data_4YNP
# 
_entry.id   4YNP 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YNP         
WWPDB D_1000207770 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          4YNM 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YNP 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-10 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Rogawski, D.S.' 1 ? 
'Ndoj, J.'       2 ? 
'Cho, H.-J.'     3 ? 
'Maillard, I.'   4 ? 
'Grembecka, J.'  5 ? 
'Cierpicki, T.'  6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biochemistry 
_citation.journal_id_ASTM           BICHAW 
_citation.journal_id_CSD            0033 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            54 
_citation.language                  ? 
_citation.page_first                5401 
_citation.page_last                 5413 
_citation.title                     
'Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.5b00697 
_citation.pdbx_database_id_PubMed   26292256 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rogawski, D.S.' 1 ? 
primary 'Ndoj, J.'       2 ? 
primary 'Cho, H.J.'      3 ? 
primary 'Maillard, I.'   4 ? 
primary 'Grembecka, J.'  5 ? 
primary 'Cierpicki, T.'  6 ? 
# 
_cell.length_a           59.262 
_cell.length_b           59.262 
_cell.length_c           233.924 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           4YNP 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.entry_id                         4YNP 
_symmetry.Int_Tables_number                154 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone-lysine N-methyltransferase ASH1L' 26060.633 2 2.1.1.43 S2259M 'SET domain (UNP residues 2074-2293)' ? 
2 non-polymer syn 'ZINC ION'                                 65.409    6 ?        ?      ?                                     ? 
3 non-polymer syn S-ADENOSYLMETHIONINE                       398.437   2 ?        ?      ?                                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'ASH1-like protein,huASH1,Absent small and homeotic disks protein 1 homolog,Lysine N-methyltransferase 2H' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCL
ERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDP
NCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHMFNVEKQQLCKCGFEKCRGIIGGKSQRVNG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMAGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCL
ERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDP
NCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHMFNVEKQQLCKCGFEKCRGIIGGKSQRVNG
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ALA n 
1 5   GLY n 
1 6   SER n 
1 7   TYR n 
1 8   LYS n 
1 9   LYS n 
1 10  ILE n 
1 11  ARG n 
1 12  SER n 
1 13  ASN n 
1 14  VAL n 
1 15  TYR n 
1 16  VAL n 
1 17  ASP n 
1 18  VAL n 
1 19  LYS n 
1 20  PRO n 
1 21  LEU n 
1 22  SER n 
1 23  GLY n 
1 24  TYR n 
1 25  GLU n 
1 26  ALA n 
1 27  THR n 
1 28  THR n 
1 29  CYS n 
1 30  ASN n 
1 31  CYS n 
1 32  LYS n 
1 33  LYS n 
1 34  PRO n 
1 35  ASP n 
1 36  ASP n 
1 37  ASP n 
1 38  THR n 
1 39  ARG n 
1 40  LYS n 
1 41  GLY n 
1 42  CYS n 
1 43  VAL n 
1 44  ASP n 
1 45  ASP n 
1 46  CYS n 
1 47  LEU n 
1 48  ASN n 
1 49  ARG n 
1 50  MET n 
1 51  ILE n 
1 52  PHE n 
1 53  ALA n 
1 54  GLU n 
1 55  CYS n 
1 56  SER n 
1 57  PRO n 
1 58  ASN n 
1 59  THR n 
1 60  CYS n 
1 61  PRO n 
1 62  CYS n 
1 63  GLY n 
1 64  GLU n 
1 65  GLN n 
1 66  CYS n 
1 67  CYS n 
1 68  ASN n 
1 69  GLN n 
1 70  ARG n 
1 71  ILE n 
1 72  GLN n 
1 73  ARG n 
1 74  HIS n 
1 75  GLU n 
1 76  TRP n 
1 77  VAL n 
1 78  GLN n 
1 79  CYS n 
1 80  LEU n 
1 81  GLU n 
1 82  ARG n 
1 83  PHE n 
1 84  ARG n 
1 85  ALA n 
1 86  GLU n 
1 87  GLU n 
1 88  LYS n 
1 89  GLY n 
1 90  TRP n 
1 91  GLY n 
1 92  ILE n 
1 93  ARG n 
1 94  THR n 
1 95  LYS n 
1 96  GLU n 
1 97  PRO n 
1 98  LEU n 
1 99  LYS n 
1 100 ALA n 
1 101 GLY n 
1 102 GLN n 
1 103 PHE n 
1 104 ILE n 
1 105 ILE n 
1 106 GLU n 
1 107 TYR n 
1 108 LEU n 
1 109 GLY n 
1 110 GLU n 
1 111 VAL n 
1 112 VAL n 
1 113 SER n 
1 114 GLU n 
1 115 GLN n 
1 116 GLU n 
1 117 PHE n 
1 118 ARG n 
1 119 ASN n 
1 120 ARG n 
1 121 MET n 
1 122 ILE n 
1 123 GLU n 
1 124 GLN n 
1 125 TYR n 
1 126 HIS n 
1 127 ASN n 
1 128 HIS n 
1 129 SER n 
1 130 ASP n 
1 131 HIS n 
1 132 TYR n 
1 133 CYS n 
1 134 LEU n 
1 135 ASN n 
1 136 LEU n 
1 137 ASP n 
1 138 SER n 
1 139 GLY n 
1 140 MET n 
1 141 VAL n 
1 142 ILE n 
1 143 ASP n 
1 144 SER n 
1 145 TYR n 
1 146 ARG n 
1 147 MET n 
1 148 GLY n 
1 149 ASN n 
1 150 GLU n 
1 151 ALA n 
1 152 ARG n 
1 153 PHE n 
1 154 ILE n 
1 155 ASN n 
1 156 HIS n 
1 157 SER n 
1 158 CYS n 
1 159 ASP n 
1 160 PRO n 
1 161 ASN n 
1 162 CYS n 
1 163 GLU n 
1 164 MET n 
1 165 GLN n 
1 166 LYS n 
1 167 TRP n 
1 168 SER n 
1 169 VAL n 
1 170 ASN n 
1 171 GLY n 
1 172 VAL n 
1 173 TYR n 
1 174 ARG n 
1 175 ILE n 
1 176 GLY n 
1 177 LEU n 
1 178 TYR n 
1 179 ALA n 
1 180 LEU n 
1 181 LYS n 
1 182 ASP n 
1 183 MET n 
1 184 PRO n 
1 185 ALA n 
1 186 GLY n 
1 187 THR n 
1 188 GLU n 
1 189 LEU n 
1 190 THR n 
1 191 TYR n 
1 192 ASP n 
1 193 TYR n 
1 194 ASN n 
1 195 PHE n 
1 196 HIS n 
1 197 MET n 
1 198 PHE n 
1 199 ASN n 
1 200 VAL n 
1 201 GLU n 
1 202 LYS n 
1 203 GLN n 
1 204 GLN n 
1 205 LEU n 
1 206 CYS n 
1 207 LYS n 
1 208 CYS n 
1 209 GLY n 
1 210 PHE n 
1 211 GLU n 
1 212 LYS n 
1 213 CYS n 
1 214 ARG n 
1 215 GLY n 
1 216 ILE n 
1 217 ILE n 
1 218 GLY n 
1 219 GLY n 
1 220 LYS n 
1 221 SER n 
1 222 GLN n 
1 223 ARG n 
1 224 VAL n 
1 225 ASN n 
1 226 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   226 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ASH1L, KIAA1420, KMT2H' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.db_code                    ASH1L_HUMAN 
_struct_ref.db_name                    UNP 
_struct_ref.details                    ? 
_struct_ref.entity_id                  1 
_struct_ref.id                         1 
_struct_ref.seq_align                  ? 
_struct_ref.seq_dif                    ? 
_struct_ref.pdbx_db_accession          Q9NR48 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   
;YKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAE
EKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQK
WSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIGGKSQRVNG
;
_struct_ref.pdbx_align_begin           2074 
_struct_ref.pdbx_align_end             ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YNP A 7 ? 226 ? Q9NR48 2074 ? 2293 ? 2069 2288 
2 1 4YNP B 7 ? 226 ? Q9NR48 2074 ? 2293 ? 2069 2288 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4YNP GLY A 1   ? UNP Q9NR48 ?   ?    'expression tag'      2063 1  
1 4YNP ALA A 2   ? UNP Q9NR48 ?   ?    'expression tag'      2064 2  
1 4YNP MET A 3   ? UNP Q9NR48 ?   ?    'expression tag'      2065 3  
1 4YNP ALA A 4   ? UNP Q9NR48 ?   ?    'expression tag'      2066 4  
1 4YNP GLY A 5   ? UNP Q9NR48 ?   ?    'expression tag'      2067 5  
1 4YNP SER A 6   ? UNP Q9NR48 ?   ?    'expression tag'      2068 6  
1 4YNP MET A 197 ? UNP Q9NR48 SER 2264 'engineered mutation' 2259 7  
2 4YNP GLY B 1   ? UNP Q9NR48 ?   ?    'expression tag'      2063 8  
2 4YNP ALA B 2   ? UNP Q9NR48 ?   ?    'expression tag'      2064 9  
2 4YNP MET B 3   ? UNP Q9NR48 ?   ?    'expression tag'      2065 10 
2 4YNP ALA B 4   ? UNP Q9NR48 ?   ?    'expression tag'      2066 11 
2 4YNP GLY B 5   ? UNP Q9NR48 ?   ?    'expression tag'      2067 12 
2 4YNP SER B 6   ? UNP Q9NR48 ?   ?    'expression tag'      2068 13 
2 4YNP MET B 197 ? UNP Q9NR48 SER 2264 'engineered mutation' 2259 14 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'      115.130 
SAM non-polymer         . S-ADENOSYLMETHIONINE ? 'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YNP 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.39 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.46 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 3350, 20 mM Tris' 
_exptl_crystal_grow.pdbx_pH_range   7.3-7.8 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-10-23 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97872 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-F' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97872 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-F 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.d_resolution_high            2.900 
_reflns.d_resolution_low             50.000 
_reflns.pdbx_number_measured_all     83961 
_reflns.number_obs                   10910 
_reflns.pdbx_Rmerge_I_obs            0.088 
_reflns.pdbx_netI_over_av_sigmaI     25.222 
_reflns.pdbx_netI_over_sigmaI        8.200 
_reflns.pdbx_chi_squared             1.417 
_reflns.pdbx_redundancy              7.700 
_reflns.percent_possible_obs         96.100 
_reflns.pdbx_Rrim_I_all              0.094 
_reflns.pdbx_Rpim_I_all              0.032 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4YNP 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
# 
loop_
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.number_measured_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_unique_obs 
_reflns_shell.pdbx_rejects 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.percent_possible_obs 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.percent_possible_all 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_CC_half 
1 1  2.900 2.950  ? ? ? 0 0.393 ? ? 0.729 7.400 ? ? ? 534 ? ? ? ? 96.000  0.417 0.135 0.930 
1 2  2.950 3.000  ? ? ? 0 0.327 ? ? 0.747 7.900 ? ? ? 517 ? ? ? ? 94.700  0.346 0.112 0.951 
1 3  3.000 3.060  ? ? ? 0 0.293 ? ? 0.780 8.000 ? ? ? 505 ? ? ? ? 91.800  0.311 0.102 0.951 
1 4  3.060 3.120  ? ? ? 0 0.249 ? ? 0.821 7.300 ? ? ? 552 ? ? ? ? 96.800  0.265 0.087 0.963 
1 5  3.120 3.190  ? ? ? 0 0.220 ? ? 0.953 7.900 ? ? ? 502 ? ? ? ? 93.300  0.234 0.077 0.972 
1 6  3.190 3.270  ? ? ? 0 0.191 ? ? 0.970 7.700 ? ? ? 523 ? ? ? ? 94.600  0.203 0.067 0.976 
1 7  3.270 3.350  ? ? ? 0 0.173 ? ? 1.113 7.700 ? ? ? 510 ? ? ? ? 93.900  0.184 0.062 0.983 
1 8  3.350 3.440  ? ? ? 0 0.149 ? ? 1.206 7.700 ? ? ? 514 ? ? ? ? 91.500  0.159 0.053 0.987 
1 9  3.440 3.540  ? ? ? 0 0.141 ? ? 1.323 7.500 ? ? ? 523 ? ? ? ? 96.100  0.150 0.050 0.987 
1 10 3.540 3.650  ? ? ? 0 0.118 ? ? 1.400 7.600 ? ? ? 529 ? ? ? ? 93.300  0.126 0.042 0.994 
1 11 3.650 3.780  ? ? ? 0 0.111 ? ? 1.842 7.500 ? ? ? 529 ? ? ? ? 95.300  0.118 0.040 0.990 
1 12 3.780 3.940  ? ? ? 0 0.099 ? ? 1.685 7.300 ? ? ? 535 ? ? ? ? 93.000  0.106 0.036 0.993 
1 13 3.940 4.110  ? ? ? 0 0.095 ? ? 1.981 7.500 ? ? ? 525 ? ? ? ? 94.600  0.102 0.034 0.993 
1 14 4.110 4.330  ? ? ? 0 0.089 ? ? 2.212 7.200 ? ? ? 549 ? ? ? ? 98.000  0.095 0.033 0.993 
1 15 4.330 4.600  ? ? ? 0 0.089 ? ? 2.536 7.100 ? ? ? 567 ? ? ? ? 99.000  0.096 0.034 0.992 
1 16 4.600 4.960  ? ? ? 0 0.082 ? ? 2.415 7.200 ? ? ? 574 ? ? ? ? 99.500  0.089 0.032 0.992 
1 17 4.960 5.460  ? ? ? 0 0.078 ? ? 2.013 7.500 ? ? ? 573 ? ? ? ? 99.800  0.084 0.029 0.993 
1 18 5.460 6.240  ? ? ? 0 0.065 ? ? 1.308 7.900 ? ? ? 580 ? ? ? ? 100.000 0.070 0.024 0.997 
1 19 6.240 7.860  ? ? ? 0 0.056 ? ? 1.171 8.900 ? ? ? 605 ? ? ? ? 100.000 0.059 0.019 0.998 
1 20 7.860 50.000 ? ? ? 0 0.041 ? ? 1.291 8.800 ? ? ? 664 ? ? ? ? 99.100  0.043 0.014 0.999 
# 
_refine.entry_id                                 4YNP 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_d_res_high                            2.9000 
_refine.ls_d_res_low                             47.0000 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    96.1000 
_refine.ls_number_reflns_obs                     10352 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.ls_matrix_type                           ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2645 
_refine.ls_R_factor_R_work                       0.2619 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.3194 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.7000 
_refine.ls_number_reflns_R_free                  513 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               54.6710 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            0.0200 
_refine.aniso_B[2][2]                            0.0200 
_refine.aniso_B[3][3]                            -0.0300 
_refine.aniso_B[1][2]                            0.0100 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.correlation_coeff_Fo_to_Fc               0.8780 
_refine.correlation_coeff_Fo_to_Fc_free          0.8120 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.5440 
_refine.overall_SU_ML                            0.4320 
_refine.overall_SU_B                             22.1900 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.4000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      4YNM 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                82.470 
_refine.B_iso_min                                31.610 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_R_factor_R_free_error_details         ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.9000 
_refine_hist.d_res_low                        47.0000 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3364 
_refine_hist.pdbx_number_residues_total       406 
_refine_hist.pdbx_B_iso_mean_ligand           54.13 
_refine_hist.pdbx_number_atoms_protein        3304 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' r_bond_refined_d       3435 0.006  0.021  ? ? 
'X-RAY DIFFRACTION' r_angle_refined_deg    4625 0.973  1.956  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 403  5.599  5.000  ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 184  35.683 24.076 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 609  15.623 15.000 ? ? 
'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 27   18.354 15.000 ? ? 
'X-RAY DIFFRACTION' r_chiral_restr         468  0.066  0.200  ? ? 
'X-RAY DIFFRACTION' r_gen_planes_refined   2649 0.003  0.021  ? ? 
'X-RAY DIFFRACTION' r_mcbond_it            2023 0.352  1.500  ? ? 
'X-RAY DIFFRACTION' r_mcangle_it           3254 0.649  2.000  ? ? 
'X-RAY DIFFRACTION' r_scbond_it            1412 0.535  3.000  ? ? 
'X-RAY DIFFRACTION' r_scangle_it           1371 0.942  4.500  ? ? 
# 
_refine_ls_shell.d_res_high                       2.8990 
_refine_ls_shell.d_res_low                        2.9740 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               94.7100 
_refine_ls_shell.number_reflns_R_work             741 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.2970 
_refine_ls_shell.R_factor_R_free                  0.3630 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             47 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                788 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                     4YNP 
_struct.title                        'ASH1L SET domain S2259M mutant in complex with S-adenosyl methionine (SAM)' 
_struct.pdbx_descriptor              ASH1L 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YNP 
_struct_keywords.text            'histone methylation, SET domain, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 CYS A 46  ? ILE A 51  ? CYS A 2108 ILE A 2113 1 ? 6  
HELX_P HELX_P2 AA2 GLU A 114 ? GLN A 124 ? GLU A 2176 GLN A 2186 1 ? 11 
HELX_P HELX_P3 AA3 ASN A 149 ? ILE A 154 ? ASN A 2211 ILE A 2216 5 ? 6  
HELX_P HELX_P4 AA4 ASP A 192 ? MET A 197 ? ASP A 2254 MET A 2259 1 ? 6  
HELX_P HELX_P5 AA5 CYS B 46  ? ILE B 51  ? CYS B 2108 ILE B 2113 1 ? 6  
HELX_P HELX_P6 AA6 GLN B 69  ? HIS B 74  ? GLN B 2131 HIS B 2136 1 ? 6  
HELX_P HELX_P7 AA7 GLU B 114 ? GLN B 124 ? GLU B 2176 GLN B 2186 1 ? 11 
HELX_P HELX_P8 AA8 ASN B 149 ? ILE B 154 ? ASN B 2211 ILE B 2216 5 ? 6  
HELX_P HELX_P9 AA9 ASP B 192 ? HIS B 196 ? ASP B 2254 HIS B 2258 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? B CYS 55  SG ? ? ? 1_555 B CYS 60 SG ? ? B CYS 2117 B CYS 2122 1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf2  disulf ? ? B CYS 55  SG ? ? ? 1_555 B CYS 66 SG ? ? B CYS 2117 B CYS 2128 1_555 ? ? ? ? ? ? ? 2.944 ? 
disulf3  disulf ? ? B CYS 60  SG ? ? ? 1_555 B CYS 66 SG ? ? B CYS 2122 B CYS 2128 1_555 ? ? ? ? ? ? ? 2.038 ? 
metalc1  metalc ? ? A CYS 29  SG ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 2091 A ZN  2303 1_555 ? ? ? ? ? ? ? 2.120 ? 
metalc2  metalc ? ? A CYS 31  SG ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 2093 A ZN  2303 1_555 ? ? ? ? ? ? ? 2.196 ? 
metalc3  metalc ? ? A CYS 42  SG ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 2104 A ZN  2302 1_555 ? ? ? ? ? ? ? 2.376 ? 
metalc4  metalc ? ? A CYS 42  SG ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 2104 A ZN  2303 1_555 ? ? ? ? ? ? ? 2.380 ? 
metalc5  metalc ? ? A CYS 46  SG ? ? ? 1_555 E ZN  .  ZN ? ? A CYS 2108 A ZN  2303 1_555 ? ? ? ? ? ? ? 2.106 ? 
metalc6  metalc ? ? A CYS 55  SG ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 2117 A ZN  2302 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc7  metalc ? ? A CYS 60  SG ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 2122 A ZN  2302 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc8  metalc ? ? A CYS 66  SG ? ? ? 1_555 D ZN  .  ZN ? ? A CYS 2128 A ZN  2302 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc9  metalc ? ? A CYS 158 SG ? ? ? 1_555 C ZN  .  ZN ? ? A CYS 2220 A ZN  2301 1_555 ? ? ? ? ? ? ? 2.428 ? 
metalc10 metalc ? ? A CYS 206 SG ? ? ? 1_555 C ZN  .  ZN ? ? A CYS 2268 A ZN  2301 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc11 metalc ? ? A CYS 208 SG ? ? ? 1_555 C ZN  .  ZN ? ? A CYS 2270 A ZN  2301 1_555 ? ? ? ? ? ? ? 2.218 ? 
metalc12 metalc ? ? A CYS 213 SG ? ? ? 1_555 C ZN  .  ZN ? ? A CYS 2275 A ZN  2301 1_555 ? ? ? ? ? ? ? 2.487 ? 
metalc13 metalc ? ? B CYS 42  SG ? ? ? 1_555 I ZN  .  ZN ? ? B CYS 2104 B ZN  2303 1_555 ? ? ? ? ? ? ? 1.971 ? 
metalc14 metalc ? ? B CYS 46  SG ? ? ? 1_555 I ZN  .  ZN ? ? B CYS 2108 B ZN  2303 1_555 ? ? ? ? ? ? ? 2.272 ? 
metalc15 metalc ? ? B CYS 55  SG ? ? ? 1_555 H ZN  .  ZN ? ? B CYS 2117 B ZN  2302 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc16 metalc ? ? B CYS 60  SG ? ? ? 1_555 H ZN  .  ZN ? ? B CYS 2122 B ZN  2302 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc17 metalc ? ? B CYS 158 SG ? ? ? 1_555 G ZN  .  ZN ? ? B CYS 2220 B ZN  2301 1_555 ? ? ? ? ? ? ? 2.169 ? 
metalc18 metalc ? ? B CYS 206 SG ? ? ? 1_555 G ZN  .  ZN ? ? B CYS 2268 B ZN  2301 1_555 ? ? ? ? ? ? ? 2.153 ? 
metalc19 metalc ? ? B CYS 208 SG ? ? ? 1_555 G ZN  .  ZN ? ? B CYS 2270 B ZN  2301 1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc20 metalc ? ? B CYS 213 SG ? ? ? 1_555 G ZN  .  ZN ? ? B CYS 2275 B ZN  2301 1_555 ? ? ? ? ? ? ? 2.295 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 4 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? parallel      
AA6 1 2 ? anti-parallel 
AA7 1 2 ? parallel      
AA8 1 2 ? parallel      
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 8   ? LYS A 9   ? LYS A 2070 LYS A 2071 
AA1 2 MET A 147 ? GLY A 148 ? MET A 2209 GLY A 2210 
AA2 1 VAL A 14  ? TYR A 15  ? VAL A 2076 TYR A 2077 
AA2 2 GLU A 110 ? SER A 113 ? GLU A 2172 SER A 2175 
AA2 3 MET A 140 ? ASP A 143 ? MET A 2202 ASP A 2205 
AA2 4 CYS A 133 ? ASN A 135 ? CYS A 2195 ASN A 2197 
AA3 1 GLU A 81  ? ALA A 85  ? GLU A 2143 ALA A 2147 
AA3 2 GLY A 89  ? ARG A 93  ? GLY A 2151 ARG A 2155 
AA4 1 PHE A 103 ? GLU A 106 ? PHE A 2165 GLU A 2168 
AA4 2 VAL A 172 ? ALA A 179 ? VAL A 2234 ALA A 2241 
AA4 3 CYS A 162 ? VAL A 169 ? CYS A 2224 VAL A 2231 
AA5 1 ASN A 155 ? HIS A 156 ? ASN A 2217 HIS A 2218 
AA5 2 THR A 190 ? TYR A 191 ? THR A 2252 TYR A 2253 
AA6 1 GLN A 204 ? LEU A 205 ? GLN A 2266 LEU A 2267 
AA6 2 ILE A 216 ? ILE A 217 ? ILE A 2278 ILE A 2279 
AA7 1 LYS B 8   ? LYS B 9   ? LYS B 2070 LYS B 2071 
AA7 2 MET B 147 ? GLY B 148 ? MET B 2209 GLY B 2210 
AA8 1 VAL B 14  ? TYR B 15  ? VAL B 2076 TYR B 2077 
AA8 2 GLU B 110 ? SER B 113 ? GLU B 2172 SER B 2175 
AA8 3 MET B 140 ? ASP B 143 ? MET B 2202 ASP B 2205 
AA8 4 CYS B 133 ? ASP B 137 ? CYS B 2195 ASP B 2199 
AA9 1 LEU B 80  ? ARG B 84  ? LEU B 2142 ARG B 2146 
AA9 2 TRP B 90  ? THR B 94  ? TRP B 2152 THR B 2156 
AB1 1 PHE B 103 ? GLU B 106 ? PHE B 2165 GLU B 2168 
AB1 2 VAL B 172 ? ALA B 179 ? VAL B 2234 ALA B 2241 
AB1 3 CYS B 162 ? VAL B 169 ? CYS B 2224 VAL B 2231 
AB2 1 ASN B 155 ? HIS B 156 ? ASN B 2217 HIS B 2218 
AB2 2 THR B 190 ? TYR B 191 ? THR B 2252 TYR B 2253 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 8   ? N LYS A 2070 O GLY A 148 ? O GLY A 2210 
AA2 1 2 N VAL A 14  ? N VAL A 2076 O VAL A 111 ? O VAL A 2173 
AA2 2 3 N GLU A 110 ? N GLU A 2172 O ASP A 143 ? O ASP A 2205 
AA2 3 4 O ILE A 142 ? O ILE A 2204 N LEU A 134 ? N LEU A 2196 
AA3 1 2 N PHE A 83  ? N PHE A 2145 O GLY A 91  ? O GLY A 2153 
AA4 1 2 N ILE A 105 ? N ILE A 2167 O LEU A 177 ? O LEU A 2239 
AA4 2 3 O VAL A 172 ? O VAL A 2234 N VAL A 169 ? N VAL A 2231 
AA5 1 2 N ASN A 155 ? N ASN A 2217 O TYR A 191 ? O TYR A 2253 
AA6 1 2 N GLN A 204 ? N GLN A 2266 O ILE A 217 ? O ILE A 2279 
AA7 1 2 N LYS B 8   ? N LYS B 2070 O GLY B 148 ? O GLY B 2210 
AA8 1 2 N VAL B 14  ? N VAL B 2076 O VAL B 111 ? O VAL B 2173 
AA8 2 3 N VAL B 112 ? N VAL B 2174 O VAL B 141 ? O VAL B 2203 
AA8 3 4 O ILE B 142 ? O ILE B 2204 N LEU B 134 ? N LEU B 2196 
AA9 1 2 N PHE B 83  ? N PHE B 2145 O GLY B 91  ? O GLY B 2153 
AB1 1 2 N ILE B 105 ? N ILE B 2167 O LEU B 177 ? O LEU B 2239 
AB1 2 3 O VAL B 172 ? O VAL B 2234 N VAL B 169 ? N VAL B 2231 
AB2 1 2 N ASN B 155 ? N ASN B 2217 O TYR B 191 ? O TYR B 2253 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  2301 ? 4  'binding site for residue ZN A 2301'  
AC2 Software A ZN  2302 ? 6  'binding site for residue ZN A 2302'  
AC3 Software A ZN  2303 ? 5  'binding site for residue ZN A 2303'  
AC4 Software A SAM 2304 ? 15 'binding site for residue SAM A 2304' 
AC5 Software B ZN  2301 ? 4  'binding site for residue ZN B 2301'  
AC6 Software B ZN  2302 ? 6  'binding site for residue ZN B 2302'  
AC7 Software B ZN  2303 ? 4  'binding site for residue ZN B 2303'  
AC8 Software B SAM 2304 ? 15 'binding site for residue SAM B 2304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  CYS A 158 ? CYS A 2220 . ? 1_555 ? 
2  AC1 4  CYS A 206 ? CYS A 2268 . ? 1_555 ? 
3  AC1 4  CYS A 208 ? CYS A 2270 . ? 1_555 ? 
4  AC1 4  CYS A 213 ? CYS A 2275 . ? 1_555 ? 
5  AC2 6  CYS A 29  ? CYS A 2091 . ? 1_555 ? 
6  AC2 6  CYS A 42  ? CYS A 2104 . ? 1_555 ? 
7  AC2 6  CYS A 55  ? CYS A 2117 . ? 1_555 ? 
8  AC2 6  CYS A 60  ? CYS A 2122 . ? 1_555 ? 
9  AC2 6  CYS A 66  ? CYS A 2128 . ? 1_555 ? 
10 AC2 6  ZN  E .   ? ZN  A 2303 . ? 1_555 ? 
11 AC3 5  CYS A 29  ? CYS A 2091 . ? 1_555 ? 
12 AC3 5  CYS A 31  ? CYS A 2093 . ? 1_555 ? 
13 AC3 5  CYS A 42  ? CYS A 2104 . ? 1_555 ? 
14 AC3 5  CYS A 46  ? CYS A 2108 . ? 1_555 ? 
15 AC3 5  ZN  D .   ? ZN  A 2302 . ? 1_555 ? 
16 AC4 15 LYS A 88  ? LYS A 2150 . ? 1_555 ? 
17 AC4 15 TRP A 90  ? TRP A 2152 . ? 1_555 ? 
18 AC4 15 SER A 129 ? SER A 2191 . ? 1_555 ? 
19 AC4 15 ASP A 130 ? ASP A 2192 . ? 1_555 ? 
20 AC4 15 HIS A 131 ? HIS A 2193 . ? 1_555 ? 
21 AC4 15 TYR A 132 ? TYR A 2194 . ? 1_555 ? 
22 AC4 15 ARG A 152 ? ARG A 2214 . ? 1_555 ? 
23 AC4 15 PHE A 153 ? PHE A 2215 . ? 1_555 ? 
24 AC4 15 ASN A 155 ? ASN A 2217 . ? 1_555 ? 
25 AC4 15 HIS A 156 ? HIS A 2218 . ? 1_555 ? 
26 AC4 15 TYR A 193 ? TYR A 2255 . ? 1_555 ? 
27 AC4 15 GLN A 204 ? GLN A 2266 . ? 1_555 ? 
28 AC4 15 LEU A 205 ? LEU A 2267 . ? 1_555 ? 
29 AC4 15 LYS A 207 ? LYS A 2269 . ? 1_555 ? 
30 AC4 15 ILE A 217 ? ILE A 2279 . ? 1_555 ? 
31 AC5 4  CYS B 158 ? CYS B 2220 . ? 1_555 ? 
32 AC5 4  CYS B 206 ? CYS B 2268 . ? 1_555 ? 
33 AC5 4  CYS B 208 ? CYS B 2270 . ? 1_555 ? 
34 AC5 4  CYS B 213 ? CYS B 2275 . ? 1_555 ? 
35 AC6 6  CYS B 42  ? CYS B 2104 . ? 1_555 ? 
36 AC6 6  CYS B 55  ? CYS B 2117 . ? 1_555 ? 
37 AC6 6  CYS B 60  ? CYS B 2122 . ? 1_555 ? 
38 AC6 6  PRO B 61  ? PRO B 2123 . ? 1_555 ? 
39 AC6 6  CYS B 66  ? CYS B 2128 . ? 1_555 ? 
40 AC6 6  ZN  I .   ? ZN  B 2303 . ? 1_555 ? 
41 AC7 4  CYS B 42  ? CYS B 2104 . ? 1_555 ? 
42 AC7 4  CYS B 46  ? CYS B 2108 . ? 1_555 ? 
43 AC7 4  PRO B 61  ? PRO B 2123 . ? 1_555 ? 
44 AC7 4  ZN  H .   ? ZN  B 2302 . ? 1_555 ? 
45 AC8 15 GLY B 89  ? GLY B 2151 . ? 1_555 ? 
46 AC8 15 TRP B 90  ? TRP B 2152 . ? 1_555 ? 
47 AC8 15 ASP B 130 ? ASP B 2192 . ? 1_555 ? 
48 AC8 15 HIS B 131 ? HIS B 2193 . ? 1_555 ? 
49 AC8 15 TYR B 132 ? TYR B 2194 . ? 1_555 ? 
50 AC8 15 ARG B 152 ? ARG B 2214 . ? 1_555 ? 
51 AC8 15 PHE B 153 ? PHE B 2215 . ? 1_555 ? 
52 AC8 15 ILE B 154 ? ILE B 2216 . ? 1_555 ? 
53 AC8 15 ASN B 155 ? ASN B 2217 . ? 1_555 ? 
54 AC8 15 HIS B 156 ? HIS B 2218 . ? 1_555 ? 
55 AC8 15 TYR B 193 ? TYR B 2255 . ? 1_555 ? 
56 AC8 15 GLN B 204 ? GLN B 2266 . ? 1_555 ? 
57 AC8 15 LEU B 205 ? LEU B 2267 . ? 1_555 ? 
58 AC8 15 CYS B 206 ? CYS B 2268 . ? 1_555 ? 
59 AC8 15 LYS B 207 ? LYS B 2269 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YNP 
_atom_sites.fract_transf_matrix[1][1]   0.016874 
_atom_sites.fract_transf_matrix[1][2]   0.009742 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019485 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004275 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . SER A 1 6   ? 2.264  -10.881 23.830 1.00 43.33 ? 2068 SER A N     1 
ATOM   2    C  CA    . SER A 1 6   ? 1.340  -10.891 22.656 1.00 43.37 ? 2068 SER A CA    1 
ATOM   3    C  C     . SER A 1 6   ? 1.883  -10.113 21.458 1.00 43.35 ? 2068 SER A C     1 
ATOM   4    O  O     . SER A 1 6   ? 2.297  -8.956  21.585 1.00 43.11 ? 2068 SER A O     1 
ATOM   5    C  CB    . SER A 1 6   ? -0.036 -10.371 23.050 1.00 43.34 ? 2068 SER A CB    1 
ATOM   6    O  OG    . SER A 1 6   ? -0.597 -11.195 24.051 1.00 44.11 ? 2068 SER A OG    1 
ATOM   7    N  N     . TYR A 1 7   ? 1.838  -10.767 20.296 1.00 43.42 ? 2069 TYR A N     1 
ATOM   8    C  CA    . TYR A 1 7   ? 2.491  -10.324 19.070 1.00 43.37 ? 2069 TYR A CA    1 
ATOM   9    C  C     . TYR A 1 7   ? 2.070  -11.255 17.937 1.00 43.66 ? 2069 TYR A C     1 
ATOM   10   O  O     . TYR A 1 7   ? 1.598  -12.365 18.188 1.00 43.75 ? 2069 TYR A O     1 
ATOM   11   C  CB    . TYR A 1 7   ? 4.010  -10.414 19.238 1.00 43.27 ? 2069 TYR A CB    1 
ATOM   12   C  CG    . TYR A 1 7   ? 4.540  -11.838 19.294 1.00 43.19 ? 2069 TYR A CG    1 
ATOM   13   C  CD1   . TYR A 1 7   ? 5.230  -12.386 18.214 1.00 42.90 ? 2069 TYR A CD1   1 
ATOM   14   C  CD2   . TYR A 1 7   ? 4.340  -12.639 20.421 1.00 43.12 ? 2069 TYR A CD2   1 
ATOM   15   C  CE1   . TYR A 1 7   ? 5.713  -13.688 18.254 1.00 43.06 ? 2069 TYR A CE1   1 
ATOM   16   C  CE2   . TYR A 1 7   ? 4.817  -13.945 20.469 1.00 43.07 ? 2069 TYR A CE2   1 
ATOM   17   C  CZ    . TYR A 1 7   ? 5.504  -14.462 19.384 1.00 43.11 ? 2069 TYR A CZ    1 
ATOM   18   O  OH    . TYR A 1 7   ? 5.985  -15.749 19.427 1.00 42.55 ? 2069 TYR A OH    1 
ATOM   19   N  N     . LYS A 1 8   ? 2.256  -10.814 16.693 1.00 43.99 ? 2070 LYS A N     1 
ATOM   20   C  CA    . LYS A 1 8   ? 2.048  -11.690 15.545 1.00 44.25 ? 2070 LYS A CA    1 
ATOM   21   C  C     . LYS A 1 8   ? 3.346  -12.403 15.193 1.00 44.48 ? 2070 LYS A C     1 
ATOM   22   O  O     . LYS A 1 8   ? 4.378  -11.762 15.005 1.00 44.52 ? 2070 LYS A O     1 
ATOM   23   C  CB    . LYS A 1 8   ? 1.522  -10.916 14.332 1.00 44.35 ? 2070 LYS A CB    1 
ATOM   24   C  CG    . LYS A 1 8   ? 1.352  -11.772 13.056 1.00 44.15 ? 2070 LYS A CG    1 
ATOM   25   C  CD    . LYS A 1 8   ? 1.234  -10.893 11.810 1.00 44.04 ? 2070 LYS A CD    1 
ATOM   26   C  CE    . LYS A 1 8   ? 1.666  -11.628 10.551 1.00 43.96 ? 2070 LYS A CE    1 
ATOM   27   N  NZ    . LYS A 1 8   ? 1.638  -10.743 9.354  1.00 43.49 ? 2070 LYS A NZ    1 
ATOM   28   N  N     . LYS A 1 9   ? 3.277  -13.732 15.113 1.00 44.81 ? 2071 LYS A N     1 
ATOM   29   C  CA    . LYS A 1 9   ? 4.399  -14.572 14.698 1.00 45.03 ? 2071 LYS A CA    1 
ATOM   30   C  C     . LYS A 1 9   ? 4.677  -14.423 13.203 1.00 45.04 ? 2071 LYS A C     1 
ATOM   31   O  O     . LYS A 1 9   ? 3.802  -14.670 12.370 1.00 45.05 ? 2071 LYS A O     1 
ATOM   32   C  CB    . LYS A 1 9   ? 4.107  -16.041 15.034 1.00 45.21 ? 2071 LYS A CB    1 
ATOM   33   C  CG    . LYS A 1 9   ? 5.169  -17.048 14.569 1.00 46.12 ? 2071 LYS A CG    1 
ATOM   34   C  CD    . LYS A 1 9   ? 6.218  -17.302 15.648 1.00 47.49 ? 2071 LYS A CD    1 
ATOM   35   C  CE    . LYS A 1 9   ? 7.200  -18.389 15.227 1.00 48.25 ? 2071 LYS A CE    1 
ATOM   36   N  NZ    . LYS A 1 9   ? 7.985  -18.894 16.393 1.00 48.86 ? 2071 LYS A NZ    1 
ATOM   37   N  N     . ILE A 1 10  ? 5.900  -14.020 12.871 1.00 45.14 ? 2072 ILE A N     1 
ATOM   38   C  CA    . ILE A 1 10  ? 6.329  -13.919 11.476 1.00 45.18 ? 2072 ILE A CA    1 
ATOM   39   C  C     . ILE A 1 10  ? 7.474  -14.880 11.211 1.00 45.42 ? 2072 ILE A C     1 
ATOM   40   O  O     . ILE A 1 10  ? 8.319  -15.091 12.074 1.00 45.52 ? 2072 ILE A O     1 
ATOM   41   C  CB    . ILE A 1 10  ? 6.734  -12.482 11.087 1.00 44.98 ? 2072 ILE A CB    1 
ATOM   42   C  CG1   . ILE A 1 10  ? 7.713  -11.896 12.111 1.00 45.00 ? 2072 ILE A CG1   1 
ATOM   43   C  CG2   . ILE A 1 10  ? 5.494  -11.619 10.965 1.00 44.77 ? 2072 ILE A CG2   1 
ATOM   44   C  CD1   . ILE A 1 10  ? 8.374  -10.589 11.698 1.00 44.81 ? 2072 ILE A CD1   1 
ATOM   45   N  N     . ARG A 1 11  ? 7.484  -15.471 10.021 1.00 45.80 ? 2073 ARG A N     1 
ATOM   46   C  CA    . ARG A 1 11  ? 8.504  -16.446 9.645  1.00 46.28 ? 2073 ARG A CA    1 
ATOM   47   C  C     . ARG A 1 11  ? 9.762  -15.750 9.133  1.00 46.28 ? 2073 ARG A C     1 
ATOM   48   O  O     . ARG A 1 11  ? 10.800 -16.384 8.927  1.00 46.53 ? 2073 ARG A O     1 
ATOM   49   C  CB    . ARG A 1 11  ? 7.967  -17.392 8.566  1.00 46.49 ? 2073 ARG A CB    1 
ATOM   50   C  CG    . ARG A 1 11  ? 6.679  -18.114 8.932  1.00 48.11 ? 2073 ARG A CG    1 
ATOM   51   C  CD    . ARG A 1 11  ? 6.283  -19.124 7.864  1.00 50.74 ? 2073 ARG A CD    1 
ATOM   52   N  NE    . ARG A 1 11  ? 5.110  -19.906 8.264  1.00 53.18 ? 2073 ARG A NE    1 
ATOM   53   C  CZ    . ARG A 1 11  ? 4.919  -21.193 7.966  1.00 54.76 ? 2073 ARG A CZ    1 
ATOM   54   N  NH1   . ARG A 1 11  ? 5.825  -21.871 7.265  1.00 55.35 ? 2073 ARG A NH1   1 
ATOM   55   N  NH2   . ARG A 1 11  ? 3.820  -21.813 8.382  1.00 55.35 ? 2073 ARG A NH2   1 
ATOM   56   N  N     . SER A 1 12  ? 9.661  -14.439 8.940  1.00 46.18 ? 2074 SER A N     1 
ATOM   57   C  CA    . SER A 1 12  ? 10.676 -13.665 8.244  1.00 46.13 ? 2074 SER A CA    1 
ATOM   58   C  C     . SER A 1 12  ? 10.481 -12.186 8.573  1.00 46.10 ? 2074 SER A C     1 
ATOM   59   O  O     . SER A 1 12  ? 9.378  -11.770 8.932  1.00 46.42 ? 2074 SER A O     1 
ATOM   60   C  CB    . SER A 1 12  ? 10.544 -13.900 6.735  1.00 46.04 ? 2074 SER A CB    1 
ATOM   61   O  OG    . SER A 1 12  ? 11.522 -13.188 6.000  1.00 46.28 ? 2074 SER A OG    1 
ATOM   62   N  N     . ASN A 1 13  ? 11.541 -11.395 8.446  1.00 45.87 ? 2075 ASN A N     1 
ATOM   63   C  CA    . ASN A 1 13  ? 11.466 -9.959  8.715  1.00 45.70 ? 2075 ASN A CA    1 
ATOM   64   C  C     . ASN A 1 13  ? 10.443 -9.228  7.857  1.00 45.74 ? 2075 ASN A C     1 
ATOM   65   O  O     . ASN A 1 13  ? 10.139 -9.648  6.741  1.00 45.61 ? 2075 ASN A O     1 
ATOM   66   C  CB    . ASN A 1 13  ? 12.839 -9.305  8.538  1.00 45.63 ? 2075 ASN A CB    1 
ATOM   67   C  CG    . ASN A 1 13  ? 13.762 -9.550  9.712  1.00 45.08 ? 2075 ASN A CG    1 
ATOM   68   O  OD1   . ASN A 1 13  ? 13.319 -9.866  10.818 1.00 44.36 ? 2075 ASN A OD1   1 
ATOM   69   N  ND2   . ASN A 1 13  ? 15.058 -9.392  9.479  1.00 44.66 ? 2075 ASN A ND2   1 
ATOM   70   N  N     . VAL A 1 14  ? 9.913  -8.134  8.393  1.00 46.02 ? 2076 VAL A N     1 
ATOM   71   C  CA    . VAL A 1 14  ? 9.009  -7.268  7.641  1.00 46.29 ? 2076 VAL A CA    1 
ATOM   72   C  C     . VAL A 1 14  ? 9.692  -5.932  7.404  1.00 46.42 ? 2076 VAL A C     1 
ATOM   73   O  O     . VAL A 1 14  ? 9.908  -5.162  8.337  1.00 46.52 ? 2076 VAL A O     1 
ATOM   74   C  CB    . VAL A 1 14  ? 7.656  -7.046  8.361  1.00 46.29 ? 2076 VAL A CB    1 
ATOM   75   C  CG1   . VAL A 1 14  ? 6.761  -6.137  7.531  1.00 46.22 ? 2076 VAL A CG1   1 
ATOM   76   C  CG2   . VAL A 1 14  ? 6.952  -8.382  8.632  1.00 46.33 ? 2076 VAL A CG2   1 
ATOM   77   N  N     . TYR A 1 15  ? 10.035 -5.674  6.149  1.00 46.65 ? 2077 TYR A N     1 
ATOM   78   C  CA    . TYR A 1 15  ? 10.742 -4.460  5.778  1.00 47.08 ? 2077 TYR A CA    1 
ATOM   79   C  C     . TYR A 1 15  ? 9.767  -3.311  5.541  1.00 47.47 ? 2077 TYR A C     1 
ATOM   80   O  O     . TYR A 1 15  ? 8.899  -3.381  4.670  1.00 47.62 ? 2077 TYR A O     1 
ATOM   81   C  CB    . TYR A 1 15  ? 11.633 -4.725  4.560  1.00 47.05 ? 2077 TYR A CB    1 
ATOM   82   C  CG    . TYR A 1 15  ? 12.708 -5.749  4.853  1.00 47.03 ? 2077 TYR A CG    1 
ATOM   83   C  CD1   . TYR A 1 15  ? 12.490 -7.111  4.627  1.00 47.20 ? 2077 TYR A CD1   1 
ATOM   84   C  CD2   . TYR A 1 15  ? 13.933 -5.360  5.389  1.00 46.72 ? 2077 TYR A CD2   1 
ATOM   85   C  CE1   . TYR A 1 15  ? 13.475 -8.056  4.924  1.00 46.99 ? 2077 TYR A CE1   1 
ATOM   86   C  CE2   . TYR A 1 15  ? 14.920 -6.291  5.685  1.00 46.68 ? 2077 TYR A CE2   1 
ATOM   87   C  CZ    . TYR A 1 15  ? 14.690 -7.633  5.452  1.00 46.80 ? 2077 TYR A CZ    1 
ATOM   88   O  OH    . TYR A 1 15  ? 15.682 -8.539  5.747  1.00 46.41 ? 2077 TYR A OH    1 
ATOM   89   N  N     . VAL A 1 16  ? 9.910  -2.259  6.340  1.00 47.86 ? 2078 VAL A N     1 
ATOM   90   C  CA    . VAL A 1 16  ? 8.959  -1.154  6.337  1.00 48.28 ? 2078 VAL A CA    1 
ATOM   91   C  C     . VAL A 1 16  ? 9.431  -0.032  5.411  1.00 48.67 ? 2078 VAL A C     1 
ATOM   92   O  O     . VAL A 1 16  ? 9.076  -0.007  4.233  1.00 48.80 ? 2078 VAL A O     1 
ATOM   93   C  CB    . VAL A 1 16  ? 8.690  -0.634  7.778  1.00 48.23 ? 2078 VAL A CB    1 
ATOM   94   C  CG1   . VAL A 1 16  ? 7.656  0.481   7.772  1.00 48.34 ? 2078 VAL A CG1   1 
ATOM   95   C  CG2   . VAL A 1 16  ? 8.230  -1.779  8.685  1.00 48.06 ? 2078 VAL A CG2   1 
ATOM   96   N  N     . ASP A 1 17  ? 10.242 0.876   5.942  1.00 49.12 ? 2079 ASP A N     1 
ATOM   97   C  CA    . ASP A 1 17  ? 10.665 2.062   5.211  1.00 49.61 ? 2079 ASP A CA    1 
ATOM   98   C  C     . ASP A 1 17  ? 12.178 2.098   5.076  1.00 50.01 ? 2079 ASP A C     1 
ATOM   99   O  O     . ASP A 1 17  ? 12.788 3.168   5.065  1.00 50.19 ? 2079 ASP A O     1 
ATOM   100  C  CB    . ASP A 1 17  ? 10.155 3.328   5.915  1.00 49.60 ? 2079 ASP A CB    1 
ATOM   101  C  CG    . ASP A 1 17  ? 10.666 3.462   7.353  1.00 49.75 ? 2079 ASP A CG    1 
ATOM   102  O  OD1   . ASP A 1 17  ? 10.759 4.609   7.839  1.00 49.60 ? 2079 ASP A OD1   1 
ATOM   103  O  OD2   . ASP A 1 17  ? 10.971 2.435   7.998  1.00 50.08 ? 2079 ASP A OD2   1 
ATOM   104  N  N     . VAL A 1 18  ? 12.777 0.918   4.957  1.00 50.52 ? 2080 VAL A N     1 
ATOM   105  C  CA    . VAL A 1 18  ? 14.226 0.777   5.041  1.00 50.94 ? 2080 VAL A CA    1 
ATOM   106  C  C     . VAL A 1 18  ? 14.728 -0.501  4.360  1.00 51.29 ? 2080 VAL A C     1 
ATOM   107  O  O     . VAL A 1 18  ? 14.031 -1.523  4.340  1.00 51.32 ? 2080 VAL A O     1 
ATOM   108  C  CB    . VAL A 1 18  ? 14.686 0.869   6.527  1.00 50.88 ? 2080 VAL A CB    1 
ATOM   109  C  CG1   . VAL A 1 18  ? 15.552 -0.310  6.935  1.00 51.06 ? 2080 VAL A CG1   1 
ATOM   110  C  CG2   . VAL A 1 18  ? 15.390 2.184   6.787  1.00 50.97 ? 2080 VAL A CG2   1 
ATOM   111  N  N     . LYS A 1 19  ? 15.928 -0.420  3.785  1.00 51.72 ? 2081 LYS A N     1 
ATOM   112  C  CA    . LYS A 1 19  ? 16.600 -1.572  3.183  1.00 52.25 ? 2081 LYS A CA    1 
ATOM   113  C  C     . LYS A 1 19  ? 18.038 -1.637  3.704  1.00 52.83 ? 2081 LYS A C     1 
ATOM   114  O  O     . LYS A 1 19  ? 18.840 -0.751  3.414  1.00 52.90 ? 2081 LYS A O     1 
ATOM   115  C  CB    . LYS A 1 19  ? 16.609 -1.468  1.655  1.00 52.13 ? 2081 LYS A CB    1 
ATOM   116  C  CG    . LYS A 1 19  ? 15.263 -1.204  1.003  1.00 51.87 ? 2081 LYS A CG    1 
ATOM   117  C  CD    . LYS A 1 19  ? 15.459 -0.874  -0.467 1.00 51.99 ? 2081 LYS A CD    1 
ATOM   118  C  CE    . LYS A 1 19  ? 14.142 -0.662  -1.192 1.00 51.86 ? 2081 LYS A CE    1 
ATOM   119  N  NZ    . LYS A 1 19  ? 14.358 -0.538  -2.660 1.00 51.69 ? 2081 LYS A NZ    1 
ATOM   120  N  N     . PRO A 1 20  ? 18.372 -2.686  4.477  1.00 53.47 ? 2082 PRO A N     1 
ATOM   121  C  CA    . PRO A 1 20  ? 19.683 -2.765  5.125  1.00 54.03 ? 2082 PRO A CA    1 
ATOM   122  C  C     . PRO A 1 20  ? 20.733 -3.517  4.301  1.00 54.77 ? 2082 PRO A C     1 
ATOM   123  O  O     . PRO A 1 20  ? 21.277 -4.526  4.761  1.00 54.92 ? 2082 PRO A O     1 
ATOM   124  C  CB    . PRO A 1 20  ? 19.374 -3.520  6.416  1.00 53.95 ? 2082 PRO A CB    1 
ATOM   125  C  CG    . PRO A 1 20  ? 18.159 -4.373  6.086  1.00 53.66 ? 2082 PRO A CG    1 
ATOM   126  C  CD    . PRO A 1 20  ? 17.519 -3.834  4.832  1.00 53.37 ? 2082 PRO A CD    1 
ATOM   127  N  N     . LEU A 1 21  ? 21.020 -3.014  3.103  1.00 55.58 ? 2083 LEU A N     1 
ATOM   128  C  CA    . LEU A 1 21  ? 21.941 -3.674  2.174  1.00 56.41 ? 2083 LEU A CA    1 
ATOM   129  C  C     . LEU A 1 21  ? 23.377 -3.655  2.681  1.00 57.05 ? 2083 LEU A C     1 
ATOM   130  O  O     . LEU A 1 21  ? 23.880 -2.613  3.092  1.00 57.07 ? 2083 LEU A O     1 
ATOM   131  C  CB    . LEU A 1 21  ? 21.860 -3.033  0.788  1.00 56.33 ? 2083 LEU A CB    1 
ATOM   132  C  CG    . LEU A 1 21  ? 20.487 -3.027  0.108  1.00 56.43 ? 2083 LEU A CG    1 
ATOM   133  C  CD1   . LEU A 1 21  ? 20.466 -2.030  -1.049 1.00 56.42 ? 2083 LEU A CD1   1 
ATOM   134  C  CD2   . LEU A 1 21  ? 20.074 -4.430  -0.355 1.00 56.10 ? 2083 LEU A CD2   1 
ATOM   135  N  N     . SER A 1 22  ? 24.027 -4.816  2.636  1.00 58.02 ? 2084 SER A N     1 
ATOM   136  C  CA    . SER A 1 22  ? 25.349 -5.005  3.235  1.00 58.91 ? 2084 SER A CA    1 
ATOM   137  C  C     . SER A 1 22  ? 26.487 -4.376  2.441  1.00 59.79 ? 2084 SER A C     1 
ATOM   138  O  O     . SER A 1 22  ? 27.554 -4.110  2.993  1.00 59.87 ? 2084 SER A O     1 
ATOM   139  C  CB    . SER A 1 22  ? 25.627 -6.491  3.475  1.00 58.77 ? 2084 SER A CB    1 
ATOM   140  O  OG    . SER A 1 22  ? 25.729 -7.205  2.259  1.00 58.55 ? 2084 SER A OG    1 
ATOM   141  N  N     . GLY A 1 23  ? 26.260 -4.142  1.152  1.00 60.91 ? 2085 GLY A N     1 
ATOM   142  C  CA    . GLY A 1 23  ? 27.252 -3.488  0.305  1.00 62.36 ? 2085 GLY A CA    1 
ATOM   143  C  C     . GLY A 1 23  ? 28.153 -4.437  -0.463 1.00 63.43 ? 2085 GLY A C     1 
ATOM   144  O  O     . GLY A 1 23  ? 28.614 -4.104  -1.558 1.00 63.49 ? 2085 GLY A O     1 
ATOM   145  N  N     . TYR A 1 24  ? 28.420 -5.610  0.110  1.00 64.50 ? 2086 TYR A N     1 
ATOM   146  C  CA    . TYR A 1 24  ? 29.208 -6.634  -0.583 1.00 65.66 ? 2086 TYR A CA    1 
ATOM   147  C  C     . TYR A 1 24  ? 28.365 -7.825  -1.041 1.00 66.45 ? 2086 TYR A C     1 
ATOM   148  O  O     . TYR A 1 24  ? 27.340 -8.152  -0.434 1.00 66.45 ? 2086 TYR A O     1 
ATOM   149  C  CB    . TYR A 1 24  ? 30.436 -7.073  0.231  1.00 65.65 ? 2086 TYR A CB    1 
ATOM   150  C  CG    . TYR A 1 24  ? 30.180 -7.434  1.680  1.00 65.66 ? 2086 TYR A CG    1 
ATOM   151  C  CD1   . TYR A 1 24  ? 29.993 -8.762  2.064  1.00 65.66 ? 2086 TYR A CD1   1 
ATOM   152  C  CD2   . TYR A 1 24  ? 30.158 -6.452  2.673  1.00 65.42 ? 2086 TYR A CD2   1 
ATOM   153  C  CE1   . TYR A 1 24  ? 29.778 -9.103  3.400  1.00 65.29 ? 2086 TYR A CE1   1 
ATOM   154  C  CE2   . TYR A 1 24  ? 29.934 -6.784  4.012  1.00 65.02 ? 2086 TYR A CE2   1 
ATOM   155  C  CZ    . TYR A 1 24  ? 29.750 -8.109  4.367  1.00 64.94 ? 2086 TYR A CZ    1 
ATOM   156  O  OH    . TYR A 1 24  ? 29.534 -8.442  5.685  1.00 64.45 ? 2086 TYR A OH    1 
ATOM   157  N  N     . GLU A 1 25  ? 28.813 -8.463  -2.122 1.00 67.50 ? 2087 GLU A N     1 
ATOM   158  C  CA    . GLU A 1 25  ? 28.010 -9.469  -2.822 1.00 68.45 ? 2087 GLU A CA    1 
ATOM   159  C  C     . GLU A 1 25  ? 28.791 -10.714 -3.276 1.00 68.95 ? 2087 GLU A C     1 
ATOM   160  O  O     . GLU A 1 25  ? 28.378 -11.841 -2.987 1.00 69.12 ? 2087 GLU A O     1 
ATOM   161  C  CB    . GLU A 1 25  ? 27.259 -8.828  -4.004 1.00 68.55 ? 2087 GLU A CB    1 
ATOM   162  C  CG    . GLU A 1 25  ? 28.083 -7.824  -4.830 1.00 69.14 ? 2087 GLU A CG    1 
ATOM   163  C  CD    . GLU A 1 25  ? 27.272 -7.139  -5.927 1.00 70.05 ? 2087 GLU A CD    1 
ATOM   164  O  OE1   . GLU A 1 25  ? 27.700 -7.186  -7.104 1.00 70.03 ? 2087 GLU A OE1   1 
ATOM   165  O  OE2   . GLU A 1 25  ? 26.206 -6.555  -5.617 1.00 70.84 ? 2087 GLU A OE2   1 
ATOM   166  N  N     . ALA A 1 26  ? 29.908 -10.508 -3.976 1.00 69.48 ? 2088 ALA A N     1 
ATOM   167  C  CA    . ALA A 1 26  ? 30.699 -11.609 -4.538 1.00 69.99 ? 2088 ALA A CA    1 
ATOM   168  C  C     . ALA A 1 26  ? 31.267 -12.523 -3.450 1.00 70.35 ? 2088 ALA A C     1 
ATOM   169  O  O     . ALA A 1 26  ? 32.074 -12.087 -2.624 1.00 70.58 ? 2088 ALA A O     1 
ATOM   170  C  CB    . ALA A 1 26  ? 31.817 -11.068 -5.428 1.00 69.96 ? 2088 ALA A CB    1 
ATOM   171  N  N     . THR A 1 27  ? 30.837 -13.786 -3.459 1.00 70.66 ? 2089 THR A N     1 
ATOM   172  C  CA    . THR A 1 27  ? 31.217 -14.756 -2.426 1.00 71.00 ? 2089 THR A CA    1 
ATOM   173  C  C     . THR A 1 27  ? 31.497 -16.157 -2.991 1.00 71.18 ? 2089 THR A C     1 
ATOM   174  O  O     . THR A 1 27  ? 30.573 -16.852 -3.424 1.00 71.18 ? 2089 THR A O     1 
ATOM   175  C  CB    . THR A 1 27  ? 30.115 -14.882 -1.336 1.00 71.04 ? 2089 THR A CB    1 
ATOM   176  O  OG1   . THR A 1 27  ? 28.858 -15.188 -1.955 1.00 71.30 ? 2089 THR A OG1   1 
ATOM   177  C  CG2   . THR A 1 27  ? 29.975 -13.594 -0.522 1.00 71.13 ? 2089 THR A CG2   1 
ATOM   178  N  N     . THR A 1 28  ? 32.768 -16.562 -2.987 1.00 71.43 ? 2090 THR A N     1 
ATOM   179  C  CA    . THR A 1 28  ? 33.160 -17.947 -3.311 1.00 71.70 ? 2090 THR A CA    1 
ATOM   180  C  C     . THR A 1 28  ? 34.215 -18.479 -2.333 1.00 71.93 ? 2090 THR A C     1 
ATOM   181  O  O     . THR A 1 28  ? 35.229 -17.826 -2.079 1.00 71.95 ? 2090 THR A O     1 
ATOM   182  C  CB    . THR A 1 28  ? 33.655 -18.120 -4.772 1.00 71.63 ? 2090 THR A CB    1 
ATOM   183  O  OG1   . THR A 1 28  ? 34.421 -16.975 -5.168 1.00 71.96 ? 2090 THR A OG1   1 
ATOM   184  C  CG2   . THR A 1 28  ? 32.482 -18.305 -5.729 1.00 71.28 ? 2090 THR A CG2   1 
ATOM   185  N  N     . CYS A 1 29  ? 33.961 -19.677 -1.810 1.00 72.18 ? 2091 CYS A N     1 
ATOM   186  C  CA    . CYS A 1 29  ? 34.722 -20.258 -0.701 1.00 72.40 ? 2091 CYS A CA    1 
ATOM   187  C  C     . CYS A 1 29  ? 36.195 -20.550 -0.971 1.00 72.67 ? 2091 CYS A C     1 
ATOM   188  O  O     . CYS A 1 29  ? 37.074 -20.040 -0.273 1.00 72.80 ? 2091 CYS A O     1 
ATOM   189  C  CB    . CYS A 1 29  ? 34.076 -21.571 -0.261 1.00 72.34 ? 2091 CYS A CB    1 
ATOM   190  S  SG    . CYS A 1 29  ? 32.426 -21.449 0.392  1.00 72.12 ? 2091 CYS A SG    1 
ATOM   191  N  N     . ASN A 1 30  ? 36.447 -21.397 -1.968 1.00 72.87 ? 2092 ASN A N     1 
ATOM   192  C  CA    . ASN A 1 30  ? 37.722 -22.113 -2.107 1.00 73.03 ? 2092 ASN A CA    1 
ATOM   193  C  C     . ASN A 1 30  ? 37.974 -23.145 -0.996 1.00 73.15 ? 2092 ASN A C     1 
ATOM   194  O  O     . ASN A 1 30  ? 39.027 -23.788 -0.969 1.00 73.16 ? 2092 ASN A O     1 
ATOM   195  C  CB    . ASN A 1 30  ? 38.914 -21.159 -2.285 1.00 73.00 ? 2092 ASN A CB    1 
ATOM   196  C  CG    . ASN A 1 30  ? 39.187 -20.828 -3.746 1.00 72.95 ? 2092 ASN A CG    1 
ATOM   197  O  OD1   . ASN A 1 30  ? 38.272 -20.781 -4.571 1.00 72.94 ? 2092 ASN A OD1   1 
ATOM   198  N  ND2   . ASN A 1 30  ? 40.454 -20.597 -4.071 1.00 72.85 ? 2092 ASN A ND2   1 
ATOM   199  N  N     . CYS A 1 31  ? 37.010 -23.299 -0.087 1.00 73.35 ? 2093 CYS A N     1 
ATOM   200  C  CA    . CYS A 1 31  ? 36.982 -24.458 0.809  1.00 73.62 ? 2093 CYS A CA    1 
ATOM   201  C  C     . CYS A 1 31  ? 36.163 -25.572 0.151  1.00 73.82 ? 2093 CYS A C     1 
ATOM   202  O  O     . CYS A 1 31  ? 35.088 -25.324 -0.405 1.00 73.84 ? 2093 CYS A O     1 
ATOM   203  C  CB    . CYS A 1 31  ? 36.488 -24.104 2.223  1.00 73.63 ? 2093 CYS A CB    1 
ATOM   204  S  SG    . CYS A 1 31  ? 34.766 -23.598 2.408  1.00 73.22 ? 2093 CYS A SG    1 
ATOM   205  N  N     . LYS A 1 32  ? 36.688 -26.793 0.211  1.00 74.07 ? 2094 LYS A N     1 
ATOM   206  C  CA    . LYS A 1 32  ? 36.286 -27.856 -0.715 1.00 74.30 ? 2094 LYS A CA    1 
ATOM   207  C  C     . LYS A 1 32  ? 35.305 -28.886 -0.159 1.00 74.44 ? 2094 LYS A C     1 
ATOM   208  O  O     . LYS A 1 32  ? 35.275 -29.150 1.047  1.00 74.49 ? 2094 LYS A O     1 
ATOM   209  C  CB    . LYS A 1 32  ? 37.530 -28.540 -1.297 1.00 74.29 ? 2094 LYS A CB    1 
ATOM   210  C  CG    . LYS A 1 32  ? 38.445 -27.571 -2.044 1.00 74.43 ? 2094 LYS A CG    1 
ATOM   211  C  CD    . LYS A 1 32  ? 39.642 -28.256 -2.678 1.00 74.74 ? 2094 LYS A CD    1 
ATOM   212  C  CE    . LYS A 1 32  ? 40.540 -27.228 -3.355 1.00 74.96 ? 2094 LYS A CE    1 
ATOM   213  N  NZ    . LYS A 1 32  ? 41.577 -27.847 -4.229 1.00 75.22 ? 2094 LYS A NZ    1 
ATOM   214  N  N     . LYS A 1 33  ? 34.508 -29.453 -1.067 1.00 74.63 ? 2095 LYS A N     1 
ATOM   215  C  CA    . LYS A 1 33  ? 33.521 -30.490 -0.759 1.00 74.81 ? 2095 LYS A CA    1 
ATOM   216  C  C     . LYS A 1 33  ? 34.139 -31.696 -0.056 1.00 75.00 ? 2095 LYS A C     1 
ATOM   217  O  O     . LYS A 1 33  ? 35.165 -32.215 -0.502 1.00 74.97 ? 2095 LYS A O     1 
ATOM   218  C  CB    . LYS A 1 33  ? 32.835 -30.971 -2.044 1.00 74.83 ? 2095 LYS A CB    1 
ATOM   219  C  CG    . LYS A 1 33  ? 31.499 -30.314 -2.365 1.00 74.80 ? 2095 LYS A CG    1 
ATOM   220  C  CD    . LYS A 1 33  ? 30.946 -30.793 -3.714 1.00 74.58 ? 2095 LYS A CD    1 
ATOM   221  C  CE    . LYS A 1 33  ? 29.516 -30.308 -3.944 1.00 74.22 ? 2095 LYS A CE    1 
ATOM   222  N  NZ    . LYS A 1 33  ? 29.042 -30.531 -5.339 1.00 73.59 ? 2095 LYS A NZ    1 
ATOM   223  N  N     . PRO A 1 34  ? 33.522 -32.136 1.055  1.00 75.17 ? 2096 PRO A N     1 
ATOM   224  C  CA    . PRO A 1 34  ? 33.884 -33.430 1.623  1.00 75.36 ? 2096 PRO A CA    1 
ATOM   225  C  C     . PRO A 1 34  ? 33.099 -34.553 0.939  1.00 75.53 ? 2096 PRO A C     1 
ATOM   226  O  O     . PRO A 1 34  ? 31.901 -34.406 0.683  1.00 75.51 ? 2096 PRO A O     1 
ATOM   227  C  CB    . PRO A 1 34  ? 33.498 -33.293 3.099  1.00 75.32 ? 2096 PRO A CB    1 
ATOM   228  C  CG    . PRO A 1 34  ? 32.439 -32.253 3.132  1.00 75.31 ? 2096 PRO A CG    1 
ATOM   229  C  CD    . PRO A 1 34  ? 32.569 -31.396 1.903  1.00 75.15 ? 2096 PRO A CD    1 
ATOM   230  N  N     . ASP A 1 35  ? 33.783 -35.656 0.643  1.00 75.81 ? 2097 ASP A N     1 
ATOM   231  C  CA    . ASP A 1 35  ? 33.197 -36.788 -0.080 1.00 76.00 ? 2097 ASP A CA    1 
ATOM   232  C  C     . ASP A 1 35  ? 31.943 -37.348 0.599  1.00 76.04 ? 2097 ASP A C     1 
ATOM   233  O  O     . ASP A 1 35  ? 30.981 -37.712 -0.078 1.00 76.12 ? 2097 ASP A O     1 
ATOM   234  C  CB    . ASP A 1 35  ? 34.242 -37.897 -0.273 1.00 76.10 ? 2097 ASP A CB    1 
ATOM   235  C  CG    . ASP A 1 35  ? 33.827 -38.925 -1.318 1.00 76.31 ? 2097 ASP A CG    1 
ATOM   236  O  OD1   . ASP A 1 35  ? 34.084 -40.131 -1.099 1.00 76.34 ? 2097 ASP A OD1   1 
ATOM   237  O  OD2   . ASP A 1 35  ? 33.249 -38.528 -2.356 1.00 76.25 ? 2097 ASP A OD2   1 
ATOM   238  N  N     . ASP A 1 36  ? 31.963 -37.410 1.929  1.00 76.05 ? 2098 ASP A N     1 
ATOM   239  C  CA    . ASP A 1 36  ? 30.827 -37.900 2.708  1.00 76.05 ? 2098 ASP A CA    1 
ATOM   240  C  C     . ASP A 1 36  ? 29.616 -36.984 2.604  1.00 76.03 ? 2098 ASP A C     1 
ATOM   241  O  O     . ASP A 1 36  ? 29.746 -35.762 2.676  1.00 76.10 ? 2098 ASP A O     1 
ATOM   242  C  CB    . ASP A 1 36  ? 31.215 -38.060 4.176  1.00 76.03 ? 2098 ASP A CB    1 
ATOM   243  C  CG    . ASP A 1 36  ? 31.879 -39.383 4.458  1.00 76.30 ? 2098 ASP A CG    1 
ATOM   244  O  OD1   . ASP A 1 36  ? 31.171 -40.413 4.441  1.00 76.64 ? 2098 ASP A OD1   1 
ATOM   245  O  OD2   . ASP A 1 36  ? 33.104 -39.394 4.706  1.00 76.64 ? 2098 ASP A OD2   1 
ATOM   246  N  N     . ASP A 1 37  ? 28.445 -37.592 2.434  1.00 75.98 ? 2099 ASP A N     1 
ATOM   247  C  CA    . ASP A 1 37  ? 27.175 -36.872 2.417  1.00 75.92 ? 2099 ASP A CA    1 
ATOM   248  C  C     . ASP A 1 37  ? 26.845 -36.305 3.792  1.00 75.83 ? 2099 ASP A C     1 
ATOM   249  O  O     . ASP A 1 37  ? 26.241 -35.236 3.902  1.00 75.88 ? 2099 ASP A O     1 
ATOM   250  C  CB    . ASP A 1 37  ? 26.039 -37.800 1.978  1.00 75.97 ? 2099 ASP A CB    1 
ATOM   251  C  CG    . ASP A 1 37  ? 26.251 -38.374 0.592  1.00 76.30 ? 2099 ASP A CG    1 
ATOM   252  O  OD1   . ASP A 1 37  ? 27.249 -38.005 -0.067 1.00 76.58 ? 2099 ASP A OD1   1 
ATOM   253  O  OD2   . ASP A 1 37  ? 25.413 -39.198 0.162  1.00 76.62 ? 2099 ASP A OD2   1 
ATOM   254  N  N     . THR A 1 38  ? 27.249 -37.030 4.832  1.00 75.63 ? 2100 THR A N     1 
ATOM   255  C  CA    . THR A 1 38  ? 26.861 -36.716 6.208  1.00 75.42 ? 2100 THR A CA    1 
ATOM   256  C  C     . THR A 1 38  ? 27.826 -35.755 6.916  1.00 75.24 ? 2100 THR A C     1 
ATOM   257  O  O     . THR A 1 38  ? 27.549 -35.302 8.032  1.00 75.31 ? 2100 THR A O     1 
ATOM   258  C  CB    . THR A 1 38  ? 26.682 -38.009 7.046  1.00 75.42 ? 2100 THR A CB    1 
ATOM   259  O  OG1   . THR A 1 38  ? 27.909 -38.748 7.061  1.00 75.41 ? 2100 THR A OG1   1 
ATOM   260  C  CG2   . THR A 1 38  ? 25.576 -38.888 6.459  1.00 75.53 ? 2100 THR A CG2   1 
ATOM   261  N  N     . ARG A 1 39  ? 28.945 -35.441 6.263  1.00 74.89 ? 2101 ARG A N     1 
ATOM   262  C  CA    . ARG A 1 39  ? 29.947 -34.524 6.812  1.00 74.56 ? 2101 ARG A CA    1 
ATOM   263  C  C     . ARG A 1 39  ? 29.784 -33.120 6.213  1.00 74.24 ? 2101 ARG A C     1 
ATOM   264  O  O     . ARG A 1 39  ? 29.844 -32.953 4.994  1.00 74.20 ? 2101 ARG A O     1 
ATOM   265  C  CB    . ARG A 1 39  ? 31.355 -35.068 6.548  1.00 74.62 ? 2101 ARG A CB    1 
ATOM   266  C  CG    . ARG A 1 39  ? 32.485 -34.373 7.308  1.00 74.75 ? 2101 ARG A CG    1 
ATOM   267  C  CD    . ARG A 1 39  ? 33.836 -34.934 6.878  1.00 74.68 ? 2101 ARG A CD    1 
ATOM   268  N  NE    . ARG A 1 39  ? 34.944 -34.444 7.694  1.00 74.47 ? 2101 ARG A NE    1 
ATOM   269  C  CZ    . ARG A 1 39  ? 36.224 -34.752 7.490  1.00 74.40 ? 2101 ARG A CZ    1 
ATOM   270  N  NH1   . ARG A 1 39  ? 36.570 -35.554 6.490  1.00 74.31 ? 2101 ARG A NH1   1 
ATOM   271  N  NH2   . ARG A 1 39  ? 37.161 -34.257 8.288  1.00 74.26 ? 2101 ARG A NH2   1 
ATOM   272  N  N     . LYS A 1 40  ? 29.592 -32.124 7.078  1.00 73.75 ? 2102 LYS A N     1 
ATOM   273  C  CA    . LYS A 1 40  ? 29.318 -30.740 6.661  1.00 73.29 ? 2102 LYS A CA    1 
ATOM   274  C  C     . LYS A 1 40  ? 30.472 -30.070 5.904  1.00 72.82 ? 2102 LYS A C     1 
ATOM   275  O  O     . LYS A 1 40  ? 31.645 -30.357 6.153  1.00 72.77 ? 2102 LYS A O     1 
ATOM   276  C  CB    . LYS A 1 40  ? 28.904 -29.891 7.866  1.00 73.41 ? 2102 LYS A CB    1 
ATOM   277  C  CG    . LYS A 1 40  ? 27.502 -30.188 8.388  1.00 73.77 ? 2102 LYS A CG    1 
ATOM   278  C  CD    . LYS A 1 40  ? 27.206 -29.411 9.668  1.00 74.36 ? 2102 LYS A CD    1 
ATOM   279  C  CE    . LYS A 1 40  ? 25.895 -29.863 10.300 1.00 74.69 ? 2102 LYS A CE    1 
ATOM   280  N  NZ    . LYS A 1 40  ? 25.604 -29.151 11.575 1.00 74.51 ? 2102 LYS A NZ    1 
ATOM   281  N  N     . GLY A 1 41  ? 30.118 -29.162 4.995  1.00 72.26 ? 2103 GLY A N     1 
ATOM   282  C  CA    . GLY A 1 41  ? 31.062 -28.581 4.035  1.00 71.51 ? 2103 GLY A CA    1 
ATOM   283  C  C     . GLY A 1 41  ? 31.904 -27.413 4.516  1.00 70.95 ? 2103 GLY A C     1 
ATOM   284  O  O     . GLY A 1 41  ? 33.086 -27.582 4.823  1.00 71.03 ? 2103 GLY A O     1 
ATOM   285  N  N     . CYS A 1 42  ? 31.305 -26.225 4.558  1.00 70.27 ? 2104 CYS A N     1 
ATOM   286  C  CA    . CYS A 1 42  ? 32.015 -25.016 4.965  1.00 69.60 ? 2104 CYS A CA    1 
ATOM   287  C  C     . CYS A 1 42  ? 32.103 -24.907 6.484  1.00 69.39 ? 2104 CYS A C     1 
ATOM   288  O  O     . CYS A 1 42  ? 31.132 -24.540 7.147  1.00 69.37 ? 2104 CYS A O     1 
ATOM   289  C  CB    . CYS A 1 42  ? 31.336 -23.774 4.391  1.00 69.57 ? 2104 CYS A CB    1 
ATOM   290  S  SG    . CYS A 1 42  ? 31.307 -23.706 2.602  1.00 68.38 ? 2104 CYS A SG    1 
ATOM   291  N  N     . VAL A 1 43  ? 33.273 -25.228 7.030  1.00 69.00 ? 2105 VAL A N     1 
ATOM   292  C  CA    . VAL A 1 43  ? 33.489 -25.161 8.474  1.00 68.66 ? 2105 VAL A CA    1 
ATOM   293  C  C     . VAL A 1 43  ? 34.244 -23.873 8.834  1.00 68.41 ? 2105 VAL A C     1 
ATOM   294  O  O     . VAL A 1 43  ? 34.032 -22.835 8.202  1.00 68.42 ? 2105 VAL A O     1 
ATOM   295  C  CB    . VAL A 1 43  ? 34.206 -26.429 9.016  1.00 68.70 ? 2105 VAL A CB    1 
ATOM   296  C  CG1   . VAL A 1 43  ? 33.893 -26.627 10.497 1.00 68.89 ? 2105 VAL A CG1   1 
ATOM   297  C  CG2   . VAL A 1 43  ? 33.786 -27.669 8.234  1.00 68.62 ? 2105 VAL A CG2   1 
ATOM   298  N  N     . ASP A 1 44  ? 35.124 -23.943 9.832  1.00 68.05 ? 2106 ASP A N     1 
ATOM   299  C  CA    . ASP A 1 44  ? 35.806 -22.763 10.372 1.00 67.66 ? 2106 ASP A CA    1 
ATOM   300  C  C     . ASP A 1 44  ? 36.869 -22.171 9.452  1.00 67.18 ? 2106 ASP A C     1 
ATOM   301  O  O     . ASP A 1 44  ? 37.352 -21.066 9.694  1.00 67.17 ? 2106 ASP A O     1 
ATOM   302  C  CB    . ASP A 1 44  ? 36.404 -23.073 11.748 1.00 67.81 ? 2106 ASP A CB    1 
ATOM   303  C  CG    . ASP A 1 44  ? 35.340 -23.360 12.797 1.00 68.11 ? 2106 ASP A CG    1 
ATOM   304  O  OD1   . ASP A 1 44  ? 34.166 -22.976 12.588 1.00 68.11 ? 2106 ASP A OD1   1 
ATOM   305  O  OD2   . ASP A 1 44  ? 35.679 -23.969 13.834 1.00 68.51 ? 2106 ASP A OD2   1 
ATOM   306  N  N     . ASP A 1 45  ? 37.221 -22.900 8.400  1.00 66.64 ? 2107 ASP A N     1 
ATOM   307  C  CA    . ASP A 1 45  ? 38.203 -22.426 7.424  1.00 66.13 ? 2107 ASP A CA    1 
ATOM   308  C  C     . ASP A 1 45  ? 37.587 -21.421 6.446  1.00 65.55 ? 2107 ASP A C     1 
ATOM   309  O  O     . ASP A 1 45  ? 38.273 -20.514 5.966  1.00 65.49 ? 2107 ASP A O     1 
ATOM   310  C  CB    . ASP A 1 45  ? 38.794 -23.607 6.646  1.00 66.26 ? 2107 ASP A CB    1 
ATOM   311  C  CG    . ASP A 1 45  ? 38.907 -24.872 7.488  1.00 66.85 ? 2107 ASP A CG    1 
ATOM   312  O  OD1   . ASP A 1 45  ? 39.362 -24.794 8.654  1.00 67.51 ? 2107 ASP A OD1   1 
ATOM   313  O  OD2   . ASP A 1 45  ? 38.538 -25.950 6.974  1.00 67.40 ? 2107 ASP A OD2   1 
ATOM   314  N  N     . CYS A 1 46  ? 36.288 -21.588 6.184  1.00 64.72 ? 2108 CYS A N     1 
ATOM   315  C  CA    . CYS A 1 46  ? 35.561 -20.896 5.112  1.00 63.80 ? 2108 CYS A CA    1 
ATOM   316  C  C     . CYS A 1 46  ? 35.768 -19.383 5.055  1.00 63.19 ? 2108 CYS A C     1 
ATOM   317  O  O     . CYS A 1 46  ? 35.500 -18.673 6.021  1.00 63.15 ? 2108 CYS A O     1 
ATOM   318  C  CB    . CYS A 1 46  ? 34.066 -21.224 5.194  1.00 63.87 ? 2108 CYS A CB    1 
ATOM   319  S  SG    . CYS A 1 46  ? 33.101 -20.693 3.762  1.00 63.60 ? 2108 CYS A SG    1 
ATOM   320  N  N     . LEU A 1 47  ? 36.233 -18.913 3.899  1.00 62.44 ? 2109 LEU A N     1 
ATOM   321  C  CA    . LEU A 1 47  ? 36.509 -17.497 3.637  1.00 61.64 ? 2109 LEU A CA    1 
ATOM   322  C  C     . LEU A 1 47  ? 35.328 -16.571 3.946  1.00 61.07 ? 2109 LEU A C     1 
ATOM   323  O  O     . LEU A 1 47  ? 35.505 -15.525 4.575  1.00 61.02 ? 2109 LEU A O     1 
ATOM   324  C  CB    . LEU A 1 47  ? 36.945 -17.313 2.173  1.00 61.68 ? 2109 LEU A CB    1 
ATOM   325  C  CG    . LEU A 1 47  ? 38.383 -17.576 1.684  1.00 61.78 ? 2109 LEU A CG    1 
ATOM   326  C  CD1   . LEU A 1 47  ? 39.291 -16.362 1.904  1.00 61.83 ? 2109 LEU A CD1   1 
ATOM   327  C  CD2   . LEU A 1 47  ? 39.019 -18.852 2.264  1.00 61.87 ? 2109 LEU A CD2   1 
ATOM   328  N  N     . ASN A 1 48  ? 34.133 -16.961 3.499  1.00 60.31 ? 2110 ASN A N     1 
ATOM   329  C  CA    . ASN A 1 48  ? 32.915 -16.167 3.696  1.00 59.50 ? 2110 ASN A CA    1 
ATOM   330  C  C     . ASN A 1 48  ? 32.466 -16.097 5.149  1.00 59.01 ? 2110 ASN A C     1 
ATOM   331  O  O     . ASN A 1 48  ? 32.050 -15.042 5.628  1.00 58.89 ? 2110 ASN A O     1 
ATOM   332  C  CB    . ASN A 1 48  ? 31.774 -16.699 2.825  1.00 59.39 ? 2110 ASN A CB    1 
ATOM   333  C  CG    . ASN A 1 48  ? 32.007 -16.468 1.343  1.00 59.25 ? 2110 ASN A CG    1 
ATOM   334  O  OD1   . ASN A 1 48  ? 31.632 -17.296 0.517  1.00 59.52 ? 2110 ASN A OD1   1 
ATOM   335  N  ND2   . ASN A 1 48  ? 32.624 -15.339 0.998  1.00 58.84 ? 2110 ASN A ND2   1 
ATOM   336  N  N     . ARG A 1 49  ? 32.552 -17.231 5.840  1.00 58.48 ? 2111 ARG A N     1 
ATOM   337  C  CA    . ARG A 1 49  ? 32.231 -17.311 7.259  1.00 57.98 ? 2111 ARG A CA    1 
ATOM   338  C  C     . ARG A 1 49  ? 33.134 -16.392 8.080  1.00 57.69 ? 2111 ARG A C     1 
ATOM   339  O  O     . ARG A 1 49  ? 32.710 -15.850 9.104  1.00 57.75 ? 2111 ARG A O     1 
ATOM   340  C  CB    . ARG A 1 49  ? 32.363 -18.756 7.744  1.00 57.97 ? 2111 ARG A CB    1 
ATOM   341  C  CG    . ARG A 1 49  ? 32.021 -18.974 9.212  1.00 57.78 ? 2111 ARG A CG    1 
ATOM   342  C  CD    . ARG A 1 49  ? 32.224 -20.421 9.617  1.00 57.42 ? 2111 ARG A CD    1 
ATOM   343  N  NE    . ARG A 1 49  ? 31.210 -21.303 9.042  1.00 57.21 ? 2111 ARG A NE    1 
ATOM   344  C  CZ    . ARG A 1 49  ? 30.077 -21.646 9.652  1.00 57.16 ? 2111 ARG A CZ    1 
ATOM   345  N  NH1   . ARG A 1 49  ? 29.800 -21.183 10.865 1.00 56.70 ? 2111 ARG A NH1   1 
ATOM   346  N  NH2   . ARG A 1 49  ? 29.220 -22.458 9.047  1.00 57.21 ? 2111 ARG A NH2   1 
ATOM   347  N  N     . MET A 1 50  ? 34.370 -16.216 7.617  1.00 57.27 ? 2112 MET A N     1 
ATOM   348  C  CA    . MET A 1 50  ? 35.357 -15.400 8.321  1.00 56.91 ? 2112 MET A CA    1 
ATOM   349  C  C     . MET A 1 50  ? 35.040 -13.909 8.273  1.00 56.35 ? 2112 MET A C     1 
ATOM   350  O  O     . MET A 1 50  ? 35.408 -13.177 9.193  1.00 56.39 ? 2112 MET A O     1 
ATOM   351  C  CB    . MET A 1 50  ? 36.776 -15.670 7.806  1.00 57.16 ? 2112 MET A CB    1 
ATOM   352  C  CG    . MET A 1 50  ? 37.326 -17.075 8.101  1.00 58.31 ? 2112 MET A CG    1 
ATOM   353  S  SD    . MET A 1 50  ? 37.379 -17.566 9.847  1.00 61.77 ? 2112 MET A SD    1 
ATOM   354  C  CE    . MET A 1 50  ? 35.788 -18.379 10.061 1.00 61.09 ? 2112 MET A CE    1 
ATOM   355  N  N     . ILE A 1 51  ? 34.362 -13.463 7.213  1.00 55.50 ? 2113 ILE A N     1 
ATOM   356  C  CA    . ILE A 1 51  ? 33.902 -12.068 7.123  1.00 54.68 ? 2113 ILE A CA    1 
ATOM   357  C  C     . ILE A 1 51  ? 32.424 -11.922 7.500  1.00 54.16 ? 2113 ILE A C     1 
ATOM   358  O  O     . ILE A 1 51  ? 31.804 -10.888 7.243  1.00 54.01 ? 2113 ILE A O     1 
ATOM   359  C  CB    . ILE A 1 51  ? 34.197 -11.424 5.741  1.00 54.59 ? 2113 ILE A CB    1 
ATOM   360  C  CG1   . ILE A 1 51  ? 33.292 -12.005 4.647  1.00 54.94 ? 2113 ILE A CG1   1 
ATOM   361  C  CG2   . ILE A 1 51  ? 35.662 -11.602 5.378  1.00 54.60 ? 2113 ILE A CG2   1 
ATOM   362  C  CD1   . ILE A 1 51  ? 33.106 -11.090 3.443  1.00 54.84 ? 2113 ILE A CD1   1 
ATOM   363  N  N     . PHE A 1 52  ? 31.886 -12.967 8.129  1.00 53.70 ? 2114 PHE A N     1 
ATOM   364  C  CA    . PHE A 1 52  ? 30.489 -13.034 8.570  1.00 53.34 ? 2114 PHE A CA    1 
ATOM   365  C  C     . PHE A 1 52  ? 29.487 -12.908 7.422  1.00 53.31 ? 2114 PHE A C     1 
ATOM   366  O  O     . PHE A 1 52  ? 28.433 -12.288 7.562  1.00 53.28 ? 2114 PHE A O     1 
ATOM   367  C  CB    . PHE A 1 52  ? 30.204 -12.003 9.669  1.00 53.22 ? 2114 PHE A CB    1 
ATOM   368  C  CG    . PHE A 1 52  ? 30.765 -12.374 11.010 1.00 52.66 ? 2114 PHE A CG    1 
ATOM   369  C  CD1   . PHE A 1 52  ? 32.045 -11.983 11.377 1.00 52.34 ? 2114 PHE A CD1   1 
ATOM   370  C  CD2   . PHE A 1 52  ? 30.010 -13.110 11.911 1.00 52.13 ? 2114 PHE A CD2   1 
ATOM   371  C  CE1   . PHE A 1 52  ? 32.569 -12.323 12.619 1.00 51.82 ? 2114 PHE A CE1   1 
ATOM   372  C  CE2   . PHE A 1 52  ? 30.524 -13.452 13.156 1.00 52.04 ? 2114 PHE A CE2   1 
ATOM   373  C  CZ    . PHE A 1 52  ? 31.808 -13.057 13.508 1.00 51.91 ? 2114 PHE A CZ    1 
ATOM   374  N  N     . ALA A 1 53  ? 29.825 -13.506 6.288  1.00 53.22 ? 2115 ALA A N     1 
ATOM   375  C  CA    . ALA A 1 53  ? 28.934 -13.523 5.142  1.00 53.25 ? 2115 ALA A CA    1 
ATOM   376  C  C     . ALA A 1 53  ? 28.482 -14.948 4.887  1.00 53.29 ? 2115 ALA A C     1 
ATOM   377  O  O     . ALA A 1 53  ? 29.272 -15.885 5.013  1.00 53.50 ? 2115 ALA A O     1 
ATOM   378  C  CB    . ALA A 1 53  ? 29.635 -12.958 3.924  1.00 53.18 ? 2115 ALA A CB    1 
ATOM   379  N  N     . GLU A 1 54  ? 27.210 -15.118 4.544  1.00 53.30 ? 2116 GLU A N     1 
ATOM   380  C  CA    . GLU A 1 54  ? 26.696 -16.436 4.188  1.00 53.40 ? 2116 GLU A CA    1 
ATOM   381  C  C     . GLU A 1 54  ? 26.939 -16.739 2.713  1.00 53.60 ? 2116 GLU A C     1 
ATOM   382  O  O     . GLU A 1 54  ? 26.837 -15.851 1.862  1.00 53.62 ? 2116 GLU A O     1 
ATOM   383  C  CB    . GLU A 1 54  ? 25.209 -16.569 4.530  1.00 53.20 ? 2116 GLU A CB    1 
ATOM   384  C  CG    . GLU A 1 54  ? 24.944 -16.934 5.985  1.00 52.86 ? 2116 GLU A CG    1 
ATOM   385  C  CD    . GLU A 1 54  ? 23.506 -17.358 6.254  1.00 52.57 ? 2116 GLU A CD    1 
ATOM   386  O  OE1   . GLU A 1 54  ? 23.209 -17.745 7.402  1.00 52.13 ? 2116 GLU A OE1   1 
ATOM   387  O  OE2   . GLU A 1 54  ? 22.671 -17.312 5.327  1.00 52.63 ? 2116 GLU A OE2   1 
ATOM   388  N  N     . CYS A 1 55  ? 27.274 -17.994 2.425  1.00 53.83 ? 2117 CYS A N     1 
ATOM   389  C  CA    . CYS A 1 55  ? 27.420 -18.466 1.056  1.00 54.16 ? 2117 CYS A CA    1 
ATOM   390  C  C     . CYS A 1 55  ? 26.082 -18.390 0.332  1.00 54.68 ? 2117 CYS A C     1 
ATOM   391  O  O     . CYS A 1 55  ? 25.024 -18.453 0.961  1.00 54.63 ? 2117 CYS A O     1 
ATOM   392  C  CB    . CYS A 1 55  ? 27.905 -19.918 1.037  1.00 54.15 ? 2117 CYS A CB    1 
ATOM   393  S  SG    . CYS A 1 55  ? 29.579 -20.207 1.649  1.00 53.07 ? 2117 CYS A SG    1 
ATOM   394  N  N     . SER A 1 56  ? 26.137 -18.240 -0.989 1.00 55.28 ? 2118 SER A N     1 
ATOM   395  C  CA    . SER A 1 56  ? 24.948 -18.357 -1.822 1.00 55.83 ? 2118 SER A CA    1 
ATOM   396  C  C     . SER A 1 56  ? 24.885 -19.777 -2.374 1.00 56.16 ? 2118 SER A C     1 
ATOM   397  O  O     . SER A 1 56  ? 25.894 -20.292 -2.865 1.00 56.16 ? 2118 SER A O     1 
ATOM   398  C  CB    . SER A 1 56  ? 24.977 -17.341 -2.957 1.00 55.90 ? 2118 SER A CB    1 
ATOM   399  O  OG    . SER A 1 56  ? 23.695 -17.235 -3.547 1.00 56.46 ? 2118 SER A OG    1 
ATOM   400  N  N     . PRO A 1 57  ? 23.699 -20.414 -2.300 1.00 56.53 ? 2119 PRO A N     1 
ATOM   401  C  CA    . PRO A 1 57  ? 23.540 -21.848 -2.581 1.00 56.84 ? 2119 PRO A CA    1 
ATOM   402  C  C     . PRO A 1 57  ? 23.999 -22.270 -3.978 1.00 57.16 ? 2119 PRO A C     1 
ATOM   403  O  O     . PRO A 1 57  ? 24.668 -23.298 -4.122 1.00 57.30 ? 2119 PRO A O     1 
ATOM   404  C  CB    . PRO A 1 57  ? 22.031 -22.074 -2.421 1.00 56.75 ? 2119 PRO A CB    1 
ATOM   405  C  CG    . PRO A 1 57  ? 21.422 -20.732 -2.620 1.00 56.83 ? 2119 PRO A CG    1 
ATOM   406  C  CD    . PRO A 1 57  ? 22.401 -19.768 -2.035 1.00 56.61 ? 2119 PRO A CD    1 
ATOM   407  N  N     . ASN A 1 58  ? 23.654 -21.474 -4.987 1.00 57.39 ? 2120 ASN A N     1 
ATOM   408  C  CA    . ASN A 1 58  ? 23.976 -21.797 -6.373 1.00 57.62 ? 2120 ASN A CA    1 
ATOM   409  C  C     . ASN A 1 58  ? 25.355 -21.302 -6.832 1.00 57.76 ? 2120 ASN A C     1 
ATOM   410  O  O     . ASN A 1 58  ? 25.630 -21.223 -8.034 1.00 57.98 ? 2120 ASN A O     1 
ATOM   411  C  CB    . ASN A 1 58  ? 22.863 -21.302 -7.310 1.00 57.67 ? 2120 ASN A CB    1 
ATOM   412  C  CG    . ASN A 1 58  ? 22.289 -19.959 -6.887 1.00 57.83 ? 2120 ASN A CG    1 
ATOM   413  O  OD1   . ASN A 1 58  ? 23.016 -18.971 -6.745 1.00 58.16 ? 2120 ASN A OD1   1 
ATOM   414  N  ND2   . ASN A 1 58  ? 20.974 -19.917 -6.693 1.00 57.35 ? 2120 ASN A ND2   1 
ATOM   415  N  N     . THR A 1 59  ? 26.222 -20.981 -5.874 1.00 57.85 ? 2121 THR A N     1 
ATOM   416  C  CA    . THR A 1 59  ? 27.569 -20.501 -6.189 1.00 57.95 ? 2121 THR A CA    1 
ATOM   417  C  C     . THR A 1 59  ? 28.617 -21.131 -5.273 1.00 57.89 ? 2121 THR A C     1 
ATOM   418  O  O     . THR A 1 59  ? 29.808 -21.127 -5.585 1.00 57.85 ? 2121 THR A O     1 
ATOM   419  C  CB    . THR A 1 59  ? 27.660 -18.957 -6.105 1.00 57.98 ? 2121 THR A CB    1 
ATOM   420  O  OG1   . THR A 1 59  ? 26.428 -18.375 -6.550 1.00 58.24 ? 2121 THR A OG1   1 
ATOM   421  C  CG2   . THR A 1 59  ? 28.802 -18.428 -6.970 1.00 57.89 ? 2121 THR A CG2   1 
ATOM   422  N  N     . CYS A 1 60  ? 28.161 -21.682 -4.153 1.00 57.96 ? 2122 CYS A N     1 
ATOM   423  C  CA    . CYS A 1 60  ? 29.056 -22.242 -3.149 1.00 58.00 ? 2122 CYS A CA    1 
ATOM   424  C  C     . CYS A 1 60  ? 29.684 -23.559 -3.599 1.00 58.00 ? 2122 CYS A C     1 
ATOM   425  O  O     . CYS A 1 60  ? 28.968 -24.474 -4.011 1.00 57.97 ? 2122 CYS A O     1 
ATOM   426  C  CB    . CYS A 1 60  ? 28.324 -22.436 -1.826 1.00 57.94 ? 2122 CYS A CB    1 
ATOM   427  S  SG    . CYS A 1 60  ? 29.362 -23.143 -0.549 1.00 58.44 ? 2122 CYS A SG    1 
ATOM   428  N  N     . PRO A 1 61  ? 31.029 -23.652 -3.518 1.00 58.11 ? 2123 PRO A N     1 
ATOM   429  C  CA    . PRO A 1 61  ? 31.818 -24.843 -3.855 1.00 58.05 ? 2123 PRO A CA    1 
ATOM   430  C  C     . PRO A 1 61  ? 31.323 -26.132 -3.205 1.00 57.99 ? 2123 PRO A C     1 
ATOM   431  O  O     . PRO A 1 61  ? 31.605 -27.217 -3.712 1.00 58.00 ? 2123 PRO A O     1 
ATOM   432  C  CB    . PRO A 1 61  ? 33.208 -24.497 -3.316 1.00 58.09 ? 2123 PRO A CB    1 
ATOM   433  C  CG    . PRO A 1 61  ? 33.293 -23.028 -3.468 1.00 58.10 ? 2123 PRO A CG    1 
ATOM   434  C  CD    . PRO A 1 61  ? 31.904 -22.507 -3.186 1.00 58.15 ? 2123 PRO A CD    1 
ATOM   435  N  N     . CYS A 1 62  ? 30.601 -26.013 -2.095 1.00 57.98 ? 2124 CYS A N     1 
ATOM   436  C  CA    . CYS A 1 62  ? 30.076 -27.181 -1.390 1.00 58.03 ? 2124 CYS A CA    1 
ATOM   437  C  C     . CYS A 1 62  ? 28.625 -27.474 -1.753 1.00 58.26 ? 2124 CYS A C     1 
ATOM   438  O  O     . CYS A 1 62  ? 28.117 -28.560 -1.468 1.00 58.31 ? 2124 CYS A O     1 
ATOM   439  C  CB    . CYS A 1 62  ? 30.225 -27.017 0.126  1.00 57.94 ? 2124 CYS A CB    1 
ATOM   440  S  SG    . CYS A 1 62  ? 31.939 -27.009 0.698  1.00 57.22 ? 2124 CYS A SG    1 
ATOM   441  N  N     . GLY A 1 63  ? 27.968 -26.500 -2.379 1.00 58.51 ? 2125 GLY A N     1 
ATOM   442  C  CA    . GLY A 1 63  ? 26.570 -26.626 -2.777 1.00 58.78 ? 2125 GLY A CA    1 
ATOM   443  C  C     . GLY A 1 63  ? 25.618 -26.864 -1.617 1.00 58.99 ? 2125 GLY A C     1 
ATOM   444  O  O     . GLY A 1 63  ? 25.279 -25.929 -0.880 1.00 59.13 ? 2125 GLY A O     1 
ATOM   445  N  N     . GLU A 1 64  ? 25.195 -28.120 -1.459 1.00 59.00 ? 2126 GLU A N     1 
ATOM   446  C  CA    . GLU A 1 64  ? 24.188 -28.502 -0.463 1.00 58.99 ? 2126 GLU A CA    1 
ATOM   447  C  C     . GLU A 1 64  ? 24.826 -29.044 0.819  1.00 59.01 ? 2126 GLU A C     1 
ATOM   448  O  O     . GLU A 1 64  ? 24.143 -29.249 1.831  1.00 59.16 ? 2126 GLU A O     1 
ATOM   449  C  CB    . GLU A 1 64  ? 23.221 -29.531 -1.055 1.00 58.95 ? 2126 GLU A CB    1 
ATOM   450  C  CG    . GLU A 1 64  ? 21.820 -29.515 -0.442 1.00 59.11 ? 2126 GLU A CG    1 
ATOM   451  C  CD    . GLU A 1 64  ? 20.906 -28.443 -1.031 1.00 59.09 ? 2126 GLU A CD    1 
ATOM   452  O  OE1   . GLU A 1 64  ? 21.242 -27.857 -2.084 1.00 58.74 ? 2126 GLU A OE1   1 
ATOM   453  O  OE2   . GLU A 1 64  ? 19.835 -28.194 -0.436 1.00 59.00 ? 2126 GLU A OE2   1 
ATOM   454  N  N     . GLN A 1 65  ? 26.138 -29.270 0.762  1.00 58.90 ? 2127 GLN A N     1 
ATOM   455  C  CA    . GLN A 1 65  ? 26.927 -29.718 1.910  1.00 58.74 ? 2127 GLN A CA    1 
ATOM   456  C  C     . GLN A 1 65  ? 27.281 -28.538 2.826  1.00 58.51 ? 2127 GLN A C     1 
ATOM   457  O  O     . GLN A 1 65  ? 27.544 -28.720 4.020  1.00 58.46 ? 2127 GLN A O     1 
ATOM   458  C  CB    . GLN A 1 65  ? 28.209 -30.390 1.418  1.00 58.82 ? 2127 GLN A CB    1 
ATOM   459  C  CG    . GLN A 1 65  ? 28.885 -31.279 2.446  1.00 59.21 ? 2127 GLN A CG    1 
ATOM   460  C  CD    . GLN A 1 65  ? 28.250 -32.647 2.539  1.00 59.38 ? 2127 GLN A CD    1 
ATOM   461  O  OE1   . GLN A 1 65  ? 28.407 -33.480 1.646  1.00 59.34 ? 2127 GLN A OE1   1 
ATOM   462  N  NE2   . GLN A 1 65  ? 27.533 -32.891 3.628  1.00 59.56 ? 2127 GLN A NE2   1 
ATOM   463  N  N     . CYS A 1 66  ? 27.288 -27.339 2.241  1.00 58.13 ? 2128 CYS A N     1 
ATOM   464  C  CA    . CYS A 1 66  ? 27.593 -26.085 2.930  1.00 57.70 ? 2128 CYS A CA    1 
ATOM   465  C  C     . CYS A 1 66  ? 26.656 -25.829 4.110  1.00 57.56 ? 2128 CYS A C     1 
ATOM   466  O  O     . CYS A 1 66  ? 25.432 -25.850 3.960  1.00 57.50 ? 2128 CYS A O     1 
ATOM   467  C  CB    . CYS A 1 66  ? 27.517 -24.929 1.925  1.00 57.77 ? 2128 CYS A CB    1 
ATOM   468  S  SG    . CYS A 1 66  ? 27.730 -23.264 2.588  1.00 56.96 ? 2128 CYS A SG    1 
ATOM   469  N  N     . CYS A 1 67  ? 27.249 -25.608 5.283  1.00 57.36 ? 2129 CYS A N     1 
ATOM   470  C  CA    . CYS A 1 67  ? 26.500 -25.260 6.496  1.00 57.13 ? 2129 CYS A CA    1 
ATOM   471  C  C     . CYS A 1 67  ? 26.745 -23.797 6.889  1.00 56.74 ? 2129 CYS A C     1 
ATOM   472  O  O     . CYS A 1 67  ? 26.773 -23.444 8.071  1.00 56.65 ? 2129 CYS A O     1 
ATOM   473  C  CB    . CYS A 1 67  ? 26.846 -26.217 7.644  1.00 57.11 ? 2129 CYS A CB    1 
ATOM   474  S  SG    . CYS A 1 67  ? 28.587 -26.219 8.143  1.00 57.97 ? 2129 CYS A SG    1 
ATOM   475  N  N     . ASN A 1 68  ? 26.928 -22.959 5.871  1.00 56.37 ? 2130 ASN A N     1 
ATOM   476  C  CA    . ASN A 1 68  ? 27.094 -21.520 6.032  1.00 56.01 ? 2130 ASN A CA    1 
ATOM   477  C  C     . ASN A 1 68  ? 25.938 -20.797 5.334  1.00 55.75 ? 2130 ASN A C     1 
ATOM   478  O  O     . ASN A 1 68  ? 26.137 -19.814 4.611  1.00 55.69 ? 2130 ASN A O     1 
ATOM   479  C  CB    . ASN A 1 68  ? 28.456 -21.075 5.473  1.00 56.04 ? 2130 ASN A CB    1 
ATOM   480  C  CG    . ASN A 1 68  ? 28.792 -19.626 5.806  1.00 56.16 ? 2130 ASN A CG    1 
ATOM   481  O  OD1   . ASN A 1 68  ? 28.543 -19.153 6.915  1.00 56.62 ? 2130 ASN A OD1   1 
ATOM   482  N  ND2   . ASN A 1 68  ? 29.365 -18.917 4.841  1.00 56.15 ? 2130 ASN A ND2   1 
ATOM   483  N  N     . GLN A 1 69  ? 24.728 -21.312 5.546  1.00 55.41 ? 2131 GLN A N     1 
ATOM   484  C  CA    . GLN A 1 69  ? 23.506 -20.748 4.971  1.00 55.11 ? 2131 GLN A CA    1 
ATOM   485  C  C     . GLN A 1 69  ? 22.354 -20.826 5.978  1.00 54.84 ? 2131 GLN A C     1 
ATOM   486  O  O     . GLN A 1 69  ? 21.181 -20.838 5.603  1.00 54.82 ? 2131 GLN A O     1 
ATOM   487  C  CB    . GLN A 1 69  ? 23.147 -21.476 3.668  1.00 55.18 ? 2131 GLN A CB    1 
ATOM   488  C  CG    . GLN A 1 69  ? 24.085 -21.165 2.499  1.00 55.60 ? 2131 GLN A CG    1 
ATOM   489  C  CD    . GLN A 1 69  ? 23.826 -22.003 1.259  1.00 56.28 ? 2131 GLN A CD    1 
ATOM   490  O  OE1   . GLN A 1 69  ? 22.718 -22.493 1.036  1.00 56.66 ? 2131 GLN A OE1   1 
ATOM   491  N  NE2   . GLN A 1 69  ? 24.857 -22.159 0.434  1.00 56.43 ? 2131 GLN A NE2   1 
ATOM   492  N  N     . ARG A 1 70  ? 22.705 -20.854 7.262  1.00 54.55 ? 2132 ARG A N     1 
ATOM   493  C  CA    . ARG A 1 70  ? 21.757 -21.147 8.340  1.00 54.23 ? 2132 ARG A CA    1 
ATOM   494  C  C     . ARG A 1 70  ? 20.573 -20.188 8.437  1.00 53.84 ? 2132 ARG A C     1 
ATOM   495  O  O     . ARG A 1 70  ? 19.440 -20.625 8.647  1.00 53.68 ? 2132 ARG A O     1 
ATOM   496  C  CB    . ARG A 1 70  ? 22.491 -21.241 9.677  1.00 54.28 ? 2132 ARG A CB    1 
ATOM   497  C  CG    . ARG A 1 70  ? 23.343 -22.491 9.813  1.00 54.91 ? 2132 ARG A CG    1 
ATOM   498  C  CD    . ARG A 1 70  ? 24.486 -22.293 10.794 1.00 56.26 ? 2132 ARG A CD    1 
ATOM   499  N  NE    . ARG A 1 70  ? 25.365 -21.200 10.383 1.00 57.17 ? 2132 ARG A NE    1 
ATOM   500  C  CZ    . ARG A 1 70  ? 26.377 -20.728 11.105 1.00 57.80 ? 2132 ARG A CZ    1 
ATOM   501  N  NH1   . ARG A 1 70  ? 26.662 -21.250 12.292 1.00 58.44 ? 2132 ARG A NH1   1 
ATOM   502  N  NH2   . ARG A 1 70  ? 27.108 -19.727 10.634 1.00 58.09 ? 2132 ARG A NH2   1 
ATOM   503  N  N     . ILE A 1 71  ? 20.839 -18.891 8.283  1.00 53.52 ? 2133 ILE A N     1 
ATOM   504  C  CA    . ILE A 1 71  ? 19.783 -17.876 8.267  1.00 53.22 ? 2133 ILE A CA    1 
ATOM   505  C  C     . ILE A 1 71  ? 18.898 -18.065 7.035  1.00 53.14 ? 2133 ILE A C     1 
ATOM   506  O  O     . ILE A 1 71  ? 17.687 -18.249 7.169  1.00 53.14 ? 2133 ILE A O     1 
ATOM   507  C  CB    . ILE A 1 71  ? 20.352 -16.439 8.315  1.00 53.12 ? 2133 ILE A CB    1 
ATOM   508  C  CG1   . ILE A 1 71  ? 21.107 -16.212 9.626  1.00 53.04 ? 2133 ILE A CG1   1 
ATOM   509  C  CG2   . ILE A 1 71  ? 19.238 -15.418 8.176  1.00 53.08 ? 2133 ILE A CG2   1 
ATOM   510  C  CD1   . ILE A 1 71  ? 21.927 -14.937 9.670  1.00 52.74 ? 2133 ILE A CD1   1 
ATOM   511  N  N     . GLN A 1 72  ? 19.520 -18.035 5.853  1.00 53.05 ? 2134 GLN A N     1 
ATOM   512  C  CA    . GLN A 1 72  ? 18.857 -18.299 4.567  1.00 52.93 ? 2134 GLN A CA    1 
ATOM   513  C  C     . GLN A 1 72  ? 17.851 -19.431 4.642  1.00 53.01 ? 2134 GLN A C     1 
ATOM   514  O  O     . GLN A 1 72  ? 16.712 -19.293 4.198  1.00 52.98 ? 2134 GLN A O     1 
ATOM   515  C  CB    . GLN A 1 72  ? 19.894 -18.676 3.509  1.00 52.77 ? 2134 GLN A CB    1 
ATOM   516  C  CG    . GLN A 1 72  ? 20.261 -17.573 2.552  1.00 52.73 ? 2134 GLN A CG    1 
ATOM   517  C  CD    . GLN A 1 72  ? 21.589 -17.824 1.872  1.00 52.41 ? 2134 GLN A CD    1 
ATOM   518  O  OE1   . GLN A 1 72  ? 22.533 -18.309 2.493  1.00 52.02 ? 2134 GLN A OE1   1 
ATOM   519  N  NE2   . GLN A 1 72  ? 21.674 -17.484 0.590  1.00 52.63 ? 2134 GLN A NE2   1 
ATOM   520  N  N     . ARG A 1 73  ? 18.292 -20.548 5.211  1.00 53.12 ? 2135 ARG A N     1 
ATOM   521  C  CA    . ARG A 1 73  ? 17.521 -21.777 5.221  1.00 53.32 ? 2135 ARG A CA    1 
ATOM   522  C  C     . ARG A 1 73  ? 16.758 -21.953 6.527  1.00 53.15 ? 2135 ARG A C     1 
ATOM   523  O  O     . ARG A 1 73  ? 16.223 -23.028 6.797  1.00 53.18 ? 2135 ARG A O     1 
ATOM   524  C  CB    . ARG A 1 73  ? 18.445 -22.971 4.961  1.00 53.57 ? 2135 ARG A CB    1 
ATOM   525  C  CG    . ARG A 1 73  ? 19.160 -22.917 3.617  1.00 54.61 ? 2135 ARG A CG    1 
ATOM   526  C  CD    . ARG A 1 73  ? 20.103 -24.094 3.429  1.00 56.89 ? 2135 ARG A CD    1 
ATOM   527  N  NE    . ARG A 1 73  ? 20.555 -24.187 2.040  1.00 59.09 ? 2135 ARG A NE    1 
ATOM   528  C  CZ    . ARG A 1 73  ? 21.348 -25.143 1.557  1.00 60.28 ? 2135 ARG A CZ    1 
ATOM   529  N  NH1   . ARG A 1 73  ? 21.808 -26.114 2.345  1.00 60.63 ? 2135 ARG A NH1   1 
ATOM   530  N  NH2   . ARG A 1 73  ? 21.690 -25.120 0.275  1.00 60.37 ? 2135 ARG A NH2   1 
ATOM   531  N  N     . HIS A 1 74  ? 16.712 -20.888 7.327  1.00 53.06 ? 2136 HIS A N     1 
ATOM   532  C  CA    . HIS A 1 74  ? 15.978 -20.862 8.600  1.00 52.93 ? 2136 HIS A CA    1 
ATOM   533  C  C     . HIS A 1 74  ? 16.193 -22.138 9.407  1.00 52.71 ? 2136 HIS A C     1 
ATOM   534  O  O     . HIS A 1 74  ? 15.242 -22.750 9.895  1.00 52.52 ? 2136 HIS A O     1 
ATOM   535  C  CB    . HIS A 1 74  ? 14.481 -20.621 8.360  1.00 52.99 ? 2136 HIS A CB    1 
ATOM   536  C  CG    . HIS A 1 74  ? 14.199 -19.550 7.356  1.00 53.17 ? 2136 HIS A CG    1 
ATOM   537  N  ND1   . HIS A 1 74  ? 13.977 -19.822 6.024  1.00 53.74 ? 2136 HIS A ND1   1 
ATOM   538  C  CD2   . HIS A 1 74  ? 14.119 -18.205 7.485  1.00 53.43 ? 2136 HIS A CD2   1 
ATOM   539  C  CE1   . HIS A 1 74  ? 13.764 -18.690 5.376  1.00 53.66 ? 2136 HIS A CE1   1 
ATOM   540  N  NE2   . HIS A 1 74  ? 13.848 -17.694 6.239  1.00 53.48 ? 2136 HIS A NE2   1 
ATOM   541  N  N     . GLU A 1 75  ? 17.455 -22.529 9.539  1.00 52.64 ? 2137 GLU A N     1 
ATOM   542  C  CA    . GLU A 1 75  ? 17.810 -23.781 10.193 1.00 52.69 ? 2137 GLU A CA    1 
ATOM   543  C  C     . GLU A 1 75  ? 17.891 -23.589 11.701 1.00 52.80 ? 2137 GLU A C     1 
ATOM   544  O  O     . GLU A 1 75  ? 18.945 -23.785 12.309 1.00 52.82 ? 2137 GLU A O     1 
ATOM   545  C  CB    . GLU A 1 75  ? 19.125 -24.333 9.624  1.00 52.62 ? 2137 GLU A CB    1 
ATOM   546  C  CG    . GLU A 1 75  ? 19.099 -24.529 8.103  1.00 52.39 ? 2137 GLU A CG    1 
ATOM   547  C  CD    . GLU A 1 75  ? 20.334 -25.225 7.553  1.00 51.70 ? 2137 GLU A CD    1 
ATOM   548  O  OE1   . GLU A 1 75  ? 21.469 -24.797 7.857  1.00 50.77 ? 2137 GLU A OE1   1 
ATOM   549  O  OE2   . GLU A 1 75  ? 20.157 -26.200 6.795  1.00 51.85 ? 2137 GLU A OE2   1 
ATOM   550  N  N     . TRP A 1 76  ? 16.765 -23.206 12.299 1.00 53.01 ? 2138 TRP A N     1 
ATOM   551  C  CA    . TRP A 1 76  ? 16.714 -22.929 13.732 1.00 53.33 ? 2138 TRP A CA    1 
ATOM   552  C  C     . TRP A 1 76  ? 16.689 -24.204 14.558 1.00 53.79 ? 2138 TRP A C     1 
ATOM   553  O  O     . TRP A 1 76  ? 16.602 -25.310 14.028 1.00 53.79 ? 2138 TRP A O     1 
ATOM   554  C  CB    . TRP A 1 76  ? 15.501 -22.066 14.115 1.00 53.13 ? 2138 TRP A CB    1 
ATOM   555  C  CG    . TRP A 1 76  ? 15.279 -20.821 13.303 1.00 52.40 ? 2138 TRP A CG    1 
ATOM   556  C  CD1   . TRP A 1 76  ? 16.211 -20.101 12.610 1.00 51.68 ? 2138 TRP A CD1   1 
ATOM   557  C  CD2   . TRP A 1 76  ? 14.036 -20.134 13.133 1.00 52.05 ? 2138 TRP A CD2   1 
ATOM   558  N  NE1   . TRP A 1 76  ? 15.620 -19.022 12.000 1.00 51.07 ? 2138 TRP A NE1   1 
ATOM   559  C  CE2   . TRP A 1 76  ? 14.286 -19.016 12.306 1.00 51.52 ? 2138 TRP A CE2   1 
ATOM   560  C  CE3   . TRP A 1 76  ? 12.728 -20.362 13.591 1.00 51.85 ? 2138 TRP A CE3   1 
ATOM   561  C  CZ2   . TRP A 1 76  ? 13.277 -18.125 11.929 1.00 51.47 ? 2138 TRP A CZ2   1 
ATOM   562  C  CZ3   . TRP A 1 76  ? 11.728 -19.477 13.216 1.00 51.62 ? 2138 TRP A CZ3   1 
ATOM   563  C  CH2   . TRP A 1 76  ? 12.009 -18.371 12.392 1.00 51.63 ? 2138 TRP A CH2   1 
ATOM   564  N  N     . VAL A 1 77  ? 16.757 -24.020 15.869 1.00 54.42 ? 2139 VAL A N     1 
ATOM   565  C  CA    . VAL A 1 77  ? 16.704 -25.110 16.819 1.00 55.23 ? 2139 VAL A CA    1 
ATOM   566  C  C     . VAL A 1 77  ? 15.266 -25.246 17.317 1.00 55.73 ? 2139 VAL A C     1 
ATOM   567  O  O     . VAL A 1 77  ? 14.559 -24.247 17.474 1.00 55.87 ? 2139 VAL A O     1 
ATOM   568  C  CB    . VAL A 1 77  ? 17.675 -24.846 17.994 1.00 55.26 ? 2139 VAL A CB    1 
ATOM   569  C  CG1   . VAL A 1 77  ? 17.778 -26.063 18.885 1.00 55.66 ? 2139 VAL A CG1   1 
ATOM   570  C  CG2   . VAL A 1 77  ? 19.065 -24.499 17.463 1.00 55.42 ? 2139 VAL A CG2   1 
ATOM   571  N  N     . GLN A 1 78  ? 14.834 -26.482 17.555 1.00 56.34 ? 2140 GLN A N     1 
ATOM   572  C  CA    . GLN A 1 78  ? 13.457 -26.751 17.974 1.00 56.93 ? 2140 GLN A CA    1 
ATOM   573  C  C     . GLN A 1 78  ? 13.272 -26.970 19.487 1.00 57.19 ? 2140 GLN A C     1 
ATOM   574  O  O     . GLN A 1 78  ? 12.198 -27.392 19.927 1.00 57.19 ? 2140 GLN A O     1 
ATOM   575  C  CB    . GLN A 1 78  ? 12.884 -27.932 17.178 1.00 56.92 ? 2140 GLN A CB    1 
ATOM   576  C  CG    . GLN A 1 78  ? 12.135 -27.544 15.900 1.00 57.53 ? 2140 GLN A CG    1 
ATOM   577  C  CD    . GLN A 1 78  ? 13.053 -27.152 14.752 1.00 57.95 ? 2140 GLN A CD    1 
ATOM   578  O  OE1   . GLN A 1 78  ? 13.611 -26.053 14.732 1.00 58.31 ? 2140 GLN A OE1   1 
ATOM   579  N  NE2   . GLN A 1 78  ? 13.197 -28.047 13.777 1.00 57.78 ? 2140 GLN A NE2   1 
ATOM   580  N  N     . CYS A 1 79  ? 14.304 -26.673 20.276 1.00 57.51 ? 2141 CYS A N     1 
ATOM   581  C  CA    . CYS A 1 79  ? 14.242 -26.865 21.730 1.00 58.02 ? 2141 CYS A CA    1 
ATOM   582  C  C     . CYS A 1 79  ? 13.406 -25.793 22.417 1.00 58.07 ? 2141 CYS A C     1 
ATOM   583  O  O     . CYS A 1 79  ? 12.630 -26.084 23.325 1.00 58.19 ? 2141 CYS A O     1 
ATOM   584  C  CB    . CYS A 1 79  ? 15.638 -26.833 22.354 1.00 58.02 ? 2141 CYS A CB    1 
ATOM   585  S  SG    . CYS A 1 79  ? 16.935 -27.631 21.420 1.00 59.24 ? 2141 CYS A SG    1 
ATOM   586  N  N     . LEU A 1 80  ? 13.580 -24.557 21.966 1.00 58.21 ? 2142 LEU A N     1 
ATOM   587  C  CA    . LEU A 1 80  ? 13.135 -23.366 22.685 1.00 58.29 ? 2142 LEU A CA    1 
ATOM   588  C  C     . LEU A 1 80  ? 11.739 -23.461 23.288 1.00 58.47 ? 2142 LEU A C     1 
ATOM   589  O  O     . LEU A 1 80  ? 10.782 -23.862 22.622 1.00 58.50 ? 2142 LEU A O     1 
ATOM   590  C  CB    . LEU A 1 80  ? 13.262 -22.130 21.789 1.00 58.26 ? 2142 LEU A CB    1 
ATOM   591  C  CG    . LEU A 1 80  ? 14.574 -22.031 21.000 1.00 58.02 ? 2142 LEU A CG    1 
ATOM   592  C  CD1   . LEU A 1 80  ? 14.556 -20.843 20.060 1.00 57.73 ? 2142 LEU A CD1   1 
ATOM   593  C  CD2   . LEU A 1 80  ? 15.786 -21.977 21.927 1.00 57.63 ? 2142 LEU A CD2   1 
ATOM   594  N  N     . GLU A 1 81  ? 11.652 -23.089 24.561 1.00 58.66 ? 2143 GLU A N     1 
ATOM   595  C  CA    . GLU A 1 81  ? 10.429 -23.167 25.338 1.00 58.97 ? 2143 GLU A CA    1 
ATOM   596  C  C     . GLU A 1 81  ? 10.271 -21.886 26.143 1.00 59.07 ? 2143 GLU A C     1 
ATOM   597  O  O     . GLU A 1 81  ? 11.192 -21.478 26.847 1.00 59.13 ? 2143 GLU A O     1 
ATOM   598  C  CB    . GLU A 1 81  ? 10.498 -24.376 26.272 1.00 59.12 ? 2143 GLU A CB    1 
ATOM   599  C  CG    . GLU A 1 81  ? 9.333  -24.524 27.251 1.00 59.67 ? 2143 GLU A CG    1 
ATOM   600  C  CD    . GLU A 1 81  ? 9.497  -25.725 28.171 1.00 60.48 ? 2143 GLU A CD    1 
ATOM   601  O  OE1   . GLU A 1 81  ? 10.630 -25.976 28.640 1.00 60.59 ? 2143 GLU A OE1   1 
ATOM   602  O  OE2   . GLU A 1 81  ? 8.492  -26.423 28.426 1.00 61.12 ? 2143 GLU A OE2   1 
ATOM   603  N  N     . ARG A 1 82  ? 9.105  -21.254 26.029 1.00 59.27 ? 2144 ARG A N     1 
ATOM   604  C  CA    . ARG A 1 82  ? 8.792  -20.052 26.796 1.00 59.43 ? 2144 ARG A CA    1 
ATOM   605  C  C     . ARG A 1 82  ? 8.396  -20.455 28.213 1.00 59.65 ? 2144 ARG A C     1 
ATOM   606  O  O     . ARG A 1 82  ? 7.616  -21.388 28.395 1.00 59.67 ? 2144 ARG A O     1 
ATOM   607  C  CB    . ARG A 1 82  ? 7.660  -19.277 26.119 1.00 59.35 ? 2144 ARG A CB    1 
ATOM   608  C  CG    . ARG A 1 82  ? 7.564  -17.808 26.524 1.00 59.24 ? 2144 ARG A CG    1 
ATOM   609  C  CD    . ARG A 1 82  ? 6.250  -17.177 26.069 1.00 58.95 ? 2144 ARG A CD    1 
ATOM   610  N  NE    . ARG A 1 82  ? 6.089  -17.190 24.613 1.00 58.55 ? 2144 ARG A NE    1 
ATOM   611  C  CZ    . ARG A 1 82  ? 4.973  -16.847 23.974 1.00 58.09 ? 2144 ARG A CZ    1 
ATOM   612  N  NH1   . ARG A 1 82  ? 3.903  -16.453 24.652 1.00 57.94 ? 2144 ARG A NH1   1 
ATOM   613  N  NH2   . ARG A 1 82  ? 4.925  -16.893 22.651 1.00 58.06 ? 2144 ARG A NH2   1 
ATOM   614  N  N     . PHE A 1 83  ? 8.930  -19.757 29.212 1.00 60.07 ? 2145 PHE A N     1 
ATOM   615  C  CA    . PHE A 1 83  ? 8.686  -20.124 30.614 1.00 60.59 ? 2145 PHE A CA    1 
ATOM   616  C  C     . PHE A 1 83  ? 8.633  -18.942 31.586 1.00 61.05 ? 2145 PHE A C     1 
ATOM   617  O  O     . PHE A 1 83  ? 9.144  -17.858 31.296 1.00 61.06 ? 2145 PHE A O     1 
ATOM   618  C  CB    . PHE A 1 83  ? 9.729  -21.149 31.091 1.00 60.43 ? 2145 PHE A CB    1 
ATOM   619  C  CG    . PHE A 1 83  ? 11.091 -20.558 31.357 1.00 60.09 ? 2145 PHE A CG    1 
ATOM   620  C  CD1   . PHE A 1 83  ? 11.441 -20.132 32.637 1.00 59.88 ? 2145 PHE A CD1   1 
ATOM   621  C  CD2   . PHE A 1 83  ? 12.022 -20.431 30.332 1.00 59.36 ? 2145 PHE A CD2   1 
ATOM   622  C  CE1   . PHE A 1 83  ? 12.693 -19.585 32.889 1.00 59.75 ? 2145 PHE A CE1   1 
ATOM   623  C  CE2   . PHE A 1 83  ? 13.275 -19.890 30.575 1.00 59.31 ? 2145 PHE A CE2   1 
ATOM   624  C  CZ    . PHE A 1 83  ? 13.613 -19.465 31.854 1.00 59.66 ? 2145 PHE A CZ    1 
ATOM   625  N  N     . ARG A 1 84  ? 8.026  -19.181 32.748 1.00 61.66 ? 2146 ARG A N     1 
ATOM   626  C  CA    . ARG A 1 84  ? 7.908  -18.185 33.816 1.00 62.29 ? 2146 ARG A CA    1 
ATOM   627  C  C     . ARG A 1 84  ? 9.276  -17.928 34.456 1.00 62.54 ? 2146 ARG A C     1 
ATOM   628  O  O     . ARG A 1 84  ? 9.720  -18.689 35.321 1.00 62.59 ? 2146 ARG A O     1 
ATOM   629  C  CB    . ARG A 1 84  ? 6.905  -18.654 34.886 1.00 62.40 ? 2146 ARG A CB    1 
ATOM   630  C  CG    . ARG A 1 84  ? 5.737  -19.494 34.358 1.00 62.93 ? 2146 ARG A CG    1 
ATOM   631  C  CD    . ARG A 1 84  ? 5.134  -20.400 35.439 1.00 63.39 ? 2146 ARG A CD    1 
ATOM   632  N  NE    . ARG A 1 84  ? 4.103  -21.288 34.892 1.00 63.92 ? 2146 ARG A NE    1 
ATOM   633  C  CZ    . ARG A 1 84  ? 2.805  -20.992 34.810 1.00 63.84 ? 2146 ARG A CZ    1 
ATOM   634  N  NH1   . ARG A 1 84  ? 2.349  -19.822 35.245 1.00 63.96 ? 2146 ARG A NH1   1 
ATOM   635  N  NH2   . ARG A 1 84  ? 1.957  -21.870 34.291 1.00 63.44 ? 2146 ARG A NH2   1 
ATOM   636  N  N     . ALA A 1 85  ? 9.941  -16.859 34.019 1.00 62.93 ? 2147 ALA A N     1 
ATOM   637  C  CA    . ALA A 1 85  ? 11.264 -16.500 34.534 1.00 63.29 ? 2147 ALA A CA    1 
ATOM   638  C  C     . ALA A 1 85  ? 11.169 -15.745 35.856 1.00 63.61 ? 2147 ALA A C     1 
ATOM   639  O  O     . ALA A 1 85  ? 10.274 -14.916 36.049 1.00 63.68 ? 2147 ALA A O     1 
ATOM   640  C  CB    . ALA A 1 85  ? 12.031 -15.685 33.511 1.00 63.30 ? 2147 ALA A CB    1 
ATOM   641  N  N     . GLU A 1 86  ? 12.105 -16.038 36.757 1.00 63.95 ? 2148 GLU A N     1 
ATOM   642  C  CA    . GLU A 1 86  ? 12.110 -15.471 38.110 1.00 64.15 ? 2148 GLU A CA    1 
ATOM   643  C  C     . GLU A 1 86  ? 12.499 -13.988 38.131 1.00 64.02 ? 2148 GLU A C     1 
ATOM   644  O  O     . GLU A 1 86  ? 13.649 -13.630 37.849 1.00 64.02 ? 2148 GLU A O     1 
ATOM   645  C  CB    . GLU A 1 86  ? 12.996 -16.312 39.051 1.00 64.32 ? 2148 GLU A CB    1 
ATOM   646  C  CG    . GLU A 1 86  ? 14.331 -16.806 38.447 1.00 65.19 ? 2148 GLU A CG    1 
ATOM   647  C  CD    . GLU A 1 86  ? 15.542 -15.968 38.870 1.00 66.32 ? 2148 GLU A CD    1 
ATOM   648  O  OE1   . GLU A 1 86  ? 16.285 -15.490 37.980 1.00 66.48 ? 2148 GLU A OE1   1 
ATOM   649  O  OE2   . GLU A 1 86  ? 15.754 -15.792 40.092 1.00 66.55 ? 2148 GLU A OE2   1 
ATOM   650  N  N     . GLU A 1 87  ? 11.517 -13.138 38.447 1.00 63.80 ? 2149 GLU A N     1 
ATOM   651  C  CA    . GLU A 1 87  ? 11.678 -11.671 38.517 1.00 63.51 ? 2149 GLU A CA    1 
ATOM   652  C  C     . GLU A 1 87  ? 11.784 -10.978 37.154 1.00 63.13 ? 2149 GLU A C     1 
ATOM   653  O  O     . GLU A 1 87  ? 11.607 -9.764  37.062 1.00 63.10 ? 2149 GLU A O     1 
ATOM   654  C  CB    . GLU A 1 87  ? 12.878 -11.271 39.392 1.00 63.63 ? 2149 GLU A CB    1 
ATOM   655  C  CG    . GLU A 1 87  ? 12.695 -11.468 40.892 1.00 64.15 ? 2149 GLU A CG    1 
ATOM   656  C  CD    . GLU A 1 87  ? 13.930 -11.054 41.691 1.00 65.06 ? 2149 GLU A CD    1 
ATOM   657  O  OE1   . GLU A 1 87  ? 15.050 -11.504 41.352 1.00 65.06 ? 2149 GLU A OE1   1 
ATOM   658  O  OE2   . GLU A 1 87  ? 13.779 -10.281 42.662 1.00 65.28 ? 2149 GLU A OE2   1 
ATOM   659  N  N     . LYS A 1 88  ? 12.071 -11.745 36.105 1.00 62.79 ? 2150 LYS A N     1 
ATOM   660  C  CA    . LYS A 1 88  ? 12.287 -11.181 34.768 1.00 62.38 ? 2150 LYS A CA    1 
ATOM   661  C  C     . LYS A 1 88  ? 11.063 -11.271 33.849 1.00 62.16 ? 2150 LYS A C     1 
ATOM   662  O  O     . LYS A 1 88  ? 11.086 -10.752 32.734 1.00 62.25 ? 2150 LYS A O     1 
ATOM   663  C  CB    . LYS A 1 88  ? 13.512 -11.820 34.102 1.00 62.27 ? 2150 LYS A CB    1 
ATOM   664  C  CG    . LYS A 1 88  ? 14.833 -11.513 34.810 1.00 61.86 ? 2150 LYS A CG    1 
ATOM   665  C  CD    . LYS A 1 88  ? 16.016 -12.224 34.166 1.00 60.77 ? 2150 LYS A CD    1 
ATOM   666  C  CE    . LYS A 1 88  ? 15.948 -13.727 34.379 1.00 60.32 ? 2150 LYS A CE    1 
ATOM   667  N  NZ    . LYS A 1 88  ? 17.099 -14.423 33.761 1.00 60.02 ? 2150 LYS A NZ    1 
ATOM   668  N  N     . GLY A 1 89  ? 10.005 -11.927 34.320 1.00 61.90 ? 2151 GLY A N     1 
ATOM   669  C  CA    . GLY A 1 89  ? 8.773  -12.074 33.545 1.00 61.69 ? 2151 GLY A CA    1 
ATOM   670  C  C     . GLY A 1 89  ? 8.670  -13.421 32.853 1.00 61.51 ? 2151 GLY A C     1 
ATOM   671  O  O     . GLY A 1 89  ? 8.475  -14.449 33.508 1.00 61.57 ? 2151 GLY A O     1 
ATOM   672  N  N     . TRP A 1 90  ? 8.792  -13.409 31.527 1.00 61.22 ? 2152 TRP A N     1 
ATOM   673  C  CA    . TRP A 1 90  ? 8.786  -14.631 30.727 1.00 61.01 ? 2152 TRP A CA    1 
ATOM   674  C  C     . TRP A 1 90  ? 10.076 -14.750 29.923 1.00 60.54 ? 2152 TRP A C     1 
ATOM   675  O  O     . TRP A 1 90  ? 10.457 -13.823 29.211 1.00 60.61 ? 2152 TRP A O     1 
ATOM   676  C  CB    . TRP A 1 90  ? 7.579  -14.660 29.787 1.00 61.28 ? 2152 TRP A CB    1 
ATOM   677  C  CG    . TRP A 1 90  ? 6.241  -14.700 30.489 1.00 62.12 ? 2152 TRP A CG    1 
ATOM   678  C  CD1   . TRP A 1 90  ? 5.486  -13.628 30.881 1.00 62.60 ? 2152 TRP A CD1   1 
ATOM   679  C  CD2   . TRP A 1 90  ? 5.499  -15.870 30.863 1.00 62.54 ? 2152 TRP A CD2   1 
ATOM   680  N  NE1   . TRP A 1 90  ? 4.325  -14.059 31.479 1.00 63.02 ? 2152 TRP A NE1   1 
ATOM   681  C  CE2   . TRP A 1 90  ? 4.306  -15.429 31.481 1.00 62.87 ? 2152 TRP A CE2   1 
ATOM   682  C  CE3   . TRP A 1 90  ? 5.725  -17.246 30.735 1.00 62.79 ? 2152 TRP A CE3   1 
ATOM   683  C  CZ2   . TRP A 1 90  ? 3.345  -16.316 31.974 1.00 63.00 ? 2152 TRP A CZ2   1 
ATOM   684  C  CZ3   . TRP A 1 90  ? 4.768  -18.128 31.225 1.00 63.18 ? 2152 TRP A CZ3   1 
ATOM   685  C  CH2   . TRP A 1 90  ? 3.594  -17.658 31.838 1.00 63.16 ? 2152 TRP A CH2   1 
ATOM   686  N  N     . GLY A 1 91  ? 10.744 -15.892 30.043 1.00 60.05 ? 2153 GLY A N     1 
ATOM   687  C  CA    . GLY A 1 91  ? 12.016 -16.118 29.357 1.00 59.41 ? 2153 GLY A CA    1 
ATOM   688  C  C     . GLY A 1 91  ? 12.018 -17.352 28.477 1.00 59.00 ? 2153 GLY A C     1 
ATOM   689  O  O     . GLY A 1 91  ? 10.990 -18.016 28.322 1.00 59.00 ? 2153 GLY A O     1 
ATOM   690  N  N     . ILE A 1 92  ? 13.178 -17.663 27.904 1.00 58.51 ? 2154 ILE A N     1 
ATOM   691  C  CA    . ILE A 1 92  ? 13.313 -18.815 27.014 1.00 58.09 ? 2154 ILE A CA    1 
ATOM   692  C  C     . ILE A 1 92  ? 14.528 -19.687 27.333 1.00 57.93 ? 2154 ILE A C     1 
ATOM   693  O  O     . ILE A 1 92  ? 15.637 -19.186 27.540 1.00 57.90 ? 2154 ILE A O     1 
ATOM   694  C  CB    . ILE A 1 92  ? 13.288 -18.389 25.527 1.00 58.11 ? 2154 ILE A CB    1 
ATOM   695  C  CG1   . ILE A 1 92  ? 11.832 -18.208 25.090 1.00 58.26 ? 2154 ILE A CG1   1 
ATOM   696  C  CG2   . ILE A 1 92  ? 14.006 -19.414 24.632 1.00 57.69 ? 2154 ILE A CG2   1 
ATOM   697  C  CD1   . ILE A 1 92  ? 11.655 -17.592 23.745 1.00 58.73 ? 2154 ILE A CD1   1 
ATOM   698  N  N     . ARG A 1 93  ? 14.292 -20.996 27.377 1.00 57.67 ? 2155 ARG A N     1 
ATOM   699  C  CA    . ARG A 1 93  ? 15.338 -21.978 27.643 1.00 57.44 ? 2155 ARG A CA    1 
ATOM   700  C  C     . ARG A 1 93  ? 15.419 -23.015 26.522 1.00 57.34 ? 2155 ARG A C     1 
ATOM   701  O  O     . ARG A 1 93  ? 14.609 -22.999 25.596 1.00 57.32 ? 2155 ARG A O     1 
ATOM   702  C  CB    . ARG A 1 93  ? 15.095 -22.660 28.996 1.00 57.36 ? 2155 ARG A CB    1 
ATOM   703  C  CG    . ARG A 1 93  ? 13.809 -23.480 29.086 1.00 56.97 ? 2155 ARG A CG    1 
ATOM   704  C  CD    . ARG A 1 93  ? 13.440 -23.744 30.537 1.00 56.44 ? 2155 ARG A CD    1 
ATOM   705  N  NE    . ARG A 1 93  ? 12.179 -24.467 30.665 1.00 55.77 ? 2155 ARG A NE    1 
ATOM   706  C  CZ    . ARG A 1 93  ? 11.408 -24.455 31.748 1.00 55.57 ? 2155 ARG A CZ    1 
ATOM   707  N  NH1   . ARG A 1 93  ? 11.751 -23.744 32.816 1.00 55.26 ? 2155 ARG A NH1   1 
ATOM   708  N  NH2   . ARG A 1 93  ? 10.280 -25.151 31.759 1.00 55.62 ? 2155 ARG A NH2   1 
ATOM   709  N  N     . THR A 1 94  ? 16.404 -23.906 26.607 1.00 57.20 ? 2156 THR A N     1 
ATOM   710  C  CA    . THR A 1 94  ? 16.490 -25.038 25.690 1.00 57.17 ? 2156 THR A CA    1 
ATOM   711  C  C     . THR A 1 94  ? 16.209 -26.351 26.400 1.00 57.07 ? 2156 THR A C     1 
ATOM   712  O  O     . THR A 1 94  ? 16.741 -26.611 27.480 1.00 57.07 ? 2156 THR A O     1 
ATOM   713  C  CB    . THR A 1 94  ? 17.862 -25.139 25.023 1.00 57.13 ? 2156 THR A CB    1 
ATOM   714  O  OG1   . THR A 1 94  ? 18.877 -25.224 26.031 1.00 57.42 ? 2156 THR A OG1   1 
ATOM   715  C  CG2   . THR A 1 94  ? 18.111 -23.929 24.146 1.00 57.43 ? 2156 THR A CG2   1 
ATOM   716  N  N     . LYS A 1 95  ? 15.367 -27.171 25.778 1.00 57.06 ? 2157 LYS A N     1 
ATOM   717  C  CA    . LYS A 1 95  ? 15.076 -28.517 26.260 1.00 57.01 ? 2157 LYS A CA    1 
ATOM   718  C  C     . LYS A 1 95  ? 16.243 -29.464 25.978 1.00 56.86 ? 2157 LYS A C     1 
ATOM   719  O  O     . LYS A 1 95  ? 16.344 -30.522 26.596 1.00 56.93 ? 2157 LYS A O     1 
ATOM   720  C  CB    . LYS A 1 95  ? 13.801 -29.051 25.603 1.00 57.09 ? 2157 LYS A CB    1 
ATOM   721  C  CG    . LYS A 1 95  ? 12.544 -28.285 25.969 1.00 57.48 ? 2157 LYS A CG    1 
ATOM   722  C  CD    . LYS A 1 95  ? 11.403 -28.602 25.017 1.00 58.27 ? 2157 LYS A CD    1 
ATOM   723  C  CE    . LYS A 1 95  ? 10.112 -27.950 25.491 1.00 59.17 ? 2157 LYS A CE    1 
ATOM   724  N  NZ    . LYS A 1 95  ? 9.065  -27.914 24.434 1.00 59.87 ? 2157 LYS A NZ    1 
ATOM   725  N  N     . GLU A 1 96  ? 17.115 -29.073 25.046 1.00 56.61 ? 2158 GLU A N     1 
ATOM   726  C  CA    . GLU A 1 96  ? 18.268 -29.880 24.639 1.00 56.35 ? 2158 GLU A CA    1 
ATOM   727  C  C     . GLU A 1 96  ? 19.586 -29.131 24.863 1.00 56.11 ? 2158 GLU A C     1 
ATOM   728  O  O     . GLU A 1 96  ? 19.620 -27.902 24.759 1.00 56.20 ? 2158 GLU A O     1 
ATOM   729  C  CB    . GLU A 1 96  ? 18.174 -30.241 23.157 1.00 56.37 ? 2158 GLU A CB    1 
ATOM   730  C  CG    . GLU A 1 96  ? 16.906 -30.959 22.714 1.00 56.57 ? 2158 GLU A CG    1 
ATOM   731  C  CD    . GLU A 1 96  ? 16.850 -31.148 21.199 1.00 56.54 ? 2158 GLU A CD    1 
ATOM   732  O  OE1   . GLU A 1 96  ? 15.750 -31.005 20.620 1.00 56.29 ? 2158 GLU A OE1   1 
ATOM   733  O  OE2   . GLU A 1 96  ? 17.909 -31.428 20.588 1.00 56.12 ? 2158 GLU A OE2   1 
ATOM   734  N  N     . PRO A 1 97  ? 20.679 -29.869 25.160 1.00 55.75 ? 2159 PRO A N     1 
ATOM   735  C  CA    . PRO A 1 97  ? 22.012 -29.267 25.262 1.00 55.28 ? 2159 PRO A CA    1 
ATOM   736  C  C     . PRO A 1 97  ? 22.463 -28.583 23.976 1.00 54.84 ? 2159 PRO A C     1 
ATOM   737  O  O     . PRO A 1 97  ? 22.140 -29.043 22.877 1.00 54.81 ? 2159 PRO A O     1 
ATOM   738  C  CB    . PRO A 1 97  ? 22.927 -30.462 25.562 1.00 55.23 ? 2159 PRO A CB    1 
ATOM   739  C  CG    . PRO A 1 97  ? 22.113 -31.673 25.270 1.00 55.57 ? 2159 PRO A CG    1 
ATOM   740  C  CD    . PRO A 1 97  ? 20.703 -31.286 25.559 1.00 55.74 ? 2159 PRO A CD    1 
ATOM   741  N  N     . LEU A 1 98  ? 23.204 -27.488 24.130 1.00 54.27 ? 2160 LEU A N     1 
ATOM   742  C  CA    . LEU A 1 98  ? 23.716 -26.718 23.001 1.00 53.71 ? 2160 LEU A CA    1 
ATOM   743  C  C     . LEU A 1 98  ? 25.222 -26.535 23.117 1.00 53.27 ? 2160 LEU A C     1 
ATOM   744  O  O     . LEU A 1 98  ? 25.751 -26.363 24.217 1.00 53.23 ? 2160 LEU A O     1 
ATOM   745  C  CB    . LEU A 1 98  ? 23.042 -25.343 22.931 1.00 53.83 ? 2160 LEU A CB    1 
ATOM   746  C  CG    . LEU A 1 98  ? 21.516 -25.198 22.970 1.00 53.68 ? 2160 LEU A CG    1 
ATOM   747  C  CD1   . LEU A 1 98  ? 21.163 -23.736 23.131 1.00 53.88 ? 2160 LEU A CD1   1 
ATOM   748  C  CD2   . LEU A 1 98  ? 20.854 -25.765 21.729 1.00 53.69 ? 2160 LEU A CD2   1 
ATOM   749  N  N     . LYS A 1 99  ? 25.905 -26.570 21.977 1.00 52.66 ? 2161 LYS A N     1 
ATOM   750  C  CA    . LYS A 1 99  ? 27.356 -26.410 21.944 1.00 52.07 ? 2161 LYS A CA    1 
ATOM   751  C  C     . LYS A 1 99  ? 27.709 -24.973 21.569 1.00 51.45 ? 2161 LYS A C     1 
ATOM   752  O  O     . LYS A 1 99  ? 26.897 -24.269 20.972 1.00 51.45 ? 2161 LYS A O     1 
ATOM   753  C  CB    . LYS A 1 99  ? 27.998 -27.394 20.954 1.00 52.20 ? 2161 LYS A CB    1 
ATOM   754  C  CG    . LYS A 1 99  ? 27.329 -28.768 20.855 1.00 52.62 ? 2161 LYS A CG    1 
ATOM   755  C  CD    . LYS A 1 99  ? 27.439 -29.571 22.146 1.00 53.55 ? 2161 LYS A CD    1 
ATOM   756  C  CE    . LYS A 1 99  ? 26.453 -30.737 22.146 1.00 54.02 ? 2161 LYS A CE    1 
ATOM   757  N  NZ    . LYS A 1 99  ? 26.407 -31.443 23.460 1.00 54.22 ? 2161 LYS A NZ    1 
ATOM   758  N  N     . ALA A 1 100 ? 28.915 -24.542 21.926 1.00 50.61 ? 2162 ALA A N     1 
ATOM   759  C  CA    . ALA A 1 100 ? 29.390 -23.203 21.592 1.00 49.75 ? 2162 ALA A CA    1 
ATOM   760  C  C     . ALA A 1 100 ? 29.390 -22.983 20.083 1.00 49.20 ? 2162 ALA A C     1 
ATOM   761  O  O     . ALA A 1 100 ? 29.549 -23.931 19.309 1.00 49.23 ? 2162 ALA A O     1 
ATOM   762  C  CB    . ALA A 1 100 ? 30.776 -22.982 22.156 1.00 49.79 ? 2162 ALA A CB    1 
ATOM   763  N  N     . GLY A 1 101 ? 29.188 -21.730 19.677 1.00 48.46 ? 2163 GLY A N     1 
ATOM   764  C  CA    . GLY A 1 101 ? 29.211 -21.336 18.265 1.00 47.30 ? 2163 GLY A CA    1 
ATOM   765  C  C     . GLY A 1 101 ? 27.995 -21.753 17.456 1.00 46.42 ? 2163 GLY A C     1 
ATOM   766  O  O     . GLY A 1 101 ? 27.863 -21.376 16.291 1.00 46.48 ? 2163 GLY A O     1 
ATOM   767  N  N     . GLN A 1 102 ? 27.109 -22.525 18.075 1.00 45.52 ? 2164 GLN A N     1 
ATOM   768  C  CA    . GLN A 1 102 ? 25.920 -23.046 17.414 1.00 44.82 ? 2164 GLN A CA    1 
ATOM   769  C  C     . GLN A 1 102 ? 24.900 -21.950 17.123 1.00 44.23 ? 2164 GLN A C     1 
ATOM   770  O  O     . GLN A 1 102 ? 24.527 -21.181 18.015 1.00 44.05 ? 2164 GLN A O     1 
ATOM   771  C  CB    . GLN A 1 102 ? 25.287 -24.132 18.283 1.00 44.91 ? 2164 GLN A CB    1 
ATOM   772  C  CG    . GLN A 1 102 ? 24.047 -24.799 17.712 1.00 45.13 ? 2164 GLN A CG    1 
ATOM   773  C  CD    . GLN A 1 102 ? 23.443 -25.811 18.674 1.00 45.99 ? 2164 GLN A CD    1 
ATOM   774  O  OE1   . GLN A 1 102 ? 24.127 -26.335 19.561 1.00 46.60 ? 2164 GLN A OE1   1 
ATOM   775  N  NE2   . GLN A 1 102 ? 22.155 -26.091 18.504 1.00 45.85 ? 2164 GLN A NE2   1 
ATOM   776  N  N     . PHE A 1 103 ? 24.468 -21.886 15.862 1.00 43.39 ? 2165 PHE A N     1 
ATOM   777  C  CA    . PHE A 1 103 ? 23.353 -21.039 15.457 1.00 42.51 ? 2165 PHE A CA    1 
ATOM   778  C  C     . PHE A 1 103 ? 22.078 -21.537 16.122 1.00 42.02 ? 2165 PHE A C     1 
ATOM   779  O  O     . PHE A 1 103 ? 21.767 -22.732 16.080 1.00 42.01 ? 2165 PHE A O     1 
ATOM   780  C  CB    . PHE A 1 103 ? 23.201 -21.034 13.932 1.00 42.55 ? 2165 PHE A CB    1 
ATOM   781  C  CG    . PHE A 1 103 ? 21.932 -20.382 13.441 1.00 42.39 ? 2165 PHE A CG    1 
ATOM   782  C  CD1   . PHE A 1 103 ? 21.801 -18.995 13.431 1.00 42.60 ? 2165 PHE A CD1   1 
ATOM   783  C  CD2   . PHE A 1 103 ? 20.872 -21.157 12.980 1.00 42.24 ? 2165 PHE A CD2   1 
ATOM   784  C  CE1   . PHE A 1 103 ? 20.631 -18.387 12.977 1.00 42.65 ? 2165 PHE A CE1   1 
ATOM   785  C  CE2   . PHE A 1 103 ? 19.695 -20.560 12.523 1.00 42.46 ? 2165 PHE A CE2   1 
ATOM   786  C  CZ    . PHE A 1 103 ? 19.576 -19.171 12.520 1.00 42.62 ? 2165 PHE A CZ    1 
ATOM   787  N  N     . ILE A 1 104 ? 21.347 -20.610 16.728 1.00 41.27 ? 2166 ILE A N     1 
ATOM   788  C  CA    . ILE A 1 104 ? 20.175 -20.942 17.523 1.00 40.69 ? 2166 ILE A CA    1 
ATOM   789  C  C     . ILE A 1 104 ? 18.883 -20.520 16.819 1.00 40.48 ? 2166 ILE A C     1 
ATOM   790  O  O     . ILE A 1 104 ? 17.996 -21.343 16.576 1.00 40.32 ? 2166 ILE A O     1 
ATOM   791  C  CB    . ILE A 1 104 ? 20.274 -20.304 18.945 1.00 40.71 ? 2166 ILE A CB    1 
ATOM   792  C  CG1   . ILE A 1 104 ? 21.489 -20.877 19.690 1.00 40.62 ? 2166 ILE A CG1   1 
ATOM   793  C  CG2   . ILE A 1 104 ? 18.978 -20.510 19.739 1.00 40.35 ? 2166 ILE A CG2   1 
ATOM   794  C  CD1   . ILE A 1 104 ? 21.857 -20.171 20.974 1.00 39.94 ? 2166 ILE A CD1   1 
ATOM   795  N  N     . ILE A 1 105 ? 18.801 -19.236 16.482 1.00 40.19 ? 2167 ILE A N     1 
ATOM   796  C  CA    . ILE A 1 105 ? 17.571 -18.624 15.999 1.00 39.88 ? 2167 ILE A CA    1 
ATOM   797  C  C     . ILE A 1 105 ? 17.901 -17.271 15.382 1.00 39.80 ? 2167 ILE A C     1 
ATOM   798  O  O     . ILE A 1 105 ? 18.821 -16.588 15.833 1.00 39.99 ? 2167 ILE A O     1 
ATOM   799  C  CB    . ILE A 1 105 ? 16.541 -18.466 17.160 1.00 39.82 ? 2167 ILE A CB    1 
ATOM   800  C  CG1   . ILE A 1 105 ? 15.190 -17.945 16.647 1.00 39.67 ? 2167 ILE A CG1   1 
ATOM   801  C  CG2   . ILE A 1 105 ? 17.113 -17.609 18.294 1.00 39.54 ? 2167 ILE A CG2   1 
ATOM   802  C  CD1   . ILE A 1 105 ? 14.042 -18.086 17.635 1.00 38.41 ? 2167 ILE A CD1   1 
ATOM   803  N  N     . GLU A 1 106 ? 17.172 -16.899 14.336 1.00 39.60 ? 2168 GLU A N     1 
ATOM   804  C  CA    . GLU A 1 106 ? 17.283 -15.559 13.778 1.00 39.51 ? 2168 GLU A CA    1 
ATOM   805  C  C     . GLU A 1 106 ? 16.422 -14.613 14.618 1.00 39.56 ? 2168 GLU A C     1 
ATOM   806  O  O     . GLU A 1 106 ? 15.356 -15.004 15.093 1.00 39.54 ? 2168 GLU A O     1 
ATOM   807  C  CB    . GLU A 1 106 ? 16.838 -15.545 12.315 1.00 39.27 ? 2168 GLU A CB    1 
ATOM   808  C  CG    . GLU A 1 106 ? 17.080 -14.224 11.607 1.00 39.25 ? 2168 GLU A CG    1 
ATOM   809  C  CD    . GLU A 1 106 ? 16.585 -14.191 10.166 1.00 39.52 ? 2168 GLU A CD    1 
ATOM   810  O  OE1   . GLU A 1 106 ? 16.161 -15.240 9.625  1.00 39.59 ? 2168 GLU A OE1   1 
ATOM   811  O  OE2   . GLU A 1 106 ? 16.620 -13.094 9.573  1.00 38.60 ? 2168 GLU A OE2   1 
ATOM   812  N  N     . TYR A 1 107 ? 16.894 -13.386 14.821 1.00 39.50 ? 2169 TYR A N     1 
ATOM   813  C  CA    . TYR A 1 107 ? 16.081 -12.363 15.467 1.00 39.52 ? 2169 TYR A CA    1 
ATOM   814  C  C     . TYR A 1 107 ? 15.196 -11.681 14.432 1.00 39.76 ? 2169 TYR A C     1 
ATOM   815  O  O     . TYR A 1 107 ? 15.687 -10.993 13.528 1.00 39.76 ? 2169 TYR A O     1 
ATOM   816  C  CB    . TYR A 1 107 ? 16.947 -11.334 16.188 1.00 39.45 ? 2169 TYR A CB    1 
ATOM   817  C  CG    . TYR A 1 107 ? 16.166 -10.391 17.080 1.00 39.15 ? 2169 TYR A CG    1 
ATOM   818  C  CD1   . TYR A 1 107 ? 15.826 -10.756 18.382 1.00 39.06 ? 2169 TYR A CD1   1 
ATOM   819  C  CD2   . TYR A 1 107 ? 15.776 -9.134  16.628 1.00 38.99 ? 2169 TYR A CD2   1 
ATOM   820  C  CE1   . TYR A 1 107 ? 15.118 -9.899  19.210 1.00 39.07 ? 2169 TYR A CE1   1 
ATOM   821  C  CE2   . TYR A 1 107 ? 15.063 -8.267  17.448 1.00 39.21 ? 2169 TYR A CE2   1 
ATOM   822  C  CZ    . TYR A 1 107 ? 14.739 -8.655  18.739 1.00 39.56 ? 2169 TYR A CZ    1 
ATOM   823  O  OH    . TYR A 1 107 ? 14.034 -7.799  19.562 1.00 40.31 ? 2169 TYR A OH    1 
ATOM   824  N  N     . LEU A 1 108 ? 13.887 -11.879 14.573 1.00 40.04 ? 2170 LEU A N     1 
ATOM   825  C  CA    . LEU A 1 108 ? 12.917 -11.369 13.607 1.00 40.13 ? 2170 LEU A CA    1 
ATOM   826  C  C     . LEU A 1 108 ? 12.081 -10.214 14.152 1.00 40.24 ? 2170 LEU A C     1 
ATOM   827  O  O     . LEU A 1 108 ? 11.890 -10.081 15.364 1.00 40.04 ? 2170 LEU A O     1 
ATOM   828  C  CB    . LEU A 1 108 ? 12.012 -12.497 13.100 1.00 39.96 ? 2170 LEU A CB    1 
ATOM   829  C  CG    . LEU A 1 108 ? 12.685 -13.653 12.350 1.00 40.17 ? 2170 LEU A CG    1 
ATOM   830  C  CD1   . LEU A 1 108 ? 11.683 -14.765 12.094 1.00 40.39 ? 2170 LEU A CD1   1 
ATOM   831  C  CD2   . LEU A 1 108 ? 13.333 -13.211 11.040 1.00 39.89 ? 2170 LEU A CD2   1 
ATOM   832  N  N     . GLY A 1 109 ? 11.596 -9.386  13.233 1.00 40.48 ? 2171 GLY A N     1 
ATOM   833  C  CA    . GLY A 1 109 ? 10.740 -8.258  13.560 1.00 40.92 ? 2171 GLY A CA    1 
ATOM   834  C  C     . GLY A 1 109 ? 10.551 -7.323  12.379 1.00 41.35 ? 2171 GLY A C     1 
ATOM   835  O  O     . GLY A 1 109 ? 10.803 -7.692  11.227 1.00 41.30 ? 2171 GLY A O     1 
ATOM   836  N  N     . GLU A 1 110 ? 10.099 -6.107  12.672 1.00 41.72 ? 2172 GLU A N     1 
ATOM   837  C  CA    . GLU A 1 110 ? 9.936  -5.080  11.657 1.00 42.29 ? 2172 GLU A CA    1 
ATOM   838  C  C     . GLU A 1 110 ? 11.239 -4.309  11.492 1.00 42.69 ? 2172 GLU A C     1 
ATOM   839  O  O     . GLU A 1 110 ? 11.792 -3.786  12.465 1.00 43.00 ? 2172 GLU A O     1 
ATOM   840  C  CB    . GLU A 1 110 ? 8.797  -4.127  12.027 1.00 42.21 ? 2172 GLU A CB    1 
ATOM   841  C  CG    . GLU A 1 110 ? 7.458  -4.814  12.272 1.00 42.50 ? 2172 GLU A CG    1 
ATOM   842  C  CD    . GLU A 1 110 ? 6.317  -3.831  12.439 1.00 42.46 ? 2172 GLU A CD    1 
ATOM   843  O  OE1   . GLU A 1 110 ? 5.826  -3.678  13.577 1.00 42.43 ? 2172 GLU A OE1   1 
ATOM   844  O  OE2   . GLU A 1 110 ? 5.916  -3.206  11.433 1.00 42.51 ? 2172 GLU A OE2   1 
ATOM   845  N  N     . VAL A 1 111 ? 11.743 -4.253  10.266 1.00 43.00 ? 2173 VAL A N     1 
ATOM   846  C  CA    . VAL A 1 111 ? 12.919 -3.442  9.987  1.00 43.48 ? 2173 VAL A CA    1 
ATOM   847  C  C     . VAL A 1 111 ? 12.457 -2.011  9.716  1.00 44.06 ? 2173 VAL A C     1 
ATOM   848  O  O     . VAL A 1 111 ? 11.783 -1.736  8.716  1.00 44.22 ? 2173 VAL A O     1 
ATOM   849  C  CB    . VAL A 1 111 ? 13.756 -3.998  8.819  1.00 43.27 ? 2173 VAL A CB    1 
ATOM   850  C  CG1   . VAL A 1 111 ? 15.085 -3.289  8.748  1.00 42.93 ? 2173 VAL A CG1   1 
ATOM   851  C  CG2   . VAL A 1 111 ? 13.983 -5.480  8.998  1.00 43.21 ? 2173 VAL A CG2   1 
ATOM   852  N  N     . VAL A 1 112 ? 12.805 -1.114  10.633 1.00 44.56 ? 2174 VAL A N     1 
ATOM   853  C  CA    . VAL A 1 112 ? 12.355 0.272   10.589 1.00 45.12 ? 2174 VAL A CA    1 
ATOM   854  C  C     . VAL A 1 112 ? 13.523 1.239   10.751 1.00 45.61 ? 2174 VAL A C     1 
ATOM   855  O  O     . VAL A 1 112 ? 14.518 0.917   11.403 1.00 45.73 ? 2174 VAL A O     1 
ATOM   856  C  CB    . VAL A 1 112 ? 11.293 0.563   11.686 1.00 45.13 ? 2174 VAL A CB    1 
ATOM   857  C  CG1   . VAL A 1 112 ? 9.962  -0.066  11.330 1.00 44.76 ? 2174 VAL A CG1   1 
ATOM   858  C  CG2   . VAL A 1 112 ? 11.764 0.085   13.063 1.00 45.24 ? 2174 VAL A CG2   1 
ATOM   859  N  N     . SER A 1 113 ? 13.396 2.422   10.154 1.00 46.25 ? 2175 SER A N     1 
ATOM   860  C  CA    . SER A 1 113 ? 14.399 3.473   10.288 1.00 46.85 ? 2175 SER A CA    1 
ATOM   861  C  C     . SER A 1 113 ? 14.353 4.066   11.690 1.00 47.40 ? 2175 SER A C     1 
ATOM   862  O  O     . SER A 1 113 ? 13.376 3.872   12.417 1.00 47.41 ? 2175 SER A O     1 
ATOM   863  C  CB    . SER A 1 113 ? 14.170 4.569   9.247  1.00 46.82 ? 2175 SER A CB    1 
ATOM   864  O  OG    . SER A 1 113 ? 12.900 5.176   9.410  1.00 46.81 ? 2175 SER A OG    1 
ATOM   865  N  N     . GLU A 1 114 ? 15.415 4.783   12.058 1.00 48.25 ? 2176 GLU A N     1 
ATOM   866  C  CA    . GLU A 1 114 ? 15.528 5.425   13.371 1.00 49.05 ? 2176 GLU A CA    1 
ATOM   867  C  C     . GLU A 1 114 ? 14.368 6.359   13.659 1.00 49.36 ? 2176 GLU A C     1 
ATOM   868  O  O     . GLU A 1 114 ? 13.797 6.321   14.748 1.00 49.23 ? 2176 GLU A O     1 
ATOM   869  C  CB    . GLU A 1 114 ? 16.839 6.202   13.490 1.00 49.11 ? 2176 GLU A CB    1 
ATOM   870  C  CG    . GLU A 1 114 ? 17.932 5.471   14.239 1.00 49.97 ? 2176 GLU A CG    1 
ATOM   871  C  CD    . GLU A 1 114 ? 19.029 6.404   14.725 1.00 51.23 ? 2176 GLU A CD    1 
ATOM   872  O  OE1   . GLU A 1 114 ? 19.167 7.516   14.162 1.00 51.43 ? 2176 GLU A OE1   1 
ATOM   873  O  OE2   . GLU A 1 114 ? 19.755 6.022   15.674 1.00 51.52 ? 2176 GLU A OE2   1 
ATOM   874  N  N     . GLN A 1 115 ? 14.032 7.197   12.679 1.00 49.95 ? 2177 GLN A N     1 
ATOM   875  C  CA    . GLN A 1 115 ? 12.906 8.114   12.809 1.00 50.64 ? 2177 GLN A CA    1 
ATOM   876  C  C     . GLN A 1 115 ? 11.566 7.393   12.882 1.00 50.92 ? 2177 GLN A C     1 
ATOM   877  O  O     . GLN A 1 115 ? 10.679 7.819   13.622 1.00 51.03 ? 2177 GLN A O     1 
ATOM   878  C  CB    . GLN A 1 115 ? 12.895 9.171   11.697 1.00 50.83 ? 2177 GLN A CB    1 
ATOM   879  C  CG    . GLN A 1 115 ? 13.468 10.531  12.120 1.00 51.21 ? 2177 GLN A CG    1 
ATOM   880  C  CD    . GLN A 1 115 ? 12.867 11.058  13.423 1.00 51.97 ? 2177 GLN A CD    1 
ATOM   881  O  OE1   . GLN A 1 115 ? 11.643 11.095  13.597 1.00 51.99 ? 2177 GLN A OE1   1 
ATOM   882  N  NE2   . GLN A 1 115 ? 13.733 11.471  14.345 1.00 52.12 ? 2177 GLN A NE2   1 
ATOM   883  N  N     . GLU A 1 116 ? 11.423 6.301   12.133 1.00 51.20 ? 2178 GLU A N     1 
ATOM   884  C  CA    . GLU A 1 116 ? 10.205 5.501   12.213 1.00 51.59 ? 2178 GLU A CA    1 
ATOM   885  C  C     . GLU A 1 116 ? 10.050 4.847   13.581 1.00 51.87 ? 2178 GLU A C     1 
ATOM   886  O  O     . GLU A 1 116 ? 8.942  4.780   14.110 1.00 51.90 ? 2178 GLU A O     1 
ATOM   887  C  CB    . GLU A 1 116 ? 10.132 4.460   11.091 1.00 51.56 ? 2178 GLU A CB    1 
ATOM   888  C  CG    . GLU A 1 116 ? 8.785  3.719   10.986 1.00 51.73 ? 2178 GLU A CG    1 
ATOM   889  C  CD    . GLU A 1 116 ? 7.560  4.621   11.172 1.00 51.98 ? 2178 GLU A CD    1 
ATOM   890  O  OE1   . GLU A 1 116 ? 7.441  5.653   10.472 1.00 52.00 ? 2178 GLU A OE1   1 
ATOM   891  O  OE2   . GLU A 1 116 ? 6.709  4.285   12.023 1.00 52.04 ? 2178 GLU A OE2   1 
ATOM   892  N  N     . PHE A 1 117 ? 11.159 4.384   14.152 1.00 52.40 ? 2179 PHE A N     1 
ATOM   893  C  CA    . PHE A 1 117 ? 11.141 3.778   15.482 1.00 52.92 ? 2179 PHE A CA    1 
ATOM   894  C  C     . PHE A 1 117 ? 10.898 4.814   16.574 1.00 53.45 ? 2179 PHE A C     1 
ATOM   895  O  O     . PHE A 1 117 ? 10.076 4.593   17.467 1.00 53.46 ? 2179 PHE A O     1 
ATOM   896  C  CB    . PHE A 1 117 ? 12.430 3.001   15.760 1.00 52.81 ? 2179 PHE A CB    1 
ATOM   897  C  CG    . PHE A 1 117 ? 12.395 2.225   17.039 1.00 52.74 ? 2179 PHE A CG    1 
ATOM   898  C  CD1   . PHE A 1 117 ? 11.734 1.002   17.108 1.00 53.00 ? 2179 PHE A CD1   1 
ATOM   899  C  CD2   . PHE A 1 117 ? 13.006 2.721   18.184 1.00 52.88 ? 2179 PHE A CD2   1 
ATOM   900  C  CE1   . PHE A 1 117 ? 11.687 0.281   18.299 1.00 52.79 ? 2179 PHE A CE1   1 
ATOM   901  C  CE2   . PHE A 1 117 ? 12.966 2.007   19.383 1.00 52.64 ? 2179 PHE A CE2   1 
ATOM   902  C  CZ    . PHE A 1 117 ? 12.304 0.789   19.438 1.00 52.63 ? 2179 PHE A CZ    1 
ATOM   903  N  N     . ARG A 1 118 ? 11.615 5.938   16.492 1.00 54.14 ? 2180 ARG A N     1 
ATOM   904  C  CA    . ARG A 1 118 ? 11.419 7.075   17.397 1.00 54.78 ? 2180 ARG A CA    1 
ATOM   905  C  C     . ARG A 1 118 ? 9.966  7.544   17.381 1.00 55.15 ? 2180 ARG A C     1 
ATOM   906  O  O     . ARG A 1 118 ? 9.399  7.843   18.431 1.00 55.28 ? 2180 ARG A O     1 
ATOM   907  C  CB    . ARG A 1 118 ? 12.360 8.231   17.039 1.00 54.90 ? 2180 ARG A CB    1 
ATOM   908  C  CG    . ARG A 1 118 ? 13.757 8.107   17.634 1.00 55.65 ? 2180 ARG A CG    1 
ATOM   909  C  CD    . ARG A 1 118 ? 14.680 9.242   17.193 1.00 56.82 ? 2180 ARG A CD    1 
ATOM   910  N  NE    . ARG A 1 118 ? 15.778 9.432   18.146 1.00 58.49 ? 2180 ARG A NE    1 
ATOM   911  C  CZ    . ARG A 1 118 ? 17.007 8.925   18.023 1.00 58.89 ? 2180 ARG A CZ    1 
ATOM   912  N  NH1   . ARG A 1 118 ? 17.341 8.185   16.970 1.00 59.24 ? 2180 ARG A NH1   1 
ATOM   913  N  NH2   . ARG A 1 118 ? 17.913 9.167   18.962 1.00 58.94 ? 2180 ARG A NH2   1 
ATOM   914  N  N     . ASN A 1 119 ? 9.371  7.600   16.189 1.00 55.60 ? 2181 ASN A N     1 
ATOM   915  C  CA    . ASN A 1 119 ? 7.934  7.824   16.043 1.00 56.03 ? 2181 ASN A CA    1 
ATOM   916  C  C     . ASN A 1 119 ? 7.103  6.788   16.806 1.00 56.28 ? 2181 ASN A C     1 
ATOM   917  O  O     . ASN A 1 119 ? 6.232  7.150   17.590 1.00 56.42 ? 2181 ASN A O     1 
ATOM   918  C  CB    . ASN A 1 119 ? 7.525  7.834   14.566 1.00 56.06 ? 2181 ASN A CB    1 
ATOM   919  C  CG    . ASN A 1 119 ? 7.830  9.155   13.875 1.00 56.28 ? 2181 ASN A CG    1 
ATOM   920  O  OD1   . ASN A 1 119 ? 8.563  9.997   14.398 1.00 56.63 ? 2181 ASN A OD1   1 
ATOM   921  N  ND2   . ASN A 1 119 ? 7.268  9.336   12.681 1.00 56.06 ? 2181 ASN A ND2   1 
ATOM   922  N  N     . ARG A 1 120 ? 7.387  5.507   16.587 1.00 56.59 ? 2182 ARG A N     1 
ATOM   923  C  CA    . ARG A 1 120 ? 6.643  4.428   17.237 1.00 56.98 ? 2182 ARG A CA    1 
ATOM   924  C  C     . ARG A 1 120 ? 6.796  4.458   18.762 1.00 57.60 ? 2182 ARG A C     1 
ATOM   925  O  O     . ARG A 1 120 ? 5.846  4.176   19.494 1.00 57.53 ? 2182 ARG A O     1 
ATOM   926  C  CB    . ARG A 1 120 ? 7.070  3.069   16.678 1.00 56.73 ? 2182 ARG A CB    1 
ATOM   927  C  CG    . ARG A 1 120 ? 6.543  2.749   15.278 1.00 55.77 ? 2182 ARG A CG    1 
ATOM   928  C  CD    . ARG A 1 120 ? 7.504  1.816   14.548 1.00 53.96 ? 2182 ARG A CD    1 
ATOM   929  N  NE    . ARG A 1 120 ? 6.962  1.287   13.299 1.00 52.21 ? 2182 ARG A NE    1 
ATOM   930  C  CZ    . ARG A 1 120 ? 6.657  0.007   13.090 1.00 51.31 ? 2182 ARG A CZ    1 
ATOM   931  N  NH1   . ARG A 1 120 ? 6.839  -0.898  14.043 1.00 50.37 ? 2182 ARG A NH1   1 
ATOM   932  N  NH2   . ARG A 1 120 ? 6.171  -0.371  11.917 1.00 50.84 ? 2182 ARG A NH2   1 
ATOM   933  N  N     . MET A 1 121 ? 7.990  4.818   19.227 1.00 58.43 ? 2183 MET A N     1 
ATOM   934  C  CA    . MET A 1 121 ? 8.284  4.922   20.658 1.00 59.25 ? 2183 MET A CA    1 
ATOM   935  C  C     . MET A 1 121 ? 7.419  5.981   21.351 1.00 59.70 ? 2183 MET A C     1 
ATOM   936  O  O     . MET A 1 121 ? 6.873  5.735   22.431 1.00 59.85 ? 2183 MET A O     1 
ATOM   937  C  CB    . MET A 1 121 ? 9.773  5.225   20.873 1.00 59.25 ? 2183 MET A CB    1 
ATOM   938  C  CG    . MET A 1 121 ? 10.269 4.989   22.292 1.00 59.72 ? 2183 MET A CG    1 
ATOM   939  S  SD    . MET A 1 121 ? 10.327 3.240   22.733 1.00 60.79 ? 2183 MET A SD    1 
ATOM   940  C  CE    . MET A 1 121 ? 10.630 3.349   24.496 1.00 61.17 ? 2183 MET A CE    1 
ATOM   941  N  N     . ILE A 1 122 ? 7.298  7.148   20.721 1.00 60.24 ? 2184 ILE A N     1 
ATOM   942  C  CA    . ILE A 1 122 ? 6.506  8.254   21.257 1.00 60.75 ? 2184 ILE A CA    1 
ATOM   943  C  C     . ILE A 1 122 ? 5.023  8.039   20.973 1.00 61.06 ? 2184 ILE A C     1 
ATOM   944  O  O     . ILE A 1 122 ? 4.182  8.200   21.855 1.00 61.22 ? 2184 ILE A O     1 
ATOM   945  C  CB    . ILE A 1 122 ? 6.956  9.625   20.672 1.00 60.79 ? 2184 ILE A CB    1 
ATOM   946  C  CG1   . ILE A 1 122 ? 8.458  9.849   20.898 1.00 60.80 ? 2184 ILE A CG1   1 
ATOM   947  C  CG2   . ILE A 1 122 ? 6.134  10.774  21.276 1.00 60.81 ? 2184 ILE A CG2   1 
ATOM   948  C  CD1   . ILE A 1 122 ? 9.083  10.908  19.994 1.00 60.67 ? 2184 ILE A CD1   1 
ATOM   949  N  N     . GLU A 1 123 ? 4.717  7.660   19.740 1.00 61.49 ? 2185 GLU A N     1 
ATOM   950  C  CA    . GLU A 1 123 ? 3.343  7.560   19.269 1.00 62.14 ? 2185 GLU A CA    1 
ATOM   951  C  C     . GLU A 1 123 ? 2.569  6.363   19.835 1.00 62.51 ? 2185 GLU A C     1 
ATOM   952  O  O     . GLU A 1 123 ? 1.341  6.416   19.947 1.00 62.53 ? 2185 GLU A O     1 
ATOM   953  C  CB    . GLU A 1 123 ? 3.343  7.506   17.740 1.00 62.09 ? 2185 GLU A CB    1 
ATOM   954  C  CG    . GLU A 1 123 ? 2.123  8.098   17.075 1.00 62.42 ? 2185 GLU A CG    1 
ATOM   955  C  CD    . GLU A 1 123 ? 2.455  8.702   15.726 1.00 62.82 ? 2185 GLU A CD    1 
ATOM   956  O  OE1   . GLU A 1 123 ? 2.051  8.123   14.693 1.00 63.10 ? 2185 GLU A OE1   1 
ATOM   957  O  OE2   . GLU A 1 123 ? 3.134  9.751   15.701 1.00 62.74 ? 2185 GLU A OE2   1 
ATOM   958  N  N     . GLN A 1 124 ? 3.280  5.293   20.191 1.00 63.05 ? 2186 GLN A N     1 
ATOM   959  C  CA    . GLN A 1 124 ? 2.630  4.008   20.480 1.00 63.50 ? 2186 GLN A CA    1 
ATOM   960  C  C     . GLN A 1 124 ? 3.177  3.228   21.688 1.00 63.85 ? 2186 GLN A C     1 
ATOM   961  O  O     . GLN A 1 124 ? 2.419  2.510   22.346 1.00 64.01 ? 2186 GLN A O     1 
ATOM   962  C  CB    . GLN A 1 124 ? 2.637  3.126   19.221 1.00 63.43 ? 2186 GLN A CB    1 
ATOM   963  C  CG    . GLN A 1 124 ? 1.727  3.639   18.096 1.00 63.58 ? 2186 GLN A CG    1 
ATOM   964  C  CD    . GLN A 1 124 ? 2.277  3.375   16.701 1.00 63.84 ? 2186 GLN A CD    1 
ATOM   965  O  OE1   . GLN A 1 124 ? 2.508  2.231   16.315 1.00 64.11 ? 2186 GLN A OE1   1 
ATOM   966  N  NE2   . GLN A 1 124 ? 2.475  4.441   15.933 1.00 63.93 ? 2186 GLN A NE2   1 
ATOM   967  N  N     . TYR A 1 125 ? 4.470  3.365   21.984 1.00 64.23 ? 2187 TYR A N     1 
ATOM   968  C  CA    . TYR A 1 125 ? 5.101  2.558   23.044 1.00 64.58 ? 2187 TYR A CA    1 
ATOM   969  C  C     . TYR A 1 125 ? 5.325  3.294   24.372 1.00 65.05 ? 2187 TYR A C     1 
ATOM   970  O  O     . TYR A 1 125 ? 6.274  3.012   25.105 1.00 65.16 ? 2187 TYR A O     1 
ATOM   971  C  CB    . TYR A 1 125 ? 6.410  1.925   22.553 1.00 64.51 ? 2187 TYR A CB    1 
ATOM   972  C  CG    . TYR A 1 125 ? 6.302  1.158   21.251 1.00 63.98 ? 2187 TYR A CG    1 
ATOM   973  C  CD1   . TYR A 1 125 ? 5.226  0.306   21.000 1.00 63.53 ? 2187 TYR A CD1   1 
ATOM   974  C  CD2   . TYR A 1 125 ? 7.291  1.270   20.278 1.00 63.56 ? 2187 TYR A CD2   1 
ATOM   975  C  CE1   . TYR A 1 125 ? 5.131  -0.394  19.804 1.00 63.24 ? 2187 TYR A CE1   1 
ATOM   976  C  CE2   . TYR A 1 125 ? 7.209  0.568   19.084 1.00 63.13 ? 2187 TYR A CE2   1 
ATOM   977  C  CZ    . TYR A 1 125 ? 6.127  -0.258  18.852 1.00 62.93 ? 2187 TYR A CZ    1 
ATOM   978  O  OH    . TYR A 1 125 ? 6.046  -0.953  17.670 1.00 62.37 ? 2187 TYR A OH    1 
ATOM   979  N  N     . HIS A 1 126 ? 4.436  4.239   24.661 1.00 65.60 ? 2188 HIS A N     1 
ATOM   980  C  CA    . HIS A 1 126 ? 4.384  4.953   25.936 1.00 66.07 ? 2188 HIS A CA    1 
ATOM   981  C  C     . HIS A 1 126 ? 3.815  4.032   27.015 1.00 66.21 ? 2188 HIS A C     1 
ATOM   982  O  O     . HIS A 1 126 ? 2.970  3.177   26.728 1.00 66.15 ? 2188 HIS A O     1 
ATOM   983  C  CB    . HIS A 1 126 ? 3.474  6.167   25.785 1.00 66.28 ? 2188 HIS A CB    1 
ATOM   984  C  CG    . HIS A 1 126 ? 2.215  5.864   25.034 1.00 66.91 ? 2188 HIS A CG    1 
ATOM   985  N  ND1   . HIS A 1 126 ? 2.160  5.847   23.655 1.00 67.10 ? 2188 HIS A ND1   1 
ATOM   986  C  CD2   . HIS A 1 126 ? 0.978  5.521   25.465 1.00 67.16 ? 2188 HIS A CD2   1 
ATOM   987  C  CE1   . HIS A 1 126 ? 0.939  5.524   23.271 1.00 67.33 ? 2188 HIS A CE1   1 
ATOM   988  N  NE2   . HIS A 1 126 ? 0.201  5.324   24.349 1.00 67.44 ? 2188 HIS A NE2   1 
ATOM   989  N  N     . ASN A 1 127 ? 4.266  4.243   28.254 1.00 66.48 ? 2189 ASN A N     1 
ATOM   990  C  CA    . ASN A 1 127 ? 3.934  3.392   29.417 1.00 66.64 ? 2189 ASN A CA    1 
ATOM   991  C  C     . ASN A 1 127 ? 4.100  1.888   29.162 1.00 66.60 ? 2189 ASN A C     1 
ATOM   992  O  O     . ASN A 1 127 ? 3.292  1.065   29.610 1.00 66.62 ? 2189 ASN A O     1 
ATOM   993  C  CB    . ASN A 1 127 ? 2.546  3.723   29.993 1.00 66.75 ? 2189 ASN A CB    1 
ATOM   994  C  CG    . ASN A 1 127 ? 2.466  3.490   31.503 1.00 67.27 ? 2189 ASN A CG    1 
ATOM   995  O  OD1   . ASN A 1 127 ? 3.431  3.724   32.237 1.00 67.65 ? 2189 ASN A OD1   1 
ATOM   996  N  ND2   . ASN A 1 127 ? 1.308  3.032   31.970 1.00 67.55 ? 2189 ASN A ND2   1 
ATOM   997  N  N     . HIS A 1 128 ? 5.163  1.552   28.434 1.00 66.47 ? 2190 HIS A N     1 
ATOM   998  C  CA    . HIS A 1 128 ? 5.536  0.175   28.135 1.00 66.23 ? 2190 HIS A CA    1 
ATOM   999  C  C     . HIS A 1 128 ? 6.705  -0.248  29.020 1.00 65.78 ? 2190 HIS A C     1 
ATOM   1000 O  O     . HIS A 1 128 ? 7.712  0.464   29.115 1.00 65.81 ? 2190 HIS A O     1 
ATOM   1001 C  CB    . HIS A 1 128 ? 5.905  0.044   26.653 1.00 66.48 ? 2190 HIS A CB    1 
ATOM   1002 C  CG    . HIS A 1 128 ? 4.830  -0.574  25.810 1.00 67.11 ? 2190 HIS A CG    1 
ATOM   1003 N  ND1   . HIS A 1 128 ? 5.106  -1.454  24.785 1.00 67.43 ? 2190 HIS A ND1   1 
ATOM   1004 C  CD2   . HIS A 1 128 ? 3.481  -0.456  25.853 1.00 67.63 ? 2190 HIS A CD2   1 
ATOM   1005 C  CE1   . HIS A 1 128 ? 3.975  -1.843  24.226 1.00 67.67 ? 2190 HIS A CE1   1 
ATOM   1006 N  NE2   . HIS A 1 128 ? 2.974  -1.254  24.856 1.00 67.94 ? 2190 HIS A NE2   1 
ATOM   1007 N  N     . SER A 1 129 ? 6.566  -1.408  29.662 1.00 65.10 ? 2191 SER A N     1 
ATOM   1008 C  CA    . SER A 1 129 ? 7.554  -1.887  30.637 1.00 64.33 ? 2191 SER A CA    1 
ATOM   1009 C  C     . SER A 1 129 ? 8.697  -2.723  30.040 1.00 63.66 ? 2191 SER A C     1 
ATOM   1010 O  O     . SER A 1 129 ? 9.726  -2.923  30.694 1.00 63.69 ? 2191 SER A O     1 
ATOM   1011 C  CB    . SER A 1 129 ? 6.860  -2.652  31.774 1.00 64.40 ? 2191 SER A CB    1 
ATOM   1012 O  OG    . SER A 1 129 ? 5.992  -3.652  31.267 1.00 64.53 ? 2191 SER A OG    1 
ATOM   1013 N  N     . ASP A 1 130 ? 8.518  -3.202  28.809 1.00 62.74 ? 2192 ASP A N     1 
ATOM   1014 C  CA    . ASP A 1 130 ? 9.536  -4.014  28.133 1.00 61.79 ? 2192 ASP A CA    1 
ATOM   1015 C  C     . ASP A 1 130 ? 10.035 -3.364  26.836 1.00 61.08 ? 2192 ASP A C     1 
ATOM   1016 O  O     . ASP A 1 130 ? 9.386  -2.464  26.297 1.00 61.03 ? 2192 ASP A O     1 
ATOM   1017 C  CB    . ASP A 1 130 ? 9.010  -5.429  27.864 1.00 61.84 ? 2192 ASP A CB    1 
ATOM   1018 C  CG    . ASP A 1 130 ? 8.697  -6.200  29.141 1.00 61.91 ? 2192 ASP A CG    1 
ATOM   1019 O  OD1   . ASP A 1 130 ? 9.390  -6.004  30.164 1.00 61.84 ? 2192 ASP A OD1   1 
ATOM   1020 O  OD2   . ASP A 1 130 ? 7.752  -7.017  29.116 1.00 62.08 ? 2192 ASP A OD2   1 
ATOM   1021 N  N     . HIS A 1 131 ? 11.191 -3.816  26.348 1.00 60.10 ? 2193 HIS A N     1 
ATOM   1022 C  CA    . HIS A 1 131 ? 11.815 -3.216  25.164 1.00 59.27 ? 2193 HIS A CA    1 
ATOM   1023 C  C     . HIS A 1 131 ? 12.262 -4.257  24.125 1.00 58.23 ? 2193 HIS A C     1 
ATOM   1024 O  O     . HIS A 1 131 ? 13.222 -4.992  24.338 1.00 58.06 ? 2193 HIS A O     1 
ATOM   1025 C  CB    . HIS A 1 131 ? 12.965 -2.289  25.579 1.00 59.58 ? 2193 HIS A CB    1 
ATOM   1026 C  CG    . HIS A 1 131 ? 12.546 -1.190  26.514 1.00 60.96 ? 2193 HIS A CG    1 
ATOM   1027 N  ND1   . HIS A 1 131 ? 12.210 0.075   26.078 1.00 62.16 ? 2193 HIS A ND1   1 
ATOM   1028 C  CD2   . HIS A 1 131 ? 12.393 -1.174  27.862 1.00 62.05 ? 2193 HIS A CD2   1 
ATOM   1029 C  CE1   . HIS A 1 131 ? 11.878 0.825   27.116 1.00 62.27 ? 2193 HIS A CE1   1 
ATOM   1030 N  NE2   . HIS A 1 131 ? 11.978 0.090   28.210 1.00 62.28 ? 2193 HIS A NE2   1 
ATOM   1031 N  N     . TYR A 1 132 ? 11.550 -4.294  22.998 1.00 56.99 ? 2194 TYR A N     1 
ATOM   1032 C  CA    . TYR A 1 132 ? 11.715 -5.334  21.982 1.00 55.76 ? 2194 TYR A CA    1 
ATOM   1033 C  C     . TYR A 1 132 ? 12.303 -4.789  20.683 1.00 55.08 ? 2194 TYR A C     1 
ATOM   1034 O  O     . TYR A 1 132 ? 11.556 -4.452  19.759 1.00 55.02 ? 2194 TYR A O     1 
ATOM   1035 C  CB    . TYR A 1 132 ? 10.363 -5.987  21.665 1.00 55.64 ? 2194 TYR A CB    1 
ATOM   1036 C  CG    . TYR A 1 132 ? 9.575  -6.464  22.863 1.00 55.27 ? 2194 TYR A CG    1 
ATOM   1037 C  CD1   . TYR A 1 132 ? 8.674  -5.621  23.508 1.00 55.12 ? 2194 TYR A CD1   1 
ATOM   1038 C  CD2   . TYR A 1 132 ? 9.718  -7.763  23.341 1.00 55.13 ? 2194 TYR A CD2   1 
ATOM   1039 C  CE1   . TYR A 1 132 ? 7.945  -6.058  24.606 1.00 54.69 ? 2194 TYR A CE1   1 
ATOM   1040 C  CE2   . TYR A 1 132 ? 8.995  -8.208  24.439 1.00 54.69 ? 2194 TYR A CE2   1 
ATOM   1041 C  CZ    . TYR A 1 132 ? 8.111  -7.352  25.064 1.00 54.54 ? 2194 TYR A CZ    1 
ATOM   1042 O  OH    . TYR A 1 132 ? 7.395  -7.791  26.150 1.00 54.62 ? 2194 TYR A OH    1 
ATOM   1043 N  N     . CYS A 1 133 ? 13.633 -4.715  20.603 1.00 54.17 ? 2195 CYS A N     1 
ATOM   1044 C  CA    . CYS A 1 133 ? 14.314 -4.230  19.393 1.00 53.35 ? 2195 CYS A CA    1 
ATOM   1045 C  C     . CYS A 1 133 ? 15.837 -4.277  19.463 1.00 52.59 ? 2195 CYS A C     1 
ATOM   1046 O  O     . CYS A 1 133 ? 16.422 -4.110  20.530 1.00 52.49 ? 2195 CYS A O     1 
ATOM   1047 C  CB    . CYS A 1 133 ? 13.886 -2.798  19.073 1.00 53.45 ? 2195 CYS A CB    1 
ATOM   1048 S  SG    . CYS A 1 133 ? 14.154 -1.679  20.432 1.00 54.03 ? 2195 CYS A SG    1 
ATOM   1049 N  N     . LEU A 1 134 ? 16.467 -4.481  18.310 1.00 51.64 ? 2196 LEU A N     1 
ATOM   1050 C  CA    . LEU A 1 134 ? 17.920 -4.423  18.199 1.00 50.75 ? 2196 LEU A CA    1 
ATOM   1051 C  C     . LEU A 1 134 ? 18.350 -3.422  17.140 1.00 50.27 ? 2196 LEU A C     1 
ATOM   1052 O  O     . LEU A 1 134 ? 17.642 -3.214  16.153 1.00 50.18 ? 2196 LEU A O     1 
ATOM   1053 C  CB    . LEU A 1 134 ? 18.496 -5.792  17.837 1.00 50.71 ? 2196 LEU A CB    1 
ATOM   1054 C  CG    . LEU A 1 134 ? 18.260 -7.024  18.710 1.00 50.43 ? 2196 LEU A CG    1 
ATOM   1055 C  CD1   . LEU A 1 134 ? 19.047 -8.181  18.132 1.00 50.56 ? 2196 LEU A CD1   1 
ATOM   1056 C  CD2   . LEU A 1 134 ? 18.662 -6.788  20.146 1.00 50.40 ? 2196 LEU A CD2   1 
ATOM   1057 N  N     . ASN A 1 135 ? 19.508 -2.801  17.355 1.00 49.72 ? 2197 ASN A N     1 
ATOM   1058 C  CA    . ASN A 1 135 ? 20.176 -2.040  16.308 1.00 49.30 ? 2197 ASN A CA    1 
ATOM   1059 C  C     . ASN A 1 135 ? 20.566 -2.992  15.201 1.00 48.94 ? 2197 ASN A C     1 
ATOM   1060 O  O     . ASN A 1 135 ? 21.098 -4.070  15.470 1.00 49.10 ? 2197 ASN A O     1 
ATOM   1061 C  CB    . ASN A 1 135 ? 21.432 -1.357  16.842 1.00 49.27 ? 2197 ASN A CB    1 
ATOM   1062 C  CG    . ASN A 1 135 ? 21.123 -0.156  17.708 1.00 49.69 ? 2197 ASN A CG    1 
ATOM   1063 O  OD1   . ASN A 1 135 ? 21.550 -0.088  18.860 1.00 50.19 ? 2197 ASN A OD1   1 
ATOM   1064 N  ND2   . ASN A 1 135 ? 20.380 0.804   17.158 1.00 49.81 ? 2197 ASN A ND2   1 
ATOM   1065 N  N     . LEU A 1 136 ? 20.287 -2.612  13.961 1.00 48.41 ? 2198 LEU A N     1 
ATOM   1066 C  CA    . LEU A 1 136 ? 20.681 -3.433  12.827 1.00 47.82 ? 2198 LEU A CA    1 
ATOM   1067 C  C     . LEU A 1 136 ? 21.920 -2.855  12.161 1.00 47.54 ? 2198 LEU A C     1 
ATOM   1068 O  O     . LEU A 1 136 ? 22.999 -3.433  12.266 1.00 47.53 ? 2198 LEU A O     1 
ATOM   1069 C  CB    . LEU A 1 136 ? 19.526 -3.607  11.833 1.00 47.73 ? 2198 LEU A CB    1 
ATOM   1070 C  CG    . LEU A 1 136 ? 19.731 -4.515  10.616 1.00 47.20 ? 2198 LEU A CG    1 
ATOM   1071 C  CD1   . LEU A 1 136 ? 20.140 -5.931  10.998 1.00 47.02 ? 2198 LEU A CD1   1 
ATOM   1072 C  CD2   . LEU A 1 136 ? 18.464 -4.546  9.801  1.00 47.06 ? 2198 LEU A CD2   1 
ATOM   1073 N  N     . ASP A 1 137 ? 21.769 -1.710  11.498 1.00 47.17 ? 2199 ASP A N     1 
ATOM   1074 C  CA    . ASP A 1 137 ? 22.876 -1.084  10.785 1.00 47.05 ? 2199 ASP A CA    1 
ATOM   1075 C  C     . ASP A 1 137 ? 22.542 0.338   10.387 1.00 46.90 ? 2199 ASP A C     1 
ATOM   1076 O  O     . ASP A 1 137 ? 21.397 0.638   10.068 1.00 47.21 ? 2199 ASP A O     1 
ATOM   1077 C  CB    . ASP A 1 137 ? 23.224 -1.881  9.522  1.00 47.13 ? 2199 ASP A CB    1 
ATOM   1078 C  CG    . ASP A 1 137 ? 24.635 -1.611  9.036  1.00 47.35 ? 2199 ASP A CG    1 
ATOM   1079 O  OD1   . ASP A 1 137 ? 24.811 -1.337  7.831  1.00 47.51 ? 2199 ASP A OD1   1 
ATOM   1080 O  OD2   . ASP A 1 137 ? 25.568 -1.664  9.863  1.00 47.32 ? 2199 ASP A OD2   1 
ATOM   1081 N  N     . SER A 1 138 ? 23.550 1.207   10.401 1.00 46.57 ? 2200 SER A N     1 
ATOM   1082 C  CA    . SER A 1 138 ? 23.426 2.581   9.903  1.00 46.25 ? 2200 SER A CA    1 
ATOM   1083 C  C     . SER A 1 138 ? 22.174 3.296   10.413 1.00 46.01 ? 2200 SER A C     1 
ATOM   1084 O  O     . SER A 1 138 ? 21.527 4.035   9.674  1.00 46.13 ? 2200 SER A O     1 
ATOM   1085 C  CB    . SER A 1 138 ? 23.451 2.593   8.369  1.00 46.26 ? 2200 SER A CB    1 
ATOM   1086 O  OG    . SER A 1 138 ? 24.332 1.605   7.861  1.00 46.44 ? 2200 SER A OG    1 
ATOM   1087 N  N     . GLY A 1 139 ? 21.834 3.073   11.678 1.00 45.79 ? 2201 GLY A N     1 
ATOM   1088 C  CA    . GLY A 1 139 ? 20.638 3.669   12.261 1.00 45.58 ? 2201 GLY A CA    1 
ATOM   1089 C  C     . GLY A 1 139 ? 19.368 3.056   11.701 1.00 45.43 ? 2201 GLY A C     1 
ATOM   1090 O  O     . GLY A 1 139 ? 18.416 3.764   11.369 1.00 45.43 ? 2201 GLY A O     1 
ATOM   1091 N  N     . MET A 1 140 ? 19.377 1.733   11.571 1.00 45.15 ? 2202 MET A N     1 
ATOM   1092 C  CA    . MET A 1 140 ? 18.184 0.968   11.230 1.00 44.75 ? 2202 MET A CA    1 
ATOM   1093 C  C     . MET A 1 140 ? 17.949 -0.006  12.378 1.00 44.49 ? 2202 MET A C     1 
ATOM   1094 O  O     . MET A 1 140 ? 18.908 -0.466  13.009 1.00 44.41 ? 2202 MET A O     1 
ATOM   1095 C  CB    . MET A 1 140 ? 18.348 0.230   9.894  1.00 44.69 ? 2202 MET A CB    1 
ATOM   1096 C  CG    . MET A 1 140 ? 18.571 1.143   8.683  1.00 44.65 ? 2202 MET A CG    1 
ATOM   1097 S  SD    . MET A 1 140 ? 18.736 0.254   7.113  1.00 44.48 ? 2202 MET A SD    1 
ATOM   1098 C  CE    . MET A 1 140 ? 19.203 1.578   6.005  1.00 44.08 ? 2202 MET A CE    1 
ATOM   1099 N  N     . VAL A 1 141 ? 16.679 -0.300  12.655 1.00 44.02 ? 2203 VAL A N     1 
ATOM   1100 C  CA    . VAL A 1 141 ? 16.296 -1.062  13.836 1.00 43.72 ? 2203 VAL A CA    1 
ATOM   1101 C  C     . VAL A 1 141 ? 15.379 -2.229  13.477 1.00 43.55 ? 2203 VAL A C     1 
ATOM   1102 O  O     . VAL A 1 141 ? 14.437 -2.070  12.699 1.00 43.60 ? 2203 VAL A O     1 
ATOM   1103 C  CB    . VAL A 1 141 ? 15.596 -0.148  14.886 1.00 43.73 ? 2203 VAL A CB    1 
ATOM   1104 C  CG1   . VAL A 1 141 ? 14.957 -0.964  16.002 1.00 43.95 ? 2203 VAL A CG1   1 
ATOM   1105 C  CG2   . VAL A 1 141 ? 16.579 0.847   15.483 1.00 43.77 ? 2203 VAL A CG2   1 
ATOM   1106 N  N     . ILE A 1 142 ? 15.661 -3.403  14.038 1.00 43.22 ? 2204 ILE A N     1 
ATOM   1107 C  CA    . ILE A 1 142 ? 14.689 -4.489  14.010 1.00 42.86 ? 2204 ILE A CA    1 
ATOM   1108 C  C     . ILE A 1 142 ? 13.785 -4.323  15.225 1.00 42.69 ? 2204 ILE A C     1 
ATOM   1109 O  O     . ILE A 1 142 ? 14.180 -4.631  16.349 1.00 42.64 ? 2204 ILE A O     1 
ATOM   1110 C  CB    . ILE A 1 142 ? 15.336 -5.891  14.001 1.00 42.75 ? 2204 ILE A CB    1 
ATOM   1111 C  CG1   . ILE A 1 142 ? 16.181 -6.087  12.740 1.00 42.93 ? 2204 ILE A CG1   1 
ATOM   1112 C  CG2   . ILE A 1 142 ? 14.257 -6.967  14.064 1.00 42.85 ? 2204 ILE A CG2   1 
ATOM   1113 C  CD1   . ILE A 1 142 ? 16.846 -7.456  12.623 1.00 43.11 ? 2204 ILE A CD1   1 
ATOM   1114 N  N     . ASP A 1 143 ? 12.584 -3.803  14.988 1.00 42.37 ? 2205 ASP A N     1 
ATOM   1115 C  CA    . ASP A 1 143 ? 11.583 -3.636  16.030 1.00 42.17 ? 2205 ASP A CA    1 
ATOM   1116 C  C     . ASP A 1 143 ? 10.735 -4.898  16.096 1.00 42.06 ? 2205 ASP A C     1 
ATOM   1117 O  O     . ASP A 1 143 ? 10.206 -5.346  15.079 1.00 42.18 ? 2205 ASP A O     1 
ATOM   1118 C  CB    . ASP A 1 143 ? 10.703 -2.410  15.735 1.00 42.13 ? 2205 ASP A CB    1 
ATOM   1119 C  CG    . ASP A 1 143 ? 9.556  -2.236  16.739 1.00 42.19 ? 2205 ASP A CG    1 
ATOM   1120 O  OD1   . ASP A 1 143 ? 9.370  -3.101  17.622 1.00 41.96 ? 2205 ASP A OD1   1 
ATOM   1121 O  OD2   . ASP A 1 143 ? 8.831  -1.223  16.640 1.00 42.10 ? 2205 ASP A OD2   1 
ATOM   1122 N  N     . SER A 1 144 ? 10.597 -5.461  17.293 1.00 41.72 ? 2206 SER A N     1 
ATOM   1123 C  CA    . SER A 1 144 ? 9.763  -6.643  17.474 1.00 41.45 ? 2206 SER A CA    1 
ATOM   1124 C  C     . SER A 1 144 ? 8.682  -6.493  18.559 1.00 41.63 ? 2206 SER A C     1 
ATOM   1125 O  O     . SER A 1 144 ? 8.176  -7.486  19.084 1.00 41.49 ? 2206 SER A O     1 
ATOM   1126 C  CB    . SER A 1 144 ? 10.629 -7.888  17.696 1.00 41.28 ? 2206 SER A CB    1 
ATOM   1127 O  OG    . SER A 1 144 ? 11.594 -7.681  18.703 1.00 40.49 ? 2206 SER A OG    1 
ATOM   1128 N  N     . TYR A 1 145 ? 8.325  -5.247  18.872 1.00 41.81 ? 2207 TYR A N     1 
ATOM   1129 C  CA    . TYR A 1 145 ? 7.257  -4.944  19.824 1.00 42.20 ? 2207 TYR A CA    1 
ATOM   1130 C  C     . TYR A 1 145 ? 5.930  -5.585  19.422 1.00 42.53 ? 2207 TYR A C     1 
ATOM   1131 O  O     . TYR A 1 145 ? 5.182  -6.061  20.279 1.00 42.70 ? 2207 TYR A O     1 
ATOM   1132 C  CB    . TYR A 1 145 ? 7.055  -3.432  19.944 1.00 42.24 ? 2207 TYR A CB    1 
ATOM   1133 C  CG    . TYR A 1 145 ? 7.933  -2.710  20.952 1.00 43.02 ? 2207 TYR A CG    1 
ATOM   1134 C  CD1   . TYR A 1 145 ? 9.206  -2.252  20.603 1.00 43.31 ? 2207 TYR A CD1   1 
ATOM   1135 C  CD2   . TYR A 1 145 ? 7.473  -2.445  22.247 1.00 43.63 ? 2207 TYR A CD2   1 
ATOM   1136 C  CE1   . TYR A 1 145 ? 10.011 -1.575  21.525 1.00 43.75 ? 2207 TYR A CE1   1 
ATOM   1137 C  CE2   . TYR A 1 145 ? 8.271  -1.769  23.178 1.00 43.67 ? 2207 TYR A CE2   1 
ATOM   1138 C  CZ    . TYR A 1 145 ? 9.537  -1.338  22.810 1.00 44.00 ? 2207 TYR A CZ    1 
ATOM   1139 O  OH    . TYR A 1 145 ? 10.330 -0.667  23.720 1.00 44.13 ? 2207 TYR A OH    1 
ATOM   1140 N  N     . ARG A 1 146 ? 5.644  -5.586  18.119 1.00 42.90 ? 2208 ARG A N     1 
ATOM   1141 C  CA    . ARG A 1 146 ? 4.360  -6.048  17.582 1.00 43.26 ? 2208 ARG A CA    1 
ATOM   1142 C  C     . ARG A 1 146 ? 4.474  -7.350  16.803 1.00 43.19 ? 2208 ARG A C     1 
ATOM   1143 O  O     . ARG A 1 146 ? 3.608  -8.213  16.900 1.00 43.29 ? 2208 ARG A O     1 
ATOM   1144 C  CB    . ARG A 1 146 ? 3.755  -4.989  16.664 1.00 43.43 ? 2208 ARG A CB    1 
ATOM   1145 C  CG    . ARG A 1 146 ? 3.213  -3.780  17.370 1.00 44.95 ? 2208 ARG A CG    1 
ATOM   1146 C  CD    . ARG A 1 146 ? 3.220  -2.598  16.426 1.00 48.52 ? 2208 ARG A CD    1 
ATOM   1147 N  NE    . ARG A 1 146 ? 2.853  -1.368  17.120 1.00 51.29 ? 2208 ARG A NE    1 
ATOM   1148 C  CZ    . ARG A 1 146 ? 1.655  -0.795  17.048 1.00 52.58 ? 2208 ARG A CZ    1 
ATOM   1149 N  NH1   . ARG A 1 146 ? 0.698  -1.332  16.296 1.00 53.07 ? 2208 ARG A NH1   1 
ATOM   1150 N  NH2   . ARG A 1 146 ? 1.416  0.322   17.724 1.00 53.08 ? 2208 ARG A NH2   1 
ATOM   1151 N  N     . MET A 1 147 ? 5.531  -7.466  16.005 1.00 43.19 ? 2209 MET A N     1 
ATOM   1152 C  CA    . MET A 1 147 ? 5.767  -8.648  15.187 1.00 43.14 ? 2209 MET A CA    1 
ATOM   1153 C  C     . MET A 1 147 ? 7.134  -9.232  15.523 1.00 42.84 ? 2209 MET A C     1 
ATOM   1154 O  O     . MET A 1 147 ? 8.064  -8.498  15.857 1.00 42.79 ? 2209 MET A O     1 
ATOM   1155 C  CB    . MET A 1 147 ? 5.708  -8.293  13.699 1.00 43.32 ? 2209 MET A CB    1 
ATOM   1156 C  CG    . MET A 1 147 ? 4.505  -7.445  13.295 1.00 44.62 ? 2209 MET A CG    1 
ATOM   1157 S  SD    . MET A 1 147 ? 4.516  -6.927  11.560 1.00 47.06 ? 2209 MET A SD    1 
ATOM   1158 C  CE    . MET A 1 147 ? 3.828  -8.384  10.784 1.00 46.82 ? 2209 MET A CE    1 
ATOM   1159 N  N     . GLY A 1 148 ? 7.258  -10.552 15.434 1.00 42.49 ? 2210 GLY A N     1 
ATOM   1160 C  CA    . GLY A 1 148 ? 8.535  -11.204 15.677 1.00 41.97 ? 2210 GLY A CA    1 
ATOM   1161 C  C     . GLY A 1 148 ? 8.426  -12.705 15.780 1.00 41.72 ? 2210 GLY A C     1 
ATOM   1162 O  O     . GLY A 1 148 ? 7.482  -13.312 15.278 1.00 41.59 ? 2210 GLY A O     1 
ATOM   1163 N  N     . ASN A 1 149 ? 9.422  -13.295 16.428 1.00 41.64 ? 2211 ASN A N     1 
ATOM   1164 C  CA    . ASN A 1 149 ? 9.457  -14.722 16.716 1.00 41.39 ? 2211 ASN A CA    1 
ATOM   1165 C  C     . ASN A 1 149 ? 9.706  -14.918 18.210 1.00 41.45 ? 2211 ASN A C     1 
ATOM   1166 O  O     . ASN A 1 149 ? 9.484  -13.995 19.003 1.00 41.43 ? 2211 ASN A O     1 
ATOM   1167 C  CB    . ASN A 1 149 ? 10.528 -15.420 15.873 1.00 41.15 ? 2211 ASN A CB    1 
ATOM   1168 C  CG    . ASN A 1 149 ? 11.910 -14.798 16.034 1.00 41.01 ? 2211 ASN A CG    1 
ATOM   1169 O  OD1   . ASN A 1 149 ? 12.064 -13.696 16.566 1.00 40.81 ? 2211 ASN A OD1   1 
ATOM   1170 N  ND2   . ASN A 1 149 ? 12.925 -15.508 15.565 1.00 40.64 ? 2211 ASN A ND2   1 
ATOM   1171 N  N     . GLU A 1 150 ? 10.163 -16.105 18.599 1.00 41.31 ? 2212 GLU A N     1 
ATOM   1172 C  CA    . GLU A 1 150 ? 10.393 -16.388 20.013 1.00 41.23 ? 2212 GLU A CA    1 
ATOM   1173 C  C     . GLU A 1 150 ? 11.626 -15.677 20.559 1.00 41.01 ? 2212 GLU A C     1 
ATOM   1174 O  O     . GLU A 1 150 ? 11.756 -15.490 21.770 1.00 41.12 ? 2212 GLU A O     1 
ATOM   1175 C  CB    . GLU A 1 150 ? 10.453 -17.898 20.279 1.00 41.36 ? 2212 GLU A CB    1 
ATOM   1176 C  CG    . GLU A 1 150 ? 9.077  -18.582 20.337 1.00 41.84 ? 2212 GLU A CG    1 
ATOM   1177 C  CD    . GLU A 1 150 ? 8.115  -17.910 21.316 1.00 42.49 ? 2212 GLU A CD    1 
ATOM   1178 O  OE1   . GLU A 1 150 ? 8.203  -18.172 22.534 1.00 42.79 ? 2212 GLU A OE1   1 
ATOM   1179 O  OE2   . GLU A 1 150 ? 7.262  -17.122 20.861 1.00 42.94 ? 2212 GLU A OE2   1 
ATOM   1180 N  N     . ALA A 1 151 ? 12.504 -15.239 19.660 1.00 40.68 ? 2213 ALA A N     1 
ATOM   1181 C  CA    . ALA A 1 151 ? 13.727 -14.533 20.044 1.00 40.27 ? 2213 ALA A CA    1 
ATOM   1182 C  C     . ALA A 1 151 ? 13.457 -13.223 20.793 1.00 39.98 ? 2213 ALA A C     1 
ATOM   1183 O  O     . ALA A 1 151 ? 14.380 -12.616 21.335 1.00 40.24 ? 2213 ALA A O     1 
ATOM   1184 C  CB    . ALA A 1 151 ? 14.608 -14.286 18.822 1.00 40.19 ? 2213 ALA A CB    1 
ATOM   1185 N  N     . ARG A 1 152 ? 12.195 -12.803 20.827 1.00 39.47 ? 2214 ARG A N     1 
ATOM   1186 C  CA    . ARG A 1 152 ? 11.807 -11.567 21.500 1.00 39.17 ? 2214 ARG A CA    1 
ATOM   1187 C  C     . ARG A 1 152 ? 11.672 -11.734 23.021 1.00 39.19 ? 2214 ARG A C     1 
ATOM   1188 O  O     . ARG A 1 152 ? 11.625 -10.747 23.763 1.00 39.07 ? 2214 ARG A O     1 
ATOM   1189 C  CB    . ARG A 1 152 ? 10.515 -11.004 20.894 1.00 38.94 ? 2214 ARG A CB    1 
ATOM   1190 C  CG    . ARG A 1 152 ? 9.251  -11.721 21.320 1.00 38.28 ? 2214 ARG A CG    1 
ATOM   1191 C  CD    . ARG A 1 152 ? 8.064  -11.376 20.430 1.00 37.39 ? 2214 ARG A CD    1 
ATOM   1192 N  NE    . ARG A 1 152 ? 7.693  -9.963  20.487 1.00 36.81 ? 2214 ARG A NE    1 
ATOM   1193 C  CZ    . ARG A 1 152 ? 7.070  -9.377  21.509 1.00 36.42 ? 2214 ARG A CZ    1 
ATOM   1194 N  NH1   . ARG A 1 152 ? 6.745  -10.065 22.597 1.00 36.01 ? 2214 ARG A NH1   1 
ATOM   1195 N  NH2   . ARG A 1 152 ? 6.782  -8.086  21.445 1.00 36.16 ? 2214 ARG A NH2   1 
ATOM   1196 N  N     . PHE A 1 153 ? 11.612 -12.982 23.477 1.00 39.11 ? 2215 PHE A N     1 
ATOM   1197 C  CA    . PHE A 1 153 ? 11.426 -13.267 24.894 1.00 39.14 ? 2215 PHE A CA    1 
ATOM   1198 C  C     . PHE A 1 153 ? 12.743 -13.502 25.640 1.00 39.25 ? 2215 PHE A C     1 
ATOM   1199 O  O     . PHE A 1 153 ? 12.740 -13.689 26.859 1.00 39.36 ? 2215 PHE A O     1 
ATOM   1200 C  CB    . PHE A 1 153 ? 10.479 -14.457 25.086 1.00 39.12 ? 2215 PHE A CB    1 
ATOM   1201 C  CG    . PHE A 1 153 ? 9.078  -14.202 24.614 1.00 38.91 ? 2215 PHE A CG    1 
ATOM   1202 C  CD1   . PHE A 1 153 ? 8.184  -13.474 25.399 1.00 38.91 ? 2215 PHE A CD1   1 
ATOM   1203 C  CD2   . PHE A 1 153 ? 8.645  -14.695 23.386 1.00 38.98 ? 2215 PHE A CD2   1 
ATOM   1204 C  CE1   . PHE A 1 153 ? 6.880  -13.233 24.964 1.00 38.83 ? 2215 PHE A CE1   1 
ATOM   1205 C  CE2   . PHE A 1 153 ? 7.343  -14.463 22.938 1.00 38.73 ? 2215 PHE A CE2   1 
ATOM   1206 C  CZ    . PHE A 1 153 ? 6.459  -13.730 23.728 1.00 38.77 ? 2215 PHE A CZ    1 
ATOM   1207 N  N     . ILE A 1 154 ? 13.860 -13.474 24.915 1.00 39.28 ? 2216 ILE A N     1 
ATOM   1208 C  CA    . ILE A 1 154 ? 15.176 -13.719 25.503 1.00 39.38 ? 2216 ILE A CA    1 
ATOM   1209 C  C     . ILE A 1 154 ? 15.625 -12.531 26.363 1.00 39.62 ? 2216 ILE A C     1 
ATOM   1210 O  O     . ILE A 1 154 ? 15.649 -11.385 25.904 1.00 39.66 ? 2216 ILE A O     1 
ATOM   1211 C  CB    . ILE A 1 154 ? 16.239 -14.048 24.422 1.00 39.34 ? 2216 ILE A CB    1 
ATOM   1212 C  CG1   . ILE A 1 154 ? 15.746 -15.167 23.507 1.00 39.18 ? 2216 ILE A CG1   1 
ATOM   1213 C  CG2   . ILE A 1 154 ? 17.551 -14.473 25.062 1.00 39.49 ? 2216 ILE A CG2   1 
ATOM   1214 C  CD1   . ILE A 1 154 ? 16.567 -15.342 22.265 1.00 38.65 ? 2216 ILE A CD1   1 
ATOM   1215 N  N     . ASN A 1 155 ? 15.980 -12.829 27.612 1.00 39.91 ? 2217 ASN A N     1 
ATOM   1216 C  CA    . ASN A 1 155 ? 16.347 -11.817 28.607 1.00 40.08 ? 2217 ASN A CA    1 
ATOM   1217 C  C     . ASN A 1 155 ? 17.826 -11.441 28.608 1.00 40.04 ? 2217 ASN A C     1 
ATOM   1218 O  O     . ASN A 1 155 ? 18.658 -12.143 28.033 1.00 39.95 ? 2217 ASN A O     1 
ATOM   1219 C  CB    . ASN A 1 155 ? 15.940 -12.284 30.009 1.00 40.09 ? 2217 ASN A CB    1 
ATOM   1220 C  CG    . ASN A 1 155 ? 14.440 -12.341 30.191 1.00 40.36 ? 2217 ASN A CG    1 
ATOM   1221 O  OD1   . ASN A 1 155 ? 13.743 -11.348 30.009 1.00 41.21 ? 2217 ASN A OD1   1 
ATOM   1222 N  ND2   . ASN A 1 155 ? 13.935 -13.508 30.562 1.00 40.90 ? 2217 ASN A ND2   1 
ATOM   1223 N  N     . HIS A 1 156 ? 18.133 -10.329 29.272 1.00 40.13 ? 2218 HIS A N     1 
ATOM   1224 C  CA    . HIS A 1 156 ? 19.498 -9.835  29.405 1.00 40.24 ? 2218 HIS A CA    1 
ATOM   1225 C  C     . HIS A 1 156 ? 20.296 -10.540 30.498 1.00 40.21 ? 2218 HIS A C     1 
ATOM   1226 O  O     . HIS A 1 156 ? 19.755 -10.880 31.552 1.00 40.31 ? 2218 HIS A O     1 
ATOM   1227 C  CB    . HIS A 1 156 ? 19.494 -8.336  29.710 1.00 40.23 ? 2218 HIS A CB    1 
ATOM   1228 C  CG    . HIS A 1 156 ? 20.764 -7.859  30.342 1.00 40.72 ? 2218 HIS A CG    1 
ATOM   1229 N  ND1   . HIS A 1 156 ? 21.864 -7.481  29.604 1.00 40.51 ? 2218 HIS A ND1   1 
ATOM   1230 C  CD2   . HIS A 1 156 ? 21.125 -7.753  31.643 1.00 41.17 ? 2218 HIS A CD2   1 
ATOM   1231 C  CE1   . HIS A 1 156 ? 22.841 -7.138  30.424 1.00 41.74 ? 2218 HIS A CE1   1 
ATOM   1232 N  NE2   . HIS A 1 156 ? 22.421 -7.298  31.667 1.00 41.70 ? 2218 HIS A NE2   1 
ATOM   1233 N  N     . SER A 1 157 ? 21.591 -10.720 30.252 1.00 40.03 ? 2219 SER A N     1 
ATOM   1234 C  CA    . SER A 1 157 ? 22.522 -11.103 31.305 1.00 40.02 ? 2219 SER A CA    1 
ATOM   1235 C  C     . SER A 1 157 ? 23.809 -10.294 31.218 1.00 40.21 ? 2219 SER A C     1 
ATOM   1236 O  O     . SER A 1 157 ? 24.267 -9.959  30.126 1.00 40.27 ? 2219 SER A O     1 
ATOM   1237 C  CB    . SER A 1 157 ? 22.844 -12.595 31.238 1.00 39.91 ? 2219 SER A CB    1 
ATOM   1238 O  OG    . SER A 1 157 ? 23.595 -13.005 32.366 1.00 39.38 ? 2219 SER A OG    1 
ATOM   1239 N  N     . CYS A 1 158 ? 24.389 -9.983  32.374 1.00 40.35 ? 2220 CYS A N     1 
ATOM   1240 C  CA    . CYS A 1 158 ? 25.728 -9.402  32.419 1.00 40.48 ? 2220 CYS A CA    1 
ATOM   1241 C  C     . CYS A 1 158 ? 26.770 -10.462 32.066 1.00 40.52 ? 2220 CYS A C     1 
ATOM   1242 O  O     . CYS A 1 158 ? 27.889 -10.136 31.656 1.00 40.60 ? 2220 CYS A O     1 
ATOM   1243 C  CB    . CYS A 1 158 ? 26.012 -8.815  33.798 1.00 40.43 ? 2220 CYS A CB    1 
ATOM   1244 S  SG    . CYS A 1 158 ? 24.961 -7.420  34.210 1.00 40.83 ? 2220 CYS A SG    1 
ATOM   1245 N  N     . ASP A 1 159 ? 26.388 -11.727 32.238 1.00 40.45 ? 2221 ASP A N     1 
ATOM   1246 C  CA    . ASP A 1 159 ? 27.221 -12.857 31.854 1.00 40.47 ? 2221 ASP A CA    1 
ATOM   1247 C  C     . ASP A 1 159 ? 26.465 -13.775 30.892 1.00 40.43 ? 2221 ASP A C     1 
ATOM   1248 O  O     . ASP A 1 159 ? 25.976 -14.830 31.292 1.00 40.32 ? 2221 ASP A O     1 
ATOM   1249 C  CB    . ASP A 1 159 ? 27.663 -13.636 33.084 1.00 40.48 ? 2221 ASP A CB    1 
ATOM   1250 C  CG    . ASP A 1 159 ? 28.852 -14.532 32.806 1.00 40.87 ? 2221 ASP A CG    1 
ATOM   1251 O  OD1   . ASP A 1 159 ? 28.728 -15.761 33.002 1.00 40.64 ? 2221 ASP A OD1   1 
ATOM   1252 O  OD2   . ASP A 1 159 ? 29.909 -14.004 32.387 1.00 40.99 ? 2221 ASP A OD2   1 
ATOM   1253 N  N     . PRO A 1 160 ? 26.382 -13.380 29.609 1.00 40.51 ? 2222 PRO A N     1 
ATOM   1254 C  CA    . PRO A 1 160 ? 25.529 -14.086 28.657 1.00 40.38 ? 2222 PRO A CA    1 
ATOM   1255 C  C     . PRO A 1 160 ? 26.136 -15.397 28.178 1.00 40.33 ? 2222 PRO A C     1 
ATOM   1256 O  O     . PRO A 1 160 ? 27.354 -15.573 28.224 1.00 40.42 ? 2222 PRO A O     1 
ATOM   1257 C  CB    . PRO A 1 160 ? 25.429 -13.107 27.479 1.00 40.41 ? 2222 PRO A CB    1 
ATOM   1258 C  CG    . PRO A 1 160 ? 26.437 -12.001 27.748 1.00 40.36 ? 2222 PRO A CG    1 
ATOM   1259 C  CD    . PRO A 1 160 ? 27.226 -12.367 28.946 1.00 40.46 ? 2222 PRO A CD    1 
ATOM   1260 N  N     . ASN A 1 161 ? 25.280 -16.307 27.729 1.00 40.25 ? 2223 ASN A N     1 
ATOM   1261 C  CA    . ASN A 1 161 ? 25.727 -17.519 27.052 1.00 40.18 ? 2223 ASN A CA    1 
ATOM   1262 C  C     . ASN A 1 161 ? 25.421 -17.474 25.551 1.00 40.21 ? 2223 ASN A C     1 
ATOM   1263 O  O     . ASN A 1 161 ? 25.861 -18.337 24.784 1.00 40.31 ? 2223 ASN A O     1 
ATOM   1264 C  CB    . ASN A 1 161 ? 25.128 -18.769 27.707 1.00 40.20 ? 2223 ASN A CB    1 
ATOM   1265 C  CG    . ASN A 1 161 ? 23.620 -18.680 27.890 1.00 40.25 ? 2223 ASN A CG    1 
ATOM   1266 O  OD1   . ASN A 1 161 ? 22.905 -18.130 27.052 1.00 40.58 ? 2223 ASN A OD1   1 
ATOM   1267 N  ND2   . ASN A 1 161 ? 23.129 -19.240 28.989 1.00 39.98 ? 2223 ASN A ND2   1 
ATOM   1268 N  N     . CYS A 1 162 ? 24.671 -16.456 25.138 1.00 40.06 ? 2224 CYS A N     1 
ATOM   1269 C  CA    . CYS A 1 162 ? 24.374 -16.253 23.727 1.00 40.04 ? 2224 CYS A CA    1 
ATOM   1270 C  C     . CYS A 1 162 ? 24.802 -14.871 23.257 1.00 39.85 ? 2224 CYS A C     1 
ATOM   1271 O  O     . CYS A 1 162 ? 25.091 -13.990 24.070 1.00 39.76 ? 2224 CYS A O     1 
ATOM   1272 C  CB    . CYS A 1 162 ? 22.891 -16.499 23.450 1.00 40.15 ? 2224 CYS A CB    1 
ATOM   1273 S  SG    . CYS A 1 162 ? 22.359 -18.173 23.854 1.00 40.58 ? 2224 CYS A SG    1 
ATOM   1274 N  N     . GLU A 1 163 ? 24.837 -14.694 21.938 1.00 39.77 ? 2225 GLU A N     1 
ATOM   1275 C  CA    . GLU A 1 163 ? 25.359 -13.479 21.320 1.00 39.71 ? 2225 GLU A CA    1 
ATOM   1276 C  C     . GLU A 1 163 ? 24.665 -13.203 19.989 1.00 39.47 ? 2225 GLU A C     1 
ATOM   1277 O  O     . GLU A 1 163 ? 24.482 -14.120 19.181 1.00 39.58 ? 2225 GLU A O     1 
ATOM   1278 C  CB    . GLU A 1 163 ? 26.857 -13.639 21.096 1.00 39.70 ? 2225 GLU A CB    1 
ATOM   1279 C  CG    . GLU A 1 163 ? 27.594 -12.368 20.739 1.00 40.49 ? 2225 GLU A CG    1 
ATOM   1280 C  CD    . GLU A 1 163 ? 28.984 -12.652 20.203 1.00 41.77 ? 2225 GLU A CD    1 
ATOM   1281 O  OE1   . GLU A 1 163 ? 29.204 -13.772 19.677 1.00 41.68 ? 2225 GLU A OE1   1 
ATOM   1282 O  OE2   . GLU A 1 163 ? 29.852 -11.755 20.306 1.00 41.85 ? 2225 GLU A OE2   1 
ATOM   1283 N  N     . MET A 1 164 ? 24.282 -11.943 19.770 1.00 39.10 ? 2226 MET A N     1 
ATOM   1284 C  CA    . MET A 1 164 ? 23.648 -11.522 18.517 1.00 38.82 ? 2226 MET A CA    1 
ATOM   1285 C  C     . MET A 1 164 ? 24.721 -11.157 17.503 1.00 38.70 ? 2226 MET A C     1 
ATOM   1286 O  O     . MET A 1 164 ? 25.559 -10.302 17.771 1.00 39.06 ? 2226 MET A O     1 
ATOM   1287 C  CB    . MET A 1 164 ? 22.728 -10.318 18.742 1.00 38.74 ? 2226 MET A CB    1 
ATOM   1288 C  CG    . MET A 1 164 ? 21.529 -10.570 19.642 1.00 38.73 ? 2226 MET A CG    1 
ATOM   1289 S  SD    . MET A 1 164 ? 20.314 -11.692 18.926 1.00 40.08 ? 2226 MET A SD    1 
ATOM   1290 C  CE    . MET A 1 164 ? 18.982 -11.537 20.097 1.00 40.16 ? 2226 MET A CE    1 
ATOM   1291 N  N     . GLN A 1 165 ? 24.698 -11.804 16.344 1.00 38.58 ? 2227 GLN A N     1 
ATOM   1292 C  CA    . GLN A 1 165 ? 25.722 -11.583 15.318 1.00 38.37 ? 2227 GLN A CA    1 
ATOM   1293 C  C     . GLN A 1 165 ? 25.137 -11.015 14.035 1.00 37.97 ? 2227 GLN A C     1 
ATOM   1294 O  O     . GLN A 1 165 ? 24.165 -11.554 13.495 1.00 37.78 ? 2227 GLN A O     1 
ATOM   1295 C  CB    . GLN A 1 165 ? 26.475 -12.883 15.012 1.00 38.50 ? 2227 GLN A CB    1 
ATOM   1296 C  CG    . GLN A 1 165 ? 27.184 -13.501 16.209 1.00 39.21 ? 2227 GLN A CG    1 
ATOM   1297 C  CD    . GLN A 1 165 ? 28.028 -14.716 15.850 1.00 40.53 ? 2227 GLN A CD    1 
ATOM   1298 O  OE1   . GLN A 1 165 ? 28.137 -15.104 14.680 1.00 41.06 ? 2227 GLN A OE1   1 
ATOM   1299 N  NE2   . GLN A 1 165 ? 28.633 -15.327 16.865 1.00 40.51 ? 2227 GLN A NE2   1 
ATOM   1300 N  N     . LYS A 1 166 ? 25.741 -9.933  13.550 1.00 37.68 ? 2228 LYS A N     1 
ATOM   1301 C  CA    . LYS A 1 166 ? 25.323 -9.306  12.295 1.00 37.57 ? 2228 LYS A CA    1 
ATOM   1302 C  C     . LYS A 1 166 ? 25.923 -10.009 11.082 1.00 37.43 ? 2228 LYS A C     1 
ATOM   1303 O  O     . LYS A 1 166 ? 27.136 -10.000 10.875 1.00 37.33 ? 2228 LYS A O     1 
ATOM   1304 C  CB    . LYS A 1 166 ? 25.693 -7.824  12.273 1.00 37.52 ? 2228 LYS A CB    1 
ATOM   1305 C  CG    . LYS A 1 166 ? 25.146 -7.079  11.072 1.00 37.64 ? 2228 LYS A CG    1 
ATOM   1306 C  CD    . LYS A 1 166 ? 26.071 -5.951  10.654 1.00 38.50 ? 2228 LYS A CD    1 
ATOM   1307 C  CE    . LYS A 1 166 ? 25.806 -4.680  11.432 1.00 38.92 ? 2228 LYS A CE    1 
ATOM   1308 N  NZ    . LYS A 1 166 ? 26.808 -3.644  11.097 1.00 39.51 ? 2228 LYS A NZ    1 
ATOM   1309 N  N     . TRP A 1 167 ? 25.057 -10.608 10.275 1.00 37.41 ? 2229 TRP A N     1 
ATOM   1310 C  CA    . TRP A 1 167 ? 25.489 -11.334 9.093  1.00 37.36 ? 2229 TRP A CA    1 
ATOM   1311 C  C     . TRP A 1 167 ? 25.040 -10.653 7.813  1.00 37.45 ? 2229 TRP A C     1 
ATOM   1312 O  O     . TRP A 1 167 ? 23.986 -10.021 7.770  1.00 37.42 ? 2229 TRP A O     1 
ATOM   1313 C  CB    . TRP A 1 167 ? 24.953 -12.762 9.133  1.00 37.24 ? 2229 TRP A CB    1 
ATOM   1314 C  CG    . TRP A 1 167 ? 25.705 -13.650 10.075 1.00 37.54 ? 2229 TRP A CG    1 
ATOM   1315 C  CD1   . TRP A 1 167 ? 25.646 -13.636 11.439 1.00 37.61 ? 2229 TRP A CD1   1 
ATOM   1316 C  CD2   . TRP A 1 167 ? 26.633 -14.687 9.725  1.00 37.31 ? 2229 TRP A CD2   1 
ATOM   1317 N  NE1   . TRP A 1 167 ? 26.477 -14.597 11.958 1.00 37.80 ? 2229 TRP A NE1   1 
ATOM   1318 C  CE2   . TRP A 1 167 ? 27.097 -15.255 10.928 1.00 37.50 ? 2229 TRP A CE2   1 
ATOM   1319 C  CE3   . TRP A 1 167 ? 27.120 -15.187 8.511  1.00 37.20 ? 2229 TRP A CE3   1 
ATOM   1320 C  CZ2   . TRP A 1 167 ? 28.022 -16.302 10.955 1.00 37.58 ? 2229 TRP A CZ2   1 
ATOM   1321 C  CZ3   . TRP A 1 167 ? 28.042 -16.223 8.538  1.00 37.32 ? 2229 TRP A CZ3   1 
ATOM   1322 C  CH2   . TRP A 1 167 ? 28.482 -16.770 9.751  1.00 37.27 ? 2229 TRP A CH2   1 
ATOM   1323 N  N     . SER A 1 168 ? 25.862 -10.776 6.777  1.00 37.69 ? 2230 SER A N     1 
ATOM   1324 C  CA    . SER A 1 168 ? 25.459 -10.438 5.425  1.00 37.87 ? 2230 SER A CA    1 
ATOM   1325 C  C     . SER A 1 168 ? 24.888 -11.692 4.796  1.00 37.91 ? 2230 SER A C     1 
ATOM   1326 O  O     . SER A 1 168 ? 25.608 -12.667 4.574  1.00 37.84 ? 2230 SER A O     1 
ATOM   1327 C  CB    . SER A 1 168 ? 26.650 -9.957  4.608  1.00 38.00 ? 2230 SER A CB    1 
ATOM   1328 O  OG    . SER A 1 168 ? 26.356 -9.975  3.219  1.00 38.83 ? 2230 SER A OG    1 
ATOM   1329 N  N     . VAL A 1 169 ? 23.587 -11.665 4.529  1.00 38.05 ? 2231 VAL A N     1 
ATOM   1330 C  CA    . VAL A 1 169 ? 22.904 -12.785 3.898  1.00 38.05 ? 2231 VAL A CA    1 
ATOM   1331 C  C     . VAL A 1 169 ? 22.320 -12.304 2.579  1.00 38.10 ? 2231 VAL A C     1 
ATOM   1332 O  O     . VAL A 1 169 ? 21.438 -11.446 2.566  1.00 38.05 ? 2231 VAL A O     1 
ATOM   1333 C  CB    . VAL A 1 169 ? 21.802 -13.361 4.806  1.00 38.05 ? 2231 VAL A CB    1 
ATOM   1334 C  CG1   . VAL A 1 169 ? 21.101 -14.508 4.120  1.00 38.13 ? 2231 VAL A CG1   1 
ATOM   1335 C  CG2   . VAL A 1 169 ? 22.388 -13.829 6.133  1.00 38.10 ? 2231 VAL A CG2   1 
ATOM   1336 N  N     . ASN A 1 170 ? 22.840 -12.855 1.479  1.00 38.33 ? 2232 ASN A N     1 
ATOM   1337 C  CA    . ASN A 1 170 ? 22.465 -12.466 0.110  1.00 38.48 ? 2232 ASN A CA    1 
ATOM   1338 C  C     . ASN A 1 170 ? 22.388 -10.942 -0.067 1.00 38.33 ? 2232 ASN A C     1 
ATOM   1339 O  O     . ASN A 1 170 ? 21.423 -10.405 -0.616 1.00 38.29 ? 2232 ASN A O     1 
ATOM   1340 C  CB    . ASN A 1 170 ? 21.161 -13.163 -0.313 1.00 38.63 ? 2232 ASN A CB    1 
ATOM   1341 C  CG    . ASN A 1 170 ? 20.826 -12.969 -1.791 1.00 39.59 ? 2232 ASN A CG    1 
ATOM   1342 O  OD1   . ASN A 1 170 ? 21.682 -12.618 -2.608 1.00 40.88 ? 2232 ASN A OD1   1 
ATOM   1343 N  ND2   . ASN A 1 170 ? 19.566 -13.200 -2.136 1.00 40.56 ? 2232 ASN A ND2   1 
ATOM   1344 N  N     . GLY A 1 171 ? 23.414 -10.254 0.426  1.00 38.23 ? 2233 GLY A N     1 
ATOM   1345 C  CA    . GLY A 1 171 ? 23.505 -8.806  0.304  1.00 38.11 ? 2233 GLY A CA    1 
ATOM   1346 C  C     . GLY A 1 171 ? 22.772 -8.037  1.387  1.00 38.10 ? 2233 GLY A C     1 
ATOM   1347 O  O     . GLY A 1 171 ? 22.839 -6.810  1.421  1.00 38.10 ? 2233 GLY A O     1 
ATOM   1348 N  N     . VAL A 1 172 ? 22.079 -8.749  2.275  1.00 38.05 ? 2234 VAL A N     1 
ATOM   1349 C  CA    . VAL A 1 172 ? 21.286 -8.106  3.328  1.00 38.06 ? 2234 VAL A CA    1 
ATOM   1350 C  C     . VAL A 1 172 ? 21.770 -8.500  4.719  1.00 38.17 ? 2234 VAL A C     1 
ATOM   1351 O  O     . VAL A 1 172 ? 22.020 -9.676  4.993  1.00 38.18 ? 2234 VAL A O     1 
ATOM   1352 C  CB    . VAL A 1 172 ? 19.777 -8.452  3.214  1.00 38.04 ? 2234 VAL A CB    1 
ATOM   1353 C  CG1   . VAL A 1 172 ? 18.959 -7.649  4.220  1.00 37.75 ? 2234 VAL A CG1   1 
ATOM   1354 C  CG2   . VAL A 1 172 ? 19.264 -8.207  1.805  1.00 37.86 ? 2234 VAL A CG2   1 
ATOM   1355 N  N     . TYR A 1 173 ? 21.895 -7.506  5.592  1.00 38.28 ? 2235 TYR A N     1 
ATOM   1356 C  CA    . TYR A 1 173 ? 22.212 -7.747  6.991  1.00 38.42 ? 2235 TYR A CA    1 
ATOM   1357 C  C     . TYR A 1 173 ? 21.025 -8.346  7.723  1.00 38.49 ? 2235 TYR A C     1 
ATOM   1358 O  O     . TYR A 1 173 ? 19.924 -7.798  7.686  1.00 38.55 ? 2235 TYR A O     1 
ATOM   1359 C  CB    . TYR A 1 173 ? 22.629 -6.453  7.692  1.00 38.41 ? 2235 TYR A CB    1 
ATOM   1360 C  CG    . TYR A 1 173 ? 24.008 -5.963  7.339  1.00 38.60 ? 2235 TYR A CG    1 
ATOM   1361 C  CD1   . TYR A 1 173 ? 24.222 -4.633  6.991  1.00 39.16 ? 2235 TYR A CD1   1 
ATOM   1362 C  CD2   . TYR A 1 173 ? 25.102 -6.823  7.357  1.00 38.68 ? 2235 TYR A CD2   1 
ATOM   1363 C  CE1   . TYR A 1 173 ? 25.489 -4.170  6.673  1.00 39.02 ? 2235 TYR A CE1   1 
ATOM   1364 C  CE2   . TYR A 1 173 ? 26.370 -6.371  7.035  1.00 39.01 ? 2235 TYR A CE2   1 
ATOM   1365 C  CZ    . TYR A 1 173 ? 26.555 -5.043  6.692  1.00 39.09 ? 2235 TYR A CZ    1 
ATOM   1366 O  OH    . TYR A 1 173 ? 27.811 -4.586  6.368  1.00 40.08 ? 2235 TYR A OH    1 
ATOM   1367 N  N     . ARG A 1 174 ? 21.258 -9.477  8.378  1.00 38.58 ? 2236 ARG A N     1 
ATOM   1368 C  CA    . ARG A 1 174 ? 20.281 -10.066 9.288  1.00 38.67 ? 2236 ARG A CA    1 
ATOM   1369 C  C     . ARG A 1 174 ? 20.990 -10.538 10.552 1.00 39.00 ? 2236 ARG A C     1 
ATOM   1370 O  O     . ARG A 1 174 ? 22.163 -10.926 10.512 1.00 39.11 ? 2236 ARG A O     1 
ATOM   1371 C  CB    . ARG A 1 174 ? 19.537 -11.232 8.640  1.00 38.55 ? 2236 ARG A CB    1 
ATOM   1372 C  CG    . ARG A 1 174 ? 18.823 -10.911 7.338  1.00 38.07 ? 2236 ARG A CG    1 
ATOM   1373 C  CD    . ARG A 1 174 ? 17.606 -11.789 7.192  1.00 37.59 ? 2236 ARG A CD    1 
ATOM   1374 N  NE    . ARG A 1 174 ? 17.563 -12.488 5.914  1.00 37.36 ? 2236 ARG A NE    1 
ATOM   1375 C  CZ    . ARG A 1 174 ? 16.962 -13.659 5.719  1.00 37.10 ? 2236 ARG A CZ    1 
ATOM   1376 N  NH1   . ARG A 1 174 ? 16.349 -14.283 6.719  1.00 36.56 ? 2236 ARG A NH1   1 
ATOM   1377 N  NH2   . ARG A 1 174 ? 16.985 -14.215 4.518  1.00 37.68 ? 2236 ARG A NH2   1 
ATOM   1378 N  N     . ILE A 1 175 ? 20.275 -10.504 11.671 1.00 39.25 ? 2237 ILE A N     1 
ATOM   1379 C  CA    . ILE A 1 175 ? 20.864 -10.820 12.965 1.00 39.44 ? 2237 ILE A CA    1 
ATOM   1380 C  C     . ILE A 1 175 ? 20.504 -12.234 13.384 1.00 39.76 ? 2237 ILE A C     1 
ATOM   1381 O  O     . ILE A 1 175 ? 19.338 -12.617 13.359 1.00 39.83 ? 2237 ILE A O     1 
ATOM   1382 C  CB    . ILE A 1 175 ? 20.425 -9.805  14.043 1.00 39.39 ? 2237 ILE A CB    1 
ATOM   1383 C  CG1   . ILE A 1 175 ? 21.005 -8.422  13.732 1.00 39.21 ? 2237 ILE A CG1   1 
ATOM   1384 C  CG2   . ILE A 1 175 ? 20.855 -10.265 15.439 1.00 39.40 ? 2237 ILE A CG2   1 
ATOM   1385 C  CD1   . ILE A 1 175 ? 20.324 -7.286  14.467 1.00 39.41 ? 2237 ILE A CD1   1 
ATOM   1386 N  N     . GLY A 1 176 ? 21.517 -13.005 13.765 1.00 40.13 ? 2238 GLY A N     1 
ATOM   1387 C  CA    . GLY A 1 176 ? 21.303 -14.358 14.262 1.00 40.65 ? 2238 GLY A CA    1 
ATOM   1388 C  C     . GLY A 1 176 ? 21.892 -14.542 15.645 1.00 41.04 ? 2238 GLY A C     1 
ATOM   1389 O  O     . GLY A 1 176 ? 22.932 -13.958 15.963 1.00 40.97 ? 2238 GLY A O     1 
ATOM   1390 N  N     . LEU A 1 177 ? 21.222 -15.354 16.463 1.00 41.41 ? 2239 LEU A N     1 
ATOM   1391 C  CA    . LEU A 1 177 ? 21.680 -15.662 17.813 1.00 41.88 ? 2239 LEU A CA    1 
ATOM   1392 C  C     . LEU A 1 177 ? 22.584 -16.886 17.808 1.00 42.21 ? 2239 LEU A C     1 
ATOM   1393 O  O     . LEU A 1 177 ? 22.200 -17.938 17.304 1.00 42.26 ? 2239 LEU A O     1 
ATOM   1394 C  CB    . LEU A 1 177 ? 20.489 -15.906 18.743 1.00 41.90 ? 2239 LEU A CB    1 
ATOM   1395 C  CG    . LEU A 1 177 ? 20.793 -16.011 20.243 1.00 41.96 ? 2239 LEU A CG    1 
ATOM   1396 C  CD1   . LEU A 1 177 ? 21.081 -14.629 20.819 1.00 42.11 ? 2239 LEU A CD1   1 
ATOM   1397 C  CD2   . LEU A 1 177 ? 19.665 -16.693 21.008 1.00 40.64 ? 2239 LEU A CD2   1 
ATOM   1398 N  N     . TYR A 1 178 ? 23.783 -16.741 18.369 1.00 42.78 ? 2240 TYR A N     1 
ATOM   1399 C  CA    . TYR A 1 178 ? 24.735 -17.851 18.467 1.00 43.33 ? 2240 TYR A CA    1 
ATOM   1400 C  C     . TYR A 1 178 ? 25.180 -18.083 19.906 1.00 43.55 ? 2240 TYR A C     1 
ATOM   1401 O  O     . TYR A 1 178 ? 25.338 -17.133 20.675 1.00 43.65 ? 2240 TYR A O     1 
ATOM   1402 C  CB    . TYR A 1 178 ? 25.955 -17.601 17.584 1.00 43.39 ? 2240 TYR A CB    1 
ATOM   1403 C  CG    . TYR A 1 178 ? 25.652 -17.514 16.104 1.00 44.35 ? 2240 TYR A CG    1 
ATOM   1404 C  CD1   . TYR A 1 178 ? 26.057 -18.518 15.230 1.00 44.87 ? 2240 TYR A CD1   1 
ATOM   1405 C  CD2   . TYR A 1 178 ? 24.968 -16.418 15.574 1.00 45.14 ? 2240 TYR A CD2   1 
ATOM   1406 C  CE1   . TYR A 1 178 ? 25.784 -18.434 13.868 1.00 45.29 ? 2240 TYR A CE1   1 
ATOM   1407 C  CE2   . TYR A 1 178 ? 24.687 -16.328 14.224 1.00 45.24 ? 2240 TYR A CE2   1 
ATOM   1408 C  CZ    . TYR A 1 178 ? 25.099 -17.333 13.376 1.00 45.81 ? 2240 TYR A CZ    1 
ATOM   1409 O  OH    . TYR A 1 178 ? 24.819 -17.233 12.030 1.00 47.17 ? 2240 TYR A OH    1 
ATOM   1410 N  N     . ALA A 1 179 ? 25.371 -19.353 20.259 1.00 43.82 ? 2241 ALA A N     1 
ATOM   1411 C  CA    . ALA A 1 179 ? 25.870 -19.741 21.576 1.00 44.04 ? 2241 ALA A CA    1 
ATOM   1412 C  C     . ALA A 1 179 ? 27.331 -19.341 21.758 1.00 44.28 ? 2241 ALA A C     1 
ATOM   1413 O  O     . ALA A 1 179 ? 28.122 -19.410 20.818 1.00 44.01 ? 2241 ALA A O     1 
ATOM   1414 C  CB    . ALA A 1 179 ? 25.707 -21.230 21.778 1.00 43.99 ? 2241 ALA A CB    1 
ATOM   1415 N  N     . LEU A 1 180 ? 27.667 -18.910 22.972 1.00 44.80 ? 2242 LEU A N     1 
ATOM   1416 C  CA    . LEU A 1 180 ? 29.034 -18.528 23.333 1.00 45.41 ? 2242 LEU A CA    1 
ATOM   1417 C  C     . LEU A 1 180 ? 29.777 -19.655 24.054 1.00 46.07 ? 2242 LEU A C     1 
ATOM   1418 O  O     . LEU A 1 180 ? 31.014 -19.683 24.060 1.00 46.23 ? 2242 LEU A O     1 
ATOM   1419 C  CB    . LEU A 1 180 ? 29.025 -17.282 24.224 1.00 45.27 ? 2242 LEU A CB    1 
ATOM   1420 C  CG    . LEU A 1 180 ? 28.626 -15.930 23.628 1.00 44.96 ? 2242 LEU A CG    1 
ATOM   1421 C  CD1   . LEU A 1 180 ? 28.340 -14.926 24.738 1.00 43.90 ? 2242 LEU A CD1   1 
ATOM   1422 C  CD2   . LEU A 1 180 ? 29.700 -15.402 22.677 1.00 44.24 ? 2242 LEU A CD2   1 
ATOM   1423 N  N     . LYS A 1 181 ? 29.013 -20.566 24.664 1.00 46.65 ? 2243 LYS A N     1 
ATOM   1424 C  CA    . LYS A 1 181 ? 29.547 -21.690 25.441 1.00 47.19 ? 2243 LYS A CA    1 
ATOM   1425 C  C     . LYS A 1 181 ? 28.635 -22.917 25.344 1.00 47.47 ? 2243 LYS A C     1 
ATOM   1426 O  O     . LYS A 1 181 ? 27.560 -22.852 24.746 1.00 47.61 ? 2243 LYS A O     1 
ATOM   1427 C  CB    . LYS A 1 181 ? 29.728 -21.283 26.910 1.00 47.29 ? 2243 LYS A CB    1 
ATOM   1428 C  CG    . LYS A 1 181 ? 28.422 -20.964 27.649 1.00 47.80 ? 2243 LYS A CG    1 
ATOM   1429 C  CD    . LYS A 1 181 ? 28.670 -20.405 29.050 1.00 48.51 ? 2243 LYS A CD    1 
ATOM   1430 C  CE    . LYS A 1 181 ? 29.072 -18.930 29.015 1.00 49.06 ? 2243 LYS A CE    1 
ATOM   1431 N  NZ    . LYS A 1 181 ? 29.229 -18.349 30.381 1.00 49.46 ? 2243 LYS A NZ    1 
ATOM   1432 N  N     . ASP A 1 182 ? 29.066 -24.032 25.929 1.00 47.71 ? 2244 ASP A N     1 
ATOM   1433 C  CA    . ASP A 1 182 ? 28.209 -25.209 26.040 1.00 48.02 ? 2244 ASP A CA    1 
ATOM   1434 C  C     . ASP A 1 182 ? 27.091 -24.929 27.038 1.00 48.14 ? 2244 ASP A C     1 
ATOM   1435 O  O     . ASP A 1 182 ? 27.316 -24.296 28.070 1.00 48.25 ? 2244 ASP A O     1 
ATOM   1436 C  CB    . ASP A 1 182 ? 29.010 -26.436 26.485 1.00 48.13 ? 2244 ASP A CB    1 
ATOM   1437 C  CG    . ASP A 1 182 ? 30.012 -26.898 25.442 1.00 48.68 ? 2244 ASP A CG    1 
ATOM   1438 O  OD1   . ASP A 1 182 ? 29.603 -27.219 24.304 1.00 49.27 ? 2244 ASP A OD1   1 
ATOM   1439 O  OD2   . ASP A 1 182 ? 31.216 -26.956 25.767 1.00 49.71 ? 2244 ASP A OD2   1 
ATOM   1440 N  N     . MET A 1 183 ? 25.886 -25.391 26.722 1.00 48.35 ? 2245 MET A N     1 
ATOM   1441 C  CA    . MET A 1 183 ? 24.734 -25.208 27.604 1.00 48.51 ? 2245 MET A CA    1 
ATOM   1442 C  C     . MET A 1 183 ? 23.980 -26.518 27.770 1.00 48.58 ? 2245 MET A C     1 
ATOM   1443 O  O     . MET A 1 183 ? 23.660 -27.174 26.784 1.00 48.70 ? 2245 MET A O     1 
ATOM   1444 C  CB    . MET A 1 183 ? 23.791 -24.147 27.049 1.00 48.52 ? 2245 MET A CB    1 
ATOM   1445 C  CG    . MET A 1 183 ? 24.379 -22.749 26.971 1.00 49.05 ? 2245 MET A CG    1 
ATOM   1446 S  SD    . MET A 1 183 ? 23.311 -21.599 26.080 1.00 50.48 ? 2245 MET A SD    1 
ATOM   1447 C  CE    . MET A 1 183 ? 21.821 -21.700 27.073 1.00 50.56 ? 2245 MET A CE    1 
ATOM   1448 N  N     . PRO A 1 184 ? 23.707 -26.916 29.020 1.00 48.68 ? 2246 PRO A N     1 
ATOM   1449 C  CA    . PRO A 1 184 ? 22.934 -28.135 29.240 1.00 48.77 ? 2246 PRO A CA    1 
ATOM   1450 C  C     . PRO A 1 184 ? 21.418 -27.892 29.247 1.00 48.76 ? 2246 PRO A C     1 
ATOM   1451 O  O     . PRO A 1 184 ? 20.974 -26.756 29.427 1.00 48.74 ? 2246 PRO A O     1 
ATOM   1452 C  CB    . PRO A 1 184 ? 23.423 -28.615 30.612 1.00 48.74 ? 2246 PRO A CB    1 
ATOM   1453 C  CG    . PRO A 1 184 ? 23.898 -27.389 31.311 1.00 48.68 ? 2246 PRO A CG    1 
ATOM   1454 C  CD    . PRO A 1 184 ? 24.226 -26.345 30.278 1.00 48.80 ? 2246 PRO A CD    1 
ATOM   1455 N  N     . ALA A 1 185 ? 20.647 -28.961 29.052 1.00 48.72 ? 2247 ALA A N     1 
ATOM   1456 C  CA    . ALA A 1 185 ? 19.180 -28.913 29.067 1.00 48.79 ? 2247 ALA A CA    1 
ATOM   1457 C  C     . ALA A 1 185 ? 18.607 -28.146 30.257 1.00 48.74 ? 2247 ALA A C     1 
ATOM   1458 O  O     . ALA A 1 185 ? 19.090 -28.276 31.384 1.00 48.86 ? 2247 ALA A O     1 
ATOM   1459 C  CB    . ALA A 1 185 ? 18.608 -30.327 29.037 1.00 48.84 ? 2247 ALA A CB    1 
ATOM   1460 N  N     . GLY A 1 186 ? 17.577 -27.347 29.994 1.00 48.72 ? 2248 GLY A N     1 
ATOM   1461 C  CA    . GLY A 1 186 ? 16.901 -26.575 31.036 1.00 48.80 ? 2248 GLY A CA    1 
ATOM   1462 C  C     . GLY A 1 186 ? 17.406 -25.151 31.225 1.00 48.90 ? 2248 GLY A C     1 
ATOM   1463 O  O     . GLY A 1 186 ? 16.707 -24.328 31.820 1.00 48.81 ? 2248 GLY A O     1 
ATOM   1464 N  N     . THR A 1 187 ? 18.609 -24.858 30.720 1.00 48.89 ? 2249 THR A N     1 
ATOM   1465 C  CA    . THR A 1 187 ? 19.240 -23.545 30.912 1.00 48.93 ? 2249 THR A CA    1 
ATOM   1466 C  C     . THR A 1 187 ? 18.657 -22.454 30.018 1.00 48.90 ? 2249 THR A C     1 
ATOM   1467 O  O     . THR A 1 187 ? 18.457 -22.649 28.817 1.00 48.80 ? 2249 THR A O     1 
ATOM   1468 C  CB    . THR A 1 187 ? 20.781 -23.582 30.736 1.00 48.98 ? 2249 THR A CB    1 
ATOM   1469 O  OG1   . THR A 1 187 ? 21.119 -24.190 29.486 1.00 49.15 ? 2249 THR A OG1   1 
ATOM   1470 C  CG2   . THR A 1 187 ? 21.442 -24.358 31.872 1.00 49.53 ? 2249 THR A CG2   1 
ATOM   1471 N  N     . GLU A 1 188 ? 18.398 -21.305 30.635 1.00 48.91 ? 2250 GLU A N     1 
ATOM   1472 C  CA    . GLU A 1 188 ? 17.802 -20.143 29.986 1.00 48.95 ? 2250 GLU A CA    1 
ATOM   1473 C  C     . GLU A 1 188 ? 18.776 -19.450 29.029 1.00 48.88 ? 2250 GLU A C     1 
ATOM   1474 O  O     . GLU A 1 188 ? 19.969 -19.343 29.318 1.00 48.84 ? 2250 GLU A O     1 
ATOM   1475 C  CB    . GLU A 1 188 ? 17.327 -19.163 31.062 1.00 48.91 ? 2250 GLU A CB    1 
ATOM   1476 C  CG    . GLU A 1 188 ? 16.743 -17.862 30.540 1.00 49.55 ? 2250 GLU A CG    1 
ATOM   1477 C  CD    . GLU A 1 188 ? 16.503 -16.838 31.635 1.00 50.26 ? 2250 GLU A CD    1 
ATOM   1478 O  OE1   . GLU A 1 188 ? 16.970 -17.049 32.776 1.00 50.68 ? 2250 GLU A OE1   1 
ATOM   1479 O  OE2   . GLU A 1 188 ? 15.849 -15.811 31.350 1.00 50.47 ? 2250 GLU A OE2   1 
ATOM   1480 N  N     . LEU A 1 189 ? 18.260 -18.985 27.893 1.00 48.80 ? 2251 LEU A N     1 
ATOM   1481 C  CA    . LEU A 1 189 ? 19.060 -18.222 26.938 1.00 48.90 ? 2251 LEU A CA    1 
ATOM   1482 C  C     . LEU A 1 189 ? 19.177 -16.760 27.373 1.00 49.07 ? 2251 LEU A C     1 
ATOM   1483 O  O     . LEU A 1 189 ? 18.192 -16.157 27.806 1.00 49.18 ? 2251 LEU A O     1 
ATOM   1484 C  CB    . LEU A 1 189 ? 18.452 -18.287 25.534 1.00 48.80 ? 2251 LEU A CB    1 
ATOM   1485 C  CG    . LEU A 1 189 ? 18.308 -19.595 24.748 1.00 48.49 ? 2251 LEU A CG    1 
ATOM   1486 C  CD1   . LEU A 1 189 ? 17.875 -19.266 23.333 1.00 48.26 ? 2251 LEU A CD1   1 
ATOM   1487 C  CD2   . LEU A 1 189 ? 19.587 -20.402 24.711 1.00 48.20 ? 2251 LEU A CD2   1 
ATOM   1488 N  N     . THR A 1 190 ? 20.380 -16.197 27.253 1.00 49.10 ? 2252 THR A N     1 
ATOM   1489 C  CA    . THR A 1 190 ? 20.633 -14.799 27.613 1.00 49.15 ? 2252 THR A CA    1 
ATOM   1490 C  C     . THR A 1 190 ? 21.664 -14.163 26.692 1.00 49.42 ? 2252 THR A C     1 
ATOM   1491 O  O     . THR A 1 190 ? 22.586 -14.838 26.234 1.00 49.65 ? 2252 THR A O     1 
ATOM   1492 C  CB    . THR A 1 190 ? 21.192 -14.661 29.042 1.00 49.03 ? 2252 THR A CB    1 
ATOM   1493 O  OG1   . THR A 1 190 ? 22.384 -15.445 29.168 1.00 48.78 ? 2252 THR A OG1   1 
ATOM   1494 C  CG2   . THR A 1 190 ? 20.176 -15.084 30.095 1.00 48.90 ? 2252 THR A CG2   1 
ATOM   1495 N  N     . TYR A 1 191 ? 21.516 -12.865 26.437 1.00 49.63 ? 2253 TYR A N     1 
ATOM   1496 C  CA    . TYR A 1 191 ? 22.557 -12.088 25.759 1.00 49.99 ? 2253 TYR A CA    1 
ATOM   1497 C  C     . TYR A 1 191 ? 22.728 -10.702 26.391 1.00 50.43 ? 2253 TYR A C     1 
ATOM   1498 O  O     . TYR A 1 191 ? 21.882 -10.266 27.177 1.00 50.36 ? 2253 TYR A O     1 
ATOM   1499 C  CB    . TYR A 1 191 ? 22.299 -11.998 24.249 1.00 49.78 ? 2253 TYR A CB    1 
ATOM   1500 C  CG    . TYR A 1 191 ? 21.088 -11.190 23.859 1.00 49.47 ? 2253 TYR A CG    1 
ATOM   1501 C  CD1   . TYR A 1 191 ? 21.207 -9.848  23.516 1.00 49.15 ? 2253 TYR A CD1   1 
ATOM   1502 C  CD2   . TYR A 1 191 ? 19.821 -11.768 23.821 1.00 49.50 ? 2253 TYR A CD2   1 
ATOM   1503 C  CE1   . TYR A 1 191 ? 20.096 -9.100  23.152 1.00 49.19 ? 2253 TYR A CE1   1 
ATOM   1504 C  CE2   . TYR A 1 191 ? 18.703 -11.026 23.463 1.00 49.21 ? 2253 TYR A CE2   1 
ATOM   1505 C  CZ    . TYR A 1 191 ? 18.850 -9.696  23.127 1.00 49.04 ? 2253 TYR A CZ    1 
ATOM   1506 O  OH    . TYR A 1 191 ? 17.750 -8.956  22.767 1.00 49.43 ? 2253 TYR A OH    1 
ATOM   1507 N  N     . ASP A 1 192 ? 23.825 -10.027 26.050 1.00 51.05 ? 2254 ASP A N     1 
ATOM   1508 C  CA    . ASP A 1 192 ? 24.120 -8.692  26.573 1.00 51.89 ? 2254 ASP A CA    1 
ATOM   1509 C  C     . ASP A 1 192 ? 23.436 -7.601  25.746 1.00 52.45 ? 2254 ASP A C     1 
ATOM   1510 O  O     . ASP A 1 192 ? 23.834 -7.329  24.616 1.00 52.48 ? 2254 ASP A O     1 
ATOM   1511 C  CB    . ASP A 1 192 ? 25.639 -8.456  26.636 1.00 51.94 ? 2254 ASP A CB    1 
ATOM   1512 C  CG    . ASP A 1 192 ? 26.016 -7.217  27.443 1.00 52.27 ? 2254 ASP A CG    1 
ATOM   1513 O  OD1   . ASP A 1 192 ? 25.424 -6.986  28.521 1.00 52.90 ? 2254 ASP A OD1   1 
ATOM   1514 O  OD2   . ASP A 1 192 ? 26.919 -6.472  27.005 1.00 52.56 ? 2254 ASP A OD2   1 
ATOM   1515 N  N     . TYR A 1 193 ? 22.409 -6.985  26.329 1.00 53.34 ? 2255 TYR A N     1 
ATOM   1516 C  CA    . TYR A 1 193 ? 21.619 -5.943  25.674 1.00 54.23 ? 2255 TYR A CA    1 
ATOM   1517 C  C     . TYR A 1 193 ? 22.456 -4.725  25.274 1.00 55.30 ? 2255 TYR A C     1 
ATOM   1518 O  O     . TYR A 1 193 ? 22.414 -4.305  24.115 1.00 55.38 ? 2255 TYR A O     1 
ATOM   1519 C  CB    . TYR A 1 193 ? 20.455 -5.502  26.574 1.00 53.93 ? 2255 TYR A CB    1 
ATOM   1520 C  CG    . TYR A 1 193 ? 19.252 -6.434  26.615 1.00 53.47 ? 2255 TYR A CG    1 
ATOM   1521 C  CD1   . TYR A 1 193 ? 18.008 -5.969  27.041 1.00 53.07 ? 2255 TYR A CD1   1 
ATOM   1522 C  CD2   . TYR A 1 193 ? 19.350 -7.774  26.232 1.00 53.43 ? 2255 TYR A CD2   1 
ATOM   1523 C  CE1   . TYR A 1 193 ? 16.894 -6.813  27.093 1.00 52.78 ? 2255 TYR A CE1   1 
ATOM   1524 C  CE2   . TYR A 1 193 ? 18.239 -8.626  26.277 1.00 53.09 ? 2255 TYR A CE2   1 
ATOM   1525 C  CZ    . TYR A 1 193 ? 17.019 -8.138  26.711 1.00 52.75 ? 2255 TYR A CZ    1 
ATOM   1526 O  OH    . TYR A 1 193 ? 15.925 -8.973  26.756 1.00 52.27 ? 2255 TYR A OH    1 
ATOM   1527 N  N     . ASN A 1 194 ? 23.220 -4.179  26.225 1.00 56.55 ? 2256 ASN A N     1 
ATOM   1528 C  CA    . ASN A 1 194 ? 23.984 -2.929  26.037 1.00 57.80 ? 2256 ASN A CA    1 
ATOM   1529 C  C     . ASN A 1 194 ? 24.664 -2.778  24.671 1.00 58.53 ? 2256 ASN A C     1 
ATOM   1530 O  O     . ASN A 1 194 ? 24.722 -1.675  24.122 1.00 58.71 ? 2256 ASN A O     1 
ATOM   1531 C  CB    . ASN A 1 194 ? 25.008 -2.727  27.167 1.00 57.87 ? 2256 ASN A CB    1 
ATOM   1532 C  CG    . ASN A 1 194 ? 24.365 -2.270  28.486 1.00 58.56 ? 2256 ASN A CG    1 
ATOM   1533 O  OD1   . ASN A 1 194 ? 23.351 -2.820  28.934 1.00 58.85 ? 2256 ASN A OD1   1 
ATOM   1534 N  ND2   . ASN A 1 194 ? 24.974 -1.272  29.122 1.00 58.82 ? 2256 ASN A ND2   1 
ATOM   1535 N  N     . PHE A 1 195 ? 25.170 -3.888  24.139 1.00 59.51 ? 2257 PHE A N     1 
ATOM   1536 C  CA    . PHE A 1 195 ? 25.745 -3.949  22.798 1.00 60.67 ? 2257 PHE A CA    1 
ATOM   1537 C  C     . PHE A 1 195 ? 24.739 -3.556  21.708 1.00 61.31 ? 2257 PHE A C     1 
ATOM   1538 O  O     . PHE A 1 195 ? 25.011 -2.682  20.881 1.00 61.30 ? 2257 PHE A O     1 
ATOM   1539 C  CB    . PHE A 1 195 ? 26.210 -5.382  22.497 1.00 60.81 ? 2257 PHE A CB    1 
ATOM   1540 C  CG    . PHE A 1 195 ? 27.639 -5.676  22.873 1.00 61.52 ? 2257 PHE A CG    1 
ATOM   1541 C  CD1   . PHE A 1 195 ? 27.936 -6.339  24.065 1.00 62.00 ? 2257 PHE A CD1   1 
ATOM   1542 C  CD2   . PHE A 1 195 ? 28.687 -5.343  22.007 1.00 61.83 ? 2257 PHE A CD2   1 
ATOM   1543 C  CE1   . PHE A 1 195 ? 29.256 -6.638  24.411 1.00 62.27 ? 2257 PHE A CE1   1 
ATOM   1544 C  CE2   . PHE A 1 195 ? 30.012 -5.636  22.339 1.00 61.99 ? 2257 PHE A CE2   1 
ATOM   1545 C  CZ    . PHE A 1 195 ? 30.297 -6.286  23.546 1.00 62.55 ? 2257 PHE A CZ    1 
ATOM   1546 N  N     . HIS A 1 196 ? 23.577 -4.209  21.723 1.00 62.19 ? 2258 HIS A N     1 
ATOM   1547 C  CA    . HIS A 1 196 ? 22.666 -4.225  20.577 1.00 63.06 ? 2258 HIS A CA    1 
ATOM   1548 C  C     . HIS A 1 196 ? 21.427 -3.348  20.742 1.00 63.57 ? 2258 HIS A C     1 
ATOM   1549 O  O     . HIS A 1 196 ? 20.916 -2.806  19.763 1.00 63.68 ? 2258 HIS A O     1 
ATOM   1550 C  CB    . HIS A 1 196 ? 22.224 -5.661  20.272 1.00 63.02 ? 2258 HIS A CB    1 
ATOM   1551 C  CG    . HIS A 1 196 ? 23.269 -6.693  20.562 1.00 63.40 ? 2258 HIS A CG    1 
ATOM   1552 N  ND1   . HIS A 1 196 ? 23.253 -7.466  21.704 1.00 63.42 ? 2258 HIS A ND1   1 
ATOM   1553 C  CD2   . HIS A 1 196 ? 24.363 -7.079  19.862 1.00 63.87 ? 2258 HIS A CD2   1 
ATOM   1554 C  CE1   . HIS A 1 196 ? 24.289 -8.287  21.693 1.00 63.80 ? 2258 HIS A CE1   1 
ATOM   1555 N  NE2   . HIS A 1 196 ? 24.980 -8.071  20.587 1.00 64.33 ? 2258 HIS A NE2   1 
ATOM   1556 N  N     . MET A 1 197 ? 20.942 -3.224  21.973 1.00 64.32 ? 2259 MET A N     1 
ATOM   1557 C  CA    . MET A 1 197 ? 19.697 -2.504  22.242 1.00 65.10 ? 2259 MET A CA    1 
ATOM   1558 C  C     . MET A 1 197 ? 19.862 -1.007  21.982 1.00 65.49 ? 2259 MET A C     1 
ATOM   1559 O  O     . MET A 1 197 ? 20.802 -0.383  22.480 1.00 65.53 ? 2259 MET A O     1 
ATOM   1560 C  CB    . MET A 1 197 ? 19.228 -2.760  23.680 1.00 65.10 ? 2259 MET A CB    1 
ATOM   1561 C  CG    . MET A 1 197 ? 17.827 -3.361  23.779 1.00 65.56 ? 2259 MET A CG    1 
ATOM   1562 S  SD    . MET A 1 197 ? 17.737 -5.022  23.057 1.00 66.52 ? 2259 MET A SD    1 
ATOM   1563 C  CE    . MET A 1 197 ? 16.119 -5.577  23.589 1.00 66.14 ? 2259 MET A CE    1 
ATOM   1564 N  N     . PHE A 1 198 ? 18.952 -0.447  21.187 1.00 66.07 ? 2260 PHE A N     1 
ATOM   1565 C  CA    . PHE A 1 198 ? 18.990 0.973   20.833 1.00 66.68 ? 2260 PHE A CA    1 
ATOM   1566 C  C     . PHE A 1 198 ? 18.846 1.851   22.074 1.00 66.82 ? 2260 PHE A C     1 
ATOM   1567 O  O     . PHE A 1 198 ? 17.874 1.722   22.825 1.00 66.87 ? 2260 PHE A O     1 
ATOM   1568 C  CB    . PHE A 1 198 ? 17.908 1.309   19.795 1.00 66.82 ? 2260 PHE A CB    1 
ATOM   1569 C  CG    . PHE A 1 198 ? 17.782 2.784   19.494 1.00 67.75 ? 2260 PHE A CG    1 
ATOM   1570 C  CD1   . PHE A 1 198 ? 18.718 3.429   18.682 1.00 68.42 ? 2260 PHE A CD1   1 
ATOM   1571 C  CD2   . PHE A 1 198 ? 16.723 3.530   20.020 1.00 68.52 ? 2260 PHE A CD2   1 
ATOM   1572 C  CE1   . PHE A 1 198 ? 18.605 4.794   18.404 1.00 68.69 ? 2260 PHE A CE1   1 
ATOM   1573 C  CE2   . PHE A 1 198 ? 16.601 4.894   19.748 1.00 68.67 ? 2260 PHE A CE2   1 
ATOM   1574 C  CZ    . PHE A 1 198 ? 17.545 5.527   18.939 1.00 68.93 ? 2260 PHE A CZ    1 
ATOM   1575 N  N     . ASN A 1 199 ? 19.823 2.734   22.279 1.00 66.98 ? 2261 ASN A N     1 
ATOM   1576 C  CA    . ASN A 1 199 ? 19.845 3.623   23.443 1.00 67.11 ? 2261 ASN A CA    1 
ATOM   1577 C  C     . ASN A 1 199 ? 18.531 4.388   23.655 1.00 66.98 ? 2261 ASN A C     1 
ATOM   1578 O  O     . ASN A 1 199 ? 18.202 5.319   22.913 1.00 67.04 ? 2261 ASN A O     1 
ATOM   1579 C  CB    . ASN A 1 199 ? 21.052 4.581   23.391 1.00 67.20 ? 2261 ASN A CB    1 
ATOM   1580 C  CG    . ASN A 1 199 ? 21.057 5.465   22.147 1.00 67.59 ? 2261 ASN A CG    1 
ATOM   1581 O  OD1   . ASN A 1 199 ? 21.251 4.986   21.026 1.00 68.21 ? 2261 ASN A OD1   1 
ATOM   1582 N  ND2   . ASN A 1 199 ? 20.847 6.764   22.345 1.00 67.64 ? 2261 ASN A ND2   1 
ATOM   1583 N  N     . VAL A 1 200 ? 17.776 3.951   24.659 1.00 66.79 ? 2262 VAL A N     1 
ATOM   1584 C  CA    . VAL A 1 200 ? 16.563 4.636   25.095 1.00 66.61 ? 2262 VAL A CA    1 
ATOM   1585 C  C     . VAL A 1 200 ? 16.847 5.266   26.458 1.00 66.50 ? 2262 VAL A C     1 
ATOM   1586 O  O     . VAL A 1 200 ? 17.477 4.635   27.315 1.00 66.60 ? 2262 VAL A O     1 
ATOM   1587 C  CB    . VAL A 1 200 ? 15.360 3.655   25.189 1.00 66.65 ? 2262 VAL A CB    1 
ATOM   1588 C  CG1   . VAL A 1 200 ? 14.125 4.335   25.789 1.00 66.54 ? 2262 VAL A CG1   1 
ATOM   1589 C  CG2   . VAL A 1 200 ? 15.032 3.071   23.816 1.00 66.58 ? 2262 VAL A CG2   1 
ATOM   1590 N  N     . GLU A 1 201 ? 16.390 6.504   26.653 1.00 66.18 ? 2263 GLU A N     1 
ATOM   1591 C  CA    . GLU A 1 201 ? 16.569 7.228   27.923 1.00 65.80 ? 2263 GLU A CA    1 
ATOM   1592 C  C     . GLU A 1 201 ? 16.311 6.395   29.199 1.00 65.37 ? 2263 GLU A C     1 
ATOM   1593 O  O     . GLU A 1 201 ? 16.962 6.615   30.229 1.00 65.43 ? 2263 GLU A O     1 
ATOM   1594 C  CB    . GLU A 1 201 ? 15.756 8.544   27.925 1.00 65.85 ? 2263 GLU A CB    1 
ATOM   1595 C  CG    . GLU A 1 201 ? 15.098 8.915   29.271 1.00 66.30 ? 2263 GLU A CG    1 
ATOM   1596 C  CD    . GLU A 1 201 ? 15.420 10.330  29.758 1.00 66.69 ? 2263 GLU A CD    1 
ATOM   1597 O  OE1   . GLU A 1 201 ? 15.728 11.218  28.930 1.00 66.81 ? 2263 GLU A OE1   1 
ATOM   1598 O  OE2   . GLU A 1 201 ? 15.361 10.551  30.989 1.00 66.56 ? 2263 GLU A OE2   1 
ATOM   1599 N  N     . LYS A 1 202 ? 15.394 5.429   29.111 1.00 64.63 ? 2264 LYS A N     1 
ATOM   1600 C  CA    . LYS A 1 202 ? 14.989 4.615   30.267 1.00 63.88 ? 2264 LYS A CA    1 
ATOM   1601 C  C     . LYS A 1 202 ? 15.993 3.526   30.669 1.00 63.12 ? 2264 LYS A C     1 
ATOM   1602 O  O     . LYS A 1 202 ? 16.595 2.870   29.813 1.00 63.08 ? 2264 LYS A O     1 
ATOM   1603 C  CB    . LYS A 1 202 ? 13.597 4.007   30.042 1.00 64.02 ? 2264 LYS A CB    1 
ATOM   1604 C  CG    . LYS A 1 202 ? 12.476 5.038   29.851 1.00 64.46 ? 2264 LYS A CG    1 
ATOM   1605 C  CD    . LYS A 1 202 ? 12.218 5.861   31.120 1.00 65.29 ? 2264 LYS A CD    1 
ATOM   1606 C  CE    . LYS A 1 202 ? 11.365 7.099   30.834 1.00 65.53 ? 2264 LYS A CE    1 
ATOM   1607 N  NZ    . LYS A 1 202 ? 9.930  6.775   30.567 1.00 65.59 ? 2264 LYS A NZ    1 
ATOM   1608 N  N     . GLN A 1 203 ? 16.156 3.353   31.981 1.00 62.10 ? 2265 GLN A N     1 
ATOM   1609 C  CA    . GLN A 1 203 ? 17.032 2.331   32.561 1.00 61.14 ? 2265 GLN A CA    1 
ATOM   1610 C  C     . GLN A 1 203 ? 16.243 1.361   33.434 1.00 60.40 ? 2265 GLN A C     1 
ATOM   1611 O  O     . GLN A 1 203 ? 15.196 1.715   33.985 1.00 60.27 ? 2265 GLN A O     1 
ATOM   1612 C  CB    . GLN A 1 203 ? 18.138 2.978   33.394 1.00 61.16 ? 2265 GLN A CB    1 
ATOM   1613 C  CG    . GLN A 1 203 ? 19.203 3.690   32.580 1.00 61.30 ? 2265 GLN A CG    1 
ATOM   1614 C  CD    . GLN A 1 203 ? 20.197 4.449   33.443 1.00 61.42 ? 2265 GLN A CD    1 
ATOM   1615 O  OE1   . GLN A 1 203 ? 19.876 4.876   34.555 1.00 61.71 ? 2265 GLN A OE1   1 
ATOM   1616 N  NE2   . GLN A 1 203 ? 21.410 4.627   32.929 1.00 61.24 ? 2265 GLN A NE2   1 
ATOM   1617 N  N     . GLN A 1 204 ? 16.754 0.139   33.561 1.00 59.43 ? 2266 GLN A N     1 
ATOM   1618 C  CA    . GLN A 1 204 ? 16.086 -0.906  34.333 1.00 58.60 ? 2266 GLN A CA    1 
ATOM   1619 C  C     . GLN A 1 204 ? 17.052 -1.695  35.206 1.00 57.85 ? 2266 GLN A C     1 
ATOM   1620 O  O     . GLN A 1 204 ? 18.167 -2.009  34.787 1.00 57.80 ? 2266 GLN A O     1 
ATOM   1621 C  CB    . GLN A 1 204 ? 15.346 -1.871  33.405 1.00 58.78 ? 2266 GLN A CB    1 
ATOM   1622 C  CG    . GLN A 1 204 ? 14.106 -1.291  32.756 1.00 59.18 ? 2266 GLN A CG    1 
ATOM   1623 C  CD    . GLN A 1 204 ? 13.183 -2.357  32.207 1.00 59.95 ? 2266 GLN A CD    1 
ATOM   1624 O  OE1   . GLN A 1 204 ? 12.814 -2.328  31.032 1.00 60.43 ? 2266 GLN A OE1   1 
ATOM   1625 N  NE2   . GLN A 1 204 ? 12.801 -3.306  33.057 1.00 59.91 ? 2266 GLN A NE2   1 
ATOM   1626 N  N     . LEU A 1 205 ? 16.605 -2.020  36.417 1.00 56.93 ? 2267 LEU A N     1 
ATOM   1627 C  CA    . LEU A 1 205 ? 17.381 -2.839  37.342 1.00 56.02 ? 2267 LEU A CA    1 
ATOM   1628 C  C     . LEU A 1 205 ? 17.648 -4.212  36.742 1.00 55.39 ? 2267 LEU A C     1 
ATOM   1629 O  O     . LEU A 1 205 ? 16.768 -4.803  36.112 1.00 55.29 ? 2267 LEU A O     1 
ATOM   1630 C  CB    . LEU A 1 205 ? 16.645 -2.991  38.678 1.00 56.05 ? 2267 LEU A CB    1 
ATOM   1631 C  CG    . LEU A 1 205 ? 16.482 -1.756  39.571 1.00 55.89 ? 2267 LEU A CG    1 
ATOM   1632 C  CD1   . LEU A 1 205 ? 15.354 -1.952  40.571 1.00 55.66 ? 2267 LEU A CD1   1 
ATOM   1633 C  CD2   . LEU A 1 205 ? 17.784 -1.407  40.286 1.00 55.79 ? 2267 LEU A CD2   1 
ATOM   1634 N  N     . CYS A 1 206 ? 18.867 -4.704  36.934 1.00 54.63 ? 2268 CYS A N     1 
ATOM   1635 C  CA    . CYS A 1 206 ? 19.251 -6.019  36.435 1.00 53.86 ? 2268 CYS A CA    1 
ATOM   1636 C  C     . CYS A 1 206 ? 19.036 -7.103  37.486 1.00 53.65 ? 2268 CYS A C     1 
ATOM   1637 O  O     . CYS A 1 206 ? 19.590 -7.043  38.588 1.00 53.55 ? 2268 CYS A O     1 
ATOM   1638 C  CB    . CYS A 1 206 ? 20.703 -6.022  35.956 1.00 53.77 ? 2268 CYS A CB    1 
ATOM   1639 S  SG    . CYS A 1 206 ? 21.213 -7.565  35.184 1.00 52.53 ? 2268 CYS A SG    1 
ATOM   1640 N  N     . LYS A 1 207 ? 18.221 -8.089  37.127 1.00 53.27 ? 2269 LYS A N     1 
ATOM   1641 C  CA    . LYS A 1 207 ? 17.956 -9.239  37.975 1.00 53.02 ? 2269 LYS A CA    1 
ATOM   1642 C  C     . LYS A 1 207 ? 18.544 -10.515 37.371 1.00 52.79 ? 2269 LYS A C     1 
ATOM   1643 O  O     . LYS A 1 207 ? 18.004 -11.604 37.581 1.00 52.68 ? 2269 LYS A O     1 
ATOM   1644 C  CB    . LYS A 1 207 ? 16.444 -9.412  38.191 1.00 53.06 ? 2269 LYS A CB    1 
ATOM   1645 C  CG    . LYS A 1 207 ? 15.717 -8.197  38.761 1.00 53.21 ? 2269 LYS A CG    1 
ATOM   1646 C  CD    . LYS A 1 207 ? 15.953 -8.021  40.262 1.00 53.52 ? 2269 LYS A CD    1 
ATOM   1647 C  CE    . LYS A 1 207 ? 15.225 -6.788  40.792 1.00 53.13 ? 2269 LYS A CE    1 
ATOM   1648 N  NZ    . LYS A 1 207 ? 15.639 -6.432  42.177 1.00 52.64 ? 2269 LYS A NZ    1 
ATOM   1649 N  N     . CYS A 1 208 ? 19.644 -10.387 36.626 1.00 52.65 ? 2270 CYS A N     1 
ATOM   1650 C  CA    . CYS A 1 208 ? 20.281 -11.559 36.012 1.00 52.60 ? 2270 CYS A CA    1 
ATOM   1651 C  C     . CYS A 1 208 ? 20.902 -12.483 37.059 1.00 52.95 ? 2270 CYS A C     1 
ATOM   1652 O  O     . CYS A 1 208 ? 21.056 -13.679 36.823 1.00 52.91 ? 2270 CYS A O     1 
ATOM   1653 C  CB    . CYS A 1 208 ? 21.295 -11.168 34.923 1.00 52.44 ? 2270 CYS A CB    1 
ATOM   1654 S  SG    . CYS A 1 208 ? 22.907 -10.538 35.465 1.00 51.11 ? 2270 CYS A SG    1 
ATOM   1655 N  N     . GLY A 1 209 ? 21.236 -11.919 38.219 1.00 53.40 ? 2271 GLY A N     1 
ATOM   1656 C  CA    . GLY A 1 209 ? 21.724 -12.693 39.359 1.00 53.98 ? 2271 GLY A CA    1 
ATOM   1657 C  C     . GLY A 1 209 ? 23.096 -13.284 39.120 1.00 54.28 ? 2271 GLY A C     1 
ATOM   1658 O  O     . GLY A 1 209 ? 23.278 -14.501 39.163 1.00 54.33 ? 2271 GLY A O     1 
ATOM   1659 N  N     . PHE A 1 210 ? 24.058 -12.406 38.872 1.00 54.60 ? 2272 PHE A N     1 
ATOM   1660 C  CA    . PHE A 1 210 ? 25.417 -12.798 38.546 1.00 54.94 ? 2272 PHE A CA    1 
ATOM   1661 C  C     . PHE A 1 210 ? 26.358 -12.074 39.503 1.00 55.37 ? 2272 PHE A C     1 
ATOM   1662 O  O     . PHE A 1 210 ? 26.086 -10.940 39.899 1.00 55.32 ? 2272 PHE A O     1 
ATOM   1663 C  CB    . PHE A 1 210 ? 25.705 -12.457 37.074 1.00 54.73 ? 2272 PHE A CB    1 
ATOM   1664 C  CG    . PHE A 1 210 ? 27.137 -12.649 36.657 1.00 54.28 ? 2272 PHE A CG    1 
ATOM   1665 C  CD1   . PHE A 1 210 ? 27.737 -13.903 36.711 1.00 53.89 ? 2272 PHE A CD1   1 
ATOM   1666 C  CD2   . PHE A 1 210 ? 27.880 -11.571 36.183 1.00 54.01 ? 2272 PHE A CD2   1 
ATOM   1667 C  CE1   . PHE A 1 210 ? 29.065 -14.075 36.318 1.00 53.67 ? 2272 PHE A CE1   1 
ATOM   1668 C  CE2   . PHE A 1 210 ? 29.207 -11.733 35.785 1.00 53.82 ? 2272 PHE A CE2   1 
ATOM   1669 C  CZ    . PHE A 1 210 ? 29.800 -12.987 35.853 1.00 53.40 ? 2272 PHE A CZ    1 
ATOM   1670 N  N     . GLU A 1 211 ? 27.443 -12.745 39.890 1.00 55.93 ? 2273 GLU A N     1 
ATOM   1671 C  CA    . GLU A 1 211 ? 28.429 -12.195 40.828 1.00 56.53 ? 2273 GLU A CA    1 
ATOM   1672 C  C     . GLU A 1 211 ? 28.832 -10.764 40.491 1.00 56.50 ? 2273 GLU A C     1 
ATOM   1673 O  O     . GLU A 1 211 ? 28.777 -9.883  41.348 1.00 56.59 ? 2273 GLU A O     1 
ATOM   1674 C  CB    . GLU A 1 211 ? 29.683 -13.076 40.879 1.00 56.80 ? 2273 GLU A CB    1 
ATOM   1675 C  CG    . GLU A 1 211 ? 29.468 -14.455 41.488 1.00 58.21 ? 2273 GLU A CG    1 
ATOM   1676 C  CD    . GLU A 1 211 ? 30.684 -15.361 41.343 1.00 60.07 ? 2273 GLU A CD    1 
ATOM   1677 O  OE1   . GLU A 1 211 ? 31.264 -15.419 40.231 1.00 60.57 ? 2273 GLU A OE1   1 
ATOM   1678 O  OE2   . GLU A 1 211 ? 31.051 -16.026 42.341 1.00 60.92 ? 2273 GLU A OE2   1 
ATOM   1679 N  N     . LYS A 1 212 ? 29.231 -10.540 39.242 1.00 56.48 ? 2274 LYS A N     1 
ATOM   1680 C  CA    . LYS A 1 212 ? 29.692 -9.226  38.805 1.00 56.52 ? 2274 LYS A CA    1 
ATOM   1681 C  C     . LYS A 1 212 ? 28.661 -8.524  37.918 1.00 56.46 ? 2274 LYS A C     1 
ATOM   1682 O  O     . LYS A 1 212 ? 29.011 -7.820  36.966 1.00 56.52 ? 2274 LYS A O     1 
ATOM   1683 C  CB    . LYS A 1 212 ? 31.059 -9.332  38.120 1.00 56.55 ? 2274 LYS A CB    1 
ATOM   1684 C  CG    . LYS A 1 212 ? 32.177 -9.713  39.082 1.00 57.25 ? 2274 LYS A CG    1 
ATOM   1685 C  CD    . LYS A 1 212 ? 33.553 -9.646  38.437 1.00 57.96 ? 2274 LYS A CD    1 
ATOM   1686 C  CE    . LYS A 1 212 ? 34.657 -9.770  39.488 1.00 58.40 ? 2274 LYS A CE    1 
ATOM   1687 N  NZ    . LYS A 1 212 ? 34.728 -8.578  40.390 1.00 58.38 ? 2274 LYS A NZ    1 
ATOM   1688 N  N     . CYS A 1 213 ? 27.388 -8.725  38.252 1.00 56.33 ? 2275 CYS A N     1 
ATOM   1689 C  CA    . CYS A 1 213 ? 26.276 -8.060  37.583 1.00 56.15 ? 2275 CYS A CA    1 
ATOM   1690 C  C     . CYS A 1 213 ? 26.402 -6.545  37.681 1.00 56.02 ? 2275 CYS A C     1 
ATOM   1691 O  O     . CYS A 1 213 ? 26.692 -6.006  38.748 1.00 55.99 ? 2275 CYS A O     1 
ATOM   1692 C  CB    . CYS A 1 213 ? 24.952 -8.518  38.191 1.00 56.15 ? 2275 CYS A CB    1 
ATOM   1693 S  SG    . CYS A 1 213 ? 23.547 -7.480  37.786 1.00 56.40 ? 2275 CYS A SG    1 
ATOM   1694 N  N     . ARG A 1 214 ? 26.177 -5.865  36.560 1.00 56.03 ? 2276 ARG A N     1 
ATOM   1695 C  CA    . ARG A 1 214 ? 26.300 -4.408  36.495 1.00 55.94 ? 2276 ARG A CA    1 
ATOM   1696 C  C     . ARG A 1 214 ? 25.213 -3.710  37.306 1.00 55.90 ? 2276 ARG A C     1 
ATOM   1697 O  O     . ARG A 1 214 ? 25.376 -2.556  37.697 1.00 56.06 ? 2276 ARG A O     1 
ATOM   1698 C  CB    . ARG A 1 214 ? 26.271 -3.910  35.045 1.00 55.93 ? 2276 ARG A CB    1 
ATOM   1699 C  CG    . ARG A 1 214 ? 27.356 -4.483  34.142 1.00 55.98 ? 2276 ARG A CG    1 
ATOM   1700 C  CD    . ARG A 1 214 ? 27.526 -3.628  32.887 1.00 56.42 ? 2276 ARG A CD    1 
ATOM   1701 N  NE    . ARG A 1 214 ? 28.005 -4.402  31.741 1.00 56.06 ? 2276 ARG A NE    1 
ATOM   1702 C  CZ    . ARG A 1 214 ? 27.230 -4.848  30.754 1.00 55.66 ? 2276 ARG A CZ    1 
ATOM   1703 N  NH1   . ARG A 1 214 ? 25.925 -4.598  30.755 1.00 55.70 ? 2276 ARG A NH1   1 
ATOM   1704 N  NH2   . ARG A 1 214 ? 27.763 -5.548  29.762 1.00 55.22 ? 2276 ARG A NH2   1 
ATOM   1705 N  N     . GLY A 1 215 ? 24.110 -4.414  37.552 1.00 55.83 ? 2277 GLY A N     1 
ATOM   1706 C  CA    . GLY A 1 215 ? 22.994 -3.872  38.324 1.00 55.73 ? 2277 GLY A CA    1 
ATOM   1707 C  C     . GLY A 1 215 ? 22.027 -3.055  37.490 1.00 55.74 ? 2277 GLY A C     1 
ATOM   1708 O  O     . GLY A 1 215 ? 20.896 -2.803  37.911 1.00 55.75 ? 2277 GLY A O     1 
ATOM   1709 N  N     . ILE A 1 216 ? 22.476 -2.641  36.307 1.00 55.80 ? 2278 ILE A N     1 
ATOM   1710 C  CA    . ILE A 1 216 ? 21.663 -1.848  35.388 1.00 55.94 ? 2278 ILE A CA    1 
ATOM   1711 C  C     . ILE A 1 216 ? 21.713 -2.395  33.958 1.00 56.06 ? 2278 ILE A C     1 
ATOM   1712 O  O     . ILE A 1 216 ? 22.730 -2.932  33.519 1.00 55.92 ? 2278 ILE A O     1 
ATOM   1713 C  CB    . ILE A 1 216 ? 22.050 -0.340  35.439 1.00 55.86 ? 2278 ILE A CB    1 
ATOM   1714 C  CG1   . ILE A 1 216 ? 21.251 0.364   36.540 1.00 55.82 ? 2278 ILE A CG1   1 
ATOM   1715 C  CG2   . ILE A 1 216 ? 21.813 0.347   34.093 1.00 55.78 ? 2278 ILE A CG2   1 
ATOM   1716 C  CD1   . ILE A 1 216 ? 21.638 1.816   36.782 1.00 55.75 ? 2278 ILE A CD1   1 
ATOM   1717 N  N     . ILE A 1 217 ? 20.588 -2.263  33.259 1.00 56.33 ? 2279 ILE A N     1 
ATOM   1718 C  CA    . ILE A 1 217 ? 20.479 -2.584  31.840 1.00 56.64 ? 2279 ILE A CA    1 
ATOM   1719 C  C     . ILE A 1 217 ? 20.484 -1.278  31.041 1.00 56.80 ? 2279 ILE A C     1 
ATOM   1720 O  O     . ILE A 1 217 ? 19.591 -0.439  31.203 1.00 56.92 ? 2279 ILE A O     1 
ATOM   1721 C  CB    . ILE A 1 217 ? 19.187 -3.387  31.545 1.00 56.64 ? 2279 ILE A CB    1 
ATOM   1722 C  CG1   . ILE A 1 217 ? 19.221 -4.735  32.271 1.00 56.75 ? 2279 ILE A CG1   1 
ATOM   1723 C  CG2   . ILE A 1 217 ? 18.996 -3.583  30.040 1.00 56.67 ? 2279 ILE A CG2   1 
ATOM   1724 C  CD1   . ILE A 1 217 ? 17.852 -5.331  32.551 1.00 56.86 ? 2279 ILE A CD1   1 
ATOM   1725 N  N     . GLY A 1 218 ? 21.497 -1.112  30.192 1.00 56.99 ? 2280 GLY A N     1 
ATOM   1726 C  CA    . GLY A 1 218 ? 21.637 0.084   29.359 1.00 57.10 ? 2280 GLY A CA    1 
ATOM   1727 C  C     . GLY A 1 218 ? 22.114 1.300   30.134 1.00 57.22 ? 2280 GLY A C     1 
ATOM   1728 O  O     . GLY A 1 218 ? 23.000 1.201   30.986 1.00 57.28 ? 2280 GLY A O     1 
ATOM   1729 N  N     . SER B 1 6   ? 32.538 1.648   14.874 1.00 40.99 ? 2068 SER B N     1 
ATOM   1730 C  CA    . SER B 1 6   ? 31.821 1.582   13.566 1.00 41.01 ? 2068 SER B CA    1 
ATOM   1731 C  C     . SER B 1 6   ? 32.682 0.900   12.506 1.00 40.77 ? 2068 SER B C     1 
ATOM   1732 O  O     . SER B 1 6   ? 33.428 1.566   11.775 1.00 40.81 ? 2068 SER B O     1 
ATOM   1733 C  CB    . SER B 1 6   ? 31.420 2.988   13.111 1.00 41.18 ? 2068 SER B CB    1 
ATOM   1734 O  OG    . SER B 1 6   ? 30.607 3.624   14.088 1.00 42.09 ? 2068 SER B OG    1 
ATOM   1735 N  N     . TYR B 1 7   ? 32.573 -0.428  12.426 1.00 40.26 ? 2069 TYR B N     1 
ATOM   1736 C  CA    . TYR B 1 7   ? 33.449 -1.230  11.565 1.00 39.89 ? 2069 TYR B CA    1 
ATOM   1737 C  C     . TYR B 1 7   ? 32.834 -2.586  11.236 1.00 39.58 ? 2069 TYR B C     1 
ATOM   1738 O  O     . TYR B 1 7   ? 31.936 -3.051  11.938 1.00 39.59 ? 2069 TYR B O     1 
ATOM   1739 C  CB    . TYR B 1 7   ? 34.811 -1.446  12.244 1.00 39.97 ? 2069 TYR B CB    1 
ATOM   1740 C  CG    . TYR B 1 7   ? 34.747 -2.395  13.425 1.00 39.59 ? 2069 TYR B CG    1 
ATOM   1741 C  CD1   . TYR B 1 7   ? 35.075 -3.744  13.281 1.00 39.18 ? 2069 TYR B CD1   1 
ATOM   1742 C  CD2   . TYR B 1 7   ? 34.338 -1.946  14.679 1.00 39.10 ? 2069 TYR B CD2   1 
ATOM   1743 C  CE1   . TYR B 1 7   ? 35.000 -4.617  14.360 1.00 39.42 ? 2069 TYR B CE1   1 
ATOM   1744 C  CE2   . TYR B 1 7   ? 34.257 -2.811  15.759 1.00 39.10 ? 2069 TYR B CE2   1 
ATOM   1745 C  CZ    . TYR B 1 7   ? 34.590 -4.138  15.596 1.00 39.21 ? 2069 TYR B CZ    1 
ATOM   1746 O  OH    . TYR B 1 7   ? 34.514 -4.982  16.673 1.00 39.19 ? 2069 TYR B OH    1 
ATOM   1747 N  N     . LYS B 1 8   ? 33.347 -3.221  10.184 1.00 39.21 ? 2070 LYS B N     1 
ATOM   1748 C  CA    . LYS B 1 8   ? 32.913 -4.554  9.779  1.00 39.07 ? 2070 LYS B CA    1 
ATOM   1749 C  C     . LYS B 1 8   ? 33.666 -5.638  10.549 1.00 38.85 ? 2070 LYS B C     1 
ATOM   1750 O  O     . LYS B 1 8   ? 34.888 -5.729  10.456 1.00 38.82 ? 2070 LYS B O     1 
ATOM   1751 C  CB    . LYS B 1 8   ? 33.130 -4.741  8.279  1.00 39.05 ? 2070 LYS B CB    1 
ATOM   1752 C  CG    . LYS B 1 8   ? 32.108 -4.050  7.396  1.00 39.70 ? 2070 LYS B CG    1 
ATOM   1753 C  CD    . LYS B 1 8   ? 32.495 -4.119  5.916  1.00 41.74 ? 2070 LYS B CD    1 
ATOM   1754 C  CE    . LYS B 1 8   ? 32.750 -5.566  5.454  1.00 43.52 ? 2070 LYS B CE    1 
ATOM   1755 N  NZ    . LYS B 1 8   ? 33.123 -5.689  4.001  1.00 44.10 ? 2070 LYS B NZ    1 
ATOM   1756 N  N     . LYS B 1 9   ? 32.935 -6.458  11.303 1.00 38.71 ? 2071 LYS B N     1 
ATOM   1757 C  CA    . LYS B 1 9   ? 33.545 -7.533  12.102 1.00 38.76 ? 2071 LYS B CA    1 
ATOM   1758 C  C     . LYS B 1 9   ? 34.064 -8.680  11.231 1.00 38.77 ? 2071 LYS B C     1 
ATOM   1759 O  O     . LYS B 1 9   ? 33.406 -9.091  10.268 1.00 38.77 ? 2071 LYS B O     1 
ATOM   1760 C  CB    . LYS B 1 9   ? 32.555 -8.096  13.135 1.00 38.65 ? 2071 LYS B CB    1 
ATOM   1761 C  CG    . LYS B 1 9   ? 32.190 -7.152  14.272 1.00 38.76 ? 2071 LYS B CG    1 
ATOM   1762 C  CD    . LYS B 1 9   ? 31.333 -7.852  15.324 1.00 38.80 ? 2071 LYS B CD    1 
ATOM   1763 C  CE    . LYS B 1 9   ? 31.050 -6.931  16.513 1.00 39.30 ? 2071 LYS B CE    1 
ATOM   1764 N  NZ    . LYS B 1 9   ? 30.573 -7.666  17.730 1.00 38.94 ? 2071 LYS B NZ    1 
ATOM   1765 N  N     . ILE B 1 10  ? 35.243 -9.190  11.578 1.00 38.71 ? 2072 ILE B N     1 
ATOM   1766 C  CA    . ILE B 1 10  ? 35.803 -10.374 10.924 1.00 38.60 ? 2072 ILE B CA    1 
ATOM   1767 C  C     . ILE B 1 10  ? 36.425 -11.344 11.937 1.00 38.63 ? 2072 ILE B C     1 
ATOM   1768 O  O     . ILE B 1 10  ? 36.855 -10.929 13.014 1.00 38.56 ? 2072 ILE B O     1 
ATOM   1769 C  CB    . ILE B 1 10  ? 36.832 -10.009 9.821  1.00 38.65 ? 2072 ILE B CB    1 
ATOM   1770 C  CG1   . ILE B 1 10  ? 37.872 -9.006  10.339 1.00 38.57 ? 2072 ILE B CG1   1 
ATOM   1771 C  CG2   . ILE B 1 10  ? 36.127 -9.478  8.587  1.00 38.41 ? 2072 ILE B CG2   1 
ATOM   1772 C  CD1   . ILE B 1 10  ? 38.975 -8.668  9.335  1.00 37.89 ? 2072 ILE B CD1   1 
ATOM   1773 N  N     . ARG B 1 11  ? 36.456 -12.631 11.581 1.00 38.67 ? 2073 ARG B N     1 
ATOM   1774 C  CA    . ARG B 1 11  ? 37.016 -13.695 12.428 1.00 38.73 ? 2073 ARG B CA    1 
ATOM   1775 C  C     . ARG B 1 11  ? 38.481 -14.003 12.127 1.00 38.35 ? 2073 ARG B C     1 
ATOM   1776 O  O     . ARG B 1 11  ? 39.160 -14.674 12.910 1.00 38.41 ? 2073 ARG B O     1 
ATOM   1777 C  CB    . ARG B 1 11  ? 36.199 -14.984 12.282 1.00 38.95 ? 2073 ARG B CB    1 
ATOM   1778 C  CG    . ARG B 1 11  ? 35.086 -15.135 13.305 1.00 40.34 ? 2073 ARG B CG    1 
ATOM   1779 C  CD    . ARG B 1 11  ? 34.575 -16.572 13.362 1.00 42.03 ? 2073 ARG B CD    1 
ATOM   1780 N  NE    . ARG B 1 11  ? 33.289 -16.648 14.053 1.00 43.45 ? 2073 ARG B NE    1 
ATOM   1781 C  CZ    . ARG B 1 11  ? 32.100 -16.593 13.452 1.00 44.65 ? 2073 ARG B CZ    1 
ATOM   1782 N  NH1   . ARG B 1 11  ? 32.005 -16.469 12.128 1.00 44.51 ? 2073 ARG B NH1   1 
ATOM   1783 N  NH2   . ARG B 1 11  ? 30.992 -16.666 14.183 1.00 45.38 ? 2073 ARG B NH2   1 
ATOM   1784 N  N     . SER B 1 12  ? 38.960 -13.516 10.989 1.00 37.95 ? 2074 SER B N     1 
ATOM   1785 C  CA    . SER B 1 12  ? 40.313 -13.801 10.529 1.00 37.70 ? 2074 SER B CA    1 
ATOM   1786 C  C     . SER B 1 12  ? 40.788 -12.651 9.646  1.00 37.37 ? 2074 SER B C     1 
ATOM   1787 O  O     . SER B 1 12  ? 39.975 -11.872 9.155  1.00 37.38 ? 2074 SER B O     1 
ATOM   1788 C  CB    . SER B 1 12  ? 40.323 -15.123 9.751  1.00 37.81 ? 2074 SER B CB    1 
ATOM   1789 O  OG    . SER B 1 12  ? 41.598 -15.733 9.766  1.00 37.96 ? 2074 SER B OG    1 
ATOM   1790 N  N     . ASN B 1 13  ? 42.099 -12.536 9.459  1.00 37.04 ? 2075 ASN B N     1 
ATOM   1791 C  CA    . ASN B 1 13  ? 42.661 -11.513 8.587  1.00 36.89 ? 2075 ASN B CA    1 
ATOM   1792 C  C     . ASN B 1 13  ? 42.208 -11.698 7.160  1.00 36.86 ? 2075 ASN B C     1 
ATOM   1793 O  O     . ASN B 1 13  ? 42.043 -12.822 6.702  1.00 36.98 ? 2075 ASN B O     1 
ATOM   1794 C  CB    . ASN B 1 13  ? 44.185 -11.545 8.624  1.00 36.96 ? 2075 ASN B CB    1 
ATOM   1795 C  CG    . ASN B 1 13  ? 44.753 -10.848 9.834  1.00 37.04 ? 2075 ASN B CG    1 
ATOM   1796 O  OD1   . ASN B 1 13  ? 44.162 -9.904  10.362 1.00 37.26 ? 2075 ASN B OD1   1 
ATOM   1797 N  ND2   . ASN B 1 13  ? 45.917 -11.302 10.275 1.00 37.08 ? 2075 ASN B ND2   1 
ATOM   1798 N  N     . VAL B 1 14  ? 42.006 -10.586 6.466  1.00 36.95 ? 2076 VAL B N     1 
ATOM   1799 C  CA    . VAL B 1 14  ? 41.645 -10.607 5.060  1.00 37.08 ? 2076 VAL B CA    1 
ATOM   1800 C  C     . VAL B 1 14  ? 42.852 -10.141 4.261  1.00 37.35 ? 2076 VAL B C     1 
ATOM   1801 O  O     . VAL B 1 14  ? 43.304 -9.006  4.408  1.00 37.42 ? 2076 VAL B O     1 
ATOM   1802 C  CB    . VAL B 1 14  ? 40.408 -9.720  4.783  1.00 37.11 ? 2076 VAL B CB    1 
ATOM   1803 C  CG1   . VAL B 1 14  ? 40.179 -9.522  3.286  1.00 36.64 ? 2076 VAL B CG1   1 
ATOM   1804 C  CG2   . VAL B 1 14  ? 39.171 -10.321 5.444  1.00 36.95 ? 2076 VAL B CG2   1 
ATOM   1805 N  N     . TYR B 1 15  ? 43.387 -11.040 3.440  1.00 37.69 ? 2077 TYR B N     1 
ATOM   1806 C  CA    . TYR B 1 15  ? 44.546 -10.734 2.610  1.00 37.91 ? 2077 TYR B CA    1 
ATOM   1807 C  C     . TYR B 1 15  ? 44.102 -10.131 1.279  1.00 38.09 ? 2077 TYR B C     1 
ATOM   1808 O  O     . TYR B 1 15  ? 43.478 -10.804 0.455  1.00 38.05 ? 2077 TYR B O     1 
ATOM   1809 C  CB    . TYR B 1 15  ? 45.403 -11.987 2.400  1.00 37.89 ? 2077 TYR B CB    1 
ATOM   1810 C  CG    . TYR B 1 15  ? 45.754 -12.691 3.689  1.00 38.08 ? 2077 TYR B CG    1 
ATOM   1811 C  CD1   . TYR B 1 15  ? 45.144 -13.891 4.034  1.00 38.80 ? 2077 TYR B CD1   1 
ATOM   1812 C  CD2   . TYR B 1 15  ? 46.684 -12.148 4.576  1.00 38.24 ? 2077 TYR B CD2   1 
ATOM   1813 C  CE1   . TYR B 1 15  ? 45.454 -14.538 5.229  1.00 38.72 ? 2077 TYR B CE1   1 
ATOM   1814 C  CE2   . TYR B 1 15  ? 46.999 -12.785 5.771  1.00 37.99 ? 2077 TYR B CE2   1 
ATOM   1815 C  CZ    . TYR B 1 15  ? 46.379 -13.976 6.088  1.00 38.25 ? 2077 TYR B CZ    1 
ATOM   1816 O  OH    . TYR B 1 15  ? 46.679 -14.612 7.265  1.00 38.84 ? 2077 TYR B OH    1 
ATOM   1817 N  N     . VAL B 1 16  ? 44.422 -8.854  1.089  1.00 38.35 ? 2078 VAL B N     1 
ATOM   1818 C  CA    . VAL B 1 16  ? 44.044 -8.122  -0.116 1.00 38.65 ? 2078 VAL B CA    1 
ATOM   1819 C  C     . VAL B 1 16  ? 44.985 -8.419  -1.289 1.00 39.05 ? 2078 VAL B C     1 
ATOM   1820 O  O     . VAL B 1 16  ? 44.602 -9.117  -2.228 1.00 39.08 ? 2078 VAL B O     1 
ATOM   1821 C  CB    . VAL B 1 16  ? 43.964 -6.604  0.144  1.00 38.55 ? 2078 VAL B CB    1 
ATOM   1822 C  CG1   . VAL B 1 16  ? 43.549 -5.865  -1.118 1.00 38.36 ? 2078 VAL B CG1   1 
ATOM   1823 C  CG2   . VAL B 1 16  ? 42.988 -6.314  1.273  1.00 38.37 ? 2078 VAL B CG2   1 
ATOM   1824 N  N     . ASP B 1 17  ? 46.208 -7.894  -1.231 1.00 39.52 ? 2079 ASP B N     1 
ATOM   1825 C  CA    . ASP B 1 17  ? 47.167 -8.073  -2.323 1.00 39.96 ? 2079 ASP B CA    1 
ATOM   1826 C  C     . ASP B 1 17  ? 48.444 -8.818  -1.914 1.00 40.42 ? 2079 ASP B C     1 
ATOM   1827 O  O     . ASP B 1 17  ? 49.324 -9.045  -2.748 1.00 40.76 ? 2079 ASP B O     1 
ATOM   1828 C  CB    . ASP B 1 17  ? 47.485 -6.729  -3.008 1.00 39.83 ? 2079 ASP B CB    1 
ATOM   1829 C  CG    . ASP B 1 17  ? 48.325 -5.788  -2.140 1.00 39.99 ? 2079 ASP B CG    1 
ATOM   1830 O  OD1   . ASP B 1 17  ? 49.182 -5.081  -2.712 1.00 40.25 ? 2079 ASP B OD1   1 
ATOM   1831 O  OD2   . ASP B 1 17  ? 48.138 -5.736  -0.905 1.00 40.10 ? 2079 ASP B OD2   1 
ATOM   1832 N  N     . VAL B 1 18  ? 48.536 -9.206  -0.641 1.00 40.86 ? 2080 VAL B N     1 
ATOM   1833 C  CA    . VAL B 1 18  ? 49.721 -9.903  -0.117 1.00 41.32 ? 2080 VAL B CA    1 
ATOM   1834 C  C     . VAL B 1 18  ? 49.391 -10.953 0.942  1.00 41.56 ? 2080 VAL B C     1 
ATOM   1835 O  O     . VAL B 1 18  ? 48.277 -10.992 1.462  1.00 41.54 ? 2080 VAL B O     1 
ATOM   1836 C  CB    . VAL B 1 18  ? 50.771 -8.922  0.493  1.00 41.37 ? 2080 VAL B CB    1 
ATOM   1837 C  CG1   . VAL B 1 18  ? 51.664 -8.326  -0.586 1.00 41.20 ? 2080 VAL B CG1   1 
ATOM   1838 C  CG2   . VAL B 1 18  ? 50.096 -7.838  1.337  1.00 41.56 ? 2080 VAL B CG2   1 
ATOM   1839 N  N     . LYS B 1 19  ? 50.385 -11.788 1.250  1.00 41.89 ? 2081 LYS B N     1 
ATOM   1840 C  CA    . LYS B 1 19  ? 50.315 -12.782 2.317  1.00 42.13 ? 2081 LYS B CA    1 
ATOM   1841 C  C     . LYS B 1 19  ? 51.690 -12.896 2.988  1.00 42.29 ? 2081 LYS B C     1 
ATOM   1842 O  O     . LYS B 1 19  ? 52.683 -13.187 2.319  1.00 42.42 ? 2081 LYS B O     1 
ATOM   1843 C  CB    . LYS B 1 19  ? 49.897 -14.132 1.748  1.00 42.16 ? 2081 LYS B CB    1 
ATOM   1844 C  CG    . LYS B 1 19  ? 49.210 -15.053 2.742  1.00 42.79 ? 2081 LYS B CG    1 
ATOM   1845 C  CD    . LYS B 1 19  ? 48.968 -16.417 2.113  1.00 43.52 ? 2081 LYS B CD    1 
ATOM   1846 C  CE    . LYS B 1 19  ? 48.038 -17.275 2.947  1.00 44.05 ? 2081 LYS B CE    1 
ATOM   1847 N  NZ    . LYS B 1 19  ? 48.039 -18.686 2.456  1.00 44.53 ? 2081 LYS B NZ    1 
ATOM   1848 N  N     . PRO B 1 20  ? 51.758 -12.661 4.312  1.00 42.46 ? 2082 PRO B N     1 
ATOM   1849 C  CA    . PRO B 1 20  ? 53.043 -12.716 5.014  1.00 42.46 ? 2082 PRO B CA    1 
ATOM   1850 C  C     . PRO B 1 20  ? 53.479 -14.147 5.333  1.00 42.43 ? 2082 PRO B C     1 
ATOM   1851 O  O     . PRO B 1 20  ? 52.886 -14.796 6.192  1.00 42.54 ? 2082 PRO B O     1 
ATOM   1852 C  CB    . PRO B 1 20  ? 52.770 -11.927 6.299  1.00 42.41 ? 2082 PRO B CB    1 
ATOM   1853 C  CG    . PRO B 1 20  ? 51.317 -12.114 6.554  1.00 42.43 ? 2082 PRO B CG    1 
ATOM   1854 C  CD    . PRO B 1 20  ? 50.647 -12.303 5.216  1.00 42.57 ? 2082 PRO B CD    1 
ATOM   1855 N  N     . LEU B 1 21  ? 54.512 -14.629 4.648  1.00 42.46 ? 2083 LEU B N     1 
ATOM   1856 C  CA    . LEU B 1 21  ? 54.944 -16.015 4.800  1.00 42.79 ? 2083 LEU B CA    1 
ATOM   1857 C  C     . LEU B 1 21  ? 56.157 -16.164 5.714  1.00 43.23 ? 2083 LEU B C     1 
ATOM   1858 O  O     . LEU B 1 21  ? 57.055 -15.314 5.704  1.00 43.65 ? 2083 LEU B O     1 
ATOM   1859 C  CB    . LEU B 1 21  ? 55.225 -16.650 3.435  1.00 42.62 ? 2083 LEU B CB    1 
ATOM   1860 C  CG    . LEU B 1 21  ? 54.077 -16.753 2.424  1.00 42.45 ? 2083 LEU B CG    1 
ATOM   1861 C  CD1   . LEU B 1 21  ? 54.526 -17.510 1.185  1.00 41.98 ? 2083 LEU B CD1   1 
ATOM   1862 C  CD2   . LEU B 1 21  ? 52.833 -17.397 3.024  1.00 42.11 ? 2083 LEU B CD2   1 
ATOM   1863 N  N     . SER B 1 22  ? 56.173 -17.251 6.491  1.00 43.41 ? 2084 SER B N     1 
ATOM   1864 C  CA    . SER B 1 22  ? 57.240 -17.542 7.458  1.00 43.55 ? 2084 SER B CA    1 
ATOM   1865 C  C     . SER B 1 22  ? 58.615 -17.561 6.796  1.00 43.65 ? 2084 SER B C     1 
ATOM   1866 O  O     . SER B 1 22  ? 58.867 -18.360 5.891  1.00 43.83 ? 2084 SER B O     1 
ATOM   1867 C  CB    . SER B 1 22  ? 56.996 -18.891 8.149  1.00 43.59 ? 2084 SER B CB    1 
ATOM   1868 O  OG    . SER B 1 22  ? 55.658 -19.020 8.600  1.00 43.88 ? 2084 SER B OG    1 
ATOM   1869 N  N     . CYS B 1 42  ? 53.199 -28.073 25.919 1.00 82.09 ? 2104 CYS B N     1 
ATOM   1870 C  CA    . CYS B 1 42  ? 54.268 -27.148 25.554 1.00 82.13 ? 2104 CYS B CA    1 
ATOM   1871 C  C     . CYS B 1 42  ? 54.210 -25.880 26.405 1.00 82.17 ? 2104 CYS B C     1 
ATOM   1872 O  O     . CYS B 1 42  ? 53.323 -25.042 26.227 1.00 82.23 ? 2104 CYS B O     1 
ATOM   1873 C  CB    . CYS B 1 42  ? 54.193 -26.799 24.064 1.00 82.14 ? 2104 CYS B CB    1 
ATOM   1874 S  SG    . CYS B 1 42  ? 54.580 -28.168 22.938 1.00 81.91 ? 2104 CYS B SG    1 
ATOM   1875 N  N     . VAL B 1 43  ? 55.155 -25.754 27.335 1.00 82.19 ? 2105 VAL B N     1 
ATOM   1876 C  CA    . VAL B 1 43  ? 55.194 -24.625 28.267 1.00 82.22 ? 2105 VAL B CA    1 
ATOM   1877 C  C     . VAL B 1 43  ? 56.493 -23.829 28.077 1.00 82.17 ? 2105 VAL B C     1 
ATOM   1878 O  O     . VAL B 1 43  ? 56.966 -23.668 26.949 1.00 82.18 ? 2105 VAL B O     1 
ATOM   1879 C  CB    . VAL B 1 43  ? 55.043 -25.084 29.756 1.00 82.30 ? 2105 VAL B CB    1 
ATOM   1880 C  CG1   . VAL B 1 43  ? 54.480 -23.952 30.625 1.00 82.40 ? 2105 VAL B CG1   1 
ATOM   1881 C  CG2   . VAL B 1 43  ? 54.155 -26.326 29.870 1.00 82.47 ? 2105 VAL B CG2   1 
ATOM   1882 N  N     . ASP B 1 44  ? 57.066 -23.352 29.183 1.00 82.07 ? 2106 ASP B N     1 
ATOM   1883 C  CA    . ASP B 1 44  ? 58.286 -22.539 29.181 1.00 81.89 ? 2106 ASP B CA    1 
ATOM   1884 C  C     . ASP B 1 44  ? 59.506 -23.302 28.651 1.00 81.67 ? 2106 ASP B C     1 
ATOM   1885 O  O     . ASP B 1 44  ? 60.494 -22.695 28.230 1.00 81.62 ? 2106 ASP B O     1 
ATOM   1886 C  CB    . ASP B 1 44  ? 58.576 -22.017 30.597 1.00 82.00 ? 2106 ASP B CB    1 
ATOM   1887 C  CG    . ASP B 1 44  ? 57.321 -21.546 31.328 1.00 82.10 ? 2106 ASP B CG    1 
ATOM   1888 O  OD1   . ASP B 1 44  ? 56.423 -20.953 30.684 1.00 82.07 ? 2106 ASP B OD1   1 
ATOM   1889 O  OD2   . ASP B 1 44  ? 57.240 -21.768 32.558 1.00 82.19 ? 2106 ASP B OD2   1 
ATOM   1890 N  N     . ASP B 1 45  ? 59.428 -24.630 28.683 1.00 81.39 ? 2107 ASP B N     1 
ATOM   1891 C  CA    . ASP B 1 45  ? 60.501 -25.483 28.192 1.00 81.14 ? 2107 ASP B CA    1 
ATOM   1892 C  C     . ASP B 1 45  ? 60.054 -26.178 26.909 1.00 80.88 ? 2107 ASP B C     1 
ATOM   1893 O  O     . ASP B 1 45  ? 59.773 -27.380 26.906 1.00 80.90 ? 2107 ASP B O     1 
ATOM   1894 C  CB    . ASP B 1 45  ? 60.901 -26.512 29.258 1.00 81.19 ? 2107 ASP B CB    1 
ATOM   1895 C  CG    . ASP B 1 45  ? 61.258 -25.869 30.592 1.00 81.44 ? 2107 ASP B CG    1 
ATOM   1896 O  OD1   . ASP B 1 45  ? 60.515 -26.089 31.573 1.00 81.82 ? 2107 ASP B OD1   1 
ATOM   1897 O  OD2   . ASP B 1 45  ? 62.273 -25.141 30.661 1.00 81.46 ? 2107 ASP B OD2   1 
ATOM   1898 N  N     . CYS B 1 46  ? 59.975 -25.403 25.826 1.00 80.49 ? 2108 CYS B N     1 
ATOM   1899 C  CA    . CYS B 1 46  ? 59.575 -25.919 24.510 1.00 80.06 ? 2108 CYS B CA    1 
ATOM   1900 C  C     . CYS B 1 46  ? 60.309 -25.207 23.372 1.00 79.81 ? 2108 CYS B C     1 
ATOM   1901 O  O     . CYS B 1 46  ? 60.662 -24.027 23.487 1.00 79.76 ? 2108 CYS B O     1 
ATOM   1902 C  CB    . CYS B 1 46  ? 58.056 -25.814 24.311 1.00 80.08 ? 2108 CYS B CB    1 
ATOM   1903 S  SG    . CYS B 1 46  ? 57.470 -26.275 22.658 1.00 79.40 ? 2108 CYS B SG    1 
ATOM   1904 N  N     . LEU B 1 47  ? 60.524 -25.936 22.277 1.00 79.39 ? 2109 LEU B N     1 
ATOM   1905 C  CA    . LEU B 1 47  ? 61.233 -25.411 21.109 1.00 78.97 ? 2109 LEU B CA    1 
ATOM   1906 C  C     . LEU B 1 47  ? 60.394 -24.363 20.380 1.00 78.54 ? 2109 LEU B C     1 
ATOM   1907 O  O     . LEU B 1 47  ? 60.784 -23.194 20.294 1.00 78.51 ? 2109 LEU B O     1 
ATOM   1908 C  CB    . LEU B 1 47  ? 61.627 -26.544 20.144 1.00 79.08 ? 2109 LEU B CB    1 
ATOM   1909 C  CG    . LEU B 1 47  ? 62.509 -27.714 20.607 1.00 79.09 ? 2109 LEU B CG    1 
ATOM   1910 C  CD1   . LEU B 1 47  ? 62.672 -28.724 19.476 1.00 78.96 ? 2109 LEU B CD1   1 
ATOM   1911 C  CD2   . LEU B 1 47  ? 63.876 -27.246 21.114 1.00 78.94 ? 2109 LEU B CD2   1 
ATOM   1912 N  N     . ASN B 1 48  ? 59.238 -24.796 19.877 1.00 77.92 ? 2110 ASN B N     1 
ATOM   1913 C  CA    . ASN B 1 48  ? 58.331 -23.947 19.103 1.00 77.27 ? 2110 ASN B CA    1 
ATOM   1914 C  C     . ASN B 1 48  ? 57.941 -22.639 19.803 1.00 76.90 ? 2110 ASN B C     1 
ATOM   1915 O  O     . ASN B 1 48  ? 57.965 -21.574 19.187 1.00 76.88 ? 2110 ASN B O     1 
ATOM   1916 C  CB    . ASN B 1 48  ? 57.076 -24.736 18.699 1.00 77.21 ? 2110 ASN B CB    1 
ATOM   1917 C  CG    . ASN B 1 48  ? 57.362 -25.826 17.674 1.00 76.70 ? 2110 ASN B CG    1 
ATOM   1918 O  OD1   . ASN B 1 48  ? 58.305 -25.731 16.892 1.00 76.52 ? 2110 ASN B OD1   1 
ATOM   1919 N  ND2   . ASN B 1 48  ? 56.532 -26.861 17.668 1.00 76.39 ? 2110 ASN B ND2   1 
ATOM   1920 N  N     . ARG B 1 49  ? 57.601 -22.726 21.087 1.00 76.45 ? 2111 ARG B N     1 
ATOM   1921 C  CA    . ARG B 1 49  ? 57.155 -21.565 21.864 1.00 76.02 ? 2111 ARG B CA    1 
ATOM   1922 C  C     . ARG B 1 49  ? 58.193 -20.450 21.998 1.00 75.71 ? 2111 ARG B C     1 
ATOM   1923 O  O     . ARG B 1 49  ? 57.829 -19.277 22.093 1.00 75.59 ? 2111 ARG B O     1 
ATOM   1924 C  CB    . ARG B 1 49  ? 56.680 -21.993 23.253 1.00 76.05 ? 2111 ARG B CB    1 
ATOM   1925 C  CG    . ARG B 1 49  ? 55.178 -22.171 23.379 1.00 76.04 ? 2111 ARG B CG    1 
ATOM   1926 C  CD    . ARG B 1 49  ? 54.789 -22.401 24.830 1.00 76.10 ? 2111 ARG B CD    1 
ATOM   1927 N  NE    . ARG B 1 49  ? 53.351 -22.281 25.058 1.00 76.05 ? 2111 ARG B NE    1 
ATOM   1928 C  CZ    . ARG B 1 49  ? 52.733 -21.150 25.389 1.00 76.23 ? 2111 ARG B CZ    1 
ATOM   1929 N  NH1   . ARG B 1 49  ? 53.422 -20.022 25.526 1.00 76.20 ? 2111 ARG B NH1   1 
ATOM   1930 N  NH2   . ARG B 1 49  ? 51.419 -21.146 25.578 1.00 76.28 ? 2111 ARG B NH2   1 
ATOM   1931 N  N     . MET B 1 50  ? 59.474 -20.817 22.010 1.00 75.38 ? 2112 MET B N     1 
ATOM   1932 C  CA    . MET B 1 50  ? 60.555 -19.842 22.206 1.00 75.05 ? 2112 MET B CA    1 
ATOM   1933 C  C     . MET B 1 50  ? 60.997 -19.138 20.923 1.00 74.77 ? 2112 MET B C     1 
ATOM   1934 O  O     . MET B 1 50  ? 61.515 -18.017 20.975 1.00 74.74 ? 2112 MET B O     1 
ATOM   1935 C  CB    . MET B 1 50  ? 61.755 -20.480 22.910 1.00 75.13 ? 2112 MET B CB    1 
ATOM   1936 C  CG    . MET B 1 50  ? 61.651 -20.475 24.427 1.00 75.16 ? 2112 MET B CG    1 
ATOM   1937 S  SD    . MET B 1 50  ? 63.188 -20.976 25.227 1.00 75.02 ? 2112 MET B SD    1 
ATOM   1938 C  CE    . MET B 1 50  ? 62.771 -20.740 26.954 1.00 75.04 ? 2112 MET B CE    1 
ATOM   1939 N  N     . ILE B 1 51  ? 60.793 -19.793 19.780 1.00 74.31 ? 2113 ILE B N     1 
ATOM   1940 C  CA    . ILE B 1 51  ? 61.048 -19.166 18.477 1.00 73.79 ? 2113 ILE B CA    1 
ATOM   1941 C  C     . ILE B 1 51  ? 59.832 -18.371 17.985 1.00 73.41 ? 2113 ILE B C     1 
ATOM   1942 O  O     . ILE B 1 51  ? 59.843 -17.833 16.874 1.00 73.53 ? 2113 ILE B O     1 
ATOM   1943 C  CB    . ILE B 1 51  ? 61.510 -20.188 17.395 1.00 73.81 ? 2113 ILE B CB    1 
ATOM   1944 C  CG1   . ILE B 1 51  ? 60.394 -21.185 17.051 1.00 73.65 ? 2113 ILE B CG1   1 
ATOM   1945 C  CG2   . ILE B 1 51  ? 62.803 -20.889 17.835 1.00 73.99 ? 2113 ILE B CG2   1 
ATOM   1946 C  CD1   . ILE B 1 51  ? 60.641 -21.999 15.783 1.00 73.38 ? 2113 ILE B CD1   1 
ATOM   1947 N  N     . PHE B 1 52  ? 58.801 -18.299 18.831 1.00 72.75 ? 2114 PHE B N     1 
ATOM   1948 C  CA    . PHE B 1 52  ? 57.543 -17.603 18.534 1.00 72.10 ? 2114 PHE B CA    1 
ATOM   1949 C  C     . PHE B 1 52  ? 56.787 -18.227 17.359 1.00 71.77 ? 2114 PHE B C     1 
ATOM   1950 O  O     . PHE B 1 52  ? 56.300 -17.527 16.473 1.00 71.70 ? 2114 PHE B O     1 
ATOM   1951 C  CB    . PHE B 1 52  ? 57.768 -16.099 18.311 1.00 72.05 ? 2114 PHE B CB    1 
ATOM   1952 C  CG    . PHE B 1 52  ? 58.164 -15.350 19.551 1.00 71.61 ? 2114 PHE B CG    1 
ATOM   1953 C  CD1   . PHE B 1 52  ? 59.506 -15.111 19.836 1.00 71.70 ? 2114 PHE B CD1   1 
ATOM   1954 C  CD2   . PHE B 1 52  ? 57.197 -14.874 20.428 1.00 70.95 ? 2114 PHE B CD2   1 
ATOM   1955 C  CE1   . PHE B 1 52  ? 59.878 -14.412 20.982 1.00 71.64 ? 2114 PHE B CE1   1 
ATOM   1956 C  CE2   . PHE B 1 52  ? 57.557 -14.178 21.573 1.00 71.09 ? 2114 PHE B CE2   1 
ATOM   1957 C  CZ    . PHE B 1 52  ? 58.900 -13.947 21.853 1.00 71.48 ? 2114 PHE B CZ    1 
ATOM   1958 N  N     . ALA B 1 53  ? 56.691 -19.551 17.368 1.00 71.43 ? 2115 ALA B N     1 
ATOM   1959 C  CA    . ALA B 1 53  ? 55.962 -20.279 16.337 1.00 71.17 ? 2115 ALA B CA    1 
ATOM   1960 C  C     . ALA B 1 53  ? 55.045 -21.308 16.981 1.00 70.93 ? 2115 ALA B C     1 
ATOM   1961 O  O     . ALA B 1 53  ? 55.429 -21.983 17.934 1.00 70.84 ? 2115 ALA B O     1 
ATOM   1962 C  CB    . ALA B 1 53  ? 56.928 -20.952 15.372 1.00 71.18 ? 2115 ALA B CB    1 
ATOM   1963 N  N     . GLU B 1 54  ? 53.830 -21.418 16.460 1.00 70.63 ? 2116 GLU B N     1 
ATOM   1964 C  CA    . GLU B 1 54  ? 52.847 -22.334 17.018 1.00 70.41 ? 2116 GLU B CA    1 
ATOM   1965 C  C     . GLU B 1 54  ? 53.106 -23.768 16.579 1.00 70.49 ? 2116 GLU B C     1 
ATOM   1966 O  O     . GLU B 1 54  ? 53.674 -24.003 15.512 1.00 70.62 ? 2116 GLU B O     1 
ATOM   1967 C  CB    . GLU B 1 54  ? 51.429 -21.907 16.628 1.00 70.24 ? 2116 GLU B CB    1 
ATOM   1968 C  CG    . GLU B 1 54  ? 51.029 -20.543 17.169 1.00 69.55 ? 2116 GLU B CG    1 
ATOM   1969 C  CD    . GLU B 1 54  ? 49.546 -20.425 17.457 1.00 68.55 ? 2116 GLU B CD    1 
ATOM   1970 O  OE1   . GLU B 1 54  ? 49.187 -19.675 18.387 1.00 68.39 ? 2116 GLU B OE1   1 
ATOM   1971 O  OE2   . GLU B 1 54  ? 48.739 -21.078 16.765 1.00 68.01 ? 2116 GLU B OE2   1 
ATOM   1972 N  N     . CYS B 1 55  ? 52.704 -24.721 17.418 1.00 70.53 ? 2117 CYS B N     1 
ATOM   1973 C  CA    . CYS B 1 55  ? 52.626 -26.124 17.030 1.00 70.61 ? 2117 CYS B CA    1 
ATOM   1974 C  C     . CYS B 1 55  ? 51.636 -26.240 15.873 1.00 70.66 ? 2117 CYS B C     1 
ATOM   1975 O  O     . CYS B 1 55  ? 51.014 -25.255 15.476 1.00 70.59 ? 2117 CYS B O     1 
ATOM   1976 C  CB    . CYS B 1 55  ? 52.109 -26.973 18.198 1.00 70.71 ? 2117 CYS B CB    1 
ATOM   1977 S  SG    . CYS B 1 55  ? 53.280 -27.506 19.503 1.00 70.84 ? 2117 CYS B SG    1 
ATOM   1978 N  N     . SER B 1 56  ? 51.493 -27.443 15.332 1.00 70.84 ? 2118 SER B N     1 
ATOM   1979 C  CA    . SER B 1 56  ? 50.404 -27.745 14.410 1.00 70.99 ? 2118 SER B CA    1 
ATOM   1980 C  C     . SER B 1 56  ? 49.832 -29.112 14.777 1.00 71.18 ? 2118 SER B C     1 
ATOM   1981 O  O     . SER B 1 56  ? 50.560 -29.958 15.301 1.00 71.19 ? 2118 SER B O     1 
ATOM   1982 C  CB    . SER B 1 56  ? 50.887 -27.720 12.958 1.00 70.93 ? 2118 SER B CB    1 
ATOM   1983 O  OG    . SER B 1 56  ? 51.830 -28.743 12.711 1.00 70.95 ? 2118 SER B OG    1 
ATOM   1984 N  N     . PRO B 1 57  ? 48.528 -29.338 14.513 1.00 71.34 ? 2119 PRO B N     1 
ATOM   1985 C  CA    . PRO B 1 57  ? 47.919 -30.635 14.822 1.00 71.52 ? 2119 PRO B CA    1 
ATOM   1986 C  C     . PRO B 1 57  ? 48.638 -31.814 14.150 1.00 71.76 ? 2119 PRO B C     1 
ATOM   1987 O  O     . PRO B 1 57  ? 48.239 -32.967 14.332 1.00 71.85 ? 2119 PRO B O     1 
ATOM   1988 C  CB    . PRO B 1 57  ? 46.498 -30.491 14.268 1.00 71.49 ? 2119 PRO B CB    1 
ATOM   1989 C  CG    . PRO B 1 57  ? 46.236 -29.036 14.287 1.00 71.36 ? 2119 PRO B CG    1 
ATOM   1990 C  CD    . PRO B 1 57  ? 47.542 -28.400 13.943 1.00 71.30 ? 2119 PRO B CD    1 
ATOM   1991 N  N     . ASN B 1 58  ? 49.692 -31.517 13.393 1.00 72.02 ? 2120 ASN B N     1 
ATOM   1992 C  CA    . ASN B 1 58  ? 50.467 -32.531 12.683 1.00 72.21 ? 2120 ASN B CA    1 
ATOM   1993 C  C     . ASN B 1 58  ? 51.931 -32.608 13.126 1.00 72.39 ? 2120 ASN B C     1 
ATOM   1994 O  O     . ASN B 1 58  ? 52.724 -33.326 12.515 1.00 72.48 ? 2120 ASN B O     1 
ATOM   1995 C  CB    . ASN B 1 58  ? 50.388 -32.293 11.168 1.00 72.14 ? 2120 ASN B CB    1 
ATOM   1996 C  CG    . ASN B 1 58  ? 48.959 -32.304 10.642 1.00 72.01 ? 2120 ASN B CG    1 
ATOM   1997 O  OD1   . ASN B 1 58  ? 48.480 -31.308 10.100 1.00 71.58 ? 2120 ASN B OD1   1 
ATOM   1998 N  ND2   . ASN B 1 58  ? 48.272 -33.431 10.805 1.00 71.81 ? 2120 ASN B ND2   1 
ATOM   1999 N  N     . THR B 1 59  ? 52.287 -31.872 14.181 1.00 72.60 ? 2121 THR B N     1 
ATOM   2000 C  CA    . THR B 1 59  ? 53.676 -31.826 14.666 1.00 72.78 ? 2121 THR B CA    1 
ATOM   2001 C  C     . THR B 1 59  ? 53.805 -31.773 16.203 1.00 72.94 ? 2121 THR B C     1 
ATOM   2002 O  O     . THR B 1 59  ? 54.705 -32.412 16.766 1.00 72.94 ? 2121 THR B O     1 
ATOM   2003 C  CB    . THR B 1 59  ? 54.486 -30.660 14.013 1.00 72.77 ? 2121 THR B CB    1 
ATOM   2004 O  OG1   . THR B 1 59  ? 54.334 -30.703 12.589 1.00 72.66 ? 2121 THR B OG1   1 
ATOM   2005 C  CG2   . THR B 1 59  ? 55.979 -30.754 14.351 1.00 72.85 ? 2121 THR B CG2   1 
ATOM   2006 N  N     . CYS B 1 60  ? 52.917 -31.030 16.875 1.00 72.98 ? 2122 CYS B N     1 
ATOM   2007 C  CA    . CYS B 1 60  ? 53.028 -30.846 18.332 1.00 72.91 ? 2122 CYS B CA    1 
ATOM   2008 C  C     . CYS B 1 60  ? 53.245 -32.180 19.030 1.00 73.23 ? 2122 CYS B C     1 
ATOM   2009 O  O     . CYS B 1 60  ? 52.463 -33.116 18.832 1.00 73.31 ? 2122 CYS B O     1 
ATOM   2010 C  CB    . CYS B 1 60  ? 51.824 -30.104 18.948 1.00 72.67 ? 2122 CYS B CB    1 
ATOM   2011 S  SG    . CYS B 1 60  ? 52.313 -29.076 20.385 1.00 71.28 ? 2122 CYS B SG    1 
ATOM   2012 N  N     . PRO B 1 61  ? 54.331 -32.278 19.821 1.00 73.50 ? 2123 PRO B N     1 
ATOM   2013 C  CA    . PRO B 1 61  ? 54.665 -33.476 20.598 1.00 73.63 ? 2123 PRO B CA    1 
ATOM   2014 C  C     . PRO B 1 61  ? 53.452 -34.030 21.346 1.00 73.65 ? 2123 PRO B C     1 
ATOM   2015 O  O     . PRO B 1 61  ? 53.074 -35.188 21.144 1.00 73.53 ? 2123 PRO B O     1 
ATOM   2016 C  CB    . PRO B 1 61  ? 55.729 -32.970 21.594 1.00 73.77 ? 2123 PRO B CB    1 
ATOM   2017 C  CG    . PRO B 1 61  ? 55.825 -31.455 21.378 1.00 73.81 ? 2123 PRO B CG    1 
ATOM   2018 C  CD    . PRO B 1 61  ? 55.348 -31.225 19.987 1.00 73.50 ? 2123 PRO B CD    1 
ATOM   2019 N  N     . CYS B 1 62  ? 52.845 -33.186 22.178 1.00 73.67 ? 2124 CYS B N     1 
ATOM   2020 C  CA    . CYS B 1 62  ? 51.686 -33.560 22.983 1.00 73.76 ? 2124 CYS B CA    1 
ATOM   2021 C  C     . CYS B 1 62  ? 50.366 -33.239 22.273 1.00 73.57 ? 2124 CYS B C     1 
ATOM   2022 O  O     . CYS B 1 62  ? 49.584 -32.406 22.741 1.00 73.62 ? 2124 CYS B O     1 
ATOM   2023 C  CB    . CYS B 1 62  ? 51.754 -32.868 24.351 1.00 73.79 ? 2124 CYS B CB    1 
ATOM   2024 S  SG    . CYS B 1 62  ? 52.049 -31.071 24.282 1.00 74.60 ? 2124 CYS B SG    1 
ATOM   2025 N  N     . GLY B 1 63  ? 50.123 -33.912 21.147 1.00 73.38 ? 2125 GLY B N     1 
ATOM   2026 C  CA    . GLY B 1 63  ? 48.905 -33.716 20.353 1.00 73.16 ? 2125 GLY B CA    1 
ATOM   2027 C  C     . GLY B 1 63  ? 47.618 -33.682 21.164 1.00 73.01 ? 2125 GLY B C     1 
ATOM   2028 O  O     . GLY B 1 63  ? 47.531 -34.299 22.232 1.00 72.99 ? 2125 GLY B O     1 
ATOM   2029 N  N     . GLU B 1 64  ? 46.623 -32.954 20.652 1.00 72.79 ? 2126 GLU B N     1 
ATOM   2030 C  CA    . GLU B 1 64  ? 45.314 -32.763 21.310 1.00 72.58 ? 2126 GLU B CA    1 
ATOM   2031 C  C     . GLU B 1 64  ? 45.384 -31.917 22.590 1.00 72.27 ? 2126 GLU B C     1 
ATOM   2032 O  O     . GLU B 1 64  ? 44.530 -31.055 22.816 1.00 72.21 ? 2126 GLU B O     1 
ATOM   2033 C  CB    . GLU B 1 64  ? 44.604 -34.103 21.580 1.00 72.69 ? 2126 GLU B CB    1 
ATOM   2034 C  CG    . GLU B 1 64  ? 44.053 -34.808 20.331 1.00 73.10 ? 2126 GLU B CG    1 
ATOM   2035 C  CD    . GLU B 1 64  ? 42.629 -34.384 19.960 1.00 73.44 ? 2126 GLU B CD    1 
ATOM   2036 O  OE1   . GLU B 1 64  ? 41.992 -33.637 20.738 1.00 73.73 ? 2126 GLU B OE1   1 
ATOM   2037 O  OE2   . GLU B 1 64  ? 42.143 -34.811 18.887 1.00 72.87 ? 2126 GLU B OE2   1 
ATOM   2038 N  N     . GLN B 1 65  ? 46.397 -32.171 23.417 1.00 71.90 ? 2127 GLN B N     1 
ATOM   2039 C  CA    . GLN B 1 65  ? 46.610 -31.420 24.657 1.00 71.47 ? 2127 GLN B CA    1 
ATOM   2040 C  C     . GLN B 1 65  ? 47.747 -30.399 24.521 1.00 71.08 ? 2127 GLN B C     1 
ATOM   2041 O  O     . GLN B 1 65  ? 48.336 -29.972 25.518 1.00 71.06 ? 2127 GLN B O     1 
ATOM   2042 C  CB    . GLN B 1 65  ? 46.877 -32.379 25.824 1.00 71.49 ? 2127 GLN B CB    1 
ATOM   2043 N  N     . CYS B 1 66  ? 48.041 -30.013 23.280 1.00 70.55 ? 2128 CYS B N     1 
ATOM   2044 C  CA    . CYS B 1 66  ? 49.087 -29.035 22.976 1.00 70.05 ? 2128 CYS B CA    1 
ATOM   2045 C  C     . CYS B 1 66  ? 48.647 -27.638 23.438 1.00 69.51 ? 2128 CYS B C     1 
ATOM   2046 O  O     . CYS B 1 66  ? 47.488 -27.257 23.263 1.00 69.54 ? 2128 CYS B O     1 
ATOM   2047 C  CB    . CYS B 1 66  ? 49.423 -29.080 21.470 1.00 70.18 ? 2128 CYS B CB    1 
ATOM   2048 S  SG    . CYS B 1 66  ? 50.694 -27.927 20.846 1.00 70.40 ? 2128 CYS B SG    1 
ATOM   2049 N  N     . CYS B 1 67  ? 49.567 -26.901 24.059 1.00 68.79 ? 2129 CYS B N     1 
ATOM   2050 C  CA    . CYS B 1 67  ? 49.289 -25.554 24.575 1.00 68.08 ? 2129 CYS B CA    1 
ATOM   2051 C  C     . CYS B 1 67  ? 49.716 -24.455 23.603 1.00 67.26 ? 2129 CYS B C     1 
ATOM   2052 O  O     . CYS B 1 67  ? 49.473 -23.270 23.848 1.00 67.19 ? 2129 CYS B O     1 
ATOM   2053 C  CB    . CYS B 1 67  ? 50.004 -25.332 25.913 1.00 68.22 ? 2129 CYS B CB    1 
ATOM   2054 S  SG    . CYS B 1 67  ? 49.333 -26.240 27.320 1.00 69.13 ? 2129 CYS B SG    1 
ATOM   2055 N  N     . ASN B 1 68  ? 50.360 -24.854 22.511 1.00 66.21 ? 2130 ASN B N     1 
ATOM   2056 C  CA    . ASN B 1 68  ? 50.940 -23.908 21.569 1.00 65.24 ? 2130 ASN B CA    1 
ATOM   2057 C  C     . ASN B 1 68  ? 50.154 -23.830 20.261 1.00 64.67 ? 2130 ASN B C     1 
ATOM   2058 O  O     . ASN B 1 68  ? 50.713 -23.971 19.172 1.00 64.62 ? 2130 ASN B O     1 
ATOM   2059 C  CB    . ASN B 1 68  ? 52.404 -24.271 21.308 1.00 65.22 ? 2130 ASN B CB    1 
ATOM   2060 C  CG    . ASN B 1 68  ? 53.198 -23.122 20.724 1.00 64.86 ? 2130 ASN B CG    1 
ATOM   2061 O  OD1   . ASN B 1 68  ? 52.792 -21.962 20.805 1.00 64.34 ? 2130 ASN B OD1   1 
ATOM   2062 N  ND2   . ASN B 1 68  ? 54.343 -23.440 20.137 1.00 64.64 ? 2130 ASN B ND2   1 
ATOM   2063 N  N     . GLN B 1 69  ? 48.847 -23.611 20.377 1.00 63.85 ? 2131 GLN B N     1 
ATOM   2064 C  CA    . GLN B 1 69  ? 47.965 -23.545 19.214 1.00 63.02 ? 2131 GLN B CA    1 
ATOM   2065 C  C     . GLN B 1 69  ? 46.872 -22.501 19.418 1.00 62.42 ? 2131 GLN B C     1 
ATOM   2066 O  O     . GLN B 1 69  ? 45.769 -22.634 18.884 1.00 62.30 ? 2131 GLN B O     1 
ATOM   2067 C  CB    . GLN B 1 69  ? 47.342 -24.918 18.938 1.00 63.06 ? 2131 GLN B CB    1 
ATOM   2068 C  CG    . GLN B 1 69  ? 48.333 -25.992 18.508 1.00 63.04 ? 2131 GLN B CG    1 
ATOM   2069 C  CD    . GLN B 1 69  ? 47.654 -27.261 18.044 1.00 63.39 ? 2131 GLN B CD    1 
ATOM   2070 O  OE1   . GLN B 1 69  ? 46.687 -27.220 17.283 1.00 63.05 ? 2131 GLN B OE1   1 
ATOM   2071 N  NE2   . GLN B 1 69  ? 48.166 -28.403 18.493 1.00 63.55 ? 2131 GLN B NE2   1 
ATOM   2072 N  N     . ARG B 1 70  ? 47.200 -21.454 20.175 1.00 61.69 ? 2132 ARG B N     1 
ATOM   2073 C  CA    . ARG B 1 70  ? 46.223 -20.459 20.628 1.00 61.08 ? 2132 ARG B CA    1 
ATOM   2074 C  C     . ARG B 1 70  ? 45.620 -19.628 19.496 1.00 60.59 ? 2132 ARG B C     1 
ATOM   2075 O  O     . ARG B 1 70  ? 44.397 -19.567 19.352 1.00 60.61 ? 2132 ARG B O     1 
ATOM   2076 C  CB    . ARG B 1 70  ? 46.833 -19.560 21.709 1.00 61.11 ? 2132 ARG B CB    1 
ATOM   2077 C  CG    . ARG B 1 70  ? 47.043 -20.269 23.050 1.00 61.27 ? 2132 ARG B CG    1 
ATOM   2078 C  CD    . ARG B 1 70  ? 48.058 -19.563 23.931 1.00 61.09 ? 2132 ARG B CD    1 
ATOM   2079 N  NE    . ARG B 1 70  ? 49.350 -19.419 23.263 1.00 61.52 ? 2132 ARG B NE    1 
ATOM   2080 C  CZ    . ARG B 1 70  ? 50.332 -18.631 23.689 1.00 61.58 ? 2132 ARG B CZ    1 
ATOM   2081 N  NH1   . ARG B 1 70  ? 50.181 -17.909 24.794 1.00 61.00 ? 2132 ARG B NH1   1 
ATOM   2082 N  NH2   . ARG B 1 70  ? 51.468 -18.565 23.006 1.00 61.18 ? 2132 ARG B NH2   1 
ATOM   2083 N  N     . ILE B 1 71  ? 46.477 -19.005 18.693 1.00 59.95 ? 2133 ILE B N     1 
ATOM   2084 C  CA    . ILE B 1 71  ? 46.036 -18.229 17.533 1.00 59.26 ? 2133 ILE B CA    1 
ATOM   2085 C  C     . ILE B 1 71  ? 45.244 -19.106 16.553 1.00 58.84 ? 2133 ILE B C     1 
ATOM   2086 O  O     . ILE B 1 71  ? 44.202 -18.690 16.044 1.00 58.72 ? 2133 ILE B O     1 
ATOM   2087 C  CB    . ILE B 1 71  ? 47.233 -17.521 16.842 1.00 59.25 ? 2133 ILE B CB    1 
ATOM   2088 C  CG1   . ILE B 1 71  ? 47.918 -16.569 17.833 1.00 59.04 ? 2133 ILE B CG1   1 
ATOM   2089 C  CG2   . ILE B 1 71  ? 46.780 -16.766 15.591 1.00 59.20 ? 2133 ILE B CG2   1 
ATOM   2090 C  CD1   . ILE B 1 71  ? 49.322 -16.140 17.449 1.00 58.51 ? 2133 ILE B CD1   1 
ATOM   2091 N  N     . GLN B 1 72  ? 45.737 -20.322 16.322 1.00 58.42 ? 2134 GLN B N     1 
ATOM   2092 C  CA    . GLN B 1 72  ? 45.065 -21.314 15.482 1.00 58.08 ? 2134 GLN B CA    1 
ATOM   2093 C  C     . GLN B 1 72  ? 43.670 -21.630 15.989 1.00 58.03 ? 2134 GLN B C     1 
ATOM   2094 O  O     . GLN B 1 72  ? 42.718 -21.700 15.207 1.00 58.04 ? 2134 GLN B O     1 
ATOM   2095 C  CB    . GLN B 1 72  ? 45.864 -22.610 15.458 1.00 57.97 ? 2134 GLN B CB    1 
ATOM   2096 C  CG    . GLN B 1 72  ? 46.904 -22.686 14.382 1.00 57.57 ? 2134 GLN B CG    1 
ATOM   2097 C  CD    . GLN B 1 72  ? 47.923 -23.766 14.658 1.00 57.04 ? 2134 GLN B CD    1 
ATOM   2098 O  OE1   . GLN B 1 72  ? 48.646 -23.714 15.651 1.00 56.16 ? 2134 GLN B OE1   1 
ATOM   2099 N  NE2   . GLN B 1 72  ? 47.988 -24.753 13.777 1.00 57.45 ? 2134 GLN B NE2   1 
ATOM   2100 N  N     . ARG B 1 73  ? 43.567 -21.830 17.302 1.00 57.87 ? 2135 ARG B N     1 
ATOM   2101 C  CA    . ARG B 1 73  ? 42.310 -22.171 17.961 1.00 57.72 ? 2135 ARG B CA    1 
ATOM   2102 C  C     . ARG B 1 73  ? 41.390 -20.968 18.158 1.00 57.34 ? 2135 ARG B C     1 
ATOM   2103 O  O     . ARG B 1 73  ? 40.211 -21.140 18.463 1.00 57.42 ? 2135 ARG B O     1 
ATOM   2104 C  CB    . ARG B 1 73  ? 42.587 -22.840 19.311 1.00 57.90 ? 2135 ARG B CB    1 
ATOM   2105 C  CG    . ARG B 1 73  ? 42.445 -24.361 19.336 1.00 58.88 ? 2135 ARG B CG    1 
ATOM   2106 C  CD    . ARG B 1 73  ? 43.436 -25.081 18.431 1.00 60.09 ? 2135 ARG B CD    1 
ATOM   2107 N  NE    . ARG B 1 73  ? 43.343 -26.532 18.596 1.00 61.29 ? 2135 ARG B NE    1 
ATOM   2108 C  CZ    . ARG B 1 73  ? 43.664 -27.426 17.662 1.00 62.16 ? 2135 ARG B CZ    1 
ATOM   2109 N  NH1   . ARG B 1 73  ? 44.103 -27.035 16.468 1.00 62.24 ? 2135 ARG B NH1   1 
ATOM   2110 N  NH2   . ARG B 1 73  ? 43.539 -28.723 17.922 1.00 62.25 ? 2135 ARG B NH2   1 
ATOM   2111 N  N     . HIS B 1 74  ? 41.934 -19.763 17.971 1.00 56.87 ? 2136 HIS B N     1 
ATOM   2112 C  CA    . HIS B 1 74  ? 41.217 -18.500 18.195 1.00 56.48 ? 2136 HIS B CA    1 
ATOM   2113 C  C     . HIS B 1 74  ? 40.809 -18.364 19.663 1.00 56.12 ? 2136 HIS B C     1 
ATOM   2114 O  O     . HIS B 1 74  ? 39.758 -17.803 19.982 1.00 56.12 ? 2136 HIS B O     1 
ATOM   2115 C  CB    . HIS B 1 74  ? 39.995 -18.359 17.268 1.00 56.55 ? 2136 HIS B CB    1 
ATOM   2116 C  CG    . HIS B 1 74  ? 40.309 -18.532 15.813 1.00 57.10 ? 2136 HIS B CG    1 
ATOM   2117 N  ND1   . HIS B 1 74  ? 40.775 -17.503 15.022 1.00 57.83 ? 2136 HIS B ND1   1 
ATOM   2118 C  CD2   . HIS B 1 74  ? 40.213 -19.614 15.002 1.00 57.53 ? 2136 HIS B CD2   1 
ATOM   2119 C  CE1   . HIS B 1 74  ? 40.962 -17.945 13.790 1.00 57.90 ? 2136 HIS B CE1   1 
ATOM   2120 N  NE2   . HIS B 1 74  ? 40.629 -19.222 13.751 1.00 57.94 ? 2136 HIS B NE2   1 
ATOM   2121 N  N     . GLU B 1 75  ? 41.661 -18.877 20.546 1.00 55.66 ? 2137 GLU B N     1 
ATOM   2122 C  CA    . GLU B 1 75  ? 41.394 -18.924 21.980 1.00 55.26 ? 2137 GLU B CA    1 
ATOM   2123 C  C     . GLU B 1 75  ? 41.506 -17.557 22.649 1.00 54.97 ? 2137 GLU B C     1 
ATOM   2124 O  O     . GLU B 1 75  ? 42.369 -17.348 23.504 1.00 54.80 ? 2137 GLU B O     1 
ATOM   2125 C  CB    . GLU B 1 75  ? 42.354 -19.904 22.659 1.00 55.27 ? 2137 GLU B CB    1 
ATOM   2126 C  CG    . GLU B 1 75  ? 41.992 -21.370 22.492 1.00 55.61 ? 2137 GLU B CG    1 
ATOM   2127 C  CD    . GLU B 1 75  ? 43.040 -22.304 23.078 1.00 56.04 ? 2137 GLU B CD    1 
ATOM   2128 O  OE1   . GLU B 1 75  ? 44.247 -21.985 22.992 1.00 55.65 ? 2137 GLU B OE1   1 
ATOM   2129 O  OE2   . GLU B 1 75  ? 42.655 -23.362 23.623 1.00 56.02 ? 2137 GLU B OE2   1 
ATOM   2130 N  N     . TRP B 1 76  ? 40.630 -16.630 22.271 1.00 54.71 ? 2138 TRP B N     1 
ATOM   2131 C  CA    . TRP B 1 76  ? 40.649 -15.295 22.865 1.00 54.54 ? 2138 TRP B CA    1 
ATOM   2132 C  C     . TRP B 1 76  ? 39.823 -15.259 24.141 1.00 54.63 ? 2138 TRP B C     1 
ATOM   2133 O  O     . TRP B 1 76  ? 38.748 -15.860 24.215 1.00 54.71 ? 2138 TRP B O     1 
ATOM   2134 C  CB    . TRP B 1 76  ? 40.135 -14.218 21.899 1.00 54.37 ? 2138 TRP B CB    1 
ATOM   2135 C  CG    . TRP B 1 76  ? 40.544 -14.371 20.460 1.00 53.57 ? 2138 TRP B CG    1 
ATOM   2136 C  CD1   . TRP B 1 76  ? 41.641 -15.026 19.974 1.00 53.10 ? 2138 TRP B CD1   1 
ATOM   2137 C  CD2   . TRP B 1 76  ? 39.866 -13.830 19.321 1.00 52.77 ? 2138 TRP B CD2   1 
ATOM   2138 N  NE1   . TRP B 1 76  ? 41.675 -14.943 18.605 1.00 52.88 ? 2138 TRP B NE1   1 
ATOM   2139 C  CE2   . TRP B 1 76  ? 40.599 -14.211 18.177 1.00 52.64 ? 2138 TRP B CE2   1 
ATOM   2140 C  CE3   . TRP B 1 76  ? 38.703 -13.067 19.156 1.00 52.17 ? 2138 TRP B CE3   1 
ATOM   2141 C  CZ2   . TRP B 1 76  ? 40.207 -13.853 16.884 1.00 51.99 ? 2138 TRP B CZ2   1 
ATOM   2142 C  CZ3   . TRP B 1 76  ? 38.317 -12.710 17.870 1.00 51.77 ? 2138 TRP B CZ3   1 
ATOM   2143 C  CH2   . TRP B 1 76  ? 39.067 -13.105 16.752 1.00 51.53 ? 2138 TRP B CH2   1 
ATOM   2144 N  N     . VAL B 1 77  ? 40.339 -14.546 25.137 1.00 54.73 ? 2139 VAL B N     1 
ATOM   2145 C  CA    . VAL B 1 77  ? 39.634 -14.316 26.393 1.00 54.86 ? 2139 VAL B CA    1 
ATOM   2146 C  C     . VAL B 1 77  ? 38.277 -13.678 26.088 1.00 54.97 ? 2139 VAL B C     1 
ATOM   2147 O  O     . VAL B 1 77  ? 38.182 -12.783 25.248 1.00 55.05 ? 2139 VAL B O     1 
ATOM   2148 C  CB    . VAL B 1 77  ? 40.440 -13.394 27.348 1.00 54.80 ? 2139 VAL B CB    1 
ATOM   2149 C  CG1   . VAL B 1 77  ? 39.949 -13.556 28.766 1.00 54.96 ? 2139 VAL B CG1   1 
ATOM   2150 C  CG2   . VAL B 1 77  ? 41.931 -13.701 27.288 1.00 54.78 ? 2139 VAL B CG2   1 
ATOM   2151 N  N     . GLN B 1 78  ? 37.234 -14.151 26.766 1.00 55.11 ? 2140 GLN B N     1 
ATOM   2152 C  CA    . GLN B 1 78  ? 35.866 -13.701 26.506 1.00 55.23 ? 2140 GLN B CA    1 
ATOM   2153 C  C     . GLN B 1 78  ? 35.386 -12.636 27.500 1.00 55.23 ? 2140 GLN B C     1 
ATOM   2154 O  O     . GLN B 1 78  ? 34.181 -12.435 27.678 1.00 55.00 ? 2140 GLN B O     1 
ATOM   2155 C  CB    . GLN B 1 78  ? 34.918 -14.904 26.484 1.00 55.32 ? 2140 GLN B CB    1 
ATOM   2156 C  CG    . GLN B 1 78  ? 35.056 -15.779 25.239 1.00 55.68 ? 2140 GLN B CG    1 
ATOM   2157 C  CD    . GLN B 1 78  ? 34.682 -17.232 25.494 1.00 56.49 ? 2140 GLN B CD    1 
ATOM   2158 O  OE1   . GLN B 1 78  ? 35.265 -17.895 26.356 1.00 56.59 ? 2140 GLN B OE1   1 
ATOM   2159 N  NE2   . GLN B 1 78  ? 33.714 -17.739 24.731 1.00 56.63 ? 2140 GLN B NE2   1 
ATOM   2160 N  N     . CYS B 1 79  ? 36.341 -11.936 28.112 1.00 55.41 ? 2141 CYS B N     1 
ATOM   2161 C  CA    . CYS B 1 79  ? 36.056 -10.977 29.177 1.00 55.61 ? 2141 CYS B CA    1 
ATOM   2162 C  C     . CYS B 1 79  ? 36.502 -9.544  28.868 1.00 55.86 ? 2141 CYS B C     1 
ATOM   2163 O  O     . CYS B 1 79  ? 36.711 -8.744  29.783 1.00 55.94 ? 2141 CYS B O     1 
ATOM   2164 C  CB    . CYS B 1 79  ? 36.707 -11.449 30.480 1.00 55.71 ? 2141 CYS B CB    1 
ATOM   2165 S  SG    . CYS B 1 79  ? 38.515 -11.281 30.529 1.00 55.38 ? 2141 CYS B SG    1 
ATOM   2166 N  N     . LEU B 1 80  ? 36.641 -9.212  27.589 1.00 56.13 ? 2142 LEU B N     1 
ATOM   2167 C  CA    . LEU B 1 80  ? 37.069 -7.870  27.206 1.00 56.46 ? 2142 LEU B CA    1 
ATOM   2168 C  C     . LEU B 1 80  ? 35.871 -6.964  26.977 1.00 56.80 ? 2142 LEU B C     1 
ATOM   2169 O  O     . LEU B 1 80  ? 34.884 -7.373  26.369 1.00 56.87 ? 2142 LEU B O     1 
ATOM   2170 C  CB    . LEU B 1 80  ? 37.950 -7.909  25.959 1.00 56.37 ? 2142 LEU B CB    1 
ATOM   2171 C  CG    . LEU B 1 80  ? 39.196 -8.798  25.983 1.00 56.26 ? 2142 LEU B CG    1 
ATOM   2172 C  CD1   . LEU B 1 80  ? 39.746 -8.947  24.573 1.00 56.37 ? 2142 LEU B CD1   1 
ATOM   2173 C  CD2   . LEU B 1 80  ? 40.264 -8.267  26.931 1.00 55.58 ? 2142 LEU B CD2   1 
ATOM   2174 N  N     . GLU B 1 81  ? 35.965 -5.733  27.469 1.00 57.38 ? 2143 GLU B N     1 
ATOM   2175 C  CA    . GLU B 1 81  ? 34.872 -4.773  27.358 1.00 57.97 ? 2143 GLU B CA    1 
ATOM   2176 C  C     . GLU B 1 81  ? 35.344 -3.442  26.785 1.00 58.28 ? 2143 GLU B C     1 
ATOM   2177 O  O     . GLU B 1 81  ? 36.407 -2.931  27.146 1.00 58.28 ? 2143 GLU B O     1 
ATOM   2178 C  CB    . GLU B 1 81  ? 34.196 -4.552  28.716 1.00 58.03 ? 2143 GLU B CB    1 
ATOM   2179 C  CG    . GLU B 1 81  ? 32.840 -3.855  28.631 1.00 58.41 ? 2143 GLU B CG    1 
ATOM   2180 C  CD    . GLU B 1 81  ? 32.315 -3.383  29.978 1.00 58.84 ? 2143 GLU B CD    1 
ATOM   2181 O  OE1   . GLU B 1 81  ? 33.121 -3.174  30.912 1.00 58.93 ? 2143 GLU B OE1   1 
ATOM   2182 O  OE2   . GLU B 1 81  ? 31.083 -3.209  30.096 1.00 58.95 ? 2143 GLU B OE2   1 
ATOM   2183 N  N     . ARG B 1 82  ? 34.527 -2.897  25.892 1.00 58.74 ? 2144 ARG B N     1 
ATOM   2184 C  CA    . ARG B 1 82  ? 34.772 -1.614  25.259 1.00 59.21 ? 2144 ARG B CA    1 
ATOM   2185 C  C     . ARG B 1 82  ? 34.214 -0.516  26.154 1.00 59.62 ? 2144 ARG B C     1 
ATOM   2186 O  O     . ARG B 1 82  ? 33.090 -0.628  26.649 1.00 59.71 ? 2144 ARG B O     1 
ATOM   2187 C  CB    . ARG B 1 82  ? 34.076 -1.598  23.904 1.00 59.20 ? 2144 ARG B CB    1 
ATOM   2188 C  CG    . ARG B 1 82  ? 34.639 -0.642  22.888 1.00 59.10 ? 2144 ARG B CG    1 
ATOM   2189 C  CD    . ARG B 1 82  ? 34.195 -1.085  21.520 1.00 59.03 ? 2144 ARG B CD    1 
ATOM   2190 N  NE    . ARG B 1 82  ? 33.717 0.029   20.715 1.00 59.61 ? 2144 ARG B NE    1 
ATOM   2191 C  CZ    . ARG B 1 82  ? 32.731 -0.062  19.830 1.00 60.01 ? 2144 ARG B CZ    1 
ATOM   2192 N  NH1   . ARG B 1 82  ? 32.108 -1.218  19.640 1.00 60.05 ? 2144 ARG B NH1   1 
ATOM   2193 N  NH2   . ARG B 1 82  ? 32.362 1.006   19.138 1.00 60.77 ? 2144 ARG B NH2   1 
ATOM   2194 N  N     . PHE B 1 83  ? 34.999 0.536   26.369 1.00 60.11 ? 2145 PHE B N     1 
ATOM   2195 C  CA    . PHE B 1 83  ? 34.611 1.602   27.291 1.00 60.77 ? 2145 PHE B CA    1 
ATOM   2196 C  C     . PHE B 1 83  ? 35.139 2.960   26.848 1.00 61.41 ? 2145 PHE B C     1 
ATOM   2197 O  O     . PHE B 1 83  ? 36.155 3.041   26.159 1.00 61.46 ? 2145 PHE B O     1 
ATOM   2198 C  CB    . PHE B 1 83  ? 35.087 1.281   28.720 1.00 60.63 ? 2145 PHE B CB    1 
ATOM   2199 C  CG    . PHE B 1 83  ? 36.561 1.534   28.956 1.00 60.34 ? 2145 PHE B CG    1 
ATOM   2200 C  CD1   . PHE B 1 83  ? 36.978 2.625   29.713 1.00 59.97 ? 2145 PHE B CD1   1 
ATOM   2201 C  CD2   . PHE B 1 83  ? 37.529 0.677   28.435 1.00 59.91 ? 2145 PHE B CD2   1 
ATOM   2202 C  CE1   . PHE B 1 83  ? 38.330 2.863   29.939 1.00 59.71 ? 2145 PHE B CE1   1 
ATOM   2203 C  CE2   . PHE B 1 83  ? 38.884 0.911   28.653 1.00 59.63 ? 2145 PHE B CE2   1 
ATOM   2204 C  CZ    . PHE B 1 83  ? 39.283 2.005   29.408 1.00 59.85 ? 2145 PHE B CZ    1 
ATOM   2205 N  N     . ARG B 1 84  ? 34.442 4.022   27.246 1.00 62.24 ? 2146 ARG B N     1 
ATOM   2206 C  CA    . ARG B 1 84  ? 34.919 5.383   27.022 1.00 63.14 ? 2146 ARG B CA    1 
ATOM   2207 C  C     . ARG B 1 84  ? 36.056 5.690   27.987 1.00 63.51 ? 2146 ARG B C     1 
ATOM   2208 O  O     . ARG B 1 84  ? 35.860 5.727   29.206 1.00 63.61 ? 2146 ARG B O     1 
ATOM   2209 C  CB    . ARG B 1 84  ? 33.782 6.401   27.172 1.00 63.29 ? 2146 ARG B CB    1 
ATOM   2210 C  CG    . ARG B 1 84  ? 33.009 6.646   25.885 1.00 64.32 ? 2146 ARG B CG    1 
ATOM   2211 C  CD    . ARG B 1 84  ? 31.654 7.288   26.144 1.00 66.01 ? 2146 ARG B CD    1 
ATOM   2212 N  NE    . ARG B 1 84  ? 30.901 7.476   24.901 1.00 67.47 ? 2146 ARG B NE    1 
ATOM   2213 C  CZ    . ARG B 1 84  ? 29.615 7.823   24.834 1.00 68.29 ? 2146 ARG B CZ    1 
ATOM   2214 N  NH1   . ARG B 1 84  ? 28.909 8.025   25.943 1.00 68.51 ? 2146 ARG B NH1   1 
ATOM   2215 N  NH2   . ARG B 1 84  ? 29.030 7.967   23.650 1.00 68.57 ? 2146 ARG B NH2   1 
ATOM   2216 N  N     . ALA B 1 85  ? 37.249 5.884   27.432 1.00 63.95 ? 2147 ALA B N     1 
ATOM   2217 C  CA    . ALA B 1 85  ? 38.429 6.182   28.231 1.00 64.43 ? 2147 ALA B CA    1 
ATOM   2218 C  C     . ALA B 1 85  ? 38.572 7.688   28.395 1.00 64.84 ? 2147 ALA B C     1 
ATOM   2219 O  O     . ALA B 1 85  ? 38.168 8.448   27.515 1.00 65.04 ? 2147 ALA B O     1 
ATOM   2220 C  CB    . ALA B 1 85  ? 39.672 5.590   27.581 1.00 64.32 ? 2147 ALA B CB    1 
ATOM   2221 N  N     . GLU B 1 86  ? 39.134 8.115   29.525 1.00 65.25 ? 2148 GLU B N     1 
ATOM   2222 C  CA    . GLU B 1 86  ? 39.428 9.529   29.758 1.00 65.60 ? 2148 GLU B CA    1 
ATOM   2223 C  C     . GLU B 1 86  ? 40.350 10.051  28.660 1.00 65.72 ? 2148 GLU B C     1 
ATOM   2224 O  O     . GLU B 1 86  ? 41.295 9.362   28.259 1.00 65.67 ? 2148 GLU B O     1 
ATOM   2225 C  CB    . GLU B 1 86  ? 40.108 9.734   31.117 1.00 65.71 ? 2148 GLU B CB    1 
ATOM   2226 C  CG    . GLU B 1 86  ? 39.324 9.235   32.329 1.00 66.40 ? 2148 GLU B CG    1 
ATOM   2227 C  CD    . GLU B 1 86  ? 40.094 9.369   33.646 1.00 67.15 ? 2148 GLU B CD    1 
ATOM   2228 O  OE1   . GLU B 1 86  ? 41.312 9.666   33.628 1.00 66.93 ? 2148 GLU B OE1   1 
ATOM   2229 O  OE2   . GLU B 1 86  ? 39.468 9.170   34.710 1.00 67.64 ? 2148 GLU B OE2   1 
ATOM   2230 N  N     . GLU B 1 87  ? 40.058 11.255  28.167 1.00 65.90 ? 2149 GLU B N     1 
ATOM   2231 C  CA    . GLU B 1 87  ? 40.938 11.977  27.227 1.00 66.01 ? 2149 GLU B CA    1 
ATOM   2232 C  C     . GLU B 1 87  ? 41.063 11.330  25.836 1.00 65.69 ? 2149 GLU B C     1 
ATOM   2233 O  O     . GLU B 1 87  ? 41.478 11.986  24.875 1.00 65.60 ? 2149 GLU B O     1 
ATOM   2234 C  CB    . GLU B 1 87  ? 42.332 12.193  27.842 1.00 66.19 ? 2149 GLU B CB    1 
ATOM   2235 C  CG    . GLU B 1 87  ? 42.354 13.068  29.098 1.00 67.23 ? 2149 GLU B CG    1 
ATOM   2236 C  CD    . GLU B 1 87  ? 42.561 14.550  28.796 1.00 68.88 ? 2149 GLU B CD    1 
ATOM   2237 O  OE1   . GLU B 1 87  ? 43.451 15.158  29.435 1.00 69.90 ? 2149 GLU B OE1   1 
ATOM   2238 O  OE2   . GLU B 1 87  ? 41.849 15.109  27.927 1.00 68.96 ? 2149 GLU B OE2   1 
ATOM   2239 N  N     . LYS B 1 88  ? 40.713 10.047  25.748 1.00 65.22 ? 2150 LYS B N     1 
ATOM   2240 C  CA    . LYS B 1 88  ? 40.735 9.299   24.494 1.00 64.76 ? 2150 LYS B CA    1 
ATOM   2241 C  C     . LYS B 1 88  ? 39.303 8.921   24.121 1.00 64.34 ? 2150 LYS B C     1 
ATOM   2242 O  O     . LYS B 1 88  ? 38.369 9.196   24.878 1.00 64.42 ? 2150 LYS B O     1 
ATOM   2243 C  CB    . LYS B 1 88  ? 41.594 8.039   24.634 1.00 64.84 ? 2150 LYS B CB    1 
ATOM   2244 C  CG    . LYS B 1 88  ? 42.942 8.255   25.319 1.00 65.26 ? 2150 LYS B CG    1 
ATOM   2245 C  CD    . LYS B 1 88  ? 43.343 7.016   26.113 1.00 65.83 ? 2150 LYS B CD    1 
ATOM   2246 C  CE    . LYS B 1 88  ? 44.494 7.286   27.071 1.00 65.87 ? 2150 LYS B CE    1 
ATOM   2247 N  NZ    . LYS B 1 88  ? 44.755 6.104   27.946 1.00 65.82 ? 2150 LYS B NZ    1 
ATOM   2248 N  N     . GLY B 1 89  ? 39.127 8.309   22.953 1.00 63.68 ? 2151 GLY B N     1 
ATOM   2249 C  CA    . GLY B 1 89  ? 37.807 7.877   22.510 1.00 62.83 ? 2151 GLY B CA    1 
ATOM   2250 C  C     . GLY B 1 89  ? 37.348 6.653   23.278 1.00 62.28 ? 2151 GLY B C     1 
ATOM   2251 O  O     . GLY B 1 89  ? 36.969 6.750   24.449 1.00 62.36 ? 2151 GLY B O     1 
ATOM   2252 N  N     . TRP B 1 90  ? 37.383 5.500   22.613 1.00 61.62 ? 2152 TRP B N     1 
ATOM   2253 C  CA    . TRP B 1 90  ? 37.058 4.227   23.250 1.00 60.85 ? 2152 TRP B CA    1 
ATOM   2254 C  C     . TRP B 1 90  ? 38.332 3.502   23.670 1.00 60.14 ? 2152 TRP B C     1 
ATOM   2255 O  O     . TRP B 1 90  ? 39.410 3.762   23.133 1.00 60.04 ? 2152 TRP B O     1 
ATOM   2256 C  CB    . TRP B 1 90  ? 36.227 3.341   22.314 1.00 60.95 ? 2152 TRP B CB    1 
ATOM   2257 C  CG    . TRP B 1 90  ? 34.914 3.943   21.922 1.00 61.33 ? 2152 TRP B CG    1 
ATOM   2258 C  CD1   . TRP B 1 90  ? 34.663 4.721   20.826 1.00 61.73 ? 2152 TRP B CD1   1 
ATOM   2259 C  CD2   . TRP B 1 90  ? 33.668 3.823   22.622 1.00 61.70 ? 2152 TRP B CD2   1 
ATOM   2260 N  NE1   . TRP B 1 90  ? 33.339 5.093   20.800 1.00 61.93 ? 2152 TRP B NE1   1 
ATOM   2261 C  CE2   . TRP B 1 90  ? 32.705 4.557   21.890 1.00 61.95 ? 2152 TRP B CE2   1 
ATOM   2262 C  CE3   . TRP B 1 90  ? 33.272 3.167   23.796 1.00 61.81 ? 2152 TRP B CE3   1 
ATOM   2263 C  CZ2   . TRP B 1 90  ? 31.368 4.653   22.294 1.00 61.91 ? 2152 TRP B CZ2   1 
ATOM   2264 C  CZ3   . TRP B 1 90  ? 31.940 3.263   24.197 1.00 61.92 ? 2152 TRP B CZ3   1 
ATOM   2265 C  CH2   . TRP B 1 90  ? 31.006 4.002   23.446 1.00 61.99 ? 2152 TRP B CH2   1 
ATOM   2266 N  N     . GLY B 1 91  ? 38.196 2.601   24.637 1.00 59.34 ? 2153 GLY B N     1 
ATOM   2267 C  CA    . GLY B 1 91  ? 39.299 1.756   25.077 1.00 58.52 ? 2153 GLY B CA    1 
ATOM   2268 C  C     . GLY B 1 91  ? 38.855 0.327   25.323 1.00 57.88 ? 2153 GLY B C     1 
ATOM   2269 O  O     . GLY B 1 91  ? 37.664 0.022   25.307 1.00 57.82 ? 2153 GLY B O     1 
ATOM   2270 N  N     . ILE B 1 92  ? 39.820 -0.553  25.555 1.00 57.35 ? 2154 ILE B N     1 
ATOM   2271 C  CA    . ILE B 1 92  ? 39.527 -1.946  25.861 1.00 56.81 ? 2154 ILE B CA    1 
ATOM   2272 C  C     . ILE B 1 92  ? 40.045 -2.297  27.251 1.00 56.51 ? 2154 ILE B C     1 
ATOM   2273 O  O     . ILE B 1 92  ? 41.254 -2.309  27.494 1.00 56.44 ? 2154 ILE B O     1 
ATOM   2274 C  CB    . ILE B 1 92  ? 40.124 -2.899  24.795 1.00 56.80 ? 2154 ILE B CB    1 
ATOM   2275 C  CG1   . ILE B 1 92  ? 39.440 -2.698  23.431 1.00 56.71 ? 2154 ILE B CG1   1 
ATOM   2276 C  CG2   . ILE B 1 92  ? 40.072 -4.361  25.260 1.00 56.77 ? 2154 ILE B CG2   1 
ATOM   2277 C  CD1   . ILE B 1 92  ? 37.932 -2.960  23.402 1.00 56.46 ? 2154 ILE B CD1   1 
ATOM   2278 N  N     . ARG B 1 93  ? 39.124 -2.560  28.169 1.00 56.14 ? 2155 ARG B N     1 
ATOM   2279 C  CA    . ARG B 1 93  ? 39.508 -2.969  29.511 1.00 55.89 ? 2155 ARG B CA    1 
ATOM   2280 C  C     . ARG B 1 93  ? 39.147 -4.417  29.758 1.00 55.84 ? 2155 ARG B C     1 
ATOM   2281 O  O     . ARG B 1 93  ? 38.174 -4.934  29.202 1.00 55.90 ? 2155 ARG B O     1 
ATOM   2282 C  CB    . ARG B 1 93  ? 38.887 -2.067  30.583 1.00 55.77 ? 2155 ARG B CB    1 
ATOM   2283 C  CG    . ARG B 1 93  ? 37.401 -2.256  30.819 1.00 55.33 ? 2155 ARG B CG    1 
ATOM   2284 C  CD    . ARG B 1 93  ? 36.944 -1.368  31.944 1.00 55.10 ? 2155 ARG B CD    1 
ATOM   2285 N  NE    . ARG B 1 93  ? 35.540 -1.002  31.814 1.00 55.33 ? 2155 ARG B NE    1 
ATOM   2286 C  CZ    . ARG B 1 93  ? 35.021 0.138   32.259 1.00 55.72 ? 2155 ARG B CZ    1 
ATOM   2287 N  NH1   . ARG B 1 93  ? 35.791 1.037   32.861 1.00 55.98 ? 2155 ARG B NH1   1 
ATOM   2288 N  NH2   . ARG B 1 93  ? 33.730 0.387   32.094 1.00 56.06 ? 2155 ARG B NH2   1 
ATOM   2289 N  N     . THR B 1 94  ? 39.947 -5.066  30.593 1.00 55.66 ? 2156 THR B N     1 
ATOM   2290 C  CA    . THR B 1 94  ? 39.689 -6.434  30.989 1.00 55.58 ? 2156 THR B CA    1 
ATOM   2291 C  C     . THR B 1 94  ? 38.741 -6.442  32.190 1.00 55.56 ? 2156 THR B C     1 
ATOM   2292 O  O     . THR B 1 94  ? 38.949 -5.709  33.154 1.00 55.69 ? 2156 THR B O     1 
ATOM   2293 C  CB    . THR B 1 94  ? 41.011 -7.194  31.266 1.00 55.56 ? 2156 THR B CB    1 
ATOM   2294 O  OG1   . THR B 1 94  ? 40.720 -8.505  31.763 1.00 55.92 ? 2156 THR B OG1   1 
ATOM   2295 C  CG2   . THR B 1 94  ? 41.905 -6.443  32.263 1.00 55.51 ? 2156 THR B CG2   1 
ATOM   2296 N  N     . LYS B 1 95  ? 37.681 -7.242  32.111 1.00 55.57 ? 2157 LYS B N     1 
ATOM   2297 C  CA    . LYS B 1 95  ? 36.704 -7.337  33.200 1.00 55.61 ? 2157 LYS B CA    1 
ATOM   2298 C  C     . LYS B 1 95  ? 37.146 -8.351  34.250 1.00 55.71 ? 2157 LYS B C     1 
ATOM   2299 O  O     . LYS B 1 95  ? 36.526 -8.470  35.311 1.00 55.66 ? 2157 LYS B O     1 
ATOM   2300 C  CB    . LYS B 1 95  ? 35.317 -7.710  32.664 1.00 55.54 ? 2157 LYS B CB    1 
ATOM   2301 C  CG    . LYS B 1 95  ? 34.586 -6.583  31.941 1.00 55.23 ? 2157 LYS B CG    1 
ATOM   2302 C  CD    . LYS B 1 95  ? 33.204 -7.020  31.463 1.00 54.35 ? 2157 LYS B CD    1 
ATOM   2303 C  CE    . LYS B 1 95  ? 33.277 -7.818  30.172 1.00 53.87 ? 2157 LYS B CE    1 
ATOM   2304 N  NZ    . LYS B 1 95  ? 32.031 -8.581  29.915 1.00 53.95 ? 2157 LYS B NZ    1 
ATOM   2305 N  N     . GLU B 1 96  ? 38.223 -9.072  33.939 1.00 55.84 ? 2158 GLU B N     1 
ATOM   2306 C  CA    . GLU B 1 96  ? 38.757 -10.135 34.790 1.00 55.91 ? 2158 GLU B CA    1 
ATOM   2307 C  C     . GLU B 1 96  ? 40.289 -10.079 34.861 1.00 55.67 ? 2158 GLU B C     1 
ATOM   2308 O  O     . GLU B 1 96  ? 40.930 -9.578  33.939 1.00 55.59 ? 2158 GLU B O     1 
ATOM   2309 C  CB    . GLU B 1 96  ? 38.312 -11.501 34.259 1.00 56.06 ? 2158 GLU B CB    1 
ATOM   2310 C  CG    . GLU B 1 96  ? 36.837 -11.814 34.458 1.00 56.91 ? 2158 GLU B CG    1 
ATOM   2311 C  CD    . GLU B 1 96  ? 36.436 -13.131 33.824 1.00 58.60 ? 2158 GLU B CD    1 
ATOM   2312 O  OE1   . GLU B 1 96  ? 37.242 -14.087 33.867 1.00 59.30 ? 2158 GLU B OE1   1 
ATOM   2313 O  OE2   . GLU B 1 96  ? 35.312 -13.215 33.282 1.00 59.56 ? 2158 GLU B OE2   1 
ATOM   2314 N  N     . PRO B 1 97  ? 40.884 -10.594 35.956 1.00 55.56 ? 2159 PRO B N     1 
ATOM   2315 C  CA    . PRO B 1 97  ? 42.342 -10.596 36.075 1.00 55.45 ? 2159 PRO B CA    1 
ATOM   2316 C  C     . PRO B 1 97  ? 43.031 -11.346 34.940 1.00 55.28 ? 2159 PRO B C     1 
ATOM   2317 O  O     . PRO B 1 97  ? 42.543 -12.386 34.499 1.00 55.25 ? 2159 PRO B O     1 
ATOM   2318 C  CB    . PRO B 1 97  ? 42.587 -11.325 37.406 1.00 55.52 ? 2159 PRO B CB    1 
ATOM   2319 C  CG    . PRO B 1 97  ? 41.312 -12.045 37.704 1.00 55.51 ? 2159 PRO B CG    1 
ATOM   2320 C  CD    . PRO B 1 97  ? 40.251 -11.147 37.166 1.00 55.59 ? 2159 PRO B CD    1 
ATOM   2321 N  N     . LEU B 1 98  ? 44.154 -10.806 34.476 1.00 55.14 ? 2160 LEU B N     1 
ATOM   2322 C  CA    . LEU B 1 98  ? 44.970 -11.464 33.456 1.00 55.04 ? 2160 LEU B CA    1 
ATOM   2323 C  C     . LEU B 1 98  ? 46.401 -11.675 33.954 1.00 54.83 ? 2160 LEU B C     1 
ATOM   2324 O  O     . LEU B 1 98  ? 46.867 -10.960 34.847 1.00 54.80 ? 2160 LEU B O     1 
ATOM   2325 C  CB    . LEU B 1 98  ? 44.964 -10.662 32.147 1.00 55.08 ? 2160 LEU B CB    1 
ATOM   2326 C  CG    . LEU B 1 98  ? 43.622 -10.325 31.484 1.00 55.16 ? 2160 LEU B CG    1 
ATOM   2327 C  CD1   . LEU B 1 98  ? 43.839 -9.402  30.295 1.00 55.36 ? 2160 LEU B CD1   1 
ATOM   2328 C  CD2   . LEU B 1 98  ? 42.853 -11.577 31.060 1.00 55.13 ? 2160 LEU B CD2   1 
ATOM   2329 N  N     . LYS B 1 99  ? 47.085 -12.653 33.364 1.00 54.55 ? 2161 LYS B N     1 
ATOM   2330 C  CA    . LYS B 1 99  ? 48.416 -13.072 33.812 1.00 54.41 ? 2161 LYS B CA    1 
ATOM   2331 C  C     . LYS B 1 99  ? 49.513 -12.783 32.784 1.00 54.07 ? 2161 LYS B C     1 
ATOM   2332 O  O     . LYS B 1 99  ? 49.267 -12.817 31.575 1.00 54.29 ? 2161 LYS B O     1 
ATOM   2333 C  CB    . LYS B 1 99  ? 48.408 -14.565 34.168 1.00 54.49 ? 2161 LYS B CB    1 
ATOM   2334 C  CG    . LYS B 1 99  ? 47.460 -14.918 35.315 1.00 55.23 ? 2161 LYS B CG    1 
ATOM   2335 C  CD    . LYS B 1 99  ? 47.704 -16.319 35.853 1.00 56.25 ? 2161 LYS B CD    1 
ATOM   2336 C  CE    . LYS B 1 99  ? 47.054 -16.492 37.223 1.00 57.01 ? 2161 LYS B CE    1 
ATOM   2337 N  NZ    . LYS B 1 99  ? 47.291 -17.846 37.807 1.00 57.12 ? 2161 LYS B NZ    1 
ATOM   2338 N  N     . ALA B 1 100 ? 50.719 -12.500 33.273 1.00 53.41 ? 2162 ALA B N     1 
ATOM   2339 C  CA    . ALA B 1 100 ? 51.872 -12.231 32.412 1.00 52.64 ? 2162 ALA B CA    1 
ATOM   2340 C  C     . ALA B 1 100 ? 52.121 -13.366 31.418 1.00 52.07 ? 2162 ALA B C     1 
ATOM   2341 O  O     . ALA B 1 100 ? 52.158 -14.538 31.802 1.00 52.05 ? 2162 ALA B O     1 
ATOM   2342 C  CB    . ALA B 1 100 ? 53.112 -11.986 33.256 1.00 52.75 ? 2162 ALA B CB    1 
ATOM   2343 N  N     . GLY B 1 101 ? 52.270 -13.005 30.143 1.00 51.29 ? 2163 GLY B N     1 
ATOM   2344 C  CA    . GLY B 1 101 ? 52.566 -13.967 29.078 1.00 50.34 ? 2163 GLY B CA    1 
ATOM   2345 C  C     . GLY B 1 101 ? 51.338 -14.535 28.386 1.00 49.68 ? 2163 GLY B C     1 
ATOM   2346 O  O     . GLY B 1 101 ? 51.448 -15.183 27.339 1.00 49.50 ? 2163 GLY B O     1 
ATOM   2347 N  N     . GLN B 1 102 ? 50.169 -14.280 28.974 1.00 48.95 ? 2164 GLN B N     1 
ATOM   2348 C  CA    . GLN B 1 102 ? 48.897 -14.813 28.492 1.00 48.19 ? 2164 GLN B CA    1 
ATOM   2349 C  C     . GLN B 1 102 ? 48.507 -14.238 27.128 1.00 47.54 ? 2164 GLN B C     1 
ATOM   2350 O  O     . GLN B 1 102 ? 48.627 -13.033 26.889 1.00 47.45 ? 2164 GLN B O     1 
ATOM   2351 C  CB    . GLN B 1 102 ? 47.794 -14.522 29.519 1.00 48.29 ? 2164 GLN B CB    1 
ATOM   2352 C  CG    . GLN B 1 102 ? 46.493 -15.302 29.325 1.00 48.57 ? 2164 GLN B CG    1 
ATOM   2353 C  CD    . GLN B 1 102 ? 45.296 -14.663 30.026 1.00 48.61 ? 2164 GLN B CD    1 
ATOM   2354 O  OE1   . GLN B 1 102 ? 45.448 -13.771 30.862 1.00 48.82 ? 2164 GLN B OE1   1 
ATOM   2355 N  NE2   . GLN B 1 102 ? 44.097 -15.127 29.684 1.00 48.58 ? 2164 GLN B NE2   1 
ATOM   2356 N  N     . PHE B 1 103 ? 48.041 -15.119 26.247 1.00 46.70 ? 2165 PHE B N     1 
ATOM   2357 C  CA    . PHE B 1 103 ? 47.458 -14.732 24.967 1.00 45.87 ? 2165 PHE B CA    1 
ATOM   2358 C  C     . PHE B 1 103 ? 46.074 -14.133 25.200 1.00 45.21 ? 2165 PHE B C     1 
ATOM   2359 O  O     . PHE B 1 103 ? 45.184 -14.796 25.743 1.00 45.22 ? 2165 PHE B O     1 
ATOM   2360 C  CB    . PHE B 1 103 ? 47.381 -15.953 24.046 1.00 45.98 ? 2165 PHE B CB    1 
ATOM   2361 C  CG    . PHE B 1 103 ? 46.595 -15.728 22.784 1.00 46.65 ? 2165 PHE B CG    1 
ATOM   2362 C  CD1   . PHE B 1 103 ? 47.104 -14.939 21.756 1.00 47.48 ? 2165 PHE B CD1   1 
ATOM   2363 C  CD2   . PHE B 1 103 ? 45.353 -16.332 22.609 1.00 47.07 ? 2165 PHE B CD2   1 
ATOM   2364 C  CE1   . PHE B 1 103 ? 46.374 -14.739 20.579 1.00 47.83 ? 2165 PHE B CE1   1 
ATOM   2365 C  CE2   . PHE B 1 103 ? 44.619 -16.143 21.435 1.00 47.31 ? 2165 PHE B CE2   1 
ATOM   2366 C  CZ    . PHE B 1 103 ? 45.131 -15.344 20.420 1.00 47.56 ? 2165 PHE B CZ    1 
ATOM   2367 N  N     . ILE B 1 104 ? 45.906 -12.875 24.798 1.00 44.29 ? 2166 ILE B N     1 
ATOM   2368 C  CA    . ILE B 1 104 ? 44.660 -12.144 25.021 1.00 43.32 ? 2166 ILE B CA    1 
ATOM   2369 C  C     . ILE B 1 104 ? 43.745 -12.209 23.800 1.00 42.69 ? 2166 ILE B C     1 
ATOM   2370 O  O     . ILE B 1 104 ? 42.623 -12.705 23.896 1.00 42.63 ? 2166 ILE B O     1 
ATOM   2371 C  CB    . ILE B 1 104 ? 44.932 -10.679 25.442 1.00 43.34 ? 2166 ILE B CB    1 
ATOM   2372 C  CG1   . ILE B 1 104 ? 45.505 -10.643 26.864 1.00 43.52 ? 2166 ILE B CG1   1 
ATOM   2373 C  CG2   . ILE B 1 104 ? 43.660 -9.830  25.353 1.00 43.49 ? 2166 ILE B CG2   1 
ATOM   2374 C  CD1   . ILE B 1 104 ? 46.348 -9.421  27.181 1.00 43.10 ? 2166 ILE B CD1   1 
ATOM   2375 N  N     . ILE B 1 105 ? 44.239 -11.726 22.660 1.00 41.81 ? 2167 ILE B N     1 
ATOM   2376 C  CA    . ILE B 1 105 ? 43.458 -11.655 21.423 1.00 40.97 ? 2167 ILE B CA    1 
ATOM   2377 C  C     . ILE B 1 105 ? 44.388 -11.478 20.212 1.00 40.34 ? 2167 ILE B C     1 
ATOM   2378 O  O     . ILE B 1 105 ? 45.487 -10.933 20.351 1.00 40.16 ? 2167 ILE B O     1 
ATOM   2379 C  CB    . ILE B 1 105 ? 42.398 -10.506 21.502 1.00 40.97 ? 2167 ILE B CB    1 
ATOM   2380 C  CG1   . ILE B 1 105 ? 41.315 -10.659 20.424 1.00 40.72 ? 2167 ILE B CG1   1 
ATOM   2381 C  CG2   . ILE B 1 105 ? 43.069 -9.123  21.474 1.00 41.13 ? 2167 ILE B CG2   1 
ATOM   2382 C  CD1   . ILE B 1 105 ? 40.099 -9.764  20.634 1.00 39.81 ? 2167 ILE B CD1   1 
ATOM   2383 N  N     . GLU B 1 106 ? 43.960 -11.964 19.043 1.00 39.48 ? 2168 GLU B N     1 
ATOM   2384 C  CA    . GLU B 1 106 ? 44.687 -11.721 17.791 1.00 38.73 ? 2168 GLU B CA    1 
ATOM   2385 C  C     . GLU B 1 106 ? 44.282 -10.388 17.184 1.00 38.47 ? 2168 GLU B C     1 
ATOM   2386 O  O     . GLU B 1 106 ? 43.101 -10.054 17.144 1.00 38.61 ? 2168 GLU B O     1 
ATOM   2387 C  CB    . GLU B 1 106 ? 44.454 -12.835 16.770 1.00 38.44 ? 2168 GLU B CB    1 
ATOM   2388 C  CG    . GLU B 1 106 ? 45.215 -12.611 15.467 1.00 37.95 ? 2168 GLU B CG    1 
ATOM   2389 C  CD    . GLU B 1 106 ? 45.015 -13.697 14.426 1.00 37.71 ? 2168 GLU B CD    1 
ATOM   2390 O  OE1   . GLU B 1 106 ? 44.232 -14.639 14.661 1.00 38.10 ? 2168 GLU B OE1   1 
ATOM   2391 O  OE2   . GLU B 1 106 ? 45.644 -13.599 13.353 1.00 37.32 ? 2168 GLU B OE2   1 
ATOM   2392 N  N     . TYR B 1 107 ? 45.262 -9.629  16.707 1.00 38.17 ? 2169 TYR B N     1 
ATOM   2393 C  CA    . TYR B 1 107 ? 44.975 -8.362  16.048 1.00 37.90 ? 2169 TYR B CA    1 
ATOM   2394 C  C     . TYR B 1 107 ? 44.585 -8.611  14.592 1.00 37.67 ? 2169 TYR B C     1 
ATOM   2395 O  O     . TYR B 1 107 ? 45.433 -8.933  13.750 1.00 37.65 ? 2169 TYR B O     1 
ATOM   2396 C  CB    . TYR B 1 107 ? 46.168 -7.410  16.147 1.00 38.00 ? 2169 TYR B CB    1 
ATOM   2397 C  CG    . TYR B 1 107 ? 45.866 -6.011  15.675 1.00 38.39 ? 2169 TYR B CG    1 
ATOM   2398 C  CD1   . TYR B 1 107 ? 45.370 -5.052  16.555 1.00 39.15 ? 2169 TYR B CD1   1 
ATOM   2399 C  CD2   . TYR B 1 107 ? 46.067 -5.645  14.344 1.00 39.09 ? 2169 TYR B CD2   1 
ATOM   2400 C  CE1   . TYR B 1 107 ? 45.080 -3.760  16.124 1.00 39.84 ? 2169 TYR B CE1   1 
ATOM   2401 C  CE2   . TYR B 1 107 ? 45.782 -4.359  13.901 1.00 39.78 ? 2169 TYR B CE2   1 
ATOM   2402 C  CZ    . TYR B 1 107 ? 45.292 -3.421  14.796 1.00 40.22 ? 2169 TYR B CZ    1 
ATOM   2403 O  OH    . TYR B 1 107 ? 45.012 -2.147  14.361 1.00 41.15 ? 2169 TYR B OH    1 
ATOM   2404 N  N     . LEU B 1 108 ? 43.293 -8.460  14.310 1.00 37.28 ? 2170 LEU B N     1 
ATOM   2405 C  CA    . LEU B 1 108 ? 42.743 -8.726  12.984 1.00 36.80 ? 2170 LEU B CA    1 
ATOM   2406 C  C     . LEU B 1 108 ? 42.559 -7.461  12.163 1.00 36.72 ? 2170 LEU B C     1 
ATOM   2407 O  O     . LEU B 1 108 ? 42.384 -6.375  12.717 1.00 37.08 ? 2170 LEU B O     1 
ATOM   2408 C  CB    . LEU B 1 108 ? 41.406 -9.454  13.104 1.00 36.60 ? 2170 LEU B CB    1 
ATOM   2409 C  CG    . LEU B 1 108 ? 41.424 -10.840 13.752 1.00 36.20 ? 2170 LEU B CG    1 
ATOM   2410 C  CD1   . LEU B 1 108 ? 40.025 -11.409 13.801 1.00 35.27 ? 2170 LEU B CD1   1 
ATOM   2411 C  CD2   . LEU B 1 108 ? 42.360 -11.784 13.017 1.00 35.89 ? 2170 LEU B CD2   1 
ATOM   2412 N  N     . GLY B 1 109 ? 42.599 -7.612  10.842 1.00 36.45 ? 2171 GLY B N     1 
ATOM   2413 C  CA    . GLY B 1 109 ? 42.338 -6.508  9.918  1.00 36.11 ? 2171 GLY B CA    1 
ATOM   2414 C  C     . GLY B 1 109 ? 42.556 -6.897  8.468  1.00 35.86 ? 2171 GLY B C     1 
ATOM   2415 O  O     . GLY B 1 109 ? 42.590 -8.085  8.137  1.00 35.80 ? 2171 GLY B O     1 
ATOM   2416 N  N     . GLU B 1 110 ? 42.696 -5.897  7.601  1.00 35.55 ? 2172 GLU B N     1 
ATOM   2417 C  CA    . GLU B 1 110 ? 42.986 -6.140  6.192  1.00 35.46 ? 2172 GLU B CA    1 
ATOM   2418 C  C     . GLU B 1 110 ? 44.491 -6.111  5.966  1.00 35.50 ? 2172 GLU B C     1 
ATOM   2419 O  O     . GLU B 1 110 ? 45.151 -5.115  6.266  1.00 35.47 ? 2172 GLU B O     1 
ATOM   2420 C  CB    . GLU B 1 110 ? 42.288 -5.107  5.299  1.00 35.43 ? 2172 GLU B CB    1 
ATOM   2421 C  CG    . GLU B 1 110 ? 40.837 -5.423  4.970  1.00 34.82 ? 2172 GLU B CG    1 
ATOM   2422 C  CD    . GLU B 1 110 ? 40.127 -4.271  4.267  1.00 34.64 ? 2172 GLU B CD    1 
ATOM   2423 O  OE1   . GLU B 1 110 ? 39.873 -3.236  4.915  1.00 34.41 ? 2172 GLU B OE1   1 
ATOM   2424 O  OE2   . GLU B 1 110 ? 39.805 -4.405  3.068  1.00 34.57 ? 2172 GLU B OE2   1 
ATOM   2425 N  N     . VAL B 1 111 ? 45.037 -7.208  5.453  1.00 35.62 ? 2173 VAL B N     1 
ATOM   2426 C  CA    . VAL B 1 111 ? 46.477 -7.286  5.225  1.00 35.99 ? 2173 VAL B CA    1 
ATOM   2427 C  C     . VAL B 1 111 ? 46.789 -6.755  3.839  1.00 36.26 ? 2173 VAL B C     1 
ATOM   2428 O  O     . VAL B 1 111 ? 46.414 -7.346  2.827  1.00 36.51 ? 2173 VAL B O     1 
ATOM   2429 C  CB    . VAL B 1 111 ? 47.048 -8.713  5.413  1.00 35.95 ? 2173 VAL B CB    1 
ATOM   2430 C  CG1   . VAL B 1 111 ? 48.546 -8.725  5.138  1.00 35.93 ? 2173 VAL B CG1   1 
ATOM   2431 C  CG2   . VAL B 1 111 ? 46.767 -9.225  6.818  1.00 35.42 ? 2173 VAL B CG2   1 
ATOM   2432 N  N     . VAL B 1 112 ? 47.480 -5.625  3.816  1.00 36.55 ? 2174 VAL B N     1 
ATOM   2433 C  CA    . VAL B 1 112 ? 47.719 -4.877  2.597  1.00 36.77 ? 2174 VAL B CA    1 
ATOM   2434 C  C     . VAL B 1 112 ? 49.203 -4.556  2.457  1.00 37.18 ? 2174 VAL B C     1 
ATOM   2435 O  O     . VAL B 1 112 ? 49.927 -4.514  3.449  1.00 37.29 ? 2174 VAL B O     1 
ATOM   2436 C  CB    . VAL B 1 112 ? 46.907 -3.558  2.592  1.00 36.66 ? 2174 VAL B CB    1 
ATOM   2437 C  CG1   . VAL B 1 112 ? 45.428 -3.837  2.436  1.00 36.57 ? 2174 VAL B CG1   1 
ATOM   2438 C  CG2   . VAL B 1 112 ? 47.154 -2.761  3.860  1.00 36.47 ? 2174 VAL B CG2   1 
ATOM   2439 N  N     . SER B 1 113 ? 49.652 -4.337  1.223  1.00 37.67 ? 2175 SER B N     1 
ATOM   2440 C  CA    . SER B 1 113 ? 51.026 -3.915  0.968  1.00 37.94 ? 2175 SER B CA    1 
ATOM   2441 C  C     . SER B 1 113 ? 51.223 -2.460  1.382  1.00 38.20 ? 2175 SER B C     1 
ATOM   2442 O  O     . SER B 1 113 ? 50.258 -1.753  1.681  1.00 38.05 ? 2175 SER B O     1 
ATOM   2443 C  CB    . SER B 1 113 ? 51.381 -4.102  -0.508 1.00 37.98 ? 2175 SER B CB    1 
ATOM   2444 O  OG    . SER B 1 113 ? 50.551 -3.305  -1.335 1.00 37.89 ? 2175 SER B OG    1 
ATOM   2445 N  N     . GLU B 1 114 ? 52.478 -2.022  1.411  1.00 38.65 ? 2176 GLU B N     1 
ATOM   2446 C  CA    . GLU B 1 114 ? 52.799 -0.643  1.748  1.00 39.23 ? 2176 GLU B CA    1 
ATOM   2447 C  C     . GLU B 1 114 ? 52.105 0.302   0.775  1.00 39.47 ? 2176 GLU B C     1 
ATOM   2448 O  O     . GLU B 1 114 ? 51.426 1.240   1.192  1.00 39.58 ? 2176 GLU B O     1 
ATOM   2449 C  CB    . GLU B 1 114 ? 54.311 -0.430  1.713  1.00 39.38 ? 2176 GLU B CB    1 
ATOM   2450 C  CG    . GLU B 1 114 ? 54.772 0.942   2.173  1.00 40.17 ? 2176 GLU B CG    1 
ATOM   2451 C  CD    . GLU B 1 114 ? 56.281 1.084   2.157  1.00 41.57 ? 2176 GLU B CD    1 
ATOM   2452 O  OE1   . GLU B 1 114 ? 56.985 0.131   2.566  1.00 42.22 ? 2176 GLU B OE1   1 
ATOM   2453 O  OE2   . GLU B 1 114 ? 56.768 2.157   1.741  1.00 42.45 ? 2176 GLU B OE2   1 
ATOM   2454 N  N     . GLN B 1 115 ? 52.271 0.027   -0.519 1.00 39.79 ? 2177 GLN B N     1 
ATOM   2455 C  CA    . GLN B 1 115 ? 51.702 0.839   -1.593 1.00 40.04 ? 2177 GLN B CA    1 
ATOM   2456 C  C     . GLN B 1 115 ? 50.176 0.903   -1.517 1.00 40.15 ? 2177 GLN B C     1 
ATOM   2457 O  O     . GLN B 1 115 ? 49.596 1.983   -1.626 1.00 40.47 ? 2177 GLN B O     1 
ATOM   2458 C  CB    . GLN B 1 115 ? 52.158 0.305   -2.956 1.00 40.12 ? 2177 GLN B CB    1 
ATOM   2459 C  CG    . GLN B 1 115 ? 51.605 1.044   -4.164 1.00 40.70 ? 2177 GLN B CG    1 
ATOM   2460 C  CD    . GLN B 1 115 ? 52.217 2.422   -4.352 1.00 41.71 ? 2177 GLN B CD    1 
ATOM   2461 O  OE1   . GLN B 1 115 ? 53.407 2.552   -4.647 1.00 42.28 ? 2177 GLN B OE1   1 
ATOM   2462 N  NE2   . GLN B 1 115 ? 51.397 3.461   -4.203 1.00 41.29 ? 2177 GLN B NE2   1 
ATOM   2463 N  N     . GLU B 1 116 ? 49.534 -0.246  -1.318 1.00 40.17 ? 2178 GLU B N     1 
ATOM   2464 C  CA    . GLU B 1 116 ? 48.076 -0.306  -1.197 1.00 40.34 ? 2178 GLU B CA    1 
ATOM   2465 C  C     . GLU B 1 116 ? 47.567 0.553   -0.035 1.00 40.54 ? 2178 GLU B C     1 
ATOM   2466 O  O     . GLU B 1 116 ? 46.551 1.244   -0.157 1.00 40.49 ? 2178 GLU B O     1 
ATOM   2467 C  CB    . GLU B 1 116 ? 47.607 -1.761  -1.060 1.00 40.39 ? 2178 GLU B CB    1 
ATOM   2468 C  CG    . GLU B 1 116 ? 46.134 -1.952  -0.678 1.00 40.43 ? 2178 GLU B CG    1 
ATOM   2469 C  CD    . GLU B 1 116 ? 45.168 -1.257  -1.619 1.00 40.29 ? 2178 GLU B CD    1 
ATOM   2470 O  OE1   . GLU B 1 116 ? 45.318 -1.395  -2.853 1.00 40.16 ? 2178 GLU B OE1   1 
ATOM   2471 O  OE2   . GLU B 1 116 ? 44.257 -0.571  -1.115 1.00 39.90 ? 2178 GLU B OE2   1 
ATOM   2472 N  N     . PHE B 1 117 ? 48.294 0.507   1.080  1.00 40.81 ? 2179 PHE B N     1 
ATOM   2473 C  CA    . PHE B 1 117 ? 47.985 1.306   2.259  1.00 40.95 ? 2179 PHE B CA    1 
ATOM   2474 C  C     . PHE B 1 117 ? 48.266 2.790   2.043  1.00 41.32 ? 2179 PHE B C     1 
ATOM   2475 O  O     . PHE B 1 117 ? 47.544 3.639   2.563  1.00 41.49 ? 2179 PHE B O     1 
ATOM   2476 C  CB    . PHE B 1 117 ? 48.781 0.797   3.453  1.00 40.86 ? 2179 PHE B CB    1 
ATOM   2477 C  CG    . PHE B 1 117 ? 48.388 1.423   4.755  1.00 40.41 ? 2179 PHE B CG    1 
ATOM   2478 C  CD1   . PHE B 1 117 ? 47.104 1.257   5.262  1.00 40.11 ? 2179 PHE B CD1   1 
ATOM   2479 C  CD2   . PHE B 1 117 ? 49.308 2.160   5.483  1.00 39.97 ? 2179 PHE B CD2   1 
ATOM   2480 C  CE1   . PHE B 1 117 ? 46.735 1.829   6.470  1.00 39.84 ? 2179 PHE B CE1   1 
ATOM   2481 C  CE2   . PHE B 1 117 ? 48.953 2.732   6.692  1.00 40.35 ? 2179 PHE B CE2   1 
ATOM   2482 C  CZ    . PHE B 1 117 ? 47.658 2.563   7.189  1.00 40.24 ? 2179 PHE B CZ    1 
ATOM   2483 N  N     . ARG B 1 118 ? 49.316 3.100   1.285  1.00 41.69 ? 2180 ARG B N     1 
ATOM   2484 C  CA    . ARG B 1 118 ? 49.611 4.482   0.923  1.00 42.03 ? 2180 ARG B CA    1 
ATOM   2485 C  C     . ARG B 1 118 ? 48.443 5.049   0.120  1.00 42.12 ? 2180 ARG B C     1 
ATOM   2486 O  O     . ARG B 1 118 ? 48.006 6.180   0.360  1.00 42.31 ? 2180 ARG B O     1 
ATOM   2487 C  CB    . ARG B 1 118 ? 50.931 4.585   0.146  1.00 42.10 ? 2180 ARG B CB    1 
ATOM   2488 C  CG    . ARG B 1 118 ? 51.232 5.982   -0.397 1.00 42.74 ? 2180 ARG B CG    1 
ATOM   2489 C  CD    . ARG B 1 118 ? 52.713 6.181   -0.685 1.00 43.94 ? 2180 ARG B CD    1 
ATOM   2490 N  NE    . ARG B 1 118 ? 52.962 7.213   -1.697 1.00 44.90 ? 2180 ARG B NE    1 
ATOM   2491 C  CZ    . ARG B 1 118 ? 52.954 8.530   -1.476 1.00 45.26 ? 2180 ARG B CZ    1 
ATOM   2492 N  NH1   . ARG B 1 118 ? 52.694 9.014   -0.265 1.00 44.90 ? 2180 ARG B NH1   1 
ATOM   2493 N  NH2   . ARG B 1 118 ? 53.201 9.372   -2.478 1.00 45.37 ? 2180 ARG B NH2   1 
ATOM   2494 N  N     . ASN B 1 119 ? 47.927 4.247   -0.811 1.00 42.08 ? 2181 ASN B N     1 
ATOM   2495 C  CA    . ASN B 1 119 ? 46.767 4.635   -1.612 1.00 42.17 ? 2181 ASN B CA    1 
ATOM   2496 C  C     . ASN B 1 119 ? 45.533 4.939   -0.758 1.00 42.03 ? 2181 ASN B C     1 
ATOM   2497 O  O     . ASN B 1 119 ? 44.910 5.991   -0.912 1.00 41.90 ? 2181 ASN B O     1 
ATOM   2498 C  CB    . ASN B 1 119 ? 46.451 3.561   -2.662 1.00 42.22 ? 2181 ASN B CB    1 
ATOM   2499 C  CG    . ASN B 1 119 ? 47.484 3.506   -3.777 1.00 42.46 ? 2181 ASN B CG    1 
ATOM   2500 O  OD1   . ASN B 1 119 ? 48.423 4.308   -3.819 1.00 43.08 ? 2181 ASN B OD1   1 
ATOM   2501 N  ND2   . ASN B 1 119 ? 47.314 2.557   -4.689 1.00 42.23 ? 2181 ASN B ND2   1 
ATOM   2502 N  N     . ARG B 1 120 ? 45.206 4.018   0.148  1.00 41.99 ? 2182 ARG B N     1 
ATOM   2503 C  CA    . ARG B 1 120 ? 44.054 4.153   1.042  1.00 42.04 ? 2182 ARG B CA    1 
ATOM   2504 C  C     . ARG B 1 120 ? 44.169 5.387   1.931  1.00 42.29 ? 2182 ARG B C     1 
ATOM   2505 O  O     . ARG B 1 120 ? 43.196 6.118   2.116  1.00 42.07 ? 2182 ARG B O     1 
ATOM   2506 C  CB    . ARG B 1 120 ? 43.905 2.906   1.916  1.00 41.82 ? 2182 ARG B CB    1 
ATOM   2507 C  CG    . ARG B 1 120 ? 43.286 1.707   1.232  1.00 41.27 ? 2182 ARG B CG    1 
ATOM   2508 C  CD    . ARG B 1 120 ? 43.633 0.434   1.985  1.00 40.72 ? 2182 ARG B CD    1 
ATOM   2509 N  NE    . ARG B 1 120 ? 43.046 -0.756  1.373  1.00 40.38 ? 2182 ARG B NE    1 
ATOM   2510 C  CZ    . ARG B 1 120 ? 42.296 -1.648  2.016  1.00 40.14 ? 2182 ARG B CZ    1 
ATOM   2511 N  NH1   . ARG B 1 120 ? 42.041 -1.507  3.313  1.00 39.79 ? 2182 ARG B NH1   1 
ATOM   2512 N  NH2   . ARG B 1 120 ? 41.810 -2.693  1.361  1.00 39.66 ? 2182 ARG B NH2   1 
ATOM   2513 N  N     . MET B 1 121 ? 45.370 5.608   2.466  1.00 42.71 ? 2183 MET B N     1 
ATOM   2514 C  CA    . MET B 1 121 ? 45.657 6.735   3.350  1.00 43.20 ? 2183 MET B CA    1 
ATOM   2515 C  C     . MET B 1 121 ? 45.325 8.061   2.678  1.00 43.34 ? 2183 MET B C     1 
ATOM   2516 O  O     . MET B 1 121 ? 44.850 8.987   3.330  1.00 43.17 ? 2183 MET B O     1 
ATOM   2517 C  CB    . MET B 1 121 ? 47.130 6.707   3.779  1.00 43.35 ? 2183 MET B CB    1 
ATOM   2518 C  CG    . MET B 1 121 ? 47.493 7.605   4.970  1.00 43.93 ? 2183 MET B CG    1 
ATOM   2519 S  SD    . MET B 1 121 ? 46.661 7.235   6.542  1.00 44.94 ? 2183 MET B SD    1 
ATOM   2520 C  CE    . MET B 1 121 ? 46.954 5.491   6.723  1.00 44.11 ? 2183 MET B CE    1 
ATOM   2521 N  N     . ILE B 1 122 ? 45.568 8.133   1.370  1.00 43.79 ? 2184 ILE B N     1 
ATOM   2522 C  CA    . ILE B 1 122 ? 45.302 9.339   0.588  1.00 44.19 ? 2184 ILE B CA    1 
ATOM   2523 C  C     . ILE B 1 122 ? 43.825 9.468   0.211  1.00 44.78 ? 2184 ILE B C     1 
ATOM   2524 O  O     . ILE B 1 122 ? 43.167 10.440  0.582  1.00 44.86 ? 2184 ILE B O     1 
ATOM   2525 C  CB    . ILE B 1 122 ? 46.184 9.405   -0.677 1.00 43.98 ? 2184 ILE B CB    1 
ATOM   2526 C  CG1   . ILE B 1 122 ? 47.666 9.394   -0.285 1.00 43.53 ? 2184 ILE B CG1   1 
ATOM   2527 C  CG2   . ILE B 1 122 ? 45.833 10.640  -1.508 1.00 43.78 ? 2184 ILE B CG2   1 
ATOM   2528 C  CD1   . ILE B 1 122 ? 48.628 9.271   -1.438 1.00 42.47 ? 2184 ILE B CD1   1 
ATOM   2529 N  N     . GLU B 1 123 ? 43.309 8.479   -0.511 1.00 45.43 ? 2185 GLU B N     1 
ATOM   2530 C  CA    . GLU B 1 123 ? 41.947 8.533   -1.029 1.00 46.25 ? 2185 GLU B CA    1 
ATOM   2531 C  C     . GLU B 1 123 ? 40.863 8.442   0.042  1.00 47.06 ? 2185 GLU B C     1 
ATOM   2532 O  O     . GLU B 1 123 ? 39.759 8.955   -0.154 1.00 47.31 ? 2185 GLU B O     1 
ATOM   2533 C  CB    . GLU B 1 123 ? 41.732 7.452   -2.091 1.00 46.08 ? 2185 GLU B CB    1 
ATOM   2534 C  CG    . GLU B 1 123 ? 42.211 7.862   -3.474 1.00 45.67 ? 2185 GLU B CG    1 
ATOM   2535 C  CD    . GLU B 1 123 ? 42.190 6.733   -4.491 1.00 45.05 ? 2185 GLU B CD    1 
ATOM   2536 O  OE1   . GLU B 1 123 ? 42.329 7.028   -5.698 1.00 44.97 ? 2185 GLU B OE1   1 
ATOM   2537 O  OE2   . GLU B 1 123 ? 42.040 5.558   -4.096 1.00 44.62 ? 2185 GLU B OE2   1 
ATOM   2538 N  N     . GLN B 1 124 ? 41.175 7.804   1.169  1.00 48.06 ? 2186 GLN B N     1 
ATOM   2539 C  CA    . GLN B 1 124 ? 40.155 7.506   2.186  1.00 48.88 ? 2186 GLN B CA    1 
ATOM   2540 C  C     . GLN B 1 124 ? 40.435 8.041   3.595  1.00 49.40 ? 2186 GLN B C     1 
ATOM   2541 O  O     . GLN B 1 124 ? 39.538 8.604   4.222  1.00 49.56 ? 2186 GLN B O     1 
ATOM   2542 C  CB    . GLN B 1 124 ? 39.881 5.996   2.253  1.00 48.81 ? 2186 GLN B CB    1 
ATOM   2543 C  CG    . GLN B 1 124 ? 39.359 5.378   0.960  1.00 49.26 ? 2186 GLN B CG    1 
ATOM   2544 C  CD    . GLN B 1 124 ? 39.275 3.862   1.022  1.00 49.96 ? 2186 GLN B CD    1 
ATOM   2545 O  OE1   . GLN B 1 124 ? 38.573 3.296   1.868  1.00 50.42 ? 2186 GLN B OE1   1 
ATOM   2546 N  NE2   . GLN B 1 124 ? 39.988 3.193   0.119  1.00 49.96 ? 2186 GLN B NE2   1 
ATOM   2547 N  N     . TYR B 1 125 ? 41.664 7.879   4.085  1.00 50.13 ? 2187 TYR B N     1 
ATOM   2548 C  CA    . TYR B 1 125 ? 41.934 8.054   5.518  1.00 50.94 ? 2187 TYR B CA    1 
ATOM   2549 C  C     . TYR B 1 125 ? 42.557 9.377   5.967  1.00 51.94 ? 2187 TYR B C     1 
ATOM   2550 O  O     . TYR B 1 125 ? 42.671 9.613   7.171  1.00 52.15 ? 2187 TYR B O     1 
ATOM   2551 C  CB    . TYR B 1 125 ? 42.783 6.893   6.072  1.00 50.62 ? 2187 TYR B CB    1 
ATOM   2552 C  CG    . TYR B 1 125 ? 42.325 5.490   5.715  1.00 49.89 ? 2187 TYR B CG    1 
ATOM   2553 C  CD1   . TYR B 1 125 ? 40.969 5.162   5.629  1.00 49.23 ? 2187 TYR B CD1   1 
ATOM   2554 C  CD2   . TYR B 1 125 ? 43.257 4.478   5.494  1.00 49.06 ? 2187 TYR B CD2   1 
ATOM   2555 C  CE1   . TYR B 1 125 ? 40.559 3.873   5.301  1.00 48.64 ? 2187 TYR B CE1   1 
ATOM   2556 C  CE2   . TYR B 1 125 ? 42.858 3.186   5.178  1.00 48.63 ? 2187 TYR B CE2   1 
ATOM   2557 C  CZ    . TYR B 1 125 ? 41.510 2.890   5.080  1.00 48.73 ? 2187 TYR B CZ    1 
ATOM   2558 O  OH    . TYR B 1 125 ? 41.117 1.607   4.761  1.00 48.54 ? 2187 TYR B OH    1 
ATOM   2559 N  N     . HIS B 1 126 ? 42.954 10.242  5.032  1.00 53.15 ? 2188 HIS B N     1 
ATOM   2560 C  CA    . HIS B 1 126 ? 43.705 11.461  5.399  1.00 54.35 ? 2188 HIS B CA    1 
ATOM   2561 C  C     . HIS B 1 126 ? 42.884 12.460  6.228  1.00 54.97 ? 2188 HIS B C     1 
ATOM   2562 O  O     . HIS B 1 126 ? 43.443 13.236  7.008  1.00 55.05 ? 2188 HIS B O     1 
ATOM   2563 C  CB    . HIS B 1 126 ? 44.334 12.137  4.166  1.00 54.42 ? 2188 HIS B CB    1 
ATOM   2564 C  CG    . HIS B 1 126 ? 43.429 13.110  3.474  1.00 55.29 ? 2188 HIS B CG    1 
ATOM   2565 N  ND1   . HIS B 1 126 ? 43.421 14.458  3.767  1.00 55.88 ? 2188 HIS B ND1   1 
ATOM   2566 C  CD2   . HIS B 1 126 ? 42.501 12.932  2.502  1.00 55.77 ? 2188 HIS B CD2   1 
ATOM   2567 C  CE1   . HIS B 1 126 ? 42.527 15.067  3.008  1.00 56.02 ? 2188 HIS B CE1   1 
ATOM   2568 N  NE2   . HIS B 1 126 ? 41.955 14.163  2.231  1.00 55.86 ? 2188 HIS B NE2   1 
ATOM   2569 N  N     . ASN B 1 127 ? 41.563 12.411  6.053  1.00 55.78 ? 2189 ASN B N     1 
ATOM   2570 C  CA    . ASN B 1 127 ? 40.603 13.269  6.759  1.00 56.53 ? 2189 ASN B CA    1 
ATOM   2571 C  C     . ASN B 1 127 ? 40.188 12.681  8.126  1.00 56.81 ? 2189 ASN B C     1 
ATOM   2572 O  O     . ASN B 1 127 ? 39.310 13.216  8.805  1.00 56.69 ? 2189 ASN B O     1 
ATOM   2573 C  CB    . ASN B 1 127 ? 39.378 13.486  5.846  1.00 56.75 ? 2189 ASN B CB    1 
ATOM   2574 C  CG    . ASN B 1 127 ? 38.354 14.463  6.424  1.00 57.34 ? 2189 ASN B CG    1 
ATOM   2575 O  OD1   . ASN B 1 127 ? 38.635 15.653  6.611  1.00 58.01 ? 2189 ASN B OD1   1 
ATOM   2576 N  ND2   . ASN B 1 127 ? 37.147 13.961  6.685  1.00 57.14 ? 2189 ASN B ND2   1 
ATOM   2577 N  N     . HIS B 1 128 ? 40.842 11.591  8.524  1.00 57.39 ? 2190 HIS B N     1 
ATOM   2578 C  CA    . HIS B 1 128 ? 40.489 10.850  9.740  1.00 58.02 ? 2190 HIS B CA    1 
ATOM   2579 C  C     . HIS B 1 128 ? 41.318 11.271  10.948 1.00 58.32 ? 2190 HIS B C     1 
ATOM   2580 O  O     . HIS B 1 128 ? 42.541 11.434  10.853 1.00 58.36 ? 2190 HIS B O     1 
ATOM   2581 C  CB    . HIS B 1 128 ? 40.668 9.343   9.522  1.00 58.10 ? 2190 HIS B CB    1 
ATOM   2582 C  CG    . HIS B 1 128 ? 39.596 8.713   8.690  1.00 58.66 ? 2190 HIS B CG    1 
ATOM   2583 N  ND1   . HIS B 1 128 ? 39.071 9.312   7.564  1.00 59.08 ? 2190 HIS B ND1   1 
ATOM   2584 C  CD2   . HIS B 1 128 ? 38.967 7.519   8.808  1.00 59.19 ? 2190 HIS B CD2   1 
ATOM   2585 C  CE1   . HIS B 1 128 ? 38.155 8.522   7.035  1.00 59.43 ? 2190 HIS B CE1   1 
ATOM   2586 N  NE2   . HIS B 1 128 ? 38.074 7.427   7.769  1.00 59.49 ? 2190 HIS B NE2   1 
ATOM   2587 N  N     . SER B 1 129 ? 40.643 11.420  12.085 1.00 58.60 ? 2191 SER B N     1 
ATOM   2588 C  CA    . SER B 1 129 ? 41.307 11.743  13.341 1.00 58.86 ? 2191 SER B CA    1 
ATOM   2589 C  C     . SER B 1 129 ? 42.061 10.527  13.873 1.00 59.02 ? 2191 SER B C     1 
ATOM   2590 O  O     . SER B 1 129 ? 43.293 10.530  13.907 1.00 59.30 ? 2191 SER B O     1 
ATOM   2591 C  CB    . SER B 1 129 ? 40.303 12.270  14.372 1.00 58.89 ? 2191 SER B CB    1 
ATOM   2592 O  OG    . SER B 1 129 ? 39.243 11.352  14.577 1.00 59.01 ? 2191 SER B OG    1 
ATOM   2593 N  N     . ASP B 1 130 ? 41.324 9.489   14.266 1.00 59.06 ? 2192 ASP B N     1 
ATOM   2594 C  CA    . ASP B 1 130 ? 41.924 8.267   14.804 1.00 59.11 ? 2192 ASP B CA    1 
ATOM   2595 C  C     . ASP B 1 130 ? 42.588 7.427   13.708 1.00 59.23 ? 2192 ASP B C     1 
ATOM   2596 O  O     . ASP B 1 130 ? 42.202 7.502   12.541 1.00 59.28 ? 2192 ASP B O     1 
ATOM   2597 C  CB    . ASP B 1 130 ? 40.879 7.435   15.557 1.00 59.05 ? 2192 ASP B CB    1 
ATOM   2598 C  CG    . ASP B 1 130 ? 40.450 8.071   16.872 1.00 58.78 ? 2192 ASP B CG    1 
ATOM   2599 O  OD1   . ASP B 1 130 ? 39.232 8.273   17.057 1.00 58.75 ? 2192 ASP B OD1   1 
ATOM   2600 O  OD2   . ASP B 1 130 ? 41.317 8.361   17.723 1.00 57.95 ? 2192 ASP B OD2   1 
ATOM   2601 N  N     . HIS B 1 131 ? 43.590 6.635   14.089 1.00 59.32 ? 2193 HIS B N     1 
ATOM   2602 C  CA    . HIS B 1 131 ? 44.339 5.823   13.133 1.00 59.50 ? 2193 HIS B CA    1 
ATOM   2603 C  C     . HIS B 1 131 ? 44.467 4.373   13.589 1.00 59.36 ? 2193 HIS B C     1 
ATOM   2604 O  O     . HIS B 1 131 ? 45.066 4.091   14.630 1.00 59.42 ? 2193 HIS B O     1 
ATOM   2605 C  CB    . HIS B 1 131 ? 45.716 6.438   12.861 1.00 59.66 ? 2193 HIS B CB    1 
ATOM   2606 C  CG    . HIS B 1 131 ? 45.650 7.811   12.265 1.00 60.77 ? 2193 HIS B CG    1 
ATOM   2607 N  ND1   . HIS B 1 131 ? 45.010 8.076   11.071 1.00 61.52 ? 2193 HIS B ND1   1 
ATOM   2608 C  CD2   . HIS B 1 131 ? 46.138 8.998   12.701 1.00 61.30 ? 2193 HIS B CD2   1 
ATOM   2609 C  CE1   . HIS B 1 131 ? 45.108 9.365   10.797 1.00 61.87 ? 2193 HIS B CE1   1 
ATOM   2610 N  NE2   . HIS B 1 131 ? 45.787 9.947   11.771 1.00 61.71 ? 2193 HIS B NE2   1 
ATOM   2611 N  N     . TYR B 1 132 ? 43.906 3.466   12.787 1.00 59.16 ? 2194 TYR B N     1 
ATOM   2612 C  CA    . TYR B 1 132 ? 43.794 2.047   13.133 1.00 58.97 ? 2194 TYR B CA    1 
ATOM   2613 C  C     . TYR B 1 132 ? 44.618 1.167   12.200 1.00 59.06 ? 2194 TYR B C     1 
ATOM   2614 O  O     . TYR B 1 132 ? 44.114 0.681   11.186 1.00 59.11 ? 2194 TYR B O     1 
ATOM   2615 C  CB    . TYR B 1 132 ? 42.332 1.588   13.062 1.00 58.79 ? 2194 TYR B CB    1 
ATOM   2616 C  CG    . TYR B 1 132 ? 41.328 2.476   13.755 1.00 58.26 ? 2194 TYR B CG    1 
ATOM   2617 C  CD1   . TYR B 1 132 ? 40.809 3.602   13.119 1.00 58.01 ? 2194 TYR B CD1   1 
ATOM   2618 C  CD2   . TYR B 1 132 ? 40.874 2.174   15.036 1.00 57.50 ? 2194 TYR B CD2   1 
ATOM   2619 C  CE1   . TYR B 1 132 ? 39.879 4.416   13.750 1.00 57.83 ? 2194 TYR B CE1   1 
ATOM   2620 C  CE2   . TYR B 1 132 ? 39.944 2.979   15.674 1.00 57.38 ? 2194 TYR B CE2   1 
ATOM   2621 C  CZ    . TYR B 1 132 ? 39.450 4.096   15.025 1.00 57.48 ? 2194 TYR B CZ    1 
ATOM   2622 O  OH    . TYR B 1 132 ? 38.527 4.896   15.653 1.00 57.66 ? 2194 TYR B OH    1 
ATOM   2623 N  N     . CYS B 1 133 ? 45.885 0.958   12.536 1.00 59.16 ? 2195 CYS B N     1 
ATOM   2624 C  CA    . CYS B 1 133 ? 46.732 0.068   11.749 1.00 59.27 ? 2195 CYS B CA    1 
ATOM   2625 C  C     . CYS B 1 133 ? 47.882 -0.479  12.579 1.00 59.35 ? 2195 CYS B C     1 
ATOM   2626 O  O     . CYS B 1 133 ? 48.149 0.014   13.670 1.00 59.51 ? 2195 CYS B O     1 
ATOM   2627 C  CB    . CYS B 1 133 ? 47.265 0.779   10.500 1.00 59.19 ? 2195 CYS B CB    1 
ATOM   2628 S  SG    . CYS B 1 133 ? 48.396 2.131   10.844 1.00 59.34 ? 2195 CYS B SG    1 
ATOM   2629 N  N     . LEU B 1 134 ? 48.538 -1.515  12.064 1.00 59.44 ? 2196 LEU B N     1 
ATOM   2630 C  CA    . LEU B 1 134 ? 49.775 -2.025  12.642 1.00 59.61 ? 2196 LEU B CA    1 
ATOM   2631 C  C     . LEU B 1 134 ? 50.717 -2.439  11.536 1.00 59.68 ? 2196 LEU B C     1 
ATOM   2632 O  O     . LEU B 1 134 ? 50.352 -3.251  10.679 1.00 59.70 ? 2196 LEU B O     1 
ATOM   2633 C  CB    . LEU B 1 134 ? 49.523 -3.225  13.559 1.00 59.61 ? 2196 LEU B CB    1 
ATOM   2634 C  CG    . LEU B 1 134 ? 49.063 -3.024  15.006 1.00 59.99 ? 2196 LEU B CG    1 
ATOM   2635 C  CD1   . LEU B 1 134 ? 49.119 -4.361  15.728 1.00 60.54 ? 2196 LEU B CD1   1 
ATOM   2636 C  CD2   . LEU B 1 134 ? 49.899 -1.984  15.748 1.00 60.06 ? 2196 LEU B CD2   1 
ATOM   2637 N  N     . ASN B 1 135 ? 51.924 -1.877  11.550 1.00 59.76 ? 2197 ASN B N     1 
ATOM   2638 C  CA    . ASN B 1 135 ? 52.966 -2.306  10.627 1.00 59.85 ? 2197 ASN B CA    1 
ATOM   2639 C  C     . ASN B 1 135 ? 53.309 -3.769  10.869 1.00 59.75 ? 2197 ASN B C     1 
ATOM   2640 O  O     . ASN B 1 135 ? 53.845 -4.138  11.913 1.00 59.81 ? 2197 ASN B O     1 
ATOM   2641 C  CB    . ASN B 1 135 ? 54.206 -1.413  10.715 1.00 59.92 ? 2197 ASN B CB    1 
ATOM   2642 C  CG    . ASN B 1 135 ? 54.069 -0.134  9.895  1.00 60.39 ? 2197 ASN B CG    1 
ATOM   2643 O  OD1   . ASN B 1 135 ? 53.104 0.624   10.045 1.00 60.94 ? 2197 ASN B OD1   1 
ATOM   2644 N  ND2   . ASN B 1 135 ? 55.043 0.113   9.024  1.00 60.48 ? 2197 ASN B ND2   1 
ATOM   2645 N  N     . LEU B 1 136 ? 52.955 -4.599  9.897  1.00 59.72 ? 2198 LEU B N     1 
ATOM   2646 C  CA    . LEU B 1 136 ? 53.112 -6.038  10.007 1.00 59.55 ? 2198 LEU B CA    1 
ATOM   2647 C  C     . LEU B 1 136 ? 54.574 -6.435  9.849  1.00 59.33 ? 2198 LEU B C     1 
ATOM   2648 O  O     . LEU B 1 136 ? 55.133 -7.094  10.728 1.00 59.35 ? 2198 LEU B O     1 
ATOM   2649 C  CB    . LEU B 1 136 ? 52.215 -6.744  8.981  1.00 59.54 ? 2198 LEU B CB    1 
ATOM   2650 C  CG    . LEU B 1 136 ? 52.381 -8.225  8.631  1.00 59.77 ? 2198 LEU B CG    1 
ATOM   2651 C  CD1   . LEU B 1 136 ? 52.028 -9.159  9.779  1.00 59.84 ? 2198 LEU B CD1   1 
ATOM   2652 C  CD2   . LEU B 1 136 ? 51.517 -8.533  7.426  1.00 60.65 ? 2198 LEU B CD2   1 
ATOM   2653 N  N     . ASP B 1 137 ? 55.191 -6.019  8.743  1.00 59.06 ? 2199 ASP B N     1 
ATOM   2654 C  CA    . ASP B 1 137 ? 56.573 -6.395  8.453  1.00 58.80 ? 2199 ASP B CA    1 
ATOM   2655 C  C     . ASP B 1 137 ? 57.192 -5.588  7.308  1.00 58.45 ? 2199 ASP B C     1 
ATOM   2656 O  O     . ASP B 1 137 ? 57.047 -4.363  7.251  1.00 58.52 ? 2199 ASP B O     1 
ATOM   2657 C  CB    . ASP B 1 137 ? 56.660 -7.898  8.161  1.00 58.91 ? 2199 ASP B CB    1 
ATOM   2658 C  CG    . ASP B 1 137 ? 57.928 -8.523  8.705  1.00 59.43 ? 2199 ASP B CG    1 
ATOM   2659 O  OD1   . ASP B 1 137 ? 58.420 -8.065  9.763  1.00 59.28 ? 2199 ASP B OD1   1 
ATOM   2660 O  OD2   . ASP B 1 137 ? 58.425 -9.483  8.075  1.00 60.37 ? 2199 ASP B OD2   1 
ATOM   2661 N  N     . SER B 1 138 ? 57.879 -6.286  6.404  1.00 57.88 ? 2200 SER B N     1 
ATOM   2662 C  CA    . SER B 1 138 ? 58.608 -5.663  5.296  1.00 57.25 ? 2200 SER B CA    1 
ATOM   2663 C  C     . SER B 1 138 ? 57.699 -5.300  4.115  1.00 56.56 ? 2200 SER B C     1 
ATOM   2664 O  O     . SER B 1 138 ? 57.508 -6.099  3.189  1.00 56.49 ? 2200 SER B O     1 
ATOM   2665 C  CB    . SER B 1 138 ? 59.746 -6.581  4.839  1.00 57.37 ? 2200 SER B CB    1 
ATOM   2666 O  OG    . SER B 1 138 ? 59.276 -7.907  4.652  1.00 57.85 ? 2200 SER B OG    1 
ATOM   2667 N  N     . GLY B 1 139 ? 57.144 -4.092  4.160  1.00 55.69 ? 2201 GLY B N     1 
ATOM   2668 C  CA    . GLY B 1 139 ? 56.269 -3.603  3.096  1.00 54.64 ? 2201 GLY B CA    1 
ATOM   2669 C  C     . GLY B 1 139 ? 54.862 -4.176  3.139  1.00 53.79 ? 2201 GLY B C     1 
ATOM   2670 O  O     . GLY B 1 139 ? 54.189 -4.270  2.105  1.00 53.71 ? 2201 GLY B O     1 
ATOM   2671 N  N     . MET B 1 140 ? 54.424 -4.555  4.341  1.00 52.77 ? 2202 MET B N     1 
ATOM   2672 C  CA    . MET B 1 140 ? 53.083 -5.088  4.571  1.00 51.72 ? 2202 MET B CA    1 
ATOM   2673 C  C     . MET B 1 140 ? 52.504 -4.516  5.862  1.00 50.86 ? 2202 MET B C     1 
ATOM   2674 O  O     . MET B 1 140 ? 53.216 -4.370  6.856  1.00 50.77 ? 2202 MET B O     1 
ATOM   2675 C  CB    . MET B 1 140 ? 53.109 -6.618  4.630  1.00 51.93 ? 2202 MET B CB    1 
ATOM   2676 C  CG    . MET B 1 140 ? 53.296 -7.303  3.275  1.00 52.24 ? 2202 MET B CG    1 
ATOM   2677 S  SD    . MET B 1 140 ? 53.361 -9.109  3.365  1.00 53.48 ? 2202 MET B SD    1 
ATOM   2678 C  CE    . MET B 1 140 ? 55.030 -9.387  3.958  1.00 53.64 ? 2202 MET B CE    1 
ATOM   2679 N  N     . VAL B 1 141 ? 51.213 -4.197  5.838  1.00 49.78 ? 2203 VAL B N     1 
ATOM   2680 C  CA    . VAL B 1 141 ? 50.543 -3.535  6.957  1.00 48.82 ? 2203 VAL B CA    1 
ATOM   2681 C  C     . VAL B 1 141 ? 49.182 -4.166  7.239  1.00 48.12 ? 2203 VAL B C     1 
ATOM   2682 O  O     . VAL B 1 141 ? 48.510 -4.630  6.321  1.00 48.03 ? 2203 VAL B O     1 
ATOM   2683 C  CB    . VAL B 1 141 ? 50.380 -2.012  6.681  1.00 48.87 ? 2203 VAL B CB    1 
ATOM   2684 C  CG1   . VAL B 1 141 ? 49.313 -1.382  7.578  1.00 48.83 ? 2203 VAL B CG1   1 
ATOM   2685 C  CG2   . VAL B 1 141 ? 51.714 -1.288  6.851  1.00 48.79 ? 2203 VAL B CG2   1 
ATOM   2686 N  N     . ILE B 1 142 ? 48.785 -4.195  8.510  1.00 47.36 ? 2204 ILE B N     1 
ATOM   2687 C  CA    . ILE B 1 142 ? 47.413 -4.575  8.868  1.00 46.62 ? 2204 ILE B CA    1 
ATOM   2688 C  C     . ILE B 1 142 ? 46.541 -3.323  8.993  1.00 46.08 ? 2204 ILE B C     1 
ATOM   2689 O  O     . ILE B 1 142 ? 46.832 -2.434  9.791  1.00 46.00 ? 2204 ILE B O     1 
ATOM   2690 C  CB    . ILE B 1 142 ? 47.330 -5.417  10.164 1.00 46.45 ? 2204 ILE B CB    1 
ATOM   2691 C  CG1   . ILE B 1 142 ? 48.175 -6.687  10.036 1.00 46.58 ? 2204 ILE B CG1   1 
ATOM   2692 C  CG2   . ILE B 1 142 ? 45.888 -5.784  10.456 1.00 46.37 ? 2204 ILE B CG2   1 
ATOM   2693 C  CD1   . ILE B 1 142 ? 48.053 -7.660  11.205 1.00 46.48 ? 2204 ILE B CD1   1 
ATOM   2694 N  N     . ASP B 1 143 ? 45.481 -3.268  8.190  1.00 45.38 ? 2205 ASP B N     1 
ATOM   2695 C  CA    . ASP B 1 143 ? 44.570 -2.131  8.162  1.00 44.57 ? 2205 ASP B CA    1 
ATOM   2696 C  C     . ASP B 1 143 ? 43.316 -2.448  8.965  1.00 44.24 ? 2205 ASP B C     1 
ATOM   2697 O  O     . ASP B 1 143 ? 42.624 -3.428  8.690  1.00 44.14 ? 2205 ASP B O     1 
ATOM   2698 C  CB    . ASP B 1 143 ? 44.212 -1.792  6.714  1.00 44.44 ? 2205 ASP B CB    1 
ATOM   2699 C  CG    . ASP B 1 143 ? 43.378 -0.533  6.589  1.00 44.35 ? 2205 ASP B CG    1 
ATOM   2700 O  OD1   . ASP B 1 143 ? 42.998 0.048   7.622  1.00 44.84 ? 2205 ASP B OD1   1 
ATOM   2701 O  OD2   . ASP B 1 143 ? 43.095 -0.121  5.445  1.00 44.18 ? 2205 ASP B OD2   1 
ATOM   2702 N  N     . SER B 1 144 ? 43.033 -1.610  9.958  1.00 43.89 ? 2206 SER B N     1 
ATOM   2703 C  CA    . SER B 1 144 ? 41.860 -1.786  10.820 1.00 43.69 ? 2206 SER B CA    1 
ATOM   2704 C  C     . SER B 1 144 ? 40.803 -0.676  10.687 1.00 43.47 ? 2206 SER B C     1 
ATOM   2705 O  O     . SER B 1 144 ? 39.797 -0.689  11.402 1.00 43.52 ? 2206 SER B O     1 
ATOM   2706 C  CB    . SER B 1 144 ? 42.290 -1.932  12.283 1.00 43.62 ? 2206 SER B CB    1 
ATOM   2707 O  OG    . SER B 1 144 ? 42.742 -3.244  12.546 1.00 44.00 ? 2206 SER B OG    1 
ATOM   2708 N  N     . TYR B 1 145 ? 41.030 0.271   9.775  1.00 43.06 ? 2207 TYR B N     1 
ATOM   2709 C  CA    . TYR B 1 145 ? 40.091 1.371   9.535  1.00 42.89 ? 2207 TYR B CA    1 
ATOM   2710 C  C     . TYR B 1 145 ? 38.682 0.889   9.200  1.00 42.61 ? 2207 TYR B C     1 
ATOM   2711 O  O     . TYR B 1 145 ? 37.701 1.487   9.644  1.00 42.44 ? 2207 TYR B O     1 
ATOM   2712 C  CB    . TYR B 1 145 ? 40.578 2.270   8.393  1.00 42.94 ? 2207 TYR B CB    1 
ATOM   2713 C  CG    . TYR B 1 145 ? 41.698 3.215   8.754  1.00 43.30 ? 2207 TYR B CG    1 
ATOM   2714 C  CD1   . TYR B 1 145 ? 43.025 2.785   8.755  1.00 43.53 ? 2207 TYR B CD1   1 
ATOM   2715 C  CD2   . TYR B 1 145 ? 41.436 4.544   9.081  1.00 43.54 ? 2207 TYR B CD2   1 
ATOM   2716 C  CE1   . TYR B 1 145 ? 44.062 3.648   9.082  1.00 43.98 ? 2207 TYR B CE1   1 
ATOM   2717 C  CE2   . TYR B 1 145 ? 42.471 5.421   9.411  1.00 43.80 ? 2207 TYR B CE2   1 
ATOM   2718 C  CZ    . TYR B 1 145 ? 43.780 4.962   9.409  1.00 44.38 ? 2207 TYR B CZ    1 
ATOM   2719 O  OH    . TYR B 1 145 ? 44.814 5.813   9.731  1.00 45.88 ? 2207 TYR B OH    1 
ATOM   2720 N  N     . ARG B 1 146 ? 38.594 -0.186  8.418  1.00 42.40 ? 2208 ARG B N     1 
ATOM   2721 C  CA    . ARG B 1 146 ? 37.318 -0.635  7.856  1.00 42.37 ? 2208 ARG B CA    1 
ATOM   2722 C  C     . ARG B 1 146 ? 36.884 -2.017  8.334  1.00 42.06 ? 2208 ARG B C     1 
ATOM   2723 O  O     . ARG B 1 146 ? 35.688 -2.268  8.486  1.00 41.99 ? 2208 ARG B O     1 
ATOM   2724 C  CB    . ARG B 1 146 ? 37.360 -0.607  6.322  1.00 42.44 ? 2208 ARG B CB    1 
ATOM   2725 C  CG    . ARG B 1 146 ? 37.485 0.783   5.718  1.00 43.18 ? 2208 ARG B CG    1 
ATOM   2726 C  CD    . ARG B 1 146 ? 37.268 0.773   4.208  1.00 45.77 ? 2208 ARG B CD    1 
ATOM   2727 N  NE    . ARG B 1 146 ? 38.164 -0.147  3.494  1.00 47.36 ? 2208 ARG B NE    1 
ATOM   2728 C  CZ    . ARG B 1 146 ? 37.775 -1.265  2.877  1.00 47.75 ? 2208 ARG B CZ    1 
ATOM   2729 N  NH1   . ARG B 1 146 ? 36.495 -1.631  2.871  1.00 47.61 ? 2208 ARG B NH1   1 
ATOM   2730 N  NH2   . ARG B 1 146 ? 38.671 -2.022  2.258  1.00 47.82 ? 2208 ARG B NH2   1 
ATOM   2731 N  N     . MET B 1 147 ? 37.853 -2.908  8.544  1.00 41.82 ? 2209 MET B N     1 
ATOM   2732 C  CA    . MET B 1 147 ? 37.583 -4.268  9.013  1.00 41.54 ? 2209 MET B CA    1 
ATOM   2733 C  C     . MET B 1 147 ? 38.547 -4.671  10.119 1.00 41.48 ? 2209 MET B C     1 
ATOM   2734 O  O     . MET B 1 147 ? 39.704 -4.250  10.131 1.00 41.60 ? 2209 MET B O     1 
ATOM   2735 C  CB    . MET B 1 147 ? 37.679 -5.270  7.865  1.00 41.55 ? 2209 MET B CB    1 
ATOM   2736 C  CG    . MET B 1 147 ? 36.760 -4.986  6.694  1.00 41.66 ? 2209 MET B CG    1 
ATOM   2737 S  SD    . MET B 1 147 ? 37.143 -6.014  5.268  1.00 41.32 ? 2209 MET B SD    1 
ATOM   2738 C  CE    . MET B 1 147 ? 36.076 -7.413  5.577  1.00 41.93 ? 2209 MET B CE    1 
ATOM   2739 N  N     . GLY B 1 148 ? 38.062 -5.493  11.044 1.00 41.41 ? 2210 GLY B N     1 
ATOM   2740 C  CA    . GLY B 1 148 ? 38.866 -5.968  12.165 1.00 41.30 ? 2210 GLY B CA    1 
ATOM   2741 C  C     . GLY B 1 148 ? 38.042 -6.553  13.297 1.00 41.24 ? 2210 GLY B C     1 
ATOM   2742 O  O     . GLY B 1 148 ? 36.938 -7.058  13.086 1.00 41.23 ? 2210 GLY B O     1 
ATOM   2743 N  N     . ASN B 1 149 ? 38.602 -6.490  14.500 1.00 41.27 ? 2211 ASN B N     1 
ATOM   2744 C  CA    . ASN B 1 149 ? 37.949 -6.952  15.716 1.00 41.30 ? 2211 ASN B CA    1 
ATOM   2745 C  C     . ASN B 1 149 ? 38.174 -5.926  16.821 1.00 41.76 ? 2211 ASN B C     1 
ATOM   2746 O  O     . ASN B 1 149 ? 38.727 -4.857  16.574 1.00 41.94 ? 2211 ASN B O     1 
ATOM   2747 C  CB    . ASN B 1 149 ? 38.501 -8.316  16.139 1.00 40.97 ? 2211 ASN B CB    1 
ATOM   2748 C  CG    . ASN B 1 149 ? 39.979 -8.267  16.496 1.00 40.31 ? 2211 ASN B CG    1 
ATOM   2749 O  OD1   . ASN B 1 149 ? 40.620 -7.220  16.408 1.00 39.45 ? 2211 ASN B OD1   1 
ATOM   2750 N  ND2   . ASN B 1 149 ? 40.525 -9.406  16.896 1.00 39.26 ? 2211 ASN B ND2   1 
ATOM   2751 N  N     . GLU B 1 150 ? 37.784 -6.273  18.042 1.00 42.17 ? 2212 GLU B N     1 
ATOM   2752 C  CA    . GLU B 1 150 ? 37.885 -5.366  19.184 1.00 42.54 ? 2212 GLU B CA    1 
ATOM   2753 C  C     . GLU B 1 150 ? 39.323 -4.942  19.535 1.00 42.65 ? 2212 GLU B C     1 
ATOM   2754 O  O     . GLU B 1 150 ? 39.530 -3.971  20.269 1.00 42.68 ? 2212 GLU B O     1 
ATOM   2755 C  CB    . GLU B 1 150 ? 37.176 -5.977  20.401 1.00 42.70 ? 2212 GLU B CB    1 
ATOM   2756 C  CG    . GLU B 1 150 ? 35.667 -6.146  20.227 1.00 43.01 ? 2212 GLU B CG    1 
ATOM   2757 C  CD    . GLU B 1 150 ? 34.918 -4.827  20.293 1.00 43.47 ? 2212 GLU B CD    1 
ATOM   2758 O  OE1   . GLU B 1 150 ? 34.649 -4.346  21.414 1.00 44.28 ? 2212 GLU B OE1   1 
ATOM   2759 O  OE2   . GLU B 1 150 ? 34.589 -4.276  19.223 1.00 43.82 ? 2212 GLU B OE2   1 
ATOM   2760 N  N     . ALA B 1 151 ? 40.310 -5.657  19.000 1.00 42.86 ? 2213 ALA B N     1 
ATOM   2761 C  CA    . ALA B 1 151 ? 41.718 -5.320  19.229 1.00 42.99 ? 2213 ALA B CA    1 
ATOM   2762 C  C     . ALA B 1 151 ? 42.081 -3.950  18.657 1.00 43.14 ? 2213 ALA B C     1 
ATOM   2763 O  O     . ALA B 1 151 ? 43.068 -3.341  19.067 1.00 43.16 ? 2213 ALA B O     1 
ATOM   2764 C  CB    . ALA B 1 151 ? 42.633 -6.404  18.666 1.00 42.81 ? 2213 ALA B CB    1 
ATOM   2765 N  N     . ARG B 1 152 ? 41.268 -3.464  17.721 1.00 43.44 ? 2214 ARG B N     1 
ATOM   2766 C  CA    . ARG B 1 152 ? 41.494 -2.163  17.096 1.00 43.87 ? 2214 ARG B CA    1 
ATOM   2767 C  C     . ARG B 1 152 ? 41.235 -0.992  18.058 1.00 44.21 ? 2214 ARG B C     1 
ATOM   2768 O  O     . ARG B 1 152 ? 41.628 0.139   17.777 1.00 44.40 ? 2214 ARG B O     1 
ATOM   2769 C  CB    . ARG B 1 152 ? 40.667 -2.022  15.802 1.00 43.65 ? 2214 ARG B CB    1 
ATOM   2770 C  CG    . ARG B 1 152 ? 39.166 -1.847  16.017 1.00 43.85 ? 2214 ARG B CG    1 
ATOM   2771 C  CD    . ARG B 1 152 ? 38.335 -2.107  14.760 1.00 43.99 ? 2214 ARG B CD    1 
ATOM   2772 N  NE    . ARG B 1 152 ? 38.451 -1.025  13.781 1.00 44.11 ? 2214 ARG B NE    1 
ATOM   2773 C  CZ    . ARG B 1 152 ? 37.759 0.111   13.816 1.00 43.66 ? 2214 ARG B CZ    1 
ATOM   2774 N  NH1   . ARG B 1 152 ? 36.880 0.343   14.784 1.00 43.49 ? 2214 ARG B NH1   1 
ATOM   2775 N  NH2   . ARG B 1 152 ? 37.954 1.025   12.878 1.00 43.73 ? 2214 ARG B NH2   1 
ATOM   2776 N  N     . PHE B 1 153 ? 40.592 -1.266  19.191 1.00 44.60 ? 2215 PHE B N     1 
ATOM   2777 C  CA    . PHE B 1 153 ? 40.218 -0.208  20.136 1.00 45.11 ? 2215 PHE B CA    1 
ATOM   2778 C  C     . PHE B 1 153 ? 41.223 0.032   21.268 1.00 45.51 ? 2215 PHE B C     1 
ATOM   2779 O  O     . PHE B 1 153 ? 41.230 1.101   21.876 1.00 45.40 ? 2215 PHE B O     1 
ATOM   2780 C  CB    . PHE B 1 153 ? 38.831 -0.472  20.714 1.00 45.06 ? 2215 PHE B CB    1 
ATOM   2781 C  CG    . PHE B 1 153 ? 37.727 -0.383  19.707 1.00 44.68 ? 2215 PHE B CG    1 
ATOM   2782 C  CD1   . PHE B 1 153 ? 37.122 0.839   19.425 1.00 44.35 ? 2215 PHE B CD1   1 
ATOM   2783 C  CD2   . PHE B 1 153 ? 37.276 -1.521  19.054 1.00 44.11 ? 2215 PHE B CD2   1 
ATOM   2784 C  CE1   . PHE B 1 153 ? 36.089 0.926   18.499 1.00 44.18 ? 2215 PHE B CE1   1 
ATOM   2785 C  CE2   . PHE B 1 153 ? 36.243 -1.444  18.126 1.00 44.25 ? 2215 PHE B CE2   1 
ATOM   2786 C  CZ    . PHE B 1 153 ? 35.648 -0.219  17.848 1.00 44.05 ? 2215 PHE B CZ    1 
ATOM   2787 N  N     . ILE B 1 154 ? 42.052 -0.972  21.545 1.00 46.17 ? 2216 ILE B N     1 
ATOM   2788 C  CA    . ILE B 1 154 ? 43.151 -0.875  22.508 1.00 46.79 ? 2216 ILE B CA    1 
ATOM   2789 C  C     . ILE B 1 154 ? 44.006 0.366   22.231 1.00 47.53 ? 2216 ILE B C     1 
ATOM   2790 O  O     . ILE B 1 154 ? 44.415 0.609   21.090 1.00 47.77 ? 2216 ILE B O     1 
ATOM   2791 C  CB    . ILE B 1 154 ? 44.043 -2.140  22.446 1.00 46.63 ? 2216 ILE B CB    1 
ATOM   2792 C  CG1   . ILE B 1 154 ? 43.209 -3.395  22.702 1.00 45.99 ? 2216 ILE B CG1   1 
ATOM   2793 C  CG2   . ILE B 1 154 ? 45.202 -2.049  23.437 1.00 46.75 ? 2216 ILE B CG2   1 
ATOM   2794 C  CD1   . ILE B 1 154 ? 43.782 -4.635  22.093 1.00 45.35 ? 2216 ILE B CD1   1 
ATOM   2795 N  N     . ASN B 1 155 ? 44.271 1.148   23.273 1.00 48.28 ? 2217 ASN B N     1 
ATOM   2796 C  CA    . ASN B 1 155 ? 45.021 2.390   23.107 1.00 49.05 ? 2217 ASN B CA    1 
ATOM   2797 C  C     . ASN B 1 155 ? 46.528 2.206   23.215 1.00 49.40 ? 2217 ASN B C     1 
ATOM   2798 O  O     . ASN B 1 155 ? 47.017 1.084   23.338 1.00 49.58 ? 2217 ASN B O     1 
ATOM   2799 C  CB    . ASN B 1 155 ? 44.530 3.451   24.095 1.00 49.19 ? 2217 ASN B CB    1 
ATOM   2800 C  CG    . ASN B 1 155 ? 43.172 4.009   23.721 1.00 49.72 ? 2217 ASN B CG    1 
ATOM   2801 O  OD1   . ASN B 1 155 ? 42.892 4.263   22.547 1.00 50.19 ? 2217 ASN B OD1   1 
ATOM   2802 N  ND2   . ASN B 1 155 ? 42.316 4.202   24.721 1.00 49.89 ? 2217 ASN B ND2   1 
ATOM   2803 N  N     . HIS B 1 156 ? 47.248 3.324   23.160 1.00 49.83 ? 2218 HIS B N     1 
ATOM   2804 C  CA    . HIS B 1 156 ? 48.700 3.352   23.254 1.00 50.24 ? 2218 HIS B CA    1 
ATOM   2805 C  C     . HIS B 1 156 ? 49.180 3.657   24.666 1.00 50.58 ? 2218 HIS B C     1 
ATOM   2806 O  O     . HIS B 1 156 ? 48.469 4.289   25.447 1.00 50.78 ? 2218 HIS B O     1 
ATOM   2807 C  CB    . HIS B 1 156 ? 49.255 4.416   22.305 1.00 50.24 ? 2218 HIS B CB    1 
ATOM   2808 C  CG    . HIS B 1 156 ? 50.682 4.778   22.571 1.00 50.49 ? 2218 HIS B CG    1 
ATOM   2809 N  ND1   . HIS B 1 156 ? 51.736 3.983   22.178 1.00 50.15 ? 2218 HIS B ND1   1 
ATOM   2810 C  CD2   . HIS B 1 156 ? 51.229 5.838   23.212 1.00 50.61 ? 2218 HIS B CD2   1 
ATOM   2811 C  CE1   . HIS B 1 156 ? 52.871 4.544   22.555 1.00 50.52 ? 2218 HIS B CE1   1 
ATOM   2812 N  NE2   . HIS B 1 156 ? 52.591 5.668   23.188 1.00 50.64 ? 2218 HIS B NE2   1 
ATOM   2813 N  N     . SER B 1 157 ? 50.393 3.207   24.983 1.00 51.01 ? 2219 SER B N     1 
ATOM   2814 C  CA    . SER B 1 157 ? 51.114 3.699   26.155 1.00 51.36 ? 2219 SER B CA    1 
ATOM   2815 C  C     . SER B 1 157 ? 52.624 3.708   25.961 1.00 51.65 ? 2219 SER B C     1 
ATOM   2816 O  O     . SER B 1 157 ? 53.184 2.867   25.258 1.00 51.89 ? 2219 SER B O     1 
ATOM   2817 C  CB    . SER B 1 157 ? 50.771 2.902   27.412 1.00 51.35 ? 2219 SER B CB    1 
ATOM   2818 O  OG    . SER B 1 157 ? 51.303 3.542   28.562 1.00 51.29 ? 2219 SER B OG    1 
ATOM   2819 N  N     . CYS B 1 158 ? 53.268 4.674   26.606 1.00 51.97 ? 2220 CYS B N     1 
ATOM   2820 C  CA    . CYS B 1 158 ? 54.720 4.718   26.724 1.00 52.15 ? 2220 CYS B CA    1 
ATOM   2821 C  C     . CYS B 1 158 ? 55.140 3.750   27.830 1.00 52.05 ? 2220 CYS B C     1 
ATOM   2822 O  O     . CYS B 1 158 ? 56.332 3.487   28.024 1.00 52.00 ? 2220 CYS B O     1 
ATOM   2823 C  CB    . CYS B 1 158 ? 55.173 6.142   27.049 1.00 52.24 ? 2220 CYS B CB    1 
ATOM   2824 S  SG    . CYS B 1 158 ? 54.327 7.417   26.069 1.00 52.98 ? 2220 CYS B SG    1 
ATOM   2825 N  N     . ASP B 1 159 ? 54.137 3.239   28.549 1.00 51.94 ? 2221 ASP B N     1 
ATOM   2826 C  CA    . ASP B 1 159 ? 54.304 2.203   29.565 1.00 51.81 ? 2221 ASP B CA    1 
ATOM   2827 C  C     . ASP B 1 159 ? 53.267 1.088   29.347 1.00 51.49 ? 2221 ASP B C     1 
ATOM   2828 O  O     . ASP B 1 159 ? 52.291 0.987   30.098 1.00 51.48 ? 2221 ASP B O     1 
ATOM   2829 C  CB    . ASP B 1 159 ? 54.167 2.806   30.969 1.00 51.93 ? 2221 ASP B CB    1 
ATOM   2830 C  CG    . ASP B 1 159 ? 54.509 1.813   32.080 1.00 52.51 ? 2221 ASP B CG    1 
ATOM   2831 O  OD1   . ASP B 1 159 ? 55.506 1.065   31.944 1.00 52.36 ? 2221 ASP B OD1   1 
ATOM   2832 O  OD2   . ASP B 1 159 ? 53.780 1.796   33.099 1.00 53.03 ? 2221 ASP B OD2   1 
ATOM   2833 N  N     . PRO B 1 160 ? 53.474 0.247   28.312 1.00 51.18 ? 2222 PRO B N     1 
ATOM   2834 C  CA    . PRO B 1 160 ? 52.489 -0.787  27.966 1.00 50.97 ? 2222 PRO B CA    1 
ATOM   2835 C  C     . PRO B 1 160 ? 52.277 -1.836  29.062 1.00 50.70 ? 2222 PRO B C     1 
ATOM   2836 O  O     . PRO B 1 160 ? 53.208 -2.151  29.808 1.00 50.73 ? 2222 PRO B O     1 
ATOM   2837 C  CB    . PRO B 1 160 ? 53.100 -1.450  26.725 1.00 50.94 ? 2222 PRO B CB    1 
ATOM   2838 C  CG    . PRO B 1 160 ? 54.563 -1.156  26.804 1.00 50.96 ? 2222 PRO B CG    1 
ATOM   2839 C  CD    . PRO B 1 160 ? 54.649 0.204   27.419 1.00 51.15 ? 2222 PRO B CD    1 
ATOM   2840 N  N     . ASN B 1 161 ? 51.050 -2.347  29.163 1.00 50.27 ? 2223 ASN B N     1 
ATOM   2841 C  CA    . ASN B 1 161 ? 50.772 -3.543  29.963 1.00 49.80 ? 2223 ASN B CA    1 
ATOM   2842 C  C     . ASN B 1 161 ? 50.537 -4.771  29.078 1.00 49.44 ? 2223 ASN B C     1 
ATOM   2843 O  O     . ASN B 1 161 ? 50.283 -5.869  29.577 1.00 49.30 ? 2223 ASN B O     1 
ATOM   2844 C  CB    . ASN B 1 161 ? 49.621 -3.318  30.960 1.00 49.76 ? 2223 ASN B CB    1 
ATOM   2845 C  CG    . ASN B 1 161 ? 48.326 -2.884  30.296 1.00 49.63 ? 2223 ASN B CG    1 
ATOM   2846 O  OD1   . ASN B 1 161 ? 47.962 -3.370  29.227 1.00 49.80 ? 2223 ASN B OD1   1 
ATOM   2847 N  ND2   . ASN B 1 161 ? 47.611 -1.973  30.945 1.00 49.49 ? 2223 ASN B ND2   1 
ATOM   2848 N  N     . CYS B 1 162 ? 50.633 -4.560  27.763 1.00 49.05 ? 2224 CYS B N     1 
ATOM   2849 C  CA    . CYS B 1 162 ? 50.550 -5.623  26.757 1.00 48.64 ? 2224 CYS B CA    1 
ATOM   2850 C  C     . CYS B 1 162 ? 51.528 -5.368  25.603 1.00 48.48 ? 2224 CYS B C     1 
ATOM   2851 O  O     . CYS B 1 162 ? 51.909 -4.229  25.339 1.00 48.54 ? 2224 CYS B O     1 
ATOM   2852 C  CB    . CYS B 1 162 ? 49.128 -5.729  26.196 1.00 48.70 ? 2224 CYS B CB    1 
ATOM   2853 S  SG    . CYS B 1 162 ? 47.815 -6.077  27.387 1.00 47.94 ? 2224 CYS B SG    1 
ATOM   2854 N  N     . GLU B 1 163 ? 51.923 -6.432  24.913 1.00 48.28 ? 2225 GLU B N     1 
ATOM   2855 C  CA    . GLU B 1 163 ? 52.792 -6.322  23.737 1.00 48.12 ? 2225 GLU B CA    1 
ATOM   2856 C  C     . GLU B 1 163 ? 52.210 -7.115  22.562 1.00 47.86 ? 2225 GLU B C     1 
ATOM   2857 O  O     . GLU B 1 163 ? 51.447 -8.060  22.768 1.00 47.84 ? 2225 GLU B O     1 
ATOM   2858 C  CB    . GLU B 1 163 ? 54.224 -6.793  24.059 1.00 48.08 ? 2225 GLU B CB    1 
ATOM   2859 C  CG    . GLU B 1 163 ? 54.357 -8.284  24.418 1.00 48.67 ? 2225 GLU B CG    1 
ATOM   2860 C  CD    . GLU B 1 163 ? 55.794 -8.821  24.355 1.00 49.72 ? 2225 GLU B CD    1 
ATOM   2861 O  OE1   . GLU B 1 163 ? 56.742 -8.036  24.104 1.00 49.79 ? 2225 GLU B OE1   1 
ATOM   2862 O  OE2   . GLU B 1 163 ? 55.973 -10.045 24.557 1.00 49.33 ? 2225 GLU B OE2   1 
ATOM   2863 N  N     . MET B 1 164 ? 52.553 -6.718  21.337 1.00 47.56 ? 2226 MET B N     1 
ATOM   2864 C  CA    . MET B 1 164 ? 52.180 -7.496  20.154 1.00 47.35 ? 2226 MET B CA    1 
ATOM   2865 C  C     . MET B 1 164 ? 53.306 -8.468  19.838 1.00 47.09 ? 2226 MET B C     1 
ATOM   2866 O  O     . MET B 1 164 ? 54.476 -8.122  19.959 1.00 47.22 ? 2226 MET B O     1 
ATOM   2867 C  CB    . MET B 1 164 ? 51.895 -6.600  18.940 1.00 47.42 ? 2226 MET B CB    1 
ATOM   2868 C  CG    . MET B 1 164 ? 50.715 -5.623  19.086 1.00 47.92 ? 2226 MET B CG    1 
ATOM   2869 S  SD    . MET B 1 164 ? 49.091 -6.400  19.295 1.00 48.64 ? 2226 MET B SD    1 
ATOM   2870 C  CE    . MET B 1 164 ? 48.034 -4.965  19.469 1.00 47.66 ? 2226 MET B CE    1 
ATOM   2871 N  N     . GLN B 1 165 ? 52.952 -9.688  19.454 1.00 46.80 ? 2227 GLN B N     1 
ATOM   2872 C  CA    . GLN B 1 165 ? 53.946 -10.714 19.168 1.00 46.59 ? 2227 GLN B CA    1 
ATOM   2873 C  C     . GLN B 1 165 ? 53.700 -11.327 17.802 1.00 46.58 ? 2227 GLN B C     1 
ATOM   2874 O  O     . GLN B 1 165 ? 52.622 -11.869 17.538 1.00 46.55 ? 2227 GLN B O     1 
ATOM   2875 C  CB    . GLN B 1 165 ? 53.913 -11.817 20.223 1.00 46.53 ? 2227 GLN B CB    1 
ATOM   2876 C  CG    . GLN B 1 165 ? 54.328 -11.400 21.618 1.00 46.43 ? 2227 GLN B CG    1 
ATOM   2877 C  CD    . GLN B 1 165 ? 54.277 -12.552 22.615 1.00 46.09 ? 2227 GLN B CD    1 
ATOM   2878 O  OE1   . GLN B 1 165 ? 54.039 -13.711 22.250 1.00 44.45 ? 2227 GLN B OE1   1 
ATOM   2879 N  NE2   . GLN B 1 165 ? 54.499 -12.232 23.885 1.00 45.89 ? 2227 GLN B NE2   1 
ATOM   2880 N  N     . LYS B 1 166 ? 54.706 -11.240 16.940 1.00 46.45 ? 2228 LYS B N     1 
ATOM   2881 C  CA    . LYS B 1 166 ? 54.637 -11.825 15.611 1.00 46.40 ? 2228 LYS B CA    1 
ATOM   2882 C  C     . LYS B 1 166 ? 54.865 -13.331 15.715 1.00 46.25 ? 2228 LYS B C     1 
ATOM   2883 O  O     . LYS B 1 166 ? 55.892 -13.770 16.238 1.00 46.39 ? 2228 LYS B O     1 
ATOM   2884 C  CB    . LYS B 1 166 ? 55.687 -11.188 14.706 1.00 46.48 ? 2228 LYS B CB    1 
ATOM   2885 C  CG    . LYS B 1 166 ? 55.409 -11.339 13.229 1.00 47.05 ? 2228 LYS B CG    1 
ATOM   2886 C  CD    . LYS B 1 166 ? 56.658 -11.075 12.419 1.00 47.83 ? 2228 LYS B CD    1 
ATOM   2887 C  CE    . LYS B 1 166 ? 56.341 -11.090 10.943 1.00 48.80 ? 2228 LYS B CE    1 
ATOM   2888 N  NZ    . LYS B 1 166 ? 57.551 -11.404 10.148 1.00 49.79 ? 2228 LYS B NZ    1 
ATOM   2889 N  N     . TRP B 1 167 ? 53.908 -14.112 15.218 1.00 45.86 ? 2229 TRP B N     1 
ATOM   2890 C  CA    . TRP B 1 167 ? 53.945 -15.562 15.361 1.00 45.43 ? 2229 TRP B CA    1 
ATOM   2891 C  C     . TRP B 1 167 ? 53.764 -16.283 14.039 1.00 45.31 ? 2229 TRP B C     1 
ATOM   2892 O  O     . TRP B 1 167 ? 52.945 -15.889 13.210 1.00 45.40 ? 2229 TRP B O     1 
ATOM   2893 C  CB    . TRP B 1 167 ? 52.875 -16.031 16.350 1.00 45.47 ? 2229 TRP B CB    1 
ATOM   2894 C  CG    . TRP B 1 167 ? 53.270 -15.910 17.806 1.00 45.34 ? 2229 TRP B CG    1 
ATOM   2895 C  CD1   . TRP B 1 167 ? 53.424 -14.756 18.523 1.00 45.17 ? 2229 TRP B CD1   1 
ATOM   2896 C  CD2   . TRP B 1 167 ? 53.532 -16.986 18.720 1.00 44.66 ? 2229 TRP B CD2   1 
ATOM   2897 N  NE1   . TRP B 1 167 ? 53.772 -15.046 19.819 1.00 45.01 ? 2229 TRP B NE1   1 
ATOM   2898 C  CE2   . TRP B 1 167 ? 53.848 -16.405 19.968 1.00 44.36 ? 2229 TRP B CE2   1 
ATOM   2899 C  CE3   . TRP B 1 167 ? 53.534 -18.382 18.603 1.00 44.48 ? 2229 TRP B CE3   1 
ATOM   2900 C  CZ2   . TRP B 1 167 ? 54.167 -17.171 21.093 1.00 43.46 ? 2229 TRP B CZ2   1 
ATOM   2901 C  CZ3   . TRP B 1 167 ? 53.854 -19.143 19.723 1.00 44.04 ? 2229 TRP B CZ3   1 
ATOM   2902 C  CH2   . TRP B 1 167 ? 54.167 -18.532 20.951 1.00 43.35 ? 2229 TRP B CH2   1 
ATOM   2903 N  N     . SER B 1 168 ? 54.534 -17.351 13.862 1.00 45.11 ? 2230 SER B N     1 
ATOM   2904 C  CA    . SER B 1 168 ? 54.456 -18.188 12.677 1.00 44.87 ? 2230 SER B CA    1 
ATOM   2905 C  C     . SER B 1 168 ? 53.353 -19.222 12.863 1.00 44.98 ? 2230 SER B C     1 
ATOM   2906 O  O     . SER B 1 168 ? 53.434 -20.075 13.744 1.00 45.08 ? 2230 SER B O     1 
ATOM   2907 C  CB    . SER B 1 168 ? 55.802 -18.866 12.425 1.00 44.66 ? 2230 SER B CB    1 
ATOM   2908 O  OG    . SER B 1 168 ? 55.772 -19.646 11.250 1.00 44.29 ? 2230 SER B OG    1 
ATOM   2909 N  N     . VAL B 1 169 ? 52.317 -19.128 12.036 1.00 45.13 ? 2231 VAL B N     1 
ATOM   2910 C  CA    . VAL B 1 169 ? 51.160 -20.015 12.124 1.00 45.30 ? 2231 VAL B CA    1 
ATOM   2911 C  C     . VAL B 1 169 ? 50.925 -20.716 10.778 1.00 45.53 ? 2231 VAL B C     1 
ATOM   2912 O  O     . VAL B 1 169 ? 50.555 -20.077 9.793  1.00 45.61 ? 2231 VAL B O     1 
ATOM   2913 C  CB    . VAL B 1 169 ? 49.882 -19.239 12.546 1.00 45.29 ? 2231 VAL B CB    1 
ATOM   2914 C  CG1   . VAL B 1 169 ? 48.770 -20.200 12.905 1.00 45.20 ? 2231 VAL B CG1   1 
ATOM   2915 C  CG2   . VAL B 1 169 ? 50.163 -18.297 13.718 1.00 45.20 ? 2231 VAL B CG2   1 
ATOM   2916 N  N     . ASN B 1 170 ? 51.151 -22.028 10.750 1.00 45.79 ? 2232 ASN B N     1 
ATOM   2917 C  CA    . ASN B 1 170 ? 50.985 -22.857 9.547  1.00 46.17 ? 2232 ASN B CA    1 
ATOM   2918 C  C     . ASN B 1 170 ? 51.370 -22.181 8.225  1.00 46.30 ? 2232 ASN B C     1 
ATOM   2919 O  O     . ASN B 1 170 ? 50.555 -22.065 7.308  1.00 46.56 ? 2232 ASN B O     1 
ATOM   2920 C  CB    . ASN B 1 170 ? 49.565 -23.447 9.479  1.00 46.25 ? 2232 ASN B CB    1 
ATOM   2921 C  CG    . ASN B 1 170 ? 49.307 -24.501 10.565 1.00 46.86 ? 2232 ASN B CG    1 
ATOM   2922 O  OD1   . ASN B 1 170 ? 49.868 -24.441 11.664 1.00 46.48 ? 2232 ASN B OD1   1 
ATOM   2923 N  ND2   . ASN B 1 170 ? 48.451 -25.472 10.253 1.00 47.20 ? 2232 ASN B ND2   1 
ATOM   2924 N  N     . GLY B 1 171 ? 52.618 -21.729 8.140  1.00 46.37 ? 2233 GLY B N     1 
ATOM   2925 C  CA    . GLY B 1 171 ? 53.132 -21.093 6.930  1.00 46.26 ? 2233 GLY B CA    1 
ATOM   2926 C  C     . GLY B 1 171 ? 52.996 -19.584 6.922  1.00 46.26 ? 2233 GLY B C     1 
ATOM   2927 O  O     . GLY B 1 171 ? 53.814 -18.888 6.319  1.00 46.41 ? 2233 GLY B O     1 
ATOM   2928 N  N     . VAL B 1 172 ? 51.971 -19.081 7.607  1.00 46.14 ? 2234 VAL B N     1 
ATOM   2929 C  CA    . VAL B 1 172 ? 51.620 -17.659 7.591  1.00 45.94 ? 2234 VAL B CA    1 
ATOM   2930 C  C     . VAL B 1 172 ? 52.067 -16.943 8.872  1.00 45.78 ? 2234 VAL B C     1 
ATOM   2931 O  O     . VAL B 1 172 ? 52.019 -17.517 9.959  1.00 45.69 ? 2234 VAL B O     1 
ATOM   2932 C  CB    . VAL B 1 172 ? 50.083 -17.477 7.402  1.00 45.99 ? 2234 VAL B CB    1 
ATOM   2933 C  CG1   . VAL B 1 172 ? 49.721 -16.013 7.203  1.00 46.13 ? 2234 VAL B CG1   1 
ATOM   2934 C  CG2   . VAL B 1 172 ? 49.574 -18.306 6.223  1.00 45.99 ? 2234 VAL B CG2   1 
ATOM   2935 N  N     . TYR B 1 173 ? 52.506 -15.693 8.732  1.00 45.61 ? 2235 TYR B N     1 
ATOM   2936 C  CA    . TYR B 1 173 ? 52.797 -14.828 9.876  1.00 45.52 ? 2235 TYR B CA    1 
ATOM   2937 C  C     . TYR B 1 173 ? 51.522 -14.187 10.409 1.00 45.40 ? 2235 TYR B C     1 
ATOM   2938 O  O     . TYR B 1 173 ? 50.690 -13.721 9.632  1.00 45.45 ? 2235 TYR B O     1 
ATOM   2939 C  CB    . TYR B 1 173 ? 53.785 -13.720 9.490  1.00 45.56 ? 2235 TYR B CB    1 
ATOM   2940 C  CG    . TYR B 1 173 ? 55.255 -14.082 9.627  1.00 46.06 ? 2235 TYR B CG    1 
ATOM   2941 C  CD1   . TYR B 1 173 ? 56.143 -13.896 8.557  1.00 45.77 ? 2235 TYR B CD1   1 
ATOM   2942 C  CD2   . TYR B 1 173 ? 55.764 -14.599 10.825 1.00 45.79 ? 2235 TYR B CD2   1 
ATOM   2943 C  CE1   . TYR B 1 173 ? 57.494 -14.216 8.677  1.00 45.36 ? 2235 TYR B CE1   1 
ATOM   2944 C  CE2   . TYR B 1 173 ? 57.109 -14.921 10.953 1.00 45.83 ? 2235 TYR B CE2   1 
ATOM   2945 C  CZ    . TYR B 1 173 ? 57.969 -14.729 9.875  1.00 45.82 ? 2235 TYR B CZ    1 
ATOM   2946 O  OH    . TYR B 1 173 ? 59.302 -15.050 10.006 1.00 45.61 ? 2235 TYR B OH    1 
ATOM   2947 N  N     . ARG B 1 174 ? 51.377 -14.164 11.733 1.00 45.27 ? 2236 ARG B N     1 
ATOM   2948 C  CA    . ARG B 1 174 ? 50.230 -13.533 12.393 1.00 45.05 ? 2236 ARG B CA    1 
ATOM   2949 C  C     . ARG B 1 174 ? 50.675 -12.734 13.620 1.00 45.17 ? 2236 ARG B C     1 
ATOM   2950 O  O     . ARG B 1 174 ? 51.776 -12.945 14.129 1.00 45.19 ? 2236 ARG B O     1 
ATOM   2951 C  CB    . ARG B 1 174 ? 49.186 -14.576 12.803 1.00 45.01 ? 2236 ARG B CB    1 
ATOM   2952 C  CG    . ARG B 1 174 ? 48.617 -15.423 11.668 1.00 44.47 ? 2236 ARG B CG    1 
ATOM   2953 C  CD    . ARG B 1 174 ? 47.144 -15.673 11.895 1.00 43.60 ? 2236 ARG B CD    1 
ATOM   2954 N  NE    . ARG B 1 174 ? 46.787 -17.083 11.794 1.00 42.98 ? 2236 ARG B NE    1 
ATOM   2955 C  CZ    . ARG B 1 174 ? 45.648 -17.600 12.246 1.00 42.50 ? 2236 ARG B CZ    1 
ATOM   2956 N  NH1   . ARG B 1 174 ? 44.740 -16.834 12.835 1.00 41.89 ? 2236 ARG B NH1   1 
ATOM   2957 N  NH2   . ARG B 1 174 ? 45.417 -18.894 12.112 1.00 43.32 ? 2236 ARG B NH2   1 
ATOM   2958 N  N     . ILE B 1 175 ? 49.814 -11.826 14.087 1.00 45.20 ? 2237 ILE B N     1 
ATOM   2959 C  CA    . ILE B 1 175 ? 50.129 -10.933 15.206 1.00 45.34 ? 2237 ILE B CA    1 
ATOM   2960 C  C     . ILE B 1 175 ? 49.114 -11.059 16.341 1.00 45.52 ? 2237 ILE B C     1 
ATOM   2961 O  O     . ILE B 1 175 ? 47.920 -10.821 16.146 1.00 45.68 ? 2237 ILE B O     1 
ATOM   2962 C  CB    . ILE B 1 175 ? 50.189 -9.455  14.752 1.00 45.33 ? 2237 ILE B CB    1 
ATOM   2963 C  CG1   . ILE B 1 175 ? 51.391 -9.222  13.835 1.00 45.97 ? 2237 ILE B CG1   1 
ATOM   2964 C  CG2   . ILE B 1 175 ? 50.248 -8.502  15.956 1.00 45.24 ? 2237 ILE B CG2   1 
ATOM   2965 C  CD1   . ILE B 1 175 ? 51.339 -7.887  13.078 1.00 46.99 ? 2237 ILE B CD1   1 
ATOM   2966 N  N     . GLY B 1 176 ? 49.600 -11.414 17.529 1.00 45.63 ? 2238 GLY B N     1 
ATOM   2967 C  CA    . GLY B 1 176 ? 48.751 -11.526 18.711 1.00 45.74 ? 2238 GLY B CA    1 
ATOM   2968 C  C     . GLY B 1 176 ? 49.140 -10.560 19.815 1.00 45.94 ? 2238 GLY B C     1 
ATOM   2969 O  O     . GLY B 1 176 ? 50.291 -10.122 19.898 1.00 45.87 ? 2238 GLY B O     1 
ATOM   2970 N  N     . LEU B 1 177 ? 48.172 -10.231 20.666 1.00 46.00 ? 2239 LEU B N     1 
ATOM   2971 C  CA    . LEU B 1 177 ? 48.392 -9.330  21.787 1.00 46.08 ? 2239 LEU B CA    1 
ATOM   2972 C  C     . LEU B 1 177 ? 48.548 -10.133 23.071 1.00 46.34 ? 2239 LEU B C     1 
ATOM   2973 O  O     . LEU B 1 177 ? 47.602 -10.759 23.538 1.00 46.39 ? 2239 LEU B O     1 
ATOM   2974 C  CB    . LEU B 1 177 ? 47.228 -8.343  21.912 1.00 45.96 ? 2239 LEU B CB    1 
ATOM   2975 C  CG    . LEU B 1 177 ? 47.206 -7.411  23.124 1.00 45.64 ? 2239 LEU B CG    1 
ATOM   2976 C  CD1   . LEU B 1 177 ? 48.002 -6.145  22.872 1.00 44.81 ? 2239 LEU B CD1   1 
ATOM   2977 C  CD2   . LEU B 1 177 ? 45.776 -7.076  23.468 1.00 45.60 ? 2239 LEU B CD2   1 
ATOM   2978 N  N     . TYR B 1 178 ? 49.750 -10.107 23.634 1.00 46.77 ? 2240 TYR B N     1 
ATOM   2979 C  CA    . TYR B 1 178 ? 50.046 -10.847 24.854 1.00 47.22 ? 2240 TYR B CA    1 
ATOM   2980 C  C     . TYR B 1 178 ? 50.265 -9.893  26.016 1.00 47.72 ? 2240 TYR B C     1 
ATOM   2981 O  O     . TYR B 1 178 ? 50.632 -8.732  25.819 1.00 47.66 ? 2240 TYR B O     1 
ATOM   2982 C  CB    . TYR B 1 178 ? 51.275 -11.736 24.659 1.00 47.14 ? 2240 TYR B CB    1 
ATOM   2983 C  CG    . TYR B 1 178 ? 51.092 -12.862 23.661 1.00 47.18 ? 2240 TYR B CG    1 
ATOM   2984 C  CD1   . TYR B 1 178 ? 50.871 -12.596 22.304 1.00 47.40 ? 2240 TYR B CD1   1 
ATOM   2985 C  CD2   . TYR B 1 178 ? 51.159 -14.193 24.068 1.00 47.01 ? 2240 TYR B CD2   1 
ATOM   2986 C  CE1   . TYR B 1 178 ? 50.708 -13.623 21.383 1.00 47.66 ? 2240 TYR B CE1   1 
ATOM   2987 C  CE2   . TYR B 1 178 ? 51.000 -15.231 23.154 1.00 47.74 ? 2240 TYR B CE2   1 
ATOM   2988 C  CZ    . TYR B 1 178 ? 50.775 -14.937 21.812 1.00 48.29 ? 2240 TYR B CZ    1 
ATOM   2989 O  OH    . TYR B 1 178 ? 50.620 -15.958 20.900 1.00 48.92 ? 2240 TYR B OH    1 
ATOM   2990 N  N     . ALA B 1 179 ? 50.032 -10.389 27.227 1.00 48.42 ? 2241 ALA B N     1 
ATOM   2991 C  CA    . ALA B 1 179 ? 50.180 -9.589  28.440 1.00 49.07 ? 2241 ALA B CA    1 
ATOM   2992 C  C     . ALA B 1 179 ? 51.638 -9.499  28.893 1.00 49.51 ? 2241 ALA B C     1 
ATOM   2993 O  O     . ALA B 1 179 ? 52.348 -10.508 28.943 1.00 49.54 ? 2241 ALA B O     1 
ATOM   2994 C  CB    . ALA B 1 179 ? 49.316 -10.159 29.550 1.00 49.09 ? 2241 ALA B CB    1 
ATOM   2995 N  N     . LEU B 1 180 ? 52.071 -8.283  29.216 1.00 50.03 ? 2242 LEU B N     1 
ATOM   2996 C  CA    . LEU B 1 180 ? 53.414 -8.043  29.733 1.00 50.64 ? 2242 LEU B CA    1 
ATOM   2997 C  C     . LEU B 1 180 ? 53.544 -8.419  31.210 1.00 51.13 ? 2242 LEU B C     1 
ATOM   2998 O  O     . LEU B 1 180 ? 54.635 -8.769  31.675 1.00 51.11 ? 2242 LEU B O     1 
ATOM   2999 C  CB    . LEU B 1 180 ? 53.805 -6.572  29.551 1.00 50.64 ? 2242 LEU B CB    1 
ATOM   3000 C  CG    . LEU B 1 180 ? 54.403 -6.102  28.222 1.00 50.77 ? 2242 LEU B CG    1 
ATOM   3001 C  CD1   . LEU B 1 180 ? 54.656 -4.612  28.276 1.00 50.48 ? 2242 LEU B CD1   1 
ATOM   3002 C  CD2   . LEU B 1 180 ? 55.699 -6.840  27.880 1.00 51.04 ? 2242 LEU B CD2   1 
ATOM   3003 N  N     . LYS B 1 181 ? 52.428 -8.343  31.937 1.00 51.61 ? 2243 LYS B N     1 
ATOM   3004 C  CA    . LYS B 1 181 ? 52.417 -8.519  33.392 1.00 52.10 ? 2243 LYS B CA    1 
ATOM   3005 C  C     . LYS B 1 181 ? 51.068 -9.046  33.885 1.00 52.32 ? 2243 LYS B C     1 
ATOM   3006 O  O     . LYS B 1 181 ? 50.086 -9.034  33.138 1.00 52.58 ? 2243 LYS B O     1 
ATOM   3007 C  CB    . LYS B 1 181 ? 52.737 -7.183  34.076 1.00 52.13 ? 2243 LYS B CB    1 
ATOM   3008 C  CG    . LYS B 1 181 ? 51.734 -6.070  33.770 1.00 52.59 ? 2243 LYS B CG    1 
ATOM   3009 C  CD    . LYS B 1 181 ? 52.295 -4.706  34.117 1.00 52.99 ? 2243 LYS B CD    1 
ATOM   3010 C  CE    . LYS B 1 181 ? 51.182 -3.716  34.420 1.00 53.20 ? 2243 LYS B CE    1 
ATOM   3011 N  NZ    . LYS B 1 181 ? 51.728 -2.452  34.992 1.00 53.68 ? 2243 LYS B NZ    1 
ATOM   3012 N  N     . ASP B 1 182 ? 51.025 -9.513  35.135 1.00 52.39 ? 2244 ASP B N     1 
ATOM   3013 C  CA    . ASP B 1 182 ? 49.754 -9.780  35.813 1.00 52.28 ? 2244 ASP B CA    1 
ATOM   3014 C  C     . ASP B 1 182 ? 49.003 -8.455  35.889 1.00 52.17 ? 2244 ASP B C     1 
ATOM   3015 O  O     . ASP B 1 182 ? 49.604 -7.419  36.189 1.00 52.09 ? 2244 ASP B O     1 
ATOM   3016 C  CB    . ASP B 1 182 ? 49.976 -10.314 37.238 1.00 52.32 ? 2244 ASP B CB    1 
ATOM   3017 C  CG    . ASP B 1 182 ? 50.553 -11.734 37.277 1.00 52.38 ? 2244 ASP B CG    1 
ATOM   3018 O  OD1   . ASP B 1 182 ? 50.711 -12.265 38.399 1.00 52.00 ? 2244 ASP B OD1   1 
ATOM   3019 O  OD2   . ASP B 1 182 ? 50.849 -12.321 36.212 1.00 52.34 ? 2244 ASP B OD2   1 
ATOM   3020 N  N     . MET B 1 183 ? 47.704 -8.474  35.598 1.00 52.11 ? 2245 MET B N     1 
ATOM   3021 C  CA    . MET B 1 183 ? 46.890 -7.260  35.734 1.00 52.05 ? 2245 MET B CA    1 
ATOM   3022 C  C     . MET B 1 183 ? 45.458 -7.537  36.209 1.00 51.90 ? 2245 MET B C     1 
ATOM   3023 O  O     . MET B 1 183 ? 44.817 -8.470  35.725 1.00 51.97 ? 2245 MET B O     1 
ATOM   3024 C  CB    . MET B 1 183 ? 46.938 -6.389  34.462 1.00 51.99 ? 2245 MET B CB    1 
ATOM   3025 C  CG    . MET B 1 183 ? 46.177 -6.904  33.254 1.00 51.91 ? 2245 MET B CG    1 
ATOM   3026 S  SD    . MET B 1 183 ? 46.701 -6.095  31.723 1.00 51.23 ? 2245 MET B SD    1 
ATOM   3027 C  CE    . MET B 1 183 ? 47.880 -7.287  31.107 1.00 50.85 ? 2245 MET B CE    1 
ATOM   3028 N  N     . PRO B 1 184 ? 44.968 -6.731  37.174 1.00 51.75 ? 2246 PRO B N     1 
ATOM   3029 C  CA    . PRO B 1 184 ? 43.661 -6.943  37.797 1.00 51.56 ? 2246 PRO B CA    1 
ATOM   3030 C  C     . PRO B 1 184 ? 42.495 -6.492  36.918 1.00 51.39 ? 2246 PRO B C     1 
ATOM   3031 O  O     . PRO B 1 184 ? 42.710 -5.869  35.874 1.00 51.31 ? 2246 PRO B O     1 
ATOM   3032 C  CB    . PRO B 1 184 ? 43.739 -6.080  39.059 1.00 51.55 ? 2246 PRO B CB    1 
ATOM   3033 C  CG    . PRO B 1 184 ? 44.647 -4.968  38.688 1.00 51.52 ? 2246 PRO B CG    1 
ATOM   3034 C  CD    . PRO B 1 184 ? 45.658 -5.554  37.742 1.00 51.74 ? 2246 PRO B CD    1 
ATOM   3035 N  N     . ALA B 1 185 ? 41.275 -6.805  37.356 1.00 51.17 ? 2247 ALA B N     1 
ATOM   3036 C  CA    . ALA B 1 185 ? 40.057 -6.468  36.623 1.00 50.96 ? 2247 ALA B CA    1 
ATOM   3037 C  C     . ALA B 1 185 ? 39.842 -4.959  36.517 1.00 50.94 ? 2247 ALA B C     1 
ATOM   3038 O  O     . ALA B 1 185 ? 40.228 -4.203  37.414 1.00 50.91 ? 2247 ALA B O     1 
ATOM   3039 C  CB    . ALA B 1 185 ? 38.864 -7.120  37.275 1.00 50.88 ? 2247 ALA B CB    1 
ATOM   3040 N  N     . GLY B 1 186 ? 39.239 -4.533  35.408 1.00 50.78 ? 2248 GLY B N     1 
ATOM   3041 C  CA    . GLY B 1 186 ? 38.888 -3.130  35.187 1.00 50.72 ? 2248 GLY B CA    1 
ATOM   3042 C  C     . GLY B 1 186 ? 39.964 -2.262  34.554 1.00 50.72 ? 2248 GLY B C     1 
ATOM   3043 O  O     . GLY B 1 186 ? 39.694 -1.121  34.165 1.00 50.38 ? 2248 GLY B O     1 
ATOM   3044 N  N     . THR B 1 187 ? 41.180 -2.794  34.450 1.00 50.88 ? 2249 THR B N     1 
ATOM   3045 C  CA    . THR B 1 187 ? 42.311 -2.023  33.929 1.00 51.15 ? 2249 THR B CA    1 
ATOM   3046 C  C     . THR B 1 187 ? 42.327 -1.979  32.404 1.00 51.19 ? 2249 THR B C     1 
ATOM   3047 O  O     . THR B 1 187 ? 42.031 -2.976  31.736 1.00 51.16 ? 2249 THR B O     1 
ATOM   3048 C  CB    . THR B 1 187 ? 43.673 -2.547  34.450 1.00 51.22 ? 2249 THR B CB    1 
ATOM   3049 O  OG1   . THR B 1 187 ? 43.849 -3.917  34.067 1.00 51.48 ? 2249 THR B OG1   1 
ATOM   3050 C  CG2   . THR B 1 187 ? 43.762 -2.416  35.980 1.00 51.60 ? 2249 THR B CG2   1 
ATOM   3051 N  N     . GLU B 1 188 ? 42.679 -0.812  31.870 1.00 51.21 ? 2250 GLU B N     1 
ATOM   3052 C  CA    . GLU B 1 188 ? 42.741 -0.587  30.434 1.00 51.48 ? 2250 GLU B CA    1 
ATOM   3053 C  C     . GLU B 1 188 ? 43.965 -1.271  29.821 1.00 51.68 ? 2250 GLU B C     1 
ATOM   3054 O  O     . GLU B 1 188 ? 45.100 -1.036  30.253 1.00 51.86 ? 2250 GLU B O     1 
ATOM   3055 C  CB    . GLU B 1 188 ? 42.773 0.917   30.152 1.00 51.44 ? 2250 GLU B CB    1 
ATOM   3056 C  CG    . GLU B 1 188 ? 42.752 1.303   28.679 1.00 51.69 ? 2250 GLU B CG    1 
ATOM   3057 C  CD    . GLU B 1 188 ? 42.952 2.799   28.457 1.00 52.52 ? 2250 GLU B CD    1 
ATOM   3058 O  OE1   . GLU B 1 188 ? 43.264 3.522   29.433 1.00 52.82 ? 2250 GLU B OE1   1 
ATOM   3059 O  OE2   . GLU B 1 188 ? 42.800 3.254   27.300 1.00 52.56 ? 2250 GLU B OE2   1 
ATOM   3060 N  N     . LEU B 1 189 ? 43.730 -2.123  28.824 1.00 51.73 ? 2251 LEU B N     1 
ATOM   3061 C  CA    . LEU B 1 189 ? 44.820 -2.758  28.089 1.00 51.77 ? 2251 LEU B CA    1 
ATOM   3062 C  C     . LEU B 1 189 ? 45.486 -1.732  27.194 1.00 51.84 ? 2251 LEU B C     1 
ATOM   3063 O  O     . LEU B 1 189 ? 44.806 -1.010  26.465 1.00 51.86 ? 2251 LEU B O     1 
ATOM   3064 C  CB    . LEU B 1 189 ? 44.321 -3.917  27.223 1.00 51.77 ? 2251 LEU B CB    1 
ATOM   3065 C  CG    . LEU B 1 189 ? 43.461 -5.060  27.766 1.00 51.62 ? 2251 LEU B CG    1 
ATOM   3066 C  CD1   . LEU B 1 189 ? 43.390 -6.146  26.705 1.00 51.72 ? 2251 LEU B CD1   1 
ATOM   3067 C  CD2   . LEU B 1 189 ? 44.003 -5.626  29.063 1.00 52.03 ? 2251 LEU B CD2   1 
ATOM   3068 N  N     . THR B 1 190 ? 46.814 -1.667  27.260 1.00 52.01 ? 2252 THR B N     1 
ATOM   3069 C  CA    . THR B 1 190 ? 47.597 -0.756  26.423 1.00 52.17 ? 2252 THR B CA    1 
ATOM   3070 C  C     . THR B 1 190 ? 48.805 -1.466  25.808 1.00 52.53 ? 2252 THR B C     1 
ATOM   3071 O  O     . THR B 1 190 ? 49.260 -2.490  26.321 1.00 52.57 ? 2252 THR B O     1 
ATOM   3072 C  CB    . THR B 1 190 ? 48.088 0.493   27.214 1.00 52.08 ? 2252 THR B CB    1 
ATOM   3073 O  OG1   . THR B 1 190 ? 48.884 0.084   28.333 1.00 51.77 ? 2252 THR B OG1   1 
ATOM   3074 C  CG2   . THR B 1 190 ? 46.920 1.347   27.700 1.00 51.56 ? 2252 THR B CG2   1 
ATOM   3075 N  N     . TYR B 1 191 ? 49.311 -0.919  24.704 1.00 52.96 ? 2253 TYR B N     1 
ATOM   3076 C  CA    . TYR B 1 191 ? 50.561 -1.384  24.097 1.00 53.43 ? 2253 TYR B CA    1 
ATOM   3077 C  C     . TYR B 1 191 ? 51.323 -0.219  23.467 1.00 53.93 ? 2253 TYR B C     1 
ATOM   3078 O  O     . TYR B 1 191 ? 50.748 0.846   23.234 1.00 53.93 ? 2253 TYR B O     1 
ATOM   3079 C  CB    . TYR B 1 191 ? 50.311 -2.513  23.083 1.00 53.29 ? 2253 TYR B CB    1 
ATOM   3080 C  CG    . TYR B 1 191 ? 49.622 -2.104  21.797 1.00 53.19 ? 2253 TYR B CG    1 
ATOM   3081 C  CD1   . TYR B 1 191 ? 50.352 -1.912  20.624 1.00 53.42 ? 2253 TYR B CD1   1 
ATOM   3082 C  CD2   . TYR B 1 191 ? 48.240 -1.932  21.745 1.00 52.92 ? 2253 TYR B CD2   1 
ATOM   3083 C  CE1   . TYR B 1 191 ? 49.722 -1.541  19.435 1.00 53.32 ? 2253 TYR B CE1   1 
ATOM   3084 C  CE2   . TYR B 1 191 ? 47.600 -1.562  20.566 1.00 52.92 ? 2253 TYR B CE2   1 
ATOM   3085 C  CZ    . TYR B 1 191 ? 48.345 -1.370  19.413 1.00 53.07 ? 2253 TYR B CZ    1 
ATOM   3086 O  OH    . TYR B 1 191 ? 47.716 -1.005  18.242 1.00 52.58 ? 2253 TYR B OH    1 
ATOM   3087 N  N     . ASP B 1 192 ? 52.614 -0.419  23.206 1.00 54.60 ? 2254 ASP B N     1 
ATOM   3088 C  CA    . ASP B 1 192 ? 53.450 0.616   22.595 1.00 55.39 ? 2254 ASP B CA    1 
ATOM   3089 C  C     . ASP B 1 192 ? 53.282 0.651   21.072 1.00 56.04 ? 2254 ASP B C     1 
ATOM   3090 O  O     . ASP B 1 192 ? 53.647 -0.299  20.377 1.00 56.10 ? 2254 ASP B O     1 
ATOM   3091 C  CB    . ASP B 1 192 ? 54.925 0.421   22.979 1.00 55.20 ? 2254 ASP B CB    1 
ATOM   3092 C  CG    . ASP B 1 192 ? 55.800 1.625   22.625 1.00 55.01 ? 2254 ASP B CG    1 
ATOM   3093 O  OD1   . ASP B 1 192 ? 55.271 2.680   22.212 1.00 54.28 ? 2254 ASP B OD1   1 
ATOM   3094 O  OD2   . ASP B 1 192 ? 57.035 1.513   22.766 1.00 54.70 ? 2254 ASP B OD2   1 
ATOM   3095 N  N     . TYR B 1 193 ? 52.725 1.754   20.572 1.00 56.90 ? 2255 TYR B N     1 
ATOM   3096 C  CA    . TYR B 1 193 ? 52.529 1.974   19.139 1.00 57.91 ? 2255 TYR B CA    1 
ATOM   3097 C  C     . TYR B 1 193 ? 53.867 2.152   18.433 1.00 59.00 ? 2255 TYR B C     1 
ATOM   3098 O  O     . TYR B 1 193 ? 54.038 1.708   17.299 1.00 58.94 ? 2255 TYR B O     1 
ATOM   3099 C  CB    . TYR B 1 193 ? 51.670 3.224   18.893 1.00 57.65 ? 2255 TYR B CB    1 
ATOM   3100 C  CG    . TYR B 1 193 ? 50.174 3.084   19.135 1.00 56.94 ? 2255 TYR B CG    1 
ATOM   3101 C  CD1   . TYR B 1 193 ? 49.285 4.041   18.643 1.00 56.00 ? 2255 TYR B CD1   1 
ATOM   3102 C  CD2   . TYR B 1 193 ? 49.645 2.006   19.845 1.00 56.47 ? 2255 TYR B CD2   1 
ATOM   3103 C  CE1   . TYR B 1 193 ? 47.915 3.933   18.858 1.00 55.59 ? 2255 TYR B CE1   1 
ATOM   3104 C  CE2   . TYR B 1 193 ? 48.277 1.889   20.063 1.00 56.09 ? 2255 TYR B CE2   1 
ATOM   3105 C  CZ    . TYR B 1 193 ? 47.417 2.856   19.568 1.00 55.69 ? 2255 TYR B CZ    1 
ATOM   3106 O  OH    . TYR B 1 193 ? 46.063 2.735   19.789 1.00 54.95 ? 2255 TYR B OH    1 
ATOM   3107 N  N     . ASN B 1 194 ? 54.810 2.799   19.119 1.00 60.49 ? 2256 ASN B N     1 
ATOM   3108 C  CA    . ASN B 1 194 ? 56.116 3.136   18.553 1.00 61.98 ? 2256 ASN B CA    1 
ATOM   3109 C  C     . ASN B 1 194 ? 56.996 1.939   18.210 1.00 63.20 ? 2256 ASN B C     1 
ATOM   3110 O  O     . ASN B 1 194 ? 57.929 2.056   17.409 1.00 63.39 ? 2256 ASN B O     1 
ATOM   3111 C  CB    . ASN B 1 194 ? 56.869 4.091   19.477 1.00 61.85 ? 2256 ASN B CB    1 
ATOM   3112 C  CG    . ASN B 1 194 ? 56.541 5.548   19.205 1.00 61.84 ? 2256 ASN B CG    1 
ATOM   3113 O  OD1   . ASN B 1 194 ? 57.423 6.337   18.859 1.00 61.74 ? 2256 ASN B OD1   1 
ATOM   3114 N  ND2   . ASN B 1 194 ? 55.273 5.915   19.367 1.00 61.70 ? 2256 ASN B ND2   1 
ATOM   3115 N  N     . PHE B 1 195 ? 56.696 0.796   18.818 1.00 64.70 ? 2257 PHE B N     1 
ATOM   3116 C  CA    . PHE B 1 195 ? 57.359 -0.457  18.474 1.00 66.28 ? 2257 PHE B CA    1 
ATOM   3117 C  C     . PHE B 1 195 ? 56.783 -1.079  17.206 1.00 67.26 ? 2257 PHE B C     1 
ATOM   3118 O  O     . PHE B 1 195 ? 57.285 -2.096  16.726 1.00 67.40 ? 2257 PHE B O     1 
ATOM   3119 C  CB    . PHE B 1 195 ? 57.271 -1.448  19.639 1.00 66.34 ? 2257 PHE B CB    1 
ATOM   3120 C  CG    . PHE B 1 195 ? 58.565 -1.622  20.392 1.00 67.05 ? 2257 PHE B CG    1 
ATOM   3121 C  CD1   . PHE B 1 195 ? 59.237 -0.520  20.930 1.00 67.37 ? 2257 PHE B CD1   1 
ATOM   3122 C  CD2   . PHE B 1 195 ? 59.108 -2.893  20.572 1.00 67.63 ? 2257 PHE B CD2   1 
ATOM   3123 C  CE1   . PHE B 1 195 ? 60.435 -0.680  21.626 1.00 67.42 ? 2257 PHE B CE1   1 
ATOM   3124 C  CE2   . PHE B 1 195 ? 60.307 -3.066  21.268 1.00 67.99 ? 2257 PHE B CE2   1 
ATOM   3125 C  CZ    . PHE B 1 195 ? 60.971 -1.956  21.795 1.00 67.85 ? 2257 PHE B CZ    1 
ATOM   3126 N  N     . HIS B 1 196 ? 55.735 -0.465  16.663 1.00 68.61 ? 2258 HIS B N     1 
ATOM   3127 C  CA    . HIS B 1 196 ? 55.018 -1.040  15.531 1.00 70.00 ? 2258 HIS B CA    1 
ATOM   3128 C  C     . HIS B 1 196 ? 54.769 -0.045  14.409 1.00 71.00 ? 2258 HIS B C     1 
ATOM   3129 O  O     . HIS B 1 196 ? 55.298 -0.213  13.311 1.00 71.28 ? 2258 HIS B O     1 
ATOM   3130 C  CB    . HIS B 1 196 ? 53.709 -1.690  15.997 1.00 69.94 ? 2258 HIS B CB    1 
ATOM   3131 C  CG    . HIS B 1 196 ? 53.918 -2.812  16.963 1.00 70.23 ? 2258 HIS B CG    1 
ATOM   3132 N  ND1   . HIS B 1 196 ? 53.960 -2.620  18.328 1.00 70.38 ? 2258 HIS B ND1   1 
ATOM   3133 C  CD2   . HIS B 1 196 ? 54.135 -4.133  16.762 1.00 70.46 ? 2258 HIS B CD2   1 
ATOM   3134 C  CE1   . HIS B 1 196 ? 54.179 -3.777  18.926 1.00 70.68 ? 2258 HIS B CE1   1 
ATOM   3135 N  NE2   . HIS B 1 196 ? 54.292 -4.711  17.999 1.00 70.56 ? 2258 HIS B NE2   1 
ATOM   3136 N  N     . MET B 1 197 ? 53.987 0.995   14.686 1.00 72.23 ? 2259 MET B N     1 
ATOM   3137 C  CA    . MET B 1 197 ? 53.558 1.927   13.641 1.00 73.34 ? 2259 MET B CA    1 
ATOM   3138 C  C     . MET B 1 197 ? 53.524 3.400   14.049 1.00 74.16 ? 2259 MET B C     1 
ATOM   3139 O  O     . MET B 1 197 ? 52.900 3.777   15.045 1.00 74.30 ? 2259 MET B O     1 
ATOM   3140 C  CB    . MET B 1 197 ? 52.195 1.500   13.072 1.00 73.35 ? 2259 MET B CB    1 
ATOM   3141 C  CG    . MET B 1 197 ? 51.131 1.159   14.119 1.00 73.55 ? 2259 MET B CG    1 
ATOM   3142 S  SD    . MET B 1 197 ? 50.139 2.564   14.670 1.00 73.61 ? 2259 MET B SD    1 
ATOM   3143 C  CE    . MET B 1 197 ? 49.117 1.785   15.921 1.00 73.74 ? 2259 MET B CE    1 
ATOM   3144 N  N     . PHE B 1 198 ? 54.228 4.220   13.275 1.00 75.14 ? 2260 PHE B N     1 
ATOM   3145 C  CA    . PHE B 1 198 ? 53.993 5.663   13.234 1.00 76.16 ? 2260 PHE B CA    1 
ATOM   3146 C  C     . PHE B 1 198 ? 54.460 6.228   11.892 1.00 76.71 ? 2260 PHE B C     1 
ATOM   3147 O  O     . PHE B 1 198 ? 55.643 6.155   11.537 1.00 76.87 ? 2260 PHE B O     1 
ATOM   3148 C  CB    . PHE B 1 198 ? 54.576 6.421   14.449 1.00 76.22 ? 2260 PHE B CB    1 
ATOM   3149 C  CG    . PHE B 1 198 ? 56.055 6.231   14.657 1.00 76.83 ? 2260 PHE B CG    1 
ATOM   3150 C  CD1   . PHE B 1 198 ? 56.966 7.154   14.144 1.00 77.41 ? 2260 PHE B CD1   1 
ATOM   3151 C  CD2   . PHE B 1 198 ? 56.537 5.149   15.395 1.00 77.22 ? 2260 PHE B CD2   1 
ATOM   3152 C  CE1   . PHE B 1 198 ? 58.338 6.989   14.339 1.00 77.76 ? 2260 PHE B CE1   1 
ATOM   3153 C  CE2   . PHE B 1 198 ? 57.906 4.977   15.600 1.00 77.50 ? 2260 PHE B CE2   1 
ATOM   3154 C  CZ    . PHE B 1 198 ? 58.809 5.900   15.071 1.00 77.66 ? 2260 PHE B CZ    1 
ATOM   3155 N  N     . ASN B 1 199 ? 53.498 6.752   11.137 1.00 77.30 ? 2261 ASN B N     1 
ATOM   3156 C  CA    . ASN B 1 199 ? 53.743 7.290   9.805  1.00 77.80 ? 2261 ASN B CA    1 
ATOM   3157 C  C     . ASN B 1 199 ? 54.048 8.787   9.863  1.00 78.15 ? 2261 ASN B C     1 
ATOM   3158 O  O     . ASN B 1 199 ? 54.702 9.333   8.969  1.00 78.24 ? 2261 ASN B O     1 
ATOM   3159 C  CB    . ASN B 1 199 ? 52.533 7.030   8.901  1.00 77.80 ? 2261 ASN B CB    1 
ATOM   3160 C  CG    . ASN B 1 199 ? 51.867 5.687   9.176  1.00 77.86 ? 2261 ASN B CG    1 
ATOM   3161 O  OD1   . ASN B 1 199 ? 52.481 4.629   9.017  1.00 78.22 ? 2261 ASN B OD1   1 
ATOM   3162 N  ND2   . ASN B 1 199 ? 50.603 5.726   9.589  1.00 77.35 ? 2261 ASN B ND2   1 
ATOM   3163 N  N     . VAL B 1 200 ? 53.565 9.432   10.928 1.00 78.57 ? 2262 VAL B N     1 
ATOM   3164 C  CA    . VAL B 1 200 ? 53.768 10.866  11.185 1.00 79.01 ? 2262 VAL B CA    1 
ATOM   3165 C  C     . VAL B 1 200 ? 53.109 11.747  10.108 1.00 79.27 ? 2262 VAL B C     1 
ATOM   3166 O  O     . VAL B 1 200 ? 53.784 12.509  9.406  1.00 79.35 ? 2262 VAL B O     1 
ATOM   3167 C  CB    . VAL B 1 200 ? 55.284 11.227  11.414 1.00 79.06 ? 2262 VAL B CB    1 
ATOM   3168 C  CG1   . VAL B 1 200 ? 55.455 12.690  11.828 1.00 79.05 ? 2262 VAL B CG1   1 
ATOM   3169 C  CG2   . VAL B 1 200 ? 55.911 10.309  12.466 1.00 79.08 ? 2262 VAL B CG2   1 
ATOM   3170 N  N     . GLU B 1 201 ? 51.789 11.616  9.970  1.00 79.53 ? 2263 GLU B N     1 
ATOM   3171 C  CA    . GLU B 1 201 ? 51.000 12.560  9.172  1.00 79.77 ? 2263 GLU B CA    1 
ATOM   3172 C  C     . GLU B 1 201 ? 50.767 13.786  10.048 1.00 79.78 ? 2263 GLU B C     1 
ATOM   3173 O  O     . GLU B 1 201 ? 51.063 14.919  9.659  1.00 79.81 ? 2263 GLU B O     1 
ATOM   3174 C  CB    . GLU B 1 201 ? 49.663 11.950  8.731  1.00 79.81 ? 2263 GLU B CB    1 
ATOM   3175 C  CG    . GLU B 1 201 ? 49.760 10.929  7.598  1.00 80.31 ? 2263 GLU B CG    1 
ATOM   3176 C  CD    . GLU B 1 201 ? 50.005 9.498   8.080  1.00 80.90 ? 2263 GLU B CD    1 
ATOM   3177 O  OE1   . GLU B 1 201 ? 49.997 9.250   9.309  1.00 80.70 ? 2263 GLU B OE1   1 
ATOM   3178 O  OE2   . GLU B 1 201 ? 50.200 8.616   7.213  1.00 80.98 ? 2263 GLU B OE2   1 
ATOM   3179 N  N     . LYS B 1 202 ? 50.219 13.525  11.231 1.00 79.77 ? 2264 LYS B N     1 
ATOM   3180 C  CA    . LYS B 1 202 ? 50.213 14.451  12.355 1.00 79.74 ? 2264 LYS B CA    1 
ATOM   3181 C  C     . LYS B 1 202 ? 50.552 13.612  13.586 1.00 79.59 ? 2264 LYS B C     1 
ATOM   3182 O  O     . LYS B 1 202 ? 50.317 12.398  13.605 1.00 79.62 ? 2264 LYS B O     1 
ATOM   3183 C  CB    . LYS B 1 202 ? 48.848 15.130  12.514 1.00 79.84 ? 2264 LYS B CB    1 
ATOM   3184 C  CG    . LYS B 1 202 ? 48.563 16.223  11.483 1.00 80.08 ? 2264 LYS B CG    1 
ATOM   3185 C  CD    . LYS B 1 202 ? 47.145 16.768  11.615 1.00 80.54 ? 2264 LYS B CD    1 
ATOM   3186 C  CE    . LYS B 1 202 ? 46.841 17.807  10.538 1.00 80.80 ? 2264 LYS B CE    1 
ATOM   3187 N  NZ    . LYS B 1 202 ? 45.465 18.373  10.670 1.00 80.70 ? 2264 LYS B NZ    1 
ATOM   3188 N  N     . GLN B 1 203 ? 51.121 14.250  14.601 1.00 79.31 ? 2265 GLN B N     1 
ATOM   3189 C  CA    . GLN B 1 203 ? 51.511 13.543  15.813 1.00 79.03 ? 2265 GLN B CA    1 
ATOM   3190 C  C     . GLN B 1 203 ? 50.540 13.835  16.951 1.00 78.82 ? 2265 GLN B C     1 
ATOM   3191 O  O     . GLN B 1 203 ? 50.664 14.845  17.649 1.00 78.87 ? 2265 GLN B O     1 
ATOM   3192 C  CB    . GLN B 1 203 ? 52.948 13.892  16.197 1.00 79.07 ? 2265 GLN B CB    1 
ATOM   3193 C  CG    . GLN B 1 203 ? 53.987 13.255  15.291 1.00 79.19 ? 2265 GLN B CG    1 
ATOM   3194 C  CD    . GLN B 1 203 ? 55.263 14.065  15.208 1.00 79.31 ? 2265 GLN B CD    1 
ATOM   3195 O  OE1   . GLN B 1 203 ? 55.243 15.239  14.835 1.00 79.30 ? 2265 GLN B OE1   1 
ATOM   3196 N  NE2   . GLN B 1 203 ? 56.385 13.437  15.544 1.00 79.28 ? 2265 GLN B NE2   1 
ATOM   3197 N  N     . GLN B 1 204 ? 49.565 12.944  17.117 1.00 78.50 ? 2266 GLN B N     1 
ATOM   3198 C  CA    . GLN B 1 204 ? 48.554 13.074  18.161 1.00 78.17 ? 2266 GLN B CA    1 
ATOM   3199 C  C     . GLN B 1 204 ? 49.206 12.989  19.532 1.00 78.03 ? 2266 GLN B C     1 
ATOM   3200 O  O     . GLN B 1 204 ? 50.071 12.140  19.765 1.00 78.03 ? 2266 GLN B O     1 
ATOM   3201 C  CB    . GLN B 1 204 ? 47.483 11.994  18.013 1.00 78.15 ? 2266 GLN B CB    1 
ATOM   3202 C  CG    . GLN B 1 204 ? 46.510 12.231  16.866 1.00 77.74 ? 2266 GLN B CG    1 
ATOM   3203 C  CD    . GLN B 1 204 ? 45.745 10.981  16.485 1.00 77.23 ? 2266 GLN B CD    1 
ATOM   3204 O  OE1   . GLN B 1 204 ? 44.530 10.906  16.662 1.00 77.22 ? 2266 GLN B OE1   1 
ATOM   3205 N  NE2   . GLN B 1 204 ? 46.455 9.986   15.966 1.00 76.93 ? 2266 GLN B NE2   1 
ATOM   3206 N  N     . LEU B 1 205 ? 48.790 13.877  20.430 1.00 77.79 ? 2267 LEU B N     1 
ATOM   3207 C  CA    . LEU B 1 205 ? 49.408 13.991  21.746 1.00 77.56 ? 2267 LEU B CA    1 
ATOM   3208 C  C     . LEU B 1 205 ? 49.076 12.825  22.667 1.00 77.31 ? 2267 LEU B C     1 
ATOM   3209 O  O     . LEU B 1 205 ? 47.909 12.580  22.980 1.00 77.29 ? 2267 LEU B O     1 
ATOM   3210 C  CB    . LEU B 1 205 ? 49.033 15.317  22.418 1.00 77.61 ? 2267 LEU B CB    1 
ATOM   3211 C  CG    . LEU B 1 205 ? 49.549 16.633  21.825 1.00 77.77 ? 2267 LEU B CG    1 
ATOM   3212 C  CD1   . LEU B 1 205 ? 49.171 17.768  22.755 1.00 77.75 ? 2267 LEU B CD1   1 
ATOM   3213 C  CD2   . LEU B 1 205 ? 51.059 16.621  21.585 1.00 77.60 ? 2267 LEU B CD2   1 
ATOM   3214 N  N     . CYS B 1 206 ? 50.118 12.115  23.096 1.00 77.01 ? 2268 CYS B N     1 
ATOM   3215 C  CA    . CYS B 1 206 ? 49.975 10.984  24.007 1.00 76.70 ? 2268 CYS B CA    1 
ATOM   3216 C  C     . CYS B 1 206 ? 49.581 11.426  25.412 1.00 76.58 ? 2268 CYS B C     1 
ATOM   3217 O  O     . CYS B 1 206 ? 50.077 12.433  25.924 1.00 76.49 ? 2268 CYS B O     1 
ATOM   3218 C  CB    . CYS B 1 206 ? 51.262 10.163  24.060 1.00 76.70 ? 2268 CYS B CB    1 
ATOM   3219 S  SG    . CYS B 1 206 ? 51.171 8.760   25.183 1.00 76.26 ? 2268 CYS B SG    1 
ATOM   3220 N  N     . LYS B 1 207 ? 48.688 10.655  26.025 1.00 76.42 ? 2269 LYS B N     1 
ATOM   3221 C  CA    . LYS B 1 207 ? 48.134 10.984  27.331 1.00 76.25 ? 2269 LYS B CA    1 
ATOM   3222 C  C     . LYS B 1 207 ? 48.070 9.748   28.227 1.00 76.17 ? 2269 LYS B C     1 
ATOM   3223 O  O     . LYS B 1 207 ? 46.996 9.365   28.702 1.00 76.14 ? 2269 LYS B O     1 
ATOM   3224 C  CB    . LYS B 1 207 ? 46.747 11.618  27.174 1.00 76.19 ? 2269 LYS B CB    1 
ATOM   3225 C  CG    . LYS B 1 207 ? 46.753 12.965  26.463 1.00 76.48 ? 2269 LYS B CG    1 
ATOM   3226 C  CD    . LYS B 1 207 ? 45.354 13.531  26.322 1.00 76.93 ? 2269 LYS B CD    1 
ATOM   3227 C  CE    . LYS B 1 207 ? 45.380 14.919  25.704 1.00 77.39 ? 2269 LYS B CE    1 
ATOM   3228 N  NZ    . LYS B 1 207 ? 44.007 15.437  25.439 1.00 77.74 ? 2269 LYS B NZ    1 
ATOM   3229 N  N     . CYS B 1 208 ? 49.229 9.129   28.449 1.00 76.06 ? 2270 CYS B N     1 
ATOM   3230 C  CA    . CYS B 1 208 ? 49.338 7.964   29.327 1.00 76.00 ? 2270 CYS B CA    1 
ATOM   3231 C  C     . CYS B 1 208 ? 48.851 8.277   30.731 1.00 76.00 ? 2270 CYS B C     1 
ATOM   3232 O  O     . CYS B 1 208 ? 47.853 7.724   31.190 1.00 76.06 ? 2270 CYS B O     1 
ATOM   3233 C  CB    . CYS B 1 208 ? 50.792 7.506   29.437 1.00 76.03 ? 2270 CYS B CB    1 
ATOM   3234 S  SG    . CYS B 1 208 ? 51.547 6.916   27.940 1.00 75.88 ? 2270 CYS B SG    1 
ATOM   3235 N  N     . GLY B 1 209 ? 49.559 9.192   31.389 1.00 76.03 ? 2271 GLY B N     1 
ATOM   3236 C  CA    . GLY B 1 209 ? 49.483 9.373   32.835 1.00 76.06 ? 2271 GLY B CA    1 
ATOM   3237 C  C     . GLY B 1 209 ? 50.802 8.920   33.434 1.00 76.06 ? 2271 GLY B C     1 
ATOM   3238 O  O     . GLY B 1 209 ? 50.992 8.949   34.651 1.00 76.02 ? 2271 GLY B O     1 
ATOM   3239 N  N     . PHE B 1 210 ? 51.711 8.503   32.552 1.00 76.13 ? 2272 PHE B N     1 
ATOM   3240 C  CA    . PHE B 1 210 ? 53.034 8.008   32.917 1.00 76.19 ? 2272 PHE B CA    1 
ATOM   3241 C  C     . PHE B 1 210 ? 54.011 9.164   33.060 1.00 76.43 ? 2272 PHE B C     1 
ATOM   3242 O  O     . PHE B 1 210 ? 54.009 10.094  32.253 1.00 76.37 ? 2272 PHE B O     1 
ATOM   3243 C  CB    . PHE B 1 210 ? 53.529 7.024   31.856 1.00 76.06 ? 2272 PHE B CB    1 
ATOM   3244 C  CG    . PHE B 1 210 ? 54.675 6.163   32.302 1.00 75.57 ? 2272 PHE B CG    1 
ATOM   3245 C  CD1   . PHE B 1 210 ? 54.577 5.384   33.454 1.00 75.26 ? 2272 PHE B CD1   1 
ATOM   3246 C  CD2   . PHE B 1 210 ? 55.842 6.104   31.551 1.00 75.13 ? 2272 PHE B CD2   1 
ATOM   3247 C  CE1   . PHE B 1 210 ? 55.635 4.578   33.862 1.00 75.03 ? 2272 PHE B CE1   1 
ATOM   3248 C  CE2   . PHE B 1 210 ? 56.907 5.298   31.949 1.00 75.21 ? 2272 PHE B CE2   1 
ATOM   3249 C  CZ    . PHE B 1 210 ? 56.803 4.533   33.107 1.00 75.04 ? 2272 PHE B CZ    1 
ATOM   3250 N  N     . GLU B 1 211 ? 54.851 9.086   34.087 1.00 76.85 ? 2273 GLU B N     1 
ATOM   3251 C  CA    . GLU B 1 211 ? 55.734 10.189  34.477 1.00 77.31 ? 2273 GLU B CA    1 
ATOM   3252 C  C     . GLU B 1 211 ? 56.924 10.422  33.534 1.00 77.50 ? 2273 GLU B C     1 
ATOM   3253 O  O     . GLU B 1 211 ? 57.536 11.492  33.566 1.00 77.55 ? 2273 GLU B O     1 
ATOM   3254 C  CB    . GLU B 1 211 ? 56.202 9.999   35.927 1.00 77.37 ? 2273 GLU B CB    1 
ATOM   3255 C  CG    . GLU B 1 211 ? 55.135 10.366  36.965 1.00 77.62 ? 2273 GLU B CG    1 
ATOM   3256 C  CD    . GLU B 1 211 ? 55.001 9.339   38.083 1.00 78.02 ? 2273 GLU B CD    1 
ATOM   3257 O  OE1   . GLU B 1 211 ? 54.881 8.127   37.779 1.00 78.12 ? 2273 GLU B OE1   1 
ATOM   3258 O  OE2   . GLU B 1 211 ? 54.994 9.746   39.269 1.00 78.27 ? 2273 GLU B OE2   1 
ATOM   3259 N  N     . LYS B 1 212 ? 57.238 9.427   32.703 1.00 77.77 ? 2274 LYS B N     1 
ATOM   3260 C  CA    . LYS B 1 212 ? 58.295 9.547   31.687 1.00 78.03 ? 2274 LYS B CA    1 
ATOM   3261 C  C     . LYS B 1 212 ? 57.763 9.376   30.253 1.00 78.09 ? 2274 LYS B C     1 
ATOM   3262 O  O     . LYS B 1 212 ? 58.510 9.007   29.338 1.00 78.02 ? 2274 LYS B O     1 
ATOM   3263 C  CB    . LYS B 1 212 ? 59.445 8.570   31.973 1.00 78.10 ? 2274 LYS B CB    1 
ATOM   3264 C  CG    . LYS B 1 212 ? 60.408 9.050   33.055 1.00 78.61 ? 2274 LYS B CG    1 
ATOM   3265 C  CD    . LYS B 1 212 ? 61.555 8.067   33.291 1.00 79.13 ? 2274 LYS B CD    1 
ATOM   3266 C  CE    . LYS B 1 212 ? 62.480 8.567   34.401 1.00 79.32 ? 2274 LYS B CE    1 
ATOM   3267 N  NZ    . LYS B 1 212 ? 63.687 7.711   34.586 1.00 79.22 ? 2274 LYS B NZ    1 
ATOM   3268 N  N     . CYS B 1 213 ? 56.470 9.655   30.076 1.00 78.20 ? 2275 CYS B N     1 
ATOM   3269 C  CA    . CYS B 1 213 ? 55.793 9.607   28.775 1.00 78.24 ? 2275 CYS B CA    1 
ATOM   3270 C  C     . CYS B 1 213 ? 56.372 10.628  27.795 1.00 78.36 ? 2275 CYS B C     1 
ATOM   3271 O  O     . CYS B 1 213 ? 56.808 11.708  28.200 1.00 78.46 ? 2275 CYS B O     1 
ATOM   3272 C  CB    . CYS B 1 213 ? 54.292 9.855   28.966 1.00 78.22 ? 2275 CYS B CB    1 
ATOM   3273 S  SG    . CYS B 1 213 ? 53.388 10.384  27.490 1.00 78.12 ? 2275 CYS B SG    1 
ATOM   3274 N  N     . ARG B 1 214 ? 56.371 10.283  26.509 1.00 78.36 ? 2276 ARG B N     1 
ATOM   3275 C  CA    . ARG B 1 214 ? 56.897 11.175  25.475 1.00 78.46 ? 2276 ARG B CA    1 
ATOM   3276 C  C     . ARG B 1 214 ? 55.957 12.339  25.189 1.00 78.36 ? 2276 ARG B C     1 
ATOM   3277 O  O     . ARG B 1 214 ? 56.405 13.467  24.979 1.00 78.38 ? 2276 ARG B O     1 
ATOM   3278 C  CB    . ARG B 1 214 ? 57.170 10.409  24.184 1.00 78.54 ? 2276 ARG B CB    1 
ATOM   3279 C  CG    . ARG B 1 214 ? 58.420 9.556   24.221 1.00 79.16 ? 2276 ARG B CG    1 
ATOM   3280 C  CD    . ARG B 1 214 ? 58.306 8.410   23.237 1.00 80.17 ? 2276 ARG B CD    1 
ATOM   3281 N  NE    . ARG B 1 214 ? 57.199 7.518   23.584 1.00 81.22 ? 2276 ARG B NE    1 
ATOM   3282 C  CZ    . ARG B 1 214 ? 56.901 6.393   22.941 1.00 81.69 ? 2276 ARG B CZ    1 
ATOM   3283 N  NH1   . ARG B 1 214 ? 57.634 5.999   21.910 1.00 81.83 ? 2276 ARG B NH1   1 
ATOM   3284 N  NH2   . ARG B 1 214 ? 55.874 5.653   23.338 1.00 81.94 ? 2276 ARG B NH2   1 
ATOM   3285 N  N     . GLY B 1 215 ? 54.657 12.056  25.182 1.00 78.29 ? 2277 GLY B N     1 
ATOM   3286 C  CA    . GLY B 1 215 ? 53.645 13.056  24.851 1.00 78.13 ? 2277 GLY B CA    1 
ATOM   3287 C  C     . GLY B 1 215 ? 53.245 13.025  23.387 1.00 77.99 ? 2277 GLY B C     1 
ATOM   3288 O  O     . GLY B 1 215 ? 52.296 13.695  22.988 1.00 77.88 ? 2277 GLY B O     1 
ATOM   3289 N  N     . ILE B 1 216 ? 53.974 12.248  22.588 1.00 77.91 ? 2278 ILE B N     1 
ATOM   3290 C  CA    . ILE B 1 216 ? 53.692 12.103  21.159 1.00 77.87 ? 2278 ILE B CA    1 
ATOM   3291 C  C     . ILE B 1 216 ? 53.692 10.637  20.724 1.00 77.87 ? 2278 ILE B C     1 
ATOM   3292 O  O     . ILE B 1 216 ? 54.384 9.800   21.313 1.00 77.82 ? 2278 ILE B O     1 
ATOM   3293 C  CB    . ILE B 1 216 ? 54.673 12.921  20.268 1.00 77.83 ? 2278 ILE B CB    1 
ATOM   3294 C  CG1   . ILE B 1 216 ? 56.132 12.680  20.686 1.00 78.06 ? 2278 ILE B CG1   1 
ATOM   3295 C  CG2   . ILE B 1 216 ? 54.317 14.405  20.301 1.00 77.71 ? 2278 ILE B CG2   1 
ATOM   3296 C  CD1   . ILE B 1 216 ? 57.173 13.152  19.671 1.00 78.12 ? 2278 ILE B CD1   1 
ATOM   3297 N  N     . ILE B 1 217 ? 52.907 10.343  19.690 1.00 77.86 ? 2279 ILE B N     1 
ATOM   3298 C  CA    . ILE B 1 217 ? 52.788 8.993   19.153 1.00 77.82 ? 2279 ILE B CA    1 
ATOM   3299 C  C     . ILE B 1 217 ? 53.322 8.943   17.722 1.00 77.90 ? 2279 ILE B C     1 
ATOM   3300 O  O     . ILE B 1 217 ? 54.480 8.588   17.490 1.00 77.98 ? 2279 ILE B O     1 
ATOM   3301 C  CB    . ILE B 1 217 ? 51.323 8.497   19.180 1.00 77.80 ? 2279 ILE B CB    1 
ATOM   3302 C  CG1   . ILE B 1 217 ? 50.697 8.729   20.562 1.00 77.64 ? 2279 ILE B CG1   1 
ATOM   3303 C  CG2   . ILE B 1 217 ? 51.253 7.021   18.789 1.00 77.74 ? 2279 ILE B CG2   1 
ATOM   3304 C  CD1   . ILE B 1 217 ? 49.176 8.707   20.579 1.00 77.39 ? 2279 ILE B CD1   1 
HETATM 3305 ZN ZN    . ZN  C 2 .   ? 23.109 -8.329  35.490 0.87 37.28 ? 2301 ZN  A ZN    1 
HETATM 3306 ZN ZN    . ZN  D 2 .   ? 29.496 -22.453 1.709  0.71 37.23 ? 2302 ZN  A ZN    1 
HETATM 3307 ZN ZN    . ZN  E 2 .   ? 33.099 -22.176 2.266  0.60 31.61 ? 2303 ZN  A ZN    1 
HETATM 3308 N  N     . SAM F 3 .   ? 11.072 -11.128 29.993 1.00 50.90 ? 2304 SAM A N     1 
HETATM 3309 C  CA    . SAM F 3 .   ? 10.405 -10.402 28.874 1.00 51.11 ? 2304 SAM A CA    1 
HETATM 3310 C  C     . SAM F 3 .   ? 8.914  -10.726 28.815 1.00 51.09 ? 2304 SAM A C     1 
HETATM 3311 O  O     . SAM F 3 .   ? 8.235  -10.440 27.824 1.00 51.14 ? 2304 SAM A O     1 
HETATM 3312 O  OXT   . SAM F 3 .   ? 8.353  -11.283 29.758 1.00 51.08 ? 2304 SAM A OXT   1 
HETATM 3313 C  CB    . SAM F 3 .   ? 11.077 -10.725 27.541 1.00 51.12 ? 2304 SAM A CB    1 
HETATM 3314 C  CG    . SAM F 3 .   ? 12.334 -9.917  27.237 1.00 51.28 ? 2304 SAM A CG    1 
HETATM 3315 S  SD    . SAM F 3 .   ? 11.970 -8.245  26.650 1.00 51.63 ? 2304 SAM A SD    1 
HETATM 3316 C  CE    . SAM F 3 .   ? 12.968 -8.194  25.142 1.00 51.58 ? 2304 SAM A CE    1 
HETATM 3317 C  "C5'" . SAM F 3 .   ? 12.983 -7.209  27.730 1.00 52.08 ? 2304 SAM A "C5'" 1 
HETATM 3318 C  "C4'" . SAM F 3 .   ? 12.309 -6.962  29.070 1.00 52.81 ? 2304 SAM A "C4'" 1 
HETATM 3319 O  "O4'" . SAM F 3 .   ? 12.392 -8.115  29.896 1.00 52.90 ? 2304 SAM A "O4'" 1 
HETATM 3320 C  "C3'" . SAM F 3 .   ? 12.966 -5.834  29.849 1.00 52.97 ? 2304 SAM A "C3'" 1 
HETATM 3321 O  "O3'" . SAM F 3 .   ? 12.342 -4.599  29.608 1.00 53.46 ? 2304 SAM A "O3'" 1 
HETATM 3322 C  "C2'" . SAM F 3 .   ? 12.780 -6.264  31.284 1.00 52.99 ? 2304 SAM A "C2'" 1 
HETATM 3323 O  "O2'" . SAM F 3 .   ? 11.534 -5.819  31.763 1.00 53.66 ? 2304 SAM A "O2'" 1 
HETATM 3324 C  "C1'" . SAM F 3 .   ? 12.780 -7.785  31.217 1.00 52.75 ? 2304 SAM A "C1'" 1 
HETATM 3325 N  N9    . SAM F 3 .   ? 14.158 -8.242  31.489 1.00 52.30 ? 2304 SAM A N9    1 
HETATM 3326 C  C8    . SAM F 3 .   ? 15.024 -8.802  30.583 1.00 51.95 ? 2304 SAM A C8    1 
HETATM 3327 N  N7    . SAM F 3 .   ? 16.187 -9.078  31.208 1.00 51.75 ? 2304 SAM A N7    1 
HETATM 3328 C  C5    . SAM F 3 .   ? 16.084 -8.697  32.498 1.00 51.53 ? 2304 SAM A C5    1 
HETATM 3329 C  C6    . SAM F 3 .   ? 16.976 -8.753  33.558 1.00 51.37 ? 2304 SAM A C6    1 
HETATM 3330 N  N6    . SAM F 3 .   ? 18.193 -9.256  33.375 1.00 51.45 ? 2304 SAM A N6    1 
HETATM 3331 N  N1    . SAM F 3 .   ? 16.587 -8.281  34.797 1.00 51.25 ? 2304 SAM A N1    1 
HETATM 3332 C  C2    . SAM F 3 .   ? 15.323 -7.756  34.978 1.00 51.29 ? 2304 SAM A C2    1 
HETATM 3333 N  N3    . SAM F 3 .   ? 14.441 -7.704  33.915 1.00 51.23 ? 2304 SAM A N3    1 
HETATM 3334 C  C4    . SAM F 3 .   ? 14.814 -8.169  32.694 1.00 51.68 ? 2304 SAM A C4    1 
HETATM 3335 ZN ZN    . ZN  G 2 .   ? 52.525 8.369   26.811 0.64 38.86 ? 2301 ZN  B ZN    1 
HETATM 3336 ZN ZN    . ZN  H 2 .   ? 54.111 -28.567 21.409 0.51 77.88 ? 2302 ZN  B ZN    1 
HETATM 3337 ZN ZN    . ZN  I 2 .   ? 56.354 -28.168 22.080 0.50 57.23 ? 2303 ZN  B ZN    1 
HETATM 3338 N  N     . SAM J 3 .   ? 40.837 5.135   21.102 1.00 56.61 ? 2304 SAM B N     1 
HETATM 3339 C  CA    . SAM J 3 .   ? 40.548 4.726   19.694 1.00 56.62 ? 2304 SAM B CA    1 
HETATM 3340 C  C     . SAM J 3 .   ? 39.075 4.933   19.349 1.00 56.59 ? 2304 SAM B C     1 
HETATM 3341 O  O     . SAM J 3 .   ? 38.550 4.330   18.410 1.00 56.56 ? 2304 SAM B O     1 
HETATM 3342 O  OXT   . SAM J 3 .   ? 38.378 5.712   20.001 1.00 56.47 ? 2304 SAM B OXT   1 
HETATM 3343 C  CB    . SAM J 3 .   ? 40.982 3.286   19.438 1.00 56.52 ? 2304 SAM B CB    1 
HETATM 3344 C  CG    . SAM J 3 .   ? 42.481 3.102   19.240 1.00 56.66 ? 2304 SAM B CG    1 
HETATM 3345 S  SD    . SAM J 3 .   ? 43.014 3.545   17.569 1.00 56.76 ? 2304 SAM B SD    1 
HETATM 3346 C  CE    . SAM J 3 .   ? 44.033 2.122   17.113 1.00 56.90 ? 2304 SAM B CE    1 
HETATM 3347 C  "C5'" . SAM J 3 .   ? 44.276 4.806   17.878 1.00 57.57 ? 2304 SAM B "C5'" 1 
HETATM 3348 C  "C4'" . SAM J 3 .   ? 43.664 6.185   18.100 1.00 58.20 ? 2304 SAM B "C4'" 1 
HETATM 3349 O  "O4'" . SAM J 3 .   ? 43.194 6.303   19.433 1.00 58.36 ? 2304 SAM B "O4'" 1 
HETATM 3350 C  "C3'" . SAM J 3 .   ? 44.661 7.310   17.874 1.00 58.36 ? 2304 SAM B "C3'" 1 
HETATM 3351 O  "O3'" . SAM J 3 .   ? 44.482 7.898   16.607 1.00 58.49 ? 2304 SAM B "O3'" 1 
HETATM 3352 C  "C2'" . SAM J 3 .   ? 44.370 8.297   18.986 1.00 58.57 ? 2304 SAM B "C2'" 1 
HETATM 3353 O  "O2'" . SAM J 3 .   ? 43.487 9.302   18.549 1.00 58.89 ? 2304 SAM B "O2'" 1 
HETATM 3354 C  "C1'" . SAM J 3 .   ? 43.690 7.468   20.066 1.00 58.55 ? 2304 SAM B "C1'" 1 
HETATM 3355 N  N9    . SAM J 3 .   ? 44.686 7.111   21.100 1.00 58.35 ? 2304 SAM B N9    1 
HETATM 3356 C  C8    . SAM J 3 .   ? 45.155 5.851   21.372 1.00 58.29 ? 2304 SAM B C8    1 
HETATM 3357 N  N7    . SAM J 3 .   ? 46.055 5.930   22.374 1.00 58.25 ? 2304 SAM B N7    1 
HETATM 3358 C  C5    . SAM J 3 .   ? 46.180 7.220   22.748 1.00 58.13 ? 2304 SAM B C5    1 
HETATM 3359 C  C6    . SAM J 3 .   ? 46.961 7.844   23.717 1.00 57.92 ? 2304 SAM B C6    1 
HETATM 3360 N  N6    . SAM J 3 .   ? 47.780 7.129   24.481 1.00 57.63 ? 2304 SAM B N6    1 
HETATM 3361 N  N1    . SAM J 3 .   ? 46.878 9.213   23.881 1.00 57.96 ? 2304 SAM B N1    1 
HETATM 3362 C  C2    . SAM J 3 .   ? 46.022 9.956   23.084 1.00 58.01 ? 2304 SAM B C2    1 
HETATM 3363 N  N3    . SAM J 3 .   ? 45.251 9.327   22.123 1.00 58.03 ? 2304 SAM B N3    1 
HETATM 3364 C  C4    . SAM J 3 .   ? 45.325 7.979   21.955 1.00 58.10 ? 2304 SAM B C4    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2063 ?    ?   ?   A . n 
A 1 2   ALA 2   2064 ?    ?   ?   A . n 
A 1 3   MET 3   2065 ?    ?   ?   A . n 
A 1 4   ALA 4   2066 ?    ?   ?   A . n 
A 1 5   GLY 5   2067 ?    ?   ?   A . n 
A 1 6   SER 6   2068 2068 SER SER A . n 
A 1 7   TYR 7   2069 2069 TYR TYR A . n 
A 1 8   LYS 8   2070 2070 LYS LYS A . n 
A 1 9   LYS 9   2071 2071 LYS LYS A . n 
A 1 10  ILE 10  2072 2072 ILE ILE A . n 
A 1 11  ARG 11  2073 2073 ARG ARG A . n 
A 1 12  SER 12  2074 2074 SER SER A . n 
A 1 13  ASN 13  2075 2075 ASN ASN A . n 
A 1 14  VAL 14  2076 2076 VAL VAL A . n 
A 1 15  TYR 15  2077 2077 TYR TYR A . n 
A 1 16  VAL 16  2078 2078 VAL VAL A . n 
A 1 17  ASP 17  2079 2079 ASP ASP A . n 
A 1 18  VAL 18  2080 2080 VAL VAL A . n 
A 1 19  LYS 19  2081 2081 LYS LYS A . n 
A 1 20  PRO 20  2082 2082 PRO PRO A . n 
A 1 21  LEU 21  2083 2083 LEU LEU A . n 
A 1 22  SER 22  2084 2084 SER SER A . n 
A 1 23  GLY 23  2085 2085 GLY GLY A . n 
A 1 24  TYR 24  2086 2086 TYR TYR A . n 
A 1 25  GLU 25  2087 2087 GLU GLU A . n 
A 1 26  ALA 26  2088 2088 ALA ALA A . n 
A 1 27  THR 27  2089 2089 THR THR A . n 
A 1 28  THR 28  2090 2090 THR THR A . n 
A 1 29  CYS 29  2091 2091 CYS CYS A . n 
A 1 30  ASN 30  2092 2092 ASN ASN A . n 
A 1 31  CYS 31  2093 2093 CYS CYS A . n 
A 1 32  LYS 32  2094 2094 LYS LYS A . n 
A 1 33  LYS 33  2095 2095 LYS LYS A . n 
A 1 34  PRO 34  2096 2096 PRO PRO A . n 
A 1 35  ASP 35  2097 2097 ASP ASP A . n 
A 1 36  ASP 36  2098 2098 ASP ASP A . n 
A 1 37  ASP 37  2099 2099 ASP ASP A . n 
A 1 38  THR 38  2100 2100 THR THR A . n 
A 1 39  ARG 39  2101 2101 ARG ARG A . n 
A 1 40  LYS 40  2102 2102 LYS LYS A . n 
A 1 41  GLY 41  2103 2103 GLY GLY A . n 
A 1 42  CYS 42  2104 2104 CYS CYS A . n 
A 1 43  VAL 43  2105 2105 VAL VAL A . n 
A 1 44  ASP 44  2106 2106 ASP ASP A . n 
A 1 45  ASP 45  2107 2107 ASP ASP A . n 
A 1 46  CYS 46  2108 2108 CYS CYS A . n 
A 1 47  LEU 47  2109 2109 LEU LEU A . n 
A 1 48  ASN 48  2110 2110 ASN ASN A . n 
A 1 49  ARG 49  2111 2111 ARG ARG A . n 
A 1 50  MET 50  2112 2112 MET MET A . n 
A 1 51  ILE 51  2113 2113 ILE ILE A . n 
A 1 52  PHE 52  2114 2114 PHE PHE A . n 
A 1 53  ALA 53  2115 2115 ALA ALA A . n 
A 1 54  GLU 54  2116 2116 GLU GLU A . n 
A 1 55  CYS 55  2117 2117 CYS CYS A . n 
A 1 56  SER 56  2118 2118 SER SER A . n 
A 1 57  PRO 57  2119 2119 PRO PRO A . n 
A 1 58  ASN 58  2120 2120 ASN ASN A . n 
A 1 59  THR 59  2121 2121 THR THR A . n 
A 1 60  CYS 60  2122 2122 CYS CYS A . n 
A 1 61  PRO 61  2123 2123 PRO PRO A . n 
A 1 62  CYS 62  2124 2124 CYS CYS A . n 
A 1 63  GLY 63  2125 2125 GLY GLY A . n 
A 1 64  GLU 64  2126 2126 GLU GLU A . n 
A 1 65  GLN 65  2127 2127 GLN GLN A . n 
A 1 66  CYS 66  2128 2128 CYS CYS A . n 
A 1 67  CYS 67  2129 2129 CYS CYS A . n 
A 1 68  ASN 68  2130 2130 ASN ASN A . n 
A 1 69  GLN 69  2131 2131 GLN GLN A . n 
A 1 70  ARG 70  2132 2132 ARG ARG A . n 
A 1 71  ILE 71  2133 2133 ILE ILE A . n 
A 1 72  GLN 72  2134 2134 GLN GLN A . n 
A 1 73  ARG 73  2135 2135 ARG ARG A . n 
A 1 74  HIS 74  2136 2136 HIS HIS A . n 
A 1 75  GLU 75  2137 2137 GLU GLU A . n 
A 1 76  TRP 76  2138 2138 TRP TRP A . n 
A 1 77  VAL 77  2139 2139 VAL VAL A . n 
A 1 78  GLN 78  2140 2140 GLN GLN A . n 
A 1 79  CYS 79  2141 2141 CYS CYS A . n 
A 1 80  LEU 80  2142 2142 LEU LEU A . n 
A 1 81  GLU 81  2143 2143 GLU GLU A . n 
A 1 82  ARG 82  2144 2144 ARG ARG A . n 
A 1 83  PHE 83  2145 2145 PHE PHE A . n 
A 1 84  ARG 84  2146 2146 ARG ARG A . n 
A 1 85  ALA 85  2147 2147 ALA ALA A . n 
A 1 86  GLU 86  2148 2148 GLU GLU A . n 
A 1 87  GLU 87  2149 2149 GLU GLU A . n 
A 1 88  LYS 88  2150 2150 LYS LYS A . n 
A 1 89  GLY 89  2151 2151 GLY GLY A . n 
A 1 90  TRP 90  2152 2152 TRP TRP A . n 
A 1 91  GLY 91  2153 2153 GLY GLY A . n 
A 1 92  ILE 92  2154 2154 ILE ILE A . n 
A 1 93  ARG 93  2155 2155 ARG ARG A . n 
A 1 94  THR 94  2156 2156 THR THR A . n 
A 1 95  LYS 95  2157 2157 LYS LYS A . n 
A 1 96  GLU 96  2158 2158 GLU GLU A . n 
A 1 97  PRO 97  2159 2159 PRO PRO A . n 
A 1 98  LEU 98  2160 2160 LEU LEU A . n 
A 1 99  LYS 99  2161 2161 LYS LYS A . n 
A 1 100 ALA 100 2162 2162 ALA ALA A . n 
A 1 101 GLY 101 2163 2163 GLY GLY A . n 
A 1 102 GLN 102 2164 2164 GLN GLN A . n 
A 1 103 PHE 103 2165 2165 PHE PHE A . n 
A 1 104 ILE 104 2166 2166 ILE ILE A . n 
A 1 105 ILE 105 2167 2167 ILE ILE A . n 
A 1 106 GLU 106 2168 2168 GLU GLU A . n 
A 1 107 TYR 107 2169 2169 TYR TYR A . n 
A 1 108 LEU 108 2170 2170 LEU LEU A . n 
A 1 109 GLY 109 2171 2171 GLY GLY A . n 
A 1 110 GLU 110 2172 2172 GLU GLU A . n 
A 1 111 VAL 111 2173 2173 VAL VAL A . n 
A 1 112 VAL 112 2174 2174 VAL VAL A . n 
A 1 113 SER 113 2175 2175 SER SER A . n 
A 1 114 GLU 114 2176 2176 GLU GLU A . n 
A 1 115 GLN 115 2177 2177 GLN GLN A . n 
A 1 116 GLU 116 2178 2178 GLU GLU A . n 
A 1 117 PHE 117 2179 2179 PHE PHE A . n 
A 1 118 ARG 118 2180 2180 ARG ARG A . n 
A 1 119 ASN 119 2181 2181 ASN ASN A . n 
A 1 120 ARG 120 2182 2182 ARG ARG A . n 
A 1 121 MET 121 2183 2183 MET MET A . n 
A 1 122 ILE 122 2184 2184 ILE ILE A . n 
A 1 123 GLU 123 2185 2185 GLU GLU A . n 
A 1 124 GLN 124 2186 2186 GLN GLN A . n 
A 1 125 TYR 125 2187 2187 TYR TYR A . n 
A 1 126 HIS 126 2188 2188 HIS HIS A . n 
A 1 127 ASN 127 2189 2189 ASN ASN A . n 
A 1 128 HIS 128 2190 2190 HIS HIS A . n 
A 1 129 SER 129 2191 2191 SER SER A . n 
A 1 130 ASP 130 2192 2192 ASP ASP A . n 
A 1 131 HIS 131 2193 2193 HIS HIS A . n 
A 1 132 TYR 132 2194 2194 TYR TYR A . n 
A 1 133 CYS 133 2195 2195 CYS CYS A . n 
A 1 134 LEU 134 2196 2196 LEU LEU A . n 
A 1 135 ASN 135 2197 2197 ASN ASN A . n 
A 1 136 LEU 136 2198 2198 LEU LEU A . n 
A 1 137 ASP 137 2199 2199 ASP ASP A . n 
A 1 138 SER 138 2200 2200 SER SER A . n 
A 1 139 GLY 139 2201 2201 GLY GLY A . n 
A 1 140 MET 140 2202 2202 MET MET A . n 
A 1 141 VAL 141 2203 2203 VAL VAL A . n 
A 1 142 ILE 142 2204 2204 ILE ILE A . n 
A 1 143 ASP 143 2205 2205 ASP ASP A . n 
A 1 144 SER 144 2206 2206 SER SER A . n 
A 1 145 TYR 145 2207 2207 TYR TYR A . n 
A 1 146 ARG 146 2208 2208 ARG ARG A . n 
A 1 147 MET 147 2209 2209 MET MET A . n 
A 1 148 GLY 148 2210 2210 GLY GLY A . n 
A 1 149 ASN 149 2211 2211 ASN ASN A . n 
A 1 150 GLU 150 2212 2212 GLU GLU A . n 
A 1 151 ALA 151 2213 2213 ALA ALA A . n 
A 1 152 ARG 152 2214 2214 ARG ARG A . n 
A 1 153 PHE 153 2215 2215 PHE PHE A . n 
A 1 154 ILE 154 2216 2216 ILE ILE A . n 
A 1 155 ASN 155 2217 2217 ASN ASN A . n 
A 1 156 HIS 156 2218 2218 HIS HIS A . n 
A 1 157 SER 157 2219 2219 SER SER A . n 
A 1 158 CYS 158 2220 2220 CYS CYS A . n 
A 1 159 ASP 159 2221 2221 ASP ASP A . n 
A 1 160 PRO 160 2222 2222 PRO PRO A . n 
A 1 161 ASN 161 2223 2223 ASN ASN A . n 
A 1 162 CYS 162 2224 2224 CYS CYS A . n 
A 1 163 GLU 163 2225 2225 GLU GLU A . n 
A 1 164 MET 164 2226 2226 MET MET A . n 
A 1 165 GLN 165 2227 2227 GLN GLN A . n 
A 1 166 LYS 166 2228 2228 LYS LYS A . n 
A 1 167 TRP 167 2229 2229 TRP TRP A . n 
A 1 168 SER 168 2230 2230 SER SER A . n 
A 1 169 VAL 169 2231 2231 VAL VAL A . n 
A 1 170 ASN 170 2232 2232 ASN ASN A . n 
A 1 171 GLY 171 2233 2233 GLY GLY A . n 
A 1 172 VAL 172 2234 2234 VAL VAL A . n 
A 1 173 TYR 173 2235 2235 TYR TYR A . n 
A 1 174 ARG 174 2236 2236 ARG ARG A . n 
A 1 175 ILE 175 2237 2237 ILE ILE A . n 
A 1 176 GLY 176 2238 2238 GLY GLY A . n 
A 1 177 LEU 177 2239 2239 LEU LEU A . n 
A 1 178 TYR 178 2240 2240 TYR TYR A . n 
A 1 179 ALA 179 2241 2241 ALA ALA A . n 
A 1 180 LEU 180 2242 2242 LEU LEU A . n 
A 1 181 LYS 181 2243 2243 LYS LYS A . n 
A 1 182 ASP 182 2244 2244 ASP ASP A . n 
A 1 183 MET 183 2245 2245 MET MET A . n 
A 1 184 PRO 184 2246 2246 PRO PRO A . n 
A 1 185 ALA 185 2247 2247 ALA ALA A . n 
A 1 186 GLY 186 2248 2248 GLY GLY A . n 
A 1 187 THR 187 2249 2249 THR THR A . n 
A 1 188 GLU 188 2250 2250 GLU GLU A . n 
A 1 189 LEU 189 2251 2251 LEU LEU A . n 
A 1 190 THR 190 2252 2252 THR THR A . n 
A 1 191 TYR 191 2253 2253 TYR TYR A . n 
A 1 192 ASP 192 2254 2254 ASP ASP A . n 
A 1 193 TYR 193 2255 2255 TYR TYR A . n 
A 1 194 ASN 194 2256 2256 ASN ASN A . n 
A 1 195 PHE 195 2257 2257 PHE PHE A . n 
A 1 196 HIS 196 2258 2258 HIS HIS A . n 
A 1 197 MET 197 2259 2259 MET MET A . n 
A 1 198 PHE 198 2260 2260 PHE PHE A . n 
A 1 199 ASN 199 2261 2261 ASN ASN A . n 
A 1 200 VAL 200 2262 2262 VAL VAL A . n 
A 1 201 GLU 201 2263 2263 GLU GLU A . n 
A 1 202 LYS 202 2264 2264 LYS LYS A . n 
A 1 203 GLN 203 2265 2265 GLN GLN A . n 
A 1 204 GLN 204 2266 2266 GLN GLN A . n 
A 1 205 LEU 205 2267 2267 LEU LEU A . n 
A 1 206 CYS 206 2268 2268 CYS CYS A . n 
A 1 207 LYS 207 2269 2269 LYS LYS A . n 
A 1 208 CYS 208 2270 2270 CYS CYS A . n 
A 1 209 GLY 209 2271 2271 GLY GLY A . n 
A 1 210 PHE 210 2272 2272 PHE PHE A . n 
A 1 211 GLU 211 2273 2273 GLU GLU A . n 
A 1 212 LYS 212 2274 2274 LYS LYS A . n 
A 1 213 CYS 213 2275 2275 CYS CYS A . n 
A 1 214 ARG 214 2276 2276 ARG ARG A . n 
A 1 215 GLY 215 2277 2277 GLY GLY A . n 
A 1 216 ILE 216 2278 2278 ILE ILE A . n 
A 1 217 ILE 217 2279 2279 ILE ILE A . n 
A 1 218 GLY 218 2280 2280 GLY GLY A . n 
A 1 219 GLY 219 2281 ?    ?   ?   A . n 
A 1 220 LYS 220 2282 ?    ?   ?   A . n 
A 1 221 SER 221 2283 ?    ?   ?   A . n 
A 1 222 GLN 222 2284 ?    ?   ?   A . n 
A 1 223 ARG 223 2285 ?    ?   ?   A . n 
A 1 224 VAL 224 2286 ?    ?   ?   A . n 
A 1 225 ASN 225 2287 ?    ?   ?   A . n 
A 1 226 GLY 226 2288 ?    ?   ?   A . n 
B 1 1   GLY 1   2063 ?    ?   ?   B . n 
B 1 2   ALA 2   2064 ?    ?   ?   B . n 
B 1 3   MET 3   2065 ?    ?   ?   B . n 
B 1 4   ALA 4   2066 ?    ?   ?   B . n 
B 1 5   GLY 5   2067 ?    ?   ?   B . n 
B 1 6   SER 6   2068 2068 SER SER B . n 
B 1 7   TYR 7   2069 2069 TYR TYR B . n 
B 1 8   LYS 8   2070 2070 LYS LYS B . n 
B 1 9   LYS 9   2071 2071 LYS LYS B . n 
B 1 10  ILE 10  2072 2072 ILE ILE B . n 
B 1 11  ARG 11  2073 2073 ARG ARG B . n 
B 1 12  SER 12  2074 2074 SER SER B . n 
B 1 13  ASN 13  2075 2075 ASN ASN B . n 
B 1 14  VAL 14  2076 2076 VAL VAL B . n 
B 1 15  TYR 15  2077 2077 TYR TYR B . n 
B 1 16  VAL 16  2078 2078 VAL VAL B . n 
B 1 17  ASP 17  2079 2079 ASP ASP B . n 
B 1 18  VAL 18  2080 2080 VAL VAL B . n 
B 1 19  LYS 19  2081 2081 LYS LYS B . n 
B 1 20  PRO 20  2082 2082 PRO PRO B . n 
B 1 21  LEU 21  2083 2083 LEU LEU B . n 
B 1 22  SER 22  2084 2084 SER SER B . n 
B 1 23  GLY 23  2085 ?    ?   ?   B . n 
B 1 24  TYR 24  2086 ?    ?   ?   B . n 
B 1 25  GLU 25  2087 ?    ?   ?   B . n 
B 1 26  ALA 26  2088 ?    ?   ?   B . n 
B 1 27  THR 27  2089 ?    ?   ?   B . n 
B 1 28  THR 28  2090 ?    ?   ?   B . n 
B 1 29  CYS 29  2091 ?    ?   ?   B . n 
B 1 30  ASN 30  2092 ?    ?   ?   B . n 
B 1 31  CYS 31  2093 ?    ?   ?   B . n 
B 1 32  LYS 32  2094 ?    ?   ?   B . n 
B 1 33  LYS 33  2095 ?    ?   ?   B . n 
B 1 34  PRO 34  2096 ?    ?   ?   B . n 
B 1 35  ASP 35  2097 ?    ?   ?   B . n 
B 1 36  ASP 36  2098 ?    ?   ?   B . n 
B 1 37  ASP 37  2099 ?    ?   ?   B . n 
B 1 38  THR 38  2100 ?    ?   ?   B . n 
B 1 39  ARG 39  2101 ?    ?   ?   B . n 
B 1 40  LYS 40  2102 ?    ?   ?   B . n 
B 1 41  GLY 41  2103 ?    ?   ?   B . n 
B 1 42  CYS 42  2104 2104 CYS CYS B . n 
B 1 43  VAL 43  2105 2105 VAL VAL B . n 
B 1 44  ASP 44  2106 2106 ASP ASP B . n 
B 1 45  ASP 45  2107 2107 ASP ASP B . n 
B 1 46  CYS 46  2108 2108 CYS CYS B . n 
B 1 47  LEU 47  2109 2109 LEU LEU B . n 
B 1 48  ASN 48  2110 2110 ASN ASN B . n 
B 1 49  ARG 49  2111 2111 ARG ARG B . n 
B 1 50  MET 50  2112 2112 MET MET B . n 
B 1 51  ILE 51  2113 2113 ILE ILE B . n 
B 1 52  PHE 52  2114 2114 PHE PHE B . n 
B 1 53  ALA 53  2115 2115 ALA ALA B . n 
B 1 54  GLU 54  2116 2116 GLU GLU B . n 
B 1 55  CYS 55  2117 2117 CYS CYS B . n 
B 1 56  SER 56  2118 2118 SER SER B . n 
B 1 57  PRO 57  2119 2119 PRO PRO B . n 
B 1 58  ASN 58  2120 2120 ASN ASN B . n 
B 1 59  THR 59  2121 2121 THR THR B . n 
B 1 60  CYS 60  2122 2122 CYS CYS B . n 
B 1 61  PRO 61  2123 2123 PRO PRO B . n 
B 1 62  CYS 62  2124 2124 CYS CYS B . n 
B 1 63  GLY 63  2125 2125 GLY GLY B . n 
B 1 64  GLU 64  2126 2126 GLU GLU B . n 
B 1 65  GLN 65  2127 2127 GLN GLN B . n 
B 1 66  CYS 66  2128 2128 CYS CYS B . n 
B 1 67  CYS 67  2129 2129 CYS CYS B . n 
B 1 68  ASN 68  2130 2130 ASN ASN B . n 
B 1 69  GLN 69  2131 2131 GLN GLN B . n 
B 1 70  ARG 70  2132 2132 ARG ARG B . n 
B 1 71  ILE 71  2133 2133 ILE ILE B . n 
B 1 72  GLN 72  2134 2134 GLN GLN B . n 
B 1 73  ARG 73  2135 2135 ARG ARG B . n 
B 1 74  HIS 74  2136 2136 HIS HIS B . n 
B 1 75  GLU 75  2137 2137 GLU GLU B . n 
B 1 76  TRP 76  2138 2138 TRP TRP B . n 
B 1 77  VAL 77  2139 2139 VAL VAL B . n 
B 1 78  GLN 78  2140 2140 GLN GLN B . n 
B 1 79  CYS 79  2141 2141 CYS CYS B . n 
B 1 80  LEU 80  2142 2142 LEU LEU B . n 
B 1 81  GLU 81  2143 2143 GLU GLU B . n 
B 1 82  ARG 82  2144 2144 ARG ARG B . n 
B 1 83  PHE 83  2145 2145 PHE PHE B . n 
B 1 84  ARG 84  2146 2146 ARG ARG B . n 
B 1 85  ALA 85  2147 2147 ALA ALA B . n 
B 1 86  GLU 86  2148 2148 GLU GLU B . n 
B 1 87  GLU 87  2149 2149 GLU GLU B . n 
B 1 88  LYS 88  2150 2150 LYS LYS B . n 
B 1 89  GLY 89  2151 2151 GLY GLY B . n 
B 1 90  TRP 90  2152 2152 TRP TRP B . n 
B 1 91  GLY 91  2153 2153 GLY GLY B . n 
B 1 92  ILE 92  2154 2154 ILE ILE B . n 
B 1 93  ARG 93  2155 2155 ARG ARG B . n 
B 1 94  THR 94  2156 2156 THR THR B . n 
B 1 95  LYS 95  2157 2157 LYS LYS B . n 
B 1 96  GLU 96  2158 2158 GLU GLU B . n 
B 1 97  PRO 97  2159 2159 PRO PRO B . n 
B 1 98  LEU 98  2160 2160 LEU LEU B . n 
B 1 99  LYS 99  2161 2161 LYS LYS B . n 
B 1 100 ALA 100 2162 2162 ALA ALA B . n 
B 1 101 GLY 101 2163 2163 GLY GLY B . n 
B 1 102 GLN 102 2164 2164 GLN GLN B . n 
B 1 103 PHE 103 2165 2165 PHE PHE B . n 
B 1 104 ILE 104 2166 2166 ILE ILE B . n 
B 1 105 ILE 105 2167 2167 ILE ILE B . n 
B 1 106 GLU 106 2168 2168 GLU GLU B . n 
B 1 107 TYR 107 2169 2169 TYR TYR B . n 
B 1 108 LEU 108 2170 2170 LEU LEU B . n 
B 1 109 GLY 109 2171 2171 GLY GLY B . n 
B 1 110 GLU 110 2172 2172 GLU GLU B . n 
B 1 111 VAL 111 2173 2173 VAL VAL B . n 
B 1 112 VAL 112 2174 2174 VAL VAL B . n 
B 1 113 SER 113 2175 2175 SER SER B . n 
B 1 114 GLU 114 2176 2176 GLU GLU B . n 
B 1 115 GLN 115 2177 2177 GLN GLN B . n 
B 1 116 GLU 116 2178 2178 GLU GLU B . n 
B 1 117 PHE 117 2179 2179 PHE PHE B . n 
B 1 118 ARG 118 2180 2180 ARG ARG B . n 
B 1 119 ASN 119 2181 2181 ASN ASN B . n 
B 1 120 ARG 120 2182 2182 ARG ARG B . n 
B 1 121 MET 121 2183 2183 MET MET B . n 
B 1 122 ILE 122 2184 2184 ILE ILE B . n 
B 1 123 GLU 123 2185 2185 GLU GLU B . n 
B 1 124 GLN 124 2186 2186 GLN GLN B . n 
B 1 125 TYR 125 2187 2187 TYR TYR B . n 
B 1 126 HIS 126 2188 2188 HIS HIS B . n 
B 1 127 ASN 127 2189 2189 ASN ASN B . n 
B 1 128 HIS 128 2190 2190 HIS HIS B . n 
B 1 129 SER 129 2191 2191 SER SER B . n 
B 1 130 ASP 130 2192 2192 ASP ASP B . n 
B 1 131 HIS 131 2193 2193 HIS HIS B . n 
B 1 132 TYR 132 2194 2194 TYR TYR B . n 
B 1 133 CYS 133 2195 2195 CYS CYS B . n 
B 1 134 LEU 134 2196 2196 LEU LEU B . n 
B 1 135 ASN 135 2197 2197 ASN ASN B . n 
B 1 136 LEU 136 2198 2198 LEU LEU B . n 
B 1 137 ASP 137 2199 2199 ASP ASP B . n 
B 1 138 SER 138 2200 2200 SER SER B . n 
B 1 139 GLY 139 2201 2201 GLY GLY B . n 
B 1 140 MET 140 2202 2202 MET MET B . n 
B 1 141 VAL 141 2203 2203 VAL VAL B . n 
B 1 142 ILE 142 2204 2204 ILE ILE B . n 
B 1 143 ASP 143 2205 2205 ASP ASP B . n 
B 1 144 SER 144 2206 2206 SER SER B . n 
B 1 145 TYR 145 2207 2207 TYR TYR B . n 
B 1 146 ARG 146 2208 2208 ARG ARG B . n 
B 1 147 MET 147 2209 2209 MET MET B . n 
B 1 148 GLY 148 2210 2210 GLY GLY B . n 
B 1 149 ASN 149 2211 2211 ASN ASN B . n 
B 1 150 GLU 150 2212 2212 GLU GLU B . n 
B 1 151 ALA 151 2213 2213 ALA ALA B . n 
B 1 152 ARG 152 2214 2214 ARG ARG B . n 
B 1 153 PHE 153 2215 2215 PHE PHE B . n 
B 1 154 ILE 154 2216 2216 ILE ILE B . n 
B 1 155 ASN 155 2217 2217 ASN ASN B . n 
B 1 156 HIS 156 2218 2218 HIS HIS B . n 
B 1 157 SER 157 2219 2219 SER SER B . n 
B 1 158 CYS 158 2220 2220 CYS CYS B . n 
B 1 159 ASP 159 2221 2221 ASP ASP B . n 
B 1 160 PRO 160 2222 2222 PRO PRO B . n 
B 1 161 ASN 161 2223 2223 ASN ASN B . n 
B 1 162 CYS 162 2224 2224 CYS CYS B . n 
B 1 163 GLU 163 2225 2225 GLU GLU B . n 
B 1 164 MET 164 2226 2226 MET MET B . n 
B 1 165 GLN 165 2227 2227 GLN GLN B . n 
B 1 166 LYS 166 2228 2228 LYS LYS B . n 
B 1 167 TRP 167 2229 2229 TRP TRP B . n 
B 1 168 SER 168 2230 2230 SER SER B . n 
B 1 169 VAL 169 2231 2231 VAL VAL B . n 
B 1 170 ASN 170 2232 2232 ASN ASN B . n 
B 1 171 GLY 171 2233 2233 GLY GLY B . n 
B 1 172 VAL 172 2234 2234 VAL VAL B . n 
B 1 173 TYR 173 2235 2235 TYR TYR B . n 
B 1 174 ARG 174 2236 2236 ARG ARG B . n 
B 1 175 ILE 175 2237 2237 ILE ILE B . n 
B 1 176 GLY 176 2238 2238 GLY GLY B . n 
B 1 177 LEU 177 2239 2239 LEU LEU B . n 
B 1 178 TYR 178 2240 2240 TYR TYR B . n 
B 1 179 ALA 179 2241 2241 ALA ALA B . n 
B 1 180 LEU 180 2242 2242 LEU LEU B . n 
B 1 181 LYS 181 2243 2243 LYS LYS B . n 
B 1 182 ASP 182 2244 2244 ASP ASP B . n 
B 1 183 MET 183 2245 2245 MET MET B . n 
B 1 184 PRO 184 2246 2246 PRO PRO B . n 
B 1 185 ALA 185 2247 2247 ALA ALA B . n 
B 1 186 GLY 186 2248 2248 GLY GLY B . n 
B 1 187 THR 187 2249 2249 THR THR B . n 
B 1 188 GLU 188 2250 2250 GLU GLU B . n 
B 1 189 LEU 189 2251 2251 LEU LEU B . n 
B 1 190 THR 190 2252 2252 THR THR B . n 
B 1 191 TYR 191 2253 2253 TYR TYR B . n 
B 1 192 ASP 192 2254 2254 ASP ASP B . n 
B 1 193 TYR 193 2255 2255 TYR TYR B . n 
B 1 194 ASN 194 2256 2256 ASN ASN B . n 
B 1 195 PHE 195 2257 2257 PHE PHE B . n 
B 1 196 HIS 196 2258 2258 HIS HIS B . n 
B 1 197 MET 197 2259 2259 MET MET B . n 
B 1 198 PHE 198 2260 2260 PHE PHE B . n 
B 1 199 ASN 199 2261 2261 ASN ASN B . n 
B 1 200 VAL 200 2262 2262 VAL VAL B . n 
B 1 201 GLU 201 2263 2263 GLU GLU B . n 
B 1 202 LYS 202 2264 2264 LYS LYS B . n 
B 1 203 GLN 203 2265 2265 GLN GLN B . n 
B 1 204 GLN 204 2266 2266 GLN GLN B . n 
B 1 205 LEU 205 2267 2267 LEU LEU B . n 
B 1 206 CYS 206 2268 2268 CYS CYS B . n 
B 1 207 LYS 207 2269 2269 LYS LYS B . n 
B 1 208 CYS 208 2270 2270 CYS CYS B . n 
B 1 209 GLY 209 2271 2271 GLY GLY B . n 
B 1 210 PHE 210 2272 2272 PHE PHE B . n 
B 1 211 GLU 211 2273 2273 GLU GLU B . n 
B 1 212 LYS 212 2274 2274 LYS LYS B . n 
B 1 213 CYS 213 2275 2275 CYS CYS B . n 
B 1 214 ARG 214 2276 2276 ARG ARG B . n 
B 1 215 GLY 215 2277 2277 GLY GLY B . n 
B 1 216 ILE 216 2278 2278 ILE ILE B . n 
B 1 217 ILE 217 2279 2279 ILE ILE B . n 
B 1 218 GLY 218 2280 ?    ?   ?   B . n 
B 1 219 GLY 219 2281 ?    ?   ?   B . n 
B 1 220 LYS 220 2282 ?    ?   ?   B . n 
B 1 221 SER 221 2283 ?    ?   ?   B . n 
B 1 222 GLN 222 2284 ?    ?   ?   B . n 
B 1 223 ARG 223 2285 ?    ?   ?   B . n 
B 1 224 VAL 224 2286 ?    ?   ?   B . n 
B 1 225 ASN 225 2287 ?    ?   ?   B . n 
B 1 226 GLY 226 2288 ?    ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1 2301 1 ZN  ZN  A . 
D 2 ZN  1 2302 2 ZN  ZN  A . 
E 2 ZN  1 2303 4 ZN  ZN  A . 
F 3 SAM 1 2304 7 SAM SAM A . 
G 2 ZN  1 2301 3 ZN  ZN  B . 
H 2 ZN  1 2302 5 ZN  ZN  B . 
I 2 ZN  1 2303 6 ZN  ZN  B . 
J 3 SAM 1 2304 8 SAM SAM B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,F 
2 1 B,G,H,I,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 29  ? A CYS 2091 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 31  ? A CYS 2093 ? 1_555 121.4 ? 
2  SG ? A CYS 29  ? A CYS 2091 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 42  ? A CYS 2104 ? 1_555 96.1  ? 
3  SG ? A CYS 31  ? A CYS 2093 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 42  ? A CYS 2104 ? 1_555 98.4  ? 
4  SG ? A CYS 29  ? A CYS 2091 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 46  ? A CYS 2108 ? 1_555 112.7 ? 
5  SG ? A CYS 31  ? A CYS 2093 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 46  ? A CYS 2108 ? 1_555 114.2 ? 
6  SG ? A CYS 42  ? A CYS 2104 ? 1_555 ZN ? E ZN . ? A ZN 2303 ? 1_555 SG ? A CYS 46  ? A CYS 2108 ? 1_555 110.7 ? 
7  SG ? A CYS 42  ? A CYS 2104 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 55  ? A CYS 2117 ? 1_555 120.6 ? 
8  SG ? A CYS 42  ? A CYS 2104 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 60  ? A CYS 2122 ? 1_555 104.4 ? 
9  SG ? A CYS 55  ? A CYS 2117 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 60  ? A CYS 2122 ? 1_555 105.5 ? 
10 SG ? A CYS 42  ? A CYS 2104 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 66  ? A CYS 2128 ? 1_555 106.0 ? 
11 SG ? A CYS 55  ? A CYS 2117 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 66  ? A CYS 2128 ? 1_555 114.9 ? 
12 SG ? A CYS 60  ? A CYS 2122 ? 1_555 ZN ? D ZN . ? A ZN 2302 ? 1_555 SG ? A CYS 66  ? A CYS 2128 ? 1_555 103.6 ? 
13 SG ? A CYS 158 ? A CYS 2220 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 206 ? A CYS 2268 ? 1_555 118.9 ? 
14 SG ? A CYS 158 ? A CYS 2220 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 208 ? A CYS 2270 ? 1_555 115.9 ? 
15 SG ? A CYS 206 ? A CYS 2268 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 208 ? A CYS 2270 ? 1_555 106.4 ? 
16 SG ? A CYS 158 ? A CYS 2220 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 213 ? A CYS 2275 ? 1_555 103.0 ? 
17 SG ? A CYS 206 ? A CYS 2268 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 213 ? A CYS 2275 ? 1_555 99.9  ? 
18 SG ? A CYS 208 ? A CYS 2270 ? 1_555 ZN ? C ZN . ? A ZN 2301 ? 1_555 SG ? A CYS 213 ? A CYS 2275 ? 1_555 111.5 ? 
19 SG ? B CYS 42  ? B CYS 2104 ? 1_555 ZN ? I ZN . ? B ZN 2303 ? 1_555 SG ? B CYS 46  ? B CYS 2108 ? 1_555 109.4 ? 
20 SG ? B CYS 55  ? B CYS 2117 ? 1_555 ZN ? H ZN . ? B ZN 2302 ? 1_555 SG ? B CYS 60  ? B CYS 2122 ? 1_555 54.3  ? 
21 SG ? B CYS 158 ? B CYS 2220 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 206 ? B CYS 2268 ? 1_555 110.1 ? 
22 SG ? B CYS 158 ? B CYS 2220 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 208 ? B CYS 2270 ? 1_555 105.6 ? 
23 SG ? B CYS 206 ? B CYS 2268 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 208 ? B CYS 2270 ? 1_555 104.0 ? 
24 SG ? B CYS 158 ? B CYS 2220 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 213 ? B CYS 2275 ? 1_555 100.0 ? 
25 SG ? B CYS 206 ? B CYS 2268 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 213 ? B CYS 2275 ? 1_555 107.5 ? 
26 SG ? B CYS 208 ? B CYS 2270 ? 1_555 ZN ? G ZN . ? B ZN 2301 ? 1_555 SG ? B CYS 213 ? B CYS 2275 ? 1_555 128.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-02 
2 'Structure model' 1 1 2015-09-09 
3 'Structure model' 1 2 2015-09-16 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2017-10-04 
6 'Structure model' 1 5 2019-12-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 5 'Structure model' 'Author supporting evidence' 
7 6 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' pdbx_audit_support    
3 4 'Structure model' pdbx_struct_oper_list 
4 5 'Structure model' pdbx_audit_support    
5 6 'Structure model' pdbx_audit_support    
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_pdbx_audit_support.funding_organization'  
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4 5 'Structure model' '_pdbx_audit_support.funding_organization'  
5 6 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.5.0109 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .        2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15     3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? DENZO       ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   SG 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   CYS 
_pdbx_validate_close_contact.auth_seq_id_1    2104 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   ZN 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   ZN 
_pdbx_validate_close_contact.auth_seq_id_2    2302 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.65 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 VAL A 2078 ? ? -94.47  -87.23  
2  1 GLU A 2087 ? ? -138.38 -51.40  
3  1 VAL A 2105 ? ? -100.55 -144.30 
4  1 GLN A 2131 ? ? -141.76 25.61   
5  1 GLU A 2149 ? ? 74.06   -17.04  
6  1 GLN A 2186 ? ? -138.82 -30.90  
7  1 CYS A 2195 ? ? -177.30 148.92  
8  1 LEU A 2198 ? ? -102.14 -70.06  
9  1 ASN A 2211 ? ? -127.36 -160.39 
10 1 ASN A 2261 ? ? -50.76  105.50  
11 1 VAL B 2078 ? ? -80.37  -72.63  
12 1 VAL B 2105 ? ? -118.54 -141.92 
13 1 ASP B 2107 ? ? -110.03 72.45   
14 1 PRO B 2119 ? ? -56.44  -0.06   
15 1 THR B 2121 ? ? -142.25 -38.58  
16 1 GLU B 2126 ? ? 68.47   -42.74  
17 1 ASN B 2130 ? ? -107.55 52.21   
18 1 GLN B 2131 ? ? -143.82 30.85   
19 1 GLU B 2149 ? ? 67.44   -18.86  
20 1 ASP B 2199 ? ? -167.72 -134.97 
21 1 ASN B 2232 ? ? 35.77   57.67   
22 1 HIS B 2258 ? ? -132.17 -63.86  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 B GLN 2127 ? CG  ? B GLN 65 CG  
2 1 Y 1 B GLN 2127 ? CD  ? B GLN 65 CD  
3 1 Y 1 B GLN 2127 ? OE1 ? B GLN 65 OE1 
4 1 Y 1 B GLN 2127 ? NE2 ? B GLN 65 NE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2063 ? A GLY 1   
2  1 Y 1 A ALA 2064 ? A ALA 2   
3  1 Y 1 A MET 2065 ? A MET 3   
4  1 Y 1 A ALA 2066 ? A ALA 4   
5  1 Y 1 A GLY 2067 ? A GLY 5   
6  1 Y 1 A GLY 2281 ? A GLY 219 
7  1 Y 1 A LYS 2282 ? A LYS 220 
8  1 Y 1 A SER 2283 ? A SER 221 
9  1 Y 1 A GLN 2284 ? A GLN 222 
10 1 Y 1 A ARG 2285 ? A ARG 223 
11 1 Y 1 A VAL 2286 ? A VAL 224 
12 1 Y 1 A ASN 2287 ? A ASN 225 
13 1 Y 1 A GLY 2288 ? A GLY 226 
14 1 Y 1 B GLY 2063 ? B GLY 1   
15 1 Y 1 B ALA 2064 ? B ALA 2   
16 1 Y 1 B MET 2065 ? B MET 3   
17 1 Y 1 B ALA 2066 ? B ALA 4   
18 1 Y 1 B GLY 2067 ? B GLY 5   
19 1 Y 1 B GLY 2085 ? B GLY 23  
20 1 Y 1 B TYR 2086 ? B TYR 24  
21 1 Y 1 B GLU 2087 ? B GLU 25  
22 1 Y 1 B ALA 2088 ? B ALA 26  
23 1 Y 1 B THR 2089 ? B THR 27  
24 1 Y 1 B THR 2090 ? B THR 28  
25 1 Y 1 B CYS 2091 ? B CYS 29  
26 1 Y 1 B ASN 2092 ? B ASN 30  
27 1 Y 1 B CYS 2093 ? B CYS 31  
28 1 Y 1 B LYS 2094 ? B LYS 32  
29 1 Y 1 B LYS 2095 ? B LYS 33  
30 1 Y 1 B PRO 2096 ? B PRO 34  
31 1 Y 1 B ASP 2097 ? B ASP 35  
32 1 Y 1 B ASP 2098 ? B ASP 36  
33 1 Y 1 B ASP 2099 ? B ASP 37  
34 1 Y 1 B THR 2100 ? B THR 38  
35 1 Y 1 B ARG 2101 ? B ARG 39  
36 1 Y 1 B LYS 2102 ? B LYS 40  
37 1 Y 1 B GLY 2103 ? B GLY 41  
38 1 Y 1 B GLY 2280 ? B GLY 218 
39 1 Y 1 B GLY 2281 ? B GLY 219 
40 1 Y 1 B LYS 2282 ? B LYS 220 
41 1 Y 1 B SER 2283 ? B SER 221 
42 1 Y 1 B GLN 2284 ? B GLN 222 
43 1 Y 1 B ARG 2285 ? B ARG 223 
44 1 Y 1 B VAL 2286 ? B VAL 224 
45 1 Y 1 B ASN 2287 ? B ASN 225 
46 1 Y 1 B GLY 2288 ? B GLY 226 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Cancer Institute (NIH/NCI)'                        'United States' 1R01CA160467      1 
'Leukemia & Lymphoma Society'                                                              'United States' 6111-14           2 
'Leukemia & Lymphoma Society'                                                              'United States' 1215-14           3 
'American Cancer Society'                                                                  'United States' RSG-13-130-01-CDD 4 
'Michigan Economic Development Corporation'                                                'United States' 085P1000817       5 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 5T32GM008597      6 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 5T32GM007863      7 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'           ZN  
3 S-ADENOSYLMETHIONINE SAM 
#