH HOH A . 
R 11 HOH 360 1060 770  HOH HOH A . 
R 11 HOH 361 1061 925  HOH HOH A . 
R 11 HOH 362 1062 959  HOH HOH A . 
R 11 HOH 363 1063 1047 HOH HOH A . 
R 11 HOH 364 1064 1065 HOH HOH A . 
R 11 HOH 365 1065 885  HOH HOH A . 
R 11 HOH 366 1066 1016 HOH HOH A . 
R 11 HOH 367 1067 1048 HOH HOH A . 
R 11 HOH 368 1068 908  HOH HOH A . 
R 11 HOH 369 1069 941  HOH HOH A . 
R 11 HOH 370 1070 982  HOH HOH A . 
R 11 HOH 371 1071 1036 HOH HOH A . 
R 11 HOH 372 1072 956  HOH HOH A . 
R 11 HOH 373 1073 1015 HOH HOH A . 
R 11 HOH 374 1074 1043 HOH HOH A . 
R 11 HOH 375 1075 974  HOH HOH A . 
R 11 HOH 376 1076 771  HOH HOH A . 
R 11 HOH 377 1077 981  HOH HOH A . 
R 11 HOH 378 1078 772  HOH HOH A . 
R 11 HOH 379 1079 773  HOH HOH A . 
R 11 HOH 380 1080 1038 HOH HOH A . 
R 11 HOH 381 1081 774  HOH HOH A . 
S 11 HOH 1   201  201  HOH HOH T . 
S 11 HOH 2   202  254  HOH HOH T . 
S 11 HOH 3   203  225  HOH HOH T . 
S 11 HOH 4   204  247  HOH HOH T . 
S 11 HOH 5   205  226  HOH HOH T . 
S 11 HOH 6   206  229  HOH HOH T . 
S 11 HOH 7   207  220  HOH HOH T . 
S 11 HOH 8   208  241  HOH HOH T . 
S 11 HOH 9   209  211  HOH HOH T . 
S 11 HOH 10  210  227  HOH HOH T . 
S 11 HOH 11  211  202  HOH HOH T . 
S 11 HOH 12  212  203  HOH HOH T . 
S 11 HOH 13  213  212  HOH HOH T . 
S 11 HOH 14  214  215  HOH HOH T . 
S 11 HOH 15  215  224  HOH HOH T . 
S 11 HOH 16  216  213  HOH HOH T . 
S 11 HOH 17  217  235  HOH HOH T . 
S 11 HOH 18  218  252  HOH HOH T . 
S 11 HOH 19  219  253  HOH HOH T . 
S 11 HOH 20  220  210  HOH HOH T . 
S 11 HOH 21  221  231  HOH HOH T . 
S 11 HOH 22  222  214  HOH HOH T . 
S 11 HOH 23  223  204  HOH HOH T . 
S 11 HOH 24  224  209  HOH HOH T . 
S 11 HOH 25  225  218  HOH HOH T . 
S 11 HOH 26  226  205  HOH HOH T . 
S 11 HOH 27  227  222  HOH HOH T . 
S 11 HOH 28  228  216  HOH HOH T . 
S 11 HOH 29  229  221  HOH HOH T . 
S 11 HOH 30  230  238  HOH HOH T . 
S 11 HOH 31  231  249  HOH HOH T . 
S 11 HOH 32  232  206  HOH HOH T . 
S 11 HOH 33  233  233  HOH HOH T . 
S 11 HOH 34  234  217  HOH HOH T . 
S 11 HOH 35  235  232  HOH HOH T . 
S 11 HOH 36  236  250  HOH HOH T . 
S 11 HOH 37  237  234  HOH HOH T . 
S 11 HOH 38  238  242  HOH HOH T . 
S 11 HOH 39  239  245  HOH HOH T . 
S 11 HOH 40  240  246  HOH HOH T . 
S 11 HOH 41  241  239  HOH HOH T . 
S 11 HOH 42  242  255  HOH HOH T . 
S 11 HOH 43  243  207  HOH HOH T . 
S 11 HOH 44  244  228  HOH HOH T . 
S 11 HOH 45  245  243  HOH HOH T . 
S 11 HOH 46  246  251  HOH HOH T . 
S 11 HOH 47  247  208  HOH HOH T . 
S 11 HOH 48  248  244  HOH HOH T . 
S 11 HOH 49  249  240  HOH HOH T . 
S 11 HOH 50  250  223  HOH HOH T . 
S 11 HOH 51  251  236  HOH HOH T . 
S 11 HOH 52  252  248  HOH HOH T . 
S 11 HOH 53  253  237  HOH HOH T . 
S 11 HOH 54  254  230  HOH HOH T . 
S 11 HOH 55  255  219  HOH HOH T . 
T 11 HOH 1   101  101  HOH HOH P . 
T 11 HOH 2   102  113  HOH HOH P . 
T 11 HOH 3   103  108  HOH HOH P . 
T 11 HOH 4   104  103  HOH HOH P . 
T 11 HOH 5   105  112  HOH HOH P . 
T 11 HOH 6   106  107  HOH HOH P . 
T 11 HOH 7   107  116  HOH HOH P . 
T 11 HOH 8   108  109  HOH HOH P . 
T 11 HOH 9   109  102  HOH HOH P . 
T 11 HOH 10  110  106  HOH HOH P . 
T 11 HOH 11  111  105  HOH HOH P . 
T 11 HOH 12  112  114  HOH HOH P . 
T 11 HOH 13  113  104  HOH HOH P . 
T 11 HOH 14  114  115  HOH HOH P . 
T 11 HOH 15  115  110  HOH HOH P . 
T 11 HOH 16  116  111  HOH HOH P . 
U 11 HOH 1   101  108  HOH HOH D . 
U 11 HOH 2   102  110  HOH HOH D . 
U 11 HOH 3   103  105  HOH HOH D . 
U 11 HOH 4   104  116  HOH HOH D . 
U 11 HOH 5   105  101  HOH HOH D . 
U 11 HOH 6   106  102  HOH HOH D . 
U 11 HOH 7   107  113  HOH HOH D . 
U 11 HOH 8   108  107  HOH HOH D . 
U 11 HOH 9   109  112  HOH HOH D . 
U 11 HOH 10  110  109  HOH HOH D . 
U 11 HOH 11  111  103  HOH HOH D . 
U 11 HOH 12  112  104  HOH HOH D . 
U 11 HOH 13  113  106  HOH HOH D . 
U 11 HOH 14  114  111  HOH HOH D . 
U 11 HOH 15  115  115  HOH HOH D . 
U 11 HOH 16  116  114  HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6440  ? 
1 MORE         -85   ? 
1 'SSA (A^2)'  16300 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O     ? A THR 113 ? A THR 241 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? A ILE 115 ? A ILE 243 ? 1_555 99.4  ? 
2  O     ? A THR 113 ? A THR 241 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? A VAL 118 ? A VAL 246 ? 1_555 88.5  ? 
3  O     ? A ILE 115 ? A ILE 243 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? A VAL 118 ? A VAL 246 ? 1_555 93.1  ? 
4  O     ? A THR 113 ? A THR 241 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? R HOH .   ? A HOH 838 ? 1_555 78.1  ? 
5  O     ? A ILE 115 ? A ILE 243 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? R HOH .   ? A HOH 838 ? 1_555 163.7 ? 
6  O     ? A VAL 118 ? A VAL 246 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? R HOH .   ? A HOH 838 ? 1_555 70.8  ? 
7  O     ? A THR 113 ? A THR 241 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? R HOH .   ? A HOH 982 ? 1_555 86.0  ? 
8  O     ? A ILE 115 ? A ILE 243 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? R HOH .   ? A HOH 982 ? 1_555 97.3  ? 
9  O     ? A VAL 118 ? A VAL 246 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? R HOH .   ? A HOH 982 ? 1_555 168.9 ? 
10 O     ? R HOH .   ? A HOH 838 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? R HOH .   ? A HOH 982 ? 1_555 98.6  ? 
11 O     ? A THR 113 ? A THR 241 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? T HOH .   ? P HOH 114 ? 1_555 98.2  ? 
12 O     ? A ILE 115 ? A ILE 243 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? T HOH .   ? P HOH 114 ? 1_555 141.6 ? 
13 O     ? A VAL 118 ? A VAL 246 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? T HOH .   ? P HOH 114 ? 1_555 121.2 ? 
14 O     ? R HOH .   ? A HOH 838 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? T HOH .   ? P HOH 114 ? 1_555 54.2  ? 
15 O     ? R HOH .   ? A HOH 982 ? 1_555 NA ? P NA . ? A NA 612 ? 1_555 O     ? T HOH .   ? P HOH 114 ? 1_555 50.4  ? 
16 OD1   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 OD2   ? A ASP 204 ? A ASP 332 ? 1_555 93.2  ? 
17 OD1   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O3G   ? K DUP .   ? A DUP 607 ? 1_555 85.2  ? 
18 OD2   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O3G   ? K DUP .   ? A DUP 607 ? 1_555 178.3 ? 
19 OD1   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O1A   ? K DUP .   ? A DUP 607 ? 1_555 100.0 ? 
20 OD2   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O1A   ? K DUP .   ? A DUP 607 ? 1_555 89.8  ? 
21 O3G   ? K DUP .   ? A DUP 607 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O1A   ? K DUP .   ? A DUP 607 ? 1_555 91.1  ? 
22 OD1   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2B   ? K DUP .   ? A DUP 607 ? 1_555 167.9 ? 
23 OD2   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2B   ? K DUP .   ? A DUP 607 ? 1_555 90.8  ? 
24 O3G   ? K DUP .   ? A DUP 607 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2B   ? K DUP .   ? A DUP 607 ? 1_555 90.6  ? 
25 O1A   ? K DUP .   ? A DUP 607 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O2B   ? K DUP .   ? A DUP 607 ? 1_555 91.4  ? 
26 OD1   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O     ? R HOH .   ? A HOH 850 ? 1_555 82.4  ? 
27 OD2   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O     ? R HOH .   ? A HOH 850 ? 1_555 88.3  ? 
28 O3G   ? K DUP .   ? A DUP 607 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O     ? R HOH .   ? A HOH 850 ? 1_555 90.8  ? 
29 O1A   ? K DUP .   ? A DUP 607 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O     ? R HOH .   ? A HOH 850 ? 1_555 177.1 ? 
30 O2B   ? K DUP .   ? A DUP 607 ? 1_555 MG ? F MG . ? A MG 602 ? 1_555 O     ? R HOH .   ? A HOH 850 ? 1_555 86.4  ? 
31 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 101.9 ? 
32 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 88.7  ? 
33 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 97.5  ? 
34 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 "O3'" ? C DA  4   ? P DA  4   ? 1_555 171.7 ? 
35 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 "O3'" ? C DA  4   ? P DA  4   ? 1_555 84.4  ? 
36 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 "O3'" ? C DA  4   ? P DA  4   ? 1_555 85.1  ? 
37 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1A   ? K DUP .   ? A DUP 607 ? 1_555 93.0  ? 
38 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1A   ? K DUP .   ? A DUP 607 ? 1_555 89.2  ? 
39 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1A   ? K DUP .   ? A DUP 607 ? 1_555 172.6 ? 
40 "O3'" ? C DA  4   ? P DA  4   ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O1A   ? K DUP .   ? A DUP 607 ? 1_555 92.4  ? 
41 OD2   ? A ASP 202 ? A ASP 330 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O     ? R HOH .   ? A HOH 770 ? 1_555 86.3  ? 
42 OD1   ? A ASP 204 ? A ASP 332 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O     ? R HOH .   ? A HOH 770 ? 1_555 168.5 ? 
43 OD2   ? A ASP 278 ? A ASP 418 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O     ? R HOH .   ? A HOH 770 ? 1_555 90.6  ? 
44 "O3'" ? C DA  4   ? P DA  4   ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O     ? R HOH .   ? A HOH 770 ? 1_555 88.2  ? 
45 O1A   ? K DUP .   ? A DUP 607 ? 1_555 MG ? E MG . ? A MG 601 ? 1_555 O     ? R HOH .   ? A HOH 770 ? 1_555 82.3  ? 
46 O     ? S HOH .   ? T HOH 216 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 207 ? 1_555 91.5  ? 
47 O     ? S HOH .   ? T HOH 216 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 223 ? 1_555 100.4 ? 
48 O     ? S HOH .   ? T HOH 207 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 223 ? 1_555 97.0  ? 
49 O     ? S HOH .   ? T HOH 216 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 255 ? 1_555 165.1 ? 
50 O     ? S HOH .   ? T HOH 207 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 255 ? 1_555 80.8  ? 
51 O     ? S HOH .   ? T HOH 223 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 255 ? 1_555 93.1  ? 
52 O     ? S HOH .   ? T HOH 216 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? U HOH .   ? D HOH 116 ? 1_555 85.6  ? 
53 O     ? S HOH .   ? T HOH 207 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? U HOH .   ? D HOH 116 ? 1_555 86.7  ? 
54 O     ? S HOH .   ? T HOH 223 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? U HOH .   ? D HOH 116 ? 1_555 172.8 ? 
55 O     ? S HOH .   ? T HOH 255 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? U HOH .   ? D HOH 116 ? 1_555 81.3  ? 
56 O     ? S HOH .   ? T HOH 216 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 247 ? 3_544 95.7  ? 
57 O     ? S HOH .   ? T HOH 207 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 247 ? 3_544 171.4 ? 
58 O     ? S HOH .   ? T HOH 223 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 247 ? 3_544 86.4  ? 
59 O     ? S HOH .   ? T HOH 255 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 247 ? 3_544 91.1  ? 
60 O     ? U HOH .   ? D HOH 116 ? 1_555 MG ? Q MG . ? T MG 101 ? 1_555 O     ? S HOH .   ? T HOH 247 ? 3_544 89.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-08-05 
2 'Structure model' 1 1 2015-08-19 
3 'Structure model' 1 2 2015-08-26 
4 'Structure model' 1 3 2017-09-20 
5 'Structure model' 1 4 2019-12-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' pdbx_audit_support    
3 4 'Structure model' pdbx_struct_oper_list 
4 5 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 5 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined 12.3796  -18.7138 -14.1580 0.1420 0.1627 0.1405 0.0596  -0.0013 -0.0188 1.4922 1.4161 1.4392 
-0.1749 -0.0248 -0.3894 0.0509 0.1966  -0.1788 -0.1315 -0.1089 -0.1354 0.1865  0.3013  0.0594  
'X-RAY DIFFRACTION' 2 ? refined 15.6396  8.1073   -17.2829 0.1870 0.2151 0.2160 -0.0247 0.0507  0.0543  1.8487 1.5867 2.5711 
-0.3844 -1.2627 0.9736  0.0869 0.1669  0.2279  -0.3253 -0.0060 -0.3902 -0.2834 0.2652  -0.0397 
'X-RAY DIFFRACTION' 3 ? refined -3.9208  8.3540   -1.8139  0.1278 0.0907 0.0926 0.0029  0.0117  -0.0164 3.0838 2.4783 0.6509 
0.0399  -0.0733 -0.2335 0.0534 -0.0409 0.2454  0.0777  -0.0316 0.1203  -0.1132 -0.0550 -0.0041 
'X-RAY DIFFRACTION' 4 ? refined -11.5573 -11.0299 -11.1775 0.0862 0.0784 0.1013 -0.0070 -0.0060 -0.0103 2.3395 1.8132 2.1063 
-0.1164 0.1705  0.3555  0.0469 0.1911  -0.0932 -0.1047 -0.0608 0.2073  0.0773  -0.1671 0.0049  
'X-RAY DIFFRACTION' 5 ? refined -1.2484  -6.5604  -23.8428 0.1754 0.2277 0.1017 0.0094  -0.0100 0.0110  1.9310 1.0134 2.3305 
-0.3591 -0.3242 0.3202  0.0995 0.3217  0.0071  -0.2960 -0.0912 0.0154  -0.0707 -0.0518 -0.0053 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.8.4_1496 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .          2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .          3 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot     ? ? ? .          4 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .          5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 NE2 A GLN 342  ? ? O A HOH 701  ? ? 2.14 
2  1 O   A HOH 719  ? ? O A HOH 963  ? ? 2.15 
3  1 O   A HOH 1064 ? ? O A HOH 1072 ? ? 2.16 
4  1 O   T HOH 217  ? ? O T HOH 236  ? ? 2.16 
5  1 NZ  A LYS 325  ? ? O A HOH 702  ? ? 2.17 
6  1 OE1 A GLN 275  ? ? O A HOH 703  ? ? 2.18 
7  1 O   T HOH 204  ? ? O T HOH 245  ? ? 2.18 
8  1 O   A HOH 763  ? ? O A HOH 870  ? ? 2.18 
9  1 O   A HOH 790  ? ? O T HOH 219  ? ? 2.19 
10 1 O   A HOH 1020 ? ? O A HOH 1039 ? ? 2.19 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            P 
_pdbx_validate_rmsd_bond.auth_asym_id_1            D 
_pdbx_validate_rmsd_bond.auth_comp_id_1            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_1             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OP3 
_pdbx_validate_rmsd_bond.auth_asym_id_2            D 
_pdbx_validate_rmsd_bond.auth_comp_id_2            DG 
_pdbx_validate_rmsd_bond.auth_seq_id_2             1 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.482 
_pdbx_validate_rmsd_bond.bond_target_value         1.607 
_pdbx_validate_rmsd_bond.bond_deviation            -0.125 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.012 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DC 4  ? ? "C1'" T DC 4  ? ? N1 T DC 4  ? ? 111.51 108.30 3.21 0.30 N 
2 1 "O4'" T DT 7  ? ? "C1'" T DT 7  ? ? N1 T DT 7  ? ? 110.37 108.30 2.07 0.30 N 
3 1 "O4'" T DG 10 ? ? "C1'" T DG 10 ? ? N9 T DG 10 ? ? 110.85 108.30 2.55 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 151 ? ? -154.63 -157.28 
2 1 ASN A 153 ? ? -141.71 42.77   
3 1 THR A 318 ? ? -128.28 -152.45 
4 1 SER A 411 ? ? -161.55 -151.61 
5 1 ASN A 493 ? ? -88.30  48.93   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLN 200 ? CG  ? A GLN 72  CG  
2  1 Y 1 A GLN 200 ? CD  ? A GLN 72  CD  
3  1 Y 1 A GLN 200 ? OE1 ? A GLN 72  OE1 
4  1 Y 1 A GLN 200 ? NE2 ? A GLN 72  NE2 
5  1 Y 1 A GLU 207 ? CD  ? A GLU 79  CD  
6  1 Y 1 A GLU 207 ? OE1 ? A GLU 79  OE1 
7  1 Y 1 A GLU 207 ? OE2 ? A GLU 79  OE2 
8  1 Y 1 A ARG 211 ? NE  ? A ARG 83  NE  
9  1 Y 1 A ARG 211 ? CZ  ? A ARG 83  CZ  
10 1 Y 1 A ARG 211 ? NH1 ? A ARG 83  NH1 
11 1 Y 1 A ARG 211 ? NH2 ? A ARG 83  NH2 
12 1 Y 1 A GLN 214 ? CD  ? A GLN 86  CD  
13 1 Y 1 A GLN 214 ? OE1 ? A GLN 86  OE1 
14 1 Y 1 A GLN 214 ? NE2 ? A GLN 86  NE2 
15 1 Y 1 A ARG 227 ? CD  ? A ARG 99  CD  
16 1 Y 1 A ARG 227 ? NE  ? A ARG 99  NE  
17 1 Y 1 A ARG 227 ? CZ  ? A ARG 99  CZ  
18 1 Y 1 A ARG 227 ? NH1 ? A ARG 99  NH1 
19 1 Y 1 A ARG 227 ? NH2 ? A ARG 99  NH2 
20 1 Y 1 A GLU 267 ? CD  ? A GLU 139 CD  
21 1 Y 1 A GLU 267 ? OE1 ? A GLU 139 OE1 
22 1 Y 1 A GLU 267 ? OE2 ? A GLU 139 OE2 
23 1 Y 1 A GLN 268 ? CG  ? A GLN 140 CG  
24 1 Y 1 A GLN 268 ? CD  ? A GLN 140 CD  
25 1 Y 1 A GLN 268 ? OE1 ? A GLN 140 OE1 
26 1 Y 1 A GLN 268 ? NE2 ? A GLN 140 NE2 
27 1 Y 1 A GLN 270 ? CG  ? A GLN 142 CG  
28 1 Y 1 A GLN 270 ? CD  ? A GLN 142 CD  
29 1 Y 1 A GLN 270 ? OE1 ? A GLN 142 OE1 
30 1 Y 1 A GLN 270 ? NE2 ? A GLN 142 NE2 
31 1 Y 1 A LYS 271 ? CG  ? A LYS 143 CG  
32 1 Y 1 A LYS 271 ? CD  ? A LYS 143 CD  
33 1 Y 1 A LYS 271 ? CE  ? A LYS 143 CE  
34 1 Y 1 A LYS 271 ? NZ  ? A LYS 143 NZ  
35 1 Y 1 A GLN 300 ? CD  ? A GLN 172 CD  
36 1 Y 1 A GLN 300 ? OE1 ? A GLN 172 OE1 
37 1 Y 1 A GLN 300 ? NE2 ? A GLN 172 NE2 
38 1 Y 1 A GLU 304 ? CD  ? A GLU 176 CD  
39 1 Y 1 A GLU 304 ? OE1 ? A GLU 176 OE1 
40 1 Y 1 A GLU 304 ? OE2 ? A GLU 176 OE2 
41 1 Y 1 A LYS 339 ? CG  ? A LYS 211 CG  
42 1 Y 1 A LYS 339 ? CD  ? A LYS 211 CD  
43 1 Y 1 A LYS 339 ? CE  ? A LYS 211 CE  
44 1 Y 1 A LYS 339 ? NZ  ? A LYS 211 NZ  
45 1 Y 1 A GLU 465 ? CG  ? A GLU 325 CG  
46 1 Y 1 A GLU 465 ? CD  ? A GLU 325 CD  
47 1 Y 1 A GLU 465 ? OE1 ? A GLU 325 OE1 
48 1 Y 1 A GLU 465 ? OE2 ? A GLU 325 OE2 
49 1 Y 1 A LYS 467 ? CD  ? A LYS 327 CD  
50 1 Y 1 A LYS 467 ? CE  ? A LYS 327 CE  
51 1 Y 1 A LYS 467 ? NZ  ? A LYS 327 NZ  
52 1 Y 1 A GLN 471 ? CD  ? A GLN 331 CD  
53 1 Y 1 A GLN 471 ? OE1 ? A GLN 331 OE1 
54 1 Y 1 A GLN 471 ? NE2 ? A GLN 331 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 129 ? A GLY 1   
2  1 Y 1 A SER 130 ? A SER 2   
3  1 Y 1 A ALA 131 ? A ALA 3   
4  1 Y 1 A ALA 132 ? A ALA 4   
5  1 Y 1 A ALA 133 ? A ALA 5   
6  1 Y 1 A SER 134 ? A SER 6   
7  1 Y 1 A PRO 135 ? A PRO 7   
8  1 Y 1 A ALA 136 ? A ALA 8   
9  1 Y 1 A TRP 137 ? A TRP 9   
10 1 Y 1 A CYS 370 ? A CYS 242 
11 1 Y 1 A GLU 371 ? A GLU 243 
12 1 Y 1 A SER 372 ? A SER 244 
13 1 Y 1 A PRO 373 ? A PRO 245 
14 1 Y 1 A THR 374 ? A THR 246 
15 1 Y 1 A ARG 375 ? A ARG 247 
16 1 Y 1 A LEU 376 ? A LEU 248 
17 1 Y 1 A ALA 377 ? A ALA 249 
18 1 Y 1 A GLN 378 ? A GLN 250 
19 1 Y 1 A GLN 379 ? A GLN 251 
20 1 Y 1 A SER 380 ? A SER 252 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4YD1 'double helix'        
4YD1 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 1  1_555 D DG 4 1_555 0.264  -0.176 0.223  -2.214  -14.431 0.984  1 T_DC1:DG4_D  T 1  ? D 4 ? 19 1 
1 B DG 2  1_555 D DC 3 1_555 -0.170 -0.210 0.168  1.031   -12.824 1.199  2 T_DG2:DC3_D  T 2  ? D 3 ? 19 1 
1 B DG 3  1_555 D DC 2 1_555 -0.233 -0.152 0.127  -2.014  -13.194 -0.204 3 T_DG3:DC2_D  T 3  ? D 2 ? 19 1 
1 B DC 4  1_555 D DG 1 1_555 0.213  -0.116 -0.243 10.303  -0.191  -0.219 4 T_DC4:DG1_D  T 4  ? D 1 ? 19 1 
1 B DT 7  1_555 C DA 4 1_555 -0.074 -0.051 -0.018 -22.696 1.389   -0.069 5 T_DT7:DA4_P  T 7  ? P 4 ? 20 1 
1 B DA 8  1_555 C DT 3 1_555 0.079  -0.052 0.054  7.762   -5.493  -0.427 6 T_DA8:DT3_P  T 8  ? P 3 ? 20 1 
1 B DC 9  1_555 C DG 2 1_555 0.437  -0.162 -0.155 8.373   -8.916  3.149  7 T_DC9:DG2_P  T 9  ? P 2 ? 19 1 
1 B DG 10 1_555 C DC 1 1_555 -0.040 -0.224 -0.030 13.203  -12.719 -2.612 8 T_DG10:DC1_P T 10 ? P 1 ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 1 1_555 D DG 4 1_555 B DG 2  1_555 D DC 3 1_555 -0.021 0.514  3.217 -0.699  12.101 29.873 -1.270 -0.089 3.181 22.351 1.291  
32.186 1 TT_DC1DG2:DC3DG4_DD  T 1 ? D 4 ? T 2  ? D 3 ? 
1 B DG 2 1_555 D DC 3 1_555 B DG 3  1_555 D DC 2 1_555 0.505  -0.621 3.347 -0.753  8.010  29.891 -2.712 -1.093 3.068 15.185 1.427  
30.930 2 TT_DG2DG3:DC2DC3_DD  T 2 ? D 3 ? T 3  ? D 2 ? 
1 B DG 3 1_555 D DC 2 1_555 B DC 4  1_555 D DG 1 1_555 0.507  -0.123 3.018 4.600   5.472  26.349 -1.535 -0.006 2.976 11.732 -9.861 
27.285 3 TT_DG3DC4:DG1DC2_DD  T 3 ? D 2 ? T 4  ? D 1 ? 
1 B DT 7 1_555 C DA 4 1_555 B DA 8  1_555 C DT 3 1_555 -0.957 1.809  2.972 -10.415 6.469  32.199 2.040  -0.020 3.400 11.171 17.985 
34.396 4 TT_DT7DA8:DT3DA4_PP  T 7 ? P 4 ? T 8  ? P 3 ? 
1 B DA 8 1_555 C DT 3 1_555 B DC 9  1_555 C DG 2 1_555 0.467  -0.705 3.383 -1.179  1.670  33.920 -1.481 -0.993 3.327 2.859  2.018  
33.980 5 TT_DA8DC9:DG2DT3_PP  T 8 ? P 3 ? T 9  ? P 2 ? 
1 B DC 9 1_555 C DG 2 1_555 B DG 10 1_555 C DC 1 1_555 -0.422 -0.548 3.273 -2.227  17.832 27.503 -3.933 0.378  2.495 33.371 4.167  
32.759 6 TT_DC9DG10:DC1DG2_PP T 9 ? P 2 ? T 10 ? P 1 ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' 'United States' '1ZIA ES102645-03' 
1 
'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' 'United States' 'Z01 ES065070'     
2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5  'MAGNESIUM ION'                                    MG  
6  1,2-ETHANEDIOL                                     EDO 
7  GLYCEROL                                           GOL 
8  
;2'-DEOXYURIDINE 5'-ALPHA,BETA-IMIDO-TRIPHOSPHATE
;
DUP 
9  'CHLORIDE ION'                                     CL  
10 'SODIUM ION'                                       NA  
11 water                                              HOH 
#