data_4YNM
# 
_entry.id   4YNM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YNM         
WWPDB D_1000206377 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          4YNP 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YNM 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Rogawski, D.S.' 1 ? 
'Ndoj, J.'       2 ? 
'Cho, H.-J.'     3 ? 
'Maillard, I.'   4 ? 
'Grembecka, J.'  5 ? 
'Cierpicki, T.'  6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biochemistry 
_citation.journal_id_ASTM           BICHAW 
_citation.journal_id_CSD            0033 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            54 
_citation.language                  ? 
_citation.page_first                5401 
_citation.page_last                 5413 
_citation.title                     
'Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.5b00697 
_citation.pdbx_database_id_PubMed   26292256 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rogawski, D.S.' 1 ? 
primary 'Ndoj, J.'       2 ? 
primary 'Cho, H.J.'      3 ? 
primary 'Maillard, I.'   4 ? 
primary 'Grembecka, J.'  5 ? 
primary 'Cierpicki, T.'  6 ? 
# 
_cell.length_a           59.141 
_cell.length_b           59.141 
_cell.length_c           230.983 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4YNM 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.entry_id                         4YNM 
_symmetry.Int_Tables_number                154 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone-lysine N-methyltransferase ASH1L' 26016.516 2   2.1.1.43 ? 'SET domain (UNP residues 2074-2293)' ? 
2 non-polymer syn 'ZINC ION'                                 65.409    6   ?        ? ?                                     ? 
3 non-polymer syn S-ADENOSYLMETHIONINE                       398.437   2   ?        ? ?                                     ? 
4 water       nat water                                      18.015    104 ?        ? ?                                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'ASH1-like protein,huASH1,Absent small and homeotic disks protein 1 homolog,Lysine N-methyltransferase 2H' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCL
ERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDP
NCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCL
ERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDP
NCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ALA n 
1 5   GLY n 
1 6   SER n 
1 7   TYR n 
1 8   LYS n 
1 9   LYS n 
1 10  ILE n 
1 11  ARG n 
1 12  SER n 
1 13  ASN n 
1 14  VAL n 
1 15  TYR n 
1 16  VAL n 
1 17  ASP n 
1 18  VAL n 
1 19  LYS n 
1 20  PRO n 
1 21  LEU n 
1 22  SER n 
1 23  GLY n 
1 24  TYR n 
1 25  GLU n 
1 26  ALA n 
1 27  THR n 
1 28  THR n 
1 29  CYS n 
1 30  ASN n 
1 31  CYS n 
1 32  LYS n 
1 33  LYS n 
1 34  PRO n 
1 35  ASP n 
1 36  ASP n 
1 37  ASP n 
1 38  THR n 
1 39  ARG n 
1 40  LYS n 
1 41  GLY n 
1 42  CYS n 
1 43  VAL n 
1 44  ASP n 
1 45  ASP n 
1 46  CYS n 
1 47  LEU n 
1 48  ASN n 
1 49  ARG n 
1 50  MET n 
1 51  ILE n 
1 52  PHE n 
1 53  ALA n 
1 54  GLU n 
1 55  CYS n 
1 56  SER n 
1 57  PRO n 
1 58  ASN n 
1 59  THR n 
1 60  CYS n 
1 61  PRO n 
1 62  CYS n 
1 63  GLY n 
1 64  GLU n 
1 65  GLN n 
1 66  CYS n 
1 67  CYS n 
1 68  ASN n 
1 69  GLN n 
1 70  ARG n 
1 71  ILE n 
1 72  GLN n 
1 73  ARG n 
1 74  HIS n 
1 75  GLU n 
1 76  TRP n 
1 77  VAL n 
1 78  GLN n 
1 79  CYS n 
1 80  LEU n 
1 81  GLU n 
1 82  ARG n 
1 83  PHE n 
1 84  ARG n 
1 85  ALA n 
1 86  GLU n 
1 87  GLU n 
1 88  LYS n 
1 89  GLY n 
1 90  TRP n 
1 91  GLY n 
1 92  ILE n 
1 93  ARG n 
1 94  THR n 
1 95  LYS n 
1 96  GLU n 
1 97  PRO n 
1 98  LEU n 
1 99  LYS n 
1 100 ALA n 
1 101 GLY n 
1 102 GLN n 
1 103 PHE n 
1 104 ILE n 
1 105 ILE n 
1 106 GLU n 
1 107 TYR n 
1 108 LEU n 
1 109 GLY n 
1 110 GLU n 
1 111 VAL n 
1 112 VAL n 
1 113 SER n 
1 114 GLU n 
1 115 GLN n 
1 116 GLU n 
1 117 PHE n 
1 118 ARG n 
1 119 ASN n 
1 120 ARG n 
1 121 MET n 
1 122 ILE n 
1 123 GLU n 
1 124 GLN n 
1 125 TYR n 
1 126 HIS n 
1 127 ASN n 
1 128 HIS n 
1 129 SER n 
1 130 ASP n 
1 131 HIS n 
1 132 TYR n 
1 133 CYS n 
1 134 LEU n 
1 135 ASN n 
1 136 LEU n 
1 137 ASP n 
1 138 SER n 
1 139 GLY n 
1 140 MET n 
1 141 VAL n 
1 142 ILE n 
1 143 ASP n 
1 144 SER n 
1 145 TYR n 
1 146 ARG n 
1 147 MET n 
1 148 GLY n 
1 149 ASN n 
1 150 GLU n 
1 151 ALA n 
1 152 ARG n 
1 153 PHE n 
1 154 ILE n 
1 155 ASN n 
1 156 HIS n 
1 157 SER n 
1 158 CYS n 
1 159 ASP n 
1 160 PRO n 
1 161 ASN n 
1 162 CYS n 
1 163 GLU n 
1 164 MET n 
1 165 GLN n 
1 166 LYS n 
1 167 TRP n 
1 168 SER n 
1 169 VAL n 
1 170 ASN n 
1 171 GLY n 
1 172 VAL n 
1 173 TYR n 
1 174 ARG n 
1 175 ILE n 
1 176 GLY n 
1 177 LEU n 
1 178 TYR n 
1 179 ALA n 
1 180 LEU n 
1 181 LYS n 
1 182 ASP n 
1 183 MET n 
1 184 PRO n 
1 185 ALA n 
1 186 GLY n 
1 187 THR n 
1 188 GLU n 
1 189 LEU n 
1 190 THR n 
1 191 TYR n 
1 192 ASP n 
1 193 TYR n 
1 194 ASN n 
1 195 PHE n 
1 196 HIS n 
1 197 SER n 
1 198 PHE n 
1 199 ASN n 
1 200 VAL n 
1 201 GLU n 
1 202 LYS n 
1 203 GLN n 
1 204 GLN n 
1 205 LEU n 
1 206 CYS n 
1 207 LYS n 
1 208 CYS n 
1 209 GLY n 
1 210 PHE n 
1 211 GLU n 
1 212 LYS n 
1 213 CYS n 
1 214 ARG n 
1 215 GLY n 
1 216 ILE n 
1 217 ILE n 
1 218 GLY n 
1 219 GLY n 
1 220 LYS n 
1 221 SER n 
1 222 GLN n 
1 223 ARG n 
1 224 VAL n 
1 225 ASN n 
1 226 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   226 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ASH1L, KIAA1420, KMT2H' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.db_code                    ASH1L_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.details                    ? 
_struct_ref.entity_id                  1 
_struct_ref.id                         1 
_struct_ref.seq_align                  ? 
_struct_ref.seq_dif                    ? 
_struct_ref.pdbx_db_accession          Q9NR48 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   
;YKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAE
EKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQK
WSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNG
;
_struct_ref.pdbx_align_begin           2074 
_struct_ref.pdbx_align_end             ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YNM A 7 ? 226 ? Q9NR48 2074 ? 2293 ? 2069 2288 
2 1 4YNM B 7 ? 226 ? Q9NR48 2074 ? 2293 ? 2069 2288 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4YNM GLY A 1 ? UNP Q9NR48 ? ? 'expression tag' 2063 1  
1 4YNM ALA A 2 ? UNP Q9NR48 ? ? 'expression tag' 2064 2  
1 4YNM MET A 3 ? UNP Q9NR48 ? ? 'expression tag' 2065 3  
1 4YNM ALA A 4 ? UNP Q9NR48 ? ? 'expression tag' 2066 4  
1 4YNM GLY A 5 ? UNP Q9NR48 ? ? 'expression tag' 2067 5  
1 4YNM SER A 6 ? UNP Q9NR48 ? ? 'expression tag' 2068 6  
2 4YNM GLY B 1 ? UNP Q9NR48 ? ? 'expression tag' 2063 7  
2 4YNM ALA B 2 ? UNP Q9NR48 ? ? 'expression tag' 2064 8  
2 4YNM MET B 3 ? UNP Q9NR48 ? ? 'expression tag' 2065 9  
2 4YNM ALA B 4 ? UNP Q9NR48 ? ? 'expression tag' 2066 10 
2 4YNM GLY B 5 ? UNP Q9NR48 ? ? 'expression tag' 2067 11 
2 4YNM SER B 6 ? UNP Q9NR48 ? ? 'expression tag' 2068 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'      115.130 
SAM non-polymer         . S-ADENOSYLMETHIONINE ? 'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YNM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.34 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         47.41 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 3350, 20 mM Tris' 
_exptl_crystal_grow.pdbx_pH_range   7.3-7.8 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           123 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-12-08 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.d_resolution_high            2.19 
_reflns.d_resolution_low             50.000 
_reflns.pdbx_number_measured_all     228388 
_reflns.number_obs                   25099 
_reflns.pdbx_Rmerge_I_obs            0.095 
_reflns.pdbx_netI_over_av_sigmaI     33.696 
_reflns.pdbx_netI_over_sigmaI        7.800 
_reflns.pdbx_chi_squared             1.645 
_reflns.pdbx_redundancy              9.100 
_reflns.percent_possible_obs         99.900 
_reflns.pdbx_Rrim_I_all              0.101 
_reflns.pdbx_Rpim_I_all              0.033 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4YNM 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  2.19  2.240  ? ? ? 0 0.590 ? ? 0.757 9.100 ? ? ? 1213 ? ? ? ? 100.000 0.626 0.204 0.865 
1 2  2.240 2.280  ? ? ? 0 0.488 ? ? 0.796 9.100 ? ? ? 1244 ? ? ? ? 100.000 0.517 0.169 0.914 
1 3  2.280 2.320  ? ? ? 0 0.451 ? ? 0.828 9.200 ? ? ? 1192 ? ? ? ? 100.000 0.477 0.155 0.912 
1 4  2.320 2.370  ? ? ? 0 0.408 ? ? 0.842 9.000 ? ? ? 1265 ? ? ? ? 100.000 0.433 0.143 0.935 
1 5  2.370 2.420  ? ? ? 0 0.369 ? ? 0.939 9.100 ? ? ? 1184 ? ? ? ? 100.000 0.391 0.129 0.939 
1 6  2.420 2.480  ? ? ? 0 0.312 ? ? 1.028 9.000 ? ? ? 1279 ? ? ? ? 100.000 0.332 0.110 0.940 
1 7  2.480 2.540  ? ? ? 0 0.277 ? ? 1.034 9.100 ? ? ? 1198 ? ? ? ? 100.000 0.294 0.097 0.963 
1 8  2.540 2.610  ? ? ? 0 0.241 ? ? 1.127 8.900 ? ? ? 1244 ? ? ? ? 100.000 0.257 0.086 0.971 
1 9  2.610 2.690  ? ? ? 0 0.206 ? ? 1.230 9.000 ? ? ? 1242 ? ? ? ? 100.000 0.219 0.072 0.976 
1 10 2.690 2.770  ? ? ? 0 0.188 ? ? 1.282 9.000 ? ? ? 1216 ? ? ? ? 100.000 0.199 0.066 0.981 
1 11 2.770 2.870  ? ? ? 0 0.162 ? ? 1.381 8.900 ? ? ? 1245 ? ? ? ? 99.900  0.172 0.057 0.986 
1 12 2.870 2.990  ? ? ? 0 0.142 ? ? 1.570 9.000 ? ? ? 1256 ? ? ? ? 100.000 0.151 0.050 0.988 
1 13 2.990 3.120  ? ? ? 0 0.127 ? ? 1.747 8.900 ? ? ? 1263 ? ? ? ? 100.000 0.135 0.045 0.991 
1 14 3.120 3.290  ? ? ? 0 0.109 ? ? 1.982 9.000 ? ? ? 1245 ? ? ? ? 100.000 0.116 0.039 0.991 
1 15 3.290 3.490  ? ? ? 0 0.097 ? ? 2.309 9.000 ? ? ? 1265 ? ? ? ? 100.000 0.103 0.035 0.993 
1 16 3.490 3.760  ? ? ? 0 0.090 ? ? 2.736 9.200 ? ? ? 1246 ? ? ? ? 99.900  0.095 0.031 0.995 
1 17 3.760 4.140  ? ? ? 0 0.084 ? ? 3.162 9.100 ? ? ? 1273 ? ? ? ? 100.000 0.089 0.029 0.996 
1 18 4.140 4.740  ? ? ? 0 0.079 ? ? 3.469 9.100 ? ? ? 1289 ? ? ? ? 100.000 0.084 0.027 0.996 
1 19 4.740 5.970  ? ? ? 0 0.067 ? ? 2.440 9.900 ? ? ? 1327 ? ? ? ? 100.000 0.070 0.022 0.997 
1 20 5.970 50.000 ? ? ? 0 0.052 ? ? 1.822 9.400 ? ? ? 1413 ? ? ? ? 99.200  0.055 0.018 0.998 
# 
_refine.entry_id                                 4YNM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.1900 
_refine.ls_d_res_low                             46.8200 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.8600 
_refine.ls_number_reflns_obs                     23762 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2438 
_refine.ls_R_factor_R_work                       0.2421 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.2775 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.1000 
_refine.ls_number_reflns_R_free                  1271 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               42.4530 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0800 
_refine.aniso_B[2][2]                            0.0800 
_refine.aniso_B[3][3]                            -0.1200 
_refine.aniso_B[1][2]                            0.0400 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.9260 
_refine.correlation_coeff_Fo_to_Fc_free          0.9130 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.3230 
_refine.pdbx_overall_ESU_R_Free                  0.2380 
_refine.overall_SU_ML                            0.1780 
_refine.overall_SU_B                             6.8750 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      3OPE 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                95.310 
_refine.B_iso_min                                20.100 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.1900 
_refine_hist.d_res_low                        46.8200 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             104 
_refine_hist.number_atoms_total               3497 
_refine_hist.pdbx_number_residues_total       411 
_refine_hist.pdbx_B_iso_mean_ligand           35.48 
_refine_hist.pdbx_B_iso_mean_solvent          39.26 
_refine_hist.pdbx_number_atoms_protein        3333 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' r_bond_refined_d       3464 0.017  0.021  ? ? 
'X-RAY DIFFRACTION' r_angle_refined_deg    4664 1.769  1.955  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 408  6.998  5.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 186  38.596 24.086 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 608  18.653 15.000 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 27   25.239 15.000 ? ? 
'X-RAY DIFFRACTION' r_chiral_restr         470  0.122  0.200  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_refined   2681 0.006  0.021  ? ? 
'X-RAY DIFFRACTION' r_mcbond_it            2045 1.099  1.500  ? ? 
'X-RAY DIFFRACTION' r_mcangle_it           3285 2.071  2.000  ? ? 
'X-RAY DIFFRACTION' r_scbond_it            1419 2.993  3.000  ? ? 
'X-RAY DIFFRACTION' r_scangle_it           1379 4.678  4.500  ? ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 'X-RAY DIFFRACTION' 1 1 'TIGHT POSITIONAL' A 684 0.110 0.050  ? ? ? 
2 'X-RAY DIFFRACTION' 1 1 'LOOSE POSITIONAL' A 716 0.270 5.000  ? ? ? 
3 'X-RAY DIFFRACTION' 1 1 'TIGHT THERMAL'    A 684 0.350 0.500  ? ? ? 
4 'X-RAY DIFFRACTION' 1 1 'LOOSE THERMAL'    A 716 0.400 10.000 ? ? ? 
5 'X-RAY DIFFRACTION' 2 1 'TIGHT POSITIONAL' A 56  0.100 0.050  ? ? ? 
6 'X-RAY DIFFRACTION' 2 1 'LOOSE POSITIONAL' A 52  0.110 5.000  ? ? ? 
7 'X-RAY DIFFRACTION' 2 1 'TIGHT THERMAL'    A 56  0.310 0.500  ? ? ? 
8 'X-RAY DIFFRACTION' 2 1 'LOOSE THERMAL'    A 52  0.260 10.000 ? ? ? 
# 
_refine_ls_shell.d_res_high                       2.1920 
_refine_ls_shell.d_res_low                        2.2490 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.4300 
_refine_ls_shell.number_reflns_R_work             1664 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2760 
_refine_ls_shell.R_factor_R_free                  0.3020 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             92 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1756 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_obs                     ? 
# 
loop_
_struct_ncs_dom.pdbx_ens_id 
_struct_ncs_dom.id 
_struct_ncs_dom.details 
1 1 A 
1 2 B 
2 1 A 
2 2 B 
# 
loop_
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.selection_details 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
1 1 1 3 A 2069 A 2256 ? ? ? ? ? ? ? ? ? 
1 2 1 3 B 2069 B 2256 ? ? ? ? ? ? ? ? ? 
2 1 1 3 A 2266 A 2280 ? ? ? ? ? ? ? ? ? 
2 2 1 3 B 2266 B 2280 ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
# 
_struct.entry_id                     4YNM 
_struct.title                        'ASH1L wild-type SET domain in complex with S-adenosyl methionine (SAM)' 
_struct.pdbx_descriptor              ASH1L 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YNM 
_struct_keywords.text            'histone methylation, SET domain, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
K N N 4 ? 
L N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 46  ? ILE A 51  ? CYS A 2108 ILE A 2113 1 ? 6  
HELX_P HELX_P2  AA2 CYS A 62  ? CYS A 66  ? CYS A 2124 CYS A 2128 5 ? 5  
HELX_P HELX_P3  AA3 GLU A 114 ? GLN A 124 ? GLU A 2176 GLN A 2186 1 ? 11 
HELX_P HELX_P4  AA4 ASN A 149 ? ILE A 154 ? ASN A 2211 ILE A 2216 5 ? 6  
HELX_P HELX_P5  AA5 ASP A 192 ? SER A 197 ? ASP A 2254 SER A 2259 1 ? 6  
HELX_P HELX_P6  AA6 ASN B 48  ? PHE B 52  ? ASN B 2110 PHE B 2114 5 ? 5  
HELX_P HELX_P7  AA7 CYS B 62  ? CYS B 66  ? CYS B 2124 CYS B 2128 5 ? 5  
HELX_P HELX_P8  AA8 GLU B 114 ? GLN B 124 ? GLU B 2176 GLN B 2186 1 ? 11 
HELX_P HELX_P9  AA9 ASN B 149 ? ILE B 154 ? ASN B 2211 ILE B 2216 5 ? 6  
HELX_P HELX_P10 AB1 ASP B 192 ? SER B 197 ? ASP B 2254 SER B 2259 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? B CYS 60  SG ? ? ? 1_555 B CYS 66 SG ? ? B CYS 2122 B CYS 2128 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc1  metalc ? ? A CYS 29  SG ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 2091 A ZN  2303 1_555 ? ? ? ? ? ? ? 1.955 ? 
metalc2  metalc ? ? A CYS 31  SG ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 2093 A ZN  2303 1_555 ? ? ? ? ? ? ? 2.350 ? 
metalc3  metalc ? ? A CYS 42  SG ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 2104 A ZN  2302 1_555 ? ? ? ? ? ? ? 2.255 ? 
metalc4  metalc ? ? A CYS 42  SG ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 2104 A ZN  2303 1_555 ? ? ? ? ? ? ? 2.182 ? 
metalc5  metalc ? ? A CYS 46  SG ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 2108 A ZN  2303 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc6  metalc ? ? A CYS 55  SG ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 2117 A ZN  2302 1_555 ? ? ? ? ? ? ? 2.110 ? 
metalc7  metalc ? ? A CYS 60  SG ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 2122 A ZN  2302 1_555 ? ? ? ? ? ? ? 2.246 ? 
metalc8  metalc ? ? A CYS 66  SG ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 2128 A ZN  2302 1_555 ? ? ? ? ? ? ? 2.049 ? 
metalc9  metalc ? ? A CYS 158 SG ? ? ? 1_555 C ZN  .  ZN ? ? A CYS 2220 A ZN  2301 1_555 ? ? ? ? ? ? ? 2.348 ? 
metalc10 metalc ? ? A CYS 206 SG ? ? ? 1_555 C ZN  .  ZN ? ? A CYS 2268 A ZN  2301 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc11 metalc ? ? A CYS 208 SG ? ? ? 1_555 C ZN  .  ZN ? ? A CYS 2270 A ZN  2301 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc12 metalc ? ? A CYS 213 SG ? ? ? 1_555 C ZN  .  ZN ? ? A CYS 2275 A ZN  2301 1_555 ? ? ? ? ? ? ? 2.312 ? 
metalc13 metalc ? ? B CYS 42  SG ? ? ? 1_555 H ZN  .  ZN ? ? B CYS 2104 B ZN  2302 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc14 metalc ? ? B CYS 42  SG ? ? ? 1_555 I ZN  .  ZN ? ? B CYS 2104 B ZN  2303 1_555 ? ? ? ? ? ? ? 1.988 ? 
metalc15 metalc ? ? B CYS 46  SG ? ? ? 1_555 I ZN  .  ZN ? ? B CYS 2108 B ZN  2303 1_555 ? ? ? ? ? ? ? 2.669 ? 
metalc16 metalc ? ? B CYS 55  SG ? ? ? 1_555 H ZN  .  ZN ? ? B CYS 2117 B ZN  2302 1_555 ? ? ? ? ? ? ? 2.473 ? 
metalc17 metalc ? ? B CYS 158 SG ? ? ? 1_555 G ZN  .  ZN ? ? B CYS 2220 B ZN  2301 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc18 metalc ? ? B CYS 206 SG ? ? ? 1_555 G ZN  .  ZN ? ? B CYS 2268 B ZN  2301 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc19 metalc ? ? B CYS 208 SG ? ? ? 1_555 G ZN  .  ZN ? ? B CYS 2270 B ZN  2301 1_555 ? ? ? ? ? ? ? 2.047 ? 
metalc20 metalc ? ? B CYS 213 SG ? ? ? 1_555 G ZN  .  ZN ? ? B CYS 2275 B ZN  2301 1_555 ? ? ? ? ? ? ? 2.458 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 4 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? parallel      
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 8   ? LYS A 9   ? LYS A 2070 LYS A 2071 
AA1 2 MET A 147 ? GLY A 148 ? MET A 2209 GLY A 2210 
AA2 1 VAL A 14  ? TYR A 15  ? VAL A 2076 TYR A 2077 
AA2 2 GLU A 110 ? SER A 113 ? GLU A 2172 SER A 2175 
AA2 3 MET A 140 ? ASP A 143 ? MET A 2202 ASP A 2205 
AA2 4 CYS A 133 ? ASP A 137 ? CYS A 2195 ASP A 2199 
AA3 1 LEU A 80  ? ARG A 84  ? LEU A 2142 ARG A 2146 
AA3 2 TRP A 90  ? THR A 94  ? TRP A 2152 THR A 2156 
AA4 1 PHE A 103 ? GLU A 106 ? PHE A 2165 GLU A 2168 
AA4 2 VAL A 172 ? ALA A 179 ? VAL A 2234 ALA A 2241 
AA4 3 CYS A 162 ? VAL A 169 ? CYS A 2224 VAL A 2231 
AA5 1 ASN A 155 ? HIS A 156 ? ASN A 2217 HIS A 2218 
AA5 2 THR A 190 ? TYR A 191 ? THR A 2252 TYR A 2253 
AA6 1 GLN A 204 ? LEU A 205 ? GLN A 2266 LEU A 2267 
AA6 2 ILE A 216 ? ILE A 217 ? ILE A 2278 ILE A 2279 
AA7 1 LYS B 8   ? LYS B 9   ? LYS B 2070 LYS B 2071 
AA7 2 MET B 147 ? GLY B 148 ? MET B 2209 GLY B 2210 
AA8 1 VAL B 14  ? TYR B 15  ? VAL B 2076 TYR B 2077 
AA8 2 GLU B 110 ? SER B 113 ? GLU B 2172 SER B 2175 
AA8 3 MET B 140 ? ASP B 143 ? MET B 2202 ASP B 2205 
AA8 4 CYS B 133 ? ASN B 135 ? CYS B 2195 ASN B 2197 
AA9 1 LEU B 80  ? ARG B 84  ? LEU B 2142 ARG B 2146 
AA9 2 TRP B 90  ? THR B 94  ? TRP B 2152 THR B 2156 
AB1 1 PHE B 103 ? GLU B 106 ? PHE B 2165 GLU B 2168 
AB1 2 VAL B 172 ? ALA B 179 ? VAL B 2234 ALA B 2241 
AB1 3 CYS B 162 ? VAL B 169 ? CYS B 2224 VAL B 2231 
AB2 1 ASN B 155 ? HIS B 156 ? ASN B 2217 HIS B 2218 
AB2 2 THR B 190 ? TYR B 191 ? THR B 2252 TYR B 2253 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 8   ? N LYS A 2070 O GLY A 148 ? O GLY A 2210 
AA2 1 2 N VAL A 14  ? N VAL A 2076 O VAL A 111 ? O VAL A 2173 
AA2 2 3 N GLU A 110 ? N GLU A 2172 O ASP A 143 ? O ASP A 2205 
AA2 3 4 O ILE A 142 ? O ILE A 2204 N LEU A 134 ? N LEU A 2196 
AA3 1 2 N PHE A 83  ? N PHE A 2145 O GLY A 91  ? O GLY A 2153 
AA4 1 2 N ILE A 105 ? N ILE A 2167 O LEU A 177 ? O LEU A 2239 
AA4 2 3 O ARG A 174 ? O ARG A 2236 N TRP A 167 ? N TRP A 2229 
AA5 1 2 N ASN A 155 ? N ASN A 2217 O TYR A 191 ? O TYR A 2253 
AA6 1 2 N GLN A 204 ? N GLN A 2266 O ILE A 217 ? O ILE A 2279 
AA7 1 2 N LYS B 8   ? N LYS B 2070 O GLY B 148 ? O GLY B 2210 
AA8 1 2 N VAL B 14  ? N VAL B 2076 O VAL B 111 ? O VAL B 2173 
AA8 2 3 N GLU B 110 ? N GLU B 2172 O ASP B 143 ? O ASP B 2205 
AA8 3 4 O ILE B 142 ? O ILE B 2204 N LEU B 134 ? N LEU B 2196 
AA9 1 2 N PHE B 83  ? N PHE B 2145 O GLY B 91  ? O GLY B 2153 
AB1 1 2 N ILE B 104 ? N ILE B 2166 O LEU B 177 ? O LEU B 2239 
AB1 2 3 O VAL B 172 ? O VAL B 2234 N VAL B 169 ? N VAL B 2231 
AB2 1 2 N ASN B 155 ? N ASN B 2217 O TYR B 191 ? O TYR B 2253 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  2301 ? 4  'binding site for residue ZN A 2301'  
AC2 Software A ZN  2302 ? 4  'binding site for residue ZN A 2302'  
AC3 Software A ZN  2303 ? 4  'binding site for residue ZN A 2303'  
AC4 Software A SAM 2304 ? 19 'binding site for residue SAM A 2304' 
AC5 Software B ZN  2301 ? 4  'binding site for residue ZN B 2301'  
AC6 Software B ZN  2302 ? 5  'binding site for residue ZN B 2302'  
AC7 Software B ZN  2303 ? 4  'binding site for residue ZN B 2303'  
AC8 Software B SAM 2304 ? 17 'binding site for residue SAM B 2304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS A 158 ? CYS A 2220 . ? 1_555 ? 
2  AC1 4  CYS A 206 ? CYS A 2268 . ? 1_555 ? 
3  AC1 4  CYS A 208 ? CYS A 2270 . ? 1_555 ? 
4  AC1 4  CYS A 213 ? CYS A 2275 . ? 1_555 ? 
5  AC2 4  CYS A 42  ? CYS A 2104 . ? 1_555 ? 
6  AC2 4  CYS A 55  ? CYS A 2117 . ? 1_555 ? 
7  AC2 4  CYS A 60  ? CYS A 2122 . ? 1_555 ? 
8  AC2 4  CYS A 66  ? CYS A 2128 . ? 1_555 ? 
9  AC3 4  CYS A 29  ? CYS A 2091 . ? 1_555 ? 
10 AC3 4  CYS A 31  ? CYS A 2093 . ? 1_555 ? 
11 AC3 4  CYS A 42  ? CYS A 2104 . ? 1_555 ? 
12 AC3 4  CYS A 46  ? CYS A 2108 . ? 1_555 ? 
13 AC4 19 LYS A 88  ? LYS A 2150 . ? 1_555 ? 
14 AC4 19 GLY A 89  ? GLY A 2151 . ? 1_555 ? 
15 AC4 19 TRP A 90  ? TRP A 2152 . ? 1_555 ? 
16 AC4 19 SER A 129 ? SER A 2191 . ? 1_555 ? 
17 AC4 19 ASP A 130 ? ASP A 2192 . ? 1_555 ? 
18 AC4 19 HIS A 131 ? HIS A 2193 . ? 1_555 ? 
19 AC4 19 TYR A 132 ? TYR A 2194 . ? 1_555 ? 
20 AC4 19 ARG A 152 ? ARG A 2214 . ? 1_555 ? 
21 AC4 19 PHE A 153 ? PHE A 2215 . ? 1_555 ? 
22 AC4 19 ASN A 155 ? ASN A 2217 . ? 1_555 ? 
23 AC4 19 HIS A 156 ? HIS A 2218 . ? 1_555 ? 
24 AC4 19 TYR A 193 ? TYR A 2255 . ? 1_555 ? 
25 AC4 19 GLN A 204 ? GLN A 2266 . ? 1_555 ? 
26 AC4 19 LEU A 205 ? LEU A 2267 . ? 1_555 ? 
27 AC4 19 CYS A 206 ? CYS A 2268 . ? 1_555 ? 
28 AC4 19 LYS A 207 ? LYS A 2269 . ? 1_555 ? 
29 AC4 19 ILE A 217 ? ILE A 2279 . ? 1_555 ? 
30 AC4 19 HOH K .   ? HOH A 2418 . ? 1_555 ? 
31 AC4 19 HOH K .   ? HOH A 2422 . ? 1_555 ? 
32 AC5 4  CYS B 158 ? CYS B 2220 . ? 1_555 ? 
33 AC5 4  CYS B 206 ? CYS B 2268 . ? 1_555 ? 
34 AC5 4  CYS B 208 ? CYS B 2270 . ? 1_555 ? 
35 AC5 4  CYS B 213 ? CYS B 2275 . ? 1_555 ? 
36 AC6 5  CYS B 42  ? CYS B 2104 . ? 1_555 ? 
37 AC6 5  CYS B 55  ? CYS B 2117 . ? 1_555 ? 
38 AC6 5  CYS B 60  ? CYS B 2122 . ? 1_555 ? 
39 AC6 5  CYS B 66  ? CYS B 2128 . ? 1_555 ? 
40 AC6 5  ZN  I .   ? ZN  B 2303 . ? 1_555 ? 
41 AC7 4  CYS B 42  ? CYS B 2104 . ? 1_555 ? 
42 AC7 4  CYS B 46  ? CYS B 2108 . ? 1_555 ? 
43 AC7 4  CYS B 55  ? CYS B 2117 . ? 1_555 ? 
44 AC7 4  ZN  H .   ? ZN  B 2302 . ? 1_555 ? 
45 AC8 17 LYS B 88  ? LYS B 2150 . ? 1_555 ? 
46 AC8 17 TRP B 90  ? TRP B 2152 . ? 1_555 ? 
47 AC8 17 SER B 129 ? SER B 2191 . ? 1_555 ? 
48 AC8 17 ASP B 130 ? ASP B 2192 . ? 1_555 ? 
49 AC8 17 HIS B 131 ? HIS B 2193 . ? 1_555 ? 
50 AC8 17 TYR B 132 ? TYR B 2194 . ? 1_555 ? 
51 AC8 17 ARG B 152 ? ARG B 2214 . ? 1_555 ? 
52 AC8 17 PHE B 153 ? PHE B 2215 . ? 1_555 ? 
53 AC8 17 ASN B 155 ? ASN B 2217 . ? 1_555 ? 
54 AC8 17 HIS B 156 ? HIS B 2218 . ? 1_555 ? 
55 AC8 17 TYR B 193 ? TYR B 2255 . ? 1_555 ? 
56 AC8 17 GLN B 204 ? GLN B 2266 . ? 1_555 ? 
57 AC8 17 LEU B 205 ? LEU B 2267 . ? 1_555 ? 
58 AC8 17 CYS B 206 ? CYS B 2268 . ? 1_555 ? 
59 AC8 17 LYS B 207 ? LYS B 2269 . ? 1_555 ? 
60 AC8 17 ILE B 217 ? ILE B 2279 . ? 1_555 ? 
61 AC8 17 HOH L .   ? HOH B 2413 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YNM 
_atom_sites.fract_transf_matrix[1][1]   0.016909 
_atom_sites.fract_transf_matrix[1][2]   0.009762 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019525 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004329 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ALA A 1 4   ? -11.153 -4.861 -30.554 1.00 43.18 ? 2066 ALA A N     1 
ATOM   2    C  CA    . ALA A 1 4   ? -12.172 -4.996 -29.507 1.00 44.06 ? 2066 ALA A CA    1 
ATOM   3    C  C     . ALA A 1 4   ? -11.474 -4.980 -28.122 1.00 44.10 ? 2066 ALA A C     1 
ATOM   4    O  O     . ALA A 1 4   ? -10.673 -5.870 -27.811 1.00 45.94 ? 2066 ALA A O     1 
ATOM   5    C  CB    . ALA A 1 4   ? -12.903 -6.264 -29.723 1.00 45.55 ? 2066 ALA A CB    1 
ATOM   6    N  N     . GLY A 1 5   ? -11.746 -3.961 -27.312 1.00 41.39 ? 2067 GLY A N     1 
ATOM   7    C  CA    . GLY A 1 5   ? -10.807 -3.563 -26.272 1.00 39.96 ? 2067 GLY A CA    1 
ATOM   8    C  C     . GLY A 1 5   ? -11.131 -4.008 -24.856 1.00 37.90 ? 2067 GLY A C     1 
ATOM   9    O  O     . GLY A 1 5   ? -12.268 -3.894 -24.415 1.00 37.89 ? 2067 GLY A O     1 
ATOM   10   N  N     . SER A 1 6   ? -10.115 -4.493 -24.148 1.00 36.19 ? 2068 SER A N     1 
ATOM   11   C  CA    . SER A 1 6   ? -10.287 -5.114 -22.817 1.00 34.50 ? 2068 SER A CA    1 
ATOM   12   C  C     . SER A 1 6   ? -10.053 -4.146 -21.670 1.00 32.48 ? 2068 SER A C     1 
ATOM   13   O  O     . SER A 1 6   ? -9.181  -3.275 -21.740 1.00 32.01 ? 2068 SER A O     1 
ATOM   14   C  CB    . SER A 1 6   ? -9.261  -6.244 -22.656 1.00 33.58 ? 2068 SER A CB    1 
ATOM   15   O  OG    . SER A 1 6   ? -9.611  -7.347 -23.463 1.00 36.07 ? 2068 SER A OG    1 
ATOM   16   N  N     . TYR A 1 7   ? -10.754 -4.355 -20.575 1.00 31.42 ? 2069 TYR A N     1 
ATOM   17   C  CA    . TYR A 1 7   ? -10.519 -3.554 -19.371 1.00 30.34 ? 2069 TYR A CA    1 
ATOM   18   C  C     . TYR A 1 7   ? -10.986 -4.309 -18.132 1.00 29.57 ? 2069 TYR A C     1 
ATOM   19   O  O     . TYR A 1 7   ? -11.688 -5.301 -18.245 1.00 29.13 ? 2069 TYR A O     1 
ATOM   20   C  CB    . TYR A 1 7   ? -11.274 -2.205 -19.500 1.00 29.62 ? 2069 TYR A CB    1 
ATOM   21   C  CG    . TYR A 1 7   ? -12.789 -2.371 -19.407 1.00 27.69 ? 2069 TYR A CG    1 
ATOM   22   C  CD1   . TYR A 1 7   ? -13.465 -2.096 -18.216 1.00 27.23 ? 2069 TYR A CD1   1 
ATOM   23   C  CD2   . TYR A 1 7   ? -13.542 -2.812 -20.499 1.00 25.85 ? 2069 TYR A CD2   1 
ATOM   24   C  CE1   . TYR A 1 7   ? -14.879 -2.267 -18.107 1.00 26.54 ? 2069 TYR A CE1   1 
ATOM   25   C  CE2   . TYR A 1 7   ? -14.944 -2.973 -20.397 1.00 27.90 ? 2069 TYR A CE2   1 
ATOM   26   C  CZ    . TYR A 1 7   ? -15.603 -2.688 -19.200 1.00 29.34 ? 2069 TYR A CZ    1 
ATOM   27   O  OH    . TYR A 1 7   ? -16.983 -2.837 -19.113 1.00 31.87 ? 2069 TYR A OH    1 
ATOM   28   N  N     . LYS A 1 8   ? -10.618 -3.810 -16.959 1.00 29.39 ? 2070 LYS A N     1 
ATOM   29   C  CA    . LYS A 1 8   ? -11.133 -4.354 -15.693 1.00 29.60 ? 2070 LYS A CA    1 
ATOM   30   C  C     . LYS A 1 8   ? -12.389 -3.623 -15.221 1.00 30.35 ? 2070 LYS A C     1 
ATOM   31   O  O     . LYS A 1 8   ? -12.347 -2.446 -14.854 1.00 30.07 ? 2070 LYS A O     1 
ATOM   32   C  CB    . LYS A 1 8   ? -10.075 -4.231 -14.606 1.00 30.88 ? 2070 LYS A CB    1 
ATOM   33   C  CG    . LYS A 1 8   ? -8.670  -4.832 -15.003 1.00 31.47 ? 2070 LYS A CG    1 
ATOM   34   C  CD    . LYS A 1 8   ? -7.613  -4.140 -14.176 1.00 36.02 ? 2070 LYS A CD    1 
ATOM   35   C  CE    . LYS A 1 8   ? -6.325  -4.941 -14.076 1.00 39.14 ? 2070 LYS A CE    1 
ATOM   36   N  NZ    . LYS A 1 8   ? -5.366  -4.368 -13.051 1.00 44.89 ? 2070 LYS A NZ    1 
ATOM   37   N  N     . LYS A 1 9   ? -13.488 -4.354 -15.216 1.00 29.65 ? 2071 LYS A N     1 
ATOM   38   C  CA    . LYS A 1 9   ? -14.781 -3.862 -14.818 1.00 31.22 ? 2071 LYS A CA    1 
ATOM   39   C  C     . LYS A 1 9   ? -14.844 -3.602 -13.316 1.00 30.86 ? 2071 LYS A C     1 
ATOM   40   O  O     . LYS A 1 9   ? -14.473 -4.479 -12.530 1.00 32.55 ? 2071 LYS A O     1 
ATOM   41   C  CB    . LYS A 1 9   ? -15.832 -4.901 -15.230 1.00 30.82 ? 2071 LYS A CB    1 
ATOM   42   C  CG    . LYS A 1 9   ? -17.289 -4.459 -15.046 1.00 36.86 ? 2071 LYS A CG    1 
ATOM   43   C  CD    . LYS A 1 9   ? -18.223 -5.404 -15.791 1.00 46.53 ? 2071 LYS A CD    1 
ATOM   44   C  CE    . LYS A 1 9   ? -18.396 -4.949 -17.250 1.00 51.65 ? 2071 LYS A CE    1 
ATOM   45   N  NZ    . LYS A 1 9   ? -18.970 -6.020 -18.154 1.00 55.40 ? 2071 LYS A NZ    1 
ATOM   46   N  N     . ILE A 1 10  ? -15.266 -2.392 -12.927 1.00 30.01 ? 2072 ILE A N     1 
ATOM   47   C  CA    . ILE A 1 10  ? -15.432 -2.010 -11.516 1.00 29.24 ? 2072 ILE A CA    1 
ATOM   48   C  C     . ILE A 1 10  ? -16.899 -1.562 -11.301 1.00 30.29 ? 2072 ILE A C     1 
ATOM   49   O  O     . ILE A 1 10  ? -17.561 -1.165 -12.266 1.00 30.66 ? 2072 ILE A O     1 
ATOM   50   C  CB    . ILE A 1 10  ? -14.460 -0.875 -11.116 1.00 27.97 ? 2072 ILE A CB    1 
ATOM   51   C  CG1   . ILE A 1 10  ? -14.609 0.345  -12.039 1.00 25.37 ? 2072 ILE A CG1   1 
ATOM   52   C  CG2   . ILE A 1 10  ? -13.011 -1.384 -11.110 1.00 28.37 ? 2072 ILE A CG2   1 
ATOM   53   C  CD1   . ILE A 1 10  ? -13.603 1.475  -11.767 1.00 21.62 ? 2072 ILE A CD1   1 
ATOM   54   N  N     . ARG A 1 11  ? -17.386 -1.588 -10.063 1.00 30.48 ? 2073 ARG A N     1 
ATOM   55   C  CA    . ARG A 1 11  ? -18.757 -1.172 -9.754  1.00 31.82 ? 2073 ARG A CA    1 
ATOM   56   C  C     . ARG A 1 11  ? -18.795 0.254  -9.173  1.00 30.37 ? 2073 ARG A C     1 
ATOM   57   O  O     . ARG A 1 11  ? -19.873 0.797  -9.007  1.00 29.54 ? 2073 ARG A O     1 
ATOM   58   C  CB    . ARG A 1 11  ? -19.372 -2.072 -8.669  1.00 33.65 ? 2073 ARG A CB    1 
ATOM   59   C  CG    . ARG A 1 11  ? -19.959 -3.423 -9.078  1.00 40.56 ? 2073 ARG A CG    1 
ATOM   60   C  CD    . ARG A 1 11  ? -21.080 -3.723 -8.041  1.00 52.42 ? 2073 ARG A CD    1 
ATOM   61   N  NE    . ARG A 1 11  ? -21.252 -5.122 -7.585  1.00 59.76 ? 2073 ARG A NE    1 
ATOM   62   C  CZ    . ARG A 1 11  ? -20.247 -5.985 -7.437  1.00 62.27 ? 2073 ARG A CZ    1 
ATOM   63   N  NH1   . ARG A 1 11  ? -19.012 -5.621 -7.773  1.00 62.44 ? 2073 ARG A NH1   1 
ATOM   64   N  NH2   . ARG A 1 11  ? -20.466 -7.230 -7.009  1.00 63.59 ? 2073 ARG A NH2   1 
ATOM   65   N  N     . SER A 1 12  ? -17.636 0.787  -8.792  1.00 29.04 ? 2074 SER A N     1 
ATOM   66   C  CA    . SER A 1 12  ? -17.503 2.153  -8.280  1.00 29.13 ? 2074 SER A CA    1 
ATOM   67   C  C     . SER A 1 12  ? -16.074 2.633  -8.543  1.00 27.55 ? 2074 SER A C     1 
ATOM   68   O  O     . SER A 1 12  ? -15.203 1.806  -8.829  1.00 27.48 ? 2074 SER A O     1 
ATOM   69   C  CB    . SER A 1 12  ? -17.853 2.202  -6.788  1.00 28.89 ? 2074 SER A CB    1 
ATOM   70   O  OG    . SER A 1 12  ? -16.943 1.439  -6.002  1.00 31.86 ? 2074 SER A OG    1 
ATOM   71   N  N     . ASN A 1 13  ? -15.834 3.942  -8.437  1.00 26.10 ? 2075 ASN A N     1 
ATOM   72   C  CA    . ASN A 1 13  ? -14.527 4.523  -8.745  1.00 25.28 ? 2075 ASN A CA    1 
ATOM   73   C  C     . ASN A 1 13  ? -13.403 3.983  -7.840  1.00 24.73 ? 2075 ASN A C     1 
ATOM   74   O  O     . ASN A 1 13  ? -13.598 3.660  -6.673  1.00 23.56 ? 2075 ASN A O     1 
ATOM   75   C  CB    . ASN A 1 13  ? -14.587 6.063  -8.664  1.00 24.26 ? 2075 ASN A CB    1 
ATOM   76   C  CG    . ASN A 1 13  ? -15.359 6.670  -9.798  1.00 25.60 ? 2075 ASN A CG    1 
ATOM   77   O  OD1   . ASN A 1 13  ? -15.579 6.025  -10.806 1.00 25.65 ? 2075 ASN A OD1   1 
ATOM   78   N  ND2   . ASN A 1 13  ? -15.754 7.941  -9.654  1.00 23.61 ? 2075 ASN A ND2   1 
ATOM   79   N  N     . VAL A 1 14  ? -12.226 3.878  -8.413  1.00 25.37 ? 2076 VAL A N     1 
ATOM   80   C  CA    . VAL A 1 14  ? -11.020 3.532  -7.658  1.00 25.14 ? 2076 VAL A CA    1 
ATOM   81   C  C     . VAL A 1 14  ? -10.237 4.818  -7.431  1.00 25.95 ? 2076 VAL A C     1 
ATOM   82   O  O     . VAL A 1 14  ? -9.774  5.448  -8.391  1.00 25.65 ? 2076 VAL A O     1 
ATOM   83   C  CB    . VAL A 1 14  ? -10.154 2.561  -8.463  1.00 25.37 ? 2076 VAL A CB    1 
ATOM   84   C  CG1   . VAL A 1 14  ? -8.725  2.337  -7.767  1.00 24.48 ? 2076 VAL A CG1   1 
ATOM   85   C  CG2   . VAL A 1 14  ? -10.897 1.246  -8.652  1.00 24.03 ? 2076 VAL A CG2   1 
ATOM   86   N  N     . TYR A 1 15  ? -10.075 5.216  -6.173  1.00 26.16 ? 2077 TYR A N     1 
ATOM   87   C  CA    . TYR A 1 15  ? -9.385  6.453  -5.884  1.00 27.75 ? 2077 TYR A CA    1 
ATOM   88   C  C     . TYR A 1 15  ? -7.925  6.224  -5.722  1.00 28.91 ? 2077 TYR A C     1 
ATOM   89   O  O     . TYR A 1 15  ? -7.498  5.494  -4.794  1.00 28.46 ? 2077 TYR A O     1 
ATOM   90   C  CB    . TYR A 1 15  ? -9.944  7.065  -4.615  1.00 27.59 ? 2077 TYR A CB    1 
ATOM   91   C  CG    . TYR A 1 15  ? -11.363 7.476  -4.873  1.00 30.16 ? 2077 TYR A CG    1 
ATOM   92   C  CD1   . TYR A 1 15  ? -12.420 6.622  -4.550  1.00 29.15 ? 2077 TYR A CD1   1 
ATOM   93   C  CD2   . TYR A 1 15  ? -11.646 8.677  -5.512  1.00 30.10 ? 2077 TYR A CD2   1 
ATOM   94   C  CE1   . TYR A 1 15  ? -13.705 6.958  -4.824  1.00 31.08 ? 2077 TYR A CE1   1 
ATOM   95   C  CE2   . TYR A 1 15  ? -12.941 9.040  -5.788  1.00 29.19 ? 2077 TYR A CE2   1 
ATOM   96   C  CZ    . TYR A 1 15  ? -13.965 8.184  -5.444  1.00 32.47 ? 2077 TYR A CZ    1 
ATOM   97   O  OH    . TYR A 1 15  ? -15.253 8.551  -5.711  1.00 31.77 ? 2077 TYR A OH    1 
ATOM   98   N  N     . VAL A 1 16  ? -7.160  6.850  -6.610  1.00 31.10 ? 2078 VAL A N     1 
ATOM   99   C  CA    . VAL A 1 16  ? -5.718  6.634  -6.662  1.00 30.85 ? 2078 VAL A CA    1 
ATOM   100  C  C     . VAL A 1 16  ? -4.967  7.632  -5.797  1.00 32.10 ? 2078 VAL A C     1 
ATOM   101  O  O     . VAL A 1 16  ? -4.671  7.302  -4.653  1.00 33.23 ? 2078 VAL A O     1 
ATOM   102  C  CB    . VAL A 1 16  ? -5.213  6.557  -8.082  1.00 31.05 ? 2078 VAL A CB    1 
ATOM   103  C  CG1   . VAL A 1 16  ? -3.644  6.306  -8.111  1.00 30.10 ? 2078 VAL A CG1   1 
ATOM   104  C  CG2   . VAL A 1 16  ? -5.967  5.433  -8.808  1.00 29.76 ? 2078 VAL A CG2   1 
ATOM   105  N  N     . ASP A 1 17  ? -4.667  8.838  -6.290  1.00 31.75 ? 2079 ASP A N     1 
ATOM   106  C  CA    . ASP A 1 17  ? -3.904  9.787  -5.438  1.00 33.13 ? 2079 ASP A CA    1 
ATOM   107  C  C     . ASP A 1 17  ? -4.688  10.998 -4.966  1.00 33.50 ? 2079 ASP A C     1 
ATOM   108  O  O     . ASP A 1 17  ? -4.094  11.934 -4.433  1.00 35.63 ? 2079 ASP A O     1 
ATOM   109  C  CB    . ASP A 1 17  ? -2.609  10.273 -6.164  1.00 31.79 ? 2079 ASP A CB    1 
ATOM   110  C  CG    . ASP A 1 17  ? -2.876  10.805 -7.589  1.00 34.12 ? 2079 ASP A CG    1 
ATOM   111  O  OD1   . ASP A 1 17  ? -2.104  11.709 -8.065  1.00 36.50 ? 2079 ASP A OD1   1 
ATOM   112  O  OD2   . ASP A 1 17  ? -3.851  10.341 -8.251  1.00 34.00 ? 2079 ASP A OD2   1 
ATOM   113  N  N     . VAL A 1 18  ? -5.995  11.040 -5.207  1.00 33.16 ? 2080 VAL A N     1 
ATOM   114  C  CA    . VAL A 1 18  ? -6.754  12.269 -4.896  1.00 33.30 ? 2080 VAL A CA    1 
ATOM   115  C  C     . VAL A 1 18  ? -8.161  11.906 -4.446  1.00 33.52 ? 2080 VAL A C     1 
ATOM   116  O  O     . VAL A 1 18  ? -8.612  10.758 -4.586  1.00 33.86 ? 2080 VAL A O     1 
ATOM   117  C  CB    . VAL A 1 18  ? -6.855  13.245 -6.099  1.00 32.72 ? 2080 VAL A CB    1 
ATOM   118  C  CG1   . VAL A 1 18  ? -5.533  13.924 -6.397  1.00 32.76 ? 2080 VAL A CG1   1 
ATOM   119  C  CG2   . VAL A 1 18  ? -7.383  12.532 -7.349  1.00 34.00 ? 2080 VAL A CG2   1 
ATOM   120  N  N     . LYS A 1 19  ? -8.833  12.886 -3.880  1.00 33.15 ? 2081 LYS A N     1 
ATOM   121  C  CA    . LYS A 1 19  ? -10.187 12.733 -3.417  1.00 34.97 ? 2081 LYS A CA    1 
ATOM   122  C  C     . LYS A 1 19  ? -10.994 13.915 -3.842  1.00 34.43 ? 2081 LYS A C     1 
ATOM   123  O  O     . LYS A 1 19  ? -10.711 15.006 -3.354  1.00 34.39 ? 2081 LYS A O     1 
ATOM   124  C  CB    . LYS A 1 19  ? -10.180 12.782 -1.919  1.00 35.74 ? 2081 LYS A CB    1 
ATOM   125  C  CG    . LYS A 1 19  ? -10.300 11.480 -1.360  1.00 41.12 ? 2081 LYS A CG    1 
ATOM   126  C  CD    . LYS A 1 19  ? -10.746 11.531 0.087   1.00 49.56 ? 2081 LYS A CD    1 
ATOM   127  C  CE    . LYS A 1 19  ? -10.906 10.085 0.657   1.00 52.40 ? 2081 LYS A CE    1 
ATOM   128  N  NZ    . LYS A 1 19  ? -10.811 10.014 2.165   1.00 56.09 ? 2081 LYS A NZ    1 
ATOM   129  N  N     . PRO A 1 20  ? -11.984 13.725 -4.740  1.00 34.24 ? 2082 PRO A N     1 
ATOM   130  C  CA    . PRO A 1 20  ? -12.679 14.882 -5.302  1.00 33.88 ? 2082 PRO A CA    1 
ATOM   131  C  C     . PRO A 1 20  ? -13.794 15.393 -4.378  1.00 35.16 ? 2082 PRO A C     1 
ATOM   132  O  O     . PRO A 1 20  ? -14.982 15.297 -4.701  1.00 34.63 ? 2082 PRO A O     1 
ATOM   133  C  CB    . PRO A 1 20  ? -13.219 14.344 -6.623  1.00 33.29 ? 2082 PRO A CB    1 
ATOM   134  C  CG    . PRO A 1 20  ? -13.456 12.925 -6.373  1.00 33.33 ? 2082 PRO A CG    1 
ATOM   135  C  CD    . PRO A 1 20  ? -12.441 12.463 -5.351  1.00 34.34 ? 2082 PRO A CD    1 
ATOM   136  N  N     . LEU A 1 21  ? -13.405 15.889 -3.198  1.00 36.34 ? 2083 LEU A N     1 
ATOM   137  C  CA    . LEU A 1 21  ? -14.383 16.366 -2.222  1.00 37.77 ? 2083 LEU A CA    1 
ATOM   138  C  C     . LEU A 1 21  ? -15.071 17.588 -2.780  1.00 38.38 ? 2083 LEU A C     1 
ATOM   139  O  O     . LEU A 1 21  ? -14.389 18.426 -3.381  1.00 38.09 ? 2083 LEU A O     1 
ATOM   140  C  CB    . LEU A 1 21  ? -13.668 16.749 -0.929  1.00 37.77 ? 2083 LEU A CB    1 
ATOM   141  C  CG    . LEU A 1 21  ? -12.796 15.584 -0.410  1.00 38.82 ? 2083 LEU A CG    1 
ATOM   142  C  CD1   . LEU A 1 21  ? -11.975 15.931 0.853   1.00 37.96 ? 2083 LEU A CD1   1 
ATOM   143  C  CD2   . LEU A 1 21  ? -13.721 14.405 -0.098  1.00 39.21 ? 2083 LEU A CD2   1 
ATOM   144  N  N     . SER A 1 22  ? -16.383 17.692 -2.577  1.00 39.23 ? 2084 SER A N     1 
ATOM   145  C  CA    . SER A 1 22  ? -17.151 18.807 -3.115  1.00 42.05 ? 2084 SER A CA    1 
ATOM   146  C  C     . SER A 1 22  ? -17.217 20.027 -2.192  1.00 44.65 ? 2084 SER A C     1 
ATOM   147  O  O     . SER A 1 22  ? -17.374 21.152 -2.655  1.00 45.77 ? 2084 SER A O     1 
ATOM   148  C  CB    . SER A 1 22  ? -18.572 18.375 -3.450  1.00 40.67 ? 2084 SER A CB    1 
ATOM   149  O  OG    . SER A 1 22  ? -19.247 18.050 -2.266  1.00 41.89 ? 2084 SER A OG    1 
ATOM   150  N  N     . GLY A 1 23  ? -17.130 19.817 -0.895  1.00 48.44 ? 2085 GLY A N     1 
ATOM   151  C  CA    . GLY A 1 23  ? -17.290 20.927 0.034   1.00 51.98 ? 2085 GLY A CA    1 
ATOM   152  C  C     . GLY A 1 23  ? -18.720 21.387 0.276   1.00 54.88 ? 2085 GLY A C     1 
ATOM   153  O  O     . GLY A 1 23  ? -18.915 22.453 0.870   1.00 55.42 ? 2085 GLY A O     1 
ATOM   154  N  N     . TYR A 1 24  ? -19.716 20.635 -0.208  1.00 57.27 ? 2086 TYR A N     1 
ATOM   155  C  CA    . TYR A 1 24  ? -21.052 20.687 0.420   1.00 60.36 ? 2086 TYR A CA    1 
ATOM   156  C  C     . TYR A 1 24  ? -21.471 19.419 1.135   1.00 62.23 ? 2086 TYR A C     1 
ATOM   157  O  O     . TYR A 1 24  ? -20.799 18.396 1.064   1.00 62.91 ? 2086 TYR A O     1 
ATOM   158  C  CB    . TYR A 1 24  ? -22.230 21.178 -0.457  1.00 60.25 ? 2086 TYR A CB    1 
ATOM   159  C  CG    . TYR A 1 24  ? -22.332 20.971 -1.961  1.00 61.35 ? 2086 TYR A CG    1 
ATOM   160  C  CD1   . TYR A 1 24  ? -23.486 20.413 -2.515  1.00 62.60 ? 2086 TYR A CD1   1 
ATOM   161  C  CD2   . TYR A 1 24  ? -21.377 21.483 -2.843  1.00 62.49 ? 2086 TYR A CD2   1 
ATOM   162  C  CE1   . TYR A 1 24  ? -23.652 20.311 -3.893  1.00 61.86 ? 2086 TYR A CE1   1 
ATOM   163  C  CE2   . TYR A 1 24  ? -21.529 21.365 -4.237  1.00 59.44 ? 2086 TYR A CE2   1 
ATOM   164  C  CZ    . TYR A 1 24  ? -22.667 20.778 -4.743  1.00 60.85 ? 2086 TYR A CZ    1 
ATOM   165  O  OH    . TYR A 1 24  ? -22.862 20.631 -6.092  1.00 60.07 ? 2086 TYR A OH    1 
ATOM   166  N  N     . GLU A 1 25  ? -22.603 19.493 1.819   1.00 65.68 ? 2087 GLU A N     1 
ATOM   167  C  CA    . GLU A 1 25  ? -23.401 18.311 2.086   1.00 67.78 ? 2087 GLU A CA    1 
ATOM   168  C  C     . GLU A 1 25  ? -24.690 18.591 1.315   1.00 68.91 ? 2087 GLU A C     1 
ATOM   169  O  O     . GLU A 1 25  ? -25.020 19.756 1.057   1.00 69.16 ? 2087 GLU A O     1 
ATOM   170  C  CB    . GLU A 1 25  ? -23.671 18.162 3.582   1.00 68.20 ? 2087 GLU A CB    1 
ATOM   171  C  CG    . GLU A 1 25  ? -23.323 16.783 4.151   1.00 69.61 ? 2087 GLU A CG    1 
ATOM   172  C  CD    . GLU A 1 25  ? -21.827 16.608 4.380   1.00 70.75 ? 2087 GLU A CD    1 
ATOM   173  O  OE1   . GLU A 1 25  ? -21.413 16.524 5.559   1.00 72.32 ? 2087 GLU A OE1   1 
ATOM   174  O  OE2   . GLU A 1 25  ? -21.059 16.580 3.394   1.00 70.81 ? 2087 GLU A OE2   1 
ATOM   175  N  N     . ALA A 1 26  ? -25.374 17.535 0.886   1.00 70.03 ? 2088 ALA A N     1 
ATOM   176  C  CA    . ALA A 1 26  ? -26.680 17.676 0.258   1.00 71.25 ? 2088 ALA A CA    1 
ATOM   177  C  C     . ALA A 1 26  ? -27.689 17.577 1.387   1.00 72.22 ? 2088 ALA A C     1 
ATOM   178  O  O     . ALA A 1 26  ? -28.037 16.471 1.821   1.00 72.99 ? 2088 ALA A O     1 
ATOM   179  C  CB    . ALA A 1 26  ? -26.897 16.580 -0.744  1.00 71.38 ? 2088 ALA A CB    1 
ATOM   180  N  N     . THR A 1 27  ? -28.141 18.729 1.882   1.00 72.51 ? 2089 THR A N     1 
ATOM   181  C  CA    . THR A 1 27  ? -28.783 18.751 3.184   1.00 72.91 ? 2089 THR A CA    1 
ATOM   182  C  C     . THR A 1 27  ? -30.258 19.119 3.164   1.00 72.73 ? 2089 THR A C     1 
ATOM   183  O  O     . THR A 1 27  ? -30.622 20.234 2.774   1.00 73.36 ? 2089 THR A O     1 
ATOM   184  C  CB    . THR A 1 27  ? -28.001 19.641 4.183   1.00 73.13 ? 2089 THR A CB    1 
ATOM   185  O  OG1   . THR A 1 27  ? -26.619 19.253 4.182   1.00 73.13 ? 2089 THR A OG1   1 
ATOM   186  C  CG2   . THR A 1 27  ? -28.565 19.492 5.596   1.00 73.10 ? 2089 THR A CG2   1 
ATOM   187  N  N     . THR A 1 28  ? -31.080 18.141 3.555   1.00 72.27 ? 2090 THR A N     1 
ATOM   188  C  CA    . THR A 1 28  ? -32.495 18.307 3.969   1.00 71.68 ? 2090 THR A CA    1 
ATOM   189  C  C     . THR A 1 28  ? -33.399 19.234 3.127   1.00 70.68 ? 2090 THR A C     1 
ATOM   190  O  O     . THR A 1 28  ? -33.635 20.386 3.492   1.00 70.69 ? 2090 THR A O     1 
ATOM   191  C  CB    . THR A 1 28  ? -32.598 18.664 5.489   1.00 71.75 ? 2090 THR A CB    1 
ATOM   192  O  OG1   . THR A 1 28  ? -31.917 17.674 6.275   1.00 72.41 ? 2090 THR A OG1   1 
ATOM   193  C  CG2   . THR A 1 28  ? -34.050 18.726 5.945   1.00 72.67 ? 2090 THR A CG2   1 
ATOM   194  N  N     . CYS A 1 29  ? -33.931 18.722 2.022   1.00 69.57 ? 2091 CYS A N     1 
ATOM   195  C  CA    . CYS A 1 29  ? -34.855 19.509 1.214   1.00 68.28 ? 2091 CYS A CA    1 
ATOM   196  C  C     . CYS A 1 29  ? -36.237 19.696 1.878   1.00 68.73 ? 2091 CYS A C     1 
ATOM   197  O  O     . CYS A 1 29  ? -36.522 19.117 2.930   1.00 68.44 ? 2091 CYS A O     1 
ATOM   198  C  CB    . CYS A 1 29  ? -34.980 18.928 -0.193  1.00 67.79 ? 2091 CYS A CB    1 
ATOM   199  S  SG    . CYS A 1 29  ? -35.638 17.271 -0.288  1.00 61.79 ? 2091 CYS A SG    1 
ATOM   200  N  N     . ASN A 1 30  ? -37.079 20.523 1.270   1.00 68.85 ? 2092 ASN A N     1 
ATOM   201  C  CA    . ASN A 1 30  ? -38.441 20.743 1.768   1.00 69.46 ? 2092 ASN A CA    1 
ATOM   202  C  C     . ASN A 1 30  ? -39.457 20.059 0.879   1.00 69.01 ? 2092 ASN A C     1 
ATOM   203  O  O     . ASN A 1 30  ? -40.609 20.492 0.795   1.00 68.70 ? 2092 ASN A O     1 
ATOM   204  C  CB    . ASN A 1 30  ? -38.768 22.240 1.912   1.00 69.48 ? 2092 ASN A CB    1 
ATOM   205  C  CG    . ASN A 1 30  ? -38.064 22.887 3.104   1.00 71.28 ? 2092 ASN A CG    1 
ATOM   206  O  OD1   . ASN A 1 30  ? -38.198 22.436 4.251   1.00 73.36 ? 2092 ASN A OD1   1 
ATOM   207  N  ND2   . ASN A 1 30  ? -37.314 23.958 2.835   1.00 72.88 ? 2092 ASN A ND2   1 
ATOM   208  N  N     . CYS A 1 31  ? -39.012 18.997 0.207   1.00 69.02 ? 2093 CYS A N     1 
ATOM   209  C  CA    . CYS A 1 31  ? -39.906 18.155 -0.577  1.00 69.47 ? 2093 CYS A CA    1 
ATOM   210  C  C     . CYS A 1 31  ? -40.825 17.372 0.358   1.00 70.30 ? 2093 CYS A C     1 
ATOM   211  O  O     . CYS A 1 31  ? -40.432 17.014 1.472   1.00 70.08 ? 2093 CYS A O     1 
ATOM   212  C  CB    . CYS A 1 31  ? -39.117 17.193 -1.467  1.00 69.29 ? 2093 CYS A CB    1 
ATOM   213  S  SG    . CYS A 1 31  ? -38.080 17.981 -2.741  1.00 67.15 ? 2093 CYS A SG    1 
ATOM   214  N  N     . LYS A 1 32  ? -42.047 17.124 -0.094  1.00 71.39 ? 2094 LYS A N     1 
ATOM   215  C  CA    . LYS A 1 32  ? -43.031 16.419 0.712   1.00 73.00 ? 2094 LYS A CA    1 
ATOM   216  C  C     . LYS A 1 32  ? -43.240 15.012 0.208   1.00 73.89 ? 2094 LYS A C     1 
ATOM   217  O  O     . LYS A 1 32  ? -43.464 14.794 -0.984  1.00 74.22 ? 2094 LYS A O     1 
ATOM   218  C  CB    . LYS A 1 32  ? -44.375 17.163 0.732   1.00 72.88 ? 2094 LYS A CB    1 
ATOM   219  C  CG    . LYS A 1 32  ? -44.335 18.562 1.357   1.00 74.23 ? 2094 LYS A CG    1 
ATOM   220  C  CD    . LYS A 1 32  ? -43.820 18.555 2.790   1.00 74.81 ? 2094 LYS A CD    1 
ATOM   221  C  CE    . LYS A 1 32  ? -43.855 19.950 3.375   1.00 76.98 ? 2094 LYS A CE    1 
ATOM   222  N  NZ    . LYS A 1 32  ? -43.608 19.953 4.852   1.00 78.61 ? 2094 LYS A NZ    1 
ATOM   223  N  N     . LYS A 1 33  ? -43.181 14.063 1.137   1.00 75.52 ? 2095 LYS A N     1 
ATOM   224  C  CA    . LYS A 1 33  ? -43.439 12.644 0.870   1.00 76.97 ? 2095 LYS A CA    1 
ATOM   225  C  C     . LYS A 1 33  ? -44.881 12.445 0.392   1.00 78.04 ? 2095 LYS A C     1 
ATOM   226  O  O     . LYS A 1 33  ? -45.810 12.612 1.174   1.00 78.32 ? 2095 LYS A O     1 
ATOM   227  C  CB    . LYS A 1 33  ? -43.202 11.856 2.161   1.00 76.66 ? 2095 LYS A CB    1 
ATOM   228  C  CG    . LYS A 1 33  ? -42.910 10.369 1.992   1.00 77.54 ? 2095 LYS A CG    1 
ATOM   229  C  CD    . LYS A 1 33  ? -42.261 9.801  3.266   1.00 76.57 ? 2095 LYS A CD    1 
ATOM   230  C  CE    . LYS A 1 33  ? -41.739 8.384  3.074   1.00 75.01 ? 2095 LYS A CE    1 
ATOM   231  N  NZ    . LYS A 1 33  ? -40.752 8.059  4.141   1.00 74.72 ? 2095 LYS A NZ    1 
ATOM   232  N  N     . PRO A 1 34  ? -45.079 12.091 -0.891  1.00 79.23 ? 2096 PRO A N     1 
ATOM   233  C  CA    . PRO A 1 34  ? -46.458 11.942 -1.356  1.00 80.29 ? 2096 PRO A CA    1 
ATOM   234  C  C     . PRO A 1 34  ? -47.143 10.740 -0.709  1.00 81.35 ? 2096 PRO A C     1 
ATOM   235  O  O     . PRO A 1 34  ? -46.548 9.663  -0.617  1.00 81.54 ? 2096 PRO A O     1 
ATOM   236  C  CB    . PRO A 1 34  ? -46.302 11.734 -2.867  1.00 80.30 ? 2096 PRO A CB    1 
ATOM   237  C  CG    . PRO A 1 34  ? -44.965 11.126 -3.017  1.00 79.65 ? 2096 PRO A CG    1 
ATOM   238  C  CD    . PRO A 1 34  ? -44.103 11.721 -1.932  1.00 79.19 ? 2096 PRO A CD    1 
ATOM   239  N  N     . ASP A 1 35  ? -48.386 10.935 -0.273  1.00 82.59 ? 2097 ASP A N     1 
ATOM   240  C  CA    . ASP A 1 35  ? -49.149 9.918  0.467   1.00 83.92 ? 2097 ASP A CA    1 
ATOM   241  C  C     . ASP A 1 35  ? -49.270 8.550  -0.255  1.00 84.77 ? 2097 ASP A C     1 
ATOM   242  O  O     . ASP A 1 35  ? -49.300 7.495  0.390   1.00 84.66 ? 2097 ASP A O     1 
ATOM   243  C  CB    . ASP A 1 35  ? -50.529 10.485 0.841   1.00 83.94 ? 2097 ASP A CB    1 
ATOM   244  C  CG    . ASP A 1 35  ? -50.435 11.800 1.636   1.00 84.10 ? 2097 ASP A CG    1 
ATOM   245  O  OD1   . ASP A 1 35  ? -50.937 12.842 1.154   1.00 82.43 ? 2097 ASP A OD1   1 
ATOM   246  O  OD2   . ASP A 1 35  ? -49.852 11.789 2.744   1.00 83.76 ? 2097 ASP A OD2   1 
ATOM   247  N  N     . ASP A 1 36  ? -49.326 8.590  -1.588  1.00 85.84 ? 2098 ASP A N     1 
ATOM   248  C  CA    . ASP A 1 36  ? -49.376 7.396  -2.434  1.00 86.95 ? 2098 ASP A CA    1 
ATOM   249  C  C     . ASP A 1 36  ? -48.038 6.624  -2.413  1.00 87.45 ? 2098 ASP A C     1 
ATOM   250  O  O     . ASP A 1 36  ? -46.960 7.219  -2.495  1.00 87.37 ? 2098 ASP A O     1 
ATOM   251  C  CB    . ASP A 1 36  ? -49.764 7.798  -3.870  1.00 87.17 ? 2098 ASP A CB    1 
ATOM   252  C  CG    . ASP A 1 36  ? -50.146 6.602  -4.750  1.00 88.35 ? 2098 ASP A CG    1 
ATOM   253  O  OD1   . ASP A 1 36  ? -50.568 5.545  -4.218  1.00 90.41 ? 2098 ASP A OD1   1 
ATOM   254  O  OD2   . ASP A 1 36  ? -50.039 6.727  -5.989  1.00 87.95 ? 2098 ASP A OD2   1 
ATOM   255  N  N     . ASP A 1 37  ? -48.131 5.298  -2.298  1.00 88.04 ? 2099 ASP A N     1 
ATOM   256  C  CA    . ASP A 1 37  ? -46.966 4.401  -2.180  1.00 88.28 ? 2099 ASP A CA    1 
ATOM   257  C  C     . ASP A 1 37  ? -46.003 4.397  -3.366  1.00 87.82 ? 2099 ASP A C     1 
ATOM   258  O  O     . ASP A 1 37  ? -44.810 4.208  -3.181  1.00 87.71 ? 2099 ASP A O     1 
ATOM   259  C  CB    . ASP A 1 37  ? -47.424 2.953  -1.908  1.00 88.80 ? 2099 ASP A CB    1 
ATOM   260  C  CG    . ASP A 1 37  ? -47.006 2.440  -0.532  1.00 90.07 ? 2099 ASP A CG    1 
ATOM   261  O  OD1   . ASP A 1 37  ? -45.997 2.936  0.017   1.00 92.06 ? 2099 ASP A OD1   1 
ATOM   262  O  OD2   . ASP A 1 37  ? -47.678 1.521  -0.004  1.00 91.10 ? 2099 ASP A OD2   1 
ATOM   263  N  N     . THR A 1 38  ? -46.509 4.577  -4.582  1.00 87.55 ? 2100 THR A N     1 
ATOM   264  C  CA    . THR A 1 38  ? -45.653 4.437  -5.769  1.00 87.15 ? 2100 THR A CA    1 
ATOM   265  C  C     . THR A 1 38  ? -45.436 5.723  -6.573  1.00 86.74 ? 2100 THR A C     1 
ATOM   266  O  O     . THR A 1 38  ? -44.872 5.684  -7.667  1.00 86.63 ? 2100 THR A O     1 
ATOM   267  C  CB    . THR A 1 38  ? -46.110 3.284  -6.695  1.00 87.29 ? 2100 THR A CB    1 
ATOM   268  O  OG1   . THR A 1 38  ? -47.516 3.396  -6.956  1.00 87.33 ? 2100 THR A OG1   1 
ATOM   269  C  CG2   . THR A 1 38  ? -45.821 1.927  -6.046  1.00 87.61 ? 2100 THR A CG2   1 
ATOM   270  N  N     . ARG A 1 39  ? -45.878 6.854  -6.024  1.00 86.31 ? 2101 ARG A N     1 
ATOM   271  C  CA    . ARG A 1 39  ? -45.549 8.168  -6.584  1.00 85.78 ? 2101 ARG A CA    1 
ATOM   272  C  C     . ARG A 1 39  ? -44.177 8.609  -6.037  1.00 84.67 ? 2101 ARG A C     1 
ATOM   273  O  O     . ARG A 1 39  ? -43.922 8.520  -4.830  1.00 84.53 ? 2101 ARG A O     1 
ATOM   274  C  CB    . ARG A 1 39  ? -46.644 9.192  -6.255  1.00 86.03 ? 2101 ARG A CB    1 
ATOM   275  C  CG    . ARG A 1 39  ? -46.643 10.409 -7.178  1.00 88.09 ? 2101 ARG A CG    1 
ATOM   276  C  CD    . ARG A 1 39  ? -47.618 11.489 -6.712  1.00 91.55 ? 2101 ARG A CD    1 
ATOM   277  N  NE    . ARG A 1 39  ? -47.515 12.704 -7.522  1.00 93.60 ? 2101 ARG A NE    1 
ATOM   278  C  CZ    . ARG A 1 39  ? -48.282 13.784 -7.373  1.00 94.87 ? 2101 ARG A CZ    1 
ATOM   279  N  NH1   . ARG A 1 39  ? -49.229 13.822 -6.439  1.00 95.31 ? 2101 ARG A NH1   1 
ATOM   280  N  NH2   . ARG A 1 39  ? -48.103 14.834 -8.163  1.00 94.87 ? 2101 ARG A NH2   1 
ATOM   281  N  N     . LYS A 1 40  ? -43.291 9.057  -6.922  1.00 83.46 ? 2102 LYS A N     1 
ATOM   282  C  CA    . LYS A 1 40  ? -41.912 9.365  -6.523  1.00 82.46 ? 2102 LYS A CA    1 
ATOM   283  C  C     . LYS A 1 40  ? -41.697 10.806 -6.057  1.00 81.26 ? 2102 LYS A C     1 
ATOM   284  O  O     . LYS A 1 40  ? -42.171 11.751 -6.688  1.00 81.59 ? 2102 LYS A O     1 
ATOM   285  C  CB    . LYS A 1 40  ? -40.911 8.962  -7.618  1.00 82.55 ? 2102 LYS A CB    1 
ATOM   286  C  CG    . LYS A 1 40  ? -40.700 7.434  -7.763  1.00 83.81 ? 2102 LYS A CG    1 
ATOM   287  C  CD    . LYS A 1 40  ? -40.573 6.735  -6.398  1.00 85.02 ? 2102 LYS A CD    1 
ATOM   288  C  CE    . LYS A 1 40  ? -39.920 5.358  -6.481  1.00 86.16 ? 2102 LYS A CE    1 
ATOM   289  N  NZ    . LYS A 1 40  ? -38.425 5.422  -6.350  1.00 87.62 ? 2102 LYS A NZ    1 
ATOM   290  N  N     . GLY A 1 41  ? -40.993 10.955 -4.935  1.00 79.78 ? 2103 GLY A N     1 
ATOM   291  C  CA    . GLY A 1 41  ? -40.702 12.260 -4.347  1.00 78.24 ? 2103 GLY A CA    1 
ATOM   292  C  C     . GLY A 1 41  ? -39.342 12.809 -4.741  1.00 77.40 ? 2103 GLY A C     1 
ATOM   293  O  O     . GLY A 1 41  ? -38.606 12.163 -5.483  1.00 76.83 ? 2103 GLY A O     1 
ATOM   294  N  N     . CYS A 1 42  ? -39.002 13.986 -4.208  1.00 76.63 ? 2104 CYS A N     1 
ATOM   295  C  CA    . CYS A 1 42  ? -37.833 14.760 -4.632  1.00 76.22 ? 2104 CYS A CA    1 
ATOM   296  C  C     . CYS A 1 42  ? -37.642 14.710 -6.144  1.00 77.35 ? 2104 CYS A C     1 
ATOM   297  O  O     . CYS A 1 42  ? -36.664 14.150 -6.644  1.00 77.15 ? 2104 CYS A O     1 
ATOM   298  C  CB    . CYS A 1 42  ? -36.558 14.294 -3.929  1.00 75.87 ? 2104 CYS A CB    1 
ATOM   299  S  SG    . CYS A 1 42  ? -36.429 14.774 -2.237  1.00 70.79 ? 2104 CYS A SG    1 
ATOM   300  N  N     . VAL A 1 43  ? -38.585 15.286 -6.878  1.00 78.46 ? 2105 VAL A N     1 
ATOM   301  C  CA    . VAL A 1 43  ? -38.507 15.273 -8.336  1.00 79.63 ? 2105 VAL A CA    1 
ATOM   302  C  C     . VAL A 1 43  ? -38.222 16.667 -8.913  1.00 80.25 ? 2105 VAL A C     1 
ATOM   303  O  O     . VAL A 1 43  ? -37.076 17.090 -8.974  1.00 80.46 ? 2105 VAL A O     1 
ATOM   304  C  CB    . VAL A 1 43  ? -39.764 14.618 -8.991  1.00 79.76 ? 2105 VAL A CB    1 
ATOM   305  C  CG1   . VAL A 1 43  ? -39.674 14.659 -10.515 1.00 80.27 ? 2105 VAL A CG1   1 
ATOM   306  C  CG2   . VAL A 1 43  ? -39.920 13.181 -8.534  1.00 79.90 ? 2105 VAL A CG2   1 
ATOM   307  N  N     . ASP A 1 44  ? -39.276 17.387 -9.280  1.00 81.02 ? 2106 ASP A N     1 
ATOM   308  C  CA    . ASP A 1 44  ? -39.174 18.565 -10.143 1.00 81.60 ? 2106 ASP A CA    1 
ATOM   309  C  C     . ASP A 1 44  ? -39.097 19.917 -9.421  1.00 81.08 ? 2106 ASP A C     1 
ATOM   310  O  O     . ASP A 1 44  ? -39.707 20.885 -9.873  1.00 81.85 ? 2106 ASP A O     1 
ATOM   311  C  CB    . ASP A 1 44  ? -40.390 18.587 -11.085 1.00 82.22 ? 2106 ASP A CB    1 
ATOM   312  C  CG    . ASP A 1 44  ? -41.696 18.915 -10.349 1.00 83.39 ? 2106 ASP A CG    1 
ATOM   313  O  OD1   . ASP A 1 44  ? -41.856 18.511 -9.173  1.00 84.22 ? 2106 ASP A OD1   1 
ATOM   314  O  OD2   . ASP A 1 44  ? -42.556 19.599 -10.940 1.00 85.64 ? 2106 ASP A OD2   1 
ATOM   315  N  N     . ASP A 1 45  ? -38.358 20.000 -8.323  1.00 80.03 ? 2107 ASP A N     1 
ATOM   316  C  CA    . ASP A 1 45  ? -38.342 21.218 -7.496  1.00 79.01 ? 2107 ASP A CA    1 
ATOM   317  C  C     . ASP A 1 45  ? -37.654 20.904 -6.185  1.00 76.97 ? 2107 ASP A C     1 
ATOM   318  O  O     . ASP A 1 45  ? -37.784 21.633 -5.202  1.00 77.29 ? 2107 ASP A O     1 
ATOM   319  C  CB    . ASP A 1 45  ? -39.765 21.760 -7.223  1.00 79.98 ? 2107 ASP A CB    1 
ATOM   320  C  CG    . ASP A 1 45  ? -40.059 23.094 -7.955  1.00 82.61 ? 2107 ASP A CG    1 
ATOM   321  O  OD1   . ASP A 1 45  ? -39.106 23.877 -8.193  1.00 84.19 ? 2107 ASP A OD1   1 
ATOM   322  O  OD2   . ASP A 1 45  ? -41.250 23.364 -8.283  1.00 84.37 ? 2107 ASP A OD2   1 
ATOM   323  N  N     . CYS A 1 46  ? -36.927 19.796 -6.179  1.00 74.19 ? 2108 CYS A N     1 
ATOM   324  C  CA    . CYS A 1 46  ? -36.170 19.400 -5.012  1.00 70.89 ? 2108 CYS A CA    1 
ATOM   325  C  C     . CYS A 1 46  ? -34.985 20.335 -4.796  1.00 68.80 ? 2108 CYS A C     1 
ATOM   326  O  O     . CYS A 1 46  ? -34.188 20.568 -5.707  1.00 68.49 ? 2108 CYS A O     1 
ATOM   327  C  CB    . CYS A 1 46  ? -35.703 17.955 -5.153  1.00 70.80 ? 2108 CYS A CB    1 
ATOM   328  S  SG    . CYS A 1 46  ? -34.569 17.513 -3.879  1.00 68.59 ? 2108 CYS A SG    1 
ATOM   329  N  N     . LEU A 1 47  ? -34.870 20.867 -3.584  1.00 66.15 ? 2109 LEU A N     1 
ATOM   330  C  CA    . LEU A 1 47  ? -33.777 21.776 -3.251  1.00 63.67 ? 2109 LEU A CA    1 
ATOM   331  C  C     . LEU A 1 47  ? -32.415 21.188 -3.620  1.00 61.55 ? 2109 LEU A C     1 
ATOM   332  O  O     . LEU A 1 47  ? -31.581 21.868 -4.224  1.00 61.16 ? 2109 LEU A O     1 
ATOM   333  C  CB    . LEU A 1 47  ? -33.796 22.156 -1.763  1.00 64.05 ? 2109 LEU A CB    1 
ATOM   334  C  CG    . LEU A 1 47  ? -34.863 23.133 -1.222  1.00 65.65 ? 2109 LEU A CG    1 
ATOM   335  C  CD1   . LEU A 1 47  ? -34.704 23.349 0.283   1.00 65.88 ? 2109 LEU A CD1   1 
ATOM   336  C  CD2   . LEU A 1 47  ? -34.861 24.476 -1.962  1.00 65.17 ? 2109 LEU A CD2   1 
ATOM   337  N  N     . ASN A 1 48  ? -32.196 19.929 -3.249  1.00 58.22 ? 2110 ASN A N     1 
ATOM   338  C  CA    . ASN A 1 48  ? -30.920 19.263 -3.511  1.00 55.21 ? 2110 ASN A CA    1 
ATOM   339  C  C     . ASN A 1 48  ? -30.643 19.107 -4.992  1.00 53.32 ? 2110 ASN A C     1 
ATOM   340  O  O     . ASN A 1 48  ? -29.613 19.562 -5.467  1.00 51.77 ? 2110 ASN A O     1 
ATOM   341  C  CB    . ASN A 1 48  ? -30.834 17.935 -2.771  1.00 54.50 ? 2110 ASN A CB    1 
ATOM   342  C  CG    . ASN A 1 48  ? -30.615 18.128 -1.296  1.00 52.94 ? 2110 ASN A CG    1 
ATOM   343  O  OD1   . ASN A 1 48  ? -29.924 19.050 -0.878  1.00 52.91 ? 2110 ASN A OD1   1 
ATOM   344  N  ND2   . ASN A 1 48  ? -31.209 17.271 -0.500  1.00 51.62 ? 2110 ASN A ND2   1 
ATOM   345  N  N     . ARG A 1 49  ? -31.589 18.506 -5.703  1.00 51.67 ? 2111 ARG A N     1 
ATOM   346  C  CA    . ARG A 1 49  ? -31.500 18.302 -7.138  1.00 51.80 ? 2111 ARG A CA    1 
ATOM   347  C  C     . ARG A 1 49  ? -31.111 19.595 -7.892  1.00 51.45 ? 2111 ARG A C     1 
ATOM   348  O  O     . ARG A 1 49  ? -30.315 19.575 -8.843  1.00 51.15 ? 2111 ARG A O     1 
ATOM   349  C  CB    . ARG A 1 49  ? -32.828 17.730 -7.652  1.00 52.41 ? 2111 ARG A CB    1 
ATOM   350  C  CG    . ARG A 1 49  ? -32.943 17.612 -9.148  1.00 53.46 ? 2111 ARG A CG    1 
ATOM   351  C  CD    . ARG A 1 49  ? -34.248 16.959 -9.552  1.00 56.55 ? 2111 ARG A CD    1 
ATOM   352  N  NE    . ARG A 1 49  ? -34.356 15.578 -9.101  1.00 58.50 ? 2111 ARG A NE    1 
ATOM   353  C  CZ    . ARG A 1 49  ? -34.395 14.521 -9.906  1.00 61.35 ? 2111 ARG A CZ    1 
ATOM   354  N  NH1   . ARG A 1 49  ? -34.357 14.685 -11.215 1.00 62.90 ? 2111 ARG A NH1   1 
ATOM   355  N  NH2   . ARG A 1 49  ? -34.495 13.294 -9.407  1.00 61.78 ? 2111 ARG A NH2   1 
ATOM   356  N  N     . MET A 1 50  ? -31.644 20.724 -7.436  1.00 50.16 ? 2112 MET A N     1 
ATOM   357  C  CA    . MET A 1 50  ? -31.471 21.985 -8.144  1.00 49.60 ? 2112 MET A CA    1 
ATOM   358  C  C     . MET A 1 50  ? -30.023 22.487 -8.166  1.00 47.28 ? 2112 MET A C     1 
ATOM   359  O  O     . MET A 1 50  ? -29.635 23.278 -9.029  1.00 46.59 ? 2112 MET A O     1 
ATOM   360  C  CB    . MET A 1 50  ? -32.425 23.043 -7.589  1.00 50.74 ? 2112 MET A CB    1 
ATOM   361  C  CG    . MET A 1 50  ? -33.871 22.586 -7.659  1.00 56.25 ? 2112 MET A CG    1 
ATOM   362  S  SD    . MET A 1 50  ? -34.741 22.859 -9.224  1.00 71.03 ? 2112 MET A SD    1 
ATOM   363  C  CE    . MET A 1 50  ? -33.519 22.629 -10.518 1.00 68.23 ? 2112 MET A CE    1 
ATOM   364  N  N     . ILE A 1 51  ? -29.233 22.010 -7.214  1.00 44.07 ? 2113 ILE A N     1 
ATOM   365  C  CA    . ILE A 1 51  ? -27.817 22.281 -7.192  1.00 41.57 ? 2113 ILE A CA    1 
ATOM   366  C  C     . ILE A 1 51  ? -26.953 21.063 -7.608  1.00 39.43 ? 2113 ILE A C     1 
ATOM   367  O  O     . ILE A 1 51  ? -25.744 21.069 -7.424  1.00 38.64 ? 2113 ILE A O     1 
ATOM   368  C  CB    . ILE A 1 51  ? -27.394 22.867 -5.834  1.00 41.28 ? 2113 ILE A CB    1 
ATOM   369  C  CG1   . ILE A 1 51  ? -27.550 21.845 -4.705  1.00 43.58 ? 2113 ILE A CG1   1 
ATOM   370  C  CG2   . ILE A 1 51  ? -28.253 24.072 -5.508  1.00 43.38 ? 2113 ILE A CG2   1 
ATOM   371  C  CD1   . ILE A 1 51  ? -26.918 22.304 -3.389  1.00 42.44 ? 2113 ILE A CD1   1 
ATOM   372  N  N     . PHE A 1 52  ? -27.577 20.049 -8.193  1.00 37.47 ? 2114 PHE A N     1 
ATOM   373  C  CA    . PHE A 1 52  ? -26.859 18.830 -8.633  1.00 36.35 ? 2114 PHE A CA    1 
ATOM   374  C  C     . PHE A 1 52  ? -26.225 18.133 -7.414  1.00 36.10 ? 2114 PHE A C     1 
ATOM   375  O  O     . PHE A 1 52  ? -25.106 17.673 -7.462  1.00 35.25 ? 2114 PHE A O     1 
ATOM   376  C  CB    . PHE A 1 52  ? -25.802 19.161 -9.719  1.00 35.78 ? 2114 PHE A CB    1 
ATOM   377  C  CG    . PHE A 1 52  ? -26.395 19.544 -11.057 1.00 33.78 ? 2114 PHE A CG    1 
ATOM   378  C  CD1   . PHE A 1 52  ? -26.411 20.870 -11.486 1.00 34.09 ? 2114 PHE A CD1   1 
ATOM   379  C  CD2   . PHE A 1 52  ? -26.960 18.598 -11.865 1.00 33.06 ? 2114 PHE A CD2   1 
ATOM   380  C  CE1   . PHE A 1 52  ? -26.971 21.236 -12.746 1.00 32.38 ? 2114 PHE A CE1   1 
ATOM   381  C  CE2   . PHE A 1 52  ? -27.500 18.912 -13.097 1.00 33.74 ? 2114 PHE A CE2   1 
ATOM   382  C  CZ    . PHE A 1 52  ? -27.530 20.248 -13.540 1.00 32.43 ? 2114 PHE A CZ    1 
ATOM   383  N  N     . ALA A 1 53  ? -26.946 18.126 -6.300  1.00 36.03 ? 2115 ALA A N     1 
ATOM   384  C  CA    . ALA A 1 53  ? -26.550 17.359 -5.132  1.00 35.96 ? 2115 ALA A CA    1 
ATOM   385  C  C     . ALA A 1 53  ? -27.626 16.310 -4.908  1.00 36.37 ? 2115 ALA A C     1 
ATOM   386  O  O     . ALA A 1 53  ? -28.835 16.618 -4.989  1.00 35.35 ? 2115 ALA A O     1 
ATOM   387  C  CB    . ALA A 1 53  ? -26.438 18.256 -3.926  1.00 36.04 ? 2115 ALA A CB    1 
ATOM   388  N  N     . GLU A 1 54  ? -27.204 15.080 -4.651  1.00 35.36 ? 2116 GLU A N     1 
ATOM   389  C  CA    . GLU A 1 54  ? -28.141 14.021 -4.297  1.00 36.38 ? 2116 GLU A CA    1 
ATOM   390  C  C     . GLU A 1 54  ? -28.612 14.151 -2.856  1.00 37.43 ? 2116 GLU A C     1 
ATOM   391  O  O     . GLU A 1 54  ? -27.916 14.696 -2.051  1.00 36.39 ? 2116 GLU A O     1 
ATOM   392  C  CB    . GLU A 1 54  ? -27.504 12.646 -4.531  1.00 35.43 ? 2116 GLU A CB    1 
ATOM   393  C  CG    . GLU A 1 54  ? -27.266 12.387 -6.030  1.00 35.21 ? 2116 GLU A CG    1 
ATOM   394  C  CD    . GLU A 1 54  ? -27.265 10.944 -6.377  1.00 32.89 ? 2116 GLU A CD    1 
ATOM   395  O  OE1   . GLU A 1 54  ? -27.585 10.631 -7.546  1.00 30.66 ? 2116 GLU A OE1   1 
ATOM   396  O  OE2   . GLU A 1 54  ? -26.914 10.127 -5.487  1.00 32.74 ? 2116 GLU A OE2   1 
ATOM   397  N  N     . CYS A 1 55  ? -29.793 13.635 -2.551  1.00 40.07 ? 2117 CYS A N     1 
ATOM   398  C  CA    . CYS A 1 55  ? -30.253 13.563 -1.171  1.00 43.94 ? 2117 CYS A CA    1 
ATOM   399  C  C     . CYS A 1 55  ? -29.431 12.530 -0.380  1.00 45.60 ? 2117 CYS A C     1 
ATOM   400  O  O     . CYS A 1 55  ? -28.851 11.593 -0.965  1.00 44.94 ? 2117 CYS A O     1 
ATOM   401  C  CB    . CYS A 1 55  ? -31.742 13.221 -1.124  1.00 44.16 ? 2117 CYS A CB    1 
ATOM   402  S  SG    . CYS A 1 55  ? -32.896 14.551 -1.678  1.00 49.78 ? 2117 CYS A SG    1 
ATOM   403  N  N     . SER A 1 56  ? -29.329 12.732 0.930   1.00 47.40 ? 2118 SER A N     1 
ATOM   404  C  CA    . SER A 1 56  ? -28.842 11.686 1.820   1.00 50.39 ? 2118 SER A CA    1 
ATOM   405  C  C     . SER A 1 56  ? -30.004 10.891 2.397   1.00 52.67 ? 2118 SER A C     1 
ATOM   406  O  O     . SER A 1 56  ? -31.013 11.480 2.818   1.00 52.44 ? 2118 SER A O     1 
ATOM   407  C  CB    . SER A 1 56  ? -28.030 12.251 2.968   1.00 50.42 ? 2118 SER A CB    1 
ATOM   408  O  OG    . SER A 1 56  ? -27.916 11.244 3.961   1.00 51.66 ? 2118 SER A OG    1 
ATOM   409  N  N     . PRO A 1 57  ? -29.864 9.551  2.434   1.00 54.52 ? 2119 PRO A N     1 
ATOM   410  C  CA    . PRO A 1 57  ? -30.928 8.667  2.928   1.00 56.41 ? 2119 PRO A CA    1 
ATOM   411  C  C     . PRO A 1 57  ? -31.209 8.873  4.435   1.00 57.98 ? 2119 PRO A C     1 
ATOM   412  O  O     . PRO A 1 57  ? -32.245 8.457  4.931   1.00 57.68 ? 2119 PRO A O     1 
ATOM   413  C  CB    . PRO A 1 57  ? -30.377 7.262  2.653   1.00 56.28 ? 2119 PRO A CB    1 
ATOM   414  C  CG    . PRO A 1 57  ? -28.876 7.431  2.659   1.00 55.70 ? 2119 PRO A CG    1 
ATOM   415  C  CD    . PRO A 1 57  ? -28.630 8.813  2.101   1.00 55.00 ? 2119 PRO A CD    1 
ATOM   416  N  N     . ASN A 1 58  ? -30.289 9.528  5.131   1.00 59.74 ? 2120 ASN A N     1 
ATOM   417  C  CA    . ASN A 1 58  ? -30.479 9.877  6.530   1.00 61.78 ? 2120 ASN A CA    1 
ATOM   418  C  C     . ASN A 1 58  ? -31.392 11.100 6.732   1.00 63.17 ? 2120 ASN A C     1 
ATOM   419  O  O     . ASN A 1 58  ? -32.129 11.180 7.721   1.00 63.38 ? 2120 ASN A O     1 
ATOM   420  C  CB    . ASN A 1 58  ? -29.122 10.149 7.179   1.00 61.92 ? 2120 ASN A CB    1 
ATOM   421  C  CG    . ASN A 1 58  ? -28.151 9.001  7.006   1.00 63.26 ? 2120 ASN A CG    1 
ATOM   422  O  OD1   . ASN A 1 58  ? -28.553 7.878  6.718   1.00 66.19 ? 2120 ASN A OD1   1 
ATOM   423  N  ND2   . ASN A 1 58  ? -26.869 9.275  7.193   1.00 63.98 ? 2120 ASN A ND2   1 
ATOM   424  N  N     . THR A 1 59  ? -31.324 12.052 5.800   1.00 64.27 ? 2121 THR A N     1 
ATOM   425  C  CA    . THR A 1 59  ? -32.006 13.336 5.946   1.00 65.46 ? 2121 THR A CA    1 
ATOM   426  C  C     . THR A 1 59  ? -33.289 13.482 5.124   1.00 65.39 ? 2121 THR A C     1 
ATOM   427  O  O     . THR A 1 59  ? -34.173 14.227 5.520   1.00 65.93 ? 2121 THR A O     1 
ATOM   428  C  CB    . THR A 1 59  ? -31.063 14.564 5.652   1.00 65.77 ? 2121 THR A CB    1 
ATOM   429  O  OG1   . THR A 1 59  ? -30.533 14.485 4.322   1.00 67.33 ? 2121 THR A OG1   1 
ATOM   430  C  CG2   . THR A 1 59  ? -29.913 14.633 6.639   1.00 66.21 ? 2121 THR A CG2   1 
ATOM   431  N  N     . CYS A 1 60  ? -33.399 12.796 3.994   1.00 65.20 ? 2122 CYS A N     1 
ATOM   432  C  CA    . CYS A 1 60  ? -34.442 13.134 3.038   1.00 65.13 ? 2122 CYS A CA    1 
ATOM   433  C  C     . CYS A 1 60  ? -35.873 12.960 3.587   1.00 65.94 ? 2122 CYS A C     1 
ATOM   434  O  O     . CYS A 1 60  ? -36.235 11.877 4.054   1.00 65.57 ? 2122 CYS A O     1 
ATOM   435  C  CB    . CYS A 1 60  ? -34.257 12.384 1.718   1.00 65.24 ? 2122 CYS A CB    1 
ATOM   436  S  SG    . CYS A 1 60  ? -35.450 12.863 0.464   1.00 61.79 ? 2122 CYS A SG    1 
ATOM   437  N  N     . PRO A 1 61  ? -36.689 14.028 3.512   1.00 66.10 ? 2123 PRO A N     1 
ATOM   438  C  CA    . PRO A 1 61  ? -38.066 13.963 3.981   1.00 66.87 ? 2123 PRO A CA    1 
ATOM   439  C  C     . PRO A 1 61  ? -38.889 12.900 3.255   1.00 67.20 ? 2123 PRO A C     1 
ATOM   440  O  O     . PRO A 1 61  ? -39.845 12.370 3.835   1.00 67.50 ? 2123 PRO A O     1 
ATOM   441  C  CB    . PRO A 1 61  ? -38.623 15.367 3.673   1.00 66.84 ? 2123 PRO A CB    1 
ATOM   442  C  CG    . PRO A 1 61  ? -37.691 15.962 2.699   1.00 66.49 ? 2123 PRO A CG    1 
ATOM   443  C  CD    . PRO A 1 61  ? -36.356 15.360 2.982   1.00 66.62 ? 2123 PRO A CD    1 
ATOM   444  N  N     . CYS A 1 62  ? -38.517 12.585 2.011   1.00 66.59 ? 2124 CYS A N     1 
ATOM   445  C  CA    . CYS A 1 62  ? -39.293 11.659 1.192   1.00 66.44 ? 2124 CYS A CA    1 
ATOM   446  C  C     . CYS A 1 62  ? -38.929 10.192 1.421   1.00 66.47 ? 2124 CYS A C     1 
ATOM   447  O  O     . CYS A 1 62  ? -39.501 9.300  0.785   1.00 66.30 ? 2124 CYS A O     1 
ATOM   448  C  CB    . CYS A 1 62  ? -39.176 12.005 -0.295  1.00 66.13 ? 2124 CYS A CB    1 
ATOM   449  S  SG    . CYS A 1 62  ? -39.819 13.638 -0.779  1.00 67.12 ? 2124 CYS A SG    1 
ATOM   450  N  N     . GLY A 1 63  ? -37.980 9.943  2.324   1.00 66.56 ? 2125 GLY A N     1 
ATOM   451  C  CA    . GLY A 1 63  ? -37.576 8.576  2.677   1.00 66.32 ? 2125 GLY A CA    1 
ATOM   452  C  C     . GLY A 1 63  ? -37.268 7.693  1.475   1.00 66.77 ? 2125 GLY A C     1 
ATOM   453  O  O     . GLY A 1 63  ? -36.359 7.985  0.683   1.00 66.59 ? 2125 GLY A O     1 
ATOM   454  N  N     . GLU A 1 64  ? -38.045 6.622  1.315   1.00 66.67 ? 2126 GLU A N     1 
ATOM   455  C  CA    . GLU A 1 64  ? -37.786 5.634  0.265   1.00 66.35 ? 2126 GLU A CA    1 
ATOM   456  C  C     . GLU A 1 64  ? -38.299 6.042  -1.110  1.00 65.82 ? 2126 GLU A C     1 
ATOM   457  O  O     . GLU A 1 64  ? -37.909 5.462  -2.128  1.00 65.54 ? 2126 GLU A O     1 
ATOM   458  C  CB    . GLU A 1 64  ? -38.320 4.252  0.663   1.00 66.85 ? 2126 GLU A CB    1 
ATOM   459  C  CG    . GLU A 1 64  ? -37.460 3.540  1.724   1.00 68.33 ? 2126 GLU A CG    1 
ATOM   460  C  CD    . GLU A 1 64  ? -35.972 3.486  1.355   1.00 70.94 ? 2126 GLU A CD    1 
ATOM   461  O  OE1   . GLU A 1 64  ? -35.590 2.704  0.450   1.00 70.04 ? 2126 GLU A OE1   1 
ATOM   462  O  OE2   . GLU A 1 64  ? -35.177 4.237  1.970   1.00 72.37 ? 2126 GLU A OE2   1 
ATOM   463  N  N     . GLN A 1 65  ? -39.169 7.039  -1.143  1.00 64.83 ? 2127 GLN A N     1 
ATOM   464  C  CA    . GLN A 1 65  ? -39.641 7.564  -2.416  1.00 64.50 ? 2127 GLN A CA    1 
ATOM   465  C  C     . GLN A 1 65  ? -38.707 8.629  -2.970  1.00 62.99 ? 2127 GLN A C     1 
ATOM   466  O  O     . GLN A 1 65  ? -38.942 9.136  -4.068  1.00 63.46 ? 2127 GLN A O     1 
ATOM   467  C  CB    . GLN A 1 65  ? -41.078 8.101  -2.310  1.00 65.27 ? 2127 GLN A CB    1 
ATOM   468  C  CG    . GLN A 1 65  ? -42.133 7.050  -2.621  1.00 67.36 ? 2127 GLN A CG    1 
ATOM   469  C  CD    . GLN A 1 65  ? -43.391 7.186  -1.770  1.00 70.60 ? 2127 GLN A CD    1 
ATOM   470  O  OE1   . GLN A 1 65  ? -43.807 8.284  -1.398  1.00 71.00 ? 2127 GLN A OE1   1 
ATOM   471  N  NE2   . GLN A 1 65  ? -44.011 6.058  -1.471  1.00 73.29 ? 2127 GLN A NE2   1 
ATOM   472  N  N     . CYS A 1 66  ? -37.660 8.984  -2.219  1.00 60.96 ? 2128 CYS A N     1 
ATOM   473  C  CA    . CYS A 1 66  ? -36.661 9.900  -2.756  1.00 57.59 ? 2128 CYS A CA    1 
ATOM   474  C  C     . CYS A 1 66  ? -36.083 9.309  -4.022  1.00 56.67 ? 2128 CYS A C     1 
ATOM   475  O  O     . CYS A 1 66  ? -35.488 8.228  -4.033  1.00 56.19 ? 2128 CYS A O     1 
ATOM   476  C  CB    . CYS A 1 66  ? -35.544 10.224 -1.782  1.00 58.09 ? 2128 CYS A CB    1 
ATOM   477  S  SG    . CYS A 1 66  ? -34.552 11.620 -2.412  1.00 52.48 ? 2128 CYS A SG    1 
ATOM   478  N  N     . CYS A 1 67  ? -36.304 10.026 -5.107  1.00 54.65 ? 2129 CYS A N     1 
ATOM   479  C  CA    . CYS A 1 67  ? -35.829 9.609  -6.397  1.00 52.83 ? 2129 CYS A CA    1 
ATOM   480  C  C     . CYS A 1 67  ? -34.596 10.421 -6.825  1.00 49.77 ? 2129 CYS A C     1 
ATOM   481  O  O     . CYS A 1 67  ? -34.240 10.469 -8.000  1.00 48.28 ? 2129 CYS A O     1 
ATOM   482  C  CB    . CYS A 1 67  ? -36.984 9.618  -7.404  1.00 53.87 ? 2129 CYS A CB    1 
ATOM   483  S  SG    . CYS A 1 67  ? -37.291 11.067 -8.367  1.00 60.17 ? 2129 CYS A SG    1 
ATOM   484  N  N     . ASN A 1 68  ? -33.938 11.021 -5.831  1.00 46.73 ? 2130 ASN A N     1 
ATOM   485  C  CA    . ASN A 1 68  ? -32.741 11.858 -6.004  1.00 44.06 ? 2130 ASN A CA    1 
ATOM   486  C  C     . ASN A 1 68  ? -31.517 11.244 -5.318  1.00 41.93 ? 2130 ASN A C     1 
ATOM   487  O  O     . ASN A 1 68  ? -30.751 11.950 -4.656  1.00 40.34 ? 2130 ASN A O     1 
ATOM   488  C  CB    . ASN A 1 68  ? -32.974 13.293 -5.478  1.00 43.56 ? 2130 ASN A CB    1 
ATOM   489  C  CG    . ASN A 1 68  ? -31.819 14.254 -5.832  1.00 44.00 ? 2130 ASN A CG    1 
ATOM   490  O  OD1   . ASN A 1 68  ? -31.281 14.187 -6.927  1.00 46.11 ? 2130 ASN A OD1   1 
ATOM   491  N  ND2   . ASN A 1 68  ? -31.444 15.148 -4.907  1.00 39.94 ? 2130 ASN A ND2   1 
ATOM   492  N  N     . GLN A 1 69  ? -31.355 9.928  -5.498  1.00 40.42 ? 2131 GLN A N     1 
ATOM   493  C  CA    . GLN A 1 69  ? -30.247 9.150  -4.931  1.00 39.69 ? 2131 GLN A CA    1 
ATOM   494  C  C     . GLN A 1 69  ? -29.787 8.115  -5.954  1.00 39.14 ? 2131 GLN A C     1 
ATOM   495  O  O     . GLN A 1 69  ? -29.336 7.014  -5.630  1.00 38.48 ? 2131 GLN A O     1 
ATOM   496  C  CB    . GLN A 1 69  ? -30.690 8.484  -3.636  1.00 39.69 ? 2131 GLN A CB    1 
ATOM   497  C  CG    . GLN A 1 69  ? -30.842 9.478  -2.500  1.00 41.19 ? 2131 GLN A CG    1 
ATOM   498  C  CD    . GLN A 1 69  ? -31.527 8.878  -1.271  1.00 44.71 ? 2131 GLN A CD    1 
ATOM   499  O  OE1   . GLN A 1 69  ? -31.109 7.863  -0.753  1.00 43.91 ? 2131 GLN A OE1   1 
ATOM   500  N  NE2   . GLN A 1 69  ? -32.574 9.532  -0.803  1.00 47.41 ? 2131 GLN A NE2   1 
ATOM   501  N  N     . ARG A 1 70  ? -29.933 8.510  -7.208  1.00 38.57 ? 2132 ARG A N     1 
ATOM   502  C  CA    . ARG A 1 70  ? -29.673 7.658  -8.333  1.00 38.74 ? 2132 ARG A CA    1 
ATOM   503  C  C     . ARG A 1 70  ? -28.231 7.181  -8.509  1.00 37.58 ? 2132 ARG A C     1 
ATOM   504  O  O     . ARG A 1 70  ? -28.033 6.057  -8.883  1.00 37.43 ? 2132 ARG A O     1 
ATOM   505  C  CB    . ARG A 1 70  ? -30.178 8.326  -9.585  1.00 39.34 ? 2132 ARG A CB    1 
ATOM   506  C  CG    . ARG A 1 70  ? -31.652 8.591  -9.460  1.00 42.70 ? 2132 ARG A CG    1 
ATOM   507  C  CD    . ARG A 1 70  ? -32.308 8.126  -10.686 1.00 48.77 ? 2132 ARG A CD    1 
ATOM   508  N  NE    . ARG A 1 70  ? -32.531 9.195  -11.653 1.00 52.15 ? 2132 ARG A NE    1 
ATOM   509  C  CZ    . ARG A 1 70  ? -33.567 10.049 -11.564 1.00 56.25 ? 2132 ARG A CZ    1 
ATOM   510  N  NH1   . ARG A 1 70  ? -33.821 10.959 -12.480 1.00 57.04 ? 2132 ARG A NH1   1 
ATOM   511  N  NH2   . ARG A 1 70  ? -34.370 10.000 -10.509 1.00 56.88 ? 2132 ARG A NH2   1 
ATOM   512  N  N     . ILE A 1 71  ? -27.241 8.022  -8.234  1.00 36.19 ? 2133 ILE A N     1 
ATOM   513  C  CA    . ILE A 1 71  ? -25.861 7.576  -8.361  1.00 36.13 ? 2133 ILE A CA    1 
ATOM   514  C  C     . ILE A 1 71  ? -25.449 6.695  -7.157  1.00 36.87 ? 2133 ILE A C     1 
ATOM   515  O  O     . ILE A 1 71  ? -24.911 5.611  -7.338  1.00 34.94 ? 2133 ILE A O     1 
ATOM   516  C  CB    . ILE A 1 71  ? -24.887 8.744  -8.578  1.00 35.85 ? 2133 ILE A CB    1 
ATOM   517  C  CG1   . ILE A 1 71  ? -25.197 9.499  -9.897  1.00 35.27 ? 2133 ILE A CG1   1 
ATOM   518  C  CG2   . ILE A 1 71  ? -23.455 8.238  -8.592  1.00 33.87 ? 2133 ILE A CG2   1 
ATOM   519  C  CD1   . ILE A 1 71  ? -24.533 10.889 -9.992  1.00 32.82 ? 2133 ILE A CD1   1 
ATOM   520  N  N     . GLN A 1 72  ? -25.721 7.188  -5.946  1.00 37.59 ? 2134 GLN A N     1 
ATOM   521  C  CA    . GLN A 1 72  ? -25.620 6.433  -4.700  1.00 39.65 ? 2134 GLN A CA    1 
ATOM   522  C  C     . GLN A 1 72  ? -26.116 5.006  -4.775  1.00 39.75 ? 2134 GLN A C     1 
ATOM   523  O  O     . GLN A 1 72  ? -25.498 4.127  -4.222  1.00 40.77 ? 2134 GLN A O     1 
ATOM   524  C  CB    . GLN A 1 72  ? -26.527 7.057  -3.653  1.00 40.51 ? 2134 GLN A CB    1 
ATOM   525  C  CG    . GLN A 1 72  ? -25.938 8.160  -2.948  1.00 44.63 ? 2134 GLN A CG    1 
ATOM   526  C  CD    . GLN A 1 72  ? -26.942 8.801  -2.042  1.00 46.45 ? 2134 GLN A CD    1 
ATOM   527  O  OE1   . GLN A 1 72  ? -27.551 8.132  -1.210  1.00 48.65 ? 2134 GLN A OE1   1 
ATOM   528  N  NE2   . GLN A 1 72  ? -27.116 10.104 -2.195  1.00 48.31 ? 2134 GLN A NE2   1 
ATOM   529  N  N     . ARG A 1 73  ? -27.280 4.812  -5.373  1.00 40.39 ? 2135 ARG A N     1 
ATOM   530  C  CA    . ARG A 1 73  ? -27.943 3.508  -5.390  1.00 42.12 ? 2135 ARG A CA    1 
ATOM   531  C  C     . ARG A 1 73  ? -27.675 2.761  -6.694  1.00 41.68 ? 2135 ARG A C     1 
ATOM   532  O  O     . ARG A 1 73  ? -28.326 1.770  -6.978  1.00 41.71 ? 2135 ARG A O     1 
ATOM   533  C  CB    . ARG A 1 73  ? -29.458 3.679  -5.209  1.00 42.45 ? 2135 ARG A CB    1 
ATOM   534  C  CG    . ARG A 1 73  ? -29.857 4.236  -3.841  1.00 45.77 ? 2135 ARG A CG    1 
ATOM   535  C  CD    . ARG A 1 73  ? -31.326 4.609  -3.753  1.00 51.38 ? 2135 ARG A CD    1 
ATOM   536  N  NE    . ARG A 1 73  ? -31.871 4.267  -2.438  1.00 59.82 ? 2135 ARG A NE    1 
ATOM   537  C  CZ    . ARG A 1 73  ? -32.694 5.043  -1.732  1.00 64.57 ? 2135 ARG A CZ    1 
ATOM   538  N  NH1   . ARG A 1 73  ? -33.058 6.234  -2.202  1.00 67.05 ? 2135 ARG A NH1   1 
ATOM   539  N  NH2   . ARG A 1 73  ? -33.152 4.637  -0.550  1.00 66.04 ? 2135 ARG A NH2   1 
ATOM   540  N  N     . HIS A 1 74  ? -26.735 3.271  -7.491  1.00 41.22 ? 2136 HIS A N     1 
ATOM   541  C  CA    . HIS A 1 74  ? -26.306 2.614  -8.712  1.00 40.89 ? 2136 HIS A CA    1 
ATOM   542  C  C     . HIS A 1 74  ? -27.504 2.241  -9.578  1.00 41.09 ? 2136 HIS A C     1 
ATOM   543  O  O     . HIS A 1 74  ? -27.621 1.114  -10.073 1.00 40.37 ? 2136 HIS A O     1 
ATOM   544  C  CB    . HIS A 1 74  ? -25.449 1.385  -8.376  1.00 41.65 ? 2136 HIS A CB    1 
ATOM   545  C  CG    . HIS A 1 74  ? -24.469 1.609  -7.264  1.00 43.08 ? 2136 HIS A CG    1 
ATOM   546  N  ND1   . HIS A 1 74  ? -23.311 2.342  -7.424  1.00 45.86 ? 2136 HIS A ND1   1 
ATOM   547  C  CD2   . HIS A 1 74  ? -24.470 1.190  -5.976  1.00 44.73 ? 2136 HIS A CD2   1 
ATOM   548  C  CE1   . HIS A 1 74  ? -22.638 2.362  -6.285  1.00 45.85 ? 2136 HIS A CE1   1 
ATOM   549  N  NE2   . HIS A 1 74  ? -23.319 1.667  -5.391  1.00 45.49 ? 2136 HIS A NE2   1 
ATOM   550  N  N     . GLU A 1 75  ? -28.396 3.204  -9.789  1.00 40.49 ? 2137 GLU A N     1 
ATOM   551  C  CA    . GLU A 1 75  ? -29.652 2.921  -10.482 1.00 40.65 ? 2137 GLU A CA    1 
ATOM   552  C  C     . GLU A 1 75  ? -29.535 3.018  -12.006 1.00 39.97 ? 2137 GLU A C     1 
ATOM   553  O  O     . GLU A 1 75  ? -30.287 3.741  -12.657 1.00 39.95 ? 2137 GLU A O     1 
ATOM   554  C  CB    . GLU A 1 75  ? -30.772 3.808  -9.948  1.00 41.07 ? 2137 GLU A CB    1 
ATOM   555  C  CG    . GLU A 1 75  ? -30.965 3.654  -8.431  1.00 44.06 ? 2137 GLU A CG    1 
ATOM   556  C  CD    . GLU A 1 75  ? -32.250 4.289  -7.921  1.00 47.36 ? 2137 GLU A CD    1 
ATOM   557  O  OE1   . GLU A 1 75  ? -32.552 5.438  -8.295  1.00 45.70 ? 2137 GLU A OE1   1 
ATOM   558  O  OE2   . GLU A 1 75  ? -32.965 3.629  -7.130  1.00 51.35 ? 2137 GLU A OE2   1 
ATOM   559  N  N     . TRP A 1 76  ? -28.577 2.279  -12.553 1.00 38.58 ? 2138 TRP A N     1 
ATOM   560  C  CA    . TRP A 1 76  ? -28.311 2.281  -13.970 1.00 38.40 ? 2138 TRP A CA    1 
ATOM   561  C  C     . TRP A 1 76  ? -29.399 1.561  -14.781 1.00 39.36 ? 2138 TRP A C     1 
ATOM   562  O  O     . TRP A 1 76  ? -29.924 0.504  -14.402 1.00 38.95 ? 2138 TRP A O     1 
ATOM   563  C  CB    . TRP A 1 76  ? -26.954 1.615  -14.267 1.00 37.96 ? 2138 TRP A CB    1 
ATOM   564  C  CG    . TRP A 1 76  ? -25.773 2.044  -13.398 1.00 36.60 ? 2138 TRP A CG    1 
ATOM   565  C  CD1   . TRP A 1 76  ? -25.706 3.116  -12.551 1.00 34.61 ? 2138 TRP A CD1   1 
ATOM   566  C  CD2   . TRP A 1 76  ? -24.493 1.404  -13.323 1.00 38.43 ? 2138 TRP A CD2   1 
ATOM   567  N  NE1   . TRP A 1 76  ? -24.468 3.191  -11.977 1.00 34.85 ? 2138 TRP A NE1   1 
ATOM   568  C  CE2   . TRP A 1 76  ? -23.707 2.147  -12.427 1.00 37.84 ? 2138 TRP A CE2   1 
ATOM   569  C  CE3   . TRP A 1 76  ? -23.925 0.283  -13.954 1.00 40.94 ? 2138 TRP A CE3   1 
ATOM   570  C  CZ2   . TRP A 1 76  ? -22.404 1.803  -12.128 1.00 40.28 ? 2138 TRP A CZ2   1 
ATOM   571  C  CZ3   . TRP A 1 76  ? -22.618 -0.055 -13.663 1.00 40.65 ? 2138 TRP A CZ3   1 
ATOM   572  C  CH2   . TRP A 1 76  ? -21.876 0.696  -12.754 1.00 41.90 ? 2138 TRP A CH2   1 
ATOM   573  N  N     . VAL A 1 77  ? -29.720 2.158  -15.910 1.00 38.87 ? 2139 VAL A N     1 
ATOM   574  C  CA    . VAL A 1 77  ? -30.470 1.514  -16.958 1.00 40.17 ? 2139 VAL A CA    1 
ATOM   575  C  C     . VAL A 1 77  ? -29.862 0.113  -17.239 1.00 40.86 ? 2139 VAL A C     1 
ATOM   576  O  O     . VAL A 1 77  ? -28.652 -0.086 -17.099 1.00 40.57 ? 2139 VAL A O     1 
ATOM   577  C  CB    . VAL A 1 77  ? -30.416 2.460  -18.191 1.00 40.30 ? 2139 VAL A CB    1 
ATOM   578  C  CG1   . VAL A 1 77  ? -30.083 1.777  -19.461 1.00 41.39 ? 2139 VAL A CG1   1 
ATOM   579  C  CG2   . VAL A 1 77  ? -31.634 3.356  -18.268 1.00 39.75 ? 2139 VAL A CG2   1 
ATOM   580  N  N     . GLN A 1 78  ? -30.699 -0.847 -17.627 1.00 41.69 ? 2140 GLN A N     1 
ATOM   581  C  CA    . GLN A 1 78  ? -30.260 -2.230 -17.849 1.00 42.81 ? 2140 GLN A CA    1 
ATOM   582  C  C     . GLN A 1 78  ? -30.296 -2.609 -19.310 1.00 41.98 ? 2140 GLN A C     1 
ATOM   583  O  O     . GLN A 1 78  ? -29.972 -3.741 -19.673 1.00 42.22 ? 2140 GLN A O     1 
ATOM   584  C  CB    . GLN A 1 78  ? -31.165 -3.200 -17.080 1.00 43.83 ? 2140 GLN A CB    1 
ATOM   585  C  CG    . GLN A 1 78  ? -31.220 -2.913 -15.599 1.00 48.45 ? 2140 GLN A CG    1 
ATOM   586  C  CD    . GLN A 1 78  ? -29.947 -3.316 -14.891 1.00 55.94 ? 2140 GLN A CD    1 
ATOM   587  O  OE1   . GLN A 1 78  ? -28.915 -3.541 -15.524 1.00 60.72 ? 2140 GLN A OE1   1 
ATOM   588  N  NE2   . GLN A 1 78  ? -30.013 -3.420 -13.569 1.00 58.47 ? 2140 GLN A NE2   1 
ATOM   589  N  N     . CYS A 1 79  ? -30.684 -1.663 -20.155 1.00 41.22 ? 2141 CYS A N     1 
ATOM   590  C  CA    . CYS A 1 79  ? -30.896 -1.965 -21.560 1.00 40.57 ? 2141 CYS A CA    1 
ATOM   591  C  C     . CYS A 1 79  ? -29.741 -1.534 -22.476 1.00 40.06 ? 2141 CYS A C     1 
ATOM   592  O  O     . CYS A 1 79  ? -29.955 -1.248 -23.656 1.00 40.05 ? 2141 CYS A O     1 
ATOM   593  C  CB    . CYS A 1 79  ? -32.165 -1.260 -22.003 1.00 40.11 ? 2141 CYS A CB    1 
ATOM   594  S  SG    . CYS A 1 79  ? -32.135 0.488  -21.609 1.00 42.82 ? 2141 CYS A SG    1 
ATOM   595  N  N     . LEU A 1 80  ? -28.516 -1.482 -21.969 1.00 38.89 ? 2142 LEU A N     1 
ATOM   596  C  CA    . LEU A 1 80  ? -27.437 -0.976 -22.829 1.00 37.74 ? 2142 LEU A CA    1 
ATOM   597  C  C     . LEU A 1 80  ? -26.696 -2.112 -23.488 1.00 37.55 ? 2142 LEU A C     1 
ATOM   598  O  O     . LEU A 1 80  ? -26.585 -3.184 -22.921 1.00 38.06 ? 2142 LEU A O     1 
ATOM   599  C  CB    . LEU A 1 80  ? -26.459 -0.128 -22.035 1.00 37.13 ? 2142 LEU A CB    1 
ATOM   600  C  CG    . LEU A 1 80  ? -27.053 1.111  -21.376 1.00 35.39 ? 2142 LEU A CG    1 
ATOM   601  C  CD1   . LEU A 1 80  ? -25.923 1.785  -20.606 1.00 39.17 ? 2142 LEU A CD1   1 
ATOM   602  C  CD2   . LEU A 1 80  ? -27.668 2.084  -22.389 1.00 33.82 ? 2142 LEU A CD2   1 
ATOM   603  N  N     . GLU A 1 81  ? -26.162 -1.870 -24.674 1.00 37.21 ? 2143 GLU A N     1 
ATOM   604  C  CA    . GLU A 1 81  ? -25.535 -2.911 -25.436 1.00 37.52 ? 2143 GLU A CA    1 
ATOM   605  C  C     . GLU A 1 81  ? -24.347 -2.387 -26.199 1.00 36.97 ? 2143 GLU A C     1 
ATOM   606  O  O     . GLU A 1 81  ? -24.426 -1.361 -26.832 1.00 36.11 ? 2143 GLU A O     1 
ATOM   607  C  CB    . GLU A 1 81  ? -26.559 -3.451 -26.418 1.00 37.57 ? 2143 GLU A CB    1 
ATOM   608  C  CG    . GLU A 1 81  ? -26.073 -4.524 -27.301 1.00 41.44 ? 2143 GLU A CG    1 
ATOM   609  C  CD    . GLU A 1 81  ? -27.167 -4.969 -28.241 1.00 45.07 ? 2143 GLU A CD    1 
ATOM   610  O  OE1   . GLU A 1 81  ? -27.536 -4.197 -29.156 1.00 46.26 ? 2143 GLU A OE1   1 
ATOM   611  O  OE2   . GLU A 1 81  ? -27.659 -6.088 -28.047 1.00 46.36 ? 2143 GLU A OE2   1 
ATOM   612  N  N     . ARG A 1 82  ? -23.240 -3.107 -26.124 1.00 37.64 ? 2144 ARG A N     1 
ATOM   613  C  CA    . ARG A 1 82  ? -22.033 -2.761 -26.873 1.00 38.64 ? 2144 ARG A CA    1 
ATOM   614  C  C     . ARG A 1 82  ? -22.184 -3.281 -28.309 1.00 39.28 ? 2144 ARG A C     1 
ATOM   615  O  O     . ARG A 1 82  ? -22.587 -4.429 -28.504 1.00 38.78 ? 2144 ARG A O     1 
ATOM   616  C  CB    . ARG A 1 82  ? -20.814 -3.384 -26.199 1.00 37.74 ? 2144 ARG A CB    1 
ATOM   617  C  CG    . ARG A 1 82  ? -19.517 -2.590 -26.412 1.00 40.76 ? 2144 ARG A CG    1 
ATOM   618  C  CD    . ARG A 1 82  ? -18.282 -3.409 -26.045 1.00 40.90 ? 2144 ARG A CD    1 
ATOM   619  N  NE    . ARG A 1 82  ? -18.147 -3.767 -24.638 1.00 42.89 ? 2144 ARG A NE    1 
ATOM   620  C  CZ    . ARG A 1 82  ? -17.328 -4.708 -24.177 1.00 43.46 ? 2144 ARG A CZ    1 
ATOM   621  N  NH1   . ARG A 1 82  ? -16.627 -5.411 -24.978 1.00 44.46 ? 2144 ARG A NH1   1 
ATOM   622  N  NH2   . ARG A 1 82  ? -17.216 -5.001 -22.919 1.00 43.28 ? 2144 ARG A NH2   1 
ATOM   623  N  N     . PHE A 1 83  ? -21.912 -2.435 -29.307 1.00 40.06 ? 2145 PHE A N     1 
ATOM   624  C  CA    . PHE A 1 83  ? -22.011 -2.858 -30.707 1.00 41.30 ? 2145 PHE A CA    1 
ATOM   625  C  C     . PHE A 1 83  ? -20.919 -2.192 -31.512 1.00 43.63 ? 2145 PHE A C     1 
ATOM   626  O  O     . PHE A 1 83  ? -20.359 -1.172 -31.087 1.00 42.52 ? 2145 PHE A O     1 
ATOM   627  C  CB    . PHE A 1 83  ? -23.380 -2.501 -31.318 1.00 40.61 ? 2145 PHE A CB    1 
ATOM   628  C  CG    . PHE A 1 83  ? -23.522 -1.038 -31.671 1.00 38.76 ? 2145 PHE A CG    1 
ATOM   629  C  CD1   . PHE A 1 83  ? -23.510 -0.621 -32.987 1.00 37.17 ? 2145 PHE A CD1   1 
ATOM   630  C  CD2   . PHE A 1 83  ? -23.619 -0.077 -30.673 1.00 37.19 ? 2145 PHE A CD2   1 
ATOM   631  C  CE1   . PHE A 1 83  ? -23.610 0.733  -33.309 1.00 35.33 ? 2145 PHE A CE1   1 
ATOM   632  C  CE2   . PHE A 1 83  ? -23.718 1.283  -30.982 1.00 34.91 ? 2145 PHE A CE2   1 
ATOM   633  C  CZ    . PHE A 1 83  ? -23.705 1.683  -32.301 1.00 36.38 ? 2145 PHE A CZ    1 
ATOM   634  N  N     . ARG A 1 84  ? -20.642 -2.761 -32.688 1.00 46.00 ? 2146 ARG A N     1 
ATOM   635  C  CA    . ARG A 1 84  ? -19.657 -2.204 -33.608 1.00 48.77 ? 2146 ARG A CA    1 
ATOM   636  C  C     . ARG A 1 84  ? -20.264 -1.034 -34.382 1.00 49.42 ? 2146 ARG A C     1 
ATOM   637  O  O     . ARG A 1 84  ? -21.250 -1.202 -35.069 1.00 49.99 ? 2146 ARG A O     1 
ATOM   638  C  CB    . ARG A 1 84  ? -19.107 -3.306 -34.539 1.00 49.30 ? 2146 ARG A CB    1 
ATOM   639  C  CG    . ARG A 1 84  ? -17.625 -3.097 -34.956 1.00 53.11 ? 2146 ARG A CG    1 
ATOM   640  C  CD    . ARG A 1 84  ? -16.881 -4.383 -35.324 1.00 59.87 ? 2146 ARG A CD    1 
ATOM   641  N  NE    . ARG A 1 84  ? -17.801 -5.506 -35.455 1.00 63.97 ? 2146 ARG A NE    1 
ATOM   642  C  CZ    . ARG A 1 84  ? -17.576 -6.727 -34.987 1.00 65.08 ? 2146 ARG A CZ    1 
ATOM   643  N  NH1   . ARG A 1 84  ? -16.435 -7.012 -34.362 1.00 65.61 ? 2146 ARG A NH1   1 
ATOM   644  N  NH2   . ARG A 1 84  ? -18.503 -7.665 -35.143 1.00 67.07 ? 2146 ARG A NH2   1 
ATOM   645  N  N     . ALA A 1 85  ? -19.691 0.160  -34.242 1.00 50.83 ? 2147 ALA A N     1 
ATOM   646  C  CA    . ALA A 1 85  ? -20.278 1.373  -34.837 1.00 51.79 ? 2147 ALA A CA    1 
ATOM   647  C  C     . ALA A 1 85  ? -19.428 1.900  -35.978 1.00 52.92 ? 2147 ALA A C     1 
ATOM   648  O  O     . ALA A 1 85  ? -18.279 2.282  -35.794 1.00 54.06 ? 2147 ALA A O     1 
ATOM   649  C  CB    . ALA A 1 85  ? -20.508 2.443  -33.790 1.00 51.41 ? 2147 ALA A CB    1 
ATOM   650  N  N     . GLU A 1 86  ? -20.011 1.895  -37.167 1.00 54.41 ? 2148 GLU A N     1 
ATOM   651  C  CA    . GLU A 1 86  ? -19.293 2.135  -38.403 1.00 55.51 ? 2148 GLU A CA    1 
ATOM   652  C  C     . GLU A 1 86  ? -18.332 3.316  -38.277 1.00 54.53 ? 2148 GLU A C     1 
ATOM   653  O  O     . GLU A 1 86  ? -18.768 4.451  -38.026 1.00 55.48 ? 2148 GLU A O     1 
ATOM   654  C  CB    . GLU A 1 86  ? -20.317 2.417  -39.509 1.00 56.86 ? 2148 GLU A CB    1 
ATOM   655  C  CG    . GLU A 1 86  ? -20.020 1.736  -40.849 1.00 62.30 ? 2148 GLU A CG    1 
ATOM   656  C  CD    . GLU A 1 86  ? -21.069 2.076  -41.911 1.00 69.47 ? 2148 GLU A CD    1 
ATOM   657  O  OE1   . GLU A 1 86  ? -21.479 3.263  -42.011 1.00 72.63 ? 2148 GLU A OE1   1 
ATOM   658  O  OE2   . GLU A 1 86  ? -21.484 1.159  -42.651 1.00 72.43 ? 2148 GLU A OE2   1 
ATOM   659  N  N     . GLU A 1 87  ? -17.036 3.048  -38.438 1.00 52.96 ? 2149 GLU A N     1 
ATOM   660  C  CA    . GLU A 1 87  ? -15.983 4.083  -38.428 1.00 51.82 ? 2149 GLU A CA    1 
ATOM   661  C  C     . GLU A 1 87  ? -15.555 4.542  -37.032 1.00 49.99 ? 2149 GLU A C     1 
ATOM   662  O  O     . GLU A 1 87  ? -14.624 5.333  -36.915 1.00 49.92 ? 2149 GLU A O     1 
ATOM   663  C  CB    . GLU A 1 87  ? -16.370 5.320  -39.273 1.00 52.84 ? 2149 GLU A CB    1 
ATOM   664  C  CG    . GLU A 1 87  ? -16.882 5.015  -40.686 1.00 56.20 ? 2149 GLU A CG    1 
ATOM   665  C  CD    . GLU A 1 87  ? -16.290 5.936  -41.730 1.00 62.01 ? 2149 GLU A CD    1 
ATOM   666  O  OE1   . GLU A 1 87  ? -16.731 7.110  -41.843 1.00 63.66 ? 2149 GLU A OE1   1 
ATOM   667  O  OE2   . GLU A 1 87  ? -15.374 5.473  -42.442 1.00 63.60 ? 2149 GLU A OE2   1 
ATOM   668  N  N     . LYS A 1 88  ? -16.221 4.058  -35.976 1.00 47.01 ? 2150 LYS A N     1 
ATOM   669  C  CA    . LYS A 1 88  ? -15.946 4.549  -34.621 1.00 44.28 ? 2150 LYS A CA    1 
ATOM   670  C  C     . LYS A 1 88  ? -15.688 3.433  -33.619 1.00 43.30 ? 2150 LYS A C     1 
ATOM   671  O  O     . LYS A 1 88  ? -16.118 3.531  -32.469 1.00 43.55 ? 2150 LYS A O     1 
ATOM   672  C  CB    . LYS A 1 88  ? -17.103 5.418  -34.107 1.00 43.05 ? 2150 LYS A CB    1 
ATOM   673  C  CG    . LYS A 1 88  ? -17.513 6.582  -35.025 1.00 41.78 ? 2150 LYS A CG    1 
ATOM   674  C  CD    . LYS A 1 88  ? -18.757 7.327  -34.513 1.00 38.43 ? 2150 LYS A CD    1 
ATOM   675  C  CE    . LYS A 1 88  ? -19.976 6.416  -34.533 1.00 36.17 ? 2150 LYS A CE    1 
ATOM   676  N  NZ    . LYS A 1 88  ? -21.175 7.074  -34.022 1.00 36.14 ? 2150 LYS A NZ    1 
ATOM   677  N  N     . GLY A 1 89  ? -14.993 2.387  -34.048 1.00 41.32 ? 2151 GLY A N     1 
ATOM   678  C  CA    . GLY A 1 89  ? -14.788 1.190  -33.242 1.00 39.44 ? 2151 GLY A CA    1 
ATOM   679  C  C     . GLY A 1 89  ? -16.075 0.713  -32.623 1.00 38.56 ? 2151 GLY A C     1 
ATOM   680  O  O     . GLY A 1 89  ? -17.107 0.664  -33.292 1.00 39.01 ? 2151 GLY A O     1 
ATOM   681  N  N     . TRP A 1 90  ? -16.037 0.405  -31.333 1.00 37.47 ? 2152 TRP A N     1 
ATOM   682  C  CA    . TRP A 1 90  ? -17.255 0.015  -30.600 1.00 36.69 ? 2152 TRP A CA    1 
ATOM   683  C  C     . TRP A 1 90  ? -18.071 1.192  -30.048 1.00 35.22 ? 2152 TRP A C     1 
ATOM   684  O  O     . TRP A 1 90  ? -17.531 2.233  -29.729 1.00 34.46 ? 2152 TRP A O     1 
ATOM   685  C  CB    . TRP A 1 90  ? -16.896 -0.951 -29.478 1.00 37.37 ? 2152 TRP A CB    1 
ATOM   686  C  CG    . TRP A 1 90  ? -16.405 -2.243 -30.070 1.00 42.45 ? 2152 TRP A CG    1 
ATOM   687  C  CD1   . TRP A 1 90  ? -15.167 -2.490 -30.578 1.00 45.44 ? 2152 TRP A CD1   1 
ATOM   688  C  CD2   . TRP A 1 90  ? -17.165 -3.445 -30.265 1.00 44.85 ? 2152 TRP A CD2   1 
ATOM   689  N  NE1   . TRP A 1 90  ? -15.099 -3.769 -31.064 1.00 46.88 ? 2152 TRP A NE1   1 
ATOM   690  C  CE2   . TRP A 1 90  ? -16.307 -4.382 -30.872 1.00 47.11 ? 2152 TRP A CE2   1 
ATOM   691  C  CE3   . TRP A 1 90  ? -18.485 -3.820 -29.968 1.00 44.74 ? 2152 TRP A CE3   1 
ATOM   692  C  CZ2   . TRP A 1 90  ? -16.717 -5.675 -31.187 1.00 48.49 ? 2152 TRP A CZ2   1 
ATOM   693  C  CZ3   . TRP A 1 90  ? -18.901 -5.109 -30.284 1.00 46.53 ? 2152 TRP A CZ3   1 
ATOM   694  C  CH2   . TRP A 1 90  ? -18.014 -6.019 -30.895 1.00 48.48 ? 2152 TRP A CH2   1 
ATOM   695  N  N     . GLY A 1 91  ? -19.376 0.994  -29.923 1.00 33.27 ? 2153 GLY A N     1 
ATOM   696  C  CA    . GLY A 1 91  ? -20.224 2.002  -29.373 1.00 32.04 ? 2153 GLY A CA    1 
ATOM   697  C  C     . GLY A 1 91  ? -21.179 1.391  -28.367 1.00 31.40 ? 2153 GLY A C     1 
ATOM   698  O  O     . GLY A 1 91  ? -21.218 0.176  -28.159 1.00 29.77 ? 2153 GLY A O     1 
ATOM   699  N  N     . ILE A 1 92  ? -21.983 2.245  -27.763 1.00 30.67 ? 2154 ILE A N     1 
ATOM   700  C  CA    . ILE A 1 92  ? -23.048 1.774  -26.882 1.00 31.60 ? 2154 ILE A CA    1 
ATOM   701  C  C     . ILE A 1 92  ? -24.376 2.243  -27.434 1.00 31.78 ? 2154 ILE A C     1 
ATOM   702  O  O     . ILE A 1 92  ? -24.534 3.399  -27.728 1.00 31.73 ? 2154 ILE A O     1 
ATOM   703  C  CB    . ILE A 1 92  ? -22.862 2.304  -25.456 1.00 30.50 ? 2154 ILE A CB    1 
ATOM   704  C  CG1   . ILE A 1 92  ? -21.587 1.729  -24.822 1.00 31.07 ? 2154 ILE A CG1   1 
ATOM   705  C  CG2   . ILE A 1 92  ? -24.148 2.109  -24.623 1.00 30.42 ? 2154 ILE A CG2   1 
ATOM   706  C  CD1   . ILE A 1 92  ? -21.631 0.202  -24.438 1.00 28.85 ? 2154 ILE A CD1   1 
ATOM   707  N  N     . ARG A 1 93  ? -25.318 1.323  -27.602 1.00 33.50 ? 2155 ARG A N     1 
ATOM   708  C  CA    . ARG A 1 93  ? -26.699 1.696  -27.909 1.00 35.02 ? 2155 ARG A CA    1 
ATOM   709  C  C     . ARG A 1 93  ? -27.674 1.214  -26.835 1.00 35.77 ? 2155 ARG A C     1 
ATOM   710  O  O     . ARG A 1 93  ? -27.349 0.316  -26.036 1.00 35.99 ? 2155 ARG A O     1 
ATOM   711  C  CB    . ARG A 1 93  ? -27.096 1.187  -29.293 1.00 35.72 ? 2155 ARG A CB    1 
ATOM   712  C  CG    . ARG A 1 93  ? -27.134 -0.328 -29.413 1.00 36.28 ? 2155 ARG A CG    1 
ATOM   713  C  CD    . ARG A 1 93  ? -27.308 -0.741 -30.887 1.00 40.39 ? 2155 ARG A CD    1 
ATOM   714  N  NE    . ARG A 1 93  ? -27.166 -2.186 -31.075 1.00 40.82 ? 2155 ARG A NE    1 
ATOM   715  C  CZ    . ARG A 1 93  ? -26.914 -2.782 -32.240 1.00 43.83 ? 2155 ARG A CZ    1 
ATOM   716  N  NH1   . ARG A 1 93  ? -26.792 -2.078 -33.365 1.00 43.03 ? 2155 ARG A NH1   1 
ATOM   717  N  NH2   . ARG A 1 93  ? -26.770 -4.097 -32.277 1.00 42.60 ? 2155 ARG A NH2   1 
ATOM   718  N  N     . THR A 1 94  ? -28.852 1.836  -26.798 1.00 36.15 ? 2156 THR A N     1 
ATOM   719  C  CA    . THR A 1 94  ? -29.911 1.417  -25.887 1.00 37.11 ? 2156 THR A CA    1 
ATOM   720  C  C     . THR A 1 94  ? -30.898 0.498  -26.609 1.00 38.90 ? 2156 THR A C     1 
ATOM   721  O  O     . THR A 1 94  ? -31.294 0.762  -27.733 1.00 38.81 ? 2156 THR A O     1 
ATOM   722  C  CB    . THR A 1 94  ? -30.672 2.599  -25.293 1.00 36.25 ? 2156 THR A CB    1 
ATOM   723  O  OG1   . THR A 1 94  ? -31.673 2.099  -24.423 1.00 36.45 ? 2156 THR A OG1   1 
ATOM   724  C  CG2   . THR A 1 94  ? -31.337 3.423  -26.376 1.00 35.18 ? 2156 THR A CG2   1 
ATOM   725  N  N     . LYS A 1 95  ? -31.284 -0.586 -25.942 1.00 40.54 ? 2157 LYS A N     1 
ATOM   726  C  CA    . LYS A 1 95  ? -32.241 -1.524 -26.493 1.00 41.78 ? 2157 LYS A CA    1 
ATOM   727  C  C     . LYS A 1 95  ? -33.702 -1.120 -26.262 1.00 43.12 ? 2157 LYS A C     1 
ATOM   728  O  O     . LYS A 1 95  ? -34.588 -1.690 -26.889 1.00 44.11 ? 2157 LYS A O     1 
ATOM   729  C  CB    . LYS A 1 95  ? -31.974 -2.919 -25.948 1.00 41.76 ? 2157 LYS A CB    1 
ATOM   730  C  CG    . LYS A 1 95  ? -30.844 -3.624 -26.670 1.00 42.18 ? 2157 LYS A CG    1 
ATOM   731  C  CD    . LYS A 1 95  ? -30.516 -4.991 -26.053 1.00 43.81 ? 2157 LYS A CD    1 
ATOM   732  C  CE    . LYS A 1 95  ? -30.172 -4.873 -24.580 1.00 45.99 ? 2157 LYS A CE    1 
ATOM   733  N  NZ    . LYS A 1 95  ? -29.651 -6.151 -24.000 1.00 45.52 ? 2157 LYS A NZ    1 
ATOM   734  N  N     . GLU A 1 96  ? -33.944 -0.146 -25.377 1.00 44.31 ? 2158 GLU A N     1 
ATOM   735  C  CA    . GLU A 1 96  ? -35.293 0.401  -25.106 1.00 44.87 ? 2158 GLU A CA    1 
ATOM   736  C  C     . GLU A 1 96  ? -35.291 1.920  -25.102 1.00 44.63 ? 2158 GLU A C     1 
ATOM   737  O  O     . GLU A 1 96  ? -34.243 2.527  -24.898 1.00 44.27 ? 2158 GLU A O     1 
ATOM   738  C  CB    . GLU A 1 96  ? -35.811 -0.036 -23.724 1.00 46.33 ? 2158 GLU A CB    1 
ATOM   739  C  CG    . GLU A 1 96  ? -35.207 -1.359 -23.230 1.00 48.97 ? 2158 GLU A CG    1 
ATOM   740  C  CD    . GLU A 1 96  ? -35.806 -1.783 -21.882 1.00 56.51 ? 2158 GLU A CD    1 
ATOM   741  O  OE1   . GLU A 1 96  ? -36.320 -0.931 -21.101 1.00 58.45 ? 2158 GLU A OE1   1 
ATOM   742  O  OE2   . GLU A 1 96  ? -35.731 -2.998 -21.595 1.00 58.25 ? 2158 GLU A OE2   1 
ATOM   743  N  N     . PRO A 1 97  ? -36.485 2.539  -25.280 1.00 44.24 ? 2159 PRO A N     1 
ATOM   744  C  CA    . PRO A 1 97  ? -36.624 3.998  -25.264 1.00 43.19 ? 2159 PRO A CA    1 
ATOM   745  C  C     . PRO A 1 97  ? -36.136 4.601  -23.961 1.00 42.45 ? 2159 PRO A C     1 
ATOM   746  O  O     . PRO A 1 97  ? -36.242 3.988  -22.905 1.00 43.28 ? 2159 PRO A O     1 
ATOM   747  C  CB    . PRO A 1 97  ? -38.143 4.237  -25.385 1.00 43.40 ? 2159 PRO A CB    1 
ATOM   748  C  CG    . PRO A 1 97  ? -38.760 2.940  -25.655 1.00 43.26 ? 2159 PRO A CG    1 
ATOM   749  C  CD    . PRO A 1 97  ? -37.789 1.848  -25.375 1.00 44.39 ? 2159 PRO A CD    1 
ATOM   750  N  N     . LEU A 1 98  ? -35.621 5.809  -24.041 1.00 41.15 ? 2160 LEU A N     1 
ATOM   751  C  CA    . LEU A 1 98  ? -35.142 6.516  -22.881 1.00 40.38 ? 2160 LEU A CA    1 
ATOM   752  C  C     . LEU A 1 98  ? -35.735 7.909  -23.027 1.00 41.00 ? 2160 LEU A C     1 
ATOM   753  O  O     . LEU A 1 98  ? -35.882 8.400  -24.160 1.00 40.58 ? 2160 LEU A O     1 
ATOM   754  C  CB    . LEU A 1 98  ? -33.598 6.628  -22.918 1.00 39.16 ? 2160 LEU A CB    1 
ATOM   755  C  CG    . LEU A 1 98  ? -32.744 5.347  -22.931 1.00 38.78 ? 2160 LEU A CG    1 
ATOM   756  C  CD1   . LEU A 1 98  ? -31.219 5.654  -22.975 1.00 32.70 ? 2160 LEU A CD1   1 
ATOM   757  C  CD2   . LEU A 1 98  ? -33.061 4.485  -21.689 1.00 37.45 ? 2160 LEU A CD2   1 
ATOM   758  N  N     . LYS A 1 99  ? -36.012 8.563  -21.902 1.00 40.40 ? 2161 LYS A N     1 
ATOM   759  C  CA    . LYS A 1 99  ? -36.627 9.872  -21.938 1.00 40.88 ? 2161 LYS A CA    1 
ATOM   760  C  C     . LYS A 1 99  ? -35.655 10.945 -21.518 1.00 41.09 ? 2161 LYS A C     1 
ATOM   761  O  O     . LYS A 1 99  ? -34.752 10.701 -20.710 1.00 41.08 ? 2161 LYS A O     1 
ATOM   762  C  CB    . LYS A 1 99  ? -37.834 9.912  -20.997 1.00 41.07 ? 2161 LYS A CB    1 
ATOM   763  C  CG    . LYS A 1 99  ? -38.703 8.666  -21.100 1.00 44.76 ? 2161 LYS A CG    1 
ATOM   764  C  CD    . LYS A 1 99  ? -40.064 8.939  -20.583 1.00 52.12 ? 2161 LYS A CD    1 
ATOM   765  C  CE    . LYS A 1 99  ? -41.152 8.602  -21.585 1.00 58.67 ? 2161 LYS A CE    1 
ATOM   766  N  NZ    . LYS A 1 99  ? -42.401 9.370  -21.243 1.00 62.10 ? 2161 LYS A NZ    1 
ATOM   767  N  N     . ALA A 1 100 ? -35.885 12.142 -22.046 1.00 40.21 ? 2162 ALA A N     1 
ATOM   768  C  CA    . ALA A 1 100 ? -35.123 13.322 -21.729 1.00 39.42 ? 2162 ALA A CA    1 
ATOM   769  C  C     . ALA A 1 100 ? -34.971 13.462 -20.234 1.00 39.13 ? 2162 ALA A C     1 
ATOM   770  O  O     . ALA A 1 100 ? -35.913 13.235 -19.497 1.00 38.85 ? 2162 ALA A O     1 
ATOM   771  C  CB    . ALA A 1 100 ? -35.827 14.563 -22.300 1.00 40.55 ? 2162 ALA A CB    1 
ATOM   772  N  N     . GLY A 1 101 ? -33.768 13.844 -19.795 1.00 38.60 ? 2163 GLY A N     1 
ATOM   773  C  CA    . GLY A 1 101 ? -33.472 14.073 -18.382 1.00 36.93 ? 2163 GLY A CA    1 
ATOM   774  C  C     . GLY A 1 101 ? -33.222 12.813 -17.562 1.00 37.02 ? 2163 GLY A C     1 
ATOM   775  O  O     . GLY A 1 101 ? -32.815 12.894 -16.401 1.00 37.65 ? 2163 GLY A O     1 
ATOM   776  N  N     . GLN A 1 102 ? -33.463 11.648 -18.144 1.00 36.02 ? 2164 GLN A N     1 
ATOM   777  C  CA    . GLN A 1 102 ? -33.334 10.395 -17.399 1.00 37.13 ? 2164 GLN A CA    1 
ATOM   778  C  C     . GLN A 1 102 ? -31.873 10.031 -17.146 1.00 35.65 ? 2164 GLN A C     1 
ATOM   779  O  O     . GLN A 1 102 ? -31.050 10.258 -17.993 1.00 35.68 ? 2164 GLN A O     1 
ATOM   780  C  CB    . GLN A 1 102 ? -34.111 9.298  -18.130 1.00 37.54 ? 2164 GLN A CB    1 
ATOM   781  C  CG    . GLN A 1 102 ? -33.454 7.978  -18.277 1.00 41.63 ? 2164 GLN A CG    1 
ATOM   782  C  CD    . GLN A 1 102 ? -34.397 6.916  -18.815 1.00 42.75 ? 2164 GLN A CD    1 
ATOM   783  O  OE1   . GLN A 1 102 ? -35.169 7.147  -19.738 1.00 43.62 ? 2164 GLN A OE1   1 
ATOM   784  N  NE2   . GLN A 1 102 ? -34.343 5.745  -18.226 1.00 45.83 ? 2164 GLN A NE2   1 
ATOM   785  N  N     . PHE A 1 103 ? -31.576 9.525  -15.949 1.00 34.70 ? 2165 PHE A N     1 
ATOM   786  C  CA    . PHE A 1 103 ? -30.241 9.104  -15.554 1.00 33.99 ? 2165 PHE A CA    1 
ATOM   787  C  C     . PHE A 1 103 ? -29.971 7.829  -16.290 1.00 33.06 ? 2165 PHE A C     1 
ATOM   788  O  O     . PHE A 1 103 ? -30.827 6.973  -16.380 1.00 32.85 ? 2165 PHE A O     1 
ATOM   789  C  CB    . PHE A 1 103 ? -30.188 8.854  -14.035 1.00 33.81 ? 2165 PHE A CB    1 
ATOM   790  C  CG    . PHE A 1 103 ? -28.925 8.176  -13.552 1.00 33.69 ? 2165 PHE A CG    1 
ATOM   791  C  CD1   . PHE A 1 103 ? -27.675 8.793  -13.692 1.00 34.54 ? 2165 PHE A CD1   1 
ATOM   792  C  CD2   . PHE A 1 103 ? -28.987 6.945  -12.923 1.00 31.68 ? 2165 PHE A CD2   1 
ATOM   793  C  CE1   . PHE A 1 103 ? -26.488 8.162  -13.223 1.00 31.27 ? 2165 PHE A CE1   1 
ATOM   794  C  CE2   . PHE A 1 103 ? -27.848 6.327  -12.449 1.00 32.05 ? 2165 PHE A CE2   1 
ATOM   795  C  CZ    . PHE A 1 103 ? -26.587 6.934  -12.593 1.00 32.72 ? 2165 PHE A CZ    1 
ATOM   796  N  N     . ILE A 1 104 ? -28.773 7.681  -16.813 1.00 32.34 ? 2166 ILE A N     1 
ATOM   797  C  CA    . ILE A 1 104 ? -28.473 6.474  -17.572 1.00 31.42 ? 2166 ILE A CA    1 
ATOM   798  C  C     . ILE A 1 104 ? -27.457 5.581  -16.876 1.00 30.73 ? 2166 ILE A C     1 
ATOM   799  O  O     . ILE A 1 104 ? -27.726 4.407  -16.654 1.00 31.70 ? 2166 ILE A O     1 
ATOM   800  C  CB    . ILE A 1 104 ? -28.014 6.827  -18.970 1.00 31.14 ? 2166 ILE A CB    1 
ATOM   801  C  CG1   . ILE A 1 104 ? -29.147 7.586  -19.701 1.00 33.06 ? 2166 ILE A CG1   1 
ATOM   802  C  CG2   . ILE A 1 104 ? -27.538 5.558  -19.711 1.00 31.12 ? 2166 ILE A CG2   1 
ATOM   803  C  CD1   . ILE A 1 104 ? -28.707 8.278  -21.021 1.00 34.47 ? 2166 ILE A CD1   1 
ATOM   804  N  N     . ILE A 1 105 ? -26.299 6.125  -16.537 1.00 28.56 ? 2167 ILE A N     1 
ATOM   805  C  CA    . ILE A 1 105 ? -25.241 5.328  -15.937 1.00 27.33 ? 2167 ILE A CA    1 
ATOM   806  C  C     . ILE A 1 105 ? -24.215 6.256  -15.296 1.00 26.59 ? 2167 ILE A C     1 
ATOM   807  O  O     . ILE A 1 105 ? -24.090 7.399  -15.718 1.00 25.65 ? 2167 ILE A O     1 
ATOM   808  C  CB    . ILE A 1 105 ? -24.585 4.419  -17.000 1.00 27.32 ? 2167 ILE A CB    1 
ATOM   809  C  CG1   . ILE A 1 105 ? -23.668 3.384  -16.359 1.00 27.39 ? 2167 ILE A CG1   1 
ATOM   810  C  CG2   . ILE A 1 105 ? -23.846 5.227  -18.077 1.00 24.49 ? 2167 ILE A CG2   1 
ATOM   811  C  CD1   . ILE A 1 105 ? -23.192 2.357  -17.407 1.00 30.33 ? 2167 ILE A CD1   1 
ATOM   812  N  N     . GLU A 1 106 ? -23.503 5.782  -14.267 1.00 25.32 ? 2168 GLU A N     1 
ATOM   813  C  CA    . GLU A 1 106 ? -22.343 6.528  -13.757 1.00 24.89 ? 2168 GLU A CA    1 
ATOM   814  C  C     . GLU A 1 106 ? -21.077 6.248  -14.580 1.00 24.51 ? 2168 GLU A C     1 
ATOM   815  O  O     . GLU A 1 106 ? -20.868 5.127  -15.044 1.00 24.00 ? 2168 GLU A O     1 
ATOM   816  C  CB    . GLU A 1 106 ? -22.110 6.283  -12.249 1.00 24.32 ? 2168 GLU A CB    1 
ATOM   817  C  CG    . GLU A 1 106 ? -20.812 6.901  -11.713 1.00 24.28 ? 2168 GLU A CG    1 
ATOM   818  C  CD    . GLU A 1 106 ? -20.618 6.758  -10.198 1.00 24.58 ? 2168 GLU A CD    1 
ATOM   819  O  OE1   . GLU A 1 106 ? -21.244 5.905  -9.541  1.00 26.58 ? 2168 GLU A OE1   1 
ATOM   820  O  OE2   . GLU A 1 106 ? -19.803 7.494  -9.634  1.00 25.60 ? 2168 GLU A OE2   1 
ATOM   821  N  N     . TYR A 1 107 ? -20.263 7.279  -14.796 1.00 23.77 ? 2169 TYR A N     1 
ATOM   822  C  CA    . TYR A 1 107 ? -19.002 7.083  -15.505 1.00 23.76 ? 2169 TYR A CA    1 
ATOM   823  C  C     . TYR A 1 107 ? -17.934 6.692  -14.529 1.00 22.59 ? 2169 TYR A C     1 
ATOM   824  O  O     . TYR A 1 107 ? -17.667 7.409  -13.585 1.00 24.03 ? 2169 TYR A O     1 
ATOM   825  C  CB    . TYR A 1 107 ? -18.591 8.320  -16.323 1.00 23.67 ? 2169 TYR A CB    1 
ATOM   826  C  CG    . TYR A 1 107 ? -17.359 8.108  -17.217 1.00 25.59 ? 2169 TYR A CG    1 
ATOM   827  C  CD1   . TYR A 1 107 ? -17.481 7.774  -18.565 1.00 23.89 ? 2169 TYR A CD1   1 
ATOM   828  C  CD2   . TYR A 1 107 ? -16.075 8.225  -16.691 1.00 24.48 ? 2169 TYR A CD2   1 
ATOM   829  C  CE1   . TYR A 1 107 ? -16.340 7.597  -19.387 1.00 23.37 ? 2169 TYR A CE1   1 
ATOM   830  C  CE2   . TYR A 1 107 ? -14.948 8.049  -17.499 1.00 24.63 ? 2169 TYR A CE2   1 
ATOM   831  C  CZ    . TYR A 1 107 ? -15.078 7.740  -18.838 1.00 24.15 ? 2169 TYR A CZ    1 
ATOM   832  O  OH    . TYR A 1 107 ? -13.910 7.602  -19.605 1.00 23.43 ? 2169 TYR A OH    1 
ATOM   833  N  N     . LEU A 1 108 ? -17.376 5.512  -14.711 1.00 22.96 ? 2170 LEU A N     1 
ATOM   834  C  CA    . LEU A 1 108 ? -16.476 4.940  -13.723 1.00 24.08 ? 2170 LEU A CA    1 
ATOM   835  C  C     . LEU A 1 108 ? -15.049 4.861  -14.236 1.00 22.82 ? 2170 LEU A C     1 
ATOM   836  O  O     . LEU A 1 108 ? -14.825 4.776  -15.435 1.00 22.03 ? 2170 LEU A O     1 
ATOM   837  C  CB    . LEU A 1 108 ? -16.948 3.549  -13.290 1.00 23.62 ? 2170 LEU A CB    1 
ATOM   838  C  CG    . LEU A 1 108 ? -18.302 3.462  -12.587 1.00 25.77 ? 2170 LEU A CG    1 
ATOM   839  C  CD1   . LEU A 1 108 ? -18.464 2.011  -12.125 1.00 26.02 ? 2170 LEU A CD1   1 
ATOM   840  C  CD2   . LEU A 1 108 ? -18.419 4.420  -11.385 1.00 24.30 ? 2170 LEU A CD2   1 
ATOM   841  N  N     . GLY A 1 109 ? -14.096 4.905  -13.312 1.00 23.72 ? 2171 GLY A N     1 
ATOM   842  C  CA    . GLY A 1 109 ? -12.687 4.685  -13.656 1.00 22.25 ? 2171 GLY A CA    1 
ATOM   843  C  C     . GLY A 1 109 ? -11.803 4.830  -12.449 1.00 23.81 ? 2171 GLY A C     1 
ATOM   844  O  O     . GLY A 1 109 ? -12.262 4.716  -11.298 1.00 23.85 ? 2171 GLY A O     1 
ATOM   845  N  N     . GLU A 1 110 ? -10.524 5.114  -12.698 1.00 23.56 ? 2172 GLU A N     1 
ATOM   846  C  CA    . GLU A 1 110 ? -9.631  5.461  -11.605 1.00 24.38 ? 2172 GLU A CA    1 
ATOM   847  C  C     . GLU A 1 110 ? -9.605  6.986  -11.571 1.00 24.30 ? 2172 GLU A C     1 
ATOM   848  O  O     . GLU A 1 110 ? -9.490  7.638  -12.605 1.00 26.15 ? 2172 GLU A O     1 
ATOM   849  C  CB    . GLU A 1 110 ? -8.218  4.908  -11.812 1.00 23.56 ? 2172 GLU A CB    1 
ATOM   850  C  CG    . GLU A 1 110 ? -8.095  3.376  -11.949 1.00 24.80 ? 2172 GLU A CG    1 
ATOM   851  C  CD    . GLU A 1 110 ? -6.679  2.954  -12.347 1.00 26.70 ? 2172 GLU A CD    1 
ATOM   852  O  OE1   . GLU A 1 110 ? -6.461  2.632  -13.552 1.00 27.80 ? 2172 GLU A OE1   1 
ATOM   853  O  OE2   . GLU A 1 110 ? -5.763  3.009  -11.473 1.00 26.56 ? 2172 GLU A OE2   1 
ATOM   854  N  N     . VAL A 1 111 ? -9.732  7.539  -10.381 1.00 25.04 ? 2173 VAL A N     1 
ATOM   855  C  CA    . VAL A 1 111 ? -9.668  8.963  -10.147 1.00 24.96 ? 2173 VAL A CA    1 
ATOM   856  C  C     . VAL A 1 111 ? -8.233  9.316  -9.769  1.00 26.15 ? 2173 VAL A C     1 
ATOM   857  O  O     . VAL A 1 111 ? -7.724  8.874  -8.721  1.00 26.51 ? 2173 VAL A O     1 
ATOM   858  C  CB    . VAL A 1 111 ? -10.651 9.350  -8.999  1.00 25.68 ? 2173 VAL A CB    1 
ATOM   859  C  CG1   . VAL A 1 111 ? -10.644 10.861 -8.754  1.00 24.00 ? 2173 VAL A CG1   1 
ATOM   860  C  CG2   . VAL A 1 111 ? -12.084 8.879  -9.350  1.00 24.32 ? 2173 VAL A CG2   1 
ATOM   861  N  N     . VAL A 1 112 ? -7.576  10.088 -10.641 1.00 26.20 ? 2174 VAL A N     1 
ATOM   862  C  CA    . VAL A 1 112 ? -6.180  10.398 -10.525 1.00 26.24 ? 2174 VAL A CA    1 
ATOM   863  C  C     . VAL A 1 112 ? -5.983  11.938 -10.611 1.00 28.25 ? 2174 VAL A C     1 
ATOM   864  O  O     . VAL A 1 112 ? -6.850  12.631 -11.148 1.00 28.35 ? 2174 VAL A O     1 
ATOM   865  C  CB    . VAL A 1 112 ? -5.363  9.634  -11.603 1.00 26.52 ? 2174 VAL A CB    1 
ATOM   866  C  CG1   . VAL A 1 112 ? -5.441  8.131  -11.345 1.00 27.46 ? 2174 VAL A CG1   1 
ATOM   867  C  CG2   . VAL A 1 112 ? -5.853  9.947  -13.069 1.00 22.90 ? 2174 VAL A CG2   1 
ATOM   868  N  N     . SER A 1 113 ? -4.870  12.469 -10.071 1.00 28.27 ? 2175 SER A N     1 
ATOM   869  C  CA    . SER A 1 113 ? -4.531  13.888 -10.307 1.00 29.46 ? 2175 SER A CA    1 
ATOM   870  C  C     . SER A 1 113 ? -4.234  14.020 -11.757 1.00 30.42 ? 2175 SER A C     1 
ATOM   871  O  O     . SER A 1 113 ? -3.998  13.009 -12.417 1.00 30.94 ? 2175 SER A O     1 
ATOM   872  C  CB    . SER A 1 113 ? -3.322  14.348 -9.494  1.00 28.98 ? 2175 SER A CB    1 
ATOM   873  O  OG    . SER A 1 113 ? -2.219  13.461 -9.676  1.00 31.54 ? 2175 SER A OG    1 
ATOM   874  N  N     . GLU A 1 114 ? -4.287  15.250 -12.264 1.00 30.98 ? 2176 GLU A N     1 
ATOM   875  C  CA    . GLU A 1 114 ? -3.731  15.582 -13.586 1.00 32.43 ? 2176 GLU A CA    1 
ATOM   876  C  C     . GLU A 1 114 ? -2.266  15.149 -13.783 1.00 31.25 ? 2176 GLU A C     1 
ATOM   877  O  O     . GLU A 1 114 ? -1.936  14.592 -14.807 1.00 31.43 ? 2176 GLU A O     1 
ATOM   878  C  CB    . GLU A 1 114 ? -3.849  17.080 -13.838 1.00 32.47 ? 2176 GLU A CB    1 
ATOM   879  C  CG    . GLU A 1 114 ? -4.962  17.441 -14.763 1.00 40.41 ? 2176 GLU A CG    1 
ATOM   880  C  CD    . GLU A 1 114 ? -5.091  18.956 -14.961 1.00 48.84 ? 2176 GLU A CD    1 
ATOM   881  O  OE1   . GLU A 1 114 ? -4.051  19.665 -14.942 1.00 50.06 ? 2176 GLU A OE1   1 
ATOM   882  O  OE2   . GLU A 1 114 ? -6.243  19.421 -15.157 1.00 51.68 ? 2176 GLU A OE2   1 
ATOM   883  N  N     . GLN A 1 115 ? -1.399  15.408 -12.817 1.00 30.89 ? 2177 GLN A N     1 
ATOM   884  C  CA    . GLN A 1 115 ? 0.001   14.924 -12.891 1.00 31.48 ? 2177 GLN A CA    1 
ATOM   885  C  C     . GLN A 1 115 ? 0.109   13.416 -13.139 1.00 31.50 ? 2177 GLN A C     1 
ATOM   886  O  O     . GLN A 1 115 ? 0.790   12.990 -14.067 1.00 32.47 ? 2177 GLN A O     1 
ATOM   887  C  CB    . GLN A 1 115 ? 0.810   15.319 -11.623 1.00 31.15 ? 2177 GLN A CB    1 
ATOM   888  C  CG    . GLN A 1 115 ? 2.292   14.897 -11.701 1.00 35.42 ? 2177 GLN A CG    1 
ATOM   889  C  CD    . GLN A 1 115 ? 3.051   15.583 -12.842 1.00 41.71 ? 2177 GLN A CD    1 
ATOM   890  O  OE1   . GLN A 1 115 ? 3.112   15.115 -13.957 1.00 46.29 ? 2177 GLN A OE1   1 
ATOM   891  N  NE2   . GLN A 1 115 ? 3.597   16.702 -12.561 1.00 43.20 ? 2177 GLN A NE2   1 
ATOM   892  N  N     . GLU A 1 116 ? -0.567  12.608 -12.320 1.00 31.13 ? 2178 GLU A N     1 
ATOM   893  C  CA    . GLU A 1 116 ? -0.615  11.150 -12.520 1.00 30.28 ? 2178 GLU A CA    1 
ATOM   894  C  C     . GLU A 1 116 ? -1.047  10.738 -13.935 1.00 30.40 ? 2178 GLU A C     1 
ATOM   895  O  O     . GLU A 1 116 ? -0.391  9.902  -14.603 1.00 30.56 ? 2178 GLU A O     1 
ATOM   896  C  CB    . GLU A 1 116 ? -1.565  10.546 -11.464 1.00 30.43 ? 2178 GLU A CB    1 
ATOM   897  C  CG    . GLU A 1 116 ? -1.780  9.033  -11.547 1.00 29.35 ? 2178 GLU A CG    1 
ATOM   898  C  CD    . GLU A 1 116 ? -0.478  8.264  -11.406 1.00 31.85 ? 2178 GLU A CD    1 
ATOM   899  O  OE1   . GLU A 1 116 ? 0.461   8.775  -10.731 1.00 31.04 ? 2178 GLU A OE1   1 
ATOM   900  O  OE2   . GLU A 1 116 ? -0.394  7.157  -11.990 1.00 32.61 ? 2178 GLU A OE2   1 
ATOM   901  N  N     . PHE A 1 117 ? -2.153  11.320 -14.388 1.00 30.26 ? 2179 PHE A N     1 
ATOM   902  C  CA    . PHE A 1 117 ? -2.724  11.021 -15.702 1.00 29.54 ? 2179 PHE A CA    1 
ATOM   903  C  C     . PHE A 1 117 ? -1.783  11.394 -16.812 1.00 29.98 ? 2179 PHE A C     1 
ATOM   904  O  O     . PHE A 1 117 ? -1.654  10.680 -17.800 1.00 29.88 ? 2179 PHE A O     1 
ATOM   905  C  CB    . PHE A 1 117 ? -4.046  11.756 -15.962 1.00 28.03 ? 2179 PHE A CB    1 
ATOM   906  C  CG    . PHE A 1 117 ? -4.649  11.371 -17.280 1.00 28.09 ? 2179 PHE A CG    1 
ATOM   907  C  CD1   . PHE A 1 117 ? -5.177  10.097 -17.448 1.00 27.03 ? 2179 PHE A CD1   1 
ATOM   908  C  CD2   . PHE A 1 117 ? -4.606  12.225 -18.376 1.00 28.23 ? 2179 PHE A CD2   1 
ATOM   909  C  CE1   . PHE A 1 117 ? -5.678  9.674  -18.678 1.00 27.87 ? 2179 PHE A CE1   1 
ATOM   910  C  CE2   . PHE A 1 117 ? -5.117  11.822 -19.628 1.00 28.65 ? 2179 PHE A CE2   1 
ATOM   911  C  CZ    . PHE A 1 117 ? -5.650  10.554 -19.770 1.00 29.12 ? 2179 PHE A CZ    1 
ATOM   912  N  N     . ARG A 1 118 ? -1.151  12.554 -16.677 1.00 31.16 ? 2180 ARG A N     1 
ATOM   913  C  CA    . ARG A 1 118 ? -0.027  12.892 -17.566 1.00 32.62 ? 2180 ARG A CA    1 
ATOM   914  C  C     . ARG A 1 118 ? 1.099   11.867 -17.630 1.00 32.90 ? 2180 ARG A C     1 
ATOM   915  O  O     . ARG A 1 118 ? 1.541   11.553 -18.743 1.00 34.01 ? 2180 ARG A O     1 
ATOM   916  C  CB    . ARG A 1 118 ? 0.619   14.132 -17.065 1.00 33.39 ? 2180 ARG A CB    1 
ATOM   917  C  CG    . ARG A 1 118 ? 0.223   15.338 -17.765 1.00 38.17 ? 2180 ARG A CG    1 
ATOM   918  C  CD    . ARG A 1 118 ? 0.943   16.463 -17.024 1.00 49.49 ? 2180 ARG A CD    1 
ATOM   919  N  NE    . ARG A 1 118 ? 1.531   17.408 -17.970 1.00 55.73 ? 2180 ARG A NE    1 
ATOM   920  C  CZ    . ARG A 1 118 ? 0.799   18.255 -18.686 1.00 58.69 ? 2180 ARG A CZ    1 
ATOM   921  N  NH1   . ARG A 1 118 ? -0.537  18.240 -18.536 1.00 57.47 ? 2180 ARG A NH1   1 
ATOM   922  N  NH2   . ARG A 1 118 ? 1.400   19.111 -19.534 1.00 59.04 ? 2180 ARG A NH2   1 
ATOM   923  N  N     . ASN A 1 119 ? 1.587   11.398 -16.461 1.00 32.31 ? 2181 ASN A N     1 
ATOM   924  C  CA    . ASN A 1 119 ? 2.601   10.317 -16.383 1.00 32.55 ? 2181 ASN A CA    1 
ATOM   925  C  C     . ASN A 1 119 ? 2.129   9.067  -17.112 1.00 33.03 ? 2181 ASN A C     1 
ATOM   926  O  O     . ASN A 1 119 ? 2.893   8.426  -17.910 1.00 34.19 ? 2181 ASN A O     1 
ATOM   927  C  CB    . ASN A 1 119 ? 2.947   9.956  -14.909 1.00 31.97 ? 2181 ASN A CB    1 
ATOM   928  C  CG    . ASN A 1 119 ? 3.631   11.084 -14.168 1.00 34.05 ? 2181 ASN A CG    1 
ATOM   929  O  OD1   . ASN A 1 119 ? 4.205   11.969 -14.799 1.00 36.41 ? 2181 ASN A OD1   1 
ATOM   930  N  ND2   . ASN A 1 119 ? 3.580   11.067 -12.803 1.00 31.87 ? 2181 ASN A ND2   1 
ATOM   931  N  N     . ARG A 1 120 ? 0.862   8.700  -16.858 1.00 32.46 ? 2182 ARG A N     1 
ATOM   932  C  CA    . ARG A 1 120 ? 0.301   7.514  -17.476 1.00 31.28 ? 2182 ARG A CA    1 
ATOM   933  C  C     . ARG A 1 120 ? 0.276   7.692  -18.983 1.00 32.67 ? 2182 ARG A C     1 
ATOM   934  O  O     . ARG A 1 120 ? 0.503   6.758  -19.728 1.00 32.47 ? 2182 ARG A O     1 
ATOM   935  C  CB    . ARG A 1 120 ? -1.113  7.241  -16.953 1.00 30.78 ? 2182 ARG A CB    1 
ATOM   936  C  CG    . ARG A 1 120 ? -1.154  6.755  -15.495 1.00 30.70 ? 2182 ARG A CG    1 
ATOM   937  C  CD    . ARG A 1 120 ? -2.632  6.647  -14.961 1.00 28.31 ? 2182 ARG A CD    1 
ATOM   938  N  NE    . ARG A 1 120 ? -2.655  6.012  -13.644 1.00 23.57 ? 2182 ARG A NE    1 
ATOM   939  C  CZ    . ARG A 1 120 ? -3.657  5.279  -13.172 1.00 27.59 ? 2182 ARG A CZ    1 
ATOM   940  N  NH1   . ARG A 1 120 ? -4.803  5.090  -13.897 1.00 23.57 ? 2182 ARG A NH1   1 
ATOM   941  N  NH2   . ARG A 1 120 ? -3.519  4.735  -11.946 1.00 27.10 ? 2182 ARG A NH2   1 
ATOM   942  N  N     . MET A 1 121 ? -0.018  8.909  -19.434 1.00 34.59 ? 2183 MET A N     1 
ATOM   943  C  CA    . MET A 1 121 ? -0.108  9.176  -20.859 1.00 36.22 ? 2183 MET A CA    1 
ATOM   944  C  C     . MET A 1 121 ? 1.261   8.921  -21.529 1.00 36.72 ? 2183 MET A C     1 
ATOM   945  O  O     . MET A 1 121 ? 1.355   8.428  -22.660 1.00 36.22 ? 2183 MET A O     1 
ATOM   946  C  CB    . MET A 1 121 ? -0.537  10.624 -21.036 1.00 35.95 ? 2183 MET A CB    1 
ATOM   947  C  CG    . MET A 1 121 ? -1.486  10.875 -22.211 1.00 42.65 ? 2183 MET A CG    1 
ATOM   948  S  SD    . MET A 1 121 ? -3.013  9.899  -22.264 1.00 45.51 ? 2183 MET A SD    1 
ATOM   949  C  CE    . MET A 1 121 ? -3.569  10.278 -23.891 1.00 49.89 ? 2183 MET A CE    1 
ATOM   950  N  N     . ILE A 1 122 ? 2.326   9.245  -20.805 1.00 37.69 ? 2184 ILE A N     1 
ATOM   951  C  CA    . ILE A 1 122 ? 3.685   9.080  -21.329 1.00 37.80 ? 2184 ILE A CA    1 
ATOM   952  C  C     . ILE A 1 122 ? 4.152   7.634  -21.156 1.00 38.03 ? 2184 ILE A C     1 
ATOM   953  O  O     . ILE A 1 122 ? 4.566   6.981  -22.115 1.00 39.65 ? 2184 ILE A O     1 
ATOM   954  C  CB    . ILE A 1 122 ? 4.639   10.061 -20.650 1.00 38.36 ? 2184 ILE A CB    1 
ATOM   955  C  CG1   . ILE A 1 122 ? 4.180   11.492 -20.960 1.00 36.68 ? 2184 ILE A CG1   1 
ATOM   956  C  CG2   . ILE A 1 122 ? 6.082   9.846  -21.139 1.00 37.87 ? 2184 ILE A CG2   1 
ATOM   957  C  CD1   . ILE A 1 122 ? 4.780   12.530 -20.011 1.00 40.87 ? 2184 ILE A CD1   1 
ATOM   958  N  N     . GLU A 1 123 ? 4.023   7.118  -19.945 1.00 37.31 ? 2185 GLU A N     1 
ATOM   959  C  CA    . GLU A 1 123 ? 4.510   5.795  -19.638 1.00 37.58 ? 2185 GLU A CA    1 
ATOM   960  C  C     . GLU A 1 123 ? 3.651   4.612  -20.041 1.00 37.94 ? 2185 GLU A C     1 
ATOM   961  O  O     . GLU A 1 123 ? 4.157   3.486  -20.124 1.00 37.59 ? 2185 GLU A O     1 
ATOM   962  C  CB    . GLU A 1 123 ? 4.788   5.709  -18.146 1.00 37.16 ? 2185 GLU A CB    1 
ATOM   963  C  CG    . GLU A 1 123 ? 6.049   6.461  -17.797 1.00 39.34 ? 2185 GLU A CG    1 
ATOM   964  C  CD    . GLU A 1 123 ? 6.377   6.361  -16.355 1.00 42.29 ? 2185 GLU A CD    1 
ATOM   965  O  OE1   . GLU A 1 123 ? 5.636   5.777  -15.578 1.00 41.63 ? 2185 GLU A OE1   1 
ATOM   966  O  OE2   . GLU A 1 123 ? 7.388   6.873  -15.931 1.00 42.75 ? 2185 GLU A OE2   1 
ATOM   967  N  N     . GLN A 1 124 ? 2.352   4.824  -20.254 1.00 37.70 ? 2186 GLN A N     1 
ATOM   968  C  CA    . GLN A 1 124 ? 1.509   3.682  -20.617 1.00 37.62 ? 2186 GLN A CA    1 
ATOM   969  C  C     . GLN A 1 124 ? 0.657   3.858  -21.840 1.00 36.91 ? 2186 GLN A C     1 
ATOM   970  O  O     . GLN A 1 124 ? 0.492   2.911  -22.585 1.00 37.71 ? 2186 GLN A O     1 
ATOM   971  C  CB    . GLN A 1 124 ? 0.640   3.265  -19.431 1.00 38.97 ? 2186 GLN A CB    1 
ATOM   972  C  CG    . GLN A 1 124 ? 1.356   3.382  -18.078 1.00 41.92 ? 2186 GLN A CG    1 
ATOM   973  C  CD    . GLN A 1 124 ? 0.680   2.595  -16.988 1.00 47.68 ? 2186 GLN A CD    1 
ATOM   974  O  OE1   . GLN A 1 124 ? -0.381  1.975  -17.194 1.00 49.86 ? 2186 GLN A OE1   1 
ATOM   975  N  NE2   . GLN A 1 124 ? 1.286   2.609  -15.803 1.00 48.33 ? 2186 GLN A NE2   1 
ATOM   976  N  N     . TYR A 1 125 ? 0.135   5.055  -22.084 1.00 36.41 ? 2187 TYR A N     1 
ATOM   977  C  CA    . TYR A 1 125 ? -0.918  5.190  -23.097 1.00 36.65 ? 2187 TYR A CA    1 
ATOM   978  C  C     . TYR A 1 125 ? -0.453  5.839  -24.400 1.00 37.96 ? 2187 TYR A C     1 
ATOM   979  O  O     . TYR A 1 125 ? -1.245  6.021  -25.336 1.00 37.94 ? 2187 TYR A O     1 
ATOM   980  C  CB    . TYR A 1 125 ? -2.108  5.997  -22.541 1.00 35.14 ? 2187 TYR A CB    1 
ATOM   981  C  CG    . TYR A 1 125 ? -2.646  5.567  -21.178 1.00 32.81 ? 2187 TYR A CG    1 
ATOM   982  C  CD1   . TYR A 1 125 ? -2.660  4.224  -20.782 1.00 28.01 ? 2187 TYR A CD1   1 
ATOM   983  C  CD2   . TYR A 1 125 ? -3.207  6.509  -20.314 1.00 28.20 ? 2187 TYR A CD2   1 
ATOM   984  C  CE1   . TYR A 1 125 ? -3.160  3.837  -19.497 1.00 28.58 ? 2187 TYR A CE1   1 
ATOM   985  C  CE2   . TYR A 1 125 ? -3.725  6.140  -19.073 1.00 28.27 ? 2187 TYR A CE2   1 
ATOM   986  C  CZ    . TYR A 1 125 ? -3.707  4.822  -18.661 1.00 25.85 ? 2187 TYR A CZ    1 
ATOM   987  O  OH    . TYR A 1 125 ? -4.255  4.512  -17.431 1.00 28.79 ? 2187 TYR A OH    1 
ATOM   988  N  N     . HIS A 1 126 ? 0.819   6.190  -24.472 1.00 40.33 ? 2188 HIS A N     1 
ATOM   989  C  CA    . HIS A 1 126 ? 1.269   7.140  -25.506 1.00 43.57 ? 2188 HIS A CA    1 
ATOM   990  C  C     . HIS A 1 126 ? 1.054   6.637  -26.934 1.00 44.10 ? 2188 HIS A C     1 
ATOM   991  O  O     . HIS A 1 126 ? 0.991   7.408  -27.882 1.00 44.46 ? 2188 HIS A O     1 
ATOM   992  C  CB    . HIS A 1 126 ? 2.723   7.532  -25.270 1.00 44.40 ? 2188 HIS A CB    1 
ATOM   993  C  CG    . HIS A 1 126 ? 3.694   6.450  -25.620 1.00 47.83 ? 2188 HIS A CG    1 
ATOM   994  N  ND1   . HIS A 1 126 ? 3.317   5.304  -26.298 1.00 51.96 ? 2188 HIS A ND1   1 
ATOM   995  C  CD2   . HIS A 1 126 ? 5.027   6.340  -25.397 1.00 53.18 ? 2188 HIS A CD2   1 
ATOM   996  C  CE1   . HIS A 1 126 ? 4.377   4.544  -26.493 1.00 53.10 ? 2188 HIS A CE1   1 
ATOM   997  N  NE2   . HIS A 1 126 ? 5.431   5.152  -25.959 1.00 55.05 ? 2188 HIS A NE2   1 
ATOM   998  N  N     . ASN A 1 127 ? 0.885   5.329  -27.031 1.00 45.21 ? 2189 ASN A N     1 
ATOM   999  C  CA    . ASN A 1 127 ? 0.674   4.575  -28.243 1.00 46.57 ? 2189 ASN A CA    1 
ATOM   1000 C  C     . ASN A 1 127 ? -0.781  4.127  -28.533 1.00 46.46 ? 2189 ASN A C     1 
ATOM   1001 O  O     . ASN A 1 127 ? -1.039  3.300  -29.400 1.00 45.71 ? 2189 ASN A O     1 
ATOM   1002 C  CB    . ASN A 1 127 ? 1.429   3.324  -27.937 1.00 48.09 ? 2189 ASN A CB    1 
ATOM   1003 C  CG    . ASN A 1 127 ? 1.941   2.712  -29.086 1.00 53.18 ? 2189 ASN A CG    1 
ATOM   1004 O  OD1   . ASN A 1 127 ? 1.715   3.227  -30.135 1.00 55.22 ? 2189 ASN A OD1   1 
ATOM   1005 N  ND2   . ASN A 1 127 ? 2.665   1.605  -28.949 1.00 58.31 ? 2189 ASN A ND2   1 
ATOM   1006 N  N     . HIS A 1 128 ? -1.728  4.631  -27.756 1.00 46.25 ? 2190 HIS A N     1 
ATOM   1007 C  CA    . HIS A 1 128 ? -3.099  4.173  -27.863 1.00 45.93 ? 2190 HIS A CA    1 
ATOM   1008 C  C     . HIS A 1 128 ? -3.798  4.886  -28.989 1.00 45.68 ? 2190 HIS A C     1 
ATOM   1009 O  O     . HIS A 1 128 ? -3.508  6.052  -29.261 1.00 45.86 ? 2190 HIS A O     1 
ATOM   1010 C  CB    . HIS A 1 128 ? -3.834  4.471  -26.566 1.00 45.81 ? 2190 HIS A CB    1 
ATOM   1011 C  CG    . HIS A 1 128 ? -3.832  3.337  -25.599 1.00 45.55 ? 2190 HIS A CG    1 
ATOM   1012 N  ND1   . HIS A 1 128 ? -2.671  2.720  -25.181 1.00 48.84 ? 2190 HIS A ND1   1 
ATOM   1013 C  CD2   . HIS A 1 128 ? -4.846  2.715  -24.954 1.00 45.93 ? 2190 HIS A CD2   1 
ATOM   1014 C  CE1   . HIS A 1 128 ? -2.971  1.763  -24.322 1.00 46.63 ? 2190 HIS A CE1   1 
ATOM   1015 N  NE2   . HIS A 1 128 ? -4.284  1.741  -24.165 1.00 46.82 ? 2190 HIS A NE2   1 
ATOM   1016 N  N     . SER A 1 129 ? -4.728  4.207  -29.650 1.00 45.43 ? 2191 SER A N     1 
ATOM   1017 C  CA    . SER A 1 129 ? -5.492  4.913  -30.666 1.00 45.93 ? 2191 SER A CA    1 
ATOM   1018 C  C     . SER A 1 129 ? -6.904  5.288  -30.207 1.00 45.10 ? 2191 SER A C     1 
ATOM   1019 O  O     . SER A 1 129 ? -7.634  5.956  -30.932 1.00 45.88 ? 2191 SER A O     1 
ATOM   1020 C  CB    . SER A 1 129 ? -5.478  4.193  -32.018 1.00 46.12 ? 2191 SER A CB    1 
ATOM   1021 O  OG    . SER A 1 129 ? -5.663  2.803  -31.871 1.00 48.89 ? 2191 SER A OG    1 
ATOM   1022 N  N     . ASP A 1 130 ? -7.274  4.884  -28.995 1.00 43.99 ? 2192 ASP A N     1 
ATOM   1023 C  CA    . ASP A 1 130 ? -8.577  5.238  -28.414 1.00 41.75 ? 2192 ASP A CA    1 
ATOM   1024 C  C     . ASP A 1 130 ? -8.332  5.842  -27.055 1.00 41.18 ? 2192 ASP A C     1 
ATOM   1025 O  O     . ASP A 1 130 ? -7.412  5.447  -26.349 1.00 40.79 ? 2192 ASP A O     1 
ATOM   1026 C  CB    . ASP A 1 130 ? -9.459  4.012  -28.297 1.00 41.39 ? 2192 ASP A CB    1 
ATOM   1027 C  CG    . ASP A 1 130 ? -10.060 3.622  -29.611 1.00 41.50 ? 2192 ASP A CG    1 
ATOM   1028 O  OD1   . ASP A 1 130 ? -10.898 4.306  -30.147 1.00 41.01 ? 2192 ASP A OD1   1 
ATOM   1029 O  OD2   . ASP A 1 130 ? -9.749  2.603  -30.170 1.00 43.09 ? 2192 ASP A OD2   1 
ATOM   1030 N  N     . HIS A 1 131 ? -9.141  6.829  -26.692 1.00 39.87 ? 2193 HIS A N     1 
ATOM   1031 C  CA    . HIS A 1 131 ? -8.921  7.551  -25.460 1.00 38.09 ? 2193 HIS A CA    1 
ATOM   1032 C  C     . HIS A 1 131 ? -10.098 7.431  -24.480 1.00 36.30 ? 2193 HIS A C     1 
ATOM   1033 O  O     . HIS A 1 131 ? -11.247 7.377  -24.883 1.00 36.43 ? 2193 HIS A O     1 
ATOM   1034 C  CB    . HIS A 1 131 ? -8.504  8.978  -25.815 1.00 38.43 ? 2193 HIS A CB    1 
ATOM   1035 C  CG    . HIS A 1 131 ? -7.325  9.003  -26.754 1.00 43.37 ? 2193 HIS A CG    1 
ATOM   1036 N  ND1   . HIS A 1 131 ? -6.042  8.676  -26.345 1.00 43.52 ? 2193 HIS A ND1   1 
ATOM   1037 C  CD2   . HIS A 1 131 ? -7.250  9.214  -28.096 1.00 42.67 ? 2193 HIS A CD2   1 
ATOM   1038 C  CE1   . HIS A 1 131 ? -5.230  8.716  -27.390 1.00 45.47 ? 2193 HIS A CE1   1 
ATOM   1039 N  NE2   . HIS A 1 131 ? -5.938  9.040  -28.460 1.00 44.35 ? 2193 HIS A NE2   1 
ATOM   1040 N  N     . TYR A 1 132 ? -9.802  7.353  -23.187 1.00 35.03 ? 2194 TYR A N     1 
ATOM   1041 C  CA    . TYR A 1 132 ? -10.807 6.948  -22.191 1.00 33.49 ? 2194 TYR A CA    1 
ATOM   1042 C  C     . TYR A 1 132 ? -10.666 7.740  -20.903 1.00 33.88 ? 2194 TYR A C     1 
ATOM   1043 O  O     . TYR A 1 132 ? -10.242 7.197  -19.845 1.00 31.81 ? 2194 TYR A O     1 
ATOM   1044 C  CB    . TYR A 1 132 ? -10.615 5.479  -21.868 1.00 33.40 ? 2194 TYR A CB    1 
ATOM   1045 C  CG    . TYR A 1 132 ? -10.792 4.552  -23.055 1.00 32.84 ? 2194 TYR A CG    1 
ATOM   1046 C  CD1   . TYR A 1 132 ? -9.695  4.056  -23.748 1.00 31.32 ? 2194 TYR A CD1   1 
ATOM   1047 C  CD2   . TYR A 1 132 ? -12.055 4.137  -23.454 1.00 28.68 ? 2194 TYR A CD2   1 
ATOM   1048 C  CE1   . TYR A 1 132 ? -9.852  3.178  -24.817 1.00 28.16 ? 2194 TYR A CE1   1 
ATOM   1049 C  CE2   . TYR A 1 132 ? -12.202 3.274  -24.513 1.00 28.67 ? 2194 TYR A CE2   1 
ATOM   1050 C  CZ    . TYR A 1 132 ? -11.098 2.808  -25.178 1.00 28.27 ? 2194 TYR A CZ    1 
ATOM   1051 O  OH    . TYR A 1 132 ? -11.274 1.977  -26.239 1.00 32.23 ? 2194 TYR A OH    1 
ATOM   1052 N  N     . CYS A 1 133 ? -11.032 9.015  -20.955 1.00 32.85 ? 2195 CYS A N     1 
ATOM   1053 C  CA    . CYS A 1 133 ? -10.789 9.864  -19.786 1.00 35.19 ? 2195 CYS A CA    1 
ATOM   1054 C  C     . CYS A 1 133 ? -11.803 11.012 -19.670 1.00 35.10 ? 2195 CYS A C     1 
ATOM   1055 O  O     . CYS A 1 133 ? -12.117 11.648 -20.686 1.00 35.44 ? 2195 CYS A O     1 
ATOM   1056 C  CB    . CYS A 1 133 ? -9.391  10.449 -19.909 1.00 35.04 ? 2195 CYS A CB    1 
ATOM   1057 S  SG    . CYS A 1 133 ? -8.716  11.254 -18.422 1.00 43.37 ? 2195 CYS A SG    1 
ATOM   1058 N  N     . LEU A 1 134 ? -12.308 11.273 -18.462 1.00 33.62 ? 2196 LEU A N     1 
ATOM   1059 C  CA    . LEU A 1 134 ? -13.205 12.426 -18.248 1.00 33.63 ? 2196 LEU A CA    1 
ATOM   1060 C  C     . LEU A 1 134 ? -12.596 13.383 -17.252 1.00 33.58 ? 2196 LEU A C     1 
ATOM   1061 O  O     . LEU A 1 134 ? -11.976 12.958 -16.275 1.00 32.97 ? 2196 LEU A O     1 
ATOM   1062 C  CB    . LEU A 1 134 ? -14.569 11.995 -17.708 1.00 33.51 ? 2196 LEU A CB    1 
ATOM   1063 C  CG    . LEU A 1 134 ? -15.733 11.431 -18.546 1.00 34.14 ? 2196 LEU A CG    1 
ATOM   1064 C  CD1   . LEU A 1 134 ? -16.986 11.426 -17.701 1.00 33.59 ? 2196 LEU A CD1   1 
ATOM   1065 C  CD2   . LEU A 1 134 ? -16.005 12.223 -19.801 1.00 34.53 ? 2196 LEU A CD2   1 
ATOM   1066 N  N     . ASN A 1 135 ? -12.778 14.671 -17.496 1.00 34.80 ? 2197 ASN A N     1 
ATOM   1067 C  CA    . ASN A 1 135 ? -12.439 15.731 -16.547 1.00 35.91 ? 2197 ASN A CA    1 
ATOM   1068 C  C     . ASN A 1 135 ? -13.294 15.543 -15.333 1.00 35.97 ? 2197 ASN A C     1 
ATOM   1069 O  O     . ASN A 1 135 ? -14.482 15.320 -15.430 1.00 35.55 ? 2197 ASN A O     1 
ATOM   1070 C  CB    . ASN A 1 135 ? -12.914 17.071 -17.094 1.00 37.63 ? 2197 ASN A CB    1 
ATOM   1071 C  CG    . ASN A 1 135 ? -11.825 17.886 -17.610 1.00 42.70 ? 2197 ASN A CG    1 
ATOM   1072 O  OD1   . ASN A 1 135 ? -10.679 17.764 -17.165 1.00 43.33 ? 2197 ASN A OD1   1 
ATOM   1073 N  ND2   . ASN A 1 135 ? -12.144 18.731 -18.586 1.00 43.32 ? 2197 ASN A ND2   1 
ATOM   1074 N  N     . LEU A 1 136 ? -12.725 15.672 -14.170 1.00 35.93 ? 2198 LEU A N     1 
ATOM   1075 C  CA    . LEU A 1 136 ? -13.587 15.628 -13.027 1.00 37.04 ? 2198 LEU A CA    1 
ATOM   1076 C  C     . LEU A 1 136 ? -13.620 17.036 -12.466 1.00 38.20 ? 2198 LEU A C     1 
ATOM   1077 O  O     . LEU A 1 136 ? -14.622 17.700 -12.564 1.00 40.03 ? 2198 LEU A O     1 
ATOM   1078 C  CB    . LEU A 1 136 ? -13.141 14.557 -12.039 1.00 35.23 ? 2198 LEU A CB    1 
ATOM   1079 C  CG    . LEU A 1 136 ? -13.994 14.358 -10.783 1.00 36.72 ? 2198 LEU A CG    1 
ATOM   1080 C  CD1   . LEU A 1 136 ? -15.366 14.105 -11.012 1.00 30.13 ? 2198 LEU A CD1   1 
ATOM   1081 C  CD2   . LEU A 1 136 ? -13.593 13.245 -9.999  1.00 33.31 ? 2198 LEU A CD2   1 
ATOM   1082 N  N     . ASP A 1 137 ? -12.528 17.564 -11.976 1.00 38.85 ? 2199 ASP A N     1 
ATOM   1083 C  CA    . ASP A 1 137 ? -12.643 18.904 -11.482 1.00 39.56 ? 2199 ASP A CA    1 
ATOM   1084 C  C     . ASP A 1 137 ? -11.338 19.211 -10.841 1.00 39.68 ? 2199 ASP A C     1 
ATOM   1085 O  O     . ASP A 1 137 ? -10.533 18.306 -10.711 1.00 39.72 ? 2199 ASP A O     1 
ATOM   1086 C  CB    . ASP A 1 137 ? -13.708 18.759 -10.449 1.00 39.47 ? 2199 ASP A CB    1 
ATOM   1087 C  CG    . ASP A 1 137 ? -14.330 20.033 -10.038 1.00 43.12 ? 2199 ASP A CG    1 
ATOM   1088 O  OD1   . ASP A 1 137 ? -14.913 20.802 -10.821 1.00 41.35 ? 2199 ASP A OD1   1 
ATOM   1089 O  OD2   . ASP A 1 137 ? -14.261 20.180 -8.806  1.00 44.30 ? 2199 ASP A OD2   1 
ATOM   1090 N  N     . SER A 1 138 ? -11.100 20.474 -10.498 1.00 40.55 ? 2200 SER A N     1 
ATOM   1091 C  CA    . SER A 1 138 ? -9.891  20.885 -9.802  1.00 41.39 ? 2200 SER A CA    1 
ATOM   1092 C  C     . SER A 1 138 ? -8.671  20.074 -10.183 1.00 40.60 ? 2200 SER A C     1 
ATOM   1093 O  O     . SER A 1 138 ? -7.993  19.589 -9.312  1.00 42.27 ? 2200 SER A O     1 
ATOM   1094 C  CB    . SER A 1 138 ? -10.093 20.763 -8.274  1.00 42.25 ? 2200 SER A CB    1 
ATOM   1095 O  OG    . SER A 1 138 ? -11.455 20.997 -7.897  1.00 46.32 ? 2200 SER A OG    1 
ATOM   1096 N  N     . GLY A 1 139 ? -8.373  19.903 -11.454 1.00 39.95 ? 2201 GLY A N     1 
ATOM   1097 C  CA    . GLY A 1 139 ? -7.165  19.140 -11.793 1.00 39.68 ? 2201 GLY A CA    1 
ATOM   1098 C  C     . GLY A 1 139 ? -7.203  17.703 -11.272 1.00 38.75 ? 2201 GLY A C     1 
ATOM   1099 O  O     . GLY A 1 139 ? -6.258  17.236 -10.621 1.00 39.19 ? 2201 GLY A O     1 
ATOM   1100 N  N     . MET A 1 140 ? -8.335  17.041 -11.523 1.00 37.05 ? 2202 MET A N     1 
ATOM   1101 C  CA    . MET A 1 140 ? -8.528  15.619 -11.307 1.00 34.98 ? 2202 MET A CA    1 
ATOM   1102 C  C     . MET A 1 140 ? -9.346  15.069 -12.448 1.00 34.47 ? 2202 MET A C     1 
ATOM   1103 O  O     . MET A 1 140 ? -10.160 15.790 -13.039 1.00 33.18 ? 2202 MET A O     1 
ATOM   1104 C  CB    . MET A 1 140 ? -9.246  15.335 -10.018 1.00 35.48 ? 2202 MET A CB    1 
ATOM   1105 C  CG    . MET A 1 140 ? -8.486  15.720 -8.758  1.00 35.07 ? 2202 MET A CG    1 
ATOM   1106 S  SD    . MET A 1 140 ? -9.585  15.577 -7.336  1.00 37.56 ? 2202 MET A SD    1 
ATOM   1107 C  CE    . MET A 1 140 ? -10.883 16.730 -7.821  1.00 42.25 ? 2202 MET A CE    1 
ATOM   1108 N  N     . VAL A 1 141 ? -9.142  13.780 -12.724 1.00 32.79 ? 2203 VAL A N     1 
ATOM   1109 C  CA    . VAL A 1 141 ? -9.540  13.171 -13.983 1.00 32.60 ? 2203 VAL A CA    1 
ATOM   1110 C  C     . VAL A 1 141 ? -10.095 11.772 -13.643 1.00 31.38 ? 2203 VAL A C     1 
ATOM   1111 O  O     . VAL A 1 141 ? -9.627  11.156 -12.686 1.00 30.09 ? 2203 VAL A O     1 
ATOM   1112 C  CB    . VAL A 1 141 ? -8.280  13.032 -14.881 1.00 33.47 ? 2203 VAL A CB    1 
ATOM   1113 C  CG1   . VAL A 1 141 ? -8.447  11.967 -15.929 1.00 36.68 ? 2203 VAL A CG1   1 
ATOM   1114 C  CG2   . VAL A 1 141 ? -7.944  14.375 -15.527 1.00 34.07 ? 2203 VAL A CG2   1 
ATOM   1115 N  N     . ILE A 1 142 ? -11.087 11.292 -14.405 1.00 29.01 ? 2204 ILE A N     1 
ATOM   1116 C  CA    . ILE A 1 142 ? -11.501 9.887  -14.327 1.00 27.05 ? 2204 ILE A CA    1 
ATOM   1117 C  C     . ILE A 1 142 ? -10.895 9.135  -15.520 1.00 26.61 ? 2204 ILE A C     1 
ATOM   1118 O  O     . ILE A 1 142 ? -11.209 9.393  -16.691 1.00 24.97 ? 2204 ILE A O     1 
ATOM   1119 C  CB    . ILE A 1 142 ? -13.041 9.645  -14.265 1.00 26.21 ? 2204 ILE A CB    1 
ATOM   1120 C  CG1   . ILE A 1 142 ? -13.698 10.412 -13.119 1.00 27.28 ? 2204 ILE A CG1   1 
ATOM   1121 C  CG2   . ILE A 1 142 ? -13.310 8.140  -14.019 1.00 25.59 ? 2204 ILE A CG2   1 
ATOM   1122 C  CD1   . ILE A 1 142 ? -15.240 10.261 -13.031 1.00 20.96 ? 2204 ILE A CD1   1 
ATOM   1123 N  N     . ASP A 1 143 ? -10.014 8.197  -15.195 1.00 25.61 ? 2205 ASP A N     1 
ATOM   1124 C  CA    . ASP A 1 143 ? -9.199  7.514  -16.221 1.00 24.52 ? 2205 ASP A CA    1 
ATOM   1125 C  C     . ASP A 1 143 ? -9.798  6.157  -16.356 1.00 23.68 ? 2205 ASP A C     1 
ATOM   1126 O  O     . ASP A 1 143 ? -9.792  5.385  -15.403 1.00 24.08 ? 2205 ASP A O     1 
ATOM   1127 C  CB    . ASP A 1 143 ? -7.747  7.387  -15.718 1.00 24.82 ? 2205 ASP A CB    1 
ATOM   1128 C  CG    . ASP A 1 143 ? -6.888  6.513  -16.619 1.00 26.17 ? 2205 ASP A CG    1 
ATOM   1129 O  OD1   . ASP A 1 143 ? -7.432  5.925  -17.588 1.00 26.30 ? 2205 ASP A OD1   1 
ATOM   1130 O  OD2   . ASP A 1 143 ? -5.669  6.423  -16.351 1.00 27.99 ? 2205 ASP A OD2   1 
ATOM   1131 N  N     . SER A 1 144 ? -10.327 5.843  -17.520 1.00 23.81 ? 2206 SER A N     1 
ATOM   1132 C  CA    . SER A 1 144 ? -10.902 4.544  -17.711 1.00 24.78 ? 2206 SER A CA    1 
ATOM   1133 C  C     . SER A 1 144 ? -10.122 3.740  -18.780 1.00 24.65 ? 2206 SER A C     1 
ATOM   1134 O  O     . SER A 1 144 ? -10.647 2.830  -19.406 1.00 24.53 ? 2206 SER A O     1 
ATOM   1135 C  CB    . SER A 1 144 ? -12.402 4.676  -17.990 1.00 24.87 ? 2206 SER A CB    1 
ATOM   1136 O  OG    . SER A 1 144 ? -12.693 5.203  -19.273 1.00 28.09 ? 2206 SER A OG    1 
ATOM   1137 N  N     . TYR A 1 145 ? -8.849  4.068  -18.978 1.00 25.64 ? 2207 TYR A N     1 
ATOM   1138 C  CA    . TYR A 1 145 ? -8.035  3.261  -19.894 1.00 27.05 ? 2207 TYR A CA    1 
ATOM   1139 C  C     . TYR A 1 145 ? -7.876  1.838  -19.380 1.00 26.97 ? 2207 TYR A C     1 
ATOM   1140 O  O     . TYR A 1 145 ? -7.878  0.928  -20.187 1.00 27.29 ? 2207 TYR A O     1 
ATOM   1141 C  CB    . TYR A 1 145 ? -6.656  3.828  -20.049 1.00 27.00 ? 2207 TYR A CB    1 
ATOM   1142 C  CG    . TYR A 1 145 ? -6.553  4.967  -20.995 1.00 30.26 ? 2207 TYR A CG    1 
ATOM   1143 C  CD1   . TYR A 1 145 ? -6.879  6.258  -20.590 1.00 29.66 ? 2207 TYR A CD1   1 
ATOM   1144 C  CD2   . TYR A 1 145 ? -6.100  4.758  -22.289 1.00 29.11 ? 2207 TYR A CD2   1 
ATOM   1145 C  CE1   . TYR A 1 145 ? -6.768  7.323  -21.449 1.00 32.53 ? 2207 TYR A CE1   1 
ATOM   1146 C  CE2   . TYR A 1 145 ? -5.950  5.816  -23.157 1.00 33.30 ? 2207 TYR A CE2   1 
ATOM   1147 C  CZ    . TYR A 1 145 ? -6.287  7.102  -22.745 1.00 33.08 ? 2207 TYR A CZ    1 
ATOM   1148 O  OH    . TYR A 1 145 ? -6.168  8.182  -23.617 1.00 32.01 ? 2207 TYR A OH    1 
ATOM   1149 N  N     . ARG A 1 146 ? -7.745  1.652  -18.059 1.00 27.09 ? 2208 ARG A N     1 
ATOM   1150 C  CA    . ARG A 1 146 ? -7.548  0.280  -17.486 1.00 28.97 ? 2208 ARG A CA    1 
ATOM   1151 C  C     . ARG A 1 146 ? -8.747  -0.301 -16.767 1.00 28.22 ? 2208 ARG A C     1 
ATOM   1152 O  O     . ARG A 1 146 ? -8.967  -1.491 -16.852 1.00 29.00 ? 2208 ARG A O     1 
ATOM   1153 C  CB    . ARG A 1 146 ? -6.410  0.258  -16.467 1.00 29.38 ? 2208 ARG A CB    1 
ATOM   1154 C  CG    . ARG A 1 146 ? -5.206  1.004  -16.908 1.00 33.67 ? 2208 ARG A CG    1 
ATOM   1155 C  CD    . ARG A 1 146 ? -4.743  0.399  -18.145 1.00 42.88 ? 2208 ARG A CD    1 
ATOM   1156 N  NE    . ARG A 1 146 ? -3.574  -0.374 -17.823 1.00 52.67 ? 2208 ARG A NE    1 
ATOM   1157 C  CZ    . ARG A 1 146 ? -3.213  -1.473 -18.457 1.00 56.56 ? 2208 ARG A CZ    1 
ATOM   1158 N  NH1   . ARG A 1 146 ? -3.943  -1.942 -19.475 1.00 57.64 ? 2208 ARG A NH1   1 
ATOM   1159 N  NH2   . ARG A 1 146 ? -2.106  -2.091 -18.067 1.00 58.70 ? 2208 ARG A NH2   1 
ATOM   1160 N  N     . MET A 1 147 ? -9.481  0.538  -16.033 1.00 27.07 ? 2209 MET A N     1 
ATOM   1161 C  CA    . MET A 1 147 ? -10.637 0.085  -15.218 1.00 27.23 ? 2209 MET A CA    1 
ATOM   1162 C  C     . MET A 1 147 ? -11.836 0.992  -15.469 1.00 26.55 ? 2209 MET A C     1 
ATOM   1163 O  O     . MET A 1 147 ? -11.668 2.188  -15.647 1.00 26.32 ? 2209 MET A O     1 
ATOM   1164 C  CB    . MET A 1 147 ? -10.284 0.171  -13.724 1.00 27.28 ? 2209 MET A CB    1 
ATOM   1165 C  CG    . MET A 1 147 ? -8.917  -0.396 -13.370 1.00 30.60 ? 2209 MET A CG    1 
ATOM   1166 S  SD    . MET A 1 147 ? -8.448  -0.192 -11.661 1.00 31.08 ? 2209 MET A SD    1 
ATOM   1167 C  CE    . MET A 1 147 ? -9.221  -1.449 -10.860 1.00 42.22 ? 2209 MET A CE    1 
ATOM   1168 N  N     . GLY A 1 148 ? -13.047 0.452  -15.448 1.00 26.56 ? 2210 GLY A N     1 
ATOM   1169 C  CA    . GLY A 1 148 ? -14.218 1.276  -15.752 1.00 26.25 ? 2210 GLY A CA    1 
ATOM   1170 C  C     . GLY A 1 148 ? -15.461 0.448  -15.922 1.00 26.21 ? 2210 GLY A C     1 
ATOM   1171 O  O     . GLY A 1 148 ? -15.615 -0.624 -15.317 1.00 26.44 ? 2210 GLY A O     1 
ATOM   1172 N  N     . ASN A 1 149 ? -16.366 0.943  -16.749 1.00 25.18 ? 2211 ASN A N     1 
ATOM   1173 C  CA    . ASN A 1 149 ? -17.586 0.229  -17.018 1.00 24.30 ? 2211 ASN A CA    1 
ATOM   1174 C  C     . ASN A 1 149 ? -17.925 0.526  -18.457 1.00 24.79 ? 2211 ASN A C     1 
ATOM   1175 O  O     . ASN A 1 149 ? -17.083 1.030  -19.157 1.00 24.16 ? 2211 ASN A O     1 
ATOM   1176 C  CB    . ASN A 1 149 ? -18.700 0.564  -16.000 1.00 23.87 ? 2211 ASN A CB    1 
ATOM   1177 C  CG    . ASN A 1 149 ? -19.182 2.035  -16.072 1.00 24.57 ? 2211 ASN A CG    1 
ATOM   1178 O  OD1   . ASN A 1 149 ? -18.695 2.835  -16.870 1.00 22.59 ? 2211 ASN A OD1   1 
ATOM   1179 N  ND2   . ASN A 1 149 ? -20.156 2.369  -15.223 1.00 22.74 ? 2211 ASN A ND2   1 
ATOM   1180 N  N     . GLU A 1 150 ? -19.121 0.155  -18.921 1.00 26.30 ? 2212 GLU A N     1 
ATOM   1181 C  CA    . GLU A 1 150 ? -19.455 0.275  -20.332 1.00 26.38 ? 2212 GLU A CA    1 
ATOM   1182 C  C     . GLU A 1 150 ? -19.574 1.739  -20.805 1.00 26.37 ? 2212 GLU A C     1 
ATOM   1183 O  O     . GLU A 1 150 ? -19.608 2.003  -22.010 1.00 27.13 ? 2212 GLU A O     1 
ATOM   1184 C  CB    . GLU A 1 150 ? -20.743 -0.507 -20.659 1.00 26.62 ? 2212 GLU A CB    1 
ATOM   1185 C  CG    . GLU A 1 150 ? -20.635 -2.070 -20.592 1.00 30.88 ? 2212 GLU A CG    1 
ATOM   1186 C  CD    . GLU A 1 150 ? -19.671 -2.618 -21.636 1.00 35.96 ? 2212 GLU A CD    1 
ATOM   1187 O  OE1   . GLU A 1 150 ? -19.993 -2.761 -22.803 1.00 37.23 ? 2212 GLU A OE1   1 
ATOM   1188 O  OE2   . GLU A 1 150 ? -18.531 -2.881 -21.339 1.00 37.42 ? 2212 GLU A OE2   1 
ATOM   1189 N  N     . ALA A 1 151 ? -19.665 2.689  -19.880 1.00 25.76 ? 2213 ALA A N     1 
ATOM   1190 C  CA    . ALA A 1 151 ? -19.792 4.088  -20.272 1.00 25.50 ? 2213 ALA A CA    1 
ATOM   1191 C  C     . ALA A 1 151 ? -18.542 4.531  -21.087 1.00 25.80 ? 2213 ALA A C     1 
ATOM   1192 O  O     . ALA A 1 151 ? -18.603 5.486  -21.891 1.00 25.99 ? 2213 ALA A O     1 
ATOM   1193 C  CB    . ALA A 1 151 ? -20.001 4.986  -19.027 1.00 25.27 ? 2213 ALA A CB    1 
ATOM   1194 N  N     . ARG A 1 152 ? -17.450 3.785  -20.911 1.00 25.62 ? 2214 ARG A N     1 
ATOM   1195 C  CA    . ARG A 1 152 ? -16.178 4.043  -21.592 1.00 25.81 ? 2214 ARG A CA    1 
ATOM   1196 C  C     . ARG A 1 152 ? -16.286 3.842  -23.081 1.00 25.57 ? 2214 ARG A C     1 
ATOM   1197 O  O     . ARG A 1 152 ? -15.478 4.377  -23.846 1.00 25.19 ? 2214 ARG A O     1 
ATOM   1198 C  CB    . ARG A 1 152 ? -15.029 3.165  -21.014 1.00 25.91 ? 2214 ARG A CB    1 
ATOM   1199 C  CG    . ARG A 1 152 ? -14.947 1.721  -21.529 1.00 24.75 ? 2214 ARG A CG    1 
ATOM   1200 C  CD    . ARG A 1 152 ? -14.156 0.767  -20.557 1.00 24.90 ? 2214 ARG A CD    1 
ATOM   1201 N  NE    . ARG A 1 152 ? -12.728 1.049  -20.607 1.00 22.79 ? 2214 ARG A NE    1 
ATOM   1202 C  CZ    . ARG A 1 152 ? -11.958 0.672  -21.612 1.00 25.59 ? 2214 ARG A CZ    1 
ATOM   1203 N  NH1   . ARG A 1 152 ? -12.494 -0.036 -22.581 1.00 25.11 ? 2214 ARG A NH1   1 
ATOM   1204 N  NH2   . ARG A 1 152 ? -10.655 0.985  -21.625 1.00 23.38 ? 2214 ARG A NH2   1 
ATOM   1205 N  N     . PHE A 1 153 ? -17.285 3.090  -23.511 1.00 26.34 ? 2215 PHE A N     1 
ATOM   1206 C  CA    . PHE A 1 153 ? -17.405 2.824  -24.926 1.00 27.48 ? 2215 PHE A CA    1 
ATOM   1207 C  C     . PHE A 1 153 ? -18.329 3.824  -25.630 1.00 28.05 ? 2215 PHE A C     1 
ATOM   1208 O  O     . PHE A 1 153 ? -18.506 3.747  -26.842 1.00 28.25 ? 2215 PHE A O     1 
ATOM   1209 C  CB    . PHE A 1 153 ? -17.885 1.384  -25.178 1.00 28.34 ? 2215 PHE A CB    1 
ATOM   1210 C  CG    . PHE A 1 153 ? -16.847 0.332  -24.880 1.00 27.99 ? 2215 PHE A CG    1 
ATOM   1211 C  CD1   . PHE A 1 153 ? -15.722 0.190  -25.687 1.00 27.10 ? 2215 PHE A CD1   1 
ATOM   1212 C  CD2   . PHE A 1 153 ? -17.000 -0.510 -23.791 1.00 29.58 ? 2215 PHE A CD2   1 
ATOM   1213 C  CE1   . PHE A 1 153 ? -14.740 -0.781 -25.393 1.00 28.86 ? 2215 PHE A CE1   1 
ATOM   1214 C  CE2   . PHE A 1 153 ? -16.023 -1.485 -23.486 1.00 29.68 ? 2215 PHE A CE2   1 
ATOM   1215 C  CZ    . PHE A 1 153 ? -14.892 -1.604 -24.278 1.00 29.14 ? 2215 PHE A CZ    1 
ATOM   1216 N  N     . ILE A 1 154 ? -18.931 4.743  -24.869 1.00 28.98 ? 2216 ILE A N     1 
ATOM   1217 C  CA    . ILE A 1 154 ? -19.876 5.732  -25.442 1.00 28.07 ? 2216 ILE A CA    1 
ATOM   1218 C  C     . ILE A 1 154 ? -19.144 6.732  -26.328 1.00 28.86 ? 2216 ILE A C     1 
ATOM   1219 O  O     . ILE A 1 154 ? -18.197 7.403  -25.881 1.00 30.44 ? 2216 ILE A O     1 
ATOM   1220 C  CB    . ILE A 1 154 ? -20.699 6.457  -24.368 1.00 27.70 ? 2216 ILE A CB    1 
ATOM   1221 C  CG1   . ILE A 1 154 ? -21.601 5.446  -23.662 1.00 26.77 ? 2216 ILE A CG1   1 
ATOM   1222 C  CG2   . ILE A 1 154 ? -21.536 7.576  -25.009 1.00 27.26 ? 2216 ILE A CG2   1 
ATOM   1223 C  CD1   . ILE A 1 154 ? -22.322 5.981  -22.418 1.00 29.58 ? 2216 ILE A CD1   1 
ATOM   1224 N  N     . ASN A 1 155 ? -19.550 6.814  -27.590 1.00 27.82 ? 2217 ASN A N     1 
ATOM   1225 C  CA    . ASN A 1 155 ? -18.833 7.672  -28.529 1.00 29.29 ? 2217 ASN A CA    1 
ATOM   1226 C  C     . ASN A 1 155 ? -19.145 9.198  -28.449 1.00 29.27 ? 2217 ASN A C     1 
ATOM   1227 O  O     . ASN A 1 155 ? -20.064 9.631  -27.750 1.00 27.64 ? 2217 ASN A O     1 
ATOM   1228 C  CB    . ASN A 1 155 ? -18.984 7.133  -29.947 1.00 28.77 ? 2217 ASN A CB    1 
ATOM   1229 C  CG    . ASN A 1 155 ? -18.151 5.901  -30.175 1.00 30.87 ? 2217 ASN A CG    1 
ATOM   1230 O  OD1   . ASN A 1 155 ? -16.988 5.861  -29.778 1.00 31.30 ? 2217 ASN A OD1   1 
ATOM   1231 N  ND2   . ASN A 1 155 ? -18.743 4.871  -30.785 1.00 27.77 ? 2217 ASN A ND2   1 
ATOM   1232 N  N     . HIS A 1 156 ? -18.345 9.996  -29.155 1.00 29.63 ? 2218 HIS A N     1 
ATOM   1233 C  CA    . HIS A 1 156 ? -18.551 11.428 -29.187 1.00 30.71 ? 2218 HIS A CA    1 
ATOM   1234 C  C     . HIS A 1 156 ? -19.534 11.784 -30.289 1.00 31.53 ? 2218 HIS A C     1 
ATOM   1235 O  O     . HIS A 1 156 ? -19.497 11.179 -31.356 1.00 30.96 ? 2218 HIS A O     1 
ATOM   1236 C  CB    . HIS A 1 156 ? -17.239 12.173 -29.469 1.00 30.56 ? 2218 HIS A CB    1 
ATOM   1237 C  CG    . HIS A 1 156 ? -17.440 13.566 -29.999 1.00 32.10 ? 2218 HIS A CG    1 
ATOM   1238 N  ND1   . HIS A 1 156 ? -17.612 14.663 -29.181 1.00 32.51 ? 2218 HIS A ND1   1 
ATOM   1239 C  CD2   . HIS A 1 156 ? -17.494 14.038 -31.271 1.00 31.71 ? 2218 HIS A CD2   1 
ATOM   1240 C  CE1   . HIS A 1 156 ? -17.752 15.751 -29.924 1.00 30.73 ? 2218 HIS A CE1   1 
ATOM   1241 N  NE2   . HIS A 1 156 ? -17.679 15.398 -31.197 1.00 33.60 ? 2218 HIS A NE2   1 
ATOM   1242 N  N     . SER A 1 157 ? -20.376 12.787 -30.044 1.00 31.51 ? 2219 SER A N     1 
ATOM   1243 C  CA    . SER A 1 157 ? -21.071 13.436 -31.155 1.00 32.89 ? 2219 SER A CA    1 
ATOM   1244 C  C     . SER A 1 157 ? -21.008 14.947 -31.035 1.00 33.79 ? 2219 SER A C     1 
ATOM   1245 O  O     . SER A 1 157 ? -21.099 15.487 -29.934 1.00 33.06 ? 2219 SER A O     1 
ATOM   1246 C  CB    . SER A 1 157 ? -22.535 12.963 -31.279 1.00 32.74 ? 2219 SER A CB    1 
ATOM   1247 O  OG    . SER A 1 157 ? -23.215 13.721 -32.273 1.00 35.46 ? 2219 SER A OG    1 
ATOM   1248 N  N     . CYS A 1 158 ? -20.841 15.632 -32.175 1.00 34.65 ? 2220 CYS A N     1 
ATOM   1249 C  CA    . CYS A 1 158 ? -20.981 17.098 -32.243 1.00 34.22 ? 2220 CYS A CA    1 
ATOM   1250 C  C     . CYS A 1 158 ? -22.450 17.521 -32.099 1.00 35.06 ? 2220 CYS A C     1 
ATOM   1251 O  O     . CYS A 1 158 ? -22.745 18.704 -31.916 1.00 35.23 ? 2220 CYS A O     1 
ATOM   1252 C  CB    . CYS A 1 158 ? -20.435 17.630 -33.564 1.00 33.93 ? 2220 CYS A CB    1 
ATOM   1253 S  SG    . CYS A 1 158 ? -18.718 17.228 -33.881 1.00 35.32 ? 2220 CYS A SG    1 
ATOM   1254 N  N     . ASP A 1 159 ? -23.375 16.562 -32.196 1.00 35.50 ? 2221 ASP A N     1 
ATOM   1255 C  CA    . ASP A 1 159 ? -24.804 16.798 -31.900 1.00 35.23 ? 2221 ASP A CA    1 
ATOM   1256 C  C     . ASP A 1 159 ? -25.283 15.718 -30.938 1.00 34.45 ? 2221 ASP A C     1 
ATOM   1257 O  O     . ASP A 1 159 ? -25.983 14.799 -31.361 1.00 34.52 ? 2221 ASP A O     1 
ATOM   1258 C  CB    . ASP A 1 159 ? -25.629 16.712 -33.198 1.00 36.18 ? 2221 ASP A CB    1 
ATOM   1259 C  CG    . ASP A 1 159 ? -27.142 16.912 -32.982 1.00 37.64 ? 2221 ASP A CG    1 
ATOM   1260 O  OD1   . ASP A 1 159 ? -27.964 16.225 -33.524 1.00 38.68 ? 2221 ASP A OD1   1 
ATOM   1261 O  OD2   . ASP A 1 159 ? -27.592 17.768 -32.266 1.00 43.40 ? 2221 ASP A OD2   1 
ATOM   1262 N  N     . PRO A 1 160 ? -24.915 15.815 -29.640 1.00 33.52 ? 2222 PRO A N     1 
ATOM   1263 C  CA    . PRO A 1 160 ? -25.096 14.664 -28.738 1.00 32.98 ? 2222 PRO A CA    1 
ATOM   1264 C  C     . PRO A 1 160 ? -26.546 14.380 -28.305 1.00 32.65 ? 2222 PRO A C     1 
ATOM   1265 O  O     . PRO A 1 160 ? -27.366 15.288 -28.253 1.00 32.35 ? 2222 PRO A O     1 
ATOM   1266 C  CB    . PRO A 1 160 ? -24.278 15.065 -27.511 1.00 32.60 ? 2222 PRO A CB    1 
ATOM   1267 C  CG    . PRO A 1 160 ? -24.387 16.591 -27.492 1.00 32.86 ? 2222 PRO A CG    1 
ATOM   1268 C  CD    . PRO A 1 160 ? -24.216 16.923 -28.964 1.00 33.84 ? 2222 PRO A CD    1 
ATOM   1269 N  N     . ASN A 1 161 ? -26.857 13.138 -27.956 1.00 31.64 ? 2223 ASN A N     1 
ATOM   1270 C  CA    . ASN A 1 161 ? -28.154 12.863 -27.303 1.00 32.01 ? 2223 ASN A CA    1 
ATOM   1271 C  C     . ASN A 1 161 ? -28.071 12.661 -25.798 1.00 30.64 ? 2223 ASN A C     1 
ATOM   1272 O  O     . ASN A 1 161 ? -29.087 12.400 -25.124 1.00 30.89 ? 2223 ASN A O     1 
ATOM   1273 C  CB    . ASN A 1 161 ? -28.899 11.691 -27.982 1.00 31.67 ? 2223 ASN A CB    1 
ATOM   1274 C  CG    . ASN A 1 161 ? -28.050 10.436 -28.088 1.00 33.86 ? 2223 ASN A CG    1 
ATOM   1275 O  OD1   . ASN A 1 161 ? -27.134 10.204 -27.264 1.00 34.90 ? 2223 ASN A OD1   1 
ATOM   1276 N  ND2   . ASN A 1 161 ? -28.365 9.597  -29.080 1.00 29.02 ? 2223 ASN A ND2   1 
ATOM   1277 N  N     . CYS A 1 162 ? -26.866 12.808 -25.253 1.00 30.23 ? 2224 CYS A N     1 
ATOM   1278 C  CA    . CYS A 1 162 ? -26.662 12.619 -23.815 1.00 28.98 ? 2224 CYS A CA    1 
ATOM   1279 C  C     . CYS A 1 162 ? -25.700 13.665 -23.304 1.00 28.30 ? 2224 CYS A C     1 
ATOM   1280 O  O     . CYS A 1 162 ? -24.957 14.237 -24.073 1.00 28.69 ? 2224 CYS A O     1 
ATOM   1281 C  CB    . CYS A 1 162 ? -26.067 11.217 -23.561 1.00 27.90 ? 2224 CYS A CB    1 
ATOM   1282 S  SG    . CYS A 1 162 ? -27.211 9.867  -23.880 1.00 31.86 ? 2224 CYS A SG    1 
ATOM   1283 N  N     . GLU A 1 163 ? -25.642 13.857 -21.990 1.00 28.88 ? 2225 GLU A N     1 
ATOM   1284 C  CA    . GLU A 1 163 ? -24.601 14.679 -21.424 1.00 28.90 ? 2225 GLU A CA    1 
ATOM   1285 C  C     . GLU A 1 163 ? -24.061 14.120 -20.120 1.00 29.18 ? 2225 GLU A C     1 
ATOM   1286 O  O     . GLU A 1 163 ? -24.749 13.350 -19.429 1.00 29.90 ? 2225 GLU A O     1 
ATOM   1287 C  CB    . GLU A 1 163 ? -25.119 16.105 -21.184 1.00 28.41 ? 2225 GLU A CB    1 
ATOM   1288 C  CG    . GLU A 1 163 ? -26.215 16.158 -20.167 1.00 31.03 ? 2225 GLU A CG    1 
ATOM   1289 C  CD    . GLU A 1 163 ? -26.578 17.597 -19.745 1.00 35.30 ? 2225 GLU A CD    1 
ATOM   1290 O  OE1   . GLU A 1 163 ? -27.447 17.784 -18.927 1.00 35.49 ? 2225 GLU A OE1   1 
ATOM   1291 O  OE2   . GLU A 1 163 ? -25.992 18.578 -20.173 1.00 37.23 ? 2225 GLU A OE2   1 
ATOM   1292 N  N     . MET A 1 164 ? -22.849 14.539 -19.763 1.00 28.05 ? 2226 MET A N     1 
ATOM   1293 C  CA    . MET A 1 164 ? -22.260 14.162 -18.469 1.00 30.01 ? 2226 MET A CA    1 
ATOM   1294 C  C     . MET A 1 164 ? -22.606 15.266 -17.477 1.00 29.94 ? 2226 MET A C     1 
ATOM   1295 O  O     . MET A 1 164 ? -22.445 16.419 -17.810 1.00 31.89 ? 2226 MET A O     1 
ATOM   1296 C  CB    . MET A 1 164 ? -20.720 14.024 -18.584 1.00 28.87 ? 2226 MET A CB    1 
ATOM   1297 C  CG    . MET A 1 164 ? -20.250 12.897 -19.461 1.00 27.39 ? 2226 MET A CG    1 
ATOM   1298 S  SD    . MET A 1 164 ? -20.716 11.304 -18.757 1.00 29.87 ? 2226 MET A SD    1 
ATOM   1299 C  CE    . MET A 1 164 ? -20.246 10.091 -19.983 1.00 25.39 ? 2226 MET A CE    1 
ATOM   1300 N  N     . GLN A 1 165 ? -23.075 14.929 -16.286 1.00 28.27 ? 2227 GLN A N     1 
ATOM   1301 C  CA    . GLN A 1 165 ? -23.308 15.931 -15.263 1.00 29.49 ? 2227 GLN A CA    1 
ATOM   1302 C  C     . GLN A 1 165 ? -22.489 15.627 -14.019 1.00 29.86 ? 2227 GLN A C     1 
ATOM   1303 O  O     . GLN A 1 165 ? -22.423 14.484 -13.573 1.00 30.82 ? 2227 GLN A O     1 
ATOM   1304 C  CB    . GLN A 1 165 ? -24.801 15.957 -14.871 1.00 30.36 ? 2227 GLN A CB    1 
ATOM   1305 C  CG    . GLN A 1 165 ? -25.763 16.281 -16.029 1.00 30.50 ? 2227 GLN A CG    1 
ATOM   1306 C  CD    . GLN A 1 165 ? -27.218 16.092 -15.636 1.00 32.83 ? 2227 GLN A CD    1 
ATOM   1307 O  OE1   . GLN A 1 165 ? -27.508 15.689 -14.498 1.00 29.94 ? 2227 GLN A OE1   1 
ATOM   1308 N  NE2   . GLN A 1 165 ? -28.152 16.386 -16.586 1.00 29.81 ? 2227 GLN A NE2   1 
ATOM   1309 N  N     . LYS A 1 166 ? -21.868 16.643 -13.454 1.00 29.33 ? 2228 LYS A N     1 
ATOM   1310 C  CA    . LYS A 1 166 ? -21.166 16.455 -12.222 1.00 30.23 ? 2228 LYS A CA    1 
ATOM   1311 C  C     . LYS A 1 166 ? -22.051 16.687 -11.017 1.00 29.63 ? 2228 LYS A C     1 
ATOM   1312 O  O     . LYS A 1 166 ? -22.630 17.763 -10.858 1.00 28.88 ? 2228 LYS A O     1 
ATOM   1313 C  CB    . LYS A 1 166 ? -19.951 17.356 -12.168 1.00 30.53 ? 2228 LYS A CB    1 
ATOM   1314 C  CG    . LYS A 1 166 ? -19.192 17.157 -10.896 1.00 32.33 ? 2228 LYS A CG    1 
ATOM   1315 C  CD    . LYS A 1 166 ? -17.920 17.939 -10.923 1.00 36.48 ? 2228 LYS A CD    1 
ATOM   1316 C  CE    . LYS A 1 166 ? -18.215 19.403 -10.784 1.00 32.54 ? 2228 LYS A CE    1 
ATOM   1317 N  NZ    . LYS A 1 166 ? -16.957 20.087 -10.529 1.00 33.93 ? 2228 LYS A NZ    1 
ATOM   1318 N  N     . TRP A 1 167 ? -22.118 15.681 -10.155 1.00 29.09 ? 2229 TRP A N     1 
ATOM   1319 C  CA    . TRP A 1 167 ? -22.981 15.708 -9.001  1.00 28.59 ? 2229 TRP A CA    1 
ATOM   1320 C  C     . TRP A 1 167 ? -22.178 15.639 -7.749  1.00 29.17 ? 2229 TRP A C     1 
ATOM   1321 O  O     . TRP A 1 167 ? -21.099 14.995 -7.743  1.00 28.61 ? 2229 TRP A O     1 
ATOM   1322 C  CB    . TRP A 1 167 ? -23.965 14.548 -9.043  1.00 27.32 ? 2229 TRP A CB    1 
ATOM   1323 C  CG    . TRP A 1 167 ? -25.085 14.838 -9.973  1.00 29.91 ? 2229 TRP A CG    1 
ATOM   1324 C  CD1   . TRP A 1 167 ? -25.019 14.921 -11.347 1.00 27.60 ? 2229 TRP A CD1   1 
ATOM   1325 C  CD2   . TRP A 1 167 ? -26.462 15.082 -9.616  1.00 25.06 ? 2229 TRP A CD2   1 
ATOM   1326 N  NE1   . TRP A 1 167 ? -26.267 15.207 -11.844 1.00 27.49 ? 2229 TRP A NE1   1 
ATOM   1327 C  CE2   . TRP A 1 167 ? -27.162 15.307 -10.804 1.00 28.42 ? 2229 TRP A CE2   1 
ATOM   1328 C  CE3   . TRP A 1 167 ? -27.156 15.120 -8.399  1.00 28.87 ? 2229 TRP A CE3   1 
ATOM   1329 C  CZ2   . TRP A 1 167 ? -28.547 15.545 -10.830 1.00 28.68 ? 2229 TRP A CZ2   1 
ATOM   1330 C  CZ3   . TRP A 1 167 ? -28.527 15.376 -8.414  1.00 28.67 ? 2229 TRP A CZ3   1 
ATOM   1331 C  CH2   . TRP A 1 167 ? -29.202 15.601 -9.626  1.00 30.09 ? 2229 TRP A CH2   1 
ATOM   1332 N  N     . SER A 1 168 ? -22.682 16.297 -6.696  1.00 29.12 ? 2230 SER A N     1 
ATOM   1333 C  CA    . SER A 1 168 ? -22.148 16.097 -5.360  1.00 30.99 ? 2230 SER A CA    1 
ATOM   1334 C  C     . SER A 1 168 ? -22.897 14.952 -4.697  1.00 31.50 ? 2230 SER A C     1 
ATOM   1335 O  O     . SER A 1 168 ? -24.095 15.032 -4.486  1.00 33.28 ? 2230 SER A O     1 
ATOM   1336 C  CB    . SER A 1 168 ? -22.247 17.350 -4.498  1.00 30.84 ? 2230 SER A CB    1 
ATOM   1337 O  OG    . SER A 1 168 ? -21.541 17.156 -3.267  1.00 31.52 ? 2230 SER A OG    1 
ATOM   1338 N  N     . VAL A 1 169 ? -22.193 13.866 -4.415  1.00 31.83 ? 2231 VAL A N     1 
ATOM   1339 C  CA    . VAL A 1 169 ? -22.808 12.665 -3.844  1.00 32.49 ? 2231 VAL A CA    1 
ATOM   1340 C  C     . VAL A 1 169 ? -22.138 12.373 -2.481  1.00 33.35 ? 2231 VAL A C     1 
ATOM   1341 O  O     . VAL A 1 169 ? -20.933 12.052 -2.405  1.00 33.61 ? 2231 VAL A O     1 
ATOM   1342 C  CB    . VAL A 1 169 ? -22.701 11.462 -4.817  1.00 32.01 ? 2231 VAL A CB    1 
ATOM   1343 C  CG1   . VAL A 1 169 ? -23.450 10.281 -4.243  1.00 33.04 ? 2231 VAL A CG1   1 
ATOM   1344 C  CG2   . VAL A 1 169 ? -23.275 11.833 -6.214  1.00 29.47 ? 2231 VAL A CG2   1 
ATOM   1345 N  N     . ASN A 1 170 ? -22.908 12.547 -1.412  1.00 33.50 ? 2232 ASN A N     1 
ATOM   1346 C  CA    . ASN A 1 170 ? -22.400 12.419 -0.065  1.00 33.71 ? 2232 ASN A CA    1 
ATOM   1347 C  C     . ASN A 1 170 ? -21.098 13.179 0.079   1.00 32.78 ? 2232 ASN A C     1 
ATOM   1348 O  O     . ASN A 1 170 ? -20.156 12.679 0.620   1.00 32.90 ? 2232 ASN A O     1 
ATOM   1349 C  CB    . ASN A 1 170 ? -22.207 10.929 0.296   1.00 34.84 ? 2232 ASN A CB    1 
ATOM   1350 C  CG    . ASN A 1 170 ? -21.752 10.732 1.745   1.00 38.96 ? 2232 ASN A CG    1 
ATOM   1351 O  OD1   . ASN A 1 170 ? -22.020 11.580 2.601   1.00 38.41 ? 2232 ASN A OD1   1 
ATOM   1352 N  ND2   . ASN A 1 170 ? -21.040 9.624  2.014   1.00 39.29 ? 2232 ASN A ND2   1 
ATOM   1353 N  N     . GLY A 1 171 ? -21.040 14.378 -0.461  1.00 33.01 ? 2233 GLY A N     1 
ATOM   1354 C  CA    . GLY A 1 171 ? -19.830 15.203 -0.406  1.00 33.17 ? 2233 GLY A CA    1 
ATOM   1355 C  C     . GLY A 1 171 ? -18.705 14.891 -1.377  1.00 33.00 ? 2233 GLY A C     1 
ATOM   1356 O  O     . GLY A 1 171 ? -17.620 15.432 -1.245  1.00 33.67 ? 2233 GLY A O     1 
ATOM   1357 N  N     . VAL A 1 172 ? -18.936 14.001 -2.342  1.00 32.03 ? 2234 VAL A N     1 
ATOM   1358 C  CA    . VAL A 1 172 ? -17.882 13.649 -3.302  1.00 30.14 ? 2234 VAL A CA    1 
ATOM   1359 C  C     . VAL A 1 172 ? -18.410 13.863 -4.723  1.00 29.45 ? 2234 VAL A C     1 
ATOM   1360 O  O     . VAL A 1 172 ? -19.507 13.411 -5.077  1.00 28.70 ? 2234 VAL A O     1 
ATOM   1361 C  CB    . VAL A 1 172 ? -17.456 12.135 -3.130  1.00 30.13 ? 2234 VAL A CB    1 
ATOM   1362 C  CG1   . VAL A 1 172 ? -16.365 11.702 -4.103  1.00 28.54 ? 2234 VAL A CG1   1 
ATOM   1363 C  CG2   . VAL A 1 172 ? -17.049 11.851 -1.695  1.00 32.94 ? 2234 VAL A CG2   1 
ATOM   1364 N  N     . TYR A 1 173 ? -17.603 14.484 -5.557  1.00 28.30 ? 2235 TYR A N     1 
ATOM   1365 C  CA    . TYR A 1 173 ? -17.996 14.683 -6.938  1.00 28.37 ? 2235 TYR A CA    1 
ATOM   1366 C  C     . TYR A 1 173 ? -17.938 13.355 -7.706  1.00 28.76 ? 2235 TYR A C     1 
ATOM   1367 O  O     . TYR A 1 173 ? -16.954 12.605 -7.600  1.00 28.50 ? 2235 TYR A O     1 
ATOM   1368 C  CB    . TYR A 1 173 ? -17.111 15.731 -7.606  1.00 28.51 ? 2235 TYR A CB    1 
ATOM   1369 C  CG    . TYR A 1 173 ? -17.503 17.151 -7.293  1.00 30.98 ? 2235 TYR A CG    1 
ATOM   1370 C  CD1   . TYR A 1 173 ? -16.546 18.081 -6.869  1.00 31.62 ? 2235 TYR A CD1   1 
ATOM   1371 C  CD2   . TYR A 1 173 ? -18.838 17.565 -7.393  1.00 32.43 ? 2235 TYR A CD2   1 
ATOM   1372 C  CE1   . TYR A 1 173 ? -16.916 19.400 -6.570  1.00 36.82 ? 2235 TYR A CE1   1 
ATOM   1373 C  CE2   . TYR A 1 173 ? -19.201 18.888 -7.098  1.00 34.79 ? 2235 TYR A CE2   1 
ATOM   1374 C  CZ    . TYR A 1 173 ? -18.237 19.782 -6.693  1.00 36.58 ? 2235 TYR A CZ    1 
ATOM   1375 O  OH    . TYR A 1 173 ? -18.594 21.085 -6.409  1.00 42.62 ? 2235 TYR A OH    1 
ATOM   1376 N  N     . ARG A 1 174 ? -19.011 13.057 -8.417  1.00 27.84 ? 2236 ARG A N     1 
ATOM   1377 C  CA    . ARG A 1 174 ? -19.113 11.867 -9.218  1.00 28.21 ? 2236 ARG A CA    1 
ATOM   1378 C  C     . ARG A 1 174 ? -19.880 12.280 -10.449 1.00 28.08 ? 2236 ARG A C     1 
ATOM   1379 O  O     . ARG A 1 174 ? -20.662 13.248 -10.412 1.00 28.14 ? 2236 ARG A O     1 
ATOM   1380 C  CB    . ARG A 1 174 ? -19.921 10.803 -8.512  1.00 26.72 ? 2236 ARG A CB    1 
ATOM   1381 C  CG    . ARG A 1 174 ? -19.269 10.183 -7.290  1.00 28.82 ? 2236 ARG A CG    1 
ATOM   1382 C  CD    . ARG A 1 174 ? -19.642 8.725  -7.390  1.00 29.54 ? 2236 ARG A CD    1 
ATOM   1383 N  NE    . ARG A 1 174 ? -20.179 8.311  -6.183  1.00 29.95 ? 2236 ARG A NE    1 
ATOM   1384 C  CZ    . ARG A 1 174 ? -20.850 7.205  -5.953  1.00 29.67 ? 2236 ARG A CZ    1 
ATOM   1385 N  NH1   . ARG A 1 174 ? -21.094 6.310  -6.830  1.00 29.91 ? 2236 ARG A NH1   1 
ATOM   1386 N  NH2   . ARG A 1 174 ? -21.264 7.004  -4.768  1.00 29.47 ? 2236 ARG A NH2   1 
ATOM   1387 N  N     . ILE A 1 175 ? -19.697 11.521 -11.519 1.00 27.99 ? 2237 ILE A N     1 
ATOM   1388 C  CA    . ILE A 1 175 ? -20.234 11.901 -12.823 1.00 28.22 ? 2237 ILE A CA    1 
ATOM   1389 C  C     . ILE A 1 175 ? -21.212 10.907 -13.372 1.00 27.99 ? 2237 ILE A C     1 
ATOM   1390 O  O     . ILE A 1 175 ? -20.873 9.734  -13.506 1.00 29.34 ? 2237 ILE A O     1 
ATOM   1391 C  CB    . ILE A 1 175 ? -19.096 12.089 -13.850 1.00 26.90 ? 2237 ILE A CB    1 
ATOM   1392 C  CG1   . ILE A 1 175 ? -18.314 13.345 -13.462 1.00 30.35 ? 2237 ILE A CG1   1 
ATOM   1393 C  CG2   . ILE A 1 175 ? -19.686 12.236 -15.260 1.00 27.85 ? 2237 ILE A CG2   1 
ATOM   1394 C  CD1   . ILE A 1 175 ? -17.171 13.663 -14.354 1.00 35.29 ? 2237 ILE A CD1   1 
ATOM   1395 N  N     . GLY A 1 176 ? -22.400 11.382 -13.726 1.00 27.56 ? 2238 GLY A N     1 
ATOM   1396 C  CA    . GLY A 1 176 ? -23.442 10.539 -14.320 1.00 27.95 ? 2238 GLY A CA    1 
ATOM   1397 C  C     . GLY A 1 176 ? -23.765 10.987 -15.729 1.00 27.06 ? 2238 GLY A C     1 
ATOM   1398 O  O     . GLY A 1 176 ? -23.589 12.153 -16.041 1.00 27.03 ? 2238 GLY A O     1 
ATOM   1399 N  N     . LEU A 1 177 ? -24.165 10.044 -16.580 1.00 26.28 ? 2239 LEU A N     1 
ATOM   1400 C  CA    . LEU A 1 177 ? -24.617 10.333 -17.917 1.00 26.46 ? 2239 LEU A CA    1 
ATOM   1401 C  C     . LEU A 1 177 ? -26.141 10.404 -17.867 1.00 27.09 ? 2239 LEU A C     1 
ATOM   1402 O  O     . LEU A 1 177 ? -26.775 9.513  -17.319 1.00 26.17 ? 2239 LEU A O     1 
ATOM   1403 C  CB    . LEU A 1 177 ? -24.198 9.238  -18.865 1.00 26.14 ? 2239 LEU A CB    1 
ATOM   1404 C  CG    . LEU A 1 177 ? -24.587 9.454  -20.319 1.00 28.89 ? 2239 LEU A CG    1 
ATOM   1405 C  CD1   . LEU A 1 177 ? -23.538 10.325 -21.014 1.00 27.66 ? 2239 LEU A CD1   1 
ATOM   1406 C  CD2   . LEU A 1 177 ? -24.746 8.140  -21.060 1.00 28.35 ? 2239 LEU A CD2   1 
ATOM   1407 N  N     . TYR A 1 178 ? -26.703 11.476 -18.433 1.00 28.34 ? 2240 TYR A N     1 
ATOM   1408 C  CA    . TYR A 1 178 ? -28.167 11.755 -18.478 1.00 28.85 ? 2240 TYR A CA    1 
ATOM   1409 C  C     . TYR A 1 178 ? -28.590 11.987 -19.910 1.00 29.90 ? 2240 TYR A C     1 
ATOM   1410 O  O     . TYR A 1 178 ? -27.808 12.560 -20.708 1.00 29.17 ? 2240 TYR A O     1 
ATOM   1411 C  CB    . TYR A 1 178 ? -28.491 12.987 -17.642 1.00 28.15 ? 2240 TYR A CB    1 
ATOM   1412 C  CG    . TYR A 1 178 ? -28.157 12.767 -16.184 1.00 30.26 ? 2240 TYR A CG    1 
ATOM   1413 C  CD1   . TYR A 1 178 ? -26.830 12.786 -15.766 1.00 31.03 ? 2240 TYR A CD1   1 
ATOM   1414 C  CD2   . TYR A 1 178 ? -29.143 12.485 -15.228 1.00 31.63 ? 2240 TYR A CD2   1 
ATOM   1415 C  CE1   . TYR A 1 178 ? -26.474 12.567 -14.472 1.00 30.45 ? 2240 TYR A CE1   1 
ATOM   1416 C  CE2   . TYR A 1 178 ? -28.776 12.271 -13.880 1.00 30.99 ? 2240 TYR A CE2   1 
ATOM   1417 C  CZ    . TYR A 1 178 ? -27.414 12.303 -13.540 1.00 32.68 ? 2240 TYR A CZ    1 
ATOM   1418 O  OH    . TYR A 1 178 ? -26.933 12.068 -12.241 1.00 35.13 ? 2240 TYR A OH    1 
ATOM   1419 N  N     . ALA A 1 179 ? -29.794 11.515 -20.269 1.00 30.82 ? 2241 ALA A N     1 
ATOM   1420 C  CA    . ALA A 1 179 ? -30.313 11.758 -21.622 1.00 33.37 ? 2241 ALA A CA    1 
ATOM   1421 C  C     . ALA A 1 179 ? -30.585 13.248 -21.809 1.00 34.64 ? 2241 ALA A C     1 
ATOM   1422 O  O     . ALA A 1 179 ? -31.059 13.918 -20.889 1.00 35.15 ? 2241 ALA A O     1 
ATOM   1423 C  CB    . ALA A 1 179 ? -31.594 10.976 -21.873 1.00 32.93 ? 2241 ALA A CB    1 
ATOM   1424 N  N     . LEU A 1 180 ? -30.262 13.747 -22.996 1.00 36.86 ? 2242 LEU A N     1 
ATOM   1425 C  CA    . LEU A 1 180 ? -30.558 15.120 -23.371 1.00 38.89 ? 2242 LEU A CA    1 
ATOM   1426 C  C     . LEU A 1 180 ? -31.927 15.195 -24.033 1.00 40.54 ? 2242 LEU A C     1 
ATOM   1427 O  O     . LEU A 1 180 ? -32.568 16.244 -23.987 1.00 41.57 ? 2242 LEU A O     1 
ATOM   1428 C  CB    . LEU A 1 180 ? -29.494 15.644 -24.357 1.00 38.81 ? 2242 LEU A CB    1 
ATOM   1429 C  CG    . LEU A 1 180 ? -28.242 16.249 -23.714 1.00 38.42 ? 2242 LEU A CG    1 
ATOM   1430 C  CD1   . LEU A 1 180 ? -27.288 16.749 -24.786 1.00 36.14 ? 2242 LEU A CD1   1 
ATOM   1431 C  CD2   . LEU A 1 180 ? -28.600 17.397 -22.706 1.00 38.89 ? 2242 LEU A CD2   1 
ATOM   1432 N  N     . LYS A 1 181 ? -32.353 14.095 -24.661 1.00 41.19 ? 2243 LYS A N     1 
ATOM   1433 C  CA    . LYS A 1 181 ? -33.602 14.065 -25.445 1.00 43.10 ? 2243 LYS A CA    1 
ATOM   1434 C  C     . LYS A 1 181 ? -34.176 12.655 -25.465 1.00 43.12 ? 2243 LYS A C     1 
ATOM   1435 O  O     . LYS A 1 181 ? -33.475 11.730 -25.094 1.00 43.71 ? 2243 LYS A O     1 
ATOM   1436 C  CB    . LYS A 1 181 ? -33.352 14.558 -26.871 1.00 43.37 ? 2243 LYS A CB    1 
ATOM   1437 C  CG    . LYS A 1 181 ? -32.334 13.745 -27.640 1.00 44.93 ? 2243 LYS A CG    1 
ATOM   1438 C  CD    . LYS A 1 181 ? -32.174 14.225 -29.063 1.00 46.06 ? 2243 LYS A CD    1 
ATOM   1439 C  CE    . LYS A 1 181 ? -31.178 15.354 -29.163 1.00 49.36 ? 2243 LYS A CE    1 
ATOM   1440 N  NZ    . LYS A 1 181 ? -30.546 15.367 -30.519 1.00 49.94 ? 2243 LYS A NZ    1 
ATOM   1441 N  N     . ASP A 1 182 ? -35.440 12.479 -25.857 1.00 43.23 ? 2244 ASP A N     1 
ATOM   1442 C  CA    . ASP A 1 182 ? -35.994 11.122 -25.981 1.00 43.73 ? 2244 ASP A CA    1 
ATOM   1443 C  C     . ASP A 1 182 ? -35.236 10.375 -27.036 1.00 42.63 ? 2244 ASP A C     1 
ATOM   1444 O  O     . ASP A 1 182 ? -34.775 10.975 -27.994 1.00 42.69 ? 2244 ASP A O     1 
ATOM   1445 C  CB    . ASP A 1 182 ? -37.473 11.119 -26.375 1.00 44.67 ? 2244 ASP A CB    1 
ATOM   1446 C  CG    . ASP A 1 182 ? -38.347 11.712 -25.327 1.00 46.99 ? 2244 ASP A CG    1 
ATOM   1447 O  OD1   . ASP A 1 182 ? -37.879 12.418 -24.443 1.00 50.28 ? 2244 ASP A OD1   1 
ATOM   1448 O  OD2   . ASP A 1 182 ? -39.552 11.494 -25.372 1.00 51.79 ? 2244 ASP A OD2   1 
ATOM   1449 N  N     . MET A 1 183 ? -35.103 9.066  -26.871 1.00 42.55 ? 2245 MET A N     1 
ATOM   1450 C  CA    . MET A 1 183 ? -34.390 8.259  -27.853 1.00 42.02 ? 2245 MET A CA    1 
ATOM   1451 C  C     . MET A 1 183 ? -35.133 6.951  -27.982 1.00 42.56 ? 2245 MET A C     1 
ATOM   1452 O  O     . MET A 1 183 ? -35.427 6.318  -26.976 1.00 43.55 ? 2245 MET A O     1 
ATOM   1453 C  CB    . MET A 1 183 ? -32.962 7.928  -27.360 1.00 42.54 ? 2245 MET A CB    1 
ATOM   1454 C  CG    . MET A 1 183 ? -31.979 9.091  -27.148 1.00 40.05 ? 2245 MET A CG    1 
ATOM   1455 S  SD    . MET A 1 183 ? -30.418 8.607  -26.312 1.00 40.63 ? 2245 MET A SD    1 
ATOM   1456 C  CE    . MET A 1 183 ? -30.743 9.281  -24.661 1.00 33.30 ? 2245 MET A CE    1 
ATOM   1457 N  N     . PRO A 1 184 ? -35.432 6.517  -29.209 1.00 42.70 ? 2246 PRO A N     1 
ATOM   1458 C  CA    . PRO A 1 184 ? -36.076 5.228  -29.326 1.00 42.28 ? 2246 PRO A CA    1 
ATOM   1459 C  C     . PRO A 1 184 ? -35.103 4.071  -29.199 1.00 43.00 ? 2246 PRO A C     1 
ATOM   1460 O  O     . PRO A 1 184 ? -33.871 4.255  -29.234 1.00 42.52 ? 2246 PRO A O     1 
ATOM   1461 C  CB    . PRO A 1 184 ? -36.637 5.258  -30.745 1.00 42.81 ? 2246 PRO A CB    1 
ATOM   1462 C  CG    . PRO A 1 184 ? -35.710 6.165  -31.488 1.00 42.88 ? 2246 PRO A CG    1 
ATOM   1463 C  CD    . PRO A 1 184 ? -35.368 7.228  -30.500 1.00 42.95 ? 2246 PRO A CD    1 
ATOM   1464 N  N     . ALA A 1 185 ? -35.667 2.875  -29.072 1.00 42.79 ? 2247 ALA A N     1 
ATOM   1465 C  CA    . ALA A 1 185 ? -34.925 1.624  -29.149 1.00 42.92 ? 2247 ALA A CA    1 
ATOM   1466 C  C     . ALA A 1 185 ? -33.966 1.572  -30.329 1.00 42.87 ? 2247 ALA A C     1 
ATOM   1467 O  O     . ALA A 1 185 ? -34.345 1.908  -31.444 1.00 43.12 ? 2247 ALA A O     1 
ATOM   1468 C  CB    . ALA A 1 185 ? -35.907 0.457  -29.245 1.00 43.08 ? 2247 ALA A CB    1 
ATOM   1469 N  N     . GLY A 1 186 ? -32.724 1.129  -30.074 1.00 42.05 ? 2248 GLY A N     1 
ATOM   1470 C  CA    . GLY A 1 186 ? -31.713 1.004  -31.126 1.00 40.50 ? 2248 GLY A CA    1 
ATOM   1471 C  C     . GLY A 1 186 ? -30.807 2.220  -31.303 1.00 40.08 ? 2248 GLY A C     1 
ATOM   1472 O  O     . GLY A 1 186 ? -29.846 2.163  -32.073 1.00 40.40 ? 2248 GLY A O     1 
ATOM   1473 N  N     . THR A 1 187 ? -31.126 3.321  -30.620 1.00 38.29 ? 2249 THR A N     1 
ATOM   1474 C  CA    . THR A 1 187 ? -30.329 4.555  -30.679 1.00 37.82 ? 2249 THR A CA    1 
ATOM   1475 C  C     . THR A 1 187 ? -28.914 4.422  -30.036 1.00 36.06 ? 2249 THR A C     1 
ATOM   1476 O  O     . THR A 1 187 ? -28.789 3.999  -28.880 1.00 34.90 ? 2249 THR A O     1 
ATOM   1477 C  CB    . THR A 1 187 ? -31.091 5.719  -29.994 1.00 37.52 ? 2249 THR A CB    1 
ATOM   1478 O  OG1   . THR A 1 187 ? -32.352 5.903  -30.644 1.00 41.10 ? 2249 THR A OG1   1 
ATOM   1479 C  CG2   . THR A 1 187 ? -30.316 7.028  -30.092 1.00 40.33 ? 2249 THR A CG2   1 
ATOM   1480 N  N     . GLU A 1 188 ? -27.868 4.801  -30.779 1.00 35.40 ? 2250 GLU A N     1 
ATOM   1481 C  CA    . GLU A 1 188 ? -26.510 4.906  -30.208 1.00 34.51 ? 2250 GLU A CA    1 
ATOM   1482 C  C     . GLU A 1 188 ? -26.419 6.120  -29.254 1.00 33.61 ? 2250 GLU A C     1 
ATOM   1483 O  O     . GLU A 1 188 ? -26.807 7.229  -29.623 1.00 33.83 ? 2250 GLU A O     1 
ATOM   1484 C  CB    . GLU A 1 188 ? -25.428 5.015  -31.295 1.00 34.94 ? 2250 GLU A CB    1 
ATOM   1485 C  CG    . GLU A 1 188 ? -24.023 5.300  -30.684 1.00 35.74 ? 2250 GLU A CG    1 
ATOM   1486 C  CD    . GLU A 1 188 ? -22.910 5.473  -31.684 1.00 36.86 ? 2250 GLU A CD    1 
ATOM   1487 O  OE1   . GLU A 1 188 ? -23.187 5.928  -32.811 1.00 40.50 ? 2250 GLU A OE1   1 
ATOM   1488 O  OE2   . GLU A 1 188 ? -21.732 5.186  -31.322 1.00 38.69 ? 2250 GLU A OE2   1 
ATOM   1489 N  N     . LEU A 1 189 ? -25.916 5.890  -28.038 1.00 31.86 ? 2251 LEU A N     1 
ATOM   1490 C  CA    . LEU A 1 189 ? -25.679 6.952  -27.065 1.00 29.95 ? 2251 LEU A CA    1 
ATOM   1491 C  C     . LEU A 1 189 ? -24.426 7.742  -27.461 1.00 28.74 ? 2251 LEU A C     1 
ATOM   1492 O  O     . LEU A 1 189 ? -23.447 7.162  -27.915 1.00 27.67 ? 2251 LEU A O     1 
ATOM   1493 C  CB    . LEU A 1 189 ? -25.484 6.346  -25.681 1.00 29.54 ? 2251 LEU A CB    1 
ATOM   1494 C  CG    . LEU A 1 189 ? -26.663 5.575  -25.106 1.00 31.84 ? 2251 LEU A CG    1 
ATOM   1495 C  CD1   . LEU A 1 189 ? -26.458 5.268  -23.629 1.00 29.08 ? 2251 LEU A CD1   1 
ATOM   1496 C  CD2   . LEU A 1 189 ? -27.976 6.329  -25.353 1.00 31.79 ? 2251 LEU A CD2   1 
ATOM   1497 N  N     . THR A 1 190 ? -24.473 9.056  -27.275 1.00 27.33 ? 2252 THR A N     1 
ATOM   1498 C  CA    . THR A 1 190 ? -23.342 9.934  -27.587 1.00 28.22 ? 2252 THR A CA    1 
ATOM   1499 C  C     . THR A 1 190 ? -23.382 11.122 -26.654 1.00 28.68 ? 2252 THR A C     1 
ATOM   1500 O  O     . THR A 1 190 ? -24.455 11.501 -26.152 1.00 28.75 ? 2252 THR A O     1 
ATOM   1501 C  CB    . THR A 1 190 ? -23.419 10.507 -29.013 1.00 28.30 ? 2252 THR A CB    1 
ATOM   1502 O  OG1   . THR A 1 190 ? -24.568 11.363 -29.075 1.00 28.65 ? 2252 THR A OG1   1 
ATOM   1503 C  CG2   . THR A 1 190 ? -23.579 9.434  -30.068 1.00 25.53 ? 2252 THR A CG2   1 
ATOM   1504 N  N     . TYR A 1 191 ? -22.202 11.697 -26.413 1.00 28.75 ? 2253 TYR A N     1 
ATOM   1505 C  CA    . TYR A 1 191 ? -22.053 12.939 -25.687 1.00 27.98 ? 2253 TYR A CA    1 
ATOM   1506 C  C     . TYR A 1 191 ? -20.933 13.737 -26.351 1.00 29.14 ? 2253 TYR A C     1 
ATOM   1507 O  O     . TYR A 1 191 ? -20.157 13.216 -27.173 1.00 28.10 ? 2253 TYR A O     1 
ATOM   1508 C  CB    . TYR A 1 191 ? -21.790 12.733 -24.183 1.00 28.64 ? 2253 TYR A CB    1 
ATOM   1509 C  CG    . TYR A 1 191 ? -20.493 12.029 -23.790 1.00 26.51 ? 2253 TYR A CG    1 
ATOM   1510 C  CD1   . TYR A 1 191 ? -19.384 12.748 -23.317 1.00 25.79 ? 2253 TYR A CD1   1 
ATOM   1511 C  CD2   . TYR A 1 191 ? -20.397 10.632 -23.859 1.00 26.35 ? 2253 TYR A CD2   1 
ATOM   1512 C  CE1   . TYR A 1 191 ? -18.197 12.075 -22.928 1.00 26.18 ? 2253 TYR A CE1   1 
ATOM   1513 C  CE2   . TYR A 1 191 ? -19.226 9.948  -23.475 1.00 24.59 ? 2253 TYR A CE2   1 
ATOM   1514 C  CZ    . TYR A 1 191 ? -18.141 10.669 -22.999 1.00 25.61 ? 2253 TYR A CZ    1 
ATOM   1515 O  OH    . TYR A 1 191 ? -17.017 9.968  -22.626 1.00 26.10 ? 2253 TYR A OH    1 
ATOM   1516 N  N     . ASP A 1 192 ? -20.870 15.007 -26.010 1.00 28.93 ? 2254 ASP A N     1 
ATOM   1517 C  CA    . ASP A 1 192 ? -19.897 15.880 -26.601 1.00 31.38 ? 2254 ASP A CA    1 
ATOM   1518 C  C     . ASP A 1 192 ? -18.671 15.855 -25.702 1.00 32.66 ? 2254 ASP A C     1 
ATOM   1519 O  O     . ASP A 1 192 ? -18.726 16.337 -24.563 1.00 33.61 ? 2254 ASP A O     1 
ATOM   1520 C  CB    . ASP A 1 192 ? -20.502 17.293 -26.659 1.00 30.97 ? 2254 ASP A CB    1 
ATOM   1521 C  CG    . ASP A 1 192 ? -19.653 18.290 -27.452 1.00 33.17 ? 2254 ASP A CG    1 
ATOM   1522 O  OD1   . ASP A 1 192 ? -18.415 18.137 -27.597 1.00 31.80 ? 2254 ASP A OD1   1 
ATOM   1523 O  OD2   . ASP A 1 192 ? -20.251 19.285 -27.913 1.00 37.43 ? 2254 ASP A OD2   1 
ATOM   1524 N  N     . TYR A 1 193 ? -17.582 15.291 -26.226 1.00 34.67 ? 2255 TYR A N     1 
ATOM   1525 C  CA    . TYR A 1 193 ? -16.301 15.128 -25.522 1.00 36.13 ? 2255 TYR A CA    1 
ATOM   1526 C  C     . TYR A 1 193 ? -15.611 16.449 -25.272 1.00 38.32 ? 2255 TYR A C     1 
ATOM   1527 O  O     . TYR A 1 193 ? -14.854 16.576 -24.308 1.00 37.82 ? 2255 TYR A O     1 
ATOM   1528 C  CB    . TYR A 1 193 ? -15.327 14.301 -26.380 1.00 35.39 ? 2255 TYR A CB    1 
ATOM   1529 C  CG    . TYR A 1 193 ? -15.509 12.807 -26.391 1.00 34.09 ? 2255 TYR A CG    1 
ATOM   1530 C  CD1   . TYR A 1 193 ? -14.448 11.978 -26.732 1.00 33.81 ? 2255 TYR A CD1   1 
ATOM   1531 C  CD2   . TYR A 1 193 ? -16.734 12.216 -26.070 1.00 32.76 ? 2255 TYR A CD2   1 
ATOM   1532 C  CE1   . TYR A 1 193 ? -14.591 10.598 -26.768 1.00 35.37 ? 2255 TYR A CE1   1 
ATOM   1533 C  CE2   . TYR A 1 193 ? -16.893 10.826 -26.106 1.00 33.39 ? 2255 TYR A CE2   1 
ATOM   1534 C  CZ    . TYR A 1 193 ? -15.806 10.017 -26.468 1.00 34.90 ? 2255 TYR A CZ    1 
ATOM   1535 O  OH    . TYR A 1 193 ? -15.927 8.628  -26.499 1.00 36.18 ? 2255 TYR A OH    1 
ATOM   1536 N  N     . ASN A 1 194 ? -15.817 17.422 -26.162 1.00 41.43 ? 2256 ASN A N     1 
ATOM   1537 C  CA    . ASN A 1 194 ? -15.088 18.696 -26.071 1.00 44.86 ? 2256 ASN A CA    1 
ATOM   1538 C  C     . ASN A 1 194 ? -15.427 19.404 -24.775 1.00 47.03 ? 2256 ASN A C     1 
ATOM   1539 O  O     . ASN A 1 194 ? -14.624 20.131 -24.193 1.00 47.32 ? 2256 ASN A O     1 
ATOM   1540 C  CB    . ASN A 1 194 ? -15.309 19.591 -27.313 1.00 45.10 ? 2256 ASN A CB    1 
ATOM   1541 C  CG    . ASN A 1 194 ? -14.639 19.019 -28.620 1.00 46.98 ? 2256 ASN A CG    1 
ATOM   1542 O  OD1   . ASN A 1 194 ? -14.099 17.908 -28.649 1.00 50.36 ? 2256 ASN A OD1   1 
ATOM   1543 N  ND2   . ASN A 1 194 ? -14.665 19.815 -29.683 1.00 49.27 ? 2256 ASN A ND2   1 
ATOM   1544 N  N     . PHE A 1 195 ? -16.607 19.127 -24.268 1.00 51.53 ? 2257 PHE A N     1 
ATOM   1545 C  CA    . PHE A 1 195 ? -16.969 19.638 -22.965 1.00 55.51 ? 2257 PHE A CA    1 
ATOM   1546 C  C     . PHE A 1 195 ? -16.297 18.826 -21.830 1.00 56.53 ? 2257 PHE A C     1 
ATOM   1547 O  O     . PHE A 1 195 ? -15.541 19.342 -20.978 1.00 56.88 ? 2257 PHE A O     1 
ATOM   1548 C  CB    . PHE A 1 195 ? -18.489 19.569 -22.845 1.00 56.90 ? 2257 PHE A CB    1 
ATOM   1549 C  CG    . PHE A 1 195 ? -19.185 20.911 -22.892 1.00 63.25 ? 2257 PHE A CG    1 
ATOM   1550 C  CD1   . PHE A 1 195 ? -19.129 21.779 -21.790 1.00 66.93 ? 2257 PHE A CD1   1 
ATOM   1551 C  CD2   . PHE A 1 195 ? -19.952 21.277 -24.011 1.00 68.91 ? 2257 PHE A CD2   1 
ATOM   1552 C  CE1   . PHE A 1 195 ? -19.795 23.007 -21.804 1.00 70.53 ? 2257 PHE A CE1   1 
ATOM   1553 C  CE2   . PHE A 1 195 ? -20.627 22.508 -24.046 1.00 71.37 ? 2257 PHE A CE2   1 
ATOM   1554 C  CZ    . PHE A 1 195 ? -20.550 23.377 -22.935 1.00 72.45 ? 2257 PHE A CZ    1 
ATOM   1555 N  N     . HIS A 1 196 ? -16.546 17.528 -21.851 1.00 57.91 ? 2258 HIS A N     1 
ATOM   1556 C  CA    . HIS A 1 196 ? -16.313 16.707 -20.672 1.00 58.68 ? 2258 HIS A CA    1 
ATOM   1557 C  C     . HIS A 1 196 ? -15.012 15.902 -20.686 1.00 58.86 ? 2258 HIS A C     1 
ATOM   1558 O  O     . HIS A 1 196 ? -14.465 15.632 -19.623 1.00 59.44 ? 2258 HIS A O     1 
ATOM   1559 C  CB    . HIS A 1 196 ? -17.538 15.819 -20.441 1.00 58.50 ? 2258 HIS A CB    1 
ATOM   1560 C  CG    . HIS A 1 196 ? -18.832 16.573 -20.448 1.00 58.98 ? 2258 HIS A CG    1 
ATOM   1561 N  ND1   . HIS A 1 196 ? -19.691 16.572 -21.529 1.00 61.92 ? 2258 HIS A ND1   1 
ATOM   1562 C  CD2   . HIS A 1 196 ? -19.408 17.366 -19.511 1.00 59.24 ? 2258 HIS A CD2   1 
ATOM   1563 C  CE1   . HIS A 1 196 ? -20.745 17.321 -21.252 1.00 62.24 ? 2258 HIS A CE1   1 
ATOM   1564 N  NE2   . HIS A 1 196 ? -20.597 17.818 -20.035 1.00 59.68 ? 2258 HIS A NE2   1 
ATOM   1565 N  N     . SER A 1 197 ? -14.522 15.540 -21.877 1.00 59.20 ? 2259 SER A N     1 
ATOM   1566 C  CA    . SER A 1 197 ? -13.311 14.719 -22.037 1.00 60.25 ? 2259 SER A CA    1 
ATOM   1567 C  C     . SER A 1 197 ? -12.022 15.506 -21.767 1.00 60.96 ? 2259 SER A C     1 
ATOM   1568 O  O     . SER A 1 197 ? -11.923 16.683 -22.113 1.00 61.26 ? 2259 SER A O     1 
ATOM   1569 C  CB    . SER A 1 197 ? -13.278 14.080 -23.433 1.00 59.96 ? 2259 SER A CB    1 
ATOM   1570 O  OG    . SER A 1 197 ? -12.061 13.395 -23.689 1.00 61.02 ? 2259 SER A OG    1 
ATOM   1571 N  N     . PHE A 1 198 ? -11.037 14.856 -21.149 1.00 61.80 ? 2260 PHE A N     1 
ATOM   1572 C  CA    . PHE A 1 198 ? -9.783  15.526 -20.799 1.00 62.96 ? 2260 PHE A CA    1 
ATOM   1573 C  C     . PHE A 1 198 ? -8.952  15.795 -22.044 1.00 64.48 ? 2260 PHE A C     1 
ATOM   1574 O  O     . PHE A 1 198 ? -8.766  14.901 -22.874 1.00 64.29 ? 2260 PHE A O     1 
ATOM   1575 C  CB    . PHE A 1 198 ? -8.961  14.715 -19.790 1.00 62.43 ? 2260 PHE A CB    1 
ATOM   1576 C  CG    . PHE A 1 198 ? -7.673  15.388 -19.381 1.00 61.56 ? 2260 PHE A CG    1 
ATOM   1577 C  CD1   . PHE A 1 198 ? -7.688  16.514 -18.567 1.00 60.82 ? 2260 PHE A CD1   1 
ATOM   1578 C  CD2   . PHE A 1 198 ? -6.447  14.908 -19.828 1.00 61.85 ? 2260 PHE A CD2   1 
ATOM   1579 C  CE1   . PHE A 1 198 ? -6.497  17.149 -18.196 1.00 61.93 ? 2260 PHE A CE1   1 
ATOM   1580 C  CE2   . PHE A 1 198 ? -5.242  15.532 -19.456 1.00 61.00 ? 2260 PHE A CE2   1 
ATOM   1581 C  CZ    . PHE A 1 198 ? -5.269  16.649 -18.631 1.00 60.55 ? 2260 PHE A CZ    1 
ATOM   1582 N  N     . ASN A 1 199 ? -8.469  17.028 -22.180 1.00 65.94 ? 2261 ASN A N     1 
ATOM   1583 C  CA    . ASN A 1 199 ? -7.664  17.387 -23.343 1.00 67.94 ? 2261 ASN A CA    1 
ATOM   1584 C  C     . ASN A 1 199 ? -6.238  16.788 -23.348 1.00 68.54 ? 2261 ASN A C     1 
ATOM   1585 O  O     . ASN A 1 199 ? -5.318  17.275 -22.662 1.00 68.38 ? 2261 ASN A O     1 
ATOM   1586 C  CB    . ASN A 1 199 ? -7.628  18.901 -23.555 1.00 68.11 ? 2261 ASN A CB    1 
ATOM   1587 C  CG    . ASN A 1 199 ? -6.492  19.321 -24.476 1.00 69.97 ? 2261 ASN A CG    1 
ATOM   1588 O  OD1   . ASN A 1 199 ? -6.517  19.064 -25.694 1.00 69.20 ? 2261 ASN A OD1   1 
ATOM   1589 N  ND2   . ASN A 1 199 ? -5.462  19.938 -23.888 1.00 71.53 ? 2261 ASN A ND2   1 
ATOM   1590 N  N     . VAL A 1 200 ? -6.072  15.748 -24.159 1.00 69.07 ? 2262 VAL A N     1 
ATOM   1591 C  CA    . VAL A 1 200 ? -4.830  14.976 -24.223 1.00 69.83 ? 2262 VAL A CA    1 
ATOM   1592 C  C     . VAL A 1 200 ? -3.803  15.539 -25.227 1.00 69.67 ? 2262 VAL A C     1 
ATOM   1593 O  O     . VAL A 1 200 ? -2.619  15.180 -25.188 1.00 69.60 ? 2262 VAL A O     1 
ATOM   1594 C  CB    . VAL A 1 200 ? -5.137  13.516 -24.588 1.00 69.79 ? 2262 VAL A CB    1 
ATOM   1595 C  CG1   . VAL A 1 200 ? -3.858  12.716 -24.700 1.00 70.64 ? 2262 VAL A CG1   1 
ATOM   1596 C  CG2   . VAL A 1 200 ? -6.082  12.906 -23.559 1.00 71.09 ? 2262 VAL A CG2   1 
ATOM   1597 N  N     . GLU A 1 201 ? -4.255  16.408 -26.127 1.00 69.01 ? 2263 GLU A N     1 
ATOM   1598 C  CA    . GLU A 1 201 ? -3.353  17.031 -27.096 1.00 68.48 ? 2263 GLU A CA    1 
ATOM   1599 C  C     . GLU A 1 201 ? -3.179  16.199 -28.378 1.00 67.01 ? 2263 GLU A C     1 
ATOM   1600 O  O     . GLU A 1 201 ? -2.362  16.539 -29.236 1.00 67.46 ? 2263 GLU A O     1 
ATOM   1601 C  CB    . GLU A 1 201 ? -1.979  17.337 -26.459 1.00 68.74 ? 2263 GLU A CB    1 
ATOM   1602 C  CG    . GLU A 1 201 ? -2.019  18.218 -25.209 1.00 70.06 ? 2263 GLU A CG    1 
ATOM   1603 C  CD    . GLU A 1 201 ? -2.205  19.697 -25.527 1.00 73.70 ? 2263 GLU A CD    1 
ATOM   1604 O  OE1   . GLU A 1 201 ? -1.390  20.516 -25.032 1.00 73.14 ? 2263 GLU A OE1   1 
ATOM   1605 O  OE2   . GLU A 1 201 ? -3.159  20.044 -26.271 1.00 73.83 ? 2263 GLU A OE2   1 
ATOM   1606 N  N     . LYS A 1 202 ? -3.944  15.121 -28.504 1.00 64.81 ? 2264 LYS A N     1 
ATOM   1607 C  CA    . LYS A 1 202 ? -3.925  14.311 -29.723 1.00 62.87 ? 2264 LYS A CA    1 
ATOM   1608 C  C     . LYS A 1 202 ? -5.288  14.325 -30.421 1.00 60.90 ? 2264 LYS A C     1 
ATOM   1609 O  O     . LYS A 1 202 ? -6.231  13.654 -29.989 1.00 60.53 ? 2264 LYS A O     1 
ATOM   1610 C  CB    . LYS A 1 202 ? -3.527  12.873 -29.413 1.00 63.40 ? 2264 LYS A CB    1 
ATOM   1611 C  CG    . LYS A 1 202 ? -3.906  11.889 -30.522 1.00 64.68 ? 2264 LYS A CG    1 
ATOM   1612 C  CD    . LYS A 1 202 ? -2.723  11.502 -31.372 1.00 67.74 ? 2264 LYS A CD    1 
ATOM   1613 C  CE    . LYS A 1 202 ? -1.958  10.362 -30.719 1.00 68.98 ? 2264 LYS A CE    1 
ATOM   1614 N  NZ    . LYS A 1 202 ? -1.097  9.676  -31.715 1.00 70.06 ? 2264 LYS A NZ    1 
ATOM   1615 N  N     . GLN A 1 203 ? -5.387  15.074 -31.511 1.00 57.69 ? 2265 GLN A N     1 
ATOM   1616 C  CA    . GLN A 1 203 ? -6.664  15.262 -32.157 1.00 54.20 ? 2265 GLN A CA    1 
ATOM   1617 C  C     . GLN A 1 203 ? -7.018  14.131 -33.117 1.00 51.57 ? 2265 GLN A C     1 
ATOM   1618 O  O     . GLN A 1 203 ? -6.148  13.466 -33.648 1.00 50.43 ? 2265 GLN A O     1 
ATOM   1619 C  CB    . GLN A 1 203 ? -6.705  16.639 -32.781 1.00 54.10 ? 2265 GLN A CB    1 
ATOM   1620 C  CG    . GLN A 1 203 ? -6.432  17.694 -31.725 1.00 54.81 ? 2265 GLN A CG    1 
ATOM   1621 C  CD    . GLN A 1 203 ? -6.358  19.093 -32.281 1.00 58.09 ? 2265 GLN A CD    1 
ATOM   1622 O  OE1   . GLN A 1 203 ? -6.615  19.331 -33.468 1.00 60.27 ? 2265 GLN A OE1   1 
ATOM   1623 N  NE2   . GLN A 1 203 ? -6.009  20.041 -31.422 1.00 60.77 ? 2265 GLN A NE2   1 
ATOM   1624 N  N     . GLN A 1 204 ? -8.313  13.912 -33.295 1.00 50.45 ? 2266 GLN A N     1 
ATOM   1625 C  CA    . GLN A 1 204 ? -8.849  12.803 -34.071 1.00 48.37 ? 2266 GLN A CA    1 
ATOM   1626 C  C     . GLN A 1 204 ? -9.994  13.289 -34.940 1.00 47.98 ? 2266 GLN A C     1 
ATOM   1627 O  O     . GLN A 1 204 ? -10.786 14.152 -34.525 1.00 46.67 ? 2266 GLN A O     1 
ATOM   1628 C  CB    . GLN A 1 204 ? -9.389  11.716 -33.150 1.00 48.33 ? 2266 GLN A CB    1 
ATOM   1629 C  CG    . GLN A 1 204 ? -8.352  11.055 -32.245 1.00 47.51 ? 2266 GLN A CG    1 
ATOM   1630 C  CD    . GLN A 1 204 ? -8.915  9.886  -31.500 1.00 45.88 ? 2266 GLN A CD    1 
ATOM   1631 O  OE1   . GLN A 1 204 ? -8.688  8.733  -31.871 1.00 47.97 ? 2266 GLN A OE1   1 
ATOM   1632 N  NE2   . GLN A 1 204 ? -9.696  10.171 -30.462 1.00 39.16 ? 2266 GLN A NE2   1 
ATOM   1633 N  N     . LEU A 1 205 ? -10.093 12.718 -36.138 1.00 46.66 ? 2267 LEU A N     1 
ATOM   1634 C  CA    . LEU A 1 205 ? -11.156 13.051 -37.052 1.00 46.09 ? 2267 LEU A CA    1 
ATOM   1635 C  C     . LEU A 1 205 ? -12.496 12.640 -36.467 1.00 45.46 ? 2267 LEU A C     1 
ATOM   1636 O  O     . LEU A 1 205 ? -12.628 11.532 -35.917 1.00 45.53 ? 2267 LEU A O     1 
ATOM   1637 C  CB    . LEU A 1 205 ? -10.951 12.356 -38.399 1.00 46.12 ? 2267 LEU A CB    1 
ATOM   1638 C  CG    . LEU A 1 205 ? -9.875  12.944 -39.314 1.00 46.65 ? 2267 LEU A CG    1 
ATOM   1639 C  CD1   . LEU A 1 205 ? -9.749  12.059 -40.555 1.00 49.43 ? 2267 LEU A CD1   1 
ATOM   1640 C  CD2   . LEU A 1 205 ? -10.143 14.392 -39.697 1.00 43.30 ? 2267 LEU A CD2   1 
ATOM   1641 N  N     . CYS A 1 206 ? -13.476 13.531 -36.578 1.00 43.21 ? 2268 CYS A N     1 
ATOM   1642 C  CA    . CYS A 1 206 ? -14.808 13.217 -36.109 1.00 41.99 ? 2268 CYS A CA    1 
ATOM   1643 C  C     . CYS A 1 206 ? -15.655 12.617 -37.224 1.00 42.31 ? 2268 CYS A C     1 
ATOM   1644 O  O     . CYS A 1 206 ? -15.761 13.157 -38.314 1.00 42.02 ? 2268 CYS A O     1 
ATOM   1645 C  CB    . CYS A 1 206 ? -15.501 14.429 -35.484 1.00 41.66 ? 2268 CYS A CB    1 
ATOM   1646 S  SG    . CYS A 1 206 ? -17.146 14.002 -34.798 1.00 37.19 ? 2268 CYS A SG    1 
ATOM   1647 N  N     . LYS A 1 207 ? -16.255 11.477 -36.921 1.00 42.80 ? 2269 LYS A N     1 
ATOM   1648 C  CA    . LYS A 1 207 ? -17.088 10.744 -37.858 1.00 42.70 ? 2269 LYS A CA    1 
ATOM   1649 C  C     . LYS A 1 207 ? -18.525 10.682 -37.345 1.00 41.82 ? 2269 LYS A C     1 
ATOM   1650 O  O     . LYS A 1 207 ? -19.242 9.704  -37.609 1.00 42.18 ? 2269 LYS A O     1 
ATOM   1651 C  CB    . LYS A 1 207 ? -16.531 9.329  -38.037 1.00 42.56 ? 2269 LYS A CB    1 
ATOM   1652 C  CG    . LYS A 1 207 ? -15.101 9.293  -38.544 1.00 45.60 ? 2269 LYS A CG    1 
ATOM   1653 C  CD    . LYS A 1 207 ? -15.097 9.504  -40.037 1.00 51.08 ? 2269 LYS A CD    1 
ATOM   1654 C  CE    . LYS A 1 207 ? -13.721 9.354  -40.641 1.00 54.51 ? 2269 LYS A CE    1 
ATOM   1655 N  NZ    . LYS A 1 207 ? -12.991 10.649 -40.850 1.00 58.02 ? 2269 LYS A NZ    1 
ATOM   1656 N  N     . CYS A 1 208 ? -18.946 11.704 -36.596 1.00 41.27 ? 2270 CYS A N     1 
ATOM   1657 C  CA    . CYS A 1 208 ? -20.280 11.660 -35.944 1.00 40.52 ? 2270 CYS A CA    1 
ATOM   1658 C  C     . CYS A 1 208 ? -21.377 11.747 -37.001 1.00 41.22 ? 2270 CYS A C     1 
ATOM   1659 O  O     . CYS A 1 208 ? -22.496 11.292 -36.774 1.00 40.23 ? 2270 CYS A O     1 
ATOM   1660 C  CB    . CYS A 1 208 ? -20.454 12.740 -34.868 1.00 40.00 ? 2270 CYS A CB    1 
ATOM   1661 S  SG    . CYS A 1 208 ? -20.707 14.469 -35.484 1.00 34.87 ? 2270 CYS A SG    1 
ATOM   1662 N  N     . GLY A 1 209 ? -21.018 12.315 -38.154 1.00 42.30 ? 2271 GLY A N     1 
ATOM   1663 C  CA    . GLY A 1 209 ? -21.921 12.410 -39.310 1.00 43.96 ? 2271 GLY A CA    1 
ATOM   1664 C  C     . GLY A 1 209 ? -22.954 13.518 -39.252 1.00 44.54 ? 2271 GLY A C     1 
ATOM   1665 O  O     . GLY A 1 209 ? -23.868 13.538 -40.058 1.00 45.04 ? 2271 GLY A O     1 
ATOM   1666 N  N     . PHE A 1 210 ? -22.808 14.436 -38.300 1.00 44.69 ? 2272 PHE A N     1 
ATOM   1667 C  CA    . PHE A 1 210 ? -23.719 15.580 -38.147 1.00 45.61 ? 2272 PHE A CA    1 
ATOM   1668 C  C     . PHE A 1 210 ? -23.512 16.601 -39.280 1.00 46.92 ? 2272 PHE A C     1 
ATOM   1669 O  O     . PHE A 1 210 ? -22.364 16.852 -39.683 1.00 45.95 ? 2272 PHE A O     1 
ATOM   1670 C  CB    . PHE A 1 210 ? -23.492 16.250 -36.768 1.00 44.79 ? 2272 PHE A CB    1 
ATOM   1671 C  CG    . PHE A 1 210 ? -24.460 17.366 -36.437 1.00 43.66 ? 2272 PHE A CG    1 
ATOM   1672 C  CD1   . PHE A 1 210 ? -25.826 17.204 -36.612 1.00 42.09 ? 2272 PHE A CD1   1 
ATOM   1673 C  CD2   . PHE A 1 210 ? -23.996 18.569 -35.907 1.00 44.32 ? 2272 PHE A CD2   1 
ATOM   1674 C  CE1   . PHE A 1 210 ? -26.713 18.231 -36.294 1.00 42.83 ? 2272 PHE A CE1   1 
ATOM   1675 C  CE2   . PHE A 1 210 ? -24.871 19.599 -35.584 1.00 43.24 ? 2272 PHE A CE2   1 
ATOM   1676 C  CZ    . PHE A 1 210 ? -26.237 19.429 -35.782 1.00 43.93 ? 2272 PHE A CZ    1 
ATOM   1677 N  N     . GLU A 1 211 ? -24.615 17.195 -39.768 1.00 48.26 ? 2273 GLU A N     1 
ATOM   1678 C  CA    . GLU A 1 211 ? -24.553 18.270 -40.788 1.00 50.55 ? 2273 GLU A CA    1 
ATOM   1679 C  C     . GLU A 1 211 ? -23.562 19.365 -40.459 1.00 49.90 ? 2273 GLU A C     1 
ATOM   1680 O  O     . GLU A 1 211 ? -22.893 19.877 -41.341 1.00 50.03 ? 2273 GLU A O     1 
ATOM   1681 C  CB    . GLU A 1 211 ? -25.924 18.942 -40.967 1.00 52.05 ? 2273 GLU A CB    1 
ATOM   1682 C  CG    . GLU A 1 211 ? -26.563 18.782 -42.352 1.00 57.50 ? 2273 GLU A CG    1 
ATOM   1683 C  CD    . GLU A 1 211 ? -27.942 19.462 -42.453 1.00 64.70 ? 2273 GLU A CD    1 
ATOM   1684 O  OE1   . GLU A 1 211 ? -28.160 20.503 -41.780 1.00 67.13 ? 2273 GLU A OE1   1 
ATOM   1685 O  OE2   . GLU A 1 211 ? -28.807 18.950 -43.205 1.00 66.88 ? 2273 GLU A OE2   1 
ATOM   1686 N  N     . LYS A 1 212 ? -23.495 19.744 -39.187 1.00 50.00 ? 2274 LYS A N     1 
ATOM   1687 C  CA    . LYS A 1 212 ? -22.561 20.778 -38.747 1.00 49.90 ? 2274 LYS A CA    1 
ATOM   1688 C  C     . LYS A 1 212 ? -21.452 20.231 -37.832 1.00 49.27 ? 2274 LYS A C     1 
ATOM   1689 O  O     . LYS A 1 212 ? -21.029 20.891 -36.878 1.00 48.95 ? 2274 LYS A O     1 
ATOM   1690 C  CB    . LYS A 1 212 ? -23.337 21.904 -38.059 1.00 51.08 ? 2274 LYS A CB    1 
ATOM   1691 C  CG    . LYS A 1 212 ? -24.243 22.731 -39.005 1.00 52.99 ? 2274 LYS A CG    1 
ATOM   1692 C  CD    . LYS A 1 212 ? -24.986 23.822 -38.248 1.00 57.13 ? 2274 LYS A CD    1 
ATOM   1693 C  CE    . LYS A 1 212 ? -25.932 23.225 -37.201 1.00 60.27 ? 2274 LYS A CE    1 
ATOM   1694 N  NZ    . LYS A 1 212 ? -27.383 23.290 -37.492 1.00 63.81 ? 2274 LYS A NZ    1 
ATOM   1695 N  N     . CYS A 1 213 ? -20.999 19.015 -38.124 1.00 48.01 ? 2275 CYS A N     1 
ATOM   1696 C  CA    . CYS A 1 213 ? -19.938 18.380 -37.358 1.00 47.13 ? 2275 CYS A CA    1 
ATOM   1697 C  C     . CYS A 1 213 ? -18.722 19.306 -37.327 1.00 47.59 ? 2275 CYS A C     1 
ATOM   1698 O  O     . CYS A 1 213 ? -18.369 19.892 -38.352 1.00 48.10 ? 2275 CYS A O     1 
ATOM   1699 C  CB    . CYS A 1 213 ? -19.586 17.034 -37.997 1.00 46.20 ? 2275 CYS A CB    1 
ATOM   1700 S  SG    . CYS A 1 213 ? -18.024 16.297 -37.477 1.00 41.42 ? 2275 CYS A SG    1 
ATOM   1701 N  N     . ARG A 1 214 ? -18.097 19.447 -36.161 1.00 47.36 ? 2276 ARG A N     1 
ATOM   1702 C  CA    . ARG A 1 214 ? -16.920 20.314 -36.015 1.00 48.06 ? 2276 ARG A CA    1 
ATOM   1703 C  C     . ARG A 1 214 ? -15.691 19.742 -36.722 1.00 48.25 ? 2276 ARG A C     1 
ATOM   1704 O  O     . ARG A 1 214 ? -14.642 20.386 -36.763 1.00 48.25 ? 2276 ARG A O     1 
ATOM   1705 C  CB    . ARG A 1 214 ? -16.564 20.552 -34.545 1.00 48.45 ? 2276 ARG A CB    1 
ATOM   1706 C  CG    . ARG A 1 214 ? -17.689 20.985 -33.599 1.00 50.58 ? 2276 ARG A CG    1 
ATOM   1707 C  CD    . ARG A 1 214 ? -17.054 21.833 -32.463 1.00 55.36 ? 2276 ARG A CD    1 
ATOM   1708 N  NE    . ARG A 1 214 ? -17.564 21.716 -31.081 1.00 56.72 ? 2276 ARG A NE    1 
ATOM   1709 C  CZ    . ARG A 1 214 ? -18.521 20.906 -30.623 1.00 56.95 ? 2276 ARG A CZ    1 
ATOM   1710 N  NH1   . ARG A 1 214 ? -19.183 20.079 -31.416 1.00 59.52 ? 2276 ARG A NH1   1 
ATOM   1711 N  NH2   . ARG A 1 214 ? -18.831 20.948 -29.334 1.00 56.77 ? 2276 ARG A NH2   1 
ATOM   1712 N  N     . GLY A 1 215 ? -15.810 18.518 -37.235 1.00 47.57 ? 2277 GLY A N     1 
ATOM   1713 C  CA    . GLY A 1 215 ? -14.750 17.904 -38.010 1.00 48.43 ? 2277 GLY A CA    1 
ATOM   1714 C  C     . GLY A 1 215 ? -13.670 17.198 -37.216 1.00 48.68 ? 2277 GLY A C     1 
ATOM   1715 O  O     . GLY A 1 215 ? -13.061 16.255 -37.711 1.00 49.48 ? 2277 GLY A O     1 
ATOM   1716 N  N     . ILE A 1 216 ? -13.439 17.655 -35.989 1.00 48.44 ? 2278 ILE A N     1 
ATOM   1717 C  CA    . ILE A 1 216 ? -12.414 17.115 -35.104 1.00 49.16 ? 2278 ILE A CA    1 
ATOM   1718 C  C     . ILE A 1 216 ? -12.935 16.939 -33.661 1.00 48.98 ? 2278 ILE A C     1 
ATOM   1719 O  O     . ILE A 1 216 ? -13.680 17.780 -33.164 1.00 48.41 ? 2278 ILE A O     1 
ATOM   1720 C  CB    . ILE A 1 216 ? -11.198 18.059 -35.060 1.00 49.31 ? 2278 ILE A CB    1 
ATOM   1721 C  CG1   . ILE A 1 216 ? -10.445 18.017 -36.389 1.00 50.69 ? 2278 ILE A CG1   1 
ATOM   1722 C  CG2   . ILE A 1 216 ? -10.258 17.694 -33.909 1.00 50.77 ? 2278 ILE A CG2   1 
ATOM   1723 C  CD1   . ILE A 1 216 ? -10.175 19.404 -36.938 1.00 53.49 ? 2278 ILE A CD1   1 
ATOM   1724 N  N     . ILE A 1 217 ? -12.536 15.838 -33.019 1.00 49.38 ? 2279 ILE A N     1 
ATOM   1725 C  CA    . ILE A 1 217 ? -12.714 15.638 -31.572 1.00 49.62 ? 2279 ILE A CA    1 
ATOM   1726 C  C     . ILE A 1 217 ? -11.494 16.254 -30.827 1.00 50.83 ? 2279 ILE A C     1 
ATOM   1727 O  O     . ILE A 1 217 ? -10.337 15.963 -31.143 1.00 51.03 ? 2279 ILE A O     1 
ATOM   1728 C  CB    . ILE A 1 217 ? -12.813 14.139 -31.238 1.00 49.19 ? 2279 ILE A CB    1 
ATOM   1729 C  CG1   . ILE A 1 217 ? -13.601 13.394 -32.314 1.00 48.58 ? 2279 ILE A CG1   1 
ATOM   1730 C  CG2   . ILE A 1 217 ? -13.406 13.943 -29.867 1.00 48.24 ? 2279 ILE A CG2   1 
ATOM   1731 C  CD1   . ILE A 1 217 ? -13.493 11.873 -32.204 1.00 49.32 ? 2279 ILE A CD1   1 
ATOM   1732 N  N     . GLY A 1 218 ? -11.742 17.139 -29.869 1.00 51.93 ? 2280 GLY A N     1 
ATOM   1733 C  CA    . GLY A 1 218 ? -10.644 17.775 -29.114 1.00 52.65 ? 2280 GLY A CA    1 
ATOM   1734 C  C     . GLY A 1 218 ? -9.861  18.786 -29.937 1.00 53.49 ? 2280 GLY A C     1 
ATOM   1735 O  O     . GLY A 1 218 ? -10.430 19.487 -30.808 1.00 54.14 ? 2280 GLY A O     1 
ATOM   1736 N  N     . GLY B 1 5   ? -12.423 29.757 -16.454 1.00 45.42 ? 2067 GLY B N     1 
ATOM   1737 C  CA    . GLY B 1 5   ? -13.341 30.458 -15.496 1.00 44.51 ? 2067 GLY B CA    1 
ATOM   1738 C  C     . GLY B 1 5   ? -14.345 29.435 -15.006 1.00 43.74 ? 2067 GLY B C     1 
ATOM   1739 O  O     . GLY B 1 5   ? -15.341 29.147 -15.680 1.00 44.09 ? 2067 GLY B O     1 
ATOM   1740 N  N     . SER B 1 6   ? -14.064 28.849 -13.850 1.00 41.72 ? 2068 SER B N     1 
ATOM   1741 C  CA    . SER B 1 6   ? -14.885 27.755 -13.357 1.00 39.92 ? 2068 SER B CA    1 
ATOM   1742 C  C     . SER B 1 6   ? -15.983 28.263 -12.392 1.00 36.47 ? 2068 SER B C     1 
ATOM   1743 O  O     . SER B 1 6   ? -15.850 29.313 -11.796 1.00 37.44 ? 2068 SER B O     1 
ATOM   1744 C  CB    . SER B 1 6   ? -13.986 26.721 -12.672 1.00 40.27 ? 2068 SER B CB    1 
ATOM   1745 O  OG    . SER B 1 6   ? -14.791 25.726 -12.060 1.00 44.13 ? 2068 SER B OG    1 
ATOM   1746 N  N     . TYR B 1 7   ? -17.047 27.499 -12.219 1.00 32.90 ? 2069 TYR B N     1 
ATOM   1747 C  CA    . TYR B 1 7   ? -18.161 27.905 -11.356 1.00 30.96 ? 2069 TYR B CA    1 
ATOM   1748 C  C     . TYR B 1 7   ? -19.007 26.679 -11.064 1.00 29.93 ? 2069 TYR B C     1 
ATOM   1749 O  O     . TYR B 1 7   ? -18.901 25.706 -11.778 1.00 29.65 ? 2069 TYR B O     1 
ATOM   1750 C  CB    . TYR B 1 7   ? -19.013 28.969 -12.088 1.00 29.91 ? 2069 TYR B CB    1 
ATOM   1751 C  CG    . TYR B 1 7   ? -19.821 28.430 -13.217 1.00 27.96 ? 2069 TYR B CG    1 
ATOM   1752 C  CD1   . TYR B 1 7   ? -21.159 28.082 -13.039 1.00 27.46 ? 2069 TYR B CD1   1 
ATOM   1753 C  CD2   . TYR B 1 7   ? -19.260 28.254 -14.488 1.00 27.72 ? 2069 TYR B CD2   1 
ATOM   1754 C  CE1   . TYR B 1 7   ? -21.929 27.576 -14.100 1.00 26.43 ? 2069 TYR B CE1   1 
ATOM   1755 C  CE2   . TYR B 1 7   ? -20.007 27.733 -15.543 1.00 26.98 ? 2069 TYR B CE2   1 
ATOM   1756 C  CZ    . TYR B 1 7   ? -21.339 27.413 -15.344 1.00 29.94 ? 2069 TYR B CZ    1 
ATOM   1757 O  OH    . TYR B 1 7   ? -22.092 26.905 -16.395 1.00 31.78 ? 2069 TYR B OH    1 
ATOM   1758 N  N     . LYS B 1 8   ? -19.856 26.731 -10.034 1.00 29.97 ? 2070 LYS B N     1 
ATOM   1759 C  CA    . LYS B 1 8   ? -20.805 25.665 -9.772  1.00 29.44 ? 2070 LYS B CA    1 
ATOM   1760 C  C     . LYS B 1 8   ? -22.122 25.858 -10.494 1.00 30.79 ? 2070 LYS B C     1 
ATOM   1761 O  O     . LYS B 1 8   ? -22.811 26.893 -10.319 1.00 30.04 ? 2070 LYS B O     1 
ATOM   1762 C  CB    . LYS B 1 8   ? -21.081 25.547 -8.280  1.00 30.31 ? 2070 LYS B CB    1 
ATOM   1763 C  CG    . LYS B 1 8   ? -19.831 25.187 -7.463  1.00 31.46 ? 2070 LYS B CG    1 
ATOM   1764 C  CD    . LYS B 1 8   ? -19.857 25.905 -6.080  1.00 37.37 ? 2070 LYS B CD    1 
ATOM   1765 C  CE    . LYS B 1 8   ? -20.362 25.013 -4.963  1.00 40.19 ? 2070 LYS B CE    1 
ATOM   1766 N  NZ    . LYS B 1 8   ? -20.158 25.640 -3.584  1.00 45.24 ? 2070 LYS B NZ    1 
ATOM   1767 N  N     . LYS B 1 9   ? -22.475 24.843 -11.279 1.00 29.39 ? 2071 LYS B N     1 
ATOM   1768 C  CA    . LYS B 1 9   ? -23.663 24.840 -12.086 1.00 31.26 ? 2071 LYS B CA    1 
ATOM   1769 C  C     . LYS B 1 9   ? -24.903 24.652 -11.222 1.00 30.97 ? 2071 LYS B C     1 
ATOM   1770 O  O     . LYS B 1 9   ? -24.884 23.842 -10.303 1.00 32.18 ? 2071 LYS B O     1 
ATOM   1771 C  CB    . LYS B 1 9   ? -23.593 23.671 -13.051 1.00 30.52 ? 2071 LYS B CB    1 
ATOM   1772 C  CG    . LYS B 1 9   ? -24.068 24.003 -14.383 1.00 37.08 ? 2071 LYS B CG    1 
ATOM   1773 C  CD    . LYS B 1 9   ? -23.448 23.067 -15.443 1.00 46.70 ? 2071 LYS B CD    1 
ATOM   1774 C  CE    . LYS B 1 9   ? -22.988 23.907 -16.646 1.00 52.00 ? 2071 LYS B CE    1 
ATOM   1775 N  NZ    . LYS B 1 9   ? -22.203 23.116 -17.656 1.00 54.78 ? 2071 LYS B NZ    1 
ATOM   1776 N  N     . ILE B 1 10  ? -25.991 25.350 -11.551 1.00 29.85 ? 2072 ILE B N     1 
ATOM   1777 C  CA    . ILE B 1 10  ? -27.256 25.200 -10.812 1.00 29.22 ? 2072 ILE B CA    1 
ATOM   1778 C  C     . ILE B 1 10  ? -28.371 25.217 -11.860 1.00 30.54 ? 2072 ILE B C     1 
ATOM   1779 O  O     . ILE B 1 10  ? -28.193 25.805 -12.926 1.00 30.41 ? 2072 ILE B O     1 
ATOM   1780 C  CB    . ILE B 1 10  ? -27.495 26.353 -9.742  1.00 28.20 ? 2072 ILE B CB    1 
ATOM   1781 C  CG1   . ILE B 1 10  ? -27.631 27.743 -10.393 1.00 24.30 ? 2072 ILE B CG1   1 
ATOM   1782 C  CG2   . ILE B 1 10  ? -26.390 26.394 -8.647  1.00 27.17 ? 2072 ILE B CG2   1 
ATOM   1783 C  CD1   . ILE B 1 10  ? -27.717 28.935 -9.365  1.00 20.88 ? 2072 ILE B CD1   1 
ATOM   1784 N  N     . ARG B 1 11  ? -29.501 24.584 -11.538 1.00 31.12 ? 2073 ARG B N     1 
ATOM   1785 C  CA    . ARG B 1 11  ? -30.692 24.534 -12.404 1.00 32.54 ? 2073 ARG B CA    1 
ATOM   1786 C  C     . ARG B 1 11  ? -31.762 25.607 -12.106 1.00 30.93 ? 2073 ARG B C     1 
ATOM   1787 O  O     . ARG B 1 11  ? -32.664 25.827 -12.921 1.00 29.92 ? 2073 ARG B O     1 
ATOM   1788 C  CB    . ARG B 1 11  ? -31.366 23.148 -12.314 1.00 33.44 ? 2073 ARG B CB    1 
ATOM   1789 C  CG    . ARG B 1 11  ? -30.789 22.083 -13.265 1.00 40.41 ? 2073 ARG B CG    1 
ATOM   1790 C  CD    . ARG B 1 11  ? -31.833 21.046 -13.767 1.00 51.68 ? 2073 ARG B CD    1 
ATOM   1791 N  NE    . ARG B 1 11  ? -31.889 19.791 -12.993 1.00 59.60 ? 2073 ARG B NE    1 
ATOM   1792 C  CZ    . ARG B 1 11  ? -30.861 18.945 -12.866 1.00 62.25 ? 2073 ARG B CZ    1 
ATOM   1793 N  NH1   . ARG B 1 11  ? -29.733 19.256 -13.452 1.00 62.80 ? 2073 ARG B NH1   1 
ATOM   1794 N  NH2   . ARG B 1 11  ? -30.933 17.816 -12.163 1.00 62.70 ? 2073 ARG B NH2   1 
ATOM   1795 N  N     . SER B 1 12  ? -31.716 26.200 -10.913 1.00 29.77 ? 2074 SER B N     1 
ATOM   1796 C  CA    . SER B 1 12  ? -32.559 27.326 -10.580 1.00 29.16 ? 2074 SER B CA    1 
ATOM   1797 C  C     . SER B 1 12  ? -31.874 28.157 -9.516  1.00 27.74 ? 2074 SER B C     1 
ATOM   1798 O  O     . SER B 1 12  ? -30.838 27.756 -8.978  1.00 28.21 ? 2074 SER B O     1 
ATOM   1799 C  CB    . SER B 1 12  ? -34.001 26.905 -10.201 1.00 29.08 ? 2074 SER B CB    1 
ATOM   1800 O  OG    . SER B 1 12  ? -34.036 26.280 -8.930  1.00 33.80 ? 2074 SER B OG    1 
ATOM   1801 N  N     . ASN B 1 13  ? -32.398 29.347 -9.245  1.00 26.22 ? 2075 ASN B N     1 
ATOM   1802 C  CA    . ASN B 1 13  ? -31.686 30.268 -8.380  1.00 24.75 ? 2075 ASN B CA    1 
ATOM   1803 C  C     . ASN B 1 13  ? -31.561 29.719 -6.971  1.00 24.95 ? 2075 ASN B C     1 
ATOM   1804 O  O     . ASN B 1 13  ? -32.488 29.085 -6.480  1.00 24.98 ? 2075 ASN B O     1 
ATOM   1805 C  CB    . ASN B 1 13  ? -32.400 31.625 -8.328  1.00 24.13 ? 2075 ASN B CB    1 
ATOM   1806 C  CG    . ASN B 1 13  ? -32.217 32.457 -9.613  1.00 26.72 ? 2075 ASN B CG    1 
ATOM   1807 O  OD1   . ASN B 1 13  ? -31.245 32.255 -10.382 1.00 26.26 ? 2075 ASN B OD1   1 
ATOM   1808 N  ND2   . ASN B 1 13  ? -33.129 33.412 -9.845  1.00 21.70 ? 2075 ASN B ND2   1 
ATOM   1809 N  N     . VAL B 1 14  ? -30.450 30.047 -6.309  1.00 25.20 ? 2076 VAL B N     1 
ATOM   1810 C  CA    . VAL B 1 14  ? -30.250 29.779 -4.907  1.00 24.80 ? 2076 VAL B CA    1 
ATOM   1811 C  C     . VAL B 1 14  ? -30.539 31.058 -4.137  1.00 25.90 ? 2076 VAL B C     1 
ATOM   1812 O  O     . VAL B 1 14  ? -29.898 32.102 -4.371  1.00 24.34 ? 2076 VAL B O     1 
ATOM   1813 C  CB    . VAL B 1 14  ? -28.793 29.366 -4.646  1.00 25.47 ? 2076 VAL B CB    1 
ATOM   1814 C  CG1   . VAL B 1 14  ? -28.496 29.205 -3.079  1.00 24.20 ? 2076 VAL B CG1   1 
ATOM   1815 C  CG2   . VAL B 1 14  ? -28.521 28.053 -5.396  1.00 25.04 ? 2076 VAL B CG2   1 
ATOM   1816 N  N     . TYR B 1 15  ? -31.510 30.971 -3.227  1.00 26.08 ? 2077 TYR B N     1 
ATOM   1817 C  CA    . TYR B 1 15  ? -31.937 32.143 -2.438  1.00 28.14 ? 2077 TYR B CA    1 
ATOM   1818 C  C     . TYR B 1 15  ? -31.090 32.259 -1.216  1.00 28.29 ? 2077 TYR B C     1 
ATOM   1819 O  O     . TYR B 1 15  ? -31.078 31.370 -0.429  1.00 27.75 ? 2077 TYR B O     1 
ATOM   1820 C  CB    . TYR B 1 15  ? -33.427 32.070 -2.087  1.00 26.69 ? 2077 TYR B CB    1 
ATOM   1821 C  CG    . TYR B 1 15  ? -34.179 32.173 -3.377  1.00 30.19 ? 2077 TYR B CG    1 
ATOM   1822 C  CD1   . TYR B 1 15  ? -34.848 31.084 -3.927  1.00 30.50 ? 2077 TYR B CD1   1 
ATOM   1823 C  CD2   . TYR B 1 15  ? -34.153 33.337 -4.094  1.00 28.98 ? 2077 TYR B CD2   1 
ATOM   1824 C  CE1   . TYR B 1 15  ? -35.517 31.201 -5.164  1.00 32.25 ? 2077 TYR B CE1   1 
ATOM   1825 C  CE2   . TYR B 1 15  ? -34.782 33.447 -5.336  1.00 30.26 ? 2077 TYR B CE2   1 
ATOM   1826 C  CZ    . TYR B 1 15  ? -35.459 32.405 -5.861  1.00 32.49 ? 2077 TYR B CZ    1 
ATOM   1827 O  OH    . TYR B 1 15  ? -36.080 32.593 -7.106  1.00 33.85 ? 2077 TYR B OH    1 
ATOM   1828 N  N     . VAL B 1 16  ? -30.380 33.371 -1.056  1.00 29.73 ? 2078 VAL B N     1 
ATOM   1829 C  CA    . VAL B 1 16  ? -29.539 33.489 0.121   1.00 30.04 ? 2078 VAL B CA    1 
ATOM   1830 C  C     . VAL B 1 16  ? -30.227 34.189 1.292   1.00 31.21 ? 2078 VAL B C     1 
ATOM   1831 O  O     . VAL B 1 16  ? -30.679 33.510 2.201   1.00 31.95 ? 2078 VAL B O     1 
ATOM   1832 C  CB    . VAL B 1 16  ? -28.143 34.068 -0.164  1.00 30.23 ? 2078 VAL B CB    1 
ATOM   1833 C  CG1   . VAL B 1 16  ? -27.292 34.113 1.141   1.00 28.57 ? 2078 VAL B CG1   1 
ATOM   1834 C  CG2   . VAL B 1 16  ? -27.450 33.258 -1.251  1.00 29.44 ? 2078 VAL B CG2   1 
ATOM   1835 N  N     . ASP B 1 17  ? -30.287 35.522 1.291   1.00 30.66 ? 2079 ASP B N     1 
ATOM   1836 C  CA    . ASP B 1 17  ? -30.875 36.230 2.434   1.00 32.12 ? 2079 ASP B CA    1 
ATOM   1837 C  C     . ASP B 1 17  ? -32.177 36.999 2.101   1.00 32.66 ? 2079 ASP B C     1 
ATOM   1838 O  O     . ASP B 1 17  ? -32.667 37.763 2.941   1.00 32.66 ? 2079 ASP B O     1 
ATOM   1839 C  CB    . ASP B 1 17  ? -29.874 37.164 3.133   1.00 30.10 ? 2079 ASP B CB    1 
ATOM   1840 C  CG    . ASP B 1 17  ? -29.330 38.225 2.220   1.00 31.78 ? 2079 ASP B CG    1 
ATOM   1841 O  OD1   . ASP B 1 17  ? -28.957 39.307 2.706   1.00 33.87 ? 2079 ASP B OD1   1 
ATOM   1842 O  OD2   . ASP B 1 17  ? -29.286 38.008 1.004   1.00 32.70 ? 2079 ASP B OD2   1 
ATOM   1843 N  N     . VAL B 1 18  ? -32.702 36.781 0.891   1.00 31.63 ? 2080 VAL B N     1 
ATOM   1844 C  CA    . VAL B 1 18  ? -33.875 37.463 0.381   1.00 32.02 ? 2080 VAL B CA    1 
ATOM   1845 C  C     . VAL B 1 18  ? -34.509 36.609 -0.704  1.00 33.13 ? 2080 VAL B C     1 
ATOM   1846 O  O     . VAL B 1 18  ? -33.830 35.788 -1.360  1.00 32.56 ? 2080 VAL B O     1 
ATOM   1847 C  CB    . VAL B 1 18  ? -33.568 38.865 -0.264  1.00 31.59 ? 2080 VAL B CB    1 
ATOM   1848 C  CG1   . VAL B 1 18  ? -33.065 39.827 0.713   1.00 32.52 ? 2080 VAL B CG1   1 
ATOM   1849 C  CG2   . VAL B 1 18  ? -32.547 38.775 -1.385  1.00 33.39 ? 2080 VAL B CG2   1 
ATOM   1850 N  N     . LYS B 1 19  ? -35.792 36.860 -0.918  1.00 33.04 ? 2081 LYS B N     1 
ATOM   1851 C  CA    . LYS B 1 19  ? -36.594 36.223 -1.913  1.00 34.51 ? 2081 LYS B CA    1 
ATOM   1852 C  C     . LYS B 1 19  ? -37.389 37.311 -2.608  1.00 34.09 ? 2081 LYS B C     1 
ATOM   1853 O  O     . LYS B 1 19  ? -38.154 38.016 -1.976  1.00 33.36 ? 2081 LYS B O     1 
ATOM   1854 C  CB    . LYS B 1 19  ? -37.589 35.365 -1.171  1.00 36.59 ? 2081 LYS B CB    1 
ATOM   1855 C  CG    . LYS B 1 19  ? -37.922 34.044 -1.772  1.00 40.61 ? 2081 LYS B CG    1 
ATOM   1856 C  CD    . LYS B 1 19  ? -38.989 33.399 -0.884  1.00 49.06 ? 2081 LYS B CD    1 
ATOM   1857 C  CE    . LYS B 1 19  ? -38.789 31.900 -0.520  1.00 52.70 ? 2081 LYS B CE    1 
ATOM   1858 N  NZ    . LYS B 1 19  ? -39.685 31.413 0.640   1.00 56.03 ? 2081 LYS B NZ    1 
ATOM   1859 N  N     . PRO B 1 20  ? -37.222 37.452 -3.923  1.00 33.70 ? 2082 PRO B N     1 
ATOM   1860 C  CA    . PRO B 1 20  ? -37.851 38.530 -4.660  1.00 34.24 ? 2082 PRO B CA    1 
ATOM   1861 C  C     . PRO B 1 20  ? -39.303 38.242 -5.047  1.00 34.95 ? 2082 PRO B C     1 
ATOM   1862 O  O     . PRO B 1 20  ? -39.582 37.740 -6.125  1.00 34.65 ? 2082 PRO B O     1 
ATOM   1863 C  CB    . PRO B 1 20  ? -36.986 38.636 -5.902  1.00 34.14 ? 2082 PRO B CB    1 
ATOM   1864 C  CG    . PRO B 1 20  ? -36.520 37.231 -6.132  1.00 33.30 ? 2082 PRO B CG    1 
ATOM   1865 C  CD    . PRO B 1 20  ? -36.362 36.622 -4.774  1.00 34.08 ? 2082 PRO B CD    1 
ATOM   1866 N  N     . LEU B 1 21  ? -40.219 38.580 -4.163  1.00 36.89 ? 2083 LEU B N     1 
ATOM   1867 C  CA    . LEU B 1 21  ? -41.643 38.363 -4.413  1.00 37.37 ? 2083 LEU B CA    1 
ATOM   1868 C  C     . LEU B 1 21  ? -42.185 39.409 -5.355  1.00 38.00 ? 2083 LEU B C     1 
ATOM   1869 O  O     . LEU B 1 21  ? -41.815 40.591 -5.291  1.00 37.79 ? 2083 LEU B O     1 
ATOM   1870 C  CB    . LEU B 1 21  ? -42.399 38.381 -3.086  1.00 36.69 ? 2083 LEU B CB    1 
ATOM   1871 C  CG    . LEU B 1 21  ? -41.802 37.377 -2.095  1.00 37.85 ? 2083 LEU B CG    1 
ATOM   1872 C  CD1   . LEU B 1 21  ? -42.555 37.402 -0.812  1.00 37.28 ? 2083 LEU B CD1   1 
ATOM   1873 C  CD2   . LEU B 1 21  ? -41.835 35.970 -2.706  1.00 39.16 ? 2083 LEU B CD2   1 
ATOM   1874 N  N     . SER B 1 22  ? -43.103 39.005 -6.220  1.00 39.56 ? 2084 SER B N     1 
ATOM   1875 C  CA    . SER B 1 22  ? -43.697 39.968 -7.132  1.00 42.28 ? 2084 SER B CA    1 
ATOM   1876 C  C     . SER B 1 22  ? -44.965 40.688 -6.648  1.00 45.11 ? 2084 SER B C     1 
ATOM   1877 O  O     . SER B 1 22  ? -45.239 41.816 -7.072  1.00 45.96 ? 2084 SER B O     1 
ATOM   1878 C  CB    . SER B 1 22  ? -43.938 39.345 -8.492  1.00 41.32 ? 2084 SER B CB    1 
ATOM   1879 O  OG    . SER B 1 22  ? -44.863 38.282 -8.399  1.00 43.08 ? 2084 SER B OG    1 
ATOM   1880 N  N     . GLY B 1 23  ? -45.759 40.045 -5.798  1.00 48.70 ? 2085 GLY B N     1 
ATOM   1881 C  CA    . GLY B 1 23  ? -46.988 40.664 -5.300  1.00 51.57 ? 2085 GLY B CA    1 
ATOM   1882 C  C     . GLY B 1 23  ? -48.178 40.567 -6.250  1.00 54.97 ? 2085 GLY B C     1 
ATOM   1883 O  O     . GLY B 1 23  ? -49.253 41.129 -5.972  1.00 55.66 ? 2085 GLY B O     1 
ATOM   1884 N  N     . TYR B 1 24  ? -48.015 39.907 -7.398  1.00 57.26 ? 2086 TYR B N     1 
ATOM   1885 C  CA    . TYR B 1 24  ? -49.196 39.504 -8.161  1.00 59.70 ? 2086 TYR B CA    1 
ATOM   1886 C  C     . TYR B 1 24  ? -49.576 38.122 -7.652  1.00 61.00 ? 2086 TYR B C     1 
ATOM   1887 O  O     . TYR B 1 24  ? -48.751 37.187 -7.730  1.00 62.57 ? 2086 TYR B O     1 
ATOM   1888 C  CB    . TYR B 1 24  ? -48.965 39.258 -9.657  1.00 60.24 ? 2086 TYR B CB    1 
ATOM   1889 C  CG    . TYR B 1 24  ? -48.060 40.077 -10.564 1.00 61.32 ? 2086 TYR B CG    1 
ATOM   1890 C  CD1   . TYR B 1 24  ? -48.003 39.710 -11.902 1.00 62.55 ? 2086 TYR B CD1   1 
ATOM   1891 C  CD2   . TYR B 1 24  ? -47.260 41.161 -10.139 1.00 62.59 ? 2086 TYR B CD2   1 
ATOM   1892 C  CE1   . TYR B 1 24  ? -47.201 40.368 -12.812 1.00 61.84 ? 2086 TYR B CE1   1 
ATOM   1893 C  CE2   . TYR B 1 24  ? -46.430 41.846 -11.071 1.00 59.94 ? 2086 TYR B CE2   1 
ATOM   1894 C  CZ    . TYR B 1 24  ? -46.426 41.425 -12.408 1.00 60.94 ? 2086 TYR B CZ    1 
ATOM   1895 O  OH    . TYR B 1 24  ? -45.670 42.034 -13.386 1.00 60.50 ? 2086 TYR B OH    1 
ATOM   1896 N  N     . CYS B 1 42  ? -51.905 30.832 -25.461 1.00 76.60 ? 2104 CYS B N     1 
ATOM   1897 C  CA    . CYS B 1 42  ? -51.357 32.013 -24.795 1.00 76.51 ? 2104 CYS B CA    1 
ATOM   1898 C  C     . CYS B 1 42  ? -50.139 32.553 -25.571 1.00 77.50 ? 2104 CYS B C     1 
ATOM   1899 O  O     . CYS B 1 42  ? -48.995 32.325 -25.172 1.00 77.29 ? 2104 CYS B O     1 
ATOM   1900 C  CB    . CYS B 1 42  ? -50.993 31.700 -23.323 1.00 75.98 ? 2104 CYS B CB    1 
ATOM   1901 S  SG    . CYS B 1 42  ? -52.382 31.597 -22.083 1.00 72.30 ? 2104 CYS B SG    1 
ATOM   1902 N  N     . VAL B 1 43  ? -50.382 33.254 -26.683 1.00 78.53 ? 2105 VAL B N     1 
ATOM   1903 C  CA    . VAL B 1 43  ? -49.279 33.865 -27.454 1.00 79.70 ? 2105 VAL B CA    1 
ATOM   1904 C  C     . VAL B 1 43  ? -49.352 35.408 -27.519 1.00 80.47 ? 2105 VAL B C     1 
ATOM   1905 O  O     . VAL B 1 43  ? -48.943 36.099 -26.575 1.00 80.72 ? 2105 VAL B O     1 
ATOM   1906 C  CB    . VAL B 1 43  ? -49.108 33.235 -28.875 1.00 79.87 ? 2105 VAL B CB    1 
ATOM   1907 C  CG1   . VAL B 1 43  ? -48.007 33.955 -29.671 1.00 80.08 ? 2105 VAL B CG1   1 
ATOM   1908 C  CG2   . VAL B 1 43  ? -48.808 31.722 -28.773 1.00 79.84 ? 2105 VAL B CG2   1 
ATOM   1909 N  N     . ASP B 1 44  ? -49.912 35.931 -28.612 1.00 81.23 ? 2106 ASP B N     1 
ATOM   1910 C  CA    . ASP B 1 44  ? -49.778 37.349 -28.999 1.00 81.64 ? 2106 ASP B CA    1 
ATOM   1911 C  C     . ASP B 1 44  ? -50.916 38.279 -28.530 1.00 81.21 ? 2106 ASP B C     1 
ATOM   1912 O  O     . ASP B 1 44  ? -51.369 39.183 -29.323 1.00 81.66 ? 2106 ASP B O     1 
ATOM   1913 C  CB    . ASP B 1 44  ? -49.744 37.418 -30.531 1.00 82.37 ? 2106 ASP B CB    1 
ATOM   1914 C  CG    . ASP B 1 44  ? -51.118 37.105 -31.160 1.00 83.48 ? 2106 ASP B CG    1 
ATOM   1915 O  OD1   . ASP B 1 44  ? -51.814 36.171 -30.684 1.00 84.18 ? 2106 ASP B OD1   1 
ATOM   1916 O  OD2   . ASP B 1 44  ? -51.511 37.814 -32.112 1.00 85.68 ? 2106 ASP B OD2   1 
ATOM   1917 N  N     . ASP B 1 45  ? -51.357 38.085 -27.255 1.00 80.43 ? 2107 ASP B N     1 
ATOM   1918 C  CA    . ASP B 1 45  ? -52.524 38.840 -26.725 1.00 79.27 ? 2107 ASP B CA    1 
ATOM   1919 C  C     . ASP B 1 45  ? -52.981 38.160 -25.442 1.00 77.25 ? 2107 ASP B C     1 
ATOM   1920 O  O     . ASP B 1 45  ? -54.126 38.330 -24.991 1.00 77.35 ? 2107 ASP B O     1 
ATOM   1921 C  CB    . ASP B 1 45  ? -53.706 38.887 -27.722 1.00 80.06 ? 2107 ASP B CB    1 
ATOM   1922 C  CG    . ASP B 1 45  ? -53.908 40.273 -28.349 1.00 82.49 ? 2107 ASP B CG    1 
ATOM   1923 O  OD1   . ASP B 1 45  ? -53.557 41.290 -27.701 1.00 84.45 ? 2107 ASP B OD1   1 
ATOM   1924 O  OD2   . ASP B 1 45  ? -54.434 40.341 -29.491 1.00 84.20 ? 2107 ASP B OD2   1 
ATOM   1925 N  N     . CYS B 1 46  ? -52.079 37.366 -24.872 1.00 74.35 ? 2108 CYS B N     1 
ATOM   1926 C  CA    . CYS B 1 46  ? -52.350 36.701 -23.610 1.00 71.47 ? 2108 CYS B CA    1 
ATOM   1927 C  C     . CYS B 1 46  ? -52.265 37.703 -22.465 1.00 69.36 ? 2108 CYS B C     1 
ATOM   1928 O  O     . CYS B 1 46  ? -51.265 38.424 -22.340 1.00 69.29 ? 2108 CYS B O     1 
ATOM   1929 C  CB    . CYS B 1 46  ? -51.369 35.567 -23.392 1.00 71.16 ? 2108 CYS B CB    1 
ATOM   1930 S  SG    . CYS B 1 46  ? -51.735 34.686 -21.923 1.00 70.98 ? 2108 CYS B SG    1 
ATOM   1931 N  N     . LEU B 1 47  ? -53.327 37.755 -21.653 1.00 66.79 ? 2109 LEU B N     1 
ATOM   1932 C  CA    . LEU B 1 47  ? -53.432 38.716 -20.543 1.00 64.22 ? 2109 LEU B CA    1 
ATOM   1933 C  C     . LEU B 1 47  ? -52.176 38.666 -19.659 1.00 61.88 ? 2109 LEU B C     1 
ATOM   1934 O  O     . LEU B 1 47  ? -51.580 39.704 -19.336 1.00 61.76 ? 2109 LEU B O     1 
ATOM   1935 C  CB    . LEU B 1 47  ? -54.688 38.439 -19.689 1.00 64.34 ? 2109 LEU B CB    1 
ATOM   1936 C  CG    . LEU B 1 47  ? -56.095 38.773 -20.201 1.00 65.80 ? 2109 LEU B CG    1 
ATOM   1937 C  CD1   . LEU B 1 47  ? -57.154 38.274 -19.199 1.00 66.18 ? 2109 LEU B CD1   1 
ATOM   1938 C  CD2   . LEU B 1 47  ? -56.282 40.291 -20.502 1.00 65.85 ? 2109 LEU B CD2   1 
ATOM   1939 N  N     . ASN B 1 48  ? -51.791 37.449 -19.275 1.00 58.83 ? 2110 ASN B N     1 
ATOM   1940 C  CA    . ASN B 1 48  ? -50.623 37.229 -18.416 1.00 55.92 ? 2110 ASN B CA    1 
ATOM   1941 C  C     . ASN B 1 48  ? -49.346 37.747 -19.077 1.00 54.38 ? 2110 ASN B C     1 
ATOM   1942 O  O     . ASN B 1 48  ? -48.704 38.656 -18.554 1.00 53.45 ? 2110 ASN B O     1 
ATOM   1943 C  CB    . ASN B 1 48  ? -50.514 35.753 -18.014 1.00 54.96 ? 2110 ASN B CB    1 
ATOM   1944 C  CG    . ASN B 1 48  ? -51.491 35.389 -16.908 1.00 53.67 ? 2110 ASN B CG    1 
ATOM   1945 O  OD1   . ASN B 1 48  ? -51.872 36.249 -16.122 1.00 54.22 ? 2110 ASN B OD1   1 
ATOM   1946 N  ND2   . ASN B 1 48  ? -51.887 34.118 -16.832 1.00 51.42 ? 2110 ASN B ND2   1 
ATOM   1947 N  N     . ARG B 1 49  ? -49.030 37.204 -20.254 1.00 53.19 ? 2111 ARG B N     1 
ATOM   1948 C  CA    . ARG B 1 49  ? -47.861 37.608 -21.019 1.00 52.41 ? 2111 ARG B CA    1 
ATOM   1949 C  C     . ARG B 1 49  ? -47.699 39.112 -21.142 1.00 52.11 ? 2111 ARG B C     1 
ATOM   1950 O  O     . ARG B 1 49  ? -46.575 39.638 -21.043 1.00 52.50 ? 2111 ARG B O     1 
ATOM   1951 C  CB    . ARG B 1 49  ? -47.923 36.995 -22.408 1.00 53.10 ? 2111 ARG B CB    1 
ATOM   1952 C  CG    . ARG B 1 49  ? -46.831 37.499 -23.349 1.00 54.35 ? 2111 ARG B CG    1 
ATOM   1953 C  CD    . ARG B 1 49  ? -46.914 36.798 -24.681 1.00 57.31 ? 2111 ARG B CD    1 
ATOM   1954 N  NE    . ARG B 1 49  ? -46.729 35.342 -24.568 1.00 59.45 ? 2111 ARG B NE    1 
ATOM   1955 C  CZ    . ARG B 1 49  ? -45.729 34.671 -25.139 1.00 61.73 ? 2111 ARG B CZ    1 
ATOM   1956 N  NH1   . ARG B 1 49  ? -44.820 35.319 -25.860 1.00 63.16 ? 2111 ARG B NH1   1 
ATOM   1957 N  NH2   . ARG B 1 49  ? -45.637 33.352 -24.997 1.00 62.06 ? 2111 ARG B NH2   1 
ATOM   1958 N  N     . MET B 1 50  ? -48.810 39.808 -21.366 1.00 51.14 ? 2112 MET B N     1 
ATOM   1959 C  CA    . MET B 1 50  ? -48.769 41.263 -21.576 1.00 50.00 ? 2112 MET B CA    1 
ATOM   1960 C  C     . MET B 1 50  ? -48.228 41.987 -20.363 1.00 47.92 ? 2112 MET B C     1 
ATOM   1961 O  O     . MET B 1 50  ? -47.835 43.161 -20.459 1.00 48.28 ? 2112 MET B O     1 
ATOM   1962 C  CB    . MET B 1 50  ? -50.160 41.811 -21.919 1.00 51.22 ? 2112 MET B CB    1 
ATOM   1963 C  CG    . MET B 1 50  ? -50.796 41.244 -23.193 1.00 56.41 ? 2112 MET B CG    1 
ATOM   1964 S  SD    . MET B 1 50  ? -49.974 41.604 -24.780 1.00 71.25 ? 2112 MET B SD    1 
ATOM   1965 C  CE    . MET B 1 50  ? -48.839 42.950 -24.417 1.00 68.15 ? 2112 MET B CE    1 
ATOM   1966 N  N     . ILE B 1 51  ? -48.223 41.300 -19.219 1.00 44.85 ? 2113 ILE B N     1 
ATOM   1967 C  CA    . ILE B 1 51  ? -47.707 41.906 -17.988 1.00 42.78 ? 2113 ILE B CA    1 
ATOM   1968 C  C     . ILE B 1 51  ? -46.359 41.291 -17.510 1.00 40.73 ? 2113 ILE B C     1 
ATOM   1969 O  O     . ILE B 1 51  ? -45.912 41.523 -16.379 1.00 40.41 ? 2113 ILE B O     1 
ATOM   1970 C  CB    . ILE B 1 51  ? -48.784 42.009 -16.883 1.00 42.16 ? 2113 ILE B CB    1 
ATOM   1971 C  CG1   . ILE B 1 51  ? -49.210 40.642 -16.349 1.00 44.46 ? 2113 ILE B CG1   1 
ATOM   1972 C  CG2   . ILE B 1 51  ? -50.054 42.681 -17.446 1.00 44.21 ? 2113 ILE B CG2   1 
ATOM   1973 C  CD1   . ILE B 1 51  ? -50.085 40.718 -15.048 1.00 42.58 ? 2113 ILE B CD1   1 
ATOM   1974 N  N     . PHE B 1 52  ? -45.696 40.566 -18.417 1.00 38.91 ? 2114 PHE B N     1 
ATOM   1975 C  CA    . PHE B 1 52  ? -44.522 39.751 -18.086 1.00 36.80 ? 2114 PHE B CA    1 
ATOM   1976 C  C     . PHE B 1 52  ? -44.815 38.826 -16.908 1.00 36.73 ? 2114 PHE B C     1 
ATOM   1977 O  O     . PHE B 1 52  ? -44.048 38.739 -15.967 1.00 36.36 ? 2114 PHE B O     1 
ATOM   1978 C  CB    . PHE B 1 52  ? -43.271 40.606 -17.822 1.00 35.67 ? 2114 PHE B CB    1 
ATOM   1979 C  CG    . PHE B 1 52  ? -42.645 41.189 -19.082 1.00 35.19 ? 2114 PHE B CG    1 
ATOM   1980 C  CD1   . PHE B 1 52  ? -42.025 42.414 -19.060 1.00 34.78 ? 2114 PHE B CD1   1 
ATOM   1981 C  CD2   . PHE B 1 52  ? -42.698 40.532 -20.290 1.00 33.17 ? 2114 PHE B CD2   1 
ATOM   1982 C  CE1   . PHE B 1 52  ? -41.468 42.951 -20.226 1.00 34.57 ? 2114 PHE B CE1   1 
ATOM   1983 C  CE2   . PHE B 1 52  ? -42.118 41.091 -21.464 1.00 34.44 ? 2114 PHE B CE2   1 
ATOM   1984 C  CZ    . PHE B 1 52  ? -41.511 42.282 -21.418 1.00 31.37 ? 2114 PHE B CZ    1 
ATOM   1985 N  N     . ALA B 1 53  ? -45.953 38.146 -16.949 1.00 36.54 ? 2115 ALA B N     1 
ATOM   1986 C  CA    . ALA B 1 53  ? -46.259 37.200 -15.912 1.00 36.57 ? 2115 ALA B CA    1 
ATOM   1987 C  C     . ALA B 1 53  ? -46.519 35.909 -16.632 1.00 37.02 ? 2115 ALA B C     1 
ATOM   1988 O  O     . ALA B 1 53  ? -47.169 35.920 -17.689 1.00 37.25 ? 2115 ALA B O     1 
ATOM   1989 C  CB    . ALA B 1 53  ? -47.500 37.651 -15.097 1.00 36.16 ? 2115 ALA B CB    1 
ATOM   1990 N  N     . GLU B 1 54  ? -46.006 34.799 -16.104 1.00 36.04 ? 2116 GLU B N     1 
ATOM   1991 C  CA    . GLU B 1 54  ? -46.283 33.522 -16.719 1.00 36.78 ? 2116 GLU B CA    1 
ATOM   1992 C  C     . GLU B 1 54  ? -47.638 32.969 -16.246 1.00 39.05 ? 2116 GLU B C     1 
ATOM   1993 O  O     . GLU B 1 54  ? -48.131 33.339 -15.170 1.00 38.57 ? 2116 GLU B O     1 
ATOM   1994 C  CB    . GLU B 1 54  ? -45.154 32.524 -16.481 1.00 35.14 ? 2116 GLU B CB    1 
ATOM   1995 C  CG    . GLU B 1 54  ? -43.910 32.902 -17.253 1.00 35.49 ? 2116 GLU B CG    1 
ATOM   1996 C  CD    . GLU B 1 54  ? -42.946 31.786 -17.440 1.00 32.94 ? 2116 GLU B CD    1 
ATOM   1997 O  OE1   . GLU B 1 54  ? -42.134 31.858 -18.381 1.00 31.24 ? 2116 GLU B OE1   1 
ATOM   1998 O  OE2   . GLU B 1 54  ? -42.988 30.821 -16.651 1.00 34.63 ? 2116 GLU B OE2   1 
ATOM   1999 N  N     . CYS B 1 55  ? -48.226 32.086 -17.045 1.00 40.64 ? 2117 CYS B N     1 
ATOM   2000 C  CA    . CYS B 1 55  ? -49.477 31.448 -16.687 1.00 44.41 ? 2117 CYS B CA    1 
ATOM   2001 C  C     . CYS B 1 55  ? -49.173 30.392 -15.653 1.00 45.97 ? 2117 CYS B C     1 
ATOM   2002 O  O     . CYS B 1 55  ? -48.055 29.832 -15.618 1.00 46.35 ? 2117 CYS B O     1 
ATOM   2003 C  CB    . CYS B 1 55  ? -50.128 30.805 -17.939 1.00 44.52 ? 2117 CYS B CB    1 
ATOM   2004 S  SG    . CYS B 1 55  ? -50.936 32.042 -19.066 1.00 51.94 ? 2117 CYS B SG    1 
ATOM   2005 N  N     . SER B 1 56  ? -50.136 30.111 -14.786 1.00 48.16 ? 2118 SER B N     1 
ATOM   2006 C  CA    . SER B 1 56  ? -49.980 28.967 -13.898 1.00 50.65 ? 2118 SER B CA    1 
ATOM   2007 C  C     . SER B 1 56  ? -50.614 27.766 -14.555 1.00 52.74 ? 2118 SER B C     1 
ATOM   2008 O  O     . SER B 1 56  ? -51.707 27.883 -15.113 1.00 53.22 ? 2118 SER B O     1 
ATOM   2009 C  CB    . SER B 1 56  ? -50.651 29.208 -12.557 1.00 50.87 ? 2118 SER B CB    1 
ATOM   2010 O  OG    . SER B 1 56  ? -50.718 27.982 -11.850 1.00 52.10 ? 2118 SER B OG    1 
ATOM   2011 N  N     . PRO B 1 57  ? -49.951 26.598 -14.476 1.00 54.89 ? 2119 PRO B N     1 
ATOM   2012 C  CA    . PRO B 1 57  ? -50.497 25.359 -15.048 1.00 56.53 ? 2119 PRO B CA    1 
ATOM   2013 C  C     . PRO B 1 57  ? -51.835 24.913 -14.400 1.00 58.50 ? 2119 PRO B C     1 
ATOM   2014 O  O     . PRO B 1 57  ? -52.548 24.066 -14.958 1.00 58.44 ? 2119 PRO B O     1 
ATOM   2015 C  CB    . PRO B 1 57  ? -49.386 24.331 -14.788 1.00 56.55 ? 2119 PRO B CB    1 
ATOM   2016 C  CG    . PRO B 1 57  ? -48.618 24.875 -13.586 1.00 55.65 ? 2119 PRO B CG    1 
ATOM   2017 C  CD    . PRO B 1 57  ? -48.705 26.370 -13.709 1.00 55.23 ? 2119 PRO B CD    1 
ATOM   2018 N  N     . ASN B 1 58  ? -52.170 25.475 -13.239 1.00 60.22 ? 2120 ASN B N     1 
ATOM   2019 C  CA    . ASN B 1 58  ? -53.438 25.173 -12.586 1.00 62.08 ? 2120 ASN B CA    1 
ATOM   2020 C  C     . ASN B 1 58  ? -54.580 25.981 -13.194 1.00 63.50 ? 2120 ASN B C     1 
ATOM   2021 O  O     . ASN B 1 58  ? -55.731 25.525 -13.233 1.00 63.89 ? 2120 ASN B O     1 
ATOM   2022 C  CB    . ASN B 1 58  ? -53.356 25.466 -11.083 1.00 62.22 ? 2120 ASN B CB    1 
ATOM   2023 C  CG    . ASN B 1 58  ? -52.228 24.726 -10.404 1.00 63.33 ? 2120 ASN B CG    1 
ATOM   2024 O  OD1   . ASN B 1 58  ? -51.735 23.725 -10.917 1.00 66.10 ? 2120 ASN B OD1   1 
ATOM   2025 N  ND2   . ASN B 1 58  ? -51.810 25.216 -9.237  1.00 64.41 ? 2120 ASN B ND2   1 
ATOM   2026 N  N     . THR B 1 59  ? -54.257 27.183 -13.665 1.00 64.58 ? 2121 THR B N     1 
ATOM   2027 C  CA    . THR B 1 59  ? -55.272 28.142 -14.078 1.00 65.62 ? 2121 THR B CA    1 
ATOM   2028 C  C     . THR B 1 59  ? -55.447 28.287 -15.595 1.00 65.74 ? 2121 THR B C     1 
ATOM   2029 O  O     . THR B 1 59  ? -56.554 28.575 -16.057 1.00 66.09 ? 2121 THR B O     1 
ATOM   2030 C  CB    . THR B 1 59  ? -54.979 29.543 -13.485 1.00 66.04 ? 2121 THR B CB    1 
ATOM   2031 O  OG1   . THR B 1 59  ? -53.659 29.953 -13.873 1.00 67.32 ? 2121 THR B OG1   1 
ATOM   2032 C  CG2   . THR B 1 59  ? -55.087 29.531 -11.953 1.00 66.39 ? 2121 THR B CG2   1 
ATOM   2033 N  N     . CYS B 1 60  ? -54.363 28.101 -16.358 1.00 65.84 ? 2122 CYS B N     1 
ATOM   2034 C  CA    . CYS B 1 60  ? -54.329 28.454 -17.797 1.00 65.63 ? 2122 CYS B CA    1 
ATOM   2035 C  C     . CYS B 1 60  ? -55.475 27.775 -18.576 1.00 66.39 ? 2122 CYS B C     1 
ATOM   2036 O  O     . CYS B 1 60  ? -55.627 26.542 -18.510 1.00 65.70 ? 2122 CYS B O     1 
ATOM   2037 C  CB    . CYS B 1 60  ? -52.944 28.134 -18.418 1.00 65.57 ? 2122 CYS B CB    1 
ATOM   2038 S  SG    . CYS B 1 60  ? -52.602 28.839 -20.074 1.00 63.53 ? 2122 CYS B SG    1 
ATOM   2039 N  N     . PRO B 1 61  ? -56.294 28.586 -19.298 1.00 66.78 ? 2123 PRO B N     1 
ATOM   2040 C  CA    . PRO B 1 61  ? -57.353 28.031 -20.157 1.00 67.17 ? 2123 PRO B CA    1 
ATOM   2041 C  C     . PRO B 1 61  ? -56.808 27.125 -21.267 1.00 67.51 ? 2123 PRO B C     1 
ATOM   2042 O  O     . PRO B 1 61  ? -57.471 26.149 -21.631 1.00 68.15 ? 2123 PRO B O     1 
ATOM   2043 C  CB    . PRO B 1 61  ? -58.034 29.276 -20.762 1.00 67.05 ? 2123 PRO B CB    1 
ATOM   2044 C  CG    . PRO B 1 61  ? -57.089 30.411 -20.532 1.00 66.86 ? 2123 PRO B CG    1 
ATOM   2045 C  CD    . PRO B 1 61  ? -56.289 30.067 -19.308 1.00 67.03 ? 2123 PRO B CD    1 
ATOM   2046 N  N     . CYS B 1 62  ? -55.615 27.431 -21.784 1.00 67.27 ? 2124 CYS B N     1 
ATOM   2047 C  CA    . CYS B 1 62  ? -55.019 26.685 -22.905 1.00 66.71 ? 2124 CYS B CA    1 
ATOM   2048 C  C     . CYS B 1 62  ? -54.301 25.405 -22.464 1.00 66.69 ? 2124 CYS B C     1 
ATOM   2049 O  O     . CYS B 1 62  ? -53.653 24.739 -23.282 1.00 66.73 ? 2124 CYS B O     1 
ATOM   2050 C  CB    . CYS B 1 62  ? -54.068 27.584 -23.701 1.00 66.36 ? 2124 CYS B CB    1 
ATOM   2051 S  SG    . CYS B 1 62  ? -54.763 29.212 -24.099 1.00 68.97 ? 2124 CYS B SG    1 
ATOM   2052 N  N     . GLY B 1 63  ? -54.410 25.066 -21.178 1.00 66.66 ? 2125 GLY B N     1 
ATOM   2053 C  CA    . GLY B 1 63  ? -53.853 23.822 -20.658 1.00 66.51 ? 2125 GLY B CA    1 
ATOM   2054 C  C     . GLY B 1 63  ? -52.437 23.595 -21.134 1.00 67.02 ? 2125 GLY B C     1 
ATOM   2055 O  O     . GLY B 1 63  ? -51.540 24.398 -20.815 1.00 67.29 ? 2125 GLY B O     1 
ATOM   2056 N  N     . GLU B 1 64  ? -52.239 22.524 -21.914 1.00 66.94 ? 2126 GLU B N     1 
ATOM   2057 C  CA    . GLU B 1 64  ? -50.887 22.083 -22.323 1.00 66.74 ? 2126 GLU B CA    1 
ATOM   2058 C  C     . GLU B 1 64  ? -50.284 22.854 -23.505 1.00 66.06 ? 2126 GLU B C     1 
ATOM   2059 O  O     . GLU B 1 64  ? -49.070 22.807 -23.741 1.00 66.15 ? 2126 GLU B O     1 
ATOM   2060 C  CB    . GLU B 1 64  ? -50.856 20.569 -22.578 1.00 67.17 ? 2126 GLU B CB    1 
ATOM   2061 C  CG    . GLU B 1 64  ? -50.801 19.740 -21.290 1.00 68.64 ? 2126 GLU B CG    1 
ATOM   2062 C  CD    . GLU B 1 64  ? -49.732 20.242 -20.324 1.00 71.04 ? 2126 GLU B CD    1 
ATOM   2063 O  OE1   . GLU B 1 64  ? -48.528 19.986 -20.570 1.00 70.55 ? 2126 GLU B OE1   1 
ATOM   2064 O  OE2   . GLU B 1 64  ? -50.102 20.896 -19.319 1.00 72.64 ? 2126 GLU B OE2   1 
ATOM   2065 N  N     . GLN B 1 65  ? -51.136 23.554 -24.245 1.00 65.05 ? 2127 GLN B N     1 
ATOM   2066 C  CA    . GLN B 1 65  ? -50.679 24.434 -25.310 1.00 64.62 ? 2127 GLN B CA    1 
ATOM   2067 C  C     . GLN B 1 65  ? -50.330 25.815 -24.776 1.00 63.17 ? 2127 GLN B C     1 
ATOM   2068 O  O     . GLN B 1 65  ? -49.978 26.712 -25.558 1.00 63.99 ? 2127 GLN B O     1 
ATOM   2069 C  CB    . GLN B 1 65  ? -51.737 24.546 -26.418 1.00 65.41 ? 2127 GLN B CB    1 
ATOM   2070 C  CG    . GLN B 1 65  ? -51.536 23.559 -27.574 1.00 67.56 ? 2127 GLN B CG    1 
ATOM   2071 C  CD    . GLN B 1 65  ? -52.848 23.034 -28.148 1.00 70.76 ? 2127 GLN B CD    1 
ATOM   2072 O  OE1   . GLN B 1 65  ? -53.877 23.721 -28.134 1.00 71.10 ? 2127 GLN B OE1   1 
ATOM   2073 N  NE2   . GLN B 1 65  ? -52.814 21.801 -28.653 1.00 73.42 ? 2127 GLN B NE2   1 
ATOM   2074 N  N     . CYS B 1 66  ? -50.455 25.994 -23.455 1.00 61.19 ? 2128 CYS B N     1 
ATOM   2075 C  CA    . CYS B 1 66  ? -49.988 27.216 -22.797 1.00 58.26 ? 2128 CYS B CA    1 
ATOM   2076 C  C     . CYS B 1 66  ? -48.501 27.310 -23.140 1.00 57.06 ? 2128 CYS B C     1 
ATOM   2077 O  O     . CYS B 1 66  ? -47.689 26.416 -22.843 1.00 56.45 ? 2128 CYS B O     1 
ATOM   2078 C  CB    . CYS B 1 66  ? -50.226 27.185 -21.268 1.00 58.56 ? 2128 CYS B CB    1 
ATOM   2079 S  SG    . CYS B 1 66  ? -50.566 28.781 -20.398 1.00 54.94 ? 2128 CYS B SG    1 
ATOM   2080 N  N     . CYS B 1 67  ? -48.198 28.413 -23.791 1.00 54.85 ? 2129 CYS B N     1 
ATOM   2081 C  CA    . CYS B 1 67  ? -46.947 28.671 -24.434 1.00 53.58 ? 2129 CYS B CA    1 
ATOM   2082 C  C     . CYS B 1 67  ? -46.369 29.869 -23.656 1.00 50.55 ? 2129 CYS B C     1 
ATOM   2083 O  O     . CYS B 1 67  ? -45.520 30.628 -24.158 1.00 49.06 ? 2129 CYS B O     1 
ATOM   2084 C  CB    . CYS B 1 67  ? -47.353 29.049 -25.856 1.00 54.02 ? 2129 CYS B CB    1 
ATOM   2085 S  SG    . CYS B 1 67  ? -46.157 29.522 -27.015 1.00 61.73 ? 2129 CYS B SG    1 
ATOM   2086 N  N     . ASN B 1 68  ? -46.887 30.038 -22.433 1.00 47.68 ? 2130 ASN B N     1 
ATOM   2087 C  CA    . ASN B 1 68  ? -46.475 31.128 -21.541 1.00 44.63 ? 2130 ASN B CA    1 
ATOM   2088 C  C     . ASN B 1 68  ? -46.022 30.570 -20.203 1.00 43.07 ? 2130 ASN B C     1 
ATOM   2089 O  O     . ASN B 1 68  ? -46.347 31.139 -19.162 1.00 42.75 ? 2130 ASN B O     1 
ATOM   2090 C  CB    . ASN B 1 68  ? -47.614 32.098 -21.297 1.00 43.83 ? 2130 ASN B CB    1 
ATOM   2091 C  CG    . ASN B 1 68  ? -47.157 33.352 -20.584 1.00 44.96 ? 2130 ASN B CG    1 
ATOM   2092 O  OD1   . ASN B 1 68  ? -45.995 33.770 -20.729 1.00 46.95 ? 2130 ASN B OD1   1 
ATOM   2093 N  ND2   . ASN B 1 68  ? -48.066 33.980 -19.822 1.00 41.71 ? 2130 ASN B ND2   1 
ATOM   2094 N  N     . GLN B 1 69  ? -45.297 29.451 -20.243 1.00 40.65 ? 2131 GLN B N     1 
ATOM   2095 C  CA    . GLN B 1 69  ? -44.691 28.864 -19.068 1.00 40.09 ? 2131 GLN B CA    1 
ATOM   2096 C  C     . GLN B 1 69  ? -43.245 28.455 -19.299 1.00 39.31 ? 2131 GLN B C     1 
ATOM   2097 O  O     . GLN B 1 69  ? -42.738 27.494 -18.698 1.00 39.18 ? 2131 GLN B O     1 
ATOM   2098 C  CB    . GLN B 1 69  ? -45.516 27.684 -18.607 1.00 40.38 ? 2131 GLN B CB    1 
ATOM   2099 C  CG    . GLN B 1 69  ? -46.782 28.133 -17.962 1.00 41.76 ? 2131 GLN B CG    1 
ATOM   2100 C  CD    . GLN B 1 69  ? -47.829 27.070 -17.955 1.00 45.66 ? 2131 GLN B CD    1 
ATOM   2101 O  OE1   . GLN B 1 69  ? -47.669 26.009 -17.331 1.00 45.25 ? 2131 GLN B OE1   1 
ATOM   2102 N  NE2   . GLN B 1 69  ? -48.935 27.341 -18.653 1.00 48.13 ? 2131 GLN B NE2   1 
ATOM   2103 N  N     . ARG B 1 70  ? -42.560 29.256 -20.108 1.00 38.73 ? 2132 ARG B N     1 
ATOM   2104 C  CA    . ARG B 1 70  ? -41.189 28.959 -20.532 1.00 39.21 ? 2132 ARG B CA    1 
ATOM   2105 C  C     . ARG B 1 70  ? -40.094 28.990 -19.483 1.00 38.28 ? 2132 ARG B C     1 
ATOM   2106 O  O     . ARG B 1 70  ? -39.165 28.138 -19.506 1.00 38.52 ? 2132 ARG B O     1 
ATOM   2107 C  CB    . ARG B 1 70  ? -40.821 29.848 -21.707 1.00 39.26 ? 2132 ARG B CB    1 
ATOM   2108 C  CG    . ARG B 1 70  ? -41.603 29.381 -22.908 1.00 42.95 ? 2132 ARG B CG    1 
ATOM   2109 C  CD    . ARG B 1 70  ? -41.058 29.999 -24.131 1.00 49.13 ? 2132 ARG B CD    1 
ATOM   2110 N  NE    . ARG B 1 70  ? -41.606 31.306 -24.014 1.00 50.98 ? 2132 ARG B NE    1 
ATOM   2111 C  CZ    . ARG B 1 70  ? -41.942 32.102 -24.998 1.00 56.27 ? 2132 ARG B CZ    1 
ATOM   2112 N  NH1   . ARG B 1 70  ? -41.726 31.857 -26.286 1.00 57.00 ? 2132 ARG B NH1   1 
ATOM   2113 N  NH2   . ARG B 1 70  ? -42.507 33.198 -24.638 1.00 56.30 ? 2132 ARG B NH2   1 
ATOM   2114 N  N     . ILE B 1 71  ? -40.170 29.960 -18.580 1.00 37.22 ? 2133 ILE B N     1 
ATOM   2115 C  CA    . ILE B 1 71  ? -39.211 29.995 -17.476 1.00 36.44 ? 2133 ILE B CA    1 
ATOM   2116 C  C     . ILE B 1 71  ? -39.476 28.863 -16.504 1.00 37.20 ? 2133 ILE B C     1 
ATOM   2117 O  O     . ILE B 1 71  ? -38.544 28.184 -16.063 1.00 36.23 ? 2133 ILE B O     1 
ATOM   2118 C  CB    . ILE B 1 71  ? -39.206 31.351 -16.766 1.00 36.43 ? 2133 ILE B CB    1 
ATOM   2119 C  CG1   . ILE B 1 71  ? -38.686 32.403 -17.747 1.00 35.77 ? 2133 ILE B CG1   1 
ATOM   2120 C  CG2   . ILE B 1 71  ? -38.265 31.325 -15.552 1.00 34.67 ? 2133 ILE B CG2   1 
ATOM   2121 C  CD1   . ILE B 1 71  ? -38.854 33.861 -17.298 1.00 33.91 ? 2133 ILE B CD1   1 
ATOM   2122 N  N     . GLN B 1 72  ? -40.752 28.665 -16.176 1.00 38.58 ? 2134 GLN B N     1 
ATOM   2123 C  CA    . GLN B 1 72  ? -41.173 27.650 -15.224 1.00 40.14 ? 2134 GLN B CA    1 
ATOM   2124 C  C     . GLN B 1 72  ? -40.686 26.304 -15.608 1.00 40.02 ? 2134 GLN B C     1 
ATOM   2125 O  O     . GLN B 1 72  ? -40.259 25.525 -14.759 1.00 40.95 ? 2134 GLN B O     1 
ATOM   2126 C  CB    . GLN B 1 72  ? -42.685 27.523 -15.270 1.00 41.04 ? 2134 GLN B CB    1 
ATOM   2127 C  CG    . GLN B 1 72  ? -43.405 28.505 -14.464 1.00 44.53 ? 2134 GLN B CG    1 
ATOM   2128 C  CD    . GLN B 1 72  ? -44.853 28.338 -14.674 1.00 46.29 ? 2134 GLN B CD    1 
ATOM   2129 O  OE1   . GLN B 1 72  ? -45.380 27.249 -14.501 1.00 49.23 ? 2134 GLN B OE1   1 
ATOM   2130 N  NE2   . GLN B 1 72  ? -45.515 29.402 -15.068 1.00 48.46 ? 2134 GLN B NE2   1 
ATOM   2131 N  N     . ARG B 1 73  ? -40.849 26.015 -16.897 1.00 41.22 ? 2135 ARG B N     1 
ATOM   2132 C  CA    . ARG B 1 73  ? -40.581 24.701 -17.463 1.00 42.65 ? 2135 ARG B CA    1 
ATOM   2133 C  C     . ARG B 1 73  ? -39.160 24.600 -17.997 1.00 42.35 ? 2135 ARG B C     1 
ATOM   2134 O  O     . ARG B 1 73  ? -38.833 23.643 -18.713 1.00 42.64 ? 2135 ARG B O     1 
ATOM   2135 C  CB    . ARG B 1 73  ? -41.584 24.409 -18.593 1.00 43.17 ? 2135 ARG B CB    1 
ATOM   2136 C  CG    . ARG B 1 73  ? -42.993 24.133 -18.117 1.00 44.99 ? 2135 ARG B CG    1 
ATOM   2137 C  CD    . ARG B 1 73  ? -43.984 24.184 -19.294 1.00 51.92 ? 2135 ARG B CD    1 
ATOM   2138 N  NE    . ARG B 1 73  ? -45.096 23.237 -19.105 1.00 59.87 ? 2135 ARG B NE    1 
ATOM   2139 C  CZ    . ARG B 1 73  ? -46.391 23.514 -19.262 1.00 64.40 ? 2135 ARG B CZ    1 
ATOM   2140 N  NH1   . ARG B 1 73  ? -46.786 24.720 -19.658 1.00 67.17 ? 2135 ARG B NH1   1 
ATOM   2141 N  NH2   . ARG B 1 73  ? -47.302 22.568 -19.051 1.00 65.79 ? 2135 ARG B NH2   1 
ATOM   2142 N  N     . HIS B 1 74  ? -38.333 25.602 -17.680 1.00 41.62 ? 2136 HIS B N     1 
ATOM   2143 C  CA    . HIS B 1 74  ? -36.924 25.600 -18.084 1.00 41.57 ? 2136 HIS B CA    1 
ATOM   2144 C  C     . HIS B 1 74  ? -36.707 25.289 -19.573 1.00 40.82 ? 2136 HIS B C     1 
ATOM   2145 O  O     . HIS B 1 74  ? -35.834 24.510 -19.933 1.00 40.69 ? 2136 HIS B O     1 
ATOM   2146 C  CB    . HIS B 1 74  ? -36.110 24.622 -17.212 1.00 41.84 ? 2136 HIS B CB    1 
ATOM   2147 C  CG    . HIS B 1 74  ? -36.473 24.648 -15.755 1.00 44.16 ? 2136 HIS B CG    1 
ATOM   2148 N  ND1   . HIS B 1 74  ? -36.100 25.672 -14.905 1.00 46.27 ? 2136 HIS B ND1   1 
ATOM   2149 C  CD2   . HIS B 1 74  ? -37.176 23.768 -14.995 1.00 46.08 ? 2136 HIS B CD2   1 
ATOM   2150 C  CE1   . HIS B 1 74  ? -36.543 25.419 -13.684 1.00 45.56 ? 2136 HIS B CE1   1 
ATOM   2151 N  NE2   . HIS B 1 74  ? -37.199 24.270 -13.711 1.00 46.52 ? 2136 HIS B NE2   1 
ATOM   2152 N  N     . GLU B 1 75  ? -37.480 25.923 -20.439 1.00 40.85 ? 2137 GLU B N     1 
ATOM   2153 C  CA    . GLU B 1 75  ? -37.411 25.653 -21.881 1.00 40.89 ? 2137 GLU B CA    1 
ATOM   2154 C  C     . GLU B 1 75  ? -36.294 26.439 -22.581 1.00 40.03 ? 2137 GLU B C     1 
ATOM   2155 O  O     . GLU B 1 75  ? -36.557 27.225 -23.509 1.00 40.22 ? 2137 GLU B O     1 
ATOM   2156 C  CB    . GLU B 1 75  ? -38.752 25.984 -22.513 1.00 41.35 ? 2137 GLU B CB    1 
ATOM   2157 C  CG    . GLU B 1 75  ? -39.876 25.225 -21.844 1.00 44.34 ? 2137 GLU B CG    1 
ATOM   2158 C  CD    . GLU B 1 75  ? -41.182 25.382 -22.564 1.00 47.09 ? 2137 GLU B CD    1 
ATOM   2159 O  OE1   . GLU B 1 75  ? -41.375 26.423 -23.219 1.00 45.40 ? 2137 GLU B OE1   1 
ATOM   2160 O  OE2   . GLU B 1 75  ? -42.001 24.443 -22.474 1.00 51.27 ? 2137 GLU B OE2   1 
ATOM   2161 N  N     . TRP B 1 76  ? -35.064 26.243 -22.123 1.00 38.31 ? 2138 TRP B N     1 
ATOM   2162 C  CA    . TRP B 1 76  ? -33.931 26.923 -22.699 1.00 38.24 ? 2138 TRP B CA    1 
ATOM   2163 C  C     . TRP B 1 76  ? -33.550 26.336 -24.071 1.00 39.88 ? 2138 TRP B C     1 
ATOM   2164 O  O     . TRP B 1 76  ? -33.497 25.101 -24.262 1.00 39.79 ? 2138 TRP B O     1 
ATOM   2165 C  CB    . TRP B 1 76  ? -32.704 26.810 -21.799 1.00 37.91 ? 2138 TRP B CB    1 
ATOM   2166 C  CG    . TRP B 1 76  ? -32.907 27.141 -20.345 1.00 36.58 ? 2138 TRP B CG    1 
ATOM   2167 C  CD1   . TRP B 1 76  ? -33.964 27.803 -19.780 1.00 34.58 ? 2138 TRP B CD1   1 
ATOM   2168 C  CD2   . TRP B 1 76  ? -32.004 26.855 -19.283 1.00 38.15 ? 2138 TRP B CD2   1 
ATOM   2169 N  NE1   . TRP B 1 76  ? -33.789 27.925 -18.433 1.00 35.98 ? 2138 TRP B NE1   1 
ATOM   2170 C  CE2   . TRP B 1 76  ? -32.589 27.357 -18.091 1.00 38.49 ? 2138 TRP B CE2   1 
ATOM   2171 C  CE3   . TRP B 1 76  ? -30.748 26.226 -19.216 1.00 40.73 ? 2138 TRP B CE3   1 
ATOM   2172 C  CZ2   . TRP B 1 76  ? -31.971 27.242 -16.847 1.00 40.31 ? 2138 TRP B CZ2   1 
ATOM   2173 C  CZ3   . TRP B 1 76  ? -30.114 26.113 -17.964 1.00 40.55 ? 2138 TRP B CZ3   1 
ATOM   2174 C  CH2   . TRP B 1 76  ? -30.736 26.605 -16.797 1.00 41.79 ? 2138 TRP B CH2   1 
ATOM   2175 N  N     . VAL B 1 77  ? -33.235 27.225 -24.999 1.00 39.21 ? 2139 VAL B N     1 
ATOM   2176 C  CA    . VAL B 1 77  ? -32.622 26.856 -26.261 1.00 40.15 ? 2139 VAL B CA    1 
ATOM   2177 C  C     . VAL B 1 77  ? -31.464 25.890 -25.982 1.00 40.67 ? 2139 VAL B C     1 
ATOM   2178 O  O     . VAL B 1 77  ? -30.822 25.997 -24.950 1.00 39.41 ? 2139 VAL B O     1 
ATOM   2179 C  CB    . VAL B 1 77  ? -32.106 28.162 -26.893 1.00 39.88 ? 2139 VAL B CB    1 
ATOM   2180 C  CG1   . VAL B 1 77  ? -30.726 28.050 -27.368 1.00 41.52 ? 2139 VAL B CG1   1 
ATOM   2181 C  CG2   . VAL B 1 77  ? -33.096 28.744 -27.897 1.00 39.24 ? 2139 VAL B CG2   1 
ATOM   2182 N  N     . GLN B 1 78  ? -31.195 24.962 -26.909 1.00 41.71 ? 2140 GLN B N     1 
ATOM   2183 C  CA    . GLN B 1 78  ? -30.128 23.948 -26.727 1.00 42.74 ? 2140 GLN B CA    1 
ATOM   2184 C  C     . GLN B 1 78  ? -28.910 24.150 -27.598 1.00 41.82 ? 2140 GLN B C     1 
ATOM   2185 O  O     . GLN B 1 78  ? -28.016 23.310 -27.629 1.00 42.44 ? 2140 GLN B O     1 
ATOM   2186 C  CB    . GLN B 1 78  ? -30.666 22.540 -27.011 1.00 44.11 ? 2140 GLN B CB    1 
ATOM   2187 C  CG    . GLN B 1 78  ? -31.939 22.199 -26.274 1.00 48.70 ? 2140 GLN B CG    1 
ATOM   2188 C  CD    . GLN B 1 78  ? -31.667 21.891 -24.844 1.00 55.72 ? 2140 GLN B CD    1 
ATOM   2189 O  OE1   . GLN B 1 78  ? -30.625 22.257 -24.313 1.00 60.53 ? 2140 GLN B OE1   1 
ATOM   2190 N  NE2   . GLN B 1 78  ? -32.587 21.192 -24.209 1.00 58.07 ? 2140 GLN B NE2   1 
ATOM   2191 N  N     . CYS B 1 79  ? -28.851 25.269 -28.290 1.00 41.34 ? 2141 CYS B N     1 
ATOM   2192 C  CA    . CYS B 1 79  ? -27.861 25.443 -29.338 1.00 40.53 ? 2141 CYS B CA    1 
ATOM   2193 C  C     . CYS B 1 79  ? -26.800 26.464 -28.954 1.00 40.08 ? 2141 CYS B C     1 
ATOM   2194 O  O     . CYS B 1 79  ? -26.161 27.046 -29.825 1.00 39.70 ? 2141 CYS B O     1 
ATOM   2195 C  CB    . CYS B 1 79  ? -28.568 25.921 -30.598 1.00 40.26 ? 2141 CYS B CB    1 
ATOM   2196 S  SG    . CYS B 1 79  ? -29.677 27.382 -30.293 1.00 42.46 ? 2141 CYS B SG    1 
ATOM   2197 N  N     . LEU B 1 80  ? -26.608 26.694 -27.661 1.00 38.47 ? 2142 LEU B N     1 
ATOM   2198 C  CA    . LEU B 1 80  ? -25.630 27.703 -27.247 1.00 37.68 ? 2142 LEU B CA    1 
ATOM   2199 C  C     . LEU B 1 80  ? -24.287 27.091 -27.031 1.00 37.30 ? 2142 LEU B C     1 
ATOM   2200 O  O     . LEU B 1 80  ? -24.198 25.938 -26.656 1.00 37.38 ? 2142 LEU B O     1 
ATOM   2201 C  CB    . LEU B 1 80  ? -26.064 28.429 -25.954 1.00 37.53 ? 2142 LEU B CB    1 
ATOM   2202 C  CG    . LEU B 1 80  ? -27.452 29.071 -26.028 1.00 35.44 ? 2142 LEU B CG    1 
ATOM   2203 C  CD1   . LEU B 1 80  ? -27.816 29.633 -24.677 1.00 38.78 ? 2142 LEU B CD1   1 
ATOM   2204 C  CD2   . LEU B 1 80  ? -27.461 30.146 -27.081 1.00 33.97 ? 2142 LEU B CD2   1 
ATOM   2205 N  N     . GLU B 1 81  ? -23.241 27.894 -27.206 1.00 37.15 ? 2143 GLU B N     1 
ATOM   2206 C  CA    . GLU B 1 81  ? -21.891 27.398 -27.150 1.00 37.68 ? 2143 GLU B CA    1 
ATOM   2207 C  C     . GLU B 1 81  ? -20.961 28.447 -26.590 1.00 37.60 ? 2143 GLU B C     1 
ATOM   2208 O  O     . GLU B 1 81  ? -20.986 29.613 -27.021 1.00 37.20 ? 2143 GLU B O     1 
ATOM   2209 C  CB    . GLU B 1 81  ? -21.467 27.068 -28.586 1.00 37.80 ? 2143 GLU B CB    1 
ATOM   2210 C  CG    . GLU B 1 81  ? -20.020 26.746 -28.772 1.00 41.68 ? 2143 GLU B CG    1 
ATOM   2211 C  CD    . GLU B 1 81  ? -19.693 26.442 -30.244 1.00 45.65 ? 2143 GLU B CD    1 
ATOM   2212 O  OE1   . GLU B 1 81  ? -19.613 27.402 -31.054 1.00 46.29 ? 2143 GLU B OE1   1 
ATOM   2213 O  OE2   . GLU B 1 81  ? -19.513 25.249 -30.574 1.00 47.27 ? 2143 GLU B OE2   1 
ATOM   2214 N  N     . ARG B 1 82  ? -20.103 28.036 -25.667 1.00 37.45 ? 2144 ARG B N     1 
ATOM   2215 C  CA    . ARG B 1 82  ? -19.111 28.937 -25.089 1.00 38.91 ? 2144 ARG B CA    1 
ATOM   2216 C  C     . ARG B 1 82  ? -17.909 29.011 -26.046 1.00 39.65 ? 2144 ARG B C     1 
ATOM   2217 O  O     . ARG B 1 82  ? -17.474 27.967 -26.506 1.00 39.53 ? 2144 ARG B O     1 
ATOM   2218 C  CB    . ARG B 1 82  ? -18.668 28.374 -23.731 1.00 38.36 ? 2144 ARG B CB    1 
ATOM   2219 C  CG    . ARG B 1 82  ? -18.093 29.362 -22.761 1.00 40.92 ? 2144 ARG B CG    1 
ATOM   2220 C  CD    . ARG B 1 82  ? -18.468 28.887 -21.372 1.00 41.56 ? 2144 ARG B CD    1 
ATOM   2221 N  NE    . ARG B 1 82  ? -17.411 28.242 -20.645 1.00 43.84 ? 2144 ARG B NE    1 
ATOM   2222 C  CZ    . ARG B 1 82  ? -17.566 27.304 -19.720 1.00 43.66 ? 2144 ARG B CZ    1 
ATOM   2223 N  NH1   . ARG B 1 82  ? -18.705 26.831 -19.415 1.00 45.26 ? 2144 ARG B NH1   1 
ATOM   2224 N  NH2   . ARG B 1 82  ? -16.562 26.783 -19.104 1.00 44.15 ? 2144 ARG B NH2   1 
ATOM   2225 N  N     . PHE B 1 83  ? -17.393 30.216 -26.333 1.00 40.20 ? 2145 PHE B N     1 
ATOM   2226 C  CA    . PHE B 1 83  ? -16.263 30.395 -27.252 1.00 41.68 ? 2145 PHE B CA    1 
ATOM   2227 C  C     . PHE B 1 83  ? -15.400 31.595 -26.856 1.00 44.02 ? 2145 PHE B C     1 
ATOM   2228 O  O     . PHE B 1 83  ? -15.856 32.491 -26.109 1.00 43.27 ? 2145 PHE B O     1 
ATOM   2229 C  CB    . PHE B 1 83  ? -16.757 30.614 -28.679 1.00 41.24 ? 2145 PHE B CB    1 
ATOM   2230 C  CG    . PHE B 1 83  ? -17.254 32.026 -28.938 1.00 39.48 ? 2145 PHE B CG    1 
ATOM   2231 C  CD1   . PHE B 1 83  ? -16.498 32.916 -29.695 1.00 37.85 ? 2145 PHE B CD1   1 
ATOM   2232 C  CD2   . PHE B 1 83  ? -18.483 32.464 -28.397 1.00 37.08 ? 2145 PHE B CD2   1 
ATOM   2233 C  CE1   . PHE B 1 83  ? -16.947 34.236 -29.932 1.00 36.09 ? 2145 PHE B CE1   1 
ATOM   2234 C  CE2   . PHE B 1 83  ? -18.963 33.772 -28.619 1.00 34.89 ? 2145 PHE B CE2   1 
ATOM   2235 C  CZ    . PHE B 1 83  ? -18.188 34.670 -29.396 1.00 37.20 ? 2145 PHE B CZ    1 
ATOM   2236 N  N     . ARG B 1 84  ? -14.158 31.633 -27.357 1.00 46.33 ? 2146 ARG B N     1 
ATOM   2237 C  CA    . ARG B 1 84  ? -13.269 32.757 -27.046 1.00 48.67 ? 2146 ARG B CA    1 
ATOM   2238 C  C     . ARG B 1 84  ? -13.610 33.953 -27.915 1.00 49.56 ? 2146 ARG B C     1 
ATOM   2239 O  O     . ARG B 1 84  ? -13.604 33.862 -29.134 1.00 49.63 ? 2146 ARG B O     1 
ATOM   2240 C  CB    . ARG B 1 84  ? -11.786 32.371 -27.116 1.00 49.25 ? 2146 ARG B CB    1 
ATOM   2241 C  CG    . ARG B 1 84  ? -11.069 32.425 -25.725 1.00 53.27 ? 2146 ARG B CG    1 
ATOM   2242 C  CD    . ARG B 1 84  ? -9.561  32.025 -25.741 1.00 59.79 ? 2146 ARG B CD    1 
ATOM   2243 N  NE    . ARG B 1 84  ? -9.341  30.881 -26.626 1.00 64.00 ? 2146 ARG B NE    1 
ATOM   2244 C  CZ    . ARG B 1 84  ? -9.156  29.622 -26.233 1.00 65.27 ? 2146 ARG B CZ    1 
ATOM   2245 N  NH1   . ARG B 1 84  ? -9.120  29.306 -24.939 1.00 65.79 ? 2146 ARG B NH1   1 
ATOM   2246 N  NH2   . ARG B 1 84  ? -8.994  28.673 -27.148 1.00 66.82 ? 2146 ARG B NH2   1 
ATOM   2247 N  N     . ALA B 1 85  ? -13.963 35.073 -27.285 1.00 50.55 ? 2147 ALA B N     1 
ATOM   2248 C  CA    . ALA B 1 85  ? -14.341 36.253 -28.047 1.00 51.82 ? 2147 ALA B CA    1 
ATOM   2249 C  C     . ALA B 1 85  ? -13.239 37.284 -28.012 1.00 52.82 ? 2147 ALA B C     1 
ATOM   2250 O  O     . ALA B 1 85  ? -12.839 37.759 -26.961 1.00 53.73 ? 2147 ALA B O     1 
ATOM   2251 C  CB    . ALA B 1 85  ? -15.673 36.840 -27.570 1.00 51.63 ? 2147 ALA B CB    1 
ATOM   2252 N  N     . GLU B 1 86  ? -12.750 37.629 -29.189 1.00 54.44 ? 2148 GLU B N     1 
ATOM   2253 C  CA    . GLU B 1 86  ? -11.578 38.462 -29.301 1.00 55.39 ? 2148 GLU B CA    1 
ATOM   2254 C  C     . GLU B 1 86  ? -11.670 39.675 -28.398 1.00 54.49 ? 2148 GLU B C     1 
ATOM   2255 O  O     . GLU B 1 86  ? -12.558 40.520 -28.573 1.00 55.03 ? 2148 GLU B O     1 
ATOM   2256 C  CB    . GLU B 1 86  ? -11.431 38.907 -30.746 1.00 56.76 ? 2148 GLU B CB    1 
ATOM   2257 C  CG    . GLU B 1 86  ? -9.994  38.921 -31.215 1.00 62.16 ? 2148 GLU B CG    1 
ATOM   2258 C  CD    . GLU B 1 86  ? -9.883  39.380 -32.638 1.00 69.34 ? 2148 GLU B CD    1 
ATOM   2259 O  OE1   . GLU B 1 86  ? -10.490 40.432 -32.974 1.00 72.40 ? 2148 GLU B OE1   1 
ATOM   2260 O  OE2   . GLU B 1 86  ? -9.189  38.687 -33.418 1.00 72.60 ? 2148 GLU B OE2   1 
ATOM   2261 N  N     . GLU B 1 87  ? -10.758 39.752 -27.430 1.00 52.92 ? 2149 GLU B N     1 
ATOM   2262 C  CA    . GLU B 1 87  ? -10.651 40.920 -26.546 1.00 51.91 ? 2149 GLU B CA    1 
ATOM   2263 C  C     . GLU B 1 87  ? -11.614 40.858 -25.352 1.00 49.97 ? 2149 GLU B C     1 
ATOM   2264 O  O     . GLU B 1 87  ? -11.521 41.690 -24.445 1.00 50.18 ? 2149 GLU B O     1 
ATOM   2265 C  CB    . GLU B 1 87  ? -10.887 42.240 -27.314 1.00 52.72 ? 2149 GLU B CB    1 
ATOM   2266 C  CG    . GLU B 1 87  ? -9.992  42.479 -28.556 1.00 56.66 ? 2149 GLU B CG    1 
ATOM   2267 C  CD    . GLU B 1 87  ? -9.257  43.823 -28.479 1.00 62.11 ? 2149 GLU B CD    1 
ATOM   2268 O  OE1   . GLU B 1 87  ? -9.858  44.886 -28.801 1.00 63.31 ? 2149 GLU B OE1   1 
ATOM   2269 O  OE2   . GLU B 1 87  ? -8.070  43.802 -28.071 1.00 63.58 ? 2149 GLU B OE2   1 
ATOM   2270 N  N     . LYS B 1 88  ? -12.534 39.892 -25.362 1.00 46.81 ? 2150 LYS B N     1 
ATOM   2271 C  CA    . LYS B 1 88  ? -13.600 39.826 -24.352 1.00 44.58 ? 2150 LYS B CA    1 
ATOM   2272 C  C     . LYS B 1 88  ? -13.639 38.495 -23.607 1.00 43.73 ? 2150 LYS B C     1 
ATOM   2273 O  O     . LYS B 1 88  ? -14.721 38.069 -23.171 1.00 44.14 ? 2150 LYS B O     1 
ATOM   2274 C  CB    . LYS B 1 88  ? -14.965 40.086 -24.998 1.00 43.01 ? 2150 LYS B CB    1 
ATOM   2275 C  CG    . LYS B 1 88  ? -15.083 41.439 -25.680 1.00 41.72 ? 2150 LYS B CG    1 
ATOM   2276 C  CD    . LYS B 1 88  ? -16.375 41.601 -26.508 1.00 38.96 ? 2150 LYS B CD    1 
ATOM   2277 C  CE    . LYS B 1 88  ? -16.630 40.423 -27.424 1.00 36.25 ? 2150 LYS B CE    1 
ATOM   2278 N  NZ    . LYS B 1 88  ? -17.801 40.683 -28.330 1.00 36.06 ? 2150 LYS B NZ    1 
ATOM   2279 N  N     . GLY B 1 89  ? -12.481 37.837 -23.466 1.00 41.41 ? 2151 GLY B N     1 
ATOM   2280 C  CA    . GLY B 1 89  ? -12.420 36.541 -22.807 1.00 39.26 ? 2151 GLY B CA    1 
ATOM   2281 C  C     . GLY B 1 89  ? -13.387 35.567 -23.455 1.00 38.98 ? 2151 GLY B C     1 
ATOM   2282 O  O     . GLY B 1 89  ? -13.480 35.527 -24.691 1.00 38.76 ? 2151 GLY B O     1 
ATOM   2283 N  N     . TRP B 1 90  ? -14.130 34.792 -22.644 1.00 37.52 ? 2152 TRP B N     1 
ATOM   2284 C  CA    . TRP B 1 90  ? -15.181 33.920 -23.165 1.00 36.48 ? 2152 TRP B CA    1 
ATOM   2285 C  C     . TRP B 1 90  ? -16.527 34.627 -23.433 1.00 35.71 ? 2152 TRP B C     1 
ATOM   2286 O  O     . TRP B 1 90  ? -16.894 35.581 -22.736 1.00 36.14 ? 2152 TRP B O     1 
ATOM   2287 C  CB    . TRP B 1 90  ? -15.417 32.732 -22.232 1.00 37.81 ? 2152 TRP B CB    1 
ATOM   2288 C  CG    . TRP B 1 90  ? -14.235 31.868 -22.099 1.00 42.51 ? 2152 TRP B CG    1 
ATOM   2289 C  CD1   . TRP B 1 90  ? -13.214 32.009 -21.197 1.00 46.50 ? 2152 TRP B CD1   1 
ATOM   2290 C  CD2   . TRP B 1 90  ? -13.909 30.746 -22.910 1.00 44.82 ? 2152 TRP B CD2   1 
ATOM   2291 N  NE1   . TRP B 1 90  ? -12.277 31.026 -21.393 1.00 48.26 ? 2152 TRP B NE1   1 
ATOM   2292 C  CE2   . TRP B 1 90  ? -12.681 30.234 -22.437 1.00 47.88 ? 2152 TRP B CE2   1 
ATOM   2293 C  CE3   . TRP B 1 90  ? -14.544 30.107 -23.977 1.00 44.93 ? 2152 TRP B CE3   1 
ATOM   2294 C  CZ2   . TRP B 1 90  ? -12.062 29.116 -23.009 1.00 49.09 ? 2152 TRP B CZ2   1 
ATOM   2295 C  CZ3   . TRP B 1 90  ? -13.944 28.984 -24.538 1.00 46.86 ? 2152 TRP B CZ3   1 
ATOM   2296 C  CH2   . TRP B 1 90  ? -12.710 28.503 -24.055 1.00 48.92 ? 2152 TRP B CH2   1 
ATOM   2297 N  N     . GLY B 1 91  ? -17.273 34.116 -24.408 1.00 33.44 ? 2153 GLY B N     1 
ATOM   2298 C  CA    . GLY B 1 91  ? -18.533 34.722 -24.826 1.00 31.98 ? 2153 GLY B CA    1 
ATOM   2299 C  C     . GLY B 1 91  ? -19.438 33.561 -25.116 1.00 31.46 ? 2153 GLY B C     1 
ATOM   2300 O  O     . GLY B 1 91  ? -19.026 32.401 -24.983 1.00 31.14 ? 2153 GLY B O     1 
ATOM   2301 N  N     . ILE B 1 92  ? -20.664 33.850 -25.502 1.00 30.46 ? 2154 ILE B N     1 
ATOM   2302 C  CA    . ILE B 1 92  ? -21.600 32.812 -25.818 1.00 31.33 ? 2154 ILE B CA    1 
ATOM   2303 C  C     . ILE B 1 92  ? -22.160 33.085 -27.207 1.00 32.22 ? 2154 ILE B C     1 
ATOM   2304 O  O     . ILE B 1 92  ? -22.558 34.227 -27.498 1.00 32.31 ? 2154 ILE B O     1 
ATOM   2305 C  CB    . ILE B 1 92  ? -22.789 32.803 -24.829 1.00 31.12 ? 2154 ILE B CB    1 
ATOM   2306 C  CG1   . ILE B 1 92  ? -22.367 32.287 -23.439 1.00 31.27 ? 2154 ILE B CG1   1 
ATOM   2307 C  CG2   . ILE B 1 92  ? -23.887 31.931 -25.367 1.00 29.65 ? 2154 ILE B CG2   1 
ATOM   2308 C  CD1   . ILE B 1 92  ? -21.998 30.779 -23.385 1.00 29.20 ? 2154 ILE B CD1   1 
ATOM   2309 N  N     . ARG B 1 93  ? -22.215 32.061 -28.053 1.00 33.09 ? 2155 ARG B N     1 
ATOM   2310 C  CA    . ARG B 1 93  ? -22.852 32.246 -29.358 1.00 35.23 ? 2155 ARG B CA    1 
ATOM   2311 C  C     . ARG B 1 93  ? -23.926 31.212 -29.627 1.00 35.75 ? 2155 ARG B C     1 
ATOM   2312 O  O     . ARG B 1 93  ? -23.963 30.153 -28.969 1.00 36.12 ? 2155 ARG B O     1 
ATOM   2313 C  CB    . ARG B 1 93  ? -21.807 32.262 -30.495 1.00 35.30 ? 2155 ARG B CB    1 
ATOM   2314 C  CG    . ARG B 1 93  ? -21.105 30.917 -30.705 1.00 36.36 ? 2155 ARG B CG    1 
ATOM   2315 C  CD    . ARG B 1 93  ? -19.929 31.083 -31.692 1.00 40.69 ? 2155 ARG B CD    1 
ATOM   2316 N  NE    . ARG B 1 93  ? -19.118 29.870 -31.839 1.00 40.97 ? 2155 ARG B NE    1 
ATOM   2317 C  CZ    . ARG B 1 93  ? -17.848 29.849 -32.255 1.00 44.05 ? 2155 ARG B CZ    1 
ATOM   2318 N  NH1   . ARG B 1 93  ? -17.215 30.977 -32.564 1.00 43.31 ? 2155 ARG B NH1   1 
ATOM   2319 N  NH2   . ARG B 1 93  ? -17.198 28.683 -32.349 1.00 43.11 ? 2155 ARG B NH2   1 
ATOM   2320 N  N     . THR B 1 94  ? -24.796 31.495 -30.601 1.00 35.96 ? 2156 THR B N     1 
ATOM   2321 C  CA    . THR B 1 94  ? -25.825 30.516 -30.938 1.00 36.92 ? 2156 THR B CA    1 
ATOM   2322 C  C     . THR B 1 94  ? -25.424 29.759 -32.189 1.00 39.59 ? 2156 THR B C     1 
ATOM   2323 O  O     . THR B 1 94  ? -24.852 30.351 -33.115 1.00 39.40 ? 2156 THR B O     1 
ATOM   2324 C  CB    . THR B 1 94  ? -27.216 31.100 -31.083 1.00 36.01 ? 2156 THR B CB    1 
ATOM   2325 O  OG1   . THR B 1 94  ? -28.143 30.055 -31.440 1.00 37.17 ? 2156 THR B OG1   1 
ATOM   2326 C  CG2   . THR B 1 94  ? -27.257 32.211 -32.134 1.00 35.21 ? 2156 THR B CG2   1 
ATOM   2327 N  N     . LYS B 1 95  ? -25.709 28.455 -32.198 1.00 40.32 ? 2157 LYS B N     1 
ATOM   2328 C  CA    . LYS B 1 95  ? -25.246 27.579 -33.257 1.00 42.06 ? 2157 LYS B CA    1 
ATOM   2329 C  C     . LYS B 1 95  ? -26.337 27.445 -34.303 1.00 43.12 ? 2157 LYS B C     1 
ATOM   2330 O  O     . LYS B 1 95  ? -26.120 26.845 -35.369 1.00 43.06 ? 2157 LYS B O     1 
ATOM   2331 C  CB    . LYS B 1 95  ? -24.872 26.189 -32.695 1.00 41.93 ? 2157 LYS B CB    1 
ATOM   2332 C  CG    . LYS B 1 95  ? -23.448 26.092 -32.195 1.00 42.00 ? 2157 LYS B CG    1 
ATOM   2333 C  CD    . LYS B 1 95  ? -23.094 24.662 -31.741 1.00 43.89 ? 2157 LYS B CD    1 
ATOM   2334 C  CE    . LYS B 1 95  ? -23.934 24.197 -30.539 1.00 45.99 ? 2157 LYS B CE    1 
ATOM   2335 N  NZ    . LYS B 1 95  ? -23.408 22.960 -29.889 1.00 44.91 ? 2157 LYS B NZ    1 
ATOM   2336 N  N     . GLU B 1 96  ? -27.509 27.986 -33.959 1.00 43.80 ? 2158 GLU B N     1 
ATOM   2337 C  CA    . GLU B 1 96  ? -28.673 27.973 -34.815 1.00 44.57 ? 2158 GLU B CA    1 
ATOM   2338 C  C     . GLU B 1 96  ? -29.329 29.348 -34.851 1.00 44.37 ? 2158 GLU B C     1 
ATOM   2339 O  O     . GLU B 1 96  ? -29.116 30.156 -33.948 1.00 44.41 ? 2158 GLU B O     1 
ATOM   2340 C  CB    . GLU B 1 96  ? -29.689 26.941 -34.323 1.00 45.96 ? 2158 GLU B CB    1 
ATOM   2341 C  CG    . GLU B 1 96  ? -29.203 25.506 -34.288 1.00 48.87 ? 2158 GLU B CG    1 
ATOM   2342 C  CD    . GLU B 1 96  ? -30.245 24.558 -33.695 1.00 56.32 ? 2158 GLU B CD    1 
ATOM   2343 O  OE1   . GLU B 1 96  ? -31.458 24.806 -33.865 1.00 59.02 ? 2158 GLU B OE1   1 
ATOM   2344 O  OE2   . GLU B 1 96  ? -29.856 23.565 -33.040 1.00 58.04 ? 2158 GLU B OE2   1 
ATOM   2345 N  N     . PRO B 1 97  ? -30.132 29.622 -35.898 1.00 43.63 ? 2159 PRO B N     1 
ATOM   2346 C  CA    . PRO B 1 97  ? -30.849 30.895 -35.950 1.00 43.10 ? 2159 PRO B CA    1 
ATOM   2347 C  C     . PRO B 1 97  ? -31.840 31.021 -34.804 1.00 42.50 ? 2159 PRO B C     1 
ATOM   2348 O  O     . PRO B 1 97  ? -32.408 30.019 -34.348 1.00 43.07 ? 2159 PRO B O     1 
ATOM   2349 C  CB    . PRO B 1 97  ? -31.595 30.864 -37.297 1.00 43.44 ? 2159 PRO B CB    1 
ATOM   2350 C  CG    . PRO B 1 97  ? -31.355 29.510 -37.908 1.00 43.32 ? 2159 PRO B CG    1 
ATOM   2351 C  CD    . PRO B 1 97  ? -30.414 28.736 -37.048 1.00 44.18 ? 2159 PRO B CD    1 
ATOM   2352 N  N     . LEU B 1 98  ? -32.023 32.255 -34.351 1.00 41.68 ? 2160 LEU B N     1 
ATOM   2353 C  CA    . LEU B 1 98  ? -32.951 32.613 -33.282 1.00 40.51 ? 2160 LEU B CA    1 
ATOM   2354 C  C     . LEU B 1 98  ? -33.827 33.739 -33.797 1.00 40.67 ? 2160 LEU B C     1 
ATOM   2355 O  O     . LEU B 1 98  ? -33.357 34.575 -34.596 1.00 40.93 ? 2160 LEU B O     1 
ATOM   2356 C  CB    . LEU B 1 98  ? -32.167 33.105 -32.065 1.00 39.50 ? 2160 LEU B CB    1 
ATOM   2357 C  CG    . LEU B 1 98  ? -31.168 32.133 -31.449 1.00 38.22 ? 2160 LEU B CG    1 
ATOM   2358 C  CD1   . LEU B 1 98  ? -30.389 32.776 -30.265 1.00 33.36 ? 2160 LEU B CD1   1 
ATOM   2359 C  CD2   . LEU B 1 98  ? -31.872 30.846 -31.041 1.00 37.47 ? 2160 LEU B CD2   1 
ATOM   2360 N  N     . LYS B 1 99  ? -35.072 33.794 -33.327 1.00 40.36 ? 2161 LYS B N     1 
ATOM   2361 C  CA    . LYS B 1 99  ? -36.030 34.804 -33.783 1.00 41.12 ? 2161 LYS B CA    1 
ATOM   2362 C  C     . LYS B 1 99  ? -36.257 35.926 -32.778 1.00 41.15 ? 2161 LYS B C     1 
ATOM   2363 O  O     . LYS B 1 99  ? -36.201 35.709 -31.557 1.00 40.97 ? 2161 LYS B O     1 
ATOM   2364 C  CB    . LYS B 1 99  ? -37.380 34.144 -34.079 1.00 41.29 ? 2161 LYS B CB    1 
ATOM   2365 C  CG    . LYS B 1 99  ? -37.306 32.947 -35.005 1.00 44.77 ? 2161 LYS B CG    1 
ATOM   2366 C  CD    . LYS B 1 99  ? -37.917 33.326 -36.315 1.00 52.26 ? 2161 LYS B CD    1 
ATOM   2367 C  CE    . LYS B 1 99  ? -38.135 32.170 -37.294 1.00 58.23 ? 2161 LYS B CE    1 
ATOM   2368 N  NZ    . LYS B 1 99  ? -39.076 32.646 -38.360 1.00 62.10 ? 2161 LYS B NZ    1 
ATOM   2369 N  N     . ALA B 1 100 ? -36.552 37.121 -33.295 1.00 40.61 ? 2162 ALA B N     1 
ATOM   2370 C  CA    . ALA B 1 100 ? -36.905 38.256 -32.472 1.00 39.41 ? 2162 ALA B CA    1 
ATOM   2371 C  C     . ALA B 1 100 ? -37.928 37.805 -31.434 1.00 39.04 ? 2162 ALA B C     1 
ATOM   2372 O  O     . ALA B 1 100 ? -38.914 37.130 -31.767 1.00 38.89 ? 2162 ALA B O     1 
ATOM   2373 C  CB    . ALA B 1 100 ? -37.485 39.358 -33.322 1.00 40.29 ? 2162 ALA B CB    1 
ATOM   2374 N  N     . GLY B 1 101 ? -37.681 38.157 -30.176 1.00 37.51 ? 2163 GLY B N     1 
ATOM   2375 C  CA    . GLY B 1 101 ? -38.665 37.930 -29.121 1.00 37.04 ? 2163 GLY B CA    1 
ATOM   2376 C  C     . GLY B 1 101 ? -38.618 36.569 -28.465 1.00 37.03 ? 2163 GLY B C     1 
ATOM   2377 O  O     . GLY B 1 101 ? -39.310 36.334 -27.471 1.00 38.00 ? 2163 GLY B O     1 
ATOM   2378 N  N     . GLN B 1 102 ? -37.824 35.653 -29.000 1.00 36.27 ? 2164 GLN B N     1 
ATOM   2379 C  CA    . GLN B 1 102 ? -37.826 34.332 -28.416 1.00 36.89 ? 2164 GLN B CA    1 
ATOM   2380 C  C     . GLN B 1 102 ? -37.056 34.264 -27.100 1.00 36.01 ? 2164 GLN B C     1 
ATOM   2381 O  O     . GLN B 1 102 ? -36.027 34.928 -26.905 1.00 35.94 ? 2164 GLN B O     1 
ATOM   2382 C  CB    . GLN B 1 102 ? -37.390 33.262 -29.404 1.00 37.05 ? 2164 GLN B CB    1 
ATOM   2383 C  CG    . GLN B 1 102 ? -35.981 32.814 -29.301 1.00 41.19 ? 2164 GLN B CG    1 
ATOM   2384 C  CD    . GLN B 1 102 ? -35.687 31.663 -30.251 1.00 42.91 ? 2164 GLN B CD    1 
ATOM   2385 O  OE1   . GLN B 1 102 ? -35.552 31.864 -31.456 1.00 42.19 ? 2164 GLN B OE1   1 
ATOM   2386 N  NE2   . GLN B 1 102 ? -35.578 30.450 -29.703 1.00 45.85 ? 2164 GLN B NE2   1 
ATOM   2387 N  N     . PHE B 1 103 ? -37.611 33.486 -26.182 1.00 34.88 ? 2165 PHE B N     1 
ATOM   2388 C  CA    . PHE B 1 103 ? -36.949 33.153 -24.939 1.00 34.42 ? 2165 PHE B CA    1 
ATOM   2389 C  C     . PHE B 1 103 ? -35.643 32.419 -25.248 1.00 33.43 ? 2165 PHE B C     1 
ATOM   2390 O  O     . PHE B 1 103 ? -35.604 31.554 -26.105 1.00 32.60 ? 2165 PHE B O     1 
ATOM   2391 C  CB    . PHE B 1 103 ? -37.881 32.307 -24.049 1.00 33.41 ? 2165 PHE B CB    1 
ATOM   2392 C  CG    . PHE B 1 103 ? -37.241 31.840 -22.764 1.00 34.20 ? 2165 PHE B CG    1 
ATOM   2393 C  CD1   . PHE B 1 103 ? -36.705 32.747 -21.859 1.00 34.18 ? 2165 PHE B CD1   1 
ATOM   2394 C  CD2   . PHE B 1 103 ? -37.193 30.485 -22.445 1.00 31.63 ? 2165 PHE B CD2   1 
ATOM   2395 C  CE1   . PHE B 1 103 ? -36.134 32.312 -20.662 1.00 31.28 ? 2165 PHE B CE1   1 
ATOM   2396 C  CE2   . PHE B 1 103 ? -36.626 30.057 -21.265 1.00 32.21 ? 2165 PHE B CE2   1 
ATOM   2397 C  CZ    . PHE B 1 103 ? -36.090 30.960 -20.376 1.00 32.07 ? 2165 PHE B CZ    1 
ATOM   2398 N  N     . ILE B 1 104 ? -34.560 32.778 -24.573 1.00 32.37 ? 2166 ILE B N     1 
ATOM   2399 C  CA    . ILE B 1 104 ? -33.339 32.039 -24.818 1.00 31.50 ? 2166 ILE B CA    1 
ATOM   2400 C  C     . ILE B 1 104 ? -32.897 31.234 -23.610 1.00 30.96 ? 2166 ILE B C     1 
ATOM   2401 O  O     . ILE B 1 104 ? -32.711 30.012 -23.698 1.00 31.87 ? 2166 ILE B O     1 
ATOM   2402 C  CB    . ILE B 1 104 ? -32.242 32.953 -25.313 1.00 31.28 ? 2166 ILE B CB    1 
ATOM   2403 C  CG1   . ILE B 1 104 ? -32.653 33.559 -26.679 1.00 33.29 ? 2166 ILE B CG1   1 
ATOM   2404 C  CG2   . ILE B 1 104 ? -30.933 32.224 -25.358 1.00 30.28 ? 2166 ILE B CG2   1 
ATOM   2405 C  CD1   . ILE B 1 104 ? -31.775 34.784 -27.121 1.00 34.88 ? 2166 ILE B CD1   1 
ATOM   2406 N  N     . ILE B 1 105 ? -32.712 31.901 -22.481 1.00 29.18 ? 2167 ILE B N     1 
ATOM   2407 C  CA    . ILE B 1 105 ? -32.264 31.164 -21.309 1.00 27.57 ? 2167 ILE B CA    1 
ATOM   2408 C  C     . ILE B 1 105 ? -32.547 32.007 -20.069 1.00 26.76 ? 2167 ILE B C     1 
ATOM   2409 O  O     . ILE B 1 105 ? -32.599 33.230 -20.184 1.00 25.53 ? 2167 ILE B O     1 
ATOM   2410 C  CB    . ILE B 1 105 ? -30.763 30.825 -21.451 1.00 27.51 ? 2167 ILE B CB    1 
ATOM   2411 C  CG1   . ILE B 1 105 ? -30.299 29.888 -20.322 1.00 26.65 ? 2167 ILE B CG1   1 
ATOM   2412 C  CG2   . ILE B 1 105 ? -29.918 32.102 -21.541 1.00 24.64 ? 2167 ILE B CG2   1 
ATOM   2413 C  CD1   . ILE B 1 105 ? -28.819 29.379 -20.498 1.00 29.89 ? 2167 ILE B CD1   1 
ATOM   2414 N  N     . GLU B 1 106 ? -32.738 31.362 -18.912 1.00 25.59 ? 2168 GLU B N     1 
ATOM   2415 C  CA    . GLU B 1 106 ? -32.850 32.101 -17.627 1.00 25.29 ? 2168 GLU B CA    1 
ATOM   2416 C  C     . GLU B 1 106 ? -31.453 32.455 -17.147 1.00 24.98 ? 2168 GLU B C     1 
ATOM   2417 O  O     . GLU B 1 106 ? -30.502 31.697 -17.327 1.00 24.80 ? 2168 GLU B O     1 
ATOM   2418 C  CB    . GLU B 1 106 ? -33.638 31.309 -16.537 1.00 24.85 ? 2168 GLU B CB    1 
ATOM   2419 C  CG    . GLU B 1 106 ? -33.895 32.158 -15.251 1.00 25.13 ? 2168 GLU B CG    1 
ATOM   2420 C  CD    . GLU B 1 106 ? -34.706 31.419 -14.208 1.00 26.49 ? 2168 GLU B CD    1 
ATOM   2421 O  OE1   . GLU B 1 106 ? -35.096 30.261 -14.463 1.00 28.04 ? 2168 GLU B OE1   1 
ATOM   2422 O  OE2   . GLU B 1 106 ? -34.957 31.996 -13.128 1.00 26.24 ? 2168 GLU B OE2   1 
ATOM   2423 N  N     . TYR B 1 107 ? -31.312 33.634 -16.580 1.00 24.21 ? 2169 TYR B N     1 
ATOM   2424 C  CA    . TYR B 1 107 ? -30.065 34.014 -15.948 1.00 23.81 ? 2169 TYR B CA    1 
ATOM   2425 C  C     . TYR B 1 107 ? -30.138 33.561 -14.488 1.00 23.40 ? 2169 TYR B C     1 
ATOM   2426 O  O     . TYR B 1 107 ? -30.992 34.019 -13.715 1.00 23.32 ? 2169 TYR B O     1 
ATOM   2427 C  CB    . TYR B 1 107 ? -29.838 35.524 -16.046 1.00 23.39 ? 2169 TYR B CB    1 
ATOM   2428 C  CG    . TYR B 1 107 ? -28.494 35.997 -15.491 1.00 26.02 ? 2169 TYR B CG    1 
ATOM   2429 C  CD1   . TYR B 1 107 ? -27.451 36.320 -16.349 1.00 23.93 ? 2169 TYR B CD1   1 
ATOM   2430 C  CD2   . TYR B 1 107 ? -28.254 36.073 -14.106 1.00 24.68 ? 2169 TYR B CD2   1 
ATOM   2431 C  CE1   . TYR B 1 107 ? -26.213 36.693 -15.852 1.00 23.57 ? 2169 TYR B CE1   1 
ATOM   2432 C  CE2   . TYR B 1 107 ? -27.028 36.498 -13.605 1.00 24.59 ? 2169 TYR B CE2   1 
ATOM   2433 C  CZ    . TYR B 1 107 ? -26.013 36.802 -14.483 1.00 25.58 ? 2169 TYR B CZ    1 
ATOM   2434 O  OH    . TYR B 1 107 ? -24.791 37.240 -14.011 1.00 24.22 ? 2169 TYR B OH    1 
ATOM   2435 N  N     . LEU B 1 108 ? -29.255 32.631 -14.128 1.00 23.06 ? 2170 LEU B N     1 
ATOM   2436 C  CA    . LEU B 1 108 ? -29.263 32.046 -12.796 1.00 23.18 ? 2170 LEU B CA    1 
ATOM   2437 C  C     . LEU B 1 108 ? -28.141 32.508 -11.903 1.00 22.59 ? 2170 LEU B C     1 
ATOM   2438 O  O     . LEU B 1 108 ? -27.062 32.939 -12.373 1.00 23.45 ? 2170 LEU B O     1 
ATOM   2439 C  CB    . LEU B 1 108 ? -29.221 30.544 -12.923 1.00 23.31 ? 2170 LEU B CB    1 
ATOM   2440 C  CG    . LEU B 1 108 ? -30.364 29.965 -13.733 1.00 25.33 ? 2170 LEU B CG    1 
ATOM   2441 C  CD1   . LEU B 1 108 ? -30.172 28.438 -13.746 1.00 26.54 ? 2170 LEU B CD1   1 
ATOM   2442 C  CD2   . LEU B 1 108 ? -31.668 30.304 -13.046 1.00 25.11 ? 2170 LEU B CD2   1 
ATOM   2443 N  N     . GLY B 1 109 ? -28.335 32.379 -10.595 1.00 24.28 ? 2171 GLY B N     1 
ATOM   2444 C  CA    . GLY B 1 109 ? -27.240 32.680 -9.642  1.00 22.21 ? 2171 GLY B CA    1 
ATOM   2445 C  C     . GLY B 1 109 ? -27.733 32.592 -8.200  1.00 23.33 ? 2171 GLY B C     1 
ATOM   2446 O  O     . GLY B 1 109 ? -28.768 31.988 -7.921  1.00 23.63 ? 2171 GLY B O     1 
ATOM   2447 N  N     . GLU B 1 110 ? -26.980 33.175 -7.274  1.00 23.19 ? 2172 GLU B N     1 
ATOM   2448 C  CA    . GLU B 1 110 ? -27.446 33.317 -5.902  1.00 23.54 ? 2172 GLU B CA    1 
ATOM   2449 C  C     . GLU B 1 110 ? -28.116 34.687 -5.780  1.00 24.27 ? 2172 GLU B C     1 
ATOM   2450 O  O     . GLU B 1 110 ? -27.546 35.724 -6.204  1.00 23.92 ? 2172 GLU B O     1 
ATOM   2451 C  CB    . GLU B 1 110 ? -26.282 33.247 -4.912  1.00 23.00 ? 2172 GLU B CB    1 
ATOM   2452 C  CG    . GLU B 1 110 ? -25.467 31.888 -4.954  1.00 24.54 ? 2172 GLU B CG    1 
ATOM   2453 C  CD    . GLU B 1 110 ? -24.290 31.918 -3.994  1.00 24.93 ? 2172 GLU B CD    1 
ATOM   2454 O  OE1   . GLU B 1 110 ? -23.166 32.264 -4.416  1.00 25.72 ? 2172 GLU B OE1   1 
ATOM   2455 O  OE2   . GLU B 1 110 ? -24.529 31.659 -2.802  1.00 24.78 ? 2172 GLU B OE2   1 
ATOM   2456 N  N     . VAL B 1 111 ? -29.314 34.696 -5.190  1.00 24.36 ? 2173 VAL B N     1 
ATOM   2457 C  CA    . VAL B 1 111 ? -30.074 35.911 -5.075  1.00 23.60 ? 2173 VAL B CA    1 
ATOM   2458 C  C     . VAL B 1 111 ? -29.781 36.447 -3.687  1.00 24.74 ? 2173 VAL B C     1 
ATOM   2459 O  O     . VAL B 1 111 ? -30.047 35.786 -2.673  1.00 25.28 ? 2173 VAL B O     1 
ATOM   2460 C  CB    . VAL B 1 111 ? -31.558 35.650 -5.281  1.00 25.04 ? 2173 VAL B CB    1 
ATOM   2461 C  CG1   . VAL B 1 111 ? -32.378 36.932 -5.000  1.00 23.63 ? 2173 VAL B CG1   1 
ATOM   2462 C  CG2   . VAL B 1 111 ? -31.820 35.108 -6.686  1.00 23.96 ? 2173 VAL B CG2   1 
ATOM   2463 N  N     . VAL B 1 112 ? -29.182 37.623 -3.639  1.00 24.39 ? 2174 VAL B N     1 
ATOM   2464 C  CA    . VAL B 1 112 ? -28.701 38.173 -2.392  1.00 25.99 ? 2174 VAL B CA    1 
ATOM   2465 C  C     . VAL B 1 112 ? -29.143 39.650 -2.258  1.00 27.15 ? 2174 VAL B C     1 
ATOM   2466 O  O     . VAL B 1 112 ? -29.368 40.333 -3.264  1.00 26.71 ? 2174 VAL B O     1 
ATOM   2467 C  CB    . VAL B 1 112 ? -27.153 38.167 -2.304  1.00 25.06 ? 2174 VAL B CB    1 
ATOM   2468 C  CG1   . VAL B 1 112 ? -26.582 36.757 -2.326  1.00 27.25 ? 2174 VAL B CG1   1 
ATOM   2469 C  CG2   . VAL B 1 112 ? -26.592 38.972 -3.418  1.00 21.82 ? 2174 VAL B CG2   1 
ATOM   2470 N  N     . SER B 1 113 ? -29.196 40.135 -1.018  1.00 26.76 ? 2175 SER B N     1 
ATOM   2471 C  CA    . SER B 1 113 ? -29.437 41.533 -0.772  1.00 28.25 ? 2175 SER B CA    1 
ATOM   2472 C  C     . SER B 1 113 ? -28.246 42.364 -1.244  1.00 30.42 ? 2175 SER B C     1 
ATOM   2473 O  O     . SER B 1 113 ? -27.115 41.861 -1.385  1.00 29.20 ? 2175 SER B O     1 
ATOM   2474 C  CB    . SER B 1 113 ? -29.673 41.791 0.716   1.00 28.05 ? 2175 SER B CB    1 
ATOM   2475 O  OG    . SER B 1 113 ? -28.502 41.565 1.469   1.00 29.28 ? 2175 SER B OG    1 
ATOM   2476 N  N     . GLU B 1 114 ? -28.499 43.646 -1.480  1.00 30.13 ? 2176 GLU B N     1 
ATOM   2477 C  CA    . GLU B 1 114 ? -27.404 44.563 -1.728  1.00 31.79 ? 2176 GLU B CA    1 
ATOM   2478 C  C     . GLU B 1 114 ? -26.295 44.546 -0.646  1.00 30.55 ? 2176 GLU B C     1 
ATOM   2479 O  O     . GLU B 1 114 ? -25.118 44.616 -0.973  1.00 27.84 ? 2176 GLU B O     1 
ATOM   2480 C  CB    . GLU B 1 114 ? -27.938 45.976 -1.938  1.00 31.40 ? 2176 GLU B CB    1 
ATOM   2481 C  CG    . GLU B 1 114 ? -28.244 46.234 -3.430  1.00 40.48 ? 2176 GLU B CG    1 
ATOM   2482 C  CD    . GLU B 1 114 ? -28.910 47.594 -3.672  1.00 48.62 ? 2176 GLU B CD    1 
ATOM   2483 O  OE1   . GLU B 1 114 ? -28.611 48.542 -2.901  1.00 48.96 ? 2176 GLU B OE1   1 
ATOM   2484 O  OE2   . GLU B 1 114 ? -29.723 47.701 -4.643  1.00 51.86 ? 2176 GLU B OE2   1 
ATOM   2485 N  N     . GLN B 1 115 ? -26.689 44.478 0.627   1.00 29.29 ? 2177 GLN B N     1 
ATOM   2486 C  CA    . GLN B 1 115 ? -25.726 44.382 1.713   1.00 29.56 ? 2177 GLN B CA    1 
ATOM   2487 C  C     . GLN B 1 115 ? -24.853 43.139 1.601   1.00 29.67 ? 2177 GLN B C     1 
ATOM   2488 O  O     . GLN B 1 115 ? -23.640 43.220 1.745   1.00 29.09 ? 2177 GLN B O     1 
ATOM   2489 C  CB    . GLN B 1 115 ? -26.409 44.420 3.096   1.00 29.59 ? 2177 GLN B CB    1 
ATOM   2490 C  CG    . GLN B 1 115 ? -25.435 44.437 4.273   1.00 33.29 ? 2177 GLN B CG    1 
ATOM   2491 C  CD    . GLN B 1 115 ? -24.579 45.697 4.301   1.00 41.02 ? 2177 GLN B CD    1 
ATOM   2492 O  OE1   . GLN B 1 115 ? -25.072 46.780 4.292   1.00 44.74 ? 2177 GLN B OE1   1 
ATOM   2493 N  NE2   . GLN B 1 115 ? -23.305 45.545 4.311   1.00 40.72 ? 2177 GLN B NE2   1 
ATOM   2494 N  N     . GLU B 1 116 ? -25.480 41.992 1.358   1.00 29.24 ? 2178 GLU B N     1 
ATOM   2495 C  CA    . GLU B 1 116 ? -24.767 40.744 1.162   1.00 29.43 ? 2178 GLU B CA    1 
ATOM   2496 C  C     . GLU B 1 116 ? -23.775 40.814 -0.028  1.00 29.18 ? 2178 GLU B C     1 
ATOM   2497 O  O     . GLU B 1 116 ? -22.571 40.518 0.123   1.00 28.28 ? 2178 GLU B O     1 
ATOM   2498 C  CB    . GLU B 1 116 ? -25.761 39.598 0.990   1.00 29.65 ? 2178 GLU B CB    1 
ATOM   2499 C  CG    . GLU B 1 116 ? -25.124 38.273 0.608   1.00 28.71 ? 2178 GLU B CG    1 
ATOM   2500 C  CD    . GLU B 1 116 ? -24.182 37.687 1.680   1.00 30.33 ? 2178 GLU B CD    1 
ATOM   2501 O  OE1   . GLU B 1 116 ? -24.334 37.982 2.887   1.00 29.42 ? 2178 GLU B OE1   1 
ATOM   2502 O  OE2   . GLU B 1 116 ? -23.280 36.908 1.303   1.00 30.26 ? 2178 GLU B OE2   1 
ATOM   2503 N  N     . PHE B 1 117 ? -24.271 41.271 -1.175  1.00 29.20 ? 2179 PHE B N     1 
ATOM   2504 C  CA    . PHE B 1 117 ? -23.450 41.426 -2.385  1.00 29.25 ? 2179 PHE B CA    1 
ATOM   2505 C  C     . PHE B 1 117 ? -22.263 42.364 -2.143  1.00 29.08 ? 2179 PHE B C     1 
ATOM   2506 O  O     . PHE B 1 117 ? -21.174 42.111 -2.569  1.00 28.61 ? 2179 PHE B O     1 
ATOM   2507 C  CB    . PHE B 1 117 ? -24.260 41.897 -3.601  1.00 26.87 ? 2179 PHE B CB    1 
ATOM   2508 C  CG    . PHE B 1 117 ? -23.435 41.930 -4.860  1.00 27.60 ? 2179 PHE B CG    1 
ATOM   2509 C  CD1   . PHE B 1 117 ? -23.000 40.739 -5.438  1.00 26.22 ? 2179 PHE B CD1   1 
ATOM   2510 C  CD2   . PHE B 1 117 ? -23.039 43.134 -5.437  1.00 27.86 ? 2179 PHE B CD2   1 
ATOM   2511 C  CE1   . PHE B 1 117 ? -22.191 40.736 -6.550  1.00 26.95 ? 2179 PHE B CE1   1 
ATOM   2512 C  CE2   . PHE B 1 117 ? -22.248 43.138 -6.596  1.00 28.66 ? 2179 PHE B CE2   1 
ATOM   2513 C  CZ    . PHE B 1 117 ? -21.819 41.938 -7.142  1.00 28.70 ? 2179 PHE B CZ    1 
ATOM   2514 N  N     . ARG B 1 118 ? -22.510 43.449 -1.447  1.00 29.25 ? 2180 ARG B N     1 
ATOM   2515 C  CA    . ARG B 1 118 ? -21.487 44.386 -1.063  1.00 31.24 ? 2180 ARG B CA    1 
ATOM   2516 C  C     . ARG B 1 118 ? -20.390 43.749 -0.135  1.00 31.91 ? 2180 ARG B C     1 
ATOM   2517 O  O     . ARG B 1 118 ? -19.188 43.998 -0.291  1.00 31.27 ? 2180 ARG B O     1 
ATOM   2518 C  CB    . ARG B 1 118 ? -22.221 45.447 -0.303  1.00 32.19 ? 2180 ARG B CB    1 
ATOM   2519 C  CG    . ARG B 1 118 ? -21.555 46.705 -0.086  1.00 37.60 ? 2180 ARG B CG    1 
ATOM   2520 C  CD    . ARG B 1 118 ? -22.654 47.678 0.352   1.00 48.99 ? 2180 ARG B CD    1 
ATOM   2521 N  NE    . ARG B 1 118 ? -22.222 49.048 0.172   1.00 55.70 ? 2180 ARG B NE    1 
ATOM   2522 C  CZ    . ARG B 1 118 ? -22.568 49.835 -0.855  1.00 58.58 ? 2180 ARG B CZ    1 
ATOM   2523 N  NH1   . ARG B 1 118 ? -23.381 49.396 -1.823  1.00 57.68 ? 2180 ARG B NH1   1 
ATOM   2524 N  NH2   . ARG B 1 118 ? -22.090 51.084 -0.899  1.00 59.26 ? 2180 ARG B NH2   1 
ATOM   2525 N  N     . ASN B 1 119 ? -20.817 42.930 0.822   1.00 30.97 ? 2181 ASN B N     1 
ATOM   2526 C  CA    . ASN B 1 119 ? -19.878 42.203 1.681   1.00 31.43 ? 2181 ASN B CA    1 
ATOM   2527 C  C     . ASN B 1 119 ? -18.995 41.275 0.836   1.00 32.05 ? 2181 ASN B C     1 
ATOM   2528 O  O     . ASN B 1 119 ? -17.783 41.213 1.052   1.00 32.49 ? 2181 ASN B O     1 
ATOM   2529 C  CB    . ASN B 1 119 ? -20.610 41.373 2.733   1.00 30.28 ? 2181 ASN B CB    1 
ATOM   2530 C  CG    . ASN B 1 119 ? -21.338 42.225 3.789   1.00 32.54 ? 2181 ASN B CG    1 
ATOM   2531 O  OD1   . ASN B 1 119 ? -21.080 43.410 3.952   1.00 33.97 ? 2181 ASN B OD1   1 
ATOM   2532 N  ND2   . ASN B 1 119 ? -22.232 41.594 4.521   1.00 28.93 ? 2181 ASN B ND2   1 
ATOM   2533 N  N     . ARG B 1 120 ? -19.621 40.544 -0.091  1.00 30.65 ? 2182 ARG B N     1 
ATOM   2534 C  CA    . ARG B 1 120 ? -18.946 39.675 -1.015  1.00 31.06 ? 2182 ARG B CA    1 
ATOM   2535 C  C     . ARG B 1 120 ? -17.981 40.467 -1.920  1.00 32.27 ? 2182 ARG B C     1 
ATOM   2536 O  O     . ARG B 1 120 ? -16.859 40.045 -2.111  1.00 31.76 ? 2182 ARG B O     1 
ATOM   2537 C  CB    . ARG B 1 120 ? -19.967 38.910 -1.862  1.00 30.36 ? 2182 ARG B CB    1 
ATOM   2538 C  CG    . ARG B 1 120 ? -20.806 37.888 -1.071  1.00 29.87 ? 2182 ARG B CG    1 
ATOM   2539 C  CD    . ARG B 1 120 ? -21.929 37.293 -1.934  1.00 26.98 ? 2182 ARG B CD    1 
ATOM   2540 N  NE    . ARG B 1 120 ? -22.581 36.172 -1.257  1.00 21.79 ? 2182 ARG B NE    1 
ATOM   2541 C  CZ    . ARG B 1 120 ? -23.031 35.098 -1.871  1.00 25.64 ? 2182 ARG B CZ    1 
ATOM   2542 N  NH1   . ARG B 1 120 ? -22.944 34.974 -3.223  1.00 23.61 ? 2182 ARG B NH1   1 
ATOM   2543 N  NH2   . ARG B 1 120 ? -23.553 34.140 -1.130  1.00 26.83 ? 2182 ARG B NH2   1 
ATOM   2544 N  N     . MET B 1 121 ? -18.418 41.607 -2.456  1.00 33.83 ? 2183 MET B N     1 
ATOM   2545 C  CA    . MET B 1 121 ? -17.556 42.452 -3.311  1.00 35.84 ? 2183 MET B CA    1 
ATOM   2546 C  C     . MET B 1 121 ? -16.254 42.764 -2.571  1.00 35.98 ? 2183 MET B C     1 
ATOM   2547 O  O     . MET B 1 121 ? -15.193 42.812 -3.166  1.00 34.58 ? 2183 MET B O     1 
ATOM   2548 C  CB    . MET B 1 121 ? -18.238 43.790 -3.669  1.00 34.77 ? 2183 MET B CB    1 
ATOM   2549 C  CG    . MET B 1 121 ? -18.813 43.992 -5.101  1.00 42.81 ? 2183 MET B CG    1 
ATOM   2550 S  SD    . MET B 1 121 ? -18.126 43.034 -6.483  1.00 45.58 ? 2183 MET B SD    1 
ATOM   2551 C  CE    . MET B 1 121 ? -18.154 44.087 -7.913  1.00 50.46 ? 2183 MET B CE    1 
ATOM   2552 N  N     . ILE B 1 122 ? -16.366 43.005 -1.265  1.00 36.62 ? 2184 ILE B N     1 
ATOM   2553 C  CA    . ILE B 1 122 ? -15.230 43.441 -0.483  1.00 37.14 ? 2184 ILE B CA    1 
ATOM   2554 C  C     . ILE B 1 122 ? -14.383 42.283 -0.084  1.00 37.45 ? 2184 ILE B C     1 
ATOM   2555 O  O     . ILE B 1 122 ? -13.191 42.320 -0.310  1.00 38.84 ? 2184 ILE B O     1 
ATOM   2556 C  CB    . ILE B 1 122 ? -15.643 44.230 0.796   1.00 37.90 ? 2184 ILE B CB    1 
ATOM   2557 C  CG1   . ILE B 1 122 ? -16.361 45.505 0.366   1.00 35.52 ? 2184 ILE B CG1   1 
ATOM   2558 C  CG2   . ILE B 1 122 ? -14.406 44.536 1.695   1.00 36.30 ? 2184 ILE B CG2   1 
ATOM   2559 C  CD1   . ILE B 1 122 ? -17.156 46.187 1.421   1.00 39.18 ? 2184 ILE B CD1   1 
ATOM   2560 N  N     . GLU B 1 123 ? -14.990 41.267 0.515   1.00 36.12 ? 2185 GLU B N     1 
ATOM   2561 C  CA    . GLU B 1 123 ? -14.256 40.161 1.035   1.00 36.86 ? 2185 GLU B CA    1 
ATOM   2562 C  C     . GLU B 1 123 ? -13.756 39.141 0.007   1.00 37.61 ? 2185 GLU B C     1 
ATOM   2563 O  O     . GLU B 1 123 ? -12.698 38.532 0.225   1.00 36.40 ? 2185 GLU B O     1 
ATOM   2564 C  CB    . GLU B 1 123 ? -15.034 39.435 2.127   1.00 36.59 ? 2185 GLU B CB    1 
ATOM   2565 C  CG    . GLU B 1 123 ? -14.886 40.065 3.456   1.00 38.30 ? 2185 GLU B CG    1 
ATOM   2566 C  CD    . GLU B 1 123 ? -15.598 39.321 4.557   1.00 40.86 ? 2185 GLU B CD    1 
ATOM   2567 O  OE1   . GLU B 1 123 ? -15.195 39.456 5.706   1.00 38.05 ? 2185 GLU B OE1   1 
ATOM   2568 O  OE2   . GLU B 1 123 ? -16.554 38.600 4.316   1.00 39.44 ? 2185 GLU B OE2   1 
ATOM   2569 N  N     . GLN B 1 124 ? -14.534 38.927 -1.063  1.00 37.28 ? 2186 GLN B N     1 
ATOM   2570 C  CA    . GLN B 1 124 ? -14.242 37.881 -2.036  1.00 37.58 ? 2186 GLN B CA    1 
ATOM   2571 C  C     . GLN B 1 124 ? -13.894 38.363 -3.450  1.00 37.11 ? 2186 GLN B C     1 
ATOM   2572 O  O     . GLN B 1 124 ? -12.988 37.831 -4.061  1.00 38.11 ? 2186 GLN B O     1 
ATOM   2573 C  CB    . GLN B 1 124 ? -15.369 36.851 -2.073  1.00 37.85 ? 2186 GLN B CB    1 
ATOM   2574 C  CG    . GLN B 1 124 ? -15.780 36.401 -0.692  1.00 40.95 ? 2186 GLN B CG    1 
ATOM   2575 C  CD    . GLN B 1 124 ? -16.885 35.389 -0.711  1.00 46.82 ? 2186 GLN B CD    1 
ATOM   2576 O  OE1   . GLN B 1 124 ? -16.973 34.556 -1.614  1.00 49.22 ? 2186 GLN B OE1   1 
ATOM   2577 N  NE2   . GLN B 1 124 ? -17.753 35.454 0.288   1.00 47.04 ? 2186 GLN B NE2   1 
ATOM   2578 N  N     . TYR B 1 125 ? -14.583 39.374 -3.977  1.00 36.71 ? 2187 TYR B N     1 
ATOM   2579 C  CA    . TYR B 1 125 ? -14.514 39.635 -5.418  1.00 36.13 ? 2187 TYR B CA    1 
ATOM   2580 C  C     . TYR B 1 125 ? -13.622 40.830 -5.801  1.00 37.81 ? 2187 TYR B C     1 
ATOM   2581 O  O     . TYR B 1 125 ? -13.436 41.112 -6.982  1.00 37.87 ? 2187 TYR B O     1 
ATOM   2582 C  CB    . TYR B 1 125 ? -15.929 39.830 -6.009  1.00 34.81 ? 2187 TYR B CB    1 
ATOM   2583 C  CG    . TYR B 1 125 ? -17.009 38.761 -5.686  1.00 32.44 ? 2187 TYR B CG    1 
ATOM   2584 C  CD1   . TYR B 1 125 ? -16.691 37.404 -5.532  1.00 28.66 ? 2187 TYR B CD1   1 
ATOM   2585 C  CD2   . TYR B 1 125 ? -18.360 39.119 -5.593  1.00 28.65 ? 2187 TYR B CD2   1 
ATOM   2586 C  CE1   . TYR B 1 125 ? -17.682 36.421 -5.245  1.00 26.73 ? 2187 TYR B CE1   1 
ATOM   2587 C  CE2   . TYR B 1 125 ? -19.371 38.139 -5.327  1.00 27.24 ? 2187 TYR B CE2   1 
ATOM   2588 C  CZ    . TYR B 1 125 ? -19.023 36.823 -5.152  1.00 24.69 ? 2187 TYR B CZ    1 
ATOM   2589 O  OH    . TYR B 1 125 ? -19.997 35.885 -4.885  1.00 27.56 ? 2187 TYR B OH    1 
ATOM   2590 N  N     . HIS B 1 126 ? -13.079 41.535 -4.818  1.00 40.00 ? 2188 HIS B N     1 
ATOM   2591 C  CA    . HIS B 1 126 ? -12.495 42.864 -5.060  1.00 43.45 ? 2188 HIS B CA    1 
ATOM   2592 C  C     . HIS B 1 126 ? -11.356 42.874 -6.112  1.00 43.91 ? 2188 HIS B C     1 
ATOM   2593 O  O     . HIS B 1 126 ? -11.223 43.830 -6.854  1.00 43.57 ? 2188 HIS B O     1 
ATOM   2594 C  CB    . HIS B 1 126 ? -12.068 43.570 -3.755  1.00 43.87 ? 2188 HIS B CB    1 
ATOM   2595 C  CG    . HIS B 1 126 ? -10.841 42.994 -3.136  1.00 47.47 ? 2188 HIS B CG    1 
ATOM   2596 N  ND1   . HIS B 1 126 ? -9.691  42.768 -3.856  1.00 51.97 ? 2188 HIS B ND1   1 
ATOM   2597 C  CD2   . HIS B 1 126 ? -10.572 42.596 -1.870  1.00 53.43 ? 2188 HIS B CD2   1 
ATOM   2598 C  CE1   . HIS B 1 126 ? -8.770  42.230 -3.073  1.00 53.42 ? 2188 HIS B CE1   1 
ATOM   2599 N  NE2   . HIS B 1 126 ? -9.272  42.134 -1.855  1.00 54.76 ? 2188 HIS B NE2   1 
ATOM   2600 N  N     . ASN B 1 127 ? -10.549 41.820 -6.190  1.00 45.37 ? 2189 ASN B N     1 
ATOM   2601 C  CA    . ASN B 1 127 ? -9.541  41.772 -7.263  1.00 46.79 ? 2189 ASN B CA    1 
ATOM   2602 C  C     . ASN B 1 127 ? -9.888  40.808 -8.391  1.00 46.41 ? 2189 ASN B C     1 
ATOM   2603 O  O     . ASN B 1 127 ? -9.016  40.139 -8.935  1.00 46.05 ? 2189 ASN B O     1 
ATOM   2604 C  CB    . ASN B 1 127 ? -8.125  41.546 -6.744  1.00 48.19 ? 2189 ASN B CB    1 
ATOM   2605 C  CG    . ASN B 1 127 ? -7.960  40.244 -6.091  1.00 53.08 ? 2189 ASN B CG    1 
ATOM   2606 O  OD1   . ASN B 1 127 ? -8.922  39.743 -5.604  1.00 55.08 ? 2189 ASN B OD1   1 
ATOM   2607 N  ND2   . ASN B 1 127 ? -6.744  39.686 -6.046  1.00 58.24 ? 2189 ASN B ND2   1 
ATOM   2608 N  N     . HIS B 1 128 ? -11.178 40.732 -8.713  1.00 46.29 ? 2190 HIS B N     1 
ATOM   2609 C  CA    . HIS B 1 128 ? -11.653 39.947 -9.847  1.00 45.88 ? 2190 HIS B CA    1 
ATOM   2610 C  C     . HIS B 1 128 ? -11.564 40.861 -11.046 1.00 45.72 ? 2190 HIS B C     1 
ATOM   2611 O  O     . HIS B 1 128 ? -11.766 42.066 -10.938 1.00 46.39 ? 2190 HIS B O     1 
ATOM   2612 C  CB    . HIS B 1 128 ? -13.107 39.533 -9.634  1.00 45.52 ? 2190 HIS B CB    1 
ATOM   2613 C  CG    . HIS B 1 128 ? -13.294 38.178 -9.011  1.00 45.60 ? 2190 HIS B CG    1 
ATOM   2614 N  ND1   . HIS B 1 128 ? -12.712 37.805 -7.815  1.00 48.31 ? 2190 HIS B ND1   1 
ATOM   2615 C  CD2   . HIS B 1 128 ? -14.067 37.131 -9.389  1.00 45.99 ? 2190 HIS B CD2   1 
ATOM   2616 C  CE1   . HIS B 1 128 ? -13.087 36.576 -7.501  1.00 45.24 ? 2190 HIS B CE1   1 
ATOM   2617 N  NE2   . HIS B 1 128 ? -13.915 36.147 -8.438  1.00 46.08 ? 2190 HIS B NE2   1 
ATOM   2618 N  N     . SER B 1 129 ? -11.249 40.310 -12.200 1.00 45.58 ? 2191 SER B N     1 
ATOM   2619 C  CA    . SER B 1 129 ? -11.237 41.149 -13.381 1.00 46.03 ? 2191 SER B CA    1 
ATOM   2620 C  C     . SER B 1 129 ? -12.489 40.963 -14.236 1.00 45.06 ? 2191 SER B C     1 
ATOM   2621 O  O     . SER B 1 129 ? -12.754 41.785 -15.104 1.00 45.61 ? 2191 SER B O     1 
ATOM   2622 C  CB    . SER B 1 129 ? -9.972  40.921 -14.200 1.00 46.29 ? 2191 SER B CB    1 
ATOM   2623 O  OG    . SER B 1 129 ? -9.622  39.551 -14.135 1.00 48.55 ? 2191 SER B OG    1 
ATOM   2624 N  N     . ASP B 1 130 ? -13.248 39.890 -14.001 1.00 43.39 ? 2192 ASP B N     1 
ATOM   2625 C  CA    . ASP B 1 130 ? -14.547 39.741 -14.666 1.00 41.91 ? 2192 ASP B CA    1 
ATOM   2626 C  C     . ASP B 1 130 ? -15.653 39.842 -13.644 1.00 40.67 ? 2192 ASP B C     1 
ATOM   2627 O  O     . ASP B 1 130 ? -15.450 39.488 -12.502 1.00 39.63 ? 2192 ASP B O     1 
ATOM   2628 C  CB    . ASP B 1 130 ? -14.637 38.433 -15.424 1.00 41.64 ? 2192 ASP B CB    1 
ATOM   2629 C  CG    . ASP B 1 130 ? -13.692 38.386 -16.593 1.00 41.57 ? 2192 ASP B CG    1 
ATOM   2630 O  OD1   . ASP B 1 130 ? -12.653 37.809 -16.473 1.00 41.54 ? 2192 ASP B OD1   1 
ATOM   2631 O  OD2   . ASP B 1 130 ? -13.926 38.930 -17.648 1.00 41.43 ? 2192 ASP B OD2   1 
ATOM   2632 N  N     . HIS B 1 131 ? -16.786 40.398 -14.057 1.00 39.85 ? 2193 HIS B N     1 
ATOM   2633 C  CA    . HIS B 1 131 ? -17.900 40.650 -13.151 1.00 38.00 ? 2193 HIS B CA    1 
ATOM   2634 C  C     . HIS B 1 131 ? -19.143 39.909 -13.608 1.00 36.33 ? 2193 HIS B C     1 
ATOM   2635 O  O     . HIS B 1 131 ? -19.380 39.804 -14.819 1.00 36.19 ? 2193 HIS B O     1 
ATOM   2636 C  CB    . HIS B 1 131 ? -18.073 42.148 -12.979 1.00 38.52 ? 2193 HIS B CB    1 
ATOM   2637 C  CG    . HIS B 1 131 ? -16.806 42.807 -12.522 1.00 43.18 ? 2193 HIS B CG    1 
ATOM   2638 N  ND1   . HIS B 1 131 ? -16.172 42.458 -11.343 1.00 43.30 ? 2193 HIS B ND1   1 
ATOM   2639 C  CD2   . HIS B 1 131 ? -16.004 43.721 -13.124 1.00 43.54 ? 2193 HIS B CD2   1 
ATOM   2640 C  CE1   . HIS B 1 131 ? -15.056 43.155 -11.226 1.00 45.80 ? 2193 HIS B CE1   1 
ATOM   2641 N  NE2   . HIS B 1 131 ? -14.934 43.932 -12.290 1.00 44.82 ? 2193 HIS B NE2   1 
ATOM   2642 N  N     . TYR B 1 132 ? -19.879 39.359 -12.631 1.00 34.41 ? 2194 TYR B N     1 
ATOM   2643 C  CA    . TYR B 1 132 ? -20.962 38.399 -12.847 1.00 33.53 ? 2194 TYR B CA    1 
ATOM   2644 C  C     . TYR B 1 132 ? -22.186 38.634 -11.944 1.00 34.16 ? 2194 TYR B C     1 
ATOM   2645 O  O     . TYR B 1 132 ? -22.368 37.926 -10.942 1.00 32.37 ? 2194 TYR B O     1 
ATOM   2646 C  CB    . TYR B 1 132 ? -20.475 36.973 -12.567 1.00 33.19 ? 2194 TYR B CB    1 
ATOM   2647 C  CG    . TYR B 1 132 ? -19.306 36.506 -13.402 1.00 32.85 ? 2194 TYR B CG    1 
ATOM   2648 C  CD1   . TYR B 1 132 ? -18.011 36.473 -12.866 1.00 30.96 ? 2194 TYR B CD1   1 
ATOM   2649 C  CD2   . TYR B 1 132 ? -19.480 36.109 -14.728 1.00 28.89 ? 2194 TYR B CD2   1 
ATOM   2650 C  CE1   . TYR B 1 132 ? -16.928 36.050 -13.641 1.00 28.44 ? 2194 TYR B CE1   1 
ATOM   2651 C  CE2   . TYR B 1 132 ? -18.394 35.685 -15.491 1.00 28.29 ? 2194 TYR B CE2   1 
ATOM   2652 C  CZ    . TYR B 1 132 ? -17.132 35.670 -14.930 1.00 28.95 ? 2194 TYR B CZ    1 
ATOM   2653 O  OH    . TYR B 1 132 ? -16.050 35.263 -15.677 1.00 32.55 ? 2194 TYR B OH    1 
ATOM   2654 N  N     . CYS B 1 133 ? -23.025 39.601 -12.293 1.00 33.45 ? 2195 CYS B N     1 
ATOM   2655 C  CA    . CYS B 1 133 ? -24.211 39.859 -11.506 1.00 34.71 ? 2195 CYS B CA    1 
ATOM   2656 C  C     . CYS B 1 133 ? -25.240 40.663 -12.283 1.00 34.49 ? 2195 CYS B C     1 
ATOM   2657 O  O     . CYS B 1 133 ? -24.884 41.477 -13.161 1.00 35.12 ? 2195 CYS B O     1 
ATOM   2658 C  CB    . CYS B 1 133 ? -23.817 40.597 -10.226 1.00 34.81 ? 2195 CYS B CB    1 
ATOM   2659 S  SG    . CYS B 1 133 ? -23.138 42.137 -10.573 1.00 41.06 ? 2195 CYS B SG    1 
ATOM   2660 N  N     . LEU B 1 134 ? -26.504 40.421 -11.964 1.00 33.25 ? 2196 LEU B N     1 
ATOM   2661 C  CA    . LEU B 1 134 ? -27.599 41.214 -12.482 1.00 33.59 ? 2196 LEU B CA    1 
ATOM   2662 C  C     . LEU B 1 134 ? -28.373 41.835 -11.323 1.00 33.63 ? 2196 LEU B C     1 
ATOM   2663 O  O     . LEU B 1 134 ? -28.555 41.222 -10.297 1.00 32.49 ? 2196 LEU B O     1 
ATOM   2664 C  CB    . LEU B 1 134 ? -28.587 40.393 -13.320 1.00 33.12 ? 2196 LEU B CB    1 
ATOM   2665 C  CG    . LEU B 1 134 ? -28.341 39.771 -14.698 1.00 34.62 ? 2196 LEU B CG    1 
ATOM   2666 C  CD1   . LEU B 1 134 ? -29.679 39.171 -15.138 1.00 34.17 ? 2196 LEU B CD1   1 
ATOM   2667 C  CD2   . LEU B 1 134 ? -27.808 40.762 -15.771 1.00 34.22 ? 2196 LEU B CD2   1 
ATOM   2668 N  N     . ASN B 1 135 ? -28.815 43.062 -11.548 1.00 35.09 ? 2197 ASN B N     1 
ATOM   2669 C  CA    . ASN B 1 135 ? -29.745 43.835 -10.709 1.00 36.40 ? 2197 ASN B CA    1 
ATOM   2670 C  C     . ASN B 1 135 ? -31.109 43.200 -10.721 1.00 36.35 ? 2197 ASN B C     1 
ATOM   2671 O  O     . ASN B 1 135 ? -31.679 43.061 -11.797 1.00 36.45 ? 2197 ASN B O     1 
ATOM   2672 C  CB    . ASN B 1 135 ? -29.879 45.163 -11.434 1.00 37.18 ? 2197 ASN B CB    1 
ATOM   2673 C  CG    . ASN B 1 135 ? -30.577 46.239 -10.629 1.00 42.63 ? 2197 ASN B CG    1 
ATOM   2674 O  OD1   . ASN B 1 135 ? -30.986 46.034 -9.471  1.00 41.88 ? 2197 ASN B OD1   1 
ATOM   2675 N  ND2   . ASN B 1 135 ? -30.725 47.428 -11.263 1.00 42.65 ? 2197 ASN B ND2   1 
ATOM   2676 N  N     . LEU B 1 136 ? -31.645 42.783 -9.570  1.00 35.90 ? 2198 LEU B N     1 
ATOM   2677 C  CA    . LEU B 1 136 ? -33.043 42.378 -9.559  1.00 37.23 ? 2198 LEU B CA    1 
ATOM   2678 C  C     . LEU B 1 136 ? -33.664 43.717 -9.177  1.00 39.06 ? 2198 LEU B C     1 
ATOM   2679 O  O     . LEU B 1 136 ? -33.122 44.762 -9.502  1.00 40.64 ? 2198 LEU B O     1 
ATOM   2680 C  CB    . LEU B 1 136 ? -33.323 41.293 -8.518  1.00 36.13 ? 2198 LEU B CB    1 
ATOM   2681 C  CG    . LEU B 1 136 ? -33.638 39.889 -9.063  1.00 37.54 ? 2198 LEU B CG    1 
ATOM   2682 C  CD1   . LEU B 1 136 ? -33.204 38.950 -8.107  1.00 29.99 ? 2198 LEU B CD1   1 
ATOM   2683 C  CD2   . LEU B 1 136 ? -35.071 39.516 -9.357  1.00 33.91 ? 2198 LEU B CD2   1 
ATOM   2684 N  N     . ASP B 1 137 ? -34.743 43.807 -8.463  1.00 39.15 ? 2199 ASP B N     1 
ATOM   2685 C  CA    . ASP B 1 137 ? -34.923 45.176 -7.945  1.00 39.89 ? 2199 ASP B CA    1 
ATOM   2686 C  C     . ASP B 1 137 ? -34.960 45.184 -6.450  1.00 39.39 ? 2199 ASP B C     1 
ATOM   2687 O  O     . ASP B 1 137 ? -34.552 44.229 -5.833  1.00 37.75 ? 2199 ASP B O     1 
ATOM   2688 C  CB    . ASP B 1 137 ? -36.243 45.701 -8.383  1.00 39.29 ? 2199 ASP B CB    1 
ATOM   2689 C  CG    . ASP B 1 137 ? -36.342 45.736 -9.784  1.00 42.84 ? 2199 ASP B CG    1 
ATOM   2690 O  OD1   . ASP B 1 137 ? -35.713 46.621 -10.427 1.00 40.06 ? 2199 ASP B OD1   1 
ATOM   2691 O  OD2   . ASP B 1 137 ? -37.019 44.840 -10.287 1.00 44.97 ? 2199 ASP B OD2   1 
ATOM   2692 N  N     . SER B 1 138 ? -35.501 46.278 -5.906  1.00 40.45 ? 2200 SER B N     1 
ATOM   2693 C  CA    . SER B 1 138 ? -35.828 46.407 -4.482  1.00 41.21 ? 2200 SER B CA    1 
ATOM   2694 C  C     . SER B 1 138 ? -34.587 46.010 -3.679  1.00 41.19 ? 2200 SER B C     1 
ATOM   2695 O  O     . SER B 1 138 ? -34.671 45.191 -2.764  1.00 42.17 ? 2200 SER B O     1 
ATOM   2696 C  CB    . SER B 1 138 ? -36.963 45.459 -4.081  1.00 41.97 ? 2200 SER B CB    1 
ATOM   2697 O  OG    . SER B 1 138 ? -38.118 45.570 -4.891  1.00 45.48 ? 2200 SER B OG    1 
ATOM   2698 N  N     . GLY B 1 139 ? -33.438 46.563 -4.028  1.00 39.76 ? 2201 GLY B N     1 
ATOM   2699 C  CA    . GLY B 1 139 ? -32.229 46.215 -3.312  1.00 39.79 ? 2201 GLY B CA    1 
ATOM   2700 C  C     . GLY B 1 139 ? -31.855 44.723 -3.286  1.00 38.71 ? 2201 GLY B C     1 
ATOM   2701 O  O     . GLY B 1 139 ? -31.524 44.214 -2.220  1.00 38.86 ? 2201 GLY B O     1 
ATOM   2702 N  N     . MET B 1 140 ? -31.911 44.052 -4.450  1.00 36.23 ? 2202 MET B N     1 
ATOM   2703 C  CA    . MET B 1 140 ? -31.576 42.651 -4.608  1.00 34.63 ? 2202 MET B CA    1 
ATOM   2704 C  C     . MET B 1 140 ? -30.769 42.417 -5.903  1.00 33.93 ? 2202 MET B C     1 
ATOM   2705 O  O     . MET B 1 140 ? -30.855 43.194 -6.831  1.00 32.24 ? 2202 MET B O     1 
ATOM   2706 C  CB    . MET B 1 140 ? -32.833 41.790 -4.597  1.00 35.05 ? 2202 MET B CB    1 
ATOM   2707 C  CG    . MET B 1 140 ? -33.583 41.758 -3.269  1.00 35.45 ? 2202 MET B CG    1 
ATOM   2708 S  SD    . MET B 1 140 ? -34.986 40.626 -3.431  1.00 38.41 ? 2202 MET B SD    1 
ATOM   2709 C  CE    . MET B 1 140 ? -35.989 41.689 -4.473  1.00 41.26 ? 2202 MET B CE    1 
ATOM   2710 N  N     . VAL B 1 141 ? -29.979 41.339 -5.937  1.00 32.85 ? 2203 VAL B N     1 
ATOM   2711 C  CA    . VAL B 1 141 ? -28.982 41.091 -6.983  1.00 31.47 ? 2203 VAL B CA    1 
ATOM   2712 C  C     . VAL B 1 141 ? -28.926 39.586 -7.270  1.00 30.81 ? 2203 VAL B C     1 
ATOM   2713 O  O     . VAL B 1 141 ? -29.044 38.755 -6.352  1.00 29.48 ? 2203 VAL B O     1 
ATOM   2714 C  CB    . VAL B 1 141 ? -27.571 41.529 -6.494  1.00 33.03 ? 2203 VAL B CB    1 
ATOM   2715 C  CG1   . VAL B 1 141 ? -26.441 41.110 -7.480  1.00 35.63 ? 2203 VAL B CG1   1 
ATOM   2716 C  CG2   . VAL B 1 141 ? -27.506 43.053 -6.233  1.00 34.08 ? 2203 VAL B CG2   1 
ATOM   2717 N  N     . ILE B 1 142 ? -28.761 39.222 -8.535  1.00 28.28 ? 2204 ILE B N     1 
ATOM   2718 C  CA    . ILE B 1 142 ? -28.430 37.831 -8.865  1.00 27.12 ? 2204 ILE B CA    1 
ATOM   2719 C  C     . ILE B 1 142 ? -26.916 37.828 -9.051  1.00 26.28 ? 2204 ILE B C     1 
ATOM   2720 O  O     . ILE B 1 142 ? -26.411 38.487 -9.983  1.00 24.98 ? 2204 ILE B O     1 
ATOM   2721 C  CB    . ILE B 1 142 ? -29.129 37.314 -10.137 1.00 26.55 ? 2204 ILE B CB    1 
ATOM   2722 C  CG1   . ILE B 1 142 ? -30.661 37.415 -9.963  1.00 26.72 ? 2204 ILE B CG1   1 
ATOM   2723 C  CG2   . ILE B 1 142 ? -28.754 35.821 -10.386 1.00 26.01 ? 2204 ILE B CG2   1 
ATOM   2724 C  CD1   . ILE B 1 142 ? -31.445 37.007 -11.173 1.00 20.10 ? 2204 ILE B CD1   1 
ATOM   2725 N  N     . ASP B 1 143 ? -26.236 37.168 -8.115  1.00 23.92 ? 2205 ASP B N     1 
ATOM   2726 C  CA    . ASP B 1 143 ? -24.764 37.057 -8.033  1.00 24.42 ? 2205 ASP B CA    1 
ATOM   2727 C  C     . ASP B 1 143 ? -24.348 35.691 -8.626  1.00 23.94 ? 2205 ASP B C     1 
ATOM   2728 O  O     . ASP B 1 143 ? -24.632 34.644 -8.032  1.00 23.05 ? 2205 ASP B O     1 
ATOM   2729 C  CB    . ASP B 1 143 ? -24.321 37.091 -6.566  1.00 24.29 ? 2205 ASP B CB    1 
ATOM   2730 C  CG    . ASP B 1 143 ? -22.822 36.766 -6.380  1.00 26.33 ? 2205 ASP B CG    1 
ATOM   2731 O  OD1   . ASP B 1 143 ? -22.110 36.502 -7.388  1.00 26.03 ? 2205 ASP B OD1   1 
ATOM   2732 O  OD2   . ASP B 1 143 ? -22.364 36.794 -5.205  1.00 27.15 ? 2205 ASP B OD2   1 
ATOM   2733 N  N     . SER B 1 144 ? -23.754 35.698 -9.826  1.00 24.24 ? 2206 SER B N     1 
ATOM   2734 C  CA    . SER B 1 144 ? -23.330 34.455 -10.518 1.00 25.21 ? 2206 SER B CA    1 
ATOM   2735 C  C     . SER B 1 144 ? -21.799 34.310 -10.505 1.00 24.53 ? 2206 SER B C     1 
ATOM   2736 O  O     . SER B 1 144 ? -21.209 33.607 -11.323 1.00 23.65 ? 2206 SER B O     1 
ATOM   2737 C  CB    . SER B 1 144 ? -23.905 34.375 -11.933 1.00 24.68 ? 2206 SER B CB    1 
ATOM   2738 O  OG    . SER B 1 144 ? -23.232 35.303 -12.840 1.00 27.63 ? 2206 SER B OG    1 
ATOM   2739 N  N     . TYR B 1 145 ? -21.155 34.961 -9.554  1.00 25.74 ? 2207 TYR B N     1 
ATOM   2740 C  CA    . TYR B 1 145 ? -19.681 34.820 -9.416  1.00 27.13 ? 2207 TYR B CA    1 
ATOM   2741 C  C     . TYR B 1 145 ? -19.292 33.389 -9.032  1.00 27.08 ? 2207 TYR B C     1 
ATOM   2742 O  O     . TYR B 1 145 ? -18.253 32.943 -9.449  1.00 26.64 ? 2207 TYR B O     1 
ATOM   2743 C  CB    . TYR B 1 145 ? -19.122 35.731 -8.326  1.00 26.60 ? 2207 TYR B CB    1 
ATOM   2744 C  CG    . TYR B 1 145 ? -18.781 37.149 -8.758  1.00 30.62 ? 2207 TYR B CG    1 
ATOM   2745 C  CD1   . TYR B 1 145 ? -19.764 38.130 -8.790  1.00 29.65 ? 2207 TYR B CD1   1 
ATOM   2746 C  CD2   . TYR B 1 145 ? -17.464 37.511 -9.103  1.00 29.02 ? 2207 TYR B CD2   1 
ATOM   2747 C  CE1   . TYR B 1 145 ? -19.477 39.424 -9.167  1.00 31.38 ? 2207 TYR B CE1   1 
ATOM   2748 C  CE2   . TYR B 1 145 ? -17.162 38.849 -9.475  1.00 32.25 ? 2207 TYR B CE2   1 
ATOM   2749 C  CZ    . TYR B 1 145 ? -18.190 39.787 -9.480  1.00 32.50 ? 2207 TYR B CZ    1 
ATOM   2750 O  OH    . TYR B 1 145 ? -17.954 41.101 -9.834  1.00 31.93 ? 2207 TYR B OH    1 
ATOM   2751 N  N     . ARG B 1 146 ? -20.109 32.697 -8.210  1.00 27.46 ? 2208 ARG B N     1 
ATOM   2752 C  CA    . ARG B 1 146 ? -19.794 31.328 -7.737  1.00 28.54 ? 2208 ARG B CA    1 
ATOM   2753 C  C     . ARG B 1 146 ? -20.658 30.268 -8.377  1.00 27.86 ? 2208 ARG B C     1 
ATOM   2754 O  O     . ARG B 1 146 ? -20.174 29.161 -8.678  1.00 28.28 ? 2208 ARG B O     1 
ATOM   2755 C  CB    . ARG B 1 146 ? -19.985 31.156 -6.222  1.00 28.86 ? 2208 ARG B CB    1 
ATOM   2756 C  CG    . ARG B 1 146 ? -19.315 32.185 -5.378  1.00 34.38 ? 2208 ARG B CG    1 
ATOM   2757 C  CD    . ARG B 1 146 ? -17.883 32.381 -5.839  1.00 43.25 ? 2208 ARG B CD    1 
ATOM   2758 N  NE    . ARG B 1 146 ? -17.018 32.092 -4.716  1.00 52.28 ? 2208 ARG B NE    1 
ATOM   2759 C  CZ    . ARG B 1 146 ? -15.709 31.891 -4.799  1.00 56.47 ? 2208 ARG B CZ    1 
ATOM   2760 N  NH1   . ARG B 1 146 ? -15.088 31.970 -5.975  1.00 57.59 ? 2208 ARG B NH1   1 
ATOM   2761 N  NH2   . ARG B 1 146 ? -15.021 31.585 -3.690  1.00 58.65 ? 2208 ARG B NH2   1 
ATOM   2762 N  N     . MET B 1 147 ? -21.948 30.582 -8.510  1.00 26.11 ? 2209 MET B N     1 
ATOM   2763 C  CA    . MET B 1 147 ? -22.898 29.616 -9.000  1.00 26.72 ? 2209 MET B CA    1 
ATOM   2764 C  C     . MET B 1 147 ? -23.822 30.254 -10.026 1.00 27.42 ? 2209 MET B C     1 
ATOM   2765 O  O     . MET B 1 147 ? -24.136 31.452 -9.947  1.00 26.45 ? 2209 MET B O     1 
ATOM   2766 C  CB    . MET B 1 147 ? -23.769 29.040 -7.889  1.00 26.72 ? 2209 MET B CB    1 
ATOM   2767 C  CG    . MET B 1 147 ? -23.249 29.086 -6.478  1.00 30.66 ? 2209 MET B CG    1 
ATOM   2768 S  SD    . MET B 1 147 ? -24.533 28.310 -5.463  1.00 29.64 ? 2209 MET B SD    1 
ATOM   2769 C  CE    . MET B 1 147 ? -24.196 28.779 -3.881  1.00 42.08 ? 2209 MET B CE    1 
ATOM   2770 N  N     . GLY B 1 148 ? -24.290 29.445 -10.975 1.00 27.08 ? 2210 GLY B N     1 
ATOM   2771 C  CA    . GLY B 1 148 ? -25.022 29.997 -12.075 1.00 26.38 ? 2210 GLY B CA    1 
ATOM   2772 C  C     . GLY B 1 148 ? -25.156 29.033 -13.217 1.00 26.00 ? 2210 GLY B C     1 
ATOM   2773 O  O     . GLY B 1 148 ? -25.175 27.804 -13.012 1.00 26.69 ? 2210 GLY B O     1 
ATOM   2774 N  N     . ASN B 1 149 ? -25.278 29.600 -14.414 1.00 24.50 ? 2211 ASN B N     1 
ATOM   2775 C  CA    . ASN B 1 149 ? -25.340 28.821 -15.630 1.00 25.05 ? 2211 ASN B CA    1 
ATOM   2776 C  C     . ASN B 1 149 ? -24.566 29.556 -16.707 1.00 24.43 ? 2211 ASN B C     1 
ATOM   2777 O  O     . ASN B 1 149 ? -23.872 30.540 -16.411 1.00 23.94 ? 2211 ASN B O     1 
ATOM   2778 C  CB    . ASN B 1 149 ? -26.795 28.482 -16.017 1.00 23.03 ? 2211 ASN B CB    1 
ATOM   2779 C  CG    . ASN B 1 149 ? -27.591 29.702 -16.469 1.00 25.45 ? 2211 ASN B CG    1 
ATOM   2780 O  OD1   . ASN B 1 149 ? -27.123 30.835 -16.380 1.00 25.11 ? 2211 ASN B OD1   1 
ATOM   2781 N  ND2   . ASN B 1 149 ? -28.806 29.473 -16.921 1.00 22.92 ? 2211 ASN B ND2   1 
ATOM   2782 N  N     . GLU B 1 150 ? -24.680 29.088 -17.951 1.00 26.59 ? 2212 GLU B N     1 
ATOM   2783 C  CA    . GLU B 1 150 ? -23.901 29.632 -19.073 1.00 26.53 ? 2212 GLU B CA    1 
ATOM   2784 C  C     . GLU B 1 150 ? -24.267 31.086 -19.399 1.00 26.56 ? 2212 GLU B C     1 
ATOM   2785 O  O     . GLU B 1 150 ? -23.492 31.746 -20.091 1.00 27.00 ? 2212 GLU B O     1 
ATOM   2786 C  CB    . GLU B 1 150 ? -24.068 28.744 -20.345 1.00 27.69 ? 2212 GLU B CB    1 
ATOM   2787 C  CG    . GLU B 1 150 ? -23.330 27.337 -20.275 1.00 31.16 ? 2212 GLU B CG    1 
ATOM   2788 C  CD    . GLU B 1 150 ? -21.833 27.453 -20.128 1.00 35.83 ? 2212 GLU B CD    1 
ATOM   2789 O  OE1   . GLU B 1 150 ? -21.244 27.060 -19.142 1.00 36.70 ? 2212 GLU B OE1   1 
ATOM   2790 O  OE2   . GLU B 1 150 ? -21.187 27.997 -20.980 1.00 38.37 ? 2212 GLU B OE2   1 
ATOM   2791 N  N     . ALA B 1 151 ? -25.426 31.573 -18.919 1.00 25.37 ? 2213 ALA B N     1 
ATOM   2792 C  CA    . ALA B 1 151 ? -25.807 33.013 -19.095 1.00 25.76 ? 2213 ALA B CA    1 
ATOM   2793 C  C     . ALA B 1 151 ? -24.777 33.971 -18.545 1.00 25.16 ? 2213 ALA B C     1 
ATOM   2794 O  O     . ALA B 1 151 ? -24.647 35.128 -19.001 1.00 27.02 ? 2213 ALA B O     1 
ATOM   2795 C  CB    . ALA B 1 151 ? -27.222 33.307 -18.478 1.00 24.94 ? 2213 ALA B CB    1 
ATOM   2796 N  N     . ARG B 1 152 ? -24.011 33.508 -17.568 1.00 25.73 ? 2214 ARG B N     1 
ATOM   2797 C  CA    . ARG B 1 152 ? -22.916 34.333 -17.002 1.00 25.36 ? 2214 ARG B CA    1 
ATOM   2798 C  C     . ARG B 1 152 ? -21.842 34.692 -18.017 1.00 25.91 ? 2214 ARG B C     1 
ATOM   2799 O  O     . ARG B 1 152 ? -21.064 35.614 -17.774 1.00 24.06 ? 2214 ARG B O     1 
ATOM   2800 C  CB    . ARG B 1 152 ? -22.244 33.706 -15.754 1.00 25.59 ? 2214 ARG B CB    1 
ATOM   2801 C  CG    . ARG B 1 152 ? -21.328 32.439 -16.029 1.00 25.78 ? 2214 ARG B CG    1 
ATOM   2802 C  CD    . ARG B 1 152 ? -21.238 31.488 -14.815 1.00 24.74 ? 2214 ARG B CD    1 
ATOM   2803 N  NE    . ARG B 1 152 ? -20.512 32.106 -13.695 1.00 23.43 ? 2214 ARG B NE    1 
ATOM   2804 C  CZ    . ARG B 1 152 ? -19.196 32.237 -13.632 1.00 25.37 ? 2214 ARG B CZ    1 
ATOM   2805 N  NH1   . ARG B 1 152 ? -18.458 31.748 -14.610 1.00 27.25 ? 2214 ARG B NH1   1 
ATOM   2806 N  NH2   . ARG B 1 152 ? -18.610 32.819 -12.581 1.00 22.73 ? 2214 ARG B NH2   1 
ATOM   2807 N  N     . PHE B 1 153 ? -21.755 33.959 -19.134 1.00 26.57 ? 2215 PHE B N     1 
ATOM   2808 C  CA    . PHE B 1 153 ? -20.624 34.210 -20.028 1.00 27.62 ? 2215 PHE B CA    1 
ATOM   2809 C  C     . PHE B 1 153 ? -21.047 35.119 -21.166 1.00 28.77 ? 2215 PHE B C     1 
ATOM   2810 O  O     . PHE B 1 153 ? -20.232 35.457 -22.029 1.00 29.64 ? 2215 PHE B O     1 
ATOM   2811 C  CB    . PHE B 1 153 ? -20.003 32.911 -20.573 1.00 27.96 ? 2215 PHE B CB    1 
ATOM   2812 C  CG    . PHE B 1 153 ? -19.288 32.082 -19.529 1.00 28.27 ? 2215 PHE B CG    1 
ATOM   2813 C  CD1   . PHE B 1 153 ? -18.115 32.524 -18.952 1.00 26.92 ? 2215 PHE B CD1   1 
ATOM   2814 C  CD2   . PHE B 1 153 ? -19.780 30.821 -19.153 1.00 29.70 ? 2215 PHE B CD2   1 
ATOM   2815 C  CE1   . PHE B 1 153 ? -17.469 31.756 -17.997 1.00 28.97 ? 2215 PHE B CE1   1 
ATOM   2816 C  CE2   . PHE B 1 153 ? -19.114 30.038 -18.192 1.00 28.05 ? 2215 PHE B CE2   1 
ATOM   2817 C  CZ    . PHE B 1 153 ? -17.974 30.502 -17.630 1.00 28.74 ? 2215 PHE B CZ    1 
ATOM   2818 N  N     . ILE B 1 154 ? -22.327 35.500 -21.198 1.00 29.37 ? 2216 ILE B N     1 
ATOM   2819 C  CA    . ILE B 1 154 ? -22.834 36.394 -22.232 1.00 28.18 ? 2216 ILE B CA    1 
ATOM   2820 C  C     . ILE B 1 154 ? -22.275 37.803 -22.009 1.00 29.77 ? 2216 ILE B C     1 
ATOM   2821 O  O     . ILE B 1 154 ? -22.370 38.366 -20.904 1.00 30.25 ? 2216 ILE B O     1 
ATOM   2822 C  CB    . ILE B 1 154 ? -24.369 36.414 -22.222 1.00 28.59 ? 2216 ILE B CB    1 
ATOM   2823 C  CG1   . ILE B 1 154 ? -24.915 35.011 -22.526 1.00 27.29 ? 2216 ILE B CG1   1 
ATOM   2824 C  CG2   . ILE B 1 154 ? -24.935 37.427 -23.211 1.00 26.40 ? 2216 ILE B CG2   1 
ATOM   2825 C  CD1   . ILE B 1 154 ? -26.459 35.014 -22.460 1.00 30.40 ? 2216 ILE B CD1   1 
ATOM   2826 N  N     . ASN B 1 155 ? -21.668 38.366 -23.054 1.00 29.18 ? 2217 ASN B N     1 
ATOM   2827 C  CA    . ASN B 1 155 ? -21.008 39.660 -22.951 1.00 29.65 ? 2217 ASN B CA    1 
ATOM   2828 C  C     . ASN B 1 155 ? -21.896 40.873 -23.179 1.00 29.23 ? 2217 ASN B C     1 
ATOM   2829 O  O     . ASN B 1 155 ? -23.004 40.782 -23.710 1.00 29.01 ? 2217 ASN B O     1 
ATOM   2830 C  CB    . ASN B 1 155 ? -19.830 39.719 -23.930 1.00 29.17 ? 2217 ASN B CB    1 
ATOM   2831 C  CG    . ASN B 1 155 ? -18.702 38.862 -23.504 1.00 31.24 ? 2217 ASN B CG    1 
ATOM   2832 O  OD1   . ASN B 1 155 ? -18.320 38.841 -22.321 1.00 31.23 ? 2217 ASN B OD1   1 
ATOM   2833 N  ND2   . ASN B 1 155 ? -18.131 38.145 -24.455 1.00 28.59 ? 2217 ASN B ND2   1 
ATOM   2834 N  N     . HIS B 1 156 ? -21.359 42.025 -22.824 1.00 29.99 ? 2218 HIS B N     1 
ATOM   2835 C  CA    . HIS B 1 156 ? -22.022 43.288 -23.036 1.00 30.87 ? 2218 HIS B CA    1 
ATOM   2836 C  C     . HIS B 1 156 ? -21.823 43.836 -24.449 1.00 31.95 ? 2218 HIS B C     1 
ATOM   2837 O  O     . HIS B 1 156 ? -20.713 43.798 -24.969 1.00 31.33 ? 2218 HIS B O     1 
ATOM   2838 C  CB    . HIS B 1 156 ? -21.481 44.320 -22.065 1.00 30.18 ? 2218 HIS B CB    1 
ATOM   2839 C  CG    . HIS B 1 156 ? -21.803 45.740 -22.452 1.00 32.59 ? 2218 HIS B CG    1 
ATOM   2840 N  ND1   . HIS B 1 156 ? -23.012 46.334 -22.171 1.00 32.71 ? 2218 HIS B ND1   1 
ATOM   2841 C  CD2   . HIS B 1 156 ? -21.068 46.678 -23.103 1.00 31.49 ? 2218 HIS B CD2   1 
ATOM   2842 C  CE1   . HIS B 1 156 ? -23.015 47.574 -22.636 1.00 30.65 ? 2218 HIS B CE1   1 
ATOM   2843 N  NE2   . HIS B 1 156 ? -21.842 47.807 -23.202 1.00 33.77 ? 2218 HIS B NE2   1 
ATOM   2844 N  N     . SER B 1 157 ? -22.896 44.380 -25.030 1.00 32.24 ? 2219 SER B N     1 
ATOM   2845 C  CA    . SER B 1 157 ? -22.772 45.300 -26.146 1.00 32.97 ? 2219 SER B CA    1 
ATOM   2846 C  C     . SER B 1 157 ? -23.502 46.625 -25.920 1.00 34.02 ? 2219 SER B C     1 
ATOM   2847 O  O     . SER B 1 157 ? -24.575 46.667 -25.306 1.00 33.28 ? 2219 SER B O     1 
ATOM   2848 C  CB    . SER B 1 157 ? -23.271 44.671 -27.438 1.00 33.33 ? 2219 SER B CB    1 
ATOM   2849 O  OG    . SER B 1 157 ? -23.226 45.641 -28.452 1.00 35.97 ? 2219 SER B OG    1 
ATOM   2850 N  N     . CYS B 1 158 ? -22.919 47.711 -26.431 1.00 34.58 ? 2220 CYS B N     1 
ATOM   2851 C  CA    . CYS B 1 158 ? -23.638 48.981 -26.524 1.00 34.96 ? 2220 CYS B CA    1 
ATOM   2852 C  C     . CYS B 1 158 ? -24.767 48.984 -27.588 1.00 35.47 ? 2220 CYS B C     1 
ATOM   2853 O  O     . CYS B 1 158 ? -25.653 49.835 -27.556 1.00 35.56 ? 2220 CYS B O     1 
ATOM   2854 C  CB    . CYS B 1 158 ? -22.672 50.121 -26.773 1.00 34.00 ? 2220 CYS B CB    1 
ATOM   2855 S  SG    . CYS B 1 158 ? -21.451 50.305 -25.473 1.00 38.04 ? 2220 CYS B SG    1 
ATOM   2856 N  N     . ASP B 1 159 ? -24.734 48.026 -28.510 1.00 36.05 ? 2221 ASP B N     1 
ATOM   2857 C  CA    . ASP B 1 159 ? -25.817 47.801 -29.482 1.00 35.71 ? 2221 ASP B CA    1 
ATOM   2858 C  C     . ASP B 1 159 ? -26.190 46.316 -29.384 1.00 34.57 ? 2221 ASP B C     1 
ATOM   2859 O  O     . ASP B 1 159 ? -25.766 45.530 -30.223 1.00 34.68 ? 2221 ASP B O     1 
ATOM   2860 C  CB    . ASP B 1 159 ? -25.285 48.142 -30.901 1.00 36.45 ? 2221 ASP B CB    1 
ATOM   2861 C  CG    . ASP B 1 159 ? -26.217 47.735 -32.024 1.00 38.02 ? 2221 ASP B CG    1 
ATOM   2862 O  OD1   . ASP B 1 159 ? -27.415 47.943 -32.008 1.00 38.83 ? 2221 ASP B OD1   1 
ATOM   2863 O  OD2   . ASP B 1 159 ? -25.750 47.208 -33.009 1.00 43.61 ? 2221 ASP B OD2   1 
ATOM   2864 N  N     . PRO B 1 160 ? -26.976 45.933 -28.352 1.00 33.83 ? 2222 PRO B N     1 
ATOM   2865 C  CA    . PRO B 1 160 ? -27.187 44.507 -28.024 1.00 33.07 ? 2222 PRO B CA    1 
ATOM   2866 C  C     . PRO B 1 160 ? -28.157 43.763 -28.948 1.00 32.23 ? 2222 PRO B C     1 
ATOM   2867 O  O     . PRO B 1 160 ? -29.006 44.391 -29.568 1.00 31.55 ? 2222 PRO B O     1 
ATOM   2868 C  CB    . PRO B 1 160 ? -27.756 44.581 -26.608 1.00 32.46 ? 2222 PRO B CB    1 
ATOM   2869 C  CG    . PRO B 1 160 ? -28.544 45.920 -26.605 1.00 32.39 ? 2222 PRO B CG    1 
ATOM   2870 C  CD    . PRO B 1 160 ? -27.641 46.826 -27.365 1.00 33.60 ? 2222 PRO B CD    1 
ATOM   2871 N  N     . ASN B 1 161 ? -28.036 42.437 -29.032 1.00 31.90 ? 2223 ASN B N     1 
ATOM   2872 C  CA    . ASN B 1 161 ? -29.045 41.662 -29.782 1.00 31.59 ? 2223 ASN B CA    1 
ATOM   2873 C  C     . ASN B 1 161 ? -30.054 40.923 -28.909 1.00 31.00 ? 2223 ASN B C     1 
ATOM   2874 O  O     . ASN B 1 161 ? -30.977 40.279 -29.437 1.00 31.46 ? 2223 ASN B O     1 
ATOM   2875 C  CB    . ASN B 1 161 ? -28.404 40.717 -30.816 1.00 31.89 ? 2223 ASN B CB    1 
ATOM   2876 C  CG    . ASN B 1 161 ? -27.349 39.796 -30.199 1.00 33.84 ? 2223 ASN B CG    1 
ATOM   2877 O  OD1   . ASN B 1 161 ? -27.420 39.467 -29.006 1.00 36.29 ? 2223 ASN B OD1   1 
ATOM   2878 N  ND2   . ASN B 1 161 ? -26.373 39.363 -31.012 1.00 30.04 ? 2223 ASN B ND2   1 
ATOM   2879 N  N     . CYS B 1 162 ? -29.859 40.993 -27.588 1.00 29.73 ? 2224 CYS B N     1 
ATOM   2880 C  CA    . CYS B 1 162 ? -30.733 40.340 -26.605 1.00 28.75 ? 2224 CYS B CA    1 
ATOM   2881 C  C     . CYS B 1 162 ? -31.015 41.281 -25.473 1.00 28.02 ? 2224 CYS B C     1 
ATOM   2882 O  O     . CYS B 1 162 ? -30.342 42.298 -25.313 1.00 28.43 ? 2224 CYS B O     1 
ATOM   2883 C  CB    . CYS B 1 162 ? -30.053 39.101 -26.016 1.00 27.79 ? 2224 CYS B CB    1 
ATOM   2884 S  SG    . CYS B 1 162 ? -29.578 37.883 -27.241 1.00 31.52 ? 2224 CYS B SG    1 
ATOM   2885 N  N     . GLU B 1 163 ? -31.998 40.940 -24.650 1.00 27.82 ? 2225 GLU B N     1 
ATOM   2886 C  CA    . GLU B 1 163 ? -32.250 41.733 -23.452 1.00 28.86 ? 2225 GLU B CA    1 
ATOM   2887 C  C     . GLU B 1 163 ? -32.735 40.839 -22.318 1.00 29.21 ? 2225 GLU B C     1 
ATOM   2888 O  O     . GLU B 1 163 ? -33.194 39.721 -22.545 1.00 30.14 ? 2225 GLU B O     1 
ATOM   2889 C  CB    . GLU B 1 163 ? -33.304 42.814 -23.728 1.00 27.40 ? 2225 GLU B CB    1 
ATOM   2890 C  CG    . GLU B 1 163 ? -34.678 42.211 -24.066 1.00 31.00 ? 2225 GLU B CG    1 
ATOM   2891 C  CD    . GLU B 1 163 ? -35.805 43.243 -24.096 1.00 34.52 ? 2225 GLU B CD    1 
ATOM   2892 O  OE1   . GLU B 1 163 ? -35.597 44.416 -23.891 1.00 33.85 ? 2225 GLU B OE1   1 
ATOM   2893 O  OE2   . GLU B 1 163 ? -36.943 42.894 -24.299 1.00 36.90 ? 2225 GLU B OE2   1 
ATOM   2894 N  N     . MET B 1 164 ? -32.633 41.353 -21.103 1.00 28.58 ? 2226 MET B N     1 
ATOM   2895 C  CA    . MET B 1 164 ? -33.130 40.685 -19.943 1.00 29.59 ? 2226 MET B CA    1 
ATOM   2896 C  C     . MET B 1 164 ? -34.539 41.191 -19.689 1.00 30.07 ? 2226 MET B C     1 
ATOM   2897 O  O     . MET B 1 164 ? -34.787 42.368 -19.798 1.00 31.45 ? 2226 MET B O     1 
ATOM   2898 C  CB    . MET B 1 164 ? -32.232 41.011 -18.751 1.00 29.30 ? 2226 MET B CB    1 
ATOM   2899 C  CG    . MET B 1 164 ? -30.811 40.409 -18.860 1.00 28.62 ? 2226 MET B CG    1 
ATOM   2900 S  SD    . MET B 1 164 ? -30.843 38.610 -18.938 1.00 31.64 ? 2226 MET B SD    1 
ATOM   2901 C  CE    . MET B 1 164 ? -29.120 38.214 -19.246 1.00 25.12 ? 2226 MET B CE    1 
ATOM   2902 N  N     . GLN B 1 165 ? -35.457 40.295 -19.359 1.00 29.21 ? 2227 GLN B N     1 
ATOM   2903 C  CA    . GLN B 1 165 ? -36.780 40.699 -18.977 1.00 29.79 ? 2227 GLN B CA    1 
ATOM   2904 C  C     . GLN B 1 165 ? -37.088 40.043 -17.639 1.00 30.45 ? 2227 GLN B C     1 
ATOM   2905 O  O     . GLN B 1 165 ? -36.842 38.828 -17.464 1.00 29.98 ? 2227 GLN B O     1 
ATOM   2906 C  CB    . GLN B 1 165 ? -37.814 40.177 -19.981 1.00 30.80 ? 2227 GLN B CB    1 
ATOM   2907 C  CG    . GLN B 1 165 ? -37.751 40.792 -21.414 1.00 31.07 ? 2227 GLN B CG    1 
ATOM   2908 C  CD    . GLN B 1 165 ? -38.588 39.996 -22.357 1.00 32.81 ? 2227 GLN B CD    1 
ATOM   2909 O  OE1   . GLN B 1 165 ? -39.414 39.192 -21.918 1.00 31.49 ? 2227 GLN B OE1   1 
ATOM   2910 N  NE2   . GLN B 1 165 ? -38.386 40.184 -23.661 1.00 31.71 ? 2227 GLN B NE2   1 
ATOM   2911 N  N     . LYS B 1 166 ? -37.700 40.830 -16.753 1.00 29.81 ? 2228 LYS B N     1 
ATOM   2912 C  CA    . LYS B 1 166 ? -38.074 40.401 -15.435 1.00 29.97 ? 2228 LYS B CA    1 
ATOM   2913 C  C     . LYS B 1 166 ? -39.504 39.941 -15.442 1.00 29.90 ? 2228 LYS B C     1 
ATOM   2914 O  O     . LYS B 1 166 ? -40.426 40.736 -15.643 1.00 29.94 ? 2228 LYS B O     1 
ATOM   2915 C  CB    . LYS B 1 166 ? -37.945 41.550 -14.423 1.00 30.62 ? 2228 LYS B CB    1 
ATOM   2916 C  CG    . LYS B 1 166 ? -38.158 41.027 -13.014 1.00 33.15 ? 2228 LYS B CG    1 
ATOM   2917 C  CD    . LYS B 1 166 ? -37.654 41.994 -11.924 1.00 37.21 ? 2228 LYS B CD    1 
ATOM   2918 C  CE    . LYS B 1 166 ? -38.585 43.166 -11.778 1.00 33.09 ? 2228 LYS B CE    1 
ATOM   2919 N  NZ    . LYS B 1 166 ? -38.541 43.592 -10.380 1.00 32.81 ? 2228 LYS B NZ    1 
ATOM   2920 N  N     . TRP B 1 167 ? -39.690 38.661 -15.166 1.00 29.35 ? 2229 TRP B N     1 
ATOM   2921 C  CA    . TRP B 1 167 ? -40.990 38.027 -15.242 1.00 29.12 ? 2229 TRP B CA    1 
ATOM   2922 C  C     . TRP B 1 167 ? -41.444 37.643 -13.869 1.00 29.46 ? 2229 TRP B C     1 
ATOM   2923 O  O     . TRP B 1 167 ? -40.633 37.297 -13.061 1.00 29.53 ? 2229 TRP B O     1 
ATOM   2924 C  CB    . TRP B 1 167 ? -40.892 36.780 -16.123 1.00 27.73 ? 2229 TRP B CB    1 
ATOM   2925 C  CG    . TRP B 1 167 ? -40.949 37.170 -17.548 1.00 29.56 ? 2229 TRP B CG    1 
ATOM   2926 C  CD1   . TRP B 1 167 ? -40.020 37.905 -18.248 1.00 28.54 ? 2229 TRP B CD1   1 
ATOM   2927 C  CD2   . TRP B 1 167 ? -42.037 36.948 -18.435 1.00 26.16 ? 2229 TRP B CD2   1 
ATOM   2928 N  NE1   . TRP B 1 167 ? -40.455 38.101 -19.548 1.00 29.00 ? 2229 TRP B NE1   1 
ATOM   2929 C  CE2   . TRP B 1 167 ? -41.685 37.519 -19.689 1.00 29.12 ? 2229 TRP B CE2   1 
ATOM   2930 C  CE3   . TRP B 1 167 ? -43.265 36.279 -18.311 1.00 29.26 ? 2229 TRP B CE3   1 
ATOM   2931 C  CZ2   . TRP B 1 167 ? -42.538 37.467 -20.814 1.00 29.22 ? 2229 TRP B CZ2   1 
ATOM   2932 C  CZ3   . TRP B 1 167 ? -44.098 36.208 -19.435 1.00 29.19 ? 2229 TRP B CZ3   1 
ATOM   2933 C  CH2   . TRP B 1 167 ? -43.723 36.804 -20.669 1.00 29.19 ? 2229 TRP B CH2   1 
ATOM   2934 N  N     . SER B 1 168 ? -42.743 37.750 -13.603 1.00 30.62 ? 2230 SER B N     1 
ATOM   2935 C  CA    . SER B 1 168 ? -43.320 37.179 -12.396 1.00 31.36 ? 2230 SER B CA    1 
ATOM   2936 C  C     . SER B 1 168 ? -43.610 35.750 -12.710 1.00 32.56 ? 2230 SER B C     1 
ATOM   2937 O  O     . SER B 1 168 ? -44.304 35.471 -13.682 1.00 34.72 ? 2230 SER B O     1 
ATOM   2938 C  CB    . SER B 1 168 ? -44.635 37.834 -12.046 1.00 30.73 ? 2230 SER B CB    1 
ATOM   2939 O  OG    . SER B 1 168 ? -45.054 37.302 -10.801 1.00 32.78 ? 2230 SER B OG    1 
ATOM   2940 N  N     . VAL B 1 169 ? -43.121 34.840 -11.888 1.00 32.20 ? 2231 VAL B N     1 
ATOM   2941 C  CA    . VAL B 1 169 ? -43.291 33.441 -12.146 1.00 32.21 ? 2231 VAL B CA    1 
ATOM   2942 C  C     . VAL B 1 169 ? -43.747 32.778 -10.855 1.00 33.67 ? 2231 VAL B C     1 
ATOM   2943 O  O     . VAL B 1 169 ? -42.985 32.593 -9.902  1.00 34.08 ? 2231 VAL B O     1 
ATOM   2944 C  CB    . VAL B 1 169 ? -41.980 32.823 -12.659 1.00 32.30 ? 2231 VAL B CB    1 
ATOM   2945 C  CG1   . VAL B 1 169 ? -42.146 31.373 -12.883 1.00 33.20 ? 2231 VAL B CG1   1 
ATOM   2946 C  CG2   . VAL B 1 169 ? -41.489 33.550 -13.953 1.00 29.59 ? 2231 VAL B CG2   1 
ATOM   2947 N  N     . ASN B 1 170 ? -45.030 32.471 -10.804 1.00 34.27 ? 2232 ASN B N     1 
ATOM   2948 C  CA    . ASN B 1 170 ? -45.652 31.929 -9.578  1.00 34.36 ? 2232 ASN B CA    1 
ATOM   2949 C  C     . ASN B 1 170 ? -45.364 32.787 -8.346  1.00 33.62 ? 2232 ASN B C     1 
ATOM   2950 O  O     . ASN B 1 170 ? -45.132 32.286 -7.266  1.00 33.91 ? 2232 ASN B O     1 
ATOM   2951 C  CB    . ASN B 1 170 ? -45.217 30.500 -9.383  1.00 34.88 ? 2232 ASN B CB    1 
ATOM   2952 C  CG    . ASN B 1 170 ? -45.712 29.907 -8.091  1.00 40.12 ? 2232 ASN B CG    1 
ATOM   2953 O  OD1   . ASN B 1 170 ? -46.879 30.120 -7.675  1.00 41.38 ? 2232 ASN B OD1   1 
ATOM   2954 N  ND2   . ASN B 1 170 ? -44.836 29.117 -7.434  1.00 41.49 ? 2232 ASN B ND2   1 
ATOM   2955 N  N     . GLY B 1 171 ? -45.390 34.095 -8.521  1.00 33.83 ? 2233 GLY B N     1 
ATOM   2956 C  CA    . GLY B 1 171 ? -45.256 35.003 -7.388  1.00 33.77 ? 2233 GLY B CA    1 
ATOM   2957 C  C     . GLY B 1 171 ? -43.828 35.434 -7.079  1.00 34.39 ? 2233 GLY B C     1 
ATOM   2958 O  O     . GLY B 1 171 ? -43.623 36.226 -6.159  1.00 35.11 ? 2233 GLY B O     1 
ATOM   2959 N  N     . VAL B 1 172 ? -42.841 34.902 -7.815  1.00 32.44 ? 2234 VAL B N     1 
ATOM   2960 C  CA    . VAL B 1 172 ? -41.446 35.293 -7.660  1.00 30.20 ? 2234 VAL B CA    1 
ATOM   2961 C  C     . VAL B 1 172 ? -40.939 35.872 -8.968  1.00 30.18 ? 2234 VAL B C     1 
ATOM   2962 O  O     . VAL B 1 172 ? -41.219 35.332 -10.032 1.00 29.50 ? 2234 VAL B O     1 
ATOM   2963 C  CB    . VAL B 1 172 ? -40.573 34.082 -7.288  1.00 30.70 ? 2234 VAL B CB    1 
ATOM   2964 C  CG1   . VAL B 1 172 ? -39.088 34.506 -7.081  1.00 29.78 ? 2234 VAL B CG1   1 
ATOM   2965 C  CG2   . VAL B 1 172 ? -41.087 33.475 -6.014  1.00 32.73 ? 2234 VAL B CG2   1 
ATOM   2966 N  N     . TYR B 1 173 ? -40.193 36.970 -8.874  1.00 29.16 ? 2235 TYR B N     1 
ATOM   2967 C  CA    . TYR B 1 173 ? -39.504 37.556 -9.998  1.00 28.55 ? 2235 TYR B CA    1 
ATOM   2968 C  C     . TYR B 1 173 ? -38.311 36.700 -10.425 1.00 28.75 ? 2235 TYR B C     1 
ATOM   2969 O  O     . TYR B 1 173 ? -37.537 36.245 -9.593  1.00 27.91 ? 2235 TYR B O     1 
ATOM   2970 C  CB    . TYR B 1 173 ? -39.012 38.944 -9.616  1.00 28.49 ? 2235 TYR B CB    1 
ATOM   2971 C  CG    . TYR B 1 173 ? -40.094 40.005 -9.716  1.00 30.33 ? 2235 TYR B CG    1 
ATOM   2972 C  CD1   . TYR B 1 173 ? -40.304 40.906 -8.678  1.00 31.91 ? 2235 TYR B CD1   1 
ATOM   2973 C  CD2   . TYR B 1 173 ? -40.934 40.072 -10.846 1.00 32.06 ? 2235 TYR B CD2   1 
ATOM   2974 C  CE1   . TYR B 1 173 ? -41.309 41.883 -8.762  1.00 37.09 ? 2235 TYR B CE1   1 
ATOM   2975 C  CE2   . TYR B 1 173 ? -41.919 41.072 -10.975 1.00 34.14 ? 2235 TYR B CE2   1 
ATOM   2976 C  CZ    . TYR B 1 173 ? -42.121 41.960 -9.921  1.00 37.39 ? 2235 TYR B CZ    1 
ATOM   2977 O  OH    . TYR B 1 173 ? -43.094 42.937 -10.019 1.00 41.35 ? 2235 TYR B OH    1 
ATOM   2978 N  N     . ARG B 1 174 ? -38.188 36.479 -11.732 1.00 27.47 ? 2236 ARG B N     1 
ATOM   2979 C  CA    . ARG B 1 174 ? -37.095 35.703 -12.292 1.00 27.77 ? 2236 ARG B CA    1 
ATOM   2980 C  C     . ARG B 1 174 ? -36.712 36.376 -13.592 1.00 28.00 ? 2236 ARG B C     1 
ATOM   2981 O  O     . ARG B 1 174 ? -37.557 36.996 -14.235 1.00 28.68 ? 2236 ARG B O     1 
ATOM   2982 C  CB    . ARG B 1 174 ? -37.544 34.267 -12.507 1.00 27.21 ? 2236 ARG B CB    1 
ATOM   2983 C  CG    . ARG B 1 174 ? -37.591 33.492 -11.177 1.00 27.94 ? 2236 ARG B CG    1 
ATOM   2984 C  CD    . ARG B 1 174 ? -38.291 32.157 -11.284 1.00 29.50 ? 2236 ARG B CD    1 
ATOM   2985 N  NE    . ARG B 1 174 ? -37.601 31.174 -12.092 1.00 28.80 ? 2236 ARG B NE    1 
ATOM   2986 C  CZ    . ARG B 1 174 ? -37.973 29.916 -12.221 1.00 29.29 ? 2236 ARG B CZ    1 
ATOM   2987 N  NH1   . ARG B 1 174 ? -39.028 29.459 -11.631 1.00 30.13 ? 2236 ARG B NH1   1 
ATOM   2988 N  NH2   . ARG B 1 174 ? -37.291 29.074 -12.923 1.00 29.00 ? 2236 ARG B NH2   1 
ATOM   2989 N  N     . ILE B 1 175 ? -35.445 36.297 -13.970 1.00 27.81 ? 2237 ILE B N     1 
ATOM   2990 C  CA    . ILE B 1 175 ? -34.946 37.070 -15.114 1.00 27.84 ? 2237 ILE B CA    1 
ATOM   2991 C  C     . ILE B 1 175 ? -34.530 36.143 -16.262 1.00 28.34 ? 2237 ILE B C     1 
ATOM   2992 O  O     . ILE B 1 175 ? -33.681 35.246 -16.084 1.00 28.24 ? 2237 ILE B O     1 
ATOM   2993 C  CB    . ILE B 1 175 ? -33.757 37.938 -14.729 1.00 26.87 ? 2237 ILE B CB    1 
ATOM   2994 C  CG1   . ILE B 1 175 ? -34.211 38.999 -13.711 1.00 30.75 ? 2237 ILE B CG1   1 
ATOM   2995 C  CG2   . ILE B 1 175 ? -33.208 38.610 -15.943 1.00 27.10 ? 2237 ILE B CG2   1 
ATOM   2996 C  CD1   . ILE B 1 175 ? -33.147 39.853 -13.153 1.00 34.92 ? 2237 ILE B CD1   1 
ATOM   2997 N  N     . GLY B 1 176 ? -35.142 36.372 -17.417 1.00 27.94 ? 2238 GLY B N     1 
ATOM   2998 C  CA    . GLY B 1 176 ? -34.793 35.652 -18.642 1.00 28.26 ? 2238 GLY B CA    1 
ATOM   2999 C  C     . GLY B 1 176 ? -34.177 36.538 -19.728 1.00 27.60 ? 2238 GLY B C     1 
ATOM   3000 O  O     . GLY B 1 176 ? -34.369 37.761 -19.744 1.00 26.48 ? 2238 GLY B O     1 
ATOM   3001 N  N     . LEU B 1 177 ? -33.411 35.898 -20.616 1.00 27.31 ? 2239 LEU B N     1 
ATOM   3002 C  CA    . LEU B 1 177 ? -32.746 36.557 -21.712 1.00 26.75 ? 2239 LEU B CA    1 
ATOM   3003 C  C     . LEU B 1 177 ? -33.612 36.204 -22.921 1.00 27.52 ? 2239 LEU B C     1 
ATOM   3004 O  O     . LEU B 1 177 ? -33.995 35.045 -23.089 1.00 26.79 ? 2239 LEU B O     1 
ATOM   3005 C  CB    . LEU B 1 177 ? -31.346 35.996 -21.896 1.00 26.58 ? 2239 LEU B CB    1 
ATOM   3006 C  CG    . LEU B 1 177 ? -30.563 36.675 -23.034 1.00 30.10 ? 2239 LEU B CG    1 
ATOM   3007 C  CD1   . LEU B 1 177 ? -29.848 37.901 -22.506 1.00 26.86 ? 2239 LEU B CD1   1 
ATOM   3008 C  CD2   . LEU B 1 177 ? -29.588 35.740 -23.808 1.00 28.31 ? 2239 LEU B CD2   1 
ATOM   3009 N  N     . TYR B 1 178 ? -33.954 37.222 -23.706 1.00 27.34 ? 2240 TYR B N     1 
ATOM   3010 C  CA    . TYR B 1 178 ? -34.869 37.133 -24.850 1.00 29.03 ? 2240 TYR B CA    1 
ATOM   3011 C  C     . TYR B 1 178 ? -34.186 37.828 -26.030 1.00 29.90 ? 2240 TYR B C     1 
ATOM   3012 O  O     . TYR B 1 178 ? -33.444 38.791 -25.846 1.00 29.58 ? 2240 TYR B O     1 
ATOM   3013 C  CB    . TYR B 1 178 ? -36.205 37.827 -24.536 1.00 27.79 ? 2240 TYR B CB    1 
ATOM   3014 C  CG    . TYR B 1 178 ? -36.978 37.112 -23.471 1.00 30.34 ? 2240 TYR B CG    1 
ATOM   3015 C  CD1   . TYR B 1 178 ? -36.571 37.204 -22.143 1.00 30.16 ? 2240 TYR B CD1   1 
ATOM   3016 C  CD2   . TYR B 1 178 ? -38.089 36.315 -23.771 1.00 30.58 ? 2240 TYR B CD2   1 
ATOM   3017 C  CE1   . TYR B 1 178 ? -37.228 36.549 -21.135 1.00 29.98 ? 2240 TYR B CE1   1 
ATOM   3018 C  CE2   . TYR B 1 178 ? -38.783 35.629 -22.740 1.00 30.88 ? 2240 TYR B CE2   1 
ATOM   3019 C  CZ    . TYR B 1 178 ? -38.321 35.765 -21.411 1.00 32.38 ? 2240 TYR B CZ    1 
ATOM   3020 O  OH    . TYR B 1 178 ? -38.904 35.138 -20.333 1.00 32.66 ? 2240 TYR B OH    1 
ATOM   3021 N  N     . ALA B 1 179 ? -34.420 37.331 -27.235 1.00 31.43 ? 2241 ALA B N     1 
ATOM   3022 C  CA    . ALA B 1 179 ? -33.821 37.941 -28.437 1.00 33.18 ? 2241 ALA B CA    1 
ATOM   3023 C  C     . ALA B 1 179 ? -34.474 39.290 -28.754 1.00 34.03 ? 2241 ALA B C     1 
ATOM   3024 O  O     . ALA B 1 179 ? -35.697 39.417 -28.695 1.00 35.24 ? 2241 ALA B O     1 
ATOM   3025 C  CB    . ALA B 1 179 ? -33.930 36.964 -29.632 1.00 32.37 ? 2241 ALA B CB    1 
ATOM   3026 N  N     . LEU B 1 180 ? -33.675 40.314 -29.025 1.00 36.40 ? 2242 LEU B N     1 
ATOM   3027 C  CA    . LEU B 1 180 ? -34.199 41.579 -29.551 1.00 38.77 ? 2242 LEU B CA    1 
ATOM   3028 C  C     . LEU B 1 180 ? -34.486 41.539 -31.076 1.00 40.36 ? 2242 LEU B C     1 
ATOM   3029 O  O     . LEU B 1 180 ? -35.338 42.283 -31.585 1.00 41.38 ? 2242 LEU B O     1 
ATOM   3030 C  CB    . LEU B 1 180 ? -33.251 42.734 -29.250 1.00 38.99 ? 2242 LEU B CB    1 
ATOM   3031 C  CG    . LEU B 1 180 ? -33.259 43.254 -27.812 1.00 39.21 ? 2242 LEU B CG    1 
ATOM   3032 C  CD1   . LEU B 1 180 ? -32.242 44.363 -27.661 1.00 35.96 ? 2242 LEU B CD1   1 
ATOM   3033 C  CD2   . LEU B 1 180 ? -34.680 43.718 -27.398 1.00 39.53 ? 2242 LEU B CD2   1 
ATOM   3034 N  N     . LYS B 1 181 ? -33.785 40.666 -31.785 1.00 41.30 ? 2243 LYS B N     1 
ATOM   3035 C  CA    . LYS B 1 181 ? -33.843 40.655 -33.238 1.00 43.04 ? 2243 LYS B CA    1 
ATOM   3036 C  C     . LYS B 1 181 ? -33.527 39.249 -33.761 1.00 42.94 ? 2243 LYS B C     1 
ATOM   3037 O  O     . LYS B 1 181 ? -33.101 38.386 -32.979 1.00 43.60 ? 2243 LYS B O     1 
ATOM   3038 C  CB    . LYS B 1 181 ? -32.891 41.712 -33.809 1.00 43.38 ? 2243 LYS B CB    1 
ATOM   3039 C  CG    . LYS B 1 181 ? -31.403 41.444 -33.571 1.00 44.80 ? 2243 LYS B CG    1 
ATOM   3040 C  CD    . LYS B 1 181 ? -30.505 42.543 -34.166 1.00 46.13 ? 2243 LYS B CD    1 
ATOM   3041 C  CE    . LYS B 1 181 ? -30.411 43.767 -33.247 1.00 49.49 ? 2243 LYS B CE    1 
ATOM   3042 N  NZ    . LYS B 1 181 ? -29.176 44.615 -33.491 1.00 50.12 ? 2243 LYS B NZ    1 
ATOM   3043 N  N     . ASP B 1 182 ? -33.781 38.983 -35.042 1.00 42.97 ? 2244 ASP B N     1 
ATOM   3044 C  CA    . ASP B 1 182 ? -33.327 37.708 -35.636 1.00 43.20 ? 2244 ASP B CA    1 
ATOM   3045 C  C     . ASP B 1 182 ? -31.817 37.646 -35.646 1.00 42.16 ? 2244 ASP B C     1 
ATOM   3046 O  O     . ASP B 1 182 ? -31.157 38.646 -35.835 1.00 41.80 ? 2244 ASP B O     1 
ATOM   3047 C  CB    . ASP B 1 182 ? -33.833 37.531 -37.073 1.00 44.28 ? 2244 ASP B CB    1 
ATOM   3048 C  CG    . ASP B 1 182 ? -35.324 37.437 -37.163 1.00 46.43 ? 2244 ASP B CG    1 
ATOM   3049 O  OD1   . ASP B 1 182 ? -35.898 38.223 -37.863 1.00 50.80 ? 2244 ASP B OD1   1 
ATOM   3050 O  OD2   . ASP B 1 182 ? -35.987 36.588 -36.576 1.00 51.14 ? 2244 ASP B OD2   1 
ATOM   3051 N  N     . MET B 1 183 ? -31.250 36.477 -35.399 1.00 42.67 ? 2245 MET B N     1 
ATOM   3052 C  CA    . MET B 1 183 ? -29.819 36.328 -35.555 1.00 41.96 ? 2245 MET B CA    1 
ATOM   3053 C  C     . MET B 1 183 ? -29.535 34.978 -36.136 1.00 42.76 ? 2245 MET B C     1 
ATOM   3054 O  O     . MET B 1 183 ? -30.162 33.998 -35.735 1.00 43.01 ? 2245 MET B O     1 
ATOM   3055 C  CB    . MET B 1 183 ? -29.008 36.594 -34.260 1.00 42.73 ? 2245 MET B CB    1 
ATOM   3056 C  CG    . MET B 1 183 ? -29.793 36.621 -33.010 1.00 41.02 ? 2245 MET B CG    1 
ATOM   3057 S  SD    . MET B 1 183 ? -29.032 37.057 -31.423 1.00 41.09 ? 2245 MET B SD    1 
ATOM   3058 C  CE    . MET B 1 183 ? -30.616 36.818 -30.579 1.00 33.01 ? 2245 MET B CE    1 
ATOM   3059 N  N     . PRO B 1 184 ? -28.601 34.930 -37.116 1.00 43.11 ? 2246 PRO B N     1 
ATOM   3060 C  CA    . PRO B 1 184 ? -28.248 33.702 -37.803 1.00 42.37 ? 2246 PRO B CA    1 
ATOM   3061 C  C     . PRO B 1 184 ? -27.309 32.870 -36.967 1.00 42.46 ? 2246 PRO B C     1 
ATOM   3062 O  O     . PRO B 1 184 ? -26.772 33.351 -35.944 1.00 41.90 ? 2246 PRO B O     1 
ATOM   3063 C  CB    . PRO B 1 184 ? -27.480 34.214 -39.028 1.00 42.83 ? 2246 PRO B CB    1 
ATOM   3064 C  CG    . PRO B 1 184 ? -26.815 35.416 -38.548 1.00 42.77 ? 2246 PRO B CG    1 
ATOM   3065 C  CD    . PRO B 1 184 ? -27.866 36.082 -37.678 1.00 43.04 ? 2246 PRO B CD    1 
ATOM   3066 N  N     . ALA B 1 185 ? -27.117 31.637 -37.424 1.00 42.24 ? 2247 ALA B N     1 
ATOM   3067 C  CA    . ALA B 1 185 ? -26.112 30.725 -36.904 1.00 42.73 ? 2247 ALA B CA    1 
ATOM   3068 C  C     . ALA B 1 185 ? -24.801 31.442 -36.802 1.00 42.60 ? 2247 ALA B C     1 
ATOM   3069 O  O     . ALA B 1 185 ? -24.447 32.190 -37.717 1.00 43.31 ? 2247 ALA B O     1 
ATOM   3070 C  CB    . ALA B 1 185 ? -25.961 29.550 -37.827 1.00 42.94 ? 2247 ALA B CB    1 
ATOM   3071 N  N     . GLY B 1 186 ? -24.097 31.214 -35.691 1.00 41.81 ? 2248 GLY B N     1 
ATOM   3072 C  CA    . GLY B 1 186 ? -22.770 31.775 -35.433 1.00 40.13 ? 2248 GLY B CA    1 
ATOM   3073 C  C     . GLY B 1 186 ? -22.722 33.097 -34.685 1.00 39.89 ? 2248 GLY B C     1 
ATOM   3074 O  O     . GLY B 1 186 ? -21.642 33.532 -34.279 1.00 40.57 ? 2248 GLY B O     1 
ATOM   3075 N  N     . THR B 1 187 ? -23.870 33.753 -34.505 1.00 38.18 ? 2249 THR B N     1 
ATOM   3076 C  CA    . THR B 1 187 ? -23.927 35.072 -33.842 1.00 37.71 ? 2249 THR B CA    1 
ATOM   3077 C  C     . THR B 1 187 ? -23.639 35.070 -32.324 1.00 35.75 ? 2249 THR B C     1 
ATOM   3078 O  O     . THR B 1 187 ? -24.260 34.332 -31.600 1.00 35.33 ? 2249 THR B O     1 
ATOM   3079 C  CB    . THR B 1 187 ? -25.326 35.670 -34.045 1.00 37.94 ? 2249 THR B CB    1 
ATOM   3080 O  OG1   . THR B 1 187 ? -25.606 35.707 -35.448 1.00 40.86 ? 2249 THR B OG1   1 
ATOM   3081 C  CG2   . THR B 1 187 ? -25.404 37.060 -33.490 1.00 40.39 ? 2249 THR B CG2   1 
ATOM   3082 N  N     . GLU B 1 188 ? -22.726 35.921 -31.853 1.00 35.17 ? 2250 GLU B N     1 
ATOM   3083 C  CA    . GLU B 1 188 ? -22.463 36.101 -30.414 1.00 34.22 ? 2250 GLU B CA    1 
ATOM   3084 C  C     . GLU B 1 188 ? -23.640 36.815 -29.726 1.00 33.52 ? 2250 GLU B C     1 
ATOM   3085 O  O     . GLU B 1 188 ? -24.077 37.864 -30.204 1.00 33.71 ? 2250 GLU B O     1 
ATOM   3086 C  CB    . GLU B 1 188 ? -21.185 36.903 -30.150 1.00 34.35 ? 2250 GLU B CB    1 
ATOM   3087 C  CG    . GLU B 1 188 ? -20.918 37.022 -28.637 1.00 35.12 ? 2250 GLU B CG    1 
ATOM   3088 C  CD    . GLU B 1 188 ? -19.717 37.857 -28.266 1.00 36.29 ? 2250 GLU B CD    1 
ATOM   3089 O  OE1   . GLU B 1 188 ? -19.189 38.587 -29.130 1.00 40.65 ? 2250 GLU B OE1   1 
ATOM   3090 O  OE2   . GLU B 1 188 ? -19.306 37.804 -27.087 1.00 38.43 ? 2250 GLU B OE2   1 
ATOM   3091 N  N     . LEU B 1 189 ? -24.151 36.238 -28.632 1.00 31.80 ? 2251 LEU B N     1 
ATOM   3092 C  CA    . LEU B 1 189 ? -25.234 36.865 -27.862 1.00 30.72 ? 2251 LEU B CA    1 
ATOM   3093 C  C     . LEU B 1 189 ? -24.668 37.996 -27.027 1.00 29.37 ? 2251 LEU B C     1 
ATOM   3094 O  O     . LEU B 1 189 ? -23.558 37.880 -26.494 1.00 29.88 ? 2251 LEU B O     1 
ATOM   3095 C  CB    . LEU B 1 189 ? -25.946 35.839 -26.962 1.00 30.26 ? 2251 LEU B CB    1 
ATOM   3096 C  CG    . LEU B 1 189 ? -26.552 34.594 -27.615 1.00 31.39 ? 2251 LEU B CG    1 
ATOM   3097 C  CD1   . LEU B 1 189 ? -27.464 33.750 -26.630 1.00 29.25 ? 2251 LEU B CD1   1 
ATOM   3098 C  CD2   . LEU B 1 189 ? -27.360 35.048 -28.801 1.00 32.17 ? 2251 LEU B CD2   1 
ATOM   3099 N  N     . THR B 1 190 ? -25.399 39.104 -26.946 1.00 28.24 ? 2252 THR B N     1 
ATOM   3100 C  CA    . THR B 1 190 ? -25.003 40.246 -26.123 1.00 28.30 ? 2252 THR B CA    1 
ATOM   3101 C  C     . THR B 1 190 ? -26.232 40.945 -25.476 1.00 28.69 ? 2252 THR B C     1 
ATOM   3102 O  O     . THR B 1 190 ? -27.324 40.905 -26.009 1.00 28.54 ? 2252 THR B O     1 
ATOM   3103 C  CB    . THR B 1 190 ? -24.243 41.314 -26.980 1.00 29.33 ? 2252 THR B CB    1 
ATOM   3104 O  OG1   . THR B 1 190 ? -25.182 41.968 -27.875 1.00 28.73 ? 2252 THR B OG1   1 
ATOM   3105 C  CG2   . THR B 1 190 ? -23.078 40.661 -27.786 1.00 25.98 ? 2252 THR B CG2   1 
ATOM   3106 N  N     . TYR B 1 191 ? -26.048 41.576 -24.327 1.00 27.97 ? 2253 TYR B N     1 
ATOM   3107 C  CA    . TYR B 1 191 ? -27.084 42.435 -23.805 1.00 28.28 ? 2253 TYR B CA    1 
ATOM   3108 C  C     . TYR B 1 191 ? -26.394 43.661 -23.256 1.00 29.03 ? 2253 TYR B C     1 
ATOM   3109 O  O     . TYR B 1 191 ? -25.167 43.671 -23.148 1.00 27.87 ? 2253 TYR B O     1 
ATOM   3110 C  CB    . TYR B 1 191 ? -27.973 41.733 -22.742 1.00 28.41 ? 2253 TYR B CB    1 
ATOM   3111 C  CG    . TYR B 1 191 ? -27.260 41.280 -21.483 1.00 25.40 ? 2253 TYR B CG    1 
ATOM   3112 C  CD1   . TYR B 1 191 ? -27.266 42.058 -20.315 1.00 26.46 ? 2253 TYR B CD1   1 
ATOM   3113 C  CD2   . TYR B 1 191 ? -26.605 40.062 -21.446 1.00 26.40 ? 2253 TYR B CD2   1 
ATOM   3114 C  CE1   . TYR B 1 191 ? -26.587 41.621 -19.125 1.00 25.33 ? 2253 TYR B CE1   1 
ATOM   3115 C  CE2   . TYR B 1 191 ? -25.918 39.631 -20.293 1.00 24.97 ? 2253 TYR B CE2   1 
ATOM   3116 C  CZ    . TYR B 1 191 ? -25.941 40.413 -19.133 1.00 25.07 ? 2253 TYR B CZ    1 
ATOM   3117 O  OH    . TYR B 1 191 ? -25.283 39.949 -18.013 1.00 27.20 ? 2253 TYR B OH    1 
ATOM   3118 N  N     . ASP B 1 192 ? -27.176 44.688 -22.933 1.00 28.70 ? 2254 ASP B N     1 
ATOM   3119 C  CA    . ASP B 1 192 ? -26.632 45.938 -22.455 1.00 31.02 ? 2254 ASP B CA    1 
ATOM   3120 C  C     . ASP B 1 192 ? -26.539 45.920 -20.950 1.00 32.69 ? 2254 ASP B C     1 
ATOM   3121 O  O     . ASP B 1 192 ? -27.560 46.038 -20.274 1.00 33.48 ? 2254 ASP B O     1 
ATOM   3122 C  CB    . ASP B 1 192 ? -27.550 47.112 -22.874 1.00 31.12 ? 2254 ASP B CB    1 
ATOM   3123 C  CG    . ASP B 1 192 ? -26.913 48.468 -22.629 1.00 32.49 ? 2254 ASP B CG    1 
ATOM   3124 O  OD1   . ASP B 1 192 ? -26.005 48.564 -21.760 1.00 30.95 ? 2254 ASP B OD1   1 
ATOM   3125 O  OD2   . ASP B 1 192 ? -27.329 49.440 -23.306 1.00 36.30 ? 2254 ASP B OD2   1 
ATOM   3126 N  N     . TYR B 1 193 ? -25.322 45.822 -20.415 1.00 34.42 ? 2255 TYR B N     1 
ATOM   3127 C  CA    . TYR B 1 193 ? -25.110 45.753 -18.965 1.00 36.43 ? 2255 TYR B CA    1 
ATOM   3128 C  C     . TYR B 1 193 ? -25.560 47.010 -18.227 1.00 38.21 ? 2255 TYR B C     1 
ATOM   3129 O  O     . TYR B 1 193 ? -25.948 46.935 -17.059 1.00 37.02 ? 2255 TYR B O     1 
ATOM   3130 C  CB    . TYR B 1 193 ? -23.613 45.572 -18.653 1.00 35.59 ? 2255 TYR B CB    1 
ATOM   3131 C  CG    . TYR B 1 193 ? -23.048 44.183 -18.867 1.00 34.35 ? 2255 TYR B CG    1 
ATOM   3132 C  CD1   . TYR B 1 193 ? -21.888 43.792 -18.200 1.00 33.99 ? 2255 TYR B CD1   1 
ATOM   3133 C  CD2   . TYR B 1 193 ? -23.648 43.269 -19.737 1.00 32.55 ? 2255 TYR B CD2   1 
ATOM   3134 C  CE1   . TYR B 1 193 ? -21.345 42.515 -18.378 1.00 35.52 ? 2255 TYR B CE1   1 
ATOM   3135 C  CE2   . TYR B 1 193 ? -23.096 41.994 -19.951 1.00 33.41 ? 2255 TYR B CE2   1 
ATOM   3136 C  CZ    . TYR B 1 193 ? -21.944 41.623 -19.268 1.00 34.98 ? 2255 TYR B CZ    1 
ATOM   3137 O  OH    . TYR B 1 193 ? -21.400 40.351 -19.434 1.00 36.26 ? 2255 TYR B OH    1 
ATOM   3138 N  N     . ASN B 1 194 ? -25.474 48.169 -18.890 1.00 40.95 ? 2256 ASN B N     1 
ATOM   3139 C  CA    . ASN B 1 194 ? -25.827 49.429 -18.233 1.00 44.19 ? 2256 ASN B CA    1 
ATOM   3140 C  C     . ASN B 1 194 ? -27.285 49.419 -17.875 1.00 46.20 ? 2256 ASN B C     1 
ATOM   3141 O  O     . ASN B 1 194 ? -27.729 50.130 -16.979 1.00 46.41 ? 2256 ASN B O     1 
ATOM   3142 C  CB    . ASN B 1 194 ? -25.553 50.615 -19.128 1.00 44.68 ? 2256 ASN B CB    1 
ATOM   3143 C  CG    . ASN B 1 194 ? -24.066 50.921 -19.248 1.00 46.72 ? 2256 ASN B CG    1 
ATOM   3144 O  OD1   . ASN B 1 194 ? -23.198 50.066 -19.011 1.00 49.33 ? 2256 ASN B OD1   1 
ATOM   3145 N  ND2   . ASN B 1 194 ? -23.770 52.150 -19.603 1.00 48.17 ? 2256 ASN B ND2   1 
ATOM   3146 N  N     . PHE B 1 195 ? -28.013 48.592 -18.610 1.00 47.95 ? 2257 PHE B N     1 
ATOM   3147 C  CA    . PHE B 1 195 ? -29.427 48.416 -18.423 1.00 50.57 ? 2257 PHE B CA    1 
ATOM   3148 C  C     . PHE B 1 195 ? -29.736 47.327 -17.383 1.00 51.67 ? 2257 PHE B C     1 
ATOM   3149 O  O     . PHE B 1 195 ? -30.554 47.538 -16.474 1.00 51.50 ? 2257 PHE B O     1 
ATOM   3150 C  CB    . PHE B 1 195 ? -30.063 48.076 -19.771 1.00 51.18 ? 2257 PHE B CB    1 
ATOM   3151 C  CG    . PHE B 1 195 ? -30.712 49.253 -20.445 1.00 53.29 ? 2257 PHE B CG    1 
ATOM   3152 C  CD1   . PHE B 1 195 ? -30.062 50.475 -20.519 1.00 54.22 ? 2257 PHE B CD1   1 
ATOM   3153 C  CD2   . PHE B 1 195 ? -31.988 49.127 -21.014 1.00 54.98 ? 2257 PHE B CD2   1 
ATOM   3154 C  CE1   . PHE B 1 195 ? -30.669 51.569 -21.139 1.00 55.69 ? 2257 PHE B CE1   1 
ATOM   3155 C  CE2   . PHE B 1 195 ? -32.615 50.224 -21.623 1.00 57.65 ? 2257 PHE B CE2   1 
ATOM   3156 C  CZ    . PHE B 1 195 ? -31.953 51.444 -21.689 1.00 56.36 ? 2257 PHE B CZ    1 
ATOM   3157 N  N     . HIS B 1 196 ? -29.050 46.184 -17.501 1.00 51.90 ? 2258 HIS B N     1 
ATOM   3158 C  CA    . HIS B 1 196 ? -29.471 44.967 -16.830 1.00 52.41 ? 2258 HIS B CA    1 
ATOM   3159 C  C     . HIS B 1 196 ? -28.544 44.477 -15.720 1.00 53.41 ? 2258 HIS B C     1 
ATOM   3160 O  O     . HIS B 1 196 ? -28.993 43.824 -14.784 1.00 52.41 ? 2258 HIS B O     1 
ATOM   3161 C  CB    . HIS B 1 196 ? -29.666 43.882 -17.869 1.00 51.93 ? 2258 HIS B CB    1 
ATOM   3162 C  CG    . HIS B 1 196 ? -30.593 44.272 -18.974 1.00 52.03 ? 2258 HIS B CG    1 
ATOM   3163 N  ND1   . HIS B 1 196 ? -31.902 44.643 -18.747 1.00 50.93 ? 2258 HIS B ND1   1 
ATOM   3164 C  CD2   . HIS B 1 196 ? -30.410 44.326 -20.319 1.00 51.67 ? 2258 HIS B CD2   1 
ATOM   3165 C  CE1   . HIS B 1 196 ? -32.480 44.923 -19.906 1.00 52.79 ? 2258 HIS B CE1   1 
ATOM   3166 N  NE2   . HIS B 1 196 ? -31.602 44.724 -20.876 1.00 51.46 ? 2258 HIS B NE2   1 
ATOM   3167 N  N     . SER B 1 197 ? -27.257 44.787 -15.826 1.00 54.80 ? 2259 SER B N     1 
ATOM   3168 C  CA    . SER B 1 197 ? -26.300 44.361 -14.817 1.00 57.58 ? 2259 SER B CA    1 
ATOM   3169 C  C     . SER B 1 197 ? -26.375 45.267 -13.559 1.00 59.07 ? 2259 SER B C     1 
ATOM   3170 O  O     . SER B 1 197 ? -27.067 46.286 -13.556 1.00 57.91 ? 2259 SER B O     1 
ATOM   3171 C  CB    . SER B 1 197 ? -24.889 44.312 -15.419 1.00 56.97 ? 2259 SER B CB    1 
ATOM   3172 O  OG    . SER B 1 197 ? -23.980 43.647 -14.564 1.00 59.40 ? 2259 SER B OG    1 
ATOM   3173 N  N     . PHE B 1 198 ? -25.670 44.880 -12.496 1.00 61.68 ? 2260 PHE B N     1 
ATOM   3174 C  CA    . PHE B 1 198 ? -25.653 45.653 -11.248 1.00 64.56 ? 2260 PHE B CA    1 
ATOM   3175 C  C     . PHE B 1 198 ? -24.343 46.443 -11.179 1.00 66.54 ? 2260 PHE B C     1 
ATOM   3176 O  O     . PHE B 1 198 ? -23.266 45.879 -10.953 1.00 66.63 ? 2260 PHE B O     1 
ATOM   3177 C  CB    . PHE B 1 198 ? -25.861 44.736 -10.036 1.00 63.97 ? 2260 PHE B CB    1 
ATOM   3178 C  CG    . PHE B 1 198 ? -26.002 45.459 -8.737  1.00 64.50 ? 2260 PHE B CG    1 
ATOM   3179 C  CD1   . PHE B 1 198 ? -27.225 45.977 -8.346  1.00 64.74 ? 2260 PHE B CD1   1 
ATOM   3180 C  CD2   . PHE B 1 198 ? -24.906 45.602 -7.883  1.00 65.75 ? 2260 PHE B CD2   1 
ATOM   3181 C  CE1   . PHE B 1 198 ? -27.366 46.648 -7.117  1.00 66.24 ? 2260 PHE B CE1   1 
ATOM   3182 C  CE2   . PHE B 1 198 ? -25.027 46.271 -6.659  1.00 66.63 ? 2260 PHE B CE2   1 
ATOM   3183 C  CZ    . PHE B 1 198 ? -26.269 46.796 -6.273  1.00 66.86 ? 2260 PHE B CZ    1 
ATOM   3184 N  N     . ASN B 1 199 ? -24.443 47.754 -11.393 1.00 69.38 ? 2261 ASN B N     1 
ATOM   3185 C  CA    . ASN B 1 199 ? -23.261 48.543 -11.737 1.00 71.61 ? 2261 ASN B CA    1 
ATOM   3186 C  C     . ASN B 1 199 ? -22.337 48.959 -10.600 1.00 72.78 ? 2261 ASN B C     1 
ATOM   3187 O  O     . ASN B 1 199 ? -22.283 50.131 -10.193 1.00 72.86 ? 2261 ASN B O     1 
ATOM   3188 C  CB    . ASN B 1 199 ? -23.614 49.669 -12.694 1.00 72.25 ? 2261 ASN B CB    1 
ATOM   3189 C  CG    . ASN B 1 199 ? -23.999 49.136 -14.058 1.00 73.50 ? 2261 ASN B CG    1 
ATOM   3190 O  OD1   . ASN B 1 199 ? -23.136 48.780 -14.865 1.00 73.88 ? 2261 ASN B OD1   1 
ATOM   3191 N  ND2   . ASN B 1 199 ? -25.307 49.033 -14.308 1.00 75.17 ? 2261 ASN B ND2   1 
ATOM   3192 N  N     . VAL B 1 200 ? -21.619 47.951 -10.099 1.00 73.90 ? 2262 VAL B N     1 
ATOM   3193 C  CA    . VAL B 1 200 ? -20.451 48.155 -9.262  1.00 74.87 ? 2262 VAL B CA    1 
ATOM   3194 C  C     . VAL B 1 200 ? -19.399 48.811 -10.124 1.00 75.35 ? 2262 VAL B C     1 
ATOM   3195 O  O     . VAL B 1 200 ? -19.196 48.426 -11.283 1.00 75.58 ? 2262 VAL B O     1 
ATOM   3196 C  CB    . VAL B 1 200 ? -19.850 46.855 -8.776  1.00 75.09 ? 2262 VAL B CB    1 
ATOM   3197 C  CG1   . VAL B 1 200 ? -19.166 47.093 -7.416  1.00 75.16 ? 2262 VAL B CG1   1 
ATOM   3198 C  CG2   . VAL B 1 200 ? -20.918 45.761 -8.715  1.00 74.91 ? 2262 VAL B CG2   1 
ATOM   3199 N  N     . GLU B 1 201 ? -18.711 49.782 -9.542  1.00 75.47 ? 2263 GLU B N     1 
ATOM   3200 C  CA    . GLU B 1 201 ? -17.970 50.732 -10.345 1.00 75.06 ? 2263 GLU B CA    1 
ATOM   3201 C  C     . GLU B 1 201 ? -16.459 50.457 -10.500 1.00 74.53 ? 2263 GLU B C     1 
ATOM   3202 O  O     . GLU B 1 201 ? -15.656 51.395 -10.587 1.00 74.82 ? 2263 GLU B O     1 
ATOM   3203 C  CB    . GLU B 1 201 ? -18.259 52.151 -9.860  1.00 74.89 ? 2263 GLU B CB    1 
ATOM   3204 C  CG    . GLU B 1 201 ? -18.588 53.098 -10.979 1.00 75.77 ? 2263 GLU B CG    1 
ATOM   3205 C  CD    . GLU B 1 201 ? -18.122 54.498 -10.677 1.00 77.01 ? 2263 GLU B CD    1 
ATOM   3206 O  OE1   . GLU B 1 201 ? -17.103 54.918 -11.281 1.00 75.81 ? 2263 GLU B OE1   1 
ATOM   3207 O  OE2   . GLU B 1 201 ? -18.754 55.159 -9.817  1.00 77.16 ? 2263 GLU B OE2   1 
ATOM   3208 N  N     . LYS B 1 202 ? -16.073 49.180 -10.547 1.00 73.53 ? 2264 LYS B N     1 
ATOM   3209 C  CA    . LYS B 1 202 ? -14.814 48.827 -11.215 1.00 71.99 ? 2264 LYS B CA    1 
ATOM   3210 C  C     . LYS B 1 202 ? -15.045 49.271 -12.672 1.00 69.96 ? 2264 LYS B C     1 
ATOM   3211 O  O     . LYS B 1 202 ? -16.131 49.047 -13.236 1.00 69.94 ? 2264 LYS B O     1 
ATOM   3212 C  CB    . LYS B 1 202 ? -14.517 47.315 -11.147 1.00 72.88 ? 2264 LYS B CB    1 
ATOM   3213 C  CG    . LYS B 1 202 ? -13.977 46.792 -9.792  1.00 74.16 ? 2264 LYS B CG    1 
ATOM   3214 C  CD    . LYS B 1 202 ? -12.456 46.988 -9.639  1.00 74.19 ? 2264 LYS B CD    1 
ATOM   3215 C  CE    . LYS B 1 202 ? -11.987 46.698 -8.197  1.00 74.36 ? 2264 LYS B CE    1 
ATOM   3216 N  NZ    . LYS B 1 202 ? -10.525 46.989 -7.961  1.00 72.23 ? 2264 LYS B NZ    1 
ATOM   3217 N  N     . GLN B 1 203 ? -14.044 49.932 -13.255 1.00 66.83 ? 2265 GLN B N     1 
ATOM   3218 C  CA    . GLN B 1 203 ? -14.204 50.616 -14.538 1.00 62.82 ? 2265 GLN B CA    1 
ATOM   3219 C  C     . GLN B 1 203 ? -13.680 49.740 -15.662 1.00 59.21 ? 2265 GLN B C     1 
ATOM   3220 O  O     . GLN B 1 203 ? -12.487 49.429 -15.679 1.00 59.30 ? 2265 GLN B O     1 
ATOM   3221 C  CB    . GLN B 1 203 ? -13.398 51.916 -14.503 1.00 63.46 ? 2265 GLN B CB    1 
ATOM   3222 C  CG    . GLN B 1 203 ? -13.568 52.805 -15.722 1.00 64.43 ? 2265 GLN B CG    1 
ATOM   3223 C  CD    . GLN B 1 203 ? -14.772 53.722 -15.602 1.00 66.69 ? 2265 GLN B CD    1 
ATOM   3224 O  OE1   . GLN B 1 203 ? -15.793 53.362 -14.994 1.00 66.62 ? 2265 GLN B OE1   1 
ATOM   3225 N  NE2   . GLN B 1 203 ? -14.663 54.916 -16.183 1.00 65.69 ? 2265 GLN B NE2   1 
ATOM   3226 N  N     . GLN B 1 204 ? -14.544 49.344 -16.597 1.00 53.33 ? 2266 GLN B N     1 
ATOM   3227 C  CA    . GLN B 1 204 ? -14.061 48.519 -17.704 1.00 49.74 ? 2266 GLN B CA    1 
ATOM   3228 C  C     . GLN B 1 204 ? -14.301 49.151 -19.077 1.00 48.54 ? 2266 GLN B C     1 
ATOM   3229 O  O     . GLN B 1 204 ? -15.415 49.579 -19.401 1.00 47.16 ? 2266 GLN B O     1 
ATOM   3230 C  CB    . GLN B 1 204 ? -14.616 47.092 -17.641 1.00 49.15 ? 2266 GLN B CB    1 
ATOM   3231 C  CG    . GLN B 1 204 ? -14.359 46.353 -16.314 1.00 48.08 ? 2266 GLN B CG    1 
ATOM   3232 C  CD    . GLN B 1 204 ? -14.615 44.835 -16.388 1.00 46.63 ? 2266 GLN B CD    1 
ATOM   3233 O  OE1   . GLN B 1 204 ? -13.675 44.057 -16.493 1.00 48.97 ? 2266 GLN B OE1   1 
ATOM   3234 N  NE2   . GLN B 1 204 ? -15.881 44.422 -16.359 1.00 40.75 ? 2266 GLN B NE2   1 
ATOM   3235 N  N     . LEU B 1 205 ? -13.221 49.228 -19.859 1.00 47.27 ? 2267 LEU B N     1 
ATOM   3236 C  CA    . LEU B 1 205 ? -13.277 49.635 -21.256 1.00 46.38 ? 2267 LEU B CA    1 
ATOM   3237 C  C     . LEU B 1 205 ? -14.182 48.706 -22.059 1.00 45.55 ? 2267 LEU B C     1 
ATOM   3238 O  O     . LEU B 1 205 ? -14.074 47.472 -21.939 1.00 45.71 ? 2267 LEU B O     1 
ATOM   3239 C  CB    . LEU B 1 205 ? -11.876 49.578 -21.878 1.00 46.35 ? 2267 LEU B CB    1 
ATOM   3240 C  CG    . LEU B 1 205 ? -10.884 50.674 -21.535 1.00 46.55 ? 2267 LEU B CG    1 
ATOM   3241 C  CD1   . LEU B 1 205 ? -9.597  50.367 -22.282 1.00 49.46 ? 2267 LEU B CD1   1 
ATOM   3242 C  CD2   . LEU B 1 205 ? -11.395 52.038 -21.885 1.00 43.28 ? 2267 LEU B CD2   1 
ATOM   3243 N  N     . CYS B 1 206 ? -15.032 49.302 -22.904 1.00 43.82 ? 2268 CYS B N     1 
ATOM   3244 C  CA    . CYS B 1 206 ? -15.942 48.526 -23.736 1.00 42.35 ? 2268 CYS B CA    1 
ATOM   3245 C  C     . CYS B 1 206 ? -15.375 48.271 -25.108 1.00 42.68 ? 2268 CYS B C     1 
ATOM   3246 O  O     . CYS B 1 206 ? -14.930 49.185 -25.784 1.00 43.13 ? 2268 CYS B O     1 
ATOM   3247 C  CB    . CYS B 1 206 ? -17.297 49.201 -23.892 1.00 42.13 ? 2268 CYS B CB    1 
ATOM   3248 S  SG    . CYS B 1 206 ? -18.396 48.218 -24.930 1.00 37.33 ? 2268 CYS B SG    1 
ATOM   3249 N  N     . LYS B 1 207 ? -15.412 47.017 -25.513 1.00 42.67 ? 2269 LYS B N     1 
ATOM   3250 C  CA    . LYS B 1 207 ? -14.804 46.573 -26.756 1.00 42.79 ? 2269 LYS B CA    1 
ATOM   3251 C  C     . LYS B 1 207 ? -15.913 45.992 -27.622 1.00 41.80 ? 2269 LYS B C     1 
ATOM   3252 O  O     . LYS B 1 207 ? -15.696 45.065 -28.412 1.00 41.67 ? 2269 LYS B O     1 
ATOM   3253 C  CB    . LYS B 1 207 ? -13.749 45.505 -26.428 1.00 42.86 ? 2269 LYS B CB    1 
ATOM   3254 C  CG    . LYS B 1 207 ? -12.616 46.012 -25.509 1.00 45.71 ? 2269 LYS B CG    1 
ATOM   3255 C  CD    . LYS B 1 207 ? -11.306 46.184 -26.298 1.00 51.26 ? 2269 LYS B CD    1 
ATOM   3256 C  CE    . LYS B 1 207 ? -10.593 47.549 -26.160 1.00 54.78 ? 2269 LYS B CE    1 
ATOM   3257 N  NZ    . LYS B 1 207 ? -10.427 48.172 -24.808 1.00 58.01 ? 2269 LYS B NZ    1 
ATOM   3258 N  N     . CYS B 1 208 ? -17.122 46.539 -27.461 1.00 41.76 ? 2270 CYS B N     1 
ATOM   3259 C  CA    . CYS B 1 208 ? -18.277 46.026 -28.216 1.00 40.83 ? 2270 CYS B CA    1 
ATOM   3260 C  C     . CYS B 1 208 ? -18.121 46.265 -29.701 1.00 41.19 ? 2270 CYS B C     1 
ATOM   3261 O  O     . CYS B 1 208 ? -18.641 45.510 -30.514 1.00 40.78 ? 2270 CYS B O     1 
ATOM   3262 C  CB    . CYS B 1 208 ? -19.617 46.543 -27.681 1.00 40.79 ? 2270 CYS B CB    1 
ATOM   3263 S  SG    . CYS B 1 208 ? -20.033 48.287 -27.962 1.00 35.95 ? 2270 CYS B SG    1 
ATOM   3264 N  N     . GLY B 1 209 ? -17.381 47.318 -30.032 1.00 42.76 ? 2271 GLY B N     1 
ATOM   3265 C  CA    . GLY B 1 209 ? -17.068 47.666 -31.420 1.00 44.39 ? 2271 GLY B CA    1 
ATOM   3266 C  C     . GLY B 1 209 ? -18.172 48.423 -32.137 1.00 45.08 ? 2271 GLY B C     1 
ATOM   3267 O  O     . GLY B 1 209 ? -18.114 48.573 -33.346 1.00 46.17 ? 2271 GLY B O     1 
ATOM   3268 N  N     . PHE B 1 210 ? -19.177 48.913 -31.408 1.00 45.29 ? 2272 PHE B N     1 
ATOM   3269 C  CA    . PHE B 1 210 ? -20.269 49.661 -32.030 1.00 45.81 ? 2272 PHE B CA    1 
ATOM   3270 C  C     . PHE B 1 210 ? -19.818 51.062 -32.433 1.00 46.88 ? 2272 PHE B C     1 
ATOM   3271 O  O     . PHE B 1 210 ? -19.118 51.713 -31.655 1.00 47.07 ? 2272 PHE B O     1 
ATOM   3272 C  CB    . PHE B 1 210 ? -21.447 49.751 -31.044 1.00 45.03 ? 2272 PHE B CB    1 
ATOM   3273 C  CG    . PHE B 1 210 ? -22.680 50.390 -31.604 1.00 43.17 ? 2272 PHE B CG    1 
ATOM   3274 C  CD1   . PHE B 1 210 ? -23.125 50.081 -32.865 1.00 41.95 ? 2272 PHE B CD1   1 
ATOM   3275 C  CD2   . PHE B 1 210 ? -23.408 51.302 -30.832 1.00 44.29 ? 2272 PHE B CD2   1 
ATOM   3276 C  CE1   . PHE B 1 210 ? -24.287 50.653 -33.366 1.00 43.13 ? 2272 PHE B CE1   1 
ATOM   3277 C  CE2   . PHE B 1 210 ? -24.576 51.882 -31.305 1.00 43.33 ? 2272 PHE B CE2   1 
ATOM   3278 C  CZ    . PHE B 1 210 ? -25.023 51.559 -32.577 1.00 43.94 ? 2272 PHE B CZ    1 
ATOM   3279 N  N     . GLU B 1 211 ? -20.234 51.533 -33.613 1.00 48.12 ? 2273 GLU B N     1 
ATOM   3280 C  CA    . GLU B 1 211 ? -19.991 52.938 -34.031 1.00 50.43 ? 2273 GLU B CA    1 
ATOM   3281 C  C     . GLU B 1 211 ? -20.167 53.969 -32.900 1.00 50.22 ? 2273 GLU B C     1 
ATOM   3282 O  O     . GLU B 1 211 ? -19.324 54.853 -32.711 1.00 50.24 ? 2273 GLU B O     1 
ATOM   3283 C  CB    . GLU B 1 211 ? -20.911 53.338 -35.181 1.00 51.34 ? 2273 GLU B CB    1 
ATOM   3284 C  CG    . GLU B 1 211 ? -20.221 53.529 -36.532 1.00 57.45 ? 2273 GLU B CG    1 
ATOM   3285 C  CD    . GLU B 1 211 ? -21.220 53.895 -37.644 1.00 64.54 ? 2273 GLU B CD    1 
ATOM   3286 O  OE1   . GLU B 1 211 ? -22.166 54.675 -37.372 1.00 66.99 ? 2273 GLU B OE1   1 
ATOM   3287 O  OE2   . GLU B 1 211 ? -21.068 53.390 -38.783 1.00 67.05 ? 2273 GLU B OE2   1 
ATOM   3288 N  N     . LYS B 1 212 ? -21.264 53.845 -32.152 1.00 50.14 ? 2274 LYS B N     1 
ATOM   3289 C  CA    . LYS B 1 212 ? -21.555 54.757 -31.060 1.00 49.93 ? 2274 LYS B CA    1 
ATOM   3290 C  C     . LYS B 1 212 ? -21.396 54.101 -29.676 1.00 49.26 ? 2274 LYS B C     1 
ATOM   3291 O  O     . LYS B 1 212 ? -22.158 54.392 -28.737 1.00 48.95 ? 2274 LYS B O     1 
ATOM   3292 C  CB    . LYS B 1 212 ? -22.960 55.351 -31.232 1.00 51.07 ? 2274 LYS B CB    1 
ATOM   3293 C  CG    . LYS B 1 212 ? -23.107 56.283 -32.430 1.00 52.65 ? 2274 LYS B CG    1 
ATOM   3294 C  CD    . LYS B 1 212 ? -24.555 56.701 -32.639 1.00 57.64 ? 2274 LYS B CD    1 
ATOM   3295 C  CE    . LYS B 1 212 ? -25.412 55.474 -33.025 1.00 60.38 ? 2274 LYS B CE    1 
ATOM   3296 N  NZ    . LYS B 1 212 ? -26.565 55.821 -33.927 1.00 63.87 ? 2274 LYS B NZ    1 
ATOM   3297 N  N     . CYS B 1 213 ? -20.398 53.223 -29.562 1.00 48.13 ? 2275 CYS B N     1 
ATOM   3298 C  CA    . CYS B 1 213 ? -20.020 52.613 -28.281 1.00 47.30 ? 2275 CYS B CA    1 
ATOM   3299 C  C     . CYS B 1 213 ? -19.839 53.690 -27.211 1.00 47.77 ? 2275 CYS B C     1 
ATOM   3300 O  O     . CYS B 1 213 ? -19.223 54.725 -27.455 1.00 48.60 ? 2275 CYS B O     1 
ATOM   3301 C  CB    . CYS B 1 213 ? -18.732 51.798 -28.437 1.00 46.12 ? 2275 CYS B CB    1 
ATOM   3302 S  SG    . CYS B 1 213 ? -18.012 51.263 -26.861 1.00 43.24 ? 2275 CYS B SG    1 
ATOM   3303 N  N     . ARG B 1 214 ? -20.404 53.461 -26.036 1.00 47.77 ? 2276 ARG B N     1 
ATOM   3304 C  CA    . ARG B 1 214 ? -20.314 54.420 -24.943 1.00 48.12 ? 2276 ARG B CA    1 
ATOM   3305 C  C     . ARG B 1 214 ? -18.865 54.471 -24.436 1.00 48.48 ? 2276 ARG B C     1 
ATOM   3306 O  O     . ARG B 1 214 ? -18.507 55.360 -23.671 1.00 48.41 ? 2276 ARG B O     1 
ATOM   3307 C  CB    . ARG B 1 214 ? -21.250 54.048 -23.774 1.00 48.46 ? 2276 ARG B CB    1 
ATOM   3308 C  CG    . ARG B 1 214 ? -22.761 53.896 -24.053 1.00 49.95 ? 2276 ARG B CG    1 
ATOM   3309 C  CD    . ARG B 1 214 ? -23.490 54.060 -22.699 1.00 54.92 ? 2276 ARG B CD    1 
ATOM   3310 N  NE    . ARG B 1 214 ? -24.827 53.464 -22.481 1.00 56.21 ? 2276 ARG B NE    1 
ATOM   3311 C  CZ    . ARG B 1 214 ? -25.328 52.353 -23.035 1.00 56.80 ? 2276 ARG B CZ    1 
ATOM   3312 N  NH1   . ARG B 1 214 ? -24.645 51.644 -23.925 1.00 59.55 ? 2276 ARG B NH1   1 
ATOM   3313 N  NH2   . ARG B 1 214 ? -26.551 51.952 -22.705 1.00 56.14 ? 2276 ARG B NH2   1 
ATOM   3314 N  N     . GLY B 1 215 ? -18.046 53.502 -24.842 1.00 48.37 ? 2277 GLY B N     1 
ATOM   3315 C  CA    . GLY B 1 215 ? -16.624 53.472 -24.472 1.00 48.69 ? 2277 GLY B CA    1 
ATOM   3316 C  C     . GLY B 1 215 ? -16.323 52.810 -23.135 1.00 49.32 ? 2277 GLY B C     1 
ATOM   3317 O  O     . GLY B 1 215 ? -15.200 52.340 -22.913 1.00 49.75 ? 2277 GLY B O     1 
ATOM   3318 N  N     . ILE B 1 216 ? -17.310 52.786 -22.238 1.00 48.91 ? 2278 ILE B N     1 
ATOM   3319 C  CA    . ILE B 1 216 ? -17.164 52.164 -20.908 1.00 49.55 ? 2278 ILE B CA    1 
ATOM   3320 C  C     . ILE B 1 216 ? -18.383 51.261 -20.540 1.00 49.27 ? 2278 ILE B C     1 
ATOM   3321 O  O     . ILE B 1 216 ? -19.503 51.552 -20.938 1.00 48.72 ? 2278 ILE B O     1 
ATOM   3322 C  CB    . ILE B 1 216 ? -16.955 53.264 -19.823 1.00 49.90 ? 2278 ILE B CB    1 
ATOM   3323 C  CG1   . ILE B 1 216 ? -15.549 53.894 -19.944 1.00 51.06 ? 2278 ILE B CG1   1 
ATOM   3324 C  CG2   . ILE B 1 216 ? -17.136 52.709 -18.423 1.00 51.18 ? 2278 ILE B CG2   1 
ATOM   3325 C  CD1   . ILE B 1 216 ? -15.559 55.420 -20.007 1.00 53.59 ? 2278 ILE B CD1   1 
ATOM   3326 N  N     . ILE B 1 217 ? -18.135 50.178 -19.797 1.00 49.32 ? 2279 ILE B N     1 
ATOM   3327 C  CA    . ILE B 1 217 ? -19.185 49.311 -19.231 1.00 49.60 ? 2279 ILE B CA    1 
ATOM   3328 C  C     . ILE B 1 217 ? -19.347 49.523 -17.735 1.00 50.66 ? 2279 ILE B C     1 
ATOM   3329 O  O     . ILE B 1 217 ? -19.519 50.632 -17.253 1.00 51.85 ? 2279 ILE B O     1 
ATOM   3330 C  CB    . ILE B 1 217 ? -18.804 47.835 -19.296 1.00 49.26 ? 2279 ILE B CB    1 
ATOM   3331 C  CG1   . ILE B 1 217 ? -18.167 47.464 -20.626 1.00 48.89 ? 2279 ILE B CG1   1 
ATOM   3332 C  CG2   . ILE B 1 217 ? -20.022 46.949 -18.983 1.00 48.81 ? 2279 ILE B CG2   1 
ATOM   3333 C  CD1   . ILE B 1 217 ? -17.649 46.033 -20.624 1.00 49.26 ? 2279 ILE B CD1   1 
HETATM 3334 ZN ZN    . ZN  C 2 .   ? -18.713 15.466 -35.433 0.87 30.37 ? 2301 ZN  A ZN    1 
HETATM 3335 ZN ZN    . ZN  D 2 .   ? -34.710 13.479 -1.565  0.71 33.31 ? 2302 ZN  A ZN    1 
HETATM 3336 ZN ZN    . ZN  E 2 .   ? -36.062 16.924 -2.165  0.60 37.53 ? 2303 ZN  A ZN    1 
HETATM 3337 N  N     . SAM F 3 .   ? -15.047 3.750  -30.135 1.00 28.58 ? 2304 SAM A N     1 
HETATM 3338 C  CA    . SAM F 3 .   ? -14.199 3.511  -28.950 1.00 31.01 ? 2304 SAM A CA    1 
HETATM 3339 C  C     . SAM F 3 .   ? -13.804 2.034  -28.894 1.00 30.86 ? 2304 SAM A C     1 
HETATM 3340 O  O     . SAM F 3 .   ? -13.131 1.652  -27.934 1.00 30.65 ? 2304 SAM A O     1 
HETATM 3341 O  OXT   . SAM F 3 .   ? -14.210 1.219  -29.739 1.00 29.78 ? 2304 SAM A OXT   1 
HETATM 3342 C  CB    . SAM F 3 .   ? -14.952 3.797  -27.651 1.00 31.93 ? 2304 SAM A CB    1 
HETATM 3343 C  CG    . SAM F 3 .   ? -15.174 5.259  -27.282 1.00 33.74 ? 2304 SAM A CG    1 
HETATM 3344 S  SD    . SAM F 3 .   ? -13.705 5.939  -26.480 1.00 49.16 ? 2304 SAM A SD    1 
HETATM 3345 C  CE    . SAM F 3 .   ? -14.255 6.766  -24.976 1.00 39.06 ? 2304 SAM A CE    1 
HETATM 3346 C  "C5'" . SAM F 3 .   ? -13.246 7.292  -27.578 1.00 37.31 ? 2304 SAM A "C5'" 1 
HETATM 3347 C  "C4'" . SAM F 3 .   ? -12.580 6.792  -28.863 1.00 31.47 ? 2304 SAM A "C4'" 1 
HETATM 3348 O  "O4'" . SAM F 3 .   ? -13.547 6.324  -29.778 1.00 29.78 ? 2304 SAM A "O4'" 1 
HETATM 3349 C  "C3'" . SAM F 3 .   ? -11.956 7.984  -29.544 1.00 30.15 ? 2304 SAM A "C3'" 1 
HETATM 3350 O  "O3'" . SAM F 3 .   ? -10.632 8.127  -29.094 1.00 28.46 ? 2304 SAM A "O3'" 1 
HETATM 3351 C  "C2'" . SAM F 3 .   ? -12.044 7.606  -30.995 1.00 32.50 ? 2304 SAM A "C2'" 1 
HETATM 3352 O  "O2'" . SAM F 3 .   ? -10.985 6.705  -31.261 1.00 32.60 ? 2304 SAM A "O2'" 1 
HETATM 3353 C  "C1'" . SAM F 3 .   ? -13.344 6.821  -31.071 1.00 31.20 ? 2304 SAM A "C1'" 1 
HETATM 3354 N  N9    . SAM F 3 .   ? -14.448 7.746  -31.366 1.00 33.99 ? 2304 SAM A N9    1 
HETATM 3355 C  C8    . SAM F 3 .   ? -15.455 8.117  -30.507 1.00 30.55 ? 2304 SAM A C8    1 
HETATM 3356 N  N7    . SAM F 3 .   ? -16.282 8.980  -31.154 1.00 32.70 ? 2304 SAM A N7    1 
HETATM 3357 C  C5    . SAM F 3 .   ? -15.813 9.189  -32.403 1.00 31.05 ? 2304 SAM A C5    1 
HETATM 3358 C  C6    . SAM F 3 .   ? -16.248 9.974  -33.445 1.00 33.54 ? 2304 SAM A C6    1 
HETATM 3359 N  N6    . SAM F 3 .   ? -17.353 10.717 -33.308 1.00 35.92 ? 2304 SAM A N6    1 
HETATM 3360 N  N1    . SAM F 3 .   ? -15.557 9.953  -34.652 1.00 33.64 ? 2304 SAM A N1    1 
HETATM 3361 C  C2    . SAM F 3 .   ? -14.414 9.190  -34.788 1.00 33.47 ? 2304 SAM A C2    1 
HETATM 3362 N  N3    . SAM F 3 .   ? -13.969 8.416  -33.724 1.00 32.95 ? 2304 SAM A N3    1 
HETATM 3363 C  C4    . SAM F 3 .   ? -14.663 8.401  -32.560 1.00 33.15 ? 2304 SAM A C4    1 
HETATM 3364 ZN ZN    . ZN  G 2 .   ? -19.583 49.447 -26.336 0.64 28.23 ? 2301 ZN  B ZN    1 
HETATM 3365 ZN ZN    . ZN  H 2 .   ? -51.586 30.192 -20.573 0.51 53.34 ? 2302 ZN  B ZN    1 
HETATM 3366 ZN ZN    . ZN  I 2 .   ? -53.653 32.927 -21.329 0.50 79.28 ? 2303 ZN  B ZN    1 
HETATM 3367 N  N     . SAM J 3 .   ? -16.196 37.405 -20.965 1.00 36.47 ? 2304 SAM B N     1 
HETATM 3368 C  CA    . SAM J 3 .   ? -16.497 36.993 -19.559 1.00 36.86 ? 2304 SAM B CA    1 
HETATM 3369 C  C     . SAM J 3 .   ? -15.621 35.811 -19.182 1.00 37.97 ? 2304 SAM B C     1 
HETATM 3370 O  O     . SAM J 3 .   ? -15.873 35.110 -18.189 1.00 38.27 ? 2304 SAM B O     1 
HETATM 3371 O  OXT   . SAM J 3 .   ? -14.641 35.542 -19.895 1.00 38.64 ? 2304 SAM B OXT   1 
HETATM 3372 C  CB    . SAM J 3 .   ? -17.979 36.624 -19.471 1.00 36.51 ? 2304 SAM B CB    1 
HETATM 3373 C  CG    . SAM J 3 .   ? -18.794 37.904 -19.486 1.00 34.36 ? 2304 SAM B CG    1 
HETATM 3374 S  SD    . SAM J 3 .   ? -18.785 38.508 -17.787 1.00 48.20 ? 2304 SAM B SD    1 
HETATM 3375 C  CE    . SAM J 3 .   ? -20.496 38.212 -17.338 1.00 35.18 ? 2304 SAM B CE    1 
HETATM 3376 C  "C5'" . SAM J 3 .   ? -18.441 40.269 -17.847 1.00 35.18 ? 2304 SAM B "C5'" 1 
HETATM 3377 C  "C4'" . SAM J 3 .   ? -16.938 40.431 -17.996 1.00 33.74 ? 2304 SAM B "C4'" 1 
HETATM 3378 O  "O4'" . SAM J 3 .   ? -16.498 40.098 -19.305 1.00 35.60 ? 2304 SAM B "O4'" 1 
HETATM 3379 C  "C3'" . SAM J 3 .   ? -16.609 41.881 -17.849 1.00 35.57 ? 2304 SAM B "C3'" 1 
HETATM 3380 O  "O3'" . SAM J 3 .   ? -16.355 42.105 -16.483 1.00 36.40 ? 2304 SAM B "O3'" 1 
HETATM 3381 C  "C2'" . SAM J 3 .   ? -15.421 42.068 -18.787 1.00 34.58 ? 2304 SAM B "C2'" 1 
HETATM 3382 O  "O2'" . SAM J 3 .   ? -14.251 41.504 -18.222 1.00 35.16 ? 2304 SAM B "O2'" 1 
HETATM 3383 C  "C1'" . SAM J 3 .   ? -15.783 41.139 -19.919 1.00 32.36 ? 2304 SAM B "C1'" 1 
HETATM 3384 N  N9    . SAM J 3 .   ? -16.644 41.806 -20.907 1.00 38.50 ? 2304 SAM B N9    1 
HETATM 3385 C  C8    . SAM J 3 .   ? -17.958 41.520 -21.198 1.00 38.48 ? 2304 SAM B C8    1 
HETATM 3386 N  N7    . SAM J 3 .   ? -18.390 42.343 -22.185 1.00 35.62 ? 2304 SAM B N7    1 
HETATM 3387 C  C5    . SAM J 3 .   ? -17.359 43.135 -22.540 1.00 38.28 ? 2304 SAM B C5    1 
HETATM 3388 C  C6    . SAM J 3 .   ? -17.247 44.164 -23.492 1.00 39.54 ? 2304 SAM B C6    1 
HETATM 3389 N  N6    . SAM J 3 .   ? -18.284 44.494 -24.254 1.00 39.90 ? 2304 SAM B N6    1 
HETATM 3390 N  N1    . SAM J 3 .   ? -16.055 44.830 -23.646 1.00 35.33 ? 2304 SAM B N1    1 
HETATM 3391 C  C2    . SAM J 3 .   ? -14.969 44.496 -22.851 1.00 40.00 ? 2304 SAM B C2    1 
HETATM 3392 N  N3    . SAM J 3 .   ? -15.076 43.489 -21.905 1.00 40.06 ? 2304 SAM B N3    1 
HETATM 3393 C  C4    . SAM J 3 .   ? -16.262 42.824 -21.750 1.00 37.76 ? 2304 SAM B C4    1 
HETATM 3394 O  O     . HOH K 4 .   ? -30.795 14.976 2.202   1.00 38.74 ? 2401 HOH A O     1 
HETATM 3395 O  O     . HOH K 4 .   ? -22.203 5.115  -3.448  1.00 33.49 ? 2402 HOH A O     1 
HETATM 3396 O  O     . HOH K 4 .   ? -15.613 3.265  -4.956  1.00 27.78 ? 2403 HOH A O     1 
HETATM 3397 O  O     . HOH K 4 .   ? -23.258 10.353 -34.565 1.00 27.08 ? 2404 HOH A O     1 
HETATM 3398 O  O     . HOH K 4 .   ? -26.910 16.224 -39.332 1.00 40.61 ? 2405 HOH A O     1 
HETATM 3399 O  O     . HOH K 4 .   ? -28.012 20.095 -39.262 1.00 71.97 ? 2406 HOH A O     1 
HETATM 3400 O  O     . HOH K 4 .   ? -21.661 5.369  -28.349 1.00 26.49 ? 2407 HOH A O     1 
HETATM 3401 O  O     . HOH K 4 .   ? -16.920 7.484  -23.320 1.00 31.30 ? 2408 HOH A O     1 
HETATM 3402 O  O     . HOH K 4 .   ? -15.994 3.767  -17.509 1.00 21.64 ? 2409 HOH A O     1 
HETATM 3403 O  O     . HOH K 4 .   ? -21.003 3.176  -8.668  1.00 29.39 ? 2410 HOH A O     1 
HETATM 3404 O  O     . HOH K 4 .   ? -23.055 16.067 -24.432 1.00 24.09 ? 2411 HOH A O     1 
HETATM 3405 O  O     . HOH K 4 .   ? -28.305 13.497 -31.168 1.00 44.44 ? 2412 HOH A O     1 
HETATM 3406 O  O     . HOH K 4 .   ? -16.204 -5.608 -10.805 1.00 40.99 ? 2413 HOH A O     1 
HETATM 3407 O  O     . HOH K 4 .   ? -23.133 -5.433 -24.763 1.00 34.82 ? 2414 HOH A O     1 
HETATM 3408 O  O     . HOH K 4 .   ? -18.871 13.626 -39.135 1.00 32.09 ? 2415 HOH A O     1 
HETATM 3409 O  O     . HOH K 4 .   ? -8.193  3.088  -15.578 1.00 27.13 ? 2416 HOH A O     1 
HETATM 3410 O  O     . HOH K 4 .   ? -10.253 18.326 -14.528 1.00 41.62 ? 2417 HOH A O     1 
HETATM 3411 O  O     . HOH K 4 .   ? -12.186 0.018  -31.175 1.00 44.16 ? 2418 HOH A O     1 
HETATM 3412 O  O     . HOH K 4 .   ? -31.549 12.045 -11.350 1.00 45.69 ? 2419 HOH A O     1 
HETATM 3413 O  O     . HOH K 4 .   ? -20.993 -1.180 -17.389 1.00 31.06 ? 2420 HOH A O     1 
HETATM 3414 O  O     . HOH K 4 .   ? -15.482 10.284 -7.995  1.00 26.26 ? 2421 HOH A O     1 
HETATM 3415 O  O     . HOH K 4 .   ? -11.499 -0.538 -28.437 1.00 37.05 ? 2422 HOH A O     1 
HETATM 3416 O  O     . HOH K 4 .   ? 0.585   2.497  -25.348 1.00 39.32 ? 2423 HOH A O     1 
HETATM 3417 O  O     . HOH K 4 .   ? -37.036 14.729 -26.380 1.00 55.73 ? 2424 HOH A O     1 
HETATM 3418 O  O     . HOH K 4 .   ? -32.038 6.348  -33.412 1.00 40.82 ? 2425 HOH A O     1 
HETATM 3419 O  O     . HOH K 4 .   ? -21.567 8.290  -36.846 1.00 47.51 ? 2426 HOH A O     1 
HETATM 3420 O  O     . HOH K 4 .   ? -18.065 9.035  -11.295 1.00 20.75 ? 2427 HOH A O     1 
HETATM 3421 O  O     . HOH K 4 .   ? -25.899 -0.765 -17.406 1.00 32.69 ? 2428 HOH A O     1 
HETATM 3422 O  O     . HOH K 4 .   ? -23.089 21.317 3.958   1.00 56.70 ? 2429 HOH A O     1 
HETATM 3423 O  O     . HOH K 4 .   ? -30.105 11.707 -8.361  1.00 38.39 ? 2430 HOH A O     1 
HETATM 3424 O  O     . HOH K 4 .   ? -33.402 15.987 1.335   1.00 38.34 ? 2431 HOH A O     1 
HETATM 3425 O  O     . HOH K 4 .   ? -41.452 15.314 -3.449  1.00 54.93 ? 2432 HOH A O     1 
HETATM 3426 O  O     . HOH K 4 .   ? -34.707 -0.802 -32.411 1.00 62.02 ? 2433 HOH A O     1 
HETATM 3427 O  O     . HOH K 4 .   ? -0.693  4.710  -10.449 1.00 39.45 ? 2434 HOH A O     1 
HETATM 3428 O  O     . HOH K 4 .   ? -15.469 -2.563 -8.090  1.00 29.02 ? 2435 HOH A O     1 
HETATM 3429 O  O     . HOH K 4 .   ? -14.059 -0.326 -7.162  1.00 25.25 ? 2436 HOH A O     1 
HETATM 3430 O  O     . HOH K 4 .   ? -12.455 9.754  -23.528 1.00 40.41 ? 2437 HOH A O     1 
HETATM 3431 O  O     . HOH K 4 .   ? -28.208 5.485  -33.810 1.00 44.47 ? 2438 HOH A O     1 
HETATM 3432 O  O     . HOH K 4 .   ? -22.420 22.458 -34.538 1.00 45.74 ? 2439 HOH A O     1 
HETATM 3433 O  O     . HOH K 4 .   ? -42.257 22.236 -1.251  1.00 51.79 ? 2440 HOH A O     1 
HETATM 3434 O  O     . HOH K 4 .   ? -3.696  1.083  -13.445 1.00 45.35 ? 2441 HOH A O     1 
HETATM 3435 O  O     . HOH K 4 .   ? -30.726 10.465 -31.038 1.00 40.42 ? 2442 HOH A O     1 
HETATM 3436 O  O     . HOH K 4 .   ? 9.564   5.280  -14.160 1.00 52.55 ? 2443 HOH A O     1 
HETATM 3437 O  O     . HOH K 4 .   ? -32.173 -5.778 -20.907 1.00 59.14 ? 2444 HOH A O     1 
HETATM 3438 O  O     . HOH K 4 .   ? -21.186 22.016 -8.500  1.00 42.78 ? 2445 HOH A O     1 
HETATM 3439 O  O     . HOH K 4 .   ? -25.761 10.849 0.659   1.00 43.73 ? 2446 HOH A O     1 
HETATM 3440 O  O     . HOH K 4 .   ? -26.609 -2.255 -19.425 1.00 45.20 ? 2447 HOH A O     1 
HETATM 3441 O  O     . HOH K 4 .   ? -19.868 8.981  -40.918 1.00 48.62 ? 2448 HOH A O     1 
HETATM 3442 O  O     . HOH K 4 .   ? -3.791  19.723 -20.740 1.00 61.80 ? 2449 HOH A O     1 
HETATM 3443 O  O     . HOH K 4 .   ? -26.659 25.955 -39.719 1.00 78.74 ? 2450 HOH A O     1 
HETATM 3444 O  O     . HOH K 4 .   ? -23.865 -3.140 -20.573 1.00 31.39 ? 2451 HOH A O     1 
HETATM 3445 O  O     . HOH L 4 .   ? -22.874 44.242 -30.389 1.00 43.24 ? 2401 HOH B O     1 
HETATM 3446 O  O     . HOH L 4 .   ? -26.402 43.730 -31.722 1.00 39.94 ? 2402 HOH B O     1 
HETATM 3447 O  O     . HOH L 4 .   ? -32.637 28.821 -2.579  1.00 33.17 ? 2403 HOH B O     1 
HETATM 3448 O  O     . HOH L 4 .   ? -51.299 42.381 -5.218  1.00 53.55 ? 2404 HOH B O     1 
HETATM 3449 O  O     . HOH L 4 .   ? -41.252 34.160 -20.048 1.00 41.82 ? 2405 HOH B O     1 
HETATM 3450 O  O     . HOH L 4 .   ? -15.761 38.450 8.010   1.00 23.38 ? 2406 HOH B O     1 
HETATM 3451 O  O     . HOH L 4 .   ? -33.697 34.216 -12.756 1.00 23.48 ? 2407 HOH B O     1 
HETATM 3452 O  O     . HOH L 4 .   ? -25.524 29.909 -1.172  1.00 35.20 ? 2408 HOH B O     1 
HETATM 3453 O  O     . HOH L 4 .   ? -45.665 43.840 -21.703 1.00 37.88 ? 2409 HOH B O     1 
HETATM 3454 O  O     . HOH L 4 .   ? -19.758 34.317 -2.818  1.00 37.39 ? 2410 HOH B O     1 
HETATM 3455 O  O     . HOH L 4 .   ? -22.362 38.581 4.488   1.00 27.97 ? 2411 HOH B O     1 
HETATM 3456 O  O     . HOH L 4 .   ? -39.594 41.987 -5.601  1.00 29.02 ? 2412 HOH B O     1 
HETATM 3457 O  O     . HOH L 4 .   ? -23.064 38.096 -15.819 1.00 26.88 ? 2413 HOH B O     1 
HETATM 3458 O  O     . HOH L 4 .   ? -16.294 26.507 -16.483 1.00 50.41 ? 2414 HOH B O     1 
HETATM 3459 O  O     . HOH L 4 .   ? -35.010 28.577 -7.132  1.00 37.12 ? 2415 HOH B O     1 
HETATM 3460 O  O     . HOH L 4 .   ? -21.081 31.683 -2.824  1.00 34.52 ? 2416 HOH B O     1 
HETATM 3461 O  O     . HOH L 4 .   ? -23.787 23.153 -7.949  1.00 37.29 ? 2417 HOH B O     1 
HETATM 3462 O  O     . HOH L 4 .   ? -18.985 33.179 -34.061 1.00 47.94 ? 2418 HOH B O     1 
HETATM 3463 O  O     . HOH L 4 .   ? -21.354 36.818 -25.357 1.00 26.23 ? 2419 HOH B O     1 
HETATM 3464 O  O     . HOH L 4 .   ? -40.861 30.519 -9.956  1.00 37.34 ? 2420 HOH B O     1 
HETATM 3465 O  O     . HOH L 4 .   ? -21.944 40.586 -15.149 1.00 40.20 ? 2421 HOH B O     1 
HETATM 3466 O  O     . HOH L 4 .   ? -34.626 30.329 -11.012 1.00 26.95 ? 2422 HOH B O     1 
HETATM 3467 O  O     . HOH L 4 .   ? -22.708 33.011 -7.031  1.00 21.48 ? 2423 HOH B O     1 
HETATM 3468 O  O     . HOH L 4 .   ? -18.087 37.713 1.758   1.00 34.04 ? 2424 HOH B O     1 
HETATM 3469 O  O     . HOH L 4 .   ? -23.554 37.880 -18.443 1.00 22.42 ? 2425 HOH B O     1 
HETATM 3470 O  O     . HOH L 4 .   ? -30.128 44.542 -23.765 1.00 24.90 ? 2426 HOH B O     1 
HETATM 3471 O  O     . HOH L 4 .   ? -17.727 28.621 -7.579  1.00 34.60 ? 2427 HOH B O     1 
HETATM 3472 O  O     . HOH L 4 .   ? -24.488 42.174 -30.528 1.00 37.25 ? 2428 HOH B O     1 
HETATM 3473 O  O     . HOH L 4 .   ? -23.094 33.767 1.567   1.00 37.01 ? 2429 HOH B O     1 
HETATM 3474 O  O     . HOH L 4 .   ? -25.412 32.594 -14.572 1.00 23.25 ? 2430 HOH B O     1 
HETATM 3475 O  O     . HOH L 4 .   ? -37.457 45.487 -25.710 1.00 41.35 ? 2431 HOH B O     1 
HETATM 3476 O  O     . HOH L 4 .   ? -20.254 25.351 -24.785 1.00 41.19 ? 2432 HOH B O     1 
HETATM 3477 O  O     . HOH L 4 .   ? -20.571 40.402 -30.811 1.00 40.33 ? 2433 HOH B O     1 
HETATM 3478 O  O     . HOH L 4 .   ? -20.719 37.044 2.642   1.00 36.34 ? 2434 HOH B O     1 
HETATM 3479 O  O     . HOH L 4 .   ? -11.567 38.326 2.882   1.00 24.06 ? 2435 HOH B O     1 
HETATM 3480 O  O     . HOH L 4 .   ? -22.817 40.134 -31.490 1.00 41.49 ? 2436 HOH B O     1 
HETATM 3481 O  O     . HOH L 4 .   ? -43.392 32.505 -20.932 1.00 32.82 ? 2437 HOH B O     1 
HETATM 3482 O  O     . HOH L 4 .   ? -37.918 42.892 -7.615  1.00 40.82 ? 2438 HOH B O     1 
HETATM 3483 O  O     . HOH L 4 .   ? -26.452 40.478 -33.720 1.00 37.24 ? 2439 HOH B O     1 
HETATM 3484 O  O     . HOH L 4 .   ? -36.431 30.161 -8.739  1.00 32.16 ? 2440 HOH B O     1 
HETATM 3485 O  O     . HOH L 4 .   ? -12.968 29.559 -29.165 1.00 42.22 ? 2441 HOH B O     1 
HETATM 3486 O  O     . HOH L 4 .   ? -29.319 45.219 1.876   1.00 27.30 ? 2442 HOH B O     1 
HETATM 3487 O  O     . HOH L 4 .   ? -20.821 22.340 -11.543 1.00 42.32 ? 2443 HOH B O     1 
HETATM 3488 O  O     . HOH L 4 .   ? -24.233 35.130 3.926   1.00 43.98 ? 2444 HOH B O     1 
HETATM 3489 O  O     . HOH L 4 .   ? -11.899 34.595 -18.797 1.00 51.05 ? 2445 HOH B O     1 
HETATM 3490 O  O     . HOH L 4 .   ? -16.403 35.483 4.210   1.00 40.49 ? 2446 HOH B O     1 
HETATM 3491 O  O     . HOH L 4 .   ? -19.099 24.382 -14.622 1.00 42.72 ? 2447 HOH B O     1 
HETATM 3492 O  O     . HOH L 4 .   ? -54.630 21.996 -25.329 1.00 56.70 ? 2448 HOH B O     1 
HETATM 3493 O  O     . HOH L 4 .   ? -14.876 37.695 -31.971 1.00 62.08 ? 2449 HOH B O     1 
HETATM 3494 O  O     . HOH L 4 .   ? -27.425 20.358 -25.649 1.00 55.10 ? 2450 HOH B O     1 
HETATM 3495 O  O     . HOH L 4 .   ? -53.296 21.672 -32.230 1.00 51.47 ? 2451 HOH B O     1 
HETATM 3496 O  O     . HOH L 4 .   ? -52.128 36.026 -9.192  1.00 46.42 ? 2452 HOH B O     1 
HETATM 3497 O  O     . HOH L 4 .   ? -31.436 46.773 -24.383 1.00 36.91 ? 2453 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2063 ?    ?   ?   A . n 
A 1 2   ALA 2   2064 ?    ?   ?   A . n 
A 1 3   MET 3   2065 ?    ?   ?   A . n 
A 1 4   ALA 4   2066 2066 ALA ALA A . n 
A 1 5   GLY 5   2067 2067 GLY GLY A . n 
A 1 6   SER 6   2068 2068 SER SER A . n 
A 1 7   TYR 7   2069 2069 TYR TYR A . n 
A 1 8   LYS 8   2070 2070 LYS LYS A . n 
A 1 9   LYS 9   2071 2071 LYS LYS A . n 
A 1 10  ILE 10  2072 2072 ILE ILE A . n 
A 1 11  ARG 11  2073 2073 ARG ARG A . n 
A 1 12  SER 12  2074 2074 SER SER A . n 
A 1 13  ASN 13  2075 2075 ASN ASN A . n 
A 1 14  VAL 14  2076 2076 VAL VAL A . n 
A 1 15  TYR 15  2077 2077 TYR TYR A . n 
A 1 16  VAL 16  2078 2078 VAL VAL A . n 
A 1 17  ASP 17  2079 2079 ASP ASP A . n 
A 1 18  VAL 18  2080 2080 VAL VAL A . n 
A 1 19  LYS 19  2081 2081 LYS LYS A . n 
A 1 20  PRO 20  2082 2082 PRO PRO A . n 
A 1 21  LEU 21  2083 2083 LEU LEU A . n 
A 1 22  SER 22  2084 2084 SER SER A . n 
A 1 23  GLY 23  2085 2085 GLY GLY A . n 
A 1 24  TYR 24  2086 2086 TYR TYR A . n 
A 1 25  GLU 25  2087 2087 GLU GLU A . n 
A 1 26  ALA 26  2088 2088 ALA ALA A . n 
A 1 27  THR 27  2089 2089 THR THR A . n 
A 1 28  THR 28  2090 2090 THR THR A . n 
A 1 29  CYS 29  2091 2091 CYS CYS A . n 
A 1 30  ASN 30  2092 2092 ASN ASN A . n 
A 1 31  CYS 31  2093 2093 CYS CYS A . n 
A 1 32  LYS 32  2094 2094 LYS LYS A . n 
A 1 33  LYS 33  2095 2095 LYS LYS A . n 
A 1 34  PRO 34  2096 2096 PRO PRO A . n 
A 1 35  ASP 35  2097 2097 ASP ASP A . n 
A 1 36  ASP 36  2098 2098 ASP ASP A . n 
A 1 37  ASP 37  2099 2099 ASP ASP A . n 
A 1 38  THR 38  2100 2100 THR THR A . n 
A 1 39  ARG 39  2101 2101 ARG ARG A . n 
A 1 40  LYS 40  2102 2102 LYS LYS A . n 
A 1 41  GLY 41  2103 2103 GLY GLY A . n 
A 1 42  CYS 42  2104 2104 CYS CYS A . n 
A 1 43  VAL 43  2105 2105 VAL VAL A . n 
A 1 44  ASP 44  2106 2106 ASP ASP A . n 
A 1 45  ASP 45  2107 2107 ASP ASP A . n 
A 1 46  CYS 46  2108 2108 CYS CYS A . n 
A 1 47  LEU 47  2109 2109 LEU LEU A . n 
A 1 48  ASN 48  2110 2110 ASN ASN A . n 
A 1 49  ARG 49  2111 2111 ARG ARG A . n 
A 1 50  MET 50  2112 2112 MET MET A . n 
A 1 51  ILE 51  2113 2113 ILE ILE A . n 
A 1 52  PHE 52  2114 2114 PHE PHE A . n 
A 1 53  ALA 53  2115 2115 ALA ALA A . n 
A 1 54  GLU 54  2116 2116 GLU GLU A . n 
A 1 55  CYS 55  2117 2117 CYS CYS A . n 
A 1 56  SER 56  2118 2118 SER SER A . n 
A 1 57  PRO 57  2119 2119 PRO PRO A . n 
A 1 58  ASN 58  2120 2120 ASN ASN A . n 
A 1 59  THR 59  2121 2121 THR THR A . n 
A 1 60  CYS 60  2122 2122 CYS CYS A . n 
A 1 61  PRO 61  2123 2123 PRO PRO A . n 
A 1 62  CYS 62  2124 2124 CYS CYS A . n 
A 1 63  GLY 63  2125 2125 GLY GLY A . n 
A 1 64  GLU 64  2126 2126 GLU GLU A . n 
A 1 65  GLN 65  2127 2127 GLN GLN A . n 
A 1 66  CYS 66  2128 2128 CYS CYS A . n 
A 1 67  CYS 67  2129 2129 CYS CYS A . n 
A 1 68  ASN 68  2130 2130 ASN ASN A . n 
A 1 69  GLN 69  2131 2131 GLN GLN A . n 
A 1 70  ARG 70  2132 2132 ARG ARG A . n 
A 1 71  ILE 71  2133 2133 ILE ILE A . n 
A 1 72  GLN 72  2134 2134 GLN GLN A . n 
A 1 73  ARG 73  2135 2135 ARG ARG A . n 
A 1 74  HIS 74  2136 2136 HIS HIS A . n 
A 1 75  GLU 75  2137 2137 GLU GLU A . n 
A 1 76  TRP 76  2138 2138 TRP TRP A . n 
A 1 77  VAL 77  2139 2139 VAL VAL A . n 
A 1 78  GLN 78  2140 2140 GLN GLN A . n 
A 1 79  CYS 79  2141 2141 CYS CYS A . n 
A 1 80  LEU 80  2142 2142 LEU LEU A . n 
A 1 81  GLU 81  2143 2143 GLU GLU A . n 
A 1 82  ARG 82  2144 2144 ARG ARG A . n 
A 1 83  PHE 83  2145 2145 PHE PHE A . n 
A 1 84  ARG 84  2146 2146 ARG ARG A . n 
A 1 85  ALA 85  2147 2147 ALA ALA A . n 
A 1 86  GLU 86  2148 2148 GLU GLU A . n 
A 1 87  GLU 87  2149 2149 GLU GLU A . n 
A 1 88  LYS 88  2150 2150 LYS LYS A . n 
A 1 89  GLY 89  2151 2151 GLY GLY A . n 
A 1 90  TRP 90  2152 2152 TRP TRP A . n 
A 1 91  GLY 91  2153 2153 GLY GLY A . n 
A 1 92  ILE 92  2154 2154 ILE ILE A . n 
A 1 93  ARG 93  2155 2155 ARG ARG A . n 
A 1 94  THR 94  2156 2156 THR THR A . n 
A 1 95  LYS 95  2157 2157 LYS LYS A . n 
A 1 96  GLU 96  2158 2158 GLU GLU A . n 
A 1 97  PRO 97  2159 2159 PRO PRO A . n 
A 1 98  LEU 98  2160 2160 LEU LEU A . n 
A 1 99  LYS 99  2161 2161 LYS LYS A . n 
A 1 100 ALA 100 2162 2162 ALA ALA A . n 
A 1 101 GLY 101 2163 2163 GLY GLY A . n 
A 1 102 GLN 102 2164 2164 GLN GLN A . n 
A 1 103 PHE 103 2165 2165 PHE PHE A . n 
A 1 104 ILE 104 2166 2166 ILE ILE A . n 
A 1 105 ILE 105 2167 2167 ILE ILE A . n 
A 1 106 GLU 106 2168 2168 GLU GLU A . n 
A 1 107 TYR 107 2169 2169 TYR TYR A . n 
A 1 108 LEU 108 2170 2170 LEU LEU A . n 
A 1 109 GLY 109 2171 2171 GLY GLY A . n 
A 1 110 GLU 110 2172 2172 GLU GLU A . n 
A 1 111 VAL 111 2173 2173 VAL VAL A . n 
A 1 112 VAL 112 2174 2174 VAL VAL A . n 
A 1 113 SER 113 2175 2175 SER SER A . n 
A 1 114 GLU 114 2176 2176 GLU GLU A . n 
A 1 115 GLN 115 2177 2177 GLN GLN A . n 
A 1 116 GLU 116 2178 2178 GLU GLU A . n 
A 1 117 PHE 117 2179 2179 PHE PHE A . n 
A 1 118 ARG 118 2180 2180 ARG ARG A . n 
A 1 119 ASN 119 2181 2181 ASN ASN A . n 
A 1 120 ARG 120 2182 2182 ARG ARG A . n 
A 1 121 MET 121 2183 2183 MET MET A . n 
A 1 122 ILE 122 2184 2184 ILE ILE A . n 
A 1 123 GLU 123 2185 2185 GLU GLU A . n 
A 1 124 GLN 124 2186 2186 GLN GLN A . n 
A 1 125 TYR 125 2187 2187 TYR TYR A . n 
A 1 126 HIS 126 2188 2188 HIS HIS A . n 
A 1 127 ASN 127 2189 2189 ASN ASN A . n 
A 1 128 HIS 128 2190 2190 HIS HIS A . n 
A 1 129 SER 129 2191 2191 SER SER A . n 
A 1 130 ASP 130 2192 2192 ASP ASP A . n 
A 1 131 HIS 131 2193 2193 HIS HIS A . n 
A 1 132 TYR 132 2194 2194 TYR TYR A . n 
A 1 133 CYS 133 2195 2195 CYS CYS A . n 
A 1 134 LEU 134 2196 2196 LEU LEU A . n 
A 1 135 ASN 135 2197 2197 ASN ASN A . n 
A 1 136 LEU 136 2198 2198 LEU LEU A . n 
A 1 137 ASP 137 2199 2199 ASP ASP A . n 
A 1 138 SER 138 2200 2200 SER SER A . n 
A 1 139 GLY 139 2201 2201 GLY GLY A . n 
A 1 140 MET 140 2202 2202 MET MET A . n 
A 1 141 VAL 141 2203 2203 VAL VAL A . n 
A 1 142 ILE 142 2204 2204 ILE ILE A . n 
A 1 143 ASP 143 2205 2205 ASP ASP A . n 
A 1 144 SER 144 2206 2206 SER SER A . n 
A 1 145 TYR 145 2207 2207 TYR TYR A . n 
A 1 146 ARG 146 2208 2208 ARG ARG A . n 
A 1 147 MET 147 2209 2209 MET MET A . n 
A 1 148 GLY 148 2210 2210 GLY GLY A . n 
A 1 149 ASN 149 2211 2211 ASN ASN A . n 
A 1 150 GLU 150 2212 2212 GLU GLU A . n 
A 1 151 ALA 151 2213 2213 ALA ALA A . n 
A 1 152 ARG 152 2214 2214 ARG ARG A . n 
A 1 153 PHE 153 2215 2215 PHE PHE A . n 
A 1 154 ILE 154 2216 2216 ILE ILE A . n 
A 1 155 ASN 155 2217 2217 ASN ASN A . n 
A 1 156 HIS 156 2218 2218 HIS HIS A . n 
A 1 157 SER 157 2219 2219 SER SER A . n 
A 1 158 CYS 158 2220 2220 CYS CYS A . n 
A 1 159 ASP 159 2221 2221 ASP ASP A . n 
A 1 160 PRO 160 2222 2222 PRO PRO A . n 
A 1 161 ASN 161 2223 2223 ASN ASN A . n 
A 1 162 CYS 162 2224 2224 CYS CYS A . n 
A 1 163 GLU 163 2225 2225 GLU GLU A . n 
A 1 164 MET 164 2226 2226 MET MET A . n 
A 1 165 GLN 165 2227 2227 GLN GLN A . n 
A 1 166 LYS 166 2228 2228 LYS LYS A . n 
A 1 167 TRP 167 2229 2229 TRP TRP A . n 
A 1 168 SER 168 2230 2230 SER SER A . n 
A 1 169 VAL 169 2231 2231 VAL VAL A . n 
A 1 170 ASN 170 2232 2232 ASN ASN A . n 
A 1 171 GLY 171 2233 2233 GLY GLY A . n 
A 1 172 VAL 172 2234 2234 VAL VAL A . n 
A 1 173 TYR 173 2235 2235 TYR TYR A . n 
A 1 174 ARG 174 2236 2236 ARG ARG A . n 
A 1 175 ILE 175 2237 2237 ILE ILE A . n 
A 1 176 GLY 176 2238 2238 GLY GLY A . n 
A 1 177 LEU 177 2239 2239 LEU LEU A . n 
A 1 178 TYR 178 2240 2240 TYR TYR A . n 
A 1 179 ALA 179 2241 2241 ALA ALA A . n 
A 1 180 LEU 180 2242 2242 LEU LEU A . n 
A 1 181 LYS 181 2243 2243 LYS LYS A . n 
A 1 182 ASP 182 2244 2244 ASP ASP A . n 
A 1 183 MET 183 2245 2245 MET MET A . n 
A 1 184 PRO 184 2246 2246 PRO PRO A . n 
A 1 185 ALA 185 2247 2247 ALA ALA A . n 
A 1 186 GLY 186 2248 2248 GLY GLY A . n 
A 1 187 THR 187 2249 2249 THR THR A . n 
A 1 188 GLU 188 2250 2250 GLU GLU A . n 
A 1 189 LEU 189 2251 2251 LEU LEU A . n 
A 1 190 THR 190 2252 2252 THR THR A . n 
A 1 191 TYR 191 2253 2253 TYR TYR A . n 
A 1 192 ASP 192 2254 2254 ASP ASP A . n 
A 1 193 TYR 193 2255 2255 TYR TYR A . n 
A 1 194 ASN 194 2256 2256 ASN ASN A . n 
A 1 195 PHE 195 2257 2257 PHE PHE A . n 
A 1 196 HIS 196 2258 2258 HIS HIS A . n 
A 1 197 SER 197 2259 2259 SER SER A . n 
A 1 198 PHE 198 2260 2260 PHE PHE A . n 
A 1 199 ASN 199 2261 2261 ASN ASN A . n 
A 1 200 VAL 200 2262 2262 VAL VAL A . n 
A 1 201 GLU 201 2263 2263 GLU GLU A . n 
A 1 202 LYS 202 2264 2264 LYS LYS A . n 
A 1 203 GLN 203 2265 2265 GLN GLN A . n 
A 1 204 GLN 204 2266 2266 GLN GLN A . n 
A 1 205 LEU 205 2267 2267 LEU LEU A . n 
A 1 206 CYS 206 2268 2268 CYS CYS A . n 
A 1 207 LYS 207 2269 2269 LYS LYS A . n 
A 1 208 CYS 208 2270 2270 CYS CYS A . n 
A 1 209 GLY 209 2271 2271 GLY GLY A . n 
A 1 210 PHE 210 2272 2272 PHE PHE A . n 
A 1 211 GLU 211 2273 2273 GLU GLU A . n 
A 1 212 LYS 212 2274 2274 LYS LYS A . n 
A 1 213 CYS 213 2275 2275 CYS CYS A . n 
A 1 214 ARG 214 2276 2276 ARG ARG A . n 
A 1 215 GLY 215 2277 2277 GLY GLY A . n 
A 1 216 ILE 216 2278 2278 ILE ILE A . n 
A 1 217 ILE 217 2279 2279 ILE ILE A . n 
A 1 218 GLY 218 2280 2280 GLY GLY A . n 
A 1 219 GLY 219 2281 ?    ?   ?   A . n 
A 1 220 LYS 220 2282 ?    ?   ?   A . n 
A 1 221 SER 221 2283 ?    ?   ?   A . n 
A 1 222 GLN 222 2284 ?    ?   ?   A . n 
A 1 223 ARG 223 2285 ?    ?   ?   A . n 
A 1 224 VAL 224 2286 ?    ?   ?   A . n 
A 1 225 ASN 225 2287 ?    ?   ?   A . n 
A 1 226 GLY 226 2288 ?    ?   ?   A . n 
B 1 1   GLY 1   2063 ?    ?   ?   B . n 
B 1 2   ALA 2   2064 ?    ?   ?   B . n 
B 1 3   MET 3   2065 ?    ?   ?   B . n 
B 1 4   ALA 4   2066 ?    ?   ?   B . n 
B 1 5   GLY 5   2067 2067 GLY GLY B . n 
B 1 6   SER 6   2068 2068 SER SER B . n 
B 1 7   TYR 7   2069 2069 TYR TYR B . n 
B 1 8   LYS 8   2070 2070 LYS LYS B . n 
B 1 9   LYS 9   2071 2071 LYS LYS B . n 
B 1 10  ILE 10  2072 2072 ILE ILE B . n 
B 1 11  ARG 11  2073 2073 ARG ARG B . n 
B 1 12  SER 12  2074 2074 SER SER B . n 
B 1 13  ASN 13  2075 2075 ASN ASN B . n 
B 1 14  VAL 14  2076 2076 VAL VAL B . n 
B 1 15  TYR 15  2077 2077 TYR TYR B . n 
B 1 16  VAL 16  2078 2078 VAL VAL B . n 
B 1 17  ASP 17  2079 2079 ASP ASP B . n 
B 1 18  VAL 18  2080 2080 VAL VAL B . n 
B 1 19  LYS 19  2081 2081 LYS LYS B . n 
B 1 20  PRO 20  2082 2082 PRO PRO B . n 
B 1 21  LEU 21  2083 2083 LEU LEU B . n 
B 1 22  SER 22  2084 2084 SER SER B . n 
B 1 23  GLY 23  2085 2085 GLY GLY B . n 
B 1 24  TYR 24  2086 2086 TYR TYR B . n 
B 1 25  GLU 25  2087 ?    ?   ?   B . n 
B 1 26  ALA 26  2088 ?    ?   ?   B . n 
B 1 27  THR 27  2089 ?    ?   ?   B . n 
B 1 28  THR 28  2090 ?    ?   ?   B . n 
B 1 29  CYS 29  2091 ?    ?   ?   B . n 
B 1 30  ASN 30  2092 ?    ?   ?   B . n 
B 1 31  CYS 31  2093 ?    ?   ?   B . n 
B 1 32  LYS 32  2094 ?    ?   ?   B . n 
B 1 33  LYS 33  2095 ?    ?   ?   B . n 
B 1 34  PRO 34  2096 ?    ?   ?   B . n 
B 1 35  ASP 35  2097 ?    ?   ?   B . n 
B 1 36  ASP 36  2098 ?    ?   ?   B . n 
B 1 37  ASP 37  2099 ?    ?   ?   B . n 
B 1 38  THR 38  2100 ?    ?   ?   B . n 
B 1 39  ARG 39  2101 ?    ?   ?   B . n 
B 1 40  LYS 40  2102 ?    ?   ?   B . n 
B 1 41  GLY 41  2103 ?    ?   ?   B . n 
B 1 42  CYS 42  2104 2104 CYS CYS B . n 
B 1 43  VAL 43  2105 2105 VAL VAL B . n 
B 1 44  ASP 44  2106 2106 ASP ASP B . n 
B 1 45  ASP 45  2107 2107 ASP ASP B . n 
B 1 46  CYS 46  2108 2108 CYS CYS B . n 
B 1 47  LEU 47  2109 2109 LEU LEU B . n 
B 1 48  ASN 48  2110 2110 ASN ASN B . n 
B 1 49  ARG 49  2111 2111 ARG ARG B . n 
B 1 50  MET 50  2112 2112 MET MET B . n 
B 1 51  ILE 51  2113 2113 ILE ILE B . n 
B 1 52  PHE 52  2114 2114 PHE PHE B . n 
B 1 53  ALA 53  2115 2115 ALA ALA B . n 
B 1 54  GLU 54  2116 2116 GLU GLU B . n 
B 1 55  CYS 55  2117 2117 CYS CYS B . n 
B 1 56  SER 56  2118 2118 SER SER B . n 
B 1 57  PRO 57  2119 2119 PRO PRO B . n 
B 1 58  ASN 58  2120 2120 ASN ASN B . n 
B 1 59  THR 59  2121 2121 THR THR B . n 
B 1 60  CYS 60  2122 2122 CYS CYS B . n 
B 1 61  PRO 61  2123 2123 PRO PRO B . n 
B 1 62  CYS 62  2124 2124 CYS CYS B . n 
B 1 63  GLY 63  2125 2125 GLY GLY B . n 
B 1 64  GLU 64  2126 2126 GLU GLU B . n 
B 1 65  GLN 65  2127 2127 GLN GLN B . n 
B 1 66  CYS 66  2128 2128 CYS CYS B . n 
B 1 67  CYS 67  2129 2129 CYS CYS B . n 
B 1 68  ASN 68  2130 2130 ASN ASN B . n 
B 1 69  GLN 69  2131 2131 GLN GLN B . n 
B 1 70  ARG 70  2132 2132 ARG ARG B . n 
B 1 71  ILE 71  2133 2133 ILE ILE B . n 
B 1 72  GLN 72  2134 2134 GLN GLN B . n 
B 1 73  ARG 73  2135 2135 ARG ARG B . n 
B 1 74  HIS 74  2136 2136 HIS HIS B . n 
B 1 75  GLU 75  2137 2137 GLU GLU B . n 
B 1 76  TRP 76  2138 2138 TRP TRP B . n 
B 1 77  VAL 77  2139 2139 VAL VAL B . n 
B 1 78  GLN 78  2140 2140 GLN GLN B . n 
B 1 79  CYS 79  2141 2141 CYS CYS B . n 
B 1 80  LEU 80  2142 2142 LEU LEU B . n 
B 1 81  GLU 81  2143 2143 GLU GLU B . n 
B 1 82  ARG 82  2144 2144 ARG ARG B . n 
B 1 83  PHE 83  2145 2145 PHE PHE B . n 
B 1 84  ARG 84  2146 2146 ARG ARG B . n 
B 1 85  ALA 85  2147 2147 ALA ALA B . n 
B 1 86  GLU 86  2148 2148 GLU GLU B . n 
B 1 87  GLU 87  2149 2149 GLU GLU B . n 
B 1 88  LYS 88  2150 2150 LYS LYS B . n 
B 1 89  GLY 89  2151 2151 GLY GLY B . n 
B 1 90  TRP 90  2152 2152 TRP TRP B . n 
B 1 91  GLY 91  2153 2153 GLY GLY B . n 
B 1 92  ILE 92  2154 2154 ILE ILE B . n 
B 1 93  ARG 93  2155 2155 ARG ARG B . n 
B 1 94  THR 94  2156 2156 THR THR B . n 
B 1 95  LYS 95  2157 2157 LYS LYS B . n 
B 1 96  GLU 96  2158 2158 GLU GLU B . n 
B 1 97  PRO 97  2159 2159 PRO PRO B . n 
B 1 98  LEU 98  2160 2160 LEU LEU B . n 
B 1 99  LYS 99  2161 2161 LYS LYS B . n 
B 1 100 ALA 100 2162 2162 ALA ALA B . n 
B 1 101 GLY 101 2163 2163 GLY GLY B . n 
B 1 102 GLN 102 2164 2164 GLN GLN B . n 
B 1 103 PHE 103 2165 2165 PHE PHE B . n 
B 1 104 ILE 104 2166 2166 ILE ILE B . n 
B 1 105 ILE 105 2167 2167 ILE ILE B . n 
B 1 106 GLU 106 2168 2168 GLU GLU B . n 
B 1 107 TYR 107 2169 2169 TYR TYR B . n 
B 1 108 LEU 108 2170 2170 LEU LEU B . n 
B 1 109 GLY 109 2171 2171 GLY GLY B . n 
B 1 110 GLU 110 2172 2172 GLU GLU B . n 
B 1 111 VAL 111 2173 2173 VAL VAL B . n 
B 1 112 VAL 112 2174 2174 VAL VAL B . n 
B 1 113 SER 113 2175 2175 SER SER B . n 
B 1 114 GLU 114 2176 2176 GLU GLU B . n 
B 1 115 GLN 115 2177 2177 GLN GLN B . n 
B 1 116 GLU 116 2178 2178 GLU GLU B . n 
B 1 117 PHE 117 2179 2179 PHE PHE B . n 
B 1 118 ARG 118 2180 2180 ARG ARG B . n 
B 1 119 ASN 119 2181 2181 ASN ASN B . n 
B 1 120 ARG 120 2182 2182 ARG ARG B . n 
B 1 121 MET 121 2183 2183 MET MET B . n 
B 1 122 ILE 122 2184 2184 ILE ILE B . n 
B 1 123 GLU 123 2185 2185 GLU GLU B . n 
B 1 124 GLN 124 2186 2186 GLN GLN B . n 
B 1 125 TYR 125 2187 2187 TYR TYR B . n 
B 1 126 HIS 126 2188 2188 HIS HIS B . n 
B 1 127 ASN 127 2189 2189 ASN ASN B . n 
B 1 128 HIS 128 2190 2190 HIS HIS B . n 
B 1 129 SER 129 2191 2191 SER SER B . n 
B 1 130 ASP 130 2192 2192 ASP ASP B . n 
B 1 131 HIS 131 2193 2193 HIS HIS B . n 
B 1 132 TYR 132 2194 2194 TYR TYR B . n 
B 1 133 CYS 133 2195 2195 CYS CYS B . n 
B 1 134 LEU 134 2196 2196 LEU LEU B . n 
B 1 135 ASN 135 2197 2197 ASN ASN B . n 
B 1 136 LEU 136 2198 2198 LEU LEU B . n 
B 1 137 ASP 137 2199 2199 ASP ASP B . n 
B 1 138 SER 138 2200 2200 SER SER B . n 
B 1 139 GLY 139 2201 2201 GLY GLY B . n 
B 1 140 MET 140 2202 2202 MET MET B . n 
B 1 141 VAL 141 2203 2203 VAL VAL B . n 
B 1 142 ILE 142 2204 2204 ILE ILE B . n 
B 1 143 ASP 143 2205 2205 ASP ASP B . n 
B 1 144 SER 144 2206 2206 SER SER B . n 
B 1 145 TYR 145 2207 2207 TYR TYR B . n 
B 1 146 ARG 146 2208 2208 ARG ARG B . n 
B 1 147 MET 147 2209 2209 MET MET B . n 
B 1 148 GLY 148 2210 2210 GLY GLY B . n 
B 1 149 ASN 149 2211 2211 ASN ASN B . n 
B 1 150 GLU 150 2212 2212 GLU GLU B . n 
B 1 151 ALA 151 2213 2213 ALA ALA B . n 
B 1 152 ARG 152 2214 2214 ARG ARG B . n 
B 1 153 PHE 153 2215 2215 PHE PHE B . n 
B 1 154 ILE 154 2216 2216 ILE ILE B . n 
B 1 155 ASN 155 2217 2217 ASN ASN B . n 
B 1 156 HIS 156 2218 2218 HIS HIS B . n 
B 1 157 SER 157 2219 2219 SER SER B . n 
B 1 158 CYS 158 2220 2220 CYS CYS B . n 
B 1 159 ASP 159 2221 2221 ASP ASP B . n 
B 1 160 PRO 160 2222 2222 PRO PRO B . n 
B 1 161 ASN 161 2223 2223 ASN ASN B . n 
B 1 162 CYS 162 2224 2224 CYS CYS B . n 
B 1 163 GLU 163 2225 2225 GLU GLU B . n 
B 1 164 MET 164 2226 2226 MET MET B . n 
B 1 165 GLN 165 2227 2227 GLN GLN B . n 
B 1 166 LYS 166 2228 2228 LYS LYS B . n 
B 1 167 TRP 167 2229 2229 TRP TRP B . n 
B 1 168 SER 168 2230 2230 SER SER B . n 
B 1 169 VAL 169 2231 2231 VAL VAL B . n 
B 1 170 ASN 170 2232 2232 ASN ASN B . n 
B 1 171 GLY 171 2233 2233 GLY GLY B . n 
B 1 172 VAL 172 2234 2234 VAL VAL B . n 
B 1 173 TYR 173 2235 2235 TYR TYR B . n 
B 1 174 ARG 174 2236 2236 ARG ARG B . n 
B 1 175 ILE 175 2237 2237 ILE ILE B . n 
B 1 176 GLY 176 2238 2238 GLY GLY B . n 
B 1 177 LEU 177 2239 2239 LEU LEU B . n 
B 1 178 TYR 178 2240 2240 TYR TYR B . n 
B 1 179 ALA 179 2241 2241 ALA ALA B . n 
B 1 180 LEU 180 2242 2242 LEU LEU B . n 
B 1 181 LYS 181 2243 2243 LYS LYS B . n 
B 1 182 ASP 182 2244 2244 ASP ASP B . n 
B 1 183 MET 183 2245 2245 MET MET B . n 
B 1 184 PRO 184 2246 2246 PRO PRO B . n 
B 1 185 ALA 185 2247 2247 ALA ALA B . n 
B 1 186 GLY 186 2248 2248 GLY GLY B . n 
B 1 187 THR 187 2249 2249 THR THR B . n 
B 1 188 GLU 188 2250 2250 GLU GLU B . n 
B 1 189 LEU 189 2251 2251 LEU LEU B . n 
B 1 190 THR 190 2252 2252 THR THR B . n 
B 1 191 TYR 191 2253 2253 TYR TYR B . n 
B 1 192 ASP 192 2254 2254 ASP ASP B . n 
B 1 193 TYR 193 2255 2255 TYR TYR B . n 
B 1 194 ASN 194 2256 2256 ASN ASN B . n 
B 1 195 PHE 195 2257 2257 PHE PHE B . n 
B 1 196 HIS 196 2258 2258 HIS HIS B . n 
B 1 197 SER 197 2259 2259 SER SER B . n 
B 1 198 PHE 198 2260 2260 PHE PHE B . n 
B 1 199 ASN 199 2261 2261 ASN ASN B . n 
B 1 200 VAL 200 2262 2262 VAL VAL B . n 
B 1 201 GLU 201 2263 2263 GLU GLU B . n 
B 1 202 LYS 202 2264 2264 LYS LYS B . n 
B 1 203 GLN 203 2265 2265 GLN GLN B . n 
B 1 204 GLN 204 2266 2266 GLN GLN B . n 
B 1 205 LEU 205 2267 2267 LEU LEU B . n 
B 1 206 CYS 206 2268 2268 CYS CYS B . n 
B 1 207 LYS 207 2269 2269 LYS LYS B . n 
B 1 208 CYS 208 2270 2270 CYS CYS B . n 
B 1 209 GLY 209 2271 2271 GLY GLY B . n 
B 1 210 PHE 210 2272 2272 PHE PHE B . n 
B 1 211 GLU 211 2273 2273 GLU GLU B . n 
B 1 212 LYS 212 2274 2274 LYS LYS B . n 
B 1 213 CYS 213 2275 2275 CYS CYS B . n 
B 1 214 ARG 214 2276 2276 ARG ARG B . n 
B 1 215 GLY 215 2277 2277 GLY GLY B . n 
B 1 216 ILE 216 2278 2278 ILE ILE B . n 
B 1 217 ILE 217 2279 2279 ILE ILE B . n 
B 1 218 GLY 218 2280 ?    ?   ?   B . n 
B 1 219 GLY 219 2281 ?    ?   ?   B . n 
B 1 220 LYS 220 2282 ?    ?   ?   B . n 
B 1 221 SER 221 2283 ?    ?   ?   B . n 
B 1 222 GLN 222 2284 ?    ?   ?   B . n 
B 1 223 ARG 223 2285 ?    ?   ?   B . n 
B 1 224 VAL 224 2286 ?    ?   ?   B . n 
B 1 225 ASN 225 2287 ?    ?   ?   B . n 
B 1 226 GLY 226 2288 ?    ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1  2301 1   ZN  ZN  A . 
D 2 ZN  1  2302 2   ZN  ZN  A . 
E 2 ZN  1  2303 4   ZN  ZN  A . 
F 3 SAM 1  2304 7   SAM SAM A . 
G 2 ZN  1  2301 3   ZN  ZN  B . 
H 2 ZN  1  2302 5   ZN  ZN  B . 
I 2 ZN  1  2303 6   ZN  ZN  B . 
J 3 SAM 1  2304 8   SAM SAM B . 
K 4 HOH 1  2401 59  HOH HOH A . 
K 4 HOH 2  2402 89  HOH HOH A . 
K 4 HOH 3  2403 38  HOH HOH A . 
K 4 HOH 4  2404 57  HOH HOH A . 
K 4 HOH 5  2405 25  HOH HOH A . 
K 4 HOH 6  2406 50  HOH HOH A . 
K 4 HOH 7  2407 36  HOH HOH A . 
K 4 HOH 8  2408 102 HOH HOH A . 
K 4 HOH 9  2409 12  HOH HOH A . 
K 4 HOH 10 2410 31  HOH HOH A . 
K 4 HOH 11 2411 33  HOH HOH A . 
K 4 HOH 12 2412 71  HOH HOH A . 
K 4 HOH 13 2413 52  HOH HOH A . 
K 4 HOH 14 2414 108 HOH HOH A . 
K 4 HOH 15 2415 55  HOH HOH A . 
K 4 HOH 16 2416 6   HOH HOH A . 
K 4 HOH 17 2417 97  HOH HOH A . 
K 4 HOH 18 2418 105 HOH HOH A . 
K 4 HOH 19 2419 60  HOH HOH A . 
K 4 HOH 20 2420 10  HOH HOH A . 
K 4 HOH 21 2421 65  HOH HOH A . 
K 4 HOH 22 2422 20  HOH HOH A . 
K 4 HOH 23 2423 95  HOH HOH A . 
K 4 HOH 24 2424 73  HOH HOH A . 
K 4 HOH 25 2425 39  HOH HOH A . 
K 4 HOH 26 2426 41  HOH HOH A . 
K 4 HOH 27 2427 21  HOH HOH A . 
K 4 HOH 28 2428 76  HOH HOH A . 
K 4 HOH 29 2429 37  HOH HOH A . 
K 4 HOH 30 2430 58  HOH HOH A . 
K 4 HOH 31 2431 18  HOH HOH A . 
K 4 HOH 32 2432 54  HOH HOH A . 
K 4 HOH 33 2433 104 HOH HOH A . 
K 4 HOH 34 2434 42  HOH HOH A . 
K 4 HOH 35 2435 24  HOH HOH A . 
K 4 HOH 36 2436 13  HOH HOH A . 
K 4 HOH 37 2437 63  HOH HOH A . 
K 4 HOH 38 2438 48  HOH HOH A . 
K 4 HOH 39 2439 16  HOH HOH A . 
K 4 HOH 40 2440 45  HOH HOH A . 
K 4 HOH 41 2441 80  HOH HOH A . 
K 4 HOH 42 2442 40  HOH HOH A . 
K 4 HOH 43 2443 88  HOH HOH A . 
K 4 HOH 44 2444 75  HOH HOH A . 
K 4 HOH 45 2445 79  HOH HOH A . 
K 4 HOH 46 2446 110 HOH HOH A . 
K 4 HOH 47 2447 43  HOH HOH A . 
K 4 HOH 48 2448 70  HOH HOH A . 
K 4 HOH 49 2449 115 HOH HOH A . 
K 4 HOH 50 2450 114 HOH HOH A . 
K 4 HOH 51 2451 66  HOH HOH A . 
L 4 HOH 1  2401 78  HOH HOH B . 
L 4 HOH 2  2402 5   HOH HOH B . 
L 4 HOH 3  2403 19  HOH HOH B . 
L 4 HOH 4  2404 93  HOH HOH B . 
L 4 HOH 5  2405 69  HOH HOH B . 
L 4 HOH 6  2406 27  HOH HOH B . 
L 4 HOH 7  2407 11  HOH HOH B . 
L 4 HOH 8  2408 7   HOH HOH B . 
L 4 HOH 9  2409 91  HOH HOH B . 
L 4 HOH 10 2410 106 HOH HOH B . 
L 4 HOH 11 2411 15  HOH HOH B . 
L 4 HOH 12 2412 51  HOH HOH B . 
L 4 HOH 13 2413 23  HOH HOH B . 
L 4 HOH 14 2414 103 HOH HOH B . 
L 4 HOH 15 2415 77  HOH HOH B . 
L 4 HOH 16 2416 22  HOH HOH B . 
L 4 HOH 17 2417 26  HOH HOH B . 
L 4 HOH 18 2418 81  HOH HOH B . 
L 4 HOH 19 2419 17  HOH HOH B . 
L 4 HOH 20 2420 67  HOH HOH B . 
L 4 HOH 21 2421 109 HOH HOH B . 
L 4 HOH 22 2422 32  HOH HOH B . 
L 4 HOH 23 2423 9   HOH HOH B . 
L 4 HOH 24 2424 74  HOH HOH B . 
L 4 HOH 25 2425 8   HOH HOH B . 
L 4 HOH 26 2426 56  HOH HOH B . 
L 4 HOH 27 2427 90  HOH HOH B . 
L 4 HOH 28 2428 101 HOH HOH B . 
L 4 HOH 29 2429 4   HOH HOH B . 
L 4 HOH 30 2430 14  HOH HOH B . 
L 4 HOH 31 2431 47  HOH HOH B . 
L 4 HOH 32 2432 68  HOH HOH B . 
L 4 HOH 33 2433 53  HOH HOH B . 
L 4 HOH 34 2434 113 HOH HOH B . 
L 4 HOH 35 2435 28  HOH HOH B . 
L 4 HOH 36 2436 46  HOH HOH B . 
L 4 HOH 37 2437 92  HOH HOH B . 
L 4 HOH 38 2438 62  HOH HOH B . 
L 4 HOH 39 2439 44  HOH HOH B . 
L 4 HOH 40 2440 100 HOH HOH B . 
L 4 HOH 41 2441 96  HOH HOH B . 
L 4 HOH 42 2442 3   HOH HOH B . 
L 4 HOH 43 2443 64  HOH HOH B . 
L 4 HOH 44 2444 29  HOH HOH B . 
L 4 HOH 45 2445 34  HOH HOH B . 
L 4 HOH 46 2446 2   HOH HOH B . 
L 4 HOH 47 2447 30  HOH HOH B . 
L 4 HOH 48 2448 94  HOH HOH B . 
L 4 HOH 49 2449 49  HOH HOH B . 
L 4 HOH 50 2450 112 HOH HOH B . 
L 4 HOH 51 2451 61  HOH HOH B . 
L 4 HOH 52 2452 85  HOH HOH B . 
L 4 HOH 53 2453 72  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F,K 
2 1 B,G,H,I,J,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 29  ? A CYS 2091 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 31  ? A CYS 2093 ? 1_555 110.0 ? 
2  SG ? A CYS 29  ? A CYS 2091 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 42  ? A CYS 2104 ? 1_555 104.1 ? 
3  SG ? A CYS 31  ? A CYS 2093 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 42  ? A CYS 2104 ? 1_555 106.9 ? 
4  SG ? A CYS 29  ? A CYS 2091 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 46  ? A CYS 2108 ? 1_555 121.2 ? 
5  SG ? A CYS 31  ? A CYS 2093 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 46  ? A CYS 2108 ? 1_555 104.7 ? 
6  SG ? A CYS 42  ? A CYS 2104 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 46  ? A CYS 2108 ? 1_555 109.3 ? 
7  SG ? A CYS 42  ? A CYS 2104 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 55  ? A CYS 2117 ? 1_555 110.3 ? 
8  SG ? A CYS 42  ? A CYS 2104 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 60  ? A CYS 2122 ? 1_555 100.1 ? 
9  SG ? A CYS 55  ? A CYS 2117 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 60  ? A CYS 2122 ? 1_555 118.1 ? 
10 SG ? A CYS 42  ? A CYS 2104 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 66  ? A CYS 2128 ? 1_555 117.2 ? 
11 SG ? A CYS 55  ? A CYS 2117 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 66  ? A CYS 2128 ? 1_555 111.9 ? 
12 SG ? A CYS 60  ? A CYS 2122 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 66  ? A CYS 2128 ? 1_555 98.6  ? 
13 SG ? A CYS 158 ? A CYS 2220 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 206 ? A CYS 2268 ? 1_555 107.8 ? 
14 SG ? A CYS 158 ? A CYS 2220 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 208 ? A CYS 2270 ? 1_555 110.4 ? 
15 SG ? A CYS 206 ? A CYS 2268 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 208 ? A CYS 2270 ? 1_555 109.9 ? 
16 SG ? A CYS 158 ? A CYS 2220 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 213 ? A CYS 2275 ? 1_555 108.4 ? 
17 SG ? A CYS 206 ? A CYS 2268 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 213 ? A CYS 2275 ? 1_555 106.1 ? 
18 SG ? A CYS 208 ? A CYS 2270 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 213 ? A CYS 2275 ? 1_555 114.0 ? 
19 SG ? B CYS 42  ? B CYS 2104 ? 1_555 ZN ? H ZN . ? B ZN 2302 ? 1_555 SG ? B CYS 55  ? B CYS 2117 ? 1_555 92.0  ? 
20 SG ? B CYS 42  ? B CYS 2104 ? 1_555 ZN ? I ZN . ? B ZN 2303 ? 1_555 SG ? B CYS 46  ? B CYS 2108 ? 1_555 84.1  ? 
21 SG ? B CYS 158 ? B CYS 2220 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 206 ? B CYS 2268 ? 1_555 114.7 ? 
22 SG ? B CYS 158 ? B CYS 2220 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 208 ? B CYS 2270 ? 1_555 110.0 ? 
23 SG ? B CYS 206 ? B CYS 2268 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 208 ? B CYS 2270 ? 1_555 107.9 ? 
24 SG ? B CYS 158 ? B CYS 2220 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 213 ? B CYS 2275 ? 1_555 109.5 ? 
25 SG ? B CYS 206 ? B CYS 2268 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 213 ? B CYS 2275 ? 1_555 101.7 ? 
26 SG ? B CYS 208 ? B CYS 2270 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 213 ? B CYS 2275 ? 1_555 112.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-02 
2 'Structure model' 1 1 2015-09-09 
3 'Structure model' 1 2 2015-09-16 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2017-10-04 
6 'Structure model' 1 5 2019-12-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Author supporting evidence' 
7 6 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' pdbx_audit_support    
3 4 'Structure model' pdbx_struct_oper_list 
4 5 'Structure model' pdbx_audit_support    
5 6 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 5 'Structure model' '_pdbx_audit_support.funding_organization'  
5 6 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.5.0109 1 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15     3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD2 B ASP 2199 ? ? NZ B LYS 2228 ? ? 1.97 
2 1 OD1 A ASP 2199 ? ? NZ A LYS 2228 ? ? 2.19 
3 1 OG1 A THR 2121 ? ? O  A HOH 2401 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 CE  A LYS 2081 ? ? 1_555 CG1 B ILE 2184 ? ? 4_455 1.93 
2 1 NH1 A ARG 2208 ? ? 1_555 CD2 B PHE 2257 ? ? 1_545 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 2144 ? ? CZ A ARG 2144 ? ? NH2 A ARG 2144 ? ? 123.33 120.30 3.03  0.50 N 
2  1 CB A ASP 2199 ? ? CG A ASP 2199 ? ? OD1 A ASP 2199 ? ? 123.80 118.30 5.50  0.90 N 
3  1 CB A ASP 2199 ? ? CG A ASP 2199 ? ? OD2 A ASP 2199 ? ? 110.78 118.30 -7.52 0.90 N 
4  1 NE A ARG 2236 ? ? CZ A ARG 2236 ? ? NH1 A ARG 2236 ? ? 124.58 120.30 4.28  0.50 N 
5  1 CA B TYR 2086 ? ? CB B TYR 2086 ? ? CG  B TYR 2086 ? ? 125.81 113.40 12.41 1.90 N 
6  1 CB B TYR 2086 ? ? CG B TYR 2086 ? ? CD2 B TYR 2086 ? ? 124.81 121.00 3.81  0.60 N 
7  1 CB B TYR 2086 ? ? CG B TYR 2086 ? ? CD1 B TYR 2086 ? ? 117.18 121.00 -3.82 0.60 N 
8  1 NE B ARG 2132 ? ? CZ B ARG 2132 ? ? NH1 B ARG 2132 ? ? 125.07 120.30 4.77  0.50 N 
9  1 NE B ARG 2132 ? ? CZ B ARG 2132 ? ? NH2 B ARG 2132 ? ? 114.89 120.30 -5.41 0.50 N 
10 1 CG B MET 2245 ? ? SD B MET 2245 ? ? CE  B MET 2245 ? ? 90.52  100.20 -9.68 1.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 2078 ? ? -91.41  -84.19  
2  1 THR A 2090 ? ? 43.64   81.98   
3  1 CYS A 2104 ? ? 39.52   65.70   
4  1 VAL A 2105 ? ? -110.41 -94.12  
5  1 ASP A 2106 ? ? -95.40  40.37   
6  1 ASP A 2107 ? ? 168.11  16.94   
7  1 GLN A 2131 ? ? -141.21 31.43   
8  1 GLU A 2149 ? ? 80.29   -4.90   
9  1 LEU A 2198 ? ? -109.61 -64.85  
10 1 ASP A 2199 ? ? 173.38  168.92  
11 1 SER A 2200 ? ? 33.37   50.44   
12 1 GLU A 2263 ? ? 87.81   6.35    
13 1 VAL B 2078 ? ? -93.27  -80.33  
14 1 VAL B 2105 ? ? -117.37 -96.87  
15 1 ASP B 2106 ? ? -94.39  42.22   
16 1 ASP B 2107 ? ? 165.69  19.16   
17 1 GLU B 2149 ? ? 84.49   -9.31   
18 1 LEU B 2198 ? ? -92.24  -147.60 
19 1 ASP B 2199 ? ? -120.52 -161.18 
20 1 GLU B 2263 ? ? -98.33  34.14   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2063 ? A GLY 1   
2  1 Y 1 A ALA 2064 ? A ALA 2   
3  1 Y 1 A MET 2065 ? A MET 3   
4  1 Y 1 A GLY 2281 ? A GLY 219 
5  1 Y 1 A LYS 2282 ? A LYS 220 
6  1 Y 1 A SER 2283 ? A SER 221 
7  1 Y 1 A GLN 2284 ? A GLN 222 
8  1 Y 1 A ARG 2285 ? A ARG 223 
9  1 Y 1 A VAL 2286 ? A VAL 224 
10 1 Y 1 A ASN 2287 ? A ASN 225 
11 1 Y 1 A GLY 2288 ? A GLY 226 
12 1 Y 1 B GLY 2063 ? B GLY 1   
13 1 Y 1 B ALA 2064 ? B ALA 2   
14 1 Y 1 B MET 2065 ? B MET 3   
15 1 Y 1 B ALA 2066 ? B ALA 4   
16 1 Y 1 B GLU 2087 ? B GLU 25  
17 1 Y 1 B ALA 2088 ? B ALA 26  
18 1 Y 1 B THR 2089 ? B THR 27  
19 1 Y 1 B THR 2090 ? B THR 28  
20 1 Y 1 B CYS 2091 ? B CYS 29  
21 1 Y 1 B ASN 2092 ? B ASN 30  
22 1 Y 1 B CYS 2093 ? B CYS 31  
23 1 Y 1 B LYS 2094 ? B LYS 32  
24 1 Y 1 B LYS 2095 ? B LYS 33  
25 1 Y 1 B PRO 2096 ? B PRO 34  
26 1 Y 1 B ASP 2097 ? B ASP 35  
27 1 Y 1 B ASP 2098 ? B ASP 36  
28 1 Y 1 B ASP 2099 ? B ASP 37  
29 1 Y 1 B THR 2100 ? B THR 38  
30 1 Y 1 B ARG 2101 ? B ARG 39  
31 1 Y 1 B LYS 2102 ? B LYS 40  
32 1 Y 1 B GLY 2103 ? B GLY 41  
33 1 Y 1 B GLY 2280 ? B GLY 218 
34 1 Y 1 B GLY 2281 ? B GLY 219 
35 1 Y 1 B LYS 2282 ? B LYS 220 
36 1 Y 1 B SER 2283 ? B SER 221 
37 1 Y 1 B GLN 2284 ? B GLN 222 
38 1 Y 1 B ARG 2285 ? B ARG 223 
39 1 Y 1 B VAL 2286 ? B VAL 224 
40 1 Y 1 B ASN 2287 ? B ASN 225 
41 1 Y 1 B GLY 2288 ? B GLY 226 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Cancer Institute (NIH/NCI)'                        'United States' 1R01CA160467      1 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 5T32GM008597      2 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 5T32GM007863      3 
'Leukemia & Lymphoma Society'                                                              'United States' 6111-14           4 
'Leukemia & Lymphoma Society'                                                              'United States' 1215-14           5 
'American Cancer Society'                                                                  'United States' RSG-13-130-01-CDD 6 
'Michigan Economic Development Corporation'                                                'United States' 085P1000817       7 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'           ZN  
3 S-ADENOSYLMETHIONINE SAM 
4 water                HOH 
#