data_4YOC
# 
_entry.id   4YOC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YOC         
WWPDB D_1000207740 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YOC 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cheng, J.' 1 
'Yang, H.'  2 
'Fang, J.'  3 
'Gong, R.'  4 
'Wang, P.'  5 
'Li, Z.'    6 
'Xu, Y.'    7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                7023 
_citation.page_last                 7023 
_citation.title                     'Molecular mechanism for USP7-mediated DNMT1 stabilization by acetylation.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/ncomms8023 
_citation.pdbx_database_id_PubMed   25960197 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cheng, J.' 1 
primary 'Yang, H.'  2 
primary 'Fang, J.'  3 
primary 'Ma, L.'    4 
primary 'Gong, R.'  5 
primary 'Wang, P.'  6 
primary 'Li, Z.'    7 
primary 'Xu, Y.'    8 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4YOC 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     110.231 
_cell.length_a_esd                 ? 
_cell.length_b                     111.619 
_cell.length_b_esd                 ? 
_cell.length_c                     163.868 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4YOC 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA (cytosine-5)-methyltransferase 1'    113916.836 1  2.1.1.37  ? 'UNP RESIDUES 600-1600' ? 
2 polymer     man 'Ubiquitin carboxyl-terminal hydrolase 7' 64106.008  1  3.4.19.12 ? 'UNP RESIDUES 560-1102' ? 
3 non-polymer syn 'ZINC ION'                                65.409     2  ?         ? ?                       ? 
4 water       nat water                                     18.015     11 ?         ? ?                       ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Dnmt1,CXXC-type zinc finger protein 9,DNA methyltransferase HsaI,M.HsaI,MCMT' 
2 
;Deubiquitinating enzyme 7,Herpesvirus-associated ubiquitin-specific protease,Ubiquitin thioesterase 7,Ubiquitin-specific-processing protease 7
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SEFRRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKF
GGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAET
LEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIY
KAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLED
LDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRI
KEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYS
MGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFH
QAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFN
SRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIIL
AAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWF
QRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVC
SCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARS
QGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKA
;
;SEFRRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKF
GGSGRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAET
LEVGDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIY
KAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLED
LDSRVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRI
KEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYS
MGGPNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFH
QAGISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFN
SRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIIL
AAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWF
QRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVC
SCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARS
QGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKA
;
A ? 
2 'polypeptide(L)' no no 
;GPLGSEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKR
PAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIR
DLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRV
DVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPK
KLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQ
EDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKE
FEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
;
;GPLGSEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKR
PAMLDNEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIR
DLLPVMCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRV
DVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPK
KLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQ
EDELLECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKE
FEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
;
C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    SER n 
1 2    GLU n 
1 3    PHE n 
1 4    ARG n 
1 5    ARG n 
1 6    GLN n 
1 7    THR n 
1 8    ILE n 
1 9    ARG n 
1 10   HIS n 
1 11   SER n 
1 12   THR n 
1 13   ARG n 
1 14   GLU n 
1 15   LYS n 
1 16   ASP n 
1 17   ARG n 
1 18   GLY n 
1 19   PRO n 
1 20   THR n 
1 21   LYS n 
1 22   ALA n 
1 23   THR n 
1 24   THR n 
1 25   THR n 
1 26   LYS n 
1 27   LEU n 
1 28   VAL n 
1 29   TYR n 
1 30   GLN n 
1 31   ILE n 
1 32   PHE n 
1 33   ASP n 
1 34   THR n 
1 35   PHE n 
1 36   PHE n 
1 37   ALA n 
1 38   GLU n 
1 39   GLN n 
1 40   ILE n 
1 41   GLU n 
1 42   LYS n 
1 43   ASP n 
1 44   ASP n 
1 45   ARG n 
1 46   GLU n 
1 47   ASP n 
1 48   LYS n 
1 49   GLU n 
1 50   ASN n 
1 51   ALA n 
1 52   PHE n 
1 53   LYS n 
1 54   ARG n 
1 55   ARG n 
1 56   ARG n 
1 57   CYS n 
1 58   GLY n 
1 59   VAL n 
1 60   CYS n 
1 61   GLU n 
1 62   VAL n 
1 63   CYS n 
1 64   GLN n 
1 65   GLN n 
1 66   PRO n 
1 67   GLU n 
1 68   CYS n 
1 69   GLY n 
1 70   LYS n 
1 71   CYS n 
1 72   LYS n 
1 73   ALA n 
1 74   CYS n 
1 75   LYS n 
1 76   ASP n 
1 77   MET n 
1 78   VAL n 
1 79   LYS n 
1 80   PHE n 
1 81   GLY n 
1 82   GLY n 
1 83   SER n 
1 84   GLY n 
1 85   ARG n 
1 86   SER n 
1 87   LYS n 
1 88   GLN n 
1 89   ALA n 
1 90   CYS n 
1 91   GLN n 
1 92   GLU n 
1 93   ARG n 
1 94   ARG n 
1 95   CYS n 
1 96   PRO n 
1 97   ASN n 
1 98   MET n 
1 99   ALA n 
1 100  MET n 
1 101  LYS n 
1 102  GLU n 
1 103  ALA n 
1 104  ASP n 
1 105  ASP n 
1 106  ASP n 
1 107  GLU n 
1 108  GLU n 
1 109  VAL n 
1 110  ASP n 
1 111  ASP n 
1 112  ASN n 
1 113  ILE n 
1 114  PRO n 
1 115  GLU n 
1 116  MET n 
1 117  PRO n 
1 118  SER n 
1 119  PRO n 
1 120  LYS n 
1 121  LYS n 
1 122  MET n 
1 123  HIS n 
1 124  GLN n 
1 125  GLY n 
1 126  LYS n 
1 127  LYS n 
1 128  LYS n 
1 129  LYS n 
1 130  GLN n 
1 131  ASN n 
1 132  LYS n 
1 133  ASN n 
1 134  ARG n 
1 135  ILE n 
1 136  SER n 
1 137  TRP n 
1 138  VAL n 
1 139  GLY n 
1 140  GLU n 
1 141  ALA n 
1 142  VAL n 
1 143  LYS n 
1 144  THR n 
1 145  ASP n 
1 146  GLY n 
1 147  LYS n 
1 148  LYS n 
1 149  SER n 
1 150  TYR n 
1 151  TYR n 
1 152  LYS n 
1 153  LYS n 
1 154  VAL n 
1 155  CYS n 
1 156  ILE n 
1 157  ASP n 
1 158  ALA n 
1 159  GLU n 
1 160  THR n 
1 161  LEU n 
1 162  GLU n 
1 163  VAL n 
1 164  GLY n 
1 165  ASP n 
1 166  CYS n 
1 167  VAL n 
1 168  SER n 
1 169  VAL n 
1 170  ILE n 
1 171  PRO n 
1 172  ASP n 
1 173  ASP n 
1 174  SER n 
1 175  SER n 
1 176  LYS n 
1 177  PRO n 
1 178  LEU n 
1 179  TYR n 
1 180  LEU n 
1 181  ALA n 
1 182  ARG n 
1 183  VAL n 
1 184  THR n 
1 185  ALA n 
1 186  LEU n 
1 187  TRP n 
1 188  GLU n 
1 189  ASP n 
1 190  SER n 
1 191  SER n 
1 192  ASN n 
1 193  GLY n 
1 194  GLN n 
1 195  MET n 
1 196  PHE n 
1 197  HIS n 
1 198  ALA n 
1 199  HIS n 
1 200  TRP n 
1 201  PHE n 
1 202  CYS n 
1 203  ALA n 
1 204  GLY n 
1 205  THR n 
1 206  ASP n 
1 207  THR n 
1 208  VAL n 
1 209  LEU n 
1 210  GLY n 
1 211  ALA n 
1 212  THR n 
1 213  SER n 
1 214  ASP n 
1 215  PRO n 
1 216  LEU n 
1 217  GLU n 
1 218  LEU n 
1 219  PHE n 
1 220  LEU n 
1 221  VAL n 
1 222  ASP n 
1 223  GLU n 
1 224  CYS n 
1 225  GLU n 
1 226  ASP n 
1 227  MET n 
1 228  GLN n 
1 229  LEU n 
1 230  SER n 
1 231  TYR n 
1 232  ILE n 
1 233  HIS n 
1 234  SER n 
1 235  LYS n 
1 236  VAL n 
1 237  LYS n 
1 238  VAL n 
1 239  ILE n 
1 240  TYR n 
1 241  LYS n 
1 242  ALA n 
1 243  PRO n 
1 244  SER n 
1 245  GLU n 
1 246  ASN n 
1 247  TRP n 
1 248  ALA n 
1 249  MET n 
1 250  GLU n 
1 251  GLY n 
1 252  GLY n 
1 253  MET n 
1 254  ASP n 
1 255  PRO n 
1 256  GLU n 
1 257  SER n 
1 258  LEU n 
1 259  LEU n 
1 260  GLU n 
1 261  GLY n 
1 262  ASP n 
1 263  ASP n 
1 264  GLY n 
1 265  LYS n 
1 266  THR n 
1 267  TYR n 
1 268  PHE n 
1 269  TYR n 
1 270  GLN n 
1 271  LEU n 
1 272  TRP n 
1 273  TYR n 
1 274  ASP n 
1 275  GLN n 
1 276  ASP n 
1 277  TYR n 
1 278  ALA n 
1 279  ARG n 
1 280  PHE n 
1 281  GLU n 
1 282  SER n 
1 283  PRO n 
1 284  PRO n 
1 285  LYS n 
1 286  THR n 
1 287  GLN n 
1 288  PRO n 
1 289  THR n 
1 290  GLU n 
1 291  ASP n 
1 292  ASN n 
1 293  LYS n 
1 294  PHE n 
1 295  LYS n 
1 296  PHE n 
1 297  CYS n 
1 298  VAL n 
1 299  SER n 
1 300  CYS n 
1 301  ALA n 
1 302  ARG n 
1 303  LEU n 
1 304  ALA n 
1 305  GLU n 
1 306  MET n 
1 307  ARG n 
1 308  GLN n 
1 309  LYS n 
1 310  GLU n 
1 311  ILE n 
1 312  PRO n 
1 313  ARG n 
1 314  VAL n 
1 315  LEU n 
1 316  GLU n 
1 317  GLN n 
1 318  LEU n 
1 319  GLU n 
1 320  ASP n 
1 321  LEU n 
1 322  ASP n 
1 323  SER n 
1 324  ARG n 
1 325  VAL n 
1 326  LEU n 
1 327  TYR n 
1 328  TYR n 
1 329  SER n 
1 330  ALA n 
1 331  THR n 
1 332  LYS n 
1 333  ASN n 
1 334  GLY n 
1 335  ILE n 
1 336  LEU n 
1 337  TYR n 
1 338  ARG n 
1 339  VAL n 
1 340  GLY n 
1 341  ASP n 
1 342  GLY n 
1 343  VAL n 
1 344  TYR n 
1 345  LEU n 
1 346  PRO n 
1 347  PRO n 
1 348  GLU n 
1 349  ALA n 
1 350  PHE n 
1 351  THR n 
1 352  PHE n 
1 353  ASN n 
1 354  ILE n 
1 355  LYS n 
1 356  LEU n 
1 357  SER n 
1 358  SER n 
1 359  PRO n 
1 360  VAL n 
1 361  LYS n 
1 362  ARG n 
1 363  PRO n 
1 364  ARG n 
1 365  LYS n 
1 366  GLU n 
1 367  PRO n 
1 368  VAL n 
1 369  ASP n 
1 370  GLU n 
1 371  ASP n 
1 372  LEU n 
1 373  TYR n 
1 374  PRO n 
1 375  GLU n 
1 376  HIS n 
1 377  TYR n 
1 378  ARG n 
1 379  LYS n 
1 380  TYR n 
1 381  SER n 
1 382  ASP n 
1 383  TYR n 
1 384  ILE n 
1 385  LYS n 
1 386  GLY n 
1 387  SER n 
1 388  ASN n 
1 389  LEU n 
1 390  ASP n 
1 391  ALA n 
1 392  PRO n 
1 393  GLU n 
1 394  PRO n 
1 395  TYR n 
1 396  ARG n 
1 397  ILE n 
1 398  GLY n 
1 399  ARG n 
1 400  ILE n 
1 401  LYS n 
1 402  GLU n 
1 403  ILE n 
1 404  PHE n 
1 405  CYS n 
1 406  PRO n 
1 407  LYS n 
1 408  LYS n 
1 409  SER n 
1 410  ASN n 
1 411  GLY n 
1 412  ARG n 
1 413  PRO n 
1 414  ASN n 
1 415  GLU n 
1 416  THR n 
1 417  ASP n 
1 418  ILE n 
1 419  LYS n 
1 420  ILE n 
1 421  ARG n 
1 422  VAL n 
1 423  ASN n 
1 424  LYS n 
1 425  PHE n 
1 426  TYR n 
1 427  ARG n 
1 428  PRO n 
1 429  GLU n 
1 430  ASN n 
1 431  THR n 
1 432  HIS n 
1 433  LYS n 
1 434  SER n 
1 435  THR n 
1 436  PRO n 
1 437  ALA n 
1 438  SER n 
1 439  TYR n 
1 440  HIS n 
1 441  ALA n 
1 442  ASP n 
1 443  ILE n 
1 444  ASN n 
1 445  LEU n 
1 446  LEU n 
1 447  TYR n 
1 448  TRP n 
1 449  SER n 
1 450  ASP n 
1 451  GLU n 
1 452  GLU n 
1 453  ALA n 
1 454  VAL n 
1 455  VAL n 
1 456  ASP n 
1 457  PHE n 
1 458  LYS n 
1 459  ALA n 
1 460  VAL n 
1 461  GLN n 
1 462  GLY n 
1 463  ARG n 
1 464  CYS n 
1 465  THR n 
1 466  VAL n 
1 467  GLU n 
1 468  TYR n 
1 469  GLY n 
1 470  GLU n 
1 471  ASP n 
1 472  LEU n 
1 473  PRO n 
1 474  GLU n 
1 475  CYS n 
1 476  VAL n 
1 477  GLN n 
1 478  VAL n 
1 479  TYR n 
1 480  SER n 
1 481  MET n 
1 482  GLY n 
1 483  GLY n 
1 484  PRO n 
1 485  ASN n 
1 486  ARG n 
1 487  PHE n 
1 488  TYR n 
1 489  PHE n 
1 490  LEU n 
1 491  GLU n 
1 492  ALA n 
1 493  TYR n 
1 494  ASN n 
1 495  ALA n 
1 496  LYS n 
1 497  SER n 
1 498  LYS n 
1 499  SER n 
1 500  PHE n 
1 501  GLU n 
1 502  ASP n 
1 503  PRO n 
1 504  PRO n 
1 505  ASN n 
1 506  HIS n 
1 507  ALA n 
1 508  ARG n 
1 509  SER n 
1 510  PRO n 
1 511  GLY n 
1 512  ASN n 
1 513  LYS n 
1 514  GLY n 
1 515  LYS n 
1 516  GLY n 
1 517  LYS n 
1 518  GLY n 
1 519  LYS n 
1 520  GLY n 
1 521  LYS n 
1 522  GLY n 
1 523  LYS n 
1 524  PRO n 
1 525  LYS n 
1 526  SER n 
1 527  GLN n 
1 528  ALA n 
1 529  CYS n 
1 530  GLU n 
1 531  PRO n 
1 532  SER n 
1 533  GLU n 
1 534  PRO n 
1 535  GLU n 
1 536  ILE n 
1 537  GLU n 
1 538  ILE n 
1 539  LYS n 
1 540  LEU n 
1 541  PRO n 
1 542  LYS n 
1 543  LEU n 
1 544  ARG n 
1 545  THR n 
1 546  LEU n 
1 547  ASP n 
1 548  VAL n 
1 549  PHE n 
1 550  SER n 
1 551  GLY n 
1 552  CYS n 
1 553  GLY n 
1 554  GLY n 
1 555  LEU n 
1 556  SER n 
1 557  GLU n 
1 558  GLY n 
1 559  PHE n 
1 560  HIS n 
1 561  GLN n 
1 562  ALA n 
1 563  GLY n 
1 564  ILE n 
1 565  SER n 
1 566  ASP n 
1 567  THR n 
1 568  LEU n 
1 569  TRP n 
1 570  ALA n 
1 571  ILE n 
1 572  GLU n 
1 573  MET n 
1 574  TRP n 
1 575  ASP n 
1 576  PRO n 
1 577  ALA n 
1 578  ALA n 
1 579  GLN n 
1 580  ALA n 
1 581  PHE n 
1 582  ARG n 
1 583  LEU n 
1 584  ASN n 
1 585  ASN n 
1 586  PRO n 
1 587  GLY n 
1 588  SER n 
1 589  THR n 
1 590  VAL n 
1 591  PHE n 
1 592  THR n 
1 593  GLU n 
1 594  ASP n 
1 595  CYS n 
1 596  ASN n 
1 597  ILE n 
1 598  LEU n 
1 599  LEU n 
1 600  LYS n 
1 601  LEU n 
1 602  VAL n 
1 603  MET n 
1 604  ALA n 
1 605  GLY n 
1 606  GLU n 
1 607  THR n 
1 608  THR n 
1 609  ASN n 
1 610  SER n 
1 611  ARG n 
1 612  GLY n 
1 613  GLN n 
1 614  ARG n 
1 615  LEU n 
1 616  PRO n 
1 617  GLN n 
1 618  LYS n 
1 619  GLY n 
1 620  ASP n 
1 621  VAL n 
1 622  GLU n 
1 623  MET n 
1 624  LEU n 
1 625  CYS n 
1 626  GLY n 
1 627  GLY n 
1 628  PRO n 
1 629  PRO n 
1 630  CYS n 
1 631  GLN n 
1 632  GLY n 
1 633  PHE n 
1 634  SER n 
1 635  GLY n 
1 636  MET n 
1 637  ASN n 
1 638  ARG n 
1 639  PHE n 
1 640  ASN n 
1 641  SER n 
1 642  ARG n 
1 643  THR n 
1 644  TYR n 
1 645  SER n 
1 646  LYS n 
1 647  PHE n 
1 648  LYS n 
1 649  ASN n 
1 650  SER n 
1 651  LEU n 
1 652  VAL n 
1 653  VAL n 
1 654  SER n 
1 655  PHE n 
1 656  LEU n 
1 657  SER n 
1 658  TYR n 
1 659  CYS n 
1 660  ASP n 
1 661  TYR n 
1 662  TYR n 
1 663  ARG n 
1 664  PRO n 
1 665  ARG n 
1 666  PHE n 
1 667  PHE n 
1 668  LEU n 
1 669  LEU n 
1 670  GLU n 
1 671  ASN n 
1 672  VAL n 
1 673  ARG n 
1 674  ASN n 
1 675  PHE n 
1 676  VAL n 
1 677  SER n 
1 678  PHE n 
1 679  LYS n 
1 680  ARG n 
1 681  SER n 
1 682  MET n 
1 683  VAL n 
1 684  LEU n 
1 685  LYS n 
1 686  LEU n 
1 687  THR n 
1 688  LEU n 
1 689  ARG n 
1 690  CYS n 
1 691  LEU n 
1 692  VAL n 
1 693  ARG n 
1 694  MET n 
1 695  GLY n 
1 696  TYR n 
1 697  GLN n 
1 698  CYS n 
1 699  THR n 
1 700  PHE n 
1 701  GLY n 
1 702  VAL n 
1 703  LEU n 
1 704  GLN n 
1 705  ALA n 
1 706  GLY n 
1 707  GLN n 
1 708  TYR n 
1 709  GLY n 
1 710  VAL n 
1 711  ALA n 
1 712  GLN n 
1 713  THR n 
1 714  ARG n 
1 715  ARG n 
1 716  ARG n 
1 717  ALA n 
1 718  ILE n 
1 719  ILE n 
1 720  LEU n 
1 721  ALA n 
1 722  ALA n 
1 723  ALA n 
1 724  PRO n 
1 725  GLY n 
1 726  GLU n 
1 727  LYS n 
1 728  LEU n 
1 729  PRO n 
1 730  LEU n 
1 731  PHE n 
1 732  PRO n 
1 733  GLU n 
1 734  PRO n 
1 735  LEU n 
1 736  HIS n 
1 737  VAL n 
1 738  PHE n 
1 739  ALA n 
1 740  PRO n 
1 741  ARG n 
1 742  ALA n 
1 743  CYS n 
1 744  GLN n 
1 745  LEU n 
1 746  SER n 
1 747  VAL n 
1 748  VAL n 
1 749  VAL n 
1 750  ASP n 
1 751  ASP n 
1 752  LYS n 
1 753  LYS n 
1 754  PHE n 
1 755  VAL n 
1 756  SER n 
1 757  ASN n 
1 758  ILE n 
1 759  THR n 
1 760  ARG n 
1 761  LEU n 
1 762  SER n 
1 763  SER n 
1 764  GLY n 
1 765  PRO n 
1 766  PHE n 
1 767  ARG n 
1 768  THR n 
1 769  ILE n 
1 770  THR n 
1 771  VAL n 
1 772  ARG n 
1 773  ASP n 
1 774  THR n 
1 775  MET n 
1 776  SER n 
1 777  ASP n 
1 778  LEU n 
1 779  PRO n 
1 780  GLU n 
1 781  VAL n 
1 782  ARG n 
1 783  ASN n 
1 784  GLY n 
1 785  ALA n 
1 786  SER n 
1 787  ALA n 
1 788  LEU n 
1 789  GLU n 
1 790  ILE n 
1 791  SER n 
1 792  TYR n 
1 793  ASN n 
1 794  GLY n 
1 795  GLU n 
1 796  PRO n 
1 797  GLN n 
1 798  SER n 
1 799  TRP n 
1 800  PHE n 
1 801  GLN n 
1 802  ARG n 
1 803  GLN n 
1 804  LEU n 
1 805  ARG n 
1 806  GLY n 
1 807  ALA n 
1 808  GLN n 
1 809  TYR n 
1 810  GLN n 
1 811  PRO n 
1 812  ILE n 
1 813  LEU n 
1 814  ARG n 
1 815  ASP n 
1 816  HIS n 
1 817  ILE n 
1 818  CYS n 
1 819  LYS n 
1 820  ASP n 
1 821  MET n 
1 822  SER n 
1 823  ALA n 
1 824  LEU n 
1 825  VAL n 
1 826  ALA n 
1 827  ALA n 
1 828  ARG n 
1 829  MET n 
1 830  ARG n 
1 831  HIS n 
1 832  ILE n 
1 833  PRO n 
1 834  LEU n 
1 835  ALA n 
1 836  PRO n 
1 837  GLY n 
1 838  SER n 
1 839  ASP n 
1 840  TRP n 
1 841  ARG n 
1 842  ASP n 
1 843  LEU n 
1 844  PRO n 
1 845  ASN n 
1 846  ILE n 
1 847  GLU n 
1 848  VAL n 
1 849  ARG n 
1 850  LEU n 
1 851  SER n 
1 852  ASP n 
1 853  GLY n 
1 854  THR n 
1 855  MET n 
1 856  ALA n 
1 857  ARG n 
1 858  LYS n 
1 859  LEU n 
1 860  ARG n 
1 861  TYR n 
1 862  THR n 
1 863  HIS n 
1 864  HIS n 
1 865  ASP n 
1 866  ARG n 
1 867  LYS n 
1 868  ASN n 
1 869  GLY n 
1 870  ARG n 
1 871  SER n 
1 872  SER n 
1 873  SER n 
1 874  GLY n 
1 875  ALA n 
1 876  LEU n 
1 877  ARG n 
1 878  GLY n 
1 879  VAL n 
1 880  CYS n 
1 881  SER n 
1 882  CYS n 
1 883  VAL n 
1 884  GLU n 
1 885  ALA n 
1 886  GLY n 
1 887  LYS n 
1 888  ALA n 
1 889  CYS n 
1 890  ASP n 
1 891  PRO n 
1 892  ALA n 
1 893  ALA n 
1 894  ARG n 
1 895  GLN n 
1 896  PHE n 
1 897  ASN n 
1 898  THR n 
1 899  LEU n 
1 900  ILE n 
1 901  PRO n 
1 902  TRP n 
1 903  CYS n 
1 904  LEU n 
1 905  PRO n 
1 906  HIS n 
1 907  THR n 
1 908  GLY n 
1 909  ASN n 
1 910  ARG n 
1 911  HIS n 
1 912  ASN n 
1 913  HIS n 
1 914  TRP n 
1 915  ALA n 
1 916  GLY n 
1 917  LEU n 
1 918  TYR n 
1 919  GLY n 
1 920  ARG n 
1 921  LEU n 
1 922  GLU n 
1 923  TRP n 
1 924  ASP n 
1 925  GLY n 
1 926  PHE n 
1 927  PHE n 
1 928  SER n 
1 929  THR n 
1 930  THR n 
1 931  VAL n 
1 932  THR n 
1 933  ASN n 
1 934  PRO n 
1 935  GLU n 
1 936  PRO n 
1 937  MET n 
1 938  GLY n 
1 939  LYS n 
1 940  GLN n 
1 941  GLY n 
1 942  ARG n 
1 943  VAL n 
1 944  LEU n 
1 945  HIS n 
1 946  PRO n 
1 947  GLU n 
1 948  GLN n 
1 949  HIS n 
1 950  ARG n 
1 951  VAL n 
1 952  VAL n 
1 953  SER n 
1 954  VAL n 
1 955  ARG n 
1 956  GLU n 
1 957  CYS n 
1 958  ALA n 
1 959  ARG n 
1 960  SER n 
1 961  GLN n 
1 962  GLY n 
1 963  PHE n 
1 964  PRO n 
1 965  ASP n 
1 966  THR n 
1 967  TYR n 
1 968  ARG n 
1 969  LEU n 
1 970  PHE n 
1 971  GLY n 
1 972  ASN n 
1 973  ILE n 
1 974  LEU n 
1 975  ASP n 
1 976  LYS n 
1 977  HIS n 
1 978  ARG n 
1 979  GLN n 
1 980  VAL n 
1 981  GLY n 
1 982  ASN n 
1 983  ALA n 
1 984  VAL n 
1 985  PRO n 
1 986  PRO n 
1 987  PRO n 
1 988  LEU n 
1 989  ALA n 
1 990  LYS n 
1 991  ALA n 
1 992  ILE n 
1 993  GLY n 
1 994  LEU n 
1 995  GLU n 
1 996  ILE n 
1 997  LYS n 
1 998  LEU n 
1 999  CYS n 
1 1000 MET n 
1 1001 LEU n 
1 1002 ALA n 
1 1003 LYS n 
1 1004 ALA n 
2 1    GLY n 
2 2    PRO n 
2 3    LEU n 
2 4    GLY n 
2 5    SER n 
2 6    GLU n 
2 7    ALA n 
2 8    HIS n 
2 9    LEU n 
2 10   TYR n 
2 11   MET n 
2 12   GLN n 
2 13   VAL n 
2 14   GLN n 
2 15   ILE n 
2 16   VAL n 
2 17   ALA n 
2 18   GLU n 
2 19   ASP n 
2 20   GLN n 
2 21   PHE n 
2 22   CYS n 
2 23   GLY n 
2 24   HIS n 
2 25   GLN n 
2 26   GLY n 
2 27   ASN n 
2 28   ASP n 
2 29   MET n 
2 30   TYR n 
2 31   ASP n 
2 32   GLU n 
2 33   GLU n 
2 34   LYS n 
2 35   VAL n 
2 36   LYS n 
2 37   TYR n 
2 38   THR n 
2 39   VAL n 
2 40   PHE n 
2 41   LYS n 
2 42   VAL n 
2 43   LEU n 
2 44   LYS n 
2 45   ASN n 
2 46   SER n 
2 47   SER n 
2 48   LEU n 
2 49   ALA n 
2 50   GLU n 
2 51   PHE n 
2 52   VAL n 
2 53   GLN n 
2 54   SER n 
2 55   LEU n 
2 56   SER n 
2 57   GLN n 
2 58   THR n 
2 59   MET n 
2 60   GLY n 
2 61   PHE n 
2 62   PRO n 
2 63   GLN n 
2 64   ASP n 
2 65   GLN n 
2 66   ILE n 
2 67   ARG n 
2 68   LEU n 
2 69   TRP n 
2 70   PRO n 
2 71   MET n 
2 72   GLN n 
2 73   ALA n 
2 74   ARG n 
2 75   SER n 
2 76   ASN n 
2 77   GLY n 
2 78   THR n 
2 79   LYS n 
2 80   ARG n 
2 81   PRO n 
2 82   ALA n 
2 83   MET n 
2 84   LEU n 
2 85   ASP n 
2 86   ASN n 
2 87   GLU n 
2 88   ALA n 
2 89   ASP n 
2 90   GLY n 
2 91   ASN n 
2 92   LYS n 
2 93   THR n 
2 94   MET n 
2 95   ILE n 
2 96   GLU n 
2 97   LEU n 
2 98   SER n 
2 99   ASP n 
2 100  ASN n 
2 101  GLU n 
2 102  ASN n 
2 103  PRO n 
2 104  TRP n 
2 105  THR n 
2 106  ILE n 
2 107  PHE n 
2 108  LEU n 
2 109  GLU n 
2 110  THR n 
2 111  VAL n 
2 112  ASP n 
2 113  PRO n 
2 114  GLU n 
2 115  LEU n 
2 116  ALA n 
2 117  ALA n 
2 118  SER n 
2 119  GLY n 
2 120  ALA n 
2 121  THR n 
2 122  LEU n 
2 123  PRO n 
2 124  LYS n 
2 125  PHE n 
2 126  ASP n 
2 127  LYS n 
2 128  ASP n 
2 129  HIS n 
2 130  ASP n 
2 131  VAL n 
2 132  MET n 
2 133  LEU n 
2 134  PHE n 
2 135  LEU n 
2 136  LYS n 
2 137  MET n 
2 138  TYR n 
2 139  ASP n 
2 140  PRO n 
2 141  LYS n 
2 142  THR n 
2 143  ARG n 
2 144  SER n 
2 145  LEU n 
2 146  ASN n 
2 147  TYR n 
2 148  CYS n 
2 149  GLY n 
2 150  HIS n 
2 151  ILE n 
2 152  TYR n 
2 153  THR n 
2 154  PRO n 
2 155  ILE n 
2 156  SER n 
2 157  CYS n 
2 158  LYS n 
2 159  ILE n 
2 160  ARG n 
2 161  ASP n 
2 162  LEU n 
2 163  LEU n 
2 164  PRO n 
2 165  VAL n 
2 166  MET n 
2 167  CYS n 
2 168  ASP n 
2 169  ARG n 
2 170  ALA n 
2 171  GLY n 
2 172  PHE n 
2 173  ILE n 
2 174  GLN n 
2 175  ASP n 
2 176  THR n 
2 177  SER n 
2 178  LEU n 
2 179  ILE n 
2 180  LEU n 
2 181  TYR n 
2 182  GLU n 
2 183  GLU n 
2 184  VAL n 
2 185  LYS n 
2 186  PRO n 
2 187  ASN n 
2 188  LEU n 
2 189  THR n 
2 190  GLU n 
2 191  ARG n 
2 192  ILE n 
2 193  GLN n 
2 194  ASP n 
2 195  TYR n 
2 196  ASP n 
2 197  VAL n 
2 198  SER n 
2 199  LEU n 
2 200  ASP n 
2 201  LYS n 
2 202  ALA n 
2 203  LEU n 
2 204  ASP n 
2 205  GLU n 
2 206  LEU n 
2 207  MET n 
2 208  ASP n 
2 209  GLY n 
2 210  ASP n 
2 211  ILE n 
2 212  ILE n 
2 213  VAL n 
2 214  PHE n 
2 215  GLN n 
2 216  LYS n 
2 217  ASP n 
2 218  ASP n 
2 219  PRO n 
2 220  GLU n 
2 221  ASN n 
2 222  ASP n 
2 223  ASN n 
2 224  SER n 
2 225  GLU n 
2 226  LEU n 
2 227  PRO n 
2 228  THR n 
2 229  ALA n 
2 230  LYS n 
2 231  GLU n 
2 232  TYR n 
2 233  PHE n 
2 234  ARG n 
2 235  ASP n 
2 236  LEU n 
2 237  TYR n 
2 238  HIS n 
2 239  ARG n 
2 240  VAL n 
2 241  ASP n 
2 242  VAL n 
2 243  ILE n 
2 244  PHE n 
2 245  CYS n 
2 246  ASP n 
2 247  LYS n 
2 248  THR n 
2 249  ILE n 
2 250  PRO n 
2 251  ASN n 
2 252  ASP n 
2 253  PRO n 
2 254  GLY n 
2 255  PHE n 
2 256  VAL n 
2 257  VAL n 
2 258  THR n 
2 259  LEU n 
2 260  SER n 
2 261  ASN n 
2 262  ARG n 
2 263  MET n 
2 264  ASN n 
2 265  TYR n 
2 266  PHE n 
2 267  GLN n 
2 268  VAL n 
2 269  ALA n 
2 270  LYS n 
2 271  THR n 
2 272  VAL n 
2 273  ALA n 
2 274  GLN n 
2 275  ARG n 
2 276  LEU n 
2 277  ASN n 
2 278  THR n 
2 279  ASP n 
2 280  PRO n 
2 281  MET n 
2 282  LEU n 
2 283  LEU n 
2 284  GLN n 
2 285  PHE n 
2 286  PHE n 
2 287  LYS n 
2 288  SER n 
2 289  GLN n 
2 290  GLY n 
2 291  TYR n 
2 292  ARG n 
2 293  ASP n 
2 294  GLY n 
2 295  PRO n 
2 296  GLY n 
2 297  ASN n 
2 298  PRO n 
2 299  LEU n 
2 300  ARG n 
2 301  HIS n 
2 302  ASN n 
2 303  TYR n 
2 304  GLU n 
2 305  GLY n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  ASP n 
2 310  LEU n 
2 311  LEU n 
2 312  GLN n 
2 313  PHE n 
2 314  PHE n 
2 315  LYS n 
2 316  PRO n 
2 317  ARG n 
2 318  GLN n 
2 319  PRO n 
2 320  LYS n 
2 321  LYS n 
2 322  LEU n 
2 323  TYR n 
2 324  TYR n 
2 325  GLN n 
2 326  GLN n 
2 327  LEU n 
2 328  LYS n 
2 329  MET n 
2 330  LYS n 
2 331  ILE n 
2 332  THR n 
2 333  ASP n 
2 334  PHE n 
2 335  GLU n 
2 336  ASN n 
2 337  ARG n 
2 338  ARG n 
2 339  SER n 
2 340  PHE n 
2 341  LYS n 
2 342  CYS n 
2 343  ILE n 
2 344  TRP n 
2 345  LEU n 
2 346  ASN n 
2 347  SER n 
2 348  GLN n 
2 349  PHE n 
2 350  ARG n 
2 351  GLU n 
2 352  GLU n 
2 353  GLU n 
2 354  ILE n 
2 355  THR n 
2 356  LEU n 
2 357  TYR n 
2 358  PRO n 
2 359  ASP n 
2 360  LYS n 
2 361  HIS n 
2 362  GLY n 
2 363  CYS n 
2 364  VAL n 
2 365  ARG n 
2 366  ASP n 
2 367  LEU n 
2 368  LEU n 
2 369  GLU n 
2 370  GLU n 
2 371  CYS n 
2 372  LYS n 
2 373  LYS n 
2 374  ALA n 
2 375  VAL n 
2 376  GLU n 
2 377  LEU n 
2 378  GLY n 
2 379  GLU n 
2 380  LYS n 
2 381  ALA n 
2 382  SER n 
2 383  GLY n 
2 384  LYS n 
2 385  LEU n 
2 386  ARG n 
2 387  LEU n 
2 388  LEU n 
2 389  GLU n 
2 390  ILE n 
2 391  VAL n 
2 392  SER n 
2 393  TYR n 
2 394  LYS n 
2 395  ILE n 
2 396  ILE n 
2 397  GLY n 
2 398  VAL n 
2 399  HIS n 
2 400  GLN n 
2 401  GLU n 
2 402  ASP n 
2 403  GLU n 
2 404  LEU n 
2 405  LEU n 
2 406  GLU n 
2 407  CYS n 
2 408  LEU n 
2 409  SER n 
2 410  PRO n 
2 411  ALA n 
2 412  THR n 
2 413  SER n 
2 414  ARG n 
2 415  THR n 
2 416  PHE n 
2 417  ARG n 
2 418  ILE n 
2 419  GLU n 
2 420  GLU n 
2 421  ILE n 
2 422  PRO n 
2 423  LEU n 
2 424  ASP n 
2 425  GLN n 
2 426  VAL n 
2 427  ASP n 
2 428  ILE n 
2 429  ASP n 
2 430  LYS n 
2 431  GLU n 
2 432  ASN n 
2 433  GLU n 
2 434  MET n 
2 435  LEU n 
2 436  VAL n 
2 437  THR n 
2 438  VAL n 
2 439  ALA n 
2 440  HIS n 
2 441  PHE n 
2 442  HIS n 
2 443  LYS n 
2 444  GLU n 
2 445  VAL n 
2 446  PHE n 
2 447  GLY n 
2 448  THR n 
2 449  PHE n 
2 450  GLY n 
2 451  ILE n 
2 452  PRO n 
2 453  PHE n 
2 454  LEU n 
2 455  LEU n 
2 456  ARG n 
2 457  ILE n 
2 458  HIS n 
2 459  GLN n 
2 460  GLY n 
2 461  GLU n 
2 462  HIS n 
2 463  PHE n 
2 464  ARG n 
2 465  GLU n 
2 466  VAL n 
2 467  MET n 
2 468  LYS n 
2 469  ARG n 
2 470  ILE n 
2 471  GLN n 
2 472  SER n 
2 473  LEU n 
2 474  LEU n 
2 475  ASP n 
2 476  ILE n 
2 477  GLN n 
2 478  GLU n 
2 479  LYS n 
2 480  GLU n 
2 481  PHE n 
2 482  GLU n 
2 483  LYS n 
2 484  PHE n 
2 485  LYS n 
2 486  PHE n 
2 487  ALA n 
2 488  ILE n 
2 489  VAL n 
2 490  MET n 
2 491  MET n 
2 492  GLY n 
2 493  ARG n 
2 494  HIS n 
2 495  GLN n 
2 496  TYR n 
2 497  ILE n 
2 498  ASN n 
2 499  GLU n 
2 500  ASP n 
2 501  GLU n 
2 502  TYR n 
2 503  GLU n 
2 504  VAL n 
2 505  ASN n 
2 506  LEU n 
2 507  LYS n 
2 508  ASP n 
2 509  PHE n 
2 510  GLU n 
2 511  PRO n 
2 512  GLN n 
2 513  PRO n 
2 514  GLY n 
2 515  ASN n 
2 516  MET n 
2 517  SER n 
2 518  HIS n 
2 519  PRO n 
2 520  ARG n 
2 521  PRO n 
2 522  TRP n 
2 523  LEU n 
2 524  GLY n 
2 525  LEU n 
2 526  ASP n 
2 527  HIS n 
2 528  PHE n 
2 529  ASN n 
2 530  LYS n 
2 531  ALA n 
2 532  PRO n 
2 533  LYS n 
2 534  ARG n 
2 535  SER n 
2 536  ARG n 
2 537  TYR n 
2 538  THR n 
2 539  TYR n 
2 540  LEU n 
2 541  GLU n 
2 542  LYS n 
2 543  ALA n 
2 544  ILE n 
2 545  LYS n 
2 546  ILE n 
2 547  HIS n 
2 548  ASN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 1004 Human ? 'DNMT1, AIM, CXXC9, DNMT' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 548  Human ? 'USP7, HAUSP'             ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DNMT1_HUMAN P26358 ? 1 
;RRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQIEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGS
GRSKQACQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVGEAVKTDGKKSYYKKVCIDAETLEV
GDCVSVIPDDSSKPLYLARVTALWEDSSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVIYKAP
SENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPTEDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDS
RVLYYSATKNGILYRVGDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNLDAPEPYRIGRIKEI
FCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASYHADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGG
PNRFYFLEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIKLPKLRTLDVFSGCGGLSEGFHQAG
ISDTLWAIEMWDPAAQAFRLNNPGSTVFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRT
YSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAA
PGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQ
LRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCV
EAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGF
PDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKA
;
600 
2 UNP UBP7_HUMAN  Q93009 ? 2 
;EAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLD
NEADGNKTMIELSDNENPWTIFLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPV
MCDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFC
DKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQ
QLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELL
ECLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQSLLDIQEKEFEKFK
FAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
;
560 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YOC A 4 ? 1004 ? P26358 600 ? 1600 ? 600 1600 
2 2 4YOC C 6 ? 548  ? Q93009 560 ? 1102 ? 560 1102 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4YOC SER A 1 ? UNP P26358 ? ? 'expression tag' 597 1 
1 4YOC GLU A 2 ? UNP P26358 ? ? 'expression tag' 598 2 
1 4YOC PHE A 3 ? UNP P26358 ? ? 'expression tag' 599 3 
2 4YOC GLY C 1 ? UNP Q93009 ? ? 'expression tag' 555 4 
2 4YOC PRO C 2 ? UNP Q93009 ? ? 'expression tag' 556 5 
2 4YOC LEU C 3 ? UNP Q93009 ? ? 'expression tag' 557 6 
2 4YOC GLY C 4 ? UNP Q93009 ? ? 'expression tag' 558 7 
2 4YOC SER C 5 ? UNP Q93009 ? ? 'expression tag' 559 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YOC 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.83 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.56 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '6-8% PEG 3350, 200 mM potassium acetate' 
_exptl_crystal_grow.pdbx_pH_range   6.0-7.0 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-03-29 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'sagitally focused Si(111)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRF BEAMLINE BL17U' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL17U 
_diffrn_source.pdbx_synchrotron_site       SSRF 
# 
_reflns.B_iso_Wilson_estimate            61.620 
_reflns.entry_id                         4YOC 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.900 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       44471 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.000 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.800 
_reflns.pdbx_Rmerge_I_obs                0.146 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         19.087 
_reflns.pdbx_netI_over_sigmaI            8.100 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.063 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         615406 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.900 3.000  ? ? ? ? ? 4367 ? 100.000 ? ? ? ? 0.858 ? ? ? ? ? ? ? ? 13.500 ? 1.141 ? ? ? ? 0 1  1 ? ? 
3.000 3.120  ? ? ? ? ? 4395 ? 100.000 ? ? ? ? 0.619 ? ? ? ? ? ? ? ? 13.600 ? 1.140 ? ? ? ? 0 2  1 ? ? 
3.120 3.270  ? ? ? ? ? 4382 ? 99.900  ? ? ? ? 0.440 ? ? ? ? ? ? ? ? 13.600 ? 1.112 ? ? ? ? 0 3  1 ? ? 
3.270 3.440  ? ? ? ? ? 4392 ? 100.000 ? ? ? ? 0.303 ? ? ? ? ? ? ? ? 13.700 ? 1.085 ? ? ? ? 0 4  1 ? ? 
3.440 3.650  ? ? ? ? ? 4401 ? 100.000 ? ? ? ? 0.217 ? ? ? ? ? ? ? ? 13.800 ? 1.061 ? ? ? ? 0 5  1 ? ? 
3.650 3.940  ? ? ? ? ? 4416 ? 100.000 ? ? ? ? 0.175 ? ? ? ? ? ? ? ? 13.900 ? 1.022 ? ? ? ? 0 6  1 ? ? 
3.940 4.330  ? ? ? ? ? 4441 ? 100.000 ? ? ? ? 0.149 ? ? ? ? ? ? ? ? 14.200 ? 1.033 ? ? ? ? 0 7  1 ? ? 
4.330 4.960  ? ? ? ? ? 4462 ? 100.000 ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 14.300 ? 0.982 ? ? ? ? 0 8  1 ? ? 
4.960 6.240  ? ? ? ? ? 4516 ? 99.900  ? ? ? ? 0.103 ? ? ? ? ? ? ? ? 13.800 ? 1.091 ? ? ? ? 0 9  1 ? ? 
6.240 50.000 ? ? ? ? ? 4699 ? 99.800  ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 14.000 ? 0.983 ? ? ? ? 0 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                186.410 
_refine.B_iso_mean                               66.1918 
_refine.B_iso_min                                9.670 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4YOC 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.9160 
_refine.ls_d_res_low                             49.4190 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     44396 
_refine.ls_number_reflns_R_free                  1991 
_refine.ls_number_reflns_R_work                  42405 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.1600 
_refine.ls_percent_reflns_R_free                 4.4800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2100 
_refine.ls_R_factor_R_free                       0.2584 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2077 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '3SWR, 2YLM' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 27.8900 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3700 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.9160 
_refine_hist.d_res_low                        49.4190 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             11 
_refine_hist.number_atoms_total               11381 
_refine_hist.pdbx_number_residues_total       1411 
_refine_hist.pdbx_B_iso_mean_ligand           67.80 
_refine_hist.pdbx_B_iso_mean_solvent          42.54 
_refine_hist.pdbx_number_atoms_protein        11368 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 11649 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.892  ? 15743 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.035  ? 1662  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 2066  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 14.800 ? 4420  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.9162 2.9891  2813 . 124 2689 89.0000  . . . 0.4148 . 0.2899 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 2.9891 3.0699  3139 . 144 2995 100.0000 . . . 0.3739 . 0.2772 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.0699 3.1602  3161 . 146 3015 100.0000 . . . 0.3311 . 0.2660 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.1602 3.2622  3143 . 139 3004 100.0000 . . . 0.3418 . 0.2528 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.2622 3.3788  3158 . 148 3010 100.0000 . . . 0.2726 . 0.2409 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.3788 3.5140  3154 . 141 3013 100.0000 . . . 0.2730 . 0.2266 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.5140 3.6739  3198 . 146 3052 100.0000 . . . 0.2941 . 0.2234 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.6739 3.8675  3156 . 141 3015 100.0000 . . . 0.2548 . 0.2148 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 3.8675 4.1098  3206 . 142 3064 100.0000 . . . 0.2552 . 0.1967 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 4.1098 4.4269  3182 . 143 3039 100.0000 . . . 0.2180 . 0.1762 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 4.4269 4.8720  3203 . 140 3063 100.0000 . . . 0.1768 . 0.1610 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 4.8720 5.5762  3224 . 139 3085 100.0000 . . . 0.2241 . 0.1799 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 5.5762 7.0222  3264 . 143 3121 100.0000 . . . 0.2567 . 0.2103 . . . . . . 14 . . . 
'X-RAY DIFFRACTION' 7.0222 49.4262 3395 . 155 3240 99.0000  . . . 0.2536 . 0.2009 . . . . . . 14 . . . 
# 
_struct.entry_id                     4YOC 
_struct.title                        'Crystal Structure of human DNMT1 and USP7/HAUSP complex' 
_struct.pdbx_descriptor              'DNMT1, USP7' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YOC 
_struct_keywords.text            
'DNA methylation, Deubiquitination, DNA methyltransferase, Modification, TRANSFERASE-HYDROLASE complex' 
_struct_keywords.pdbx_keywords   TRANSFERASE/HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 25  ? THR A 34   ? THR A 621  THR A 630  1 ? 10 
HELX_P HELX_P2  AA2 THR A 205 ? THR A 207  ? THR A 801  THR A 803  5 ? 3  
HELX_P HELX_P3  AA3 LEU A 209 ? SER A 213  ? LEU A 805  SER A 809  5 ? 5  
HELX_P HELX_P4  AA4 ASN A 246 ? GLU A 250  ? ASN A 842  GLU A 846  5 ? 5  
HELX_P HELX_P5  AA5 CYS A 297 ? GLU A 310  ? CYS A 893  GLU A 906  1 ? 14 
HELX_P HELX_P6  AA6 GLU A 375 ? TYR A 380  ? GLU A 971  TYR A 976  5 ? 6  
HELX_P HELX_P7  AA7 ARG A 427 ? THR A 431  ? ARG A 1023 THR A 1027 5 ? 5  
HELX_P HELX_P8  AA8 SER A 434 ? TYR A 439  ? SER A 1030 TYR A 1035 5 ? 6  
HELX_P HELX_P9  AA9 LYS A 458 ? VAL A 460  ? LYS A 1054 VAL A 1056 5 ? 3  
HELX_P HELX_P10 AB1 CYS A 475 ? MET A 481  ? CYS A 1071 MET A 1077 1 ? 7  
HELX_P HELX_P11 AB2 PRO A 504 ? ARG A 508  ? PRO A 1100 ARG A 1104 5 ? 5  
HELX_P HELX_P12 AB3 GLY A 553 ? GLY A 563  ? GLY A 1149 GLY A 1159 1 ? 11 
HELX_P HELX_P13 AB4 TRP A 574 ? ASN A 585  ? TRP A 1170 ASN A 1181 1 ? 12 
HELX_P HELX_P14 AB5 ASP A 594 ? ALA A 604  ? ASP A 1190 ALA A 1200 1 ? 11 
HELX_P HELX_P15 AB6 ASN A 640 ? ASN A 649  ? ASN A 1236 ASN A 1245 1 ? 10 
HELX_P HELX_P16 AB7 SER A 650 ? ARG A 663  ? SER A 1246 ARG A 1259 1 ? 14 
HELX_P HELX_P17 AB8 ASN A 674 ? PHE A 678  ? ASN A 1270 PHE A 1274 5 ? 5  
HELX_P HELX_P18 AB9 SER A 681 ? GLY A 695  ? SER A 1277 GLY A 1291 1 ? 15 
HELX_P HELX_P19 AC1 GLY A 706 ? GLY A 709  ? GLY A 1302 GLY A 1305 5 ? 4  
HELX_P HELX_P20 AC2 ALA A 739 ? CYS A 743  ? ALA A 1335 CYS A 1339 5 ? 5  
HELX_P HELX_P21 AC3 THR A 770 ? SER A 776  ? THR A 1366 SER A 1372 1 ? 7  
HELX_P HELX_P22 AC4 SER A 798 ? GLY A 806  ? SER A 1394 GLY A 1402 1 ? 9  
HELX_P HELX_P23 AC5 SER A 822 ? HIS A 831  ? SER A 1418 HIS A 1427 1 ? 10 
HELX_P HELX_P24 AC6 ASP A 839 ? LEU A 843  ? ASP A 1435 LEU A 1439 5 ? 5  
HELX_P HELX_P25 AC7 CYS A 880 ? ALA A 885  ? CYS A 1476 ALA A 1481 5 ? 6  
HELX_P HELX_P26 AC8 ASP A 890 ? ARG A 894  ? ASP A 1486 ARG A 1490 5 ? 5  
HELX_P HELX_P27 AC9 TRP A 902 ? THR A 907  ? TRP A 1498 THR A 1503 1 ? 6  
HELX_P HELX_P28 AD1 GLY A 908 ? ALA A 915  ? GLY A 1504 ALA A 1511 5 ? 8  
HELX_P HELX_P29 AD2 SER A 953 ? GLN A 961  ? SER A 1549 GLN A 1557 1 ? 9  
HELX_P HELX_P30 AD3 ASN A 972 ? ASN A 982  ? ASN A 1568 ASN A 1578 1 ? 11 
HELX_P HELX_P31 AD4 PRO A 985 ? LYS A 1003 ? PRO A 1581 LYS A 1599 1 ? 19 
HELX_P HELX_P32 AD5 GLU B 6   ? HIS B 8    ? GLU C 560  HIS C 562  5 ? 3  
HELX_P HELX_P33 AD6 ASP B 19  ? PHE B 21   ? ASP C 573  PHE C 575  5 ? 3  
HELX_P HELX_P34 AD7 SER B 47  ? GLY B 60   ? SER C 601  GLY C 614  1 ? 14 
HELX_P HELX_P35 AD8 PRO B 62  ? ASP B 64   ? PRO C 616  ASP C 618  5 ? 3  
HELX_P HELX_P36 AD9 THR B 93  ? SER B 98   ? THR C 647  SER C 652  1 ? 6  
HELX_P HELX_P37 AE1 ASP B 112 ? ALA B 117  ? ASP C 666  ALA C 671  1 ? 6  
HELX_P HELX_P38 AE2 LYS B 158 ? ASP B 161  ? LYS C 712  ASP C 715  5 ? 4  
HELX_P HELX_P39 AE3 LEU B 162 ? ALA B 170  ? LEU C 716  ALA C 724  1 ? 9  
HELX_P HELX_P40 AE4 SER B 198 ? LEU B 203  ? SER C 752  LEU C 757  1 ? 6  
HELX_P HELX_P41 AE5 ASP B 218 ? SER B 224  ? ASP C 772  SER C 778  5 ? 7  
HELX_P HELX_P42 AE6 THR B 228 ? HIS B 238  ? THR C 782  HIS C 792  1 ? 11 
HELX_P HELX_P43 AE7 ASN B 264 ? ASN B 277  ? ASN C 818  ASN C 831  1 ? 14 
HELX_P HELX_P44 AE8 ASP B 279 ? MET B 281  ? ASP C 833  MET C 835  5 ? 3  
HELX_P HELX_P45 AE9 THR B 306 ? GLN B 312  ? THR C 860  GLN C 866  1 ? 7  
HELX_P HELX_P46 AF1 LYS B 330 ? ASN B 336  ? LYS C 884  ASN C 890  1 ? 7  
HELX_P HELX_P47 AF2 CYS B 363 ? VAL B 375  ? CYS C 917  VAL C 929  1 ? 13 
HELX_P HELX_P48 AF3 LEU B 404 ? LEU B 408  ? LEU C 958  LEU C 962  5 ? 5  
HELX_P HELX_P49 AF4 PRO B 422 ? ASP B 427  ? PRO C 976  ASP C 981  1 ? 6  
HELX_P HELX_P50 AF5 HIS B 462 ? ASP B 475  ? HIS C 1016 ASP C 1029 1 ? 14 
HELX_P HELX_P51 AF6 GLU B 480 ? PHE B 484  ? GLU C 1034 PHE C 1038 5 ? 5  
HELX_P HELX_P52 AF7 ASN B 505 ? PHE B 509  ? ASN C 1059 PHE C 1063 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 197 NE2 ? ? ? 1_555 D ZN . ZN ? ? A HIS 793  A ZN 1702 1_555 ? ? ? ? ? ? ? 2.081 ? 
metalc2 metalc ? ? A CYS 224 SG  ? ? ? 1_555 D ZN . ZN ? ? A CYS 820  A ZN 1702 1_555 ? ? ? ? ? ? ? 2.325 ? 
metalc3 metalc ? ? A CYS 297 SG  ? ? ? 1_555 D ZN . ZN ? ? A CYS 893  A ZN 1702 1_555 ? ? ? ? ? ? ? 2.302 ? 
metalc4 metalc ? ? A CYS 300 SG  ? ? ? 1_555 D ZN . ZN ? ? A CYS 896  A ZN 1702 1_555 ? ? ? ? ? ? ? 2.368 ? 
metalc5 metalc ? ? A CYS 880 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 1476 A ZN 1701 1_555 ? ? ? ? ? ? ? 2.470 ? 
metalc6 metalc ? ? A CYS 882 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 1478 A ZN 1701 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc7 metalc ? ? A CYS 889 SG  ? ? ? 1_555 C ZN . ZN ? ? A CYS 1485 A ZN 1701 1_555 ? ? ? ? ? ? ? 2.527 ? 
metalc8 metalc ? ? A HIS 906 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 1502 A ZN 1701 1_555 ? ? ? ? ? ? ? 2.220 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ASN 
_struct_mon_prot_cis.label_seq_id           102 
_struct_mon_prot_cis.label_asym_id          B 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ASN 
_struct_mon_prot_cis.auth_seq_id            656 
_struct_mon_prot_cis.auth_asym_id           C 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    103 
_struct_mon_prot_cis.pdbx_label_asym_id_2   B 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     657 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    C 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -6.40 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 7 ? 
AA3 ? 7 ? 
AA4 ? 3 ? 
AA5 ? 7 ? 
AA6 ? 7 ? 
AA7 ? 7 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 5 ? 
AB3 ? 5 ? 
AB4 ? 5 ? 
AB5 ? 5 ? 
AB6 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? parallel      
AA2 6 7 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? parallel      
AA3 6 7 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? parallel      
AA5 6 7 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? parallel      
AA6 6 7 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? parallel      
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA7 5 6 ? anti-parallel 
AA7 6 7 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? parallel      
AB3 3 4 ? anti-parallel 
AB3 4 5 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? parallel      
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? parallel      
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 135 ? VAL A 138 ? ILE A 731  VAL A 734  
AA1 2 LYS A 153 ? ILE A 156 ? LYS A 749  ILE A 752  
AA1 3 GLU A 159 ? GLU A 162 ? GLU A 755  GLU A 758  
AA2 1 LYS A 143 ? THR A 144 ? LYS A 739  THR A 740  
AA2 2 LYS A 148 ? TYR A 151 ? LYS A 744  TYR A 747  
AA2 3 TYR A 179 ? ASP A 189 ? TYR A 775  ASP A 785  
AA2 4 GLY A 193 ? ALA A 203 ? GLY A 789  ALA A 799  
AA2 5 GLU A 217 ? GLN A 228 ? GLU A 813  GLN A 824  
AA2 6 TYR A 267 ? ASP A 274 ? TYR A 863  ASP A 870  
AA2 7 VAL A 238 ? TYR A 240 ? VAL A 834  TYR A 836  
AA3 1 ILE A 232 ? VAL A 236 ? ILE A 828  VAL A 832  
AA3 2 CYS A 166 ? VAL A 169 ? CYS A 762  VAL A 765  
AA3 3 TYR A 179 ? ASP A 189 ? TYR A 775  ASP A 785  
AA3 4 GLY A 193 ? ALA A 203 ? GLY A 789  ALA A 799  
AA3 5 GLU A 217 ? GLN A 228 ? GLU A 813  GLN A 824  
AA3 6 TYR A 267 ? ASP A 274 ? TYR A 863  ASP A 870  
AA3 7 ARG A 279 ? GLU A 281 ? ARG A 875  GLU A 877  
AA4 1 ARG A 313 ? VAL A 314 ? ARG A 909  VAL A 910  
AA4 2 SER A 329 ? LYS A 332 ? SER A 925  LYS A 928  
AA4 3 ILE A 335 ? ARG A 338 ? ILE A 931  ARG A 934  
AA5 1 GLN A 317 ? ASP A 320 ? GLN A 913  ASP A 916  
AA5 2 ARG A 324 ? TYR A 327 ? ARG A 920  TYR A 923  
AA5 3 ARG A 396 ? PRO A 406 ? ARG A 992  PRO A 1002 
AA5 4 GLY A 342 ? LEU A 345 ? GLY A 938  LEU A 941  
AA5 5 GLY A 462 ? TYR A 468 ? GLY A 1058 TYR A 1064 
AA5 6 ARG A 486 ? ASN A 494 ? ARG A 1082 ASN A 1090 
AA5 7 SER A 499 ? GLU A 501 ? SER A 1095 GLU A 1097 
AA6 1 GLN A 317 ? ASP A 320 ? GLN A 913  ASP A 916  
AA6 2 ARG A 324 ? TYR A 327 ? ARG A 920  TYR A 923  
AA6 3 ARG A 396 ? PRO A 406 ? ARG A 992  PRO A 1002 
AA6 4 LYS A 419 ? TYR A 426 ? LYS A 1015 TYR A 1022 
AA6 5 LEU A 445 ? ASP A 456 ? LEU A 1041 ASP A 1052 
AA6 6 ARG A 486 ? ASN A 494 ? ARG A 1082 ASN A 1090 
AA6 7 SER A 499 ? GLU A 501 ? SER A 1095 GLU A 1097 
AA7 1 THR A 589 ? PHE A 591 ? THR A 1185 PHE A 1187 
AA7 2 SER A 565 ? ILE A 571 ? SER A 1161 ILE A 1167 
AA7 3 LEU A 543 ? VAL A 548 ? LEU A 1139 VAL A 1144 
AA7 4 MET A 623 ? GLY A 626 ? MET A 1219 GLY A 1222 
AA7 5 PHE A 666 ? VAL A 672 ? PHE A 1262 VAL A 1268 
AA7 6 ARG A 715 ? ALA A 722 ? ARG A 1311 ALA A 1318 
AA7 7 GLN A 697 ? GLN A 704 ? GLN A 1293 GLN A 1300 
AA8 1 VAL A 747 ? VAL A 749 ? VAL A 1343 VAL A 1345 
AA8 2 LYS A 752 ? PHE A 754 ? LYS A 1348 PHE A 1350 
AA9 1 GLU A 789 ? ILE A 790 ? GLU A 1385 ILE A 1386 
AA9 2 LEU A 813 ? ARG A 814 ? LEU A 1409 ARG A 1410 
AB1 1 VAL A 848 ? ARG A 849 ? VAL A 1444 ARG A 1445 
AB1 2 MET A 855 ? ALA A 856 ? MET A 1451 ALA A 1452 
AB2 1 THR B 38  ? LEU B 43  ? THR C 592  LEU C 597  
AB2 2 TYR B 10  ? ALA B 17  ? TYR C 564  ALA C 571  
AB2 3 TRP B 104 ? THR B 110 ? TRP C 658  THR C 664  
AB2 4 ILE B 66  ? ALA B 73  ? ILE C 620  ALA C 627  
AB2 5 LYS B 79  ? PRO B 81  ? LYS C 633  PRO C 635  
AB3 1 SER B 144 ? PRO B 154 ? SER C 698  PRO C 708  
AB3 2 ASP B 130 ? ASP B 139 ? ASP C 684  ASP C 693  
AB3 3 ILE B 211 ? LYS B 216 ? ILE C 765  LYS C 770  
AB3 4 LEU B 178 ? LYS B 185 ? LEU C 732  LYS C 739  
AB3 5 LEU B 188 ? ARG B 191 ? LEU C 742  ARG C 745  
AB4 1 PHE B 255 ? SER B 260 ? PHE C 809  SER C 814  
AB4 2 ARG B 239 ? ASP B 246 ? ARG C 793  ASP C 800  
AB4 3 LYS B 320 ? GLN B 326 ? LYS C 874  GLN C 880  
AB4 4 LEU B 283 ? SER B 288 ? LEU C 837  SER C 842  
AB4 5 PRO B 295 ? PRO B 298 ? PRO C 849  PRO C 852  
AB5 1 GLU B 351 ? LEU B 356 ? GLU C 905  LEU C 910  
AB5 2 PHE B 340 ? LEU B 345 ? PHE C 894  LEU C 899  
AB5 3 THR B 415 ? GLU B 420 ? THR C 969  GLU C 974  
AB5 4 LEU B 385 ? VAL B 391 ? LEU C 939  VAL C 945  
AB5 5 LYS B 394 ? HIS B 399 ? LYS C 948  HIS C 953  
AB6 1 THR B 448 ? ILE B 457 ? THR C 1002 ILE C 1011 
AB6 2 MET B 434 ? PHE B 441 ? MET C 988  PHE C 995  
AB6 3 TRP B 522 ? ASP B 526 ? TRP C 1076 ASP C 1080 
AB6 4 LYS B 485 ? MET B 490 ? LYS C 1039 MET C 1044 
AB6 5 ARG B 493 ? TYR B 496 ? ARG C 1047 TYR C 1050 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 138 ? N VAL A 734  O LYS A 153 ? O LYS A 749  
AA1 2 3 N VAL A 154 ? N VAL A 750  O LEU A 161 ? O LEU A 757  
AA2 1 2 N LYS A 143 ? N LYS A 739  O TYR A 150 ? O TYR A 746  
AA2 2 3 N SER A 149 ? N SER A 745  O GLU A 188 ? O GLU A 784  
AA2 3 4 N ASP A 189 ? N ASP A 785  O GLY A 193 ? O GLY A 789  
AA2 4 5 N PHE A 196 ? N PHE A 792  O MET A 227 ? O MET A 823  
AA2 5 6 N LEU A 220 ? N LEU A 816  O TYR A 273 ? O TYR A 869  
AA2 6 7 O TYR A 267 ? O TYR A 863  N ILE A 239 ? N ILE A 835  
AA3 1 2 O SER A 234 ? O SER A 830  N SER A 168 ? N SER A 764  
AA3 2 3 N VAL A 169 ? N VAL A 765  O TYR A 179 ? O TYR A 775  
AA3 3 4 N ASP A 189 ? N ASP A 785  O GLY A 193 ? O GLY A 789  
AA3 4 5 N PHE A 196 ? N PHE A 792  O MET A 227 ? O MET A 823  
AA3 5 6 N LEU A 220 ? N LEU A 816  O TYR A 273 ? O TYR A 869  
AA3 6 7 N ASP A 274 ? N ASP A 870  O ARG A 279 ? O ARG A 875  
AA4 1 2 N ARG A 313 ? N ARG A 909  O THR A 331 ? O THR A 927  
AA4 2 3 N ALA A 330 ? N ALA A 926  O TYR A 337 ? O TYR A 933  
AA5 1 2 N GLU A 319 ? N GLU A 915  O LEU A 326 ? O LEU A 922  
AA5 2 3 N TYR A 327 ? N TYR A 923  O ILE A 403 ? O ILE A 999  
AA5 3 4 O GLY A 398 ? O GLY A 994  N VAL A 343 ? N VAL A 939  
AA5 4 5 N TYR A 344 ? N TYR A 940  O GLY A 462 ? O GLY A 1058 
AA5 5 6 N THR A 465 ? N THR A 1061 O PHE A 487 ? O PHE A 1083 
AA5 6 7 N ASN A 494 ? N ASN A 1090 O SER A 499 ? O SER A 1095 
AA6 1 2 N GLU A 319 ? N GLU A 915  O LEU A 326 ? O LEU A 922  
AA6 2 3 N TYR A 327 ? N TYR A 923  O ILE A 403 ? O ILE A 999  
AA6 3 4 N PHE A 404 ? N PHE A 1000 O LYS A 419 ? O LYS A 1015 
AA6 4 5 N ILE A 420 ? N ILE A 1016 O VAL A 455 ? O VAL A 1051 
AA6 5 6 N TRP A 448 ? N TRP A 1044 O TYR A 493 ? O TYR A 1089 
AA6 6 7 N ASN A 494 ? N ASN A 1090 O SER A 499 ? O SER A 1095 
AA7 1 2 O THR A 589 ? O THR A 1185 N LEU A 568 ? N LEU A 1164 
AA7 2 3 O ASP A 566 ? O ASP A 1162 N LEU A 543 ? N LEU A 1139 
AA7 3 4 N LEU A 546 ? N LEU A 1142 O MET A 623 ? O MET A 1219 
AA7 4 5 N GLY A 626 ? N GLY A 1222 O GLU A 670 ? O GLU A 1266 
AA7 5 6 N LEU A 669 ? N LEU A 1265 O ILE A 719 ? O ILE A 1315 
AA7 6 7 O ILE A 718 ? O ILE A 1314 N GLY A 701 ? N GLY A 1297 
AA8 1 2 N VAL A 747 ? N VAL A 1343 O PHE A 754 ? O PHE A 1350 
AA9 1 2 N ILE A 790 ? N ILE A 1386 O LEU A 813 ? O LEU A 1409 
AB1 1 2 N VAL A 848 ? N VAL A 1444 O ALA A 856 ? O ALA A 1452 
AB2 1 2 O VAL B 42  ? O VAL C 596  N MET B 11  ? N MET C 565  
AB2 2 3 N GLN B 12  ? N GLN C 566  O TRP B 104 ? O TRP C 658  
AB2 3 4 O PHE B 107 ? O PHE C 661  N TRP B 69  ? N TRP C 623  
AB2 4 5 N GLN B 72  ? N GLN C 626  O ARG B 80  ? O ARG C 634  
AB3 1 2 O CYS B 148 ? O CYS C 702  N LEU B 135 ? N LEU C 689  
AB3 2 3 N PHE B 134 ? N PHE C 688  O ILE B 212 ? O ILE C 766  
AB3 3 4 O VAL B 213 ? O VAL C 767  N TYR B 181 ? N TYR C 735  
AB3 4 5 N GLU B 182 ? N GLU C 736  O GLU B 190 ? O GLU C 744  
AB4 1 2 O LEU B 259 ? O LEU C 813  N VAL B 240 ? N VAL C 794  
AB4 2 3 N ILE B 243 ? N ILE C 797  O LYS B 320 ? O LYS C 874  
AB4 3 4 O GLN B 325 ? O GLN C 879  N GLN B 284 ? N GLN C 838  
AB4 4 5 N LYS B 287 ? N LYS C 841  O GLY B 296 ? O GLY C 850  
AB5 1 2 O ILE B 354 ? O ILE C 908  N CYS B 342 ? N CYS C 896  
AB5 2 3 N ILE B 343 ? N ILE C 897  O ILE B 418 ? O ILE C 972  
AB5 3 4 O THR B 415 ? O THR C 969  N ILE B 390 ? N ILE C 944  
AB5 4 5 N VAL B 391 ? N VAL C 945  O LYS B 394 ? O LYS C 948  
AB6 1 2 O LEU B 455 ? O LEU C 1009 N VAL B 436 ? N VAL C 990  
AB6 2 3 N THR B 437 ? N THR C 991  O LEU B 523 ? O LEU C 1077 
AB6 3 4 O TRP B 522 ? O TRP C 1076 N VAL B 489 ? N VAL C 1043 
AB6 4 5 N MET B 490 ? N MET C 1044 O ARG B 493 ? O ARG C 1047 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1701 ? 4 'binding site for residue ZN A 1701' 
AC2 Software A ZN 1702 ? 4 'binding site for residue ZN A 1702' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 CYS A 880 ? CYS A 1476 . ? 1_555 ? 
2 AC1 4 CYS A 882 ? CYS A 1478 . ? 1_555 ? 
3 AC1 4 CYS A 889 ? CYS A 1485 . ? 1_555 ? 
4 AC1 4 HIS A 906 ? HIS A 1502 . ? 1_555 ? 
5 AC2 4 HIS A 197 ? HIS A 793  . ? 1_555 ? 
6 AC2 4 CYS A 224 ? CYS A 820  . ? 1_555 ? 
7 AC2 4 CYS A 297 ? CYS A 893  . ? 1_555 ? 
8 AC2 4 CYS A 300 ? CYS A 896  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YOC 
_atom_sites.fract_transf_matrix[1][1]   0.009072 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008959 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006102 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . PRO A 1 19   ? -80.661 17.273  15.143  1.00 118.34 ? 615  PRO A N   1 
ATOM   2     C  CA  . PRO A 1 19   ? -79.357 17.015  14.530  1.00 121.41 ? 615  PRO A CA  1 
ATOM   3     C  C   . PRO A 1 19   ? -78.358 16.417  15.515  1.00 112.28 ? 615  PRO A C   1 
ATOM   4     O  O   . PRO A 1 19   ? -77.411 15.745  15.102  1.00 93.15  ? 615  PRO A O   1 
ATOM   5     C  CB  . PRO A 1 19   ? -78.907 18.408  14.078  1.00 114.01 ? 615  PRO A CB  1 
ATOM   6     C  CG  . PRO A 1 19   ? -80.186 19.223  13.951  1.00 105.26 ? 615  PRO A CG  1 
ATOM   7     C  CD  . PRO A 1 19   ? -81.334 18.415  14.507  1.00 106.75 ? 615  PRO A CD  1 
ATOM   8     N  N   . THR A 1 20   ? -78.574 16.667  16.804  1.00 122.30 ? 616  THR A N   1 
ATOM   9     C  CA  . THR A 1 20   ? -77.658 16.219  17.848  1.00 116.25 ? 616  THR A CA  1 
ATOM   10    C  C   . THR A 1 20   ? -77.549 14.699  17.909  1.00 106.65 ? 616  THR A C   1 
ATOM   11    O  O   . THR A 1 20   ? -76.457 14.141  17.791  1.00 96.96  ? 616  THR A O   1 
ATOM   12    C  CB  . THR A 1 20   ? -78.095 16.735  19.232  1.00 93.74  ? 616  THR A CB  1 
ATOM   13    O  OG1 . THR A 1 20   ? -78.377 18.139  19.158  1.00 89.39  ? 616  THR A OG1 1 
ATOM   14    C  CG2 . THR A 1 20   ? -77.001 16.492  20.261  1.00 81.52  ? 616  THR A CG2 1 
ATOM   15    N  N   . LYS A 1 21   ? -78.686 14.036  18.088  1.00 88.75  ? 617  LYS A N   1 
ATOM   16    C  CA  . LYS A 1 21   ? -78.713 12.583  18.205  1.00 65.54  ? 617  LYS A CA  1 
ATOM   17    C  C   . LYS A 1 21   ? -78.336 11.924  16.885  1.00 77.71  ? 617  LYS A C   1 
ATOM   18    O  O   . LYS A 1 21   ? -78.836 12.302  15.825  1.00 79.70  ? 617  LYS A O   1 
ATOM   19    C  CB  . LYS A 1 21   ? -80.094 12.103  18.655  1.00 69.50  ? 617  LYS A CB  1 
ATOM   20    C  CG  . LYS A 1 21   ? -80.108 10.677  19.180  1.00 71.70  ? 617  LYS A CG  1 
ATOM   21    C  CD  . LYS A 1 21   ? -81.525 10.150  19.309  1.00 66.02  ? 617  LYS A CD  1 
ATOM   22    C  CE  . LYS A 1 21   ? -82.183 10.022  17.945  1.00 66.10  ? 617  LYS A CE  1 
ATOM   23    N  NZ  . LYS A 1 21   ? -83.546 9.429   18.036  1.00 72.29  ? 617  LYS A NZ  1 
ATOM   24    N  N   . ALA A 1 22   ? -77.448 10.939  16.956  1.00 62.38  ? 618  ALA A N   1 
ATOM   25    C  CA  . ALA A 1 22   ? -76.998 10.235  15.764  1.00 58.81  ? 618  ALA A CA  1 
ATOM   26    C  C   . ALA A 1 22   ? -77.971 9.133   15.375  1.00 53.33  ? 618  ALA A C   1 
ATOM   27    O  O   . ALA A 1 22   ? -78.461 8.395   16.231  1.00 60.63  ? 618  ALA A O   1 
ATOM   28    C  CB  . ALA A 1 22   ? -75.610 9.657   15.985  1.00 52.58  ? 618  ALA A CB  1 
ATOM   29    N  N   . THR A 1 23   ? -78.257 9.033   14.081  1.00 51.44  ? 619  THR A N   1 
ATOM   30    C  CA  . THR A 1 23   ? -79.023 7.911   13.560  1.00 50.00  ? 619  THR A CA  1 
ATOM   31    C  C   . THR A 1 23   ? -78.218 6.643   13.790  1.00 59.77  ? 619  THR A C   1 
ATOM   32    O  O   . THR A 1 23   ? -77.011 6.619   13.549  1.00 68.82  ? 619  THR A O   1 
ATOM   33    C  CB  . THR A 1 23   ? -79.340 8.071   12.066  1.00 43.15  ? 619  THR A CB  1 
ATOM   34    O  OG1 . THR A 1 23   ? -80.086 9.277   11.866  1.00 57.14  ? 619  THR A OG1 1 
ATOM   35    C  CG2 . THR A 1 23   ? -80.152 6.887   11.560  1.00 43.65  ? 619  THR A CG2 1 
ATOM   36    N  N   . THR A 1 24   ? -78.876 5.595   14.268  1.00 60.74  ? 620  THR A N   1 
ATOM   37    C  CA  . THR A 1 24   ? -78.155 4.407   14.698  1.00 52.37  ? 620  THR A CA  1 
ATOM   38    C  C   . THR A 1 24   ? -78.954 3.122   14.537  1.00 52.86  ? 620  THR A C   1 
ATOM   39    O  O   . THR A 1 24   ? -80.177 3.146   14.403  1.00 66.81  ? 620  THR A O   1 
ATOM   40    C  CB  . THR A 1 24   ? -77.734 4.536   16.172  1.00 40.25  ? 620  THR A CB  1 
ATOM   41    O  OG1 . THR A 1 24   ? -77.324 3.256   16.667  1.00 74.46  ? 620  THR A OG1 1 
ATOM   42    C  CG2 . THR A 1 24   ? -78.899 5.043   17.008  1.00 50.57  ? 620  THR A CG2 1 
ATOM   43    N  N   . THR A 1 25   ? -78.244 2.000   14.539  1.00 53.61  ? 621  THR A N   1 
ATOM   44    C  CA  . THR A 1 25   ? -78.877 0.692   14.603  1.00 46.39  ? 621  THR A CA  1 
ATOM   45    C  C   . THR A 1 25   ? -78.952 0.271   16.062  1.00 54.70  ? 621  THR A C   1 
ATOM   46    O  O   . THR A 1 25   ? -78.162 0.734   16.885  1.00 61.23  ? 621  THR A O   1 
ATOM   47    C  CB  . THR A 1 25   ? -78.107 -0.365  13.794  1.00 44.16  ? 621  THR A CB  1 
ATOM   48    O  OG1 . THR A 1 25   ? -76.755 -0.435  14.262  1.00 54.30  ? 621  THR A OG1 1 
ATOM   49    C  CG2 . THR A 1 25   ? -78.107 -0.010  12.317  1.00 51.40  ? 621  THR A CG2 1 
ATOM   50    N  N   . LYS A 1 26   ? -79.903 -0.598  16.382  1.00 54.17  ? 622  LYS A N   1 
ATOM   51    C  CA  . LYS A 1 26   ? -80.090 -1.042  17.758  1.00 61.74  ? 622  LYS A CA  1 
ATOM   52    C  C   . LYS A 1 26   ? -78.846 -1.754  18.275  1.00 57.42  ? 622  LYS A C   1 
ATOM   53    O  O   . LYS A 1 26   ? -78.504 -1.646  19.449  1.00 53.86  ? 622  LYS A O   1 
ATOM   54    C  CB  . LYS A 1 26   ? -81.313 -1.954  17.861  1.00 59.63  ? 622  LYS A CB  1 
ATOM   55    C  CG  . LYS A 1 26   ? -82.590 -1.303  17.360  1.00 72.47  ? 622  LYS A CG  1 
ATOM   56    C  CD  . LYS A 1 26   ? -83.811 -2.148  17.669  1.00 72.11  ? 622  LYS A CD  1 
ATOM   57    C  CE  . LYS A 1 26   ? -85.070 -1.508  17.110  1.00 76.12  ? 622  LYS A CE  1 
ATOM   58    N  NZ  . LYS A 1 26   ? -86.287 -2.311  17.411  1.00 84.52  ? 622  LYS A NZ  1 
ATOM   59    N  N   . LEU A 1 27   ? -78.167 -2.466  17.382  1.00 58.43  ? 623  LEU A N   1 
ATOM   60    C  CA  . LEU A 1 27   ? -76.930 -3.164  17.714  1.00 51.38  ? 623  LEU A CA  1 
ATOM   61    C  C   . LEU A 1 27   ? -75.854 -2.193  18.203  1.00 54.65  ? 623  LEU A C   1 
ATOM   62    O  O   . LEU A 1 27   ? -75.378 -2.288  19.340  1.00 55.96  ? 623  LEU A O   1 
ATOM   63    C  CB  . LEU A 1 27   ? -76.437 -3.946  16.492  1.00 44.22  ? 623  LEU A CB  1 
ATOM   64    C  CG  . LEU A 1 27   ? -75.191 -4.827  16.585  1.00 47.09  ? 623  LEU A CG  1 
ATOM   65    C  CD1 . LEU A 1 27   ? -75.365 -6.054  15.707  1.00 48.14  ? 623  LEU A CD1 1 
ATOM   66    C  CD2 . LEU A 1 27   ? -73.950 -4.058  16.163  1.00 48.82  ? 623  LEU A CD2 1 
ATOM   67    N  N   . VAL A 1 28   ? -75.483 -1.260  17.330  1.00 44.18  ? 624  VAL A N   1 
ATOM   68    C  CA  . VAL A 1 28   ? -74.468 -0.257  17.636  1.00 48.33  ? 624  VAL A CA  1 
ATOM   69    C  C   . VAL A 1 28   ? -74.849 0.566   18.862  1.00 57.48  ? 624  VAL A C   1 
ATOM   70    O  O   . VAL A 1 28   ? -74.034 0.769   19.774  1.00 64.87  ? 624  VAL A O   1 
ATOM   71    C  CB  . VAL A 1 28   ? -74.245 0.692   16.442  1.00 54.05  ? 624  VAL A CB  1 
ATOM   72    C  CG1 . VAL A 1 28   ? -73.269 1.795   16.811  1.00 50.77  ? 624  VAL A CG1 1 
ATOM   73    C  CG2 . VAL A 1 28   ? -73.747 -0.084  15.232  1.00 48.85  ? 624  VAL A CG2 1 
ATOM   74    N  N   . TYR A 1 29   ? -76.096 1.031   18.876  1.00 51.31  ? 625  TYR A N   1 
ATOM   75    C  CA  . TYR A 1 29   ? -76.607 1.821   19.987  1.00 55.10  ? 625  TYR A CA  1 
ATOM   76    C  C   . TYR A 1 29   ? -76.450 1.071   21.298  1.00 56.92  ? 625  TYR A C   1 
ATOM   77    O  O   . TYR A 1 29   ? -76.041 1.650   22.296  1.00 58.28  ? 625  TYR A O   1 
ATOM   78    C  CB  . TYR A 1 29   ? -78.075 2.190   19.775  1.00 50.18  ? 625  TYR A CB  1 
ATOM   79    C  CG  . TYR A 1 29   ? -78.670 2.938   20.947  1.00 53.27  ? 625  TYR A CG  1 
ATOM   80    C  CD1 . TYR A 1 29   ? -78.443 4.298   21.113  1.00 66.66  ? 625  TYR A CD1 1 
ATOM   81    C  CD2 . TYR A 1 29   ? -79.451 2.284   21.892  1.00 68.78  ? 625  TYR A CD2 1 
ATOM   82    C  CE1 . TYR A 1 29   ? -78.979 4.987   22.184  1.00 84.32  ? 625  TYR A CE1 1 
ATOM   83    C  CE2 . TYR A 1 29   ? -79.991 2.965   22.967  1.00 74.08  ? 625  TYR A CE2 1 
ATOM   84    C  CZ  . TYR A 1 29   ? -79.752 4.316   23.107  1.00 73.48  ? 625  TYR A CZ  1 
ATOM   85    O  OH  . TYR A 1 29   ? -80.287 5.000   24.175  1.00 87.24  ? 625  TYR A OH  1 
ATOM   86    N  N   . GLN A 1 30   ? -76.774 -0.218  21.290  1.00 56.32  ? 626  GLN A N   1 
ATOM   87    C  CA  . GLN A 1 30   ? -76.609 -1.042  22.479  1.00 54.98  ? 626  GLN A CA  1 
ATOM   88    C  C   . GLN A 1 30   ? -75.144 -1.148  22.867  1.00 49.61  ? 626  GLN A C   1 
ATOM   89    O  O   . GLN A 1 30   ? -74.806 -1.045  24.043  1.00 63.45  ? 626  GLN A O   1 
ATOM   90    C  CB  . GLN A 1 30   ? -77.197 -2.436  22.264  1.00 49.25  ? 626  GLN A CB  1 
ATOM   91    C  CG  . GLN A 1 30   ? -78.701 -2.495  22.435  1.00 60.02  ? 626  GLN A CG  1 
ATOM   92    C  CD  . GLN A 1 30   ? -79.270 -3.846  22.062  1.00 93.20  ? 626  GLN A CD  1 
ATOM   93    O  OE1 . GLN A 1 30   ? -78.545 -4.837  21.989  1.00 93.53  ? 626  GLN A OE1 1 
ATOM   94    N  NE2 . GLN A 1 30   ? -80.575 -3.892  21.817  1.00 72.73  ? 626  GLN A NE2 1 
ATOM   95    N  N   . ILE A 1 31   ? -74.279 -1.348  21.876  1.00 53.77  ? 627  ILE A N   1 
ATOM   96    C  CA  . ILE A 1 31   ? -72.843 -1.427  22.134  1.00 45.60  ? 627  ILE A CA  1 
ATOM   97    C  C   . ILE A 1 31   ? -72.340 -0.188  22.865  1.00 53.10  ? 627  ILE A C   1 
ATOM   98    O  O   . ILE A 1 31   ? -71.607 -0.292  23.848  1.00 61.49  ? 627  ILE A O   1 
ATOM   99    C  CB  . ILE A 1 31   ? -72.038 -1.599  20.833  1.00 57.60  ? 627  ILE A CB  1 
ATOM   100   C  CG1 . ILE A 1 31   ? -72.234 -3.006  20.270  1.00 56.87  ? 627  ILE A CG1 1 
ATOM   101   C  CG2 . ILE A 1 31   ? -70.558 -1.358  21.086  1.00 40.03  ? 627  ILE A CG2 1 
ATOM   102   C  CD1 . ILE A 1 31   ? -71.639 -4.090  21.138  1.00 47.54  ? 627  ILE A CD1 1 
ATOM   103   N  N   . PHE A 1 32   ? -72.750 0.986   22.396  1.00 54.16  ? 628  PHE A N   1 
ATOM   104   C  CA  . PHE A 1 32   ? -72.277 2.230   22.997  1.00 61.16  ? 628  PHE A CA  1 
ATOM   105   C  C   . PHE A 1 32   ? -73.078 2.654   24.231  1.00 68.34  ? 628  PHE A C   1 
ATOM   106   O  O   . PHE A 1 32   ? -72.688 3.585   24.937  1.00 70.67  ? 628  PHE A O   1 
ATOM   107   C  CB  . PHE A 1 32   ? -72.288 3.355   21.961  1.00 60.92  ? 628  PHE A CB  1 
ATOM   108   C  CG  . PHE A 1 32   ? -71.207 3.232   20.927  1.00 58.11  ? 628  PHE A CG  1 
ATOM   109   C  CD1 . PHE A 1 32   ? -71.418 2.504   19.768  1.00 55.69  ? 628  PHE A CD1 1 
ATOM   110   C  CD2 . PHE A 1 32   ? -69.977 3.839   21.115  1.00 51.97  ? 628  PHE A CD2 1 
ATOM   111   C  CE1 . PHE A 1 32   ? -70.423 2.386   18.816  1.00 50.35  ? 628  PHE A CE1 1 
ATOM   112   C  CE2 . PHE A 1 32   ? -68.978 3.725   20.164  1.00 47.47  ? 628  PHE A CE2 1 
ATOM   113   C  CZ  . PHE A 1 32   ? -69.204 2.997   19.013  1.00 58.95  ? 628  PHE A CZ  1 
ATOM   114   N  N   . ASP A 1 33   ? -74.190 1.974   24.492  1.00 72.32  ? 629  ASP A N   1 
ATOM   115   C  CA  . ASP A 1 33   ? -75.021 2.295   25.650  1.00 70.54  ? 629  ASP A CA  1 
ATOM   116   C  C   . ASP A 1 33   ? -74.755 1.333   26.802  1.00 89.82  ? 629  ASP A C   1 
ATOM   117   O  O   . ASP A 1 33   ? -74.781 1.722   27.970  1.00 93.24  ? 629  ASP A O   1 
ATOM   118   C  CB  . ASP A 1 33   ? -76.505 2.265   25.281  1.00 79.28  ? 629  ASP A CB  1 
ATOM   119   C  CG  . ASP A 1 33   ? -77.395 2.774   26.396  1.00 87.56  ? 629  ASP A CG  1 
ATOM   120   O  OD1 . ASP A 1 33   ? -77.090 3.847   26.960  1.00 104.45 ? 629  ASP A OD1 1 
ATOM   121   O  OD2 . ASP A 1 33   ? -78.396 2.099   26.713  1.00 87.25  ? 629  ASP A OD2 1 
ATOM   122   N  N   . THR A 1 34   ? -74.491 0.074   26.463  1.00 86.56  ? 630  THR A N   1 
ATOM   123   C  CA  . THR A 1 34   ? -74.224 -0.955  27.463  1.00 77.38  ? 630  THR A CA  1 
ATOM   124   C  C   . THR A 1 34   ? -72.830 -0.778  28.062  1.00 72.62  ? 630  THR A C   1 
ATOM   125   O  O   . THR A 1 34   ? -72.433 -1.505  28.972  1.00 86.61  ? 630  THR A O   1 
ATOM   126   C  CB  . THR A 1 34   ? -74.347 -2.371  26.859  1.00 73.75  ? 630  THR A CB  1 
ATOM   127   O  OG1 . THR A 1 34   ? -75.336 -2.369  25.821  1.00 88.59  ? 630  THR A OG1 1 
ATOM   128   C  CG2 . THR A 1 34   ? -74.737 -3.385  27.924  1.00 92.68  ? 630  THR A CG2 1 
ATOM   129   N  N   . PHE A 1 35   ? -72.089 0.190   27.533  1.00 75.51  ? 631  PHE A N   1 
ATOM   130   C  CA  . PHE A 1 35   ? -70.721 0.451   27.962  1.00 79.43  ? 631  PHE A CA  1 
ATOM   131   C  C   . PHE A 1 35   ? -70.600 1.574   29.004  1.00 85.85  ? 631  PHE A C   1 
ATOM   132   O  O   . PHE A 1 35   ? -69.507 1.835   29.506  1.00 87.58  ? 631  PHE A O   1 
ATOM   133   C  CB  . PHE A 1 35   ? -69.858 0.779   26.734  1.00 73.07  ? 631  PHE A CB  1 
ATOM   134   C  CG  . PHE A 1 35   ? -68.458 1.189   27.072  1.00 69.78  ? 631  PHE A CG  1 
ATOM   135   C  CD1 . PHE A 1 35   ? -67.540 0.254   27.517  1.00 68.92  ? 631  PHE A CD1 1 
ATOM   136   C  CD2 . PHE A 1 35   ? -68.072 2.517   26.990  1.00 70.76  ? 631  PHE A CD2 1 
ATOM   137   C  CE1 . PHE A 1 35   ? -66.257 0.632   27.850  1.00 66.62  ? 631  PHE A CE1 1 
ATOM   138   C  CE2 . PHE A 1 35   ? -66.791 2.900   27.325  1.00 58.50  ? 631  PHE A CE2 1 
ATOM   139   C  CZ  . PHE A 1 35   ? -65.885 1.957   27.757  1.00 66.70  ? 631  PHE A CZ  1 
ATOM   140   N  N   . PHE A 1 36   ? -71.728 2.146   29.418  1.00 96.55  ? 632  PHE A N   1 
ATOM   141   C  CA  . PHE A 1 36   ? -71.784 3.543   29.868  1.00 109.60 ? 632  PHE A CA  1 
ATOM   142   C  C   . PHE A 1 36   ? -70.622 3.985   30.763  1.00 112.59 ? 632  PHE A C   1 
ATOM   143   O  O   . PHE A 1 36   ? -69.832 4.843   30.366  1.00 84.82  ? 632  PHE A O   1 
ATOM   144   C  CB  . PHE A 1 36   ? -73.107 3.792   30.597  1.00 108.87 ? 632  PHE A CB  1 
ATOM   145   C  CG  . PHE A 1 36   ? -73.588 5.209   30.500  1.00 114.89 ? 632  PHE A CG  1 
ATOM   146   C  CD1 . PHE A 1 36   ? -73.577 5.870   29.283  1.00 100.57 ? 632  PHE A CD1 1 
ATOM   147   C  CD2 . PHE A 1 36   ? -74.065 5.875   31.616  1.00 119.57 ? 632  PHE A CD2 1 
ATOM   148   C  CE1 . PHE A 1 36   ? -74.020 7.172   29.181  1.00 110.85 ? 632  PHE A CE1 1 
ATOM   149   C  CE2 . PHE A 1 36   ? -74.513 7.180   31.520  1.00 119.76 ? 632  PHE A CE2 1 
ATOM   150   C  CZ  . PHE A 1 36   ? -74.490 7.829   30.301  1.00 119.47 ? 632  PHE A CZ  1 
ATOM   151   N  N   . ALA A 1 37   ? -70.507 3.414   31.955  1.00 129.61 ? 633  ALA A N   1 
ATOM   152   C  CA  . ALA A 1 37   ? -69.362 3.717   32.811  1.00 128.97 ? 633  ALA A CA  1 
ATOM   153   C  C   . ALA A 1 37   ? -68.880 2.480   33.562  1.00 117.91 ? 633  ALA A C   1 
ATOM   154   O  O   . ALA A 1 37   ? -68.805 1.389   32.994  1.00 89.99  ? 633  ALA A O   1 
ATOM   155   C  CB  . ALA A 1 37   ? -69.708 4.829   33.789  1.00 101.67 ? 633  ALA A CB  1 
ATOM   156   N  N   . ASP A 1 106  ? -53.493 19.047  15.076  1.00 112.83 ? 702  ASP A N   1 
ATOM   157   C  CA  . ASP A 1 106  ? -53.642 18.680  16.478  1.00 132.79 ? 702  ASP A CA  1 
ATOM   158   C  C   . ASP A 1 106  ? -53.009 17.318  16.745  1.00 142.65 ? 702  ASP A C   1 
ATOM   159   O  O   . ASP A 1 106  ? -53.677 16.378  17.175  1.00 141.45 ? 702  ASP A O   1 
ATOM   160   C  CB  . ASP A 1 106  ? -55.121 18.676  16.879  1.00 131.14 ? 702  ASP A CB  1 
ATOM   161   C  CG  . ASP A 1 106  ? -55.324 18.509  18.376  1.00 130.12 ? 702  ASP A CG  1 
ATOM   162   O  OD1 . ASP A 1 106  ? -55.031 19.461  19.130  1.00 128.58 ? 702  ASP A OD1 1 
ATOM   163   O  OD2 . ASP A 1 106  ? -55.785 17.427  18.798  1.00 113.32 ? 702  ASP A OD2 1 
ATOM   164   N  N   . GLU A 1 107  ? -51.715 17.213  16.465  1.00 133.61 ? 703  GLU A N   1 
ATOM   165   C  CA  . GLU A 1 107  ? -50.959 16.023  16.829  1.00 130.37 ? 703  GLU A CA  1 
ATOM   166   C  C   . GLU A 1 107  ? -50.155 16.290  18.096  1.00 120.88 ? 703  GLU A C   1 
ATOM   167   O  O   . GLU A 1 107  ? -49.228 17.100  18.098  1.00 117.29 ? 703  GLU A O   1 
ATOM   168   C  CB  . GLU A 1 107  ? -50.036 15.588  15.689  1.00 119.59 ? 703  GLU A CB  1 
ATOM   169   C  CG  . GLU A 1 107  ? -48.973 14.585  16.112  1.00 127.06 ? 703  GLU A CG  1 
ATOM   170   C  CD  . GLU A 1 107  ? -48.897 13.382  15.193  1.00 101.82 ? 703  GLU A CD  1 
ATOM   171   O  OE1 . GLU A 1 107  ? -49.963 12.861  14.802  1.00 78.21  ? 703  GLU A OE1 1 
ATOM   172   O  OE2 . GLU A 1 107  ? -47.770 12.955  14.866  1.00 107.10 ? 703  GLU A OE2 1 
ATOM   173   N  N   . GLU A 1 108  ? -50.517 15.600  19.171  1.00 117.36 ? 704  GLU A N   1 
ATOM   174   C  CA  . GLU A 1 108  ? -49.839 15.745  20.451  1.00 128.17 ? 704  GLU A CA  1 
ATOM   175   C  C   . GLU A 1 108  ? -48.635 14.820  20.505  1.00 144.38 ? 704  GLU A C   1 
ATOM   176   O  O   . GLU A 1 108  ? -47.994 14.685  21.548  1.00 149.00 ? 704  GLU A O   1 
ATOM   177   C  CB  . GLU A 1 108  ? -50.799 15.452  21.610  1.00 114.83 ? 704  GLU A CB  1 
ATOM   178   C  CG  . GLU A 1 108  ? -52.133 16.180  21.518  1.00 124.01 ? 704  GLU A CG  1 
ATOM   179   C  CD  . GLU A 1 108  ? -51.972 17.667  21.257  1.00 133.20 ? 704  GLU A CD  1 
ATOM   180   O  OE1 . GLU A 1 108  ? -51.118 18.304  21.911  1.00 136.78 ? 704  GLU A OE1 1 
ATOM   181   O  OE2 . GLU A 1 108  ? -52.699 18.203  20.392  1.00 116.41 ? 704  GLU A OE2 1 
ATOM   182   N  N   . VAL A 1 109  ? -48.387 14.151  19.378  1.00 131.90 ? 705  VAL A N   1 
ATOM   183   C  CA  . VAL A 1 109  ? -47.304 13.175  19.192  1.00 138.94 ? 705  VAL A CA  1 
ATOM   184   C  C   . VAL A 1 109  ? -47.178 12.238  20.403  1.00 148.08 ? 705  VAL A C   1 
ATOM   185   O  O   . VAL A 1 109  ? -46.243 12.306  21.202  1.00 154.06 ? 705  VAL A O   1 
ATOM   186   C  CB  . VAL A 1 109  ? -45.934 13.869  18.827  1.00 142.17 ? 705  VAL A CB  1 
ATOM   187   C  CG1 . VAL A 1 109  ? -45.426 14.847  19.900  1.00 133.50 ? 705  VAL A CG1 1 
ATOM   188   C  CG2 . VAL A 1 109  ? -44.882 12.823  18.474  1.00 140.50 ? 705  VAL A CG2 1 
ATOM   189   N  N   . ASP A 1 110  ? -48.176 11.369  20.530  1.00 134.46 ? 706  ASP A N   1 
ATOM   190   C  CA  . ASP A 1 110  ? -48.254 10.421  21.634  1.00 140.20 ? 706  ASP A CA  1 
ATOM   191   C  C   . ASP A 1 110  ? -47.088 9.436   21.660  1.00 148.14 ? 706  ASP A C   1 
ATOM   192   O  O   . ASP A 1 110  ? -46.866 8.771   22.671  1.00 149.05 ? 706  ASP A O   1 
ATOM   193   C  CB  . ASP A 1 110  ? -49.577 9.651   21.572  1.00 116.74 ? 706  ASP A CB  1 
ATOM   194   C  CG  . ASP A 1 110  ? -49.866 8.881   22.848  1.00 130.95 ? 706  ASP A CG  1 
ATOM   195   O  OD1 . ASP A 1 110  ? -50.266 9.515   23.847  1.00 102.73 ? 706  ASP A OD1 1 
ATOM   196   O  OD2 . ASP A 1 110  ? -49.698 7.642   22.854  1.00 127.27 ? 706  ASP A OD2 1 
ATOM   197   N  N   . ASP A 1 111  ? -46.338 9.327   20.566  1.00 150.56 ? 707  ASP A N   1 
ATOM   198   C  CA  . ASP A 1 111  ? -45.205 8.415   20.591  1.00 147.72 ? 707  ASP A CA  1 
ATOM   199   C  C   . ASP A 1 111  ? -43.865 9.022   20.183  1.00 148.82 ? 707  ASP A C   1 
ATOM   200   O  O   . ASP A 1 111  ? -43.626 9.360   19.026  1.00 147.64 ? 707  ASP A O   1 
ATOM   201   C  CB  . ASP A 1 111  ? -45.499 7.199   19.702  1.00 136.46 ? 707  ASP A CB  1 
ATOM   202   C  CG  . ASP A 1 111  ? -46.112 7.585   18.369  1.00 115.56 ? 707  ASP A CG  1 
ATOM   203   O  OD1 . ASP A 1 111  ? -46.769 8.645   18.301  1.00 110.13 ? 707  ASP A OD1 1 
ATOM   204   O  OD2 . ASP A 1 111  ? -45.944 6.826   17.392  1.00 98.58  ? 707  ASP A OD2 1 
ATOM   205   N  N   . ASN A 1 112  ? -43.000 9.140   21.183  1.00 150.61 ? 708  ASN A N   1 
ATOM   206   C  CA  . ASN A 1 112  ? -41.564 9.009   21.027  1.00 147.77 ? 708  ASN A CA  1 
ATOM   207   C  C   . ASN A 1 112  ? -41.286 7.980   22.101  1.00 150.51 ? 708  ASN A C   1 
ATOM   208   O  O   . ASN A 1 112  ? -41.397 8.280   23.288  1.00 146.28 ? 708  ASN A O   1 
ATOM   209   C  CB  . ASN A 1 112  ? -40.816 10.318  21.262  1.00 148.12 ? 708  ASN A CB  1 
ATOM   210   C  CG  . ASN A 1 112  ? -41.507 11.509  20.627  1.00 146.42 ? 708  ASN A CG  1 
ATOM   211   O  OD1 . ASN A 1 112  ? -42.373 12.133  21.239  1.00 145.60 ? 708  ASN A OD1 1 
ATOM   212   N  ND2 . ASN A 1 112  ? -41.124 11.831  19.397  1.00 138.84 ? 708  ASN A ND2 1 
ATOM   213   N  N   . ILE A 1 113  ? -40.916 6.772   21.696  1.00 158.23 ? 709  ILE A N   1 
ATOM   214   C  CA  . ILE A 1 113  ? -41.337 5.617   22.481  1.00 175.83 ? 709  ILE A CA  1 
ATOM   215   C  C   . ILE A 1 113  ? -40.289 4.928   23.358  1.00 169.87 ? 709  ILE A C   1 
ATOM   216   O  O   . ILE A 1 113  ? -39.198 4.577   22.911  1.00 155.89 ? 709  ILE A O   1 
ATOM   217   C  CB  . ILE A 1 113  ? -42.002 4.557   21.552  1.00 164.95 ? 709  ILE A CB  1 
ATOM   218   C  CG1 . ILE A 1 113  ? -42.830 3.568   22.378  1.00 149.63 ? 709  ILE A CG1 1 
ATOM   219   C  CG2 . ILE A 1 113  ? -40.988 3.863   20.640  1.00 146.50 ? 709  ILE A CG2 1 
ATOM   220   C  CD1 . ILE A 1 113  ? -43.992 4.217   23.102  1.00 141.06 ? 709  ILE A CD1 1 
ATOM   221   N  N   . PRO A 1 114  ? -40.628 4.785   24.647  1.00 169.15 ? 710  PRO A N   1 
ATOM   222   C  CA  . PRO A 1 114  ? -40.042 3.809   25.567  1.00 162.26 ? 710  PRO A CA  1 
ATOM   223   C  C   . PRO A 1 114  ? -40.583 2.434   25.200  1.00 160.90 ? 710  PRO A C   1 
ATOM   224   O  O   . PRO A 1 114  ? -41.514 1.938   25.835  1.00 161.88 ? 710  PRO A O   1 
ATOM   225   C  CB  . PRO A 1 114  ? -40.531 4.272   26.941  1.00 148.27 ? 710  PRO A CB  1 
ATOM   226   C  CG  . PRO A 1 114  ? -41.772 5.046   26.656  1.00 147.05 ? 710  PRO A CG  1 
ATOM   227   C  CD  . PRO A 1 114  ? -41.544 5.712   25.337  1.00 156.06 ? 710  PRO A CD  1 
ATOM   228   N  N   . GLU A 1 115  ? -39.995 1.841   24.164  1.00 149.58 ? 711  GLU A N   1 
ATOM   229   C  CA  . GLU A 1 115  ? -40.586 0.720   23.427  1.00 152.22 ? 711  GLU A CA  1 
ATOM   230   C  C   . GLU A 1 115  ? -40.785 -0.563  24.231  1.00 156.00 ? 711  GLU A C   1 
ATOM   231   O  O   . GLU A 1 115  ? -40.114 -0.782  25.235  1.00 144.31 ? 711  GLU A O   1 
ATOM   232   C  CB  . GLU A 1 115  ? -39.724 0.422   22.193  1.00 146.01 ? 711  GLU A CB  1 
ATOM   233   C  CG  . GLU A 1 115  ? -38.231 0.491   22.459  1.00 143.42 ? 711  GLU A CG  1 
ATOM   234   C  CD  . GLU A 1 115  ? -37.419 0.359   21.182  1.00 127.92 ? 711  GLU A CD  1 
ATOM   235   O  OE1 . GLU A 1 115  ? -36.424 -0.396  21.174  1.00 123.76 ? 711  GLU A OE1 1 
ATOM   236   O  OE2 . GLU A 1 115  ? -37.774 1.019   20.182  1.00 123.62 ? 711  GLU A OE2 1 
ATOM   237   N  N   . MET A 1 116  ? -41.708 -1.411  23.768  1.00 146.75 ? 712  MET A N   1 
ATOM   238   C  CA  . MET A 1 116  ? -42.075 -2.652  24.477  1.00 135.55 ? 712  MET A CA  1 
ATOM   239   C  C   . MET A 1 116  ? -41.929 -3.895  23.602  1.00 134.23 ? 712  MET A C   1 
ATOM   240   O  O   . MET A 1 116  ? -42.203 -3.859  22.397  1.00 146.48 ? 712  MET A O   1 
ATOM   241   C  CB  . MET A 1 116  ? -43.524 -2.585  24.992  1.00 129.05 ? 712  MET A CB  1 
ATOM   242   C  CG  . MET A 1 116  ? -43.933 -1.243  25.560  1.00 130.96 ? 712  MET A CG  1 
ATOM   243   S  SD  . MET A 1 116  ? -45.563 -1.187  26.334  1.00 152.07 ? 712  MET A SD  1 
ATOM   244   C  CE  . MET A 1 116  ? -45.449 0.326   27.291  1.00 105.61 ? 712  MET A CE  1 
ATOM   245   N  N   . PRO A 1 117  ? -41.440 -4.988  24.184  1.00 139.72 ? 713  PRO A N   1 
ATOM   246   C  CA  . PRO A 1 117  ? -41.311 -6.164  23.325  1.00 136.53 ? 713  PRO A CA  1 
ATOM   247   C  C   . PRO A 1 117  ? -42.643 -6.745  22.797  1.00 134.65 ? 713  PRO A C   1 
ATOM   248   O  O   . PRO A 1 117  ? -42.736 -6.947  21.585  1.00 129.78 ? 713  PRO A O   1 
ATOM   249   C  CB  . PRO A 1 117  ? -40.615 -7.150  24.239  1.00 135.45 ? 713  PRO A CB  1 
ATOM   250   C  CG  . PRO A 1 117  ? -41.134 -6.794  25.588  1.00 131.11 ? 713  PRO A CG  1 
ATOM   251   C  CD  . PRO A 1 117  ? -41.122 -5.290  25.587  1.00 133.66 ? 713  PRO A CD  1 
ATOM   252   N  N   . SER A 1 118  ? -43.599 -6.990  23.706  1.00 153.80 ? 714  SER A N   1 
ATOM   253   C  CA  . SER A 1 118  ? -45.057 -7.082  23.508  1.00 131.93 ? 714  SER A CA  1 
ATOM   254   C  C   . SER A 1 118  ? -45.576 -8.290  22.699  1.00 146.41 ? 714  SER A C   1 
ATOM   255   O  O   . SER A 1 118  ? -44.805 -8.948  22.005  1.00 152.44 ? 714  SER A O   1 
ATOM   256   C  CB  . SER A 1 118  ? -45.593 -5.780  22.950  1.00 126.44 ? 714  SER A CB  1 
ATOM   257   O  OG  . SER A 1 118  ? -46.105 -4.965  24.024  1.00 105.42 ? 714  SER A OG  1 
ATOM   258   N  N   . PRO A 1 119  ? -46.925 -8.500  22.725  1.00 121.41 ? 715  PRO A N   1 
ATOM   259   C  CA  . PRO A 1 119  ? -47.481 -9.573  23.573  1.00 131.72 ? 715  PRO A CA  1 
ATOM   260   C  C   . PRO A 1 119  ? -47.193 -11.065 23.339  1.00 134.74 ? 715  PRO A C   1 
ATOM   261   O  O   . PRO A 1 119  ? -48.113 -11.817 23.001  1.00 130.57 ? 715  PRO A O   1 
ATOM   262   C  CB  . PRO A 1 119  ? -49.017 -9.399  23.438  1.00 125.00 ? 715  PRO A CB  1 
ATOM   263   C  CG  . PRO A 1 119  ? -49.245 -8.314  22.463  1.00 113.21 ? 715  PRO A CG  1 
ATOM   264   C  CD  . PRO A 1 119  ? -47.954 -7.977  21.801  1.00 98.82  ? 715  PRO A CD  1 
ATOM   265   N  N   . LYS A 1 120  ? -45.953 -11.491 23.560  1.00 127.34 ? 716  LYS A N   1 
ATOM   266   C  CA  . LYS A 1 120  ? -45.734 -12.358 24.718  1.00 124.43 ? 716  LYS A CA  1 
ATOM   267   C  C   . LYS A 1 120  ? -46.824 -13.435 24.884  1.00 141.04 ? 716  LYS A C   1 
ATOM   268   O  O   . LYS A 1 120  ? -47.780 -13.205 25.630  1.00 127.28 ? 716  LYS A O   1 
ATOM   269   C  CB  . LYS A 1 120  ? -45.632 -11.470 25.945  1.00 124.55 ? 716  LYS A CB  1 
ATOM   270   C  CG  . LYS A 1 120  ? -45.450 -12.192 27.267  1.00 118.21 ? 716  LYS A CG  1 
ATOM   271   C  CD  . LYS A 1 120  ? -46.631 -11.916 28.180  1.00 124.05 ? 716  LYS A CD  1 
ATOM   272   C  CE  . LYS A 1 120  ? -46.632 -10.479 28.686  1.00 118.63 ? 716  LYS A CE  1 
ATOM   273   N  NZ  . LYS A 1 120  ? -45.586 -10.239 29.724  1.00 105.10 ? 716  LYS A NZ  1 
ATOM   274   N  N   . LYS A 1 121  ? -46.785 -14.517 24.099  1.00 149.56 ? 717  LYS A N   1 
ATOM   275   C  CA  . LYS A 1 121  ? -47.887 -15.498 24.109  1.00 140.09 ? 717  LYS A CA  1 
ATOM   276   C  C   . LYS A 1 121  ? -48.237 -15.899 25.536  1.00 130.89 ? 717  LYS A C   1 
ATOM   277   O  O   . LYS A 1 121  ? -47.380 -16.308 26.307  1.00 144.58 ? 717  LYS A O   1 
ATOM   278   C  CB  . LYS A 1 121  ? -47.518 -16.738 23.289  1.00 117.48 ? 717  LYS A CB  1 
ATOM   279   C  CG  . LYS A 1 121  ? -46.878 -16.448 21.954  1.00 119.28 ? 717  LYS A CG  1 
ATOM   280   C  CD  . LYS A 1 121  ? -47.690 -15.407 21.215  1.00 126.82 ? 717  LYS A CD  1 
ATOM   281   C  CE  . LYS A 1 121  ? -46.904 -14.779 20.090  1.00 104.46 ? 717  LYS A CE  1 
ATOM   282   N  NZ  . LYS A 1 121  ? -46.884 -15.665 18.903  1.00 100.23 ? 717  LYS A NZ  1 
ATOM   283   N  N   . MET A 1 122  ? -49.525 -15.788 25.844  1.00 116.56 ? 718  MET A N   1 
ATOM   284   C  CA  . MET A 1 122  ? -49.991 -15.511 27.203  1.00 115.62 ? 718  MET A CA  1 
ATOM   285   C  C   . MET A 1 122  ? -50.111 -16.678 28.182  1.00 120.16 ? 718  MET A C   1 
ATOM   286   O  O   . MET A 1 122  ? -50.152 -16.475 29.398  1.00 121.83 ? 718  MET A O   1 
ATOM   287   C  CB  . MET A 1 122  ? -51.351 -14.813 27.110  1.00 116.94 ? 718  MET A CB  1 
ATOM   288   C  CG  . MET A 1 122  ? -52.053 -15.025 25.771  1.00 101.84 ? 718  MET A CG  1 
ATOM   289   S  SD  . MET A 1 122  ? -53.730 -15.665 25.931  1.00 111.08 ? 718  MET A SD  1 
ATOM   290   C  CE  . MET A 1 122  ? -54.127 -15.986 24.214  1.00 103.95 ? 718  MET A CE  1 
ATOM   291   N  N   . HIS A 1 123  ? -50.178 -17.889 27.651  1.00 127.88 ? 719  HIS A N   1 
ATOM   292   C  CA  . HIS A 1 123  ? -50.517 -19.063 28.444  1.00 128.22 ? 719  HIS A CA  1 
ATOM   293   C  C   . HIS A 1 123  ? -49.292 -19.798 28.976  1.00 133.58 ? 719  HIS A C   1 
ATOM   294   O  O   . HIS A 1 123  ? -49.409 -20.884 29.541  1.00 118.05 ? 719  HIS A O   1 
ATOM   295   C  CB  . HIS A 1 123  ? -51.419 -19.981 27.622  1.00 102.81 ? 719  HIS A CB  1 
ATOM   296   C  CG  . HIS A 1 123  ? -52.791 -19.416 27.414  1.00 104.69 ? 719  HIS A CG  1 
ATOM   297   N  ND1 . HIS A 1 123  ? -53.701 -19.961 26.535  1.00 96.38  ? 719  HIS A ND1 1 
ATOM   298   C  CD2 . HIS A 1 123  ? -53.406 -18.352 27.980  1.00 112.05 ? 719  HIS A CD2 1 
ATOM   299   C  CE1 . HIS A 1 123  ? -54.819 -19.256 26.570  1.00 96.46  ? 719  HIS A CE1 1 
ATOM   300   N  NE2 . HIS A 1 123  ? -54.666 -18.275 27.440  1.00 105.79 ? 719  HIS A NE2 1 
ATOM   301   N  N   . GLN A 1 124  ? -48.119 -19.204 28.769  1.00 136.27 ? 720  GLN A N   1 
ATOM   302   C  CA  . GLN A 1 124  ? -46.863 -19.736 29.301  1.00 131.58 ? 720  GLN A CA  1 
ATOM   303   C  C   . GLN A 1 124  ? -46.913 -19.926 30.813  1.00 146.51 ? 720  GLN A C   1 
ATOM   304   O  O   . GLN A 1 124  ? -47.598 -19.182 31.519  1.00 137.02 ? 720  GLN A O   1 
ATOM   305   C  CB  . GLN A 1 124  ? -45.695 -18.805 28.972  1.00 126.87 ? 720  GLN A CB  1 
ATOM   306   C  CG  . GLN A 1 124  ? -45.462 -18.538 27.504  1.00 131.29 ? 720  GLN A CG  1 
ATOM   307   C  CD  . GLN A 1 124  ? -44.702 -17.245 27.282  1.00 133.11 ? 720  GLN A CD  1 
ATOM   308   O  OE1 . GLN A 1 124  ? -44.611 -16.406 28.180  1.00 129.87 ? 720  GLN A OE1 1 
ATOM   309   N  NE2 . GLN A 1 124  ? -44.160 -17.073 26.084  1.00 116.13 ? 720  GLN A NE2 1 
ATOM   310   N  N   . GLY A 1 125  ? -46.196 -20.930 31.306  1.00 150.23 ? 721  GLY A N   1 
ATOM   311   C  CA  . GLY A 1 125  ? -46.044 -21.110 32.736  1.00 150.80 ? 721  GLY A CA  1 
ATOM   312   C  C   . GLY A 1 125  ? -46.861 -22.228 33.350  1.00 145.53 ? 721  GLY A C   1 
ATOM   313   O  O   . GLY A 1 125  ? -47.443 -23.057 32.648  1.00 131.98 ? 721  GLY A O   1 
ATOM   314   N  N   . LYS A 1 126  ? -46.897 -22.246 34.678  1.00 142.30 ? 722  LYS A N   1 
ATOM   315   C  CA  . LYS A 1 126  ? -47.546 -23.317 35.422  1.00 130.19 ? 722  LYS A CA  1 
ATOM   316   C  C   . LYS A 1 126  ? -49.016 -23.026 35.712  1.00 129.14 ? 722  LYS A C   1 
ATOM   317   O  O   . LYS A 1 126  ? -49.508 -21.936 35.421  1.00 125.92 ? 722  LYS A O   1 
ATOM   318   C  CB  . LYS A 1 126  ? -46.796 -23.539 36.736  1.00 123.67 ? 722  LYS A CB  1 
ATOM   319   C  CG  . LYS A 1 126  ? -46.532 -22.241 37.482  1.00 127.86 ? 722  LYS A CG  1 
ATOM   320   C  CD  . LYS A 1 126  ? -45.096 -22.138 37.967  1.00 124.85 ? 722  LYS A CD  1 
ATOM   321   C  CE  . LYS A 1 126  ? -44.836 -23.076 39.131  1.00 120.67 ? 722  LYS A CE  1 
ATOM   322   N  NZ  . LYS A 1 126  ? -43.456 -22.915 39.667  1.00 115.91 ? 722  LYS A NZ  1 
ATOM   323   N  N   . LYS A 1 127  ? -49.696 -24.000 36.314  1.00 128.02 ? 723  LYS A N   1 
ATOM   324   C  CA  . LYS A 1 127  ? -51.112 -23.886 36.664  1.00 121.64 ? 723  LYS A CA  1 
ATOM   325   C  C   . LYS A 1 127  ? -51.494 -24.874 37.770  1.00 116.08 ? 723  LYS A C   1 
ATOM   326   O  O   . LYS A 1 127  ? -50.774 -25.840 38.020  1.00 116.49 ? 723  LYS A O   1 
ATOM   327   C  CB  . LYS A 1 127  ? -51.992 -24.096 35.427  1.00 118.12 ? 723  LYS A CB  1 
ATOM   328   C  CG  . LYS A 1 127  ? -52.338 -22.800 34.707  1.00 125.86 ? 723  LYS A CG  1 
ATOM   329   C  CD  . LYS A 1 127  ? -52.614 -23.017 33.231  1.00 119.89 ? 723  LYS A CD  1 
ATOM   330   C  CE  . LYS A 1 127  ? -53.916 -23.756 33.030  1.00 121.87 ? 723  LYS A CE  1 
ATOM   331   N  NZ  . LYS A 1 127  ? -54.993 -23.173 33.878  1.00 114.32 ? 723  LYS A NZ  1 
ATOM   332   N  N   . LYS A 1 128  ? -52.624 -24.628 38.429  1.00 116.74 ? 724  LYS A N   1 
ATOM   333   C  CA  . LYS A 1 128  ? -53.062 -25.463 39.548  1.00 114.93 ? 724  LYS A CA  1 
ATOM   334   C  C   . LYS A 1 128  ? -53.724 -26.767 39.103  1.00 111.47 ? 724  LYS A C   1 
ATOM   335   O  O   . LYS A 1 128  ? -54.683 -26.760 38.330  1.00 103.23 ? 724  LYS A O   1 
ATOM   336   C  CB  . LYS A 1 128  ? -54.024 -24.682 40.450  1.00 109.24 ? 724  LYS A CB  1 
ATOM   337   C  CG  . LYS A 1 128  ? -54.907 -25.567 41.322  1.00 119.71 ? 724  LYS A CG  1 
ATOM   338   C  CD  . LYS A 1 128  ? -55.646 -24.775 42.391  1.00 117.83 ? 724  LYS A CD  1 
ATOM   339   C  CE  . LYS A 1 128  ? -54.890 -24.795 43.712  1.00 118.59 ? 724  LYS A CE  1 
ATOM   340   N  NZ  . LYS A 1 128  ? -55.643 -24.113 44.800  1.00 96.92  ? 724  LYS A NZ  1 
ATOM   341   N  N   . LYS A 1 129  ? -53.198 -27.884 39.600  1.00 101.31 ? 725  LYS A N   1 
ATOM   342   C  CA  . LYS A 1 129  ? -53.769 -29.199 39.333  1.00 102.89 ? 725  LYS A CA  1 
ATOM   343   C  C   . LYS A 1 129  ? -54.988 -29.450 40.219  1.00 105.62 ? 725  LYS A C   1 
ATOM   344   O  O   . LYS A 1 129  ? -55.109 -28.876 41.301  1.00 104.16 ? 725  LYS A O   1 
ATOM   345   C  CB  . LYS A 1 129  ? -52.723 -30.294 39.550  1.00 97.88  ? 725  LYS A CB  1 
ATOM   346   C  CG  . LYS A 1 129  ? -52.945 -31.539 38.704  1.00 98.82  ? 725  LYS A CG  1 
ATOM   347   C  CD  . LYS A 1 129  ? -52.119 -32.717 39.203  1.00 104.28 ? 725  LYS A CD  1 
ATOM   348   C  CE  . LYS A 1 129  ? -50.629 -32.416 39.186  1.00 103.31 ? 725  LYS A CE  1 
ATOM   349   N  NZ  . LYS A 1 129  ? -49.834 -33.574 39.688  1.00 82.86  ? 725  LYS A NZ  1 
ATOM   350   N  N   . GLN A 1 130  ? -55.889 -30.311 39.757  1.00 102.44 ? 726  GLN A N   1 
ATOM   351   C  CA  . GLN A 1 130  ? -57.093 -30.645 40.511  1.00 103.01 ? 726  GLN A CA  1 
ATOM   352   C  C   . GLN A 1 130  ? -57.038 -32.074 41.035  1.00 95.97  ? 726  GLN A C   1 
ATOM   353   O  O   . GLN A 1 130  ? -56.431 -32.947 40.415  1.00 84.97  ? 726  GLN A O   1 
ATOM   354   C  CB  . GLN A 1 130  ? -58.342 -30.458 39.647  1.00 100.22 ? 726  GLN A CB  1 
ATOM   355   C  CG  . GLN A 1 130  ? -58.560 -29.036 39.165  1.00 91.93  ? 726  GLN A CG  1 
ATOM   356   C  CD  . GLN A 1 130  ? -58.721 -28.056 40.309  1.00 104.92 ? 726  GLN A CD  1 
ATOM   357   O  OE1 . GLN A 1 130  ? -57.767 -27.388 40.707  1.00 102.35 ? 726  GLN A OE1 1 
ATOM   358   N  NE2 . GLN A 1 130  ? -59.933 -27.964 40.845  1.00 106.04 ? 726  GLN A NE2 1 
ATOM   359   N  N   . ASN A 1 131  ? -57.675 -32.311 42.177  1.00 108.26 ? 727  ASN A N   1 
ATOM   360   C  CA  . ASN A 1 131  ? -57.756 -33.661 42.718  1.00 106.08 ? 727  ASN A CA  1 
ATOM   361   C  C   . ASN A 1 131  ? -59.033 -34.342 42.246  1.00 94.63  ? 727  ASN A C   1 
ATOM   362   O  O   . ASN A 1 131  ? -60.137 -33.966 42.641  1.00 92.66  ? 727  ASN A O   1 
ATOM   363   C  CB  . ASN A 1 131  ? -57.699 -33.641 44.247  1.00 91.04  ? 727  ASN A CB  1 
ATOM   364   C  CG  . ASN A 1 131  ? -56.356 -33.175 44.776  1.00 98.55  ? 727  ASN A CG  1 
ATOM   365   O  OD1 . ASN A 1 131  ? -55.325 -33.346 44.125  1.00 96.19  ? 727  ASN A OD1 1 
ATOM   366   N  ND2 . ASN A 1 131  ? -56.360 -32.587 45.967  1.00 93.11  ? 727  ASN A ND2 1 
ATOM   367   N  N   . LYS A 1 132  ? -58.866 -35.354 41.402  1.00 91.31  ? 728  LYS A N   1 
ATOM   368   C  CA  . LYS A 1 132  ? -59.991 -36.079 40.827  1.00 94.25  ? 728  LYS A CA  1 
ATOM   369   C  C   . LYS A 1 132  ? -59.944 -37.534 41.267  1.00 100.38 ? 728  LYS A C   1 
ATOM   370   O  O   . LYS A 1 132  ? -58.902 -38.185 41.176  1.00 107.67 ? 728  LYS A O   1 
ATOM   371   C  CB  . LYS A 1 132  ? -59.976 -35.973 39.300  1.00 99.54  ? 728  LYS A CB  1 
ATOM   372   C  CG  . LYS A 1 132  ? -60.262 -34.576 38.770  1.00 91.39  ? 728  LYS A CG  1 
ATOM   373   C  CD  . LYS A 1 132  ? -61.749 -34.260 38.821  1.00 100.43 ? 728  LYS A CD  1 
ATOM   374   C  CE  . LYS A 1 132  ? -62.029 -32.815 38.436  1.00 83.52  ? 728  LYS A CE  1 
ATOM   375   N  NZ  . LYS A 1 132  ? -61.549 -31.861 39.474  1.00 74.71  ? 728  LYS A NZ  1 
ATOM   376   N  N   . ASN A 1 133  ? -61.074 -38.039 41.744  1.00 91.88  ? 729  ASN A N   1 
ATOM   377   C  CA  . ASN A 1 133  ? -61.123 -39.363 42.352  1.00 94.68  ? 729  ASN A CA  1 
ATOM   378   C  C   . ASN A 1 133  ? -61.133 -40.507 41.343  1.00 89.16  ? 729  ASN A C   1 
ATOM   379   O  O   . ASN A 1 133  ? -60.530 -41.554 41.579  1.00 74.66  ? 729  ASN A O   1 
ATOM   380   C  CB  . ASN A 1 133  ? -62.346 -39.462 43.265  1.00 103.72 ? 729  ASN A CB  1 
ATOM   381   C  CG  . ASN A 1 133  ? -62.326 -38.428 44.373  1.00 118.24 ? 729  ASN A CG  1 
ATOM   382   O  OD1 . ASN A 1 133  ? -61.260 -37.990 44.807  1.00 82.76  ? 729  ASN A OD1 1 
ATOM   383   N  ND2 . ASN A 1 133  ? -63.506 -38.030 44.836  1.00 104.10 ? 729  ASN A ND2 1 
ATOM   384   N  N   . ARG A 1 134  ? -61.818 -40.311 40.222  1.00 88.52  ? 730  ARG A N   1 
ATOM   385   C  CA  . ARG A 1 134  ? -61.893 -41.347 39.197  1.00 86.00  ? 730  ARG A CA  1 
ATOM   386   C  C   . ARG A 1 134  ? -61.741 -40.790 37.787  1.00 86.51  ? 730  ARG A C   1 
ATOM   387   O  O   . ARG A 1 134  ? -62.449 -39.865 37.388  1.00 79.26  ? 730  ARG A O   1 
ATOM   388   C  CB  . ARG A 1 134  ? -63.215 -42.117 39.308  1.00 100.97 ? 730  ARG A CB  1 
ATOM   389   C  CG  . ARG A 1 134  ? -63.720 -42.667 37.980  1.00 82.40  ? 730  ARG A CG  1 
ATOM   390   C  CD  . ARG A 1 134  ? -64.637 -43.862 38.162  1.00 100.37 ? 730  ARG A CD  1 
ATOM   391   N  NE  . ARG A 1 134  ? -63.884 -45.106 38.280  1.00 87.21  ? 730  ARG A NE  1 
ATOM   392   C  CZ  . ARG A 1 134  ? -64.420 -46.317 38.179  1.00 88.59  ? 730  ARG A CZ  1 
ATOM   393   N  NH1 . ARG A 1 134  ? -65.720 -46.454 37.956  1.00 69.22  ? 730  ARG A NH1 1 
ATOM   394   N  NH2 . ARG A 1 134  ? -63.654 -47.393 38.295  1.00 77.80  ? 730  ARG A NH2 1 
ATOM   395   N  N   . ILE A 1 135  ? -60.800 -41.360 37.042  1.00 89.20  ? 731  ILE A N   1 
ATOM   396   C  CA  . ILE A 1 135  ? -60.621 -41.043 35.631  1.00 78.84  ? 731  ILE A CA  1 
ATOM   397   C  C   . ILE A 1 135  ? -60.528 -42.339 34.837  1.00 74.61  ? 731  ILE A C   1 
ATOM   398   O  O   . ILE A 1 135  ? -59.590 -43.111 35.034  1.00 82.26  ? 731  ILE A O   1 
ATOM   399   C  CB  . ILE A 1 135  ? -59.350 -40.211 35.379  1.00 69.15  ? 731  ILE A CB  1 
ATOM   400   C  CG1 . ILE A 1 135  ? -59.332 -38.955 36.252  1.00 67.20  ? 731  ILE A CG1 1 
ATOM   401   C  CG2 . ILE A 1 135  ? -59.240 -39.857 33.905  1.00 70.03  ? 731  ILE A CG2 1 
ATOM   402   C  CD1 . ILE A 1 135  ? -58.051 -38.157 36.134  1.00 59.61  ? 731  ILE A CD1 1 
ATOM   403   N  N   . SER A 1 136  ? -61.485 -42.598 33.949  1.00 80.51  ? 732  SER A N   1 
ATOM   404   C  CA  . SER A 1 136  ? -61.428 -43.853 33.194  1.00 88.34  ? 732  SER A CA  1 
ATOM   405   C  C   . SER A 1 136  ? -61.786 -43.694 31.720  1.00 78.79  ? 732  SER A C   1 
ATOM   406   O  O   . SER A 1 136  ? -62.635 -42.889 31.355  1.00 80.39  ? 732  SER A O   1 
ATOM   407   C  CB  . SER A 1 136  ? -62.337 -44.909 33.838  1.00 83.19  ? 732  SER A CB  1 
ATOM   408   O  OG  . SER A 1 136  ? -63.692 -44.498 33.869  1.00 74.83  ? 732  SER A OG  1 
ATOM   409   N  N   . TRP A 1 137  ? -61.127 -44.484 30.879  1.00 72.52  ? 733  TRP A N   1 
ATOM   410   C  CA  . TRP A 1 137  ? -61.358 -44.436 29.443  1.00 87.95  ? 733  TRP A CA  1 
ATOM   411   C  C   . TRP A 1 137  ? -62.614 -45.200 29.053  1.00 89.31  ? 733  TRP A C   1 
ATOM   412   O  O   . TRP A 1 137  ? -62.722 -46.401 29.305  1.00 91.80  ? 733  TRP A O   1 
ATOM   413   C  CB  . TRP A 1 137  ? -60.161 -45.013 28.687  1.00 93.74  ? 733  TRP A CB  1 
ATOM   414   C  CG  . TRP A 1 137  ? -58.843 -44.436 29.085  1.00 84.50  ? 733  TRP A CG  1 
ATOM   415   C  CD1 . TRP A 1 137  ? -57.839 -45.072 29.757  1.00 94.99  ? 733  TRP A CD1 1 
ATOM   416   C  CD2 . TRP A 1 137  ? -58.376 -43.109 28.830  1.00 91.03  ? 733  TRP A CD2 1 
ATOM   417   N  NE1 . TRP A 1 137  ? -56.776 -44.222 29.935  1.00 96.39  ? 733  TRP A NE1 1 
ATOM   418   C  CE2 . TRP A 1 137  ? -57.081 -43.009 29.375  1.00 94.63  ? 733  TRP A CE2 1 
ATOM   419   C  CE3 . TRP A 1 137  ? -58.927 -41.995 28.192  1.00 87.74  ? 733  TRP A CE3 1 
ATOM   420   C  CZ2 . TRP A 1 137  ? -56.330 -41.839 29.303  1.00 102.71 ? 733  TRP A CZ2 1 
ATOM   421   C  CZ3 . TRP A 1 137  ? -58.181 -40.834 28.122  1.00 93.32  ? 733  TRP A CZ3 1 
ATOM   422   C  CH2 . TRP A 1 137  ? -56.896 -40.765 28.674  1.00 102.62 ? 733  TRP A CH2 1 
ATOM   423   N  N   . VAL A 1 138  ? -63.561 -44.504 28.436  1.00 86.99  ? 734  VAL A N   1 
ATOM   424   C  CA  . VAL A 1 138  ? -64.743 -45.153 27.892  1.00 78.29  ? 734  VAL A CA  1 
ATOM   425   C  C   . VAL A 1 138  ? -64.382 -45.843 26.581  1.00 89.64  ? 734  VAL A C   1 
ATOM   426   O  O   . VAL A 1 138  ? -63.678 -45.275 25.745  1.00 101.98 ? 734  VAL A O   1 
ATOM   427   C  CB  . VAL A 1 138  ? -65.891 -44.150 27.665  1.00 76.50  ? 734  VAL A CB  1 
ATOM   428   C  CG1 . VAL A 1 138  ? -67.086 -44.838 27.023  1.00 80.76  ? 734  VAL A CG1 1 
ATOM   429   C  CG2 . VAL A 1 138  ? -66.290 -43.506 28.982  1.00 71.82  ? 734  VAL A CG2 1 
ATOM   430   N  N   . GLY A 1 139  ? -64.850 -47.076 26.415  1.00 90.68  ? 735  GLY A N   1 
ATOM   431   C  CA  . GLY A 1 139  ? -64.569 -47.844 25.218  1.00 81.98  ? 735  GLY A CA  1 
ATOM   432   C  C   . GLY A 1 139  ? -63.129 -48.310 25.160  1.00 91.11  ? 735  GLY A C   1 
ATOM   433   O  O   . GLY A 1 139  ? -62.451 -48.406 26.184  1.00 87.02  ? 735  GLY A O   1 
ATOM   434   N  N   . GLU A 1 140  ? -62.658 -48.591 23.951  1.00 109.57 ? 736  GLU A N   1 
ATOM   435   C  CA  . GLU A 1 140  ? -61.307 -49.096 23.750  1.00 112.53 ? 736  GLU A CA  1 
ATOM   436   C  C   . GLU A 1 140  ? -60.541 -48.190 22.795  1.00 109.70 ? 736  GLU A C   1 
ATOM   437   O  O   . GLU A 1 140  ? -61.140 -47.388 22.079  1.00 113.51 ? 736  GLU A O   1 
ATOM   438   C  CB  . GLU A 1 140  ? -61.351 -50.529 23.221  1.00 96.48  ? 736  GLU A CB  1 
ATOM   439   C  CG  . GLU A 1 140  ? -62.078 -51.490 24.149  1.00 109.42 ? 736  GLU A CG  1 
ATOM   440   C  CD  . GLU A 1 140  ? -62.291 -52.856 23.531  1.00 122.18 ? 736  GLU A CD  1 
ATOM   441   O  OE1 . GLU A 1 140  ? -62.112 -52.992 22.303  1.00 124.23 ? 736  GLU A OE1 1 
ATOM   442   O  OE2 . GLU A 1 140  ? -62.639 -53.796 24.277  1.00 114.47 ? 736  GLU A OE2 1 
ATOM   443   N  N   . ALA A 1 141  ? -59.217 -48.315 22.800  1.00 103.14 ? 737  ALA A N   1 
ATOM   444   C  CA  . ALA A 1 141  ? -58.359 -47.423 22.026  1.00 95.48  ? 737  ALA A CA  1 
ATOM   445   C  C   . ALA A 1 141  ? -58.705 -47.439 20.542  1.00 109.17 ? 737  ALA A C   1 
ATOM   446   O  O   . ALA A 1 141  ? -58.741 -48.496 19.912  1.00 120.95 ? 737  ALA A O   1 
ATOM   447   C  CB  . ALA A 1 141  ? -56.898 -47.793 22.231  1.00 92.13  ? 737  ALA A CB  1 
ATOM   448   N  N   . VAL A 1 142  ? -58.956 -46.257 19.991  1.00 110.69 ? 738  VAL A N   1 
ATOM   449   C  CA  . VAL A 1 142  ? -59.269 -46.124 18.575  1.00 121.37 ? 738  VAL A CA  1 
ATOM   450   C  C   . VAL A 1 142  ? -57.986 -46.246 17.766  1.00 124.14 ? 738  VAL A C   1 
ATOM   451   O  O   . VAL A 1 142  ? -57.975 -46.825 16.679  1.00 121.54 ? 738  VAL A O   1 
ATOM   452   C  CB  . VAL A 1 142  ? -59.972 -44.786 18.271  1.00 125.87 ? 738  VAL A CB  1 
ATOM   453   C  CG1 . VAL A 1 142  ? -60.210 -44.630 16.775  1.00 112.37 ? 738  VAL A CG1 1 
ATOM   454   C  CG2 . VAL A 1 142  ? -61.287 -44.699 19.031  1.00 110.65 ? 738  VAL A CG2 1 
ATOM   455   N  N   . LYS A 1 143  ? -56.898 -45.706 18.307  1.00 107.65 ? 739  LYS A N   1 
ATOM   456   C  CA  . LYS A 1 143  ? -55.593 -45.890 17.690  1.00 125.88 ? 739  LYS A CA  1 
ATOM   457   C  C   . LYS A 1 143  ? -54.472 -45.979 18.721  1.00 114.63 ? 739  LYS A C   1 
ATOM   458   O  O   . LYS A 1 143  ? -54.476 -45.273 19.730  1.00 99.97  ? 739  LYS A O   1 
ATOM   459   C  CB  . LYS A 1 143  ? -55.301 -44.760 16.701  1.00 128.73 ? 739  LYS A CB  1 
ATOM   460   C  CG  . LYS A 1 143  ? -54.101 -45.035 15.809  1.00 122.54 ? 739  LYS A CG  1 
ATOM   461   C  CD  . LYS A 1 143  ? -54.155 -46.462 15.275  1.00 123.86 ? 739  LYS A CD  1 
ATOM   462   C  CE  . LYS A 1 143  ? -52.858 -46.873 14.598  1.00 118.05 ? 739  LYS A CE  1 
ATOM   463   N  NZ  . LYS A 1 143  ? -52.784 -46.390 13.194  1.00 126.09 ? 739  LYS A NZ  1 
ATOM   464   N  N   . THR A 1 144  ? -53.518 -46.863 18.451  1.00 125.45 ? 740  THR A N   1 
ATOM   465   C  CA  . THR A 1 144  ? -52.332 -47.007 19.281  1.00 121.74 ? 740  THR A CA  1 
ATOM   466   C  C   . THR A 1 144  ? -51.103 -46.581 18.487  1.00 125.73 ? 740  THR A C   1 
ATOM   467   O  O   . THR A 1 144  ? -50.931 -46.980 17.335  1.00 124.06 ? 740  THR A O   1 
ATOM   468   C  CB  . THR A 1 144  ? -52.147 -48.455 19.769  1.00 117.11 ? 740  THR A CB  1 
ATOM   469   O  OG1 . THR A 1 144  ? -51.577 -49.248 18.719  1.00 112.10 ? 740  THR A OG1 1 
ATOM   470   C  CG2 . THR A 1 144  ? -53.482 -49.054 20.187  1.00 101.60 ? 740  THR A CG2 1 
ATOM   471   N  N   . ASP A 1 145  ? -50.252 -45.773 19.108  1.00 129.41 ? 741  ASP A N   1 
ATOM   472   C  CA  . ASP A 1 145  ? -49.044 -45.277 18.458  1.00 124.81 ? 741  ASP A CA  1 
ATOM   473   C  C   . ASP A 1 145  ? -47.815 -45.591 19.301  1.00 116.32 ? 741  ASP A C   1 
ATOM   474   O  O   . ASP A 1 145  ? -47.912 -46.303 20.301  1.00 116.68 ? 741  ASP A O   1 
ATOM   475   C  CB  . ASP A 1 145  ? -49.146 -43.773 18.188  1.00 119.63 ? 741  ASP A CB  1 
ATOM   476   C  CG  . ASP A 1 145  ? -49.767 -43.466 16.836  1.00 125.42 ? 741  ASP A CG  1 
ATOM   477   O  OD1 . ASP A 1 145  ? -50.491 -44.333 16.303  1.00 125.44 ? 741  ASP A OD1 1 
ATOM   478   O  OD2 . ASP A 1 145  ? -49.529 -42.361 16.305  1.00 96.78  ? 741  ASP A OD2 1 
ATOM   479   N  N   . GLY A 1 146  ? -46.669 -45.056 18.888  1.00 115.75 ? 742  GLY A N   1 
ATOM   480   C  CA  . GLY A 1 146  ? -45.375 -45.446 19.424  1.00 121.55 ? 742  GLY A CA  1 
ATOM   481   C  C   . GLY A 1 146  ? -45.259 -45.529 20.936  1.00 125.24 ? 742  GLY A C   1 
ATOM   482   O  O   . GLY A 1 146  ? -44.594 -46.424 21.456  1.00 135.87 ? 742  GLY A O   1 
ATOM   483   N  N   . LYS A 1 147  ? -45.901 -44.609 21.646  1.00 121.42 ? 743  LYS A N   1 
ATOM   484   C  CA  . LYS A 1 147  ? -45.905 -44.671 23.103  1.00 124.95 ? 743  LYS A CA  1 
ATOM   485   C  C   . LYS A 1 147  ? -47.247 -44.225 23.679  1.00 129.91 ? 743  LYS A C   1 
ATOM   486   O  O   . LYS A 1 147  ? -47.506 -44.380 24.872  1.00 118.48 ? 743  LYS A O   1 
ATOM   487   C  CB  . LYS A 1 147  ? -44.768 -43.820 23.677  1.00 120.22 ? 743  LYS A CB  1 
ATOM   488   C  CG  . LYS A 1 147  ? -44.370 -44.213 25.090  1.00 127.12 ? 743  LYS A CG  1 
ATOM   489   C  CD  . LYS A 1 147  ? -44.039 -45.696 25.160  1.00 132.07 ? 743  LYS A CD  1 
ATOM   490   C  CE  . LYS A 1 147  ? -44.460 -46.306 26.488  1.00 130.94 ? 743  LYS A CE  1 
ATOM   491   N  NZ  . LYS A 1 147  ? -43.738 -45.714 27.644  1.00 119.00 ? 743  LYS A NZ  1 
ATOM   492   N  N   . LYS A 1 148  ? -48.104 -43.684 22.820  1.00 131.65 ? 744  LYS A N   1 
ATOM   493   C  CA  . LYS A 1 148  ? -49.408 -43.193 23.251  1.00 111.16 ? 744  LYS A CA  1 
ATOM   494   C  C   . LYS A 1 148  ? -50.529 -44.125 22.804  1.00 113.04 ? 744  LYS A C   1 
ATOM   495   O  O   . LYS A 1 148  ? -50.381 -44.870 21.835  1.00 106.40 ? 744  LYS A O   1 
ATOM   496   C  CB  . LYS A 1 148  ? -49.650 -41.783 22.709  1.00 96.79  ? 744  LYS A CB  1 
ATOM   497   C  CG  . LYS A 1 148  ? -48.451 -40.856 22.834  1.00 95.56  ? 744  LYS A CG  1 
ATOM   498   C  CD  . LYS A 1 148  ? -48.778 -39.464 22.317  1.00 105.25 ? 744  LYS A CD  1 
ATOM   499   C  CE  . LYS A 1 148  ? -47.614 -38.871 21.537  1.00 100.50 ? 744  LYS A CE  1 
ATOM   500   N  NZ  . LYS A 1 148  ? -46.358 -38.838 22.333  1.00 77.22  ? 744  LYS A NZ  1 
ATOM   501   N  N   . SER A 1 149  ? -51.651 -44.081 23.517  1.00 117.52 ? 745  SER A N   1 
ATOM   502   C  CA  . SER A 1 149  ? -52.816 -44.888 23.169  1.00 114.07 ? 745  SER A CA  1 
ATOM   503   C  C   . SER A 1 149  ? -54.084 -44.039 23.221  1.00 102.63 ? 745  SER A C   1 
ATOM   504   O  O   . SER A 1 149  ? -54.573 -43.705 24.298  1.00 92.47  ? 745  SER A O   1 
ATOM   505   C  CB  . SER A 1 149  ? -52.938 -46.089 24.107  1.00 100.94 ? 745  SER A CB  1 
ATOM   506   O  OG  . SER A 1 149  ? -53.954 -46.976 23.671  1.00 93.82  ? 745  SER A OG  1 
ATOM   507   N  N   . TYR A 1 150  ? -54.617 -43.702 22.051  1.00 107.08 ? 746  TYR A N   1 
ATOM   508   C  CA  . TYR A 1 150  ? -55.697 -42.723 21.948  1.00 110.38 ? 746  TYR A CA  1 
ATOM   509   C  C   . TYR A 1 150  ? -57.090 -43.294 22.201  1.00 108.90 ? 746  TYR A C   1 
ATOM   510   O  O   . TYR A 1 150  ? -57.416 -44.394 21.760  1.00 111.15 ? 746  TYR A O   1 
ATOM   511   C  CB  . TYR A 1 150  ? -55.663 -42.059 20.569  1.00 110.27 ? 746  TYR A CB  1 
ATOM   512   C  CG  . TYR A 1 150  ? -54.397 -41.279 20.307  1.00 102.61 ? 746  TYR A CG  1 
ATOM   513   C  CD1 . TYR A 1 150  ? -54.278 -39.957 20.716  1.00 105.22 ? 746  TYR A CD1 1 
ATOM   514   C  CD2 . TYR A 1 150  ? -53.319 -41.863 19.656  1.00 107.05 ? 746  TYR A CD2 1 
ATOM   515   C  CE1 . TYR A 1 150  ? -53.122 -39.239 20.482  1.00 104.63 ? 746  TYR A CE1 1 
ATOM   516   C  CE2 . TYR A 1 150  ? -52.158 -41.152 19.417  1.00 105.70 ? 746  TYR A CE2 1 
ATOM   517   C  CZ  . TYR A 1 150  ? -52.067 -39.840 19.833  1.00 105.60 ? 746  TYR A CZ  1 
ATOM   518   O  OH  . TYR A 1 150  ? -50.915 -39.125 19.600  1.00 99.85  ? 746  TYR A OH  1 
ATOM   519   N  N   . TYR A 1 151  ? -57.906 -42.521 22.913  1.00 112.07 ? 747  TYR A N   1 
ATOM   520   C  CA  . TYR A 1 151  ? -59.298 -42.869 23.167  1.00 102.58 ? 747  TYR A CA  1 
ATOM   521   C  C   . TYR A 1 151  ? -60.235 -41.772 22.668  1.00 96.01  ? 747  TYR A C   1 
ATOM   522   O  O   . TYR A 1 151  ? -59.820 -40.631 22.461  1.00 78.40  ? 747  TYR A O   1 
ATOM   523   C  CB  . TYR A 1 151  ? -59.532 -43.114 24.659  1.00 90.94  ? 747  TYR A CB  1 
ATOM   524   C  CG  . TYR A 1 151  ? -58.943 -44.407 25.170  1.00 101.47 ? 747  TYR A CG  1 
ATOM   525   C  CD1 . TYR A 1 151  ? -59.660 -45.594 25.096  1.00 94.37  ? 747  TYR A CD1 1 
ATOM   526   C  CD2 . TYR A 1 151  ? -57.671 -44.443 25.728  1.00 104.98 ? 747  TYR A CD2 1 
ATOM   527   C  CE1 . TYR A 1 151  ? -59.128 -46.779 25.563  1.00 90.07  ? 747  TYR A CE1 1 
ATOM   528   C  CE2 . TYR A 1 151  ? -57.131 -45.625 26.197  1.00 96.71  ? 747  TYR A CE2 1 
ATOM   529   C  CZ  . TYR A 1 151  ? -57.864 -46.789 26.111  1.00 95.42  ? 747  TYR A CZ  1 
ATOM   530   O  OH  . TYR A 1 151  ? -57.332 -47.969 26.577  1.00 96.03  ? 747  TYR A OH  1 
ATOM   531   N  N   . LYS A 1 152  ? -61.501 -42.130 22.483  1.00 97.43  ? 748  LYS A N   1 
ATOM   532   C  CA  . LYS A 1 152  ? -62.508 -41.198 21.990  1.00 82.54  ? 748  LYS A CA  1 
ATOM   533   C  C   . LYS A 1 152  ? -63.108 -40.365 23.120  1.00 99.32  ? 748  LYS A C   1 
ATOM   534   O  O   . LYS A 1 152  ? -63.412 -39.185 22.939  1.00 99.45  ? 748  LYS A O   1 
ATOM   535   C  CB  . LYS A 1 152  ? -63.609 -41.965 21.247  1.00 79.40  ? 748  LYS A CB  1 
ATOM   536   C  CG  . LYS A 1 152  ? -64.956 -41.256 21.158  1.00 102.98 ? 748  LYS A CG  1 
ATOM   537   C  CD  . LYS A 1 152  ? -64.933 -40.092 20.179  1.00 122.04 ? 748  LYS A CD  1 
ATOM   538   C  CE  . LYS A 1 152  ? -66.321 -39.489 20.015  1.00 108.27 ? 748  LYS A CE  1 
ATOM   539   N  NZ  . LYS A 1 152  ? -66.877 -39.000 21.309  1.00 87.79  ? 748  LYS A NZ  1 
ATOM   540   N  N   . LYS A 1 153  ? -63.262 -40.975 24.290  1.00 100.68 ? 749  LYS A N   1 
ATOM   541   C  CA  . LYS A 1 153  ? -63.968 -40.327 25.387  1.00 81.67  ? 749  LYS A CA  1 
ATOM   542   C  C   . LYS A 1 153  ? -63.522 -40.831 26.755  1.00 77.49  ? 749  LYS A C   1 
ATOM   543   O  O   . LYS A 1 153  ? -63.317 -42.028 26.952  1.00 86.06  ? 749  LYS A O   1 
ATOM   544   C  CB  . LYS A 1 153  ? -65.475 -40.526 25.204  1.00 86.66  ? 749  LYS A CB  1 
ATOM   545   C  CG  . LYS A 1 153  ? -66.284 -40.588 26.486  1.00 84.91  ? 749  LYS A CG  1 
ATOM   546   C  CD  . LYS A 1 153  ? -67.756 -40.344 26.197  1.00 99.20  ? 749  LYS A CD  1 
ATOM   547   C  CE  . LYS A 1 153  ? -68.206 -41.084 24.947  1.00 89.64  ? 749  LYS A CE  1 
ATOM   548   N  NZ  . LYS A 1 153  ? -69.531 -40.607 24.466  1.00 82.42  ? 749  LYS A NZ  1 
ATOM   549   N  N   . VAL A 1 154  ? -63.369 -39.900 27.692  1.00 75.81  ? 750  VAL A N   1 
ATOM   550   C  CA  . VAL A 1 154  ? -62.928 -40.219 29.046  1.00 68.90  ? 750  VAL A CA  1 
ATOM   551   C  C   . VAL A 1 154  ? -64.029 -39.857 30.042  1.00 77.84  ? 750  VAL A C   1 
ATOM   552   O  O   . VAL A 1 154  ? -64.990 -39.178 29.691  1.00 86.79  ? 750  VAL A O   1 
ATOM   553   C  CB  . VAL A 1 154  ? -61.624 -39.467 29.400  1.00 79.75  ? 750  VAL A CB  1 
ATOM   554   C  CG1 . VAL A 1 154  ? -61.932 -38.031 29.792  1.00 74.34  ? 750  VAL A CG1 1 
ATOM   555   C  CG2 . VAL A 1 154  ? -60.856 -40.178 30.511  1.00 69.71  ? 750  VAL A CG2 1 
ATOM   556   N  N   . CYS A 1 155  ? -63.892 -40.318 31.281  1.00 78.23  ? 751  CYS A N   1 
ATOM   557   C  CA  . CYS A 1 155  ? -64.850 -40.008 32.331  1.00 81.11  ? 751  CYS A CA  1 
ATOM   558   C  C   . CYS A 1 155  ? -64.122 -39.534 33.585  1.00 83.57  ? 751  CYS A C   1 
ATOM   559   O  O   . CYS A 1 155  ? -63.307 -40.275 34.152  1.00 78.49  ? 751  CYS A O   1 
ATOM   560   C  CB  . CYS A 1 155  ? -65.715 -41.232 32.645  1.00 79.43  ? 751  CYS A CB  1 
ATOM   561   S  SG  . CYS A 1 155  ? -66.934 -40.994 33.961  1.00 99.51  ? 751  CYS A SG  1 
ATOM   562   N  N   . ILE A 1 156  ? -64.404 -38.297 34.001  1.00 75.90  ? 752  ILE A N   1 
ATOM   563   C  CA  . ILE A 1 156  ? -63.867 -37.771 35.257  1.00 69.78  ? 752  ILE A CA  1 
ATOM   564   C  C   . ILE A 1 156  ? -64.990 -37.651 36.293  1.00 81.82  ? 752  ILE A C   1 
ATOM   565   O  O   . ILE A 1 156  ? -66.012 -37.015 36.037  1.00 88.73  ? 752  ILE A O   1 
ATOM   566   C  CB  . ILE A 1 156  ? -63.141 -36.394 35.060  1.00 73.92  ? 752  ILE A CB  1 
ATOM   567   C  CG1 . ILE A 1 156  ? -64.108 -35.251 34.726  1.00 106.02 ? 752  ILE A CG1 1 
ATOM   568   C  CG2 . ILE A 1 156  ? -62.055 -36.505 33.996  1.00 80.38  ? 752  ILE A CG2 1 
ATOM   569   C  CD1 . ILE A 1 156  ? -64.424 -34.331 35.904  1.00 100.88 ? 752  ILE A CD1 1 
ATOM   570   N  N   . ASP A 1 157  ? -64.790 -38.282 37.451  1.00 84.79  ? 753  ASP A N   1 
ATOM   571   C  CA  . ASP A 1 157  ? -65.761 -38.289 38.550  1.00 72.69  ? 753  ASP A CA  1 
ATOM   572   C  C   . ASP A 1 157  ? -67.223 -38.286 38.093  1.00 82.05  ? 753  ASP A C   1 
ATOM   573   O  O   . ASP A 1 157  ? -67.967 -37.344 38.379  1.00 90.78  ? 753  ASP A O   1 
ATOM   574   C  CB  . ASP A 1 157  ? -65.511 -37.097 39.480  1.00 69.09  ? 753  ASP A CB  1 
ATOM   575   C  CG  . ASP A 1 157  ? -64.217 -37.231 40.270  1.00 86.40  ? 753  ASP A CG  1 
ATOM   576   O  OD1 . ASP A 1 157  ? -63.690 -38.360 40.367  1.00 78.10  ? 753  ASP A OD1 1 
ATOM   577   O  OD2 . ASP A 1 157  ? -63.730 -36.211 40.801  1.00 88.12  ? 753  ASP A OD2 1 
ATOM   578   N  N   . ALA A 1 158  ? -67.596 -39.323 37.343  1.00 67.17  ? 754  ALA A N   1 
ATOM   579   C  CA  . ALA A 1 158  ? -68.987 -39.605 36.963  1.00 77.20  ? 754  ALA A CA  1 
ATOM   580   C  C   . ALA A 1 158  ? -69.550 -38.613 35.949  1.00 67.08  ? 754  ALA A C   1 
ATOM   581   O  O   . ALA A 1 158  ? -70.760 -38.546 35.729  1.00 83.48  ? 754  ALA A O   1 
ATOM   582   C  CB  . ALA A 1 158  ? -69.873 -39.649 38.202  1.00 86.30  ? 754  ALA A CB  1 
ATOM   583   N  N   . GLU A 1 159  ? -68.663 -37.855 35.324  1.00 75.77  ? 755  GLU A N   1 
ATOM   584   C  CA  . GLU A 1 159  ? -69.050 -36.936 34.269  1.00 82.52  ? 755  GLU A CA  1 
ATOM   585   C  C   . GLU A 1 159  ? -68.220 -37.236 33.024  1.00 84.76  ? 755  GLU A C   1 
ATOM   586   O  O   . GLU A 1 159  ? -66.985 -37.263 33.073  1.00 75.61  ? 755  GLU A O   1 
ATOM   587   C  CB  . GLU A 1 159  ? -68.885 -35.485 34.732  1.00 90.24  ? 755  GLU A CB  1 
ATOM   588   C  CG  . GLU A 1 159  ? -69.962 -35.043 35.724  1.00 87.03  ? 755  GLU A CG  1 
ATOM   589   C  CD  . GLU A 1 159  ? -69.476 -34.008 36.725  1.00 87.71  ? 755  GLU A CD  1 
ATOM   590   O  OE1 . GLU A 1 159  ? -70.047 -32.897 36.758  1.00 78.69  ? 755  GLU A OE1 1 
ATOM   591   O  OE2 . GLU A 1 159  ? -68.535 -34.309 37.489  1.00 67.36  ? 755  GLU A OE2 1 
ATOM   592   N  N   . THR A 1 160  ? -68.915 -37.497 31.918  1.00 83.98  ? 756  THR A N   1 
ATOM   593   C  CA  . THR A 1 160  ? -68.276 -37.903 30.670  1.00 94.92  ? 756  THR A CA  1 
ATOM   594   C  C   . THR A 1 160  ? -67.676 -36.710 29.936  1.00 103.70 ? 756  THR A C   1 
ATOM   595   O  O   . THR A 1 160  ? -68.076 -35.568 30.158  1.00 108.54 ? 756  THR A O   1 
ATOM   596   C  CB  . THR A 1 160  ? -69.266 -38.617 29.739  1.00 100.99 ? 756  THR A CB  1 
ATOM   597   O  OG1 . THR A 1 160  ? -69.890 -37.658 28.877  1.00 108.22 ? 756  THR A OG1 1 
ATOM   598   C  CG2 . THR A 1 160  ? -70.331 -39.337 30.551  1.00 94.93  ? 756  THR A CG2 1 
ATOM   599   N  N   . LEU A 1 161  ? -66.731 -36.985 29.046  1.00 96.69  ? 757  LEU A N   1 
ATOM   600   C  CA  . LEU A 1 161  ? -65.953 -35.931 28.415  1.00 79.57  ? 757  LEU A CA  1 
ATOM   601   C  C   . LEU A 1 161  ? -65.360 -36.430 27.101  1.00 72.92  ? 757  LEU A C   1 
ATOM   602   O  O   . LEU A 1 161  ? -64.462 -37.273 27.095  1.00 84.47  ? 757  LEU A O   1 
ATOM   603   C  CB  . LEU A 1 161  ? -64.856 -35.453 29.373  1.00 69.59  ? 757  LEU A CB  1 
ATOM   604   C  CG  . LEU A 1 161  ? -64.134 -34.126 29.132  1.00 72.05  ? 757  LEU A CG  1 
ATOM   605   C  CD1 . LEU A 1 161  ? -62.869 -34.343 28.319  1.00 78.77  ? 757  LEU A CD1 1 
ATOM   606   C  CD2 . LEU A 1 161  ? -65.056 -33.127 28.450  1.00 69.52  ? 757  LEU A CD2 1 
ATOM   607   N  N   . GLU A 1 162  ? -65.872 -35.909 25.991  1.00 79.14  ? 758  GLU A N   1 
ATOM   608   C  CA  . GLU A 1 162  ? -65.479 -36.379 24.666  1.00 84.41  ? 758  GLU A CA  1 
ATOM   609   C  C   . GLU A 1 162  ? -64.522 -35.415 23.981  1.00 93.95  ? 758  GLU A C   1 
ATOM   610   O  O   . GLU A 1 162  ? -64.352 -34.278 24.422  1.00 88.00  ? 758  GLU A O   1 
ATOM   611   C  CB  . GLU A 1 162  ? -66.712 -36.577 23.784  1.00 74.87  ? 758  GLU A CB  1 
ATOM   612   C  CG  . GLU A 1 162  ? -67.919 -37.120 24.519  1.00 97.50  ? 758  GLU A CG  1 
ATOM   613   C  CD  . GLU A 1 162  ? -69.191 -36.996 23.708  1.00 118.81 ? 758  GLU A CD  1 
ATOM   614   O  OE1 . GLU A 1 162  ? -69.133 -37.193 22.475  1.00 110.38 ? 758  GLU A OE1 1 
ATOM   615   O  OE2 . GLU A 1 162  ? -70.247 -36.694 24.302  1.00 118.92 ? 758  GLU A OE2 1 
ATOM   616   N  N   . VAL A 1 163  ? -63.903 -35.874 22.898  1.00 96.93  ? 759  VAL A N   1 
ATOM   617   C  CA  . VAL A 1 163  ? -63.087 -34.999 22.069  1.00 96.53  ? 759  VAL A CA  1 
ATOM   618   C  C   . VAL A 1 163  ? -63.995 -34.017 21.338  1.00 89.11  ? 759  VAL A C   1 
ATOM   619   O  O   . VAL A 1 163  ? -65.031 -34.399 20.793  1.00 90.11  ? 759  VAL A O   1 
ATOM   620   C  CB  . VAL A 1 163  ? -62.230 -35.790 21.054  1.00 83.40  ? 759  VAL A CB  1 
ATOM   621   C  CG1 . VAL A 1 163  ? -61.083 -36.495 21.761  1.00 73.55  ? 759  VAL A CG1 1 
ATOM   622   C  CG2 . VAL A 1 163  ? -63.083 -36.789 20.284  1.00 87.31  ? 759  VAL A CG2 1 
ATOM   623   N  N   . GLY A 1 164  ? -63.611 -32.746 21.342  1.00 96.55  ? 760  GLY A N   1 
ATOM   624   C  CA  . GLY A 1 164  ? -64.430 -31.708 20.748  1.00 84.94  ? 760  GLY A CA  1 
ATOM   625   C  C   . GLY A 1 164  ? -65.146 -30.891 21.805  1.00 81.78  ? 760  GLY A C   1 
ATOM   626   O  O   . GLY A 1 164  ? -65.661 -29.810 21.524  1.00 97.50  ? 760  GLY A O   1 
ATOM   627   N  N   . ASP A 1 165  ? -65.182 -31.414 23.026  1.00 72.05  ? 761  ASP A N   1 
ATOM   628   C  CA  . ASP A 1 165  ? -65.750 -30.682 24.151  1.00 78.51  ? 761  ASP A CA  1 
ATOM   629   C  C   . ASP A 1 165  ? -64.781 -29.602 24.612  1.00 73.92  ? 761  ASP A C   1 
ATOM   630   O  O   . ASP A 1 165  ? -63.630 -29.564 24.178  1.00 79.51  ? 761  ASP A O   1 
ATOM   631   C  CB  . ASP A 1 165  ? -66.082 -31.628 25.307  1.00 89.84  ? 761  ASP A CB  1 
ATOM   632   C  CG  . ASP A 1 165  ? -67.317 -32.468 25.042  1.00 90.75  ? 761  ASP A CG  1 
ATOM   633   O  OD1 . ASP A 1 165  ? -67.690 -32.627 23.860  1.00 95.47  ? 761  ASP A OD1 1 
ATOM   634   O  OD2 . ASP A 1 165  ? -67.915 -32.972 26.016  1.00 84.40  ? 761  ASP A OD2 1 
ATOM   635   N  N   . CYS A 1 166  ? -65.250 -28.725 25.492  1.00 70.26  ? 762  CYS A N   1 
ATOM   636   C  CA  . CYS A 1 166  ? -64.416 -27.646 26.004  1.00 73.08  ? 762  CYS A CA  1 
ATOM   637   C  C   . CYS A 1 166  ? -64.308 -27.718 27.520  1.00 70.10  ? 762  CYS A C   1 
ATOM   638   O  O   . CYS A 1 166  ? -65.262 -28.095 28.203  1.00 71.24  ? 762  CYS A O   1 
ATOM   639   C  CB  . CYS A 1 166  ? -64.970 -26.288 25.575  1.00 67.09  ? 762  CYS A CB  1 
ATOM   640   S  SG  . CYS A 1 166  ? -65.157 -26.099 23.789  1.00 69.27  ? 762  CYS A SG  1 
ATOM   641   N  N   . VAL A 1 167  ? -63.144 -27.355 28.048  1.00 63.70  ? 763  VAL A N   1 
ATOM   642   C  CA  . VAL A 1 167  ? -62.910 -27.460 29.482  1.00 63.20  ? 763  VAL A CA  1 
ATOM   643   C  C   . VAL A 1 167  ? -62.278 -26.221 30.104  1.00 74.28  ? 763  VAL A C   1 
ATOM   644   O  O   . VAL A 1 167  ? -61.617 -25.424 29.428  1.00 83.66  ? 763  VAL A O   1 
ATOM   645   C  CB  . VAL A 1 167  ? -62.008 -28.661 29.816  1.00 66.69  ? 763  VAL A CB  1 
ATOM   646   C  CG1 . VAL A 1 167  ? -62.753 -29.969 29.599  1.00 66.93  ? 763  VAL A CG1 1 
ATOM   647   C  CG2 . VAL A 1 167  ? -60.731 -28.613 28.990  1.00 57.37  ? 763  VAL A CG2 1 
ATOM   648   N  N   . SER A 1 168  ? -62.480 -26.094 31.413  1.00 70.17  ? 764  SER A N   1 
ATOM   649   C  CA  . SER A 1 168  ? -61.917 -25.019 32.215  1.00 77.90  ? 764  SER A CA  1 
ATOM   650   C  C   . SER A 1 168  ? -60.840 -25.537 33.168  1.00 79.25  ? 764  SER A C   1 
ATOM   651   O  O   . SER A 1 168  ? -61.049 -26.525 33.891  1.00 95.81  ? 764  SER A O   1 
ATOM   652   C  CB  . SER A 1 168  ? -63.015 -24.309 33.010  1.00 77.25  ? 764  SER A CB  1 
ATOM   653   O  OG  . SER A 1 168  ? -63.507 -25.121 34.065  1.00 72.10  ? 764  SER A OG  1 
ATOM   654   N  N   . VAL A 1 169  ? -59.695 -24.856 33.140  1.00 68.99  ? 765  VAL A N   1 
ATOM   655   C  CA  . VAL A 1 169  ? -58.539 -25.146 33.971  1.00 75.50  ? 765  VAL A CA  1 
ATOM   656   C  C   . VAL A 1 169  ? -58.186 -23.899 34.779  1.00 81.13  ? 765  VAL A C   1 
ATOM   657   O  O   . VAL A 1 169  ? -58.304 -22.771 34.278  1.00 84.09  ? 765  VAL A O   1 
ATOM   658   C  CB  . VAL A 1 169  ? -57.323 -25.571 33.128  1.00 73.28  ? 765  VAL A CB  1 
ATOM   659   C  CG1 . VAL A 1 169  ? -56.261 -26.210 34.011  1.00 93.29  ? 765  VAL A CG1 1 
ATOM   660   C  CG2 . VAL A 1 169  ? -57.748 -26.518 32.019  1.00 73.47  ? 765  VAL A CG2 1 
ATOM   661   N  N   . ILE A 1 170  ? -57.745 -24.114 36.018  1.00 83.43  ? 766  ILE A N   1 
ATOM   662   C  CA  . ILE A 1 170  ? -57.455 -23.041 36.975  1.00 98.12  ? 766  ILE A CA  1 
ATOM   663   C  C   . ILE A 1 170  ? -56.010 -22.529 36.923  1.00 107.14 ? 766  ILE A C   1 
ATOM   664   O  O   . ILE A 1 170  ? -55.066 -23.320 36.935  1.00 105.15 ? 766  ILE A O   1 
ATOM   665   C  CB  . ILE A 1 170  ? -57.756 -23.517 38.420  1.00 94.80  ? 766  ILE A CB  1 
ATOM   666   C  CG1 . ILE A 1 170  ? -59.264 -23.609 38.652  1.00 76.38  ? 766  ILE A CG1 1 
ATOM   667   C  CG2 . ILE A 1 170  ? -57.122 -22.593 39.456  1.00 93.94  ? 766  ILE A CG2 1 
ATOM   668   C  CD1 . ILE A 1 170  ? -59.932 -22.269 38.851  1.00 69.27  ? 766  ILE A CD1 1 
ATOM   669   N  N   . PRO A 1 171  ? -55.836 -21.195 36.881  1.00 113.20 ? 767  PRO A N   1 
ATOM   670   C  CA  . PRO A 1 171  ? -54.513 -20.557 36.929  1.00 109.62 ? 767  PRO A CA  1 
ATOM   671   C  C   . PRO A 1 171  ? -53.830 -20.753 38.280  1.00 115.69 ? 767  PRO A C   1 
ATOM   672   O  O   . PRO A 1 171  ? -54.496 -20.645 39.308  1.00 123.21 ? 767  PRO A O   1 
ATOM   673   C  CB  . PRO A 1 171  ? -54.832 -19.077 36.698  1.00 114.89 ? 767  PRO A CB  1 
ATOM   674   C  CG  . PRO A 1 171  ? -56.225 -18.923 37.204  1.00 110.09 ? 767  PRO A CG  1 
ATOM   675   C  CD  . PRO A 1 171  ? -56.917 -20.197 36.812  1.00 101.81 ? 767  PRO A CD  1 
ATOM   676   N  N   . ASP A 1 172  ? -52.528 -21.029 38.278  1.00 116.70 ? 768  ASP A N   1 
ATOM   677   C  CA  . ASP A 1 172  ? -51.794 -21.210 39.526  1.00 129.83 ? 768  ASP A CA  1 
ATOM   678   C  C   . ASP A 1 172  ? -51.803 -19.923 40.337  1.00 134.42 ? 768  ASP A C   1 
ATOM   679   O  O   . ASP A 1 172  ? -51.926 -19.951 41.562  1.00 128.73 ? 768  ASP A O   1 
ATOM   680   C  CB  . ASP A 1 172  ? -50.352 -21.654 39.265  1.00 137.78 ? 768  ASP A CB  1 
ATOM   681   C  CG  . ASP A 1 172  ? -49.522 -20.581 38.589  1.00 137.71 ? 768  ASP A CG  1 
ATOM   682   O  OD1 . ASP A 1 172  ? -49.986 -20.014 37.578  1.00 128.59 ? 768  ASP A OD1 1 
ATOM   683   O  OD2 . ASP A 1 172  ? -48.411 -20.292 39.081  1.00 131.40 ? 768  ASP A OD2 1 
ATOM   684   N  N   . ASP A 1 173  ? -51.676 -18.795 39.647  1.00 143.09 ? 769  ASP A N   1 
ATOM   685   C  CA  . ASP A 1 173  ? -51.765 -17.500 40.299  1.00 143.27 ? 769  ASP A CA  1 
ATOM   686   C  C   . ASP A 1 173  ? -53.197 -17.262 40.748  1.00 139.83 ? 769  ASP A C   1 
ATOM   687   O  O   . ASP A 1 173  ? -54.140 -17.787 40.155  1.00 126.30 ? 769  ASP A O   1 
ATOM   688   C  CB  . ASP A 1 173  ? -51.303 -16.380 39.363  1.00 127.15 ? 769  ASP A CB  1 
ATOM   689   C  CG  . ASP A 1 173  ? -49.811 -16.419 39.097  1.00 140.75 ? 769  ASP A CG  1 
ATOM   690   O  OD1 . ASP A 1 173  ? -49.250 -17.529 38.989  1.00 151.39 ? 769  ASP A OD1 1 
ATOM   691   O  OD2 . ASP A 1 173  ? -49.197 -15.335 38.999  1.00 132.38 ? 769  ASP A OD2 1 
ATOM   692   N  N   . SER A 1 174  ? -53.354 -16.462 41.798  1.00 150.43 ? 770  SER A N   1 
ATOM   693   C  CA  . SER A 1 174  ? -54.670 -16.102 42.310  1.00 146.53 ? 770  SER A CA  1 
ATOM   694   C  C   . SER A 1 174  ? -55.433 -15.236 41.311  1.00 150.35 ? 770  SER A C   1 
ATOM   695   O  O   . SER A 1 174  ? -56.613 -14.941 41.508  1.00 138.96 ? 770  SER A O   1 
ATOM   696   C  CB  . SER A 1 174  ? -54.541 -15.383 43.654  1.00 139.00 ? 770  SER A CB  1 
ATOM   697   O  OG  . SER A 1 174  ? -53.505 -14.418 43.618  1.00 127.77 ? 770  SER A OG  1 
ATOM   698   N  N   . SER A 1 175  ? -54.745 -14.828 40.247  1.00 151.15 ? 771  SER A N   1 
ATOM   699   C  CA  . SER A 1 175  ? -55.326 -14.001 39.196  1.00 144.57 ? 771  SER A CA  1 
ATOM   700   C  C   . SER A 1 175  ? -56.592 -14.622 38.617  1.00 144.56 ? 771  SER A C   1 
ATOM   701   O  O   . SER A 1 175  ? -56.686 -15.839 38.451  1.00 145.29 ? 771  SER A O   1 
ATOM   702   C  CB  . SER A 1 175  ? -54.305 -13.768 38.079  1.00 136.70 ? 771  SER A CB  1 
ATOM   703   O  OG  . SER A 1 175  ? -53.093 -13.249 38.593  1.00 124.35 ? 771  SER A OG  1 
ATOM   704   N  N   . LYS A 1 176  ? -57.560 -13.765 38.310  1.00 140.58 ? 772  LYS A N   1 
ATOM   705   C  CA  . LYS A 1 176  ? -58.881 -14.188 37.850  1.00 138.32 ? 772  LYS A CA  1 
ATOM   706   C  C   . LYS A 1 176  ? -58.999 -15.016 36.558  1.00 126.15 ? 772  LYS A C   1 
ATOM   707   O  O   . LYS A 1 176  ? -59.888 -15.868 36.489  1.00 117.02 ? 772  LYS A O   1 
ATOM   708   C  CB  . LYS A 1 176  ? -59.782 -12.960 37.698  1.00 135.31 ? 772  LYS A CB  1 
ATOM   709   C  CG  . LYS A 1 176  ? -60.627 -12.670 38.932  1.00 133.03 ? 772  LYS A CG  1 
ATOM   710   C  CD  . LYS A 1 176  ? -61.862 -11.850 38.588  1.00 126.70 ? 772  LYS A CD  1 
ATOM   711   C  CE  . LYS A 1 176  ? -62.800 -12.618 37.668  1.00 117.42 ? 772  LYS A CE  1 
ATOM   712   N  NZ  . LYS A 1 176  ? -63.328 -13.864 38.293  1.00 117.38 ? 772  LYS A NZ  1 
ATOM   713   N  N   . PRO A 1 177  ? -58.161 -14.756 35.525  1.00 116.35 ? 773  PRO A N   1 
ATOM   714   C  CA  . PRO A 1 177  ? -58.502 -15.418 34.257  1.00 119.94 ? 773  PRO A CA  1 
ATOM   715   C  C   . PRO A 1 177  ? -58.589 -16.936 34.354  1.00 115.08 ? 773  PRO A C   1 
ATOM   716   O  O   . PRO A 1 177  ? -57.667 -17.594 34.828  1.00 122.04 ? 773  PRO A O   1 
ATOM   717   C  CB  . PRO A 1 177  ? -57.349 -15.013 33.326  1.00 118.57 ? 773  PRO A CB  1 
ATOM   718   C  CG  . PRO A 1 177  ? -56.229 -14.660 34.238  1.00 118.92 ? 773  PRO A CG  1 
ATOM   719   C  CD  . PRO A 1 177  ? -56.899 -14.005 35.404  1.00 112.84 ? 773  PRO A CD  1 
ATOM   720   N  N   . LEU A 1 178  ? -59.706 -17.476 33.882  1.00 95.43  ? 774  LEU A N   1 
ATOM   721   C  CA  . LEU A 1 178  ? -59.971 -18.902 33.961  1.00 93.88  ? 774  LEU A CA  1 
ATOM   722   C  C   . LEU A 1 178  ? -59.644 -19.539 32.625  1.00 81.40  ? 774  LEU A C   1 
ATOM   723   O  O   . LEU A 1 178  ? -60.336 -19.297 31.636  1.00 84.34  ? 774  LEU A O   1 
ATOM   724   C  CB  . LEU A 1 178  ? -61.431 -19.158 34.343  1.00 97.84  ? 774  LEU A CB  1 
ATOM   725   C  CG  . LEU A 1 178  ? -61.897 -20.611 34.466  1.00 91.51  ? 774  LEU A CG  1 
ATOM   726   C  CD1 . LEU A 1 178  ? -61.129 -21.329 35.561  1.00 81.67  ? 774  LEU A CD1 1 
ATOM   727   C  CD2 . LEU A 1 178  ? -63.394 -20.665 34.731  1.00 80.08  ? 774  LEU A CD2 1 
ATOM   728   N  N   . TYR A 1 179  ? -58.586 -20.343 32.594  1.00 77.39  ? 775  TYR A N   1 
ATOM   729   C  CA  . TYR A 1 179  ? -58.109 -20.889 31.330  1.00 75.81  ? 775  TYR A CA  1 
ATOM   730   C  C   . TYR A 1 179  ? -59.164 -21.783 30.701  1.00 67.94  ? 775  TYR A C   1 
ATOM   731   O  O   . TYR A 1 179  ? -59.729 -22.648 31.358  1.00 81.91  ? 775  TYR A O   1 
ATOM   732   C  CB  . TYR A 1 179  ? -56.803 -21.660 31.528  1.00 85.03  ? 775  TYR A CB  1 
ATOM   733   C  CG  . TYR A 1 179  ? -55.595 -20.780 31.767  1.00 94.38  ? 775  TYR A CG  1 
ATOM   734   C  CD1 . TYR A 1 179  ? -55.388 -20.171 32.997  1.00 102.86 ? 775  TYR A CD1 1 
ATOM   735   C  CD2 . TYR A 1 179  ? -54.656 -20.568 30.765  1.00 100.46 ? 775  TYR A CD2 1 
ATOM   736   C  CE1 . TYR A 1 179  ? -54.283 -19.370 33.222  1.00 108.97 ? 775  TYR A CE1 1 
ATOM   737   C  CE2 . TYR A 1 179  ? -53.547 -19.770 30.982  1.00 104.29 ? 775  TYR A CE2 1 
ATOM   738   C  CZ  . TYR A 1 179  ? -53.367 -19.174 32.212  1.00 102.77 ? 775  TYR A CZ  1 
ATOM   739   O  OH  . TYR A 1 179  ? -52.266 -18.378 32.434  1.00 93.32  ? 775  TYR A OH  1 
ATOM   740   N  N   . LEU A 1 180  ? -59.443 -21.545 29.425  1.00 63.13  ? 776  LEU A N   1 
ATOM   741   C  CA  . LEU A 1 180  ? -60.418 -22.337 28.690  1.00 60.73  ? 776  LEU A CA  1 
ATOM   742   C  C   . LEU A 1 180  ? -59.751 -22.992 27.494  1.00 61.79  ? 776  LEU A C   1 
ATOM   743   O  O   . LEU A 1 180  ? -58.893 -22.389 26.849  1.00 80.48  ? 776  LEU A O   1 
ATOM   744   C  CB  . LEU A 1 180  ? -61.589 -21.467 28.230  1.00 67.28  ? 776  LEU A CB  1 
ATOM   745   C  CG  . LEU A 1 180  ? -62.322 -20.658 29.301  1.00 66.07  ? 776  LEU A CG  1 
ATOM   746   C  CD1 . LEU A 1 180  ? -63.539 -19.974 28.703  1.00 64.09  ? 776  LEU A CD1 1 
ATOM   747   C  CD2 . LEU A 1 180  ? -62.722 -21.540 30.471  1.00 82.50  ? 776  LEU A CD2 1 
ATOM   748   N  N   . ALA A 1 181  ? -60.143 -24.224 27.194  1.00 58.31  ? 777  ALA A N   1 
ATOM   749   C  CA  . ALA A 1 181  ? -59.541 -24.936 26.075  1.00 46.58  ? 777  ALA A CA  1 
ATOM   750   C  C   . ALA A 1 181  ? -60.519 -25.879 25.401  1.00 57.85  ? 777  ALA A C   1 
ATOM   751   O  O   . ALA A 1 181  ? -61.601 -26.147 25.916  1.00 71.64  ? 777  ALA A O   1 
ATOM   752   C  CB  . ALA A 1 181  ? -58.318 -25.705 26.541  1.00 49.56  ? 777  ALA A CB  1 
ATOM   753   N  N   . ARG A 1 182  ? -60.122 -26.368 24.233  1.00 58.58  ? 778  ARG A N   1 
ATOM   754   C  CA  . ARG A 1 182  ? -60.854 -27.412 23.537  1.00 53.43  ? 778  ARG A CA  1 
ATOM   755   C  C   . ARG A 1 182  ? -60.022 -28.686 23.557  1.00 69.05  ? 778  ARG A C   1 
ATOM   756   O  O   . ARG A 1 182  ? -58.813 -28.655 23.310  1.00 71.06  ? 778  ARG A O   1 
ATOM   757   C  CB  . ARG A 1 182  ? -61.177 -26.996 22.101  1.00 54.09  ? 778  ARG A CB  1 
ATOM   758   C  CG  . ARG A 1 182  ? -61.578 -28.151 21.193  1.00 68.34  ? 778  ARG A CG  1 
ATOM   759   C  CD  . ARG A 1 182  ? -62.013 -27.664 19.819  1.00 63.54  ? 778  ARG A CD  1 
ATOM   760   N  NE  . ARG A 1 182  ? -63.467 -27.593 19.698  1.00 67.56  ? 778  ARG A NE  1 
ATOM   761   C  CZ  . ARG A 1 182  ? -64.190 -26.515 19.982  1.00 77.31  ? 778  ARG A CZ  1 
ATOM   762   N  NH1 . ARG A 1 182  ? -63.596 -25.409 20.403  1.00 64.45  ? 778  ARG A NH1 1 
ATOM   763   N  NH2 . ARG A 1 182  ? -65.509 -26.542 19.842  1.00 82.34  ? 778  ARG A NH2 1 
ATOM   764   N  N   . VAL A 1 183  ? -60.675 -29.799 23.874  1.00 79.37  ? 779  VAL A N   1 
ATOM   765   C  CA  . VAL A 1 183  ? -60.018 -31.098 23.913  1.00 85.05  ? 779  VAL A CA  1 
ATOM   766   C  C   . VAL A 1 183  ? -59.870 -31.655 22.504  1.00 77.35  ? 779  VAL A C   1 
ATOM   767   O  O   . VAL A 1 183  ? -60.853 -32.072 21.891  1.00 64.64  ? 779  VAL A O   1 
ATOM   768   C  CB  . VAL A 1 183  ? -60.804 -32.101 24.776  1.00 84.63  ? 779  VAL A CB  1 
ATOM   769   C  CG1 . VAL A 1 183  ? -60.100 -33.448 24.800  1.00 72.04  ? 779  VAL A CG1 1 
ATOM   770   C  CG2 . VAL A 1 183  ? -60.985 -31.559 26.185  1.00 55.85  ? 779  VAL A CG2 1 
ATOM   771   N  N   . THR A 1 184  ? -58.645 -31.662 21.988  1.00 77.63  ? 780  THR A N   1 
ATOM   772   C  CA  . THR A 1 184  ? -58.425 -32.103 20.614  1.00 76.56  ? 780  THR A CA  1 
ATOM   773   C  C   . THR A 1 184  ? -58.051 -33.578 20.536  1.00 77.47  ? 780  THR A C   1 
ATOM   774   O  O   . THR A 1 184  ? -58.245 -34.220 19.505  1.00 75.76  ? 780  THR A O   1 
ATOM   775   C  CB  . THR A 1 184  ? -57.327 -31.282 19.927  1.00 65.66  ? 780  THR A CB  1 
ATOM   776   O  OG1 . THR A 1 184  ? -56.054 -31.624 20.484  1.00 78.63  ? 780  THR A OG1 1 
ATOM   777   C  CG2 . THR A 1 184  ? -57.581 -29.799 20.116  1.00 58.49  ? 780  THR A CG2 1 
ATOM   778   N  N   . ALA A 1 185  ? -57.508 -34.107 21.627  1.00 78.62  ? 781  ALA A N   1 
ATOM   779   C  CA  . ALA A 1 185  ? -57.090 -35.502 21.667  1.00 83.50  ? 781  ALA A CA  1 
ATOM   780   C  C   . ALA A 1 185  ? -57.058 -36.029 23.093  1.00 84.59  ? 781  ALA A C   1 
ATOM   781   O  O   . ALA A 1 185  ? -56.729 -35.300 24.022  1.00 76.50  ? 781  ALA A O   1 
ATOM   782   C  CB  . ALA A 1 185  ? -55.726 -35.664 21.020  1.00 87.94  ? 781  ALA A CB  1 
ATOM   783   N  N   . LEU A 1 186  ? -57.405 -37.300 23.256  1.00 89.24  ? 782  LEU A N   1 
ATOM   784   C  CA  . LEU A 1 186  ? -57.310 -37.973 24.546  1.00 75.37  ? 782  LEU A CA  1 
ATOM   785   C  C   . LEU A 1 186  ? -56.439 -39.209 24.396  1.00 86.37  ? 782  LEU A C   1 
ATOM   786   O  O   . LEU A 1 186  ? -56.642 -39.992 23.471  1.00 76.57  ? 782  LEU A O   1 
ATOM   787   C  CB  . LEU A 1 186  ? -58.696 -38.361 25.063  1.00 72.59  ? 782  LEU A CB  1 
ATOM   788   C  CG  . LEU A 1 186  ? -59.692 -37.236 25.345  1.00 66.85  ? 782  LEU A CG  1 
ATOM   789   C  CD1 . LEU A 1 186  ? -61.104 -37.790 25.416  1.00 65.89  ? 782  LEU A CD1 1 
ATOM   790   C  CD2 . LEU A 1 186  ? -59.334 -36.526 26.638  1.00 64.26  ? 782  LEU A CD2 1 
ATOM   791   N  N   . TRP A 1 187  ? -55.469 -39.391 25.287  1.00 89.45  ? 783  TRP A N   1 
ATOM   792   C  CA  . TRP A 1 187  ? -54.616 -40.571 25.199  1.00 95.07  ? 783  TRP A CA  1 
ATOM   793   C  C   . TRP A 1 187  ? -53.963 -40.971 26.518  1.00 95.91  ? 783  TRP A C   1 
ATOM   794   O  O   . TRP A 1 187  ? -53.723 -40.142 27.396  1.00 100.31 ? 783  TRP A O   1 
ATOM   795   C  CB  . TRP A 1 187  ? -53.528 -40.363 24.138  1.00 96.72  ? 783  TRP A CB  1 
ATOM   796   C  CG  . TRP A 1 187  ? -52.361 -39.523 24.577  1.00 94.22  ? 783  TRP A CG  1 
ATOM   797   C  CD1 . TRP A 1 187  ? -51.205 -39.963 25.157  1.00 105.56 ? 783  TRP A CD1 1 
ATOM   798   C  CD2 . TRP A 1 187  ? -52.229 -38.103 24.451  1.00 85.23  ? 783  TRP A CD2 1 
ATOM   799   N  NE1 . TRP A 1 187  ? -50.366 -38.904 25.406  1.00 89.87  ? 783  TRP A NE1 1 
ATOM   800   C  CE2 . TRP A 1 187  ? -50.970 -37.751 24.979  1.00 86.56  ? 783  TRP A CE2 1 
ATOM   801   C  CE3 . TRP A 1 187  ? -53.053 -37.094 23.944  1.00 88.87  ? 783  TRP A CE3 1 
ATOM   802   C  CZ2 . TRP A 1 187  ? -50.519 -36.434 25.018  1.00 87.51  ? 783  TRP A CZ2 1 
ATOM   803   C  CZ3 . TRP A 1 187  ? -52.603 -35.788 23.984  1.00 91.30  ? 783  TRP A CZ3 1 
ATOM   804   C  CH2 . TRP A 1 187  ? -51.349 -35.470 24.518  1.00 87.52  ? 783  TRP A CH2 1 
ATOM   805   N  N   . GLU A 1 188  ? -53.689 -42.266 26.633  1.00 93.17  ? 784  GLU A N   1 
ATOM   806   C  CA  . GLU A 1 188  ? -52.940 -42.825 27.747  1.00 103.61 ? 784  GLU A CA  1 
ATOM   807   C  C   . GLU A 1 188  ? -51.497 -43.060 27.321  1.00 98.42  ? 784  GLU A C   1 
ATOM   808   O  O   . GLU A 1 188  ? -51.233 -43.813 26.382  1.00 93.37  ? 784  GLU A O   1 
ATOM   809   C  CB  . GLU A 1 188  ? -53.572 -44.134 28.225  1.00 104.50 ? 784  GLU A CB  1 
ATOM   810   C  CG  . GLU A 1 188  ? -52.700 -44.941 29.179  1.00 88.29  ? 784  GLU A CG  1 
ATOM   811   C  CD  . GLU A 1 188  ? -52.847 -44.505 30.624  1.00 99.47  ? 784  GLU A CD  1 
ATOM   812   O  OE1 . GLU A 1 188  ? -53.997 -44.356 31.088  1.00 106.35 ? 784  GLU A OE1 1 
ATOM   813   O  OE2 . GLU A 1 188  ? -51.811 -44.312 31.295  1.00 93.76  ? 784  GLU A OE2 1 
ATOM   814   N  N   . ASP A 1 189  ? -50.568 -42.402 28.004  1.00 107.71 ? 785  ASP A N   1 
ATOM   815   C  CA  . ASP A 1 189  ? -49.149 -42.603 27.751  1.00 119.49 ? 785  ASP A CA  1 
ATOM   816   C  C   . ASP A 1 189  ? -48.491 -43.210 28.980  1.00 112.19 ? 785  ASP A C   1 
ATOM   817   O  O   . ASP A 1 189  ? -48.263 -42.522 29.974  1.00 99.96  ? 785  ASP A O   1 
ATOM   818   C  CB  . ASP A 1 189  ? -48.470 -41.284 27.371  1.00 126.61 ? 785  ASP A CB  1 
ATOM   819   C  CG  . ASP A 1 189  ? -46.987 -41.450 27.090  1.00 131.32 ? 785  ASP A CG  1 
ATOM   820   O  OD1 . ASP A 1 189  ? -46.555 -42.585 26.800  1.00 131.13 ? 785  ASP A OD1 1 
ATOM   821   O  OD2 . ASP A 1 189  ? -46.254 -40.441 27.151  1.00 123.19 ? 785  ASP A OD2 1 
ATOM   822   N  N   . SER A 1 190  ? -48.185 -44.502 28.901  1.00 115.69 ? 786  SER A N   1 
ATOM   823   C  CA  . SER A 1 190  ? -47.592 -45.234 30.016  1.00 120.17 ? 786  SER A CA  1 
ATOM   824   C  C   . SER A 1 190  ? -46.285 -44.607 30.492  1.00 113.25 ? 786  SER A C   1 
ATOM   825   O  O   . SER A 1 190  ? -45.868 -44.805 31.633  1.00 102.13 ? 786  SER A O   1 
ATOM   826   C  CB  . SER A 1 190  ? -47.369 -46.695 29.624  1.00 113.14 ? 786  SER A CB  1 
ATOM   827   O  OG  . SER A 1 190  ? -47.132 -46.814 28.232  1.00 119.91 ? 786  SER A OG  1 
ATOM   828   N  N   . SER A 1 191  ? -45.645 -43.844 29.613  1.00 113.35 ? 787  SER A N   1 
ATOM   829   C  CA  . SER A 1 191  ? -44.452 -43.096 29.981  1.00 123.45 ? 787  SER A CA  1 
ATOM   830   C  C   . SER A 1 191  ? -44.806 -41.877 30.828  1.00 119.23 ? 787  SER A C   1 
ATOM   831   O  O   . SER A 1 191  ? -44.118 -41.565 31.800  1.00 99.06  ? 787  SER A O   1 
ATOM   832   C  CB  . SER A 1 191  ? -43.687 -42.655 28.732  1.00 122.26 ? 787  SER A CB  1 
ATOM   833   O  OG  . SER A 1 191  ? -42.585 -41.831 29.072  1.00 119.22 ? 787  SER A OG  1 
ATOM   834   N  N   . ASN A 1 192  ? -45.888 -41.197 30.460  1.00 114.93 ? 788  ASN A N   1 
ATOM   835   C  CA  . ASN A 1 192  ? -46.221 -39.917 31.074  1.00 117.19 ? 788  ASN A CA  1 
ATOM   836   C  C   . ASN A 1 192  ? -47.519 -39.938 31.885  1.00 116.55 ? 788  ASN A C   1 
ATOM   837   O  O   . ASN A 1 192  ? -47.616 -39.276 32.919  1.00 104.57 ? 788  ASN A O   1 
ATOM   838   C  CB  . ASN A 1 192  ? -46.299 -38.834 29.995  1.00 110.53 ? 788  ASN A CB  1 
ATOM   839   C  CG  . ASN A 1 192  ? -45.936 -37.461 30.522  1.00 113.36 ? 788  ASN A CG  1 
ATOM   840   O  OD1 . ASN A 1 192  ? -45.535 -37.314 31.677  1.00 94.22  ? 788  ASN A OD1 1 
ATOM   841   N  ND2 . ASN A 1 192  ? -46.061 -36.447 29.672  1.00 91.58  ? 788  ASN A ND2 1 
ATOM   842   N  N   . GLY A 1 193  ? -48.514 -40.687 31.417  1.00 101.50 ? 789  GLY A N   1 
ATOM   843   C  CA  . GLY A 1 193  ? -49.763 -40.829 32.147  1.00 87.04  ? 789  GLY A CA  1 
ATOM   844   C  C   . GLY A 1 193  ? -51.006 -40.646 31.295  1.00 92.25  ? 789  GLY A C   1 
ATOM   845   O  O   . GLY A 1 193  ? -50.978 -40.853 30.081  1.00 97.43  ? 789  GLY A O   1 
ATOM   846   N  N   . GLN A 1 194  ? -52.105 -40.268 31.943  1.00 101.35 ? 790  GLN A N   1 
ATOM   847   C  CA  . GLN A 1 194  ? -53.352 -39.965 31.249  1.00 99.03  ? 790  GLN A CA  1 
ATOM   848   C  C   . GLN A 1 194  ? -53.314 -38.528 30.744  1.00 101.54 ? 790  GLN A C   1 
ATOM   849   O  O   . GLN A 1 194  ? -53.225 -37.590 31.535  1.00 100.16 ? 790  GLN A O   1 
ATOM   850   C  CB  . GLN A 1 194  ? -54.553 -40.176 32.171  1.00 93.31  ? 790  GLN A CB  1 
ATOM   851   C  CG  . GLN A 1 194  ? -54.712 -41.601 32.674  1.00 85.31  ? 790  GLN A CG  1 
ATOM   852   C  CD  . GLN A 1 194  ? -55.831 -41.738 33.687  1.00 89.43  ? 790  GLN A CD  1 
ATOM   853   O  OE1 . GLN A 1 194  ? -55.808 -41.106 34.745  1.00 71.85  ? 790  GLN A OE1 1 
ATOM   854   N  NE2 . GLN A 1 194  ? -56.821 -42.563 33.368  1.00 83.58  ? 790  GLN A NE2 1 
ATOM   855   N  N   . MET A 1 195  ? -53.384 -38.357 29.428  1.00 94.72  ? 791  MET A N   1 
ATOM   856   C  CA  . MET A 1 195  ? -53.119 -37.056 28.823  1.00 84.05  ? 791  MET A CA  1 
ATOM   857   C  C   . MET A 1 195  ? -54.171 -36.606 27.812  1.00 80.52  ? 791  MET A C   1 
ATOM   858   O  O   . MET A 1 195  ? -54.878 -37.424 27.222  1.00 75.44  ? 791  MET A O   1 
ATOM   859   C  CB  . MET A 1 195  ? -51.753 -37.080 28.140  1.00 74.19  ? 791  MET A CB  1 
ATOM   860   C  CG  . MET A 1 195  ? -50.600 -37.466 29.043  1.00 77.08  ? 791  MET A CG  1 
ATOM   861   S  SD  . MET A 1 195  ? -49.763 -36.022 29.713  1.00 93.06  ? 791  MET A SD  1 
ATOM   862   C  CE  . MET A 1 195  ? -49.135 -35.283 28.209  1.00 94.15  ? 791  MET A CE  1 
ATOM   863   N  N   . PHE A 1 196  ? -54.254 -35.293 27.616  1.00 81.84  ? 792  PHE A N   1 
ATOM   864   C  CA  . PHE A 1 196  ? -55.097 -34.714 26.576  1.00 83.11  ? 792  PHE A CA  1 
ATOM   865   C  C   . PHE A 1 196  ? -54.414 -33.492 25.970  1.00 72.70  ? 792  PHE A C   1 
ATOM   866   O  O   . PHE A 1 196  ? -53.532 -32.900 26.590  1.00 70.41  ? 792  PHE A O   1 
ATOM   867   C  CB  . PHE A 1 196  ? -56.474 -34.337 27.130  1.00 71.35  ? 792  PHE A CB  1 
ATOM   868   C  CG  . PHE A 1 196  ? -56.519 -32.990 27.797  1.00 62.11  ? 792  PHE A CG  1 
ATOM   869   C  CD1 . PHE A 1 196  ? -55.790 -32.744 28.948  1.00 64.57  ? 792  PHE A CD1 1 
ATOM   870   C  CD2 . PHE A 1 196  ? -57.297 -31.969 27.273  1.00 58.81  ? 792  PHE A CD2 1 
ATOM   871   C  CE1 . PHE A 1 196  ? -55.832 -31.507 29.562  1.00 59.44  ? 792  PHE A CE1 1 
ATOM   872   C  CE2 . PHE A 1 196  ? -57.344 -30.730 27.885  1.00 55.99  ? 792  PHE A CE2 1 
ATOM   873   C  CZ  . PHE A 1 196  ? -56.610 -30.499 29.030  1.00 58.11  ? 792  PHE A CZ  1 
ATOM   874   N  N   . HIS A 1 197  ? -54.815 -33.123 24.758  1.00 81.41  ? 793  HIS A N   1 
ATOM   875   C  CA  . HIS A 1 197  ? -54.244 -31.950 24.106  1.00 77.64  ? 793  HIS A CA  1 
ATOM   876   C  C   . HIS A 1 197  ? -55.210 -30.771 24.152  1.00 66.83  ? 793  HIS A C   1 
ATOM   877   O  O   . HIS A 1 197  ? -56.316 -30.825 23.597  1.00 63.90  ? 793  HIS A O   1 
ATOM   878   C  CB  . HIS A 1 197  ? -53.858 -32.259 22.659  1.00 85.77  ? 793  HIS A CB  1 
ATOM   879   C  CG  . HIS A 1 197  ? -53.129 -31.140 21.981  1.00 87.50  ? 793  HIS A CG  1 
ATOM   880   N  ND1 . HIS A 1 197  ? -52.088 -30.462 22.577  1.00 72.62  ? 793  HIS A ND1 1 
ATOM   881   C  CD2 . HIS A 1 197  ? -53.291 -30.580 20.759  1.00 85.99  ? 793  HIS A CD2 1 
ATOM   882   C  CE1 . HIS A 1 197  ? -51.639 -29.532 21.754  1.00 72.98  ? 793  HIS A CE1 1 
ATOM   883   N  NE2 . HIS A 1 197  ? -52.353 -29.583 20.642  1.00 87.94  ? 793  HIS A NE2 1 
ATOM   884   N  N   . ALA A 1 198  ? -54.772 -29.707 24.819  1.00 63.91  ? 794  ALA A N   1 
ATOM   885   C  CA  . ALA A 1 198  ? -55.598 -28.529 25.026  1.00 73.28  ? 794  ALA A CA  1 
ATOM   886   C  C   . ALA A 1 198  ? -55.304 -27.444 23.998  1.00 81.26  ? 794  ALA A C   1 
ATOM   887   O  O   . ALA A 1 198  ? -54.176 -26.941 23.911  1.00 69.52  ? 794  ALA A O   1 
ATOM   888   C  CB  . ALA A 1 198  ? -55.398 -27.988 26.432  1.00 60.84  ? 794  ALA A CB  1 
ATOM   889   N  N   . HIS A 1 199  ? -56.328 -27.100 23.220  1.00 76.74  ? 795  HIS A N   1 
ATOM   890   C  CA  . HIS A 1 199  ? -56.259 -25.981 22.286  1.00 62.74  ? 795  HIS A CA  1 
ATOM   891   C  C   . HIS A 1 199  ? -56.946 -24.770 22.904  1.00 66.12  ? 795  HIS A C   1 
ATOM   892   O  O   . HIS A 1 199  ? -58.172 -24.688 22.939  1.00 65.54  ? 795  HIS A O   1 
ATOM   893   C  CB  . HIS A 1 199  ? -56.910 -26.343 20.951  1.00 69.94  ? 795  HIS A CB  1 
ATOM   894   C  CG  . HIS A 1 199  ? -56.877 -25.237 19.940  1.00 76.32  ? 795  HIS A CG  1 
ATOM   895   N  ND1 . HIS A 1 199  ? -57.572 -25.298 18.752  1.00 70.17  ? 795  HIS A ND1 1 
ATOM   896   C  CD2 . HIS A 1 199  ? -56.232 -24.048 19.939  1.00 65.40  ? 795  HIS A CD2 1 
ATOM   897   C  CE1 . HIS A 1 199  ? -57.359 -24.191 18.063  1.00 69.28  ? 795  HIS A CE1 1 
ATOM   898   N  NE2 . HIS A 1 199  ? -56.550 -23.415 18.761  1.00 59.13  ? 795  HIS A NE2 1 
ATOM   899   N  N   . TRP A 1 200  ? -56.143 -23.823 23.369  1.00 73.83  ? 796  TRP A N   1 
ATOM   900   C  CA  . TRP A 1 200  ? -56.636 -22.729 24.196  1.00 68.06  ? 796  TRP A CA  1 
ATOM   901   C  C   . TRP A 1 200  ? -57.520 -21.715 23.479  1.00 67.60  ? 796  TRP A C   1 
ATOM   902   O  O   . TRP A 1 200  ? -57.349 -21.445 22.290  1.00 67.42  ? 796  TRP A O   1 
ATOM   903   C  CB  . TRP A 1 200  ? -55.454 -21.990 24.816  1.00 69.00  ? 796  TRP A CB  1 
ATOM   904   C  CG  . TRP A 1 200  ? -54.583 -22.855 25.660  1.00 76.60  ? 796  TRP A CG  1 
ATOM   905   C  CD1 . TRP A 1 200  ? -53.318 -23.275 25.372  1.00 76.64  ? 796  TRP A CD1 1 
ATOM   906   C  CD2 . TRP A 1 200  ? -54.912 -23.415 26.935  1.00 91.62  ? 796  TRP A CD2 1 
ATOM   907   N  NE1 . TRP A 1 200  ? -52.837 -24.059 26.391  1.00 83.13  ? 796  TRP A NE1 1 
ATOM   908   C  CE2 . TRP A 1 200  ? -53.798 -24.162 27.363  1.00 95.54  ? 796  TRP A CE2 1 
ATOM   909   C  CE3 . TRP A 1 200  ? -56.041 -23.356 27.758  1.00 77.80  ? 796  TRP A CE3 1 
ATOM   910   C  CZ2 . TRP A 1 200  ? -53.778 -24.845 28.576  1.00 93.58  ? 796  TRP A CZ2 1 
ATOM   911   C  CZ3 . TRP A 1 200  ? -56.021 -24.035 28.960  1.00 82.13  ? 796  TRP A CZ3 1 
ATOM   912   C  CH2 . TRP A 1 200  ? -54.897 -24.769 29.359  1.00 93.50  ? 796  TRP A CH2 1 
ATOM   913   N  N   . PHE A 1 201  ? -58.467 -21.158 24.227  1.00 64.33  ? 797  PHE A N   1 
ATOM   914   C  CA  . PHE A 1 201  ? -59.210 -19.987 23.788  1.00 61.80  ? 797  PHE A CA  1 
ATOM   915   C  C   . PHE A 1 201  ? -58.544 -18.741 24.349  1.00 61.67  ? 797  PHE A C   1 
ATOM   916   O  O   . PHE A 1 201  ? -57.757 -18.819 25.294  1.00 62.84  ? 797  PHE A O   1 
ATOM   917   C  CB  . PHE A 1 201  ? -60.669 -20.037 24.247  1.00 57.97  ? 797  PHE A CB  1 
ATOM   918   C  CG  . PHE A 1 201  ? -61.466 -21.148 23.636  1.00 56.85  ? 797  PHE A CG  1 
ATOM   919   C  CD1 . PHE A 1 201  ? -61.857 -21.094 22.309  1.00 68.41  ? 797  PHE A CD1 1 
ATOM   920   C  CD2 . PHE A 1 201  ? -61.850 -22.238 24.398  1.00 59.49  ? 797  PHE A CD2 1 
ATOM   921   C  CE1 . PHE A 1 201  ? -62.600 -22.113 21.749  1.00 74.30  ? 797  PHE A CE1 1 
ATOM   922   C  CE2 . PHE A 1 201  ? -62.594 -23.259 23.845  1.00 71.07  ? 797  PHE A CE2 1 
ATOM   923   C  CZ  . PHE A 1 201  ? -62.970 -23.197 22.519  1.00 70.42  ? 797  PHE A CZ  1 
ATOM   924   N  N   . CYS A 1 202  ? -58.866 -17.592 23.768  1.00 57.20  ? 798  CYS A N   1 
ATOM   925   C  CA  . CYS A 1 202  ? -58.415 -16.319 24.303  1.00 66.75  ? 798  CYS A CA  1 
ATOM   926   C  C   . CYS A 1 202  ? -59.598 -15.552 24.855  1.00 68.86  ? 798  CYS A C   1 
ATOM   927   O  O   . CYS A 1 202  ? -60.629 -15.418 24.189  1.00 70.57  ? 798  CYS A O   1 
ATOM   928   C  CB  . CYS A 1 202  ? -57.706 -15.487 23.236  1.00 56.83  ? 798  CYS A CB  1 
ATOM   929   S  SG  . CYS A 1 202  ? -57.041 -13.916 23.842  1.00 63.00  ? 798  CYS A SG  1 
ATOM   930   N  N   . ALA A 1 203  ? -59.447 -15.063 26.080  1.00 64.21  ? 799  ALA A N   1 
ATOM   931   C  CA  . ALA A 1 203  ? -60.457 -14.215 26.687  1.00 68.86  ? 799  ALA A CA  1 
ATOM   932   C  C   . ALA A 1 203  ? -60.595 -12.946 25.864  1.00 68.52  ? 799  ALA A C   1 
ATOM   933   O  O   . ALA A 1 203  ? -59.597 -12.367 25.433  1.00 54.37  ? 799  ALA A O   1 
ATOM   934   C  CB  . ALA A 1 203  ? -60.093 -13.889 28.126  1.00 58.78  ? 799  ALA A CB  1 
ATOM   935   N  N   . GLY A 1 204  ? -61.834 -12.526 25.637  1.00 66.06  ? 800  GLY A N   1 
ATOM   936   C  CA  . GLY A 1 204  ? -62.097 -11.323 24.872  1.00 60.17  ? 800  GLY A CA  1 
ATOM   937   C  C   . GLY A 1 204  ? -61.480 -10.103 25.525  1.00 59.95  ? 800  GLY A C   1 
ATOM   938   O  O   . GLY A 1 204  ? -61.124 -9.138  24.851  1.00 64.66  ? 800  GLY A O   1 
ATOM   939   N  N   . THR A 1 205  ? -61.348 -10.154 26.846  1.00 60.96  ? 801  THR A N   1 
ATOM   940   C  CA  . THR A 1 205  ? -60.761 -9.055  27.601  1.00 64.13  ? 801  THR A CA  1 
ATOM   941   C  C   . THR A 1 205  ? -59.237 -9.100  27.570  1.00 61.04  ? 801  THR A C   1 
ATOM   942   O  O   . THR A 1 205  ? -58.573 -8.205  28.090  1.00 63.65  ? 801  THR A O   1 
ATOM   943   C  CB  . THR A 1 205  ? -61.234 -9.063  29.065  1.00 61.77  ? 801  THR A CB  1 
ATOM   944   O  OG1 . THR A 1 205  ? -60.445 -8.144  29.827  1.00 68.79  ? 801  THR A OG1 1 
ATOM   945   C  CG2 . THR A 1 205  ? -61.094 -10.454 29.660  1.00 57.22  ? 801  THR A CG2 1 
ATOM   946   N  N   . ASP A 1 206  ? -58.689 -10.146 26.961  1.00 50.60  ? 802  ASP A N   1 
ATOM   947   C  CA  . ASP A 1 206  ? -57.243 -10.268 26.819  1.00 70.07  ? 802  ASP A CA  1 
ATOM   948   C  C   . ASP A 1 206  ? -56.812 -9.959  25.390  1.00 71.31  ? 802  ASP A C   1 
ATOM   949   O  O   . ASP A 1 206  ? -55.637 -10.081 25.043  1.00 75.07  ? 802  ASP A O   1 
ATOM   950   C  CB  . ASP A 1 206  ? -56.774 -11.664 27.229  1.00 91.84  ? 802  ASP A CB  1 
ATOM   951   C  CG  . ASP A 1 206  ? -56.812 -11.872 28.732  1.00 87.70  ? 802  ASP A CG  1 
ATOM   952   O  OD1 . ASP A 1 206  ? -57.803 -11.456 29.367  1.00 84.32  ? 802  ASP A OD1 1 
ATOM   953   O  OD2 . ASP A 1 206  ? -55.844 -12.443 29.279  1.00 85.44  ? 802  ASP A OD2 1 
ATOM   954   N  N   . THR A 1 207  ? -57.774 -9.565  24.563  1.00 67.58  ? 803  THR A N   1 
ATOM   955   C  CA  . THR A 1 207  ? -57.482 -9.093  23.217  1.00 53.68  ? 803  THR A CA  1 
ATOM   956   C  C   . THR A 1 207  ? -57.329 -7.579  23.240  1.00 61.30  ? 803  THR A C   1 
ATOM   957   O  O   . THR A 1 207  ? -57.117 -6.988  24.299  1.00 76.64  ? 803  THR A O   1 
ATOM   958   C  CB  . THR A 1 207  ? -58.586 -9.483  22.218  1.00 50.75  ? 803  THR A CB  1 
ATOM   959   O  OG1 . THR A 1 207  ? -59.835 -8.923  22.640  1.00 59.51  ? 803  THR A OG1 1 
ATOM   960   C  CG2 . THR A 1 207  ? -58.716 -10.994 22.130  1.00 50.93  ? 803  THR A CG2 1 
ATOM   961   N  N   . VAL A 1 208  ? -57.439 -6.950  22.075  1.00 67.49  ? 804  VAL A N   1 
ATOM   962   C  CA  . VAL A 1 208  ? -57.390 -5.496  22.000  1.00 62.15  ? 804  VAL A CA  1 
ATOM   963   C  C   . VAL A 1 208  ? -58.671 -4.906  22.571  1.00 61.65  ? 804  VAL A C   1 
ATOM   964   O  O   . VAL A 1 208  ? -58.677 -3.786  23.077  1.00 54.47  ? 804  VAL A O   1 
ATOM   965   C  CB  . VAL A 1 208  ? -57.205 -4.994  20.559  1.00 56.42  ? 804  VAL A CB  1 
ATOM   966   C  CG1 . VAL A 1 208  ? -56.254 -3.807  20.535  1.00 45.58  ? 804  VAL A CG1 1 
ATOM   967   C  CG2 . VAL A 1 208  ? -56.690 -6.109  19.668  1.00 73.30  ? 804  VAL A CG2 1 
ATOM   968   N  N   . LEU A 1 209  ? -59.750 -5.680  22.484  1.00 52.11  ? 805  LEU A N   1 
ATOM   969   C  CA  . LEU A 1 209  ? -61.069 -5.256  22.943  1.00 48.17  ? 805  LEU A CA  1 
ATOM   970   C  C   . LEU A 1 209  ? -61.071 -4.824  24.405  1.00 60.82  ? 805  LEU A C   1 
ATOM   971   O  O   . LEU A 1 209  ? -61.697 -3.826  24.762  1.00 66.23  ? 805  LEU A O   1 
ATOM   972   C  CB  . LEU A 1 209  ? -62.083 -6.385  22.738  1.00 45.51  ? 805  LEU A CB  1 
ATOM   973   C  CG  . LEU A 1 209  ? -62.877 -6.412  21.430  1.00 50.51  ? 805  LEU A CG  1 
ATOM   974   C  CD1 . LEU A 1 209  ? -62.228 -5.560  20.350  1.00 48.97  ? 805  LEU A CD1 1 
ATOM   975   C  CD2 . LEU A 1 209  ? -63.062 -7.844  20.952  1.00 41.51  ? 805  LEU A CD2 1 
ATOM   976   N  N   . GLY A 1 210  ? -60.369 -5.580  25.243  1.00 61.05  ? 806  GLY A N   1 
ATOM   977   C  CA  . GLY A 1 210  ? -60.280 -5.271  26.657  1.00 65.15  ? 806  GLY A CA  1 
ATOM   978   C  C   . GLY A 1 210  ? -61.621 -5.341  27.361  1.00 67.66  ? 806  GLY A C   1 
ATOM   979   O  O   . GLY A 1 210  ? -62.384 -6.289  27.173  1.00 67.59  ? 806  GLY A O   1 
ATOM   980   N  N   . ALA A 1 211  ? -61.913 -4.323  28.162  1.00 64.76  ? 807  ALA A N   1 
ATOM   981   C  CA  . ALA A 1 211  ? -63.144 -4.286  28.945  1.00 79.40  ? 807  ALA A CA  1 
ATOM   982   C  C   . ALA A 1 211  ? -64.384 -4.146  28.065  1.00 77.13  ? 807  ALA A C   1 
ATOM   983   O  O   . ALA A 1 211  ? -65.506 -4.356  28.525  1.00 73.39  ? 807  ALA A O   1 
ATOM   984   C  CB  . ALA A 1 211  ? -63.087 -3.151  29.955  1.00 54.58  ? 807  ALA A CB  1 
ATOM   985   N  N   . THR A 1 212  ? -64.179 -3.788  26.801  1.00 54.41  ? 808  THR A N   1 
ATOM   986   C  CA  . THR A 1 212  ? -65.289 -3.604  25.874  1.00 65.23  ? 808  THR A CA  1 
ATOM   987   C  C   . THR A 1 212  ? -65.898 -4.934  25.455  1.00 66.60  ? 808  THR A C   1 
ATOM   988   O  O   . THR A 1 212  ? -67.075 -5.004  25.100  1.00 61.87  ? 808  THR A O   1 
ATOM   989   C  CB  . THR A 1 212  ? -64.848 -2.847  24.606  1.00 63.40  ? 808  THR A CB  1 
ATOM   990   O  OG1 . THR A 1 212  ? -63.906 -3.641  23.874  1.00 60.00  ? 808  THR A OG1 1 
ATOM   991   C  CG2 . THR A 1 212  ? -64.210 -1.524  24.973  1.00 64.47  ? 808  THR A CG2 1 
ATOM   992   N  N   . SER A 1 213  ? -65.089 -5.987  25.503  1.00 64.27  ? 809  SER A N   1 
ATOM   993   C  CA  . SER A 1 213  ? -65.500 -7.289  24.995  1.00 69.62  ? 809  SER A CA  1 
ATOM   994   C  C   . SER A 1 213  ? -66.656 -7.900  25.771  1.00 77.31  ? 809  SER A C   1 
ATOM   995   O  O   . SER A 1 213  ? -66.785 -7.708  26.981  1.00 82.54  ? 809  SER A O   1 
ATOM   996   C  CB  . SER A 1 213  ? -64.319 -8.260  25.007  1.00 64.38  ? 809  SER A CB  1 
ATOM   997   O  OG  . SER A 1 213  ? -64.730 -9.549  24.588  1.00 64.16  ? 809  SER A OG  1 
ATOM   998   N  N   . ASP A 1 214  ? -67.503 -8.628  25.051  1.00 75.29  ? 810  ASP A N   1 
ATOM   999   C  CA  . ASP A 1 214  ? -68.530 -9.448  25.668  1.00 69.05  ? 810  ASP A CA  1 
ATOM   1000  C  C   . ASP A 1 214  ? -67.838 -10.432 26.597  1.00 73.36  ? 810  ASP A C   1 
ATOM   1001  O  O   . ASP A 1 214  ? -66.969 -11.186 26.160  1.00 68.01  ? 810  ASP A O   1 
ATOM   1002  C  CB  . ASP A 1 214  ? -69.354 -10.176 24.601  1.00 72.47  ? 810  ASP A CB  1 
ATOM   1003  C  CG  . ASP A 1 214  ? -70.625 -10.799 25.154  1.00 72.92  ? 810  ASP A CG  1 
ATOM   1004  O  OD1 . ASP A 1 214  ? -70.585 -11.410 26.242  1.00 71.70  ? 810  ASP A OD1 1 
ATOM   1005  O  OD2 . ASP A 1 214  ? -71.672 -10.675 24.485  1.00 76.76  ? 810  ASP A OD2 1 
ATOM   1006  N  N   . PRO A 1 215  ? -68.214 -10.424 27.885  1.00 75.14  ? 811  PRO A N   1 
ATOM   1007  C  CA  . PRO A 1 215  ? -67.588 -11.304 28.879  1.00 63.03  ? 811  PRO A CA  1 
ATOM   1008  C  C   . PRO A 1 215  ? -67.749 -12.783 28.531  1.00 68.33  ? 811  PRO A C   1 
ATOM   1009  O  O   . PRO A 1 215  ? -67.029 -13.625 29.067  1.00 75.55  ? 811  PRO A O   1 
ATOM   1010  C  CB  . PRO A 1 215  ? -68.332 -10.960 30.176  1.00 61.35  ? 811  PRO A CB  1 
ATOM   1011  C  CG  . PRO A 1 215  ? -69.613 -10.333 29.734  1.00 63.77  ? 811  PRO A CG  1 
ATOM   1012  C  CD  . PRO A 1 215  ? -69.277 -9.595  28.477  1.00 68.89  ? 811  PRO A CD  1 
ATOM   1013  N  N   . LEU A 1 216  ? -68.685 -13.085 27.635  1.00 57.35  ? 812  LEU A N   1 
ATOM   1014  C  CA  . LEU A 1 216  ? -68.937 -14.454 27.205  1.00 65.77  ? 812  LEU A CA  1 
ATOM   1015  C  C   . LEU A 1 216  ? -68.219 -14.806 25.908  1.00 77.04  ? 812  LEU A C   1 
ATOM   1016  O  O   . LEU A 1 216  ? -68.357 -15.921 25.405  1.00 76.62  ? 812  LEU A O   1 
ATOM   1017  C  CB  . LEU A 1 216  ? -70.437 -14.683 27.026  1.00 81.38  ? 812  LEU A CB  1 
ATOM   1018  C  CG  . LEU A 1 216  ? -71.325 -14.481 28.250  1.00 82.54  ? 812  LEU A CG  1 
ATOM   1019  C  CD1 . LEU A 1 216  ? -72.786 -14.522 27.840  1.00 69.12  ? 812  LEU A CD1 1 
ATOM   1020  C  CD2 . LEU A 1 216  ? -71.027 -15.540 29.298  1.00 69.80  ? 812  LEU A CD2 1 
ATOM   1021  N  N   . GLU A 1 217  ? -67.458 -13.864 25.359  1.00 81.65  ? 813  GLU A N   1 
ATOM   1022  C  CA  . GLU A 1 217  ? -66.847 -14.083 24.054  1.00 72.78  ? 813  GLU A CA  1 
ATOM   1023  C  C   . GLU A 1 217  ? -65.425 -14.627 24.151  1.00 59.19  ? 813  GLU A C   1 
ATOM   1024  O  O   . GLU A 1 217  ? -64.611 -14.153 24.944  1.00 54.52  ? 813  GLU A O   1 
ATOM   1025  C  CB  . GLU A 1 217  ? -66.857 -12.792 23.232  1.00 67.00  ? 813  GLU A CB  1 
ATOM   1026  C  CG  . GLU A 1 217  ? -66.525 -13.012 21.764  1.00 57.99  ? 813  GLU A CG  1 
ATOM   1027  C  CD  . GLU A 1 217  ? -67.113 -11.943 20.864  1.00 55.37  ? 813  GLU A CD  1 
ATOM   1028  O  OE1 . GLU A 1 217  ? -67.480 -10.866 21.380  1.00 68.08  ? 813  GLU A OE1 1 
ATOM   1029  O  OE2 . GLU A 1 217  ? -67.213 -12.183 19.642  1.00 54.56  ? 813  GLU A OE2 1 
ATOM   1030  N  N   . LEU A 1 218  ? -65.145 -15.635 23.333  1.00 60.11  ? 814  LEU A N   1 
ATOM   1031  C  CA  . LEU A 1 218  ? -63.818 -16.227 23.250  1.00 70.87  ? 814  LEU A CA  1 
ATOM   1032  C  C   . LEU A 1 218  ? -63.281 -16.084 21.834  1.00 59.77  ? 814  LEU A C   1 
ATOM   1033  O  O   . LEU A 1 218  ? -64.050 -15.921 20.886  1.00 59.61  ? 814  LEU A O   1 
ATOM   1034  C  CB  . LEU A 1 218  ? -63.855 -17.700 23.655  1.00 83.11  ? 814  LEU A CB  1 
ATOM   1035  C  CG  . LEU A 1 218  ? -64.525 -18.017 24.994  1.00 69.01  ? 814  LEU A CG  1 
ATOM   1036  C  CD1 . LEU A 1 218  ? -64.628 -19.521 25.199  1.00 66.31  ? 814  LEU A CD1 1 
ATOM   1037  C  CD2 . LEU A 1 218  ? -63.772 -17.362 26.141  1.00 55.97  ? 814  LEU A CD2 1 
ATOM   1038  N  N   . PHE A 1 219  ? -61.961 -16.144 21.689  1.00 57.29  ? 815  PHE A N   1 
ATOM   1039  C  CA  . PHE A 1 219  ? -61.355 -16.066 20.363  1.00 63.68  ? 815  PHE A CA  1 
ATOM   1040  C  C   . PHE A 1 219  ? -60.289 -17.136 20.148  1.00 59.44  ? 815  PHE A C   1 
ATOM   1041  O  O   . PHE A 1 219  ? -59.366 -17.275 20.947  1.00 68.84  ? 815  PHE A O   1 
ATOM   1042  C  CB  . PHE A 1 219  ? -60.748 -14.684 20.133  1.00 58.91  ? 815  PHE A CB  1 
ATOM   1043  C  CG  . PHE A 1 219  ? -61.749 -13.569 20.178  1.00 59.57  ? 815  PHE A CG  1 
ATOM   1044  C  CD1 . PHE A 1 219  ? -62.565 -13.306 19.089  1.00 60.96  ? 815  PHE A CD1 1 
ATOM   1045  C  CD2 . PHE A 1 219  ? -61.880 -12.788 21.310  1.00 45.68  ? 815  PHE A CD2 1 
ATOM   1046  C  CE1 . PHE A 1 219  ? -63.489 -12.279 19.130  1.00 63.38  ? 815  PHE A CE1 1 
ATOM   1047  C  CE2 . PHE A 1 219  ? -62.800 -11.760 21.359  1.00 50.75  ? 815  PHE A CE2 1 
ATOM   1048  C  CZ  . PHE A 1 219  ? -63.607 -11.504 20.268  1.00 57.42  ? 815  PHE A CZ  1 
ATOM   1049  N  N   . LEU A 1 220  ? -60.427 -17.884 19.057  1.00 49.15  ? 816  LEU A N   1 
ATOM   1050  C  CA  . LEU A 1 220  ? -59.433 -18.878 18.667  1.00 59.43  ? 816  LEU A CA  1 
ATOM   1051  C  C   . LEU A 1 220  ? -58.051 -18.217 18.517  1.00 54.94  ? 816  LEU A C   1 
ATOM   1052  O  O   . LEU A 1 220  ? -57.947 -17.096 18.024  1.00 72.22  ? 816  LEU A O   1 
ATOM   1053  C  CB  . LEU A 1 220  ? -59.847 -19.563 17.359  1.00 53.55  ? 816  LEU A CB  1 
ATOM   1054  C  CG  . LEU A 1 220  ? -61.311 -20.003 17.202  1.00 58.41  ? 816  LEU A CG  1 
ATOM   1055  C  CD1 . LEU A 1 220  ? -61.561 -20.609 15.826  1.00 62.38  ? 816  LEU A CD1 1 
ATOM   1056  C  CD2 . LEU A 1 220  ? -61.701 -20.990 18.293  1.00 65.46  ? 816  LEU A CD2 1 
ATOM   1057  N  N   . VAL A 1 221  ? -57.009 -18.901 18.982  1.00 53.95  ? 817  VAL A N   1 
ATOM   1058  C  CA  . VAL A 1 221  ? -55.622 -18.447 18.860  1.00 65.42  ? 817  VAL A CA  1 
ATOM   1059  C  C   . VAL A 1 221  ? -54.775 -19.637 18.437  1.00 62.69  ? 817  VAL A C   1 
ATOM   1060  O  O   . VAL A 1 221  ? -55.275 -20.757 18.410  1.00 54.47  ? 817  VAL A O   1 
ATOM   1061  C  CB  . VAL A 1 221  ? -55.095 -17.867 20.197  1.00 60.47  ? 817  VAL A CB  1 
ATOM   1062  C  CG1 . VAL A 1 221  ? -55.811 -16.589 20.550  1.00 53.65  ? 817  VAL A CG1 1 
ATOM   1063  C  CG2 . VAL A 1 221  ? -55.250 -18.901 21.302  1.00 64.92  ? 817  VAL A CG2 1 
ATOM   1064  N  N   . ASP A 1 222  ? -53.512 -19.413 18.095  1.00 77.10  ? 818  ASP A N   1 
ATOM   1065  C  CA  . ASP A 1 222  ? -52.594 -20.532 17.963  1.00 76.82  ? 818  ASP A CA  1 
ATOM   1066  C  C   . ASP A 1 222  ? -51.775 -20.530 19.227  1.00 71.33  ? 818  ASP A C   1 
ATOM   1067  O  O   . ASP A 1 222  ? -50.934 -19.640 19.453  1.00 70.18  ? 818  ASP A O   1 
ATOM   1068  C  CB  . ASP A 1 222  ? -51.726 -20.434 16.698  1.00 65.39  ? 818  ASP A CB  1 
ATOM   1069  C  CG  . ASP A 1 222  ? -52.563 -20.300 15.440  1.00 70.38  ? 818  ASP A CG  1 
ATOM   1070  O  OD1 . ASP A 1 222  ? -53.519 -21.087 15.279  1.00 73.82  ? 818  ASP A OD1 1 
ATOM   1071  O  OD2 . ASP A 1 222  ? -52.292 -19.389 14.637  1.00 79.24  ? 818  ASP A OD2 1 
ATOM   1072  N  N   . GLU A 1 223  ? -52.040 -21.566 20.019  1.00 71.55  ? 819  GLU A N   1 
ATOM   1073  C  CA  . GLU A 1 223  ? -51.643 -21.696 21.410  1.00 66.54  ? 819  GLU A CA  1 
ATOM   1074  C  C   . GLU A 1 223  ? -52.264 -23.025 21.846  1.00 70.91  ? 819  GLU A C   1 
ATOM   1075  O  O   . GLU A 1 223  ? -53.482 -23.131 21.992  1.00 65.21  ? 819  GLU A O   1 
ATOM   1076  C  CB  . GLU A 1 223  ? -52.137 -20.519 22.284  1.00 62.38  ? 819  GLU A CB  1 
ATOM   1077  C  CG  . GLU A 1 223  ? -51.270 -19.249 22.219  1.00 73.64  ? 819  GLU A CG  1 
ATOM   1078  C  CD  . GLU A 1 223  ? -51.373 -18.388 23.445  1.00 91.61  ? 819  GLU A CD  1 
ATOM   1079  O  OE1 . GLU A 1 223  ? -51.230 -17.153 23.315  1.00 90.07  ? 819  GLU A OE1 1 
ATOM   1080  O  OE2 . GLU A 1 223  ? -51.570 -18.958 24.538  1.00 100.23 ? 819  GLU A OE2 1 
ATOM   1081  N  N   . CYS A 1 224  ? -51.439 -24.048 22.016  1.00 72.72  ? 820  CYS A N   1 
ATOM   1082  C  CA  . CYS A 1 224  ? -51.946 -25.369 22.347  1.00 69.54  ? 820  CYS A CA  1 
ATOM   1083  C  C   . CYS A 1 224  ? -50.852 -26.098 23.079  1.00 70.09  ? 820  CYS A C   1 
ATOM   1084  O  O   . CYS A 1 224  ? -49.678 -25.800 22.877  1.00 69.02  ? 820  CYS A O   1 
ATOM   1085  C  CB  . CYS A 1 224  ? -52.357 -26.141 21.095  1.00 54.72  ? 820  CYS A CB  1 
ATOM   1086  S  SG  . CYS A 1 224  ? -50.988 -26.465 19.967  1.00 69.51  ? 820  CYS A SG  1 
ATOM   1087  N  N   . GLU A 1 225  ? -51.218 -27.044 23.932  1.00 87.22  ? 821  GLU A N   1 
ATOM   1088  C  CA  . GLU A 1 225  ? -50.201 -27.819 24.627  1.00 79.44  ? 821  GLU A CA  1 
ATOM   1089  C  C   . GLU A 1 225  ? -50.784 -29.106 25.162  1.00 67.48  ? 821  GLU A C   1 
ATOM   1090  O  O   . GLU A 1 225  ? -51.976 -29.186 25.462  1.00 71.43  ? 821  GLU A O   1 
ATOM   1091  C  CB  . GLU A 1 225  ? -49.575 -27.007 25.767  1.00 61.31  ? 821  GLU A CB  1 
ATOM   1092  C  CG  . GLU A 1 225  ? -50.570 -26.439 26.757  1.00 57.56  ? 821  GLU A CG  1 
ATOM   1093  C  CD  . GLU A 1 225  ? -49.916 -25.512 27.759  1.00 65.91  ? 821  GLU A CD  1 
ATOM   1094  O  OE1 . GLU A 1 225  ? -50.593 -24.582 28.245  1.00 78.00  ? 821  GLU A OE1 1 
ATOM   1095  O  OE2 . GLU A 1 225  ? -48.721 -25.712 28.058  1.00 79.41  ? 821  GLU A OE2 1 
ATOM   1096  N  N   . ASP A 1 226  ? -49.935 -30.121 25.249  1.00 73.50  ? 822  ASP A N   1 
ATOM   1097  C  CA  . ASP A 1 226  ? -50.303 -31.361 25.902  1.00 66.09  ? 822  ASP A CA  1 
ATOM   1098  C  C   . ASP A 1 226  ? -50.379 -31.116 27.399  1.00 68.76  ? 822  ASP A C   1 
ATOM   1099  O  O   . ASP A 1 226  ? -49.638 -30.295 27.941  1.00 65.20  ? 822  ASP A O   1 
ATOM   1100  C  CB  . ASP A 1 226  ? -49.301 -32.466 25.580  1.00 63.47  ? 822  ASP A CB  1 
ATOM   1101  C  CG  . ASP A 1 226  ? -49.294 -32.832 24.111  1.00 71.95  ? 822  ASP A CG  1 
ATOM   1102  O  OD1 . ASP A 1 226  ? -50.256 -32.468 23.402  1.00 71.49  ? 822  ASP A OD1 1 
ATOM   1103  O  OD2 . ASP A 1 226  ? -48.333 -33.492 23.668  1.00 76.14  ? 822  ASP A OD2 1 
ATOM   1104  N  N   . MET A 1 227  ? -51.282 -31.823 28.063  1.00 61.30  ? 823  MET A N   1 
ATOM   1105  C  CA  . MET A 1 227  ? -51.512 -31.609 29.482  1.00 72.62  ? 823  MET A CA  1 
ATOM   1106  C  C   . MET A 1 227  ? -52.107 -32.855 30.127  1.00 85.73  ? 823  MET A C   1 
ATOM   1107  O  O   . MET A 1 227  ? -52.894 -33.569 29.506  1.00 80.00  ? 823  MET A O   1 
ATOM   1108  C  CB  . MET A 1 227  ? -52.428 -30.399 29.687  1.00 76.52  ? 823  MET A CB  1 
ATOM   1109  C  CG  . MET A 1 227  ? -52.747 -30.079 31.135  1.00 83.19  ? 823  MET A CG  1 
ATOM   1110  S  SD  . MET A 1 227  ? -53.522 -28.463 31.326  1.00 99.09  ? 823  MET A SD  1 
ATOM   1111  C  CE  . MET A 1 227  ? -52.123 -27.381 31.046  1.00 83.12  ? 823  MET A CE  1 
ATOM   1112  N  N   . GLN A 1 228  ? -51.713 -33.121 31.367  1.00 95.97  ? 824  GLN A N   1 
ATOM   1113  C  CA  . GLN A 1 228  ? -52.261 -34.244 32.114  1.00 98.65  ? 824  GLN A CA  1 
ATOM   1114  C  C   . GLN A 1 228  ? -53.706 -33.956 32.507  1.00 85.49  ? 824  GLN A C   1 
ATOM   1115  O  O   . GLN A 1 228  ? -54.021 -32.861 32.975  1.00 74.22  ? 824  GLN A O   1 
ATOM   1116  C  CB  . GLN A 1 228  ? -51.408 -34.535 33.352  1.00 101.05 ? 824  GLN A CB  1 
ATOM   1117  C  CG  . GLN A 1 228  ? -49.987 -34.973 33.028  1.00 97.19  ? 824  GLN A CG  1 
ATOM   1118  C  CD  . GLN A 1 228  ? -49.199 -35.379 34.258  1.00 105.51 ? 824  GLN A CD  1 
ATOM   1119  O  OE1 . GLN A 1 228  ? -49.019 -34.590 35.184  1.00 86.17  ? 824  GLN A OE1 1 
ATOM   1120  N  NE2 . GLN A 1 228  ? -48.724 -36.620 34.272  1.00 95.34  ? 824  GLN A NE2 1 
ATOM   1121  N  N   . LEU A 1 229  ? -54.575 -34.947 32.314  1.00 78.57  ? 825  LEU A N   1 
ATOM   1122  C  CA  . LEU A 1 229  ? -56.019 -34.794 32.511  1.00 68.94  ? 825  LEU A CA  1 
ATOM   1123  C  C   . LEU A 1 229  ? -56.415 -34.220 33.867  1.00 70.26  ? 825  LEU A C   1 
ATOM   1124  O  O   . LEU A 1 229  ? -57.495 -33.647 34.013  1.00 71.83  ? 825  LEU A O   1 
ATOM   1125  C  CB  . LEU A 1 229  ? -56.716 -36.142 32.324  1.00 64.84  ? 825  LEU A CB  1 
ATOM   1126  C  CG  . LEU A 1 229  ? -57.004 -36.601 30.897  1.00 68.30  ? 825  LEU A CG  1 
ATOM   1127  C  CD1 . LEU A 1 229  ? -57.564 -38.011 30.908  1.00 73.79  ? 825  LEU A CD1 1 
ATOM   1128  C  CD2 . LEU A 1 229  ? -57.976 -35.650 30.221  1.00 62.32  ? 825  LEU A CD2 1 
ATOM   1129  N  N   . SER A 1 230  ? -55.540 -34.375 34.855  1.00 71.49  ? 826  SER A N   1 
ATOM   1130  C  CA  . SER A 1 230  ? -55.842 -33.962 36.220  1.00 72.91  ? 826  SER A CA  1 
ATOM   1131  C  C   . SER A 1 230  ? -56.054 -32.459 36.360  1.00 84.89  ? 826  SER A C   1 
ATOM   1132  O  O   . SER A 1 230  ? -56.697 -32.005 37.305  1.00 92.92  ? 826  SER A O   1 
ATOM   1133  C  CB  . SER A 1 230  ? -54.723 -34.407 37.163  1.00 88.66  ? 826  SER A CB  1 
ATOM   1134  O  OG  . SER A 1 230  ? -55.012 -34.030 38.497  1.00 123.69 ? 826  SER A OG  1 
ATOM   1135  N  N   . TYR A 1 231  ? -55.512 -31.689 35.423  1.00 86.79  ? 827  TYR A N   1 
ATOM   1136  C  CA  . TYR A 1 231  ? -55.602 -30.236 35.497  1.00 81.77  ? 827  TYR A CA  1 
ATOM   1137  C  C   . TYR A 1 231  ? -57.007 -29.741 35.182  1.00 69.11  ? 827  TYR A C   1 
ATOM   1138  O  O   . TYR A 1 231  ? -57.387 -28.645 35.590  1.00 76.79  ? 827  TYR A O   1 
ATOM   1139  C  CB  . TYR A 1 231  ? -54.596 -29.585 34.546  1.00 80.52  ? 827  TYR A CB  1 
ATOM   1140  C  CG  . TYR A 1 231  ? -53.162 -29.675 35.016  1.00 83.68  ? 827  TYR A CG  1 
ATOM   1141  C  CD1 . TYR A 1 231  ? -52.642 -28.739 35.900  1.00 82.58  ? 827  TYR A CD1 1 
ATOM   1142  C  CD2 . TYR A 1 231  ? -52.329 -30.694 34.575  1.00 94.61  ? 827  TYR A CD2 1 
ATOM   1143  C  CE1 . TYR A 1 231  ? -51.331 -28.816 36.331  1.00 85.04  ? 827  TYR A CE1 1 
ATOM   1144  C  CE2 . TYR A 1 231  ? -51.018 -30.778 35.000  1.00 102.94 ? 827  TYR A CE2 1 
ATOM   1145  C  CZ  . TYR A 1 231  ? -50.524 -29.837 35.878  1.00 88.85  ? 827  TYR A CZ  1 
ATOM   1146  O  OH  . TYR A 1 231  ? -49.218 -29.919 36.304  1.00 83.95  ? 827  TYR A OH  1 
ATOM   1147  N  N   . ILE A 1 232  ? -57.774 -30.548 34.458  1.00 49.71  ? 828  ILE A N   1 
ATOM   1148  C  CA  . ILE A 1 232  ? -59.141 -30.183 34.107  1.00 59.34  ? 828  ILE A CA  1 
ATOM   1149  C  C   . ILE A 1 232  ? -59.978 -29.899 35.352  1.00 74.80  ? 828  ILE A C   1 
ATOM   1150  O  O   . ILE A 1 232  ? -60.180 -30.778 36.188  1.00 86.88  ? 828  ILE A O   1 
ATOM   1151  C  CB  . ILE A 1 232  ? -59.827 -31.286 33.281  1.00 72.78  ? 828  ILE A CB  1 
ATOM   1152  C  CG1 . ILE A 1 232  ? -59.135 -31.442 31.927  1.00 53.96  ? 828  ILE A CG1 1 
ATOM   1153  C  CG2 . ILE A 1 232  ? -61.302 -30.968 33.089  1.00 54.89  ? 828  ILE A CG2 1 
ATOM   1154  C  CD1 . ILE A 1 232  ? -59.795 -32.448 31.011  1.00 55.35  ? 828  ILE A CD1 1 
ATOM   1155  N  N   . HIS A 1 233  ? -60.447 -28.663 35.479  1.00 75.70  ? 829  HIS A N   1 
ATOM   1156  C  CA  . HIS A 1 233  ? -61.317 -28.293 36.585  1.00 72.03  ? 829  HIS A CA  1 
ATOM   1157  C  C   . HIS A 1 233  ? -62.776 -28.602 36.252  1.00 74.07  ? 829  HIS A C   1 
ATOM   1158  O  O   . HIS A 1 233  ? -63.500 -29.153 37.082  1.00 87.55  ? 829  HIS A O   1 
ATOM   1159  C  CB  . HIS A 1 233  ? -61.152 -26.812 36.936  1.00 70.76  ? 829  HIS A CB  1 
ATOM   1160  C  CG  . HIS A 1 233  ? -62.178 -26.302 37.899  1.00 90.65  ? 829  HIS A CG  1 
ATOM   1161  N  ND1 . HIS A 1 233  ? -63.433 -25.887 37.503  1.00 99.88  ? 829  HIS A ND1 1 
ATOM   1162  C  CD2 . HIS A 1 233  ? -62.137 -26.141 39.243  1.00 90.38  ? 829  HIS A CD2 1 
ATOM   1163  C  CE1 . HIS A 1 233  ? -64.119 -25.495 38.561  1.00 93.96  ? 829  HIS A CE1 1 
ATOM   1164  N  NE2 . HIS A 1 233  ? -63.355 -25.638 39.630  1.00 85.55  ? 829  HIS A NE2 1 
ATOM   1165  N  N   . SER A 1 234  ? -63.218 -28.250 35.046  1.00 73.82  ? 830  SER A N   1 
ATOM   1166  C  CA  . SER A 1 234  ? -64.621 -28.509 34.697  1.00 71.80  ? 830  SER A CA  1 
ATOM   1167  C  C   . SER A 1 234  ? -64.888 -28.630 33.203  1.00 70.66  ? 830  SER A C   1 
ATOM   1168  O  O   . SER A 1 234  ? -64.095 -28.187 32.392  1.00 76.10  ? 830  SER A O   1 
ATOM   1169  C  CB  . SER A 1 234  ? -65.524 -27.408 35.271  1.00 75.66  ? 830  SER A CB  1 
ATOM   1170  O  OG  . SER A 1 234  ? -66.876 -27.592 34.867  1.00 92.22  ? 830  SER A OG  1 
ATOM   1171  N  N   . LYS A 1 235  ? -66.021 -29.229 32.849  1.00 63.26  ? 831  LYS A N   1 
ATOM   1172  C  CA  . LYS A 1 235  ? -66.454 -29.258 31.459  1.00 64.01  ? 831  LYS A CA  1 
ATOM   1173  C  C   . LYS A 1 235  ? -67.361 -28.065 31.200  1.00 77.96  ? 831  LYS A C   1 
ATOM   1174  O  O   . LYS A 1 235  ? -68.480 -28.004 31.711  1.00 85.56  ? 831  LYS A O   1 
ATOM   1175  C  CB  . LYS A 1 235  ? -67.174 -30.566 31.130  1.00 53.16  ? 831  LYS A CB  1 
ATOM   1176  C  CG  . LYS A 1 235  ? -67.974 -30.521 29.835  1.00 54.73  ? 831  LYS A CG  1 
ATOM   1177  C  CD  . LYS A 1 235  ? -68.460 -31.901 29.431  1.00 76.16  ? 831  LYS A CD  1 
ATOM   1178  C  CE  . LYS A 1 235  ? -69.681 -31.817 28.527  1.00 86.62  ? 831  LYS A CE  1 
ATOM   1179  N  NZ  . LYS A 1 235  ? -70.900 -31.377 29.266  1.00 78.24  ? 831  LYS A NZ  1 
ATOM   1180  N  N   . VAL A 1 236  ? -66.866 -27.107 30.423  1.00 88.90  ? 832  VAL A N   1 
ATOM   1181  C  CA  . VAL A 1 236  ? -67.633 -25.903 30.124  1.00 77.91  ? 832  VAL A CA  1 
ATOM   1182  C  C   . VAL A 1 236  ? -68.177 -25.944 28.702  1.00 63.15  ? 832  VAL A C   1 
ATOM   1183  O  O   . VAL A 1 236  ? -67.606 -26.590 27.823  1.00 69.59  ? 832  VAL A O   1 
ATOM   1184  C  CB  . VAL A 1 236  ? -66.785 -24.632 30.314  1.00 61.58  ? 832  VAL A CB  1 
ATOM   1185  C  CG1 . VAL A 1 236  ? -66.335 -24.515 31.758  1.00 52.93  ? 832  VAL A CG1 1 
ATOM   1186  C  CG2 . VAL A 1 236  ? -65.586 -24.645 29.378  1.00 78.08  ? 832  VAL A CG2 1 
ATOM   1187  N  N   . LYS A 1 237  ? -69.289 -25.253 28.483  1.00 67.90  ? 833  LYS A N   1 
ATOM   1188  C  CA  . LYS A 1 237  ? -69.936 -25.256 27.179  1.00 83.76  ? 833  LYS A CA  1 
ATOM   1189  C  C   . LYS A 1 237  ? -69.539 -24.029 26.362  1.00 86.06  ? 833  LYS A C   1 
ATOM   1190  O  O   . LYS A 1 237  ? -69.604 -22.899 26.847  1.00 73.19  ? 833  LYS A O   1 
ATOM   1191  C  CB  . LYS A 1 237  ? -71.456 -25.316 27.337  1.00 73.02  ? 833  LYS A CB  1 
ATOM   1192  C  CG  . LYS A 1 237  ? -72.195 -25.665 26.057  1.00 79.77  ? 833  LYS A CG  1 
ATOM   1193  C  CD  . LYS A 1 237  ? -73.700 -25.545 26.235  1.00 97.36  ? 833  LYS A CD  1 
ATOM   1194  C  CE  . LYS A 1 237  ? -74.436 -25.927 24.961  1.00 89.95  ? 833  LYS A CE  1 
ATOM   1195  N  NZ  . LYS A 1 237  ? -75.896 -25.640 25.053  1.00 66.50  ? 833  LYS A NZ  1 
ATOM   1196  N  N   . VAL A 1 238  ? -69.119 -24.264 25.123  1.00 75.21  ? 834  VAL A N   1 
ATOM   1197  C  CA  . VAL A 1 238  ? -68.751 -23.189 24.206  1.00 72.97  ? 834  VAL A CA  1 
ATOM   1198  C  C   . VAL A 1 238  ? -69.390 -23.415 22.841  1.00 77.65  ? 834  VAL A C   1 
ATOM   1199  O  O   . VAL A 1 238  ? -69.204 -24.469 22.235  1.00 78.78  ? 834  VAL A O   1 
ATOM   1200  C  CB  . VAL A 1 238  ? -67.222 -23.080 24.030  1.00 78.83  ? 834  VAL A CB  1 
ATOM   1201  C  CG1 . VAL A 1 238  ? -66.881 -22.006 23.012  1.00 74.34  ? 834  VAL A CG1 1 
ATOM   1202  C  CG2 . VAL A 1 238  ? -66.546 -22.791 25.360  1.00 86.80  ? 834  VAL A CG2 1 
ATOM   1203  N  N   . ILE A 1 239  ? -70.139 -22.429 22.357  1.00 74.78  ? 835  ILE A N   1 
ATOM   1204  C  CA  . ILE A 1 239  ? -70.803 -22.566 21.065  1.00 85.58  ? 835  ILE A CA  1 
ATOM   1205  C  C   . ILE A 1 239  ? -70.146 -21.705 19.991  1.00 77.49  ? 835  ILE A C   1 
ATOM   1206  O  O   . ILE A 1 239  ? -69.428 -20.747 20.290  1.00 63.80  ? 835  ILE A O   1 
ATOM   1207  C  CB  . ILE A 1 239  ? -72.301 -22.204 21.151  1.00 72.94  ? 835  ILE A CB  1 
ATOM   1208  C  CG1 . ILE A 1 239  ? -72.491 -20.691 21.269  1.00 70.00  ? 835  ILE A CG1 1 
ATOM   1209  C  CG2 . ILE A 1 239  ? -72.958 -22.928 22.315  1.00 77.60  ? 835  ILE A CG2 1 
ATOM   1210  C  CD1 . ILE A 1 239  ? -73.940 -20.255 21.238  1.00 67.29  ? 835  ILE A CD1 1 
ATOM   1211  N  N   . TYR A 1 240  ? -70.397 -22.065 18.737  1.00 68.48  ? 836  TYR A N   1 
ATOM   1212  C  CA  . TYR A 1 240  ? -69.845 -21.342 17.600  1.00 70.49  ? 836  TYR A CA  1 
ATOM   1213  C  C   . TYR A 1 240  ? -70.897 -20.448 16.955  1.00 74.04  ? 836  TYR A C   1 
ATOM   1214  O  O   . TYR A 1 240  ? -71.812 -20.933 16.290  1.00 60.03  ? 836  TYR A O   1 
ATOM   1215  C  CB  . TYR A 1 240  ? -69.278 -22.321 16.570  1.00 66.21  ? 836  TYR A CB  1 
ATOM   1216  C  CG  . TYR A 1 240  ? -68.816 -21.667 15.287  1.00 68.56  ? 836  TYR A CG  1 
ATOM   1217  C  CD1 . TYR A 1 240  ? -67.968 -20.568 15.313  1.00 73.18  ? 836  TYR A CD1 1 
ATOM   1218  C  CD2 . TYR A 1 240  ? -69.233 -22.144 14.052  1.00 56.54  ? 836  TYR A CD2 1 
ATOM   1219  C  CE1 . TYR A 1 240  ? -67.545 -19.966 14.145  1.00 70.99  ? 836  TYR A CE1 1 
ATOM   1220  C  CE2 . TYR A 1 240  ? -68.810 -21.550 12.878  1.00 60.71  ? 836  TYR A CE2 1 
ATOM   1221  C  CZ  . TYR A 1 240  ? -67.969 -20.459 12.932  1.00 66.23  ? 836  TYR A CZ  1 
ATOM   1222  O  OH  . TYR A 1 240  ? -67.547 -19.860 11.769  1.00 68.29  ? 836  TYR A OH  1 
ATOM   1223  N  N   . LYS A 1 241  ? -70.759 -19.142 17.155  1.00 62.12  ? 837  LYS A N   1 
ATOM   1224  C  CA  . LYS A 1 241  ? -71.693 -18.183 16.584  1.00 71.29  ? 837  LYS A CA  1 
ATOM   1225  C  C   . LYS A 1 241  ? -71.390 -17.968 15.103  1.00 62.78  ? 837  LYS A C   1 
ATOM   1226  O  O   . LYS A 1 241  ? -70.773 -16.974 14.715  1.00 76.74  ? 837  LYS A O   1 
ATOM   1227  C  CB  . LYS A 1 241  ? -71.641 -16.859 17.353  1.00 69.71  ? 837  LYS A CB  1 
ATOM   1228  C  CG  . LYS A 1 241  ? -72.669 -15.831 16.905  1.00 75.40  ? 837  LYS A CG  1 
ATOM   1229  C  CD  . LYS A 1 241  ? -73.086 -14.924 18.049  1.00 61.86  ? 837  LYS A CD  1 
ATOM   1230  C  CE  . LYS A 1 241  ? -73.952 -15.672 19.049  1.00 108.34 ? 837  LYS A CE  1 
ATOM   1231  N  NZ  . LYS A 1 241  ? -74.512 -14.768 20.092  1.00 100.17 ? 837  LYS A NZ  1 
ATOM   1232  N  N   . ALA A 1 242  ? -71.819 -18.920 14.282  1.00 54.49  ? 838  ALA A N   1 
ATOM   1233  C  CA  . ALA A 1 242  ? -71.605 -18.844 12.845  1.00 64.75  ? 838  ALA A CA  1 
ATOM   1234  C  C   . ALA A 1 242  ? -72.482 -17.769 12.228  1.00 72.06  ? 838  ALA A C   1 
ATOM   1235  O  O   . ALA A 1 242  ? -73.631 -17.593 12.634  1.00 85.17  ? 838  ALA A O   1 
ATOM   1236  C  CB  . ALA A 1 242  ? -71.886 -20.185 12.193  1.00 49.29  ? 838  ALA A CB  1 
ATOM   1237  N  N   . PRO A 1 243  ? -71.937 -17.037 11.248  1.00 68.91  ? 839  PRO A N   1 
ATOM   1238  C  CA  . PRO A 1 243  ? -72.751 -16.082 10.494  1.00 56.58  ? 839  PRO A CA  1 
ATOM   1239  C  C   . PRO A 1 243  ? -73.862 -16.798 9.741   1.00 52.43  ? 839  PRO A C   1 
ATOM   1240  O  O   . PRO A 1 243  ? -73.625 -17.854 9.155   1.00 58.35  ? 839  PRO A O   1 
ATOM   1241  C  CB  . PRO A 1 243  ? -71.748 -15.445 9.526   1.00 48.65  ? 839  PRO A CB  1 
ATOM   1242  C  CG  . PRO A 1 243  ? -70.419 -15.657 10.164  1.00 58.62  ? 839  PRO A CG  1 
ATOM   1243  C  CD  . PRO A 1 243  ? -70.519 -16.980 10.857  1.00 71.46  ? 839  PRO A CD  1 
ATOM   1244  N  N   . SER A 1 244  ? -75.059 -16.227 9.768   1.00 55.16  ? 840  SER A N   1 
ATOM   1245  C  CA  . SER A 1 244  ? -76.202 -16.811 9.083   1.00 50.42  ? 840  SER A CA  1 
ATOM   1246  C  C   . SER A 1 244  ? -76.030 -16.757 7.573   1.00 61.10  ? 840  SER A C   1 
ATOM   1247  O  O   . SER A 1 244  ? -75.234 -15.974 7.055   1.00 69.47  ? 840  SER A O   1 
ATOM   1248  C  CB  . SER A 1 244  ? -77.489 -16.092 9.485   1.00 53.22  ? 840  SER A CB  1 
ATOM   1249  O  OG  . SER A 1 244  ? -78.331 -15.890 8.363   1.00 65.47  ? 840  SER A OG  1 
ATOM   1250  N  N   . GLU A 1 245  ? -76.779 -17.600 6.871   1.00 71.23  ? 841  GLU A N   1 
ATOM   1251  C  CA  . GLU A 1 245  ? -76.793 -17.588 5.413   1.00 85.79  ? 841  GLU A CA  1 
ATOM   1252  C  C   . GLU A 1 245  ? -77.415 -16.289 4.898   1.00 83.23  ? 841  GLU A C   1 
ATOM   1253  O  O   . GLU A 1 245  ? -77.359 -15.987 3.705   1.00 80.79  ? 841  GLU A O   1 
ATOM   1254  C  CB  . GLU A 1 245  ? -77.562 -18.798 4.880   1.00 92.74  ? 841  GLU A CB  1 
ATOM   1255  C  CG  . GLU A 1 245  ? -76.944 -19.443 3.650   1.00 113.89 ? 841  GLU A CG  1 
ATOM   1256  C  CD  . GLU A 1 245  ? -77.745 -20.635 3.153   1.00 130.73 ? 841  GLU A CD  1 
ATOM   1257  O  OE1 . GLU A 1 245  ? -77.393 -21.186 2.089   1.00 125.98 ? 841  GLU A OE1 1 
ATOM   1258  O  OE2 . GLU A 1 245  ? -78.727 -21.018 3.823   1.00 116.59 ? 841  GLU A OE2 1 
ATOM   1259  N  N   . ASN A 1 246  ? -78.007 -15.527 5.814   1.00 69.16  ? 842  ASN A N   1 
ATOM   1260  C  CA  . ASN A 1 246  ? -78.635 -14.253 5.496   1.00 70.99  ? 842  ASN A CA  1 
ATOM   1261  C  C   . ASN A 1 246  ? -77.983 -13.113 6.282   1.00 74.91  ? 842  ASN A C   1 
ATOM   1262  O  O   . ASN A 1 246  ? -78.641 -12.140 6.653   1.00 74.02  ? 842  ASN A O   1 
ATOM   1263  C  CB  . ASN A 1 246  ? -80.135 -14.325 5.791   1.00 65.57  ? 842  ASN A CB  1 
ATOM   1264  C  CG  . ASN A 1 246  ? -80.918 -13.217 5.121   1.00 79.06  ? 842  ASN A CG  1 
ATOM   1265  O  OD1 . ASN A 1 246  ? -81.422 -12.309 5.783   1.00 72.45  ? 842  ASN A OD1 1 
ATOM   1266  N  ND2 . ASN A 1 246  ? -81.021 -13.282 3.799   1.00 88.69  ? 842  ASN A ND2 1 
ATOM   1267  N  N   . TRP A 1 247  ? -76.680 -13.244 6.524   1.00 62.13  ? 843  TRP A N   1 
ATOM   1268  C  CA  . TRP A 1 247  ? -75.926 -12.294 7.341   1.00 54.07  ? 843  TRP A CA  1 
ATOM   1269  C  C   . TRP A 1 247  ? -75.896 -10.886 6.753   1.00 57.28  ? 843  TRP A C   1 
ATOM   1270  O  O   . TRP A 1 247  ? -75.828 -9.899  7.486   1.00 51.98  ? 843  TRP A O   1 
ATOM   1271  C  CB  . TRP A 1 247  ? -74.492 -12.801 7.535   1.00 46.74  ? 843  TRP A CB  1 
ATOM   1272  C  CG  . TRP A 1 247  ? -73.573 -11.827 8.224   1.00 51.47  ? 843  TRP A CG  1 
ATOM   1273  C  CD1 . TRP A 1 247  ? -73.300 -11.762 9.560   1.00 59.60  ? 843  TRP A CD1 1 
ATOM   1274  C  CD2 . TRP A 1 247  ? -72.796 -10.792 7.606   1.00 53.32  ? 843  TRP A CD2 1 
ATOM   1275  N  NE1 . TRP A 1 247  ? -72.408 -10.747 9.813   1.00 44.99  ? 843  TRP A NE1 1 
ATOM   1276  C  CE2 . TRP A 1 247  ? -72.084 -10.136 8.630   1.00 54.14  ? 843  TRP A CE2 1 
ATOM   1277  C  CE3 . TRP A 1 247  ? -72.639 -10.354 6.287   1.00 45.02  ? 843  TRP A CE3 1 
ATOM   1278  C  CZ2 . TRP A 1 247  ? -71.228 -9.067  8.377   1.00 45.56  ? 843  TRP A CZ2 1 
ATOM   1279  C  CZ3 . TRP A 1 247  ? -71.789 -9.292  6.039   1.00 54.64  ? 843  TRP A CZ3 1 
ATOM   1280  C  CH2 . TRP A 1 247  ? -71.094 -8.660  7.078   1.00 57.14  ? 843  TRP A CH2 1 
ATOM   1281  N  N   . ALA A 1 248  ? -75.941 -10.800 5.429   1.00 54.80  ? 844  ALA A N   1 
ATOM   1282  C  CA  . ALA A 1 248  ? -75.789 -9.522  4.742   1.00 45.87  ? 844  ALA A CA  1 
ATOM   1283  C  C   . ALA A 1 248  ? -77.035 -8.649  4.853   1.00 58.48  ? 844  ALA A C   1 
ATOM   1284  O  O   . ALA A 1 248  ? -76.999 -7.462  4.527   1.00 69.69  ? 844  ALA A O   1 
ATOM   1285  C  CB  . ALA A 1 248  ? -75.440 -9.752  3.283   1.00 40.73  ? 844  ALA A CB  1 
ATOM   1286  N  N   . MET A 1 249  ? -78.136 -9.235  5.310   1.00 46.94  ? 845  MET A N   1 
ATOM   1287  C  CA  . MET A 1 249  ? -79.383 -8.492  5.454   1.00 48.97  ? 845  MET A CA  1 
ATOM   1288  C  C   . MET A 1 249  ? -79.759 -8.308  6.919   1.00 57.33  ? 845  MET A C   1 
ATOM   1289  O  O   . MET A 1 249  ? -80.741 -7.638  7.237   1.00 50.43  ? 845  MET A O   1 
ATOM   1290  C  CB  . MET A 1 249  ? -80.515 -9.201  4.708   1.00 35.46  ? 845  MET A CB  1 
ATOM   1291  C  CG  . MET A 1 249  ? -80.303 -9.291  3.209   1.00 51.37  ? 845  MET A CG  1 
ATOM   1292  S  SD  . MET A 1 249  ? -80.262 -7.671  2.420   1.00 65.68  ? 845  MET A SD  1 
ATOM   1293  C  CE  . MET A 1 249  ? -79.829 -8.125  0.743   1.00 60.87  ? 845  MET A CE  1 
ATOM   1294  N  N   . GLU A 1 250  ? -78.964 -8.895  7.809   1.00 55.36  ? 846  GLU A N   1 
ATOM   1295  C  CA  . GLU A 1 250  ? -79.250 -8.849  9.238   1.00 49.46  ? 846  GLU A CA  1 
ATOM   1296  C  C   . GLU A 1 250  ? -78.946 -7.487  9.851   1.00 52.07  ? 846  GLU A C   1 
ATOM   1297  O  O   . GLU A 1 250  ? -79.123 -7.287  11.052  1.00 61.45  ? 846  GLU A O   1 
ATOM   1298  C  CB  . GLU A 1 250  ? -78.463 -9.934  9.971   1.00 66.56  ? 846  GLU A CB  1 
ATOM   1299  C  CG  . GLU A 1 250  ? -78.965 -11.339 9.705   1.00 62.78  ? 846  GLU A CG  1 
ATOM   1300  C  CD  . GLU A 1 250  ? -78.264 -12.375 10.555  1.00 87.49  ? 846  GLU A CD  1 
ATOM   1301  O  OE1 . GLU A 1 250  ? -78.800 -13.494 10.689  1.00 81.85  ? 846  GLU A OE1 1 
ATOM   1302  O  OE2 . GLU A 1 250  ? -77.177 -12.069 11.091  1.00 78.38  ? 846  GLU A OE2 1 
ATOM   1303  N  N   . GLY A 1 251  ? -78.479 -6.558  9.025   1.00 58.72  ? 847  GLY A N   1 
ATOM   1304  C  CA  . GLY A 1 251  ? -78.244 -5.200  9.473   1.00 54.87  ? 847  GLY A CA  1 
ATOM   1305  C  C   . GLY A 1 251  ? -79.538 -4.472  9.778   1.00 52.55  ? 847  GLY A C   1 
ATOM   1306  O  O   . GLY A 1 251  ? -80.454 -4.446  8.956   1.00 51.96  ? 847  GLY A O   1 
ATOM   1307  N  N   . GLY A 1 252  ? -79.618 -3.882  10.966  1.00 58.75  ? 848  GLY A N   1 
ATOM   1308  C  CA  . GLY A 1 252  ? -80.788 -3.116  11.355  1.00 73.53  ? 848  GLY A CA  1 
ATOM   1309  C  C   . GLY A 1 252  ? -81.813 -3.934  12.118  1.00 71.89  ? 848  GLY A C   1 
ATOM   1310  O  O   . GLY A 1 252  ? -82.770 -3.389  12.668  1.00 79.58  ? 848  GLY A O   1 
ATOM   1311  N  N   . MET A 1 253  ? -81.613 -5.247  12.145  1.00 76.65  ? 849  MET A N   1 
ATOM   1312  C  CA  . MET A 1 253  ? -82.487 -6.139  12.899  1.00 69.03  ? 849  MET A CA  1 
ATOM   1313  C  C   . MET A 1 253  ? -82.142 -6.088  14.381  1.00 65.91  ? 849  MET A C   1 
ATOM   1314  O  O   . MET A 1 253  ? -80.969 -6.022  14.749  1.00 76.47  ? 849  MET A O   1 
ATOM   1315  C  CB  . MET A 1 253  ? -82.373 -7.574  12.378  1.00 74.82  ? 849  MET A CB  1 
ATOM   1316  C  CG  . MET A 1 253  ? -83.035 -7.806  11.029  1.00 73.29  ? 849  MET A CG  1 
ATOM   1317  S  SD  . MET A 1 253  ? -82.650 -9.430  10.346  1.00 89.93  ? 849  MET A SD  1 
ATOM   1318  C  CE  . MET A 1 253  ? -82.844 -10.467 11.794  1.00 68.56  ? 849  MET A CE  1 
ATOM   1319  N  N   . ASP A 1 254  ? -83.163 -6.112  15.231  1.00 81.03  ? 850  ASP A N   1 
ATOM   1320  C  CA  . ASP A 1 254  ? -82.945 -6.063  16.673  1.00 95.39  ? 850  ASP A CA  1 
ATOM   1321  C  C   . ASP A 1 254  ? -82.391 -7.388  17.189  1.00 91.39  ? 850  ASP A C   1 
ATOM   1322  O  O   . ASP A 1 254  ? -82.698 -8.449  16.643  1.00 92.57  ? 850  ASP A O   1 
ATOM   1323  C  CB  . ASP A 1 254  ? -84.241 -5.692  17.403  1.00 101.27 ? 850  ASP A CB  1 
ATOM   1324  C  CG  . ASP A 1 254  ? -85.461 -6.330  16.784  1.00 106.14 ? 850  ASP A CG  1 
ATOM   1325  O  OD1 . ASP A 1 254  ? -85.507 -6.447  15.541  1.00 97.12  ? 850  ASP A OD1 1 
ATOM   1326  O  OD2 . ASP A 1 254  ? -86.380 -6.707  17.540  1.00 114.75 ? 850  ASP A OD2 1 
ATOM   1327  N  N   . PRO A 1 255  ? -81.575 -7.327  18.254  1.00 82.86  ? 851  PRO A N   1 
ATOM   1328  C  CA  . PRO A 1 255  ? -80.855 -8.482  18.806  1.00 95.88  ? 851  PRO A CA  1 
ATOM   1329  C  C   . PRO A 1 255  ? -81.747 -9.645  19.232  1.00 115.81 ? 851  PRO A C   1 
ATOM   1330  O  O   . PRO A 1 255  ? -81.231 -10.749 19.420  1.00 106.29 ? 851  PRO A O   1 
ATOM   1331  C  CB  . PRO A 1 255  ? -80.133 -7.887  20.015  1.00 91.38  ? 851  PRO A CB  1 
ATOM   1332  C  CG  . PRO A 1 255  ? -79.891 -6.476  19.621  1.00 81.63  ? 851  PRO A CG  1 
ATOM   1333  C  CD  . PRO A 1 255  ? -81.124 -6.067  18.870  1.00 84.14  ? 851  PRO A CD  1 
ATOM   1334  N  N   . GLU A 1 256  ? -83.048 -9.419  19.394  1.00 117.50 ? 852  GLU A N   1 
ATOM   1335  C  CA  . GLU A 1 256  ? -83.939 -10.552 19.587  1.00 108.68 ? 852  GLU A CA  1 
ATOM   1336  C  C   . GLU A 1 256  ? -83.960 -11.274 18.250  1.00 117.57 ? 852  GLU A C   1 
ATOM   1337  O  O   . GLU A 1 256  ? -84.345 -10.694 17.234  1.00 102.95 ? 852  GLU A O   1 
ATOM   1338  C  CB  . GLU A 1 256  ? -85.342 -10.109 20.005  1.00 112.02 ? 852  GLU A CB  1 
ATOM   1339  C  CG  . GLU A 1 256  ? -85.378 -9.225  21.242  1.00 118.70 ? 852  GLU A CG  1 
ATOM   1340  C  CD  . GLU A 1 256  ? -85.958 -9.931  22.453  1.00 129.71 ? 852  GLU A CD  1 
ATOM   1341  O  OE1 . GLU A 1 256  ? -85.605 -11.106 22.689  1.00 105.28 ? 852  GLU A OE1 1 
ATOM   1342  O  OE2 . GLU A 1 256  ? -86.769 -9.307  23.169  1.00 111.73 ? 852  GLU A OE2 1 
ATOM   1343  N  N   . SER A 1 257  ? -83.577 -12.546 18.260  1.00 137.61 ? 853  SER A N   1 
ATOM   1344  C  CA  . SER A 1 257  ? -83.239 -13.250 17.028  1.00 130.09 ? 853  SER A CA  1 
ATOM   1345  C  C   . SER A 1 257  ? -82.860 -14.702 17.302  1.00 105.06 ? 853  SER A C   1 
ATOM   1346  O  O   . SER A 1 257  ? -82.292 -15.020 18.346  1.00 86.97  ? 853  SER A O   1 
ATOM   1347  C  CB  . SER A 1 257  ? -82.086 -12.536 16.308  1.00 102.51 ? 853  SER A CB  1 
ATOM   1348  O  OG  . SER A 1 257  ? -81.983 -12.948 14.954  1.00 89.44  ? 853  SER A OG  1 
ATOM   1349  N  N   . GLY A 1 264  ? -79.321 -19.900 26.550  1.00 94.72  ? 860  GLY A N   1 
ATOM   1350  C  CA  . GLY A 1 264  ? -79.297 -18.615 27.225  1.00 107.59 ? 860  GLY A CA  1 
ATOM   1351  C  C   . GLY A 1 264  ? -77.971 -17.906 27.040  1.00 124.02 ? 860  GLY A C   1 
ATOM   1352  O  O   . GLY A 1 264  ? -77.545 -17.653 25.913  1.00 114.42 ? 860  GLY A O   1 
ATOM   1353  N  N   . LYS A 1 265  ? -77.311 -17.587 28.149  1.00 128.22 ? 861  LYS A N   1 
ATOM   1354  C  CA  . LYS A 1 265  ? -76.003 -16.950 28.089  1.00 125.24 ? 861  LYS A CA  1 
ATOM   1355  C  C   . LYS A 1 265  ? -74.896 -17.972 28.341  1.00 118.60 ? 861  LYS A C   1 
ATOM   1356  O  O   . LYS A 1 265  ? -74.743 -18.487 29.449  1.00 96.01  ? 861  LYS A O   1 
ATOM   1357  C  CB  . LYS A 1 265  ? -75.910 -15.798 29.092  1.00 109.57 ? 861  LYS A CB  1 
ATOM   1358  C  CG  . LYS A 1 265  ? -76.483 -16.102 30.467  1.00 113.10 ? 861  LYS A CG  1 
ATOM   1359  C  CD  . LYS A 1 265  ? -75.914 -15.159 31.514  1.00 122.48 ? 861  LYS A CD  1 
ATOM   1360  C  CE  . LYS A 1 265  ? -74.913 -15.872 32.412  1.00 121.82 ? 861  LYS A CE  1 
ATOM   1361  N  NZ  . LYS A 1 265  ? -73.871 -16.600 31.636  1.00 87.43  ? 861  LYS A NZ  1 
ATOM   1362  N  N   . THR A 1 266  ? -74.128 -18.257 27.296  1.00 120.03 ? 862  THR A N   1 
ATOM   1363  C  CA  . THR A 1 266  ? -73.069 -19.254 27.360  1.00 110.01 ? 862  THR A CA  1 
ATOM   1364  C  C   . THR A 1 266  ? -71.795 -18.677 26.759  1.00 95.49  ? 862  THR A C   1 
ATOM   1365  O  O   . THR A 1 266  ? -71.813 -17.582 26.198  1.00 97.82  ? 862  THR A O   1 
ATOM   1366  C  CB  . THR A 1 266  ? -73.461 -20.543 26.606  1.00 86.61  ? 862  THR A CB  1 
ATOM   1367  O  OG1 . THR A 1 266  ? -74.887 -20.684 26.604  1.00 82.78  ? 862  THR A OG1 1 
ATOM   1368  C  CG2 . THR A 1 266  ? -72.831 -21.767 27.256  1.00 79.24  ? 862  THR A CG2 1 
ATOM   1369  N  N   . TYR A 1 267  ? -70.688 -19.400 26.888  1.00 84.41  ? 863  TYR A N   1 
ATOM   1370  C  CA  . TYR A 1 267  ? -69.471 -19.030 26.180  1.00 61.96  ? 863  TYR A CA  1 
ATOM   1371  C  C   . TYR A 1 267  ? -69.682 -19.244 24.690  1.00 80.61  ? 863  TYR A C   1 
ATOM   1372  O  O   . TYR A 1 267  ? -70.239 -20.259 24.276  1.00 71.62  ? 863  TYR A O   1 
ATOM   1373  C  CB  . TYR A 1 267  ? -68.272 -19.844 26.665  1.00 64.40  ? 863  TYR A CB  1 
ATOM   1374  C  CG  . TYR A 1 267  ? -67.678 -19.362 27.965  1.00 65.66  ? 863  TYR A CG  1 
ATOM   1375  C  CD1 . TYR A 1 267  ? -67.124 -18.093 28.067  1.00 57.27  ? 863  TYR A CD1 1 
ATOM   1376  C  CD2 . TYR A 1 267  ? -67.653 -20.180 29.086  1.00 70.39  ? 863  TYR A CD2 1 
ATOM   1377  C  CE1 . TYR A 1 267  ? -66.575 -17.647 29.252  1.00 64.20  ? 863  TYR A CE1 1 
ATOM   1378  C  CE2 . TYR A 1 267  ? -67.105 -19.743 30.276  1.00 72.32  ? 863  TYR A CE2 1 
ATOM   1379  C  CZ  . TYR A 1 267  ? -66.567 -18.476 30.353  1.00 62.62  ? 863  TYR A CZ  1 
ATOM   1380  O  OH  . TYR A 1 267  ? -66.018 -18.035 31.534  1.00 57.10  ? 863  TYR A OH  1 
ATOM   1381  N  N   . PHE A 1 268  ? -69.246 -18.282 23.885  1.00 86.77  ? 864  PHE A N   1 
ATOM   1382  C  CA  . PHE A 1 268  ? -69.347 -18.416 22.439  1.00 73.39  ? 864  PHE A CA  1 
ATOM   1383  C  C   . PHE A 1 268  ? -68.108 -17.859 21.758  1.00 74.75  ? 864  PHE A C   1 
ATOM   1384  O  O   . PHE A 1 268  ? -67.352 -17.089 22.352  1.00 65.32  ? 864  PHE A O   1 
ATOM   1385  C  CB  . PHE A 1 268  ? -70.602 -17.714 21.911  1.00 57.73  ? 864  PHE A CB  1 
ATOM   1386  C  CG  . PHE A 1 268  ? -70.570 -16.219 22.054  1.00 72.59  ? 864  PHE A CG  1 
ATOM   1387  C  CD1 . PHE A 1 268  ? -71.009 -15.611 23.219  1.00 60.59  ? 864  PHE A CD1 1 
ATOM   1388  C  CD2 . PHE A 1 268  ? -70.115 -15.418 21.019  1.00 78.20  ? 864  PHE A CD2 1 
ATOM   1389  C  CE1 . PHE A 1 268  ? -70.983 -14.237 23.351  1.00 74.35  ? 864  PHE A CE1 1 
ATOM   1390  C  CE2 . PHE A 1 268  ? -70.085 -14.044 21.146  1.00 61.45  ? 864  PHE A CE2 1 
ATOM   1391  C  CZ  . PHE A 1 268  ? -70.521 -13.453 22.314  1.00 70.95  ? 864  PHE A CZ  1 
ATOM   1392  N  N   . TYR A 1 269  ? -67.904 -18.256 20.508  1.00 62.52  ? 865  TYR A N   1 
ATOM   1393  C  CA  . TYR A 1 269  ? -66.808 -17.716 19.718  1.00 53.33  ? 865  TYR A CA  1 
ATOM   1394  C  C   . TYR A 1 269  ? -67.228 -17.609 18.260  1.00 61.30  ? 865  TYR A C   1 
ATOM   1395  O  O   . TYR A 1 269  ? -68.079 -18.366 17.791  1.00 48.83  ? 865  TYR A O   1 
ATOM   1396  C  CB  . TYR A 1 269  ? -65.561 -18.590 19.843  1.00 55.70  ? 865  TYR A CB  1 
ATOM   1397  C  CG  . TYR A 1 269  ? -65.611 -19.832 18.987  1.00 61.44  ? 865  TYR A CG  1 
ATOM   1398  C  CD1 . TYR A 1 269  ? -66.324 -20.950 19.395  1.00 70.69  ? 865  TYR A CD1 1 
ATOM   1399  C  CD2 . TYR A 1 269  ? -64.954 -19.882 17.764  1.00 54.34  ? 865  TYR A CD2 1 
ATOM   1400  C  CE1 . TYR A 1 269  ? -66.376 -22.084 18.615  1.00 74.31  ? 865  TYR A CE1 1 
ATOM   1401  C  CE2 . TYR A 1 269  ? -65.001 -21.012 16.977  1.00 70.93  ? 865  TYR A CE2 1 
ATOM   1402  C  CZ  . TYR A 1 269  ? -65.713 -22.110 17.406  1.00 71.43  ? 865  TYR A CZ  1 
ATOM   1403  O  OH  . TYR A 1 269  ? -65.761 -23.237 16.622  1.00 77.15  ? 865  TYR A OH  1 
ATOM   1404  N  N   . GLN A 1 270  ? -66.622 -16.672 17.539  1.00 65.02  ? 866  GLN A N   1 
ATOM   1405  C  CA  . GLN A 1 270  ? -66.922 -16.507 16.124  1.00 63.60  ? 866  GLN A CA  1 
ATOM   1406  C  C   . GLN A 1 270  ? -65.685 -16.151 15.308  1.00 50.50  ? 866  GLN A C   1 
ATOM   1407  O  O   . GLN A 1 270  ? -65.684 -16.293 14.087  1.00 53.92  ? 866  GLN A O   1 
ATOM   1408  C  CB  . GLN A 1 270  ? -68.002 -15.439 15.930  1.00 55.45  ? 866  GLN A CB  1 
ATOM   1409  C  CG  . GLN A 1 270  ? -67.701 -14.110 16.598  1.00 54.14  ? 866  GLN A CG  1 
ATOM   1410  C  CD  . GLN A 1 270  ? -68.735 -13.054 16.264  1.00 58.82  ? 866  GLN A CD  1 
ATOM   1411  O  OE1 . GLN A 1 270  ? -69.535 -13.224 15.344  1.00 57.91  ? 866  GLN A OE1 1 
ATOM   1412  N  NE2 . GLN A 1 270  ? -68.725 -11.956 17.011  1.00 51.08  ? 866  GLN A NE2 1 
ATOM   1413  N  N   . LEU A 1 271  ? -64.631 -15.698 15.980  1.00 42.21  ? 867  LEU A N   1 
ATOM   1414  C  CA  . LEU A 1 271  ? -63.452 -15.209 15.273  1.00 49.09  ? 867  LEU A CA  1 
ATOM   1415  C  C   . LEU A 1 271  ? -62.128 -15.708 15.847  1.00 56.26  ? 867  LEU A C   1 
ATOM   1416  O  O   . LEU A 1 271  ? -61.973 -15.858 17.058  1.00 64.02  ? 867  LEU A O   1 
ATOM   1417  C  CB  . LEU A 1 271  ? -63.450 -13.677 15.260  1.00 59.46  ? 867  LEU A CB  1 
ATOM   1418  C  CG  . LEU A 1 271  ? -64.576 -12.988 14.488  1.00 48.05  ? 867  LEU A CG  1 
ATOM   1419  C  CD1 . LEU A 1 271  ? -64.542 -11.489 14.723  1.00 48.71  ? 867  LEU A CD1 1 
ATOM   1420  C  CD2 . LEU A 1 271  ? -64.474 -13.300 13.005  1.00 38.93  ? 867  LEU A CD2 1 
ATOM   1421  N  N   . TRP A 1 272  ? -61.183 -15.962 14.949  1.00 64.39  ? 868  TRP A N   1 
ATOM   1422  C  CA  . TRP A 1 272  ? -59.802 -16.264 15.300  1.00 52.64  ? 868  TRP A CA  1 
ATOM   1423  C  C   . TRP A 1 272  ? -59.051 -14.946 15.480  1.00 58.61  ? 868  TRP A C   1 
ATOM   1424  O  O   . TRP A 1 272  ? -59.397 -13.944 14.853  1.00 61.80  ? 868  TRP A O   1 
ATOM   1425  C  CB  . TRP A 1 272  ? -59.163 -17.131 14.214  1.00 61.79  ? 868  TRP A CB  1 
ATOM   1426  C  CG  . TRP A 1 272  ? -57.700 -17.388 14.380  1.00 80.10  ? 868  TRP A CG  1 
ATOM   1427  C  CD1 . TRP A 1 272  ? -57.118 -18.394 15.096  1.00 71.17  ? 868  TRP A CD1 1 
ATOM   1428  C  CD2 . TRP A 1 272  ? -56.628 -16.640 13.796  1.00 96.00  ? 868  TRP A CD2 1 
ATOM   1429  N  NE1 . TRP A 1 272  ? -55.750 -18.311 15.003  1.00 79.14  ? 868  TRP A NE1 1 
ATOM   1430  C  CE2 . TRP A 1 272  ? -55.424 -17.242 14.209  1.00 95.52  ? 868  TRP A CE2 1 
ATOM   1431  C  CE3 . TRP A 1 272  ? -56.570 -15.514 12.968  1.00 75.97  ? 868  TRP A CE3 1 
ATOM   1432  C  CZ2 . TRP A 1 272  ? -54.176 -16.759 13.823  1.00 100.91 ? 868  TRP A CZ2 1 
ATOM   1433  C  CZ3 . TRP A 1 272  ? -55.331 -15.035 12.586  1.00 71.17  ? 868  TRP A CZ3 1 
ATOM   1434  C  CH2 . TRP A 1 272  ? -54.151 -15.657 13.013  1.00 89.48  ? 868  TRP A CH2 1 
ATOM   1435  N  N   . TYR A 1 273  ? -58.034 -14.936 16.336  1.00 56.83  ? 869  TYR A N   1 
ATOM   1436  C  CA  . TYR A 1 273  ? -57.394 -13.679 16.713  1.00 51.92  ? 869  TYR A CA  1 
ATOM   1437  C  C   . TYR A 1 273  ? -55.868 -13.722 16.699  1.00 63.54  ? 869  TYR A C   1 
ATOM   1438  O  O   . TYR A 1 273  ? -55.246 -14.423 17.496  1.00 68.45  ? 869  TYR A O   1 
ATOM   1439  C  CB  . TYR A 1 273  ? -57.887 -13.254 18.100  1.00 50.28  ? 869  TYR A CB  1 
ATOM   1440  C  CG  . TYR A 1 273  ? -57.154 -12.075 18.708  1.00 53.32  ? 869  TYR A CG  1 
ATOM   1441  C  CD1 . TYR A 1 273  ? -57.367 -10.781 18.249  1.00 51.37  ? 869  TYR A CD1 1 
ATOM   1442  C  CD2 . TYR A 1 273  ? -56.269 -12.257 19.762  1.00 42.91  ? 869  TYR A CD2 1 
ATOM   1443  C  CE1 . TYR A 1 273  ? -56.704 -9.703  18.814  1.00 51.52  ? 869  TYR A CE1 1 
ATOM   1444  C  CE2 . TYR A 1 273  ? -55.604 -11.188 20.333  1.00 48.21  ? 869  TYR A CE2 1 
ATOM   1445  C  CZ  . TYR A 1 273  ? -55.824 -9.914  19.856  1.00 58.23  ? 869  TYR A CZ  1 
ATOM   1446  O  OH  . TYR A 1 273  ? -55.160 -8.852  20.427  1.00 50.85  ? 869  TYR A OH  1 
ATOM   1447  N  N   . ASP A 1 274  ? -55.276 -12.957 15.787  1.00 57.25  ? 870  ASP A N   1 
ATOM   1448  C  CA  . ASP A 1 274  ? -53.833 -12.751 15.766  1.00 55.87  ? 870  ASP A CA  1 
ATOM   1449  C  C   . ASP A 1 274  ? -53.475 -11.632 16.741  1.00 57.03  ? 870  ASP A C   1 
ATOM   1450  O  O   . ASP A 1 274  ? -53.982 -10.511 16.633  1.00 59.53  ? 870  ASP A O   1 
ATOM   1451  C  CB  . ASP A 1 274  ? -53.347 -12.420 14.354  1.00 42.88  ? 870  ASP A CB  1 
ATOM   1452  C  CG  . ASP A 1 274  ? -51.840 -12.549 14.207  1.00 64.98  ? 870  ASP A CG  1 
ATOM   1453  O  OD1 . ASP A 1 274  ? -51.106 -12.049 15.084  1.00 59.57  ? 870  ASP A OD1 1 
ATOM   1454  O  OD2 . ASP A 1 274  ? -51.386 -13.157 13.213  1.00 63.31  ? 870  ASP A OD2 1 
ATOM   1455  N  N   . GLN A 1 275  ? -52.589 -11.949 17.681  1.00 48.79  ? 871  GLN A N   1 
ATOM   1456  C  CA  . GLN A 1 275  ? -52.312 -11.085 18.821  1.00 53.66  ? 871  GLN A CA  1 
ATOM   1457  C  C   . GLN A 1 275  ? -51.265 -10.011 18.532  1.00 58.38  ? 871  GLN A C   1 
ATOM   1458  O  O   . GLN A 1 275  ? -51.342 -8.902  19.063  1.00 54.25  ? 871  GLN A O   1 
ATOM   1459  C  CB  . GLN A 1 275  ? -51.866 -11.944 20.005  1.00 70.57  ? 871  GLN A CB  1 
ATOM   1460  C  CG  . GLN A 1 275  ? -52.312 -13.399 19.895  1.00 79.19  ? 871  GLN A CG  1 
ATOM   1461  C  CD  . GLN A 1 275  ? -52.514 -14.050 21.247  1.00 99.91  ? 871  GLN A CD  1 
ATOM   1462  O  OE1 . GLN A 1 275  ? -52.693 -13.366 22.254  1.00 95.36  ? 871  GLN A OE1 1 
ATOM   1463  N  NE2 . GLN A 1 275  ? -52.491 -15.378 21.276  1.00 95.59  ? 871  GLN A NE2 1 
ATOM   1464  N  N   . ASP A 1 276  ? -50.286 -10.342 17.697  1.00 50.92  ? 872  ASP A N   1 
ATOM   1465  C  CA  . ASP A 1 276  ? -49.235 -9.395  17.345  1.00 57.20  ? 872  ASP A CA  1 
ATOM   1466  C  C   . ASP A 1 276  ? -49.775 -8.295  16.443  1.00 55.52  ? 872  ASP A C   1 
ATOM   1467  O  O   . ASP A 1 276  ? -49.500 -7.113  16.649  1.00 60.86  ? 872  ASP A O   1 
ATOM   1468  C  CB  . ASP A 1 276  ? -48.074 -10.113 16.651  1.00 61.67  ? 872  ASP A CB  1 
ATOM   1469  C  CG  . ASP A 1 276  ? -47.391 -11.123 17.550  1.00 63.35  ? 872  ASP A CG  1 
ATOM   1470  O  OD1 . ASP A 1 276  ? -47.035 -10.766 18.693  1.00 72.15  ? 872  ASP A OD1 1 
ATOM   1471  O  OD2 . ASP A 1 276  ? -47.212 -12.280 17.111  1.00 64.02  ? 872  ASP A OD2 1 
ATOM   1472  N  N   . TYR A 1 277  ? -50.544 -8.701  15.439  1.00 61.67  ? 873  TYR A N   1 
ATOM   1473  C  CA  . TYR A 1 277  ? -51.041 -7.782  14.424  1.00 49.66  ? 873  TYR A CA  1 
ATOM   1474  C  C   . TYR A 1 277  ? -52.448 -7.274  14.718  1.00 52.34  ? 873  TYR A C   1 
ATOM   1475  O  O   . TYR A 1 277  ? -52.989 -6.473  13.956  1.00 55.47  ? 873  TYR A O   1 
ATOM   1476  C  CB  . TYR A 1 277  ? -51.009 -8.461  13.053  1.00 47.92  ? 873  TYR A CB  1 
ATOM   1477  C  CG  . TYR A 1 277  ? -49.634 -8.941  12.658  1.00 47.14  ? 873  TYR A CG  1 
ATOM   1478  C  CD1 . TYR A 1 277  ? -48.499 -8.230  13.027  1.00 53.06  ? 873  TYR A CD1 1 
ATOM   1479  C  CD2 . TYR A 1 277  ? -49.467 -10.102 11.916  1.00 38.56  ? 873  TYR A CD2 1 
ATOM   1480  C  CE1 . TYR A 1 277  ? -47.239 -8.662  12.671  1.00 43.98  ? 873  TYR A CE1 1 
ATOM   1481  C  CE2 . TYR A 1 277  ? -48.208 -10.542 11.555  1.00 53.92  ? 873  TYR A CE2 1 
ATOM   1482  C  CZ  . TYR A 1 277  ? -47.098 -9.817  11.936  1.00 52.54  ? 873  TYR A CZ  1 
ATOM   1483  O  OH  . TYR A 1 277  ? -45.842 -10.248 11.579  1.00 59.08  ? 873  TYR A OH  1 
ATOM   1484  N  N   . ALA A 1 278  ? -53.028 -7.744  15.821  1.00 42.99  ? 874  ALA A N   1 
ATOM   1485  C  CA  . ALA A 1 278  ? -54.397 -7.397  16.203  1.00 48.62  ? 874  ALA A CA  1 
ATOM   1486  C  C   . ALA A 1 278  ? -55.387 -7.695  15.082  1.00 46.68  ? 874  ALA A C   1 
ATOM   1487  O  O   . ALA A 1 278  ? -56.170 -6.830  14.693  1.00 46.96  ? 874  ALA A O   1 
ATOM   1488  C  CB  . ALA A 1 278  ? -54.486 -5.936  16.604  1.00 42.66  ? 874  ALA A CB  1 
ATOM   1489  N  N   . ARG A 1 279  ? -55.350 -8.919  14.564  1.00 46.91  ? 875  ARG A N   1 
ATOM   1490  C  CA  . ARG A 1 279  ? -56.208 -9.276  13.438  1.00 46.10  ? 875  ARG A CA  1 
ATOM   1491  C  C   . ARG A 1 279  ? -57.317 -10.249 13.826  1.00 52.90  ? 875  ARG A C   1 
ATOM   1492  O  O   . ARG A 1 279  ? -57.054 -11.402 14.157  1.00 56.77  ? 875  ARG A O   1 
ATOM   1493  C  CB  . ARG A 1 279  ? -55.375 -9.877  12.302  1.00 41.98  ? 875  ARG A CB  1 
ATOM   1494  C  CG  . ARG A 1 279  ? -54.454 -8.886  11.611  1.00 45.13  ? 875  ARG A CG  1 
ATOM   1495  C  CD  . ARG A 1 279  ? -53.639 -9.556  10.519  1.00 46.51  ? 875  ARG A CD  1 
ATOM   1496  N  NE  . ARG A 1 279  ? -54.482 -10.115 9.467   1.00 36.65  ? 875  ARG A NE  1 
ATOM   1497  C  CZ  . ARG A 1 279  ? -54.854 -9.449  8.379   1.00 45.10  ? 875  ARG A CZ  1 
ATOM   1498  N  NH1 . ARG A 1 279  ? -54.460 -8.196  8.202   1.00 50.86  ? 875  ARG A NH1 1 
ATOM   1499  N  NH2 . ARG A 1 279  ? -55.620 -10.036 7.469   1.00 43.04  ? 875  ARG A NH2 1 
ATOM   1500  N  N   . PHE A 1 280  ? -58.559 -9.782  13.781  1.00 48.85  ? 876  PHE A N   1 
ATOM   1501  C  CA  . PHE A 1 280  ? -59.701 -10.669 13.963  1.00 42.20  ? 876  PHE A CA  1 
ATOM   1502  C  C   . PHE A 1 280  ? -60.110 -11.195 12.595  1.00 49.83  ? 876  PHE A C   1 
ATOM   1503  O  O   . PHE A 1 280  ? -60.446 -10.416 11.709  1.00 50.95  ? 876  PHE A O   1 
ATOM   1504  C  CB  . PHE A 1 280  ? -60.871 -9.948  14.638  1.00 38.76  ? 876  PHE A CB  1 
ATOM   1505  C  CG  . PHE A 1 280  ? -60.545 -9.396  16.000  1.00 47.35  ? 876  PHE A CG  1 
ATOM   1506  C  CD1 . PHE A 1 280  ? -59.885 -8.186  16.133  1.00 49.18  ? 876  PHE A CD1 1 
ATOM   1507  C  CD2 . PHE A 1 280  ? -60.912 -10.081 17.147  1.00 55.20  ? 876  PHE A CD2 1 
ATOM   1508  C  CE1 . PHE A 1 280  ? -59.586 -7.674  17.382  1.00 42.02  ? 876  PHE A CE1 1 
ATOM   1509  C  CE2 . PHE A 1 280  ? -60.617 -9.572  18.400  1.00 54.15  ? 876  PHE A CE2 1 
ATOM   1510  C  CZ  . PHE A 1 280  ? -59.954 -8.368  18.516  1.00 50.48  ? 876  PHE A CZ  1 
ATOM   1511  N  N   . GLU A 1 281  ? -60.057 -12.511 12.413  1.00 54.48  ? 877  GLU A N   1 
ATOM   1512  C  CA  . GLU A 1 281  ? -60.378 -13.111 11.119  1.00 49.12  ? 877  GLU A CA  1 
ATOM   1513  C  C   . GLU A 1 281  ? -61.336 -14.287 11.264  1.00 51.51  ? 877  GLU A C   1 
ATOM   1514  O  O   . GLU A 1 281  ? -61.583 -14.761 12.369  1.00 57.97  ? 877  GLU A O   1 
ATOM   1515  C  CB  . GLU A 1 281  ? -59.103 -13.570 10.406  1.00 48.14  ? 877  GLU A CB  1 
ATOM   1516  C  CG  . GLU A 1 281  ? -57.999 -12.525 10.370  1.00 60.37  ? 877  GLU A CG  1 
ATOM   1517  C  CD  . GLU A 1 281  ? -56.921 -12.849 9.360   1.00 58.87  ? 877  GLU A CD  1 
ATOM   1518  O  OE1 . GLU A 1 281  ? -55.727 -12.694 9.692   1.00 65.28  ? 877  GLU A OE1 1 
ATOM   1519  O  OE2 . GLU A 1 281  ? -57.269 -13.253 8.230   1.00 64.36  ? 877  GLU A OE2 1 
ATOM   1520  N  N   . SER A 1 282  ? -61.878 -14.747 10.141  1.00 50.01  ? 878  SER A N   1 
ATOM   1521  C  CA  . SER A 1 282  ? -62.738 -15.924 10.132  1.00 51.21  ? 878  SER A CA  1 
ATOM   1522  C  C   . SER A 1 282  ? -61.939 -17.154 10.547  1.00 65.63  ? 878  SER A C   1 
ATOM   1523  O  O   . SER A 1 282  ? -60.743 -17.238 10.268  1.00 54.71  ? 878  SER A O   1 
ATOM   1524  C  CB  . SER A 1 282  ? -63.357 -16.131 8.748   1.00 50.26  ? 878  SER A CB  1 
ATOM   1525  O  OG  . SER A 1 282  ? -64.169 -15.030 8.382   1.00 57.09  ? 878  SER A OG  1 
ATOM   1526  N  N   . PRO A 1 283  ? -62.597 -18.108 11.228  1.00 74.36  ? 879  PRO A N   1 
ATOM   1527  C  CA  . PRO A 1 283  ? -61.940 -19.341 11.677  1.00 64.16  ? 879  PRO A CA  1 
ATOM   1528  C  C   . PRO A 1 283  ? -61.288 -20.106 10.530  1.00 61.89  ? 879  PRO A C   1 
ATOM   1529  O  O   . PRO A 1 283  ? -61.929 -20.312 9.500   1.00 61.03  ? 879  PRO A O   1 
ATOM   1530  C  CB  . PRO A 1 283  ? -63.091 -20.149 12.285  1.00 59.92  ? 879  PRO A CB  1 
ATOM   1531  C  CG  . PRO A 1 283  ? -64.077 -19.126 12.711  1.00 54.44  ? 879  PRO A CG  1 
ATOM   1532  C  CD  . PRO A 1 283  ? -64.000 -18.043 11.675  1.00 79.32  ? 879  PRO A CD  1 
ATOM   1533  N  N   . PRO A 1 284  ? -60.021 -20.515 10.710  1.00 56.69  ? 880  PRO A N   1 
ATOM   1534  C  CA  . PRO A 1 284  ? -59.244 -21.252 9.707   1.00 52.71  ? 880  PRO A CA  1 
ATOM   1535  C  C   . PRO A 1 284  ? -59.980 -22.484 9.201   1.00 70.46  ? 880  PRO A C   1 
ATOM   1536  O  O   . PRO A 1 284  ? -60.659 -23.161 9.973   1.00 80.11  ? 880  PRO A O   1 
ATOM   1537  C  CB  . PRO A 1 284  ? -57.975 -21.643 10.467  1.00 57.47  ? 880  PRO A CB  1 
ATOM   1538  C  CG  . PRO A 1 284  ? -57.830 -20.588 11.502  1.00 69.23  ? 880  PRO A CG  1 
ATOM   1539  C  CD  . PRO A 1 284  ? -59.231 -20.250 11.925  1.00 68.08  ? 880  PRO A CD  1 
ATOM   1540  N  N   . LYS A 1 285  ? -59.848 -22.759 7.909   1.00 76.78  ? 881  LYS A N   1 
ATOM   1541  C  CA  . LYS A 1 285  ? -60.613 -23.821 7.273   1.00 91.93  ? 881  LYS A CA  1 
ATOM   1542  C  C   . LYS A 1 285  ? -59.879 -25.156 7.220   1.00 93.43  ? 881  LYS A C   1 
ATOM   1543  O  O   . LYS A 1 285  ? -60.452 -26.151 6.775   1.00 96.37  ? 881  LYS A O   1 
ATOM   1544  C  CB  . LYS A 1 285  ? -60.996 -23.404 5.852   1.00 82.60  ? 881  LYS A CB  1 
ATOM   1545  C  CG  . LYS A 1 285  ? -62.440 -23.686 5.494   1.00 84.27  ? 881  LYS A CG  1 
ATOM   1546  C  CD  . LYS A 1 285  ? -63.373 -22.831 6.331   1.00 93.54  ? 881  LYS A CD  1 
ATOM   1547  C  CE  . LYS A 1 285  ? -64.825 -23.066 5.962   1.00 92.25  ? 881  LYS A CE  1 
ATOM   1548  N  NZ  . LYS A 1 285  ? -65.735 -22.228 6.788   1.00 70.11  ? 881  LYS A NZ  1 
ATOM   1549  N  N   . THR A 1 286  ? -58.626 -25.180 7.672   1.00 88.97  ? 882  THR A N   1 
ATOM   1550  C  CA  . THR A 1 286  ? -57.768 -26.341 7.438   1.00 111.90 ? 882  THR A CA  1 
ATOM   1551  C  C   . THR A 1 286  ? -58.374 -27.630 7.984   1.00 101.35 ? 882  THR A C   1 
ATOM   1552  O  O   . THR A 1 286  ? -58.662 -27.750 9.175   1.00 89.60  ? 882  THR A O   1 
ATOM   1553  C  CB  . THR A 1 286  ? -56.373 -26.141 8.062   1.00 112.89 ? 882  THR A CB  1 
ATOM   1554  O  OG1 . THR A 1 286  ? -56.501 -25.467 9.320   1.00 92.28  ? 882  THR A OG1 1 
ATOM   1555  C  CG2 . THR A 1 286  ? -55.493 -25.309 7.141   1.00 111.51 ? 882  THR A CG2 1 
ATOM   1556  N  N   . GLN A 1 287  ? -58.537 -28.595 7.085   1.00 108.83 ? 883  GLN A N   1 
ATOM   1557  C  CA  . GLN A 1 287  ? -59.178 -29.867 7.388   1.00 114.42 ? 883  GLN A CA  1 
ATOM   1558  C  C   . GLN A 1 287  ? -58.197 -30.950 7.819   1.00 126.62 ? 883  GLN A C   1 
ATOM   1559  O  O   . GLN A 1 287  ? -57.043 -30.959 7.389   1.00 117.90 ? 883  GLN A O   1 
ATOM   1560  C  CB  . GLN A 1 287  ? -59.983 -30.344 6.178   1.00 115.32 ? 883  GLN A CB  1 
ATOM   1561  C  CG  . GLN A 1 287  ? -61.350 -29.691 6.055   1.00 113.26 ? 883  GLN A CG  1 
ATOM   1562  C  CD  . GLN A 1 287  ? -62.323 -30.174 7.116   1.00 124.64 ? 883  GLN A CD  1 
ATOM   1563  O  OE1 . GLN A 1 287  ? -62.455 -31.375 7.350   1.00 128.49 ? 883  GLN A OE1 1 
ATOM   1564  N  NE2 . GLN A 1 287  ? -63.004 -29.238 7.768   1.00 104.49 ? 883  GLN A NE2 1 
ATOM   1565  N  N   . PRO A 1 288  ? -58.659 -31.873 8.674   1.00 126.08 ? 884  PRO A N   1 
ATOM   1566  C  CA  . PRO A 1 288  ? -57.891 -33.068 9.026   1.00 117.77 ? 884  PRO A CA  1 
ATOM   1567  C  C   . PRO A 1 288  ? -57.935 -34.117 7.927   1.00 106.07 ? 884  PRO A C   1 
ATOM   1568  O  O   . PRO A 1 288  ? -58.876 -34.126 7.132   1.00 105.94 ? 884  PRO A O   1 
ATOM   1569  C  CB  . PRO A 1 288  ? -58.607 -33.584 10.273  1.00 121.33 ? 884  PRO A CB  1 
ATOM   1570  C  CG  . PRO A 1 288  ? -60.015 -33.141 10.091  1.00 113.07 ? 884  PRO A CG  1 
ATOM   1571  C  CD  . PRO A 1 288  ? -59.933 -31.802 9.413   1.00 111.24 ? 884  PRO A CD  1 
ATOM   1572  N  N   . THR A 1 289  ? -56.933 -34.988 7.877   1.00 120.30 ? 885  THR A N   1 
ATOM   1573  C  CA  . THR A 1 289  ? -57.092 -36.235 7.148   1.00 128.23 ? 885  THR A CA  1 
ATOM   1574  C  C   . THR A 1 289  ? -57.842 -37.176 8.081   1.00 131.03 ? 885  THR A C   1 
ATOM   1575  O  O   . THR A 1 289  ? -58.150 -36.812 9.216   1.00 135.14 ? 885  THR A O   1 
ATOM   1576  C  CB  . THR A 1 289  ? -55.743 -36.845 6.704   1.00 113.31 ? 885  THR A CB  1 
ATOM   1577  O  OG1 . THR A 1 289  ? -55.839 -38.274 6.708   1.00 110.33 ? 885  THR A OG1 1 
ATOM   1578  C  CG2 . THR A 1 289  ? -54.625 -36.420 7.633   1.00 98.48  ? 885  THR A CG2 1 
ATOM   1579  N  N   . GLU A 1 290  ? -58.143 -38.381 7.622   1.00 133.75 ? 886  GLU A N   1 
ATOM   1580  C  CA  . GLU A 1 290  ? -58.933 -39.283 8.445   1.00 127.80 ? 886  GLU A CA  1 
ATOM   1581  C  C   . GLU A 1 290  ? -58.058 -40.160 9.332   1.00 127.40 ? 886  GLU A C   1 
ATOM   1582  O  O   . GLU A 1 290  ? -58.556 -40.880 10.197  1.00 111.14 ? 886  GLU A O   1 
ATOM   1583  C  CB  . GLU A 1 290  ? -59.844 -40.135 7.565   1.00 110.10 ? 886  GLU A CB  1 
ATOM   1584  C  CG  . GLU A 1 290  ? -60.943 -39.328 6.894   1.00 122.51 ? 886  GLU A CG  1 
ATOM   1585  C  CD  . GLU A 1 290  ? -61.813 -40.164 5.984   1.00 132.49 ? 886  GLU A CD  1 
ATOM   1586  O  OE1 . GLU A 1 290  ? -61.508 -41.361 5.805   1.00 132.50 ? 886  GLU A OE1 1 
ATOM   1587  O  OE2 . GLU A 1 290  ? -62.804 -39.625 5.447   1.00 133.45 ? 886  GLU A OE2 1 
ATOM   1588  N  N   . ASP A 1 291  ? -56.750 -40.090 9.114   1.00 130.16 ? 887  ASP A N   1 
ATOM   1589  C  CA  . ASP A 1 291  ? -55.804 -40.813 9.953   1.00 112.23 ? 887  ASP A CA  1 
ATOM   1590  C  C   . ASP A 1 291  ? -55.542 -40.079 11.268  1.00 109.68 ? 887  ASP A C   1 
ATOM   1591  O  O   . ASP A 1 291  ? -55.336 -40.708 12.299  1.00 119.06 ? 887  ASP A O   1 
ATOM   1592  C  CB  . ASP A 1 291  ? -54.498 -41.056 9.194   1.00 107.63 ? 887  ASP A CB  1 
ATOM   1593  C  CG  . ASP A 1 291  ? -54.707 -41.867 7.927   1.00 124.81 ? 887  ASP A CG  1 
ATOM   1594  O  OD1 . ASP A 1 291  ? -54.880 -43.099 8.032   1.00 124.51 ? 887  ASP A OD1 1 
ATOM   1595  O  OD2 . ASP A 1 291  ? -54.704 -41.273 6.829   1.00 115.75 ? 887  ASP A OD2 1 
ATOM   1596  N  N   . ASN A 1 292  ? -55.522 -38.750 11.223  1.00 115.45 ? 888  ASN A N   1 
ATOM   1597  C  CA  . ASN A 1 292  ? -55.415 -37.936 12.436  1.00 122.13 ? 888  ASN A CA  1 
ATOM   1598  C  C   . ASN A 1 292  ? -56.766 -37.439 12.972  1.00 114.25 ? 888  ASN A C   1 
ATOM   1599  O  O   . ASN A 1 292  ? -56.801 -36.624 13.895  1.00 101.08 ? 888  ASN A O   1 
ATOM   1600  C  CB  . ASN A 1 292  ? -54.461 -36.755 12.225  1.00 120.79 ? 888  ASN A CB  1 
ATOM   1601  C  CG  . ASN A 1 292  ? -54.814 -35.913 11.019  1.00 128.34 ? 888  ASN A CG  1 
ATOM   1602  O  OD1 . ASN A 1 292  ? -55.951 -35.913 10.551  1.00 128.44 ? 888  ASN A OD1 1 
ATOM   1603  N  ND2 . ASN A 1 292  ? -53.831 -35.180 10.511  1.00 118.83 ? 888  ASN A ND2 1 
ATOM   1604  N  N   . LYS A 1 293  ? -57.861 -37.914 12.376  1.00 113.13 ? 889  LYS A N   1 
ATOM   1605  C  CA  . LYS A 1 293  ? -59.214 -37.423 12.666  1.00 110.12 ? 889  LYS A CA  1 
ATOM   1606  C  C   . LYS A 1 293  ? -59.534 -37.313 14.156  1.00 114.77 ? 889  LYS A C   1 
ATOM   1607  O  O   . LYS A 1 293  ? -60.245 -36.401 14.580  1.00 106.96 ? 889  LYS A O   1 
ATOM   1608  C  CB  . LYS A 1 293  ? -60.251 -38.352 12.029  1.00 125.52 ? 889  LYS A CB  1 
ATOM   1609  C  CG  . LYS A 1 293  ? -61.038 -37.774 10.868  1.00 121.95 ? 889  LYS A CG  1 
ATOM   1610  C  CD  . LYS A 1 293  ? -62.180 -38.712 10.481  1.00 118.95 ? 889  LYS A CD  1 
ATOM   1611  C  CE  . LYS A 1 293  ? -61.761 -40.177 10.585  1.00 123.17 ? 889  LYS A CE  1 
ATOM   1612  N  NZ  . LYS A 1 293  ? -62.840 -41.123 10.188  1.00 107.50 ? 889  LYS A NZ  1 
ATOM   1613  N  N   . PHE A 1 294  ? -59.010 -38.243 14.945  1.00 122.12 ? 890  PHE A N   1 
ATOM   1614  C  CA  . PHE A 1 294  ? -59.280 -38.267 16.378  1.00 106.61 ? 890  PHE A CA  1 
ATOM   1615  C  C   . PHE A 1 294  ? -58.447 -37.247 17.152  1.00 103.81 ? 890  PHE A C   1 
ATOM   1616  O  O   . PHE A 1 294  ? -58.947 -36.604 18.074  1.00 102.63 ? 890  PHE A O   1 
ATOM   1617  C  CB  . PHE A 1 294  ? -59.039 -39.673 16.936  1.00 102.60 ? 890  PHE A CB  1 
ATOM   1618  C  CG  . PHE A 1 294  ? -57.922 -40.413 16.255  1.00 118.16 ? 890  PHE A CG  1 
ATOM   1619  C  CD1 . PHE A 1 294  ? -56.609 -40.242 16.661  1.00 119.75 ? 890  PHE A CD1 1 
ATOM   1620  C  CD2 . PHE A 1 294  ? -58.188 -41.286 15.212  1.00 106.96 ? 890  PHE A CD2 1 
ATOM   1621  C  CE1 . PHE A 1 294  ? -55.582 -40.922 16.037  1.00 104.06 ? 890  PHE A CE1 1 
ATOM   1622  C  CE2 . PHE A 1 294  ? -57.164 -41.968 14.584  1.00 109.28 ? 890  PHE A CE2 1 
ATOM   1623  C  CZ  . PHE A 1 294  ? -55.860 -41.787 15.001  1.00 105.41 ? 890  PHE A CZ  1 
ATOM   1624  N  N   . LYS A 1 295  ? -57.176 -37.114 16.786  1.00 105.14 ? 891  LYS A N   1 
ATOM   1625  C  CA  . LYS A 1 295  ? -56.255 -36.246 17.517  1.00 109.06 ? 891  LYS A CA  1 
ATOM   1626  C  C   . LYS A 1 295  ? -56.086 -34.852 16.914  1.00 101.52 ? 891  LYS A C   1 
ATOM   1627  O  O   . LYS A 1 295  ? -55.298 -34.052 17.420  1.00 86.33  ? 891  LYS A O   1 
ATOM   1628  C  CB  . LYS A 1 295  ? -54.882 -36.914 17.624  1.00 111.30 ? 891  LYS A CB  1 
ATOM   1629  C  CG  . LYS A 1 295  ? -54.125 -37.005 16.310  1.00 107.96 ? 891  LYS A CG  1 
ATOM   1630  C  CD  . LYS A 1 295  ? -52.679 -37.409 16.547  1.00 104.29 ? 891  LYS A CD  1 
ATOM   1631  C  CE  . LYS A 1 295  ? -51.893 -37.449 15.249  1.00 107.31 ? 891  LYS A CE  1 
ATOM   1632  N  NZ  . LYS A 1 295  ? -50.448 -37.712 15.491  1.00 92.95  ? 891  LYS A NZ  1 
ATOM   1633  N  N   . PHE A 1 296  ? -56.814 -34.567 15.838  1.00 96.42  ? 892  PHE A N   1 
ATOM   1634  C  CA  . PHE A 1 296  ? -56.581 -33.354 15.057  1.00 96.14  ? 892  PHE A CA  1 
ATOM   1635  C  C   . PHE A 1 296  ? -56.683 -32.052 15.849  1.00 77.32  ? 892  PHE A C   1 
ATOM   1636  O  O   . PHE A 1 296  ? -57.669 -31.798 16.539  1.00 93.38  ? 892  PHE A O   1 
ATOM   1637  C  CB  . PHE A 1 296  ? -57.550 -33.285 13.877  1.00 94.96  ? 892  PHE A CB  1 
ATOM   1638  C  CG  . PHE A 1 296  ? -57.274 -32.143 12.944  1.00 105.00 ? 892  PHE A CG  1 
ATOM   1639  C  CD1 . PHE A 1 296  ? -56.128 -32.135 12.167  1.00 117.15 ? 892  PHE A CD1 1 
ATOM   1640  C  CD2 . PHE A 1 296  ? -58.156 -31.080 12.840  1.00 99.62  ? 892  PHE A CD2 1 
ATOM   1641  C  CE1 . PHE A 1 296  ? -55.864 -31.090 11.303  1.00 97.88  ? 892  PHE A CE1 1 
ATOM   1642  C  CE2 . PHE A 1 296  ? -57.897 -30.030 11.976  1.00 102.59 ? 892  PHE A CE2 1 
ATOM   1643  C  CZ  . PHE A 1 296  ? -56.749 -30.036 11.207  1.00 97.87  ? 892  PHE A CZ  1 
ATOM   1644  N  N   . CYS A 1 297  ? -55.644 -31.231 15.729  1.00 68.34  ? 893  CYS A N   1 
ATOM   1645  C  CA  . CYS A 1 297  ? -55.639 -29.896 16.307  1.00 72.24  ? 893  CYS A CA  1 
ATOM   1646  C  C   . CYS A 1 297  ? -55.316 -28.873 15.223  1.00 79.68  ? 893  CYS A C   1 
ATOM   1647  O  O   . CYS A 1 297  ? -54.359 -29.041 14.466  1.00 85.59  ? 893  CYS A O   1 
ATOM   1648  C  CB  . CYS A 1 297  ? -54.630 -29.797 17.449  1.00 59.42  ? 893  CYS A CB  1 
ATOM   1649  S  SG  . CYS A 1 297  ? -54.508 -28.150 18.178  1.00 63.77  ? 893  CYS A SG  1 
ATOM   1650  N  N   . VAL A 1 298  ? -56.121 -27.818 15.147  1.00 74.71  ? 894  VAL A N   1 
ATOM   1651  C  CA  . VAL A 1 298  ? -55.931 -26.788 14.133  1.00 72.58  ? 894  VAL A CA  1 
ATOM   1652  C  C   . VAL A 1 298  ? -54.667 -25.980 14.411  1.00 66.41  ? 894  VAL A C   1 
ATOM   1653  O  O   . VAL A 1 298  ? -53.901 -25.674 13.497  1.00 76.84  ? 894  VAL A O   1 
ATOM   1654  C  CB  . VAL A 1 298  ? -57.142 -25.838 14.061  1.00 58.02  ? 894  VAL A CB  1 
ATOM   1655  C  CG1 . VAL A 1 298  ? -56.918 -24.769 13.006  1.00 62.85  ? 894  VAL A CG1 1 
ATOM   1656  C  CG2 . VAL A 1 298  ? -58.406 -26.622 13.758  1.00 63.68  ? 894  VAL A CG2 1 
ATOM   1657  N  N   . SER A 1 299  ? -54.454 -25.647 15.680  1.00 58.94  ? 895  SER A N   1 
ATOM   1658  C  CA  . SER A 1 299  ? -53.284 -24.881 16.090  1.00 55.82  ? 895  SER A CA  1 
ATOM   1659  C  C   . SER A 1 299  ? -51.988 -25.604 15.739  1.00 66.28  ? 895  SER A C   1 
ATOM   1660  O  O   . SER A 1 299  ? -51.022 -24.983 15.295  1.00 73.04  ? 895  SER A O   1 
ATOM   1661  C  CB  . SER A 1 299  ? -53.334 -24.598 17.592  1.00 49.59  ? 895  SER A CB  1 
ATOM   1662  O  OG  . SER A 1 299  ? -52.210 -23.842 18.004  1.00 61.48  ? 895  SER A OG  1 
ATOM   1663  N  N   . CYS A 1 300  ? -51.973 -26.917 15.940  1.00 72.54  ? 896  CYS A N   1 
ATOM   1664  C  CA  . CYS A 1 300  ? -50.804 -27.725 15.612  1.00 75.96  ? 896  CYS A CA  1 
ATOM   1665  C  C   . CYS A 1 300  ? -50.557 -27.731 14.108  1.00 82.26  ? 896  CYS A C   1 
ATOM   1666  O  O   . CYS A 1 300  ? -49.415 -27.642 13.655  1.00 85.71  ? 896  CYS A O   1 
ATOM   1667  C  CB  . CYS A 1 300  ? -50.972 -29.157 16.125  1.00 67.60  ? 896  CYS A CB  1 
ATOM   1668  S  SG  . CYS A 1 300  ? -50.853 -29.333 17.920  1.00 66.73  ? 896  CYS A SG  1 
ATOM   1669  N  N   . ALA A 1 301  ? -51.638 -27.833 13.341  1.00 76.22  ? 897  ALA A N   1 
ATOM   1670  C  CA  . ALA A 1 301  ? -51.550 -27.856 11.887  1.00 76.12  ? 897  ALA A CA  1 
ATOM   1671  C  C   . ALA A 1 301  ? -51.008 -26.538 11.350  1.00 76.67  ? 897  ALA A C   1 
ATOM   1672  O  O   . ALA A 1 301  ? -50.184 -26.521 10.437  1.00 81.37  ? 897  ALA A O   1 
ATOM   1673  C  CB  . ALA A 1 301  ? -52.909 -28.157 11.279  1.00 62.21  ? 897  ALA A CB  1 
ATOM   1674  N  N   . ARG A 1 302  ? -51.474 -25.434 11.925  1.00 69.08  ? 898  ARG A N   1 
ATOM   1675  C  CA  . ARG A 1 302  ? -51.046 -24.112 11.487  1.00 62.37  ? 898  ARG A CA  1 
ATOM   1676  C  C   . ARG A 1 302  ? -49.615 -23.819 11.922  1.00 66.09  ? 898  ARG A C   1 
ATOM   1677  O  O   . ARG A 1 302  ? -48.862 -23.177 11.193  1.00 91.81  ? 898  ARG A O   1 
ATOM   1678  C  CB  . ARG A 1 302  ? -52.000 -23.040 12.019  1.00 59.10  ? 898  ARG A CB  1 
ATOM   1679  C  CG  . ARG A 1 302  ? -53.419 -23.193 11.502  1.00 63.19  ? 898  ARG A CG  1 
ATOM   1680  C  CD  . ARG A 1 302  ? -54.350 -22.136 12.069  1.00 64.61  ? 898  ARG A CD  1 
ATOM   1681  N  NE  . ARG A 1 302  ? -54.465 -20.973 11.194  1.00 74.35  ? 898  ARG A NE  1 
ATOM   1682  C  CZ  . ARG A 1 302  ? -53.797 -19.838 11.362  1.00 81.80  ? 898  ARG A CZ  1 
ATOM   1683  N  NH1 . ARG A 1 302  ? -52.959 -19.704 12.380  1.00 84.10  ? 898  ARG A NH1 1 
ATOM   1684  N  NH2 . ARG A 1 302  ? -53.970 -18.833 10.515  1.00 91.17  ? 898  ARG A NH2 1 
ATOM   1685  N  N   . LEU A 1 303  ? -49.242 -24.290 13.108  1.00 67.24  ? 899  LEU A N   1 
ATOM   1686  C  CA  . LEU A 1 303  ? -47.859 -24.181 13.560  1.00 70.90  ? 899  LEU A CA  1 
ATOM   1687  C  C   . LEU A 1 303  ? -46.946 -24.946 12.610  1.00 74.99  ? 899  LEU A C   1 
ATOM   1688  O  O   . LEU A 1 303  ? -45.863 -24.475 12.247  1.00 71.80  ? 899  LEU A O   1 
ATOM   1689  C  CB  . LEU A 1 303  ? -47.700 -24.714 14.986  1.00 81.07  ? 899  LEU A CB  1 
ATOM   1690  C  CG  . LEU A 1 303  ? -47.471 -23.692 16.101  1.00 81.92  ? 899  LEU A CG  1 
ATOM   1691  C  CD1 . LEU A 1 303  ? -48.764 -22.974 16.462  1.00 69.03  ? 899  LEU A CD1 1 
ATOM   1692  C  CD2 . LEU A 1 303  ? -46.881 -24.377 17.322  1.00 73.02  ? 899  LEU A CD2 1 
ATOM   1693  N  N   . ALA A 1 304  ? -47.401 -26.130 12.209  1.00 81.22  ? 900  ALA A N   1 
ATOM   1694  C  CA  . ALA A 1 304  ? -46.674 -26.957 11.258  1.00 79.88  ? 900  ALA A CA  1 
ATOM   1695  C  C   . ALA A 1 304  ? -46.493 -26.222 9.937   1.00 85.11  ? 900  ALA A C   1 
ATOM   1696  O  O   . ALA A 1 304  ? -45.373 -26.087 9.449   1.00 87.24  ? 900  ALA A O   1 
ATOM   1697  C  CB  . ALA A 1 304  ? -47.396 -28.274 11.038  1.00 71.92  ? 900  ALA A CB  1 
ATOM   1698  N  N   . GLU A 1 305  ? -47.600 -25.748 9.370   1.00 87.45  ? 901  GLU A N   1 
ATOM   1699  C  CA  . GLU A 1 305  ? -47.575 -25.008 8.111   1.00 84.06  ? 901  GLU A CA  1 
ATOM   1700  C  C   . GLU A 1 305  ? -46.609 -23.835 8.173   1.00 78.85  ? 901  GLU A C   1 
ATOM   1701  O  O   . GLU A 1 305  ? -45.769 -23.661 7.287   1.00 85.22  ? 901  GLU A O   1 
ATOM   1702  C  CB  . GLU A 1 305  ? -48.972 -24.496 7.753   1.00 82.54  ? 901  GLU A CB  1 
ATOM   1703  C  CG  . GLU A 1 305  ? -49.960 -25.573 7.352   1.00 101.21 ? 901  GLU A CG  1 
ATOM   1704  C  CD  . GLU A 1 305  ? -51.313 -25.000 6.977   1.00 119.62 ? 901  GLU A CD  1 
ATOM   1705  O  OE1 . GLU A 1 305  ? -51.453 -23.758 6.964   1.00 98.25  ? 901  GLU A OE1 1 
ATOM   1706  O  OE2 . GLU A 1 305  ? -52.237 -25.792 6.695   1.00 113.67 ? 901  GLU A OE2 1 
ATOM   1707  N  N   . MET A 1 306  ? -46.734 -23.037 9.227   1.00 80.46  ? 902  MET A N   1 
ATOM   1708  C  CA  . MET A 1 306  ? -45.903 -21.854 9.390   1.00 82.11  ? 902  MET A CA  1 
ATOM   1709  C  C   . MET A 1 306  ? -44.428 -22.214 9.483   1.00 81.95  ? 902  MET A C   1 
ATOM   1710  O  O   . MET A 1 306  ? -43.634 -21.779 8.652   1.00 102.92 ? 902  MET A O   1 
ATOM   1711  C  CB  . MET A 1 306  ? -46.331 -21.059 10.625  1.00 77.24  ? 902  MET A CB  1 
ATOM   1712  C  CG  . MET A 1 306  ? -47.640 -20.311 10.442  1.00 98.44  ? 902  MET A CG  1 
ATOM   1713  S  SD  . MET A 1 306  ? -48.046 -19.249 11.838  1.00 145.83 ? 902  MET A SD  1 
ATOM   1714  C  CE  . MET A 1 306  ? -49.573 -18.510 11.262  1.00 107.21 ? 902  MET A CE  1 
ATOM   1715  N  N   . ARG A 1 307  ? -44.064 -23.019 10.477  1.00 87.35  ? 903  ARG A N   1 
ATOM   1716  C  CA  . ARG A 1 307  ? -42.659 -23.358 10.691  1.00 93.97  ? 903  ARG A CA  1 
ATOM   1717  C  C   . ARG A 1 307  ? -42.053 -24.141 9.529   1.00 88.90  ? 903  ARG A C   1 
ATOM   1718  O  O   . ARG A 1 307  ? -40.833 -24.181 9.372   1.00 94.83  ? 903  ARG A O   1 
ATOM   1719  C  CB  . ARG A 1 307  ? -42.492 -24.147 11.992  1.00 104.52 ? 903  ARG A CB  1 
ATOM   1720  C  CG  . ARG A 1 307  ? -42.005 -23.299 13.154  1.00 120.16 ? 903  ARG A CG  1 
ATOM   1721  C  CD  . ARG A 1 307  ? -40.682 -22.626 12.815  1.00 128.23 ? 903  ARG A CD  1 
ATOM   1722  N  NE  . ARG A 1 307  ? -40.739 -21.177 12.991  1.00 133.82 ? 903  ARG A NE  1 
ATOM   1723  C  CZ  . ARG A 1 307  ? -39.790 -20.338 12.587  1.00 139.10 ? 903  ARG A CZ  1 
ATOM   1724  N  NH1 . ARG A 1 307  ? -38.709 -20.802 11.974  1.00 134.88 ? 903  ARG A NH1 1 
ATOM   1725  N  NH2 . ARG A 1 307  ? -39.925 -19.034 12.786  1.00 131.32 ? 903  ARG A NH2 1 
ATOM   1726  N  N   . GLN A 1 308  ? -42.899 -24.761 8.714   1.00 81.03  ? 904  GLN A N   1 
ATOM   1727  C  CA  . GLN A 1 308  ? -42.418 -25.459 7.529   1.00 89.60  ? 904  GLN A CA  1 
ATOM   1728  C  C   . GLN A 1 308  ? -42.220 -24.470 6.386   1.00 95.44  ? 904  GLN A C   1 
ATOM   1729  O  O   . GLN A 1 308  ? -41.363 -24.663 5.522   1.00 93.45  ? 904  GLN A O   1 
ATOM   1730  C  CB  . GLN A 1 308  ? -43.389 -26.565 7.109   1.00 84.01  ? 904  GLN A CB  1 
ATOM   1731  C  CG  . GLN A 1 308  ? -42.775 -27.631 6.218   1.00 89.08  ? 904  GLN A CG  1 
ATOM   1732  C  CD  . GLN A 1 308  ? -42.165 -28.772 7.009   1.00 107.73 ? 904  GLN A CD  1 
ATOM   1733  O  OE1 . GLN A 1 308  ? -42.851 -29.446 7.778   1.00 94.44  ? 904  GLN A OE1 1 
ATOM   1734  N  NE2 . GLN A 1 308  ? -40.869 -28.994 6.826   1.00 104.54 ? 904  GLN A NE2 1 
ATOM   1735  N  N   . LYS A 1 309  ? -43.017 -23.406 6.391   1.00 90.61  ? 905  LYS A N   1 
ATOM   1736  C  CA  . LYS A 1 309  ? -42.955 -22.396 5.341   1.00 84.27  ? 905  LYS A CA  1 
ATOM   1737  C  C   . LYS A 1 309  ? -41.700 -21.537 5.442   1.00 82.23  ? 905  LYS A C   1 
ATOM   1738  O  O   . LYS A 1 309  ? -41.180 -21.068 4.430   1.00 83.00  ? 905  LYS A O   1 
ATOM   1739  C  CB  . LYS A 1 309  ? -44.197 -21.498 5.387   1.00 79.23  ? 905  LYS A CB  1 
ATOM   1740  C  CG  . LYS A 1 309  ? -44.307 -20.538 4.208   1.00 85.17  ? 905  LYS A CG  1 
ATOM   1741  C  CD  . LYS A 1 309  ? -45.508 -19.608 4.325   1.00 65.13  ? 905  LYS A CD  1 
ATOM   1742  C  CE  . LYS A 1 309  ? -45.204 -18.408 5.206   1.00 71.76  ? 905  LYS A CE  1 
ATOM   1743  N  NZ  . LYS A 1 309  ? -46.277 -17.378 5.116   1.00 66.02  ? 905  LYS A NZ  1 
ATOM   1744  N  N   . GLU A 1 310  ? -41.207 -21.342 6.660   1.00 85.78  ? 906  GLU A N   1 
ATOM   1745  C  CA  . GLU A 1 310  ? -40.154 -20.358 6.895   1.00 97.20  ? 906  GLU A CA  1 
ATOM   1746  C  C   . GLU A 1 310  ? -38.756 -20.945 7.089   1.00 95.04  ? 906  GLU A C   1 
ATOM   1747  O  O   . GLU A 1 310  ? -37.839 -20.233 7.500   1.00 92.20  ? 906  GLU A O   1 
ATOM   1748  C  CB  . GLU A 1 310  ? -40.520 -19.495 8.104   1.00 94.01  ? 906  GLU A CB  1 
ATOM   1749  C  CG  . GLU A 1 310  ? -41.005 -20.280 9.307   1.00 110.04 ? 906  GLU A CG  1 
ATOM   1750  C  CD  . GLU A 1 310  ? -41.818 -19.426 10.259  1.00 124.63 ? 906  GLU A CD  1 
ATOM   1751  O  OE1 . GLU A 1 310  ? -42.879 -19.894 10.723  1.00 123.77 ? 906  GLU A OE1 1 
ATOM   1752  O  OE2 . GLU A 1 310  ? -41.396 -18.286 10.546  1.00 112.57 ? 906  GLU A OE2 1 
ATOM   1753  N  N   . ILE A 1 311  ? -38.581 -22.230 6.795   1.00 83.11  ? 907  ILE A N   1 
ATOM   1754  C  CA  . ILE A 1 311  ? -37.236 -22.792 6.747   1.00 90.10  ? 907  ILE A CA  1 
ATOM   1755  C  C   . ILE A 1 311  ? -36.750 -22.853 5.301   1.00 89.70  ? 907  ILE A C   1 
ATOM   1756  O  O   . ILE A 1 311  ? -37.280 -23.610 4.485   1.00 84.69  ? 907  ILE A O   1 
ATOM   1757  C  CB  . ILE A 1 311  ? -37.149 -24.196 7.389   1.00 82.27  ? 907  ILE A CB  1 
ATOM   1758  C  CG1 . ILE A 1 311  ? -38.294 -25.095 6.922   1.00 99.71  ? 907  ILE A CG1 1 
ATOM   1759  C  CG2 . ILE A 1 311  ? -37.150 -24.086 8.908   1.00 81.46  ? 907  ILE A CG2 1 
ATOM   1760  C  CD1 . ILE A 1 311  ? -38.110 -26.550 7.300   1.00 99.90  ? 907  ILE A CD1 1 
ATOM   1761  N  N   . PRO A 1 312  ? -35.743 -22.031 4.977   1.00 81.51  ? 908  PRO A N   1 
ATOM   1762  C  CA  . PRO A 1 312  ? -35.198 -21.992 3.618   1.00 69.20  ? 908  PRO A CA  1 
ATOM   1763  C  C   . PRO A 1 312  ? -34.616 -23.335 3.202   1.00 85.59  ? 908  PRO A C   1 
ATOM   1764  O  O   . PRO A 1 312  ? -33.826 -23.933 3.937   1.00 92.41  ? 908  PRO A O   1 
ATOM   1765  C  CB  . PRO A 1 312  ? -34.109 -20.920 3.703   1.00 67.91  ? 908  PRO A CB  1 
ATOM   1766  C  CG  . PRO A 1 312  ? -33.774 -20.824 5.154   1.00 58.53  ? 908  PRO A CG  1 
ATOM   1767  C  CD  . PRO A 1 312  ? -35.054 -21.092 5.876   1.00 72.34  ? 908  PRO A CD  1 
ATOM   1768  N  N   . ARG A 1 313  ? -35.019 -23.794 2.022   1.00 72.00  ? 909  ARG A N   1 
ATOM   1769  C  CA  . ARG A 1 313  ? -34.557 -25.061 1.479   1.00 78.31  ? 909  ARG A CA  1 
ATOM   1770  C  C   . ARG A 1 313  ? -34.334 -24.968 -0.029  1.00 80.87  ? 909  ARG A C   1 
ATOM   1771  O  O   . ARG A 1 313  ? -35.158 -24.417 -0.758  1.00 85.96  ? 909  ARG A O   1 
ATOM   1772  C  CB  . ARG A 1 313  ? -35.561 -26.173 1.799   1.00 74.58  ? 909  ARG A CB  1 
ATOM   1773  C  CG  . ARG A 1 313  ? -37.001 -25.802 1.467   1.00 74.58  ? 909  ARG A CG  1 
ATOM   1774  C  CD  . ARG A 1 313  ? -38.003 -26.835 1.968   1.00 86.15  ? 909  ARG A CD  1 
ATOM   1775  N  NE  . ARG A 1 313  ? -39.278 -26.214 2.323   1.00 106.22 ? 909  ARG A NE  1 
ATOM   1776  C  CZ  . ARG A 1 313  ? -40.318 -26.097 1.502   1.00 113.08 ? 909  ARG A CZ  1 
ATOM   1777  N  NH1 . ARG A 1 313  ? -40.249 -26.566 0.263   1.00 121.57 ? 909  ARG A NH1 1 
ATOM   1778  N  NH2 . ARG A 1 313  ? -41.432 -25.511 1.922   1.00 85.32  ? 909  ARG A NH2 1 
ATOM   1779  N  N   . VAL A 1 314  ? -33.206 -25.514 -0.477  1.00 70.85  ? 910  VAL A N   1 
ATOM   1780  C  CA  . VAL A 1 314  ? -32.880 -25.640 -1.895  1.00 72.21  ? 910  VAL A CA  1 
ATOM   1781  C  C   . VAL A 1 314  ? -33.798 -26.682 -2.525  1.00 76.56  ? 910  VAL A C   1 
ATOM   1782  O  O   . VAL A 1 314  ? -34.331 -27.532 -1.813  1.00 83.32  ? 910  VAL A O   1 
ATOM   1783  C  CB  . VAL A 1 314  ? -31.410 -26.039 -2.096  1.00 71.45  ? 910  VAL A CB  1 
ATOM   1784  C  CG1 . VAL A 1 314  ? -30.504 -25.025 -1.414  1.00 70.74  ? 910  VAL A CG1 1 
ATOM   1785  C  CG2 . VAL A 1 314  ? -31.151 -27.437 -1.543  1.00 91.99  ? 910  VAL A CG2 1 
ATOM   1786  N  N   . LEU A 1 315  ? -34.006 -26.633 -3.839  1.00 68.28  ? 911  LEU A N   1 
ATOM   1787  C  CA  . LEU A 1 315  ? -34.985 -27.549 -4.427  1.00 69.17  ? 911  LEU A CA  1 
ATOM   1788  C  C   . LEU A 1 315  ? -34.431 -28.571 -5.419  1.00 88.96  ? 911  LEU A C   1 
ATOM   1789  O  O   . LEU A 1 315  ? -34.302 -29.748 -5.075  1.00 109.93 ? 911  LEU A O   1 
ATOM   1790  C  CB  . LEU A 1 315  ? -36.096 -26.747 -5.094  1.00 70.15  ? 911  LEU A CB  1 
ATOM   1791  C  CG  . LEU A 1 315  ? -36.871 -25.935 -4.060  1.00 78.38  ? 911  LEU A CG  1 
ATOM   1792  C  CD1 . LEU A 1 315  ? -37.827 -24.962 -4.719  1.00 82.86  ? 911  LEU A CD1 1 
ATOM   1793  C  CD2 . LEU A 1 315  ? -37.617 -26.839 -3.074  1.00 80.25  ? 911  LEU A CD2 1 
ATOM   1794  N  N   . GLU A 1 316  ? -34.099 -28.144 -6.635  1.00 88.67  ? 912  GLU A N   1 
ATOM   1795  C  CA  . GLU A 1 316  ? -33.559 -29.091 -7.607  1.00 91.47  ? 912  GLU A CA  1 
ATOM   1796  C  C   . GLU A 1 316  ? -32.148 -28.715 -8.033  1.00 91.37  ? 912  GLU A C   1 
ATOM   1797  O  O   . GLU A 1 316  ? -31.913 -27.672 -8.646  1.00 80.04  ? 912  GLU A O   1 
ATOM   1798  C  CB  . GLU A 1 316  ? -34.477 -29.229 -8.833  1.00 84.06  ? 912  GLU A CB  1 
ATOM   1799  C  CG  . GLU A 1 316  ? -34.950 -27.946 -9.496  1.00 103.85 ? 912  GLU A CG  1 
ATOM   1800  C  CD  . GLU A 1 316  ? -35.509 -28.210 -10.884 1.00 111.02 ? 912  GLU A CD  1 
ATOM   1801  O  OE1 . GLU A 1 316  ? -34.798 -28.844 -11.693 1.00 105.26 ? 912  GLU A OE1 1 
ATOM   1802  O  OE2 . GLU A 1 316  ? -36.657 -27.802 -11.161 1.00 96.48  ? 912  GLU A OE2 1 
ATOM   1803  N  N   . GLN A 1 317  ? -31.214 -29.592 -7.686  1.00 88.28  ? 913  GLN A N   1 
ATOM   1804  C  CA  . GLN A 1 317  ? -29.802 -29.365 -7.934  1.00 91.96  ? 913  GLN A CA  1 
ATOM   1805  C  C   . GLN A 1 317  ? -29.459 -29.620 -9.391  1.00 85.65  ? 913  GLN A C   1 
ATOM   1806  O  O   . GLN A 1 317  ? -30.180 -30.332 -10.093 1.00 76.32  ? 913  GLN A O   1 
ATOM   1807  C  CB  . GLN A 1 317  ? -28.956 -30.259 -7.025  1.00 86.47  ? 913  GLN A CB  1 
ATOM   1808  C  CG  . GLN A 1 317  ? -28.539 -31.566 -7.666  1.00 98.29  ? 913  GLN A CG  1 
ATOM   1809  C  CD  . GLN A 1 317  ? -27.183 -32.008 -7.178  1.00 97.22  ? 913  GLN A CD  1 
ATOM   1810  O  OE1 . GLN A 1 317  ? -26.543 -31.299 -6.410  1.00 91.24  ? 913  GLN A OE1 1 
ATOM   1811  N  NE2 . GLN A 1 317  ? -26.734 -33.179 -7.617  1.00 89.55  ? 913  GLN A NE2 1 
ATOM   1812  N  N   . LEU A 1 318  ? -28.358 -29.037 -9.851  1.00 83.37  ? 914  LEU A N   1 
ATOM   1813  C  CA  . LEU A 1 318  ? -28.009 -29.187 -11.256 1.00 96.58  ? 914  LEU A CA  1 
ATOM   1814  C  C   . LEU A 1 318  ? -26.508 -29.320 -11.499 1.00 88.43  ? 914  LEU A C   1 
ATOM   1815  O  O   . LEU A 1 318  ? -26.085 -29.561 -12.630 1.00 87.62  ? 914  LEU A O   1 
ATOM   1816  C  CB  . LEU A 1 318  ? -28.574 -28.011 -12.065 1.00 92.20  ? 914  LEU A CB  1 
ATOM   1817  C  CG  . LEU A 1 318  ? -27.793 -26.704 -12.191 1.00 73.52  ? 914  LEU A CG  1 
ATOM   1818  C  CD1 . LEU A 1 318  ? -28.562 -25.741 -13.079 1.00 70.11  ? 914  LEU A CD1 1 
ATOM   1819  C  CD2 . LEU A 1 318  ? -27.513 -26.068 -10.841 1.00 82.45  ? 914  LEU A CD2 1 
ATOM   1820  N  N   . GLU A 1 319  ? -25.706 -29.177 -10.448 1.00 81.95  ? 915  GLU A N   1 
ATOM   1821  C  CA  . GLU A 1 319  ? -24.257 -29.305 -10.592 1.00 80.55  ? 915  GLU A CA  1 
ATOM   1822  C  C   . GLU A 1 319  ? -23.540 -29.501 -9.256  1.00 82.58  ? 915  GLU A C   1 
ATOM   1823  O  O   . GLU A 1 319  ? -23.786 -28.774 -8.293  1.00 78.41  ? 915  GLU A O   1 
ATOM   1824  C  CB  . GLU A 1 319  ? -23.688 -28.076 -11.307 1.00 90.66  ? 915  GLU A CB  1 
ATOM   1825  C  CG  . GLU A 1 319  ? -22.266 -28.250 -11.804 1.00 106.28 ? 915  GLU A CG  1 
ATOM   1826  C  CD  . GLU A 1 319  ? -21.853 -27.160 -12.772 1.00 95.18  ? 915  GLU A CD  1 
ATOM   1827  O  OE1 . GLU A 1 319  ? -20.635 -26.985 -12.984 1.00 89.62  ? 915  GLU A OE1 1 
ATOM   1828  O  OE2 . GLU A 1 319  ? -22.745 -26.481 -13.323 1.00 73.35  ? 915  GLU A OE2 1 
ATOM   1829  N  N   . ASP A 1 320  ? -22.653 -30.491 -9.213  1.00 81.93  ? 916  ASP A N   1 
ATOM   1830  C  CA  . ASP A 1 320  ? -21.844 -30.761 -8.029  1.00 89.32  ? 916  ASP A CA  1 
ATOM   1831  C  C   . ASP A 1 320  ? -20.371 -30.514 -8.332  1.00 77.75  ? 916  ASP A C   1 
ATOM   1832  O  O   . ASP A 1 320  ? -19.834 -31.032 -9.312  1.00 80.74  ? 916  ASP A O   1 
ATOM   1833  C  CB  . ASP A 1 320  ? -22.056 -32.201 -7.545  1.00 97.70  ? 916  ASP A CB  1 
ATOM   1834  C  CG  . ASP A 1 320  ? -21.390 -32.477 -6.202  1.00 103.53 ? 916  ASP A CG  1 
ATOM   1835  O  OD1 . ASP A 1 320  ? -20.155 -32.327 -6.091  1.00 96.69  ? 916  ASP A OD1 1 
ATOM   1836  O  OD2 . ASP A 1 320  ? -22.107 -32.864 -5.256  1.00 105.76 ? 916  ASP A OD2 1 
ATOM   1837  N  N   . LEU A 1 321  ? -19.721 -29.723 -7.485  1.00 74.33  ? 917  LEU A N   1 
ATOM   1838  C  CA  . LEU A 1 321  ? -18.304 -29.429 -7.649  1.00 84.66  ? 917  LEU A CA  1 
ATOM   1839  C  C   . LEU A 1 321  ? -17.514 -29.891 -6.427  1.00 90.53  ? 917  LEU A C   1 
ATOM   1840  O  O   . LEU A 1 321  ? -18.072 -30.491 -5.510  1.00 83.71  ? 917  LEU A O   1 
ATOM   1841  C  CB  . LEU A 1 321  ? -18.092 -27.933 -7.893  1.00 81.93  ? 917  LEU A CB  1 
ATOM   1842  C  CG  . LEU A 1 321  ? -18.918 -27.316 -9.026  1.00 74.47  ? 917  LEU A CG  1 
ATOM   1843  C  CD1 . LEU A 1 321  ? -18.556 -25.852 -9.221  1.00 78.61  ? 917  LEU A CD1 1 
ATOM   1844  C  CD2 . LEU A 1 321  ? -18.738 -28.092 -10.323 1.00 74.34  ? 917  LEU A CD2 1 
ATOM   1845  N  N   . ASP A 1 322  ? -16.217 -29.606 -6.417  1.00 100.91 ? 918  ASP A N   1 
ATOM   1846  C  CA  . ASP A 1 322  ? -15.334 -30.097 -5.363  1.00 97.74  ? 918  ASP A CA  1 
ATOM   1847  C  C   . ASP A 1 322  ? -15.564 -29.410 -4.019  1.00 102.38 ? 918  ASP A C   1 
ATOM   1848  O  O   . ASP A 1 322  ? -15.366 -30.016 -2.966  1.00 108.40 ? 918  ASP A O   1 
ATOM   1849  C  CB  . ASP A 1 322  ? -13.872 -29.927 -5.782  1.00 101.42 ? 918  ASP A CB  1 
ATOM   1850  C  CG  . ASP A 1 322  ? -13.491 -30.824 -6.943  1.00 121.07 ? 918  ASP A CG  1 
ATOM   1851  O  OD1 . ASP A 1 322  ? -14.404 -31.336 -7.625  1.00 120.39 ? 918  ASP A OD1 1 
ATOM   1852  O  OD2 . ASP A 1 322  ? -12.279 -31.015 -7.177  1.00 119.72 ? 918  ASP A OD2 1 
ATOM   1853  N  N   . SER A 1 323  ? -15.980 -28.149 -4.055  1.00 99.72  ? 919  SER A N   1 
ATOM   1854  C  CA  . SER A 1 323  ? -16.134 -27.371 -2.831  1.00 96.51  ? 919  SER A CA  1 
ATOM   1855  C  C   . SER A 1 323  ? -17.587 -27.051 -2.523  1.00 93.47  ? 919  SER A C   1 
ATOM   1856  O  O   . SER A 1 323  ? -17.925 -26.691 -1.396  1.00 81.44  ? 919  SER A O   1 
ATOM   1857  C  CB  . SER A 1 323  ? -15.341 -26.067 -2.924  1.00 82.32  ? 919  SER A CB  1 
ATOM   1858  O  OG  . SER A 1 323  ? -13.950 -26.318 -2.992  1.00 102.59 ? 919  SER A OG  1 
ATOM   1859  N  N   . ARG A 1 324  ? -18.449 -27.182 -3.522  1.00 85.58  ? 920  ARG A N   1 
ATOM   1860  C  CA  . ARG A 1 324  ? -19.806 -26.686 -3.377  1.00 77.73  ? 920  ARG A CA  1 
ATOM   1861  C  C   . ARG A 1 324  ? -20.812 -27.422 -4.249  1.00 71.58  ? 920  ARG A C   1 
ATOM   1862  O  O   . ARG A 1 324  ? -20.447 -28.241 -5.091  1.00 69.43  ? 920  ARG A O   1 
ATOM   1863  C  CB  . ARG A 1 324  ? -19.841 -25.201 -3.710  1.00 80.75  ? 920  ARG A CB  1 
ATOM   1864  C  CG  . ARG A 1 324  ? -19.468 -24.925 -5.148  1.00 73.16  ? 920  ARG A CG  1 
ATOM   1865  C  CD  . ARG A 1 324  ? -19.453 -23.448 -5.446  1.00 73.04  ? 920  ARG A CD  1 
ATOM   1866  N  NE  . ARG A 1 324  ? -19.472 -23.207 -6.883  1.00 78.36  ? 920  ARG A NE  1 
ATOM   1867  C  CZ  . ARG A 1 324  ? -19.463 -22.001 -7.439  1.00 92.48  ? 920  ARG A CZ  1 
ATOM   1868  N  NH1 . ARG A 1 324  ? -19.430 -20.917 -6.676  1.00 91.48  ? 920  ARG A NH1 1 
ATOM   1869  N  NH2 . ARG A 1 324  ? -19.486 -21.879 -8.759  1.00 99.09  ? 920  ARG A NH2 1 
ATOM   1870  N  N   . VAL A 1 325  ? -22.085 -27.108 -4.039  1.00 71.50  ? 921  VAL A N   1 
ATOM   1871  C  CA  . VAL A 1 325  ? -23.178 -27.755 -4.749  1.00 74.37  ? 921  VAL A CA  1 
ATOM   1872  C  C   . VAL A 1 325  ? -24.150 -26.712 -5.293  1.00 76.56  ? 921  VAL A C   1 
ATOM   1873  O  O   . VAL A 1 325  ? -24.626 -25.855 -4.546  1.00 78.07  ? 921  VAL A O   1 
ATOM   1874  C  CB  . VAL A 1 325  ? -23.929 -28.731 -3.827  1.00 75.72  ? 921  VAL A CB  1 
ATOM   1875  C  CG1 . VAL A 1 325  ? -25.032 -29.436 -4.581  1.00 76.01  ? 921  VAL A CG1 1 
ATOM   1876  C  CG2 . VAL A 1 325  ? -22.960 -29.734 -3.207  1.00 85.80  ? 921  VAL A CG2 1 
ATOM   1877  N  N   . LEU A 1 326  ? -24.445 -26.797 -6.588  1.00 71.25  ? 922  LEU A N   1 
ATOM   1878  C  CA  . LEU A 1 326  ? -25.293 -25.815 -7.259  1.00 69.61  ? 922  LEU A CA  1 
ATOM   1879  C  C   . LEU A 1 326  ? -26.730 -26.299 -7.473  1.00 77.71  ? 922  LEU A C   1 
ATOM   1880  O  O   . LEU A 1 326  ? -26.974 -27.468 -7.792  1.00 80.02  ? 922  LEU A O   1 
ATOM   1881  C  CB  . LEU A 1 326  ? -24.691 -25.431 -8.613  1.00 74.19  ? 922  LEU A CB  1 
ATOM   1882  C  CG  . LEU A 1 326  ? -23.231 -24.986 -8.731  1.00 77.17  ? 922  LEU A CG  1 
ATOM   1883  C  CD1 . LEU A 1 326  ? -22.982 -24.429 -10.124 1.00 73.30  ? 922  LEU A CD1 1 
ATOM   1884  C  CD2 . LEU A 1 326  ? -22.866 -23.961 -7.680  1.00 68.48  ? 922  LEU A CD2 1 
ATOM   1885  N  N   . TYR A 1 327  ? -27.670 -25.369 -7.330  1.00 71.83  ? 923  TYR A N   1 
ATOM   1886  C  CA  . TYR A 1 327  ? -29.093 -25.649 -7.473  1.00 74.10  ? 923  TYR A CA  1 
ATOM   1887  C  C   . TYR A 1 327  ? -29.747 -24.669 -8.447  1.00 68.95  ? 923  TYR A C   1 
ATOM   1888  O  O   . TYR A 1 327  ? -29.206 -23.597 -8.716  1.00 56.69  ? 923  TYR A O   1 
ATOM   1889  C  CB  . TYR A 1 327  ? -29.782 -25.583 -6.109  1.00 75.19  ? 923  TYR A CB  1 
ATOM   1890  C  CG  . TYR A 1 327  ? -29.142 -26.478 -5.074  1.00 80.83  ? 923  TYR A CG  1 
ATOM   1891  C  CD1 . TYR A 1 327  ? -28.102 -26.020 -4.275  1.00 80.69  ? 923  TYR A CD1 1 
ATOM   1892  C  CD2 . TYR A 1 327  ? -29.577 -27.780 -4.894  1.00 72.04  ? 923  TYR A CD2 1 
ATOM   1893  C  CE1 . TYR A 1 327  ? -27.513 -26.840 -3.332  1.00 74.08  ? 923  TYR A CE1 1 
ATOM   1894  C  CE2 . TYR A 1 327  ? -28.992 -28.609 -3.959  1.00 70.75  ? 923  TYR A CE2 1 
ATOM   1895  C  CZ  . TYR A 1 327  ? -27.963 -28.134 -3.179  1.00 79.99  ? 923  TYR A CZ  1 
ATOM   1896  O  OH  . TYR A 1 327  ? -27.383 -28.958 -2.242  1.00 95.76  ? 923  TYR A OH  1 
ATOM   1897  N  N   . TYR A 1 328  ? -30.909 -25.043 -8.977  1.00 67.48  ? 924  TYR A N   1 
ATOM   1898  C  CA  . TYR A 1 328  ? -31.625 -24.184 -9.915  1.00 66.62  ? 924  TYR A CA  1 
ATOM   1899  C  C   . TYR A 1 328  ? -32.589 -23.246 -9.200  1.00 68.48  ? 924  TYR A C   1 
ATOM   1900  O  O   . TYR A 1 328  ? -32.779 -22.103 -9.612  1.00 67.87  ? 924  TYR A O   1 
ATOM   1901  C  CB  . TYR A 1 328  ? -32.392 -25.020 -10.941 1.00 73.45  ? 924  TYR A CB  1 
ATOM   1902  C  CG  . TYR A 1 328  ? -33.365 -24.210 -11.772 1.00 76.78  ? 924  TYR A CG  1 
ATOM   1903  C  CD1 . TYR A 1 328  ? -32.913 -23.365 -12.777 1.00 71.23  ? 924  TYR A CD1 1 
ATOM   1904  C  CD2 . TYR A 1 328  ? -34.734 -24.289 -11.549 1.00 85.56  ? 924  TYR A CD2 1 
ATOM   1905  C  CE1 . TYR A 1 328  ? -33.796 -22.622 -13.537 1.00 67.55  ? 924  TYR A CE1 1 
ATOM   1906  C  CE2 . TYR A 1 328  ? -35.625 -23.551 -12.304 1.00 79.28  ? 924  TYR A CE2 1 
ATOM   1907  C  CZ  . TYR A 1 328  ? -35.151 -22.719 -13.296 1.00 79.03  ? 924  TYR A CZ  1 
ATOM   1908  O  OH  . TYR A 1 328  ? -36.034 -21.982 -14.050 1.00 73.07  ? 924  TYR A OH  1 
ATOM   1909  N  N   . SER A 1 329  ? -33.201 -23.735 -8.128  1.00 63.62  ? 925  SER A N   1 
ATOM   1910  C  CA  . SER A 1 329  ? -34.195 -22.949 -7.415  1.00 60.96  ? 925  SER A CA  1 
ATOM   1911  C  C   . SER A 1 329  ? -34.145 -23.168 -5.908  1.00 58.98  ? 925  SER A C   1 
ATOM   1912  O  O   . SER A 1 329  ? -34.048 -24.298 -5.433  1.00 71.52  ? 925  SER A O   1 
ATOM   1913  C  CB  . SER A 1 329  ? -35.595 -23.270 -7.944  1.00 59.34  ? 925  SER A CB  1 
ATOM   1914  O  OG  . SER A 1 329  ? -35.793 -24.668 -8.050  1.00 70.68  ? 925  SER A OG  1 
ATOM   1915  N  N   . ALA A 1 330  ? -34.201 -22.069 -5.164  1.00 57.30  ? 926  ALA A N   1 
ATOM   1916  C  CA  . ALA A 1 330  ? -34.320 -22.122 -3.714  1.00 67.97  ? 926  ALA A CA  1 
ATOM   1917  C  C   . ALA A 1 330  ? -35.658 -21.514 -3.328  1.00 73.72  ? 926  ALA A C   1 
ATOM   1918  O  O   . ALA A 1 330  ? -36.252 -20.792 -4.118  1.00 66.03  ? 926  ALA A O   1 
ATOM   1919  C  CB  . ALA A 1 330  ? -33.173 -21.383 -3.046  1.00 64.96  ? 926  ALA A CB  1 
ATOM   1920  N  N   . THR A 1 331  ? -36.143 -21.805 -2.127  1.00 72.81  ? 927  THR A N   1 
ATOM   1921  C  CA  . THR A 1 331  ? -37.421 -21.250 -1.687  1.00 64.79  ? 927  THR A CA  1 
ATOM   1922  C  C   . THR A 1 331  ? -37.349 -20.761 -0.249  1.00 59.45  ? 927  THR A C   1 
ATOM   1923  O  O   . THR A 1 331  ? -36.692 -21.375 0.594   1.00 61.57  ? 927  THR A O   1 
ATOM   1924  C  CB  . THR A 1 331  ? -38.563 -22.276 -1.811  1.00 58.89  ? 927  THR A CB  1 
ATOM   1925  O  OG1 . THR A 1 331  ? -39.750 -21.747 -1.206  1.00 57.73  ? 927  THR A OG1 1 
ATOM   1926  C  CG2 . THR A 1 331  ? -38.194 -23.571 -1.118  1.00 67.21  ? 927  THR A CG2 1 
ATOM   1927  N  N   . LYS A 1 332  ? -38.024 -19.652 0.030   1.00 59.07  ? 928  LYS A N   1 
ATOM   1928  C  CA  . LYS A 1 332  ? -38.035 -19.108 1.384   1.00 62.96  ? 928  LYS A CA  1 
ATOM   1929  C  C   . LYS A 1 332  ? -39.296 -18.302 1.619   1.00 70.47  ? 928  LYS A C   1 
ATOM   1930  O  O   . LYS A 1 332  ? -39.749 -17.605 0.722   1.00 64.80  ? 928  LYS A O   1 
ATOM   1931  C  CB  . LYS A 1 332  ? -36.801 -18.239 1.630   1.00 53.76  ? 928  LYS A CB  1 
ATOM   1932  C  CG  . LYS A 1 332  ? -36.710 -17.692 3.042   1.00 68.52  ? 928  LYS A CG  1 
ATOM   1933  C  CD  . LYS A 1 332  ? -35.456 -16.856 3.225   1.00 56.34  ? 928  LYS A CD  1 
ATOM   1934  C  CE  . LYS A 1 332  ? -35.429 -15.679 2.260   1.00 47.60  ? 928  LYS A CE  1 
ATOM   1935  N  NZ  . LYS A 1 332  ? -34.218 -14.829 2.445   1.00 57.12  ? 928  LYS A NZ  1 
ATOM   1936  N  N   . ASN A 1 333  ? -39.858 -18.406 2.821   1.00 69.12  ? 929  ASN A N   1 
ATOM   1937  C  CA  . ASN A 1 333  ? -41.058 -17.656 3.190   1.00 52.80  ? 929  ASN A CA  1 
ATOM   1938  C  C   . ASN A 1 333  ? -42.188 -17.757 2.167   1.00 62.90  ? 929  ASN A C   1 
ATOM   1939  O  O   . ASN A 1 333  ? -42.934 -16.800 1.958   1.00 63.37  ? 929  ASN A O   1 
ATOM   1940  C  CB  . ASN A 1 333  ? -40.704 -16.185 3.421   1.00 56.69  ? 929  ASN A CB  1 
ATOM   1941  C  CG  . ASN A 1 333  ? -40.694 -15.813 4.890   1.00 93.61  ? 929  ASN A CG  1 
ATOM   1942  O  OD1 . ASN A 1 333  ? -41.674 -16.032 5.602   1.00 83.42  ? 929  ASN A OD1 1 
ATOM   1943  N  ND2 . ASN A 1 333  ? -39.580 -15.257 5.354   1.00 70.93  ? 929  ASN A ND2 1 
ATOM   1944  N  N   . GLY A 1 334  ? -42.300 -18.914 1.526   1.00 58.17  ? 930  GLY A N   1 
ATOM   1945  C  CA  . GLY A 1 334  ? -43.362 -19.151 0.568   1.00 52.03  ? 930  GLY A CA  1 
ATOM   1946  C  C   . GLY A 1 334  ? -43.023 -18.732 -0.849  1.00 60.83  ? 930  GLY A C   1 
ATOM   1947  O  O   . GLY A 1 334  ? -43.623 -19.227 -1.805  1.00 51.82  ? 930  GLY A O   1 
ATOM   1948  N  N   . ILE A 1 335  ? -42.067 -17.821 -1.000  1.00 61.03  ? 931  ILE A N   1 
ATOM   1949  C  CA  . ILE A 1 335  ? -41.703 -17.362 -2.335  1.00 63.11  ? 931  ILE A CA  1 
ATOM   1950  C  C   . ILE A 1 335  ? -40.545 -18.165 -2.930  1.00 57.58  ? 931  ILE A C   1 
ATOM   1951  O  O   . ILE A 1 335  ? -39.619 -18.596 -2.224  1.00 52.77  ? 931  ILE A O   1 
ATOM   1952  C  CB  . ILE A 1 335  ? -41.370 -15.855 -2.345  1.00 52.31  ? 931  ILE A CB  1 
ATOM   1953  C  CG1 . ILE A 1 335  ? -40.330 -15.503 -1.285  1.00 59.47  ? 931  ILE A CG1 1 
ATOM   1954  C  CG2 . ILE A 1 335  ? -42.635 -15.051 -2.115  1.00 28.46  ? 931  ILE A CG2 1 
ATOM   1955  C  CD1 . ILE A 1 335  ? -40.301 -14.032 -0.904  1.00 75.39  ? 931  ILE A CD1 1 
ATOM   1956  N  N   . LEU A 1 336  ? -40.638 -18.366 -4.242  1.00 51.63  ? 932  LEU A N   1 
ATOM   1957  C  CA  . LEU A 1 336  ? -39.725 -19.219 -4.992  1.00 54.35  ? 932  LEU A CA  1 
ATOM   1958  C  C   . LEU A 1 336  ? -38.734 -18.402 -5.814  1.00 60.21  ? 932  LEU A C   1 
ATOM   1959  O  O   . LEU A 1 336  ? -39.118 -17.494 -6.552  1.00 53.74  ? 932  LEU A O   1 
ATOM   1960  C  CB  . LEU A 1 336  ? -40.517 -20.158 -5.907  1.00 46.98  ? 932  LEU A CB  1 
ATOM   1961  C  CG  . LEU A 1 336  ? -39.745 -20.886 -7.006  1.00 51.14  ? 932  LEU A CG  1 
ATOM   1962  C  CD1 . LEU A 1 336  ? -38.721 -21.815 -6.385  1.00 64.45  ? 932  LEU A CD1 1 
ATOM   1963  C  CD2 . LEU A 1 336  ? -40.687 -21.657 -7.924  1.00 40.67  ? 932  LEU A CD2 1 
ATOM   1964  N  N   . TYR A 1 337  ? -37.457 -18.742 -5.690  1.00 54.62  ? 933  TYR A N   1 
ATOM   1965  C  CA  . TYR A 1 337  ? -36.390 -18.057 -6.407  1.00 51.89  ? 933  TYR A CA  1 
ATOM   1966  C  C   . TYR A 1 337  ? -35.695 -18.994 -7.384  1.00 56.47  ? 933  TYR A C   1 
ATOM   1967  O  O   . TYR A 1 337  ? -35.017 -19.935 -6.971  1.00 60.65  ? 933  TYR A O   1 
ATOM   1968  C  CB  . TYR A 1 337  ? -35.358 -17.495 -5.430  1.00 55.49  ? 933  TYR A CB  1 
ATOM   1969  C  CG  . TYR A 1 337  ? -35.888 -16.443 -4.490  1.00 45.35  ? 933  TYR A CG  1 
ATOM   1970  C  CD1 . TYR A 1 337  ? -36.587 -16.796 -3.344  1.00 48.04  ? 933  TYR A CD1 1 
ATOM   1971  C  CD2 . TYR A 1 337  ? -35.678 -15.096 -4.742  1.00 58.22  ? 933  TYR A CD2 1 
ATOM   1972  C  CE1 . TYR A 1 337  ? -37.068 -15.836 -2.481  1.00 56.43  ? 933  TYR A CE1 1 
ATOM   1973  C  CE2 . TYR A 1 337  ? -36.153 -14.130 -3.885  1.00 50.35  ? 933  TYR A CE2 1 
ATOM   1974  C  CZ  . TYR A 1 337  ? -36.848 -14.504 -2.757  1.00 46.33  ? 933  TYR A CZ  1 
ATOM   1975  O  OH  . TYR A 1 337  ? -37.322 -13.541 -1.902  1.00 48.46  ? 933  TYR A OH  1 
ATOM   1976  N  N   . ARG A 1 338  ? -35.859 -18.737 -8.677  1.00 55.21  ? 934  ARG A N   1 
ATOM   1977  C  CA  . ARG A 1 338  ? -35.136 -19.489 -9.695  1.00 50.37  ? 934  ARG A CA  1 
ATOM   1978  C  C   . ARG A 1 338  ? -33.850 -18.756 -10.041 1.00 51.45  ? 934  ARG A C   1 
ATOM   1979  O  O   . ARG A 1 338  ? -33.645 -17.619 -9.617  1.00 54.28  ? 934  ARG A O   1 
ATOM   1980  C  CB  . ARG A 1 338  ? -35.989 -19.677 -10.949 1.00 43.26  ? 934  ARG A CB  1 
ATOM   1981  C  CG  . ARG A 1 338  ? -37.306 -20.391 -10.715 1.00 41.86  ? 934  ARG A CG  1 
ATOM   1982  C  CD  . ARG A 1 338  ? -38.355 -19.889 -11.691 1.00 68.57  ? 934  ARG A CD  1 
ATOM   1983  N  NE  . ARG A 1 338  ? -39.572 -20.695 -11.676 1.00 94.18  ? 934  ARG A NE  1 
ATOM   1984  C  CZ  . ARG A 1 338  ? -40.695 -20.356 -12.302 1.00 89.86  ? 934  ARG A CZ  1 
ATOM   1985  N  NH1 . ARG A 1 338  ? -41.757 -21.147 -12.243 1.00 62.53  ? 934  ARG A NH1 1 
ATOM   1986  N  NH2 . ARG A 1 338  ? -40.756 -19.220 -12.984 1.00 88.42  ? 934  ARG A NH2 1 
ATOM   1987  N  N   . VAL A 1 339  ? -32.980 -19.409 -10.803 1.00 59.21  ? 935  VAL A N   1 
ATOM   1988  C  CA  . VAL A 1 339  ? -31.782 -18.749 -11.303 1.00 67.33  ? 935  VAL A CA  1 
ATOM   1989  C  C   . VAL A 1 339  ? -32.175 -17.753 -12.387 1.00 62.20  ? 935  VAL A C   1 
ATOM   1990  O  O   . VAL A 1 339  ? -32.825 -18.116 -13.367 1.00 58.98  ? 935  VAL A O   1 
ATOM   1991  C  CB  . VAL A 1 339  ? -30.760 -19.756 -11.866 1.00 55.98  ? 935  VAL A CB  1 
ATOM   1992  C  CG1 . VAL A 1 339  ? -29.644 -19.027 -12.598 1.00 40.93  ? 935  VAL A CG1 1 
ATOM   1993  C  CG2 . VAL A 1 339  ? -30.193 -20.613 -10.750 1.00 54.56  ? 935  VAL A CG2 1 
ATOM   1994  N  N   . GLY A 1 340  ? -31.785 -16.495 -12.205 1.00 56.47  ? 936  GLY A N   1 
ATOM   1995  C  CA  . GLY A 1 340  ? -32.112 -15.453 -13.161 1.00 48.91  ? 936  GLY A CA  1 
ATOM   1996  C  C   . GLY A 1 340  ? -33.210 -14.518 -12.689 1.00 55.80  ? 936  GLY A C   1 
ATOM   1997  O  O   . GLY A 1 340  ? -33.504 -13.517 -13.343 1.00 55.05  ? 936  GLY A O   1 
ATOM   1998  N  N   . ASP A 1 341  ? -33.821 -14.843 -11.554 1.00 43.67  ? 937  ASP A N   1 
ATOM   1999  C  CA  . ASP A 1 341  ? -34.839 -13.981 -10.965 1.00 46.12  ? 937  ASP A CA  1 
ATOM   2000  C  C   . ASP A 1 341  ? -34.192 -12.805 -10.243 1.00 49.04  ? 937  ASP A C   1 
ATOM   2001  O  O   . ASP A 1 341  ? -32.996 -12.830 -9.950  1.00 40.02  ? 937  ASP A O   1 
ATOM   2002  C  CB  . ASP A 1 341  ? -35.728 -14.771 -10.002 1.00 49.96  ? 937  ASP A CB  1 
ATOM   2003  C  CG  . ASP A 1 341  ? -36.615 -15.774 -10.716 1.00 58.20  ? 937  ASP A CG  1 
ATOM   2004  O  OD1 . ASP A 1 341  ? -36.854 -15.600 -11.929 1.00 54.91  ? 937  ASP A OD1 1 
ATOM   2005  O  OD2 . ASP A 1 341  ? -37.078 -16.731 -10.062 1.00 66.16  ? 937  ASP A OD2 1 
ATOM   2006  N  N   . GLY A 1 342  ? -34.981 -11.773 -9.961  1.00 54.15  ? 938  GLY A N   1 
ATOM   2007  C  CA  . GLY A 1 342  ? -34.462 -10.601 -9.282  1.00 39.02  ? 938  GLY A CA  1 
ATOM   2008  C  C   . GLY A 1 342  ? -34.527 -10.747 -7.778  1.00 42.41  ? 938  GLY A C   1 
ATOM   2009  O  O   . GLY A 1 342  ? -35.428 -11.394 -7.241  1.00 38.43  ? 938  GLY A O   1 
ATOM   2010  N  N   . VAL A 1 343  ? -33.570 -10.135 -7.093  1.00 35.88  ? 939  VAL A N   1 
ATOM   2011  C  CA  . VAL A 1 343  ? -33.467 -10.263 -5.649  1.00 39.48  ? 939  VAL A CA  1 
ATOM   2012  C  C   . VAL A 1 343  ? -33.244 -8.910  -4.971  1.00 46.04  ? 939  VAL A C   1 
ATOM   2013  O  O   . VAL A 1 343  ? -32.391 -8.108  -5.385  1.00 43.35  ? 939  VAL A O   1 
ATOM   2014  C  CB  . VAL A 1 343  ? -32.336 -11.254 -5.265  1.00 38.23  ? 939  VAL A CB  1 
ATOM   2015  C  CG1 . VAL A 1 343  ? -31.520 -10.750 -4.091  1.00 38.00  ? 939  VAL A CG1 1 
ATOM   2016  C  CG2 . VAL A 1 343  ? -32.922 -12.620 -4.951  1.00 40.70  ? 939  VAL A CG2 1 
ATOM   2017  N  N   . TYR A 1 344  ? -34.058 -8.670  -3.946  1.00 38.18  ? 940  TYR A N   1 
ATOM   2018  C  CA  . TYR A 1 344  ? -33.917 -7.529  -3.056  1.00 35.22  ? 940  TYR A CA  1 
ATOM   2019  C  C   . TYR A 1 344  ? -32.860 -7.826  -2.004  1.00 42.04  ? 940  TYR A C   1 
ATOM   2020  O  O   . TYR A 1 344  ? -32.797 -8.933  -1.470  1.00 45.92  ? 940  TYR A O   1 
ATOM   2021  C  CB  . TYR A 1 344  ? -35.245 -7.203  -2.370  1.00 36.50  ? 940  TYR A CB  1 
ATOM   2022  C  CG  . TYR A 1 344  ? -36.252 -6.489  -3.239  1.00 45.15  ? 940  TYR A CG  1 
ATOM   2023  C  CD1 . TYR A 1 344  ? -35.847 -5.595  -4.220  1.00 39.07  ? 940  TYR A CD1 1 
ATOM   2024  C  CD2 . TYR A 1 344  ? -37.614 -6.704  -3.070  1.00 40.26  ? 940  TYR A CD2 1 
ATOM   2025  C  CE1 . TYR A 1 344  ? -36.770 -4.937  -5.012  1.00 40.45  ? 940  TYR A CE1 1 
ATOM   2026  C  CE2 . TYR A 1 344  ? -38.543 -6.053  -3.855  1.00 25.63  ? 940  TYR A CE2 1 
ATOM   2027  C  CZ  . TYR A 1 344  ? -38.117 -5.171  -4.824  1.00 32.49  ? 940  TYR A CZ  1 
ATOM   2028  O  OH  . TYR A 1 344  ? -39.043 -4.522  -5.607  1.00 35.90  ? 940  TYR A OH  1 
ATOM   2029  N  N   . LEU A 1 345  ? -32.036 -6.832  -1.699  1.00 45.05  ? 941  LEU A N   1 
ATOM   2030  C  CA  . LEU A 1 345  ? -30.996 -6.985  -0.694  1.00 42.51  ? 941  LEU A CA  1 
ATOM   2031  C  C   . LEU A 1 345  ? -30.898 -5.735  0.162   1.00 38.59  ? 941  LEU A C   1 
ATOM   2032  O  O   . LEU A 1 345  ? -31.266 -4.650  -0.276  1.00 36.84  ? 941  LEU A O   1 
ATOM   2033  C  CB  . LEU A 1 345  ? -29.648 -7.280  -1.355  1.00 45.90  ? 941  LEU A CB  1 
ATOM   2034  C  CG  . LEU A 1 345  ? -29.516 -8.643  -2.035  1.00 38.58  ? 941  LEU A CG  1 
ATOM   2035  C  CD1 . LEU A 1 345  ? -28.222 -8.736  -2.821  1.00 47.41  ? 941  LEU A CD1 1 
ATOM   2036  C  CD2 . LEU A 1 345  ? -29.602 -9.764  -1.013  1.00 48.21  ? 941  LEU A CD2 1 
ATOM   2037  N  N   . PRO A 1 346  ? -30.419 -5.883  1.401   1.00 47.11  ? 942  PRO A N   1 
ATOM   2038  C  CA  . PRO A 1 346  ? -30.159 -4.700  2.222   1.00 39.88  ? 942  PRO A CA  1 
ATOM   2039  C  C   . PRO A 1 346  ? -28.967 -3.935  1.667   1.00 40.80  ? 942  PRO A C   1 
ATOM   2040  O  O   . PRO A 1 346  ? -28.145 -4.532  0.975   1.00 50.17  ? 942  PRO A O   1 
ATOM   2041  C  CB  . PRO A 1 346  ? -29.850 -5.287  3.606   1.00 47.62  ? 942  PRO A CB  1 
ATOM   2042  C  CG  . PRO A 1 346  ? -30.393 -6.683  3.568   1.00 42.13  ? 942  PRO A CG  1 
ATOM   2043  C  CD  . PRO A 1 346  ? -30.218 -7.129  2.156   1.00 49.27  ? 942  PRO A CD  1 
ATOM   2044  N  N   . PRO A 1 347  ? -28.870 -2.631  1.960   1.00 44.74  ? 943  PRO A N   1 
ATOM   2045  C  CA  . PRO A 1 347  ? -27.714 -1.846  1.513   1.00 48.50  ? 943  PRO A CA  1 
ATOM   2046  C  C   . PRO A 1 347  ? -26.400 -2.392  2.068   1.00 56.12  ? 943  PRO A C   1 
ATOM   2047  O  O   . PRO A 1 347  ? -25.326 -2.072  1.556   1.00 53.59  ? 943  PRO A O   1 
ATOM   2048  C  CB  . PRO A 1 347  ? -28.004 -0.448  2.067   1.00 41.27  ? 943  PRO A CB  1 
ATOM   2049  C  CG  . PRO A 1 347  ? -29.485 -0.405  2.220   1.00 38.07  ? 943  PRO A CG  1 
ATOM   2050  C  CD  . PRO A 1 347  ? -29.882 -1.793  2.626   1.00 45.20  ? 943  PRO A CD  1 
ATOM   2051  N  N   . GLU A 1 348  ? -26.497 -3.209  3.111   1.00 58.82  ? 944  GLU A N   1 
ATOM   2052  C  CA  . GLU A 1 348  ? -25.330 -3.819  3.737   1.00 60.06  ? 944  GLU A CA  1 
ATOM   2053  C  C   . GLU A 1 348  ? -24.798 -4.998  2.927   1.00 53.99  ? 944  GLU A C   1 
ATOM   2054  O  O   . GLU A 1 348  ? -23.653 -5.411  3.108   1.00 52.01  ? 944  GLU A O   1 
ATOM   2055  C  CB  . GLU A 1 348  ? -25.672 -4.277  5.159   1.00 61.71  ? 944  GLU A CB  1 
ATOM   2056  C  CG  . GLU A 1 348  ? -25.976 -3.148  6.138   1.00 88.33  ? 944  GLU A CG  1 
ATOM   2057  C  CD  . GLU A 1 348  ? -27.346 -2.526  5.929   1.00 73.37  ? 944  GLU A CD  1 
ATOM   2058  O  OE1 . GLU A 1 348  ? -28.287 -3.259  5.559   1.00 70.80  ? 944  GLU A OE1 1 
ATOM   2059  O  OE2 . GLU A 1 348  ? -27.479 -1.301  6.133   1.00 58.48  ? 944  GLU A OE2 1 
ATOM   2060  N  N   . ALA A 1 349  ? -25.630 -5.528  2.033   1.00 50.83  ? 945  ALA A N   1 
ATOM   2061  C  CA  . ALA A 1 349  ? -25.302 -6.742  1.287   1.00 48.12  ? 945  ALA A CA  1 
ATOM   2062  C  C   . ALA A 1 349  ? -24.021 -6.607  0.470   1.00 51.19  ? 945  ALA A C   1 
ATOM   2063  O  O   . ALA A 1 349  ? -23.114 -7.430  0.599   1.00 66.73  ? 945  ALA A O   1 
ATOM   2064  C  CB  . ALA A 1 349  ? -26.456 -7.129  0.381   1.00 45.90  ? 945  ALA A CB  1 
ATOM   2065  N  N   . PHE A 1 350  ? -23.942 -5.580  -0.371  1.00 44.55  ? 946  PHE A N   1 
ATOM   2066  C  CA  . PHE A 1 350  ? -22.728 -5.353  -1.147  1.00 46.25  ? 946  PHE A CA  1 
ATOM   2067  C  C   . PHE A 1 350  ? -22.491 -3.885  -1.486  1.00 54.20  ? 946  PHE A C   1 
ATOM   2068  O  O   . PHE A 1 350  ? -23.382 -3.043  -1.357  1.00 51.11  ? 946  PHE A O   1 
ATOM   2069  C  CB  . PHE A 1 350  ? -22.734 -6.190  -2.435  1.00 50.55  ? 946  PHE A CB  1 
ATOM   2070  C  CG  . PHE A 1 350  ? -23.878 -5.894  -3.368  1.00 46.31  ? 946  PHE A CG  1 
ATOM   2071  C  CD1 . PHE A 1 350  ? -23.849 -4.788  -4.202  1.00 42.90  ? 946  PHE A CD1 1 
ATOM   2072  C  CD2 . PHE A 1 350  ? -24.967 -6.745  -3.433  1.00 47.54  ? 946  PHE A CD2 1 
ATOM   2073  C  CE1 . PHE A 1 350  ? -24.894 -4.526  -5.066  1.00 39.36  ? 946  PHE A CE1 1 
ATOM   2074  C  CE2 . PHE A 1 350  ? -26.012 -6.489  -4.299  1.00 43.50  ? 946  PHE A CE2 1 
ATOM   2075  C  CZ  . PHE A 1 350  ? -25.976 -5.378  -5.115  1.00 47.66  ? 946  PHE A CZ  1 
ATOM   2076  N  N   . THR A 1 351  ? -21.267 -3.596  -1.912  1.00 56.01  ? 947  THR A N   1 
ATOM   2077  C  CA  . THR A 1 351  ? -20.866 -2.249  -2.284  1.00 56.63  ? 947  THR A CA  1 
ATOM   2078  C  C   . THR A 1 351  ? -20.522 -2.205  -3.765  1.00 49.85  ? 947  THR A C   1 
ATOM   2079  O  O   . THR A 1 351  ? -20.207 -3.230  -4.368  1.00 50.51  ? 947  THR A O   1 
ATOM   2080  C  CB  . THR A 1 351  ? -19.647 -1.771  -1.473  1.00 48.72  ? 947  THR A CB  1 
ATOM   2081  O  OG1 . THR A 1 351  ? -18.507 -2.580  -1.794  1.00 54.71  ? 947  THR A OG1 1 
ATOM   2082  C  CG2 . THR A 1 351  ? -19.925 -1.863  0.018   1.00 47.14  ? 947  THR A CG2 1 
ATOM   2083  N  N   . PHE A 1 352  ? -20.598 -1.015  -4.349  1.00 53.96  ? 948  PHE A N   1 
ATOM   2084  C  CA  . PHE A 1 352  ? -20.270 -0.830  -5.756  1.00 50.58  ? 948  PHE A CA  1 
ATOM   2085  C  C   . PHE A 1 352  ? -18.806 -0.441  -5.906  1.00 50.68  ? 948  PHE A C   1 
ATOM   2086  O  O   . PHE A 1 352  ? -18.268 0.300   -5.083  1.00 67.78  ? 948  PHE A O   1 
ATOM   2087  C  CB  . PHE A 1 352  ? -21.170 0.235   -6.386  1.00 45.28  ? 948  PHE A CB  1 
ATOM   2088  C  CG  . PHE A 1 352  ? -22.636 -0.015  -6.185  1.00 48.16  ? 948  PHE A CG  1 
ATOM   2089  C  CD1 . PHE A 1 352  ? -23.318 -0.909  -6.995  1.00 45.60  ? 948  PHE A CD1 1 
ATOM   2090  C  CD2 . PHE A 1 352  ? -23.333 0.643   -5.186  1.00 35.56  ? 948  PHE A CD2 1 
ATOM   2091  C  CE1 . PHE A 1 352  ? -24.668 -1.141  -6.810  1.00 38.33  ? 948  PHE A CE1 1 
ATOM   2092  C  CE2 . PHE A 1 352  ? -24.682 0.414   -4.997  1.00 30.10  ? 948  PHE A CE2 1 
ATOM   2093  C  CZ  . PHE A 1 352  ? -25.350 -0.478  -5.811  1.00 32.66  ? 948  PHE A CZ  1 
ATOM   2094  N  N   . ASN A 1 353  ? -18.165 -0.945  -6.957  1.00 51.83  ? 949  ASN A N   1 
ATOM   2095  C  CA  . ASN A 1 353  ? -16.748 -0.682  -7.201  1.00 63.98  ? 949  ASN A CA  1 
ATOM   2096  C  C   . ASN A 1 353  ? -16.436 0.795   -7.422  1.00 58.32  ? 949  ASN A C   1 
ATOM   2097  O  O   . ASN A 1 353  ? -15.276 1.204   -7.385  1.00 70.31  ? 949  ASN A O   1 
ATOM   2098  C  CB  . ASN A 1 353  ? -16.260 -1.488  -8.406  1.00 50.59  ? 949  ASN A CB  1 
ATOM   2099  C  CG  . ASN A 1 353  ? -16.381 -2.982  -8.195  1.00 61.16  ? 949  ASN A CG  1 
ATOM   2100  O  OD1 . ASN A 1 353  ? -16.608 -3.446  -7.078  1.00 58.01  ? 949  ASN A OD1 1 
ATOM   2101  N  ND2 . ASN A 1 353  ? -16.221 -3.746  -9.270  1.00 54.09  ? 949  ASN A ND2 1 
ATOM   2102  N  N   . ILE A 1 354  ? -17.477 1.585   -7.659  1.00 62.65  ? 950  ILE A N   1 
ATOM   2103  C  CA  . ILE A 1 354  ? -17.330 3.021   -7.851  1.00 69.57  ? 950  ILE A CA  1 
ATOM   2104  C  C   . ILE A 1 354  ? -16.723 3.685   -6.617  1.00 81.85  ? 950  ILE A C   1 
ATOM   2105  O  O   . ILE A 1 354  ? -17.088 3.370   -5.482  1.00 70.99  ? 950  ILE A O   1 
ATOM   2106  C  CB  . ILE A 1 354  ? -18.694 3.675   -8.193  1.00 55.89  ? 950  ILE A CB  1 
ATOM   2107  C  CG1 . ILE A 1 354  ? -18.784 3.939   -9.694  1.00 55.97  ? 950  ILE A CG1 1 
ATOM   2108  C  CG2 . ILE A 1 354  ? -18.898 4.984   -7.442  1.00 61.79  ? 950  ILE A CG2 1 
ATOM   2109  C  CD1 . ILE A 1 354  ? -17.713 4.877   -10.201 1.00 47.01  ? 950  ILE A CD1 1 
ATOM   2110  N  N   . LYS A 1 355  ? -15.775 4.590   -6.850  1.00 80.41  ? 951  LYS A N   1 
ATOM   2111  C  CA  . LYS A 1 355  ? -15.206 5.386   -5.772  1.00 90.49  ? 951  LYS A CA  1 
ATOM   2112  C  C   . LYS A 1 355  ? -16.259 6.369   -5.276  1.00 91.33  ? 951  LYS A C   1 
ATOM   2113  O  O   . LYS A 1 355  ? -16.802 7.155   -6.053  1.00 84.51  ? 951  LYS A O   1 
ATOM   2114  C  CB  . LYS A 1 355  ? -13.955 6.129   -6.245  1.00 101.17 ? 951  LYS A CB  1 
ATOM   2115  C  CG  . LYS A 1 355  ? -12.764 5.231   -6.544  1.00 106.16 ? 951  LYS A CG  1 
ATOM   2116  C  CD  . LYS A 1 355  ? -11.795 5.202   -5.373  1.00 102.65 ? 951  LYS A CD  1 
ATOM   2117  C  CE  . LYS A 1 355  ? -11.303 6.603   -5.037  1.00 95.26  ? 951  LYS A CE  1 
ATOM   2118  N  NZ  . LYS A 1 355  ? -10.476 6.628   -3.798  1.00 84.95  ? 951  LYS A NZ  1 
ATOM   2119  N  N   . LEU A 1 356  ? -16.539 6.327   -3.979  1.00 89.80  ? 952  LEU A N   1 
ATOM   2120  C  CA  . LEU A 1 356  ? -17.627 7.114   -3.411  1.00 102.27 ? 952  LEU A CA  1 
ATOM   2121  C  C   . LEU A 1 356  ? -17.205 8.561   -3.160  1.00 102.65 ? 952  LEU A C   1 
ATOM   2122  O  O   . LEU A 1 356  ? -16.516 8.860   -2.184  1.00 105.86 ? 952  LEU A O   1 
ATOM   2123  C  CB  . LEU A 1 356  ? -18.122 6.469   -2.115  1.00 90.97  ? 952  LEU A CB  1 
ATOM   2124  C  CG  . LEU A 1 356  ? -19.625 6.567   -1.834  1.00 77.42  ? 952  LEU A CG  1 
ATOM   2125  C  CD1 . LEU A 1 356  ? -20.064 5.444   -0.910  1.00 69.81  ? 952  LEU A CD1 1 
ATOM   2126  C  CD2 . LEU A 1 356  ? -19.979 7.919   -1.236  1.00 81.42  ? 952  LEU A CD2 1 
ATOM   2127  N  N   . GLU A 1 366  ? -19.107 29.488  10.455  1.00 75.58  ? 962  GLU A N   1 
ATOM   2128  C  CA  . GLU A 1 366  ? -18.858 30.918  10.592  1.00 93.46  ? 962  GLU A CA  1 
ATOM   2129  C  C   . GLU A 1 366  ? -19.698 31.520  11.713  1.00 100.33 ? 962  GLU A C   1 
ATOM   2130  O  O   . GLU A 1 366  ? -20.888 31.226  11.827  1.00 104.30 ? 962  GLU A O   1 
ATOM   2131  C  CB  . GLU A 1 366  ? -19.149 31.643  9.274   1.00 92.67  ? 962  GLU A CB  1 
ATOM   2132  C  CG  . GLU A 1 366  ? -19.019 33.158  9.356   1.00 98.17  ? 962  GLU A CG  1 
ATOM   2133  C  CD  . GLU A 1 366  ? -19.200 33.842  8.016   1.00 103.69 ? 962  GLU A CD  1 
ATOM   2134  O  OE1 . GLU A 1 366  ? -19.694 33.188  7.073   1.00 93.27  ? 962  GLU A OE1 1 
ATOM   2135  O  OE2 . GLU A 1 366  ? -18.841 35.034  7.906   1.00 96.64  ? 962  GLU A OE2 1 
ATOM   2136  N  N   . PRO A 1 367  ? -19.076 32.365  12.552  1.00 100.76 ? 963  PRO A N   1 
ATOM   2137  C  CA  . PRO A 1 367  ? -19.824 33.070  13.597  1.00 82.34  ? 963  PRO A CA  1 
ATOM   2138  C  C   . PRO A 1 367  ? -20.867 34.005  12.997  1.00 69.98  ? 963  PRO A C   1 
ATOM   2139  O  O   . PRO A 1 367  ? -20.732 34.426  11.849  1.00 80.22  ? 963  PRO A O   1 
ATOM   2140  C  CB  . PRO A 1 367  ? -18.740 33.856  14.343  1.00 71.11  ? 963  PRO A CB  1 
ATOM   2141  C  CG  . PRO A 1 367  ? -17.616 33.977  13.366  1.00 80.10  ? 963  PRO A CG  1 
ATOM   2142  C  CD  . PRO A 1 367  ? -17.644 32.708  12.572  1.00 84.77  ? 963  PRO A CD  1 
ATOM   2143  N  N   . VAL A 1 368  ? -21.896 34.322  13.771  1.00 71.18  ? 964  VAL A N   1 
ATOM   2144  C  CA  . VAL A 1 368  ? -23.011 35.117  13.278  1.00 61.87  ? 964  VAL A CA  1 
ATOM   2145  C  C   . VAL A 1 368  ? -23.048 36.477  13.963  1.00 59.48  ? 964  VAL A C   1 
ATOM   2146  O  O   . VAL A 1 368  ? -22.726 36.592  15.146  1.00 78.25  ? 964  VAL A O   1 
ATOM   2147  C  CB  . VAL A 1 368  ? -24.351 34.371  13.500  1.00 66.00  ? 964  VAL A CB  1 
ATOM   2148  C  CG1 . VAL A 1 368  ? -25.545 35.247  13.149  1.00 55.49  ? 964  VAL A CG1 1 
ATOM   2149  C  CG2 . VAL A 1 368  ? -24.375 33.087  12.689  1.00 50.15  ? 964  VAL A CG2 1 
ATOM   2150  N  N   . ASP A 1 369  ? -23.439 37.507  13.219  1.00 54.86  ? 965  ASP A N   1 
ATOM   2151  C  CA  . ASP A 1 369  ? -23.624 38.819  13.810  1.00 46.90  ? 965  ASP A CA  1 
ATOM   2152  C  C   . ASP A 1 369  ? -24.910 38.740  14.619  1.00 60.25  ? 965  ASP A C   1 
ATOM   2153  O  O   . ASP A 1 369  ? -25.981 38.477  14.072  1.00 68.48  ? 965  ASP A O   1 
ATOM   2154  C  CB  . ASP A 1 369  ? -23.710 39.895  12.721  1.00 57.25  ? 965  ASP A CB  1 
ATOM   2155  C  CG  . ASP A 1 369  ? -23.707 41.308  13.275  1.00 65.30  ? 965  ASP A CG  1 
ATOM   2156  O  OD1 . ASP A 1 369  ? -24.203 41.524  14.399  1.00 55.29  ? 965  ASP A OD1 1 
ATOM   2157  O  OD2 . ASP A 1 369  ? -23.204 42.210  12.571  1.00 57.03  ? 965  ASP A OD2 1 
ATOM   2158  N  N   . GLU A 1 370  ? -24.803 38.980  15.921  1.00 62.03  ? 966  GLU A N   1 
ATOM   2159  C  CA  . GLU A 1 370  ? -25.940 38.800  16.816  1.00 56.01  ? 966  GLU A CA  1 
ATOM   2160  C  C   . GLU A 1 370  ? -26.703 40.101  16.999  1.00 53.85  ? 966  GLU A C   1 
ATOM   2161  O  O   . GLU A 1 370  ? -27.757 40.137  17.636  1.00 59.16  ? 966  GLU A O   1 
ATOM   2162  C  CB  . GLU A 1 370  ? -25.478 38.248  18.166  1.00 67.37  ? 966  GLU A CB  1 
ATOM   2163  C  CG  . GLU A 1 370  ? -25.053 36.789  18.105  1.00 79.51  ? 966  GLU A CG  1 
ATOM   2164  C  CD  . GLU A 1 370  ? -24.704 36.216  19.464  1.00 107.23 ? 966  GLU A CD  1 
ATOM   2165  O  OE1 . GLU A 1 370  ? -24.268 36.988  20.344  1.00 103.08 ? 966  GLU A OE1 1 
ATOM   2166  O  OE2 . GLU A 1 370  ? -24.870 34.993  19.654  1.00 99.27  ? 966  GLU A OE2 1 
ATOM   2167  N  N   . ASP A 1 371  ? -26.161 41.168  16.429  1.00 52.46  ? 967  ASP A N   1 
ATOM   2168  C  CA  . ASP A 1 371  ? -26.880 42.427  16.338  1.00 60.29  ? 967  ASP A CA  1 
ATOM   2169  C  C   . ASP A 1 371  ? -27.889 42.296  15.208  1.00 60.43  ? 967  ASP A C   1 
ATOM   2170  O  O   . ASP A 1 371  ? -29.098 42.381  15.422  1.00 57.99  ? 967  ASP A O   1 
ATOM   2171  C  CB  . ASP A 1 371  ? -25.928 43.598  16.095  1.00 68.28  ? 967  ASP A CB  1 
ATOM   2172  C  CG  . ASP A 1 371  ? -26.511 44.923  16.543  1.00 70.83  ? 967  ASP A CG  1 
ATOM   2173  O  OD1 . ASP A 1 371  ? -27.177 44.951  17.599  1.00 56.86  ? 967  ASP A OD1 1 
ATOM   2174  O  OD2 . ASP A 1 371  ? -26.309 45.933  15.837  1.00 64.30  ? 967  ASP A OD2 1 
ATOM   2175  N  N   . LEU A 1 372  ? -27.369 42.095  14.001  1.00 60.45  ? 968  LEU A N   1 
ATOM   2176  C  CA  . LEU A 1 372  ? -28.189 41.914  12.809  1.00 53.69  ? 968  LEU A CA  1 
ATOM   2177  C  C   . LEU A 1 372  ? -29.111 40.696  12.897  1.00 50.14  ? 968  LEU A C   1 
ATOM   2178  O  O   . LEU A 1 372  ? -30.253 40.753  12.448  1.00 52.47  ? 968  LEU A O   1 
ATOM   2179  C  CB  . LEU A 1 372  ? -27.292 41.797  11.577  1.00 50.03  ? 968  LEU A CB  1 
ATOM   2180  C  CG  . LEU A 1 372  ? -27.987 41.852  10.219  1.00 46.10  ? 968  LEU A CG  1 
ATOM   2181  C  CD1 . LEU A 1 372  ? -28.826 43.111  10.112  1.00 41.65  ? 968  LEU A CD1 1 
ATOM   2182  C  CD2 . LEU A 1 372  ? -26.964 41.796  9.099   1.00 30.80  ? 968  LEU A CD2 1 
ATOM   2183  N  N   . TYR A 1 373  ? -28.620 39.600  13.470  1.00 41.75  ? 969  TYR A N   1 
ATOM   2184  C  CA  . TYR A 1 373  ? -29.422 38.382  13.599  1.00 43.39  ? 969  TYR A CA  1 
ATOM   2185  C  C   . TYR A 1 373  ? -29.597 37.977  15.061  1.00 48.81  ? 969  TYR A C   1 
ATOM   2186  O  O   . TYR A 1 373  ? -28.951 37.042  15.533  1.00 44.10  ? 969  TYR A O   1 
ATOM   2187  C  CB  . TYR A 1 373  ? -28.787 37.233  12.812  1.00 46.69  ? 969  TYR A CB  1 
ATOM   2188  C  CG  . TYR A 1 373  ? -28.441 37.585  11.384  1.00 52.44  ? 969  TYR A CG  1 
ATOM   2189  C  CD1 . TYR A 1 373  ? -29.436 37.864  10.457  1.00 45.26  ? 969  TYR A CD1 1 
ATOM   2190  C  CD2 . TYR A 1 373  ? -27.119 37.630  10.961  1.00 50.34  ? 969  TYR A CD2 1 
ATOM   2191  C  CE1 . TYR A 1 373  ? -29.124 38.185  9.150   1.00 48.46  ? 969  TYR A CE1 1 
ATOM   2192  C  CE2 . TYR A 1 373  ? -26.797 37.949  9.657   1.00 47.30  ? 969  TYR A CE2 1 
ATOM   2193  C  CZ  . TYR A 1 373  ? -27.803 38.226  8.756   1.00 45.54  ? 969  TYR A CZ  1 
ATOM   2194  O  OH  . TYR A 1 373  ? -27.484 38.544  7.457   1.00 43.82  ? 969  TYR A OH  1 
ATOM   2195  N  N   . PRO A 1 374  ? -30.486 38.681  15.779  1.00 51.66  ? 970  PRO A N   1 
ATOM   2196  C  CA  . PRO A 1 374  ? -30.669 38.543  17.229  1.00 50.05  ? 970  PRO A CA  1 
ATOM   2197  C  C   . PRO A 1 374  ? -31.294 37.222  17.674  1.00 54.90  ? 970  PRO A C   1 
ATOM   2198  O  O   . PRO A 1 374  ? -31.170 36.877  18.846  1.00 61.64  ? 970  PRO A O   1 
ATOM   2199  C  CB  . PRO A 1 374  ? -31.609 39.709  17.577  1.00 43.96  ? 970  PRO A CB  1 
ATOM   2200  C  CG  . PRO A 1 374  ? -31.634 40.588  16.367  1.00 52.98  ? 970  PRO A CG  1 
ATOM   2201  C  CD  . PRO A 1 374  ? -31.408 39.678  15.215  1.00 49.65  ? 970  PRO A CD  1 
ATOM   2202  N  N   . GLU A 1 375  ? -31.957 36.507  16.771  1.00 53.27  ? 971  GLU A N   1 
ATOM   2203  C  CA  . GLU A 1 375  ? -32.697 35.307  17.155  1.00 45.35  ? 971  GLU A CA  1 
ATOM   2204  C  C   . GLU A 1 375  ? -32.087 34.027  16.595  1.00 48.97  ? 971  GLU A C   1 
ATOM   2205  O  O   . GLU A 1 375  ? -32.629 32.938  16.787  1.00 45.77  ? 971  GLU A O   1 
ATOM   2206  C  CB  . GLU A 1 375  ? -34.155 35.424  16.704  1.00 54.58  ? 971  GLU A CB  1 
ATOM   2207  C  CG  . GLU A 1 375  ? -34.906 36.584  17.332  1.00 54.20  ? 971  GLU A CG  1 
ATOM   2208  C  CD  . GLU A 1 375  ? -35.142 36.389  18.817  1.00 58.12  ? 971  GLU A CD  1 
ATOM   2209  O  OE1 . GLU A 1 375  ? -35.361 35.236  19.240  1.00 54.56  ? 971  GLU A OE1 1 
ATOM   2210  O  OE2 . GLU A 1 375  ? -35.106 37.387  19.564  1.00 66.07  ? 971  GLU A OE2 1 
ATOM   2211  N  N   . HIS A 1 376  ? -30.960 34.164  15.905  1.00 58.53  ? 972  HIS A N   1 
ATOM   2212  C  CA  . HIS A 1 376  ? -30.280 33.023  15.301  1.00 52.52  ? 972  HIS A CA  1 
ATOM   2213  C  C   . HIS A 1 376  ? -29.824 32.004  16.345  1.00 62.96  ? 972  HIS A C   1 
ATOM   2214  O  O   . HIS A 1 376  ? -29.709 30.811  16.053  1.00 55.03  ? 972  HIS A O   1 
ATOM   2215  C  CB  . HIS A 1 376  ? -29.082 33.500  14.477  1.00 38.50  ? 972  HIS A CB  1 
ATOM   2216  C  CG  . HIS A 1 376  ? -28.261 32.389  13.907  1.00 46.37  ? 972  HIS A CG  1 
ATOM   2217  N  ND1 . HIS A 1 376  ? -28.575 31.762  12.719  1.00 59.24  ? 972  HIS A ND1 1 
ATOM   2218  C  CD2 . HIS A 1 376  ? -27.138 31.784  14.363  1.00 52.83  ? 972  HIS A CD2 1 
ATOM   2219  C  CE1 . HIS A 1 376  ? -27.682 30.824  12.468  1.00 62.91  ? 972  HIS A CE1 1 
ATOM   2220  N  NE2 . HIS A 1 376  ? -26.797 30.817  13.451  1.00 69.72  ? 972  HIS A NE2 1 
ATOM   2221  N  N   . TYR A 1 377  ? -29.581 32.478  17.564  1.00 53.77  ? 973  TYR A N   1 
ATOM   2222  C  CA  . TYR A 1 377  ? -29.083 31.625  18.640  1.00 52.45  ? 973  TYR A CA  1 
ATOM   2223  C  C   . TYR A 1 377  ? -30.074 30.521  18.996  1.00 63.14  ? 973  TYR A C   1 
ATOM   2224  O  O   . TYR A 1 377  ? -29.703 29.514  19.600  1.00 58.37  ? 973  TYR A O   1 
ATOM   2225  C  CB  . TYR A 1 377  ? -28.764 32.461  19.886  1.00 53.47  ? 973  TYR A CB  1 
ATOM   2226  C  CG  . TYR A 1 377  ? -29.982 32.985  20.616  1.00 56.26  ? 973  TYR A CG  1 
ATOM   2227  C  CD1 . TYR A 1 377  ? -30.579 34.180  20.240  1.00 58.66  ? 973  TYR A CD1 1 
ATOM   2228  C  CD2 . TYR A 1 377  ? -30.530 32.289  21.688  1.00 47.66  ? 973  TYR A CD2 1 
ATOM   2229  C  CE1 . TYR A 1 377  ? -31.689 34.664  20.905  1.00 55.64  ? 973  TYR A CE1 1 
ATOM   2230  C  CE2 . TYR A 1 377  ? -31.640 32.766  22.358  1.00 49.26  ? 973  TYR A CE2 1 
ATOM   2231  C  CZ  . TYR A 1 377  ? -32.215 33.953  21.962  1.00 57.84  ? 973  TYR A CZ  1 
ATOM   2232  O  OH  . TYR A 1 377  ? -33.320 34.436  22.623  1.00 60.63  ? 973  TYR A OH  1 
ATOM   2233  N  N   . ARG A 1 378  ? -31.333 30.711  18.618  1.00 54.58  ? 974  ARG A N   1 
ATOM   2234  C  CA  . ARG A 1 378  ? -32.369 29.724  18.889  1.00 53.20  ? 974  ARG A CA  1 
ATOM   2235  C  C   . ARG A 1 378  ? -32.296 28.558  17.907  1.00 62.30  ? 974  ARG A C   1 
ATOM   2236  O  O   . ARG A 1 378  ? -33.143 27.665  17.929  1.00 71.14  ? 974  ARG A O   1 
ATOM   2237  C  CB  . ARG A 1 378  ? -33.752 30.373  18.837  1.00 42.56  ? 974  ARG A CB  1 
ATOM   2238  C  CG  . ARG A 1 378  ? -33.938 31.508  19.829  1.00 46.57  ? 974  ARG A CG  1 
ATOM   2239  C  CD  . ARG A 1 378  ? -35.307 32.145  19.677  1.00 50.05  ? 974  ARG A CD  1 
ATOM   2240  N  NE  . ARG A 1 378  ? -36.184 31.859  20.808  1.00 69.10  ? 974  ARG A NE  1 
ATOM   2241  C  CZ  . ARG A 1 378  ? -36.387 32.690  21.826  1.00 64.35  ? 974  ARG A CZ  1 
ATOM   2242  N  NH1 . ARG A 1 378  ? -37.204 32.345  22.811  1.00 75.96  ? 974  ARG A NH1 1 
ATOM   2243  N  NH2 . ARG A 1 378  ? -35.776 33.867  21.857  1.00 57.53  ? 974  ARG A NH2 1 
ATOM   2244  N  N   . LYS A 1 379  ? -31.286 28.576  17.043  1.00 66.87  ? 975  LYS A N   1 
ATOM   2245  C  CA  . LYS A 1 379  ? -31.052 27.475  16.115  1.00 68.20  ? 975  LYS A CA  1 
ATOM   2246  C  C   . LYS A 1 379  ? -29.955 26.556  16.635  1.00 85.83  ? 975  LYS A C   1 
ATOM   2247  O  O   . LYS A 1 379  ? -29.809 25.426  16.172  1.00 90.81  ? 975  LYS A O   1 
ATOM   2248  C  CB  . LYS A 1 379  ? -30.671 28.004  14.731  1.00 65.28  ? 975  LYS A CB  1 
ATOM   2249  C  CG  . LYS A 1 379  ? -31.725 28.879  14.085  1.00 64.30  ? 975  LYS A CG  1 
ATOM   2250  C  CD  . LYS A 1 379  ? -31.163 29.607  12.875  1.00 66.03  ? 975  LYS A CD  1 
ATOM   2251  C  CE  . LYS A 1 379  ? -30.826 28.648  11.744  1.00 71.21  ? 975  LYS A CE  1 
ATOM   2252  N  NZ  . LYS A 1 379  ? -32.052 28.109  11.092  1.00 45.45  ? 975  LYS A NZ  1 
ATOM   2253  N  N   . TYR A 1 380  ? -29.188 27.049  17.603  1.00 87.15  ? 976  TYR A N   1 
ATOM   2254  C  CA  . TYR A 1 380  ? -28.038 26.317  18.121  1.00 85.64  ? 976  TYR A CA  1 
ATOM   2255  C  C   . TYR A 1 380  ? -28.441 25.152  19.015  1.00 98.49  ? 976  TYR A C   1 
ATOM   2256  O  O   . TYR A 1 380  ? -27.609 24.318  19.372  1.00 102.15 ? 976  TYR A O   1 
ATOM   2257  C  CB  . TYR A 1 380  ? -27.107 27.269  18.876  1.00 92.25  ? 976  TYR A CB  1 
ATOM   2258  C  CG  . TYR A 1 380  ? -26.175 28.031  17.964  1.00 111.86 ? 976  TYR A CG  1 
ATOM   2259  C  CD1 . TYR A 1 380  ? -25.588 27.408  16.871  1.00 116.41 ? 976  TYR A CD1 1 
ATOM   2260  C  CD2 . TYR A 1 380  ? -25.889 29.372  18.186  1.00 102.07 ? 976  TYR A CD2 1 
ATOM   2261  C  CE1 . TYR A 1 380  ? -24.736 28.094  16.029  1.00 113.45 ? 976  TYR A CE1 1 
ATOM   2262  C  CE2 . TYR A 1 380  ? -25.038 30.068  17.346  1.00 106.99 ? 976  TYR A CE2 1 
ATOM   2263  C  CZ  . TYR A 1 380  ? -24.464 29.423  16.269  1.00 112.60 ? 976  TYR A CZ  1 
ATOM   2264  O  OH  . TYR A 1 380  ? -23.616 30.111  15.431  1.00 91.30  ? 976  TYR A OH  1 
ATOM   2265  N  N   . SER A 1 381  ? -29.715 25.101  19.384  1.00 98.66  ? 977  SER A N   1 
ATOM   2266  C  CA  . SER A 1 381  ? -30.249 23.945  20.088  1.00 103.34 ? 977  SER A CA  1 
ATOM   2267  C  C   . SER A 1 381  ? -30.829 22.951  19.085  1.00 106.60 ? 977  SER A C   1 
ATOM   2268  O  O   . SER A 1 381  ? -31.248 21.853  19.452  1.00 106.95 ? 977  SER A O   1 
ATOM   2269  C  CB  . SER A 1 381  ? -31.311 24.372  21.106  1.00 112.62 ? 977  SER A CB  1 
ATOM   2270  O  OG  . SER A 1 381  ? -32.312 25.166  20.495  1.00 95.63  ? 977  SER A OG  1 
ATOM   2271  N  N   . ASP A 1 382  ? -30.848 23.346  17.816  1.00 125.48 ? 978  ASP A N   1 
ATOM   2272  C  CA  . ASP A 1 382  ? -31.299 22.469  16.739  1.00 125.96 ? 978  ASP A CA  1 
ATOM   2273  C  C   . ASP A 1 382  ? -30.136 21.759  16.049  1.00 117.95 ? 978  ASP A C   1 
ATOM   2274  O  O   . ASP A 1 382  ? -30.341 20.975  15.123  1.00 108.70 ? 978  ASP A O   1 
ATOM   2275  C  CB  . ASP A 1 382  ? -32.113 23.254  15.706  1.00 119.94 ? 978  ASP A CB  1 
ATOM   2276  C  CG  . ASP A 1 382  ? -33.531 23.526  16.165  1.00 114.53 ? 978  ASP A CG  1 
ATOM   2277  O  OD1 . ASP A 1 382  ? -33.981 22.872  17.130  1.00 124.15 ? 978  ASP A OD1 1 
ATOM   2278  O  OD2 . ASP A 1 382  ? -34.202 24.383  15.553  1.00 87.18  ? 978  ASP A OD2 1 
ATOM   2279  N  N   . TYR A 1 383  ? -28.915 22.045  16.491  1.00 121.37 ? 979  TYR A N   1 
ATOM   2280  C  CA  . TYR A 1 383  ? -27.738 21.388  15.935  1.00 119.68 ? 979  TYR A CA  1 
ATOM   2281  C  C   . TYR A 1 383  ? -27.237 20.289  16.865  1.00 115.33 ? 979  TYR A C   1 
ATOM   2282  O  O   . TYR A 1 383  ? -27.656 19.136  16.763  1.00 96.36  ? 979  TYR A O   1 
ATOM   2283  C  CB  . TYR A 1 383  ? -26.618 22.400  15.671  1.00 102.77 ? 979  TYR A CB  1 
ATOM   2284  C  CG  . TYR A 1 383  ? -26.984 23.493  14.693  1.00 116.86 ? 979  TYR A CG  1 
ATOM   2285  C  CD1 . TYR A 1 383  ? -27.365 23.192  13.391  1.00 124.39 ? 979  TYR A CD1 1 
ATOM   2286  C  CD2 . TYR A 1 383  ? -26.951 24.828  15.073  1.00 111.59 ? 979  TYR A CD2 1 
ATOM   2287  C  CE1 . TYR A 1 383  ? -27.700 24.192  12.495  1.00 123.89 ? 979  TYR A CE1 1 
ATOM   2288  C  CE2 . TYR A 1 383  ? -27.284 25.834  14.185  1.00 97.95  ? 979  TYR A CE2 1 
ATOM   2289  C  CZ  . TYR A 1 383  ? -27.658 25.511  12.898  1.00 119.59 ? 979  TYR A CZ  1 
ATOM   2290  O  OH  . TYR A 1 383  ? -27.990 26.512  12.014  1.00 112.10 ? 979  TYR A OH  1 
ATOM   2291  N  N   . ASN A 1 388  ? -30.970 13.866  13.688  1.00 83.31  ? 984  ASN A N   1 
ATOM   2292  C  CA  . ASN A 1 388  ? -31.995 13.323  12.804  1.00 106.10 ? 984  ASN A CA  1 
ATOM   2293  C  C   . ASN A 1 388  ? -31.407 12.484  11.677  1.00 104.05 ? 984  ASN A C   1 
ATOM   2294  O  O   . ASN A 1 388  ? -30.784 13.009  10.755  1.00 106.16 ? 984  ASN A O   1 
ATOM   2295  C  CB  . ASN A 1 388  ? -32.844 14.452  12.219  1.00 104.59 ? 984  ASN A CB  1 
ATOM   2296  C  CG  . ASN A 1 388  ? -34.042 14.787  13.083  1.00 101.74 ? 984  ASN A CG  1 
ATOM   2297  O  OD1 . ASN A 1 388  ? -34.740 13.896  13.569  1.00 91.56  ? 984  ASN A OD1 1 
ATOM   2298  N  ND2 . ASN A 1 388  ? -34.287 16.076  13.282  1.00 96.86  ? 984  ASN A ND2 1 
ATOM   2299  N  N   . LEU A 1 389  ? -31.611 11.174  11.759  1.00 96.92  ? 985  LEU A N   1 
ATOM   2300  C  CA  . LEU A 1 389  ? -31.136 10.263  10.727  1.00 101.45 ? 985  LEU A CA  1 
ATOM   2301  C  C   . LEU A 1 389  ? -31.956 10.424  9.452   1.00 96.95  ? 985  LEU A C   1 
ATOM   2302  O  O   . LEU A 1 389  ? -33.185 10.482  9.497   1.00 91.79  ? 985  LEU A O   1 
ATOM   2303  C  CB  . LEU A 1 389  ? -31.195 8.812   11.214  1.00 90.72  ? 985  LEU A CB  1 
ATOM   2304  C  CG  . LEU A 1 389  ? -30.112 8.316   12.178  1.00 100.57 ? 985  LEU A CG  1 
ATOM   2305  C  CD1 . LEU A 1 389  ? -30.277 8.899   13.577  1.00 87.11  ? 985  LEU A CD1 1 
ATOM   2306  C  CD2 . LEU A 1 389  ? -30.114 6.796   12.226  1.00 104.61 ? 985  LEU A CD2 1 
ATOM   2307  N  N   . ASP A 1 390  ? -31.270 10.488  8.315   1.00 99.71  ? 986  ASP A N   1 
ATOM   2308  C  CA  . ASP A 1 390  ? -31.934 10.663  7.029   1.00 82.95  ? 986  ASP A CA  1 
ATOM   2309  C  C   . ASP A 1 390  ? -32.652 9.396   6.590   1.00 60.97  ? 986  ASP A C   1 
ATOM   2310  O  O   . ASP A 1 390  ? -32.640 8.384   7.292   1.00 66.50  ? 986  ASP A O   1 
ATOM   2311  C  CB  . ASP A 1 390  ? -30.925 11.080  5.956   1.00 74.22  ? 986  ASP A CB  1 
ATOM   2312  C  CG  . ASP A 1 390  ? -30.536 12.540  6.059   1.00 87.56  ? 986  ASP A CG  1 
ATOM   2313  O  OD1 . ASP A 1 390  ? -31.435 13.382  6.264   1.00 95.10  ? 986  ASP A OD1 1 
ATOM   2314  O  OD2 . ASP A 1 390  ? -29.331 12.844  5.937   1.00 85.42  ? 986  ASP A OD2 1 
ATOM   2315  N  N   . ALA A 1 391  ? -33.280 9.463   5.422   1.00 45.52  ? 987  ALA A N   1 
ATOM   2316  C  CA  . ALA A 1 391  ? -33.941 8.303   4.847   1.00 50.32  ? 987  ALA A CA  1 
ATOM   2317  C  C   . ALA A 1 391  ? -32.909 7.238   4.507   1.00 53.39  ? 987  ALA A C   1 
ATOM   2318  O  O   . ALA A 1 391  ? -31.788 7.557   4.110   1.00 56.71  ? 987  ALA A O   1 
ATOM   2319  C  CB  . ALA A 1 391  ? -34.734 8.694   3.611   1.00 47.56  ? 987  ALA A CB  1 
ATOM   2320  N  N   . PRO A 1 392  ? -33.280 5.963   4.676   1.00 39.42  ? 988  PRO A N   1 
ATOM   2321  C  CA  . PRO A 1 392  ? -32.376 4.850   4.372   1.00 37.50  ? 988  PRO A CA  1 
ATOM   2322  C  C   . PRO A 1 392  ? -32.092 4.729   2.883   1.00 39.76  ? 988  PRO A C   1 
ATOM   2323  O  O   . PRO A 1 392  ? -32.810 5.310   2.070   1.00 45.09  ? 988  PRO A O   1 
ATOM   2324  C  CB  . PRO A 1 392  ? -33.148 3.623   4.869   1.00 28.32  ? 988  PRO A CB  1 
ATOM   2325  C  CG  . PRO A 1 392  ? -34.195 4.158   5.783   1.00 38.25  ? 988  PRO A CG  1 
ATOM   2326  C  CD  . PRO A 1 392  ? -34.556 5.492   5.234   1.00 43.79  ? 988  PRO A CD  1 
ATOM   2327  N  N   . GLU A 1 393  ? -31.043 3.993   2.532   1.00 46.37  ? 989  GLU A N   1 
ATOM   2328  C  CA  . GLU A 1 393  ? -30.827 3.624   1.142   1.00 37.43  ? 989  GLU A CA  1 
ATOM   2329  C  C   . GLU A 1 393  ? -31.898 2.629   0.728   1.00 46.92  ? 989  GLU A C   1 
ATOM   2330  O  O   . GLU A 1 393  ? -32.278 1.761   1.515   1.00 43.74  ? 989  GLU A O   1 
ATOM   2331  C  CB  . GLU A 1 393  ? -29.440 3.017   0.926   1.00 37.60  ? 989  GLU A CB  1 
ATOM   2332  C  CG  . GLU A 1 393  ? -28.280 3.964   1.148   1.00 53.18  ? 989  GLU A CG  1 
ATOM   2333  C  CD  . GLU A 1 393  ? -27.018 3.490   0.453   1.00 49.02  ? 989  GLU A CD  1 
ATOM   2334  O  OE1 . GLU A 1 393  ? -25.968 3.389   1.122   1.00 57.12  ? 989  GLU A OE1 1 
ATOM   2335  O  OE2 . GLU A 1 393  ? -27.076 3.222   -0.766  1.00 58.70  ? 989  GLU A OE2 1 
ATOM   2336  N  N   . PRO A 1 394  ? -32.398 2.755   -0.508  1.00 35.64  ? 990  PRO A N   1 
ATOM   2337  C  CA  . PRO A 1 394  ? -33.316 1.748   -1.046  1.00 28.81  ? 990  PRO A CA  1 
ATOM   2338  C  C   . PRO A 1 394  ? -32.606 0.413   -1.246  1.00 36.11  ? 990  PRO A C   1 
ATOM   2339  O  O   . PRO A 1 394  ? -31.375 0.372   -1.218  1.00 41.72  ? 990  PRO A O   1 
ATOM   2340  C  CB  . PRO A 1 394  ? -33.759 2.348   -2.384  1.00 37.66  ? 990  PRO A CB  1 
ATOM   2341  C  CG  . PRO A 1 394  ? -32.678 3.303   -2.752  1.00 30.58  ? 990  PRO A CG  1 
ATOM   2342  C  CD  . PRO A 1 394  ? -32.168 3.859   -1.455  1.00 23.51  ? 990  PRO A CD  1 
ATOM   2343  N  N   . TYR A 1 395  ? -33.378 -0.657  -1.413  1.00 40.74  ? 991  TYR A N   1 
ATOM   2344  C  CA  . TYR A 1 395  ? -32.839 -1.996  -1.646  1.00 35.76  ? 991  TYR A CA  1 
ATOM   2345  C  C   . TYR A 1 395  ? -31.721 -2.040  -2.684  1.00 37.94  ? 991  TYR A C   1 
ATOM   2346  O  O   . TYR A 1 395  ? -31.807 -1.401  -3.732  1.00 40.36  ? 991  TYR A O   1 
ATOM   2347  C  CB  . TYR A 1 395  ? -33.949 -2.942  -2.108  1.00 28.02  ? 991  TYR A CB  1 
ATOM   2348  C  CG  . TYR A 1 395  ? -34.907 -3.407  -1.036  1.00 43.26  ? 991  TYR A CG  1 
ATOM   2349  C  CD1 . TYR A 1 395  ? -34.475 -3.658  0.259   1.00 40.77  ? 991  TYR A CD1 1 
ATOM   2350  C  CD2 . TYR A 1 395  ? -36.249 -3.610  -1.330  1.00 44.27  ? 991  TYR A CD2 1 
ATOM   2351  C  CE1 . TYR A 1 395  ? -35.357 -4.092  1.234   1.00 39.09  ? 991  TYR A CE1 1 
ATOM   2352  C  CE2 . TYR A 1 395  ? -37.136 -4.040  -0.366  1.00 49.79  ? 991  TYR A CE2 1 
ATOM   2353  C  CZ  . TYR A 1 395  ? -36.686 -4.280  0.915   1.00 41.36  ? 991  TYR A CZ  1 
ATOM   2354  O  OH  . TYR A 1 395  ? -37.570 -4.710  1.877   1.00 49.31  ? 991  TYR A OH  1 
ATOM   2355  N  N   . ARG A 1 396  ? -30.669 -2.792  -2.379  1.00 44.00  ? 992  ARG A N   1 
ATOM   2356  C  CA  . ARG A 1 396  ? -29.751 -3.258  -3.408  1.00 40.69  ? 992  ARG A CA  1 
ATOM   2357  C  C   . ARG A 1 396  ? -30.538 -4.219  -4.280  1.00 40.09  ? 992  ARG A C   1 
ATOM   2358  O  O   . ARG A 1 396  ? -31.395 -4.948  -3.783  1.00 43.33  ? 992  ARG A O   1 
ATOM   2359  C  CB  . ARG A 1 396  ? -28.530 -3.957  -2.807  1.00 33.95  ? 992  ARG A CB  1 
ATOM   2360  C  CG  . ARG A 1 396  ? -27.640 -3.073  -1.956  1.00 38.45  ? 992  ARG A CG  1 
ATOM   2361  C  CD  . ARG A 1 396  ? -26.658 -2.287  -2.804  1.00 34.39  ? 992  ARG A CD  1 
ATOM   2362  N  NE  . ARG A 1 396  ? -25.667 -1.600  -1.981  1.00 38.19  ? 992  ARG A NE  1 
ATOM   2363  C  CZ  . ARG A 1 396  ? -25.797 -0.351  -1.545  1.00 40.09  ? 992  ARG A CZ  1 
ATOM   2364  N  NH1 . ARG A 1 396  ? -26.877 0.351   -1.857  1.00 55.06  ? 992  ARG A NH1 1 
ATOM   2365  N  NH2 . ARG A 1 396  ? -24.846 0.196   -0.801  1.00 52.92  ? 992  ARG A NH2 1 
ATOM   2366  N  N   . ILE A 1 397  ? -30.270 -4.220  -5.578  1.00 52.22  ? 993  ILE A N   1 
ATOM   2367  C  CA  . ILE A 1 397  ? -30.954 -5.147  -6.469  1.00 46.79  ? 993  ILE A CA  1 
ATOM   2368  C  C   . ILE A 1 397  ? -29.945 -6.014  -7.199  1.00 44.48  ? 993  ILE A C   1 
ATOM   2369  O  O   . ILE A 1 397  ? -29.018 -5.504  -7.828  1.00 52.91  ? 993  ILE A O   1 
ATOM   2370  C  CB  . ILE A 1 397  ? -31.836 -4.410  -7.489  1.00 43.61  ? 993  ILE A CB  1 
ATOM   2371  C  CG1 . ILE A 1 397  ? -32.883 -3.565  -6.761  1.00 33.38  ? 993  ILE A CG1 1 
ATOM   2372  C  CG2 . ILE A 1 397  ? -32.509 -5.401  -8.429  1.00 42.64  ? 993  ILE A CG2 1 
ATOM   2373  C  CD1 . ILE A 1 397  ? -33.822 -2.833  -7.683  1.00 44.21  ? 993  ILE A CD1 1 
ATOM   2374  N  N   . GLY A 1 398  ? -30.118 -7.327  -7.107  1.00 36.12  ? 994  GLY A N   1 
ATOM   2375  C  CA  . GLY A 1 398  ? -29.199 -8.236  -7.763  1.00 35.73  ? 994  GLY A CA  1 
ATOM   2376  C  C   . GLY A 1 398  ? -29.913 -9.254  -8.624  1.00 34.00  ? 994  GLY A C   1 
ATOM   2377  O  O   . GLY A 1 398  ? -31.100 -9.505  -8.433  1.00 41.21  ? 994  GLY A O   1 
ATOM   2378  N  N   . ARG A 1 399  ? -29.203 -9.839  -9.583  1.00 36.96  ? 995  ARG A N   1 
ATOM   2379  C  CA  . ARG A 1 399  ? -29.786 -10.933 -10.351 1.00 39.25  ? 995  ARG A CA  1 
ATOM   2380  C  C   . ARG A 1 399  ? -29.116 -12.249 -9.988  1.00 47.65  ? 995  ARG A C   1 
ATOM   2381  O  O   . ARG A 1 399  ? -27.889 -12.352 -9.993  1.00 53.97  ? 995  ARG A O   1 
ATOM   2382  C  CB  . ARG A 1 399  ? -29.674 -10.691 -11.856 1.00 44.25  ? 995  ARG A CB  1 
ATOM   2383  C  CG  . ARG A 1 399  ? -30.560 -11.630 -12.665 1.00 38.99  ? 995  ARG A CG  1 
ATOM   2384  C  CD  . ARG A 1 399  ? -29.993 -11.920 -14.044 1.00 54.59  ? 995  ARG A CD  1 
ATOM   2385  N  NE  . ARG A 1 399  ? -30.214 -10.830 -14.989 1.00 57.84  ? 995  ARG A NE  1 
ATOM   2386  C  CZ  . ARG A 1 399  ? -31.318 -10.686 -15.715 1.00 42.90  ? 995  ARG A CZ  1 
ATOM   2387  N  NH1 . ARG A 1 399  ? -32.310 -11.559 -15.598 1.00 67.00  ? 995  ARG A NH1 1 
ATOM   2388  N  NH2 . ARG A 1 399  ? -31.432 -9.668  -16.555 1.00 48.73  ? 995  ARG A NH2 1 
ATOM   2389  N  N   . ILE A 1 400  ? -29.932 -13.252 -9.680  1.00 50.17  ? 996  ILE A N   1 
ATOM   2390  C  CA  . ILE A 1 400  ? -29.428 -14.556 -9.267  1.00 51.37  ? 996  ILE A CA  1 
ATOM   2391  C  C   . ILE A 1 400  ? -28.698 -15.278 -10.395 1.00 52.48  ? 996  ILE A C   1 
ATOM   2392  O  O   . ILE A 1 400  ? -29.296 -15.675 -11.396 1.00 47.78  ? 996  ILE A O   1 
ATOM   2393  C  CB  . ILE A 1 400  ? -30.562 -15.455 -8.751  1.00 54.71  ? 996  ILE A CB  1 
ATOM   2394  C  CG1 . ILE A 1 400  ? -31.205 -14.834 -7.508  1.00 43.99  ? 996  ILE A CG1 1 
ATOM   2395  C  CG2 . ILE A 1 400  ? -30.036 -16.845 -8.436  1.00 50.14  ? 996  ILE A CG2 1 
ATOM   2396  C  CD1 . ILE A 1 400  ? -32.300 -15.682 -6.901  1.00 40.85  ? 996  ILE A CD1 1 
ATOM   2397  N  N   . LYS A 1 401  ? -27.394 -15.435 -10.211 1.00 54.88  ? 997  LYS A N   1 
ATOM   2398  C  CA  . LYS A 1 401  ? -26.536 -16.144 -11.146 1.00 59.26  ? 997  LYS A CA  1 
ATOM   2399  C  C   . LYS A 1 401  ? -26.322 -17.575 -10.668 1.00 61.25  ? 997  LYS A C   1 
ATOM   2400  O  O   . LYS A 1 401  ? -26.535 -18.530 -11.415 1.00 65.39  ? 997  LYS A O   1 
ATOM   2401  C  CB  . LYS A 1 401  ? -25.198 -15.417 -11.290 1.00 48.21  ? 997  LYS A CB  1 
ATOM   2402  C  CG  . LYS A 1 401  ? -24.241 -16.026 -12.297 1.00 52.81  ? 997  LYS A CG  1 
ATOM   2403  C  CD  . LYS A 1 401  ? -22.987 -15.175 -12.418 1.00 59.61  ? 997  LYS A CD  1 
ATOM   2404  C  CE  . LYS A 1 401  ? -22.068 -15.680 -13.516 1.00 64.96  ? 997  LYS A CE  1 
ATOM   2405  N  NZ  . LYS A 1 401  ? -20.876 -14.805 -13.685 1.00 51.64  ? 997  LYS A NZ  1 
ATOM   2406  N  N   . GLU A 1 402  ? -25.908 -17.713 -9.413  1.00 60.40  ? 998  GLU A N   1 
ATOM   2407  C  CA  . GLU A 1 402  ? -25.707 -19.024 -8.810  1.00 58.84  ? 998  GLU A CA  1 
ATOM   2408  C  C   . GLU A 1 402  ? -26.441 -19.163 -7.482  1.00 54.16  ? 998  GLU A C   1 
ATOM   2409  O  O   . GLU A 1 402  ? -26.458 -18.242 -6.667  1.00 56.20  ? 998  GLU A O   1 
ATOM   2410  C  CB  . GLU A 1 402  ? -24.218 -19.296 -8.588  1.00 68.28  ? 998  GLU A CB  1 
ATOM   2411  C  CG  . GLU A 1 402  ? -23.397 -19.446 -9.851  1.00 76.33  ? 998  GLU A CG  1 
ATOM   2412  C  CD  . GLU A 1 402  ? -21.942 -19.751 -9.550  1.00 89.50  ? 998  GLU A CD  1 
ATOM   2413  O  OE1 . GLU A 1 402  ? -21.638 -20.108 -8.393  1.00 69.57  ? 998  GLU A OE1 1 
ATOM   2414  O  OE2 . GLU A 1 402  ? -21.103 -19.626 -10.466 1.00 103.19 ? 998  GLU A OE2 1 
ATOM   2415  N  N   . ILE A 1 403  ? -27.049 -20.324 -7.279  1.00 59.08  ? 999  ILE A N   1 
ATOM   2416  C  CA  . ILE A 1 403  ? -27.558 -20.715 -5.973  1.00 62.77  ? 999  ILE A CA  1 
ATOM   2417  C  C   . ILE A 1 403  ? -26.723 -21.892 -5.501  1.00 65.70  ? 999  ILE A C   1 
ATOM   2418  O  O   . ILE A 1 403  ? -26.711 -22.931 -6.153  1.00 63.66  ? 999  ILE A O   1 
ATOM   2419  C  CB  . ILE A 1 403  ? -29.043 -21.120 -6.018  1.00 59.62  ? 999  ILE A CB  1 
ATOM   2420  C  CG1 . ILE A 1 403  ? -29.893 -19.993 -6.605  1.00 56.96  ? 999  ILE A CG1 1 
ATOM   2421  C  CG2 . ILE A 1 403  ? -29.530 -21.500 -4.629  1.00 63.74  ? 999  ILE A CG2 1 
ATOM   2422  C  CD1 . ILE A 1 403  ? -31.341 -20.372 -6.820  1.00 57.40  ? 999  ILE A CD1 1 
ATOM   2423  N  N   . PHE A 1 404  ? -26.008 -21.748 -4.390  1.00 68.21  ? 1000 PHE A N   1 
ATOM   2424  C  CA  . PHE A 1 404  ? -25.132 -22.836 -3.973  1.00 74.07  ? 1000 PHE A CA  1 
ATOM   2425  C  C   . PHE A 1 404  ? -24.994 -23.027 -2.469  1.00 78.09  ? 1000 PHE A C   1 
ATOM   2426  O  O   . PHE A 1 404  ? -25.096 -22.082 -1.686  1.00 70.22  ? 1000 PHE A O   1 
ATOM   2427  C  CB  . PHE A 1 404  ? -23.737 -22.649 -4.583  1.00 61.36  ? 1000 PHE A CB  1 
ATOM   2428  C  CG  . PHE A 1 404  ? -22.972 -21.484 -4.027  1.00 60.77  ? 1000 PHE A CG  1 
ATOM   2429  C  CD1 . PHE A 1 404  ? -23.123 -20.219 -4.566  1.00 53.91  ? 1000 PHE A CD1 1 
ATOM   2430  C  CD2 . PHE A 1 404  ? -22.083 -21.657 -2.977  1.00 60.22  ? 1000 PHE A CD2 1 
ATOM   2431  C  CE1 . PHE A 1 404  ? -22.415 -19.146 -4.062  1.00 63.85  ? 1000 PHE A CE1 1 
ATOM   2432  C  CE2 . PHE A 1 404  ? -21.373 -20.588 -2.469  1.00 59.40  ? 1000 PHE A CE2 1 
ATOM   2433  C  CZ  . PHE A 1 404  ? -21.538 -19.331 -3.012  1.00 61.03  ? 1000 PHE A CZ  1 
ATOM   2434  N  N   . CYS A 1 405  ? -24.754 -24.277 -2.083  1.00 95.52  ? 1001 CYS A N   1 
ATOM   2435  C  CA  . CYS A 1 405  ? -24.452 -24.622 -0.702  1.00 90.62  ? 1001 CYS A CA  1 
ATOM   2436  C  C   . CYS A 1 405  ? -23.051 -25.206 -0.611  1.00 82.23  ? 1001 CYS A C   1 
ATOM   2437  O  O   . CYS A 1 405  ? -22.701 -26.107 -1.376  1.00 85.86  ? 1001 CYS A O   1 
ATOM   2438  C  CB  . CYS A 1 405  ? -25.468 -25.622 -0.152  1.00 78.57  ? 1001 CYS A CB  1 
ATOM   2439  S  SG  . CYS A 1 405  ? -27.175 -25.058 -0.199  1.00 76.17  ? 1001 CYS A SG  1 
ATOM   2440  N  N   . PRO A 1 406  ? -22.238 -24.691 0.320   1.00 82.23  ? 1002 PRO A N   1 
ATOM   2441  C  CA  . PRO A 1 406  ? -20.904 -25.258 0.519   1.00 89.54  ? 1002 PRO A CA  1 
ATOM   2442  C  C   . PRO A 1 406  ? -20.991 -26.627 1.173   1.00 111.92 ? 1002 PRO A C   1 
ATOM   2443  O  O   . PRO A 1 406  ? -21.855 -26.841 2.024   1.00 103.78 ? 1002 PRO A O   1 
ATOM   2444  C  CB  . PRO A 1 406  ? -20.218 -24.249 1.452   1.00 74.98  ? 1002 PRO A CB  1 
ATOM   2445  C  CG  . PRO A 1 406  ? -21.093 -23.029 1.439   1.00 83.47  ? 1002 PRO A CG  1 
ATOM   2446  C  CD  . PRO A 1 406  ? -22.475 -23.534 1.194   1.00 90.81  ? 1002 PRO A CD  1 
ATOM   2447  N  N   . LYS A 1 407  ? -20.115 -27.543 0.777   1.00 123.02 ? 1003 LYS A N   1 
ATOM   2448  C  CA  . LYS A 1 407  ? -20.063 -28.850 1.413   1.00 104.05 ? 1003 LYS A CA  1 
ATOM   2449  C  C   . LYS A 1 407  ? -19.491 -28.708 2.820   1.00 109.37 ? 1003 LYS A C   1 
ATOM   2450  O  O   . LYS A 1 407  ? -18.803 -27.734 3.123   1.00 98.91  ? 1003 LYS A O   1 
ATOM   2451  C  CB  . LYS A 1 407  ? -19.235 -29.827 0.573   1.00 89.86  ? 1003 LYS A CB  1 
ATOM   2452  C  CG  . LYS A 1 407  ? -19.911 -30.227 -0.733  1.00 86.79  ? 1003 LYS A CG  1 
ATOM   2453  C  CD  . LYS A 1 407  ? -18.988 -31.027 -1.638  1.00 93.85  ? 1003 LYS A CD  1 
ATOM   2454  C  CE  . LYS A 1 407  ? -19.708 -31.453 -2.908  1.00 90.97  ? 1003 LYS A CE  1 
ATOM   2455  N  NZ  . LYS A 1 407  ? -18.793 -32.098 -3.888  1.00 89.90  ? 1003 LYS A NZ  1 
ATOM   2456  N  N   . LYS A 1 408  ? -19.773 -29.687 3.672   1.00 118.98 ? 1004 LYS A N   1 
ATOM   2457  C  CA  . LYS A 1 408  ? -19.367 -29.640 5.074   1.00 113.70 ? 1004 LYS A CA  1 
ATOM   2458  C  C   . LYS A 1 408  ? -17.937 -30.144 5.224   1.00 124.38 ? 1004 LYS A C   1 
ATOM   2459  O  O   . LYS A 1 408  ? -17.417 -30.267 6.333   1.00 123.56 ? 1004 LYS A O   1 
ATOM   2460  C  CB  . LYS A 1 408  ? -20.322 -30.463 5.941   1.00 117.20 ? 1004 LYS A CB  1 
ATOM   2461  C  CG  . LYS A 1 408  ? -21.755 -29.950 5.957   1.00 97.08  ? 1004 LYS A CG  1 
ATOM   2462  C  CD  . LYS A 1 408  ? -22.661 -30.847 6.788   1.00 78.90  ? 1004 LYS A CD  1 
ATOM   2463  C  CE  . LYS A 1 408  ? -24.056 -30.255 6.918   1.00 93.66  ? 1004 LYS A CE  1 
ATOM   2464  N  NZ  . LYS A 1 408  ? -24.967 -31.123 7.716   1.00 85.48  ? 1004 LYS A NZ  1 
ATOM   2465  N  N   . SER A 1 409  ? -17.333 -30.447 4.079   1.00 137.61 ? 1005 SER A N   1 
ATOM   2466  C  CA  . SER A 1 409  ? -15.991 -31.015 3.955   1.00 133.09 ? 1005 SER A CA  1 
ATOM   2467  C  C   . SER A 1 409  ? -15.897 -32.402 4.573   1.00 132.30 ? 1005 SER A C   1 
ATOM   2468  O  O   . SER A 1 409  ? -14.810 -32.867 4.918   1.00 114.09 ? 1005 SER A O   1 
ATOM   2469  C  CB  . SER A 1 409  ? -14.945 -30.091 4.590   1.00 111.30 ? 1005 SER A CB  1 
ATOM   2470  O  OG  . SER A 1 409  ? -14.990 -30.169 6.005   1.00 106.19 ? 1005 SER A OG  1 
ATOM   2471  N  N   . ASN A 1 410  ? -17.043 -33.058 4.716   1.00 124.56 ? 1006 ASN A N   1 
ATOM   2472  C  CA  . ASN A 1 410  ? -17.096 -34.510 4.686   1.00 115.49 ? 1006 ASN A CA  1 
ATOM   2473  C  C   . ASN A 1 410  ? -17.533 -34.910 3.282   1.00 121.41 ? 1006 ASN A C   1 
ATOM   2474  O  O   . ASN A 1 410  ? -17.640 -36.092 2.956   1.00 115.41 ? 1006 ASN A O   1 
ATOM   2475  C  CB  . ASN A 1 410  ? -18.031 -35.073 5.757   1.00 104.78 ? 1006 ASN A CB  1 
ATOM   2476  C  CG  . ASN A 1 410  ? -19.387 -34.411 5.757   1.00 111.58 ? 1006 ASN A CG  1 
ATOM   2477  O  OD1 . ASN A 1 410  ? -19.626 -33.463 6.504   1.00 114.84 ? 1006 ASN A OD1 1 
ATOM   2478  N  ND2 . ASN A 1 410  ? -20.290 -34.913 4.927   1.00 102.89 ? 1006 ASN A ND2 1 
ATOM   2479  N  N   . GLY A 1 411  ? -17.787 -33.896 2.457   1.00 121.41 ? 1007 GLY A N   1 
ATOM   2480  C  CA  . GLY A 1 411  ? -18.188 -34.094 1.077   1.00 121.21 ? 1007 GLY A CA  1 
ATOM   2481  C  C   . GLY A 1 411  ? -19.683 -33.986 0.839   1.00 130.38 ? 1007 GLY A C   1 
ATOM   2482  O  O   . GLY A 1 411  ? -20.171 -34.354 -0.229  1.00 121.81 ? 1007 GLY A O   1 
ATOM   2483  N  N   . ARG A 1 412  ? -20.412 -33.471 1.825   1.00 121.55 ? 1008 ARG A N   1 
ATOM   2484  C  CA  . ARG A 1 412  ? -21.863 -33.354 1.715   1.00 121.33 ? 1008 ARG A CA  1 
ATOM   2485  C  C   . ARG A 1 412  ? -22.290 -31.902 1.925   1.00 112.41 ? 1008 ARG A C   1 
ATOM   2486  O  O   . ARG A 1 412  ? -21.731 -31.209 2.776   1.00 104.77 ? 1008 ARG A O   1 
ATOM   2487  C  CB  . ARG A 1 412  ? -22.546 -34.275 2.734   1.00 112.70 ? 1008 ARG A CB  1 
ATOM   2488  C  CG  . ARG A 1 412  ? -23.858 -34.888 2.269   1.00 103.20 ? 1008 ARG A CG  1 
ATOM   2489  C  CD  . ARG A 1 412  ? -23.657 -35.772 1.047   1.00 113.09 ? 1008 ARG A CD  1 
ATOM   2490  N  NE  . ARG A 1 412  ? -23.230 -37.122 1.404   1.00 137.74 ? 1008 ARG A NE  1 
ATOM   2491  C  CZ  . ARG A 1 412  ? -24.055 -38.158 1.517   1.00 135.99 ? 1008 ARG A CZ  1 
ATOM   2492  N  NH1 . ARG A 1 412  ? -25.354 -38.001 1.298   1.00 131.69 ? 1008 ARG A NH1 1 
ATOM   2493  N  NH2 . ARG A 1 412  ? -23.582 -39.353 1.847   1.00 118.04 ? 1008 ARG A NH2 1 
ATOM   2494  N  N   . PRO A 1 413  ? -23.291 -31.439 1.158   1.00 105.95 ? 1009 PRO A N   1 
ATOM   2495  C  CA  . PRO A 1 413  ? -23.697 -30.029 1.201   1.00 98.14  ? 1009 PRO A CA  1 
ATOM   2496  C  C   . PRO A 1 413  ? -24.340 -29.608 2.516   1.00 91.00  ? 1009 PRO A C   1 
ATOM   2497  O  O   . PRO A 1 413  ? -25.134 -30.352 3.091   1.00 92.11  ? 1009 PRO A O   1 
ATOM   2498  C  CB  . PRO A 1 413  ? -24.711 -29.922 0.056   1.00 98.72  ? 1009 PRO A CB  1 
ATOM   2499  C  CG  . PRO A 1 413  ? -25.227 -31.305 -0.120  1.00 89.28  ? 1009 PRO A CG  1 
ATOM   2500  C  CD  . PRO A 1 413  ? -24.050 -32.191 0.143   1.00 103.72 ? 1009 PRO A CD  1 
ATOM   2501  N  N   . ASN A 1 414  ? -23.996 -28.409 2.975   1.00 78.35  ? 1010 ASN A N   1 
ATOM   2502  C  CA  . ASN A 1 414  ? -24.652 -27.824 4.132   1.00 76.44  ? 1010 ASN A CA  1 
ATOM   2503  C  C   . ASN A 1 414  ? -25.795 -26.950 3.647   1.00 82.11  ? 1010 ASN A C   1 
ATOM   2504  O  O   . ASN A 1 414  ? -25.576 -25.890 3.063   1.00 92.81  ? 1010 ASN A O   1 
ATOM   2505  C  CB  . ASN A 1 414  ? -23.654 -27.014 4.962   1.00 81.94  ? 1010 ASN A CB  1 
ATOM   2506  C  CG  . ASN A 1 414  ? -24.292 -26.340 6.163   1.00 91.22  ? 1010 ASN A CG  1 
ATOM   2507  O  OD1 . ASN A 1 414  ? -25.412 -26.667 6.558   1.00 93.18  ? 1010 ASN A OD1 1 
ATOM   2508  N  ND2 . ASN A 1 414  ? -23.573 -25.395 6.755   1.00 90.57  ? 1010 ASN A ND2 1 
ATOM   2509  N  N   . GLU A 1 415  ? -27.019 -27.395 3.906   1.00 76.32  ? 1011 GLU A N   1 
ATOM   2510  C  CA  . GLU A 1 415  ? -28.195 -26.743 3.351   1.00 76.05  ? 1011 GLU A CA  1 
ATOM   2511  C  C   . GLU A 1 415  ? -28.796 -25.740 4.325   1.00 68.90  ? 1011 GLU A C   1 
ATOM   2512  O  O   . GLU A 1 415  ? -29.820 -25.119 4.043   1.00 77.71  ? 1011 GLU A O   1 
ATOM   2513  C  CB  . GLU A 1 415  ? -29.223 -27.793 2.932   1.00 68.20  ? 1011 GLU A CB  1 
ATOM   2514  C  CG  . GLU A 1 415  ? -28.758 -28.613 1.733   1.00 64.61  ? 1011 GLU A CG  1 
ATOM   2515  C  CD  . GLU A 1 415  ? -29.728 -29.709 1.343   1.00 79.22  ? 1011 GLU A CD  1 
ATOM   2516  O  OE1 . GLU A 1 415  ? -30.445 -30.218 2.230   1.00 93.68  ? 1011 GLU A OE1 1 
ATOM   2517  O  OE2 . GLU A 1 415  ? -29.771 -30.065 0.145   1.00 68.36  ? 1011 GLU A OE2 1 
ATOM   2518  N  N   . THR A 1 416  ? -28.153 -25.593 5.477   1.00 79.37  ? 1012 THR A N   1 
ATOM   2519  C  CA  . THR A 1 416  ? -28.463 -24.500 6.386   1.00 94.69  ? 1012 THR A CA  1 
ATOM   2520  C  C   . THR A 1 416  ? -27.758 -23.250 5.871   1.00 97.88  ? 1012 THR A C   1 
ATOM   2521  O  O   . THR A 1 416  ? -28.129 -22.120 6.195   1.00 105.97 ? 1012 THR A O   1 
ATOM   2522  C  CB  . THR A 1 416  ? -28.018 -24.808 7.834   1.00 98.79  ? 1012 THR A CB  1 
ATOM   2523  O  OG1 . THR A 1 416  ? -28.532 -26.086 8.230   1.00 94.34  ? 1012 THR A OG1 1 
ATOM   2524  C  CG2 . THR A 1 416  ? -28.521 -23.741 8.800   1.00 64.61  ? 1012 THR A CG2 1 
ATOM   2525  N  N   . ASP A 1 417  ? -26.748 -23.473 5.037   1.00 87.63  ? 1013 ASP A N   1 
ATOM   2526  C  CA  . ASP A 1 417  ? -25.896 -22.399 4.546   1.00 83.27  ? 1013 ASP A CA  1 
ATOM   2527  C  C   . ASP A 1 417  ? -26.096 -22.155 3.051   1.00 79.70  ? 1013 ASP A C   1 
ATOM   2528  O  O   . ASP A 1 417  ? -25.137 -22.167 2.281   1.00 76.66  ? 1013 ASP A O   1 
ATOM   2529  C  CB  . ASP A 1 417  ? -24.428 -22.723 4.836   1.00 80.94  ? 1013 ASP A CB  1 
ATOM   2530  C  CG  . ASP A 1 417  ? -23.541 -21.496 4.805   1.00 92.68  ? 1013 ASP A CG  1 
ATOM   2531  O  OD1 . ASP A 1 417  ? -24.021 -20.402 5.170   1.00 81.89  ? 1013 ASP A OD1 1 
ATOM   2532  O  OD2 . ASP A 1 417  ? -22.359 -21.626 4.421   1.00 94.32  ? 1013 ASP A OD2 1 
ATOM   2533  N  N   . ILE A 1 418  ? -27.343 -21.936 2.647   1.00 77.81  ? 1014 ILE A N   1 
ATOM   2534  C  CA  . ILE A 1 418  ? -27.651 -21.625 1.254   1.00 68.68  ? 1014 ILE A CA  1 
ATOM   2535  C  C   . ILE A 1 418  ? -27.084 -20.261 0.885   1.00 53.64  ? 1014 ILE A C   1 
ATOM   2536  O  O   . ILE A 1 418  ? -27.281 -19.286 1.609   1.00 60.73  ? 1014 ILE A O   1 
ATOM   2537  C  CB  . ILE A 1 418  ? -29.166 -21.627 0.988   1.00 65.20  ? 1014 ILE A CB  1 
ATOM   2538  C  CG1 . ILE A 1 418  ? -29.816 -22.875 1.586   1.00 66.93  ? 1014 ILE A CG1 1 
ATOM   2539  C  CG2 . ILE A 1 418  ? -29.444 -21.533 -0.505  1.00 55.04  ? 1014 ILE A CG2 1 
ATOM   2540  C  CD1 . ILE A 1 418  ? -31.328 -22.868 1.514   1.00 65.79  ? 1014 ILE A CD1 1 
ATOM   2541  N  N   . LYS A 1 419  ? -26.380 -20.190 -0.239  1.00 51.54  ? 1015 LYS A N   1 
ATOM   2542  C  CA  . LYS A 1 419  ? -25.764 -18.935 -0.655  1.00 60.97  ? 1015 LYS A CA  1 
ATOM   2543  C  C   . LYS A 1 419  ? -26.112 -18.554 -2.090  1.00 48.77  ? 1015 LYS A C   1 
ATOM   2544  O  O   . LYS A 1 419  ? -26.349 -19.414 -2.938  1.00 48.73  ? 1015 LYS A O   1 
ATOM   2545  C  CB  . LYS A 1 419  ? -24.246 -19.010 -0.485  1.00 63.99  ? 1015 LYS A CB  1 
ATOM   2546  C  CG  . LYS A 1 419  ? -23.808 -19.168 0.959   1.00 69.39  ? 1015 LYS A CG  1 
ATOM   2547  C  CD  . LYS A 1 419  ? -22.425 -18.592 1.190   1.00 76.27  ? 1015 LYS A CD  1 
ATOM   2548  C  CE  . LYS A 1 419  ? -22.114 -18.519 2.674   1.00 72.06  ? 1015 LYS A CE  1 
ATOM   2549  N  NZ  . LYS A 1 419  ? -20.848 -17.790 2.945   1.00 75.69  ? 1015 LYS A NZ  1 
ATOM   2550  N  N   . ILE A 1 420  ? -26.140 -17.250 -2.346  1.00 48.90  ? 1016 ILE A N   1 
ATOM   2551  C  CA  . ILE A 1 420  ? -26.510 -16.724 -3.652  1.00 53.14  ? 1016 ILE A CA  1 
ATOM   2552  C  C   . ILE A 1 420  ? -25.397 -15.870 -4.247  1.00 56.87  ? 1016 ILE A C   1 
ATOM   2553  O  O   . ILE A 1 420  ? -24.899 -14.949 -3.600  1.00 54.73  ? 1016 ILE A O   1 
ATOM   2554  C  CB  . ILE A 1 420  ? -27.789 -15.865 -3.575  1.00 47.26  ? 1016 ILE A CB  1 
ATOM   2555  C  CG1 . ILE A 1 420  ? -28.843 -16.532 -2.689  1.00 41.35  ? 1016 ILE A CG1 1 
ATOM   2556  C  CG2 . ILE A 1 420  ? -28.339 -15.611 -4.966  1.00 50.16  ? 1016 ILE A CG2 1 
ATOM   2557  C  CD1 . ILE A 1 420  ? -29.418 -17.798 -3.277  1.00 56.03  ? 1016 ILE A CD1 1 
ATOM   2558  N  N   . ARG A 1 421  ? -25.004 -16.180 -5.477  1.00 50.69  ? 1017 ARG A N   1 
ATOM   2559  C  CA  . ARG A 1 421  ? -24.103 -15.312 -6.226  1.00 58.06  ? 1017 ARG A CA  1 
ATOM   2560  C  C   . ARG A 1 421  ? -24.932 -14.461 -7.174  1.00 50.31  ? 1017 ARG A C   1 
ATOM   2561  O  O   . ARG A 1 421  ? -25.738 -14.988 -7.930  1.00 50.00  ? 1017 ARG A O   1 
ATOM   2562  C  CB  . ARG A 1 421  ? -23.062 -16.120 -7.002  1.00 56.89  ? 1017 ARG A CB  1 
ATOM   2563  C  CG  . ARG A 1 421  ? -22.176 -15.266 -7.897  1.00 65.79  ? 1017 ARG A CG  1 
ATOM   2564  C  CD  . ARG A 1 421  ? -21.109 -16.096 -8.589  1.00 72.53  ? 1017 ARG A CD  1 
ATOM   2565  N  NE  . ARG A 1 421  ? -20.176 -16.693 -7.638  1.00 86.71  ? 1017 ARG A NE  1 
ATOM   2566  C  CZ  . ARG A 1 421  ? -19.084 -16.088 -7.183  1.00 89.98  ? 1017 ARG A CZ  1 
ATOM   2567  N  NH1 . ARG A 1 421  ? -18.784 -14.860 -7.589  1.00 73.21  ? 1017 ARG A NH1 1 
ATOM   2568  N  NH2 . ARG A 1 421  ? -18.291 -16.709 -6.320  1.00 75.17  ? 1017 ARG A NH2 1 
ATOM   2569  N  N   . VAL A 1 422  ? -24.742 -13.147 -7.129  1.00 47.23  ? 1018 VAL A N   1 
ATOM   2570  C  CA  . VAL A 1 422  ? -25.585 -12.236 -7.891  1.00 52.33  ? 1018 VAL A CA  1 
ATOM   2571  C  C   . VAL A 1 422  ? -24.808 -11.221 -8.717  1.00 46.05  ? 1018 VAL A C   1 
ATOM   2572  O  O   . VAL A 1 422  ? -23.674 -10.855 -8.383  1.00 48.57  ? 1018 VAL A O   1 
ATOM   2573  C  CB  . VAL A 1 422  ? -26.541 -11.447 -6.967  1.00 57.46  ? 1018 VAL A CB  1 
ATOM   2574  C  CG1 . VAL A 1 422  ? -27.567 -12.370 -6.340  1.00 50.50  ? 1018 VAL A CG1 1 
ATOM   2575  C  CG2 . VAL A 1 422  ? -25.758 -10.701 -5.898  1.00 39.91  ? 1018 VAL A CG2 1 
ATOM   2576  N  N   . ASN A 1 423  ? -25.441 -10.777 -9.800  1.00 42.74  ? 1019 ASN A N   1 
ATOM   2577  C  CA  . ASN A 1 423  ? -24.977 -9.622  -10.555 1.00 40.44  ? 1019 ASN A CA  1 
ATOM   2578  C  C   . ASN A 1 423  ? -25.530 -8.349  -9.935  1.00 42.92  ? 1019 ASN A C   1 
ATOM   2579  O  O   . ASN A 1 423  ? -26.738 -8.240  -9.709  1.00 39.10  ? 1019 ASN A O   1 
ATOM   2580  C  CB  . ASN A 1 423  ? -25.401 -9.706  -12.022 1.00 42.02  ? 1019 ASN A CB  1 
ATOM   2581  C  CG  . ASN A 1 423  ? -24.767 -10.869 -12.751 1.00 58.94  ? 1019 ASN A CG  1 
ATOM   2582  O  OD1 . ASN A 1 423  ? -25.382 -11.924 -12.916 1.00 54.84  ? 1019 ASN A OD1 1 
ATOM   2583  N  ND2 . ASN A 1 423  ? -23.531 -10.682 -13.200 1.00 49.61  ? 1019 ASN A ND2 1 
ATOM   2584  N  N   . LYS A 1 424  ? -24.646 -7.395  -9.662  1.00 29.85  ? 1020 LYS A N   1 
ATOM   2585  C  CA  . LYS A 1 424  ? -25.056 -6.111  -9.110  1.00 34.77  ? 1020 LYS A CA  1 
ATOM   2586  C  C   . LYS A 1 424  ? -25.786 -5.275  -10.151 1.00 42.71  ? 1020 LYS A C   1 
ATOM   2587  O  O   . LYS A 1 424  ? -25.407 -5.253  -11.321 1.00 42.49  ? 1020 LYS A O   1 
ATOM   2588  C  CB  . LYS A 1 424  ? -23.850 -5.323  -8.594  1.00 38.18  ? 1020 LYS A CB  1 
ATOM   2589  C  CG  . LYS A 1 424  ? -22.925 -6.075  -7.656  1.00 43.82  ? 1020 LYS A CG  1 
ATOM   2590  C  CD  . LYS A 1 424  ? -21.787 -5.164  -7.216  1.00 35.67  ? 1020 LYS A CD  1 
ATOM   2591  C  CE  . LYS A 1 424  ? -20.646 -5.941  -6.584  1.00 51.16  ? 1020 LYS A CE  1 
ATOM   2592  N  NZ  . LYS A 1 424  ? -19.469 -5.062  -6.331  1.00 53.36  ? 1020 LYS A NZ  1 
ATOM   2593  N  N   . PHE A 1 425  ? -26.835 -4.586  -9.718  1.00 38.91  ? 1021 PHE A N   1 
ATOM   2594  C  CA  . PHE A 1 425  ? -27.461 -3.565  -10.543 1.00 34.22  ? 1021 PHE A CA  1 
ATOM   2595  C  C   . PHE A 1 425  ? -27.141 -2.193  -9.970  1.00 38.87  ? 1021 PHE A C   1 
ATOM   2596  O  O   . PHE A 1 425  ? -27.071 -2.020  -8.755  1.00 42.80  ? 1021 PHE A O   1 
ATOM   2597  C  CB  . PHE A 1 425  ? -28.974 -3.767  -10.625 1.00 37.29  ? 1021 PHE A CB  1 
ATOM   2598  C  CG  . PHE A 1 425  ? -29.390 -4.873  -11.549 1.00 36.47  ? 1021 PHE A CG  1 
ATOM   2599  C  CD1 . PHE A 1 425  ? -29.543 -4.637  -12.904 1.00 38.08  ? 1021 PHE A CD1 1 
ATOM   2600  C  CD2 . PHE A 1 425  ? -29.632 -6.145  -11.064 1.00 37.24  ? 1021 PHE A CD2 1 
ATOM   2601  C  CE1 . PHE A 1 425  ? -29.927 -5.652  -13.759 1.00 45.11  ? 1021 PHE A CE1 1 
ATOM   2602  C  CE2 . PHE A 1 425  ? -30.017 -7.164  -11.914 1.00 36.36  ? 1021 PHE A CE2 1 
ATOM   2603  C  CZ  . PHE A 1 425  ? -30.164 -6.917  -13.263 1.00 36.90  ? 1021 PHE A CZ  1 
ATOM   2604  N  N   . TYR A 1 426  ? -26.935 -1.221  -10.850 1.00 42.08  ? 1022 TYR A N   1 
ATOM   2605  C  CA  . TYR A 1 426  ? -26.697 0.148   -10.419 1.00 35.81  ? 1022 TYR A CA  1 
ATOM   2606  C  C   . TYR A 1 426  ? -27.976 0.964   -10.500 1.00 40.20  ? 1022 TYR A C   1 
ATOM   2607  O  O   . TYR A 1 426  ? -28.672 0.929   -11.506 1.00 42.65  ? 1022 TYR A O   1 
ATOM   2608  C  CB  . TYR A 1 426  ? -25.620 0.810   -11.279 1.00 42.49  ? 1022 TYR A CB  1 
ATOM   2609  C  CG  . TYR A 1 426  ? -24.199 0.533   -10.849 1.00 36.21  ? 1022 TYR A CG  1 
ATOM   2610  C  CD1 . TYR A 1 426  ? -23.588 -0.678  -11.139 1.00 38.44  ? 1022 TYR A CD1 1 
ATOM   2611  C  CD2 . TYR A 1 426  ? -23.463 1.492   -10.166 1.00 40.28  ? 1022 TYR A CD2 1 
ATOM   2612  C  CE1 . TYR A 1 426  ? -22.284 -0.931  -10.754 1.00 48.51  ? 1022 TYR A CE1 1 
ATOM   2613  C  CE2 . TYR A 1 426  ? -22.161 1.251   -9.778  1.00 51.62  ? 1022 TYR A CE2 1 
ATOM   2614  C  CZ  . TYR A 1 426  ? -21.576 0.038   -10.073 1.00 45.30  ? 1022 TYR A CZ  1 
ATOM   2615  O  OH  . TYR A 1 426  ? -20.278 -0.206  -9.687  1.00 44.20  ? 1022 TYR A OH  1 
ATOM   2616  N  N   . ARG A 1 427  ? -28.298 1.693   -9.439  1.00 37.91  ? 1023 ARG A N   1 
ATOM   2617  C  CA  . ARG A 1 427  ? -29.286 2.750   -9.569  1.00 33.84  ? 1023 ARG A CA  1 
ATOM   2618  C  C   . ARG A 1 427  ? -28.532 3.937   -10.141 1.00 38.36  ? 1023 ARG A C   1 
ATOM   2619  O  O   . ARG A 1 427  ? -27.335 4.076   -9.890  1.00 42.06  ? 1023 ARG A O   1 
ATOM   2620  C  CB  . ARG A 1 427  ? -29.939 3.093   -8.230  1.00 37.19  ? 1023 ARG A CB  1 
ATOM   2621  C  CG  . ARG A 1 427  ? -30.740 1.956   -7.621  1.00 39.41  ? 1023 ARG A CG  1 
ATOM   2622  C  CD  . ARG A 1 427  ? -31.331 2.362   -6.283  1.00 42.10  ? 1023 ARG A CD  1 
ATOM   2623  N  NE  . ARG A 1 427  ? -31.918 1.231   -5.572  1.00 38.15  ? 1023 ARG A NE  1 
ATOM   2624  C  CZ  . ARG A 1 427  ? -33.200 0.887   -5.640  1.00 38.49  ? 1023 ARG A CZ  1 
ATOM   2625  N  NH1 . ARG A 1 427  ? -34.038 1.587   -6.392  1.00 42.02  ? 1023 ARG A NH1 1 
ATOM   2626  N  NH2 . ARG A 1 427  ? -33.645 -0.158  -4.954  1.00 34.33  ? 1023 ARG A NH2 1 
ATOM   2627  N  N   . PRO A 1 428  ? -29.212 4.782   -10.933 1.00 35.98  ? 1024 PRO A N   1 
ATOM   2628  C  CA  . PRO A 1 428  ? -28.567 5.973   -11.498 1.00 32.19  ? 1024 PRO A CA  1 
ATOM   2629  C  C   . PRO A 1 428  ? -27.795 6.775   -10.451 1.00 34.08  ? 1024 PRO A C   1 
ATOM   2630  O  O   . PRO A 1 428  ? -26.738 7.329   -10.750 1.00 38.31  ? 1024 PRO A O   1 
ATOM   2631  C  CB  . PRO A 1 428  ? -29.747 6.776   -12.043 1.00 28.83  ? 1024 PRO A CB  1 
ATOM   2632  C  CG  . PRO A 1 428  ? -30.741 5.736   -12.424 1.00 25.80  ? 1024 PRO A CG  1 
ATOM   2633  C  CD  . PRO A 1 428  ? -30.602 4.636   -11.401 1.00 27.72  ? 1024 PRO A CD  1 
ATOM   2634  N  N   . GLU A 1 429  ? -28.309 6.800   -9.226  1.00 40.99  ? 1025 GLU A N   1 
ATOM   2635  C  CA  . GLU A 1 429  ? -27.668 7.525   -8.138  1.00 43.63  ? 1025 GLU A CA  1 
ATOM   2636  C  C   . GLU A 1 429  ? -26.477 6.769   -7.549  1.00 44.05  ? 1025 GLU A C   1 
ATOM   2637  O  O   . GLU A 1 429  ? -25.736 7.317   -6.735  1.00 44.29  ? 1025 GLU A O   1 
ATOM   2638  C  CB  . GLU A 1 429  ? -28.685 7.832   -7.033  1.00 38.25  ? 1025 GLU A CB  1 
ATOM   2639  C  CG  . GLU A 1 429  ? -29.457 6.621   -6.530  1.00 27.02  ? 1025 GLU A CG  1 
ATOM   2640  C  CD  . GLU A 1 429  ? -30.750 6.391   -7.288  1.00 37.60  ? 1025 GLU A CD  1 
ATOM   2641  O  OE1 . GLU A 1 429  ? -30.885 6.912   -8.415  1.00 41.71  ? 1025 GLU A OE1 1 
ATOM   2642  O  OE2 . GLU A 1 429  ? -31.635 5.692   -6.750  1.00 38.71  ? 1025 GLU A OE2 1 
ATOM   2643  N  N   . ASN A 1 430  ? -26.293 5.517   -7.955  1.00 38.35  ? 1026 ASN A N   1 
ATOM   2644  C  CA  . ASN A 1 430  ? -25.163 4.729   -7.470  1.00 42.04  ? 1026 ASN A CA  1 
ATOM   2645  C  C   . ASN A 1 430  ? -23.920 4.917   -8.330  1.00 43.67  ? 1026 ASN A C   1 
ATOM   2646  O  O   . ASN A 1 430  ? -22.814 4.563   -7.923  1.00 49.23  ? 1026 ASN A O   1 
ATOM   2647  C  CB  . ASN A 1 430  ? -25.522 3.242   -7.407  1.00 36.61  ? 1026 ASN A CB  1 
ATOM   2648  C  CG  . ASN A 1 430  ? -26.564 2.939   -6.352  1.00 36.48  ? 1026 ASN A CG  1 
ATOM   2649  O  OD1 . ASN A 1 430  ? -27.433 2.089   -6.548  1.00 43.61  ? 1026 ASN A OD1 1 
ATOM   2650  N  ND2 . ASN A 1 430  ? -26.484 3.636   -5.225  1.00 35.51  ? 1026 ASN A ND2 1 
ATOM   2651  N  N   . THR A 1 431  ? -24.107 5.477   -9.520  1.00 41.39  ? 1027 THR A N   1 
ATOM   2652  C  CA  . THR A 1 431  ? -22.995 5.709   -10.434 1.00 42.86  ? 1027 THR A CA  1 
ATOM   2653  C  C   . THR A 1 431  ? -22.146 6.892   -9.982  1.00 40.01  ? 1027 THR A C   1 
ATOM   2654  O  O   . THR A 1 431  ? -22.315 7.409   -8.877  1.00 36.38  ? 1027 THR A O   1 
ATOM   2655  C  CB  . THR A 1 431  ? -23.484 5.968   -11.871 1.00 38.90  ? 1027 THR A CB  1 
ATOM   2656  O  OG1 . THR A 1 431  ? -24.128 7.246   -11.938 1.00 45.17  ? 1027 THR A OG1 1 
ATOM   2657  C  CG2 . THR A 1 431  ? -24.457 4.885   -12.306 1.00 36.78  ? 1027 THR A CG2 1 
ATOM   2658  N  N   . HIS A 1 432  ? -21.235 7.319   -10.848 1.00 33.00  ? 1028 HIS A N   1 
ATOM   2659  C  CA  . HIS A 1 432  ? -20.366 8.447   -10.545 1.00 36.60  ? 1028 HIS A CA  1 
ATOM   2660  C  C   . HIS A 1 432  ? -21.124 9.766   -10.649 1.00 47.38  ? 1028 HIS A C   1 
ATOM   2661  O  O   . HIS A 1 432  ? -20.699 10.780  -10.094 1.00 45.10  ? 1028 HIS A O   1 
ATOM   2662  C  CB  . HIS A 1 432  ? -19.160 8.459   -11.482 1.00 33.59  ? 1028 HIS A CB  1 
ATOM   2663  C  CG  . HIS A 1 432  ? -19.517 8.646   -12.922 1.00 44.71  ? 1028 HIS A CG  1 
ATOM   2664  N  ND1 . HIS A 1 432  ? -19.929 7.607   -13.729 1.00 43.57  ? 1028 HIS A ND1 1 
ATOM   2665  C  CD2 . HIS A 1 432  ? -19.529 9.753   -13.701 1.00 43.53  ? 1028 HIS A CD2 1 
ATOM   2666  C  CE1 . HIS A 1 432  ? -20.176 8.065   -14.942 1.00 46.66  ? 1028 HIS A CE1 1 
ATOM   2667  N  NE2 . HIS A 1 432  ? -19.942 9.365   -14.953 1.00 44.16  ? 1028 HIS A NE2 1 
ATOM   2668  N  N   . LYS A 1 433  ? -22.249 9.746   -11.359 1.00 47.93  ? 1029 LYS A N   1 
ATOM   2669  C  CA  . LYS A 1 433  ? -23.081 10.935  -11.507 1.00 44.65  ? 1029 LYS A CA  1 
ATOM   2670  C  C   . LYS A 1 433  ? -23.851 11.221  -10.221 1.00 52.72  ? 1029 LYS A C   1 
ATOM   2671  O  O   . LYS A 1 433  ? -24.405 12.308  -10.050 1.00 45.09  ? 1029 LYS A O   1 
ATOM   2672  C  CB  . LYS A 1 433  ? -24.043 10.774  -12.686 1.00 42.27  ? 1029 LYS A CB  1 
ATOM   2673  C  CG  . LYS A 1 433  ? -23.349 10.504  -14.010 1.00 42.90  ? 1029 LYS A CG  1 
ATOM   2674  C  CD  . LYS A 1 433  ? -24.286 10.729  -15.184 1.00 58.90  ? 1029 LYS A CD  1 
ATOM   2675  C  CE  . LYS A 1 433  ? -25.514 9.839   -15.097 1.00 66.90  ? 1029 LYS A CE  1 
ATOM   2676  N  NZ  . LYS A 1 433  ? -26.430 10.055  -16.251 1.00 65.51  ? 1029 LYS A NZ  1 
ATOM   2677  N  N   . SER A 1 434  ? -23.884 10.226  -9.336  1.00 45.03  ? 1030 SER A N   1 
ATOM   2678  C  CA  . SER A 1 434  ? -24.417 10.368  -7.983  1.00 42.71  ? 1030 SER A CA  1 
ATOM   2679  C  C   . SER A 1 434  ? -25.885 10.777  -7.944  1.00 49.45  ? 1030 SER A C   1 
ATOM   2680  O  O   . SER A 1 434  ? -26.615 10.586  -8.910  1.00 51.95  ? 1030 SER A O   1 
ATOM   2681  C  CB  . SER A 1 434  ? -23.582 11.376  -7.189  1.00 32.28  ? 1030 SER A CB  1 
ATOM   2682  O  OG  . SER A 1 434  ? -24.061 11.476  -5.863  1.00 41.29  ? 1030 SER A OG  1 
ATOM   2683  N  N   . THR A 1 435  ? -26.296 11.338  -6.812  1.00 45.91  ? 1031 THR A N   1 
ATOM   2684  C  CA  . THR A 1 435  ? -27.687 11.714  -6.553  1.00 44.06  ? 1031 THR A CA  1 
ATOM   2685  C  C   . THR A 1 435  ? -28.378 12.507  -7.675  1.00 46.05  ? 1031 THR A C   1 
ATOM   2686  O  O   . THR A 1 435  ? -29.543 12.240  -7.977  1.00 45.47  ? 1031 THR A O   1 
ATOM   2687  C  CB  . THR A 1 435  ? -27.791 12.529  -5.239  1.00 42.10  ? 1031 THR A CB  1 
ATOM   2688  O  OG1 . THR A 1 435  ? -27.095 11.842  -4.195  1.00 41.86  ? 1031 THR A OG1 1 
ATOM   2689  C  CG2 . THR A 1 435  ? -29.231 12.731  -4.814  1.00 35.30  ? 1031 THR A CG2 1 
ATOM   2690  N  N   . PRO A 1 436  ? -27.686 13.481  -8.299  1.00 43.97  ? 1032 PRO A N   1 
ATOM   2691  C  CA  . PRO A 1 436  ? -28.461 14.199  -9.318  1.00 41.04  ? 1032 PRO A CA  1 
ATOM   2692  C  C   . PRO A 1 436  ? -28.881 13.347  -10.515 1.00 37.02  ? 1032 PRO A C   1 
ATOM   2693  O  O   . PRO A 1 436  ? -29.686 13.819  -11.313 1.00 39.89  ? 1032 PRO A O   1 
ATOM   2694  C  CB  . PRO A 1 436  ? -27.509 15.309  -9.765  1.00 28.45  ? 1032 PRO A CB  1 
ATOM   2695  C  CG  . PRO A 1 436  ? -26.584 15.491  -8.647  1.00 27.97  ? 1032 PRO A CG  1 
ATOM   2696  C  CD  . PRO A 1 436  ? -26.401 14.148  -8.026  1.00 33.87  ? 1032 PRO A CD  1 
ATOM   2697  N  N   . ALA A 1 437  ? -28.361 12.131  -10.645 1.00 31.45  ? 1033 ALA A N   1 
ATOM   2698  C  CA  . ALA A 1 437  ? -28.789 11.258  -11.733 1.00 38.48  ? 1033 ALA A CA  1 
ATOM   2699  C  C   . ALA A 1 437  ? -30.195 10.729  -11.497 1.00 41.38  ? 1033 ALA A C   1 
ATOM   2700  O  O   . ALA A 1 437  ? -30.819 10.184  -12.407 1.00 41.87  ? 1033 ALA A O   1 
ATOM   2701  C  CB  . ALA A 1 437  ? -27.829 10.107  -11.900 1.00 29.75  ? 1033 ALA A CB  1 
ATOM   2702  N  N   . SER A 1 438  ? -30.689 10.881  -10.273 1.00 39.70  ? 1034 SER A N   1 
ATOM   2703  C  CA  . SER A 1 438  ? -32.003 10.360  -9.928  1.00 37.63  ? 1034 SER A CA  1 
ATOM   2704  C  C   . SER A 1 438  ? -33.124 11.311  -10.340 1.00 41.67  ? 1034 SER A C   1 
ATOM   2705  O  O   . SER A 1 438  ? -34.250 10.878  -10.561 1.00 49.82  ? 1034 SER A O   1 
ATOM   2706  C  CB  . SER A 1 438  ? -32.075 10.059  -8.421  1.00 33.59  ? 1034 SER A CB  1 
ATOM   2707  O  OG  . SER A 1 438  ? -31.546 11.140  -7.663  1.00 52.44  ? 1034 SER A OG  1 
ATOM   2708  N  N   . TYR A 1 439  ? -32.798 12.595  -10.469 1.00 42.52  ? 1035 TYR A N   1 
ATOM   2709  C  CA  . TYR A 1 439  ? -33.789 13.641  -10.739 1.00 34.23  ? 1035 TYR A CA  1 
ATOM   2710  C  C   . TYR A 1 439  ? -34.717 13.324  -11.923 1.00 42.38  ? 1035 TYR A C   1 
ATOM   2711  O  O   . TYR A 1 439  ? -35.937 13.249  -11.759 1.00 51.42  ? 1035 TYR A O   1 
ATOM   2712  C  CB  . TYR A 1 439  ? -33.086 14.983  -10.986 1.00 34.21  ? 1035 TYR A CB  1 
ATOM   2713  C  CG  . TYR A 1 439  ? -32.261 15.499  -9.814  1.00 36.07  ? 1035 TYR A CG  1 
ATOM   2714  C  CD1 . TYR A 1 439  ? -32.299 14.871  -8.574  1.00 43.30  ? 1035 TYR A CD1 1 
ATOM   2715  C  CD2 . TYR A 1 439  ? -31.442 16.616  -9.952  1.00 35.57  ? 1035 TYR A CD2 1 
ATOM   2716  C  CE1 . TYR A 1 439  ? -31.550 15.334  -7.510  1.00 36.08  ? 1035 TYR A CE1 1 
ATOM   2717  C  CE2 . TYR A 1 439  ? -30.689 17.089  -8.887  1.00 37.57  ? 1035 TYR A CE2 1 
ATOM   2718  C  CZ  . TYR A 1 439  ? -30.748 16.441  -7.668  1.00 39.80  ? 1035 TYR A CZ  1 
ATOM   2719  O  OH  . TYR A 1 439  ? -30.007 16.895  -6.600  1.00 42.80  ? 1035 TYR A OH  1 
ATOM   2720  N  N   . HIS A 1 440  ? -34.141 13.146  -13.108 1.00 34.76  ? 1036 HIS A N   1 
ATOM   2721  C  CA  . HIS A 1 440  ? -34.925 12.857  -14.308 1.00 37.00  ? 1036 HIS A CA  1 
ATOM   2722  C  C   . HIS A 1 440  ? -35.344 11.391  -14.423 1.00 35.74  ? 1036 HIS A C   1 
ATOM   2723  O  O   . HIS A 1 440  ? -36.402 11.088  -14.969 1.00 36.26  ? 1036 HIS A O   1 
ATOM   2724  C  CB  . HIS A 1 440  ? -34.144 13.258  -15.563 1.00 47.53  ? 1036 HIS A CB  1 
ATOM   2725  C  CG  . HIS A 1 440  ? -34.794 12.827  -16.841 1.00 50.99  ? 1036 HIS A CG  1 
ATOM   2726  N  ND1 . HIS A 1 440  ? -35.791 13.558  -17.457 1.00 67.78  ? 1036 HIS A ND1 1 
ATOM   2727  C  CD2 . HIS A 1 440  ? -34.603 11.733  -17.617 1.00 43.54  ? 1036 HIS A CD2 1 
ATOM   2728  C  CE1 . HIS A 1 440  ? -36.177 12.938  -18.555 1.00 47.40  ? 1036 HIS A CE1 1 
ATOM   2729  N  NE2 . HIS A 1 440  ? -35.472 11.825  -18.676 1.00 55.98  ? 1036 HIS A NE2 1 
ATOM   2730  N  N   . ALA A 1 441  ? -34.518 10.485  -13.910 1.00 34.29  ? 1037 ALA A N   1 
ATOM   2731  C  CA  . ALA A 1 441  ? -34.695 9.053   -14.156 1.00 33.65  ? 1037 ALA A CA  1 
ATOM   2732  C  C   . ALA A 1 441  ? -35.969 8.462   -13.551 1.00 30.98  ? 1037 ALA A C   1 
ATOM   2733  O  O   . ALA A 1 441  ? -36.457 8.930   -12.523 1.00 42.16  ? 1037 ALA A O   1 
ATOM   2734  C  CB  . ALA A 1 441  ? -33.481 8.294   -13.642 1.00 31.43  ? 1037 ALA A CB  1 
ATOM   2735  N  N   . ASP A 1 442  ? -36.502 7.431   -14.203 1.00 40.19  ? 1038 ASP A N   1 
ATOM   2736  C  CA  . ASP A 1 442  ? -37.605 6.652   -13.646 1.00 35.25  ? 1038 ASP A CA  1 
ATOM   2737  C  C   . ASP A 1 442  ? -37.145 5.988   -12.358 1.00 34.98  ? 1038 ASP A C   1 
ATOM   2738  O  O   . ASP A 1 442  ? -35.969 5.656   -12.217 1.00 55.14  ? 1038 ASP A O   1 
ATOM   2739  C  CB  . ASP A 1 442  ? -38.095 5.591   -14.633 1.00 39.36  ? 1038 ASP A CB  1 
ATOM   2740  C  CG  . ASP A 1 442  ? -38.816 6.184   -15.823 1.00 36.52  ? 1038 ASP A CG  1 
ATOM   2741  O  OD1 . ASP A 1 442  ? -39.312 7.323   -15.712 1.00 50.61  ? 1038 ASP A OD1 1 
ATOM   2742  O  OD2 . ASP A 1 442  ? -38.894 5.503   -16.867 1.00 34.32  ? 1038 ASP A OD2 1 
ATOM   2743  N  N   . ILE A 1 443  ? -38.063 5.782   -11.420 1.00 33.80  ? 1039 ILE A N   1 
ATOM   2744  C  CA  . ILE A 1 443  ? -37.688 5.194   -10.141 1.00 37.53  ? 1039 ILE A CA  1 
ATOM   2745  C  C   . ILE A 1 443  ? -37.337 3.715   -10.274 1.00 34.51  ? 1039 ILE A C   1 
ATOM   2746  O  O   . ILE A 1 443  ? -36.620 3.169   -9.439  1.00 49.70  ? 1039 ILE A O   1 
ATOM   2747  C  CB  . ILE A 1 443  ? -38.800 5.352   -9.087  1.00 38.36  ? 1039 ILE A CB  1 
ATOM   2748  C  CG1 . ILE A 1 443  ? -40.103 4.722   -9.576  1.00 38.45  ? 1039 ILE A CG1 1 
ATOM   2749  C  CG2 . ILE A 1 443  ? -39.008 6.819   -8.745  1.00 31.37  ? 1039 ILE A CG2 1 
ATOM   2750  C  CD1 . ILE A 1 443  ? -41.175 4.664   -8.513  1.00 43.70  ? 1039 ILE A CD1 1 
ATOM   2751  N  N   . ASN A 1 444  ? -37.852 3.063   -11.312 1.00 33.68  ? 1040 ASN A N   1 
ATOM   2752  C  CA  . ASN A 1 444  ? -37.554 1.652   -11.534 1.00 33.26  ? 1040 ASN A CA  1 
ATOM   2753  C  C   . ASN A 1 444  ? -36.414 1.409   -12.524 1.00 27.90  ? 1040 ASN A C   1 
ATOM   2754  O  O   . ASN A 1 444  ? -36.108 0.263   -12.851 1.00 35.57  ? 1040 ASN A O   1 
ATOM   2755  C  CB  . ASN A 1 444  ? -38.809 0.910   -11.995 1.00 29.20  ? 1040 ASN A CB  1 
ATOM   2756  C  CG  . ASN A 1 444  ? -39.425 1.516   -13.237 1.00 42.80  ? 1040 ASN A CG  1 
ATOM   2757  O  OD1 . ASN A 1 444  ? -39.352 2.725   -13.456 1.00 45.26  ? 1040 ASN A OD1 1 
ATOM   2758  N  ND2 . ASN A 1 444  ? -40.043 0.674   -14.057 1.00 39.45  ? 1040 ASN A ND2 1 
ATOM   2759  N  N   . LEU A 1 445  ? -35.797 2.482   -13.010 1.00 36.23  ? 1041 LEU A N   1 
ATOM   2760  C  CA  . LEU A 1 445  ? -34.680 2.355   -13.945 1.00 37.94  ? 1041 LEU A CA  1 
ATOM   2761  C  C   . LEU A 1 445  ? -33.401 1.888   -13.255 1.00 32.11  ? 1041 LEU A C   1 
ATOM   2762  O  O   . LEU A 1 445  ? -33.023 2.411   -12.207 1.00 43.32  ? 1041 LEU A O   1 
ATOM   2763  C  CB  . LEU A 1 445  ? -34.413 3.684   -14.654 1.00 40.00  ? 1041 LEU A CB  1 
ATOM   2764  C  CG  . LEU A 1 445  ? -33.194 3.683   -15.582 1.00 33.53  ? 1041 LEU A CG  1 
ATOM   2765  C  CD1 . LEU A 1 445  ? -33.499 2.948   -16.878 1.00 24.05  ? 1041 LEU A CD1 1 
ATOM   2766  C  CD2 . LEU A 1 445  ? -32.707 5.096   -15.859 1.00 39.33  ? 1041 LEU A CD2 1 
ATOM   2767  N  N   . LEU A 1 446  ? -32.737 0.904   -13.855 1.00 37.56  ? 1042 LEU A N   1 
ATOM   2768  C  CA  . LEU A 1 446  ? -31.453 0.420   -13.358 1.00 39.53  ? 1042 LEU A CA  1 
ATOM   2769  C  C   . LEU A 1 446  ? -30.436 0.301   -14.490 1.00 40.24  ? 1042 LEU A C   1 
ATOM   2770  O  O   . LEU A 1 446  ? -30.757 0.526   -15.657 1.00 54.52  ? 1042 LEU A O   1 
ATOM   2771  C  CB  . LEU A 1 446  ? -31.614 -0.935  -12.667 1.00 38.89  ? 1042 LEU A CB  1 
ATOM   2772  C  CG  . LEU A 1 446  ? -32.663 -1.072  -11.562 1.00 43.32  ? 1042 LEU A CG  1 
ATOM   2773  C  CD1 . LEU A 1 446  ? -32.793 -2.530  -11.155 1.00 38.01  ? 1042 LEU A CD1 1 
ATOM   2774  C  CD2 . LEU A 1 446  ? -32.308 -0.210  -10.363 1.00 28.15  ? 1042 LEU A CD2 1 
ATOM   2775  N  N   . TYR A 1 447  ? -29.207 -0.051  -14.133 1.00 31.17  ? 1043 TYR A N   1 
ATOM   2776  C  CA  . TYR A 1 447  ? -28.163 -0.339  -15.105 1.00 34.84  ? 1043 TYR A CA  1 
ATOM   2777  C  C   . TYR A 1 447  ? -27.539 -1.691  -14.792 1.00 39.75  ? 1043 TYR A C   1 
ATOM   2778  O  O   . TYR A 1 447  ? -27.301 -2.021  -13.628 1.00 37.35  ? 1043 TYR A O   1 
ATOM   2779  C  CB  . TYR A 1 447  ? -27.080 0.742   -15.105 1.00 31.99  ? 1043 TYR A CB  1 
ATOM   2780  C  CG  . TYR A 1 447  ? -27.552 2.121   -15.505 1.00 32.61  ? 1043 TYR A CG  1 
ATOM   2781  C  CD1 . TYR A 1 447  ? -27.743 2.454   -16.839 1.00 34.39  ? 1043 TYR A CD1 1 
ATOM   2782  C  CD2 . TYR A 1 447  ? -27.783 3.098   -14.546 1.00 41.20  ? 1043 TYR A CD2 1 
ATOM   2783  C  CE1 . TYR A 1 447  ? -28.166 3.719   -17.206 1.00 38.11  ? 1043 TYR A CE1 1 
ATOM   2784  C  CE2 . TYR A 1 447  ? -28.205 4.364   -14.902 1.00 44.10  ? 1043 TYR A CE2 1 
ATOM   2785  C  CZ  . TYR A 1 447  ? -28.395 4.670   -16.233 1.00 44.08  ? 1043 TYR A CZ  1 
ATOM   2786  O  OH  . TYR A 1 447  ? -28.816 5.931   -16.588 1.00 38.01  ? 1043 TYR A OH  1 
ATOM   2787  N  N   . TRP A 1 448  ? -27.279 -2.470  -15.834 1.00 42.07  ? 1044 TRP A N   1 
ATOM   2788  C  CA  . TRP A 1 448  ? -26.616 -3.755  -15.679 1.00 39.97  ? 1044 TRP A CA  1 
ATOM   2789  C  C   . TRP A 1 448  ? -25.137 -3.555  -15.368 1.00 43.89  ? 1044 TRP A C   1 
ATOM   2790  O  O   . TRP A 1 448  ? -24.532 -2.570  -15.790 1.00 44.23  ? 1044 TRP A O   1 
ATOM   2791  C  CB  . TRP A 1 448  ? -26.788 -4.601  -16.943 1.00 36.07  ? 1044 TRP A CB  1 
ATOM   2792  C  CG  . TRP A 1 448  ? -25.935 -5.831  -16.975 1.00 40.18  ? 1044 TRP A CG  1 
ATOM   2793  C  CD1 . TRP A 1 448  ? -24.678 -5.942  -17.495 1.00 40.82  ? 1044 TRP A CD1 1 
ATOM   2794  C  CD2 . TRP A 1 448  ? -26.273 -7.126  -16.464 1.00 38.90  ? 1044 TRP A CD2 1 
ATOM   2795  N  NE1 . TRP A 1 448  ? -24.213 -7.224  -17.341 1.00 51.68  ? 1044 TRP A NE1 1 
ATOM   2796  C  CE2 . TRP A 1 448  ? -25.174 -7.972  -16.711 1.00 44.36  ? 1044 TRP A CE2 1 
ATOM   2797  C  CE3 . TRP A 1 448  ? -27.398 -7.653  -15.823 1.00 40.66  ? 1044 TRP A CE3 1 
ATOM   2798  C  CZ2 . TRP A 1 448  ? -25.165 -9.313  -16.340 1.00 40.72  ? 1044 TRP A CZ2 1 
ATOM   2799  C  CZ3 . TRP A 1 448  ? -27.388 -8.985  -15.456 1.00 41.71  ? 1044 TRP A CZ3 1 
ATOM   2800  C  CH2 . TRP A 1 448  ? -26.279 -9.800  -15.715 1.00 46.40  ? 1044 TRP A CH2 1 
ATOM   2801  N  N   . SER A 1 449  ? -24.561 -4.484  -14.615 1.00 40.78  ? 1045 SER A N   1 
ATOM   2802  C  CA  . SER A 1 449  ? -23.128 -4.472  -14.364 1.00 41.21  ? 1045 SER A CA  1 
ATOM   2803  C  C   . SER A 1 449  ? -22.599 -5.898  -14.346 1.00 45.45  ? 1045 SER A C   1 
ATOM   2804  O  O   . SER A 1 449  ? -23.325 -6.835  -14.014 1.00 40.70  ? 1045 SER A O   1 
ATOM   2805  C  CB  . SER A 1 449  ? -22.805 -3.766  -13.045 1.00 43.55  ? 1045 SER A CB  1 
ATOM   2806  O  OG  . SER A 1 449  ? -23.153 -4.572  -11.933 1.00 55.71  ? 1045 SER A OG  1 
ATOM   2807  N  N   . ASP A 1 450  ? -21.333 -6.059  -14.712 1.00 53.95  ? 1046 ASP A N   1 
ATOM   2808  C  CA  . ASP A 1 450  ? -20.704 -7.370  -14.698 1.00 58.07  ? 1046 ASP A CA  1 
ATOM   2809  C  C   . ASP A 1 450  ? -20.092 -7.657  -13.333 1.00 65.70  ? 1046 ASP A C   1 
ATOM   2810  O  O   . ASP A 1 450  ? -19.547 -8.736  -13.100 1.00 63.65  ? 1046 ASP A O   1 
ATOM   2811  C  CB  . ASP A 1 450  ? -19.648 -7.468  -15.798 1.00 50.25  ? 1046 ASP A CB  1 
ATOM   2812  C  CG  . ASP A 1 450  ? -20.260 -7.644  -17.174 1.00 64.38  ? 1046 ASP A CG  1 
ATOM   2813  O  OD1 . ASP A 1 450  ? -21.207 -8.450  -17.301 1.00 64.55  ? 1046 ASP A OD1 1 
ATOM   2814  O  OD2 . ASP A 1 450  ? -19.802 -6.977  -18.125 1.00 59.49  ? 1046 ASP A OD2 1 
ATOM   2815  N  N   . GLU A 1 451  ? -20.185 -6.679  -12.435 1.00 51.05  ? 1047 GLU A N   1 
ATOM   2816  C  CA  . GLU A 1 451  ? -19.764 -6.866  -11.052 1.00 41.40  ? 1047 GLU A CA  1 
ATOM   2817  C  C   . GLU A 1 451  ? -20.614 -7.951  -10.405 1.00 49.13  ? 1047 GLU A C   1 
ATOM   2818  O  O   . GLU A 1 451  ? -21.805 -8.068  -10.692 1.00 55.17  ? 1047 GLU A O   1 
ATOM   2819  C  CB  . GLU A 1 451  ? -19.884 -5.565  -10.259 1.00 41.92  ? 1047 GLU A CB  1 
ATOM   2820  C  CG  . GLU A 1 451  ? -19.195 -4.370  -10.888 1.00 48.53  ? 1047 GLU A CG  1 
ATOM   2821  C  CD  . GLU A 1 451  ? -19.301 -3.128  -10.024 1.00 55.86  ? 1047 GLU A CD  1 
ATOM   2822  O  OE1 . GLU A 1 451  ? -19.471 -3.270  -8.794  1.00 49.02  ? 1047 GLU A OE1 1 
ATOM   2823  O  OE2 . GLU A 1 451  ? -19.219 -2.009  -10.573 1.00 49.03  ? 1047 GLU A OE2 1 
ATOM   2824  N  N   . GLU A 1 452  ? -20.001 -8.746  -9.536  1.00 50.30  ? 1048 GLU A N   1 
ATOM   2825  C  CA  . GLU A 1 452  ? -20.718 -9.826  -8.869  1.00 44.45  ? 1048 GLU A CA  1 
ATOM   2826  C  C   . GLU A 1 452  ? -20.497 -9.784  -7.364  1.00 48.95  ? 1048 GLU A C   1 
ATOM   2827  O  O   . GLU A 1 452  ? -19.592 -9.103  -6.882  1.00 51.65  ? 1048 GLU A O   1 
ATOM   2828  C  CB  . GLU A 1 452  ? -20.284 -11.183 -9.425  1.00 51.37  ? 1048 GLU A CB  1 
ATOM   2829  C  CG  . GLU A 1 452  ? -20.479 -11.328 -10.924 1.00 53.61  ? 1048 GLU A CG  1 
ATOM   2830  C  CD  . GLU A 1 452  ? -20.048 -12.685 -11.438 1.00 56.83  ? 1048 GLU A CD  1 
ATOM   2831  O  OE1 . GLU A 1 452  ? -20.045 -12.878 -12.672 1.00 66.21  ? 1048 GLU A OE1 1 
ATOM   2832  O  OE2 . GLU A 1 452  ? -19.716 -13.560 -10.611 1.00 74.71  ? 1048 GLU A OE2 1 
ATOM   2833  N  N   . ALA A 1 453  ? -21.329 -10.512 -6.625  1.00 43.00  ? 1049 ALA A N   1 
ATOM   2834  C  CA  . ALA A 1 453  ? -21.166 -10.600 -5.176  1.00 43.89  ? 1049 ALA A CA  1 
ATOM   2835  C  C   . ALA A 1 453  ? -21.875 -11.821 -4.607  1.00 44.14  ? 1049 ALA A C   1 
ATOM   2836  O  O   . ALA A 1 453  ? -22.899 -12.246 -5.129  1.00 46.08  ? 1049 ALA A O   1 
ATOM   2837  C  CB  . ALA A 1 453  ? -21.678 -9.333  -4.505  1.00 35.60  ? 1049 ALA A CB  1 
ATOM   2838  N  N   . VAL A 1 454  ? -21.331 -12.385 -3.534  1.00 58.86  ? 1050 VAL A N   1 
ATOM   2839  C  CA  . VAL A 1 454  ? -21.985 -13.500 -2.856  1.00 60.77  ? 1050 VAL A CA  1 
ATOM   2840  C  C   . VAL A 1 454  ? -22.626 -13.046 -1.549  1.00 49.08  ? 1050 VAL A C   1 
ATOM   2841  O  O   . VAL A 1 454  ? -22.001 -12.363 -0.738  1.00 46.37  ? 1050 VAL A O   1 
ATOM   2842  C  CB  . VAL A 1 454  ? -21.005 -14.656 -2.566  1.00 53.60  ? 1050 VAL A CB  1 
ATOM   2843  C  CG1 . VAL A 1 454  ? -20.818 -15.517 -3.806  1.00 61.37  ? 1050 VAL A CG1 1 
ATOM   2844  C  CG2 . VAL A 1 454  ? -19.672 -14.119 -2.070  1.00 73.05  ? 1050 VAL A CG2 1 
ATOM   2845  N  N   . VAL A 1 455  ? -23.885 -13.424 -1.359  1.00 49.10  ? 1051 VAL A N   1 
ATOM   2846  C  CA  . VAL A 1 455  ? -24.622 -13.073 -0.153  1.00 42.47  ? 1051 VAL A CA  1 
ATOM   2847  C  C   . VAL A 1 455  ? -25.346 -14.292 0.400   1.00 51.46  ? 1051 VAL A C   1 
ATOM   2848  O  O   . VAL A 1 455  ? -25.619 -15.244 -0.330  1.00 54.05  ? 1051 VAL A O   1 
ATOM   2849  C  CB  . VAL A 1 455  ? -25.651 -11.953 -0.418  1.00 41.97  ? 1051 VAL A CB  1 
ATOM   2850  C  CG1 . VAL A 1 455  ? -24.954 -10.677 -0.859  1.00 37.10  ? 1051 VAL A CG1 1 
ATOM   2851  C  CG2 . VAL A 1 455  ? -26.666 -12.399 -1.460  1.00 36.46  ? 1051 VAL A CG2 1 
ATOM   2852  N  N   . ASP A 1 456  ? -25.646 -14.265 1.693   1.00 47.09  ? 1052 ASP A N   1 
ATOM   2853  C  CA  . ASP A 1 456  ? -26.447 -15.318 2.301   1.00 60.93  ? 1052 ASP A CA  1 
ATOM   2854  C  C   . ASP A 1 456  ? -27.879 -15.239 1.787   1.00 58.75  ? 1052 ASP A C   1 
ATOM   2855  O  O   . ASP A 1 456  ? -28.372 -14.158 1.468   1.00 59.04  ? 1052 ASP A O   1 
ATOM   2856  C  CB  . ASP A 1 456  ? -26.423 -15.212 3.827   1.00 72.81  ? 1052 ASP A CB  1 
ATOM   2857  C  CG  . ASP A 1 456  ? -25.085 -15.603 4.419   1.00 77.91  ? 1052 ASP A CG  1 
ATOM   2858  O  OD1 . ASP A 1 456  ? -24.478 -16.577 3.928   1.00 86.06  ? 1052 ASP A OD1 1 
ATOM   2859  O  OD2 . ASP A 1 456  ? -24.638 -14.933 5.373   1.00 90.27  ? 1052 ASP A OD2 1 
ATOM   2860  N  N   . PHE A 1 457  ? -28.543 -16.387 1.710   1.00 46.82  ? 1053 PHE A N   1 
ATOM   2861  C  CA  . PHE A 1 457  ? -29.933 -16.431 1.273   1.00 50.95  ? 1053 PHE A CA  1 
ATOM   2862  C  C   . PHE A 1 457  ? -30.841 -15.799 2.325   1.00 65.87  ? 1053 PHE A C   1 
ATOM   2863  O  O   . PHE A 1 457  ? -31.971 -15.407 2.033   1.00 60.95  ? 1053 PHE A O   1 
ATOM   2864  C  CB  . PHE A 1 457  ? -30.356 -17.874 0.986   1.00 55.49  ? 1053 PHE A CB  1 
ATOM   2865  C  CG  . PHE A 1 457  ? -31.679 -17.996 0.285   1.00 48.85  ? 1053 PHE A CG  1 
ATOM   2866  C  CD1 . PHE A 1 457  ? -32.025 -17.117 -0.728  1.00 49.11  ? 1053 PHE A CD1 1 
ATOM   2867  C  CD2 . PHE A 1 457  ? -32.577 -18.988 0.640   1.00 42.71  ? 1053 PHE A CD2 1 
ATOM   2868  C  CE1 . PHE A 1 457  ? -33.242 -17.227 -1.375  1.00 54.25  ? 1053 PHE A CE1 1 
ATOM   2869  C  CE2 . PHE A 1 457  ? -33.794 -19.105 -0.005  1.00 47.99  ? 1053 PHE A CE2 1 
ATOM   2870  C  CZ  . PHE A 1 457  ? -34.127 -18.223 -1.012  1.00 59.93  ? 1053 PHE A CZ  1 
ATOM   2871  N  N   . LYS A 1 458  ? -30.331 -15.698 3.550   1.00 64.89  ? 1054 LYS A N   1 
ATOM   2872  C  CA  . LYS A 1 458  ? -31.057 -15.063 4.647   1.00 64.77  ? 1054 LYS A CA  1 
ATOM   2873  C  C   . LYS A 1 458  ? -31.266 -13.574 4.396   1.00 65.67  ? 1054 LYS A C   1 
ATOM   2874  O  O   . LYS A 1 458  ? -32.271 -13.000 4.817   1.00 53.86  ? 1054 LYS A O   1 
ATOM   2875  C  CB  . LYS A 1 458  ? -30.310 -15.256 5.969   1.00 66.36  ? 1054 LYS A CB  1 
ATOM   2876  C  CG  . LYS A 1 458  ? -30.256 -16.689 6.469   1.00 72.36  ? 1054 LYS A CG  1 
ATOM   2877  C  CD  . LYS A 1 458  ? -29.296 -16.812 7.642   1.00 61.04  ? 1054 LYS A CD  1 
ATOM   2878  C  CE  . LYS A 1 458  ? -29.203 -18.244 8.139   1.00 71.39  ? 1054 LYS A CE  1 
ATOM   2879  N  NZ  . LYS A 1 458  ? -28.074 -18.417 9.094   1.00 77.21  ? 1054 LYS A NZ  1 
ATOM   2880  N  N   . ALA A 1 459  ? -30.310 -12.956 3.709   1.00 57.42  ? 1055 ALA A N   1 
ATOM   2881  C  CA  . ALA A 1 459  ? -30.319 -11.513 3.498   1.00 50.55  ? 1055 ALA A CA  1 
ATOM   2882  C  C   . ALA A 1 459  ? -31.333 -11.084 2.440   1.00 50.40  ? 1055 ALA A C   1 
ATOM   2883  O  O   . ALA A 1 459  ? -31.687 -9.909  2.357   1.00 54.53  ? 1055 ALA A O   1 
ATOM   2884  C  CB  . ALA A 1 459  ? -28.927 -11.035 3.115   1.00 42.77  ? 1055 ALA A CB  1 
ATOM   2885  N  N   . VAL A 1 460  ? -31.793 -12.035 1.633   1.00 44.79  ? 1056 VAL A N   1 
ATOM   2886  C  CA  . VAL A 1 460  ? -32.769 -11.741 0.589   1.00 41.29  ? 1056 VAL A CA  1 
ATOM   2887  C  C   . VAL A 1 460  ? -34.082 -11.251 1.195   1.00 44.79  ? 1056 VAL A C   1 
ATOM   2888  O  O   . VAL A 1 460  ? -34.679 -11.928 2.031   1.00 61.85  ? 1056 VAL A O   1 
ATOM   2889  C  CB  . VAL A 1 460  ? -33.039 -12.973 -0.289  1.00 52.62  ? 1056 VAL A CB  1 
ATOM   2890  C  CG1 . VAL A 1 460  ? -34.115 -12.666 -1.317  1.00 50.93  ? 1056 VAL A CG1 1 
ATOM   2891  C  CG2 . VAL A 1 460  ? -31.759 -13.425 -0.970  1.00 47.06  ? 1056 VAL A CG2 1 
ATOM   2892  N  N   . GLN A 1 461  ? -34.526 -10.072 0.769   1.00 39.60  ? 1057 GLN A N   1 
ATOM   2893  C  CA  . GLN A 1 461  ? -35.709 -9.447  1.351   1.00 35.23  ? 1057 GLN A CA  1 
ATOM   2894  C  C   . GLN A 1 461  ? -36.947 -9.586  0.466   1.00 41.36  ? 1057 GLN A C   1 
ATOM   2895  O  O   . GLN A 1 461  ? -38.015 -9.078  0.803   1.00 32.39  ? 1057 GLN A O   1 
ATOM   2896  C  CB  . GLN A 1 461  ? -35.440 -7.967  1.627   1.00 30.43  ? 1057 GLN A CB  1 
ATOM   2897  C  CG  . GLN A 1 461  ? -34.213 -7.699  2.488   1.00 47.39  ? 1057 GLN A CG  1 
ATOM   2898  C  CD  . GLN A 1 461  ? -34.451 -7.966  3.962   1.00 50.37  ? 1057 GLN A CD  1 
ATOM   2899  O  OE1 . GLN A 1 461  ? -34.649 -9.108  4.379   1.00 58.92  ? 1057 GLN A OE1 1 
ATOM   2900  N  NE2 . GLN A 1 461  ? -34.431 -6.907  4.763   1.00 55.99  ? 1057 GLN A NE2 1 
ATOM   2901  N  N   . GLY A 1 462  ? -36.801 -10.272 -0.663  1.00 38.05  ? 1058 GLY A N   1 
ATOM   2902  C  CA  . GLY A 1 462  ? -37.911 -10.463 -1.579  1.00 39.74  ? 1058 GLY A CA  1 
ATOM   2903  C  C   . GLY A 1 462  ? -37.461 -10.644 -3.015  1.00 41.42  ? 1058 GLY A C   1 
ATOM   2904  O  O   . GLY A 1 462  ? -36.310 -10.376 -3.349  1.00 37.35  ? 1058 GLY A O   1 
ATOM   2905  N  N   . ARG A 1 463  ? -38.371 -11.105 -3.866  1.00 34.27  ? 1059 ARG A N   1 
ATOM   2906  C  CA  . ARG A 1 463  ? -38.065 -11.313 -5.276  1.00 38.26  ? 1059 ARG A CA  1 
ATOM   2907  C  C   . ARG A 1 463  ? -38.604 -10.169 -6.123  1.00 47.51  ? 1059 ARG A C   1 
ATOM   2908  O  O   . ARG A 1 463  ? -39.716 -9.691  -5.901  1.00 53.52  ? 1059 ARG A O   1 
ATOM   2909  C  CB  . ARG A 1 463  ? -38.648 -12.640 -5.768  1.00 30.32  ? 1059 ARG A CB  1 
ATOM   2910  C  CG  . ARG A 1 463  ? -38.355 -12.941 -7.229  1.00 41.69  ? 1059 ARG A CG  1 
ATOM   2911  C  CD  . ARG A 1 463  ? -39.120 -14.160 -7.712  1.00 38.30  ? 1059 ARG A CD  1 
ATOM   2912  N  NE  . ARG A 1 463  ? -40.547 -14.049 -7.430  1.00 67.69  ? 1059 ARG A NE  1 
ATOM   2913  C  CZ  . ARG A 1 463  ? -41.480 -14.826 -7.972  1.00 79.66  ? 1059 ARG A CZ  1 
ATOM   2914  N  NH1 . ARG A 1 463  ? -41.138 -15.770 -8.838  1.00 73.22  ? 1059 ARG A NH1 1 
ATOM   2915  N  NH2 . ARG A 1 463  ? -42.755 -14.653 -7.653  1.00 55.23  ? 1059 ARG A NH2 1 
ATOM   2916  N  N   . CYS A 1 464  ? -37.810 -9.729  -7.092  1.00 43.28  ? 1060 CYS A N   1 
ATOM   2917  C  CA  . CYS A 1 464  ? -38.261 -8.696  -8.014  1.00 41.07  ? 1060 CYS A CA  1 
ATOM   2918  C  C   . CYS A 1 464  ? -38.069 -9.131  -9.461  1.00 46.93  ? 1060 CYS A C   1 
ATOM   2919  O  O   . CYS A 1 464  ? -37.387 -10.115 -9.747  1.00 45.41  ? 1060 CYS A O   1 
ATOM   2920  C  CB  . CYS A 1 464  ? -37.527 -7.377  -7.750  1.00 28.54  ? 1060 CYS A CB  1 
ATOM   2921  S  SG  . CYS A 1 464  ? -35.728 -7.471  -7.844  1.00 44.70  ? 1060 CYS A SG  1 
ATOM   2922  N  N   . THR A 1 465  ? -38.702 -8.396  -10.368 1.00 45.37  ? 1061 THR A N   1 
ATOM   2923  C  CA  . THR A 1 465  ? -38.565 -8.630  -11.797 1.00 47.76  ? 1061 THR A CA  1 
ATOM   2924  C  C   . THR A 1 465  ? -37.697 -7.542  -12.403 1.00 43.94  ? 1061 THR A C   1 
ATOM   2925  O  O   . THR A 1 465  ? -38.042 -6.376  -12.325 1.00 42.42  ? 1061 THR A O   1 
ATOM   2926  C  CB  . THR A 1 465  ? -39.933 -8.640  -12.511 1.00 38.48  ? 1061 THR A CB  1 
ATOM   2927  O  OG1 . THR A 1 465  ? -40.703 -9.761  -12.064 1.00 41.99  ? 1061 THR A OG1 1 
ATOM   2928  C  CG2 . THR A 1 465  ? -39.748 -8.728  -14.017 1.00 34.48  ? 1061 THR A CG2 1 
ATOM   2929  N  N   . VAL A 1 466  ? -36.567 -7.913  -12.992 1.00 47.09  ? 1062 VAL A N   1 
ATOM   2930  C  CA  . VAL A 1 466  ? -35.707 -6.926  -13.639 1.00 32.41  ? 1062 VAL A CA  1 
ATOM   2931  C  C   . VAL A 1 466  ? -35.464 -7.295  -15.095 1.00 35.78  ? 1062 VAL A C   1 
ATOM   2932  O  O   . VAL A 1 466  ? -34.689 -8.206  -15.387 1.00 43.07  ? 1062 VAL A O   1 
ATOM   2933  C  CB  . VAL A 1 466  ? -34.353 -6.787  -12.925 1.00 28.74  ? 1062 VAL A CB  1 
ATOM   2934  C  CG1 . VAL A 1 466  ? -33.517 -5.719  -13.607 1.00 37.46  ? 1062 VAL A CG1 1 
ATOM   2935  C  CG2 . VAL A 1 466  ? -34.556 -6.451  -11.455 1.00 34.12  ? 1062 VAL A CG2 1 
ATOM   2936  N  N   . GLU A 1 467  ? -36.122 -6.596  -16.013 1.00 39.84  ? 1063 GLU A N   1 
ATOM   2937  C  CA  . GLU A 1 467  ? -36.018 -6.968  -17.422 1.00 41.99  ? 1063 GLU A CA  1 
ATOM   2938  C  C   . GLU A 1 467  ? -35.164 -6.003  -18.236 1.00 42.92  ? 1063 GLU A C   1 
ATOM   2939  O  O   . GLU A 1 467  ? -34.839 -4.904  -17.787 1.00 55.11  ? 1063 GLU A O   1 
ATOM   2940  C  CB  . GLU A 1 467  ? -37.413 -7.076  -18.046 1.00 42.46  ? 1063 GLU A CB  1 
ATOM   2941  C  CG  . GLU A 1 467  ? -38.252 -8.226  -17.507 1.00 37.36  ? 1063 GLU A CG  1 
ATOM   2942  C  CD  . GLU A 1 467  ? -37.749 -9.590  -17.954 1.00 62.83  ? 1063 GLU A CD  1 
ATOM   2943  O  OE1 . GLU A 1 467  ? -36.994 -9.661  -18.947 1.00 64.40  ? 1063 GLU A OE1 1 
ATOM   2944  O  OE2 . GLU A 1 467  ? -38.116 -10.595 -17.309 1.00 72.37  ? 1063 GLU A OE2 1 
ATOM   2945  N  N   . TYR A 1 468  ? -34.778 -6.444  -19.429 1.00 41.79  ? 1064 TYR A N   1 
ATOM   2946  C  CA  . TYR A 1 468  ? -34.163 -5.561  -20.408 1.00 40.86  ? 1064 TYR A CA  1 
ATOM   2947  C  C   . TYR A 1 468  ? -35.285 -4.912  -21.207 1.00 36.40  ? 1064 TYR A C   1 
ATOM   2948  O  O   . TYR A 1 468  ? -36.112 -5.601  -21.804 1.00 48.88  ? 1064 TYR A O   1 
ATOM   2949  C  CB  . TYR A 1 468  ? -33.202 -6.329  -21.318 1.00 44.30  ? 1064 TYR A CB  1 
ATOM   2950  C  CG  . TYR A 1 468  ? -32.563 -5.483  -22.396 1.00 44.78  ? 1064 TYR A CG  1 
ATOM   2951  C  CD1 . TYR A 1 468  ? -31.876 -4.320  -22.076 1.00 43.07  ? 1064 TYR A CD1 1 
ATOM   2952  C  CD2 . TYR A 1 468  ? -32.652 -5.844  -23.735 1.00 41.96  ? 1064 TYR A CD2 1 
ATOM   2953  C  CE1 . TYR A 1 468  ? -31.295 -3.542  -23.056 1.00 45.08  ? 1064 TYR A CE1 1 
ATOM   2954  C  CE2 . TYR A 1 468  ? -32.069 -5.074  -24.721 1.00 43.01  ? 1064 TYR A CE2 1 
ATOM   2955  C  CZ  . TYR A 1 468  ? -31.393 -3.922  -24.376 1.00 43.74  ? 1064 TYR A CZ  1 
ATOM   2956  O  OH  . TYR A 1 468  ? -30.812 -3.148  -25.353 1.00 44.07  ? 1064 TYR A OH  1 
ATOM   2957  N  N   . GLY A 1 469  ? -35.312 -3.583  -21.204 1.00 31.20  ? 1065 GLY A N   1 
ATOM   2958  C  CA  . GLY A 1 469  ? -36.440 -2.828  -21.723 1.00 41.89  ? 1065 GLY A CA  1 
ATOM   2959  C  C   . GLY A 1 469  ? -36.814 -3.049  -23.177 1.00 40.92  ? 1065 GLY A C   1 
ATOM   2960  O  O   . GLY A 1 469  ? -37.970 -2.859  -23.554 1.00 45.66  ? 1065 GLY A O   1 
ATOM   2961  N  N   . GLU A 1 470  ? -35.845 -3.440  -23.998 1.00 50.07  ? 1066 GLU A N   1 
ATOM   2962  C  CA  . GLU A 1 470  ? -36.087 -3.606  -25.429 1.00 44.20  ? 1066 GLU A CA  1 
ATOM   2963  C  C   . GLU A 1 470  ? -36.788 -4.919  -25.771 1.00 54.35  ? 1066 GLU A C   1 
ATOM   2964  O  O   . GLU A 1 470  ? -37.533 -4.990  -26.746 1.00 64.59  ? 1066 GLU A O   1 
ATOM   2965  C  CB  . GLU A 1 470  ? -34.772 -3.506  -26.204 1.00 46.47  ? 1066 GLU A CB  1 
ATOM   2966  C  CG  . GLU A 1 470  ? -34.003 -2.216  -25.966 1.00 37.91  ? 1066 GLU A CG  1 
ATOM   2967  C  CD  . GLU A 1 470  ? -34.722 -0.991  -26.500 1.00 51.80  ? 1066 GLU A CD  1 
ATOM   2968  O  OE1 . GLU A 1 470  ? -35.624 -1.144  -27.352 1.00 52.55  ? 1066 GLU A OE1 1 
ATOM   2969  O  OE2 . GLU A 1 470  ? -34.380 0.129   -26.066 1.00 60.94  ? 1066 GLU A OE2 1 
ATOM   2970  N  N   . ASP A 1 471  ? -36.553 -5.954  -24.970 1.00 53.40  ? 1067 ASP A N   1 
ATOM   2971  C  CA  . ASP A 1 471  ? -37.145 -7.261  -25.233 1.00 41.67  ? 1067 ASP A CA  1 
ATOM   2972  C  C   . ASP A 1 471  ? -38.570 -7.339  -24.701 1.00 54.87  ? 1067 ASP A C   1 
ATOM   2973  O  O   . ASP A 1 471  ? -39.249 -8.353  -24.862 1.00 66.50  ? 1067 ASP A O   1 
ATOM   2974  C  CB  . ASP A 1 471  ? -36.294 -8.372  -24.618 1.00 44.37  ? 1067 ASP A CB  1 
ATOM   2975  C  CG  . ASP A 1 471  ? -34.946 -8.515  -25.293 1.00 66.51  ? 1067 ASP A CG  1 
ATOM   2976  O  OD1 . ASP A 1 471  ? -34.774 -7.959  -26.398 1.00 71.22  ? 1067 ASP A OD1 1 
ATOM   2977  O  OD2 . ASP A 1 471  ? -34.063 -9.191  -24.725 1.00 65.49  ? 1067 ASP A OD2 1 
ATOM   2978  N  N   . LEU A 1 472  ? -39.015 -6.260  -24.065 1.00 57.13  ? 1068 LEU A N   1 
ATOM   2979  C  CA  . LEU A 1 472  ? -40.383 -6.169  -23.572 1.00 64.48  ? 1068 LEU A CA  1 
ATOM   2980  C  C   . LEU A 1 472  ? -41.369 -6.028  -24.723 1.00 69.51  ? 1068 LEU A C   1 
ATOM   2981  O  O   . LEU A 1 472  ? -41.206 -5.159  -25.581 1.00 58.27  ? 1068 LEU A O   1 
ATOM   2982  C  CB  . LEU A 1 472  ? -40.537 -4.986  -22.613 1.00 62.74  ? 1068 LEU A CB  1 
ATOM   2983  C  CG  . LEU A 1 472  ? -39.747 -5.013  -21.305 1.00 58.02  ? 1068 LEU A CG  1 
ATOM   2984  C  CD1 . LEU A 1 472  ? -39.948 -3.712  -20.549 1.00 53.49  ? 1068 LEU A CD1 1 
ATOM   2985  C  CD2 . LEU A 1 472  ? -40.165 -6.197  -20.451 1.00 61.85  ? 1068 LEU A CD2 1 
ATOM   2986  N  N   . PRO A 1 473  ? -42.394 -6.893  -24.753 1.00 73.79  ? 1069 PRO A N   1 
ATOM   2987  C  CA  . PRO A 1 473  ? -43.479 -6.743  -25.727 1.00 74.27  ? 1069 PRO A CA  1 
ATOM   2988  C  C   . PRO A 1 473  ? -44.257 -5.458  -25.465 1.00 77.87  ? 1069 PRO A C   1 
ATOM   2989  O  O   . PRO A 1 473  ? -44.643 -4.754  -26.399 1.00 77.89  ? 1069 PRO A O   1 
ATOM   2990  C  CB  . PRO A 1 473  ? -44.347 -7.979  -25.483 1.00 64.83  ? 1069 PRO A CB  1 
ATOM   2991  C  CG  . PRO A 1 473  ? -44.051 -8.379  -24.075 1.00 69.09  ? 1069 PRO A CG  1 
ATOM   2992  C  CD  . PRO A 1 473  ? -42.610 -8.034  -23.849 1.00 66.15  ? 1069 PRO A CD  1 
ATOM   2993  N  N   . GLU A 1 474  ? -44.477 -5.165  -24.187 1.00 74.66  ? 1070 GLU A N   1 
ATOM   2994  C  CA  . GLU A 1 474  ? -45.125 -3.931  -23.767 1.00 61.29  ? 1070 GLU A CA  1 
ATOM   2995  C  C   . GLU A 1 474  ? -44.172 -2.755  -23.919 1.00 60.47  ? 1070 GLU A C   1 
ATOM   2996  O  O   . GLU A 1 474  ? -42.956 -2.938  -23.978 1.00 63.51  ? 1070 GLU A O   1 
ATOM   2997  C  CB  . GLU A 1 474  ? -45.589 -4.035  -22.314 1.00 62.25  ? 1070 GLU A CB  1 
ATOM   2998  C  CG  . GLU A 1 474  ? -46.412 -5.272  -22.003 1.00 83.29  ? 1070 GLU A CG  1 
ATOM   2999  C  CD  . GLU A 1 474  ? -46.329 -5.670  -20.542 1.00 98.11  ? 1070 GLU A CD  1 
ATOM   3000  O  OE1 . GLU A 1 474  ? -45.284 -6.221  -20.134 1.00 94.69  ? 1070 GLU A OE1 1 
ATOM   3001  O  OE2 . GLU A 1 474  ? -47.306 -5.431  -19.801 1.00 94.79  ? 1070 GLU A OE2 1 
ATOM   3002  N  N   . CYS A 1 475  ? -44.721 -1.547  -23.990 1.00 63.73  ? 1071 CYS A N   1 
ATOM   3003  C  CA  . CYS A 1 475  ? -43.893 -0.361  -23.848 1.00 55.74  ? 1071 CYS A CA  1 
ATOM   3004  C  C   . CYS A 1 475  ? -43.413 -0.338  -22.402 1.00 62.36  ? 1071 CYS A C   1 
ATOM   3005  O  O   . CYS A 1 475  ? -44.048 -0.933  -21.530 1.00 65.32  ? 1071 CYS A O   1 
ATOM   3006  C  CB  . CYS A 1 475  ? -44.660 0.915   -24.197 1.00 58.35  ? 1071 CYS A CB  1 
ATOM   3007  S  SG  . CYS A 1 475  ? -45.453 1.723   -22.790 1.00 73.63  ? 1071 CYS A SG  1 
ATOM   3008  N  N   . VAL A 1 476  ? -42.293 0.333   -22.151 1.00 66.84  ? 1072 VAL A N   1 
ATOM   3009  C  CA  . VAL A 1 476  ? -41.654 0.302   -20.838 1.00 53.01  ? 1072 VAL A CA  1 
ATOM   3010  C  C   . VAL A 1 476  ? -42.597 0.701   -19.704 1.00 51.67  ? 1072 VAL A C   1 
ATOM   3011  O  O   . VAL A 1 476  ? -42.624 0.055   -18.656 1.00 59.11  ? 1072 VAL A O   1 
ATOM   3012  C  CB  . VAL A 1 476  ? -40.411 1.217   -20.811 1.00 45.60  ? 1072 VAL A CB  1 
ATOM   3013  C  CG1 . VAL A 1 476  ? -40.040 1.598   -19.384 1.00 38.52  ? 1072 VAL A CG1 1 
ATOM   3014  C  CG2 . VAL A 1 476  ? -39.244 0.534   -21.502 1.00 35.89  ? 1072 VAL A CG2 1 
ATOM   3015  N  N   . GLN A 1 477  ? -43.388 1.746   -19.924 1.00 46.72  ? 1073 GLN A N   1 
ATOM   3016  C  CA  . GLN A 1 477  ? -44.248 2.263   -18.867 1.00 60.83  ? 1073 GLN A CA  1 
ATOM   3017  C  C   . GLN A 1 477  ? -45.470 1.379   -18.625 1.00 51.56  ? 1073 GLN A C   1 
ATOM   3018  O  O   . GLN A 1 477  ? -45.948 1.276   -17.495 1.00 42.54  ? 1073 GLN A O   1 
ATOM   3019  C  CB  . GLN A 1 477  ? -44.687 3.692   -19.185 1.00 67.15  ? 1073 GLN A CB  1 
ATOM   3020  C  CG  . GLN A 1 477  ? -44.559 4.630   -17.995 1.00 80.74  ? 1073 GLN A CG  1 
ATOM   3021  C  CD  . GLN A 1 477  ? -43.152 4.648   -17.422 1.00 95.06  ? 1073 GLN A CD  1 
ATOM   3022  O  OE1 . GLN A 1 477  ? -42.167 4.651   -18.162 1.00 78.07  ? 1073 GLN A OE1 1 
ATOM   3023  N  NE2 . GLN A 1 477  ? -43.051 4.650   -16.096 1.00 80.47  ? 1073 GLN A NE2 1 
ATOM   3024  N  N   . VAL A 1 478  ? -45.973 0.747   -19.682 1.00 46.15  ? 1074 VAL A N   1 
ATOM   3025  C  CA  . VAL A 1 478  ? -47.052 -0.226  -19.534 1.00 52.82  ? 1074 VAL A CA  1 
ATOM   3026  C  C   . VAL A 1 478  ? -46.578 -1.358  -18.629 1.00 54.91  ? 1074 VAL A C   1 
ATOM   3027  O  O   . VAL A 1 478  ? -47.301 -1.806  -17.737 1.00 56.92  ? 1074 VAL A O   1 
ATOM   3028  C  CB  . VAL A 1 478  ? -47.511 -0.796  -20.895 1.00 49.41  ? 1074 VAL A CB  1 
ATOM   3029  C  CG1 . VAL A 1 478  ? -48.242 -2.117  -20.709 1.00 46.19  ? 1074 VAL A CG1 1 
ATOM   3030  C  CG2 . VAL A 1 478  ? -48.400 0.203   -21.615 1.00 36.48  ? 1074 VAL A CG2 1 
ATOM   3031  N  N   . TYR A 1 479  ? -45.347 -1.796  -18.860 1.00 41.99  ? 1075 TYR A N   1 
ATOM   3032  C  CA  . TYR A 1 479  ? -44.714 -2.808  -18.028 1.00 41.28  ? 1075 TYR A CA  1 
ATOM   3033  C  C   . TYR A 1 479  ? -44.546 -2.317  -16.595 1.00 38.57  ? 1075 TYR A C   1 
ATOM   3034  O  O   . TYR A 1 479  ? -44.799 -3.053  -15.646 1.00 53.83  ? 1075 TYR A O   1 
ATOM   3035  C  CB  . TYR A 1 479  ? -43.357 -3.201  -18.618 1.00 45.81  ? 1075 TYR A CB  1 
ATOM   3036  C  CG  . TYR A 1 479  ? -42.402 -3.821  -17.624 1.00 51.32  ? 1075 TYR A CG  1 
ATOM   3037  C  CD1 . TYR A 1 479  ? -42.559 -5.135  -17.206 1.00 36.33  ? 1075 TYR A CD1 1 
ATOM   3038  C  CD2 . TYR A 1 479  ? -41.341 -3.090  -17.105 1.00 46.07  ? 1075 TYR A CD2 1 
ATOM   3039  C  CE1 . TYR A 1 479  ? -41.686 -5.705  -16.299 1.00 29.49  ? 1075 TYR A CE1 1 
ATOM   3040  C  CE2 . TYR A 1 479  ? -40.464 -3.650  -16.198 1.00 36.77  ? 1075 TYR A CE2 1 
ATOM   3041  C  CZ  . TYR A 1 479  ? -40.640 -4.958  -15.800 1.00 40.29  ? 1075 TYR A CZ  1 
ATOM   3042  O  OH  . TYR A 1 479  ? -39.768 -5.517  -14.896 1.00 43.98  ? 1075 TYR A OH  1 
ATOM   3043  N  N   . SER A 1 480  ? -44.130 -1.065  -16.448 1.00 48.32  ? 1076 SER A N   1 
ATOM   3044  C  CA  . SER A 1 480  ? -43.860 -0.494  -15.133 1.00 48.83  ? 1076 SER A CA  1 
ATOM   3045  C  C   . SER A 1 480  ? -45.123 -0.339  -14.289 1.00 48.24  ? 1076 SER A C   1 
ATOM   3046  O  O   . SER A 1 480  ? -45.070 -0.412  -13.062 1.00 50.32  ? 1076 SER A O   1 
ATOM   3047  C  CB  . SER A 1 480  ? -43.170 0.862   -15.281 1.00 34.25  ? 1076 SER A CB  1 
ATOM   3048  O  OG  . SER A 1 480  ? -42.008 0.753   -16.083 1.00 37.41  ? 1076 SER A OG  1 
ATOM   3049  N  N   . MET A 1 481  ? -46.257 -0.130  -14.948 1.00 55.10  ? 1077 MET A N   1 
ATOM   3050  C  CA  . MET A 1 481  ? -47.510 0.122   -14.246 1.00 45.37  ? 1077 MET A CA  1 
ATOM   3051  C  C   . MET A 1 481  ? -48.417 -1.110  -14.203 1.00 52.39  ? 1077 MET A C   1 
ATOM   3052  O  O   . MET A 1 481  ? -49.589 -1.003  -13.847 1.00 64.42  ? 1077 MET A O   1 
ATOM   3053  C  CB  . MET A 1 481  ? -48.248 1.294   -14.905 1.00 45.90  ? 1077 MET A CB  1 
ATOM   3054  C  CG  . MET A 1 481  ? -47.463 2.600   -14.909 1.00 62.04  ? 1077 MET A CG  1 
ATOM   3055  S  SD  . MET A 1 481  ? -47.215 3.253   -13.249 1.00 79.58  ? 1077 MET A SD  1 
ATOM   3056  C  CE  . MET A 1 481  ? -48.915 3.445   -12.718 1.00 47.63  ? 1077 MET A CE  1 
ATOM   3057  N  N   . GLY A 1 482  ? -47.875 -2.271  -14.570 1.00 57.44  ? 1078 GLY A N   1 
ATOM   3058  C  CA  . GLY A 1 482  ? -48.663 -3.490  -14.694 1.00 39.33  ? 1078 GLY A CA  1 
ATOM   3059  C  C   . GLY A 1 482  ? -48.497 -4.498  -13.563 1.00 46.60  ? 1078 GLY A C   1 
ATOM   3060  O  O   . GLY A 1 482  ? -49.196 -5.512  -13.523 1.00 45.52  ? 1078 GLY A O   1 
ATOM   3061  N  N   . GLY A 1 483  ? -47.559 -4.232  -12.657 1.00 44.15  ? 1079 GLY A N   1 
ATOM   3062  C  CA  . GLY A 1 483  ? -47.275 -5.135  -11.553 1.00 49.72  ? 1079 GLY A CA  1 
ATOM   3063  C  C   . GLY A 1 483  ? -46.453 -4.475  -10.459 1.00 54.42  ? 1079 GLY A C   1 
ATOM   3064  O  O   . GLY A 1 483  ? -45.827 -3.448  -10.695 1.00 44.16  ? 1079 GLY A O   1 
ATOM   3065  N  N   . PRO A 1 484  ? -46.463 -5.058  -9.247  1.00 50.11  ? 1080 PRO A N   1 
ATOM   3066  C  CA  . PRO A 1 484  ? -45.883 -4.494  -8.017  1.00 52.94  ? 1080 PRO A CA  1 
ATOM   3067  C  C   . PRO A 1 484  ? -44.363 -4.304  -8.017  1.00 57.72  ? 1080 PRO A C   1 
ATOM   3068  O  O   . PRO A 1 484  ? -43.929 -3.223  -7.632  1.00 68.82  ? 1080 PRO A O   1 
ATOM   3069  C  CB  . PRO A 1 484  ? -46.283 -5.509  -6.931  1.00 32.38  ? 1080 PRO A CB  1 
ATOM   3070  C  CG  . PRO A 1 484  ? -46.621 -6.748  -7.658  1.00 55.50  ? 1080 PRO A CG  1 
ATOM   3071  C  CD  . PRO A 1 484  ? -47.094 -6.366  -9.010  1.00 49.98  ? 1080 PRO A CD  1 
ATOM   3072  N  N   . ASN A 1 485  ? -43.580 -5.283  -8.473  1.00 42.89  ? 1081 ASN A N   1 
ATOM   3073  C  CA  . ASN A 1 485  ? -42.125 -5.221  -8.282  1.00 38.39  ? 1081 ASN A CA  1 
ATOM   3074  C  C   . ASN A 1 485  ? -41.314 -5.268  -9.571  1.00 46.24  ? 1081 ASN A C   1 
ATOM   3075  O  O   . ASN A 1 485  ? -40.542 -6.200  -9.788  1.00 53.23  ? 1081 ASN A O   1 
ATOM   3076  C  CB  . ASN A 1 485  ? -41.666 -6.354  -7.354  1.00 54.53  ? 1081 ASN A CB  1 
ATOM   3077  C  CG  . ASN A 1 485  ? -41.874 -6.023  -5.894  1.00 42.10  ? 1081 ASN A CG  1 
ATOM   3078  O  OD1 . ASN A 1 485  ? -41.171 -5.184  -5.335  1.00 44.38  ? 1081 ASN A OD1 1 
ATOM   3079  N  ND2 . ASN A 1 485  ? -42.856 -6.663  -5.273  1.00 32.39  ? 1081 ASN A ND2 1 
ATOM   3080  N  N   . ARG A 1 486  ? -41.458 -4.240  -10.401 1.00 38.91  ? 1082 ARG A N   1 
ATOM   3081  C  CA  . ARG A 1 486  ? -40.868 -4.268  -11.733 1.00 32.95  ? 1082 ARG A CA  1 
ATOM   3082  C  C   . ARG A 1 486  ? -39.831 -3.176  -12.002 1.00 35.20  ? 1082 ARG A C   1 
ATOM   3083  O  O   . ARG A 1 486  ? -40.103 -1.985  -11.861 1.00 42.30  ? 1082 ARG A O   1 
ATOM   3084  C  CB  . ARG A 1 486  ? -41.985 -4.202  -12.771 1.00 31.71  ? 1082 ARG A CB  1 
ATOM   3085  C  CG  . ARG A 1 486  ? -42.901 -5.407  -12.701 1.00 29.80  ? 1082 ARG A CG  1 
ATOM   3086  C  CD  . ARG A 1 486  ? -44.154 -5.204  -13.512 1.00 35.26  ? 1082 ARG A CD  1 
ATOM   3087  N  NE  . ARG A 1 486  ? -44.937 -6.429  -13.630 1.00 38.49  ? 1082 ARG A NE  1 
ATOM   3088  C  CZ  . ARG A 1 486  ? -45.823 -6.647  -14.595 1.00 44.52  ? 1082 ARG A CZ  1 
ATOM   3089  N  NH1 . ARG A 1 486  ? -46.028 -5.724  -15.521 1.00 42.43  ? 1082 ARG A NH1 1 
ATOM   3090  N  NH2 . ARG A 1 486  ? -46.498 -7.787  -14.642 1.00 46.99  ? 1082 ARG A NH2 1 
ATOM   3091  N  N   . PHE A 1 487  ? -38.639 -3.621  -12.388 1.00 38.68  ? 1083 PHE A N   1 
ATOM   3092  C  CA  . PHE A 1 487  ? -37.514 -2.769  -12.751 1.00 41.91  ? 1083 PHE A CA  1 
ATOM   3093  C  C   . PHE A 1 487  ? -37.045 -3.146  -14.145 1.00 45.07  ? 1083 PHE A C   1 
ATOM   3094  O  O   . PHE A 1 487  ? -37.270 -4.273  -14.600 1.00 41.79  ? 1083 PHE A O   1 
ATOM   3095  C  CB  . PHE A 1 487  ? -36.353 -2.926  -11.772 1.00 39.95  ? 1083 PHE A CB  1 
ATOM   3096  C  CG  . PHE A 1 487  ? -36.672 -2.510  -10.376 1.00 37.83  ? 1083 PHE A CG  1 
ATOM   3097  C  CD1 . PHE A 1 487  ? -37.288 -3.387  -9.499  1.00 39.62  ? 1083 PHE A CD1 1 
ATOM   3098  C  CD2 . PHE A 1 487  ? -36.339 -1.245  -9.933  1.00 33.67  ? 1083 PHE A CD2 1 
ATOM   3099  C  CE1 . PHE A 1 487  ? -37.575 -3.000  -8.211  1.00 41.53  ? 1083 PHE A CE1 1 
ATOM   3100  C  CE2 . PHE A 1 487  ? -36.624 -0.854  -8.651  1.00 35.67  ? 1083 PHE A CE2 1 
ATOM   3101  C  CZ  . PHE A 1 487  ? -37.242 -1.731  -7.787  1.00 45.48  ? 1083 PHE A CZ  1 
ATOM   3102  N  N   . TYR A 1 488  ? -36.369 -2.218  -14.811 1.00 38.38  ? 1084 TYR A N   1 
ATOM   3103  C  CA  . TYR A 1 488  ? -35.867 -2.470  -16.151 1.00 37.72  ? 1084 TYR A CA  1 
ATOM   3104  C  C   . TYR A 1 488  ? -34.537 -1.763  -16.357 1.00 39.47  ? 1084 TYR A C   1 
ATOM   3105  O  O   . TYR A 1 488  ? -34.218 -0.805  -15.652 1.00 35.89  ? 1084 TYR A O   1 
ATOM   3106  C  CB  . TYR A 1 488  ? -36.876 -2.009  -17.205 1.00 36.02  ? 1084 TYR A CB  1 
ATOM   3107  C  CG  . TYR A 1 488  ? -36.928 -0.506  -17.379 1.00 41.39  ? 1084 TYR A CG  1 
ATOM   3108  C  CD1 . TYR A 1 488  ? -37.599 0.296   -16.467 1.00 27.53  ? 1084 TYR A CD1 1 
ATOM   3109  C  CD2 . TYR A 1 488  ? -36.300 0.111   -18.456 1.00 35.43  ? 1084 TYR A CD2 1 
ATOM   3110  C  CE1 . TYR A 1 488  ? -37.647 1.669   -16.621 1.00 34.89  ? 1084 TYR A CE1 1 
ATOM   3111  C  CE2 . TYR A 1 488  ? -36.343 1.483   -18.619 1.00 30.01  ? 1084 TYR A CE2 1 
ATOM   3112  C  CZ  . TYR A 1 488  ? -37.016 2.256   -17.700 1.00 39.86  ? 1084 TYR A CZ  1 
ATOM   3113  O  OH  . TYR A 1 488  ? -37.054 3.622   -17.868 1.00 26.18  ? 1084 TYR A OH  1 
ATOM   3114  N  N   . PHE A 1 489  ? -33.759 -2.239  -17.321 1.00 35.63  ? 1085 PHE A N   1 
ATOM   3115  C  CA  . PHE A 1 489  ? -32.526 -1.563  -17.693 1.00 39.79  ? 1085 PHE A CA  1 
ATOM   3116  C  C   . PHE A 1 489  ? -32.422 -1.508  -19.207 1.00 42.65  ? 1085 PHE A C   1 
ATOM   3117  O  O   . PHE A 1 489  ? -32.958 -2.367  -19.907 1.00 45.52  ? 1085 PHE A O   1 
ATOM   3118  C  CB  . PHE A 1 489  ? -31.303 -2.262  -17.088 1.00 36.92  ? 1085 PHE A CB  1 
ATOM   3119  C  CG  . PHE A 1 489  ? -31.152 -3.697  -17.502 1.00 31.08  ? 1085 PHE A CG  1 
ATOM   3120  C  CD1 . PHE A 1 489  ? -31.784 -4.705  -16.795 1.00 41.16  ? 1085 PHE A CD1 1 
ATOM   3121  C  CD2 . PHE A 1 489  ? -30.368 -4.040  -18.591 1.00 36.89  ? 1085 PHE A CD2 1 
ATOM   3122  C  CE1 . PHE A 1 489  ? -31.646 -6.027  -17.171 1.00 43.29  ? 1085 PHE A CE1 1 
ATOM   3123  C  CE2 . PHE A 1 489  ? -30.226 -5.360  -18.972 1.00 43.28  ? 1085 PHE A CE2 1 
ATOM   3124  C  CZ  . PHE A 1 489  ? -30.866 -6.354  -18.261 1.00 37.73  ? 1085 PHE A CZ  1 
ATOM   3125  N  N   . LEU A 1 490  ? -31.745 -0.482  -19.707 1.00 39.88  ? 1086 LEU A N   1 
ATOM   3126  C  CA  . LEU A 1 490  ? -31.542 -0.325  -21.139 1.00 32.55  ? 1086 LEU A CA  1 
ATOM   3127  C  C   . LEU A 1 490  ? -30.059 -0.376  -21.463 1.00 39.28  ? 1086 LEU A C   1 
ATOM   3128  O  O   . LEU A 1 490  ? -29.670 -0.665  -22.593 1.00 41.37  ? 1086 LEU A O   1 
ATOM   3129  C  CB  . LEU A 1 490  ? -32.144 0.991   -21.632 1.00 23.21  ? 1086 LEU A CB  1 
ATOM   3130  C  CG  . LEU A 1 490  ? -33.666 1.115   -21.590 1.00 25.99  ? 1086 LEU A CG  1 
ATOM   3131  C  CD1 . LEU A 1 490  ? -34.088 2.501   -22.036 1.00 13.32  ? 1086 LEU A CD1 1 
ATOM   3132  C  CD2 . LEU A 1 490  ? -34.306 0.053   -22.464 1.00 29.41  ? 1086 LEU A CD2 1 
ATOM   3133  N  N   . GLU A 1 491  ? -29.233 -0.092  -20.461 1.00 43.96  ? 1087 GLU A N   1 
ATOM   3134  C  CA  . GLU A 1 491  ? -27.790 -0.038  -20.656 1.00 44.97  ? 1087 GLU A CA  1 
ATOM   3135  C  C   . GLU A 1 491  ? -27.036 -0.792  -19.569 1.00 41.63  ? 1087 GLU A C   1 
ATOM   3136  O  O   . GLU A 1 491  ? -27.630 -1.352  -18.649 1.00 32.17  ? 1087 GLU A O   1 
ATOM   3137  C  CB  . GLU A 1 491  ? -27.309 1.415   -20.689 1.00 38.55  ? 1087 GLU A CB  1 
ATOM   3138  C  CG  . GLU A 1 491  ? -27.978 2.286   -21.736 1.00 28.92  ? 1087 GLU A CG  1 
ATOM   3139  C  CD  . GLU A 1 491  ? -27.628 3.752   -21.575 1.00 51.80  ? 1087 GLU A CD  1 
ATOM   3140  O  OE1 . GLU A 1 491  ? -26.602 4.186   -22.140 1.00 55.81  ? 1087 GLU A OE1 1 
ATOM   3141  O  OE2 . GLU A 1 491  ? -28.377 4.469   -20.878 1.00 56.59  ? 1087 GLU A OE2 1 
ATOM   3142  N  N   . ALA A 1 492  ? -25.716 -0.795  -19.697 1.00 40.54  ? 1088 ALA A N   1 
ATOM   3143  C  CA  . ALA A 1 492  ? -24.825 -1.349  -18.695 1.00 45.19  ? 1088 ALA A CA  1 
ATOM   3144  C  C   . ALA A 1 492  ? -23.788 -0.304  -18.319 1.00 43.44  ? 1088 ALA A C   1 
ATOM   3145  O  O   . ALA A 1 492  ? -23.342 0.483   -19.166 1.00 49.33  ? 1088 ALA A O   1 
ATOM   3146  C  CB  . ALA A 1 492  ? -24.154 -2.612  -19.204 1.00 38.04  ? 1088 ALA A CB  1 
ATOM   3147  N  N   . TYR A 1 493  ? -23.411 -0.302  -17.045 1.00 41.35  ? 1089 TYR A N   1 
ATOM   3148  C  CA  . TYR A 1 493  ? -22.478 0.680   -16.519 1.00 49.83  ? 1089 TYR A CA  1 
ATOM   3149  C  C   . TYR A 1 493  ? -21.117 0.057   -16.248 1.00 49.64  ? 1089 TYR A C   1 
ATOM   3150  O  O   . TYR A 1 493  ? -21.016 -1.041  -15.700 1.00 44.31  ? 1089 TYR A O   1 
ATOM   3151  C  CB  . TYR A 1 493  ? -23.034 1.311   -15.242 1.00 42.18  ? 1089 TYR A CB  1 
ATOM   3152  C  CG  . TYR A 1 493  ? -22.153 2.381   -14.631 1.00 43.70  ? 1089 TYR A CG  1 
ATOM   3153  C  CD1 . TYR A 1 493  ? -21.842 3.538   -15.333 1.00 37.56  ? 1089 TYR A CD1 1 
ATOM   3154  C  CD2 . TYR A 1 493  ? -21.649 2.240   -13.344 1.00 47.40  ? 1089 TYR A CD2 1 
ATOM   3155  C  CE1 . TYR A 1 493  ? -21.043 4.519   -14.776 1.00 42.62  ? 1089 TYR A CE1 1 
ATOM   3156  C  CE2 . TYR A 1 493  ? -20.850 3.216   -12.778 1.00 36.09  ? 1089 TYR A CE2 1 
ATOM   3157  C  CZ  . TYR A 1 493  ? -20.551 4.353   -13.498 1.00 39.69  ? 1089 TYR A CZ  1 
ATOM   3158  O  OH  . TYR A 1 493  ? -19.757 5.325   -12.938 1.00 40.62  ? 1089 TYR A OH  1 
ATOM   3159  N  N   . ASN A 1 494  ? -20.072 0.763   -16.652 1.00 55.05  ? 1090 ASN A N   1 
ATOM   3160  C  CA  . ASN A 1 494  ? -18.712 0.350   -16.370 1.00 52.45  ? 1090 ASN A CA  1 
ATOM   3161  C  C   . ASN A 1 494  ? -18.082 1.336   -15.401 1.00 51.75  ? 1090 ASN A C   1 
ATOM   3162  O  O   . ASN A 1 494  ? -17.765 2.467   -15.770 1.00 55.83  ? 1090 ASN A O   1 
ATOM   3163  C  CB  . ASN A 1 494  ? -17.892 0.253   -17.654 1.00 64.55  ? 1090 ASN A CB  1 
ATOM   3164  C  CG  . ASN A 1 494  ? -16.663 -0.611  -17.490 1.00 60.91  ? 1090 ASN A CG  1 
ATOM   3165  O  OD1 . ASN A 1 494  ? -15.672 -0.193  -16.893 1.00 62.34  ? 1090 ASN A OD1 1 
ATOM   3166  N  ND2 . ASN A 1 494  ? -16.722 -1.828  -18.019 1.00 62.59  ? 1090 ASN A ND2 1 
ATOM   3167  N  N   . ALA A 1 495  ? -17.927 0.899   -14.157 1.00 47.77  ? 1091 ALA A N   1 
ATOM   3168  C  CA  . ALA A 1 495  ? -17.407 1.739   -13.088 1.00 52.31  ? 1091 ALA A CA  1 
ATOM   3169  C  C   . ALA A 1 495  ? -15.935 2.067   -13.290 1.00 61.84  ? 1091 ALA A C   1 
ATOM   3170  O  O   . ALA A 1 495  ? -15.450 3.107   -12.839 1.00 53.46  ? 1091 ALA A O   1 
ATOM   3171  C  CB  . ALA A 1 495  ? -17.610 1.056   -11.754 1.00 54.31  ? 1091 ALA A CB  1 
ATOM   3172  N  N   . LYS A 1 496  ? -15.230 1.165   -13.961 1.00 62.33  ? 1092 LYS A N   1 
ATOM   3173  C  CA  . LYS A 1 496  ? -13.810 1.339   -14.209 1.00 64.27  ? 1092 LYS A CA  1 
ATOM   3174  C  C   . LYS A 1 496  ? -13.588 2.486   -15.185 1.00 66.28  ? 1092 LYS A C   1 
ATOM   3175  O  O   . LYS A 1 496  ? -12.749 3.356   -14.956 1.00 54.57  ? 1092 LYS A O   1 
ATOM   3176  C  CB  . LYS A 1 496  ? -13.202 0.043   -14.745 1.00 57.60  ? 1092 LYS A CB  1 
ATOM   3177  C  CG  . LYS A 1 496  ? -11.730 -0.125  -14.421 1.00 75.50  ? 1092 LYS A CG  1 
ATOM   3178  C  CD  . LYS A 1 496  ? -11.318 -1.585  -14.495 1.00 99.26  ? 1092 LYS A CD  1 
ATOM   3179  C  CE  . LYS A 1 496  ? -9.912  -1.788  -13.954 1.00 90.35  ? 1092 LYS A CE  1 
ATOM   3180  N  NZ  . LYS A 1 496  ? -8.885  -1.093  -14.779 1.00 78.76  ? 1092 LYS A NZ  1 
ATOM   3181  N  N   . SER A 1 497  ? -14.356 2.488   -16.269 1.00 58.33  ? 1093 SER A N   1 
ATOM   3182  C  CA  . SER A 1 497  ? -14.249 3.539   -17.272 1.00 60.38  ? 1093 SER A CA  1 
ATOM   3183  C  C   . SER A 1 497  ? -15.255 4.657   -17.027 1.00 60.17  ? 1093 SER A C   1 
ATOM   3184  O  O   . SER A 1 497  ? -15.278 5.642   -17.765 1.00 59.66  ? 1093 SER A O   1 
ATOM   3185  C  CB  . SER A 1 497  ? -14.446 2.962   -18.677 1.00 63.53  ? 1093 SER A CB  1 
ATOM   3186  O  OG  . SER A 1 497  ? -15.737 2.396   -18.821 1.00 65.48  ? 1093 SER A OG  1 
ATOM   3187  N  N   . LYS A 1 498  ? -16.075 4.497   -15.989 1.00 57.70  ? 1094 LYS A N   1 
ATOM   3188  C  CA  . LYS A 1 498  ? -17.157 5.435   -15.688 1.00 46.78  ? 1094 LYS A CA  1 
ATOM   3189  C  C   . LYS A 1 498  ? -17.993 5.718   -16.931 1.00 52.87  ? 1094 LYS A C   1 
ATOM   3190  O  O   . LYS A 1 498  ? -18.231 6.877   -17.273 1.00 54.28  ? 1094 LYS A O   1 
ATOM   3191  C  CB  . LYS A 1 498  ? -16.603 6.739   -15.115 1.00 47.72  ? 1094 LYS A CB  1 
ATOM   3192  C  CG  . LYS A 1 498  ? -15.928 6.573   -13.768 1.00 55.83  ? 1094 LYS A CG  1 
ATOM   3193  C  CD  . LYS A 1 498  ? -15.381 7.891   -13.249 1.00 43.88  ? 1094 LYS A CD  1 
ATOM   3194  C  CE  . LYS A 1 498  ? -14.684 7.688   -11.913 1.00 72.81  ? 1094 LYS A CE  1 
ATOM   3195  N  NZ  . LYS A 1 498  ? -14.109 8.950   -11.377 1.00 80.26  ? 1094 LYS A NZ  1 
ATOM   3196  N  N   . SER A 1 499  ? -18.429 4.661   -17.612 1.00 47.49  ? 1095 SER A N   1 
ATOM   3197  C  CA  . SER A 1 499  ? -19.117 4.837   -18.889 1.00 44.63  ? 1095 SER A CA  1 
ATOM   3198  C  C   . SER A 1 499  ? -20.352 3.957   -19.038 1.00 51.87  ? 1095 SER A C   1 
ATOM   3199  O  O   . SER A 1 499  ? -20.612 3.088   -18.214 1.00 57.12  ? 1095 SER A O   1 
ATOM   3200  C  CB  . SER A 1 499  ? -18.152 4.566   -20.048 1.00 58.80  ? 1095 SER A CB  1 
ATOM   3201  O  OG  . SER A 1 499  ? -17.551 3.289   -19.938 1.00 54.10  ? 1095 SER A OG  1 
ATOM   3202  N  N   . PHE A 1 500  ? -21.111 4.196   -20.101 1.00 46.27  ? 1096 PHE A N   1 
ATOM   3203  C  CA  . PHE A 1 500  ? -22.321 3.432   -20.369 1.00 43.82  ? 1096 PHE A CA  1 
ATOM   3204  C  C   . PHE A 1 500  ? -22.254 2.798   -21.748 1.00 52.77  ? 1096 PHE A C   1 
ATOM   3205  O  O   . PHE A 1 500  ? -21.888 3.457   -22.722 1.00 74.28  ? 1096 PHE A O   1 
ATOM   3206  C  CB  . PHE A 1 500  ? -23.560 4.322   -20.267 1.00 46.63  ? 1096 PHE A CB  1 
ATOM   3207  C  CG  . PHE A 1 500  ? -23.773 4.917   -18.907 1.00 47.29  ? 1096 PHE A CG  1 
ATOM   3208  C  CD1 . PHE A 1 500  ? -24.512 4.241   -17.953 1.00 53.53  ? 1096 PHE A CD1 1 
ATOM   3209  C  CD2 . PHE A 1 500  ? -23.245 6.156   -18.585 1.00 46.08  ? 1096 PHE A CD2 1 
ATOM   3210  C  CE1 . PHE A 1 500  ? -24.718 4.784   -16.701 1.00 42.55  ? 1096 PHE A CE1 1 
ATOM   3211  C  CE2 . PHE A 1 500  ? -23.446 6.706   -17.332 1.00 49.60  ? 1096 PHE A CE2 1 
ATOM   3212  C  CZ  . PHE A 1 500  ? -24.184 6.018   -16.389 1.00 49.73  ? 1096 PHE A CZ  1 
ATOM   3213  N  N   . GLU A 1 501  ? -22.608 1.520   -21.834 1.00 53.22  ? 1097 GLU A N   1 
ATOM   3214  C  CA  . GLU A 1 501  ? -22.645 0.839   -23.125 1.00 49.83  ? 1097 GLU A CA  1 
ATOM   3215  C  C   . GLU A 1 501  ? -23.848 -0.090  -23.189 1.00 51.59  ? 1097 GLU A C   1 
ATOM   3216  O  O   . GLU A 1 501  ? -24.604 -0.181  -22.234 1.00 57.51  ? 1097 GLU A O   1 
ATOM   3217  C  CB  . GLU A 1 501  ? -21.352 0.059   -23.368 1.00 71.79  ? 1097 GLU A CB  1 
ATOM   3218  C  CG  . GLU A 1 501  ? -21.097 -1.052  -22.364 1.00 78.73  ? 1097 GLU A CG  1 
ATOM   3219  C  CD  . GLU A 1 501  ? -19.765 -0.900  -21.654 1.00 91.96  ? 1097 GLU A CD  1 
ATOM   3220  O  OE1 . GLU A 1 501  ? -19.219 0.224   -21.646 1.00 75.97  ? 1097 GLU A OE1 1 
ATOM   3221  O  OE2 . GLU A 1 501  ? -19.263 -1.903  -21.105 1.00 93.13  ? 1097 GLU A OE2 1 
ATOM   3222  N  N   . ASP A 1 502  ? -24.037 -0.769  -24.314 1.00 54.88  ? 1098 ASP A N   1 
ATOM   3223  C  CA  . ASP A 1 502  ? -25.147 -1.707  -24.433 1.00 51.63  ? 1098 ASP A CA  1 
ATOM   3224  C  C   . ASP A 1 502  ? -24.893 -2.950  -23.588 1.00 51.43  ? 1098 ASP A C   1 
ATOM   3225  O  O   . ASP A 1 502  ? -23.747 -3.364  -23.419 1.00 58.55  ? 1098 ASP A O   1 
ATOM   3226  C  CB  . ASP A 1 502  ? -25.381 -2.092  -25.894 1.00 62.64  ? 1098 ASP A CB  1 
ATOM   3227  C  CG  . ASP A 1 502  ? -26.450 -1.243  -26.552 1.00 73.52  ? 1098 ASP A CG  1 
ATOM   3228  O  OD1 . ASP A 1 502  ? -26.518 -0.033  -26.250 1.00 65.51  ? 1098 ASP A OD1 1 
ATOM   3229  O  OD2 . ASP A 1 502  ? -27.230 -1.786  -27.364 1.00 80.91  ? 1098 ASP A OD2 1 
ATOM   3230  N  N   . PRO A 1 503  ? -25.967 -3.541  -23.041 1.00 49.67  ? 1099 PRO A N   1 
ATOM   3231  C  CA  . PRO A 1 503  ? -25.845 -4.736  -22.200 1.00 51.93  ? 1099 PRO A CA  1 
ATOM   3232  C  C   . PRO A 1 503  ? -25.225 -5.910  -22.942 1.00 54.36  ? 1099 PRO A C   1 
ATOM   3233  O  O   . PRO A 1 503  ? -25.405 -6.027  -24.153 1.00 50.31  ? 1099 PRO A O   1 
ATOM   3234  C  CB  . PRO A 1 503  ? -27.297 -5.050  -21.821 1.00 39.13  ? 1099 PRO A CB  1 
ATOM   3235  C  CG  . PRO A 1 503  ? -28.009 -3.758  -21.962 1.00 43.33  ? 1099 PRO A CG  1 
ATOM   3236  C  CD  . PRO A 1 503  ? -27.359 -3.069  -23.119 1.00 48.54  ? 1099 PRO A CD  1 
ATOM   3237  N  N   . PRO A 1 504  ? -24.494 -6.771  -22.221 1.00 57.44  ? 1100 PRO A N   1 
ATOM   3238  C  CA  . PRO A 1 504  ? -23.975 -8.010  -22.810 1.00 50.46  ? 1100 PRO A CA  1 
ATOM   3239  C  C   . PRO A 1 504  ? -25.129 -8.939  -23.186 1.00 52.83  ? 1100 PRO A C   1 
ATOM   3240  O  O   . PRO A 1 504  ? -26.221 -8.777  -22.648 1.00 59.92  ? 1100 PRO A O   1 
ATOM   3241  C  CB  . PRO A 1 504  ? -23.116 -8.607  -21.689 1.00 49.96  ? 1100 PRO A CB  1 
ATOM   3242  C  CG  . PRO A 1 504  ? -22.880 -7.481  -20.720 1.00 66.88  ? 1100 PRO A CG  1 
ATOM   3243  C  CD  . PRO A 1 504  ? -24.093 -6.618  -20.814 1.00 60.14  ? 1100 PRO A CD  1 
ATOM   3244  N  N   . ASN A 1 505  ? -24.905 -9.888  -24.089 1.00 60.56  ? 1101 ASN A N   1 
ATOM   3245  C  CA  . ASN A 1 505  ? -25.988 -10.757 -24.542 1.00 61.86  ? 1101 ASN A CA  1 
ATOM   3246  C  C   . ASN A 1 505  ? -26.486 -11.724 -23.463 1.00 60.42  ? 1101 ASN A C   1 
ATOM   3247  O  O   . ASN A 1 505  ? -27.654 -12.115 -23.465 1.00 59.54  ? 1101 ASN A O   1 
ATOM   3248  C  CB  . ASN A 1 505  ? -25.554 -11.544 -25.781 1.00 57.29  ? 1101 ASN A CB  1 
ATOM   3249  C  CG  . ASN A 1 505  ? -26.263 -11.087 -27.046 1.00 68.77  ? 1101 ASN A CG  1 
ATOM   3250  O  OD1 . ASN A 1 505  ? -26.407 -9.891  -27.299 1.00 68.64  ? 1101 ASN A OD1 1 
ATOM   3251  N  ND2 . ASN A 1 505  ? -26.717 -12.045 -27.843 1.00 85.98  ? 1101 ASN A ND2 1 
ATOM   3252  N  N   . HIS A 1 506  ? -25.612 -12.103 -22.535 1.00 63.46  ? 1102 HIS A N   1 
ATOM   3253  C  CA  . HIS A 1 506  ? -26.019 -12.993 -21.449 1.00 54.69  ? 1102 HIS A CA  1 
ATOM   3254  C  C   . HIS A 1 506  ? -26.900 -12.282 -20.416 1.00 61.47  ? 1102 HIS A C   1 
ATOM   3255  O  O   . HIS A 1 506  ? -27.305 -12.883 -19.421 1.00 63.46  ? 1102 HIS A O   1 
ATOM   3256  C  CB  . HIS A 1 506  ? -24.793 -13.606 -20.761 1.00 57.22  ? 1102 HIS A CB  1 
ATOM   3257  C  CG  . HIS A 1 506  ? -23.767 -12.606 -20.319 1.00 51.90  ? 1102 HIS A CG  1 
ATOM   3258  N  ND1 . HIS A 1 506  ? -23.658 -12.177 -19.014 1.00 49.93  ? 1102 HIS A ND1 1 
ATOM   3259  C  CD2 . HIS A 1 506  ? -22.786 -11.974 -21.006 1.00 49.76  ? 1102 HIS A CD2 1 
ATOM   3260  C  CE1 . HIS A 1 506  ? -22.662 -11.313 -18.918 1.00 53.44  ? 1102 HIS A CE1 1 
ATOM   3261  N  NE2 . HIS A 1 506  ? -22.116 -11.174 -20.113 1.00 64.13  ? 1102 HIS A NE2 1 
ATOM   3262  N  N   . ALA A 1 507  ? -27.201 -11.009 -20.665 1.00 62.31  ? 1103 ALA A N   1 
ATOM   3263  C  CA  . ALA A 1 507  ? -28.015 -10.200 -19.756 1.00 51.89  ? 1103 ALA A CA  1 
ATOM   3264  C  C   . ALA A 1 507  ? -29.474 -10.068 -20.206 1.00 55.71  ? 1103 ALA A C   1 
ATOM   3265  O  O   . ALA A 1 507  ? -30.348 -9.723  -19.406 1.00 66.16  ? 1103 ALA A O   1 
ATOM   3266  C  CB  . ALA A 1 507  ? -27.398 -8.821  -19.596 1.00 47.67  ? 1103 ALA A CB  1 
ATOM   3267  N  N   . ARG A 1 508  ? -29.732 -10.317 -21.487 1.00 52.73  ? 1104 ARG A N   1 
ATOM   3268  C  CA  . ARG A 1 508  ? -31.095 -10.303 -22.015 1.00 63.37  ? 1104 ARG A CA  1 
ATOM   3269  C  C   . ARG A 1 508  ? -31.741 -11.655 -21.739 1.00 67.09  ? 1104 ARG A C   1 
ATOM   3270  O  O   . ARG A 1 508  ? -31.345 -12.665 -22.330 1.00 71.00  ? 1104 ARG A O   1 
ATOM   3271  C  CB  . ARG A 1 508  ? -31.089 -9.983  -23.508 1.00 53.17  ? 1104 ARG A CB  1 
ATOM   3272  C  CG  . ARG A 1 508  ? -30.288 -8.735  -23.834 1.00 52.90  ? 1104 ARG A CG  1 
ATOM   3273  C  CD  . ARG A 1 508  ? -30.011 -8.601  -25.319 1.00 63.95  ? 1104 ARG A CD  1 
ATOM   3274  N  NE  . ARG A 1 508  ? -31.242 -8.514  -26.094 1.00 54.80  ? 1104 ARG A NE  1 
ATOM   3275  C  CZ  . ARG A 1 508  ? -31.324 -7.968  -27.302 1.00 57.82  ? 1104 ARG A CZ  1 
ATOM   3276  N  NH1 . ARG A 1 508  ? -32.486 -7.931  -27.937 1.00 78.25  ? 1104 ARG A NH1 1 
ATOM   3277  N  NH2 . ARG A 1 508  ? -30.245 -7.453  -27.872 1.00 60.32  ? 1104 ARG A NH2 1 
ATOM   3278  N  N   . SER A 1 509  ? -32.750 -11.652 -20.865 1.00 96.67  ? 1105 SER A N   1 
ATOM   3279  C  CA  . SER A 1 509  ? -33.145 -12.843 -20.112 1.00 99.16  ? 1105 SER A CA  1 
ATOM   3280  C  C   . SER A 1 509  ? -33.340 -14.065 -21.005 1.00 108.34 ? 1105 SER A C   1 
ATOM   3281  O  O   . SER A 1 509  ? -34.073 -14.017 -21.997 1.00 105.49 ? 1105 SER A O   1 
ATOM   3282  C  CB  . SER A 1 509  ? -34.416 -12.559 -19.298 1.00 104.91 ? 1105 SER A CB  1 
ATOM   3283  O  OG  . SER A 1 509  ? -35.524 -12.296 -20.138 1.00 109.97 ? 1105 SER A OG  1 
ATOM   3284  N  N   . PRO A 1 510  ? -32.675 -15.175 -20.636 1.00 120.07 ? 1106 PRO A N   1 
ATOM   3285  C  CA  . PRO A 1 510  ? -32.534 -16.378 -21.462 1.00 119.72 ? 1106 PRO A CA  1 
ATOM   3286  C  C   . PRO A 1 510  ? -33.898 -16.909 -21.863 1.00 121.82 ? 1106 PRO A C   1 
ATOM   3287  O  O   . PRO A 1 510  ? -34.050 -17.515 -22.933 1.00 111.66 ? 1106 PRO A O   1 
ATOM   3288  C  CB  . PRO A 1 510  ? -31.795 -17.359 -20.540 1.00 112.62 ? 1106 PRO A CB  1 
ATOM   3289  C  CG  . PRO A 1 510  ? -32.096 -16.883 -19.160 1.00 115.75 ? 1106 PRO A CG  1 
ATOM   3290  C  CD  . PRO A 1 510  ? -32.167 -15.389 -19.269 1.00 104.48 ? 1106 PRO A CD  1 
ATOM   3291  N  N   . GLY A 1 511  ? -34.885 -16.638 -21.007 1.00 117.90 ? 1107 GLY A N   1 
ATOM   3292  C  CA  . GLY A 1 511  ? -36.264 -17.050 -21.200 1.00 98.90  ? 1107 GLY A CA  1 
ATOM   3293  C  C   . GLY A 1 511  ? -36.931 -16.623 -22.482 1.00 111.25 ? 1107 GLY A C   1 
ATOM   3294  O  O   . GLY A 1 511  ? -37.370 -17.474 -23.249 1.00 115.24 ? 1107 GLY A O   1 
ATOM   3295  N  N   . ASN A 1 512  ? -36.955 -15.331 -22.793 1.00 118.43 ? 1108 ASN A N   1 
ATOM   3296  C  CA  . ASN A 1 512  ? -37.648 -14.962 -24.035 1.00 125.50 ? 1108 ASN A CA  1 
ATOM   3297  C  C   . ASN A 1 512  ? -36.649 -14.750 -25.172 1.00 122.69 ? 1108 ASN A C   1 
ATOM   3298  O  O   . ASN A 1 512  ? -35.919 -13.748 -25.228 1.00 110.95 ? 1108 ASN A O   1 
ATOM   3299  C  CB  . ASN A 1 512  ? -38.482 -13.676 -23.811 1.00 144.05 ? 1108 ASN A CB  1 
ATOM   3300  C  CG  . ASN A 1 512  ? -39.455 -13.811 -22.632 1.00 141.51 ? 1108 ASN A CG  1 
ATOM   3301  O  OD1 . ASN A 1 512  ? -40.260 -14.754 -22.600 1.00 141.82 ? 1108 ASN A OD1 1 
ATOM   3302  N  ND2 . ASN A 1 512  ? -39.369 -12.901 -21.654 1.00 109.43 ? 1108 ASN A ND2 1 
ATOM   3303  N  N   . LYS A 1 513  ? -36.574 -15.767 -26.030 1.00 128.87 ? 1109 LYS A N   1 
ATOM   3304  C  CA  . LYS A 1 513  ? -36.090 -15.682 -27.398 1.00 110.43 ? 1109 LYS A CA  1 
ATOM   3305  C  C   . LYS A 1 513  ? -37.181 -15.236 -28.380 1.00 80.37  ? 1109 LYS A C   1 
ATOM   3306  O  O   . LYS A 1 513  ? -36.952 -14.388 -29.235 1.00 74.62  ? 1109 LYS A O   1 
ATOM   3307  C  CB  . LYS A 1 513  ? -35.513 -17.050 -27.798 1.00 90.45  ? 1109 LYS A CB  1 
ATOM   3308  C  CG  . LYS A 1 513  ? -34.686 -17.063 -29.054 1.00 71.98  ? 1109 LYS A CG  1 
ATOM   3309  C  CD  . LYS A 1 513  ? -33.229 -16.718 -28.787 1.00 66.87  ? 1109 LYS A CD  1 
ATOM   3310  C  CE  . LYS A 1 513  ? -32.345 -17.528 -29.723 1.00 71.72  ? 1109 LYS A CE  1 
ATOM   3311  N  NZ  . LYS A 1 513  ? -30.926 -17.088 -29.784 1.00 54.44  ? 1109 LYS A NZ  1 
ATOM   3312  N  N   . GLY A 1 514  ? -38.364 -15.827 -28.225 1.00 75.03  ? 1110 GLY A N   1 
ATOM   3313  C  CA  . GLY A 1 514  ? -39.563 -15.425 -28.942 1.00 74.88  ? 1110 GLY A CA  1 
ATOM   3314  C  C   . GLY A 1 514  ? -39.891 -16.020 -30.314 1.00 63.32  ? 1110 GLY A C   1 
ATOM   3315  O  O   . GLY A 1 514  ? -40.676 -15.443 -31.077 1.00 71.73  ? 1110 GLY A O   1 
ATOM   3316  N  N   . LYS A 1 515  ? -39.320 -17.173 -30.643 1.00 59.44  ? 1111 LYS A N   1 
ATOM   3317  C  CA  . LYS A 1 515  ? -39.464 -17.712 -31.996 1.00 50.18  ? 1111 LYS A CA  1 
ATOM   3318  C  C   . LYS A 1 515  ? -40.561 -18.768 -32.076 1.00 62.23  ? 1111 LYS A C   1 
ATOM   3319  O  O   . LYS A 1 515  ? -41.601 -18.541 -32.693 1.00 64.39  ? 1111 LYS A O   1 
ATOM   3320  C  CB  . LYS A 1 515  ? -38.132 -18.284 -32.482 1.00 55.32  ? 1111 LYS A CB  1 
ATOM   3321  C  CG  . LYS A 1 515  ? -37.028 -17.248 -32.571 1.00 49.33  ? 1111 LYS A CG  1 
ATOM   3322  C  CD  . LYS A 1 515  ? -35.684 -17.866 -32.931 1.00 44.91  ? 1111 LYS A CD  1 
ATOM   3323  C  CE  . LYS A 1 515  ? -35.681 -18.498 -34.313 1.00 55.11  ? 1111 LYS A CE  1 
ATOM   3324  N  NZ  . LYS A 1 515  ? -34.309 -18.989 -34.648 1.00 44.00  ? 1111 LYS A NZ  1 
ATOM   3325  N  N   . GLY A 1 516  ? -40.324 -19.926 -31.469 1.00 87.33  ? 1112 GLY A N   1 
ATOM   3326  C  CA  . GLY A 1 516  ? -41.324 -20.978 -31.441 1.00 80.79  ? 1112 GLY A CA  1 
ATOM   3327  C  C   . GLY A 1 516  ? -40.742 -22.321 -31.050 1.00 91.07  ? 1112 GLY A C   1 
ATOM   3328  O  O   . GLY A 1 516  ? -39.659 -22.395 -30.472 1.00 90.93  ? 1112 GLY A O   1 
ATOM   3329  N  N   . LYS A 1 517  ? -41.460 -23.391 -31.369 1.00 93.73  ? 1113 LYS A N   1 
ATOM   3330  C  CA  . LYS A 1 517  ? -40.963 -24.728 -31.083 1.00 110.55 ? 1113 LYS A CA  1 
ATOM   3331  C  C   . LYS A 1 517  ? -39.861 -25.069 -32.070 1.00 104.72 ? 1113 LYS A C   1 
ATOM   3332  O  O   . LYS A 1 517  ? -38.699 -25.227 -31.693 1.00 98.23  ? 1113 LYS A O   1 
ATOM   3333  C  CB  . LYS A 1 517  ? -42.086 -25.763 -31.160 1.00 89.86  ? 1113 LYS A CB  1 
ATOM   3334  C  CG  . LYS A 1 517  ? -43.292 -25.424 -30.306 1.00 110.25 ? 1113 LYS A CG  1 
ATOM   3335  C  CD  . LYS A 1 517  ? -42.893 -25.206 -28.856 1.00 106.43 ? 1113 LYS A CD  1 
ATOM   3336  C  CE  . LYS A 1 517  ? -43.637 -24.023 -28.256 1.00 99.10  ? 1113 LYS A CE  1 
ATOM   3337  N  NZ  . LYS A 1 517  ? -45.114 -24.168 -28.383 1.00 88.05  ? 1113 LYS A NZ  1 
ATOM   3338  N  N   . GLY A 1 518  ? -40.233 -25.172 -33.340 1.00 92.41  ? 1114 GLY A N   1 
ATOM   3339  C  CA  . GLY A 1 518  ? -39.287 -25.533 -34.374 1.00 96.77  ? 1114 GLY A CA  1 
ATOM   3340  C  C   . GLY A 1 518  ? -38.783 -26.944 -34.168 1.00 93.59  ? 1114 GLY A C   1 
ATOM   3341  O  O   . GLY A 1 518  ? -39.559 -27.862 -33.902 1.00 93.25  ? 1114 GLY A O   1 
ATOM   3342  N  N   . LYS A 1 519  ? -37.472 -27.116 -34.293 1.00 75.04  ? 1115 LYS A N   1 
ATOM   3343  C  CA  . LYS A 1 519  ? -36.863 -28.436 -34.221 1.00 88.09  ? 1115 LYS A CA  1 
ATOM   3344  C  C   . LYS A 1 519  ? -35.370 -28.338 -33.938 1.00 86.88  ? 1115 LYS A C   1 
ATOM   3345  O  O   . LYS A 1 519  ? -34.634 -29.305 -34.120 1.00 89.90  ? 1115 LYS A O   1 
ATOM   3346  C  CB  . LYS A 1 519  ? -37.105 -29.208 -35.522 1.00 87.11  ? 1115 LYS A CB  1 
ATOM   3347  C  CG  . LYS A 1 519  ? -37.052 -28.351 -36.784 1.00 92.34  ? 1115 LYS A CG  1 
ATOM   3348  C  CD  . LYS A 1 519  ? -38.449 -27.975 -37.264 1.00 69.62  ? 1115 LYS A CD  1 
ATOM   3349  C  CE  . LYS A 1 519  ? -38.407 -27.009 -38.436 1.00 81.17  ? 1115 LYS A CE  1 
ATOM   3350  N  NZ  . LYS A 1 519  ? -38.318 -27.715 -39.744 1.00 76.06  ? 1115 LYS A NZ  1 
ATOM   3351  N  N   . GLU A 1 537  ? -54.394 -11.906 -16.563 1.00 97.14  ? 1133 GLU A N   1 
ATOM   3352  C  CA  . GLU A 1 537  ? -55.249 -10.749 -16.802 1.00 103.30 ? 1133 GLU A CA  1 
ATOM   3353  C  C   . GLU A 1 537  ? -56.691 -11.020 -16.386 1.00 113.84 ? 1133 GLU A C   1 
ATOM   3354  O  O   . GLU A 1 537  ? -57.591 -11.081 -17.225 1.00 115.56 ? 1133 GLU A O   1 
ATOM   3355  C  CB  . GLU A 1 537  ? -55.194 -10.338 -18.276 1.00 109.74 ? 1133 GLU A CB  1 
ATOM   3356  C  CG  . GLU A 1 537  ? -55.277 -11.502 -19.254 1.00 130.03 ? 1133 GLU A CG  1 
ATOM   3357  C  CD  . GLU A 1 537  ? -55.452 -11.046 -20.689 1.00 133.45 ? 1133 GLU A CD  1 
ATOM   3358  O  OE1 . GLU A 1 537  ? -55.841 -9.878  -20.902 1.00 124.41 ? 1133 GLU A OE1 1 
ATOM   3359  O  OE2 . GLU A 1 537  ? -55.200 -11.856 -21.606 1.00 121.78 ? 1133 GLU A OE2 1 
ATOM   3360  N  N   . ILE A 1 538  ? -56.911 -11.172 -15.085 1.00 118.53 ? 1134 ILE A N   1 
ATOM   3361  C  CA  . ILE A 1 538  ? -58.257 -11.389 -14.577 1.00 115.56 ? 1134 ILE A CA  1 
ATOM   3362  C  C   . ILE A 1 538  ? -58.873 -10.051 -14.209 1.00 111.75 ? 1134 ILE A C   1 
ATOM   3363  O  O   . ILE A 1 538  ? -58.431 -9.390  -13.268 1.00 91.02  ? 1134 ILE A O   1 
ATOM   3364  C  CB  . ILE A 1 538  ? -58.277 -12.314 -13.342 1.00 105.69 ? 1134 ILE A CB  1 
ATOM   3365  C  CG1 . ILE A 1 538  ? -57.530 -13.620 -13.626 1.00 99.57  ? 1134 ILE A CG1 1 
ATOM   3366  C  CG2 . ILE A 1 538  ? -59.709 -12.594 -12.913 1.00 98.00  ? 1134 ILE A CG2 1 
ATOM   3367  C  CD1 . ILE A 1 538  ? -56.100 -13.633 -13.122 1.00 89.34  ? 1134 ILE A CD1 1 
ATOM   3368  N  N   . LYS A 1 539  ? -59.897 -9.655  -14.955 1.00 113.17 ? 1135 LYS A N   1 
ATOM   3369  C  CA  . LYS A 1 539  ? -60.548 -8.376  -14.722 1.00 92.82  ? 1135 LYS A CA  1 
ATOM   3370  C  C   . LYS A 1 539  ? -61.748 -8.562  -13.809 1.00 90.98  ? 1135 LYS A C   1 
ATOM   3371  O  O   . LYS A 1 539  ? -62.729 -9.205  -14.177 1.00 83.88  ? 1135 LYS A O   1 
ATOM   3372  C  CB  . LYS A 1 539  ? -60.980 -7.733  -16.041 1.00 108.10 ? 1135 LYS A CB  1 
ATOM   3373  C  CG  . LYS A 1 539  ? -60.184 -8.192  -17.251 1.00 124.83 ? 1135 LYS A CG  1 
ATOM   3374  C  CD  . LYS A 1 539  ? -60.395 -7.258  -18.433 1.00 132.55 ? 1135 LYS A CD  1 
ATOM   3375  C  CE  . LYS A 1 539  ? -60.136 -7.964  -19.754 1.00 119.43 ? 1135 LYS A CE  1 
ATOM   3376  N  NZ  . LYS A 1 539  ? -58.877 -8.758  -19.730 1.00 112.55 ? 1135 LYS A NZ  1 
ATOM   3377  N  N   . LEU A 1 540  ? -61.656 -7.999  -12.610 1.00 82.08  ? 1136 LEU A N   1 
ATOM   3378  C  CA  . LEU A 1 540  ? -62.737 -8.084  -11.642 1.00 68.27  ? 1136 LEU A CA  1 
ATOM   3379  C  C   . LEU A 1 540  ? -63.770 -7.001  -11.886 1.00 69.13  ? 1136 LEU A C   1 
ATOM   3380  O  O   . LEU A 1 540  ? -63.434 -5.909  -12.346 1.00 69.75  ? 1136 LEU A O   1 
ATOM   3381  C  CB  . LEU A 1 540  ? -62.198 -7.960  -10.218 1.00 68.13  ? 1136 LEU A CB  1 
ATOM   3382  C  CG  . LEU A 1 540  ? -61.262 -9.059  -9.723  1.00 77.98  ? 1136 LEU A CG  1 
ATOM   3383  C  CD1 . LEU A 1 540  ? -60.520 -8.575  -8.494  1.00 71.05  ? 1136 LEU A CD1 1 
ATOM   3384  C  CD2 . LEU A 1 540  ? -62.045 -10.324 -9.417  1.00 53.66  ? 1136 LEU A CD2 1 
ATOM   3385  N  N   . PRO A 1 541  ? -65.039 -7.304  -11.591 1.00 65.69  ? 1137 PRO A N   1 
ATOM   3386  C  CA  . PRO A 1 541  ? -66.041 -6.238  -11.555 1.00 50.44  ? 1137 PRO A CA  1 
ATOM   3387  C  C   . PRO A 1 541  ? -65.722 -5.284  -10.415 1.00 45.55  ? 1137 PRO A C   1 
ATOM   3388  O  O   . PRO A 1 541  ? -65.347 -5.737  -9.333  1.00 52.02  ? 1137 PRO A O   1 
ATOM   3389  C  CB  . PRO A 1 541  ? -67.356 -6.989  -11.308 1.00 42.71  ? 1137 PRO A CB  1 
ATOM   3390  C  CG  . PRO A 1 541  ? -67.074 -8.402  -11.711 1.00 44.78  ? 1137 PRO A CG  1 
ATOM   3391  C  CD  . PRO A 1 541  ? -65.636 -8.630  -11.372 1.00 54.30  ? 1137 PRO A CD  1 
ATOM   3392  N  N   . LYS A 1 542  ? -65.853 -3.985  -10.654 1.00 46.53  ? 1138 LYS A N   1 
ATOM   3393  C  CA  . LYS A 1 542  ? -65.545 -2.998  -9.630  1.00 36.60  ? 1138 LYS A CA  1 
ATOM   3394  C  C   . LYS A 1 542  ? -66.607 -2.996  -8.538  1.00 41.10  ? 1138 LYS A C   1 
ATOM   3395  O  O   . LYS A 1 542  ? -67.791 -3.197  -8.809  1.00 46.43  ? 1138 LYS A O   1 
ATOM   3396  C  CB  . LYS A 1 542  ? -65.416 -1.607  -10.252 1.00 38.45  ? 1138 LYS A CB  1 
ATOM   3397  C  CG  . LYS A 1 542  ? -64.195 -1.448  -11.143 1.00 39.36  ? 1138 LYS A CG  1 
ATOM   3398  C  CD  . LYS A 1 542  ? -64.278 -0.178  -11.969 1.00 46.51  ? 1138 LYS A CD  1 
ATOM   3399  C  CE  . LYS A 1 542  ? -62.956 0.117   -12.655 1.00 55.82  ? 1138 LYS A CE  1 
ATOM   3400  N  NZ  . LYS A 1 542  ? -61.889 0.427   -11.661 1.00 61.16  ? 1138 LYS A NZ  1 
ATOM   3401  N  N   . LEU A 1 543  ? -66.170 -2.779  -7.302  1.00 42.83  ? 1139 LEU A N   1 
ATOM   3402  C  CA  . LEU A 1 543  ? -67.080 -2.724  -6.167  1.00 29.90  ? 1139 LEU A CA  1 
ATOM   3403  C  C   . LEU A 1 543  ? -67.855 -1.420  -6.159  1.00 45.15  ? 1139 LEU A C   1 
ATOM   3404  O  O   . LEU A 1 543  ? -67.267 -0.345  -6.252  1.00 39.61  ? 1139 LEU A O   1 
ATOM   3405  C  CB  . LEU A 1 543  ? -66.316 -2.872  -4.852  1.00 23.82  ? 1139 LEU A CB  1 
ATOM   3406  C  CG  . LEU A 1 543  ? -65.571 -4.184  -4.618  1.00 37.91  ? 1139 LEU A CG  1 
ATOM   3407  C  CD1 . LEU A 1 543  ? -64.821 -4.125  -3.300  1.00 31.13  ? 1139 LEU A CD1 1 
ATOM   3408  C  CD2 . LEU A 1 543  ? -66.543 -5.348  -4.632  1.00 33.50  ? 1139 LEU A CD2 1 
ATOM   3409  N  N   . ARG A 1 544  ? -69.175 -1.513  -6.048  1.00 43.75  ? 1140 ARG A N   1 
ATOM   3410  C  CA  . ARG A 1 544  ? -69.978 -0.314  -5.869  1.00 39.32  ? 1140 ARG A CA  1 
ATOM   3411  C  C   . ARG A 1 544  ? -69.617 0.293   -4.519  1.00 43.01  ? 1140 ARG A C   1 
ATOM   3412  O  O   . ARG A 1 544  ? -69.779 -0.345  -3.468  1.00 40.76  ? 1140 ARG A O   1 
ATOM   3413  C  CB  . ARG A 1 544  ? -71.470 -0.624  -5.963  1.00 39.05  ? 1140 ARG A CB  1 
ATOM   3414  C  CG  . ARG A 1 544  ? -71.890 -1.143  -7.333  1.00 36.43  ? 1140 ARG A CG  1 
ATOM   3415  C  CD  . ARG A 1 544  ? -73.388 -1.404  -7.409  1.00 39.68  ? 1140 ARG A CD  1 
ATOM   3416  N  NE  . ARG A 1 544  ? -73.794 -2.516  -6.555  1.00 40.44  ? 1140 ARG A NE  1 
ATOM   3417  C  CZ  . ARG A 1 544  ? -73.811 -3.788  -6.940  1.00 38.87  ? 1140 ARG A CZ  1 
ATOM   3418  N  NH1 . ARG A 1 544  ? -73.444 -4.120  -8.171  1.00 35.30  ? 1140 ARG A NH1 1 
ATOM   3419  N  NH2 . ARG A 1 544  ? -74.195 -4.732  -6.092  1.00 42.85  ? 1140 ARG A NH2 1 
ATOM   3420  N  N   . THR A 1 545  ? -69.099 1.517   -4.550  1.00 31.92  ? 1141 THR A N   1 
ATOM   3421  C  CA  . THR A 1 545  ? -68.559 2.113   -3.337  1.00 38.97  ? 1141 THR A CA  1 
ATOM   3422  C  C   . THR A 1 545  ? -69.330 3.335   -2.857  1.00 41.69  ? 1141 THR A C   1 
ATOM   3423  O  O   . THR A 1 545  ? -69.743 4.199   -3.648  1.00 41.86  ? 1141 THR A O   1 
ATOM   3424  C  CB  . THR A 1 545  ? -67.084 2.505   -3.528  1.00 43.07  ? 1141 THR A CB  1 
ATOM   3425  O  OG1 . THR A 1 545  ? -66.345 1.350   -3.933  1.00 39.93  ? 1141 THR A OG1 1 
ATOM   3426  C  CG2 . THR A 1 545  ? -66.484 3.037   -2.228  1.00 29.49  ? 1141 THR A CG2 1 
ATOM   3427  N  N   . LEU A 1 546  ? -69.518 3.376   -1.541  1.00 39.88  ? 1142 LEU A N   1 
ATOM   3428  C  CA  . LEU A 1 546  ? -70.101 4.506   -0.845  1.00 40.58  ? 1142 LEU A CA  1 
ATOM   3429  C  C   . LEU A 1 546  ? -69.010 5.188   -0.024  1.00 37.12  ? 1142 LEU A C   1 
ATOM   3430  O  O   . LEU A 1 546  ? -68.390 4.573   0.858   1.00 35.40  ? 1142 LEU A O   1 
ATOM   3431  C  CB  . LEU A 1 546  ? -71.260 4.049   0.043   1.00 41.34  ? 1142 LEU A CB  1 
ATOM   3432  C  CG  . LEU A 1 546  ? -71.851 5.052   1.026   1.00 33.88  ? 1142 LEU A CG  1 
ATOM   3433  C  CD1 . LEU A 1 546  ? -72.329 6.294   0.297   1.00 35.11  ? 1142 LEU A CD1 1 
ATOM   3434  C  CD2 . LEU A 1 546  ? -72.993 4.403   1.786   1.00 35.14  ? 1142 LEU A CD2 1 
ATOM   3435  N  N   . ASP A 1 547  ? -68.766 6.455   -0.343  1.00 33.07  ? 1143 ASP A N   1 
ATOM   3436  C  CA  . ASP A 1 547  ? -67.739 7.240   0.328   1.00 32.27  ? 1143 ASP A CA  1 
ATOM   3437  C  C   . ASP A 1 547  ? -68.373 8.285   1.243   1.00 39.26  ? 1143 ASP A C   1 
ATOM   3438  O  O   . ASP A 1 547  ? -68.896 9.296   0.775   1.00 43.53  ? 1143 ASP A O   1 
ATOM   3439  C  CB  . ASP A 1 547  ? -66.833 7.915   -0.704  1.00 29.59  ? 1143 ASP A CB  1 
ATOM   3440  C  CG  . ASP A 1 547  ? -65.486 8.317   -0.134  1.00 54.64  ? 1143 ASP A CG  1 
ATOM   3441  O  OD1 . ASP A 1 547  ? -65.374 8.495   1.098   1.00 62.08  ? 1143 ASP A OD1 1 
ATOM   3442  O  OD2 . ASP A 1 547  ? -64.532 8.457   -0.930  1.00 62.72  ? 1143 ASP A OD2 1 
ATOM   3443  N  N   . VAL A 1 548  ? -68.327 8.038   2.548   1.00 33.48  ? 1144 VAL A N   1 
ATOM   3444  C  CA  . VAL A 1 548  ? -68.910 8.957   3.519   1.00 40.52  ? 1144 VAL A CA  1 
ATOM   3445  C  C   . VAL A 1 548  ? -67.854 9.945   3.997   1.00 40.06  ? 1144 VAL A C   1 
ATOM   3446  O  O   . VAL A 1 548  ? -66.724 9.550   4.283   1.00 43.71  ? 1144 VAL A O   1 
ATOM   3447  C  CB  . VAL A 1 548  ? -69.503 8.203   4.720   1.00 33.65  ? 1144 VAL A CB  1 
ATOM   3448  C  CG1 . VAL A 1 548  ? -70.383 9.126   5.540   1.00 32.33  ? 1144 VAL A CG1 1 
ATOM   3449  C  CG2 . VAL A 1 548  ? -70.302 7.005   4.240   1.00 39.69  ? 1144 VAL A CG2 1 
ATOM   3450  N  N   . PHE A 1 549  ? -68.232 11.220  4.086   1.00 32.00  ? 1145 PHE A N   1 
ATOM   3451  C  CA  . PHE A 1 549  ? -67.287 12.305  4.347   1.00 33.85  ? 1145 PHE A CA  1 
ATOM   3452  C  C   . PHE A 1 549  ? -66.181 12.250  3.301   1.00 38.92  ? 1145 PHE A C   1 
ATOM   3453  O  O   . PHE A 1 549  ? -65.008 12.066  3.624   1.00 42.18  ? 1145 PHE A O   1 
ATOM   3454  C  CB  . PHE A 1 549  ? -66.705 12.213  5.760   1.00 45.10  ? 1145 PHE A CB  1 
ATOM   3455  C  CG  . PHE A 1 549  ? -67.647 11.616  6.767   1.00 44.28  ? 1145 PHE A CG  1 
ATOM   3456  C  CD1 . PHE A 1 549  ? -68.823 12.262  7.108   1.00 37.63  ? 1145 PHE A CD1 1 
ATOM   3457  C  CD2 . PHE A 1 549  ? -67.351 10.408  7.374   1.00 45.64  ? 1145 PHE A CD2 1 
ATOM   3458  C  CE1 . PHE A 1 549  ? -69.688 11.710  8.035   1.00 41.87  ? 1145 PHE A CE1 1 
ATOM   3459  C  CE2 . PHE A 1 549  ? -68.210 9.853   8.303   1.00 42.66  ? 1145 PHE A CE2 1 
ATOM   3460  C  CZ  . PHE A 1 549  ? -69.379 10.505  8.635   1.00 40.17  ? 1145 PHE A CZ  1 
ATOM   3461  N  N   . SER A 1 550  ? -66.578 12.406  2.043   1.00 42.05  ? 1146 SER A N   1 
ATOM   3462  C  CA  . SER A 1 550  ? -65.703 12.135  0.911   1.00 35.26  ? 1146 SER A CA  1 
ATOM   3463  C  C   . SER A 1 550  ? -64.649 13.209  0.669   1.00 37.09  ? 1146 SER A C   1 
ATOM   3464  O  O   . SER A 1 550  ? -63.537 12.907  0.237   1.00 45.43  ? 1146 SER A O   1 
ATOM   3465  C  CB  . SER A 1 550  ? -66.540 11.962  -0.357  1.00 38.29  ? 1146 SER A CB  1 
ATOM   3466  O  OG  . SER A 1 550  ? -67.199 13.172  -0.695  1.00 28.54  ? 1146 SER A OG  1 
ATOM   3467  N  N   . GLY A 1 551  ? -65.000 14.461  0.940   1.00 35.90  ? 1147 GLY A N   1 
ATOM   3468  C  CA  . GLY A 1 551  ? -64.156 15.572  0.544   1.00 39.31  ? 1147 GLY A CA  1 
ATOM   3469  C  C   . GLY A 1 551  ? -64.194 15.683  -0.967  1.00 36.69  ? 1147 GLY A C   1 
ATOM   3470  O  O   . GLY A 1 551  ? -65.198 15.335  -1.588  1.00 32.15  ? 1147 GLY A O   1 
ATOM   3471  N  N   . CYS A 1 552  ? -63.104 16.150  -1.569  1.00 36.91  ? 1148 CYS A N   1 
ATOM   3472  C  CA  . CYS A 1 552  ? -63.044 16.256  -3.023  1.00 35.27  ? 1148 CYS A CA  1 
ATOM   3473  C  C   . CYS A 1 552  ? -62.848 14.878  -3.652  1.00 34.76  ? 1148 CYS A C   1 
ATOM   3474  O  O   . CYS A 1 552  ? -62.988 14.713  -4.864  1.00 36.53  ? 1148 CYS A O   1 
ATOM   3475  C  CB  . CYS A 1 552  ? -61.929 17.212  -3.457  1.00 24.21  ? 1148 CYS A CB  1 
ATOM   3476  S  SG  . CYS A 1 552  ? -60.264 16.716  -2.976  1.00 39.10  ? 1148 CYS A SG  1 
ATOM   3477  N  N   . GLY A 1 553  ? -62.522 13.893  -2.821  1.00 37.44  ? 1149 GLY A N   1 
ATOM   3478  C  CA  . GLY A 1 553  ? -62.494 12.506  -3.251  1.00 39.58  ? 1149 GLY A CA  1 
ATOM   3479  C  C   . GLY A 1 553  ? -61.129 11.942  -3.588  1.00 35.62  ? 1149 GLY A C   1 
ATOM   3480  O  O   . GLY A 1 553  ? -60.961 11.296  -4.622  1.00 47.32  ? 1149 GLY A O   1 
ATOM   3481  N  N   . GLY A 1 554  ? -60.153 12.174  -2.717  1.00 33.23  ? 1150 GLY A N   1 
ATOM   3482  C  CA  . GLY A 1 554  ? -58.827 11.614  -2.905  1.00 32.26  ? 1150 GLY A CA  1 
ATOM   3483  C  C   . GLY A 1 554  ? -58.822 10.116  -2.670  1.00 36.22  ? 1150 GLY A C   1 
ATOM   3484  O  O   . GLY A 1 554  ? -58.192 9.355   -3.411  1.00 45.53  ? 1150 GLY A O   1 
ATOM   3485  N  N   . LEU A 1 555  ? -59.533 9.696   -1.629  1.00 30.66  ? 1151 LEU A N   1 
ATOM   3486  C  CA  . LEU A 1 555  ? -59.651 8.285   -1.279  1.00 34.25  ? 1151 LEU A CA  1 
ATOM   3487  C  C   . LEU A 1 555  ? -60.292 7.501   -2.422  1.00 36.37  ? 1151 LEU A C   1 
ATOM   3488  O  O   . LEU A 1 555  ? -59.765 6.472   -2.866  1.00 41.96  ? 1151 LEU A O   1 
ATOM   3489  C  CB  . LEU A 1 555  ? -60.467 8.131   0.007   1.00 31.65  ? 1151 LEU A CB  1 
ATOM   3490  C  CG  . LEU A 1 555  ? -60.618 6.744   0.632   1.00 36.86  ? 1151 LEU A CG  1 
ATOM   3491  C  CD1 . LEU A 1 555  ? -59.263 6.156   0.973   1.00 44.03  ? 1151 LEU A CD1 1 
ATOM   3492  C  CD2 . LEU A 1 555  ? -61.486 6.827   1.874   1.00 31.56  ? 1151 LEU A CD2 1 
ATOM   3493  N  N   . SER A 1 556  ? -61.424 8.006   -2.903  1.00 30.67  ? 1152 SER A N   1 
ATOM   3494  C  CA  . SER A 1 556  ? -62.126 7.390   -4.021  1.00 34.76  ? 1152 SER A CA  1 
ATOM   3495  C  C   . SER A 1 556  ? -61.268 7.405   -5.279  1.00 35.95  ? 1152 SER A C   1 
ATOM   3496  O  O   . SER A 1 556  ? -61.362 6.504   -6.108  1.00 42.70  ? 1152 SER A O   1 
ATOM   3497  C  CB  . SER A 1 556  ? -63.455 8.102   -4.284  1.00 31.67  ? 1152 SER A CB  1 
ATOM   3498  O  OG  . SER A 1 556  ? -64.375 7.868   -3.233  1.00 46.64  ? 1152 SER A OG  1 
ATOM   3499  N  N   . GLU A 1 557  ? -60.433 8.430   -5.417  1.00 35.51  ? 1153 GLU A N   1 
ATOM   3500  C  CA  . GLU A 1 557  ? -59.528 8.522   -6.556  1.00 31.28  ? 1153 GLU A CA  1 
ATOM   3501  C  C   . GLU A 1 557  ? -58.514 7.388   -6.523  1.00 36.69  ? 1153 GLU A C   1 
ATOM   3502  O  O   . GLU A 1 557  ? -58.373 6.639   -7.495  1.00 38.94  ? 1153 GLU A O   1 
ATOM   3503  C  CB  . GLU A 1 557  ? -58.809 9.873   -6.573  1.00 27.88  ? 1153 GLU A CB  1 
ATOM   3504  C  CG  . GLU A 1 557  ? -57.724 9.987   -7.635  1.00 38.53  ? 1153 GLU A CG  1 
ATOM   3505  C  CD  . GLU A 1 557  ? -58.271 9.942   -9.050  1.00 36.14  ? 1153 GLU A CD  1 
ATOM   3506  O  OE1 . GLU A 1 557  ? -59.463 10.260  -9.248  1.00 42.12  ? 1153 GLU A OE1 1 
ATOM   3507  O  OE2 . GLU A 1 557  ? -57.502 9.587   -9.969  1.00 38.20  ? 1153 GLU A OE2 1 
ATOM   3508  N  N   . GLY A 1 558  ? -57.816 7.264   -5.398  1.00 38.51  ? 1154 GLY A N   1 
ATOM   3509  C  CA  . GLY A 1 558  ? -56.846 6.198   -5.212  1.00 33.44  ? 1154 GLY A CA  1 
ATOM   3510  C  C   . GLY A 1 558  ? -57.464 4.825   -5.396  1.00 41.83  ? 1154 GLY A C   1 
ATOM   3511  O  O   . GLY A 1 558  ? -56.863 3.937   -6.010  1.00 41.25  ? 1154 GLY A O   1 
ATOM   3512  N  N   . PHE A 1 559  ? -58.674 4.651   -4.873  1.00 38.61  ? 1155 PHE A N   1 
ATOM   3513  C  CA  . PHE A 1 559  ? -59.379 3.385   -5.034  1.00 34.94  ? 1155 PHE A CA  1 
ATOM   3514  C  C   . PHE A 1 559  ? -59.733 3.111   -6.494  1.00 40.86  ? 1155 PHE A C   1 
ATOM   3515  O  O   . PHE A 1 559  ? -59.672 1.968   -6.947  1.00 35.16  ? 1155 PHE A O   1 
ATOM   3516  C  CB  . PHE A 1 559  ? -60.641 3.360   -4.173  1.00 31.70  ? 1155 PHE A CB  1 
ATOM   3517  C  CG  . PHE A 1 559  ? -60.395 2.933   -2.756  1.00 43.94  ? 1155 PHE A CG  1 
ATOM   3518  C  CD1 . PHE A 1 559  ? -59.130 2.546   -2.348  1.00 33.15  ? 1155 PHE A CD1 1 
ATOM   3519  C  CD2 . PHE A 1 559  ? -61.428 2.903   -1.836  1.00 52.28  ? 1155 PHE A CD2 1 
ATOM   3520  C  CE1 . PHE A 1 559  ? -58.898 2.148   -1.048  1.00 29.25  ? 1155 PHE A CE1 1 
ATOM   3521  C  CE2 . PHE A 1 559  ? -61.201 2.504   -0.534  1.00 43.32  ? 1155 PHE A CE2 1 
ATOM   3522  C  CZ  . PHE A 1 559  ? -59.934 2.126   -0.142  1.00 42.83  ? 1155 PHE A CZ  1 
ATOM   3523  N  N   . HIS A 1 560  ? -60.101 4.158   -7.227  1.00 32.96  ? 1156 HIS A N   1 
ATOM   3524  C  CA  . HIS A 1 560  ? -60.387 4.023   -8.650  1.00 30.43  ? 1156 HIS A CA  1 
ATOM   3525  C  C   . HIS A 1 560  ? -59.119 3.624   -9.391  1.00 35.32  ? 1156 HIS A C   1 
ATOM   3526  O  O   . HIS A 1 560  ? -59.165 2.872   -10.364 1.00 40.11  ? 1156 HIS A O   1 
ATOM   3527  C  CB  . HIS A 1 560  ? -60.952 5.324   -9.231  0.76 38.28  ? 1156 HIS A CB  1 
ATOM   3528  C  CG  A HIS A 1 560  ? -62.351 5.626   -8.794  0.59 37.32  ? 1156 HIS A CG  1 
ATOM   3529  C  CG  B HIS A 1 560  ? -61.529 5.172   -10.605 0.41 44.10  ? 1156 HIS A CG  1 
ATOM   3530  N  ND1 A HIS A 1 560  ? -62.748 6.880   -8.383  0.59 36.87  ? 1156 HIS A ND1 1 
ATOM   3531  N  ND1 B HIS A 1 560  ? -62.643 4.403   -10.863 0.41 45.05  ? 1156 HIS A ND1 1 
ATOM   3532  C  CD2 A HIS A 1 560  ? -63.450 4.839   -8.713  0.59 31.52  ? 1156 HIS A CD2 1 
ATOM   3533  C  CD2 B HIS A 1 560  ? -61.145 5.690   -11.796 0.41 33.99  ? 1156 HIS A CD2 1 
ATOM   3534  C  CE1 A HIS A 1 560  ? -64.029 6.852   -8.061  0.59 32.56  ? 1156 HIS A CE1 1 
ATOM   3535  C  CE1 B HIS A 1 560  ? -62.922 4.453   -12.153 0.41 38.41  ? 1156 HIS A CE1 1 
ATOM   3536  N  NE2 A HIS A 1 560  ? -64.479 5.625   -8.253  0.59 28.18  ? 1156 HIS A NE2 1 
ATOM   3537  N  NE2 B HIS A 1 560  ? -62.028 5.227   -12.742 0.41 37.78  ? 1156 HIS A NE2 1 
ATOM   3538  N  N   . GLN A 1 561  ? -57.986 4.132   -8.916  1.00 39.07  ? 1157 GLN A N   1 
ATOM   3539  C  CA  . GLN A 1 561  ? -56.695 3.797   -9.505  1.00 41.37  ? 1157 GLN A CA  1 
ATOM   3540  C  C   . GLN A 1 561  ? -56.313 2.352   -9.212  1.00 36.82  ? 1157 GLN A C   1 
ATOM   3541  O  O   . GLN A 1 561  ? -55.660 1.697   -10.024 1.00 27.91  ? 1157 GLN A O   1 
ATOM   3542  C  CB  . GLN A 1 561  ? -55.612 4.746   -8.992  1.00 28.68  ? 1157 GLN A CB  1 
ATOM   3543  C  CG  . GLN A 1 561  ? -55.823 6.187   -9.414  1.00 27.90  ? 1157 GLN A CG  1 
ATOM   3544  C  CD  . GLN A 1 561  ? -54.712 7.103   -8.950  1.00 29.05  ? 1157 GLN A CD  1 
ATOM   3545  O  OE1 . GLN A 1 561  ? -53.746 6.663   -8.325  1.00 30.18  ? 1157 GLN A OE1 1 
ATOM   3546  N  NE2 . GLN A 1 561  ? -54.843 8.388   -9.257  1.00 24.35  ? 1157 GLN A NE2 1 
ATOM   3547  N  N   . ALA A 1 562  ? -56.724 1.858   -8.048  1.00 47.65  ? 1158 ALA A N   1 
ATOM   3548  C  CA  . ALA A 1 562  ? -56.473 0.467   -7.688  1.00 34.84  ? 1158 ALA A CA  1 
ATOM   3549  C  C   . ALA A 1 562  ? -57.250 -0.481  -8.597  1.00 32.64  ? 1158 ALA A C   1 
ATOM   3550  O  O   . ALA A 1 562  ? -56.858 -1.631  -8.791  1.00 34.75  ? 1158 ALA A O   1 
ATOM   3551  C  CB  . ALA A 1 562  ? -56.834 0.220   -6.235  1.00 45.16  ? 1158 ALA A CB  1 
ATOM   3552  N  N   . GLY A 1 563  ? -58.355 0.012   -9.148  1.00 38.23  ? 1159 GLY A N   1 
ATOM   3553  C  CA  . GLY A 1 563  ? -59.166 -0.762  -10.071 1.00 35.70  ? 1159 GLY A CA  1 
ATOM   3554  C  C   . GLY A 1 563  ? -60.151 -1.676  -9.371  1.00 47.01  ? 1159 GLY A C   1 
ATOM   3555  O  O   . GLY A 1 563  ? -60.599 -2.673  -9.938  1.00 49.83  ? 1159 GLY A O   1 
ATOM   3556  N  N   . ILE A 1 564  ? -60.497 -1.330  -8.137  1.00 42.44  ? 1160 ILE A N   1 
ATOM   3557  C  CA  . ILE A 1 564  ? -61.361 -2.177  -7.326  1.00 33.88  ? 1160 ILE A CA  1 
ATOM   3558  C  C   . ILE A 1 564  ? -62.735 -1.569  -7.117  1.00 37.22  ? 1160 ILE A C   1 
ATOM   3559  O  O   . ILE A 1 564  ? -63.664 -2.252  -6.688  1.00 43.16  ? 1160 ILE A O   1 
ATOM   3560  C  CB  . ILE A 1 564  ? -60.745 -2.445  -5.945  1.00 32.39  ? 1160 ILE A CB  1 
ATOM   3561  C  CG1 . ILE A 1 564  ? -60.650 -1.141  -5.148  1.00 31.50  ? 1160 ILE A CG1 1 
ATOM   3562  C  CG2 . ILE A 1 564  ? -59.382 -3.074  -6.093  1.00 28.90  ? 1160 ILE A CG2 1 
ATOM   3563  C  CD1 . ILE A 1 564  ? -60.190 -1.328  -3.723  1.00 35.71  ? 1160 ILE A CD1 1 
ATOM   3564  N  N   . SER A 1 565  ? -62.870 -0.283  -7.415  1.00 43.47  ? 1161 SER A N   1 
ATOM   3565  C  CA  . SER A 1 565  ? -64.077 0.422   -7.021  1.00 37.73  ? 1161 SER A CA  1 
ATOM   3566  C  C   . SER A 1 565  ? -64.648 1.359   -8.072  1.00 37.00  ? 1161 SER A C   1 
ATOM   3567  O  O   . SER A 1 565  ? -63.936 1.908   -8.910  1.00 40.57  ? 1161 SER A O   1 
ATOM   3568  C  CB  . SER A 1 565  ? -63.814 1.219   -5.745  1.00 39.54  ? 1161 SER A CB  1 
ATOM   3569  O  OG  . SER A 1 565  ? -63.044 2.375   -6.016  1.00 51.01  ? 1161 SER A OG  1 
ATOM   3570  N  N   . ASP A 1 566  ? -65.961 1.514   -8.004  1.00 43.73  ? 1162 ASP A N   1 
ATOM   3571  C  CA  . ASP A 1 566  ? -66.688 2.544   -8.711  1.00 37.09  ? 1162 ASP A CA  1 
ATOM   3572  C  C   . ASP A 1 566  ? -67.522 3.209   -7.638  1.00 43.48  ? 1162 ASP A C   1 
ATOM   3573  O  O   . ASP A 1 566  ? -68.508 2.632   -7.176  1.00 49.34  ? 1162 ASP A O   1 
ATOM   3574  C  CB  . ASP A 1 566  ? -67.562 1.957   -9.821  1.00 48.33  ? 1162 ASP A CB  1 
ATOM   3575  C  CG  . ASP A 1 566  ? -68.167 3.020   -10.719 1.00 69.53  ? 1162 ASP A CG  1 
ATOM   3576  O  OD1 . ASP A 1 566  ? -67.615 4.139   -10.796 1.00 83.69  ? 1162 ASP A OD1 1 
ATOM   3577  O  OD2 . ASP A 1 566  ? -69.201 2.728   -11.356 1.00 61.79  ? 1162 ASP A OD2 1 
ATOM   3578  N  N   . THR A 1 567  ? -67.096 4.389   -7.195  1.00 38.84  ? 1163 THR A N   1 
ATOM   3579  C  CA  . THR A 1 567  ? -67.810 5.112   -6.147  1.00 32.57  ? 1163 THR A CA  1 
ATOM   3580  C  C   . THR A 1 567  ? -69.063 5.747   -6.722  1.00 41.70  ? 1163 THR A C   1 
ATOM   3581  O  O   . THR A 1 567  ? -68.989 6.757   -7.424  1.00 37.00  ? 1163 THR A O   1 
ATOM   3582  C  CB  . THR A 1 567  ? -66.923 6.194   -5.496  1.00 34.14  ? 1163 THR A CB  1 
ATOM   3583  O  OG1 . THR A 1 567  ? -65.767 5.575   -4.920  1.00 36.28  ? 1163 THR A OG1 1 
ATOM   3584  C  CG2 . THR A 1 567  ? -67.682 6.950   -4.403  1.00 32.92  ? 1163 THR A CG2 1 
ATOM   3585  N  N   . LEU A 1 568  ? -70.214 5.156   -6.421  1.00 39.96  ? 1164 LEU A N   1 
ATOM   3586  C  CA  . LEU A 1 568  ? -71.455 5.598   -7.046  1.00 37.82  ? 1164 LEU A CA  1 
ATOM   3587  C  C   . LEU A 1 568  ? -72.191 6.586   -6.157  1.00 42.77  ? 1164 LEU A C   1 
ATOM   3588  O  O   . LEU A 1 568  ? -72.997 7.386   -6.631  1.00 44.05  ? 1164 LEU A O   1 
ATOM   3589  C  CB  . LEU A 1 568  ? -72.349 4.400   -7.369  1.00 34.66  ? 1164 LEU A CB  1 
ATOM   3590  C  CG  . LEU A 1 568  ? -71.820 3.449   -8.442  1.00 34.29  ? 1164 LEU A CG  1 
ATOM   3591  C  CD1 . LEU A 1 568  ? -72.684 2.210   -8.493  1.00 28.52  ? 1164 LEU A CD1 1 
ATOM   3592  C  CD2 . LEU A 1 568  ? -71.791 4.134   -9.798  1.00 38.42  ? 1164 LEU A CD2 1 
ATOM   3593  N  N   . TRP A 1 569  ? -71.899 6.535   -4.863  1.00 42.56  ? 1165 TRP A N   1 
ATOM   3594  C  CA  . TRP A 1 569  ? -72.542 7.424   -3.907  1.00 32.84  ? 1165 TRP A CA  1 
ATOM   3595  C  C   . TRP A 1 569  ? -71.506 8.065   -2.995  1.00 39.29  ? 1165 TRP A C   1 
ATOM   3596  O  O   . TRP A 1 569  ? -70.578 7.403   -2.532  1.00 40.67  ? 1165 TRP A O   1 
ATOM   3597  C  CB  . TRP A 1 569  ? -73.574 6.663   -3.075  1.00 36.32  ? 1165 TRP A CB  1 
ATOM   3598  C  CG  . TRP A 1 569  ? -74.404 5.706   -3.870  1.00 39.81  ? 1165 TRP A CG  1 
ATOM   3599  C  CD1 . TRP A 1 569  ? -75.544 5.988   -4.563  1.00 43.69  ? 1165 TRP A CD1 1 
ATOM   3600  C  CD2 . TRP A 1 569  ? -74.159 4.307   -4.052  1.00 33.87  ? 1165 TRP A CD2 1 
ATOM   3601  N  NE1 . TRP A 1 569  ? -76.024 4.851   -5.168  1.00 50.57  ? 1165 TRP A NE1 1 
ATOM   3602  C  CE2 . TRP A 1 569  ? -75.191 3.805   -4.869  1.00 39.49  ? 1165 TRP A CE2 1 
ATOM   3603  C  CE3 . TRP A 1 569  ? -73.167 3.430   -3.605  1.00 37.78  ? 1165 TRP A CE3 1 
ATOM   3604  C  CZ2 . TRP A 1 569  ? -75.259 2.467   -5.247  1.00 42.55  ? 1165 TRP A CZ2 1 
ATOM   3605  C  CZ3 . TRP A 1 569  ? -73.236 2.102   -3.981  1.00 38.69  ? 1165 TRP A CZ3 1 
ATOM   3606  C  CH2 . TRP A 1 569  ? -74.275 1.634   -4.793  1.00 33.57  ? 1165 TRP A CH2 1 
ATOM   3607  N  N   . ALA A 1 570  ? -71.668 9.359   -2.742  1.00 40.18  ? 1166 ALA A N   1 
ATOM   3608  C  CA  . ALA A 1 570  ? -70.781 10.075  -1.835  1.00 34.12  ? 1166 ALA A CA  1 
ATOM   3609  C  C   . ALA A 1 570  ? -71.590 10.968  -0.908  1.00 34.63  ? 1166 ALA A C   1 
ATOM   3610  O  O   . ALA A 1 570  ? -72.688 11.404  -1.255  1.00 37.75  ? 1166 ALA A O   1 
ATOM   3611  C  CB  . ALA A 1 570  ? -69.766 10.894  -2.613  1.00 28.54  ? 1166 ALA A CB  1 
ATOM   3612  N  N   . ILE A 1 571  ? -71.046 11.231  0.274   1.00 31.66  ? 1167 ILE A N   1 
ATOM   3613  C  CA  . ILE A 1 571  ? -71.710 12.082  1.251   1.00 25.54  ? 1167 ILE A CA  1 
ATOM   3614  C  C   . ILE A 1 571  ? -70.751 13.136  1.785   1.00 37.23  ? 1167 ILE A C   1 
ATOM   3615  O  O   . ILE A 1 571  ? -69.775 12.810  2.458   1.00 34.79  ? 1167 ILE A O   1 
ATOM   3616  C  CB  . ILE A 1 571  ? -72.268 11.263  2.431   1.00 34.01  ? 1167 ILE A CB  1 
ATOM   3617  C  CG1 . ILE A 1 571  ? -73.311 10.257  1.941   1.00 32.10  ? 1167 ILE A CG1 1 
ATOM   3618  C  CG2 . ILE A 1 571  ? -72.869 12.185  3.481   1.00 36.18  ? 1167 ILE A CG2 1 
ATOM   3619  C  CD1 . ILE A 1 571  ? -73.847 9.356   3.026   1.00 31.90  ? 1167 ILE A CD1 1 
ATOM   3620  N  N   . GLU A 1 572  ? -71.029 14.400  1.481   1.00 30.36  ? 1168 GLU A N   1 
ATOM   3621  C  CA  . GLU A 1 572  ? -70.204 15.502  1.960   1.00 34.40  ? 1168 GLU A CA  1 
ATOM   3622  C  C   . GLU A 1 572  ? -71.052 16.741  2.225   1.00 31.55  ? 1168 GLU A C   1 
ATOM   3623  O  O   . GLU A 1 572  ? -71.719 17.249  1.325   1.00 41.13  ? 1168 GLU A O   1 
ATOM   3624  C  CB  . GLU A 1 572  ? -69.100 15.825  0.953   1.00 34.94  ? 1168 GLU A CB  1 
ATOM   3625  C  CG  . GLU A 1 572  ? -68.198 16.969  1.380   1.00 29.02  ? 1168 GLU A CG  1 
ATOM   3626  C  CD  . GLU A 1 572  ? -67.499 16.693  2.695   1.00 44.30  ? 1168 GLU A CD  1 
ATOM   3627  O  OE1 . GLU A 1 572  ? -66.676 15.754  2.745   1.00 54.16  ? 1168 GLU A OE1 1 
ATOM   3628  O  OE2 . GLU A 1 572  ? -67.776 17.409  3.681   1.00 53.73  ? 1168 GLU A OE2 1 
ATOM   3629  N  N   . MET A 1 573  ? -71.022 17.226  3.462   1.00 39.19  ? 1169 MET A N   1 
ATOM   3630  C  CA  . MET A 1 573  ? -71.859 18.356  3.853   1.00 42.70  ? 1169 MET A CA  1 
ATOM   3631  C  C   . MET A 1 573  ? -71.314 19.684  3.344   1.00 37.06  ? 1169 MET A C   1 
ATOM   3632  O  O   . MET A 1 573  ? -72.080 20.592  3.024   1.00 44.35  ? 1169 MET A O   1 
ATOM   3633  C  CB  . MET A 1 573  ? -72.013 18.409  5.374   1.00 46.94  ? 1169 MET A CB  1 
ATOM   3634  C  CG  . MET A 1 573  ? -72.836 17.272  5.950   1.00 67.21  ? 1169 MET A CG  1 
ATOM   3635  S  SD  . MET A 1 573  ? -73.798 17.787  7.385   1.00 77.39  ? 1169 MET A SD  1 
ATOM   3636  C  CE  . MET A 1 573  ? -74.895 18.989  6.634   1.00 46.94  ? 1169 MET A CE  1 
ATOM   3637  N  N   . TRP A 1 574  ? -69.992 19.799  3.275   1.00 33.98  ? 1170 TRP A N   1 
ATOM   3638  C  CA  . TRP A 1 574  ? -69.366 21.012  2.762   1.00 31.69  ? 1170 TRP A CA  1 
ATOM   3639  C  C   . TRP A 1 574  ? -69.541 21.084  1.247   1.00 29.48  ? 1170 TRP A C   1 
ATOM   3640  O  O   . TRP A 1 574  ? -69.066 20.216  0.516   1.00 42.48  ? 1170 TRP A O   1 
ATOM   3641  C  CB  . TRP A 1 574  ? -67.884 21.061  3.129   1.00 35.52  ? 1170 TRP A CB  1 
ATOM   3642  C  CG  . TRP A 1 574  ? -67.268 22.413  2.939   1.00 43.89  ? 1170 TRP A CG  1 
ATOM   3643  C  CD1 . TRP A 1 574  ? -67.833 23.621  3.235   1.00 42.12  ? 1170 TRP A CD1 1 
ATOM   3644  C  CD2 . TRP A 1 574  ? -65.975 22.698  2.394   1.00 41.95  ? 1170 TRP A CD2 1 
ATOM   3645  N  NE1 . TRP A 1 574  ? -66.967 24.638  2.917   1.00 44.85  ? 1170 TRP A NE1 1 
ATOM   3646  C  CE2 . TRP A 1 574  ? -65.820 24.098  2.397   1.00 45.84  ? 1170 TRP A CE2 1 
ATOM   3647  C  CE3 . TRP A 1 574  ? -64.933 21.903  1.906   1.00 39.25  ? 1170 TRP A CE3 1 
ATOM   3648  C  CZ2 . TRP A 1 574  ? -64.664 24.721  1.932   1.00 50.11  ? 1170 TRP A CZ2 1 
ATOM   3649  C  CZ3 . TRP A 1 574  ? -63.788 22.523  1.445   1.00 36.05  ? 1170 TRP A CZ3 1 
ATOM   3650  C  CH2 . TRP A 1 574  ? -63.663 23.918  1.461   1.00 47.36  ? 1170 TRP A CH2 1 
ATOM   3651  N  N   . ASP A 1 575  ? -70.220 22.129  0.786   1.00 32.45  ? 1171 ASP A N   1 
ATOM   3652  C  CA  . ASP A 1 575  ? -70.630 22.228  -0.612  1.00 44.30  ? 1171 ASP A CA  1 
ATOM   3653  C  C   . ASP A 1 575  ? -69.491 22.244  -1.646  1.00 43.98  ? 1171 ASP A C   1 
ATOM   3654  O  O   . ASP A 1 575  ? -69.570 21.513  -2.632  1.00 42.40  ? 1171 ASP A O   1 
ATOM   3655  C  CB  . ASP A 1 575  ? -71.511 23.464  -0.810  1.00 47.30  ? 1171 ASP A CB  1 
ATOM   3656  C  CG  . ASP A 1 575  ? -72.266 23.428  -2.120  1.00 59.84  ? 1171 ASP A CG  1 
ATOM   3657  O  OD1 . ASP A 1 575  ? -73.176 22.581  -2.251  1.00 59.08  ? 1171 ASP A OD1 1 
ATOM   3658  O  OD2 . ASP A 1 575  ? -71.949 24.231  -3.022  1.00 61.10  ? 1171 ASP A OD2 1 
ATOM   3659  N  N   . PRO A 1 576  ? -68.439 23.069  -1.443  1.00 51.12  ? 1172 PRO A N   1 
ATOM   3660  C  CA  . PRO A 1 576  ? -67.388 23.087  -2.472  1.00 46.12  ? 1172 PRO A CA  1 
ATOM   3661  C  C   . PRO A 1 576  ? -66.759 21.716  -2.735  1.00 39.68  ? 1172 PRO A C   1 
ATOM   3662  O  O   . PRO A 1 576  ? -66.537 21.344  -3.892  1.00 45.69  ? 1172 PRO A O   1 
ATOM   3663  C  CB  . PRO A 1 576  ? -66.346 24.053  -1.891  1.00 38.56  ? 1172 PRO A CB  1 
ATOM   3664  C  CG  . PRO A 1 576  ? -67.122 24.939  -0.991  1.00 28.82  ? 1172 PRO A CG  1 
ATOM   3665  C  CD  . PRO A 1 576  ? -68.165 24.055  -0.380  1.00 33.06  ? 1172 PRO A CD  1 
ATOM   3666  N  N   . ALA A 1 577  ? -66.490 20.974  -1.666  1.00 35.54  ? 1173 ALA A N   1 
ATOM   3667  C  CA  . ALA A 1 577  ? -65.904 19.645  -1.781  1.00 28.58  ? 1173 ALA A CA  1 
ATOM   3668  C  C   . ALA A 1 577  ? -66.837 18.706  -2.536  1.00 38.96  ? 1173 ALA A C   1 
ATOM   3669  O  O   . ALA A 1 577  ? -66.395 17.909  -3.366  1.00 44.91  ? 1173 ALA A O   1 
ATOM   3670  C  CB  . ALA A 1 577  ? -65.587 19.087  -0.409  1.00 26.35  ? 1173 ALA A CB  1 
ATOM   3671  N  N   . ALA A 1 578  ? -68.128 18.809  -2.242  1.00 30.20  ? 1174 ALA A N   1 
ATOM   3672  C  CA  . ALA A 1 578  ? -69.138 18.012  -2.925  1.00 42.56  ? 1174 ALA A CA  1 
ATOM   3673  C  C   . ALA A 1 578  ? -69.122 18.308  -4.420  1.00 43.03  ? 1174 ALA A C   1 
ATOM   3674  O  O   . ALA A 1 578  ? -69.156 17.393  -5.249  1.00 41.77  ? 1174 ALA A O   1 
ATOM   3675  C  CB  . ALA A 1 578  ? -70.512 18.285  -2.342  1.00 31.57  ? 1174 ALA A CB  1 
ATOM   3676  N  N   . GLN A 1 579  ? -69.067 19.596  -4.750  1.00 39.58  ? 1175 GLN A N   1 
ATOM   3677  C  CA  . GLN A 1 579  ? -68.962 20.043  -6.134  1.00 36.66  ? 1175 GLN A CA  1 
ATOM   3678  C  C   . GLN A 1 579  ? -67.747 19.425  -6.811  1.00 43.70  ? 1175 GLN A C   1 
ATOM   3679  O  O   . GLN A 1 579  ? -67.835 18.932  -7.937  1.00 37.29  ? 1175 GLN A O   1 
ATOM   3680  C  CB  . GLN A 1 579  ? -68.870 21.567  -6.202  1.00 49.32  ? 1175 GLN A CB  1 
ATOM   3681  C  CG  . GLN A 1 579  ? -70.061 22.301  -5.617  1.00 60.22  ? 1175 GLN A CG  1 
ATOM   3682  C  CD  . GLN A 1 579  ? -71.030 22.775  -6.676  1.00 68.69  ? 1175 GLN A CD  1 
ATOM   3683  O  OE1 . GLN A 1 579  ? -71.301 22.069  -7.647  1.00 87.90  ? 1175 GLN A OE1 1 
ATOM   3684  N  NE2 . GLN A 1 579  ? -71.550 23.983  -6.501  1.00 68.42  ? 1175 GLN A NE2 1 
ATOM   3685  N  N   . ALA A 1 580  ? -66.612 19.461  -6.117  1.00 38.18  ? 1176 ALA A N   1 
ATOM   3686  C  CA  . ALA A 1 580  ? -65.376 18.891  -6.643  1.00 33.24  ? 1176 ALA A CA  1 
ATOM   3687  C  C   . ALA A 1 580  ? -65.527 17.398  -6.925  1.00 34.62  ? 1176 ALA A C   1 
ATOM   3688  O  O   . ALA A 1 580  ? -65.097 16.906  -7.976  1.00 39.60  ? 1176 ALA A O   1 
ATOM   3689  C  CB  . ALA A 1 580  ? -64.232 19.132  -5.675  1.00 34.21  ? 1176 ALA A CB  1 
ATOM   3690  N  N   . PHE A 1 581  ? -66.145 16.685  -5.987  1.00 31.61  ? 1177 PHE A N   1 
ATOM   3691  C  CA  . PHE A 1 581  ? -66.375 15.254  -6.152  1.00 36.69  ? 1177 PHE A CA  1 
ATOM   3692  C  C   . PHE A 1 581  ? -67.250 14.999  -7.374  1.00 40.88  ? 1177 PHE A C   1 
ATOM   3693  O  O   . PHE A 1 581  ? -66.992 14.075  -8.146  1.00 43.11  ? 1177 PHE A O   1 
ATOM   3694  C  CB  . PHE A 1 581  ? -67.024 14.651  -4.904  1.00 35.43  ? 1177 PHE A CB  1 
ATOM   3695  C  CG  . PHE A 1 581  ? -66.867 13.158  -4.803  1.00 28.75  ? 1177 PHE A CG  1 
ATOM   3696  C  CD1 . PHE A 1 581  ? -67.678 12.307  -5.536  1.00 30.51  ? 1177 PHE A CD1 1 
ATOM   3697  C  CD2 . PHE A 1 581  ? -65.900 12.606  -3.981  1.00 32.14  ? 1177 PHE A CD2 1 
ATOM   3698  C  CE1 . PHE A 1 581  ? -67.529 10.935  -5.446  1.00 26.20  ? 1177 PHE A CE1 1 
ATOM   3699  C  CE2 . PHE A 1 581  ? -65.748 11.234  -3.885  1.00 28.61  ? 1177 PHE A CE2 1 
ATOM   3700  C  CZ  . PHE A 1 581  ? -66.563 10.399  -4.619  1.00 25.26  ? 1177 PHE A CZ  1 
ATOM   3701  N  N   . ARG A 1 582  ? -68.282 15.822  -7.543  1.00 35.56  ? 1178 ARG A N   1 
ATOM   3702  C  CA  . ARG A 1 582  ? -69.139 15.729  -8.722  1.00 39.44  ? 1178 ARG A CA  1 
ATOM   3703  C  C   . ARG A 1 582  ? -68.335 15.920  -10.001 1.00 45.92  ? 1178 ARG A C   1 
ATOM   3704  O  O   . ARG A 1 582  ? -68.496 15.167  -10.962 1.00 32.04  ? 1178 ARG A O   1 
ATOM   3705  C  CB  . ARG A 1 582  ? -70.268 16.759  -8.655  1.00 40.56  ? 1178 ARG A CB  1 
ATOM   3706  C  CG  . ARG A 1 582  ? -71.540 16.228  -8.024  1.00 43.99  ? 1178 ARG A CG  1 
ATOM   3707  C  CD  . ARG A 1 582  ? -72.483 17.349  -7.628  1.00 51.74  ? 1178 ARG A CD  1 
ATOM   3708  N  NE  . ARG A 1 582  ? -73.479 16.889  -6.666  1.00 69.62  ? 1178 ARG A NE  1 
ATOM   3709  C  CZ  . ARG A 1 582  ? -73.908 17.608  -5.634  1.00 56.87  ? 1178 ARG A CZ  1 
ATOM   3710  N  NH1 . ARG A 1 582  ? -73.431 18.829  -5.431  1.00 54.35  ? 1178 ARG A NH1 1 
ATOM   3711  N  NH2 . ARG A 1 582  ? -74.815 17.108  -4.806  1.00 50.60  ? 1178 ARG A NH2 1 
ATOM   3712  N  N   . LEU A 1 583  ? -67.466 16.927  -10.002 1.00 49.71  ? 1179 LEU A N   1 
ATOM   3713  C  CA  . LEU A 1 583  ? -66.631 17.217  -11.162 1.00 40.00  ? 1179 LEU A CA  1 
ATOM   3714  C  C   . LEU A 1 583  ? -65.726 16.045  -11.515 1.00 45.01  ? 1179 LEU A C   1 
ATOM   3715  O  O   . LEU A 1 583  ? -65.589 15.693  -12.686 1.00 51.10  ? 1179 LEU A O   1 
ATOM   3716  C  CB  . LEU A 1 583  ? -65.788 18.469  -10.918 1.00 37.40  ? 1179 LEU A CB  1 
ATOM   3717  C  CG  . LEU A 1 583  ? -66.521 19.806  -11.005 1.00 38.09  ? 1179 LEU A CG  1 
ATOM   3718  C  CD1 . LEU A 1 583  ? -65.573 20.951  -10.699 1.00 35.16  ? 1179 LEU A CD1 1 
ATOM   3719  C  CD2 . LEU A 1 583  ? -67.141 19.977  -12.381 1.00 33.78  ? 1179 LEU A CD2 1 
ATOM   3720  N  N   . ASN A 1 584  ? -65.113 15.440  -10.503 1.00 40.34  ? 1180 ASN A N   1 
ATOM   3721  C  CA  . ASN A 1 584  ? -64.198 14.329  -10.747 1.00 36.81  ? 1180 ASN A CA  1 
ATOM   3722  C  C   . ASN A 1 584  ? -64.900 12.977  -10.866 1.00 38.62  ? 1180 ASN A C   1 
ATOM   3723  O  O   . ASN A 1 584  ? -64.294 11.992  -11.285 1.00 37.57  ? 1180 ASN A O   1 
ATOM   3724  C  CB  . ASN A 1 584  ? -63.141 14.267  -9.644  1.00 37.44  ? 1180 ASN A CB  1 
ATOM   3725  C  CG  . ASN A 1 584  ? -62.195 15.449  -9.679  1.00 40.22  ? 1180 ASN A CG  1 
ATOM   3726  O  OD1 . ASN A 1 584  ? -61.289 15.507  -10.511 1.00 36.72  ? 1180 ASN A OD1 1 
ATOM   3727  N  ND2 . ASN A 1 584  ? -62.401 16.400  -8.775  1.00 36.78  ? 1180 ASN A ND2 1 
ATOM   3728  N  N   . ASN A 1 585  ? -66.176 12.933  -10.494 1.00 43.14  ? 1181 ASN A N   1 
ATOM   3729  C  CA  . ASN A 1 585  ? -66.959 11.704  -10.593 1.00 38.28  ? 1181 ASN A CA  1 
ATOM   3730  C  C   . ASN A 1 585  ? -68.376 11.975  -11.087 1.00 45.82  ? 1181 ASN A C   1 
ATOM   3731  O  O   . ASN A 1 585  ? -69.328 11.926  -10.309 1.00 57.70  ? 1181 ASN A O   1 
ATOM   3732  C  CB  . ASN A 1 585  ? -67.009 10.986  -9.243  1.00 31.63  ? 1181 ASN A CB  1 
ATOM   3733  C  CG  . ASN A 1 585  ? -65.632 10.664  -8.702  1.00 38.42  ? 1181 ASN A CG  1 
ATOM   3734  O  OD1 . ASN A 1 585  ? -65.003 9.690   -9.112  1.00 52.05  ? 1181 ASN A OD1 1 
ATOM   3735  N  ND2 . ASN A 1 585  ? -65.156 11.486  -7.772  1.00 31.50  ? 1181 ASN A ND2 1 
ATOM   3736  N  N   . PRO A 1 586  ? -68.519 12.252  -12.391 1.00 41.60  ? 1182 PRO A N   1 
ATOM   3737  C  CA  . PRO A 1 586  ? -69.797 12.658  -12.988 1.00 45.46  ? 1182 PRO A CA  1 
ATOM   3738  C  C   . PRO A 1 586  ? -70.850 11.551  -12.998 1.00 44.61  ? 1182 PRO A C   1 
ATOM   3739  O  O   . PRO A 1 586  ? -72.036 11.845  -13.145 1.00 47.20  ? 1182 PRO A O   1 
ATOM   3740  C  CB  . PRO A 1 586  ? -69.406 13.040  -14.417 1.00 41.76  ? 1182 PRO A CB  1 
ATOM   3741  C  CG  . PRO A 1 586  ? -68.192 12.228  -14.697 1.00 38.97  ? 1182 PRO A CG  1 
ATOM   3742  C  CD  . PRO A 1 586  ? -67.449 12.147  -13.398 1.00 38.08  ? 1182 PRO A CD  1 
ATOM   3743  N  N   . GLY A 1 587  ? -70.424 10.302  -12.843 1.00 55.24  ? 1183 GLY A N   1 
ATOM   3744  C  CA  . GLY A 1 587  ? -71.345 9.181   -12.868 1.00 47.63  ? 1183 GLY A CA  1 
ATOM   3745  C  C   . GLY A 1 587  ? -71.812 8.768   -11.487 1.00 46.69  ? 1183 GLY A C   1 
ATOM   3746  O  O   . GLY A 1 587  ? -72.359 7.679   -11.309 1.00 57.33  ? 1183 GLY A O   1 
ATOM   3747  N  N   . SER A 1 588  ? -71.600 9.640   -10.506 1.00 47.04  ? 1184 SER A N   1 
ATOM   3748  C  CA  . SER A 1 588  ? -71.948 9.327   -9.126  1.00 43.21  ? 1184 SER A CA  1 
ATOM   3749  C  C   . SER A 1 588  ? -72.984 10.290  -8.559  1.00 43.28  ? 1184 SER A C   1 
ATOM   3750  O  O   . SER A 1 588  ? -73.248 11.349  -9.129  1.00 52.19  ? 1184 SER A O   1 
ATOM   3751  C  CB  . SER A 1 588  ? -70.699 9.344   -8.244  1.00 39.15  ? 1184 SER A CB  1 
ATOM   3752  O  OG  . SER A 1 588  ? -70.223 10.666  -8.064  1.00 47.47  ? 1184 SER A OG  1 
ATOM   3753  N  N   . THR A 1 589  ? -73.559 9.909   -7.423  1.00 45.28  ? 1185 THR A N   1 
ATOM   3754  C  CA  . THR A 1 589  ? -74.564 10.719  -6.752  1.00 44.74  ? 1185 THR A CA  1 
ATOM   3755  C  C   . THR A 1 589  ? -74.020 11.269  -5.441  1.00 44.15  ? 1185 THR A C   1 
ATOM   3756  O  O   . THR A 1 589  ? -73.704 10.511  -4.523  1.00 39.82  ? 1185 THR A O   1 
ATOM   3757  C  CB  . THR A 1 589  ? -75.842 9.910   -6.469  1.00 40.37  ? 1185 THR A CB  1 
ATOM   3758  O  OG1 . THR A 1 589  ? -76.271 9.254   -7.669  1.00 41.54  ? 1185 THR A OG1 1 
ATOM   3759  C  CG2 . THR A 1 589  ? -76.949 10.819  -5.966  1.00 37.14  ? 1185 THR A CG2 1 
ATOM   3760  N  N   . VAL A 1 590  ? -73.914 12.590  -5.354  1.00 53.01  ? 1186 VAL A N   1 
ATOM   3761  C  CA  . VAL A 1 590  ? -73.379 13.228  -4.159  1.00 43.65  ? 1186 VAL A CA  1 
ATOM   3762  C  C   . VAL A 1 590  ? -74.483 13.822  -3.293  1.00 37.85  ? 1186 VAL A C   1 
ATOM   3763  O  O   . VAL A 1 590  ? -75.259 14.663  -3.748  1.00 40.97  ? 1186 VAL A O   1 
ATOM   3764  C  CB  . VAL A 1 590  ? -72.378 14.338  -4.513  1.00 44.33  ? 1186 VAL A CB  1 
ATOM   3765  C  CG1 . VAL A 1 590  ? -71.800 14.946  -3.248  1.00 37.72  ? 1186 VAL A CG1 1 
ATOM   3766  C  CG2 . VAL A 1 590  ? -71.272 13.786  -5.391  1.00 46.97  ? 1186 VAL A CG2 1 
ATOM   3767  N  N   . PHE A 1 591  ? -74.546 13.377  -2.043  1.00 34.31  ? 1187 PHE A N   1 
ATOM   3768  C  CA  . PHE A 1 591  ? -75.497 13.924  -1.086  1.00 37.31  ? 1187 PHE A CA  1 
ATOM   3769  C  C   . PHE A 1 591  ? -74.818 14.961  -0.197  1.00 39.00  ? 1187 PHE A C   1 
ATOM   3770  O  O   . PHE A 1 591  ? -73.724 14.727  0.315   1.00 42.91  ? 1187 PHE A O   1 
ATOM   3771  C  CB  . PHE A 1 591  ? -76.100 12.815  -0.224  1.00 42.01  ? 1187 PHE A CB  1 
ATOM   3772  C  CG  . PHE A 1 591  ? -76.715 11.693  -1.012  1.00 34.03  ? 1187 PHE A CG  1 
ATOM   3773  C  CD1 . PHE A 1 591  ? -77.994 11.810  -1.529  1.00 27.08  ? 1187 PHE A CD1 1 
ATOM   3774  C  CD2 . PHE A 1 591  ? -76.019 10.514  -1.220  1.00 27.91  ? 1187 PHE A CD2 1 
ATOM   3775  C  CE1 . PHE A 1 591  ? -78.562 10.776  -2.248  1.00 33.13  ? 1187 PHE A CE1 1 
ATOM   3776  C  CE2 . PHE A 1 591  ? -76.582 9.478   -1.937  1.00 25.59  ? 1187 PHE A CE2 1 
ATOM   3777  C  CZ  . PHE A 1 591  ? -77.855 9.608   -2.451  1.00 35.11  ? 1187 PHE A CZ  1 
ATOM   3778  N  N   . THR A 1 592  ? -75.470 16.104  -0.011  1.00 39.90  ? 1188 THR A N   1 
ATOM   3779  C  CA  . THR A 1 592  ? -74.916 17.162  0.826   1.00 32.89  ? 1188 THR A CA  1 
ATOM   3780  C  C   . THR A 1 592  ? -75.642 17.251  2.164   1.00 51.82  ? 1188 THR A C   1 
ATOM   3781  O  O   . THR A 1 592  ? -75.231 17.995  3.055   1.00 62.30  ? 1188 THR A O   1 
ATOM   3782  C  CB  . THR A 1 592  ? -74.985 18.528  0.131   1.00 35.09  ? 1188 THR A CB  1 
ATOM   3783  O  OG1 . THR A 1 592  ? -76.347 18.969  0.071   1.00 59.07  ? 1188 THR A OG1 1 
ATOM   3784  C  CG2 . THR A 1 592  ? -74.419 18.436  -1.275  1.00 51.99  ? 1188 THR A CG2 1 
ATOM   3785  N  N   . GLU A 1 593  ? -76.724 16.492  2.296   1.00 50.07  ? 1189 GLU A N   1 
ATOM   3786  C  CA  . GLU A 1 593  ? -77.500 16.473  3.529   1.00 48.47  ? 1189 GLU A CA  1 
ATOM   3787  C  C   . GLU A 1 593  ? -76.750 15.716  4.617   1.00 52.39  ? 1189 GLU A C   1 
ATOM   3788  O  O   . GLU A 1 593  ? -75.839 14.941  4.325   1.00 51.07  ? 1189 GLU A O   1 
ATOM   3789  C  CB  . GLU A 1 593  ? -78.873 15.841  3.294   1.00 57.34  ? 1189 GLU A CB  1 
ATOM   3790  C  CG  . GLU A 1 593  ? -79.522 16.253  1.984   1.00 82.49  ? 1189 GLU A CG  1 
ATOM   3791  C  CD  . GLU A 1 593  ? -81.027 16.088  2.004   1.00 80.92  ? 1189 GLU A CD  1 
ATOM   3792  O  OE1 . GLU A 1 593  ? -81.651 16.470  3.017   1.00 72.09  ? 1189 GLU A OE1 1 
ATOM   3793  O  OE2 . GLU A 1 593  ? -81.586 15.578  1.011   1.00 72.09  ? 1189 GLU A OE2 1 
ATOM   3794  N  N   . ASP A 1 594  ? -77.121 15.966  5.870   1.00 50.84  ? 1190 ASP A N   1 
ATOM   3795  C  CA  . ASP A 1 594  ? -76.536 15.261  7.005   1.00 46.80  ? 1190 ASP A CA  1 
ATOM   3796  C  C   . ASP A 1 594  ? -76.673 13.753  6.814   1.00 50.90  ? 1190 ASP A C   1 
ATOM   3797  O  O   . ASP A 1 594  ? -77.722 13.270  6.389   1.00 60.98  ? 1190 ASP A O   1 
ATOM   3798  C  CB  . ASP A 1 594  ? -77.207 15.698  8.310   1.00 43.51  ? 1190 ASP A CB  1 
ATOM   3799  C  CG  . ASP A 1 594  ? -76.436 15.259  9.540   1.00 60.88  ? 1190 ASP A CG  1 
ATOM   3800  O  OD1 . ASP A 1 594  ? -76.339 14.039  9.781   1.00 61.90  ? 1190 ASP A OD1 1 
ATOM   3801  O  OD2 . ASP A 1 594  ? -75.937 16.140  10.272  1.00 61.69  ? 1190 ASP A OD2 1 
ATOM   3802  N  N   . CYS A 1 595  ? -75.611 13.013  7.118   1.00 33.12  ? 1191 CYS A N   1 
ATOM   3803  C  CA  . CYS A 1 595  ? -75.606 11.568  6.904   1.00 45.09  ? 1191 CYS A CA  1 
ATOM   3804  C  C   . CYS A 1 595  ? -76.640 10.871  7.782   1.00 50.16  ? 1191 CYS A C   1 
ATOM   3805  O  O   . CYS A 1 595  ? -77.207 9.843   7.401   1.00 38.41  ? 1191 CYS A O   1 
ATOM   3806  C  CB  . CYS A 1 595  ? -74.213 10.989  7.169   1.00 41.11  ? 1191 CYS A CB  1 
ATOM   3807  S  SG  . CYS A 1 595  ? -73.616 11.198  8.859   1.00 51.53  ? 1191 CYS A SG  1 
ATOM   3808  N  N   . ASN A 1 596  ? -76.889 11.446  8.954   1.00 46.77  ? 1192 ASN A N   1 
ATOM   3809  C  CA  . ASN A 1 596  ? -77.843 10.877  9.896   1.00 37.76  ? 1192 ASN A CA  1 
ATOM   3810  C  C   . ASN A 1 596  ? -79.269 10.876  9.362   1.00 48.29  ? 1192 ASN A C   1 
ATOM   3811  O  O   . ASN A 1 596  ? -79.969 9.871   9.466   1.00 55.08  ? 1192 ASN A O   1 
ATOM   3812  C  CB  . ASN A 1 596  ? -77.790 11.628  11.227  1.00 41.65  ? 1192 ASN A CB  1 
ATOM   3813  C  CG  . ASN A 1 596  ? -76.633 11.185  12.098  1.00 43.72  ? 1192 ASN A CG  1 
ATOM   3814  O  OD1 . ASN A 1 596  ? -76.338 9.994   12.195  1.00 47.32  ? 1192 ASN A OD1 1 
ATOM   3815  N  ND2 . ASN A 1 596  ? -75.969 12.141  12.735  1.00 47.68  ? 1192 ASN A ND2 1 
ATOM   3816  N  N   . ILE A 1 597  ? -79.703 11.992  8.786   1.00 46.66  ? 1193 ILE A N   1 
ATOM   3817  C  CA  . ILE A 1 597  ? -81.070 12.067  8.290   1.00 58.25  ? 1193 ILE A CA  1 
ATOM   3818  C  C   . ILE A 1 597  ? -81.224 11.238  7.019   1.00 48.70  ? 1193 ILE A C   1 
ATOM   3819  O  O   . ILE A 1 597  ? -82.321 10.793  6.696   1.00 51.55  ? 1193 ILE A O   1 
ATOM   3820  C  CB  . ILE A 1 597  ? -81.518 13.522  8.029   1.00 44.66  ? 1193 ILE A CB  1 
ATOM   3821  C  CG1 . ILE A 1 597  ? -80.740 14.144  6.874   1.00 49.90  ? 1193 ILE A CG1 1 
ATOM   3822  C  CG2 . ILE A 1 597  ? -81.373 14.359  9.293   1.00 62.80  ? 1193 ILE A CG2 1 
ATOM   3823  C  CD1 . ILE A 1 597  ? -81.129 15.581  6.594   1.00 64.69  ? 1193 ILE A CD1 1 
ATOM   3824  N  N   . LEU A 1 598  ? -80.121 11.015  6.310   1.00 43.46  ? 1194 LEU A N   1 
ATOM   3825  C  CA  . LEU A 1 598  ? -80.143 10.155  5.130   1.00 47.21  ? 1194 LEU A CA  1 
ATOM   3826  C  C   . LEU A 1 598  ? -80.301 8.696   5.534   1.00 38.16  ? 1194 LEU A C   1 
ATOM   3827  O  O   . LEU A 1 598  ? -81.151 7.981   4.998   1.00 49.22  ? 1194 LEU A O   1 
ATOM   3828  C  CB  . LEU A 1 598  ? -78.871 10.334  4.301   1.00 47.09  ? 1194 LEU A CB  1 
ATOM   3829  C  CG  . LEU A 1 598  ? -78.748 11.624  3.497   1.00 53.86  ? 1194 LEU A CG  1 
ATOM   3830  C  CD1 . LEU A 1 598  ? -77.378 11.692  2.861   1.00 53.17  ? 1194 LEU A CD1 1 
ATOM   3831  C  CD2 . LEU A 1 598  ? -79.837 11.706  2.438   1.00 40.91  ? 1194 LEU A CD2 1 
ATOM   3832  N  N   . LEU A 1 599  ? -79.473 8.261   6.479   1.00 40.73  ? 1195 LEU A N   1 
ATOM   3833  C  CA  . LEU A 1 599  ? -79.564 6.901   6.995   1.00 39.52  ? 1195 LEU A CA  1 
ATOM   3834  C  C   . LEU A 1 599  ? -80.945 6.665   7.593   1.00 49.60  ? 1195 LEU A C   1 
ATOM   3835  O  O   . LEU A 1 599  ? -81.540 5.602   7.414   1.00 44.57  ? 1195 LEU A O   1 
ATOM   3836  C  CB  . LEU A 1 599  ? -78.476 6.644   8.037   1.00 32.02  ? 1195 LEU A CB  1 
ATOM   3837  C  CG  . LEU A 1 599  ? -78.411 5.227   8.604   1.00 36.17  ? 1195 LEU A CG  1 
ATOM   3838  C  CD1 . LEU A 1 599  ? -78.296 4.208   7.483   1.00 23.61  ? 1195 LEU A CD1 1 
ATOM   3839  C  CD2 . LEU A 1 599  ? -77.243 5.098   9.566   1.00 34.13  ? 1195 LEU A CD2 1 
ATOM   3840  N  N   . LYS A 1 600  ? -81.453 7.676   8.291   1.00 47.72  ? 1196 LYS A N   1 
ATOM   3841  C  CA  . LYS A 1 600  ? -82.801 7.635   8.840   1.00 47.36  ? 1196 LYS A CA  1 
ATOM   3842  C  C   . LYS A 1 600  ? -83.841 7.482   7.733   1.00 47.08  ? 1196 LYS A C   1 
ATOM   3843  O  O   . LYS A 1 600  ? -84.790 6.711   7.869   1.00 56.45  ? 1196 LYS A O   1 
ATOM   3844  C  CB  . LYS A 1 600  ? -83.081 8.895   9.660   1.00 50.80  ? 1196 LYS A CB  1 
ATOM   3845  C  CG  . LYS A 1 600  ? -84.538 9.070   10.037  1.00 55.24  ? 1196 LYS A CG  1 
ATOM   3846  C  CD  . LYS A 1 600  ? -84.729 10.258  10.961  1.00 67.84  ? 1196 LYS A CD  1 
ATOM   3847  C  CE  . LYS A 1 600  ? -84.104 9.998   12.320  1.00 75.24  ? 1196 LYS A CE  1 
ATOM   3848  N  NZ  . LYS A 1 600  ? -84.348 11.124  13.261  1.00 84.13  ? 1196 LYS A NZ  1 
ATOM   3849  N  N   . LEU A 1 601  ? -83.656 8.219   6.639   1.00 41.55  ? 1197 LEU A N   1 
ATOM   3850  C  CA  . LEU A 1 601  ? -84.528 8.089   5.475   1.00 43.07  ? 1197 LEU A CA  1 
ATOM   3851  C  C   . LEU A 1 601  ? -84.533 6.654   4.963   1.00 52.82  ? 1197 LEU A C   1 
ATOM   3852  O  O   . LEU A 1 601  ? -85.590 6.087   4.691   1.00 53.96  ? 1197 LEU A O   1 
ATOM   3853  C  CB  . LEU A 1 601  ? -84.091 9.031   4.348   1.00 50.97  ? 1197 LEU A CB  1 
ATOM   3854  C  CG  . LEU A 1 601  ? -84.408 10.524  4.442   1.00 46.05  ? 1197 LEU A CG  1 
ATOM   3855  C  CD1 . LEU A 1 601  ? -83.792 11.263  3.266   1.00 39.90  ? 1197 LEU A CD1 1 
ATOM   3856  C  CD2 . LEU A 1 601  ? -85.904 10.758  4.496   1.00 56.23  ? 1197 LEU A CD2 1 
ATOM   3857  N  N   . VAL A 1 602  ? -83.344 6.070   4.841   1.00 55.85  ? 1198 VAL A N   1 
ATOM   3858  C  CA  . VAL A 1 602  ? -83.210 4.720   4.303   1.00 53.85  ? 1198 VAL A CA  1 
ATOM   3859  C  C   . VAL A 1 602  ? -83.860 3.678   5.210   1.00 49.79  ? 1198 VAL A C   1 
ATOM   3860  O  O   . VAL A 1 602  ? -84.564 2.787   4.735   1.00 45.49  ? 1198 VAL A O   1 
ATOM   3861  C  CB  . VAL A 1 602  ? -81.732 4.348   4.084   1.00 43.48  ? 1198 VAL A CB  1 
ATOM   3862  C  CG1 . VAL A 1 602  ? -81.618 2.937   3.537   1.00 41.05  ? 1198 VAL A CG1 1 
ATOM   3863  C  CG2 . VAL A 1 602  ? -81.075 5.333   3.137   1.00 42.50  ? 1198 VAL A CG2 1 
ATOM   3864  N  N   . MET A 1 603  ? -83.628 3.797   6.514   1.00 47.07  ? 1199 MET A N   1 
ATOM   3865  C  CA  . MET A 1 603  ? -84.200 2.862   7.479   1.00 47.64  ? 1199 MET A CA  1 
ATOM   3866  C  C   . MET A 1 603  ? -85.720 2.981   7.534   1.00 55.03  ? 1199 MET A C   1 
ATOM   3867  O  O   . MET A 1 603  ? -86.411 2.053   7.954   1.00 64.88  ? 1199 MET A O   1 
ATOM   3868  C  CB  . MET A 1 603  ? -83.603 3.093   8.870   1.00 34.91  ? 1199 MET A CB  1 
ATOM   3869  C  CG  . MET A 1 603  ? -82.102 2.875   8.937   1.00 48.71  ? 1199 MET A CG  1 
ATOM   3870  S  SD  . MET A 1 603  ? -81.414 3.136   10.581  1.00 54.75  ? 1199 MET A SD  1 
ATOM   3871  C  CE  . MET A 1 603  ? -82.147 1.765   11.471  1.00 78.71  ? 1199 MET A CE  1 
ATOM   3872  N  N   . ALA A 1 604  ? -86.232 4.130   7.105   1.00 53.34  ? 1200 ALA A N   1 
ATOM   3873  C  CA  . ALA A 1 604  ? -87.669 4.371   7.077   1.00 44.79  ? 1200 ALA A CA  1 
ATOM   3874  C  C   . ALA A 1 604  ? -88.292 3.840   5.790   1.00 51.81  ? 1200 ALA A C   1 
ATOM   3875  O  O   . ALA A 1 604  ? -89.492 3.994   5.560   1.00 55.42  ? 1200 ALA A O   1 
ATOM   3876  C  CB  . ALA A 1 604  ? -87.961 5.853   7.230   1.00 50.29  ? 1200 ALA A CB  1 
ATOM   3877  N  N   . GLY A 1 605  ? -87.470 3.220   4.951   1.00 46.30  ? 1201 GLY A N   1 
ATOM   3878  C  CA  . GLY A 1 605  ? -87.950 2.618   3.721   1.00 51.54  ? 1201 GLY A CA  1 
ATOM   3879  C  C   . GLY A 1 605  ? -88.177 3.616   2.604   1.00 51.58  ? 1201 GLY A C   1 
ATOM   3880  O  O   . GLY A 1 605  ? -88.922 3.343   1.664   1.00 48.80  ? 1201 GLY A O   1 
ATOM   3881  N  N   . GLU A 1 606  ? -87.536 4.777   2.704   1.00 56.15  ? 1202 GLU A N   1 
ATOM   3882  C  CA  . GLU A 1 606  ? -87.638 5.795   1.663   1.00 50.93  ? 1202 GLU A CA  1 
ATOM   3883  C  C   . GLU A 1 606  ? -86.716 5.486   0.490   1.00 55.75  ? 1202 GLU A C   1 
ATOM   3884  O  O   . GLU A 1 606  ? -85.562 5.099   0.676   1.00 55.80  ? 1202 GLU A O   1 
ATOM   3885  C  CB  . GLU A 1 606  ? -87.318 7.180   2.228   1.00 51.46  ? 1202 GLU A CB  1 
ATOM   3886  C  CG  . GLU A 1 606  ? -88.458 7.832   2.995   1.00 54.55  ? 1202 GLU A CG  1 
ATOM   3887  C  CD  . GLU A 1 606  ? -89.463 8.520   2.086   1.00 69.48  ? 1202 GLU A CD  1 
ATOM   3888  O  OE1 . GLU A 1 606  ? -89.488 8.218   0.873   1.00 79.48  ? 1202 GLU A OE1 1 
ATOM   3889  O  OE2 . GLU A 1 606  ? -90.226 9.372   2.586   1.00 80.41  ? 1202 GLU A OE2 1 
ATOM   3890  N  N   . THR A 1 607  ? -87.237 5.654   -0.720  1.00 59.72  ? 1203 THR A N   1 
ATOM   3891  C  CA  . THR A 1 607  ? -86.473 5.393   -1.933  1.00 56.11  ? 1203 THR A CA  1 
ATOM   3892  C  C   . THR A 1 607  ? -85.525 6.540   -2.285  1.00 56.93  ? 1203 THR A C   1 
ATOM   3893  O  O   . THR A 1 607  ? -84.389 6.309   -2.701  1.00 50.94  ? 1203 THR A O   1 
ATOM   3894  C  CB  . THR A 1 607  ? -87.407 5.123   -3.129  1.00 41.17  ? 1203 THR A CB  1 
ATOM   3895  O  OG1 . THR A 1 607  ? -86.679 5.282   -4.352  1.00 70.36  ? 1203 THR A OG1 1 
ATOM   3896  C  CG2 . THR A 1 607  ? -88.586 6.087   -3.120  1.00 68.18  ? 1203 THR A CG2 1 
ATOM   3897  N  N   . THR A 1 608  ? -85.998 7.774   -2.122  1.00 50.99  ? 1204 THR A N   1 
ATOM   3898  C  CA  . THR A 1 608  ? -85.221 8.955   -2.492  1.00 42.32  ? 1204 THR A CA  1 
ATOM   3899  C  C   . THR A 1 608  ? -85.225 9.994   -1.377  1.00 43.04  ? 1204 THR A C   1 
ATOM   3900  O  O   . THR A 1 608  ? -86.007 9.896   -0.432  1.00 48.30  ? 1204 THR A O   1 
ATOM   3901  C  CB  . THR A 1 608  ? -85.765 9.628   -3.776  1.00 48.23  ? 1204 THR A CB  1 
ATOM   3902  O  OG1 . THR A 1 608  ? -86.926 10.407  -3.458  1.00 43.43  ? 1204 THR A OG1 1 
ATOM   3903  C  CG2 . THR A 1 608  ? -86.121 8.591   -4.833  1.00 45.93  ? 1204 THR A CG2 1 
ATOM   3904  N  N   . ASN A 1 609  ? -84.345 10.985  -1.482  1.00 41.68  ? 1205 ASN A N   1 
ATOM   3905  C  CA  . ASN A 1 609  ? -84.411 12.135  -0.590  1.00 42.76  ? 1205 ASN A CA  1 
ATOM   3906  C  C   . ASN A 1 609  ? -85.363 13.182  -1.164  1.00 46.17  ? 1205 ASN A C   1 
ATOM   3907  O  O   . ASN A 1 609  ? -86.058 12.923  -2.148  1.00 44.08  ? 1205 ASN A O   1 
ATOM   3908  C  CB  . ASN A 1 609  ? -83.020 12.733  -0.345  1.00 36.31  ? 1205 ASN A CB  1 
ATOM   3909  C  CG  . ASN A 1 609  ? -82.354 13.231  -1.615  1.00 42.93  ? 1205 ASN A CG  1 
ATOM   3910  O  OD1 . ASN A 1 609  ? -82.911 13.138  -2.709  1.00 50.74  ? 1205 ASN A OD1 1 
ATOM   3911  N  ND2 . ASN A 1 609  ? -81.151 13.776  -1.470  1.00 38.34  ? 1205 ASN A ND2 1 
ATOM   3912  N  N   . SER A 1 610  ? -85.388 14.362  -0.555  1.00 46.53  ? 1206 SER A N   1 
ATOM   3913  C  CA  . SER A 1 610  ? -86.358 15.390  -0.922  1.00 34.23  ? 1206 SER A CA  1 
ATOM   3914  C  C   . SER A 1 610  ? -86.194 15.914  -2.349  1.00 44.38  ? 1206 SER A C   1 
ATOM   3915  O  O   . SER A 1 610  ? -87.173 16.319  -2.973  1.00 56.08  ? 1206 SER A O   1 
ATOM   3916  C  CB  . SER A 1 610  ? -86.282 16.556  0.068   1.00 41.72  ? 1206 SER A CB  1 
ATOM   3917  O  OG  . SER A 1 610  ? -84.958 17.045  0.180   1.00 63.02  ? 1206 SER A OG  1 
ATOM   3918  N  N   . ARG A 1 611  ? -84.969 15.903  -2.868  1.00 52.87  ? 1207 ARG A N   1 
ATOM   3919  C  CA  . ARG A 1 611  ? -84.720 16.439  -4.206  1.00 34.31  ? 1207 ARG A CA  1 
ATOM   3920  C  C   . ARG A 1 611  ? -84.775 15.367  -5.294  1.00 49.91  ? 1207 ARG A C   1 
ATOM   3921  O  O   . ARG A 1 611  ? -84.553 15.657  -6.470  1.00 45.89  ? 1207 ARG A O   1 
ATOM   3922  C  CB  . ARG A 1 611  ? -83.367 17.152  -4.264  1.00 34.67  ? 1207 ARG A CB  1 
ATOM   3923  C  CG  . ARG A 1 611  ? -82.629 17.236  -2.942  1.00 71.68  ? 1207 ARG A CG  1 
ATOM   3924  C  CD  . ARG A 1 611  ? -81.364 18.064  -3.094  1.00 76.57  ? 1207 ARG A CD  1 
ATOM   3925  N  NE  . ARG A 1 611  ? -80.707 17.814  -4.374  1.00 66.27  ? 1207 ARG A NE  1 
ATOM   3926  C  CZ  . ARG A 1 611  ? -79.481 18.227  -4.677  1.00 93.63  ? 1207 ARG A CZ  1 
ATOM   3927  N  NH1 . ARG A 1 611  ? -78.770 18.906  -3.787  1.00 90.69  ? 1207 ARG A NH1 1 
ATOM   3928  N  NH2 . ARG A 1 611  ? -78.963 17.957  -5.868  1.00 69.24  ? 1207 ARG A NH2 1 
ATOM   3929  N  N   . GLY A 1 612  ? -85.059 14.130  -4.901  1.00 47.40  ? 1208 GLY A N   1 
ATOM   3930  C  CA  . GLY A 1 612  ? -85.259 13.063  -5.865  1.00 49.82  ? 1208 GLY A CA  1 
ATOM   3931  C  C   . GLY A 1 612  ? -84.053 12.178  -6.125  1.00 56.01  ? 1208 GLY A C   1 
ATOM   3932  O  O   . GLY A 1 612  ? -84.117 11.265  -6.950  1.00 57.02  ? 1208 GLY A O   1 
ATOM   3933  N  N   . GLN A 1 613  ? -82.952 12.444  -5.429  1.00 47.03  ? 1209 GLN A N   1 
ATOM   3934  C  CA  . GLN A 1 613  ? -81.751 11.625  -5.566  1.00 39.77  ? 1209 GLN A CA  1 
ATOM   3935  C  C   . GLN A 1 613  ? -81.981 10.234  -4.987  1.00 38.78  ? 1209 GLN A C   1 
ATOM   3936  O  O   . GLN A 1 613  ? -82.467 10.096  -3.865  1.00 41.91  ? 1209 GLN A O   1 
ATOM   3937  C  CB  . GLN A 1 613  ? -80.559 12.292  -4.877  1.00 46.35  ? 1209 GLN A CB  1 
ATOM   3938  C  CG  . GLN A 1 613  ? -80.089 13.571  -5.547  1.00 33.48  ? 1209 GLN A CG  1 
ATOM   3939  C  CD  . GLN A 1 613  ? -78.991 14.264  -4.767  1.00 36.19  ? 1209 GLN A CD  1 
ATOM   3940  O  OE1 . GLN A 1 613  ? -79.110 14.478  -3.560  1.00 41.97  ? 1209 GLN A OE1 1 
ATOM   3941  N  NE2 . GLN A 1 613  ? -77.910 14.617  -5.453  1.00 47.72  ? 1209 GLN A NE2 1 
ATOM   3942  N  N   . ARG A 1 614  ? -81.630 9.206   -5.752  1.00 36.16  ? 1210 ARG A N   1 
ATOM   3943  C  CA  . ARG A 1 614  ? -81.863 7.830   -5.326  1.00 33.00  ? 1210 ARG A CA  1 
ATOM   3944  C  C   . ARG A 1 614  ? -80.934 7.424   -4.188  1.00 48.34  ? 1210 ARG A C   1 
ATOM   3945  O  O   . ARG A 1 614  ? -79.717 7.589   -4.274  1.00 54.70  ? 1210 ARG A O   1 
ATOM   3946  C  CB  . ARG A 1 614  ? -81.694 6.864   -6.498  1.00 30.69  ? 1210 ARG A CB  1 
ATOM   3947  C  CG  . ARG A 1 614  ? -82.097 5.438   -6.163  1.00 46.81  ? 1210 ARG A CG  1 
ATOM   3948  C  CD  . ARG A 1 614  ? -81.740 4.471   -7.278  1.00 42.01  ? 1210 ARG A CD  1 
ATOM   3949  N  NE  . ARG A 1 614  ? -82.229 3.124   -6.997  1.00 56.56  ? 1210 ARG A NE  1 
ATOM   3950  C  CZ  . ARG A 1 614  ? -81.596 2.242   -6.229  1.00 62.85  ? 1210 ARG A CZ  1 
ATOM   3951  N  NH1 . ARG A 1 614  ? -80.443 2.563   -5.658  1.00 34.03  ? 1210 ARG A NH1 1 
ATOM   3952  N  NH2 . ARG A 1 614  ? -82.118 1.039   -6.030  1.00 73.14  ? 1210 ARG A NH2 1 
ATOM   3953  N  N   . LEU A 1 615  ? -81.522 6.890   -3.123  1.00 48.37  ? 1211 LEU A N   1 
ATOM   3954  C  CA  . LEU A 1 615  ? -80.760 6.441   -1.964  1.00 46.44  ? 1211 LEU A CA  1 
ATOM   3955  C  C   . LEU A 1 615  ? -80.213 5.037   -2.178  1.00 43.53  ? 1211 LEU A C   1 
ATOM   3956  O  O   . LEU A 1 615  ? -80.865 4.202   -2.805  1.00 48.92  ? 1211 LEU A O   1 
ATOM   3957  C  CB  . LEU A 1 615  ? -81.632 6.468   -0.708  1.00 43.49  ? 1211 LEU A CB  1 
ATOM   3958  C  CG  . LEU A 1 615  ? -82.178 7.824   -0.262  1.00 50.75  ? 1211 LEU A CG  1 
ATOM   3959  C  CD1 . LEU A 1 615  ? -83.284 7.632   0.758   1.00 58.12  ? 1211 LEU A CD1 1 
ATOM   3960  C  CD2 . LEU A 1 615  ? -81.064 8.680   0.315   1.00 43.61  ? 1211 LEU A CD2 1 
ATOM   3961  N  N   . PRO A 1 616  ? -79.006 4.772   -1.659  1.00 43.85  ? 1212 PRO A N   1 
ATOM   3962  C  CA  . PRO A 1 616  ? -78.463 3.413   -1.719  1.00 44.05  ? 1212 PRO A CA  1 
ATOM   3963  C  C   . PRO A 1 616  ? -79.232 2.468   -0.802  1.00 48.10  ? 1212 PRO A C   1 
ATOM   3964  O  O   . PRO A 1 616  ? -79.654 2.864   0.283   1.00 41.70  ? 1212 PRO A O   1 
ATOM   3965  C  CB  . PRO A 1 616  ? -77.015 3.588   -1.251  1.00 36.63  ? 1212 PRO A CB  1 
ATOM   3966  C  CG  . PRO A 1 616  ? -77.030 4.826   -0.427  1.00 34.26  ? 1212 PRO A CG  1 
ATOM   3967  C  CD  . PRO A 1 616  ? -78.064 5.722   -1.041  1.00 46.00  ? 1212 PRO A CD  1 
ATOM   3968  N  N   . GLN A 1 617  ? -79.399 1.228   -1.243  1.00 52.58  ? 1213 GLN A N   1 
ATOM   3969  C  CA  . GLN A 1 617  ? -80.185 0.241   -0.514  1.00 42.09  ? 1213 GLN A CA  1 
ATOM   3970  C  C   . GLN A 1 617  ? -79.318 -0.973  -0.221  1.00 43.85  ? 1213 GLN A C   1 
ATOM   3971  O  O   . GLN A 1 617  ? -78.238 -1.112  -0.792  1.00 51.54  ? 1213 GLN A O   1 
ATOM   3972  C  CB  . GLN A 1 617  ? -81.422 -0.169  -1.315  1.00 30.51  ? 1213 GLN A CB  1 
ATOM   3973  C  CG  . GLN A 1 617  ? -82.308 0.988   -1.744  1.00 40.06  ? 1213 GLN A CG  1 
ATOM   3974  C  CD  . GLN A 1 617  ? -83.112 1.570   -0.598  1.00 44.53  ? 1213 GLN A CD  1 
ATOM   3975  O  OE1 . GLN A 1 617  ? -83.202 0.981   0.479   1.00 54.45  ? 1213 GLN A OE1 1 
ATOM   3976  N  NE2 . GLN A 1 617  ? -83.705 2.736   -0.828  1.00 47.73  ? 1213 GLN A NE2 1 
ATOM   3977  N  N   . LYS A 1 618  ? -79.772 -1.829  0.690   1.00 45.83  ? 1214 LYS A N   1 
ATOM   3978  C  CA  . LYS A 1 618  ? -79.046 -3.057  0.995   1.00 30.67  ? 1214 LYS A CA  1 
ATOM   3979  C  C   . LYS A 1 618  ? -78.776 -3.837  -0.285  1.00 38.53  ? 1214 LYS A C   1 
ATOM   3980  O  O   . LYS A 1 618  ? -79.688 -4.095  -1.070  1.00 39.71  ? 1214 LYS A O   1 
ATOM   3981  C  CB  . LYS A 1 618  ? -79.830 -3.927  1.978   1.00 38.71  ? 1214 LYS A CB  1 
ATOM   3982  C  CG  . LYS A 1 618  ? -79.902 -3.387  3.396   1.00 47.24  ? 1214 LYS A CG  1 
ATOM   3983  C  CD  . LYS A 1 618  ? -80.634 -4.365  4.302   1.00 44.97  ? 1214 LYS A CD  1 
ATOM   3984  C  CE  . LYS A 1 618  ? -80.662 -3.886  5.742   1.00 41.72  ? 1214 LYS A CE  1 
ATOM   3985  N  NZ  . LYS A 1 618  ? -81.390 -4.842  6.622   1.00 54.54  ? 1214 LYS A NZ  1 
ATOM   3986  N  N   . GLY A 1 619  ? -77.517 -4.204  -0.489  1.00 45.98  ? 1215 GLY A N   1 
ATOM   3987  C  CA  . GLY A 1 619  ? -77.109 -4.904  -1.693  1.00 44.02  ? 1215 GLY A CA  1 
ATOM   3988  C  C   . GLY A 1 619  ? -76.491 -3.986  -2.731  1.00 47.23  ? 1215 GLY A C   1 
ATOM   3989  O  O   . GLY A 1 619  ? -75.751 -4.440  -3.604  1.00 50.29  ? 1215 GLY A O   1 
ATOM   3990  N  N   . ASP A 1 620  ? -76.790 -2.693  -2.642  1.00 45.33  ? 1216 ASP A N   1 
ATOM   3991  C  CA  . ASP A 1 620  ? -76.184 -1.718  -3.542  1.00 39.18  ? 1216 ASP A CA  1 
ATOM   3992  C  C   . ASP A 1 620  ? -74.756 -1.417  -3.121  1.00 47.20  ? 1216 ASP A C   1 
ATOM   3993  O  O   . ASP A 1 620  ? -73.842 -1.413  -3.945  1.00 45.63  ? 1216 ASP A O   1 
ATOM   3994  C  CB  . ASP A 1 620  ? -76.994 -0.422  -3.580  1.00 36.80  ? 1216 ASP A CB  1 
ATOM   3995  C  CG  . ASP A 1 620  ? -78.343 -0.598  -4.237  1.00 54.03  ? 1216 ASP A CG  1 
ATOM   3996  O  OD1 . ASP A 1 620  ? -78.490 -1.534  -5.052  1.00 61.80  ? 1216 ASP A OD1 1 
ATOM   3997  O  OD2 . ASP A 1 620  ? -79.254 0.203   -3.943  1.00 61.32  ? 1216 ASP A OD2 1 
ATOM   3998  N  N   . VAL A 1 621  ? -74.568 -1.170  -1.830  1.00 36.89  ? 1217 VAL A N   1 
ATOM   3999  C  CA  . VAL A 1 621  ? -73.249 -0.839  -1.323  1.00 37.02  ? 1217 VAL A CA  1 
ATOM   4000  C  C   . VAL A 1 621  ? -72.427 -2.101  -1.126  1.00 42.41  ? 1217 VAL A C   1 
ATOM   4001  O  O   . VAL A 1 621  ? -72.785 -2.972  -0.334  1.00 45.94  ? 1217 VAL A O   1 
ATOM   4002  C  CB  . VAL A 1 621  ? -73.332 -0.067  0.005   1.00 33.83  ? 1217 VAL A CB  1 
ATOM   4003  C  CG1 . VAL A 1 621  ? -71.940 0.205   0.548   1.00 39.46  ? 1217 VAL A CG1 1 
ATOM   4004  C  CG2 . VAL A 1 621  ? -74.094 1.229   -0.189  1.00 29.28  ? 1217 VAL A CG2 1 
ATOM   4005  N  N   . GLU A 1 622  ? -71.310 -2.183  -1.839  1.00 40.81  ? 1218 GLU A N   1 
ATOM   4006  C  CA  . GLU A 1 622  ? -70.417 -3.327  -1.730  1.00 38.22  ? 1218 GLU A CA  1 
ATOM   4007  C  C   . GLU A 1 622  ? -69.157 -2.944  -0.971  1.00 38.77  ? 1218 GLU A C   1 
ATOM   4008  O  O   . GLU A 1 622  ? -68.527 -3.784  -0.327  1.00 38.64  ? 1218 GLU A O   1 
ATOM   4009  C  CB  . GLU A 1 622  ? -70.060 -3.868  -3.113  1.00 37.04  ? 1218 GLU A CB  1 
ATOM   4010  C  CG  . GLU A 1 622  ? -71.208 -4.568  -3.819  1.00 46.30  ? 1218 GLU A CG  1 
ATOM   4011  C  CD  . GLU A 1 622  ? -70.810 -5.087  -5.184  1.00 52.04  ? 1218 GLU A CD  1 
ATOM   4012  O  OE1 . GLU A 1 622  ? -70.146 -4.337  -5.930  1.00 53.44  ? 1218 GLU A OE1 1 
ATOM   4013  O  OE2 . GLU A 1 622  ? -71.151 -6.244  -5.507  1.00 59.68  ? 1218 GLU A OE2 1 
ATOM   4014  N  N   . MET A 1 623  ? -68.793 -1.671  -1.050  1.00 41.83  ? 1219 MET A N   1 
ATOM   4015  C  CA  . MET A 1 623  ? -67.649 -1.175  -0.298  1.00 33.09  ? 1219 MET A CA  1 
ATOM   4016  C  C   . MET A 1 623  ? -67.978 0.126   0.420   1.00 45.76  ? 1219 MET A C   1 
ATOM   4017  O  O   . MET A 1 623  ? -68.532 1.050   -0.177  1.00 39.46  ? 1219 MET A O   1 
ATOM   4018  C  CB  . MET A 1 623  ? -66.446 -0.982  -1.220  1.00 38.57  ? 1219 MET A CB  1 
ATOM   4019  C  CG  . MET A 1 623  ? -65.353 -0.114  -0.629  1.00 51.59  ? 1219 MET A CG  1 
ATOM   4020  S  SD  . MET A 1 623  ? -63.764 -0.385  -1.422  1.00 67.23  ? 1219 MET A SD  1 
ATOM   4021  C  CE  . MET A 1 623  ? -62.940 -1.296  -0.126  1.00 35.32  ? 1219 MET A CE  1 
ATOM   4022  N  N   . LEU A 1 624  ? -67.638 0.191   1.704   1.00 45.44  ? 1220 LEU A N   1 
ATOM   4023  C  CA  . LEU A 1 624  ? -67.891 1.397   2.485   1.00 32.67  ? 1220 LEU A CA  1 
ATOM   4024  C  C   . LEU A 1 624  ? -66.585 2.018   2.944   1.00 34.72  ? 1220 LEU A C   1 
ATOM   4025  O  O   . LEU A 1 624  ? -65.806 1.369   3.639   1.00 40.70  ? 1220 LEU A O   1 
ATOM   4026  C  CB  . LEU A 1 624  ? -68.771 1.088   3.696   1.00 34.77  ? 1220 LEU A CB  1 
ATOM   4027  C  CG  . LEU A 1 624  ? -69.175 2.301   4.539   1.00 34.56  ? 1220 LEU A CG  1 
ATOM   4028  C  CD1 . LEU A 1 624  ? -70.155 3.187   3.783   1.00 32.80  ? 1220 LEU A CD1 1 
ATOM   4029  C  CD2 . LEU A 1 624  ? -69.764 1.856   5.861   1.00 40.99  ? 1220 LEU A CD2 1 
ATOM   4030  N  N   . CYS A 1 625  ? -66.344 3.271   2.564   1.00 35.09  ? 1221 CYS A N   1 
ATOM   4031  C  CA  . CYS A 1 625  ? -65.119 3.946   2.993   1.00 34.91  ? 1221 CYS A CA  1 
ATOM   4032  C  C   . CYS A 1 625  ? -65.390 5.347   3.522   1.00 33.45  ? 1221 CYS A C   1 
ATOM   4033  O  O   . CYS A 1 625  ? -66.327 6.018   3.078   1.00 33.31  ? 1221 CYS A O   1 
ATOM   4034  C  CB  . CYS A 1 625  ? -64.107 4.012   1.846   1.00 34.43  ? 1221 CYS A CB  1 
ATOM   4035  S  SG  . CYS A 1 625  ? -64.659 4.927   0.396   1.00 50.33  ? 1221 CYS A SG  1 
ATOM   4036  N  N   . GLY A 1 626  ? -64.570 5.790   4.472   1.00 31.67  ? 1222 GLY A N   1 
ATOM   4037  C  CA  . GLY A 1 626  ? -64.737 7.128   5.010   1.00 28.58  ? 1222 GLY A CA  1 
ATOM   4038  C  C   . GLY A 1 626  ? -63.720 7.615   6.027   1.00 37.40  ? 1222 GLY A C   1 
ATOM   4039  O  O   . GLY A 1 626  ? -62.904 6.848   6.537   1.00 40.47  ? 1222 GLY A O   1 
ATOM   4040  N  N   . GLY A 1 627  ? -63.783 8.913   6.317   1.00 43.78  ? 1223 GLY A N   1 
ATOM   4041  C  CA  . GLY A 1 627  ? -62.935 9.539   7.316   1.00 40.69  ? 1223 GLY A CA  1 
ATOM   4042  C  C   . GLY A 1 627  ? -63.736 10.425  8.254   1.00 51.31  ? 1223 GLY A C   1 
ATOM   4043  O  O   . GLY A 1 627  ? -63.802 11.641  8.064   1.00 61.30  ? 1223 GLY A O   1 
ATOM   4044  N  N   . PRO A 1 628  ? -64.357 9.817   9.276   1.00 44.02  ? 1224 PRO A N   1 
ATOM   4045  C  CA  . PRO A 1 628  ? -65.190 10.542  10.243  1.00 47.42  ? 1224 PRO A CA  1 
ATOM   4046  C  C   . PRO A 1 628  ? -64.400 11.513  11.115  1.00 48.12  ? 1224 PRO A C   1 
ATOM   4047  O  O   . PRO A 1 628  ? -63.352 11.144  11.645  1.00 53.82  ? 1224 PRO A O   1 
ATOM   4048  C  CB  . PRO A 1 628  ? -65.786 9.420   11.098  1.00 55.41  ? 1224 PRO A CB  1 
ATOM   4049  C  CG  . PRO A 1 628  ? -64.804 8.309   10.993  1.00 44.39  ? 1224 PRO A CG  1 
ATOM   4050  C  CD  . PRO A 1 628  ? -64.267 8.381   9.594   1.00 43.85  ? 1224 PRO A CD  1 
ATOM   4051  N  N   . PRO A 1 629  ? -64.902 12.749  11.260  1.00 55.65  ? 1225 PRO A N   1 
ATOM   4052  C  CA  . PRO A 1 629  ? -64.306 13.748  12.151  1.00 55.02  ? 1225 PRO A CA  1 
ATOM   4053  C  C   . PRO A 1 629  ? -64.439 13.349  13.615  1.00 61.50  ? 1225 PRO A C   1 
ATOM   4054  O  O   . PRO A 1 629  ? -65.518 12.944  14.049  1.00 72.23  ? 1225 PRO A O   1 
ATOM   4055  C  CB  . PRO A 1 629  ? -65.116 15.017  11.856  1.00 47.65  ? 1225 PRO A CB  1 
ATOM   4056  C  CG  . PRO A 1 629  ? -65.764 14.768  10.535  1.00 54.79  ? 1225 PRO A CG  1 
ATOM   4057  C  CD  . PRO A 1 629  ? -66.035 13.301  10.502  1.00 59.24  ? 1225 PRO A CD  1 
ATOM   4058  N  N   . CYS A 1 630  ? -63.346 13.462  14.359  1.00 61.05  ? 1226 CYS A N   1 
ATOM   4059  C  CA  . CYS A 1 630  ? -63.320 13.077  15.763  1.00 63.67  ? 1226 CYS A CA  1 
ATOM   4060  C  C   . CYS A 1 630  ? -63.559 14.235  16.727  1.00 66.12  ? 1226 CYS A C   1 
ATOM   4061  O  O   . CYS A 1 630  ? -63.448 14.064  17.941  1.00 72.96  ? 1226 CYS A O   1 
ATOM   4062  C  CB  . CYS A 1 630  ? -61.992 12.397  16.094  1.00 74.51  ? 1226 CYS A CB  1 
ATOM   4063  S  SG  . CYS A 1 630  ? -61.976 10.634  15.718  1.00 74.04  ? 1226 CYS A SG  1 
ATOM   4064  N  N   . GLN A 1 631  ? -63.869 15.408  16.185  1.00 78.83  ? 1227 GLN A N   1 
ATOM   4065  C  CA  . GLN A 1 631  ? -63.839 16.651  16.956  1.00 83.27  ? 1227 GLN A CA  1 
ATOM   4066  C  C   . GLN A 1 631  ? -64.644 16.610  18.259  1.00 77.59  ? 1227 GLN A C   1 
ATOM   4067  O  O   . GLN A 1 631  ? -65.821 16.248  18.280  1.00 73.90  ? 1227 GLN A O   1 
ATOM   4068  C  CB  . GLN A 1 631  ? -64.338 17.805  16.086  1.00 87.01  ? 1227 GLN A CB  1 
ATOM   4069  C  CG  . GLN A 1 631  ? -64.112 19.184  16.684  1.00 106.14 ? 1227 GLN A CG  1 
ATOM   4070  C  CD  . GLN A 1 631  ? -64.368 20.297  15.689  1.00 120.25 ? 1227 GLN A CD  1 
ATOM   4071  O  OE1 . GLN A 1 631  ? -64.901 20.067  14.603  1.00 106.63 ? 1227 GLN A OE1 1 
ATOM   4072  N  NE2 . GLN A 1 631  ? -63.983 21.514  16.052  1.00 112.77 ? 1227 GLN A NE2 1 
ATOM   4073  N  N   . GLY A 1 632  ? -63.963 16.986  19.338  1.00 86.22  ? 1228 GLY A N   1 
ATOM   4074  C  CA  . GLY A 1 632  ? -64.525 17.111  20.672  1.00 82.96  ? 1228 GLY A CA  1 
ATOM   4075  C  C   . GLY A 1 632  ? -64.266 15.945  21.613  1.00 77.97  ? 1228 GLY A C   1 
ATOM   4076  O  O   . GLY A 1 632  ? -64.281 16.131  22.827  1.00 92.74  ? 1228 GLY A O   1 
ATOM   4077  N  N   . PHE A 1 633  ? -64.043 14.747  21.075  1.00 70.29  ? 1229 PHE A N   1 
ATOM   4078  C  CA  . PHE A 1 633  ? -63.479 13.639  21.858  1.00 62.99  ? 1229 PHE A CA  1 
ATOM   4079  C  C   . PHE A 1 633  ? -61.974 13.443  21.627  1.00 61.85  ? 1229 PHE A C   1 
ATOM   4080  O  O   . PHE A 1 633  ? -61.398 12.460  22.098  1.00 59.32  ? 1229 PHE A O   1 
ATOM   4081  C  CB  . PHE A 1 633  ? -64.231 12.314  21.643  1.00 46.00  ? 1229 PHE A CB  1 
ATOM   4082  C  CG  . PHE A 1 633  ? -64.710 12.074  20.243  1.00 46.49  ? 1229 PHE A CG  1 
ATOM   4083  C  CD1 . PHE A 1 633  ? -65.832 12.723  19.757  1.00 59.65  ? 1229 PHE A CD1 1 
ATOM   4084  C  CD2 . PHE A 1 633  ? -64.078 11.145  19.433  1.00 54.79  ? 1229 PHE A CD2 1 
ATOM   4085  C  CE1 . PHE A 1 633  ? -66.286 12.488  18.484  1.00 65.47  ? 1229 PHE A CE1 1 
ATOM   4086  C  CE2 . PHE A 1 633  ? -64.535 10.899  18.157  1.00 67.78  ? 1229 PHE A CE2 1 
ATOM   4087  C  CZ  . PHE A 1 633  ? -65.643 11.569  17.684  1.00 68.06  ? 1229 PHE A CZ  1 
ATOM   4088  N  N   . SER A 1 634  ? -61.337 14.347  20.889  1.00 55.72  ? 1230 SER A N   1 
ATOM   4089  C  CA  . SER A 1 634  ? -60.008 14.071  20.345  1.00 60.53  ? 1230 SER A CA  1 
ATOM   4090  C  C   . SER A 1 634  ? -58.881 14.230  21.372  1.00 54.63  ? 1230 SER A C   1 
ATOM   4091  O  O   . SER A 1 634  ? -57.710 14.060  21.039  1.00 65.35  ? 1230 SER A O   1 
ATOM   4092  C  CB  . SER A 1 634  ? -59.728 14.979  19.146  1.00 56.40  ? 1230 SER A CB  1 
ATOM   4093  O  OG  . SER A 1 634  ? -59.313 16.266  19.568  1.00 89.06  ? 1230 SER A OG  1 
ATOM   4094  N  N   . GLY A 1 635  ? -59.223 14.580  22.608  1.00 52.71  ? 1231 GLY A N   1 
ATOM   4095  C  CA  . GLY A 1 635  ? -58.244 14.581  23.683  1.00 51.25  ? 1231 GLY A CA  1 
ATOM   4096  C  C   . GLY A 1 635  ? -57.742 13.180  24.003  1.00 58.54  ? 1231 GLY A C   1 
ATOM   4097  O  O   . GLY A 1 635  ? -58.396 12.190  23.674  1.00 58.08  ? 1231 GLY A O   1 
ATOM   4098  N  N   . MET A 1 636  ? -56.573 13.095  24.633  1.00 52.77  ? 1232 MET A N   1 
ATOM   4099  C  CA  . MET A 1 636  ? -55.964 11.809  24.975  1.00 61.89  ? 1232 MET A CA  1 
ATOM   4100  C  C   . MET A 1 636  ? -56.545 11.167  26.238  1.00 75.12  ? 1232 MET A C   1 
ATOM   4101  O  O   . MET A 1 636  ? -56.753 9.954   26.290  1.00 66.36  ? 1232 MET A O   1 
ATOM   4102  C  CB  . MET A 1 636  ? -54.450 11.977  25.140  1.00 57.53  ? 1232 MET A CB  1 
ATOM   4103  C  CG  . MET A 1 636  ? -53.728 12.508  23.905  1.00 83.95  ? 1232 MET A CG  1 
ATOM   4104  S  SD  . MET A 1 636  ? -53.189 11.230  22.746  1.00 73.22  ? 1232 MET A SD  1 
ATOM   4105  C  CE  . MET A 1 636  ? -54.665 10.981  21.766  1.00 44.72  ? 1232 MET A CE  1 
ATOM   4106  N  N   . ASN A 1 637  ? -56.798 11.988  27.253  1.00 71.89  ? 1233 ASN A N   1 
ATOM   4107  C  CA  . ASN A 1 637  ? -57.222 11.509  28.568  1.00 67.30  ? 1233 ASN A CA  1 
ATOM   4108  C  C   . ASN A 1 637  ? -58.618 10.888  28.591  1.00 73.26  ? 1233 ASN A C   1 
ATOM   4109  O  O   . ASN A 1 637  ? -59.417 11.093  27.683  1.00 68.71  ? 1233 ASN A O   1 
ATOM   4110  C  CB  . ASN A 1 637  ? -57.147 12.646  29.589  1.00 72.93  ? 1233 ASN A CB  1 
ATOM   4111  C  CG  . ASN A 1 637  ? -57.715 13.943  29.056  1.00 102.41 ? 1233 ASN A CG  1 
ATOM   4112  O  OD1 . ASN A 1 637  ? -58.491 13.947  28.100  1.00 90.21  ? 1233 ASN A OD1 1 
ATOM   4113  N  ND2 . ASN A 1 637  ? -57.327 15.054  29.671  1.00 102.38 ? 1233 ASN A ND2 1 
ATOM   4114  N  N   . ARG A 1 638  ? -58.886 10.132  29.652  1.00 91.14  ? 1234 ARG A N   1 
ATOM   4115  C  CA  . ARG A 1 638  ? -60.065 9.275   29.783  1.00 70.31  ? 1234 ARG A CA  1 
ATOM   4116  C  C   . ARG A 1 638  ? -61.413 9.972   29.585  1.00 65.03  ? 1234 ARG A C   1 
ATOM   4117  O  O   . ARG A 1 638  ? -61.574 11.156  29.888  1.00 77.84  ? 1234 ARG A O   1 
ATOM   4118  C  CB  . ARG A 1 638  ? -60.057 8.622   31.168  1.00 87.92  ? 1234 ARG A CB  1 
ATOM   4119  C  CG  . ARG A 1 638  ? -60.233 9.628   32.302  1.00 102.31 ? 1234 ARG A CG  1 
ATOM   4120  C  CD  . ARG A 1 638  ? -60.011 9.015   33.676  1.00 111.94 ? 1234 ARG A CD  1 
ATOM   4121  N  NE  . ARG A 1 638  ? -60.920 7.907   33.950  1.00 124.99 ? 1234 ARG A NE  1 
ATOM   4122  C  CZ  . ARG A 1 638  ? -60.537 6.640   34.066  1.00 118.44 ? 1234 ARG A CZ  1 
ATOM   4123  N  NH1 . ARG A 1 638  ? -59.257 6.318   33.937  1.00 96.91  ? 1234 ARG A NH1 1 
ATOM   4124  N  NH2 . ARG A 1 638  ? -61.432 5.695   34.318  1.00 114.95 ? 1234 ARG A NH2 1 
ATOM   4125  N  N   . PHE A 1 639  ? -62.363 9.215   29.043  1.00 59.30  ? 1235 PHE A N   1 
ATOM   4126  C  CA  . PHE A 1 639  ? -63.753 9.646   28.909  1.00 67.12  ? 1235 PHE A CA  1 
ATOM   4127  C  C   . PHE A 1 639  ? -64.366 10.086  30.237  1.00 74.29  ? 1235 PHE A C   1 
ATOM   4128  O  O   . PHE A 1 639  ? -64.189 9.426   31.262  1.00 67.59  ? 1235 PHE A O   1 
ATOM   4129  C  CB  . PHE A 1 639  ? -64.606 8.508   28.333  1.00 66.38  ? 1235 PHE A CB  1 
ATOM   4130  C  CG  . PHE A 1 639  ? -64.705 8.501   26.833  1.00 71.45  ? 1235 PHE A CG  1 
ATOM   4131  C  CD1 . PHE A 1 639  ? -65.051 9.645   26.133  1.00 77.14  ? 1235 PHE A CD1 1 
ATOM   4132  C  CD2 . PHE A 1 639  ? -64.486 7.330   26.125  1.00 77.91  ? 1235 PHE A CD2 1 
ATOM   4133  C  CE1 . PHE A 1 639  ? -65.156 9.623   24.752  1.00 67.23  ? 1235 PHE A CE1 1 
ATOM   4134  C  CE2 . PHE A 1 639  ? -64.585 7.303   24.747  1.00 53.30  ? 1235 PHE A CE2 1 
ATOM   4135  C  CZ  . PHE A 1 639  ? -64.920 8.449   24.059  1.00 50.29  ? 1235 PHE A CZ  1 
ATOM   4136  N  N   . ASN A 1 640  ? -65.083 11.204  30.215  1.00 77.80  ? 1236 ASN A N   1 
ATOM   4137  C  CA  . ASN A 1 640  ? -66.047 11.500  31.268  1.00 60.09  ? 1236 ASN A CA  1 
ATOM   4138  C  C   . ASN A 1 640  ? -67.431 11.318  30.664  1.00 68.48  ? 1236 ASN A C   1 
ATOM   4139  O  O   . ASN A 1 640  ? -67.534 10.946  29.502  1.00 78.65  ? 1236 ASN A O   1 
ATOM   4140  C  CB  . ASN A 1 640  ? -65.858 12.908  31.843  1.00 59.40  ? 1236 ASN A CB  1 
ATOM   4141  C  CG  . ASN A 1 640  ? -65.827 13.992  30.777  1.00 67.59  ? 1236 ASN A CG  1 
ATOM   4142  O  OD1 . ASN A 1 640  ? -66.517 13.917  29.760  1.00 79.02  ? 1236 ASN A OD1 1 
ATOM   4143  N  ND2 . ASN A 1 640  ? -65.017 15.017  31.015  1.00 56.86  ? 1236 ASN A ND2 1 
ATOM   4144  N  N   . SER A 1 641  ? -68.494 11.568  31.416  1.00 76.80  ? 1237 SER A N   1 
ATOM   4145  C  CA  . SER A 1 641  ? -69.832 11.338  30.873  1.00 75.82  ? 1237 SER A CA  1 
ATOM   4146  C  C   . SER A 1 641  ? -70.157 12.322  29.752  1.00 78.79  ? 1237 SER A C   1 
ATOM   4147  O  O   . SER A 1 641  ? -70.909 12.001  28.835  1.00 85.05  ? 1237 SER A O   1 
ATOM   4148  C  CB  . SER A 1 641  ? -70.885 11.427  31.981  1.00 70.14  ? 1237 SER A CB  1 
ATOM   4149  O  OG  . SER A 1 641  ? -70.721 12.623  32.725  1.00 94.30  ? 1237 SER A OG  1 
ATOM   4150  N  N   . ARG A 1 642  ? -69.597 13.524  29.851  1.00 73.02  ? 1238 ARG A N   1 
ATOM   4151  C  CA  . ARG A 1 642  ? -69.802 14.576  28.855  1.00 72.19  ? 1238 ARG A CA  1 
ATOM   4152  C  C   . ARG A 1 642  ? -69.234 14.191  27.495  1.00 79.05  ? 1238 ARG A C   1 
ATOM   4153  O  O   . ARG A 1 642  ? -69.968 14.025  26.517  1.00 80.86  ? 1238 ARG A O   1 
ATOM   4154  C  CB  . ARG A 1 642  ? -69.160 15.883  29.338  1.00 79.02  ? 1238 ARG A CB  1 
ATOM   4155  C  CG  . ARG A 1 642  ? -69.387 17.110  28.462  1.00 88.13  ? 1238 ARG A CG  1 
ATOM   4156  C  CD  . ARG A 1 642  ? -68.687 18.309  29.087  1.00 91.95  ? 1238 ARG A CD  1 
ATOM   4157  N  NE  . ARG A 1 642  ? -67.236 18.119  29.131  1.00 122.01 ? 1238 ARG A NE  1 
ATOM   4158  C  CZ  . ARG A 1 642  ? -66.420 18.699  30.009  1.00 122.33 ? 1238 ARG A CZ  1 
ATOM   4159  N  NH1 . ARG A 1 642  ? -66.901 19.504  30.946  1.00 98.42  ? 1238 ARG A NH1 1 
ATOM   4160  N  NH2 . ARG A 1 642  ? -65.114 18.466  29.957  1.00 100.50 ? 1238 ARG A NH2 1 
ATOM   4161  N  N   . THR A 1 643  ? -67.914 14.054  27.447  1.00 79.21  ? 1239 THR A N   1 
ATOM   4162  C  CA  . THR A 1 643  ? -67.230 13.687  26.215  1.00 80.62  ? 1239 THR A CA  1 
ATOM   4163  C  C   . THR A 1 643  ? -67.742 12.365  25.655  1.00 76.67  ? 1239 THR A C   1 
ATOM   4164  O  O   . THR A 1 643  ? -67.816 12.195  24.440  1.00 80.12  ? 1239 THR A O   1 
ATOM   4165  C  CB  . THR A 1 643  ? -65.705 13.586  26.411  1.00 71.42  ? 1239 THR A CB  1 
ATOM   4166  O  OG1 . THR A 1 643  ? -65.417 12.758  27.542  1.00 71.13  ? 1239 THR A OG1 1 
ATOM   4167  C  CG2 . THR A 1 643  ? -65.101 14.966  26.630  1.00 64.59  ? 1239 THR A CG2 1 
ATOM   4168  N  N   . TYR A 1 644  ? -68.080 11.422  26.531  1.00 66.20  ? 1240 TYR A N   1 
ATOM   4169  C  CA  . TYR A 1 644  ? -68.631 10.167  26.051  1.00 69.63  ? 1240 TYR A CA  1 
ATOM   4170  C  C   . TYR A 1 644  ? -70.029 10.403  25.512  1.00 72.32  ? 1240 TYR A C   1 
ATOM   4171  O  O   . TYR A 1 644  ? -70.491 9.659   24.652  1.00 61.20  ? 1240 TYR A O   1 
ATOM   4172  C  CB  . TYR A 1 644  ? -68.662 9.089   27.137  1.00 57.44  ? 1240 TYR A CB  1 
ATOM   4173  C  CG  . TYR A 1 644  ? -69.118 7.752   26.596  1.00 61.39  ? 1240 TYR A CG  1 
ATOM   4174  C  CD1 . TYR A 1 644  ? -68.232 6.918   25.930  1.00 58.46  ? 1240 TYR A CD1 1 
ATOM   4175  C  CD2 . TYR A 1 644  ? -70.434 7.333   26.735  1.00 64.42  ? 1240 TYR A CD2 1 
ATOM   4176  C  CE1 . TYR A 1 644  ? -68.637 5.696   25.431  1.00 51.30  ? 1240 TYR A CE1 1 
ATOM   4177  C  CE2 . TYR A 1 644  ? -70.851 6.114   26.239  1.00 66.55  ? 1240 TYR A CE2 1 
ATOM   4178  C  CZ  . TYR A 1 644  ? -69.949 5.299   25.589  1.00 58.60  ? 1240 TYR A CZ  1 
ATOM   4179  O  OH  . TYR A 1 644  ? -70.373 4.086   25.099  1.00 60.96  ? 1240 TYR A OH  1 
ATOM   4180  N  N   . SER A 1 645  ? -70.712 11.427  26.013  1.00 80.24  ? 1241 SER A N   1 
ATOM   4181  C  CA  . SER A 1 645  ? -72.042 11.722  25.498  1.00 83.16  ? 1241 SER A CA  1 
ATOM   4182  C  C   . SER A 1 645  ? -71.864 12.276  24.098  1.00 77.82  ? 1241 SER A C   1 
ATOM   4183  O  O   . SER A 1 645  ? -72.697 12.061  23.208  1.00 73.65  ? 1241 SER A O   1 
ATOM   4184  C  CB  . SER A 1 645  ? -72.796 12.714  26.393  1.00 89.06  ? 1241 SER A CB  1 
ATOM   4185  O  OG  . SER A 1 645  ? -74.078 13.049  25.878  1.00 96.24  ? 1241 SER A OG  1 
ATOM   4186  N  N   . LYS A 1 646  ? -70.758 12.986  23.900  1.00 69.47  ? 1242 LYS A N   1 
ATOM   4187  C  CA  . LYS A 1 646  ? -70.512 13.571  22.594  1.00 74.83  ? 1242 LYS A CA  1 
ATOM   4188  C  C   . LYS A 1 646  ? -70.082 12.496  21.593  1.00 78.76  ? 1242 LYS A C   1 
ATOM   4189  O  O   . LYS A 1 646  ? -70.484 12.537  20.432  1.00 75.39  ? 1242 LYS A O   1 
ATOM   4190  C  CB  . LYS A 1 646  ? -69.469 14.684  22.674  1.00 71.41  ? 1242 LYS A CB  1 
ATOM   4191  C  CG  . LYS A 1 646  ? -69.594 15.687  21.526  1.00 96.88  ? 1242 LYS A CG  1 
ATOM   4192  C  CD  . LYS A 1 646  ? -68.639 16.862  21.647  1.00 102.96 ? 1242 LYS A CD  1 
ATOM   4193  C  CE  . LYS A 1 646  ? -68.917 17.675  22.902  1.00 84.26  ? 1242 LYS A CE  1 
ATOM   4194  N  NZ  . LYS A 1 646  ? -70.128 18.531  22.758  1.00 95.57  ? 1242 LYS A NZ  1 
ATOM   4195  N  N   . PHE A 1 647  ? -69.289 11.530  22.051  1.00 64.37  ? 1243 PHE A N   1 
ATOM   4196  C  CA  . PHE A 1 647  ? -68.783 10.455  21.192  1.00 51.09  ? 1243 PHE A CA  1 
ATOM   4197  C  C   . PHE A 1 647  ? -69.880 9.444   20.884  1.00 46.08  ? 1243 PHE A C   1 
ATOM   4198  O  O   . PHE A 1 647  ? -69.850 8.762   19.861  1.00 55.24  ? 1243 PHE A O   1 
ATOM   4199  C  CB  . PHE A 1 647  ? -67.589 9.762   21.859  1.00 52.44  ? 1243 PHE A CB  1 
ATOM   4200  C  CG  . PHE A 1 647  ? -67.091 8.542   21.124  1.00 55.45  ? 1243 PHE A CG  1 
ATOM   4201  C  CD1 . PHE A 1 647  ? -66.522 8.653   19.866  1.00 57.02  ? 1243 PHE A CD1 1 
ATOM   4202  C  CD2 . PHE A 1 647  ? -67.172 7.286   21.704  1.00 54.00  ? 1243 PHE A CD2 1 
ATOM   4203  C  CE1 . PHE A 1 647  ? -66.059 7.531   19.192  1.00 56.73  ? 1243 PHE A CE1 1 
ATOM   4204  C  CE2 . PHE A 1 647  ? -66.709 6.161   21.037  1.00 55.86  ? 1243 PHE A CE2 1 
ATOM   4205  C  CZ  . PHE A 1 647  ? -66.152 6.284   19.780  1.00 49.39  ? 1243 PHE A CZ  1 
ATOM   4206  N  N   . LYS A 1 648  ? -70.851 9.371   21.788  1.00 63.29  ? 1244 LYS A N   1 
ATOM   4207  C  CA  . LYS A 1 648  ? -71.981 8.454   21.688  1.00 57.87  ? 1244 LYS A CA  1 
ATOM   4208  C  C   . LYS A 1 648  ? -72.832 8.774   20.465  1.00 49.76  ? 1244 LYS A C   1 
ATOM   4209  O  O   . LYS A 1 648  ? -73.457 7.889   19.879  1.00 60.11  ? 1244 LYS A O   1 
ATOM   4210  C  CB  . LYS A 1 648  ? -72.823 8.533   22.965  1.00 73.48  ? 1244 LYS A CB  1 
ATOM   4211  C  CG  . LYS A 1 648  ? -73.929 7.509   23.109  1.00 74.29  ? 1244 LYS A CG  1 
ATOM   4212  C  CD  . LYS A 1 648  ? -74.746 7.828   24.356  1.00 79.50  ? 1244 LYS A CD  1 
ATOM   4213  C  CE  . LYS A 1 648  ? -75.891 6.851   24.555  1.00 91.13  ? 1244 LYS A CE  1 
ATOM   4214  N  NZ  . LYS A 1 648  ? -75.432 5.555   25.124  1.00 89.10  ? 1244 LYS A NZ  1 
ATOM   4215  N  N   . ASN A 1 649  ? -72.846 10.048  20.083  1.00 50.25  ? 1245 ASN A N   1 
ATOM   4216  C  CA  . ASN A 1 649  ? -73.621 10.496  18.934  1.00 60.53  ? 1245 ASN A CA  1 
ATOM   4217  C  C   . ASN A 1 649  ? -72.741 11.060  17.826  1.00 51.14  ? 1245 ASN A C   1 
ATOM   4218  O  O   . ASN A 1 649  ? -73.217 11.777  16.947  1.00 47.26  ? 1245 ASN A O   1 
ATOM   4219  C  CB  . ASN A 1 649  ? -74.644 11.547  19.361  1.00 62.30  ? 1245 ASN A CB  1 
ATOM   4220  C  CG  . ASN A 1 649  ? -75.690 10.991  20.299  1.00 61.33  ? 1245 ASN A CG  1 
ATOM   4221  O  OD1 . ASN A 1 649  ? -76.662 10.373  19.866  1.00 62.25  ? 1245 ASN A OD1 1 
ATOM   4222  N  ND2 . ASN A 1 649  ? -75.501 11.209  21.595  1.00 67.66  ? 1245 ASN A ND2 1 
ATOM   4223  N  N   . SER A 1 650  ? -71.457 10.723  17.875  1.00 49.58  ? 1246 SER A N   1 
ATOM   4224  C  CA  . SER A 1 650  ? -70.489 11.223  16.909  1.00 41.87  ? 1246 SER A CA  1 
ATOM   4225  C  C   . SER A 1 650  ? -70.728 10.667  15.510  1.00 49.11  ? 1246 SER A C   1 
ATOM   4226  O  O   . SER A 1 650  ? -71.565 9.787   15.313  1.00 45.50  ? 1246 SER A O   1 
ATOM   4227  C  CB  . SER A 1 650  ? -69.072 10.880  17.363  1.00 46.69  ? 1246 SER A CB  1 
ATOM   4228  O  OG  . SER A 1 650  ? -68.902 9.479   17.484  1.00 54.48  ? 1246 SER A OG  1 
ATOM   4229  N  N   . LEU A 1 651  ? -69.979 11.183  14.542  1.00 50.51  ? 1247 LEU A N   1 
ATOM   4230  C  CA  . LEU A 1 651  ? -70.083 10.715  13.166  1.00 44.99  ? 1247 LEU A CA  1 
ATOM   4231  C  C   . LEU A 1 651  ? -69.396 9.366   12.992  1.00 50.98  ? 1247 LEU A C   1 
ATOM   4232  O  O   . LEU A 1 651  ? -69.583 8.689   11.981  1.00 51.67  ? 1247 LEU A O   1 
ATOM   4233  C  CB  . LEU A 1 651  ? -69.485 11.742  12.203  1.00 44.94  ? 1247 LEU A CB  1 
ATOM   4234  C  CG  . LEU A 1 651  ? -70.277 13.043  12.058  1.00 38.17  ? 1247 LEU A CG  1 
ATOM   4235  C  CD1 . LEU A 1 651  ? -69.581 13.994  11.100  1.00 38.00  ? 1247 LEU A CD1 1 
ATOM   4236  C  CD2 . LEU A 1 651  ? -71.690 12.752  11.588  1.00 38.55  ? 1247 LEU A CD2 1 
ATOM   4237  N  N   . VAL A 1 652  ? -68.596 8.983   13.982  1.00 40.16  ? 1248 VAL A N   1 
ATOM   4238  C  CA  . VAL A 1 652  ? -67.969 7.668   13.985  1.00 38.37  ? 1248 VAL A CA  1 
ATOM   4239  C  C   . VAL A 1 652  ? -69.032 6.599   14.206  1.00 45.94  ? 1248 VAL A C   1 
ATOM   4240  O  O   . VAL A 1 652  ? -69.049 5.568   13.530  1.00 56.62  ? 1248 VAL A O   1 
ATOM   4241  C  CB  . VAL A 1 652  ? -66.886 7.555   15.074  1.00 41.43  ? 1248 VAL A CB  1 
ATOM   4242  C  CG1 . VAL A 1 652  ? -66.194 6.204   14.993  1.00 33.28  ? 1248 VAL A CG1 1 
ATOM   4243  C  CG2 . VAL A 1 652  ? -65.877 8.683   14.934  1.00 44.80  ? 1248 VAL A CG2 1 
ATOM   4244  N  N   . VAL A 1 653  ? -69.924 6.863   15.155  1.00 48.65  ? 1249 VAL A N   1 
ATOM   4245  C  CA  . VAL A 1 653  ? -71.031 5.963   15.450  1.00 49.65  ? 1249 VAL A CA  1 
ATOM   4246  C  C   . VAL A 1 653  ? -72.005 5.915   14.276  1.00 46.33  ? 1249 VAL A C   1 
ATOM   4247  O  O   . VAL A 1 653  ? -72.561 4.863   13.962  1.00 45.90  ? 1249 VAL A O   1 
ATOM   4248  C  CB  . VAL A 1 653  ? -71.773 6.391   16.733  1.00 48.78  ? 1249 VAL A CB  1 
ATOM   4249  C  CG1 . VAL A 1 653  ? -72.980 5.503   16.985  1.00 43.04  ? 1249 VAL A CG1 1 
ATOM   4250  C  CG2 . VAL A 1 653  ? -70.828 6.351   17.921  1.00 36.20  ? 1249 VAL A CG2 1 
ATOM   4251  N  N   . SER A 1 654  ? -72.199 7.058   13.624  1.00 41.29  ? 1250 SER A N   1 
ATOM   4252  C  CA  . SER A 1 654  ? -73.043 7.126   12.436  1.00 46.16  ? 1250 SER A CA  1 
ATOM   4253  C  C   . SER A 1 654  ? -72.454 6.276   11.315  1.00 47.18  ? 1250 SER A C   1 
ATOM   4254  O  O   . SER A 1 654  ? -73.165 5.526   10.646  1.00 52.20  ? 1250 SER A O   1 
ATOM   4255  C  CB  . SER A 1 654  ? -73.206 8.575   11.969  1.00 40.40  ? 1250 SER A CB  1 
ATOM   4256  O  OG  . SER A 1 654  ? -73.787 9.377   12.981  1.00 58.23  ? 1250 SER A OG  1 
ATOM   4257  N  N   . PHE A 1 655  ? -71.146 6.399   11.126  1.00 40.54  ? 1251 PHE A N   1 
ATOM   4258  C  CA  . PHE A 1 655  ? -70.432 5.653   10.097  1.00 47.07  ? 1251 PHE A CA  1 
ATOM   4259  C  C   . PHE A 1 655  ? -70.511 4.148   10.358  1.00 54.42  ? 1251 PHE A C   1 
ATOM   4260  O  O   . PHE A 1 655  ? -70.805 3.356   9.451   1.00 47.85  ? 1251 PHE A O   1 
ATOM   4261  C  CB  . PHE A 1 655  ? -68.977 6.122   10.037  1.00 35.30  ? 1251 PHE A CB  1 
ATOM   4262  C  CG  . PHE A 1 655  ? -68.210 5.583   8.868   1.00 45.88  ? 1251 PHE A CG  1 
ATOM   4263  C  CD1 . PHE A 1 655  ? -68.739 5.631   7.590   1.00 44.20  ? 1251 PHE A CD1 1 
ATOM   4264  C  CD2 . PHE A 1 655  ? -66.945 5.049   9.045   1.00 42.95  ? 1251 PHE A CD2 1 
ATOM   4265  C  CE1 . PHE A 1 655  ? -68.027 5.139   6.512   1.00 43.88  ? 1251 PHE A CE1 1 
ATOM   4266  C  CE2 . PHE A 1 655  ? -66.226 4.559   7.973   1.00 36.79  ? 1251 PHE A CE2 1 
ATOM   4267  C  CZ  . PHE A 1 655  ? -66.768 4.602   6.705   1.00 41.98  ? 1251 PHE A CZ  1 
ATOM   4268  N  N   . LEU A 1 656  ? -70.260 3.760   11.606  1.00 47.23  ? 1252 LEU A N   1 
ATOM   4269  C  CA  . LEU A 1 656  ? -70.369 2.363   12.011  1.00 41.85  ? 1252 LEU A CA  1 
ATOM   4270  C  C   . LEU A 1 656  ? -71.796 1.852   11.835  1.00 46.61  ? 1252 LEU A C   1 
ATOM   4271  O  O   . LEU A 1 656  ? -72.011 0.676   11.548  1.00 50.01  ? 1252 LEU A O   1 
ATOM   4272  C  CB  . LEU A 1 656  ? -69.918 2.188   13.461  1.00 38.26  ? 1252 LEU A CB  1 
ATOM   4273  C  CG  . LEU A 1 656  ? -68.410 2.290   13.699  1.00 50.45  ? 1252 LEU A CG  1 
ATOM   4274  C  CD1 . LEU A 1 656  ? -68.099 2.340   15.185  1.00 43.14  ? 1252 LEU A CD1 1 
ATOM   4275  C  CD2 . LEU A 1 656  ? -67.695 1.119   13.044  1.00 49.33  ? 1252 LEU A CD2 1 
ATOM   4276  N  N   . SER A 1 657  ? -72.767 2.744   12.000  1.00 40.19  ? 1253 SER A N   1 
ATOM   4277  C  CA  . SER A 1 657  ? -74.168 2.398   11.790  1.00 41.11  ? 1253 SER A CA  1 
ATOM   4278  C  C   . SER A 1 657  ? -74.431 2.140   10.310  1.00 42.66  ? 1253 SER A C   1 
ATOM   4279  O  O   . SER A 1 657  ? -75.168 1.218   9.953   1.00 50.56  ? 1253 SER A O   1 
ATOM   4280  C  CB  . SER A 1 657  ? -75.084 3.506   12.312  1.00 47.82  ? 1253 SER A CB  1 
ATOM   4281  O  OG  . SER A 1 657  ? -74.894 3.710   13.702  1.00 54.12  ? 1253 SER A OG  1 
ATOM   4282  N  N   . TYR A 1 658  ? -73.825 2.962   9.456   1.00 35.84  ? 1254 TYR A N   1 
ATOM   4283  C  CA  . TYR A 1 658  ? -73.867 2.738   8.015   1.00 44.72  ? 1254 TYR A CA  1 
ATOM   4284  C  C   . TYR A 1 658  ? -73.303 1.363   7.690   1.00 49.13  ? 1254 TYR A C   1 
ATOM   4285  O  O   . TYR A 1 658  ? -73.864 0.621   6.873   1.00 41.97  ? 1254 TYR A O   1 
ATOM   4286  C  CB  . TYR A 1 658  ? -73.079 3.818   7.268   1.00 40.95  ? 1254 TYR A CB  1 
ATOM   4287  C  CG  . TYR A 1 658  ? -73.893 5.028   6.861   1.00 39.79  ? 1254 TYR A CG  1 
ATOM   4288  C  CD1 . TYR A 1 658  ? -74.088 6.086   7.737   1.00 41.77  ? 1254 TYR A CD1 1 
ATOM   4289  C  CD2 . TYR A 1 658  ? -74.455 5.115   5.594   1.00 41.22  ? 1254 TYR A CD2 1 
ATOM   4290  C  CE1 . TYR A 1 658  ? -74.825 7.194   7.366   1.00 43.16  ? 1254 TYR A CE1 1 
ATOM   4291  C  CE2 . TYR A 1 658  ? -75.193 6.219   5.214   1.00 33.25  ? 1254 TYR A CE2 1 
ATOM   4292  C  CZ  . TYR A 1 658  ? -75.375 7.255   6.103   1.00 38.20  ? 1254 TYR A CZ  1 
ATOM   4293  O  OH  . TYR A 1 658  ? -76.109 8.355   5.728   1.00 45.11  ? 1254 TYR A OH  1 
ATOM   4294  N  N   . CYS A 1 659  ? -72.194 1.026   8.344   1.00 43.64  ? 1255 CYS A N   1 
ATOM   4295  C  CA  . CYS A 1 659  ? -71.554 -0.270  8.140   1.00 39.63  ? 1255 CYS A CA  1 
ATOM   4296  C  C   . CYS A 1 659  ? -72.468 -1.422  8.537   1.00 44.58  ? 1255 CYS A C   1 
ATOM   4297  O  O   . CYS A 1 659  ? -72.648 -2.370  7.772   1.00 50.01  ? 1255 CYS A O   1 
ATOM   4298  C  CB  . CYS A 1 659  ? -70.246 -0.354  8.926   1.00 47.17  ? 1255 CYS A CB  1 
ATOM   4299  S  SG  . CYS A 1 659  ? -69.289 -1.848  8.589   1.00 47.10  ? 1255 CYS A SG  1 
ATOM   4300  N  N   . ASP A 1 660  ? -73.040 -1.337  9.734   1.00 48.08  ? 1256 ASP A N   1 
ATOM   4301  C  CA  . ASP A 1 660  ? -73.920 -2.385  10.232  1.00 49.78  ? 1256 ASP A CA  1 
ATOM   4302  C  C   . ASP A 1 660  ? -75.138 -2.553  9.337   1.00 45.87  ? 1256 ASP A C   1 
ATOM   4303  O  O   . ASP A 1 660  ? -75.546 -3.673  9.041   1.00 53.04  ? 1256 ASP A O   1 
ATOM   4304  C  CB  . ASP A 1 660  ? -74.364 -2.091  11.667  1.00 49.57  ? 1256 ASP A CB  1 
ATOM   4305  C  CG  . ASP A 1 660  ? -75.200 -3.212  12.259  1.00 55.06  ? 1256 ASP A CG  1 
ATOM   4306  O  OD1 . ASP A 1 660  ? -75.042 -4.371  11.819  1.00 61.94  ? 1256 ASP A OD1 1 
ATOM   4307  O  OD2 . ASP A 1 660  ? -76.014 -2.938  13.166  1.00 55.88  ? 1256 ASP A OD2 1 
ATOM   4308  N  N   . TYR A 1 661  ? -75.713 -1.438  8.897   1.00 49.20  ? 1257 TYR A N   1 
ATOM   4309  C  CA  . TYR A 1 661  ? -76.912 -1.499  8.071   1.00 47.11  ? 1257 TYR A CA  1 
ATOM   4310  C  C   . TYR A 1 661  ? -76.635 -2.075  6.687   1.00 40.37  ? 1257 TYR A C   1 
ATOM   4311  O  O   . TYR A 1 661  ? -77.315 -3.001  6.250   1.00 50.29  ? 1257 TYR A O   1 
ATOM   4312  C  CB  . TYR A 1 661  ? -77.552 -0.116  7.928   1.00 38.43  ? 1257 TYR A CB  1 
ATOM   4313  C  CG  . TYR A 1 661  ? -78.790 -0.131  7.057   1.00 37.34  ? 1257 TYR A CG  1 
ATOM   4314  C  CD1 . TYR A 1 661  ? -80.015 -0.541  7.567   1.00 34.04  ? 1257 TYR A CD1 1 
ATOM   4315  C  CD2 . TYR A 1 661  ? -78.730 0.247   5.721   1.00 38.21  ? 1257 TYR A CD2 1 
ATOM   4316  C  CE1 . TYR A 1 661  ? -81.147 -0.564  6.775   1.00 27.73  ? 1257 TYR A CE1 1 
ATOM   4317  C  CE2 . TYR A 1 661  ? -79.855 0.224   4.922   1.00 43.94  ? 1257 TYR A CE2 1 
ATOM   4318  C  CZ  . TYR A 1 661  ? -81.061 -0.181  5.454   1.00 44.35  ? 1257 TYR A CZ  1 
ATOM   4319  O  OH  . TYR A 1 661  ? -82.184 -0.203  4.660   1.00 49.64  ? 1257 TYR A OH  1 
ATOM   4320  N  N   . TYR A 1 662  ? -75.643 -1.523  5.997   1.00 43.94  ? 1258 TYR A N   1 
ATOM   4321  C  CA  . TYR A 1 662  ? -75.426 -1.884  4.599   1.00 43.06  ? 1258 TYR A CA  1 
ATOM   4322  C  C   . TYR A 1 662  ? -74.694 -3.208  4.414   1.00 38.81  ? 1258 TYR A C   1 
ATOM   4323  O  O   . TYR A 1 662  ? -74.850 -3.865  3.383   1.00 40.42  ? 1258 TYR A O   1 
ATOM   4324  C  CB  . TYR A 1 662  ? -74.671 -0.766  3.875   1.00 31.67  ? 1258 TYR A CB  1 
ATOM   4325  C  CG  . TYR A 1 662  ? -75.576 0.352   3.428   1.00 30.91  ? 1258 TYR A CG  1 
ATOM   4326  C  CD1 . TYR A 1 662  ? -76.443 0.176   2.358   1.00 39.58  ? 1258 TYR A CD1 1 
ATOM   4327  C  CD2 . TYR A 1 662  ? -75.584 1.573   4.086   1.00 36.48  ? 1258 TYR A CD2 1 
ATOM   4328  C  CE1 . TYR A 1 662  ? -77.282 1.188   1.947   1.00 37.38  ? 1258 TYR A CE1 1 
ATOM   4329  C  CE2 . TYR A 1 662  ? -76.419 2.594   3.681   1.00 31.11  ? 1258 TYR A CE2 1 
ATOM   4330  C  CZ  . TYR A 1 662  ? -77.266 2.394   2.610   1.00 39.05  ? 1258 TYR A CZ  1 
ATOM   4331  O  OH  . TYR A 1 662  ? -78.102 3.406   2.204   1.00 35.89  ? 1258 TYR A OH  1 
ATOM   4332  N  N   . ARG A 1 663  ? -73.905 -3.592  5.412   1.00 37.81  ? 1259 ARG A N   1 
ATOM   4333  C  CA  . ARG A 1 663  ? -73.127 -4.831  5.366   1.00 48.23  ? 1259 ARG A CA  1 
ATOM   4334  C  C   . ARG A 1 663  ? -72.307 -4.993  4.084   1.00 43.98  ? 1259 ARG A C   1 
ATOM   4335  O  O   . ARG A 1 663  ? -72.524 -5.937  3.325   1.00 49.38  ? 1259 ARG A O   1 
ATOM   4336  C  CB  . ARG A 1 663  ? -74.052 -6.040  5.533   1.00 50.49  ? 1259 ARG A CB  1 
ATOM   4337  C  CG  . ARG A 1 663  ? -74.765 -6.089  6.869   1.00 45.55  ? 1259 ARG A CG  1 
ATOM   4338  C  CD  . ARG A 1 663  ? -73.771 -6.233  8.006   1.00 34.55  ? 1259 ARG A CD  1 
ATOM   4339  N  NE  . ARG A 1 663  ? -74.416 -6.100  9.307   1.00 42.02  ? 1259 ARG A NE  1 
ATOM   4340  C  CZ  . ARG A 1 663  ? -74.954 -7.111  9.980   1.00 41.08  ? 1259 ARG A CZ  1 
ATOM   4341  N  NH1 . ARG A 1 663  ? -75.521 -6.896  11.158  1.00 52.61  ? 1259 ARG A NH1 1 
ATOM   4342  N  NH2 . ARG A 1 663  ? -74.924 -8.337  9.476   1.00 45.01  ? 1259 ARG A NH2 1 
ATOM   4343  N  N   . PRO A 1 664  ? -71.363 -4.070  3.834   1.00 45.69  ? 1260 PRO A N   1 
ATOM   4344  C  CA  . PRO A 1 664  ? -70.528 -4.202  2.637   1.00 38.85  ? 1260 PRO A CA  1 
ATOM   4345  C  C   . PRO A 1 664  ? -69.501 -5.318  2.771   1.00 35.58  ? 1260 PRO A C   1 
ATOM   4346  O  O   . PRO A 1 664  ? -69.216 -5.756  3.886   1.00 35.54  ? 1260 PRO A O   1 
ATOM   4347  C  CB  . PRO A 1 664  ? -69.836 -2.842  2.545   1.00 41.49  ? 1260 PRO A CB  1 
ATOM   4348  C  CG  . PRO A 1 664  ? -69.761 -2.381  3.954   1.00 31.34  ? 1260 PRO A CG  1 
ATOM   4349  C  CD  . PRO A 1 664  ? -71.033 -2.852  4.596   1.00 32.81  ? 1260 PRO A CD  1 
ATOM   4350  N  N   . ARG A 1 665  ? -68.956 -5.768  1.645   1.00 39.19  ? 1261 ARG A N   1 
ATOM   4351  C  CA  . ARG A 1 665  ? -67.917 -6.788  1.662   1.00 32.24  ? 1261 ARG A CA  1 
ATOM   4352  C  C   . ARG A 1 665  ? -66.662 -6.240  2.332   1.00 34.22  ? 1261 ARG A C   1 
ATOM   4353  O  O   . ARG A 1 665  ? -65.963 -6.964  3.040   1.00 36.89  ? 1261 ARG A O   1 
ATOM   4354  C  CB  . ARG A 1 665  ? -67.604 -7.271  0.241   1.00 38.92  ? 1261 ARG A CB  1 
ATOM   4355  C  CG  . ARG A 1 665  ? -68.843 -7.558  -0.595  1.00 27.95  ? 1261 ARG A CG  1 
ATOM   4356  C  CD  . ARG A 1 665  ? -68.636 -8.722  -1.554  1.00 35.58  ? 1261 ARG A CD  1 
ATOM   4357  N  NE  . ARG A 1 665  ? -67.840 -8.365  -2.725  1.00 52.43  ? 1261 ARG A NE  1 
ATOM   4358  C  CZ  . ARG A 1 665  ? -66.766 -9.035  -3.132  1.00 47.73  ? 1261 ARG A CZ  1 
ATOM   4359  N  NH1 . ARG A 1 665  ? -66.351 -10.100 -2.461  1.00 49.19  ? 1261 ARG A NH1 1 
ATOM   4360  N  NH2 . ARG A 1 665  ? -66.106 -8.641  -4.213  1.00 50.00  ? 1261 ARG A NH2 1 
ATOM   4361  N  N   . PHE A 1 666  ? -66.389 -4.956  2.117   1.00 39.92  ? 1262 PHE A N   1 
ATOM   4362  C  CA  . PHE A 1 666  ? -65.219 -4.318  2.710   1.00 33.56  ? 1262 PHE A CA  1 
ATOM   4363  C  C   . PHE A 1 666  ? -65.540 -2.958  3.324   1.00 38.56  ? 1262 PHE A C   1 
ATOM   4364  O  O   . PHE A 1 666  ? -66.469 -2.260  2.896   1.00 48.56  ? 1262 PHE A O   1 
ATOM   4365  C  CB  . PHE A 1 666  ? -64.112 -4.158  1.670   1.00 28.77  ? 1262 PHE A CB  1 
ATOM   4366  C  CG  . PHE A 1 666  ? -63.583 -5.455  1.144   1.00 38.26  ? 1262 PHE A CG  1 
ATOM   4367  C  CD1 . PHE A 1 666  ? -62.597 -6.142  1.830   1.00 28.59  ? 1262 PHE A CD1 1 
ATOM   4368  C  CD2 . PHE A 1 666  ? -64.065 -5.984  -0.041  1.00 40.02  ? 1262 PHE A CD2 1 
ATOM   4369  C  CE1 . PHE A 1 666  ? -62.105 -7.333  1.347   1.00 37.39  ? 1262 PHE A CE1 1 
ATOM   4370  C  CE2 . PHE A 1 666  ? -63.576 -7.176  -0.530  1.00 32.35  ? 1262 PHE A CE2 1 
ATOM   4371  C  CZ  . PHE A 1 666  ? -62.594 -7.851  0.166   1.00 38.36  ? 1262 PHE A CZ  1 
ATOM   4372  N  N   . PHE A 1 667  ? -64.732 -2.580  4.309   1.00 30.65  ? 1263 PHE A N   1 
ATOM   4373  C  CA  . PHE A 1 667  ? -64.971 -1.394  5.118   1.00 32.10  ? 1263 PHE A CA  1 
ATOM   4374  C  C   . PHE A 1 667  ? -63.656 -0.724  5.510   1.00 40.81  ? 1263 PHE A C   1 
ATOM   4375  O  O   . PHE A 1 667  ? -62.779 -1.367  6.096   1.00 32.22  ? 1263 PHE A O   1 
ATOM   4376  C  CB  . PHE A 1 667  ? -65.770 -1.775  6.368   1.00 46.52  ? 1263 PHE A CB  1 
ATOM   4377  C  CG  . PHE A 1 667  ? -65.846 -0.689  7.401   1.00 40.61  ? 1263 PHE A CG  1 
ATOM   4378  C  CD1 . PHE A 1 667  ? -66.820 0.289   7.320   1.00 34.76  ? 1263 PHE A CD1 1 
ATOM   4379  C  CD2 . PHE A 1 667  ? -64.954 -0.653  8.463   1.00 27.80  ? 1263 PHE A CD2 1 
ATOM   4380  C  CE1 . PHE A 1 667  ? -66.900 1.286   8.270   1.00 33.24  ? 1263 PHE A CE1 1 
ATOM   4381  C  CE2 . PHE A 1 667  ? -65.028 0.346   9.415   1.00 41.37  ? 1263 PHE A CE2 1 
ATOM   4382  C  CZ  . PHE A 1 667  ? -66.003 1.316   9.318   1.00 37.34  ? 1263 PHE A CZ  1 
ATOM   4383  N  N   . LEU A 1 668  ? -63.524 0.564   5.197   1.00 35.86  ? 1264 LEU A N   1 
ATOM   4384  C  CA  . LEU A 1 668  ? -62.325 1.320   5.551   1.00 38.97  ? 1264 LEU A CA  1 
ATOM   4385  C  C   . LEU A 1 668  ? -62.675 2.590   6.311   1.00 32.52  ? 1264 LEU A C   1 
ATOM   4386  O  O   . LEU A 1 668  ? -63.451 3.425   5.833   1.00 37.47  ? 1264 LEU A O   1 
ATOM   4387  C  CB  . LEU A 1 668  ? -61.509 1.680   4.305   1.00 37.15  ? 1264 LEU A CB  1 
ATOM   4388  C  CG  . LEU A 1 668  ? -60.052 2.113   4.526   1.00 36.40  ? 1264 LEU A CG  1 
ATOM   4389  C  CD1 . LEU A 1 668  ? -59.278 1.947   3.242   1.00 55.92  ? 1264 LEU A CD1 1 
ATOM   4390  C  CD2 . LEU A 1 668  ? -59.905 3.550   5.020   1.00 32.16  ? 1264 LEU A CD2 1 
ATOM   4391  N  N   . LEU A 1 669  ? -62.079 2.732   7.490   1.00 39.08  ? 1265 LEU A N   1 
ATOM   4392  C  CA  . LEU A 1 669  ? -62.195 3.954   8.269   1.00 35.52  ? 1265 LEU A CA  1 
ATOM   4393  C  C   . LEU A 1 669  ? -60.810 4.564   8.428   1.00 34.23  ? 1265 LEU A C   1 
ATOM   4394  O  O   . LEU A 1 669  ? -59.972 4.024   9.151   1.00 38.83  ? 1265 LEU A O   1 
ATOM   4395  C  CB  . LEU A 1 669  ? -62.830 3.671   9.635   1.00 38.32  ? 1265 LEU A CB  1 
ATOM   4396  C  CG  . LEU A 1 669  ? -63.317 4.832   10.509  1.00 40.63  ? 1265 LEU A CG  1 
ATOM   4397  C  CD1 . LEU A 1 669  ? -64.362 4.319   11.479  1.00 48.80  ? 1265 LEU A CD1 1 
ATOM   4398  C  CD2 . LEU A 1 669  ? -62.179 5.488   11.278  1.00 38.64  ? 1265 LEU A CD2 1 
ATOM   4399  N  N   . GLU A 1 670  ? -60.565 5.682   7.753   1.00 32.25  ? 1266 GLU A N   1 
ATOM   4400  C  CA  . GLU A 1 670  ? -59.282 6.365   7.860   1.00 34.12  ? 1266 GLU A CA  1 
ATOM   4401  C  C   . GLU A 1 670  ? -59.409 7.593   8.754   1.00 34.62  ? 1266 GLU A C   1 
ATOM   4402  O  O   . GLU A 1 670  ? -60.443 8.261   8.766   1.00 38.05  ? 1266 GLU A O   1 
ATOM   4403  C  CB  . GLU A 1 670  ? -58.753 6.756   6.473   1.00 24.83  ? 1266 GLU A CB  1 
ATOM   4404  C  CG  . GLU A 1 670  ? -59.467 7.929   5.812   1.00 37.56  ? 1266 GLU A CG  1 
ATOM   4405  C  CD  . GLU A 1 670  ? -58.819 9.264   6.135   1.00 57.18  ? 1266 GLU A CD  1 
ATOM   4406  O  OE1 . GLU A 1 670  ? -59.487 10.308  5.978   1.00 56.63  ? 1266 GLU A OE1 1 
ATOM   4407  O  OE2 . GLU A 1 670  ? -57.637 9.268   6.543   1.00 54.27  ? 1266 GLU A OE2 1 
ATOM   4408  N  N   . ASN A 1 671  ? -58.357 7.882   9.512   1.00 29.73  ? 1267 ASN A N   1 
ATOM   4409  C  CA  . ASN A 1 671  ? -58.353 9.058   10.371  1.00 31.91  ? 1267 ASN A CA  1 
ATOM   4410  C  C   . ASN A 1 671  ? -56.931 9.481   10.698  1.00 36.57  ? 1267 ASN A C   1 
ATOM   4411  O  O   . ASN A 1 671  ? -55.976 8.872   10.220  1.00 37.58  ? 1267 ASN A O   1 
ATOM   4412  C  CB  . ASN A 1 671  ? -59.130 8.787   11.659  1.00 33.59  ? 1267 ASN A CB  1 
ATOM   4413  C  CG  . ASN A 1 671  ? -59.883 10.005  12.153  1.00 46.20  ? 1267 ASN A CG  1 
ATOM   4414  O  OD1 . ASN A 1 671  ? -59.300 10.912  12.747  1.00 44.19  ? 1267 ASN A OD1 1 
ATOM   4415  N  ND2 . ASN A 1 671  ? -61.187 10.031  11.907  1.00 49.38  ? 1267 ASN A ND2 1 
ATOM   4416  N  N   . VAL A 1 672  ? -56.790 10.528  11.506  1.00 37.14  ? 1268 VAL A N   1 
ATOM   4417  C  CA  . VAL A 1 672  ? -55.479 10.922  12.004  1.00 38.23  ? 1268 VAL A CA  1 
ATOM   4418  C  C   . VAL A 1 672  ? -54.934 9.786   12.856  1.00 43.32  ? 1268 VAL A C   1 
ATOM   4419  O  O   . VAL A 1 672  ? -55.701 8.957   13.343  1.00 50.45  ? 1268 VAL A O   1 
ATOM   4420  C  CB  . VAL A 1 672  ? -55.537 12.222  12.829  1.00 34.52  ? 1268 VAL A CB  1 
ATOM   4421  C  CG1 . VAL A 1 672  ? -55.992 13.379  11.959  1.00 26.74  ? 1268 VAL A CG1 1 
ATOM   4422  C  CG2 . VAL A 1 672  ? -56.464 12.055  14.022  1.00 39.78  ? 1268 VAL A CG2 1 
ATOM   4423  N  N   . ARG A 1 673  ? -53.618 9.738   13.028  1.00 39.01  ? 1269 ARG A N   1 
ATOM   4424  C  CA  . ARG A 1 673  ? -52.997 8.629   13.748  1.00 49.04  ? 1269 ARG A CA  1 
ATOM   4425  C  C   . ARG A 1 673  ? -53.546 8.489   15.165  1.00 54.70  ? 1269 ARG A C   1 
ATOM   4426  O  O   . ARG A 1 673  ? -53.949 7.398   15.585  1.00 49.27  ? 1269 ARG A O   1 
ATOM   4427  C  CB  . ARG A 1 673  ? -51.480 8.801   13.797  1.00 38.42  ? 1269 ARG A CB  1 
ATOM   4428  C  CG  . ARG A 1 673  ? -50.776 7.638   14.468  1.00 48.32  ? 1269 ARG A CG  1 
ATOM   4429  C  CD  . ARG A 1 673  ? -49.973 8.090   15.671  1.00 58.79  ? 1269 ARG A CD  1 
ATOM   4430  N  NE  . ARG A 1 673  ? -49.634 6.967   16.539  1.00 77.95  ? 1269 ARG A NE  1 
ATOM   4431  C  CZ  . ARG A 1 673  ? -50.212 6.733   17.712  1.00 63.11  ? 1269 ARG A CZ  1 
ATOM   4432  N  NH1 . ARG A 1 673  ? -51.151 7.552   18.165  1.00 57.62  ? 1269 ARG A NH1 1 
ATOM   4433  N  NH2 . ARG A 1 673  ? -49.846 5.684   18.437  1.00 65.88  ? 1269 ARG A NH2 1 
ATOM   4434  N  N   . ASN A 1 674  ? -53.601 9.605   15.885  1.00 55.98  ? 1270 ASN A N   1 
ATOM   4435  C  CA  . ASN A 1 674  ? -54.027 9.612   17.280  1.00 43.79  ? 1270 ASN A CA  1 
ATOM   4436  C  C   . ASN A 1 674  ? -55.426 9.043   17.509  1.00 51.09  ? 1270 ASN A C   1 
ATOM   4437  O  O   . ASN A 1 674  ? -55.881 8.953   18.645  1.00 53.77  ? 1270 ASN A O   1 
ATOM   4438  C  CB  . ASN A 1 674  ? -53.950 11.037  17.838  1.00 38.31  ? 1270 ASN A CB  1 
ATOM   4439  C  CG  . ASN A 1 674  ? -52.521 11.501  18.048  1.00 51.35  ? 1270 ASN A CG  1 
ATOM   4440  O  OD1 . ASN A 1 674  ? -51.628 10.688  18.283  1.00 41.45  ? 1270 ASN A OD1 1 
ATOM   4441  N  ND2 . ASN A 1 674  ? -52.299 12.810  17.969  1.00 74.26  ? 1270 ASN A ND2 1 
ATOM   4442  N  N   . PHE A 1 675  ? -56.107 8.670   16.429  1.00 50.16  ? 1271 PHE A N   1 
ATOM   4443  C  CA  . PHE A 1 675  ? -57.371 7.948   16.520  1.00 47.02  ? 1271 PHE A CA  1 
ATOM   4444  C  C   . PHE A 1 675  ? -57.173 6.679   17.336  1.00 52.85  ? 1271 PHE A C   1 
ATOM   4445  O  O   . PHE A 1 675  ? -58.056 6.264   18.087  1.00 65.47  ? 1271 PHE A O   1 
ATOM   4446  C  CB  . PHE A 1 675  ? -57.902 7.608   15.125  1.00 42.13  ? 1271 PHE A CB  1 
ATOM   4447  C  CG  . PHE A 1 675  ? -59.260 6.964   15.123  1.00 38.91  ? 1271 PHE A CG  1 
ATOM   4448  C  CD1 . PHE A 1 675  ? -59.397 5.593   15.262  1.00 40.96  ? 1271 PHE A CD1 1 
ATOM   4449  C  CD2 . PHE A 1 675  ? -60.401 7.731   14.964  1.00 43.64  ? 1271 PHE A CD2 1 
ATOM   4450  C  CE1 . PHE A 1 675  ? -60.647 5.003   15.256  1.00 39.88  ? 1271 PHE A CE1 1 
ATOM   4451  C  CE2 . PHE A 1 675  ? -61.653 7.145   14.955  1.00 42.64  ? 1271 PHE A CE2 1 
ATOM   4452  C  CZ  . PHE A 1 675  ? -61.775 5.780   15.099  1.00 38.74  ? 1271 PHE A CZ  1 
ATOM   4453  N  N   . VAL A 1 676  ? -56.001 6.069   17.194  1.00 49.74  ? 1272 VAL A N   1 
ATOM   4454  C  CA  . VAL A 1 676  ? -55.715 4.836   17.923  1.00 50.40  ? 1272 VAL A CA  1 
ATOM   4455  C  C   . VAL A 1 676  ? -55.363 5.097   19.387  1.00 56.01  ? 1272 VAL A C   1 
ATOM   4456  O  O   . VAL A 1 676  ? -55.166 4.164   20.161  1.00 56.83  ? 1272 VAL A O   1 
ATOM   4457  C  CB  . VAL A 1 676  ? -54.568 4.051   17.268  1.00 46.17  ? 1272 VAL A CB  1 
ATOM   4458  C  CG1 . VAL A 1 676  ? -54.931 3.668   15.841  1.00 37.11  ? 1272 VAL A CG1 1 
ATOM   4459  C  CG2 . VAL A 1 676  ? -53.283 4.858   17.298  1.00 49.48  ? 1272 VAL A CG2 1 
ATOM   4460  N  N   . SER A 1 677  ? -55.289 6.367   19.763  1.00 49.38  ? 1273 SER A N   1 
ATOM   4461  C  CA  . SER A 1 677  ? -54.925 6.743   21.124  1.00 48.85  ? 1273 SER A CA  1 
ATOM   4462  C  C   . SER A 1 677  ? -55.957 7.659   21.777  1.00 53.53  ? 1273 SER A C   1 
ATOM   4463  O  O   . SER A 1 677  ? -55.769 8.096   22.910  1.00 51.90  ? 1273 SER A O   1 
ATOM   4464  C  CB  . SER A 1 677  ? -53.555 7.425   21.134  1.00 50.91  ? 1273 SER A CB  1 
ATOM   4465  O  OG  . SER A 1 677  ? -52.533 6.527   20.742  1.00 58.93  ? 1273 SER A OG  1 
ATOM   4466  N  N   . PHE A 1 678  ? -57.042 7.951   21.063  1.00 62.39  ? 1274 PHE A N   1 
ATOM   4467  C  CA  . PHE A 1 678  ? -58.066 8.859   21.573  1.00 56.89  ? 1274 PHE A CA  1 
ATOM   4468  C  C   . PHE A 1 678  ? -58.779 8.303   22.797  1.00 66.60  ? 1274 PHE A C   1 
ATOM   4469  O  O   . PHE A 1 678  ? -59.191 7.141   22.812  1.00 61.82  ? 1274 PHE A O   1 
ATOM   4470  C  CB  . PHE A 1 678  ? -59.092 9.180   20.487  1.00 59.47  ? 1274 PHE A CB  1 
ATOM   4471  C  CG  . PHE A 1 678  ? -58.634 10.221  19.513  1.00 60.92  ? 1274 PHE A CG  1 
ATOM   4472  C  CD1 . PHE A 1 678  ? -57.593 11.076  19.832  1.00 52.76  ? 1274 PHE A CD1 1 
ATOM   4473  C  CD2 . PHE A 1 678  ? -59.247 10.352  18.280  1.00 62.26  ? 1274 PHE A CD2 1 
ATOM   4474  C  CE1 . PHE A 1 678  ? -57.165 12.033  18.933  1.00 52.15  ? 1274 PHE A CE1 1 
ATOM   4475  C  CE2 . PHE A 1 678  ? -58.825 11.312  17.380  1.00 47.51  ? 1274 PHE A CE2 1 
ATOM   4476  C  CZ  . PHE A 1 678  ? -57.784 12.154  17.709  1.00 53.90  ? 1274 PHE A CZ  1 
ATOM   4477  N  N   . LYS A 1 679  ? -58.922 9.156   23.810  1.00 64.36  ? 1275 LYS A N   1 
ATOM   4478  C  CA  . LYS A 1 679  ? -59.552 8.791   25.074  1.00 51.23  ? 1275 LYS A CA  1 
ATOM   4479  C  C   . LYS A 1 679  ? -58.934 7.518   25.632  1.00 57.09  ? 1275 LYS A C   1 
ATOM   4480  O  O   . LYS A 1 679  ? -59.643 6.608   26.061  1.00 57.91  ? 1275 LYS A O   1 
ATOM   4481  C  CB  . LYS A 1 679  ? -61.062 8.629   24.892  1.00 53.47  ? 1275 LYS A CB  1 
ATOM   4482  C  CG  . LYS A 1 679  ? -61.758 9.911   24.464  1.00 53.32  ? 1275 LYS A CG  1 
ATOM   4483  C  CD  . LYS A 1 679  ? -61.223 11.102  25.242  1.00 53.98  ? 1275 LYS A CD  1 
ATOM   4484  C  CE  . LYS A 1 679  ? -62.129 12.315  25.142  1.00 75.22  ? 1275 LYS A CE  1 
ATOM   4485  N  NZ  . LYS A 1 679  ? -61.540 13.492  25.840  1.00 77.29  ? 1275 LYS A NZ  1 
ATOM   4486  N  N   . ARG A 1 680  ? -57.604 7.477   25.614  1.00 54.03  ? 1276 ARG A N   1 
ATOM   4487  C  CA  . ARG A 1 680  ? -56.837 6.290   25.977  1.00 62.46  ? 1276 ARG A CA  1 
ATOM   4488  C  C   . ARG A 1 680  ? -57.319 5.065   25.203  1.00 62.15  ? 1276 ARG A C   1 
ATOM   4489  O  O   . ARG A 1 680  ? -57.651 4.033   25.791  1.00 63.66  ? 1276 ARG A O   1 
ATOM   4490  C  CB  . ARG A 1 680  ? -56.898 6.051   27.488  1.00 58.82  ? 1276 ARG A CB  1 
ATOM   4491  C  CG  . ARG A 1 680  ? -56.235 7.163   28.288  1.00 66.35  ? 1276 ARG A CG  1 
ATOM   4492  C  CD  . ARG A 1 680  ? -55.216 6.622   29.279  1.00 63.64  ? 1276 ARG A CD  1 
ATOM   4493  N  NE  . ARG A 1 680  ? -55.832 6.220   30.540  1.00 105.11 ? 1276 ARG A NE  1 
ATOM   4494  C  CZ  . ARG A 1 680  ? -55.785 4.990   31.042  1.00 104.11 ? 1276 ARG A CZ  1 
ATOM   4495  N  NH1 . ARG A 1 680  ? -55.146 4.027   30.392  1.00 91.47  ? 1276 ARG A NH1 1 
ATOM   4496  N  NH2 . ARG A 1 680  ? -56.377 4.724   32.199  1.00 103.38 ? 1276 ARG A NH2 1 
ATOM   4497  N  N   . SER A 1 681  ? -57.376 5.223   23.881  1.00 62.98  ? 1277 SER A N   1 
ATOM   4498  C  CA  . SER A 1 681  ? -57.637 4.137   22.937  1.00 51.27  ? 1277 SER A CA  1 
ATOM   4499  C  C   . SER A 1 681  ? -59.049 3.561   23.030  1.00 53.60  ? 1277 SER A C   1 
ATOM   4500  O  O   . SER A 1 681  ? -59.312 2.475   22.518  1.00 44.95  ? 1277 SER A O   1 
ATOM   4501  C  CB  . SER A 1 681  ? -56.611 3.014   23.131  1.00 45.16  ? 1277 SER A CB  1 
ATOM   4502  O  OG  . SER A 1 681  ? -55.294 3.530   23.151  1.00 56.95  ? 1277 SER A OG  1 
ATOM   4503  N  N   . MET A 1 682  ? -59.959 4.290   23.665  1.00 53.00  ? 1278 MET A N   1 
ATOM   4504  C  CA  . MET A 1 682  ? -61.315 3.784   23.839  1.00 47.09  ? 1278 MET A CA  1 
ATOM   4505  C  C   . MET A 1 682  ? -62.169 3.939   22.585  1.00 49.22  ? 1278 MET A C   1 
ATOM   4506  O  O   . MET A 1 682  ? -63.065 3.134   22.338  1.00 46.34  ? 1278 MET A O   1 
ATOM   4507  C  CB  . MET A 1 682  ? -62.002 4.472   25.019  1.00 53.04  ? 1278 MET A CB  1 
ATOM   4508  C  CG  . MET A 1 682  ? -61.515 4.001   26.379  1.00 89.38  ? 1278 MET A CG  1 
ATOM   4509  S  SD  . MET A 1 682  ? -61.394 2.205   26.518  1.00 73.16  ? 1278 MET A SD  1 
ATOM   4510  C  CE  . MET A 1 682  ? -63.035 1.695   26.023  1.00 37.49  ? 1278 MET A CE  1 
ATOM   4511  N  N   . VAL A 1 683  ? -61.901 4.980   21.804  1.00 49.44  ? 1279 VAL A N   1 
ATOM   4512  C  CA  . VAL A 1 683  ? -62.582 5.159   20.528  1.00 42.17  ? 1279 VAL A CA  1 
ATOM   4513  C  C   . VAL A 1 683  ? -62.266 3.972   19.628  1.00 39.35  ? 1279 VAL A C   1 
ATOM   4514  O  O   . VAL A 1 683  ? -63.158 3.352   19.039  1.00 42.39  ? 1279 VAL A O   1 
ATOM   4515  C  CB  . VAL A 1 683  ? -62.160 6.466   19.830  1.00 50.43  ? 1279 VAL A CB  1 
ATOM   4516  C  CG1 . VAL A 1 683  ? -62.771 6.547   18.443  1.00 47.46  ? 1279 VAL A CG1 1 
ATOM   4517  C  CG2 . VAL A 1 683  ? -62.563 7.670   20.671  1.00 39.91  ? 1279 VAL A CG2 1 
ATOM   4518  N  N   . LEU A 1 684  ? -60.978 3.655   19.553  1.00 39.50  ? 1280 LEU A N   1 
ATOM   4519  C  CA  . LEU A 1 684  ? -60.486 2.531   18.771  1.00 45.99  ? 1280 LEU A CA  1 
ATOM   4520  C  C   . LEU A 1 684  ? -61.065 1.209   19.258  1.00 51.92  ? 1280 LEU A C   1 
ATOM   4521  O  O   . LEU A 1 684  ? -61.600 0.426   18.467  1.00 51.60  ? 1280 LEU A O   1 
ATOM   4522  C  CB  . LEU A 1 684  ? -58.960 2.484   18.829  1.00 44.16  ? 1280 LEU A CB  1 
ATOM   4523  C  CG  . LEU A 1 684  ? -58.271 1.281   18.189  1.00 36.76  ? 1280 LEU A CG  1 
ATOM   4524  C  CD1 . LEU A 1 684  ? -58.522 1.254   16.692  1.00 38.82  ? 1280 LEU A CD1 1 
ATOM   4525  C  CD2 . LEU A 1 684  ? -56.781 1.313   18.486  1.00 33.76  ? 1280 LEU A CD2 1 
ATOM   4526  N  N   . LYS A 1 685  ? -60.955 0.971   20.562  1.00 52.65  ? 1281 LYS A N   1 
ATOM   4527  C  CA  . LYS A 1 685  ? -61.430 -0.272  21.161  1.00 40.92  ? 1281 LYS A CA  1 
ATOM   4528  C  C   . LYS A 1 685  ? -62.925 -0.476  20.955  1.00 44.58  ? 1281 LYS A C   1 
ATOM   4529  O  O   . LYS A 1 685  ? -63.370 -1.585  20.668  1.00 53.24  ? 1281 LYS A O   1 
ATOM   4530  C  CB  . LYS A 1 685  ? -61.100 -0.304  22.655  1.00 43.18  ? 1281 LYS A CB  1 
ATOM   4531  C  CG  . LYS A 1 685  ? -59.658 -0.670  22.957  1.00 40.74  ? 1281 LYS A CG  1 
ATOM   4532  C  CD  . LYS A 1 685  ? -59.466 -0.991  24.429  1.00 47.36  ? 1281 LYS A CD  1 
ATOM   4533  C  CE  . LYS A 1 685  ? -58.884 0.184   25.189  1.00 60.24  ? 1281 LYS A CE  1 
ATOM   4534  N  NZ  . LYS A 1 685  ? -58.821 -0.095  26.652  1.00 55.92  ? 1281 LYS A NZ  1 
ATOM   4535  N  N   . LEU A 1 686  ? -63.698 0.594   21.097  1.00 37.44  ? 1282 LEU A N   1 
ATOM   4536  C  CA  . LEU A 1 686  ? -65.142 0.512   20.910  1.00 44.81  ? 1282 LEU A CA  1 
ATOM   4537  C  C   . LEU A 1 686  ? -65.504 0.314   19.442  1.00 49.79  ? 1282 LEU A C   1 
ATOM   4538  O  O   . LEU A 1 686  ? -66.445 -0.415  19.122  1.00 57.82  ? 1282 LEU A O   1 
ATOM   4539  C  CB  . LEU A 1 686  ? -65.827 1.763   21.461  1.00 41.20  ? 1282 LEU A CB  1 
ATOM   4540  C  CG  . LEU A 1 686  ? -66.074 1.747   22.970  1.00 46.49  ? 1282 LEU A CG  1 
ATOM   4541  C  CD1 . LEU A 1 686  ? -66.433 3.133   23.467  1.00 52.63  ? 1282 LEU A CD1 1 
ATOM   4542  C  CD2 . LEU A 1 686  ? -67.175 0.757   23.314  1.00 49.34  ? 1282 LEU A CD2 1 
ATOM   4543  N  N   . THR A 1 687  ? -64.757 0.964   18.553  1.00 42.85  ? 1283 THR A N   1 
ATOM   4544  C  CA  . THR A 1 687  ? -64.951 0.772   17.119  1.00 47.75  ? 1283 THR A CA  1 
ATOM   4545  C  C   . THR A 1 687  ? -64.749 -0.697  16.745  1.00 50.17  ? 1283 THR A C   1 
ATOM   4546  O  O   . THR A 1 687  ? -65.623 -1.333  16.131  1.00 49.68  ? 1283 THR A O   1 
ATOM   4547  C  CB  . THR A 1 687  ? -63.984 1.644   16.296  1.00 48.01  ? 1283 THR A CB  1 
ATOM   4548  O  OG1 . THR A 1 687  ? -64.142 3.019   16.669  1.00 50.39  ? 1283 THR A OG1 1 
ATOM   4549  C  CG2 . THR A 1 687  ? -64.261 1.489   14.810  1.00 46.15  ? 1283 THR A CG2 1 
ATOM   4550  N  N   . LEU A 1 688  ? -63.591 -1.225  17.132  1.00 49.32  ? 1284 LEU A N   1 
ATOM   4551  C  CA  . LEU A 1 688  ? -63.257 -2.624  16.889  1.00 54.12  ? 1284 LEU A CA  1 
ATOM   4552  C  C   . LEU A 1 688  ? -64.296 -3.561  17.493  1.00 56.24  ? 1284 LEU A C   1 
ATOM   4553  O  O   . LEU A 1 688  ? -64.726 -4.515  16.847  1.00 52.96  ? 1284 LEU A O   1 
ATOM   4554  C  CB  . LEU A 1 688  ? -61.872 -2.947  17.453  1.00 57.31  ? 1284 LEU A CB  1 
ATOM   4555  C  CG  . LEU A 1 688  ? -60.676 -2.375  16.693  1.00 53.04  ? 1284 LEU A CG  1 
ATOM   4556  C  CD1 . LEU A 1 688  ? -59.386 -2.622  17.457  1.00 43.89  ? 1284 LEU A CD1 1 
ATOM   4557  C  CD2 . LEU A 1 688  ? -60.598 -2.983  15.303  1.00 49.32  ? 1284 LEU A CD2 1 
ATOM   4558  N  N   . ARG A 1 689  ? -64.694 -3.282  18.731  1.00 42.78  ? 1285 ARG A N   1 
ATOM   4559  C  CA  . ARG A 1 689  ? -65.697 -4.089  19.420  1.00 54.34  ? 1285 ARG A CA  1 
ATOM   4560  C  C   . ARG A 1 689  ? -67.009 -4.128  18.648  1.00 53.48  ? 1285 ARG A C   1 
ATOM   4561  O  O   . ARG A 1 689  ? -67.630 -5.182  18.509  1.00 47.03  ? 1285 ARG A O   1 
ATOM   4562  C  CB  . ARG A 1 689  ? -65.941 -3.550  20.830  1.00 57.05  ? 1285 ARG A CB  1 
ATOM   4563  C  CG  . ARG A 1 689  ? -67.183 -4.112  21.504  1.00 53.71  ? 1285 ARG A CG  1 
ATOM   4564  C  CD  . ARG A 1 689  ? -67.031 -5.589  21.831  1.00 54.81  ? 1285 ARG A CD  1 
ATOM   4565  N  NE  . ARG A 1 689  ? -68.213 -6.112  22.513  1.00 64.54  ? 1285 ARG A NE  1 
ATOM   4566  C  CZ  . ARG A 1 689  ? -69.060 -6.988  21.983  1.00 60.37  ? 1285 ARG A CZ  1 
ATOM   4567  N  NH1 . ARG A 1 689  ? -68.854 -7.460  20.760  1.00 48.52  ? 1285 ARG A NH1 1 
ATOM   4568  N  NH2 . ARG A 1 689  ? -70.108 -7.402  22.681  1.00 80.34  ? 1285 ARG A NH2 1 
ATOM   4569  N  N   . CYS A 1 690  ? -67.423 -2.970  18.147  1.00 48.43  ? 1286 CYS A N   1 
ATOM   4570  C  CA  . CYS A 1 690  ? -68.658 -2.868  17.384  1.00 44.95  ? 1286 CYS A CA  1 
ATOM   4571  C  C   . CYS A 1 690  ? -68.561 -3.679  16.093  1.00 49.04  ? 1286 CYS A C   1 
ATOM   4572  O  O   . CYS A 1 690  ? -69.474 -4.448  15.750  1.00 53.33  ? 1286 CYS A O   1 
ATOM   4573  C  CB  . CYS A 1 690  ? -68.970 -1.403  17.078  1.00 39.12  ? 1286 CYS A CB  1 
ATOM   4574  S  SG  . CYS A 1 690  ? -70.674 -1.101  16.581  1.00 74.51  ? 1286 CYS A SG  1 
ATOM   4575  N  N   . LEU A 1 691  ? -67.444 -3.513  15.387  1.00 47.54  ? 1287 LEU A N   1 
ATOM   4576  C  CA  . LEU A 1 691  ? -67.205 -4.274  14.162  1.00 53.84  ? 1287 LEU A CA  1 
ATOM   4577  C  C   . LEU A 1 691  ? -67.261 -5.779  14.418  1.00 48.16  ? 1287 LEU A C   1 
ATOM   4578  O  O   . LEU A 1 691  ? -67.837 -6.529  13.629  1.00 32.43  ? 1287 LEU A O   1 
ATOM   4579  C  CB  . LEU A 1 691  ? -65.856 -3.896  13.550  1.00 47.09  ? 1287 LEU A CB  1 
ATOM   4580  C  CG  . LEU A 1 691  ? -65.817 -2.562  12.805  1.00 44.73  ? 1287 LEU A CG  1 
ATOM   4581  C  CD1 . LEU A 1 691  ? -64.392 -2.198  12.429  1.00 31.82  ? 1287 LEU A CD1 1 
ATOM   4582  C  CD2 . LEU A 1 691  ? -66.697 -2.625  11.567  1.00 46.26  ? 1287 LEU A CD2 1 
ATOM   4583  N  N   . VAL A 1 692  ? -66.667 -6.212  15.526  1.00 49.64  ? 1288 VAL A N   1 
ATOM   4584  C  CA  . VAL A 1 692  ? -66.687 -7.618  15.913  1.00 48.89  ? 1288 VAL A CA  1 
ATOM   4585  C  C   . VAL A 1 692  ? -68.113 -8.081  16.194  1.00 53.47  ? 1288 VAL A C   1 
ATOM   4586  O  O   . VAL A 1 692  ? -68.518 -9.168  15.775  1.00 51.89  ? 1288 VAL A O   1 
ATOM   4587  C  CB  . VAL A 1 692  ? -65.809 -7.874  17.155  1.00 48.71  ? 1288 VAL A CB  1 
ATOM   4588  C  CG1 . VAL A 1 692  ? -66.050 -9.270  17.708  1.00 48.17  ? 1288 VAL A CG1 1 
ATOM   4589  C  CG2 . VAL A 1 692  ? -64.342 -7.680  16.812  1.00 37.09  ? 1288 VAL A CG2 1 
ATOM   4590  N  N   . ARG A 1 693  ? -68.870 -7.245  16.899  1.00 38.39  ? 1289 ARG A N   1 
ATOM   4591  C  CA  . ARG A 1 693  ? -70.267 -7.535  17.201  1.00 35.85  ? 1289 ARG A CA  1 
ATOM   4592  C  C   . ARG A 1 693  ? -71.075 -7.723  15.922  1.00 48.61  ? 1289 ARG A C   1 
ATOM   4593  O  O   . ARG A 1 693  ? -71.968 -8.568  15.863  1.00 54.45  ? 1289 ARG A O   1 
ATOM   4594  C  CB  . ARG A 1 693  ? -70.876 -6.420  18.053  1.00 46.69  ? 1289 ARG A CB  1 
ATOM   4595  C  CG  . ARG A 1 693  ? -72.381 -6.527  18.250  1.00 49.21  ? 1289 ARG A CG  1 
ATOM   4596  C  CD  . ARG A 1 693  ? -72.777 -7.809  18.966  1.00 41.04  ? 1289 ARG A CD  1 
ATOM   4597  N  NE  . ARG A 1 693  ? -74.211 -7.849  19.245  1.00 55.08  ? 1289 ARG A NE  1 
ATOM   4598  C  CZ  . ARG A 1 693  ? -75.112 -8.429  18.458  1.00 54.45  ? 1289 ARG A CZ  1 
ATOM   4599  N  NH1 . ARG A 1 693  ? -74.732 -9.030  17.338  1.00 63.68  ? 1289 ARG A NH1 1 
ATOM   4600  N  NH2 . ARG A 1 693  ? -76.395 -8.414  18.793  1.00 60.13  ? 1289 ARG A NH2 1 
ATOM   4601  N  N   . MET A 1 694  ? -70.755 -6.944  14.892  1.00 50.90  ? 1290 MET A N   1 
ATOM   4602  C  CA  . MET A 1 694  ? -71.417 -7.124  13.601  1.00 49.24  ? 1290 MET A CA  1 
ATOM   4603  C  C   . MET A 1 694  ? -71.068 -8.470  12.968  1.00 47.94  ? 1290 MET A C   1 
ATOM   4604  O  O   . MET A 1 694  ? -71.784 -8.959  12.095  1.00 42.77  ? 1290 MET A O   1 
ATOM   4605  C  CB  . MET A 1 694  ? -71.046 -5.998  12.639  1.00 55.19  ? 1290 MET A CB  1 
ATOM   4606  C  CG  . MET A 1 694  ? -71.410 -4.620  13.133  1.00 53.93  ? 1290 MET A CG  1 
ATOM   4607  S  SD  . MET A 1 694  ? -70.908 -3.355  11.959  1.00 47.97  ? 1290 MET A SD  1 
ATOM   4608  C  CE  . MET A 1 694  ? -70.873 -1.924  13.029  1.00 57.27  ? 1290 MET A CE  1 
ATOM   4609  N  N   . GLY A 1 695  ? -69.963 -9.061  13.409  1.00 53.25  ? 1291 GLY A N   1 
ATOM   4610  C  CA  . GLY A 1 695  ? -69.511 -10.329 12.869  1.00 49.44  ? 1291 GLY A CA  1 
ATOM   4611  C  C   . GLY A 1 695  ? -68.426 -10.138 11.829  1.00 59.53  ? 1291 GLY A C   1 
ATOM   4612  O  O   . GLY A 1 695  ? -68.077 -11.067 11.099  1.00 54.03  ? 1291 GLY A O   1 
ATOM   4613  N  N   . TYR A 1 696  ? -67.893 -8.923  11.764  1.00 60.60  ? 1292 TYR A N   1 
ATOM   4614  C  CA  . TYR A 1 696  ? -66.851 -8.586  10.803  1.00 46.67  ? 1292 TYR A CA  1 
ATOM   4615  C  C   . TYR A 1 696  ? -65.484 -9.093  11.229  1.00 50.51  ? 1292 TYR A C   1 
ATOM   4616  O  O   . TYR A 1 696  ? -65.183 -9.168  12.420  1.00 46.82  ? 1292 TYR A O   1 
ATOM   4617  C  CB  . TYR A 1 696  ? -66.776 -7.071  10.602  1.00 48.33  ? 1292 TYR A CB  1 
ATOM   4618  C  CG  . TYR A 1 696  ? -67.694 -6.538  9.534   1.00 50.03  ? 1292 TYR A CG  1 
ATOM   4619  C  CD1 . TYR A 1 696  ? -67.394 -6.707  8.191   1.00 49.65  ? 1292 TYR A CD1 1 
ATOM   4620  C  CD2 . TYR A 1 696  ? -68.857 -5.859  9.866   1.00 52.11  ? 1292 TYR A CD2 1 
ATOM   4621  C  CE1 . TYR A 1 696  ? -68.225 -6.220  7.210   1.00 36.83  ? 1292 TYR A CE1 1 
ATOM   4622  C  CE2 . TYR A 1 696  ? -69.696 -5.366  8.892   1.00 44.52  ? 1292 TYR A CE2 1 
ATOM   4623  C  CZ  . TYR A 1 696  ? -69.374 -5.551  7.565   1.00 42.23  ? 1292 TYR A CZ  1 
ATOM   4624  O  OH  . TYR A 1 696  ? -70.202 -5.066  6.586   1.00 53.65  ? 1292 TYR A OH  1 
ATOM   4625  N  N   . GLN A 1 697  ? -64.658 -9.443  10.249  1.00 52.20  ? 1293 GLN A N   1 
ATOM   4626  C  CA  . GLN A 1 697  ? -63.237 -9.623  10.502  1.00 48.20  ? 1293 GLN A CA  1 
ATOM   4627  C  C   . GLN A 1 697  ? -62.635 -8.229  10.458  1.00 53.44  ? 1293 GLN A C   1 
ATOM   4628  O  O   . GLN A 1 697  ? -62.972 -7.457  9.573   1.00 59.13  ? 1293 GLN A O   1 
ATOM   4629  C  CB  . GLN A 1 697  ? -62.586 -10.532 9.460   1.00 41.52  ? 1293 GLN A CB  1 
ATOM   4630  C  CG  . GLN A 1 697  ? -63.528 -11.520 8.805   1.00 35.85  ? 1293 GLN A CG  1 
ATOM   4631  C  CD  . GLN A 1 697  ? -62.837 -12.354 7.748   1.00 49.67  ? 1293 GLN A CD  1 
ATOM   4632  O  OE1 . GLN A 1 697  ? -61.735 -12.860 7.963   1.00 56.32  ? 1293 GLN A OE1 1 
ATOM   4633  N  NE2 . GLN A 1 697  ? -63.478 -12.499 6.594   1.00 45.07  ? 1293 GLN A NE2 1 
ATOM   4634  N  N   . CYS A 1 698  ? -61.767 -7.878  11.399  1.00 40.79  ? 1294 CYS A N   1 
ATOM   4635  C  CA  . CYS A 1 698  ? -61.254 -6.510  11.405  1.00 38.70  ? 1294 CYS A CA  1 
ATOM   4636  C  C   . CYS A 1 698  ? -59.853 -6.359  11.981  1.00 44.39  ? 1294 CYS A C   1 
ATOM   4637  O  O   . CYS A 1 698  ? -59.355 -7.233  12.688  1.00 40.56  ? 1294 CYS A O   1 
ATOM   4638  C  CB  . CYS A 1 698  ? -62.215 -5.598  12.173  1.00 48.76  ? 1294 CYS A CB  1 
ATOM   4639  S  SG  . CYS A 1 698  ? -62.429 -6.031  13.911  1.00 53.58  ? 1294 CYS A SG  1 
ATOM   4640  N  N   . THR A 1 699  ? -59.230 -5.225  11.665  1.00 42.08  ? 1295 THR A N   1 
ATOM   4641  C  CA  . THR A 1 699  ? -57.904 -4.899  12.174  1.00 40.50  ? 1295 THR A CA  1 
ATOM   4642  C  C   . THR A 1 699  ? -57.646 -3.400  12.076  1.00 40.89  ? 1295 THR A C   1 
ATOM   4643  O  O   . THR A 1 699  ? -58.431 -2.663  11.474  1.00 49.15  ? 1295 THR A O   1 
ATOM   4644  C  CB  . THR A 1 699  ? -56.798 -5.646  11.407  1.00 42.40  ? 1295 THR A CB  1 
ATOM   4645  O  OG1 . THR A 1 699  ? -55.525 -5.369  12.006  1.00 41.99  ? 1295 THR A OG1 1 
ATOM   4646  C  CG2 . THR A 1 699  ? -56.773 -5.204  9.952   1.00 43.12  ? 1295 THR A CG2 1 
ATOM   4647  N  N   . PHE A 1 700  ? -56.543 -2.955  12.670  1.00 28.56  ? 1296 PHE A N   1 
ATOM   4648  C  CA  . PHE A 1 700  ? -56.134 -1.560  12.572  1.00 34.42  ? 1296 PHE A CA  1 
ATOM   4649  C  C   . PHE A 1 700  ? -54.631 -1.453  12.351  1.00 44.82  ? 1296 PHE A C   1 
ATOM   4650  O  O   . PHE A 1 700  ? -53.893 -2.418  12.553  1.00 52.37  ? 1296 PHE A O   1 
ATOM   4651  C  CB  . PHE A 1 700  ? -56.539 -0.782  13.827  1.00 44.16  ? 1296 PHE A CB  1 
ATOM   4652  C  CG  . PHE A 1 700  ? -55.710 -1.103  15.038  1.00 41.84  ? 1296 PHE A CG  1 
ATOM   4653  C  CD1 . PHE A 1 700  ? -55.990 -2.219  15.809  1.00 39.70  ? 1296 PHE A CD1 1 
ATOM   4654  C  CD2 . PHE A 1 700  ? -54.655 -0.286  15.410  1.00 36.77  ? 1296 PHE A CD2 1 
ATOM   4655  C  CE1 . PHE A 1 700  ? -55.232 -2.514  16.925  1.00 39.53  ? 1296 PHE A CE1 1 
ATOM   4656  C  CE2 . PHE A 1 700  ? -53.893 -0.578  16.525  1.00 50.00  ? 1296 PHE A CE2 1 
ATOM   4657  C  CZ  . PHE A 1 700  ? -54.182 -1.694  17.283  1.00 45.87  ? 1296 PHE A CZ  1 
ATOM   4658  N  N   . GLY A 1 701  ? -54.181 -0.274  11.935  1.00 46.53  ? 1297 GLY A N   1 
ATOM   4659  C  CA  . GLY A 1 701  ? -52.765 -0.042  11.716  1.00 46.27  ? 1297 GLY A CA  1 
ATOM   4660  C  C   . GLY A 1 701  ? -52.448 1.417   11.458  1.00 46.73  ? 1297 GLY A C   1 
ATOM   4661  O  O   . GLY A 1 701  ? -53.348 2.243   11.353  1.00 46.72  ? 1297 GLY A O   1 
ATOM   4662  N  N   . VAL A 1 702  ? -51.163 1.737   11.365  1.00 46.88  ? 1298 VAL A N   1 
ATOM   4663  C  CA  . VAL A 1 702  ? -50.737 3.097   11.057  1.00 38.25  ? 1298 VAL A CA  1 
ATOM   4664  C  C   . VAL A 1 702  ? -49.856 3.107   9.816   1.00 41.51  ? 1298 VAL A C   1 
ATOM   4665  O  O   . VAL A 1 702  ? -48.927 2.308   9.699   1.00 53.10  ? 1298 VAL A O   1 
ATOM   4666  C  CB  . VAL A 1 702  ? -49.972 3.735   12.230  1.00 41.28  ? 1298 VAL A CB  1 
ATOM   4667  C  CG1 . VAL A 1 702  ? -49.470 5.118   11.850  1.00 47.02  ? 1298 VAL A CG1 1 
ATOM   4668  C  CG2 . VAL A 1 702  ? -50.860 3.813   13.455  1.00 52.83  ? 1298 VAL A CG2 1 
ATOM   4669  N  N   . LEU A 1 703  ? -50.152 4.010   8.887   1.00 42.97  ? 1299 LEU A N   1 
ATOM   4670  C  CA  . LEU A 1 703  ? -49.377 4.100   7.655   1.00 42.28  ? 1299 LEU A CA  1 
ATOM   4671  C  C   . LEU A 1 703  ? -48.780 5.486   7.464   1.00 36.85  ? 1299 LEU A C   1 
ATOM   4672  O  O   . LEU A 1 703  ? -49.433 6.490   7.724   1.00 30.69  ? 1299 LEU A O   1 
ATOM   4673  C  CB  . LEU A 1 703  ? -50.246 3.750   6.447   1.00 26.75  ? 1299 LEU A CB  1 
ATOM   4674  C  CG  . LEU A 1 703  ? -50.879 2.361   6.407   1.00 29.90  ? 1299 LEU A CG  1 
ATOM   4675  C  CD1 . LEU A 1 703  ? -51.764 2.234   5.182   1.00 31.05  ? 1299 LEU A CD1 1 
ATOM   4676  C  CD2 . LEU A 1 703  ? -49.810 1.285   6.407   1.00 37.63  ? 1299 LEU A CD2 1 
ATOM   4677  N  N   . GLN A 1 704  ? -47.534 5.537   7.007   1.00 27.22  ? 1300 GLN A N   1 
ATOM   4678  C  CA  . GLN A 1 704  ? -46.931 6.802   6.611   1.00 24.64  ? 1300 GLN A CA  1 
ATOM   4679  C  C   . GLN A 1 704  ? -47.089 6.982   5.107   1.00 40.30  ? 1300 GLN A C   1 
ATOM   4680  O  O   . GLN A 1 704  ? -46.642 6.143   4.325   1.00 35.84  ? 1300 GLN A O   1 
ATOM   4681  C  CB  . GLN A 1 704  ? -45.456 6.860   7.011   1.00 27.34  ? 1300 GLN A CB  1 
ATOM   4682  C  CG  . GLN A 1 704  ? -44.684 8.007   6.372   1.00 32.50  ? 1300 GLN A CG  1 
ATOM   4683  C  CD  . GLN A 1 704  ? -45.242 9.369   6.738   1.00 42.46  ? 1300 GLN A CD  1 
ATOM   4684  O  OE1 . GLN A 1 704  ? -45.893 10.025  5.925   1.00 44.89  ? 1300 GLN A OE1 1 
ATOM   4685  N  NE2 . GLN A 1 704  ? -44.983 9.804   7.966   1.00 39.35  ? 1300 GLN A NE2 1 
ATOM   4686  N  N   . ALA A 1 705  ? -47.734 8.075   4.708   1.00 34.60  ? 1301 ALA A N   1 
ATOM   4687  C  CA  . ALA A 1 705  ? -48.011 8.339   3.300   1.00 30.34  ? 1301 ALA A CA  1 
ATOM   4688  C  C   . ALA A 1 705  ? -46.725 8.462   2.494   1.00 35.77  ? 1301 ALA A C   1 
ATOM   4689  O  O   . ALA A 1 705  ? -46.675 8.082   1.323   1.00 41.16  ? 1301 ALA A O   1 
ATOM   4690  C  CB  . ALA A 1 705  ? -48.848 9.599   3.154   1.00 30.01  ? 1301 ALA A CB  1 
ATOM   4691  N  N   . GLY A 1 706  ? -45.684 8.987   3.135   1.00 30.54  ? 1302 GLY A N   1 
ATOM   4692  C  CA  . GLY A 1 706  ? -44.400 9.186   2.488   1.00 40.25  ? 1302 GLY A CA  1 
ATOM   4693  C  C   . GLY A 1 706  ? -43.776 7.902   1.980   1.00 32.60  ? 1302 GLY A C   1 
ATOM   4694  O  O   . GLY A 1 706  ? -42.961 7.921   1.059   1.00 39.07  ? 1302 GLY A O   1 
ATOM   4695  N  N   . GLN A 1 707  ? -44.164 6.782   2.581   1.00 40.01  ? 1303 GLN A N   1 
ATOM   4696  C  CA  . GLN A 1 707  ? -43.638 5.483   2.185   1.00 33.95  ? 1303 GLN A CA  1 
ATOM   4697  C  C   . GLN A 1 707  ? -44.340 4.938   0.951   1.00 32.62  ? 1303 GLN A C   1 
ATOM   4698  O  O   . GLN A 1 707  ? -44.037 3.835   0.501   1.00 44.92  ? 1303 GLN A O   1 
ATOM   4699  C  CB  . GLN A 1 707  ? -43.768 4.478   3.332   1.00 31.67  ? 1303 GLN A CB  1 
ATOM   4700  C  CG  . GLN A 1 707  ? -42.920 4.799   4.545   1.00 38.00  ? 1303 GLN A CG  1 
ATOM   4701  C  CD  . GLN A 1 707  ? -42.923 3.678   5.563   1.00 43.08  ? 1303 GLN A CD  1 
ATOM   4702  O  OE1 . GLN A 1 707  ? -43.861 3.539   6.349   1.00 44.58  ? 1303 GLN A OE1 1 
ATOM   4703  N  NE2 . GLN A 1 707  ? -41.873 2.866   5.551   1.00 39.06  ? 1303 GLN A NE2 1 
ATOM   4704  N  N   . TYR A 1 708  ? -45.275 5.706   0.401   1.00 32.78  ? 1304 TYR A N   1 
ATOM   4705  C  CA  . TYR A 1 708  ? -46.073 5.208   -0.712  1.00 31.17  ? 1304 TYR A CA  1 
ATOM   4706  C  C   . TYR A 1 708  ? -46.117 6.149   -1.910  1.00 30.37  ? 1304 TYR A C   1 
ATOM   4707  O  O   . TYR A 1 708  ? -47.023 6.064   -2.737  1.00 45.06  ? 1304 TYR A O   1 
ATOM   4708  C  CB  . TYR A 1 708  ? -47.491 4.897   -0.229  1.00 25.33  ? 1304 TYR A CB  1 
ATOM   4709  C  CG  . TYR A 1 708  ? -47.511 3.829   0.833   1.00 34.37  ? 1304 TYR A CG  1 
ATOM   4710  C  CD1 . TYR A 1 708  ? -47.451 2.485   0.491   1.00 36.13  ? 1304 TYR A CD1 1 
ATOM   4711  C  CD2 . TYR A 1 708  ? -47.558 4.163   2.178   1.00 29.99  ? 1304 TYR A CD2 1 
ATOM   4712  C  CE1 . TYR A 1 708  ? -47.455 1.504   1.460   1.00 37.87  ? 1304 TYR A CE1 1 
ATOM   4713  C  CE2 . TYR A 1 708  ? -47.563 3.190   3.154   1.00 30.18  ? 1304 TYR A CE2 1 
ATOM   4714  C  CZ  . TYR A 1 708  ? -47.513 1.862   2.790   1.00 39.48  ? 1304 TYR A CZ  1 
ATOM   4715  O  OH  . TYR A 1 708  ? -47.518 0.890   3.762   1.00 45.62  ? 1304 TYR A OH  1 
ATOM   4716  N  N   . GLY A 1 709  ? -45.142 7.047   -2.003  1.00 21.55  ? 1305 GLY A N   1 
ATOM   4717  C  CA  . GLY A 1 709  ? -44.913 7.763   -3.245  1.00 44.84  ? 1305 GLY A CA  1 
ATOM   4718  C  C   . GLY A 1 709  ? -45.164 9.257   -3.285  1.00 42.33  ? 1305 GLY A C   1 
ATOM   4719  O  O   . GLY A 1 709  ? -45.342 9.817   -4.363  1.00 45.24  ? 1305 GLY A O   1 
ATOM   4720  N  N   . VAL A 1 710  ? -45.183 9.910   -2.130  1.00 35.26  ? 1306 VAL A N   1 
ATOM   4721  C  CA  . VAL A 1 710  ? -45.304 11.364  -2.086  1.00 32.06  ? 1306 VAL A CA  1 
ATOM   4722  C  C   . VAL A 1 710  ? -44.217 11.930  -1.190  1.00 45.39  ? 1306 VAL A C   1 
ATOM   4723  O  O   . VAL A 1 710  ? -43.670 11.205  -0.357  1.00 44.00  ? 1306 VAL A O   1 
ATOM   4724  C  CB  . VAL A 1 710  ? -46.683 11.813  -1.556  1.00 36.86  ? 1306 VAL A CB  1 
ATOM   4725  C  CG1 . VAL A 1 710  ? -47.793 11.345  -2.482  1.00 30.61  ? 1306 VAL A CG1 1 
ATOM   4726  C  CG2 . VAL A 1 710  ? -46.905 11.294  -0.145  1.00 29.84  ? 1306 VAL A CG2 1 
ATOM   4727  N  N   . ALA A 1 711  ? -43.891 13.212  -1.329  1.00 40.87  ? 1307 ALA A N   1 
ATOM   4728  C  CA  . ALA A 1 711  ? -43.060 13.784  -0.289  1.00 38.87  ? 1307 ALA A CA  1 
ATOM   4729  C  C   . ALA A 1 711  ? -43.960 14.590  0.613   1.00 36.34  ? 1307 ALA A C   1 
ATOM   4730  O  O   . ALA A 1 711  ? -44.338 15.721  0.312   1.00 43.73  ? 1307 ALA A O   1 
ATOM   4731  C  CB  . ALA A 1 711  ? -41.973 14.660  -0.881  1.00 28.97  ? 1307 ALA A CB  1 
ATOM   4732  N  N   . GLN A 1 712  ? -44.261 13.984  1.750   1.00 34.16  ? 1308 GLN A N   1 
ATOM   4733  C  CA  . GLN A 1 712  ? -45.035 14.590  2.809   1.00 32.31  ? 1308 GLN A CA  1 
ATOM   4734  C  C   . GLN A 1 712  ? -44.771 13.730  4.030   1.00 38.28  ? 1308 GLN A C   1 
ATOM   4735  O  O   . GLN A 1 712  ? -44.399 12.569  3.883   1.00 45.68  ? 1308 GLN A O   1 
ATOM   4736  C  CB  . GLN A 1 712  ? -46.519 14.631  2.449   1.00 24.60  ? 1308 GLN A CB  1 
ATOM   4737  C  CG  . GLN A 1 712  ? -47.383 15.472  3.366   1.00 43.88  ? 1308 GLN A CG  1 
ATOM   4738  C  CD  . GLN A 1 712  ? -48.850 15.380  3.005   1.00 39.20  ? 1308 GLN A CD  1 
ATOM   4739  O  OE1 . GLN A 1 712  ? -49.720 15.783  3.775   1.00 44.53  ? 1308 GLN A OE1 1 
ATOM   4740  N  NE2 . GLN A 1 712  ? -49.133 14.841  1.825   1.00 48.45  ? 1308 GLN A NE2 1 
ATOM   4741  N  N   . THR A 1 713  ? -45.004 14.249  5.226   1.00 40.65  ? 1309 THR A N   1 
ATOM   4742  C  CA  . THR A 1 713  ? -45.077 13.364  6.376   1.00 36.47  ? 1309 THR A CA  1 
ATOM   4743  C  C   . THR A 1 713  ? -46.519 13.384  6.856   1.00 41.46  ? 1309 THR A C   1 
ATOM   4744  O  O   . THR A 1 713  ? -47.041 14.422  7.254   1.00 49.29  ? 1309 THR A O   1 
ATOM   4745  C  CB  . THR A 1 713  ? -44.099 13.762  7.499   1.00 31.86  ? 1309 THR A CB  1 
ATOM   4746  O  OG1 . THR A 1 713  ? -44.454 13.078  8.707   1.00 49.92  ? 1309 THR A OG1 1 
ATOM   4747  C  CG2 . THR A 1 713  ? -44.116 15.263  7.737   1.00 33.57  ? 1309 THR A CG2 1 
ATOM   4748  N  N   . ARG A 1 714  ? -47.173 12.233  6.780   1.00 39.68  ? 1310 ARG A N   1 
ATOM   4749  C  CA  . ARG A 1 714  ? -48.607 12.175  7.010   1.00 31.29  ? 1310 ARG A CA  1 
ATOM   4750  C  C   . ARG A 1 714  ? -49.028 10.793  7.477   1.00 39.69  ? 1310 ARG A C   1 
ATOM   4751  O  O   . ARG A 1 714  ? -49.416 9.945   6.673   1.00 43.80  ? 1310 ARG A O   1 
ATOM   4752  C  CB  . ARG A 1 714  ? -49.357 12.557  5.734   1.00 37.05  ? 1310 ARG A CB  1 
ATOM   4753  C  CG  . ARG A 1 714  ? -50.842 12.792  5.909   1.00 37.65  ? 1310 ARG A CG  1 
ATOM   4754  C  CD  . ARG A 1 714  ? -51.476 13.133  4.573   1.00 31.32  ? 1310 ARG A CD  1 
ATOM   4755  N  NE  . ARG A 1 714  ? -52.854 13.590  4.709   1.00 48.19  ? 1310 ARG A NE  1 
ATOM   4756  C  CZ  . ARG A 1 714  ? -53.208 14.866  4.814   1.00 54.34  ? 1310 ARG A CZ  1 
ATOM   4757  N  NH1 . ARG A 1 714  ? -52.283 15.817  4.801   1.00 37.70  ? 1310 ARG A NH1 1 
ATOM   4758  N  NH2 . ARG A 1 714  ? -54.488 15.193  4.933   1.00 48.60  ? 1310 ARG A NH2 1 
ATOM   4759  N  N   . ARG A 1 715  ? -48.943 10.571  8.783   1.00 36.91  ? 1311 ARG A N   1 
ATOM   4760  C  CA  . ARG A 1 715  ? -49.321 9.292   9.363   1.00 35.25  ? 1311 ARG A CA  1 
ATOM   4761  C  C   . ARG A 1 715  ? -50.835 9.201   9.511   1.00 41.10  ? 1311 ARG A C   1 
ATOM   4762  O  O   . ARG A 1 715  ? -51.484 10.146  9.960   1.00 49.99  ? 1311 ARG A O   1 
ATOM   4763  C  CB  . ARG A 1 715  ? -48.630 9.097   10.713  1.00 40.28  ? 1311 ARG A CB  1 
ATOM   4764  C  CG  . ARG A 1 715  ? -47.118 9.224   10.631  1.00 45.97  ? 1311 ARG A CG  1 
ATOM   4765  C  CD  . ARG A 1 715  ? -46.509 9.599   11.969  1.00 43.01  ? 1311 ARG A CD  1 
ATOM   4766  N  NE  . ARG A 1 715  ? -46.487 8.476   12.900  1.00 55.20  ? 1311 ARG A NE  1 
ATOM   4767  C  CZ  . ARG A 1 715  ? -46.802 8.570   14.187  1.00 63.59  ? 1311 ARG A CZ  1 
ATOM   4768  N  NH1 . ARG A 1 715  ? -47.171 9.737   14.697  1.00 50.94  ? 1311 ARG A NH1 1 
ATOM   4769  N  NH2 . ARG A 1 715  ? -46.751 7.496   14.964  1.00 75.46  ? 1311 ARG A NH2 1 
ATOM   4770  N  N   . ARG A 1 716  ? -51.389 8.060   9.120   1.00 39.92  ? 1312 ARG A N   1 
ATOM   4771  C  CA  . ARG A 1 716  ? -52.826 7.839   9.160   1.00 34.28  ? 1312 ARG A CA  1 
ATOM   4772  C  C   . ARG A 1 716  ? -53.170 6.563   9.912   1.00 37.91  ? 1312 ARG A C   1 
ATOM   4773  O  O   . ARG A 1 716  ? -52.495 5.539   9.765   1.00 55.08  ? 1312 ARG A O   1 
ATOM   4774  C  CB  . ARG A 1 716  ? -53.398 7.763   7.743   1.00 41.38  ? 1312 ARG A CB  1 
ATOM   4775  C  CG  . ARG A 1 716  ? -53.331 9.061   6.967   1.00 44.96  ? 1312 ARG A CG  1 
ATOM   4776  C  CD  . ARG A 1 716  ? -54.480 9.978   7.335   1.00 43.73  ? 1312 ARG A CD  1 
ATOM   4777  N  NE  . ARG A 1 716  ? -54.012 11.255  7.861   1.00 57.87  ? 1312 ARG A NE  1 
ATOM   4778  C  CZ  . ARG A 1 716  ? -54.806 12.283  8.138   1.00 62.34  ? 1312 ARG A CZ  1 
ATOM   4779  N  NH1 . ARG A 1 716  ? -56.114 12.186  7.935   1.00 54.78  ? 1312 ARG A NH1 1 
ATOM   4780  N  NH2 . ARG A 1 716  ? -54.293 13.409  8.616   1.00 52.33  ? 1312 ARG A NH2 1 
ATOM   4781  N  N   . ALA A 1 717  ? -54.220 6.637   10.722  1.00 40.50  ? 1313 ALA A N   1 
ATOM   4782  C  CA  . ALA A 1 717  ? -54.789 5.456   11.350  1.00 38.16  ? 1313 ALA A CA  1 
ATOM   4783  C  C   . ALA A 1 717  ? -55.794 4.824   10.398  1.00 40.12  ? 1313 ALA A C   1 
ATOM   4784  O  O   . ALA A 1 717  ? -56.740 5.477   9.944   1.00 46.55  ? 1313 ALA A O   1 
ATOM   4785  C  CB  . ALA A 1 717  ? -55.447 5.807   12.671  1.00 34.84  ? 1313 ALA A CB  1 
ATOM   4786  N  N   . ILE A 1 718  ? -55.569 3.553   10.093  1.00 34.96  ? 1314 ILE A N   1 
ATOM   4787  C  CA  . ILE A 1 718  ? -56.393 2.817   9.151   1.00 31.88  ? 1314 ILE A CA  1 
ATOM   4788  C  C   . ILE A 1 718  ? -57.104 1.666   9.843   1.00 41.84  ? 1314 ILE A C   1 
ATOM   4789  O  O   . ILE A 1 718  ? -56.466 0.816   10.468  1.00 41.35  ? 1314 ILE A O   1 
ATOM   4790  C  CB  . ILE A 1 718  ? -55.554 2.261   7.986   1.00 34.03  ? 1314 ILE A CB  1 
ATOM   4791  C  CG1 . ILE A 1 718  ? -54.884 3.402   7.222   1.00 32.83  ? 1314 ILE A CG1 1 
ATOM   4792  C  CG2 . ILE A 1 718  ? -56.420 1.429   7.052   1.00 39.46  ? 1314 ILE A CG2 1 
ATOM   4793  C  CD1 . ILE A 1 718  ? -55.862 4.332   6.548   1.00 39.86  ? 1314 ILE A CD1 1 
ATOM   4794  N  N   . ILE A 1 719  ? -58.428 1.649   9.735   1.00 32.15  ? 1315 ILE A N   1 
ATOM   4795  C  CA  . ILE A 1 719  ? -59.223 0.550   10.261  1.00 37.44  ? 1315 ILE A CA  1 
ATOM   4796  C  C   . ILE A 1 719  ? -59.879 -0.225  9.127   1.00 41.23  ? 1315 ILE A C   1 
ATOM   4797  O  O   . ILE A 1 719  ? -60.682 0.322   8.364   1.00 41.21  ? 1315 ILE A O   1 
ATOM   4798  C  CB  . ILE A 1 719  ? -60.302 1.039   11.234  1.00 38.34  ? 1315 ILE A CB  1 
ATOM   4799  C  CG1 . ILE A 1 719  ? -59.652 1.666   12.467  1.00 29.77  ? 1315 ILE A CG1 1 
ATOM   4800  C  CG2 . ILE A 1 719  ? -61.206 -0.114  11.641  1.00 26.44  ? 1315 ILE A CG2 1 
ATOM   4801  C  CD1 . ILE A 1 719  ? -60.622 1.948   13.583  1.00 57.24  ? 1315 ILE A CD1 1 
ATOM   4802  N  N   . LEU A 1 720  ? -59.529 -1.504  9.032   1.00 35.13  ? 1316 LEU A N   1 
ATOM   4803  C  CA  . LEU A 1 720  ? -60.008 -2.366  7.960   1.00 31.28  ? 1316 LEU A CA  1 
ATOM   4804  C  C   . LEU A 1 720  ? -60.988 -3.411  8.469   1.00 44.63  ? 1316 LEU A C   1 
ATOM   4805  O  O   . LEU A 1 720  ? -60.833 -3.934  9.576   1.00 52.71  ? 1316 LEU A O   1 
ATOM   4806  C  CB  . LEU A 1 720  ? -58.833 -3.062  7.273   1.00 36.86  ? 1316 LEU A CB  1 
ATOM   4807  C  CG  . LEU A 1 720  ? -57.848 -2.180  6.510   1.00 41.07  ? 1316 LEU A CG  1 
ATOM   4808  C  CD1 . LEU A 1 720  ? -56.595 -2.966  6.172   1.00 46.32  ? 1316 LEU A CD1 1 
ATOM   4809  C  CD2 . LEU A 1 720  ? -58.496 -1.639  5.249   1.00 40.44  ? 1316 LEU A CD2 1 
ATOM   4810  N  N   . ALA A 1 721  ? -61.988 -3.722  7.649   1.00 43.80  ? 1317 ALA A N   1 
ATOM   4811  C  CA  . ALA A 1 721  ? -62.950 -4.761  7.995   1.00 44.39  ? 1317 ALA A CA  1 
ATOM   4812  C  C   . ALA A 1 721  ? -63.473 -5.485  6.759   1.00 40.70  ? 1317 ALA A C   1 
ATOM   4813  O  O   . ALA A 1 721  ? -63.733 -4.867  5.730   1.00 40.88  ? 1317 ALA A O   1 
ATOM   4814  C  CB  . ALA A 1 721  ? -64.102 -4.167  8.786   1.00 45.67  ? 1317 ALA A CB  1 
ATOM   4815  N  N   . ALA A 1 722  ? -63.625 -6.801  6.867   1.00 46.50  ? 1318 ALA A N   1 
ATOM   4816  C  CA  . ALA A 1 722  ? -64.146 -7.613  5.777   1.00 40.73  ? 1318 ALA A CA  1 
ATOM   4817  C  C   . ALA A 1 722  ? -65.251 -8.544  6.264   1.00 42.37  ? 1318 ALA A C   1 
ATOM   4818  O  O   . ALA A 1 722  ? -65.241 -8.997  7.414   1.00 43.48  ? 1318 ALA A O   1 
ATOM   4819  C  CB  . ALA A 1 722  ? -63.028 -8.414  5.129   1.00 44.33  ? 1318 ALA A CB  1 
ATOM   4820  N  N   . ALA A 1 723  ? -66.198 -8.820  5.372   1.00 35.08  ? 1319 ALA A N   1 
ATOM   4821  C  CA  . ALA A 1 723  ? -67.323 -9.703  5.655   1.00 40.27  ? 1319 ALA A CA  1 
ATOM   4822  C  C   . ALA A 1 723  ? -66.841 -11.134 5.898   1.00 50.53  ? 1319 ALA A C   1 
ATOM   4823  O  O   . ALA A 1 723  ? -65.751 -11.499 5.457   1.00 54.89  ? 1319 ALA A O   1 
ATOM   4824  C  CB  . ALA A 1 723  ? -68.325 -9.656  4.502   1.00 32.78  ? 1319 ALA A CB  1 
ATOM   4825  N  N   . PRO A 1 724  ? -67.647 -11.945 6.611   1.00 60.35  ? 1320 PRO A N   1 
ATOM   4826  C  CA  . PRO A 1 724  ? -67.297 -13.335 6.935   1.00 53.59  ? 1320 PRO A CA  1 
ATOM   4827  C  C   . PRO A 1 724  ? -66.834 -14.177 5.745   1.00 61.90  ? 1320 PRO A C   1 
ATOM   4828  O  O   . PRO A 1 724  ? -65.879 -14.941 5.880   1.00 67.03  ? 1320 PRO A O   1 
ATOM   4829  C  CB  . PRO A 1 724  ? -68.606 -13.888 7.499   1.00 65.83  ? 1320 PRO A CB  1 
ATOM   4830  C  CG  . PRO A 1 724  ? -69.235 -12.717 8.150   1.00 50.28  ? 1320 PRO A CG  1 
ATOM   4831  C  CD  . PRO A 1 724  ? -68.892 -11.532 7.286   1.00 61.19  ? 1320 PRO A CD  1 
ATOM   4832  N  N   . GLY A 1 725  ? -67.494 -14.036 4.600   1.00 52.70  ? 1321 GLY A N   1 
ATOM   4833  C  CA  . GLY A 1 725  ? -67.149 -14.826 3.432   1.00 51.94  ? 1321 GLY A CA  1 
ATOM   4834  C  C   . GLY A 1 725  ? -65.905 -14.338 2.714   1.00 54.14  ? 1321 GLY A C   1 
ATOM   4835  O  O   . GLY A 1 725  ? -65.485 -14.922 1.714   1.00 53.48  ? 1321 GLY A O   1 
ATOM   4836  N  N   . GLU A 1 726  ? -65.307 -13.270 3.230   1.00 52.16  ? 1322 GLU A N   1 
ATOM   4837  C  CA  . GLU A 1 726  ? -64.176 -12.633 2.569   1.00 46.83  ? 1322 GLU A CA  1 
ATOM   4838  C  C   . GLU A 1 726  ? -62.836 -12.985 3.202   1.00 47.93  ? 1322 GLU A C   1 
ATOM   4839  O  O   . GLU A 1 726  ? -62.763 -13.743 4.170   1.00 62.57  ? 1322 GLU A O   1 
ATOM   4840  C  CB  . GLU A 1 726  ? -64.350 -11.112 2.577   1.00 45.79  ? 1322 GLU A CB  1 
ATOM   4841  C  CG  . GLU A 1 726  ? -65.634 -10.630 1.933   1.00 40.07  ? 1322 GLU A CG  1 
ATOM   4842  C  CD  . GLU A 1 726  ? -65.656 -10.865 0.438   1.00 55.51  ? 1322 GLU A CD  1 
ATOM   4843  O  OE1 . GLU A 1 726  ? -66.762 -10.897 -0.141  1.00 53.10  ? 1322 GLU A OE1 1 
ATOM   4844  O  OE2 . GLU A 1 726  ? -64.569 -11.014 -0.161  1.00 54.98  ? 1322 GLU A OE2 1 
ATOM   4845  N  N   . LYS A 1 727  ? -61.780 -12.417 2.631   1.00 47.22  ? 1323 LYS A N   1 
ATOM   4846  C  CA  . LYS A 1 727  ? -60.431 -12.534 3.163   1.00 44.69  ? 1323 LYS A CA  1 
ATOM   4847  C  C   . LYS A 1 727  ? -59.990 -11.157 3.647   1.00 43.96  ? 1323 LYS A C   1 
ATOM   4848  O  O   . LYS A 1 727  ? -60.124 -10.172 2.924   1.00 52.70  ? 1323 LYS A O   1 
ATOM   4849  C  CB  . LYS A 1 727  ? -59.478 -13.078 2.099   1.00 43.24  ? 1323 LYS A CB  1 
ATOM   4850  C  CG  . LYS A 1 727  ? -58.001 -12.987 2.445   1.00 60.40  ? 1323 LYS A CG  1 
ATOM   4851  C  CD  . LYS A 1 727  ? -57.156 -13.307 1.220   1.00 77.39  ? 1323 LYS A CD  1 
ATOM   4852  C  CE  . LYS A 1 727  ? -55.704 -12.903 1.410   1.00 88.22  ? 1323 LYS A CE  1 
ATOM   4853  N  NZ  . LYS A 1 727  ? -54.958 -12.900 0.119   1.00 51.22  ? 1323 LYS A NZ  1 
ATOM   4854  N  N   . LEU A 1 728  ? -59.480 -11.085 4.872   1.00 44.86  ? 1324 LEU A N   1 
ATOM   4855  C  CA  . LEU A 1 728  ? -59.112 -9.801  5.461   1.00 45.34  ? 1324 LEU A CA  1 
ATOM   4856  C  C   . LEU A 1 728  ? -57.833 -9.246  4.843   1.00 46.64  ? 1324 LEU A C   1 
ATOM   4857  O  O   . LEU A 1 728  ? -56.791 -9.902  4.866   1.00 55.65  ? 1324 LEU A O   1 
ATOM   4858  C  CB  . LEU A 1 728  ? -58.948 -9.930  6.975   1.00 48.44  ? 1324 LEU A CB  1 
ATOM   4859  C  CG  . LEU A 1 728  ? -58.704 -8.619  7.727   1.00 46.84  ? 1324 LEU A CG  1 
ATOM   4860  C  CD1 . LEU A 1 728  ? -59.920 -7.709  7.636   1.00 41.53  ? 1324 LEU A CD1 1 
ATOM   4861  C  CD2 . LEU A 1 728  ? -58.341 -8.887  9.178   1.00 45.14  ? 1324 LEU A CD2 1 
ATOM   4862  N  N   . PRO A 1 729  ? -57.913 -8.029  4.282   1.00 43.43  ? 1325 PRO A N   1 
ATOM   4863  C  CA  . PRO A 1 729  ? -56.784 -7.351  3.636   1.00 36.30  ? 1325 PRO A CA  1 
ATOM   4864  C  C   . PRO A 1 729  ? -55.595 -7.131  4.558   1.00 35.91  ? 1325 PRO A C   1 
ATOM   4865  O  O   . PRO A 1 729  ? -55.772 -6.892  5.752   1.00 43.59  ? 1325 PRO A O   1 
ATOM   4866  C  CB  . PRO A 1 729  ? -57.383 -6.006  3.209   1.00 40.00  ? 1325 PRO A CB  1 
ATOM   4867  C  CG  . PRO A 1 729  ? -58.831 -6.278  3.055   1.00 41.30  ? 1325 PRO A CG  1 
ATOM   4868  C  CD  . PRO A 1 729  ? -59.164 -7.267  4.130   1.00 44.85  ? 1325 PRO A CD  1 
ATOM   4869  N  N   . LEU A 1 730  ? -54.391 -7.216  4.003   1.00 44.96  ? 1326 LEU A N   1 
ATOM   4870  C  CA  . LEU A 1 730  ? -53.201 -6.852  4.752   1.00 43.06  ? 1326 LEU A CA  1 
ATOM   4871  C  C   . LEU A 1 730  ? -52.981 -5.357  4.601   1.00 40.56  ? 1326 LEU A C   1 
ATOM   4872  O  O   . LEU A 1 730  ? -53.713 -4.686  3.874   1.00 52.67  ? 1326 LEU A O   1 
ATOM   4873  C  CB  . LEU A 1 730  ? -51.978 -7.624  4.254   1.00 40.85  ? 1326 LEU A CB  1 
ATOM   4874  C  CG  . LEU A 1 730  ? -52.036 -9.150  4.320   1.00 41.68  ? 1326 LEU A CG  1 
ATOM   4875  C  CD1 . LEU A 1 730  ? -50.831 -9.756  3.623   1.00 23.25  ? 1326 LEU A CD1 1 
ATOM   4876  C  CD2 . LEU A 1 730  ? -52.110 -9.614  5.764   1.00 47.01  ? 1326 LEU A CD2 1 
ATOM   4877  N  N   . PHE A 1 731  ? -51.973 -4.835  5.286   1.00 44.85  ? 1327 PHE A N   1 
ATOM   4878  C  CA  . PHE A 1 731  ? -51.568 -3.454  5.084   1.00 44.50  ? 1327 PHE A CA  1 
ATOM   4879  C  C   . PHE A 1 731  ? -50.491 -3.390  4.012   1.00 47.24  ? 1327 PHE A C   1 
ATOM   4880  O  O   . PHE A 1 731  ? -49.662 -4.295  3.908   1.00 46.65  ? 1327 PHE A O   1 
ATOM   4881  C  CB  . PHE A 1 731  ? -51.094 -2.834  6.396   1.00 38.00  ? 1327 PHE A CB  1 
ATOM   4882  C  CG  . PHE A 1 731  ? -52.218 -2.489  7.325   1.00 47.04  ? 1327 PHE A CG  1 
ATOM   4883  C  CD1 . PHE A 1 731  ? -52.761 -3.448  8.161   1.00 55.42  ? 1327 PHE A CD1 1 
ATOM   4884  C  CD2 . PHE A 1 731  ? -52.750 -1.211  7.344   1.00 56.06  ? 1327 PHE A CD2 1 
ATOM   4885  C  CE1 . PHE A 1 731  ? -53.804 -3.136  9.011   1.00 59.21  ? 1327 PHE A CE1 1 
ATOM   4886  C  CE2 . PHE A 1 731  ? -53.793 -0.893  8.193   1.00 47.69  ? 1327 PHE A CE2 1 
ATOM   4887  C  CZ  . PHE A 1 731  ? -54.320 -1.857  9.026   1.00 65.52  ? 1327 PHE A CZ  1 
ATOM   4888  N  N   . PRO A 1 732  ? -50.507 -2.323  3.200   1.00 34.97  ? 1328 PRO A N   1 
ATOM   4889  C  CA  . PRO A 1 732  ? -49.560 -2.219  2.086   1.00 31.24  ? 1328 PRO A CA  1 
ATOM   4890  C  C   . PRO A 1 732  ? -48.107 -2.182  2.539   1.00 36.90  ? 1328 PRO A C   1 
ATOM   4891  O  O   . PRO A 1 732  ? -47.746 -1.412  3.427   1.00 42.75  ? 1328 PRO A O   1 
ATOM   4892  C  CB  . PRO A 1 732  ? -49.954 -0.902  1.414   1.00 31.06  ? 1328 PRO A CB  1 
ATOM   4893  C  CG  . PRO A 1 732  ? -50.671 -0.131  2.465   1.00 35.29  ? 1328 PRO A CG  1 
ATOM   4894  C  CD  . PRO A 1 732  ? -51.398 -1.155  3.276   1.00 43.09  ? 1328 PRO A CD  1 
ATOM   4895  N  N   . GLU A 1 733  ? -47.288 -3.023  1.919   1.00 41.76  ? 1329 GLU A N   1 
ATOM   4896  C  CA  . GLU A 1 733  ? -45.858 -3.032  2.175   1.00 37.01  ? 1329 GLU A CA  1 
ATOM   4897  C  C   . GLU A 1 733  ? -45.257 -1.774  1.555   1.00 41.46  ? 1329 GLU A C   1 
ATOM   4898  O  O   . GLU A 1 733  ? -45.526 -1.473  0.391   1.00 43.41  ? 1329 GLU A O   1 
ATOM   4899  C  CB  . GLU A 1 733  ? -45.220 -4.299  1.600   1.00 23.79  ? 1329 GLU A CB  1 
ATOM   4900  C  CG  . GLU A 1 733  ? -43.983 -4.775  2.333   1.00 44.08  ? 1329 GLU A CG  1 
ATOM   4901  C  CD  . GLU A 1 733  ? -44.286 -5.333  3.709   1.00 47.17  ? 1329 GLU A CD  1 
ATOM   4902  O  OE1 . GLU A 1 733  ? -45.131 -6.249  3.815   1.00 46.70  ? 1329 GLU A OE1 1 
ATOM   4903  O  OE2 . GLU A 1 733  ? -43.674 -4.854  4.685   1.00 41.96  ? 1329 GLU A OE2 1 
ATOM   4904  N  N   . PRO A 1 734  ? -44.457 -1.026  2.333   1.00 38.17  ? 1330 PRO A N   1 
ATOM   4905  C  CA  . PRO A 1 734  ? -43.943 0.283   1.908   1.00 33.12  ? 1330 PRO A CA  1 
ATOM   4906  C  C   . PRO A 1 734  ? -43.151 0.240   0.603   1.00 40.10  ? 1330 PRO A C   1 
ATOM   4907  O  O   . PRO A 1 734  ? -42.231 -0.565  0.452   1.00 45.84  ? 1330 PRO A O   1 
ATOM   4908  C  CB  . PRO A 1 734  ? -43.035 0.694   3.072   1.00 33.27  ? 1330 PRO A CB  1 
ATOM   4909  C  CG  . PRO A 1 734  ? -43.575 -0.041  4.247   1.00 24.40  ? 1330 PRO A CG  1 
ATOM   4910  C  CD  . PRO A 1 734  ? -44.050 -1.357  3.710   1.00 37.27  ? 1330 PRO A CD  1 
ATOM   4911  N  N   . LEU A 1 735  ? -43.526 1.109   -0.331  1.00 32.77  ? 1331 LEU A N   1 
ATOM   4912  C  CA  . LEU A 1 735  ? -42.856 1.216   -1.622  1.00 27.58  ? 1331 LEU A CA  1 
ATOM   4913  C  C   . LEU A 1 735  ? -41.587 2.066   -1.575  1.00 30.49  ? 1331 LEU A C   1 
ATOM   4914  O  O   . LEU A 1 735  ? -40.579 1.727   -2.194  1.00 34.00  ? 1331 LEU A O   1 
ATOM   4915  C  CB  . LEU A 1 735  ? -43.821 1.785   -2.662  1.00 31.59  ? 1331 LEU A CB  1 
ATOM   4916  C  CG  . LEU A 1 735  ? -45.082 0.954   -2.905  1.00 28.44  ? 1331 LEU A CG  1 
ATOM   4917  C  CD1 . LEU A 1 735  ? -46.008 1.663   -3.877  1.00 19.43  ? 1331 LEU A CD1 1 
ATOM   4918  C  CD2 . LEU A 1 735  ? -44.719 -0.426  -3.423  1.00 27.49  ? 1331 LEU A CD2 1 
ATOM   4919  N  N   . HIS A 1 736  ? -41.649 3.180   -0.853  1.00 26.74  ? 1332 HIS A N   1 
ATOM   4920  C  CA  . HIS A 1 736  ? -40.547 4.137   -0.832  1.00 34.61  ? 1332 HIS A CA  1 
ATOM   4921  C  C   . HIS A 1 736  ? -39.876 4.223   0.531   1.00 34.76  ? 1332 HIS A C   1 
ATOM   4922  O  O   . HIS A 1 736  ? -40.545 4.188   1.563   1.00 45.29  ? 1332 HIS A O   1 
ATOM   4923  C  CB  . HIS A 1 736  ? -41.038 5.529   -1.234  1.00 32.21  ? 1332 HIS A CB  1 
ATOM   4924  C  CG  . HIS A 1 736  ? -41.569 5.609   -2.631  1.00 31.26  ? 1332 HIS A CG  1 
ATOM   4925  N  ND1 . HIS A 1 736  ? -40.900 6.260   -3.644  1.00 32.75  ? 1332 HIS A ND1 1 
ATOM   4926  C  CD2 . HIS A 1 736  ? -42.707 5.124   -3.180  1.00 37.74  ? 1332 HIS A CD2 1 
ATOM   4927  C  CE1 . HIS A 1 736  ? -41.603 6.172   -4.759  1.00 41.67  ? 1332 HIS A CE1 1 
ATOM   4928  N  NE2 . HIS A 1 736  ? -42.704 5.488   -4.505  1.00 34.50  ? 1332 HIS A NE2 1 
ATOM   4929  N  N   . VAL A 1 737  ? -38.553 4.348   0.529   1.00 33.29  ? 1333 VAL A N   1 
ATOM   4930  C  CA  . VAL A 1 737  ? -37.824 4.618   1.760   1.00 35.92  ? 1333 VAL A CA  1 
ATOM   4931  C  C   . VAL A 1 737  ? -38.195 6.011   2.244   1.00 36.24  ? 1333 VAL A C   1 
ATOM   4932  O  O   . VAL A 1 737  ? -38.544 6.877   1.444   1.00 40.31  ? 1333 VAL A O   1 
ATOM   4933  C  CB  . VAL A 1 737  ? -36.300 4.515   1.568   1.00 34.17  ? 1333 VAL A CB  1 
ATOM   4934  C  CG1 . VAL A 1 737  ? -35.883 3.061   1.433   1.00 34.82  ? 1333 VAL A CG1 1 
ATOM   4935  C  CG2 . VAL A 1 737  ? -35.859 5.319   0.356   1.00 35.75  ? 1333 VAL A CG2 1 
ATOM   4936  N  N   . PHE A 1 738  ? -38.136 6.221   3.552   1.00 43.65  ? 1334 PHE A N   1 
ATOM   4937  C  CA  . PHE A 1 738  ? -38.549 7.494   4.124   1.00 37.36  ? 1334 PHE A CA  1 
ATOM   4938  C  C   . PHE A 1 738  ? -37.874 7.727   5.469   1.00 38.21  ? 1334 PHE A C   1 
ATOM   4939  O  O   . PHE A 1 738  ? -37.374 6.787   6.086   1.00 54.71  ? 1334 PHE A O   1 
ATOM   4940  C  CB  . PHE A 1 738  ? -40.070 7.536   4.273   1.00 42.79  ? 1334 PHE A CB  1 
ATOM   4941  C  CG  . PHE A 1 738  ? -40.634 8.923   4.328   1.00 52.27  ? 1334 PHE A CG  1 
ATOM   4942  C  CD1 . PHE A 1 738  ? -40.795 9.665   3.171   1.00 35.16  ? 1334 PHE A CD1 1 
ATOM   4943  C  CD2 . PHE A 1 738  ? -40.998 9.488   5.538   1.00 49.70  ? 1334 PHE A CD2 1 
ATOM   4944  C  CE1 . PHE A 1 738  ? -41.311 10.941  3.219   1.00 39.39  ? 1334 PHE A CE1 1 
ATOM   4945  C  CE2 . PHE A 1 738  ? -41.514 10.765  5.592   1.00 49.26  ? 1334 PHE A CE2 1 
ATOM   4946  C  CZ  . PHE A 1 738  ? -41.668 11.492  4.432   1.00 41.09  ? 1334 PHE A CZ  1 
ATOM   4947  N  N   . ALA A 1 739  ? -37.856 8.982   5.912   1.00 49.80  ? 1335 ALA A N   1 
ATOM   4948  C  CA  . ALA A 1 739  ? -37.241 9.346   7.186   1.00 46.24  ? 1335 ALA A CA  1 
ATOM   4949  C  C   . ALA A 1 739  ? -37.837 8.542   8.336   1.00 40.35  ? 1335 ALA A C   1 
ATOM   4950  O  O   . ALA A 1 739  ? -39.045 8.584   8.566   1.00 49.81  ? 1335 ALA A O   1 
ATOM   4951  C  CB  . ALA A 1 739  ? -37.399 10.835  7.445   1.00 38.24  ? 1335 ALA A CB  1 
ATOM   4952  N  N   . PRO A 1 740  ? -36.980 7.803   9.060   1.00 50.12  ? 1336 PRO A N   1 
ATOM   4953  C  CA  . PRO A 1 740  ? -37.373 6.868   10.123  1.00 55.05  ? 1336 PRO A CA  1 
ATOM   4954  C  C   . PRO A 1 740  ? -38.230 7.511   11.209  1.00 46.28  ? 1336 PRO A C   1 
ATOM   4955  O  O   . PRO A 1 740  ? -39.150 6.873   11.723  1.00 46.58  ? 1336 PRO A O   1 
ATOM   4956  C  CB  . PRO A 1 740  ? -36.030 6.412   10.701  1.00 39.78  ? 1336 PRO A CB  1 
ATOM   4957  C  CG  . PRO A 1 740  ? -35.058 6.612   9.596   1.00 43.14  ? 1336 PRO A CG  1 
ATOM   4958  C  CD  . PRO A 1 740  ? -35.519 7.844   8.882   1.00 49.24  ? 1336 PRO A CD  1 
ATOM   4959  N  N   . ARG A 1 741  ? -37.926 8.759   11.546  1.00 39.50  ? 1337 ARG A N   1 
ATOM   4960  C  CA  . ARG A 1 741  ? -38.663 9.490   12.572  1.00 41.39  ? 1337 ARG A CA  1 
ATOM   4961  C  C   . ARG A 1 741  ? -40.141 9.637   12.225  1.00 54.84  ? 1337 ARG A C   1 
ATOM   4962  O  O   . ARG A 1 741  ? -40.990 9.722   13.113  1.00 52.49  ? 1337 ARG A O   1 
ATOM   4963  C  CB  . ARG A 1 741  ? -38.039 10.871  12.786  1.00 63.18  ? 1337 ARG A CB  1 
ATOM   4964  C  CG  . ARG A 1 741  ? -37.470 11.495  11.521  1.00 83.09  ? 1337 ARG A CG  1 
ATOM   4965  C  CD  . ARG A 1 741  ? -35.958 11.321  11.450  1.00 96.01  ? 1337 ARG A CD  1 
ATOM   4966  N  NE  . ARG A 1 741  ? -35.440 11.559  10.106  1.00 113.44 ? 1337 ARG A NE  1 
ATOM   4967  C  CZ  . ARG A 1 741  ? -35.224 12.764  9.588   1.00 128.21 ? 1337 ARG A CZ  1 
ATOM   4968  N  NH1 . ARG A 1 741  ? -35.485 13.853  10.300  1.00 111.10 ? 1337 ARG A NH1 1 
ATOM   4969  N  NH2 . ARG A 1 741  ? -34.750 12.882  8.355   1.00 106.50 ? 1337 ARG A NH2 1 
ATOM   4970  N  N   . ALA A 1 742  ? -40.441 9.668   10.931  1.00 57.10  ? 1338 ALA A N   1 
ATOM   4971  C  CA  . ALA A 1 742  ? -41.815 9.821   10.465  1.00 44.97  ? 1338 ALA A CA  1 
ATOM   4972  C  C   . ALA A 1 742  ? -42.459 8.470   10.198  1.00 39.77  ? 1338 ALA A C   1 
ATOM   4973  O  O   . ALA A 1 742  ? -43.618 8.391   9.793   1.00 44.07  ? 1338 ALA A O   1 
ATOM   4974  C  CB  . ALA A 1 742  ? -41.852 10.678  9.212   1.00 32.08  ? 1338 ALA A CB  1 
ATOM   4975  N  N   . CYS A 1 743  ? -41.698 7.406   10.427  1.00 38.64  ? 1339 CYS A N   1 
ATOM   4976  C  CA  . CYS A 1 743  ? -42.171 6.059   10.130  1.00 48.46  ? 1339 CYS A CA  1 
ATOM   4977  C  C   . CYS A 1 743  ? -42.324 5.206   11.367  1.00 46.10  ? 1339 CYS A C   1 
ATOM   4978  O  O   . CYS A 1 743  ? -41.996 4.024   11.349  1.00 52.36  ? 1339 CYS A O   1 
ATOM   4979  C  CB  . CYS A 1 743  ? -41.222 5.359   9.155   1.00 47.26  ? 1339 CYS A CB  1 
ATOM   4980  S  SG  . CYS A 1 743  ? -41.013 6.188   7.574   1.00 30.64  ? 1339 CYS A SG  1 
ATOM   4981  N  N   . GLN A 1 744  ? -42.823 5.789   12.449  1.00 52.55  ? 1340 GLN A N   1 
ATOM   4982  C  CA  . GLN A 1 744  ? -43.121 4.955   13.603  1.00 48.93  ? 1340 GLN A CA  1 
ATOM   4983  C  C   . GLN A 1 744  ? -44.579 4.546   13.495  1.00 49.66  ? 1340 GLN A C   1 
ATOM   4984  O  O   . GLN A 1 744  ? -45.485 5.359   13.687  1.00 52.21  ? 1340 GLN A O   1 
ATOM   4985  C  CB  . GLN A 1 744  ? -42.818 5.724   14.893  1.00 53.89  ? 1340 GLN A CB  1 
ATOM   4986  C  CG  . GLN A 1 744  ? -43.418 5.127   16.146  1.00 80.72  ? 1340 GLN A CG  1 
ATOM   4987  C  CD  . GLN A 1 744  ? -43.113 3.658   16.301  1.00 85.70  ? 1340 GLN A CD  1 
ATOM   4988  O  OE1 . GLN A 1 744  ? -44.022 2.842   16.389  1.00 72.15  ? 1340 GLN A OE1 1 
ATOM   4989  N  NE2 . GLN A 1 744  ? -41.832 3.311   16.338  1.00 89.59  ? 1340 GLN A NE2 1 
ATOM   4990  N  N   . LEU A 1 745  ? -44.792 3.281   13.148  1.00 46.76  ? 1341 LEU A N   1 
ATOM   4991  C  CA  . LEU A 1 745  ? -46.133 2.793   12.840  1.00 42.15  ? 1341 LEU A CA  1 
ATOM   4992  C  C   . LEU A 1 745  ? -46.837 2.022   13.947  1.00 42.63  ? 1341 LEU A C   1 
ATOM   4993  O  O   . LEU A 1 745  ? -47.992 1.633   13.796  1.00 42.38  ? 1341 LEU A O   1 
ATOM   4994  C  CB  . LEU A 1 745  ? -46.065 1.913   11.593  1.00 46.01  ? 1341 LEU A CB  1 
ATOM   4995  C  CG  . LEU A 1 745  ? -45.379 2.537   10.373  1.00 37.51  ? 1341 LEU A CG  1 
ATOM   4996  C  CD1 . LEU A 1 745  ? -45.420 1.587   9.189   1.00 42.51  ? 1341 LEU A CD1 1 
ATOM   4997  C  CD2 . LEU A 1 745  ? -46.023 3.868   10.021  1.00 41.91  ? 1341 LEU A CD2 1 
ATOM   4998  N  N   . SER A 1 746  ? -46.150 1.804   15.059  1.00 66.17  ? 1342 SER A N   1 
ATOM   4999  C  CA  . SER A 1 746  ? -46.677 0.902   16.074  1.00 59.46  ? 1342 SER A CA  1 
ATOM   5000  C  C   . SER A 1 746  ? -47.650 1.628   16.988  1.00 52.11  ? 1342 SER A C   1 
ATOM   5001  O  O   . SER A 1 746  ? -47.637 2.856   17.083  1.00 52.89  ? 1342 SER A O   1 
ATOM   5002  C  CB  . SER A 1 746  ? -45.548 0.266   16.893  1.00 51.19  ? 1342 SER A CB  1 
ATOM   5003  O  OG  . SER A 1 746  ? -44.819 1.250   17.604  1.00 66.92  ? 1342 SER A OG  1 
ATOM   5004  N  N   . VAL A 1 747  ? -48.506 0.856   17.646  1.00 46.26  ? 1343 VAL A N   1 
ATOM   5005  C  CA  . VAL A 1 747  ? -49.552 1.418   18.481  1.00 57.19  ? 1343 VAL A CA  1 
ATOM   5006  C  C   . VAL A 1 747  ? -49.533 0.764   19.849  1.00 53.89  ? 1343 VAL A C   1 
ATOM   5007  O  O   . VAL A 1 747  ? -49.495 -0.455  19.948  1.00 56.81  ? 1343 VAL A O   1 
ATOM   5008  C  CB  . VAL A 1 747  ? -50.941 1.223   17.849  1.00 51.50  ? 1343 VAL A CB  1 
ATOM   5009  C  CG1 . VAL A 1 747  ? -52.019 1.794   18.751  1.00 47.05  ? 1343 VAL A CG1 1 
ATOM   5010  C  CG2 . VAL A 1 747  ? -50.995 1.863   16.472  1.00 49.10  ? 1343 VAL A CG2 1 
ATOM   5011  N  N   . VAL A 1 748  ? -49.554 1.563   20.908  1.00 53.82  ? 1344 VAL A N   1 
ATOM   5012  C  CA  . VAL A 1 748  ? -49.660 0.996   22.246  1.00 59.99  ? 1344 VAL A CA  1 
ATOM   5013  C  C   . VAL A 1 748  ? -51.099 1.083   22.740  1.00 56.64  ? 1344 VAL A C   1 
ATOM   5014  O  O   . VAL A 1 748  ? -51.664 2.175   22.828  1.00 55.16  ? 1344 VAL A O   1 
ATOM   5015  C  CB  . VAL A 1 748  ? -48.729 1.702   23.246  1.00 48.96  ? 1344 VAL A CB  1 
ATOM   5016  C  CG1 . VAL A 1 748  ? -49.020 1.227   24.659  1.00 51.97  ? 1344 VAL A CG1 1 
ATOM   5017  C  CG2 . VAL A 1 748  ? -47.276 1.435   22.888  1.00 49.64  ? 1344 VAL A CG2 1 
ATOM   5018  N  N   . VAL A 1 749  ? -51.698 -0.068  23.036  1.00 70.28  ? 1345 VAL A N   1 
ATOM   5019  C  CA  . VAL A 1 749  ? -53.035 -0.110  23.622  1.00 67.26  ? 1345 VAL A CA  1 
ATOM   5020  C  C   . VAL A 1 749  ? -53.033 -0.942  24.901  1.00 68.96  ? 1345 VAL A C   1 
ATOM   5021  O  O   . VAL A 1 749  ? -52.648 -2.112  24.870  1.00 63.93  ? 1345 VAL A O   1 
ATOM   5022  C  CB  . VAL A 1 749  ? -54.065 -0.697  22.649  1.00 58.10  ? 1345 VAL A CB  1 
ATOM   5023  C  CG1 . VAL A 1 749  ? -55.446 -0.669  23.276  1.00 55.92  ? 1345 VAL A CG1 1 
ATOM   5024  C  CG2 . VAL A 1 749  ? -54.054 0.084   21.356  1.00 70.02  ? 1345 VAL A CG2 1 
ATOM   5025  N  N   . ASP A 1 750  ? -53.462 -0.334  26.011  1.00 71.40  ? 1346 ASP A N   1 
ATOM   5026  C  CA  . ASP A 1 750  ? -53.456 -0.959  27.349  1.00 61.46  ? 1346 ASP A CA  1 
ATOM   5027  C  C   . ASP A 1 750  ? -52.192 -1.788  27.634  1.00 66.57  ? 1346 ASP A C   1 
ATOM   5028  O  O   . ASP A 1 750  ? -52.274 -2.967  27.993  1.00 76.27  ? 1346 ASP A O   1 
ATOM   5029  C  CB  . ASP A 1 750  ? -54.705 -1.832  27.544  1.00 49.69  ? 1346 ASP A CB  1 
ATOM   5030  C  CG  . ASP A 1 750  ? -55.990 -1.020  27.562  1.00 56.70  ? 1346 ASP A CG  1 
ATOM   5031  O  OD1 . ASP A 1 750  ? -55.955 0.149   28.004  1.00 68.47  ? 1346 ASP A OD1 1 
ATOM   5032  O  OD2 . ASP A 1 750  ? -57.036 -1.561  27.142  1.00 57.00  ? 1346 ASP A OD2 1 
ATOM   5033  N  N   . ASP A 1 751  ? -51.036 -1.147  27.454  1.00 58.36  ? 1347 ASP A N   1 
ATOM   5034  C  CA  . ASP A 1 751  ? -49.712 -1.727  27.712  1.00 78.76  ? 1347 ASP A CA  1 
ATOM   5035  C  C   . ASP A 1 751  ? -49.366 -2.941  26.842  1.00 81.76  ? 1347 ASP A C   1 
ATOM   5036  O  O   . ASP A 1 751  ? -48.536 -3.770  27.226  1.00 94.63  ? 1347 ASP A O   1 
ATOM   5037  C  CB  . ASP A 1 751  ? -49.581 -2.092  29.193  1.00 93.35  ? 1347 ASP A CB  1 
ATOM   5038  C  CG  . ASP A 1 751  ? -49.687 -0.881  30.095  1.00 116.72 ? 1347 ASP A CG  1 
ATOM   5039  O  OD1 . ASP A 1 751  ? -48.786 -0.018  30.025  1.00 89.90  ? 1347 ASP A OD1 1 
ATOM   5040  O  OD2 . ASP A 1 751  ? -50.666 -0.788  30.868  1.00 98.06  ? 1347 ASP A OD2 1 
ATOM   5041  N  N   . LYS A 1 752  ? -50.009 -3.044  25.679  1.00 76.66  ? 1348 LYS A N   1 
ATOM   5042  C  CA  . LYS A 1 752  ? -49.629 -4.025  24.663  1.00 68.77  ? 1348 LYS A CA  1 
ATOM   5043  C  C   . LYS A 1 752  ? -49.207 -3.282  23.404  1.00 73.97  ? 1348 LYS A C   1 
ATOM   5044  O  O   . LYS A 1 752  ? -49.887 -2.339  22.987  1.00 73.38  ? 1348 LYS A O   1 
ATOM   5045  C  CB  . LYS A 1 752  ? -50.782 -4.986  24.348  1.00 68.24  ? 1348 LYS A CB  1 
ATOM   5046  C  CG  . LYS A 1 752  ? -51.446 -5.597  25.567  1.00 90.05  ? 1348 LYS A CG  1 
ATOM   5047  C  CD  . LYS A 1 752  ? -52.585 -6.526  25.157  1.00 82.67  ? 1348 LYS A CD  1 
ATOM   5048  C  CE  . LYS A 1 752  ? -53.291 -7.152  26.358  1.00 81.87  ? 1348 LYS A CE  1 
ATOM   5049  N  NZ  . LYS A 1 752  ? -54.629 -6.540  26.603  1.00 80.62  ? 1348 LYS A NZ  1 
ATOM   5050  N  N   . LYS A 1 753  ? -48.088 -3.685  22.806  1.00 83.09  ? 1349 LYS A N   1 
ATOM   5051  C  CA  . LYS A 1 753  ? -47.659 -3.076  21.552  1.00 61.28  ? 1349 LYS A CA  1 
ATOM   5052  C  C   . LYS A 1 753  ? -48.188 -3.881  20.376  1.00 60.77  ? 1349 LYS A C   1 
ATOM   5053  O  O   . LYS A 1 753  ? -48.013 -5.099  20.294  1.00 69.60  ? 1349 LYS A O   1 
ATOM   5054  C  CB  . LYS A 1 753  ? -46.134 -2.957  21.479  1.00 76.38  ? 1349 LYS A CB  1 
ATOM   5055  C  CG  . LYS A 1 753  ? -45.600 -2.338  20.199  1.00 67.93  ? 1349 LYS A CG  1 
ATOM   5056  C  CD  . LYS A 1 753  ? -44.106 -2.593  20.048  1.00 76.13  ? 1349 LYS A CD  1 
ATOM   5057  C  CE  . LYS A 1 753  ? -43.814 -4.038  19.648  1.00 74.86  ? 1349 LYS A CE  1 
ATOM   5058  N  NZ  . LYS A 1 753  ? -42.364 -4.255  19.356  1.00 81.67  ? 1349 LYS A NZ  1 
ATOM   5059  N  N   . PHE A 1 754  ? -48.852 -3.173  19.475  1.00 59.46  ? 1350 PHE A N   1 
ATOM   5060  C  CA  . PHE A 1 754  ? -49.440 -3.758  18.289  1.00 52.58  ? 1350 PHE A CA  1 
ATOM   5061  C  C   . PHE A 1 754  ? -48.776 -3.177  17.054  1.00 52.73  ? 1350 PHE A C   1 
ATOM   5062  O  O   . PHE A 1 754  ? -48.656 -1.958  16.912  1.00 65.27  ? 1350 PHE A O   1 
ATOM   5063  C  CB  . PHE A 1 754  ? -50.945 -3.504  18.256  1.00 49.72  ? 1350 PHE A CB  1 
ATOM   5064  C  CG  . PHE A 1 754  ? -51.700 -4.232  19.326  1.00 72.26  ? 1350 PHE A CG  1 
ATOM   5065  C  CD1 . PHE A 1 754  ? -52.158 -5.517  19.103  1.00 61.04  ? 1350 PHE A CD1 1 
ATOM   5066  C  CD2 . PHE A 1 754  ? -51.949 -3.640  20.554  1.00 69.85  ? 1350 PHE A CD2 1 
ATOM   5067  C  CE1 . PHE A 1 754  ? -52.854 -6.199  20.076  1.00 56.40  ? 1350 PHE A CE1 1 
ATOM   5068  C  CE2 . PHE A 1 754  ? -52.648 -4.319  21.534  1.00 55.90  ? 1350 PHE A CE2 1 
ATOM   5069  C  CZ  . PHE A 1 754  ? -53.099 -5.602  21.294  1.00 64.06  ? 1350 PHE A CZ  1 
ATOM   5070  N  N   . VAL A 1 755  ? -48.329 -4.063  16.175  1.00 45.97  ? 1351 VAL A N   1 
ATOM   5071  C  CA  . VAL A 1 755  ? -47.768 -3.665  14.898  1.00 46.22  ? 1351 VAL A CA  1 
ATOM   5072  C  C   . VAL A 1 755  ? -48.692 -4.156  13.798  1.00 49.54  ? 1351 VAL A C   1 
ATOM   5073  O  O   . VAL A 1 755  ? -49.646 -4.886  14.065  1.00 58.67  ? 1351 VAL A O   1 
ATOM   5074  C  CB  . VAL A 1 755  ? -46.359 -4.239  14.691  1.00 54.88  ? 1351 VAL A CB  1 
ATOM   5075  C  CG1 . VAL A 1 755  ? -45.435 -3.775  15.804  1.00 34.50  ? 1351 VAL A CG1 1 
ATOM   5076  C  CG2 . VAL A 1 755  ? -46.413 -5.757  14.641  1.00 34.00  ? 1351 VAL A CG2 1 
ATOM   5077  N  N   . SER A 1 756  ? -48.423 -3.749  12.564  1.00 41.06  ? 1352 SER A N   1 
ATOM   5078  C  CA  . SER A 1 756  ? -49.160 -4.287  11.431  1.00 39.22  ? 1352 SER A CA  1 
ATOM   5079  C  C   . SER A 1 756  ? -48.327 -5.380  10.775  1.00 46.82  ? 1352 SER A C   1 
ATOM   5080  O  O   . SER A 1 756  ? -47.208 -5.663  11.206  1.00 48.31  ? 1352 SER A O   1 
ATOM   5081  C  CB  . SER A 1 756  ? -49.511 -3.187  10.426  1.00 48.03  ? 1352 SER A CB  1 
ATOM   5082  O  OG  . SER A 1 756  ? -48.353 -2.497  9.986   1.00 53.91  ? 1352 SER A OG  1 
ATOM   5083  N  N   . ASN A 1 757  ? -48.871 -5.991  9.730   1.00 37.46  ? 1353 ASN A N   1 
ATOM   5084  C  CA  . ASN A 1 757  ? -48.195 -7.086  9.046   1.00 42.60  ? 1353 ASN A CA  1 
ATOM   5085  C  C   . ASN A 1 757  ? -46.962 -6.645  8.268   1.00 49.00  ? 1353 ASN A C   1 
ATOM   5086  O  O   . ASN A 1 757  ? -46.230 -7.483  7.740   1.00 61.96  ? 1353 ASN A O   1 
ATOM   5087  C  CB  . ASN A 1 757  ? -49.165 -7.798  8.103   1.00 44.77  ? 1353 ASN A CB  1 
ATOM   5088  C  CG  . ASN A 1 757  ? -49.807 -6.854  7.111   1.00 48.76  ? 1353 ASN A CG  1 
ATOM   5089  O  OD1 . ASN A 1 757  ? -50.882 -6.311  7.363   1.00 60.77  ? 1353 ASN A OD1 1 
ATOM   5090  N  ND2 . ASN A 1 757  ? -49.152 -6.654  5.973   1.00 50.11  ? 1353 ASN A ND2 1 
ATOM   5091  N  N   . ILE A 1 758  ? -46.747 -5.334  8.181   1.00 41.66  ? 1354 ILE A N   1 
ATOM   5092  C  CA  . ILE A 1 758  ? -45.659 -4.793  7.377   1.00 41.24  ? 1354 ILE A CA  1 
ATOM   5093  C  C   . ILE A 1 758  ? -44.313 -5.373  7.800   1.00 46.14  ? 1354 ILE A C   1 
ATOM   5094  O  O   . ILE A 1 758  ? -43.907 -5.256  8.957   1.00 47.40  ? 1354 ILE A O   1 
ATOM   5095  C  CB  . ILE A 1 758  ? -45.612 -3.254  7.494   1.00 44.35  ? 1354 ILE A CB  1 
ATOM   5096  C  CG1 . ILE A 1 758  ? -46.777 -2.625  6.727   1.00 42.62  ? 1354 ILE A CG1 1 
ATOM   5097  C  CG2 . ILE A 1 758  ? -44.283 -2.712  7.001   1.00 47.96  ? 1354 ILE A CG2 1 
ATOM   5098  C  CD1 . ILE A 1 758  ? -46.826 -1.117  6.822   1.00 33.51  ? 1354 ILE A CD1 1 
ATOM   5099  N  N   . THR A 1 759  ? -43.629 -5.998  6.846   1.00 56.77  ? 1355 THR A N   1 
ATOM   5100  C  CA  . THR A 1 759  ? -42.321 -6.592  7.094   1.00 47.71  ? 1355 THR A CA  1 
ATOM   5101  C  C   . THR A 1 759  ? -41.160 -5.672  6.734   1.00 48.79  ? 1355 THR A C   1 
ATOM   5102  O  O   . THR A 1 759  ? -40.009 -5.971  7.052   1.00 57.00  ? 1355 THR A O   1 
ATOM   5103  C  CB  . THR A 1 759  ? -42.159 -7.911  6.323   1.00 47.31  ? 1355 THR A CB  1 
ATOM   5104  O  OG1 . THR A 1 759  ? -42.547 -7.717  4.957   1.00 58.76  ? 1355 THR A OG1 1 
ATOM   5105  C  CG2 . THR A 1 759  ? -43.031 -8.990  6.938   1.00 55.35  ? 1355 THR A CG2 1 
ATOM   5106  N  N   . ARG A 1 760  ? -41.455 -4.557  6.075   1.00 55.57  ? 1356 ARG A N   1 
ATOM   5107  C  CA  . ARG A 1 760  ? -40.400 -3.638  5.672   1.00 55.52  ? 1356 ARG A CA  1 
ATOM   5108  C  C   . ARG A 1 760  ? -40.265 -2.522  6.691   1.00 57.25  ? 1356 ARG A C   1 
ATOM   5109  O  O   . ARG A 1 760  ? -41.140 -1.666  6.817   1.00 59.63  ? 1356 ARG A O   1 
ATOM   5110  C  CB  . ARG A 1 760  ? -40.674 -3.054  4.284   1.00 44.40  ? 1356 ARG A CB  1 
ATOM   5111  C  CG  . ARG A 1 760  ? -40.576 -4.060  3.150   1.00 40.64  ? 1356 ARG A CG  1 
ATOM   5112  C  CD  . ARG A 1 760  ? -40.799 -3.386  1.807   1.00 42.31  ? 1356 ARG A CD  1 
ATOM   5113  N  NE  . ARG A 1 760  ? -41.021 -4.355  0.737   1.00 46.74  ? 1356 ARG A NE  1 
ATOM   5114  C  CZ  . ARG A 1 760  ? -41.641 -4.075  -0.405  1.00 46.72  ? 1356 ARG A CZ  1 
ATOM   5115  N  NH1 . ARG A 1 760  ? -42.109 -2.853  -0.625  1.00 36.16  ? 1356 ARG A NH1 1 
ATOM   5116  N  NH2 . ARG A 1 760  ? -41.801 -5.017  -1.324  1.00 40.29  ? 1356 ARG A NH2 1 
ATOM   5117  N  N   . LEU A 1 761  ? -39.144 -2.524  7.400   1.00 60.91  ? 1357 LEU A N   1 
ATOM   5118  C  CA  . LEU A 1 761  ? -38.902 -1.548  8.450   1.00 67.69  ? 1357 LEU A CA  1 
ATOM   5119  C  C   . LEU A 1 761  ? -37.834 -0.563  8.010   1.00 81.00  ? 1357 LEU A C   1 
ATOM   5120  O  O   . LEU A 1 761  ? -38.092 0.632   7.869   1.00 84.29  ? 1357 LEU A O   1 
ATOM   5121  C  CB  . LEU A 1 761  ? -38.484 -2.238  9.749   1.00 73.18  ? 1357 LEU A CB  1 
ATOM   5122  C  CG  . LEU A 1 761  ? -39.380 -3.375  10.244  1.00 93.48  ? 1357 LEU A CG  1 
ATOM   5123  C  CD1 . LEU A 1 761  ? -38.849 -3.939  11.554  1.00 69.18  ? 1357 LEU A CD1 1 
ATOM   5124  C  CD2 . LEU A 1 761  ? -40.824 -2.913  10.394  1.00 46.80  ? 1357 LEU A CD2 1 
ATOM   5125  N  N   . SER A 1 762  ? -36.629 -1.077  7.794   1.00 73.39  ? 1358 SER A N   1 
ATOM   5126  C  CA  . SER A 1 762  ? -35.475 -0.237  7.509   1.00 82.30  ? 1358 SER A CA  1 
ATOM   5127  C  C   . SER A 1 762  ? -35.293 0.128   6.041   1.00 82.67  ? 1358 SER A C   1 
ATOM   5128  O  O   . SER A 1 762  ? -34.487 0.994   5.728   1.00 86.24  ? 1358 SER A O   1 
ATOM   5129  C  CB  . SER A 1 762  ? -34.203 -0.919  8.013   1.00 92.70  ? 1358 SER A CB  1 
ATOM   5130  O  OG  . SER A 1 762  ? -33.063 -0.126  7.736   1.00 87.30  ? 1358 SER A OG  1 
ATOM   5131  N  N   . SER A 1 763  ? -36.022 -0.516  5.133   1.00 66.62  ? 1359 SER A N   1 
ATOM   5132  C  CA  . SER A 1 763  ? -35.766 -0.270  3.714   1.00 70.89  ? 1359 SER A CA  1 
ATOM   5133  C  C   . SER A 1 763  ? -36.992 -0.354  2.808   1.00 59.63  ? 1359 SER A C   1 
ATOM   5134  O  O   . SER A 1 763  ? -38.112 -0.570  3.269   1.00 72.87  ? 1359 SER A O   1 
ATOM   5135  C  CB  . SER A 1 763  ? -34.701 -1.246  3.209   1.00 64.74  ? 1359 SER A CB  1 
ATOM   5136  O  OG  . SER A 1 763  ? -34.308 -0.930  1.886   1.00 56.66  ? 1359 SER A OG  1 
ATOM   5137  N  N   . GLY A 1 764  ? -36.755 -0.179  1.511   1.00 40.34  ? 1360 GLY A N   1 
ATOM   5138  C  CA  . GLY A 1 764  ? -37.806 -0.210  0.511   1.00 46.59  ? 1360 GLY A CA  1 
ATOM   5139  C  C   . GLY A 1 764  ? -37.253 -0.238  -0.904  1.00 38.87  ? 1360 GLY A C   1 
ATOM   5140  O  O   . GLY A 1 764  ? -36.094 0.108   -1.128  1.00 34.73  ? 1360 GLY A O   1 
ATOM   5141  N  N   . PRO A 1 765  ? -38.085 -0.654  -1.871  1.00 36.98  ? 1361 PRO A N   1 
ATOM   5142  C  CA  . PRO A 1 765  ? -37.706 -0.782  -3.284  1.00 40.62  ? 1361 PRO A CA  1 
ATOM   5143  C  C   . PRO A 1 765  ? -37.319 0.534   -3.953  1.00 32.28  ? 1361 PRO A C   1 
ATOM   5144  O  O   . PRO A 1 765  ? -36.370 0.563   -4.735  1.00 34.91  ? 1361 PRO A O   1 
ATOM   5145  C  CB  . PRO A 1 765  ? -38.972 -1.346  -3.936  1.00 34.09  ? 1361 PRO A CB  1 
ATOM   5146  C  CG  . PRO A 1 765  ? -39.712 -2.000  -2.832  1.00 44.94  ? 1361 PRO A CG  1 
ATOM   5147  C  CD  . PRO A 1 765  ? -39.442 -1.166  -1.621  1.00 35.54  ? 1361 PRO A CD  1 
ATOM   5148  N  N   . PHE A 1 766  ? -38.044 1.605   -3.648  1.00 32.04  ? 1362 PHE A N   1 
ATOM   5149  C  CA  . PHE A 1 766  ? -37.893 2.858   -4.383  1.00 32.16  ? 1362 PHE A CA  1 
ATOM   5150  C  C   . PHE A 1 766  ? -37.293 3.981   -3.545  1.00 30.11  ? 1362 PHE A C   1 
ATOM   5151  O  O   . PHE A 1 766  ? -37.467 4.027   -2.327  1.00 29.81  ? 1362 PHE A O   1 
ATOM   5152  C  CB  . PHE A 1 766  ? -39.247 3.299   -4.939  1.00 30.96  ? 1362 PHE A CB  1 
ATOM   5153  C  CG  . PHE A 1 766  ? -39.859 2.311   -5.890  1.00 38.56  ? 1362 PHE A CG  1 
ATOM   5154  C  CD1 . PHE A 1 766  ? -39.110 1.766   -6.920  1.00 32.95  ? 1362 PHE A CD1 1 
ATOM   5155  C  CD2 . PHE A 1 766  ? -41.183 1.929   -5.758  1.00 35.01  ? 1362 PHE A CD2 1 
ATOM   5156  C  CE1 . PHE A 1 766  ? -39.669 0.855   -7.798  1.00 34.97  ? 1362 PHE A CE1 1 
ATOM   5157  C  CE2 . PHE A 1 766  ? -41.748 1.018   -6.632  1.00 27.13  ? 1362 PHE A CE2 1 
ATOM   5158  C  CZ  . PHE A 1 766  ? -40.989 0.482   -7.653  1.00 30.33  ? 1362 PHE A CZ  1 
ATOM   5159  N  N   . ARG A 1 767  ? -36.584 4.886   -4.212  1.00 25.01  ? 1363 ARG A N   1 
ATOM   5160  C  CA  . ARG A 1 767  ? -36.004 6.044   -3.546  1.00 33.60  ? 1363 ARG A CA  1 
ATOM   5161  C  C   . ARG A 1 767  ? -37.109 6.955   -3.033  1.00 30.85  ? 1363 ARG A C   1 
ATOM   5162  O  O   . ARG A 1 767  ? -38.226 6.941   -3.551  1.00 30.25  ? 1363 ARG A O   1 
ATOM   5163  C  CB  . ARG A 1 767  ? -35.083 6.817   -4.489  1.00 34.81  ? 1363 ARG A CB  1 
ATOM   5164  C  CG  . ARG A 1 767  ? -35.810 7.558   -5.599  1.00 19.12  ? 1363 ARG A CG  1 
ATOM   5165  C  CD  . ARG A 1 767  ? -34.862 8.467   -6.362  1.00 34.28  ? 1363 ARG A CD  1 
ATOM   5166  N  NE  . ARG A 1 767  ? -35.553 9.239   -7.391  1.00 36.68  ? 1363 ARG A NE  1 
ATOM   5167  C  CZ  . ARG A 1 767  ? -36.158 10.402  -7.170  1.00 27.24  ? 1363 ARG A CZ  1 
ATOM   5168  N  NH1 . ARG A 1 767  ? -36.761 11.038  -8.165  1.00 36.19  ? 1363 ARG A NH1 1 
ATOM   5169  N  NH2 . ARG A 1 767  ? -36.160 10.930  -5.953  1.00 30.02  ? 1363 ARG A NH2 1 
ATOM   5170  N  N   . THR A 1 768  ? -36.799 7.745   -2.013  1.00 37.28  ? 1364 THR A N   1 
ATOM   5171  C  CA  . THR A 1 768  ? -37.788 8.650   -1.448  1.00 38.61  ? 1364 THR A CA  1 
ATOM   5172  C  C   . THR A 1 768  ? -38.138 9.741   -2.456  1.00 29.54  ? 1364 THR A C   1 
ATOM   5173  O  O   . THR A 1 768  ? -37.297 10.165  -3.250  1.00 41.02  ? 1364 THR A O   1 
ATOM   5174  C  CB  . THR A 1 768  ? -37.296 9.287   -0.128  1.00 23.11  ? 1364 THR A CB  1 
ATOM   5175  O  OG1 . THR A 1 768  ? -38.378 9.982   0.504   1.00 41.70  ? 1364 THR A OG1 1 
ATOM   5176  C  CG2 . THR A 1 768  ? -36.145 10.252  -0.375  1.00 39.73  ? 1364 THR A CG2 1 
ATOM   5177  N  N   . ILE A 1 769  ? -39.394 10.172  -2.438  1.00 30.75  ? 1365 ILE A N   1 
ATOM   5178  C  CA  . ILE A 1 769  ? -39.831 11.269  -3.286  1.00 35.99  ? 1365 ILE A CA  1 
ATOM   5179  C  C   . ILE A 1 769  ? -39.517 12.576  -2.571  1.00 36.66  ? 1365 ILE A C   1 
ATOM   5180  O  O   . ILE A 1 769  ? -39.635 12.658  -1.349  1.00 35.63  ? 1365 ILE A O   1 
ATOM   5181  C  CB  . ILE A 1 769  ? -41.334 11.177  -3.612  1.00 38.45  ? 1365 ILE A CB  1 
ATOM   5182  C  CG1 . ILE A 1 769  ? -41.659 9.812   -4.219  1.00 35.23  ? 1365 ILE A CG1 1 
ATOM   5183  C  CG2 . ILE A 1 769  ? -41.748 12.280  -4.570  1.00 36.26  ? 1365 ILE A CG2 1 
ATOM   5184  C  CD1 . ILE A 1 769  ? -40.942 9.544   -5.525  1.00 31.12  ? 1365 ILE A CD1 1 
ATOM   5185  N  N   . THR A 1 770  ? -39.093 13.585  -3.324  1.00 37.27  ? 1366 THR A N   1 
ATOM   5186  C  CA  . THR A 1 770  ? -38.690 14.856  -2.732  1.00 33.25  ? 1366 THR A CA  1 
ATOM   5187  C  C   . THR A 1 770  ? -39.540 16.025  -3.216  1.00 40.89  ? 1366 THR A C   1 
ATOM   5188  O  O   . THR A 1 770  ? -40.407 15.866  -4.075  1.00 41.39  ? 1366 THR A O   1 
ATOM   5189  C  CB  . THR A 1 770  ? -37.216 15.168  -3.034  1.00 31.08  ? 1366 THR A CB  1 
ATOM   5190  O  OG1 . THR A 1 770  ? -37.037 15.308  -4.449  1.00 40.35  ? 1366 THR A OG1 1 
ATOM   5191  C  CG2 . THR A 1 770  ? -36.320 14.054  -2.520  1.00 14.88  ? 1366 THR A CG2 1 
ATOM   5192  N  N   . VAL A 1 771  ? -39.277 17.199  -2.652  1.00 34.66  ? 1367 VAL A N   1 
ATOM   5193  C  CA  . VAL A 1 771  ? -39.938 18.429  -3.069  1.00 31.68  ? 1367 VAL A CA  1 
ATOM   5194  C  C   . VAL A 1 771  ? -39.565 18.756  -4.512  1.00 33.81  ? 1367 VAL A C   1 
ATOM   5195  O  O   . VAL A 1 771  ? -40.404 19.196  -5.306  1.00 33.72  ? 1367 VAL A O   1 
ATOM   5196  C  CB  . VAL A 1 771  ? -39.560 19.604  -2.146  1.00 36.06  ? 1367 VAL A CB  1 
ATOM   5197  C  CG1 . VAL A 1 771  ? -40.047 20.920  -2.719  1.00 33.81  ? 1367 VAL A CG1 1 
ATOM   5198  C  CG2 . VAL A 1 771  ? -40.126 19.383  -0.752  1.00 25.75  ? 1367 VAL A CG2 1 
ATOM   5199  N  N   . ARG A 1 772  ? -38.300 18.520  -4.843  1.00 38.12  ? 1368 ARG A N   1 
ATOM   5200  C  CA  . ARG A 1 772  ? -37.805 18.695  -6.201  1.00 32.10  ? 1368 ARG A CA  1 
ATOM   5201  C  C   . ARG A 1 772  ? -38.588 17.826  -7.177  1.00 32.38  ? 1368 ARG A C   1 
ATOM   5202  O  O   . ARG A 1 772  ? -39.021 18.295  -8.229  1.00 36.64  ? 1368 ARG A O   1 
ATOM   5203  C  CB  . ARG A 1 772  ? -36.319 18.354  -6.277  1.00 27.45  ? 1368 ARG A CB  1 
ATOM   5204  C  CG  . ARG A 1 772  ? -35.679 18.660  -7.616  1.00 26.82  ? 1368 ARG A CG  1 
ATOM   5205  C  CD  . ARG A 1 772  ? -34.336 17.966  -7.733  1.00 38.62  ? 1368 ARG A CD  1 
ATOM   5206  N  NE  . ARG A 1 772  ? -33.625 17.959  -6.459  1.00 40.17  ? 1368 ARG A NE  1 
ATOM   5207  C  CZ  . ARG A 1 772  ? -32.800 18.919  -6.061  1.00 44.69  ? 1368 ARG A CZ  1 
ATOM   5208  N  NH1 . ARG A 1 772  ? -32.576 19.969  -6.840  1.00 57.17  ? 1368 ARG A NH1 1 
ATOM   5209  N  NH2 . ARG A 1 772  ? -32.197 18.831  -4.884  1.00 38.83  ? 1368 ARG A NH2 1 
ATOM   5210  N  N   . ASP A 1 773  ? -38.770 16.558  -6.819  1.00 30.44  ? 1369 ASP A N   1 
ATOM   5211  C  CA  . ASP A 1 773  ? -39.563 15.640  -7.628  1.00 28.67  ? 1369 ASP A CA  1 
ATOM   5212  C  C   . ASP A 1 773  ? -40.985 16.158  -7.774  1.00 37.13  ? 1369 ASP A C   1 
ATOM   5213  O  O   . ASP A 1 773  ? -41.643 15.937  -8.790  1.00 33.22  ? 1369 ASP A O   1 
ATOM   5214  C  CB  . ASP A 1 773  ? -39.590 14.243  -7.004  1.00 27.65  ? 1369 ASP A CB  1 
ATOM   5215  C  CG  . ASP A 1 773  ? -38.207 13.658  -6.813  1.00 42.89  ? 1369 ASP A CG  1 
ATOM   5216  O  OD1 . ASP A 1 773  ? -37.300 13.996  -7.601  1.00 48.28  ? 1369 ASP A OD1 1 
ATOM   5217  O  OD2 . ASP A 1 773  ? -38.032 12.855  -5.872  1.00 41.53  ? 1369 ASP A OD2 1 
ATOM   5218  N  N   . THR A 1 774  ? -41.440 16.865  -6.746  1.00 30.69  ? 1370 THR A N   1 
ATOM   5219  C  CA  . THR A 1 774  ? -42.837 17.239  -6.612  1.00 27.73  ? 1370 THR A CA  1 
ATOM   5220  C  C   . THR A 1 774  ? -43.229 18.477  -7.417  1.00 33.46  ? 1370 THR A C   1 
ATOM   5221  O  O   . THR A 1 774  ? -44.286 18.493  -8.048  1.00 32.86  ? 1370 THR A O   1 
ATOM   5222  C  CB  . THR A 1 774  ? -43.181 17.475  -5.128  1.00 33.45  ? 1370 THR A CB  1 
ATOM   5223  O  OG1 . THR A 1 774  ? -42.909 16.283  -4.379  1.00 35.43  ? 1370 THR A OG1 1 
ATOM   5224  C  CG2 . THR A 1 774  ? -44.639 17.842  -4.962  1.00 28.52  ? 1370 THR A CG2 1 
ATOM   5225  N  N   . MET A 1 775  ? -42.392 19.510  -7.410  1.00 38.26  ? 1371 MET A N   1 
ATOM   5226  C  CA  . MET A 1 775  ? -42.814 20.779  -8.001  1.00 28.15  ? 1371 MET A CA  1 
ATOM   5227  C  C   . MET A 1 775  ? -41.713 21.603  -8.673  1.00 32.58  ? 1371 MET A C   1 
ATOM   5228  O  O   . MET A 1 775  ? -41.812 22.828  -8.745  1.00 36.07  ? 1371 MET A O   1 
ATOM   5229  C  CB  . MET A 1 775  ? -43.488 21.632  -6.922  1.00 42.88  ? 1371 MET A CB  1 
ATOM   5230  C  CG  . MET A 1 775  ? -42.574 22.019  -5.769  1.00 16.85  ? 1371 MET A CG  1 
ATOM   5231  S  SD  . MET A 1 775  ? -43.518 22.606  -4.354  1.00 47.79  ? 1371 MET A SD  1 
ATOM   5232  C  CE  . MET A 1 775  ? -42.299 23.612  -3.521  1.00 30.83  ? 1371 MET A CE  1 
ATOM   5233  N  N   . SER A 1 776  ? -40.678 20.944  -9.180  1.00 28.35  ? 1372 SER A N   1 
ATOM   5234  C  CA  . SER A 1 776  ? -39.591 21.673  -9.827  1.00 32.78  ? 1372 SER A CA  1 
ATOM   5235  C  C   . SER A 1 776  ? -39.964 22.108  -11.241 1.00 42.23  ? 1372 SER A C   1 
ATOM   5236  O  O   . SER A 1 776  ? -39.316 22.979  -11.821 1.00 52.87  ? 1372 SER A O   1 
ATOM   5237  C  CB  . SER A 1 776  ? -38.319 20.825  -9.871  1.00 26.98  ? 1372 SER A CB  1 
ATOM   5238  O  OG  . SER A 1 776  ? -38.465 19.736  -10.766 1.00 31.82  ? 1372 SER A OG  1 
ATOM   5239  N  N   . ASP A 1 777  ? -41.007 21.495  -11.792 1.00 37.27  ? 1373 ASP A N   1 
ATOM   5240  C  CA  . ASP A 1 777  ? -41.407 21.756  -13.171 1.00 31.24  ? 1373 ASP A CA  1 
ATOM   5241  C  C   . ASP A 1 777  ? -42.390 22.915  -13.291 1.00 34.90  ? 1373 ASP A C   1 
ATOM   5242  O  O   . ASP A 1 777  ? -42.673 23.388  -14.392 1.00 47.66  ? 1373 ASP A O   1 
ATOM   5243  C  CB  . ASP A 1 777  ? -42.027 20.500  -13.782 1.00 29.70  ? 1373 ASP A CB  1 
ATOM   5244  C  CG  . ASP A 1 777  ? -43.338 20.119  -13.122 1.00 33.94  ? 1373 ASP A CG  1 
ATOM   5245  O  OD1 . ASP A 1 777  ? -43.516 20.424  -11.924 1.00 35.05  ? 1373 ASP A OD1 1 
ATOM   5246  O  OD2 . ASP A 1 777  ? -44.195 19.519  -13.803 1.00 43.10  ? 1373 ASP A OD2 1 
ATOM   5247  N  N   . LEU A 1 778  ? -42.907 23.372  -12.157 1.00 33.05  ? 1374 LEU A N   1 
ATOM   5248  C  CA  . LEU A 1 778  ? -43.937 24.400  -12.156 1.00 29.65  ? 1374 LEU A CA  1 
ATOM   5249  C  C   . LEU A 1 778  ? -43.355 25.785  -12.400 1.00 35.19  ? 1374 LEU A C   1 
ATOM   5250  O  O   . LEU A 1 778  ? -42.321 26.139  -11.835 1.00 39.41  ? 1374 LEU A O   1 
ATOM   5251  C  CB  . LEU A 1 778  ? -44.710 24.376  -10.839 1.00 36.49  ? 1374 LEU A CB  1 
ATOM   5252  C  CG  . LEU A 1 778  ? -45.474 23.080  -10.568 1.00 40.60  ? 1374 LEU A CG  1 
ATOM   5253  C  CD1 . LEU A 1 778  ? -46.318 23.210  -9.318  1.00 35.96  ? 1374 LEU A CD1 1 
ATOM   5254  C  CD2 . LEU A 1 778  ? -46.339 22.707  -11.761 1.00 22.69  ? 1374 LEU A CD2 1 
ATOM   5255  N  N   . PRO A 1 779  ? -44.029 26.572  -13.252 1.00 35.42  ? 1375 PRO A N   1 
ATOM   5256  C  CA  . PRO A 1 779  ? -43.619 27.935  -13.603 1.00 21.61  ? 1375 PRO A CA  1 
ATOM   5257  C  C   . PRO A 1 779  ? -43.497 28.826  -12.375 1.00 28.91  ? 1375 PRO A C   1 
ATOM   5258  O  O   . PRO A 1 779  ? -44.268 28.669  -11.427 1.00 40.02  ? 1375 PRO A O   1 
ATOM   5259  C  CB  . PRO A 1 779  ? -44.752 28.424  -14.512 1.00 25.75  ? 1375 PRO A CB  1 
ATOM   5260  C  CG  . PRO A 1 779  ? -45.381 27.189  -15.035 1.00 36.76  ? 1375 PRO A CG  1 
ATOM   5261  C  CD  . PRO A 1 779  ? -45.272 26.182  -13.937 1.00 34.24  ? 1375 PRO A CD  1 
ATOM   5262  N  N   . GLU A 1 780  ? -42.541 29.748  -12.395 1.00 30.07  ? 1376 GLU A N   1 
ATOM   5263  C  CA  . GLU A 1 780  ? -42.350 30.651  -11.271 1.00 29.15  ? 1376 GLU A CA  1 
ATOM   5264  C  C   . GLU A 1 780  ? -43.506 31.636  -11.179 1.00 27.04  ? 1376 GLU A C   1 
ATOM   5265  O  O   . GLU A 1 780  ? -43.812 32.339  -12.140 1.00 46.04  ? 1376 GLU A O   1 
ATOM   5266  C  CB  . GLU A 1 780  ? -41.024 31.404  -11.401 1.00 39.08  ? 1376 GLU A CB  1 
ATOM   5267  C  CG  . GLU A 1 780  ? -40.870 32.552  -10.416 1.00 63.53  ? 1376 GLU A CG  1 
ATOM   5268  C  CD  . GLU A 1 780  ? -39.514 33.223  -10.508 1.00 70.13  ? 1376 GLU A CD  1 
ATOM   5269  O  OE1 . GLU A 1 780  ? -39.335 34.293  -9.887  1.00 54.95  ? 1376 GLU A OE1 1 
ATOM   5270  O  OE2 . GLU A 1 780  ? -38.626 32.679  -11.199 1.00 66.27  ? 1376 GLU A OE2 1 
ATOM   5271  N  N   . VAL A 1 781  ? -44.148 31.678  -10.018 1.00 30.50  ? 1377 VAL A N   1 
ATOM   5272  C  CA  . VAL A 1 781  ? -45.218 32.636  -9.780  1.00 36.56  ? 1377 VAL A CA  1 
ATOM   5273  C  C   . VAL A 1 781  ? -44.883 33.492  -8.570  1.00 37.63  ? 1377 VAL A C   1 
ATOM   5274  O  O   . VAL A 1 781  ? -43.835 33.324  -7.947  1.00 37.87  ? 1377 VAL A O   1 
ATOM   5275  C  CB  . VAL A 1 781  ? -46.581 31.949  -9.565  1.00 30.13  ? 1377 VAL A CB  1 
ATOM   5276  C  CG1 . VAL A 1 781  ? -46.969 31.148  -10.796 1.00 23.47  ? 1377 VAL A CG1 1 
ATOM   5277  C  CG2 . VAL A 1 781  ? -46.547 31.063  -8.334  1.00 31.09  ? 1377 VAL A CG2 1 
ATOM   5278  N  N   . ARG A 1 782  ? -45.789 34.400  -8.234  1.00 34.65  ? 1378 ARG A N   1 
ATOM   5279  C  CA  . ARG A 1 782  ? -45.508 35.421  -7.240  1.00 33.52  ? 1378 ARG A CA  1 
ATOM   5280  C  C   . ARG A 1 782  ? -46.578 35.452  -6.162  1.00 35.09  ? 1378 ARG A C   1 
ATOM   5281  O  O   . ARG A 1 782  ? -47.640 34.847  -6.315  1.00 38.07  ? 1378 ARG A O   1 
ATOM   5282  C  CB  . ARG A 1 782  ? -45.388 36.788  -7.912  1.00 26.11  ? 1378 ARG A CB  1 
ATOM   5283  C  CG  . ARG A 1 782  ? -44.115 37.532  -7.561  1.00 58.17  ? 1378 ARG A CG  1 
ATOM   5284  C  CD  . ARG A 1 782  ? -43.667 38.406  -8.715  1.00 43.28  ? 1378 ARG A CD  1 
ATOM   5285  N  NE  . ARG A 1 782  ? -43.297 37.612  -9.884  1.00 85.21  ? 1378 ARG A NE  1 
ATOM   5286  C  CZ  . ARG A 1 782  ? -42.048 37.289  -10.205 1.00 84.66  ? 1378 ARG A CZ  1 
ATOM   5287  N  NH1 . ARG A 1 782  ? -41.038 37.698  -9.449  1.00 85.52  ? 1378 ARG A NH1 1 
ATOM   5288  N  NH2 . ARG A 1 782  ? -41.806 36.562  -11.288 1.00 73.41  ? 1378 ARG A NH2 1 
ATOM   5289  N  N   . ASN A 1 783  ? -46.283 36.146  -5.067  1.00 33.07  ? 1379 ASN A N   1 
ATOM   5290  C  CA  . ASN A 1 783  ? -47.196 36.219  -3.936  1.00 27.13  ? 1379 ASN A CA  1 
ATOM   5291  C  C   . ASN A 1 783  ? -48.572 36.719  -4.354  1.00 28.55  ? 1379 ASN A C   1 
ATOM   5292  O  O   . ASN A 1 783  ? -48.704 37.784  -4.956  1.00 45.09  ? 1379 ASN A O   1 
ATOM   5293  C  CB  . ASN A 1 783  ? -46.614 37.124  -2.848  1.00 28.91  ? 1379 ASN A CB  1 
ATOM   5294  C  CG  . ASN A 1 783  ? -47.604 37.419  -1.740  1.00 47.25  ? 1379 ASN A CG  1 
ATOM   5295  O  OD1 . ASN A 1 783  ? -47.948 36.540  -0.950  1.00 61.45  ? 1379 ASN A OD1 1 
ATOM   5296  N  ND2 . ASN A 1 783  ? -48.058 38.665  -1.668  1.00 46.08  ? 1379 ASN A ND2 1 
ATOM   5297  N  N   . GLY A 1 784  ? -49.594 35.937  -4.027  1.00 35.07  ? 1380 GLY A N   1 
ATOM   5298  C  CA  . GLY A 1 784  ? -50.956 36.257  -4.407  1.00 34.70  ? 1380 GLY A CA  1 
ATOM   5299  C  C   . GLY A 1 784  ? -51.249 36.060  -5.884  1.00 25.20  ? 1380 GLY A C   1 
ATOM   5300  O  O   . GLY A 1 784  ? -51.966 36.860  -6.483  1.00 35.06  ? 1380 GLY A O   1 
ATOM   5301  N  N   . ALA A 1 785  ? -50.712 34.997  -6.476  1.00 19.43  ? 1381 ALA A N   1 
ATOM   5302  C  CA  . ALA A 1 785  ? -50.965 34.730  -7.888  1.00 26.95  ? 1381 ALA A CA  1 
ATOM   5303  C  C   . ALA A 1 785  ? -52.414 34.305  -8.080  1.00 38.25  ? 1381 ALA A C   1 
ATOM   5304  O  O   . ALA A 1 785  ? -52.867 33.340  -7.473  1.00 35.33  ? 1381 ALA A O   1 
ATOM   5305  C  CB  . ALA A 1 785  ? -50.020 33.660  -8.404  1.00 19.64  ? 1381 ALA A CB  1 
ATOM   5306  N  N   . SER A 1 786  ? -53.144 35.044  -8.911  1.00 47.01  ? 1382 SER A N   1 
ATOM   5307  C  CA  . SER A 1 786  ? -54.566 34.784  -9.118  1.00 28.53  ? 1382 SER A CA  1 
ATOM   5308  C  C   . SER A 1 786  ? -54.920 33.984  -10.372 1.00 30.33  ? 1382 SER A C   1 
ATOM   5309  O  O   . SER A 1 786  ? -56.090 33.665  -10.585 1.00 54.29  ? 1382 SER A O   1 
ATOM   5310  C  CB  . SER A 1 786  ? -55.330 36.109  -9.153  1.00 43.97  ? 1382 SER A CB  1 
ATOM   5311  O  OG  . SER A 1 786  ? -55.092 36.798  -10.367 1.00 58.69  ? 1382 SER A OG  1 
ATOM   5312  N  N   . ALA A 1 787  ? -53.936 33.647  -11.198 1.00 37.92  ? 1383 ALA A N   1 
ATOM   5313  C  CA  . ALA A 1 787  ? -54.257 33.119  -12.523 1.00 30.03  ? 1383 ALA A CA  1 
ATOM   5314  C  C   . ALA A 1 787  ? -54.638 31.645  -12.463 1.00 38.54  ? 1383 ALA A C   1 
ATOM   5315  O  O   . ALA A 1 787  ? -53.837 30.797  -12.073 1.00 42.71  ? 1383 ALA A O   1 
ATOM   5316  C  CB  . ALA A 1 787  ? -53.089 33.327  -13.469 1.00 14.85  ? 1383 ALA A CB  1 
ATOM   5317  N  N   . LEU A 1 788  ? -55.869 31.354  -12.874 1.00 33.76  ? 1384 LEU A N   1 
ATOM   5318  C  CA  . LEU A 1 788  ? -56.413 30.002  -12.810 1.00 24.13  ? 1384 LEU A CA  1 
ATOM   5319  C  C   . LEU A 1 788  ? -55.949 29.122  -13.964 1.00 38.61  ? 1384 LEU A C   1 
ATOM   5320  O  O   . LEU A 1 788  ? -55.834 27.906  -13.817 1.00 43.52  ? 1384 LEU A O   1 
ATOM   5321  C  CB  . LEU A 1 788  ? -57.940 30.051  -12.776 1.00 30.10  ? 1384 LEU A CB  1 
ATOM   5322  C  CG  . LEU A 1 788  ? -58.548 30.678  -11.522 1.00 28.18  ? 1384 LEU A CG  1 
ATOM   5323  C  CD1 . LEU A 1 788  ? -60.061 30.727  -11.633 1.00 22.69  ? 1384 LEU A CD1 1 
ATOM   5324  C  CD2 . LEU A 1 788  ? -58.128 29.906  -10.282 1.00 21.80  ? 1384 LEU A CD2 1 
ATOM   5325  N  N   . GLU A 1 789  ? -55.701 29.734  -15.117 1.00 43.25  ? 1385 GLU A N   1 
ATOM   5326  C  CA  . GLU A 1 789  ? -55.254 28.985  -16.285 1.00 33.61  ? 1385 GLU A CA  1 
ATOM   5327  C  C   . GLU A 1 789  ? -53.970 29.574  -16.857 1.00 33.47  ? 1385 GLU A C   1 
ATOM   5328  O  O   . GLU A 1 789  ? -53.966 30.691  -17.373 1.00 47.62  ? 1385 GLU A O   1 
ATOM   5329  C  CB  . GLU A 1 789  ? -56.347 28.964  -17.356 1.00 40.24  ? 1385 GLU A CB  1 
ATOM   5330  C  CG  . GLU A 1 789  ? -57.621 28.245  -16.936 1.00 39.65  ? 1385 GLU A CG  1 
ATOM   5331  C  CD  . GLU A 1 789  ? -58.761 28.460  -17.913 1.00 47.65  ? 1385 GLU A CD  1 
ATOM   5332  O  OE1 . GLU A 1 789  ? -58.927 29.602  -18.393 1.00 53.82  ? 1385 GLU A OE1 1 
ATOM   5333  O  OE2 . GLU A 1 789  ? -59.489 27.489  -18.204 1.00 57.57  ? 1385 GLU A OE2 1 
ATOM   5334  N  N   . ILE A 1 790  ? -52.884 28.812  -16.770 1.00 23.90  ? 1386 ILE A N   1 
ATOM   5335  C  CA  . ILE A 1 790  ? -51.590 29.240  -17.295 1.00 22.14  ? 1386 ILE A CA  1 
ATOM   5336  C  C   . ILE A 1 790  ? -50.899 28.095  -18.020 1.00 35.00  ? 1386 ILE A C   1 
ATOM   5337  O  O   . ILE A 1 790  ? -51.314 26.942  -17.920 1.00 38.49  ? 1386 ILE A O   1 
ATOM   5338  C  CB  . ILE A 1 790  ? -50.645 29.756  -16.187 1.00 12.54  ? 1386 ILE A CB  1 
ATOM   5339  C  CG1 . ILE A 1 790  ? -50.328 28.642  -15.187 1.00 32.80  ? 1386 ILE A CG1 1 
ATOM   5340  C  CG2 . ILE A 1 790  ? -51.236 30.966  -15.487 1.00 10.25  ? 1386 ILE A CG2 1 
ATOM   5341  C  CD1 . ILE A 1 790  ? -49.320 29.041  -14.128 1.00 26.46  ? 1386 ILE A CD1 1 
ATOM   5342  N  N   . SER A 1 791  ? -49.843 28.423  -18.755 1.00 30.65  ? 1387 SER A N   1 
ATOM   5343  C  CA  . SER A 1 791  ? -49.057 27.414  -19.450 1.00 33.23  ? 1387 SER A CA  1 
ATOM   5344  C  C   . SER A 1 791  ? -48.058 26.746  -18.508 1.00 37.54  ? 1387 SER A C   1 
ATOM   5345  O  O   . SER A 1 791  ? -47.506 27.393  -17.618 1.00 39.21  ? 1387 SER A O   1 
ATOM   5346  C  CB  . SER A 1 791  ? -48.321 28.035  -20.638 1.00 18.57  ? 1387 SER A CB  1 
ATOM   5347  O  OG  . SER A 1 791  ? -47.535 27.068  -21.310 1.00 36.39  ? 1387 SER A OG  1 
ATOM   5348  N  N   . TYR A 1 792  ? -47.837 25.448  -18.704 1.00 42.25  ? 1388 TYR A N   1 
ATOM   5349  C  CA  . TYR A 1 792  ? -46.803 24.726  -17.969 1.00 34.67  ? 1388 TYR A CA  1 
ATOM   5350  C  C   . TYR A 1 792  ? -45.428 25.287  -18.306 1.00 40.69  ? 1388 TYR A C   1 
ATOM   5351  O  O   . TYR A 1 792  ? -44.517 25.270  -17.476 1.00 36.29  ? 1388 TYR A O   1 
ATOM   5352  C  CB  . TYR A 1 792  ? -46.845 23.231  -18.288 1.00 24.96  ? 1388 TYR A CB  1 
ATOM   5353  C  CG  . TYR A 1 792  ? -47.807 22.429  -17.442 1.00 23.99  ? 1388 TYR A CG  1 
ATOM   5354  C  CD1 . TYR A 1 792  ? -47.447 21.993  -16.175 1.00 33.63  ? 1388 TYR A CD1 1 
ATOM   5355  C  CD2 . TYR A 1 792  ? -49.068 22.095  -17.918 1.00 28.34  ? 1388 TYR A CD2 1 
ATOM   5356  C  CE1 . TYR A 1 792  ? -48.318 21.254  -15.400 1.00 32.37  ? 1388 TYR A CE1 1 
ATOM   5357  C  CE2 . TYR A 1 792  ? -49.946 21.355  -17.151 1.00 32.28  ? 1388 TYR A CE2 1 
ATOM   5358  C  CZ  . TYR A 1 792  ? -49.566 20.938  -15.894 1.00 40.55  ? 1388 TYR A CZ  1 
ATOM   5359  O  OH  . TYR A 1 792  ? -50.438 20.202  -15.127 1.00 34.90  ? 1388 TYR A OH  1 
ATOM   5360  N  N   . ASN A 1 793  ? -45.294 25.769  -19.539 1.00 36.62  ? 1389 ASN A N   1 
ATOM   5361  C  CA  . ASN A 1 793  ? -44.065 26.381  -20.032 1.00 28.34  ? 1389 ASN A CA  1 
ATOM   5362  C  C   . ASN A 1 793  ? -42.852 25.455  -19.936 1.00 35.27  ? 1389 ASN A C   1 
ATOM   5363  O  O   . ASN A 1 793  ? -41.725 25.918  -19.762 1.00 39.90  ? 1389 ASN A O   1 
ATOM   5364  C  CB  . ASN A 1 793  ? -43.786 27.685  -19.277 1.00 41.03  ? 1389 ASN A CB  1 
ATOM   5365  C  CG  . ASN A 1 793  ? -42.967 28.665  -20.092 1.00 52.45  ? 1389 ASN A CG  1 
ATOM   5366  O  OD1 . ASN A 1 793  ? -43.045 28.683  -21.320 1.00 41.38  ? 1389 ASN A OD1 1 
ATOM   5367  N  ND2 . ASN A 1 793  ? -42.174 29.484  -19.411 1.00 48.26  ? 1389 ASN A ND2 1 
ATOM   5368  N  N   . GLY A 1 794  ? -43.080 24.150  -20.052 1.00 32.51  ? 1390 GLY A N   1 
ATOM   5369  C  CA  . GLY A 1 794  ? -41.982 23.202  -20.021 1.00 31.96  ? 1390 GLY A CA  1 
ATOM   5370  C  C   . GLY A 1 794  ? -42.373 21.736  -19.957 1.00 37.79  ? 1390 GLY A C   1 
ATOM   5371  O  O   . GLY A 1 794  ? -43.552 21.389  -19.881 1.00 31.47  ? 1390 GLY A O   1 
ATOM   5372  N  N   . GLU A 1 795  ? -41.358 20.877  -19.999 1.00 36.12  ? 1391 GLU A N   1 
ATOM   5373  C  CA  . GLU A 1 795  ? -41.534 19.433  -19.897 1.00 33.98  ? 1391 GLU A CA  1 
ATOM   5374  C  C   . GLU A 1 795  ? -41.515 18.981  -18.444 1.00 43.06  ? 1391 GLU A C   1 
ATOM   5375  O  O   . GLU A 1 795  ? -40.954 19.665  -17.588 1.00 38.87  ? 1391 GLU A O   1 
ATOM   5376  C  CB  . GLU A 1 795  ? -40.433 18.706  -20.677 1.00 30.32  ? 1391 GLU A CB  1 
ATOM   5377  C  CG  . GLU A 1 795  ? -40.790 18.369  -22.109 1.00 38.63  ? 1391 GLU A CG  1 
ATOM   5378  C  CD  . GLU A 1 795  ? -41.697 17.161  -22.206 1.00 48.20  ? 1391 GLU A CD  1 
ATOM   5379  O  OE1 . GLU A 1 795  ? -42.853 17.323  -22.648 1.00 44.13  ? 1391 GLU A OE1 1 
ATOM   5380  O  OE2 . GLU A 1 795  ? -41.254 16.051  -21.840 1.00 39.99  ? 1391 GLU A OE2 1 
ATOM   5381  N  N   . PRO A 1 796  ? -42.143 17.831  -18.154 1.00 33.94  ? 1392 PRO A N   1 
ATOM   5382  C  CA  . PRO A 1 796  ? -41.979 17.220  -16.832 1.00 24.31  ? 1392 PRO A CA  1 
ATOM   5383  C  C   . PRO A 1 796  ? -40.520 16.847  -16.589 1.00 28.06  ? 1392 PRO A C   1 
ATOM   5384  O  O   . PRO A 1 796  ? -39.911 16.211  -17.448 1.00 47.49  ? 1392 PRO A O   1 
ATOM   5385  C  CB  . PRO A 1 796  ? -42.864 15.972  -16.906 1.00 30.63  ? 1392 PRO A CB  1 
ATOM   5386  C  CG  . PRO A 1 796  ? -43.867 16.285  -17.964 1.00 23.39  ? 1392 PRO A CG  1 
ATOM   5387  C  CD  . PRO A 1 796  ? -43.136 17.116  -18.974 1.00 23.00  ? 1392 PRO A CD  1 
ATOM   5388  N  N   . GLN A 1 797  ? -39.968 17.241  -15.447 1.00 34.03  ? 1393 GLN A N   1 
ATOM   5389  C  CA  . GLN A 1 797  ? -38.555 17.000  -15.172 1.00 32.26  ? 1393 GLN A CA  1 
ATOM   5390  C  C   . GLN A 1 797  ? -38.283 15.742  -14.354 1.00 31.42  ? 1393 GLN A C   1 
ATOM   5391  O  O   . GLN A 1 797  ? -37.125 15.391  -14.127 1.00 50.22  ? 1393 GLN A O   1 
ATOM   5392  C  CB  . GLN A 1 797  ? -37.951 18.197  -14.440 1.00 32.97  ? 1393 GLN A CB  1 
ATOM   5393  C  CG  . GLN A 1 797  ? -37.904 19.478  -15.242 1.00 23.81  ? 1393 GLN A CG  1 
ATOM   5394  C  CD  . GLN A 1 797  ? -37.243 20.598  -14.469 1.00 39.63  ? 1393 GLN A CD  1 
ATOM   5395  O  OE1 . GLN A 1 797  ? -37.096 21.711  -14.967 1.00 85.28  ? 1393 GLN A OE1 1 
ATOM   5396  N  NE2 . GLN A 1 797  ? -36.839 20.306  -13.238 1.00 61.37  ? 1393 GLN A NE2 1 
ATOM   5397  N  N   . SER A 1 798  ? -39.334 15.058  -13.917 1.00 25.47  ? 1394 SER A N   1 
ATOM   5398  C  CA  . SER A 1 798  ? -39.147 13.916  -13.027 1.00 26.96  ? 1394 SER A CA  1 
ATOM   5399  C  C   . SER A 1 798  ? -40.179 12.824  -13.257 1.00 37.73  ? 1394 SER A C   1 
ATOM   5400  O  O   . SER A 1 798  ? -41.206 13.049  -13.898 1.00 44.47  ? 1394 SER A O   1 
ATOM   5401  C  CB  . SER A 1 798  ? -39.199 14.364  -11.566 1.00 25.62  ? 1394 SER A CB  1 
ATOM   5402  O  OG  . SER A 1 798  ? -40.531 14.626  -11.161 1.00 25.41  ? 1394 SER A OG  1 
ATOM   5403  N  N   . TRP A 1 799  ? -39.893 11.640  -12.723 1.00 32.87  ? 1395 TRP A N   1 
ATOM   5404  C  CA  . TRP A 1 799  ? -40.813 10.513  -12.800 1.00 28.01  ? 1395 TRP A CA  1 
ATOM   5405  C  C   . TRP A 1 799  ? -42.158 10.884  -12.192 1.00 29.82  ? 1395 TRP A C   1 
ATOM   5406  O  O   . TRP A 1 799  ? -43.200 10.669  -12.800 1.00 24.65  ? 1395 TRP A O   1 
ATOM   5407  C  CB  . TRP A 1 799  ? -40.229 9.289   -12.089 1.00 34.25  ? 1395 TRP A CB  1 
ATOM   5408  C  CG  . TRP A 1 799  ? -41.179 8.133   -12.017 1.00 33.79  ? 1395 TRP A CG  1 
ATOM   5409  C  CD1 . TRP A 1 799  ? -41.366 7.165   -12.959 1.00 34.77  ? 1395 TRP A CD1 1 
ATOM   5410  C  CD2 . TRP A 1 799  ? -42.076 7.824   -10.942 1.00 36.09  ? 1395 TRP A CD2 1 
ATOM   5411  N  NE1 . TRP A 1 799  ? -42.323 6.274   -12.541 1.00 31.51  ? 1395 TRP A NE1 1 
ATOM   5412  C  CE2 . TRP A 1 799  ? -42.775 6.656   -11.305 1.00 32.96  ? 1395 TRP A CE2 1 
ATOM   5413  C  CE3 . TRP A 1 799  ? -42.357 8.423   -9.710  1.00 37.73  ? 1395 TRP A CE3 1 
ATOM   5414  C  CZ2 . TRP A 1 799  ? -43.736 6.074   -10.481 1.00 32.70  ? 1395 TRP A CZ2 1 
ATOM   5415  C  CZ3 . TRP A 1 799  ? -43.309 7.843   -8.893  1.00 35.00  ? 1395 TRP A CZ3 1 
ATOM   5416  C  CH2 . TRP A 1 799  ? -43.988 6.681   -9.281  1.00 24.01  ? 1395 TRP A CH2 1 
ATOM   5417  N  N   . PHE A 1 800  ? -42.112 11.451  -10.990 1.00 35.99  ? 1396 PHE A N   1 
ATOM   5418  C  CA  . PHE A 1 800  ? -43.301 11.883  -10.261 1.00 37.49  ? 1396 PHE A CA  1 
ATOM   5419  C  C   . PHE A 1 800  ? -44.165 12.835  -11.093 1.00 34.78  ? 1396 PHE A C   1 
ATOM   5420  O  O   . PHE A 1 800  ? -45.371 12.610  -11.280 1.00 36.53  ? 1396 PHE A O   1 
ATOM   5421  C  CB  . PHE A 1 800  ? -42.874 12.550  -8.951  1.00 32.63  ? 1396 PHE A CB  1 
ATOM   5422  C  CG  . PHE A 1 800  ? -43.997 12.787  -7.988  1.00 25.79  ? 1396 PHE A CG  1 
ATOM   5423  C  CD1 . PHE A 1 800  ? -44.583 11.732  -7.313  1.00 24.42  ? 1396 PHE A CD1 1 
ATOM   5424  C  CD2 . PHE A 1 800  ? -44.452 14.070  -7.739  1.00 32.98  ? 1396 PHE A CD2 1 
ATOM   5425  C  CE1 . PHE A 1 800  ? -45.614 11.950  -6.422  1.00 25.99  ? 1396 PHE A CE1 1 
ATOM   5426  C  CE2 . PHE A 1 800  ? -45.480 14.294  -6.845  1.00 29.39  ? 1396 PHE A CE2 1 
ATOM   5427  C  CZ  . PHE A 1 800  ? -46.062 13.232  -6.186  1.00 24.53  ? 1396 PHE A CZ  1 
ATOM   5428  N  N   . GLN A 1 801  ? -43.532 13.889  -11.600 1.00 27.19  ? 1397 GLN A N   1 
ATOM   5429  C  CA  . GLN A 1 801  ? -44.205 14.865  -12.448 1.00 29.24  ? 1397 GLN A CA  1 
ATOM   5430  C  C   . GLN A 1 801  ? -44.783 14.206  -13.692 1.00 27.08  ? 1397 GLN A C   1 
ATOM   5431  O  O   . GLN A 1 801  ? -45.876 14.551  -14.135 1.00 27.01  ? 1397 GLN A O   1 
ATOM   5432  C  CB  . GLN A 1 801  ? -43.238 15.980  -12.845 1.00 27.01  ? 1397 GLN A CB  1 
ATOM   5433  C  CG  . GLN A 1 801  ? -42.768 16.827  -11.679 1.00 32.20  ? 1397 GLN A CG  1 
ATOM   5434  C  CD  . GLN A 1 801  ? -41.489 17.572  -11.984 1.00 35.20  ? 1397 GLN A CD  1 
ATOM   5435  O  OE1 . GLN A 1 801  ? -40.999 17.550  -13.112 1.00 37.11  ? 1397 GLN A OE1 1 
ATOM   5436  N  NE2 . GLN A 1 801  ? -40.934 18.234  -10.975 1.00 33.93  ? 1397 GLN A NE2 1 
ATOM   5437  N  N   . ARG A 1 802  ? -44.043 13.253  -14.248 1.00 31.53  ? 1398 ARG A N   1 
ATOM   5438  C  CA  . ARG A 1 802  ? -44.504 12.506  -15.410 1.00 25.61  ? 1398 ARG A CA  1 
ATOM   5439  C  C   . ARG A 1 802  ? -45.772 11.724  -15.090 1.00 28.36  ? 1398 ARG A C   1 
ATOM   5440  O  O   . ARG A 1 802  ? -46.680 11.628  -15.917 1.00 34.01  ? 1398 ARG A O   1 
ATOM   5441  C  CB  . ARG A 1 802  ? -43.410 11.560  -15.906 1.00 26.67  ? 1398 ARG A CB  1 
ATOM   5442  C  CG  . ARG A 1 802  ? -42.768 11.993  -17.209 1.00 19.87  ? 1398 ARG A CG  1 
ATOM   5443  C  CD  . ARG A 1 802  ? -41.612 11.084  -17.592 1.00 21.81  ? 1398 ARG A CD  1 
ATOM   5444  N  NE  . ARG A 1 802  ? -40.348 11.544  -17.028 1.00 31.64  ? 1398 ARG A NE  1 
ATOM   5445  C  CZ  . ARG A 1 802  ? -39.556 10.804  -16.262 1.00 21.79  ? 1398 ARG A CZ  1 
ATOM   5446  N  NH1 . ARG A 1 802  ? -39.892 9.557   -15.967 1.00 35.32  ? 1398 ARG A NH1 1 
ATOM   5447  N  NH2 . ARG A 1 802  ? -38.424 11.310  -15.796 1.00 27.51  ? 1398 ARG A NH2 1 
ATOM   5448  N  N   . GLN A 1 803  ? -45.832 11.172  -13.882 1.00 33.78  ? 1399 GLN A N   1 
ATOM   5449  C  CA  . GLN A 1 803  ? -46.990 10.401  -13.450 1.00 28.36  ? 1399 GLN A CA  1 
ATOM   5450  C  C   . GLN A 1 803  ? -48.195 11.304  -13.246 1.00 38.98  ? 1399 GLN A C   1 
ATOM   5451  O  O   . GLN A 1 803  ? -49.310 10.967  -13.647 1.00 33.23  ? 1399 GLN A O   1 
ATOM   5452  C  CB  . GLN A 1 803  ? -46.687 9.643   -12.155 1.00 23.21  ? 1399 GLN A CB  1 
ATOM   5453  C  CG  . GLN A 1 803  ? -45.502 8.698   -12.238 1.00 34.99  ? 1399 GLN A CG  1 
ATOM   5454  C  CD  . GLN A 1 803  ? -45.706 7.585   -13.243 1.00 44.39  ? 1399 GLN A CD  1 
ATOM   5455  O  OE1 . GLN A 1 803  ? -44.936 7.441   -14.193 1.00 49.68  ? 1399 GLN A OE1 1 
ATOM   5456  N  NE2 . GLN A 1 803  ? -46.745 6.785   -13.034 1.00 46.10  ? 1399 GLN A NE2 1 
ATOM   5457  N  N   . LEU A 1 804  ? -47.966 12.458  -12.626 1.00 39.10  ? 1400 LEU A N   1 
ATOM   5458  C  CA  . LEU A 1 804  ? -49.068 13.344  -12.263 1.00 29.45  ? 1400 LEU A CA  1 
ATOM   5459  C  C   . LEU A 1 804  ? -49.528 14.250  -13.406 1.00 27.55  ? 1400 LEU A C   1 
ATOM   5460  O  O   . LEU A 1 804  ? -50.583 14.877  -13.317 1.00 35.95  ? 1400 LEU A O   1 
ATOM   5461  C  CB  . LEU A 1 804  ? -48.676 14.191  -11.053 1.00 29.50  ? 1400 LEU A CB  1 
ATOM   5462  C  CG  . LEU A 1 804  ? -49.192 13.685  -9.705  1.00 31.74  ? 1400 LEU A CG  1 
ATOM   5463  C  CD1 . LEU A 1 804  ? -48.974 12.191  -9.549  1.00 24.15  ? 1400 LEU A CD1 1 
ATOM   5464  C  CD2 . LEU A 1 804  ? -48.521 14.434  -8.573  1.00 29.18  ? 1400 LEU A CD2 1 
ATOM   5465  N  N   . ARG A 1 805  ? -48.743 14.317  -14.477 1.00 39.35  ? 1401 ARG A N   1 
ATOM   5466  C  CA  . ARG A 1 805  ? -49.103 15.144  -15.626 1.00 32.70  ? 1401 ARG A CA  1 
ATOM   5467  C  C   . ARG A 1 805  ? -49.586 14.306  -16.807 1.00 35.36  ? 1401 ARG A C   1 
ATOM   5468  O  O   . ARG A 1 805  ? -50.338 14.788  -17.654 1.00 40.83  ? 1401 ARG A O   1 
ATOM   5469  C  CB  . ARG A 1 805  ? -47.920 16.015  -16.057 1.00 23.66  ? 1401 ARG A CB  1 
ATOM   5470  C  CG  . ARG A 1 805  ? -47.719 17.244  -15.190 1.00 34.70  ? 1401 ARG A CG  1 
ATOM   5471  C  CD  . ARG A 1 805  ? -46.443 17.987  -15.548 1.00 38.71  ? 1401 ARG A CD  1 
ATOM   5472  N  NE  . ARG A 1 805  ? -46.469 18.534  -16.901 1.00 33.02  ? 1401 ARG A NE  1 
ATOM   5473  C  CZ  . ARG A 1 805  ? -45.568 19.393  -17.369 1.00 40.62  ? 1401 ARG A CZ  1 
ATOM   5474  N  NH1 . ARG A 1 805  ? -45.658 19.845  -18.612 1.00 27.94  ? 1401 ARG A NH1 1 
ATOM   5475  N  NH2 . ARG A 1 805  ? -44.579 19.805  -16.588 1.00 35.27  ? 1401 ARG A NH2 1 
ATOM   5476  N  N   . GLY A 1 806  ? -49.150 13.052  -16.862 1.00 26.59  ? 1402 GLY A N   1 
ATOM   5477  C  CA  . GLY A 1 806  ? -49.539 12.166  -17.943 1.00 29.46  ? 1402 GLY A CA  1 
ATOM   5478  C  C   . GLY A 1 806  ? -48.671 12.338  -19.174 1.00 43.36  ? 1402 GLY A C   1 
ATOM   5479  O  O   . GLY A 1 806  ? -47.874 13.273  -19.256 1.00 46.06  ? 1402 GLY A O   1 
ATOM   5480  N  N   . ALA A 1 807  ? -48.824 11.429  -20.132 1.00 38.22  ? 1403 ALA A N   1 
ATOM   5481  C  CA  . ALA A 1 807  ? -48.021 11.447  -21.351 1.00 33.43  ? 1403 ALA A CA  1 
ATOM   5482  C  C   . ALA A 1 807  ? -48.522 12.469  -22.369 1.00 33.73  ? 1403 ALA A C   1 
ATOM   5483  O  O   . ALA A 1 807  ? -47.749 12.969  -23.187 1.00 49.76  ? 1403 ALA A O   1 
ATOM   5484  C  CB  . ALA A 1 807  ? -47.991 10.062  -21.975 1.00 20.18  ? 1403 ALA A CB  1 
ATOM   5485  N  N   . GLN A 1 808  ? -49.814 12.774  -22.320 1.00 32.21  ? 1404 GLN A N   1 
ATOM   5486  C  CA  . GLN A 1 808  ? -50.429 13.663  -23.301 1.00 40.15  ? 1404 GLN A CA  1 
ATOM   5487  C  C   . GLN A 1 808  ? -50.146 15.133  -22.996 1.00 37.95  ? 1404 GLN A C   1 
ATOM   5488  O  O   . GLN A 1 808  ? -50.038 15.526  -21.835 1.00 42.72  ? 1404 GLN A O   1 
ATOM   5489  C  CB  . GLN A 1 808  ? -51.939 13.415  -23.362 1.00 41.25  ? 1404 GLN A CB  1 
ATOM   5490  C  CG  . GLN A 1 808  ? -52.670 14.225  -24.420 1.00 62.67  ? 1404 GLN A CG  1 
ATOM   5491  C  CD  . GLN A 1 808  ? -54.135 13.856  -24.526 1.00 77.70  ? 1404 GLN A CD  1 
ATOM   5492  O  OE1 . GLN A 1 808  ? -54.493 12.678  -24.502 1.00 87.22  ? 1404 GLN A OE1 1 
ATOM   5493  N  NE2 . GLN A 1 808  ? -54.993 14.864  -24.641 1.00 68.65  ? 1404 GLN A NE2 1 
ATOM   5494  N  N   . TYR A 1 809  ? -50.022 15.935  -24.051 1.00 42.80  ? 1405 TYR A N   1 
ATOM   5495  C  CA  . TYR A 1 809  ? -49.770 17.368  -23.922 1.00 35.01  ? 1405 TYR A CA  1 
ATOM   5496  C  C   . TYR A 1 809  ? -50.874 18.075  -23.141 1.00 42.92  ? 1405 TYR A C   1 
ATOM   5497  O  O   . TYR A 1 809  ? -52.058 17.783  -23.312 1.00 52.93  ? 1405 TYR A O   1 
ATOM   5498  C  CB  . TYR A 1 809  ? -49.620 18.008  -25.304 1.00 38.01  ? 1405 TYR A CB  1 
ATOM   5499  C  CG  . TYR A 1 809  ? -49.490 19.515  -25.269 1.00 42.37  ? 1405 TYR A CG  1 
ATOM   5500  C  CD1 . TYR A 1 809  ? -48.286 20.120  -24.937 1.00 44.08  ? 1405 TYR A CD1 1 
ATOM   5501  C  CD2 . TYR A 1 809  ? -50.573 20.332  -25.568 1.00 40.32  ? 1405 TYR A CD2 1 
ATOM   5502  C  CE1 . TYR A 1 809  ? -48.163 21.497  -24.902 1.00 40.80  ? 1405 TYR A CE1 1 
ATOM   5503  C  CE2 . TYR A 1 809  ? -50.458 21.709  -25.541 1.00 48.46  ? 1405 TYR A CE2 1 
ATOM   5504  C  CZ  . TYR A 1 809  ? -49.251 22.285  -25.205 1.00 43.01  ? 1405 TYR A CZ  1 
ATOM   5505  O  OH  . TYR A 1 809  ? -49.132 23.656  -25.173 1.00 44.74  ? 1405 TYR A OH  1 
ATOM   5506  N  N   . GLN A 1 810  ? -50.468 19.008  -22.286 1.00 38.68  ? 1406 GLN A N   1 
ATOM   5507  C  CA  . GLN A 1 810  ? -51.397 19.749  -21.443 1.00 33.04  ? 1406 GLN A CA  1 
ATOM   5508  C  C   . GLN A 1 810  ? -51.198 21.255  -21.569 1.00 38.98  ? 1406 GLN A C   1 
ATOM   5509  O  O   . GLN A 1 810  ? -50.356 21.833  -20.882 1.00 38.77  ? 1406 GLN A O   1 
ATOM   5510  C  CB  . GLN A 1 810  ? -51.256 19.318  -19.984 1.00 44.74  ? 1406 GLN A CB  1 
ATOM   5511  C  CG  . GLN A 1 810  ? -51.793 17.924  -19.704 1.00 40.63  ? 1406 GLN A CG  1 
ATOM   5512  C  CD  . GLN A 1 810  ? -53.290 17.814  -19.940 1.00 45.40  ? 1406 GLN A CD  1 
ATOM   5513  O  OE1 . GLN A 1 810  ? -54.005 18.818  -19.970 1.00 33.18  ? 1406 GLN A OE1 1 
ATOM   5514  N  NE2 . GLN A 1 810  ? -53.771 16.588  -20.109 1.00 37.18  ? 1406 GLN A NE2 1 
ATOM   5515  N  N   . PRO A 1 811  ? -51.965 21.891  -22.467 1.00 42.04  ? 1407 PRO A N   1 
ATOM   5516  C  CA  . PRO A 1 811  ? -51.872 23.332  -22.725 1.00 37.09  ? 1407 PRO A CA  1 
ATOM   5517  C  C   . PRO A 1 811  ? -52.128 24.183  -21.486 1.00 35.35  ? 1407 PRO A C   1 
ATOM   5518  O  O   . PRO A 1 811  ? -51.596 25.288  -21.390 1.00 50.90  ? 1407 PRO A O   1 
ATOM   5519  C  CB  . PRO A 1 811  ? -52.967 23.572  -23.769 1.00 36.27  ? 1407 PRO A CB  1 
ATOM   5520  C  CG  . PRO A 1 811  ? -53.939 22.464  -23.550 1.00 27.50  ? 1407 PRO A CG  1 
ATOM   5521  C  CD  . PRO A 1 811  ? -53.098 21.280  -23.181 1.00 31.35  ? 1407 PRO A CD  1 
ATOM   5522  N  N   . ILE A 1 812  ? -52.931 23.675  -20.556 1.00 36.90  ? 1408 ILE A N   1 
ATOM   5523  C  CA  . ILE A 1 812  ? -53.329 24.459  -19.393 1.00 33.48  ? 1408 ILE A CA  1 
ATOM   5524  C  C   . ILE A 1 812  ? -52.988 23.792  -18.064 1.00 33.76  ? 1408 ILE A C   1 
ATOM   5525  O  O   . ILE A 1 812  ? -53.383 22.657  -17.801 1.00 43.54  ? 1408 ILE A O   1 
ATOM   5526  C  CB  . ILE A 1 812  ? -54.840 24.751  -19.413 1.00 36.28  ? 1408 ILE A CB  1 
ATOM   5527  C  CG1 . ILE A 1 812  ? -55.215 25.543  -20.667 1.00 31.88  ? 1408 ILE A CG1 1 
ATOM   5528  C  CG2 . ILE A 1 812  ? -55.252 25.513  -18.163 1.00 34.05  ? 1408 ILE A CG2 1 
ATOM   5529  C  CD1 . ILE A 1 812  ? -56.683 25.891  -20.752 1.00 34.19  ? 1408 ILE A CD1 1 
ATOM   5530  N  N   . LEU A 1 813  ? -52.247 24.517  -17.234 1.00 34.32  ? 1409 LEU A N   1 
ATOM   5531  C  CA  . LEU A 1 813  ? -52.007 24.125  -15.852 1.00 30.70  ? 1409 LEU A CA  1 
ATOM   5532  C  C   . LEU A 1 813  ? -52.969 24.894  -14.960 1.00 36.16  ? 1409 LEU A C   1 
ATOM   5533  O  O   . LEU A 1 813  ? -53.065 26.117  -15.056 1.00 37.36  ? 1409 LEU A O   1 
ATOM   5534  C  CB  . LEU A 1 813  ? -50.557 24.400  -15.452 1.00 32.90  ? 1409 LEU A CB  1 
ATOM   5535  C  CG  . LEU A 1 813  ? -50.258 24.665  -13.975 1.00 24.82  ? 1409 LEU A CG  1 
ATOM   5536  C  CD1 . LEU A 1 813  ? -50.353 23.390  -13.152 1.00 34.09  ? 1409 LEU A CD1 1 
ATOM   5537  C  CD2 . LEU A 1 813  ? -48.886 25.302  -13.832 1.00 24.77  ? 1409 LEU A CD2 1 
ATOM   5538  N  N   . ARG A 1 814  ? -53.681 24.183  -14.092 1.00 40.65  ? 1410 ARG A N   1 
ATOM   5539  C  CA  . ARG A 1 814  ? -54.745 24.810  -13.320 1.00 34.46  ? 1410 ARG A CA  1 
ATOM   5540  C  C   . ARG A 1 814  ? -54.394 24.963  -11.852 1.00 36.98  ? 1410 ARG A C   1 
ATOM   5541  O  O   . ARG A 1 814  ? -53.657 24.155  -11.285 1.00 35.11  ? 1410 ARG A O   1 
ATOM   5542  C  CB  . ARG A 1 814  ? -56.043 24.013  -13.441 1.00 28.64  ? 1410 ARG A CB  1 
ATOM   5543  C  CG  . ARG A 1 814  ? -56.269 23.390  -14.797 1.00 45.12  ? 1410 ARG A CG  1 
ATOM   5544  C  CD  . ARG A 1 814  ? -57.723 22.999  -14.974 1.00 30.20  ? 1410 ARG A CD  1 
ATOM   5545  N  NE  . ARG A 1 814  ? -58.453 24.005  -15.736 1.00 56.21  ? 1410 ARG A NE  1 
ATOM   5546  C  CZ  . ARG A 1 814  ? -58.617 23.962  -17.053 1.00 59.30  ? 1410 ARG A CZ  1 
ATOM   5547  N  NH1 . ARG A 1 814  ? -58.109 22.955  -17.752 1.00 48.53  ? 1410 ARG A NH1 1 
ATOM   5548  N  NH2 . ARG A 1 814  ? -59.291 24.921  -17.673 1.00 56.01  ? 1410 ARG A NH2 1 
ATOM   5549  N  N   . ASP A 1 815  ? -54.934 26.020  -11.257 1.00 42.09  ? 1411 ASP A N   1 
ATOM   5550  C  CA  . ASP A 1 815  ? -54.835 26.259  -9.826  1.00 35.35  ? 1411 ASP A CA  1 
ATOM   5551  C  C   . ASP A 1 815  ? -53.402 26.334  -9.331  1.00 30.61  ? 1411 ASP A C   1 
ATOM   5552  O  O   . ASP A 1 815  ? -53.097 25.872  -8.231  1.00 36.63  ? 1411 ASP A O   1 
ATOM   5553  C  CB  . ASP A 1 815  ? -55.591 25.173  -9.055  1.00 35.94  ? 1411 ASP A CB  1 
ATOM   5554  C  CG  . ASP A 1 815  ? -57.067 25.141  -9.397  1.00 43.16  ? 1411 ASP A CG  1 
ATOM   5555  O  OD1 . ASP A 1 815  ? -57.645 26.223  -9.633  1.00 44.44  ? 1411 ASP A OD1 1 
ATOM   5556  O  OD2 . ASP A 1 815  ? -57.650 24.038  -9.434  1.00 48.99  ? 1411 ASP A OD2 1 
ATOM   5557  N  N   . HIS A 1 816  ? -52.517 26.928  -10.123 1.00 43.66  ? 1412 HIS A N   1 
ATOM   5558  C  CA  . HIS A 1 816  ? -51.242 27.299  -9.551  1.00 40.05  ? 1412 HIS A CA  1 
ATOM   5559  C  C   . HIS A 1 816  ? -51.504 28.730  -9.128  1.00 29.61  ? 1412 HIS A C   1 
ATOM   5560  O  O   . HIS A 1 816  ? -51.494 29.649  -9.946  1.00 50.37  ? 1412 HIS A O   1 
ATOM   5561  C  CB  . HIS A 1 816  ? -50.128 27.188  -10.598 1.00 25.41  ? 1412 HIS A CB  1 
ATOM   5562  C  CG  . HIS A 1 816  ? -48.738 27.201  -10.044 1.00 33.38  ? 1412 HIS A CG  1 
ATOM   5563  N  ND1 . HIS A 1 816  ? -48.378 26.523  -8.896  1.00 41.12  ? 1412 HIS A ND1 1 
ATOM   5564  C  CD2 . HIS A 1 816  ? -47.604 27.779  -10.506 1.00 28.48  ? 1412 HIS A CD2 1 
ATOM   5565  C  CE1 . HIS A 1 816  ? -47.090 26.703  -8.668  1.00 25.77  ? 1412 HIS A CE1 1 
ATOM   5566  N  NE2 . HIS A 1 816  ? -46.596 27.462  -9.630  1.00 26.17  ? 1412 HIS A NE2 1 
ATOM   5567  N  N   . ILE A 1 817  ? -51.691 28.906  -7.827  1.00 27.92  ? 1413 ILE A N   1 
ATOM   5568  C  CA  . ILE A 1 817  ? -52.146 30.166  -7.251  1.00 32.65  ? 1413 ILE A CA  1 
ATOM   5569  C  C   . ILE A 1 817  ? -51.695 30.245  -5.807  1.00 32.19  ? 1413 ILE A C   1 
ATOM   5570  O  O   . ILE A 1 817  ? -51.640 29.230  -5.120  1.00 31.85  ? 1413 ILE A O   1 
ATOM   5571  C  CB  . ILE A 1 817  ? -53.694 30.331  -7.310  1.00 29.04  ? 1413 ILE A CB  1 
ATOM   5572  C  CG1 . ILE A 1 817  ? -54.405 29.072  -6.816  1.00 40.49  ? 1413 ILE A CG1 1 
ATOM   5573  C  CG2 . ILE A 1 817  ? -54.167 30.690  -8.713  1.00 20.99  ? 1413 ILE A CG2 1 
ATOM   5574  C  CD1 . ILE A 1 817  ? -55.914 29.208  -6.787  1.00 17.15  ? 1413 ILE A CD1 1 
ATOM   5575  N  N   . CYS A 1 818  ? -51.420 31.447  -5.325  1.00 26.73  ? 1414 CYS A N   1 
ATOM   5576  C  CA  . CYS A 1 818  ? -50.953 31.592  -3.959  1.00 28.31  ? 1414 CYS A CA  1 
ATOM   5577  C  C   . CYS A 1 818  ? -51.790 32.605  -3.201  1.00 35.99  ? 1414 CYS A C   1 
ATOM   5578  O  O   . CYS A 1 818  ? -52.403 33.491  -3.797  1.00 32.51  ? 1414 CYS A O   1 
ATOM   5579  C  CB  . CYS A 1 818  ? -49.481 31.992  -3.948  1.00 20.63  ? 1414 CYS A CB  1 
ATOM   5580  S  SG  . CYS A 1 818  ? -48.443 30.844  -4.871  1.00 39.83  ? 1414 CYS A SG  1 
ATOM   5581  N  N   . LYS A 1 819  ? -51.827 32.453  -1.881  1.00 37.81  ? 1415 LYS A N   1 
ATOM   5582  C  CA  . LYS A 1 819  ? -52.514 33.406  -1.024  1.00 30.65  ? 1415 LYS A CA  1 
ATOM   5583  C  C   . LYS A 1 819  ? -51.827 34.752  -1.148  1.00 42.12  ? 1415 LYS A C   1 
ATOM   5584  O  O   . LYS A 1 819  ? -50.635 34.819  -1.450  1.00 38.23  ? 1415 LYS A O   1 
ATOM   5585  C  CB  . LYS A 1 819  ? -52.511 32.934  0.431   1.00 23.19  ? 1415 LYS A CB  1 
ATOM   5586  C  CG  . LYS A 1 819  ? -53.299 31.661  0.673   1.00 34.28  ? 1415 LYS A CG  1 
ATOM   5587  C  CD  . LYS A 1 819  ? -53.070 31.128  2.077   1.00 34.56  ? 1415 LYS A CD  1 
ATOM   5588  C  CE  . LYS A 1 819  ? -53.513 32.127  3.132   1.00 40.79  ? 1415 LYS A CE  1 
ATOM   5589  N  NZ  . LYS A 1 819  ? -53.269 31.613  4.509   1.00 42.99  ? 1415 LYS A NZ  1 
ATOM   5590  N  N   . ASP A 1 820  ? -52.568 35.828  -0.916  1.00 47.02  ? 1416 ASP A N   1 
ATOM   5591  C  CA  . ASP A 1 820  ? -51.954 37.140  -0.980  1.00 32.48  ? 1416 ASP A CA  1 
ATOM   5592  C  C   . ASP A 1 820  ? -51.669 37.574  0.444   1.00 46.18  ? 1416 ASP A C   1 
ATOM   5593  O  O   . ASP A 1 820  ? -52.575 37.925  1.200   1.00 55.18  ? 1416 ASP A O   1 
ATOM   5594  C  CB  . ASP A 1 820  ? -52.875 38.135  -1.692  1.00 41.60  ? 1416 ASP A CB  1 
ATOM   5595  C  CG  . ASP A 1 820  ? -52.165 39.411  -2.091  1.00 47.35  ? 1416 ASP A CG  1 
ATOM   5596  O  OD1 . ASP A 1 820  ? -51.976 40.287  -1.222  1.00 79.76  ? 1416 ASP A OD1 1 
ATOM   5597  O  OD2 . ASP A 1 820  ? -51.798 39.537  -3.278  1.00 68.07  ? 1416 ASP A OD2 1 
ATOM   5598  N  N   . MET A 1 821  ? -50.390 37.546  0.795   1.00 42.02  ? 1417 MET A N   1 
ATOM   5599  C  CA  . MET A 1 821  ? -49.939 37.887  2.135   1.00 42.04  ? 1417 MET A CA  1 
ATOM   5600  C  C   . MET A 1 821  ? -49.744 39.391  2.256   1.00 42.93  ? 1417 MET A C   1 
ATOM   5601  O  O   . MET A 1 821  ? -49.383 40.052  1.283   1.00 45.81  ? 1417 MET A O   1 
ATOM   5602  C  CB  . MET A 1 821  ? -48.646 37.142  2.476   1.00 40.66  ? 1417 MET A CB  1 
ATOM   5603  C  CG  . MET A 1 821  ? -48.689 35.649  2.165   1.00 37.32  ? 1417 MET A CG  1 
ATOM   5604  S  SD  . MET A 1 821  ? -50.088 34.771  2.899   1.00 53.33  ? 1417 MET A SD  1 
ATOM   5605  C  CE  . MET A 1 821  ? -49.606 34.704  4.622   1.00 37.91  ? 1417 MET A CE  1 
ATOM   5606  N  N   . SER A 1 822  ? -49.999 39.925  3.446   1.00 42.47  ? 1418 SER A N   1 
ATOM   5607  C  CA  . SER A 1 822  ? -49.774 41.340  3.717   1.00 37.53  ? 1418 SER A CA  1 
ATOM   5608  C  C   . SER A 1 822  ? -48.336 41.742  3.399   1.00 44.88  ? 1418 SER A C   1 
ATOM   5609  O  O   . SER A 1 822  ? -47.446 40.891  3.328   1.00 48.37  ? 1418 SER A O   1 
ATOM   5610  C  CB  . SER A 1 822  ? -50.100 41.664  5.176   1.00 53.24  ? 1418 SER A CB  1 
ATOM   5611  O  OG  . SER A 1 822  ? -49.274 40.925  6.059   1.00 48.53  ? 1418 SER A OG  1 
ATOM   5612  N  N   . ALA A 1 823  ? -48.119 43.040  3.205   1.00 43.19  ? 1419 ALA A N   1 
ATOM   5613  C  CA  . ALA A 1 823  ? -46.804 43.566  2.849   1.00 53.02  ? 1419 ALA A CA  1 
ATOM   5614  C  C   . ALA A 1 823  ? -45.738 43.149  3.858   1.00 45.65  ? 1419 ALA A C   1 
ATOM   5615  O  O   . ALA A 1 823  ? -44.597 42.859  3.492   1.00 43.19  ? 1419 ALA A O   1 
ATOM   5616  C  CB  . ALA A 1 823  ? -46.858 45.079  2.736   1.00 50.46  ? 1419 ALA A CB  1 
ATOM   5617  N  N   . LEU A 1 824  ? -46.128 43.119  5.128   1.00 39.66  ? 1420 LEU A N   1 
ATOM   5618  C  CA  . LEU A 1 824  ? -45.239 42.705  6.203   1.00 41.27  ? 1420 LEU A CA  1 
ATOM   5619  C  C   . LEU A 1 824  ? -44.786 41.261  6.011   1.00 41.74  ? 1420 LEU A C   1 
ATOM   5620  O  O   . LEU A 1 824  ? -43.585 40.971  5.978   1.00 43.77  ? 1420 LEU A O   1 
ATOM   5621  C  CB  . LEU A 1 824  ? -45.940 42.869  7.553   1.00 38.87  ? 1420 LEU A CB  1 
ATOM   5622  C  CG  . LEU A 1 824  ? -45.147 42.542  8.818   1.00 44.82  ? 1420 LEU A CG  1 
ATOM   5623  C  CD1 . LEU A 1 824  ? -43.919 43.430  8.923   1.00 41.76  ? 1420 LEU A CD1 1 
ATOM   5624  C  CD2 . LEU A 1 824  ? -46.035 42.701  10.037  1.00 39.45  ? 1420 LEU A CD2 1 
ATOM   5625  N  N   . VAL A 1 825  ? -45.757 40.364  5.871   1.00 41.50  ? 1421 VAL A N   1 
ATOM   5626  C  CA  . VAL A 1 825  ? -45.482 38.944  5.693   1.00 42.05  ? 1421 VAL A CA  1 
ATOM   5627  C  C   . VAL A 1 825  ? -44.682 38.696  4.419   1.00 32.17  ? 1421 VAL A C   1 
ATOM   5628  O  O   . VAL A 1 825  ? -43.796 37.847  4.393   1.00 49.68  ? 1421 VAL A O   1 
ATOM   5629  C  CB  . VAL A 1 825  ? -46.786 38.120  5.652   1.00 42.61  ? 1421 VAL A CB  1 
ATOM   5630  C  CG1 . VAL A 1 825  ? -46.484 36.645  5.449   1.00 39.37  ? 1421 VAL A CG1 1 
ATOM   5631  C  CG2 . VAL A 1 825  ? -47.576 38.324  6.933   1.00 29.76  ? 1421 VAL A CG2 1 
ATOM   5632  N  N   . ALA A 1 826  ? -44.988 39.448  3.367   1.00 37.76  ? 1422 ALA A N   1 
ATOM   5633  C  CA  . ALA A 1 826  ? -44.258 39.327  2.109   1.00 34.45  ? 1422 ALA A CA  1 
ATOM   5634  C  C   . ALA A 1 826  ? -42.795 39.730  2.284   1.00 41.11  ? 1422 ALA A C   1 
ATOM   5635  O  O   . ALA A 1 826  ? -41.889 39.058  1.783   1.00 51.25  ? 1422 ALA A O   1 
ATOM   5636  C  CB  . ALA A 1 826  ? -44.916 40.169  1.031   1.00 24.05  ? 1422 ALA A CB  1 
ATOM   5637  N  N   . ALA A 1 827  ? -42.575 40.828  3.002   1.00 36.75  ? 1423 ALA A N   1 
ATOM   5638  C  CA  . ALA A 1 827  ? -41.225 41.304  3.289   1.00 38.52  ? 1423 ALA A CA  1 
ATOM   5639  C  C   . ALA A 1 827  ? -40.440 40.267  4.087   1.00 36.78  ? 1423 ALA A C   1 
ATOM   5640  O  O   . ALA A 1 827  ? -39.295 39.934  3.747   1.00 43.96  ? 1423 ALA A O   1 
ATOM   5641  C  CB  . ALA A 1 827  ? -41.279 42.621  4.042   1.00 37.50  ? 1423 ALA A CB  1 
ATOM   5642  N  N   . ARG A 1 828  ? -41.064 39.762  5.149   1.00 31.32  ? 1424 ARG A N   1 
ATOM   5643  C  CA  . ARG A 1 828  ? -40.473 38.700  5.955   1.00 44.57  ? 1424 ARG A CA  1 
ATOM   5644  C  C   . ARG A 1 828  ? -40.074 37.521  5.080   1.00 37.21  ? 1424 ARG A C   1 
ATOM   5645  O  O   . ARG A 1 828  ? -38.941 37.044  5.143   1.00 41.06  ? 1424 ARG A O   1 
ATOM   5646  C  CB  . ARG A 1 828  ? -41.445 38.228  7.036   1.00 42.95  ? 1424 ARG A CB  1 
ATOM   5647  C  CG  . ARG A 1 828  ? -41.746 39.248  8.116   1.00 35.95  ? 1424 ARG A CG  1 
ATOM   5648  C  CD  . ARG A 1 828  ? -42.830 38.718  9.035   1.00 39.48  ? 1424 ARG A CD  1 
ATOM   5649  N  NE  . ARG A 1 828  ? -43.157 39.639  10.118  1.00 50.38  ? 1424 ARG A NE  1 
ATOM   5650  C  CZ  . ARG A 1 828  ? -44.251 39.544  10.866  1.00 55.16  ? 1424 ARG A CZ  1 
ATOM   5651  N  NH1 . ARG A 1 828  ? -45.126 38.573  10.638  1.00 46.86  ? 1424 ARG A NH1 1 
ATOM   5652  N  NH2 . ARG A 1 828  ? -44.477 40.420  11.835  1.00 58.87  ? 1424 ARG A NH2 1 
ATOM   5653  N  N   . MET A 1 829  ? -41.016 37.066  4.260   1.00 31.93  ? 1425 MET A N   1 
ATOM   5654  C  CA  . MET A 1 829  ? -40.791 35.929  3.378   1.00 38.61  ? 1425 MET A CA  1 
ATOM   5655  C  C   . MET A 1 829  ? -39.611 36.161  2.453   1.00 39.62  ? 1425 MET A C   1 
ATOM   5656  O  O   . MET A 1 829  ? -38.779 35.274  2.269   1.00 52.30  ? 1425 MET A O   1 
ATOM   5657  C  CB  . MET A 1 829  ? -42.044 35.624  2.553   1.00 26.75  ? 1425 MET A CB  1 
ATOM   5658  C  CG  . MET A 1 829  ? -43.133 34.898  3.325   1.00 37.48  ? 1425 MET A CG  1 
ATOM   5659  S  SD  . MET A 1 829  ? -44.423 34.231  2.257   1.00 47.76  ? 1425 MET A SD  1 
ATOM   5660  C  CE  . MET A 1 829  ? -45.036 35.724  1.483   1.00 21.61  ? 1425 MET A CE  1 
ATOM   5661  N  N   . ARG A 1 830  ? -39.529 37.355  1.876   1.00 34.82  ? 1426 ARG A N   1 
ATOM   5662  C  CA  . ARG A 1 830  ? -38.448 37.641  0.945   1.00 37.07  ? 1426 ARG A CA  1 
ATOM   5663  C  C   . ARG A 1 830  ? -37.133 37.870  1.685   1.00 45.07  ? 1426 ARG A C   1 
ATOM   5664  O  O   . ARG A 1 830  ? -36.067 37.903  1.073   1.00 37.01  ? 1426 ARG A O   1 
ATOM   5665  C  CB  . ARG A 1 830  ? -38.797 38.843  0.062   1.00 41.05  ? 1426 ARG A CB  1 
ATOM   5666  C  CG  . ARG A 1 830  ? -38.204 40.167  0.503   1.00 48.91  ? 1426 ARG A CG  1 
ATOM   5667  C  CD  . ARG A 1 830  ? -38.444 41.217  -0.568  1.00 39.90  ? 1426 ARG A CD  1 
ATOM   5668  N  NE  . ARG A 1 830  ? -37.779 42.482  -0.273  1.00 63.38  ? 1426 ARG A NE  1 
ATOM   5669  C  CZ  . ARG A 1 830  ? -38.352 43.495  0.366   1.00 63.61  ? 1426 ARG A CZ  1 
ATOM   5670  N  NH1 . ARG A 1 830  ? -39.607 43.393  0.783   1.00 51.90  ? 1426 ARG A NH1 1 
ATOM   5671  N  NH2 . ARG A 1 830  ? -37.671 44.611  0.588   1.00 62.32  ? 1426 ARG A NH2 1 
ATOM   5672  N  N   . HIS A 1 831  ? -37.208 38.014  3.006   1.00 47.53  ? 1427 HIS A N   1 
ATOM   5673  C  CA  . HIS A 1 831  ? -35.992 38.134  3.810   1.00 34.71  ? 1427 HIS A CA  1 
ATOM   5674  C  C   . HIS A 1 831  ? -35.562 36.815  4.461   1.00 47.49  ? 1427 HIS A C   1 
ATOM   5675  O  O   . HIS A 1 831  ? -34.611 36.786  5.244   1.00 44.88  ? 1427 HIS A O   1 
ATOM   5676  C  CB  . HIS A 1 831  ? -36.167 39.211  4.881   1.00 34.31  ? 1427 HIS A CB  1 
ATOM   5677  C  CG  . HIS A 1 831  ? -35.918 40.594  4.379   1.00 48.95  ? 1427 HIS A CG  1 
ATOM   5678  N  ND1 . HIS A 1 831  ? -36.935 41.438  3.967   1.00 39.60  ? 1427 HIS A ND1 1 
ATOM   5679  C  CD2 . HIS A 1 831  ? -34.769 41.287  4.200   1.00 36.32  ? 1427 HIS A CD2 1 
ATOM   5680  C  CE1 . HIS A 1 831  ? -36.421 42.582  3.570   1.00 53.94  ? 1427 HIS A CE1 1 
ATOM   5681  N  NE2 . HIS A 1 831  ? -35.103 42.519  3.701   1.00 48.66  ? 1427 HIS A NE2 1 
ATOM   5682  N  N   . ILE A 1 832  ? -36.260 35.731  4.139   1.00 47.67  ? 1428 ILE A N   1 
ATOM   5683  C  CA  . ILE A 1 832  ? -35.840 34.402  4.578   1.00 38.16  ? 1428 ILE A CA  1 
ATOM   5684  C  C   . ILE A 1 832  ? -34.813 33.844  3.597   1.00 41.18  ? 1428 ILE A C   1 
ATOM   5685  O  O   . ILE A 1 832  ? -35.079 33.769  2.398   1.00 40.10  ? 1428 ILE A O   1 
ATOM   5686  C  CB  . ILE A 1 832  ? -37.028 33.423  4.684   1.00 39.96  ? 1428 ILE A CB  1 
ATOM   5687  C  CG1 . ILE A 1 832  ? -38.098 33.969  5.629   1.00 32.62  ? 1428 ILE A CG1 1 
ATOM   5688  C  CG2 . ILE A 1 832  ? -36.553 32.057  5.161   1.00 37.68  ? 1428 ILE A CG2 1 
ATOM   5689  C  CD1 . ILE A 1 832  ? -37.684 33.977  7.082   1.00 35.56  ? 1428 ILE A CD1 1 
ATOM   5690  N  N   . PRO A 1 833  ? -33.632 33.457  4.104   1.00 41.33  ? 1429 PRO A N   1 
ATOM   5691  C  CA  . PRO A 1 833  ? -32.539 32.949  3.264   1.00 33.18  ? 1429 PRO A CA  1 
ATOM   5692  C  C   . PRO A 1 833  ? -32.915 31.671  2.516   1.00 46.08  ? 1429 PRO A C   1 
ATOM   5693  O  O   . PRO A 1 833  ? -33.837 30.971  2.932   1.00 44.41  ? 1429 PRO A O   1 
ATOM   5694  C  CB  . PRO A 1 833  ? -31.418 32.673  4.274   1.00 31.31  ? 1429 PRO A CB  1 
ATOM   5695  C  CG  . PRO A 1 833  ? -31.748 33.520  5.454   1.00 40.08  ? 1429 PRO A CG  1 
ATOM   5696  C  CD  . PRO A 1 833  ? -33.241 33.542  5.520   1.00 35.93  ? 1429 PRO A CD  1 
ATOM   5697  N  N   . LEU A 1 834  ? -32.205 31.375  1.431   1.00 45.80  ? 1430 LEU A N   1 
ATOM   5698  C  CA  . LEU A 1 834  ? -32.521 30.214  0.603   1.00 40.52  ? 1430 LEU A CA  1 
ATOM   5699  C  C   . LEU A 1 834  ? -31.866 28.933  1.109   1.00 47.18  ? 1430 LEU A C   1 
ATOM   5700  O  O   . LEU A 1 834  ? -32.199 27.839  0.651   1.00 47.62  ? 1430 LEU A O   1 
ATOM   5701  C  CB  . LEU A 1 834  ? -32.096 30.458  -0.846  1.00 28.81  ? 1430 LEU A CB  1 
ATOM   5702  C  CG  . LEU A 1 834  ? -32.715 31.649  -1.578  1.00 41.65  ? 1430 LEU A CG  1 
ATOM   5703  C  CD1 . LEU A 1 834  ? -32.487 31.519  -3.078  1.00 25.20  ? 1430 LEU A CD1 1 
ATOM   5704  C  CD2 . LEU A 1 834  ? -34.197 31.776  -1.266  1.00 36.29  ? 1430 LEU A CD2 1 
ATOM   5705  N  N   . ALA A 1 835  ? -30.931 29.073  2.044   1.00 48.94  ? 1431 ALA A N   1 
ATOM   5706  C  CA  . ALA A 1 835  ? -30.205 27.926  2.576   1.00 43.21  ? 1431 ALA A CA  1 
ATOM   5707  C  C   . ALA A 1 835  ? -31.134 26.989  3.339   1.00 48.76  ? 1431 ALA A C   1 
ATOM   5708  O  O   . ALA A 1 835  ? -31.995 27.443  4.090   1.00 59.24  ? 1431 ALA A O   1 
ATOM   5709  C  CB  . ALA A 1 835  ? -29.072 28.389  3.473   1.00 39.06  ? 1431 ALA A CB  1 
ATOM   5710  N  N   . PRO A 1 836  ? -30.968 25.672  3.135   1.00 56.58  ? 1432 PRO A N   1 
ATOM   5711  C  CA  . PRO A 1 836  ? -31.777 24.659  3.823   1.00 55.08  ? 1432 PRO A CA  1 
ATOM   5712  C  C   . PRO A 1 836  ? -31.729 24.812  5.339   1.00 47.67  ? 1432 PRO A C   1 
ATOM   5713  O  O   . PRO A 1 836  ? -30.649 24.980  5.905   1.00 54.67  ? 1432 PRO A O   1 
ATOM   5714  C  CB  . PRO A 1 836  ? -31.130 23.341  3.386   1.00 43.28  ? 1432 PRO A CB  1 
ATOM   5715  C  CG  . PRO A 1 836  ? -30.519 23.650  2.065   1.00 43.30  ? 1432 PRO A CG  1 
ATOM   5716  C  CD  . PRO A 1 836  ? -30.032 25.067  2.172   1.00 54.08  ? 1432 PRO A CD  1 
ATOM   5717  N  N   . GLY A 1 837  ? -32.891 24.763  5.983   1.00 57.77  ? 1433 GLY A N   1 
ATOM   5718  C  CA  . GLY A 1 837  ? -32.969 24.921  7.423   1.00 62.84  ? 1433 GLY A CA  1 
ATOM   5719  C  C   . GLY A 1 837  ? -33.331 26.337  7.831   1.00 59.38  ? 1433 GLY A C   1 
ATOM   5720  O  O   . GLY A 1 837  ? -33.264 26.690  9.008   1.00 55.84  ? 1433 GLY A O   1 
ATOM   5721  N  N   . SER A 1 838  ? -33.725 27.149  6.854   1.00 52.67  ? 1434 SER A N   1 
ATOM   5722  C  CA  . SER A 1 838  ? -34.013 28.557  7.100   1.00 41.70  ? 1434 SER A CA  1 
ATOM   5723  C  C   . SER A 1 838  ? -35.454 28.790  7.531   1.00 47.36  ? 1434 SER A C   1 
ATOM   5724  O  O   . SER A 1 838  ? -36.389 28.321  6.885   1.00 48.75  ? 1434 SER A O   1 
ATOM   5725  C  CB  . SER A 1 838  ? -33.718 29.389  5.850   1.00 35.15  ? 1434 SER A CB  1 
ATOM   5726  O  OG  . SER A 1 838  ? -32.355 29.292  5.480   1.00 42.54  ? 1434 SER A OG  1 
ATOM   5727  N  N   . ASP A 1 839  ? -35.621 29.520  8.629   1.00 41.76  ? 1435 ASP A N   1 
ATOM   5728  C  CA  . ASP A 1 839  ? -36.939 29.973  9.054   1.00 40.47  ? 1435 ASP A CA  1 
ATOM   5729  C  C   . ASP A 1 839  ? -36.852 31.386  9.623   1.00 53.12  ? 1435 ASP A C   1 
ATOM   5730  O  O   . ASP A 1 839  ? -35.966 32.157  9.252   1.00 47.10  ? 1435 ASP A O   1 
ATOM   5731  C  CB  . ASP A 1 839  ? -37.552 29.006  10.075  1.00 50.12  ? 1435 ASP A CB  1 
ATOM   5732  C  CG  . ASP A 1 839  ? -36.621 28.698  11.235  1.00 53.90  ? 1435 ASP A CG  1 
ATOM   5733  O  OD1 . ASP A 1 839  ? -35.974 29.628  11.760  1.00 51.11  ? 1435 ASP A OD1 1 
ATOM   5734  O  OD2 . ASP A 1 839  ? -36.550 27.517  11.636  1.00 48.41  ? 1435 ASP A OD2 1 
ATOM   5735  N  N   . TRP A 1 840  ? -37.764 31.716  10.532  1.00 48.47  ? 1436 TRP A N   1 
ATOM   5736  C  CA  . TRP A 1 840  ? -37.849 33.065  11.086  1.00 49.00  ? 1436 TRP A CA  1 
ATOM   5737  C  C   . TRP A 1 840  ? -36.627 33.432  11.920  1.00 58.33  ? 1436 TRP A C   1 
ATOM   5738  O  O   . TRP A 1 840  ? -36.350 34.609  12.145  1.00 49.18  ? 1436 TRP A O   1 
ATOM   5739  C  CB  . TRP A 1 840  ? -39.107 33.207  11.942  1.00 39.11  ? 1436 TRP A CB  1 
ATOM   5740  C  CG  . TRP A 1 840  ? -39.020 32.468  13.240  1.00 49.17  ? 1436 TRP A CG  1 
ATOM   5741  C  CD1 . TRP A 1 840  ? -39.290 31.148  13.450  1.00 56.20  ? 1436 TRP A CD1 1 
ATOM   5742  C  CD2 . TRP A 1 840  ? -38.636 33.007  14.510  1.00 49.31  ? 1436 TRP A CD2 1 
ATOM   5743  N  NE1 . TRP A 1 840  ? -39.098 30.831  14.773  1.00 52.07  ? 1436 TRP A NE1 1 
ATOM   5744  C  CE2 . TRP A 1 840  ? -38.697 31.955  15.445  1.00 51.04  ? 1436 TRP A CE2 1 
ATOM   5745  C  CE3 . TRP A 1 840  ? -38.247 34.276  14.948  1.00 41.79  ? 1436 TRP A CE3 1 
ATOM   5746  C  CZ2 . TRP A 1 840  ? -38.385 32.132  16.790  1.00 51.09  ? 1436 TRP A CZ2 1 
ATOM   5747  C  CZ3 . TRP A 1 840  ? -37.937 34.450  16.284  1.00 50.54  ? 1436 TRP A CZ3 1 
ATOM   5748  C  CH2 . TRP A 1 840  ? -38.008 33.385  17.189  1.00 53.67  ? 1436 TRP A CH2 1 
ATOM   5749  N  N   . ARG A 1 841  ? -35.901 32.420  12.380  1.00 53.38  ? 1437 ARG A N   1 
ATOM   5750  C  CA  . ARG A 1 841  ? -34.745 32.642  13.238  1.00 47.19  ? 1437 ARG A CA  1 
ATOM   5751  C  C   . ARG A 1 841  ? -33.551 33.185  12.458  1.00 51.87  ? 1437 ARG A C   1 
ATOM   5752  O  O   . ARG A 1 841  ? -32.542 33.574  13.046  1.00 47.90  ? 1437 ARG A O   1 
ATOM   5753  C  CB  . ARG A 1 841  ? -34.367 31.348  13.954  1.00 53.98  ? 1437 ARG A CB  1 
ATOM   5754  C  CG  . ARG A 1 841  ? -35.399 30.899  14.975  1.00 50.51  ? 1437 ARG A CG  1 
ATOM   5755  C  CD  . ARG A 1 841  ? -35.077 29.523  15.524  1.00 46.73  ? 1437 ARG A CD  1 
ATOM   5756  N  NE  . ARG A 1 841  ? -35.315 28.475  14.538  1.00 59.09  ? 1437 ARG A NE  1 
ATOM   5757  C  CZ  . ARG A 1 841  ? -35.137 27.180  14.773  1.00 53.82  ? 1437 ARG A CZ  1 
ATOM   5758  N  NH1 . ARG A 1 841  ? -34.716 26.775  15.965  1.00 62.08  ? 1437 ARG A NH1 1 
ATOM   5759  N  NH2 . ARG A 1 841  ? -35.379 26.290  13.821  1.00 50.94  ? 1437 ARG A NH2 1 
ATOM   5760  N  N   . ASP A 1 842  ? -33.672 33.212  11.135  1.00 54.58  ? 1438 ASP A N   1 
ATOM   5761  C  CA  . ASP A 1 842  ? -32.625 33.763  10.283  1.00 43.15  ? 1438 ASP A CA  1 
ATOM   5762  C  C   . ASP A 1 842  ? -32.966 35.182  9.852   1.00 38.87  ? 1438 ASP A C   1 
ATOM   5763  O  O   . ASP A 1 842  ? -32.222 35.806  9.095   1.00 43.83  ? 1438 ASP A O   1 
ATOM   5764  C  CB  . ASP A 1 842  ? -32.411 32.883  9.052   1.00 43.62  ? 1438 ASP A CB  1 
ATOM   5765  C  CG  . ASP A 1 842  ? -32.049 31.460  9.412   1.00 51.59  ? 1438 ASP A CG  1 
ATOM   5766  O  OD1 . ASP A 1 842  ? -30.843 31.173  9.565   1.00 59.36  ? 1438 ASP A OD1 1 
ATOM   5767  O  OD2 . ASP A 1 842  ? -32.971 30.628  9.542   1.00 52.66  ? 1438 ASP A OD2 1 
ATOM   5768  N  N   . LEU A 1 843  ? -34.097 35.685  10.333  1.00 33.26  ? 1439 LEU A N   1 
ATOM   5769  C  CA  . LEU A 1 843  ? -34.540 37.028  9.983   1.00 34.68  ? 1439 LEU A CA  1 
ATOM   5770  C  C   . LEU A 1 843  ? -33.628 38.096  10.561  1.00 40.82  ? 1439 LEU A C   1 
ATOM   5771  O  O   . LEU A 1 843  ? -33.339 38.097  11.757  1.00 51.96  ? 1439 LEU A O   1 
ATOM   5772  C  CB  . LEU A 1 843  ? -35.970 37.267  10.464  1.00 28.08  ? 1439 LEU A CB  1 
ATOM   5773  C  CG  . LEU A 1 843  ? -37.088 36.768  9.554   1.00 41.42  ? 1439 LEU A CG  1 
ATOM   5774  C  CD1 . LEU A 1 843  ? -38.437 37.081  10.172  1.00 35.95  ? 1439 LEU A CD1 1 
ATOM   5775  C  CD2 . LEU A 1 843  ? -36.967 37.403  8.178   1.00 34.23  ? 1439 LEU A CD2 1 
ATOM   5776  N  N   . PRO A 1 844  ? -33.166 39.015  9.705   1.00 40.01  ? 1440 PRO A N   1 
ATOM   5777  C  CA  . PRO A 1 844  ? -32.394 40.158  10.189  1.00 43.89  ? 1440 PRO A CA  1 
ATOM   5778  C  C   . PRO A 1 844  ? -33.299 41.142  10.915  1.00 50.65  ? 1440 PRO A C   1 
ATOM   5779  O  O   . PRO A 1 844  ? -34.447 41.317  10.505  1.00 50.01  ? 1440 PRO A O   1 
ATOM   5780  C  CB  . PRO A 1 844  ? -31.832 40.770  8.906   1.00 46.30  ? 1440 PRO A CB  1 
ATOM   5781  C  CG  . PRO A 1 844  ? -32.843 40.417  7.863   1.00 43.67  ? 1440 PRO A CG  1 
ATOM   5782  C  CD  . PRO A 1 844  ? -33.365 39.057  8.245   1.00 37.91  ? 1440 PRO A CD  1 
ATOM   5783  N  N   . ASN A 1 845  ? -32.803 41.780  11.968  1.00 48.13  ? 1441 ASN A N   1 
ATOM   5784  C  CA  . ASN A 1 845  ? -33.598 42.808  12.615  1.00 45.96  ? 1441 ASN A CA  1 
ATOM   5785  C  C   . ASN A 1 845  ? -33.220 44.144  12.007  1.00 54.06  ? 1441 ASN A C   1 
ATOM   5786  O  O   . ASN A 1 845  ? -32.137 44.671  12.263  1.00 56.38  ? 1441 ASN A O   1 
ATOM   5787  C  CB  . ASN A 1 845  ? -33.365 42.810  14.125  1.00 43.55  ? 1441 ASN A CB  1 
ATOM   5788  C  CG  . ASN A 1 845  ? -34.419 43.594  14.877  1.00 55.68  ? 1441 ASN A CG  1 
ATOM   5789  O  OD1 . ASN A 1 845  ? -35.527 43.802  14.381  1.00 55.29  ? 1441 ASN A OD1 1 
ATOM   5790  N  ND2 . ASN A 1 845  ? -34.083 44.028  16.085  1.00 56.40  ? 1441 ASN A ND2 1 
ATOM   5791  N  N   . ILE A 1 846  ? -34.140 44.705  11.229  1.00 45.32  ? 1442 ILE A N   1 
ATOM   5792  C  CA  . ILE A 1 846  ? -33.858 45.882  10.415  1.00 53.99  ? 1442 ILE A CA  1 
ATOM   5793  C  C   . ILE A 1 846  ? -35.117 46.678  10.127  1.00 62.85  ? 1442 ILE A C   1 
ATOM   5794  O  O   . ILE A 1 846  ? -36.230 46.159  10.209  1.00 52.70  ? 1442 ILE A O   1 
ATOM   5795  C  CB  . ILE A 1 846  ? -33.213 45.515  9.051   1.00 44.53  ? 1442 ILE A CB  1 
ATOM   5796  C  CG1 . ILE A 1 846  ? -33.994 44.386  8.376   1.00 54.16  ? 1442 ILE A CG1 1 
ATOM   5797  C  CG2 . ILE A 1 846  ? -31.745 45.147  9.208   1.00 43.98  ? 1442 ILE A CG2 1 
ATOM   5798  C  CD1 . ILE A 1 846  ? -33.514 44.067  6.974   1.00 41.86  ? 1442 ILE A CD1 1 
ATOM   5799  N  N   . GLU A 1 847  ? -34.927 47.943  9.774   1.00 68.82  ? 1443 GLU A N   1 
ATOM   5800  C  CA  . GLU A 1 847  ? -36.021 48.781  9.317   1.00 63.84  ? 1443 GLU A CA  1 
ATOM   5801  C  C   . GLU A 1 847  ? -36.300 48.473  7.850   1.00 60.68  ? 1443 GLU A C   1 
ATOM   5802  O  O   . GLU A 1 847  ? -35.381 48.433  7.033   1.00 54.58  ? 1443 GLU A O   1 
ATOM   5803  C  CB  . GLU A 1 847  ? -35.687 50.260  9.510   1.00 82.41  ? 1443 GLU A CB  1 
ATOM   5804  C  CG  . GLU A 1 847  ? -36.790 51.071  10.167  1.00 78.78  ? 1443 GLU A CG  1 
ATOM   5805  C  CD  . GLU A 1 847  ? -36.371 52.503  10.438  1.00 80.30  ? 1443 GLU A CD  1 
ATOM   5806  O  OE1 . GLU A 1 847  ? -35.179 52.824  10.243  1.00 74.65  ? 1443 GLU A OE1 1 
ATOM   5807  O  OE2 . GLU A 1 847  ? -37.234 53.309  10.843  1.00 81.08  ? 1443 GLU A OE2 1 
ATOM   5808  N  N   . VAL A 1 848  ? -37.567 48.237  7.522   1.00 59.79  ? 1444 VAL A N   1 
ATOM   5809  C  CA  . VAL A 1 848  ? -37.950 47.888  6.158   1.00 62.58  ? 1444 VAL A CA  1 
ATOM   5810  C  C   . VAL A 1 848  ? -39.086 48.777  5.660   1.00 63.14  ? 1444 VAL A C   1 
ATOM   5811  O  O   . VAL A 1 848  ? -39.998 49.117  6.415   1.00 55.27  ? 1444 VAL A O   1 
ATOM   5812  C  CB  . VAL A 1 848  ? -38.379 46.402  6.054   1.00 64.33  ? 1444 VAL A CB  1 
ATOM   5813  C  CG1 . VAL A 1 848  ? -38.734 46.034  4.618   1.00 56.77  ? 1444 VAL A CG1 1 
ATOM   5814  C  CG2 . VAL A 1 848  ? -37.280 45.492  6.569   1.00 56.76  ? 1444 VAL A CG2 1 
ATOM   5815  N  N   . ARG A 1 849  ? -39.025 49.148  4.385   1.00 62.56  ? 1445 ARG A N   1 
ATOM   5816  C  CA  . ARG A 1 849  ? -40.091 49.917  3.758   1.00 70.78  ? 1445 ARG A CA  1 
ATOM   5817  C  C   . ARG A 1 849  ? -41.077 48.955  3.111   1.00 67.58  ? 1445 ARG A C   1 
ATOM   5818  O  O   . ARG A 1 849  ? -40.752 48.287  2.129   1.00 51.85  ? 1445 ARG A O   1 
ATOM   5819  C  CB  . ARG A 1 849  ? -39.518 50.879  2.716   1.00 63.69  ? 1445 ARG A CB  1 
ATOM   5820  C  CG  . ARG A 1 849  ? -39.761 52.353  2.998   1.00 73.08  ? 1445 ARG A CG  1 
ATOM   5821  C  CD  . ARG A 1 849  ? -41.100 52.812  2.444   1.00 90.50  ? 1445 ARG A CD  1 
ATOM   5822  N  NE  . ARG A 1 849  ? -41.173 54.266  2.331   1.00 121.04 ? 1445 ARG A NE  1 
ATOM   5823  C  CZ  . ARG A 1 849  ? -42.149 54.918  1.706   1.00 126.35 ? 1445 ARG A CZ  1 
ATOM   5824  N  NH1 . ARG A 1 849  ? -43.138 54.245  1.134   1.00 110.06 ? 1445 ARG A NH1 1 
ATOM   5825  N  NH2 . ARG A 1 849  ? -42.135 56.243  1.649   1.00 122.08 ? 1445 ARG A NH2 1 
ATOM   5826  N  N   . LEU A 1 850  ? -42.283 48.890  3.665   1.00 56.90  ? 1446 LEU A N   1 
ATOM   5827  C  CA  . LEU A 1 850  ? -43.297 47.955  3.193   1.00 50.28  ? 1446 LEU A CA  1 
ATOM   5828  C  C   . LEU A 1 850  ? -43.944 48.427  1.898   1.00 64.95  ? 1446 LEU A C   1 
ATOM   5829  O  O   . LEU A 1 850  ? -43.935 49.617  1.585   1.00 75.47  ? 1446 LEU A O   1 
ATOM   5830  C  CB  . LEU A 1 850  ? -44.362 47.737  4.267   1.00 57.63  ? 1446 LEU A CB  1 
ATOM   5831  C  CG  . LEU A 1 850  ? -43.865 47.104  5.565   1.00 55.07  ? 1446 LEU A CG  1 
ATOM   5832  C  CD1 . LEU A 1 850  ? -45.031 46.772  6.481   1.00 64.09  ? 1446 LEU A CD1 1 
ATOM   5833  C  CD2 . LEU A 1 850  ? -43.044 45.862  5.267   1.00 51.22  ? 1446 LEU A CD2 1 
ATOM   5834  N  N   . SER A 1 851  ? -44.503 47.477  1.152   1.00 79.24  ? 1447 SER A N   1 
ATOM   5835  C  CA  . SER A 1 851  ? -45.111 47.749  -0.147  1.00 76.83  ? 1447 SER A CA  1 
ATOM   5836  C  C   . SER A 1 851  ? -46.227 48.787  -0.074  1.00 80.79  ? 1447 SER A C   1 
ATOM   5837  O  O   . SER A 1 851  ? -46.458 49.527  -1.029  1.00 80.27  ? 1447 SER A O   1 
ATOM   5838  C  CB  . SER A 1 851  ? -45.656 46.453  -0.752  1.00 64.49  ? 1447 SER A CB  1 
ATOM   5839  O  OG  . SER A 1 851  ? -44.656 45.450  -0.799  1.00 88.51  ? 1447 SER A OG  1 
ATOM   5840  N  N   . ASP A 1 852  ? -46.919 48.837  1.060   1.00 64.67  ? 1448 ASP A N   1 
ATOM   5841  C  CA  . ASP A 1 852  ? -48.031 49.764  1.234   1.00 72.04  ? 1448 ASP A CA  1 
ATOM   5842  C  C   . ASP A 1 852  ? -47.565 51.127  1.741   1.00 90.11  ? 1448 ASP A C   1 
ATOM   5843  O  O   . ASP A 1 852  ? -48.374 52.032  1.946   1.00 92.79  ? 1448 ASP A O   1 
ATOM   5844  C  CB  . ASP A 1 852  ? -49.072 49.175  2.190   1.00 77.86  ? 1448 ASP A CB  1 
ATOM   5845  C  CG  . ASP A 1 852  ? -48.455 48.646  3.470   1.00 77.17  ? 1448 ASP A CG  1 
ATOM   5846  O  OD1 . ASP A 1 852  ? -47.271 48.944  3.731   1.00 70.71  ? 1448 ASP A OD1 1 
ATOM   5847  O  OD2 . ASP A 1 852  ? -49.156 47.936  4.222   1.00 74.23  ? 1448 ASP A OD2 1 
ATOM   5848  N  N   . GLY A 1 853  ? -46.259 51.266  1.945   1.00 92.36  ? 1449 GLY A N   1 
ATOM   5849  C  CA  . GLY A 1 853  ? -45.690 52.524  2.394   1.00 83.82  ? 1449 GLY A CA  1 
ATOM   5850  C  C   . GLY A 1 853  ? -45.401 52.551  3.882   1.00 79.07  ? 1449 GLY A C   1 
ATOM   5851  O  O   . GLY A 1 853  ? -44.784 53.490  4.387   1.00 82.34  ? 1449 GLY A O   1 
ATOM   5852  N  N   . THR A 1 854  ? -45.854 51.519  4.585   1.00 74.98  ? 1450 THR A N   1 
ATOM   5853  C  CA  . THR A 1 854  ? -45.630 51.414  6.021   1.00 70.66  ? 1450 THR A CA  1 
ATOM   5854  C  C   . THR A 1 854  ? -44.157 51.155  6.311   1.00 74.51  ? 1450 THR A C   1 
ATOM   5855  O  O   . THR A 1 854  ? -43.422 50.674  5.448   1.00 71.96  ? 1450 THR A O   1 
ATOM   5856  C  CB  . THR A 1 854  ? -46.479 50.289  6.647   1.00 74.17  ? 1450 THR A CB  1 
ATOM   5857  O  OG1 . THR A 1 854  ? -47.736 50.203  5.967   1.00 99.02  ? 1450 THR A OG1 1 
ATOM   5858  C  CG2 . THR A 1 854  ? -46.724 50.555  8.126   1.00 74.50  ? 1450 THR A CG2 1 
ATOM   5859  N  N   . MET A 1 855  ? -43.726 51.483  7.523   1.00 72.47  ? 1451 MET A N   1 
ATOM   5860  C  CA  . MET A 1 855  ? -42.356 51.222  7.934   1.00 77.68  ? 1451 MET A CA  1 
ATOM   5861  C  C   . MET A 1 855  ? -42.322 50.109  8.973   1.00 88.06  ? 1451 MET A C   1 
ATOM   5862  O  O   . MET A 1 855  ? -43.063 50.146  9.956   1.00 91.37  ? 1451 MET A O   1 
ATOM   5863  C  CB  . MET A 1 855  ? -41.709 52.489  8.493   1.00 66.52  ? 1451 MET A CB  1 
ATOM   5864  C  CG  . MET A 1 855  ? -40.215 52.573  8.248   1.00 69.70  ? 1451 MET A CG  1 
ATOM   5865  S  SD  . MET A 1 855  ? -39.849 52.681  6.488   1.00 86.74  ? 1451 MET A SD  1 
ATOM   5866  C  CE  . MET A 1 855  ? -38.059 52.705  6.512   1.00 76.72  ? 1451 MET A CE  1 
ATOM   5867  N  N   . ALA A 1 856  ? -41.465 49.118  8.752   1.00 84.41  ? 1452 ALA A N   1 
ATOM   5868  C  CA  . ALA A 1 856  ? -41.305 48.037  9.714   1.00 77.44  ? 1452 ALA A CA  1 
ATOM   5869  C  C   . ALA A 1 856  ? -40.142 48.347  10.646  1.00 67.10  ? 1452 ALA A C   1 
ATOM   5870  O  O   . ALA A 1 856  ? -38.988 48.357  10.227  1.00 71.63  ? 1452 ALA A O   1 
ATOM   5871  C  CB  . ALA A 1 856  ? -41.083 46.714  9.002   1.00 52.19  ? 1452 ALA A CB  1 
ATOM   5872  N  N   . ARG A 1 857  ? -40.455 48.600  11.912  1.00 74.72  ? 1453 ARG A N   1 
ATOM   5873  C  CA  . ARG A 1 857  ? -39.441 48.973  12.890  1.00 83.09  ? 1453 ARG A CA  1 
ATOM   5874  C  C   . ARG A 1 857  ? -38.672 47.765  13.412  1.00 68.51  ? 1453 ARG A C   1 
ATOM   5875  O  O   . ARG A 1 857  ? -39.172 46.640  13.392  1.00 59.53  ? 1453 ARG A O   1 
ATOM   5876  C  CB  . ARG A 1 857  ? -40.081 49.738  14.051  1.00 75.58  ? 1453 ARG A CB  1 
ATOM   5877  C  CG  . ARG A 1 857  ? -40.731 51.042  13.622  1.00 68.55  ? 1453 ARG A CG  1 
ATOM   5878  C  CD  . ARG A 1 857  ? -39.784 51.847  12.745  1.00 79.67  ? 1453 ARG A CD  1 
ATOM   5879  N  NE  . ARG A 1 857  ? -40.493 52.797  11.892  1.00 90.72  ? 1453 ARG A NE  1 
ATOM   5880  C  CZ  . ARG A 1 857  ? -40.454 54.116  12.047  1.00 95.75  ? 1453 ARG A CZ  1 
ATOM   5881  N  NH1 . ARG A 1 857  ? -39.733 54.652  13.022  1.00 102.24 ? 1453 ARG A NH1 1 
ATOM   5882  N  NH2 . ARG A 1 857  ? -41.133 54.900  11.222  1.00 80.06  ? 1453 ARG A NH2 1 
ATOM   5883  N  N   . LYS A 1 858  ? -37.446 48.009  13.864  1.00 53.73  ? 1454 LYS A N   1 
ATOM   5884  C  CA  . LYS A 1 858  ? -36.632 46.968  14.476  1.00 51.27  ? 1454 LYS A CA  1 
ATOM   5885  C  C   . LYS A 1 858  ? -37.291 46.471  15.752  1.00 54.81  ? 1454 LYS A C   1 
ATOM   5886  O  O   . LYS A 1 858  ? -37.934 47.241  16.468  1.00 57.95  ? 1454 LYS A O   1 
ATOM   5887  C  CB  . LYS A 1 858  ? -35.227 47.486  14.789  1.00 49.10  ? 1454 LYS A CB  1 
ATOM   5888  C  CG  . LYS A 1 858  ? -34.482 48.044  13.593  1.00 66.78  ? 1454 LYS A CG  1 
ATOM   5889  C  CD  . LYS A 1 858  ? -33.139 48.624  14.009  1.00 64.22  ? 1454 LYS A CD  1 
ATOM   5890  C  CE  . LYS A 1 858  ? -32.251 47.570  14.656  1.00 65.28  ? 1454 LYS A CE  1 
ATOM   5891  N  NZ  . LYS A 1 858  ? -30.905 48.107  15.008  1.00 57.68  ? 1454 LYS A NZ  1 
ATOM   5892  N  N   . LEU A 1 859  ? -37.139 45.182  16.034  1.00 54.90  ? 1455 LEU A N   1 
ATOM   5893  C  CA  . LEU A 1 859  ? -37.617 44.638  17.294  1.00 48.29  ? 1455 LEU A CA  1 
ATOM   5894  C  C   . LEU A 1 859  ? -36.701 45.101  18.414  1.00 61.31  ? 1455 LEU A C   1 
ATOM   5895  O  O   . LEU A 1 859  ? -35.486 44.913  18.352  1.00 61.87  ? 1455 LEU A O   1 
ATOM   5896  C  CB  . LEU A 1 859  ? -37.678 43.110  17.252  1.00 50.15  ? 1455 LEU A CB  1 
ATOM   5897  C  CG  . LEU A 1 859  ? -38.224 42.427  18.510  1.00 52.88  ? 1455 LEU A CG  1 
ATOM   5898  C  CD1 . LEU A 1 859  ? -39.703 42.734  18.691  1.00 48.27  ? 1455 LEU A CD1 1 
ATOM   5899  C  CD2 . LEU A 1 859  ? -37.987 40.926  18.459  1.00 35.55  ? 1455 LEU A CD2 1 
ATOM   5900  N  N   . ARG A 1 860  ? -37.285 45.717  19.435  1.00 54.70  ? 1456 ARG A N   1 
ATOM   5901  C  CA  . ARG A 1 860  ? -36.515 46.161  20.586  1.00 59.61  ? 1456 ARG A CA  1 
ATOM   5902  C  C   . ARG A 1 860  ? -36.526 45.093  21.665  1.00 68.07  ? 1456 ARG A C   1 
ATOM   5903  O  O   . ARG A 1 860  ? -37.543 44.438  21.888  1.00 66.66  ? 1456 ARG A O   1 
ATOM   5904  C  CB  . ARG A 1 860  ? -37.069 47.473  21.142  1.00 59.09  ? 1456 ARG A CB  1 
ATOM   5905  C  CG  . ARG A 1 860  ? -36.654 48.702  20.361  1.00 58.66  ? 1456 ARG A CG  1 
ATOM   5906  C  CD  . ARG A 1 860  ? -36.918 49.961  21.164  1.00 75.67  ? 1456 ARG A CD  1 
ATOM   5907  N  NE  . ARG A 1 860  ? -35.922 50.993  20.892  1.00 126.93 ? 1456 ARG A NE  1 
ATOM   5908  C  CZ  . ARG A 1 860  ? -34.743 51.069  21.501  1.00 123.03 ? 1456 ARG A CZ  1 
ATOM   5909  N  NH1 . ARG A 1 860  ? -34.407 50.171  22.417  1.00 103.59 ? 1456 ARG A NH1 1 
ATOM   5910  N  NH2 . ARG A 1 860  ? -33.897 52.043  21.193  1.00 89.62  ? 1456 ARG A NH2 1 
ATOM   5911  N  N   . TYR A 1 861  ? -35.392 44.911  22.331  1.00 68.29  ? 1457 TYR A N   1 
ATOM   5912  C  CA  . TYR A 1 861  ? -35.333 43.962  23.430  1.00 66.72  ? 1457 TYR A CA  1 
ATOM   5913  C  C   . TYR A 1 861  ? -35.318 44.699  24.759  1.00 72.60  ? 1457 TYR A C   1 
ATOM   5914  O  O   . TYR A 1 861  ? -34.321 45.314  25.140  1.00 63.27  ? 1457 TYR A O   1 
ATOM   5915  C  CB  . TYR A 1 861  ? -34.109 43.071  23.286  1.00 56.12  ? 1457 TYR A CB  1 
ATOM   5916  C  CG  . TYR A 1 861  ? -34.201 42.112  22.123  1.00 65.48  ? 1457 TYR A CG  1 
ATOM   5917  C  CD1 . TYR A 1 861  ? -33.753 42.474  20.859  1.00 64.59  ? 1457 TYR A CD1 1 
ATOM   5918  C  CD2 . TYR A 1 861  ? -34.746 40.847  22.288  1.00 64.39  ? 1457 TYR A CD2 1 
ATOM   5919  C  CE1 . TYR A 1 861  ? -33.842 41.599  19.794  1.00 56.86  ? 1457 TYR A CE1 1 
ATOM   5920  C  CE2 . TYR A 1 861  ? -34.839 39.968  21.231  1.00 57.63  ? 1457 TYR A CE2 1 
ATOM   5921  C  CZ  . TYR A 1 861  ? -34.386 40.347  19.987  1.00 58.47  ? 1457 TYR A CZ  1 
ATOM   5922  O  OH  . TYR A 1 861  ? -34.479 39.470  18.932  1.00 54.75  ? 1457 TYR A OH  1 
ATOM   5923  N  N   . THR A 1 862  ? -36.443 44.617  25.460  1.00 77.62  ? 1458 THR A N   1 
ATOM   5924  C  CA  . THR A 1 862  ? -36.673 45.406  26.662  1.00 78.19  ? 1458 THR A CA  1 
ATOM   5925  C  C   . THR A 1 862  ? -36.414 44.678  27.980  1.00 83.84  ? 1458 THR A C   1 
ATOM   5926  O  O   . THR A 1 862  ? -36.551 45.271  29.050  1.00 92.42  ? 1458 THR A O   1 
ATOM   5927  C  CB  . THR A 1 862  ? -38.115 45.934  26.676  1.00 85.28  ? 1458 THR A CB  1 
ATOM   5928  O  OG1 . THR A 1 862  ? -39.021 44.847  26.444  1.00 83.28  ? 1458 THR A OG1 1 
ATOM   5929  C  CG2 . THR A 1 862  ? -38.304 46.973  25.582  1.00 60.60  ? 1458 THR A CG2 1 
ATOM   5930  N  N   . HIS A 1 863  ? -36.053 43.401  27.916  1.00 74.04  ? 1459 HIS A N   1 
ATOM   5931  C  CA  . HIS A 1 863  ? -35.909 42.606  29.134  1.00 74.75  ? 1459 HIS A CA  1 
ATOM   5932  C  C   . HIS A 1 863  ? -34.748 41.622  29.069  1.00 77.45  ? 1459 HIS A C   1 
ATOM   5933  O  O   . HIS A 1 863  ? -34.351 41.181  27.993  1.00 90.66  ? 1459 HIS A O   1 
ATOM   5934  C  CB  . HIS A 1 863  ? -37.203 41.839  29.429  1.00 82.58  ? 1459 HIS A CB  1 
ATOM   5935  C  CG  . HIS A 1 863  ? -38.382 42.717  29.710  1.00 94.23  ? 1459 HIS A CG  1 
ATOM   5936  N  ND1 . HIS A 1 863  ? -39.091 43.355  28.715  1.00 90.50  ? 1459 HIS A ND1 1 
ATOM   5937  C  CD2 . HIS A 1 863  ? -38.984 43.057  30.875  1.00 94.27  ? 1459 HIS A CD2 1 
ATOM   5938  C  CE1 . HIS A 1 863  ? -40.075 44.052  29.253  1.00 89.90  ? 1459 HIS A CE1 1 
ATOM   5939  N  NE2 . HIS A 1 863  ? -40.033 43.888  30.563  1.00 71.39  ? 1459 HIS A NE2 1 
ATOM   5940  N  N   . HIS A 1 864  ? -34.214 41.279  30.237  1.00 82.51  ? 1460 HIS A N   1 
ATOM   5941  C  CA  . HIS A 1 864  ? -33.154 40.285  30.341  1.00 85.48  ? 1460 HIS A CA  1 
ATOM   5942  C  C   . HIS A 1 864  ? -33.757 38.893  30.467  1.00 91.79  ? 1460 HIS A C   1 
ATOM   5943  O  O   . HIS A 1 864  ? -34.526 38.627  31.391  1.00 80.76  ? 1460 HIS A O   1 
ATOM   5944  C  CB  . HIS A 1 864  ? -32.254 40.584  31.541  1.00 87.26  ? 1460 HIS A CB  1 
ATOM   5945  C  CG  . HIS A 1 864  ? -31.119 39.621  31.705  1.00 82.74  ? 1460 HIS A CG  1 
ATOM   5946  N  ND1 . HIS A 1 864  ? -29.840 39.897  31.271  1.00 87.94  ? 1460 HIS A ND1 1 
ATOM   5947  C  CD2 . HIS A 1 864  ? -31.068 38.386  32.260  1.00 82.46  ? 1460 HIS A CD2 1 
ATOM   5948  C  CE1 . HIS A 1 864  ? -29.052 38.875  31.550  1.00 96.16  ? 1460 HIS A CE1 1 
ATOM   5949  N  NE2 . HIS A 1 864  ? -29.773 37.945  32.150  1.00 96.08  ? 1460 HIS A NE2 1 
ATOM   5950  N  N   . ASP A 1 865  ? -33.412 38.006  29.540  1.00 86.03  ? 1461 ASP A N   1 
ATOM   5951  C  CA  . ASP A 1 865  ? -33.953 36.655  29.570  1.00 88.75  ? 1461 ASP A CA  1 
ATOM   5952  C  C   . ASP A 1 865  ? -33.064 35.732  30.394  1.00 93.23  ? 1461 ASP A C   1 
ATOM   5953  O  O   . ASP A 1 865  ? -31.895 35.519  30.074  1.00 90.78  ? 1461 ASP A O   1 
ATOM   5954  C  CB  . ASP A 1 865  ? -34.122 36.106  28.153  1.00 92.05  ? 1461 ASP A CB  1 
ATOM   5955  C  CG  . ASP A 1 865  ? -34.990 34.862  28.115  1.00 89.93  ? 1461 ASP A CG  1 
ATOM   5956  O  OD1 . ASP A 1 865  ? -35.630 34.550  29.142  1.00 77.23  ? 1461 ASP A OD1 1 
ATOM   5957  O  OD2 . ASP A 1 865  ? -35.045 34.202  27.057  1.00 93.26  ? 1461 ASP A OD2 1 
ATOM   5958  N  N   . ARG A 1 866  ? -33.644 35.197  31.463  1.00 98.78  ? 1462 ARG A N   1 
ATOM   5959  C  CA  . ARG A 1 866  ? -32.962 34.285  32.374  1.00 93.58  ? 1462 ARG A CA  1 
ATOM   5960  C  C   . ARG A 1 866  ? -32.372 33.073  31.660  1.00 95.08  ? 1462 ARG A C   1 
ATOM   5961  O  O   . ARG A 1 866  ? -31.155 32.884  31.640  1.00 84.41  ? 1462 ARG A O   1 
ATOM   5962  C  CB  . ARG A 1 866  ? -33.933 33.826  33.462  1.00 107.41 ? 1462 ARG A CB  1 
ATOM   5963  C  CG  . ARG A 1 866  ? -33.458 32.642  34.285  1.00 117.99 ? 1462 ARG A CG  1 
ATOM   5964  C  CD  . ARG A 1 866  ? -34.608 32.045  35.081  1.00 130.64 ? 1462 ARG A CD  1 
ATOM   5965  N  NE  . ARG A 1 866  ? -34.594 32.461  36.481  1.00 125.87 ? 1462 ARG A NE  1 
ATOM   5966  C  CZ  . ARG A 1 866  ? -35.107 33.600  36.932  1.00 115.75 ? 1462 ARG A CZ  1 
ATOM   5967  N  NH1 . ARG A 1 866  ? -35.675 34.453  36.093  1.00 125.85 ? 1462 ARG A NH1 1 
ATOM   5968  N  NH2 . ARG A 1 866  ? -35.048 33.888  38.225  1.00 120.26 ? 1462 ARG A NH2 1 
ATOM   5969  N  N   . LYS A 1 867  ? -33.245 32.252  31.085  1.00 88.18  ? 1463 LYS A N   1 
ATOM   5970  C  CA  . LYS A 1 867  ? -32.839 31.002  30.452  1.00 75.79  ? 1463 LYS A CA  1 
ATOM   5971  C  C   . LYS A 1 867  ? -31.855 31.201  29.307  1.00 88.68  ? 1463 LYS A C   1 
ATOM   5972  O  O   . LYS A 1 867  ? -30.846 30.502  29.221  1.00 86.12  ? 1463 LYS A O   1 
ATOM   5973  C  CB  . LYS A 1 867  ? -34.067 30.252  29.935  1.00 74.98  ? 1463 LYS A CB  1 
ATOM   5974  C  CG  . LYS A 1 867  ? -35.129 30.004  30.982  1.00 89.18  ? 1463 LYS A CG  1 
ATOM   5975  C  CD  . LYS A 1 867  ? -34.577 29.230  32.162  1.00 113.57 ? 1463 LYS A CD  1 
ATOM   5976  C  CE  . LYS A 1 867  ? -35.706 28.792  33.070  1.00 98.10  ? 1463 LYS A CE  1 
ATOM   5977  N  NZ  . LYS A 1 867  ? -36.683 29.896  33.262  1.00 106.14 ? 1463 LYS A NZ  1 
ATOM   5978  N  N   . ASN A 1 868  ? -32.157 32.151  28.429  1.00 84.87  ? 1464 ASN A N   1 
ATOM   5979  C  CA  . ASN A 1 868  ? -31.397 32.332  27.198  1.00 70.62  ? 1464 ASN A CA  1 
ATOM   5980  C  C   . ASN A 1 868  ? -30.221 33.298  27.325  1.00 72.76  ? 1464 ASN A C   1 
ATOM   5981  O  O   . ASN A 1 868  ? -29.419 33.431  26.401  1.00 75.41  ? 1464 ASN A O   1 
ATOM   5982  C  CB  . ASN A 1 868  ? -32.333 32.802  26.086  1.00 66.92  ? 1464 ASN A CB  1 
ATOM   5983  C  CG  . ASN A 1 868  ? -33.467 31.828  25.834  1.00 76.56  ? 1464 ASN A CG  1 
ATOM   5984  O  OD1 . ASN A 1 868  ? -33.275 30.612  25.880  1.00 69.18  ? 1464 ASN A OD1 1 
ATOM   5985  N  ND2 . ASN A 1 868  ? -34.657 32.357  25.575  1.00 77.34  ? 1464 ASN A ND2 1 
ATOM   5986  N  N   . GLY A 1 869  ? -30.125 33.973  28.464  1.00 69.03  ? 1465 GLY A N   1 
ATOM   5987  C  CA  . GLY A 1 869  ? -28.970 34.799  28.764  1.00 81.12  ? 1465 GLY A CA  1 
ATOM   5988  C  C   . GLY A 1 869  ? -28.809 36.064  27.940  1.00 72.30  ? 1465 GLY A C   1 
ATOM   5989  O  O   . GLY A 1 869  ? -29.764 36.813  27.728  1.00 73.66  ? 1465 GLY A O   1 
ATOM   5990  N  N   . ARG A 1 870  ? -27.587 36.294  27.470  1.00 69.63  ? 1466 ARG A N   1 
ATOM   5991  C  CA  . ARG A 1 870  ? -27.225 37.559  26.841  1.00 82.97  ? 1466 ARG A CA  1 
ATOM   5992  C  C   . ARG A 1 870  ? -26.404 37.337  25.573  1.00 77.59  ? 1466 ARG A C   1 
ATOM   5993  O  O   . ARG A 1 870  ? -25.667 36.357  25.464  1.00 84.64  ? 1466 ARG A O   1 
ATOM   5994  C  CB  . ARG A 1 870  ? -26.444 38.424  27.833  1.00 90.07  ? 1466 ARG A CB  1 
ATOM   5995  C  CG  . ARG A 1 870  ? -26.801 39.900  27.821  1.00 89.99  ? 1466 ARG A CG  1 
ATOM   5996  C  CD  . ARG A 1 870  ? -26.811 40.458  29.237  1.00 78.91  ? 1466 ARG A CD  1 
ATOM   5997  N  NE  . ARG A 1 870  ? -26.916 41.914  29.271  1.00 97.02  ? 1466 ARG A NE  1 
ATOM   5998  C  CZ  . ARG A 1 870  ? -27.215 42.614  30.361  1.00 91.49  ? 1466 ARG A CZ  1 
ATOM   5999  N  NH1 . ARG A 1 870  ? -27.452 41.991  31.508  1.00 83.17  ? 1466 ARG A NH1 1 
ATOM   6000  N  NH2 . ARG A 1 870  ? -27.285 43.937  30.305  1.00 75.54  ? 1466 ARG A NH2 1 
ATOM   6001  N  N   . SER A 1 871  ? -26.537 38.252  24.616  1.00 72.87  ? 1467 SER A N   1 
ATOM   6002  C  CA  . SER A 1 871  ? -25.785 38.177  23.367  1.00 89.98  ? 1467 SER A CA  1 
ATOM   6003  C  C   . SER A 1 871  ? -24.304 38.432  23.614  1.00 92.75  ? 1467 SER A C   1 
ATOM   6004  O  O   . SER A 1 871  ? -23.928 38.976  24.652  1.00 91.11  ? 1467 SER A O   1 
ATOM   6005  C  CB  . SER A 1 871  ? -26.323 39.179  22.344  1.00 80.01  ? 1467 SER A CB  1 
ATOM   6006  O  OG  . SER A 1 871  ? -25.811 40.479  22.584  1.00 75.16  ? 1467 SER A OG  1 
ATOM   6007  N  N   . SER A 1 872  ? -23.466 38.014  22.669  1.00 95.12  ? 1468 SER A N   1 
ATOM   6008  C  CA  . SER A 1 872  ? -22.035 38.303  22.723  1.00 104.39 ? 1468 SER A CA  1 
ATOM   6009  C  C   . SER A 1 872  ? -21.787 39.798  22.903  1.00 106.31 ? 1468 SER A C   1 
ATOM   6010  O  O   . SER A 1 872  ? -20.870 40.206  23.617  1.00 105.10 ? 1468 SER A O   1 
ATOM   6011  C  CB  . SER A 1 872  ? -21.334 37.805  21.460  1.00 95.30  ? 1468 SER A CB  1 
ATOM   6012  O  OG  . SER A 1 872  ? -19.970 38.183  21.452  1.00 102.59 ? 1468 SER A OG  1 
ATOM   6013  N  N   . SER A 1 873  ? -22.620 40.609  22.258  1.00 98.36  ? 1469 SER A N   1 
ATOM   6014  C  CA  . SER A 1 873  ? -22.550 42.057  22.399  1.00 90.70  ? 1469 SER A CA  1 
ATOM   6015  C  C   . SER A 1 873  ? -22.984 42.494  23.794  1.00 96.94  ? 1469 SER A C   1 
ATOM   6016  O  O   . SER A 1 873  ? -22.627 43.577  24.254  1.00 94.51  ? 1469 SER A O   1 
ATOM   6017  C  CB  . SER A 1 873  ? -23.418 42.743  21.343  1.00 83.74  ? 1469 SER A CB  1 
ATOM   6018  O  OG  . SER A 1 873  ? -22.957 42.455  20.035  1.00 102.07 ? 1469 SER A OG  1 
ATOM   6019  N  N   . GLY A 1 874  ? -23.753 41.641  24.463  1.00 99.86  ? 1470 GLY A N   1 
ATOM   6020  C  CA  . GLY A 1 874  ? -24.269 41.952  25.784  1.00 95.00  ? 1470 GLY A CA  1 
ATOM   6021  C  C   . GLY A 1 874  ? -25.684 42.495  25.734  1.00 95.57  ? 1470 GLY A C   1 
ATOM   6022  O  O   . GLY A 1 874  ? -26.172 43.073  26.705  1.00 101.24 ? 1470 GLY A O   1 
ATOM   6023  N  N   . ALA A 1 875  ? -26.344 42.307  24.597  1.00 95.63  ? 1471 ALA A N   1 
ATOM   6024  C  CA  . ALA A 1 875  ? -27.707 42.790  24.409  1.00 78.47  ? 1471 ALA A CA  1 
ATOM   6025  C  C   . ALA A 1 875  ? -28.734 41.883  25.086  1.00 78.25  ? 1471 ALA A C   1 
ATOM   6026  O  O   . ALA A 1 875  ? -28.516 40.682  25.232  1.00 76.03  ? 1471 ALA A O   1 
ATOM   6027  C  CB  . ALA A 1 875  ? -28.018 42.922  22.928  1.00 94.24  ? 1471 ALA A CB  1 
ATOM   6028  N  N   . LEU A 1 876  ? -29.854 42.474  25.489  1.00 81.60  ? 1472 LEU A N   1 
ATOM   6029  C  CA  . LEU A 1 876  ? -30.937 41.749  26.149  1.00 73.90  ? 1472 LEU A CA  1 
ATOM   6030  C  C   . LEU A 1 876  ? -31.684 40.872  25.150  1.00 65.08  ? 1472 LEU A C   1 
ATOM   6031  O  O   . LEU A 1 876  ? -31.872 41.266  24.004  1.00 74.55  ? 1472 LEU A O   1 
ATOM   6032  C  CB  . LEU A 1 876  ? -31.910 42.727  26.813  1.00 81.43  ? 1472 LEU A CB  1 
ATOM   6033  C  CG  . LEU A 1 876  ? -31.364 43.937  27.575  1.00 85.28  ? 1472 LEU A CG  1 
ATOM   6034  C  CD1 . LEU A 1 876  ? -31.134 45.122  26.641  1.00 78.62  ? 1472 LEU A CD1 1 
ATOM   6035  C  CD2 . LEU A 1 876  ? -32.312 44.320  28.699  1.00 70.32  ? 1472 LEU A CD2 1 
ATOM   6036  N  N   . ARG A 1 877  ? -32.043 39.656  25.549  1.00 64.20  ? 1473 ARG A N   1 
ATOM   6037  C  CA  . ARG A 1 877  ? -32.846 38.803  24.676  1.00 61.16  ? 1473 ARG A CA  1 
ATOM   6038  C  C   . ARG A 1 877  ? -34.360 38.734  24.950  1.00 61.61  ? 1473 ARG A C   1 
ATOM   6039  O  O   . ARG A 1 877  ? -35.086 38.085  24.195  1.00 72.49  ? 1473 ARG A O   1 
ATOM   6040  C  CB  . ARG A 1 877  ? -32.255 37.392  24.694  1.00 56.90  ? 1473 ARG A CB  1 
ATOM   6041  C  CG  . ARG A 1 877  ? -30.919 37.334  23.971  1.00 54.58  ? 1473 ARG A CG  1 
ATOM   6042  C  CD  . ARG A 1 877  ? -30.273 35.964  24.001  1.00 57.85  ? 1473 ARG A CD  1 
ATOM   6043  N  NE  . ARG A 1 877  ? -29.068 35.958  23.176  1.00 67.82  ? 1473 ARG A NE  1 
ATOM   6044  C  CZ  . ARG A 1 877  ? -28.229 34.934  23.073  1.00 73.37  ? 1473 ARG A CZ  1 
ATOM   6045  N  NH1 . ARG A 1 877  ? -28.456 33.818  23.751  1.00 62.72  ? 1473 ARG A NH1 1 
ATOM   6046  N  NH2 . ARG A 1 877  ? -27.160 35.028  22.294  1.00 70.76  ? 1473 ARG A NH2 1 
ATOM   6047  N  N   . GLY A 1 878  ? -34.845 39.370  26.014  1.00 71.70  ? 1474 GLY A N   1 
ATOM   6048  C  CA  . GLY A 1 878  ? -36.278 39.356  26.283  1.00 72.22  ? 1474 GLY A CA  1 
ATOM   6049  C  C   . GLY A 1 878  ? -37.091 40.428  25.575  1.00 70.12  ? 1474 GLY A C   1 
ATOM   6050  O  O   . GLY A 1 878  ? -36.641 41.566  25.442  1.00 63.86  ? 1474 GLY A O   1 
ATOM   6051  N  N   . VAL A 1 879  ? -38.290 40.070  25.118  1.00 71.09  ? 1475 VAL A N   1 
ATOM   6052  C  CA  . VAL A 1 879  ? -39.242 41.057  24.607  1.00 85.46  ? 1475 VAL A CA  1 
ATOM   6053  C  C   . VAL A 1 879  ? -40.345 41.452  25.595  1.00 85.80  ? 1475 VAL A C   1 
ATOM   6054  O  O   . VAL A 1 879  ? -41.173 42.309  25.287  1.00 85.62  ? 1475 VAL A O   1 
ATOM   6055  C  CB  . VAL A 1 879  ? -39.913 40.562  23.314  1.00 70.43  ? 1475 VAL A CB  1 
ATOM   6056  C  CG1 . VAL A 1 879  ? -38.880 40.396  22.213  1.00 67.03  ? 1475 VAL A CG1 1 
ATOM   6057  C  CG2 . VAL A 1 879  ? -40.654 39.265  23.564  1.00 70.61  ? 1475 VAL A CG2 1 
ATOM   6058  N  N   . CYS A 1 880  ? -40.367 40.829  26.770  1.00 87.00  ? 1476 CYS A N   1 
ATOM   6059  C  CA  . CYS A 1 880  ? -41.467 41.043  27.709  1.00 85.73  ? 1476 CYS A CA  1 
ATOM   6060  C  C   . CYS A 1 880  ? -41.089 40.664  29.137  1.00 90.44  ? 1476 CYS A C   1 
ATOM   6061  O  O   . CYS A 1 880  ? -40.093 39.981  29.363  1.00 83.46  ? 1476 CYS A O   1 
ATOM   6062  C  CB  . CYS A 1 880  ? -42.703 40.250  27.272  1.00 70.81  ? 1476 CYS A CB  1 
ATOM   6063  S  SG  . CYS A 1 880  ? -44.180 40.543  28.273  1.00 78.08  ? 1476 CYS A SG  1 
ATOM   6064  N  N   . SER A 1 881  ? -41.899 41.108  30.094  1.00 91.14  ? 1477 SER A N   1 
ATOM   6065  C  CA  . SER A 1 881  ? -41.641 40.860  31.509  1.00 81.00  ? 1477 SER A CA  1 
ATOM   6066  C  C   . SER A 1 881  ? -41.817 39.389  31.866  1.00 84.43  ? 1477 SER A C   1 
ATOM   6067  O  O   . SER A 1 881  ? -41.203 38.886  32.812  1.00 82.49  ? 1477 SER A O   1 
ATOM   6068  C  CB  . SER A 1 881  ? -42.569 41.717  32.373  1.00 84.56  ? 1477 SER A CB  1 
ATOM   6069  O  OG  . SER A 1 881  ? -42.575 43.065  31.937  1.00 97.83  ? 1477 SER A OG  1 
ATOM   6070  N  N   . CYS A 1 882  ? -42.646 38.699  31.088  1.00 94.20  ? 1478 CYS A N   1 
ATOM   6071  C  CA  . CYS A 1 882  ? -43.037 37.326  31.390  1.00 87.59  ? 1478 CYS A CA  1 
ATOM   6072  C  C   . CYS A 1 882  ? -41.878 36.332  31.326  1.00 86.71  ? 1478 CYS A C   1 
ATOM   6073  O  O   . CYS A 1 882  ? -42.051 35.154  31.638  1.00 86.91  ? 1478 CYS A O   1 
ATOM   6074  C  CB  . CYS A 1 882  ? -44.149 36.876  30.439  1.00 82.24  ? 1478 CYS A CB  1 
ATOM   6075  S  SG  . CYS A 1 882  ? -43.650 36.772  28.706  1.00 101.84 ? 1478 CYS A SG  1 
ATOM   6076  N  N   . VAL A 1 883  ? -40.701 36.797  30.921  1.00 83.53  ? 1479 VAL A N   1 
ATOM   6077  C  CA  . VAL A 1 883  ? -39.516 35.947  30.928  1.00 86.43  ? 1479 VAL A CA  1 
ATOM   6078  C  C   . VAL A 1 883  ? -39.036 35.720  32.358  1.00 110.27 ? 1479 VAL A C   1 
ATOM   6079  O  O   . VAL A 1 883  ? -38.339 34.746  32.642  1.00 106.67 ? 1479 VAL A O   1 
ATOM   6080  C  CB  . VAL A 1 883  ? -38.364 36.546  30.094  1.00 91.77  ? 1479 VAL A CB  1 
ATOM   6081  C  CG1 . VAL A 1 883  ? -38.729 36.567  28.619  1.00 92.70  ? 1479 VAL A CG1 1 
ATOM   6082  C  CG2 . VAL A 1 883  ? -38.010 37.941  30.590  1.00 84.50  ? 1479 VAL A CG2 1 
ATOM   6083  N  N   . GLU A 1 884  ? -39.426 36.619  33.258  1.00 123.14 ? 1480 GLU A N   1 
ATOM   6084  C  CA  . GLU A 1 884  ? -39.020 36.530  34.657  1.00 127.64 ? 1480 GLU A CA  1 
ATOM   6085  C  C   . GLU A 1 884  ? -39.990 35.649  35.456  1.00 133.66 ? 1480 GLU A C   1 
ATOM   6086  O  O   . GLU A 1 884  ? -40.012 35.682  36.688  1.00 138.37 ? 1480 GLU A O   1 
ATOM   6087  C  CB  . GLU A 1 884  ? -38.927 37.939  35.260  1.00 110.91 ? 1480 GLU A CB  1 
ATOM   6088  C  CG  . GLU A 1 884  ? -38.215 38.041  36.607  1.00 114.32 ? 1480 GLU A CG  1 
ATOM   6089  C  CD  . GLU A 1 884  ? -37.072 37.052  36.747  1.00 127.41 ? 1480 GLU A CD  1 
ATOM   6090  O  OE1 . GLU A 1 884  ? -36.007 37.278  36.136  1.00 120.70 ? 1480 GLU A OE1 1 
ATOM   6091  O  OE2 . GLU A 1 884  ? -37.239 36.045  37.467  1.00 131.78 ? 1480 GLU A OE2 1 
ATOM   6092  N  N   . ALA A 1 885  ? -40.793 34.864  34.741  1.00 128.01 ? 1481 ALA A N   1 
ATOM   6093  C  CA  . ALA A 1 885  ? -41.798 33.983  35.345  1.00 122.99 ? 1481 ALA A CA  1 
ATOM   6094  C  C   . ALA A 1 885  ? -42.819 34.743  36.184  1.00 128.81 ? 1481 ALA A C   1 
ATOM   6095  O  O   . ALA A 1 885  ? -43.706 34.132  36.777  1.00 117.74 ? 1481 ALA A O   1 
ATOM   6096  C  CB  . ALA A 1 885  ? -41.116 32.918  36.190  1.00 20.00  ? 1481 ALA A CB  1 
ATOM   6097  N  N   . GLY A 1 886  ? -42.696 36.067  36.227  1.00 150.28 ? 1482 GLY A N   1 
ATOM   6098  C  CA  . GLY A 1 886  ? -43.516 36.895  37.092  1.00 152.17 ? 1482 GLY A CA  1 
ATOM   6099  C  C   . GLY A 1 886  ? -44.973 36.829  36.689  1.00 160.32 ? 1482 GLY A C   1 
ATOM   6100  O  O   . GLY A 1 886  ? -45.859 37.177  37.476  1.00 165.69 ? 1482 GLY A O   1 
ATOM   6101  N  N   . LYS A 1 887  ? -45.210 36.381  35.455  1.00 143.35 ? 1483 LYS A N   1 
ATOM   6102  C  CA  . LYS A 1 887  ? -46.557 36.188  34.924  1.00 145.61 ? 1483 LYS A CA  1 
ATOM   6103  C  C   . LYS A 1 887  ? -47.337 37.492  35.019  1.00 146.87 ? 1483 LYS A C   1 
ATOM   6104  O  O   . LYS A 1 887  ? -48.305 37.613  35.774  1.00 157.48 ? 1483 LYS A O   1 
ATOM   6105  C  CB  . LYS A 1 887  ? -47.284 35.073  35.676  1.00 20.00  ? 1483 LYS A CB  1 
ATOM   6106  C  CG  . LYS A 1 887  ? -46.702 33.687  35.449  1.00 20.00  ? 1483 LYS A CG  1 
ATOM   6107  C  CD  . LYS A 1 887  ? -47.456 32.633  36.243  1.00 20.00  ? 1483 LYS A CD  1 
ATOM   6108  C  CE  . LYS A 1 887  ? -46.889 31.245  35.997  1.00 20.00  ? 1483 LYS A CE  1 
ATOM   6109  N  NZ  . LYS A 1 887  ? -47.603 30.205  36.788  1.00 20.00  ? 1483 LYS A NZ  1 
ATOM   6110  N  N   . ALA A 1 888  ? -46.870 38.463  34.241  1.00 110.47 ? 1484 ALA A N   1 
ATOM   6111  C  CA  . ALA A 1 888  ? -47.385 39.825  34.222  1.00 127.15 ? 1484 ALA A CA  1 
ATOM   6112  C  C   . ALA A 1 888  ? -47.887 40.167  32.827  1.00 131.72 ? 1484 ALA A C   1 
ATOM   6113  O  O   . ALA A 1 888  ? -49.066 40.451  32.621  1.00 138.74 ? 1484 ALA A O   1 
ATOM   6114  C  CB  . ALA A 1 888  ? -46.316 40.803  34.641  1.00 102.13 ? 1484 ALA A CB  1 
ATOM   6115  N  N   . CYS A 1 889  ? -46.947 40.135  31.881  1.00 101.90 ? 1485 CYS A N   1 
ATOM   6116  C  CA  . CYS A 1 889  ? -47.162 40.546  30.499  1.00 97.95  ? 1485 CYS A CA  1 
ATOM   6117  C  C   . CYS A 1 889  ? -47.549 42.023  30.407  1.00 90.26  ? 1485 CYS A C   1 
ATOM   6118  O  O   . CYS A 1 889  ? -48.698 42.356  30.115  1.00 79.03  ? 1485 CYS A O   1 
ATOM   6119  C  CB  . CYS A 1 889  ? -48.233 39.681  29.831  1.00 102.36 ? 1485 CYS A CB  1 
ATOM   6120  S  SG  . CYS A 1 889  ? -47.655 38.097  29.164  1.00 98.49  ? 1485 CYS A SG  1 
ATOM   6121  N  N   . ASP A 1 890  ? -46.582 42.894  30.693  1.00 83.60  ? 1486 ASP A N   1 
ATOM   6122  C  CA  . ASP A 1 890  ? -46.691 44.325  30.425  1.00 88.93  ? 1486 ASP A CA  1 
ATOM   6123  C  C   . ASP A 1 890  ? -47.283 44.548  29.037  1.00 91.79  ? 1486 ASP A C   1 
ATOM   6124  O  O   . ASP A 1 890  ? -46.588 44.387  28.035  1.00 97.07  ? 1486 ASP A O   1 
ATOM   6125  C  CB  . ASP A 1 890  ? -45.318 44.997  30.534  1.00 84.29  ? 1486 ASP A CB  1 
ATOM   6126  C  CG  . ASP A 1 890  ? -45.400 46.511  30.446  1.00 100.24 ? 1486 ASP A CG  1 
ATOM   6127  O  OD1 . ASP A 1 890  ? -46.499 47.065  30.670  1.00 94.43  ? 1486 ASP A OD1 1 
ATOM   6128  O  OD2 . ASP A 1 890  ? -44.366 47.148  30.157  1.00 89.77  ? 1486 ASP A OD2 1 
ATOM   6129  N  N   . PRO A 1 891  ? -48.574 44.921  28.977  1.00 89.55  ? 1487 PRO A N   1 
ATOM   6130  C  CA  . PRO A 1 891  ? -49.308 45.089  27.718  1.00 91.82  ? 1487 PRO A CA  1 
ATOM   6131  C  C   . PRO A 1 891  ? -48.758 46.256  26.910  1.00 98.23  ? 1487 PRO A C   1 
ATOM   6132  O  O   . PRO A 1 891  ? -48.980 46.351  25.701  1.00 112.52 ? 1487 PRO A O   1 
ATOM   6133  C  CB  . PRO A 1 891  ? -50.748 45.375  28.177  1.00 102.18 ? 1487 PRO A CB  1 
ATOM   6134  C  CG  . PRO A 1 891  ? -50.775 45.060  29.654  1.00 101.63 ? 1487 PRO A CG  1 
ATOM   6135  C  CD  . PRO A 1 891  ? -49.390 45.334  30.130  1.00 94.54  ? 1487 PRO A CD  1 
ATOM   6136  N  N   . ALA A 1 892  ? -48.043 47.143  27.595  1.00 91.87  ? 1488 ALA A N   1 
ATOM   6137  C  CA  . ALA A 1 892  ? -47.392 48.277  26.959  1.00 100.62 ? 1488 ALA A CA  1 
ATOM   6138  C  C   . ALA A 1 892  ? -46.104 47.847  26.266  1.00 99.05  ? 1488 ALA A C   1 
ATOM   6139  O  O   . ALA A 1 892  ? -45.543 48.594  25.466  1.00 94.16  ? 1488 ALA A O   1 
ATOM   6140  C  CB  . ALA A 1 892  ? -47.105 49.362  27.987  1.00 106.32 ? 1488 ALA A CB  1 
ATOM   6141  N  N   . ALA A 1 893  ? -45.643 46.638  26.574  1.00 98.00  ? 1489 ALA A N   1 
ATOM   6142  C  CA  . ALA A 1 893  ? -44.380 46.142  26.038  1.00 99.14  ? 1489 ALA A CA  1 
ATOM   6143  C  C   . ALA A 1 893  ? -44.574 45.298  24.780  1.00 87.13  ? 1489 ALA A C   1 
ATOM   6144  O  O   . ALA A 1 893  ? -43.602 44.832  24.185  1.00 85.81  ? 1489 ALA A O   1 
ATOM   6145  C  CB  . ALA A 1 893  ? -43.638 45.342  27.097  1.00 80.10  ? 1489 ALA A CB  1 
ATOM   6146  N  N   . ARG A 1 894  ? -45.826 45.097  24.380  1.00 89.40  ? 1490 ARG A N   1 
ATOM   6147  C  CA  . ARG A 1 894  ? -46.120 44.379  23.145  1.00 74.16  ? 1490 ARG A CA  1 
ATOM   6148  C  C   . ARG A 1 894  ? -45.677 45.217  21.951  1.00 76.53  ? 1490 ARG A C   1 
ATOM   6149  O  O   . ARG A 1 894  ? -45.908 46.425  21.917  1.00 78.89  ? 1490 ARG A O   1 
ATOM   6150  C  CB  . ARG A 1 894  ? -47.612 44.053  23.040  1.00 77.22  ? 1490 ARG A CB  1 
ATOM   6151  C  CG  . ARG A 1 894  ? -47.907 42.714  22.382  1.00 84.77  ? 1490 ARG A CG  1 
ATOM   6152  C  CD  . ARG A 1 894  ? -49.310 42.665  21.797  1.00 89.96  ? 1490 ARG A CD  1 
ATOM   6153  N  NE  . ARG A 1 894  ? -50.312 43.231  22.696  1.00 122.32 ? 1490 ARG A NE  1 
ATOM   6154  C  CZ  . ARG A 1 894  ? -51.614 43.269  22.432  1.00 125.60 ? 1490 ARG A CZ  1 
ATOM   6155  N  NH1 . ARG A 1 894  ? -52.078 42.767  21.295  1.00 109.00 ? 1490 ARG A NH1 1 
ATOM   6156  N  NH2 . ARG A 1 894  ? -52.455 43.806  23.306  1.00 94.79  ? 1490 ARG A NH2 1 
ATOM   6157  N  N   . GLN A 1 895  ? -45.038 44.579  20.975  1.00 73.09  ? 1491 GLN A N   1 
ATOM   6158  C  CA  . GLN A 1 895  ? -44.536 45.298  19.808  1.00 59.75  ? 1491 GLN A CA  1 
ATOM   6159  C  C   . GLN A 1 895  ? -45.243 44.869  18.526  1.00 66.26  ? 1491 GLN A C   1 
ATOM   6160  O  O   . GLN A 1 895  ? -45.557 43.693  18.340  1.00 66.03  ? 1491 GLN A O   1 
ATOM   6161  C  CB  . GLN A 1 895  ? -43.025 45.096  19.671  1.00 53.39  ? 1491 GLN A CB  1 
ATOM   6162  C  CG  . GLN A 1 895  ? -42.243 45.478  20.917  1.00 56.09  ? 1491 GLN A CG  1 
ATOM   6163  C  CD  . GLN A 1 895  ? -40.748 45.530  20.677  1.00 52.71  ? 1491 GLN A CD  1 
ATOM   6164  O  OE1 . GLN A 1 895  ? -40.294 45.909  19.597  1.00 59.33  ? 1491 GLN A OE1 1 
ATOM   6165  N  NE2 . GLN A 1 895  ? -39.973 45.146  21.684  1.00 58.69  ? 1491 GLN A NE2 1 
ATOM   6166  N  N   . PHE A 1 896  ? -45.488 45.833  17.644  1.00 59.85  ? 1492 PHE A N   1 
ATOM   6167  C  CA  . PHE A 1 896  ? -46.206 45.577  16.401  1.00 58.25  ? 1492 PHE A CA  1 
ATOM   6168  C  C   . PHE A 1 896  ? -45.388 45.978  15.177  1.00 60.48  ? 1492 PHE A C   1 
ATOM   6169  O  O   . PHE A 1 896  ? -44.458 46.779  15.277  1.00 60.92  ? 1492 PHE A O   1 
ATOM   6170  C  CB  . PHE A 1 896  ? -47.542 46.323  16.388  1.00 57.26  ? 1492 PHE A CB  1 
ATOM   6171  C  CG  . PHE A 1 896  ? -48.445 45.981  17.538  1.00 67.29  ? 1492 PHE A CG  1 
ATOM   6172  C  CD1 . PHE A 1 896  ? -49.342 44.930  17.443  1.00 59.36  ? 1492 PHE A CD1 1 
ATOM   6173  C  CD2 . PHE A 1 896  ? -48.405 46.719  18.710  1.00 66.21  ? 1492 PHE A CD2 1 
ATOM   6174  C  CE1 . PHE A 1 896  ? -50.178 44.617  18.498  1.00 75.97  ? 1492 PHE A CE1 1 
ATOM   6175  C  CE2 . PHE A 1 896  ? -49.238 46.410  19.769  1.00 73.47  ? 1492 PHE A CE2 1 
ATOM   6176  C  CZ  . PHE A 1 896  ? -50.125 45.358  19.662  1.00 89.51  ? 1492 PHE A CZ  1 
ATOM   6177  N  N   . ASN A 1 897  ? -45.755 45.417  14.027  1.00 57.64  ? 1493 ASN A N   1 
ATOM   6178  C  CA  . ASN A 1 897  ? -45.128 45.733  12.744  1.00 57.60  ? 1493 ASN A CA  1 
ATOM   6179  C  C   . ASN A 1 897  ? -43.606 45.632  12.745  1.00 54.75  ? 1493 ASN A C   1 
ATOM   6180  O  O   . ASN A 1 897  ? -42.912 46.544  12.297  1.00 60.50  ? 1493 ASN A O   1 
ATOM   6181  C  CB  . ASN A 1 897  ? -45.542 47.131  12.284  1.00 61.48  ? 1493 ASN A CB  1 
ATOM   6182  C  CG  . ASN A 1 897  ? -46.520 47.095  11.129  1.00 80.88  ? 1493 ASN A CG  1 
ATOM   6183  O  OD1 . ASN A 1 897  ? -47.447 46.284  11.111  1.00 73.51  ? 1493 ASN A OD1 1 
ATOM   6184  N  ND2 . ASN A 1 897  ? -46.308 47.962  10.148  1.00 89.46  ? 1493 ASN A ND2 1 
ATOM   6185  N  N   . THR A 1 898  ? -43.096 44.518  13.252  1.00 45.64  ? 1494 THR A N   1 
ATOM   6186  C  CA  . THR A 1 898  ? -41.667 44.247  13.216  1.00 44.53  ? 1494 THR A CA  1 
ATOM   6187  C  C   . THR A 1 898  ? -41.379 43.153  12.199  1.00 50.83  ? 1494 THR A C   1 
ATOM   6188  O  O   . THR A 1 898  ? -42.203 42.260  11.995  1.00 43.36  ? 1494 THR A O   1 
ATOM   6189  C  CB  . THR A 1 898  ? -41.135 43.823  14.596  1.00 51.31  ? 1494 THR A CB  1 
ATOM   6190  O  OG1 . THR A 1 898  ? -42.020 42.853  15.173  1.00 43.77  ? 1494 THR A OG1 1 
ATOM   6191  C  CG2 . THR A 1 898  ? -41.045 45.024  15.521  1.00 49.59  ? 1494 THR A CG2 1 
ATOM   6192  N  N   . LEU A 1 899  ? -40.223 43.230  11.545  1.00 52.71  ? 1495 LEU A N   1 
ATOM   6193  C  CA  . LEU A 1 899  ? -39.832 42.193  10.600  1.00 43.62  ? 1495 LEU A CA  1 
ATOM   6194  C  C   . LEU A 1 899  ? -39.713 40.864  11.336  1.00 51.88  ? 1495 LEU A C   1 
ATOM   6195  O  O   . LEU A 1 899  ? -40.251 39.849  10.896  1.00 56.77  ? 1495 LEU A O   1 
ATOM   6196  C  CB  . LEU A 1 899  ? -38.517 42.542  9.905   1.00 45.83  ? 1495 LEU A CB  1 
ATOM   6197  C  CG  . LEU A 1 899  ? -38.231 41.718  8.648   1.00 37.39  ? 1495 LEU A CG  1 
ATOM   6198  C  CD1 . LEU A 1 899  ? -39.254 42.028  7.566   1.00 40.29  ? 1495 LEU A CD1 1 
ATOM   6199  C  CD2 . LEU A 1 899  ? -36.821 41.964  8.141   1.00 48.22  ? 1495 LEU A CD2 1 
ATOM   6200  N  N   . ILE A 1 900  ? -39.009 40.880  12.462  1.00 46.85  ? 1496 ILE A N   1 
ATOM   6201  C  CA  . ILE A 1 900  ? -38.996 39.733  13.359  1.00 42.56  ? 1496 ILE A CA  1 
ATOM   6202  C  C   . ILE A 1 900  ? -40.227 39.803  14.250  1.00 46.85  ? 1496 ILE A C   1 
ATOM   6203  O  O   . ILE A 1 900  ? -40.340 40.703  15.081  1.00 45.31  ? 1496 ILE A O   1 
ATOM   6204  C  CB  . ILE A 1 900  ? -37.727 39.689  14.227  1.00 40.71  ? 1496 ILE A CB  1 
ATOM   6205  C  CG1 . ILE A 1 900  ? -36.478 39.685  13.345  1.00 38.78  ? 1496 ILE A CG1 1 
ATOM   6206  C  CG2 . ILE A 1 900  ? -37.745 38.468  15.133  1.00 41.01  ? 1496 ILE A CG2 1 
ATOM   6207  C  CD1 . ILE A 1 900  ? -35.187 39.589  14.120  1.00 41.41  ? 1496 ILE A CD1 1 
ATOM   6208  N  N   . PRO A 1 901  ? -41.157 38.853  14.076  1.00 52.22  ? 1497 PRO A N   1 
ATOM   6209  C  CA  . PRO A 1 901  ? -42.434 38.862  14.797  1.00 45.82  ? 1497 PRO A CA  1 
ATOM   6210  C  C   . PRO A 1 901  ? -42.238 38.791  16.303  1.00 59.41  ? 1497 PRO A C   1 
ATOM   6211  O  O   . PRO A 1 901  ? -41.619 37.847  16.766  1.00 66.27  ? 1497 PRO A O   1 
ATOM   6212  C  CB  . PRO A 1 901  ? -43.141 37.601  14.283  1.00 35.19  ? 1497 PRO A CB  1 
ATOM   6213  C  CG  . PRO A 1 901  ? -42.463 37.276  12.995  1.00 47.58  ? 1497 PRO A CG  1 
ATOM   6214  C  CD  . PRO A 1 901  ? -41.040 37.687  13.186  1.00 45.87  ? 1497 PRO A CD  1 
ATOM   6215  N  N   . TRP A 1 902  ? -42.757 39.771  17.038  1.00 53.17  ? 1498 TRP A N   1 
ATOM   6216  C  CA  . TRP A 1 902  ? -42.619 39.842  18.493  1.00 46.79  ? 1498 TRP A CA  1 
ATOM   6217  C  C   . TRP A 1 902  ? -43.128 38.580  19.199  1.00 49.78  ? 1498 TRP A C   1 
ATOM   6218  O  O   . TRP A 1 902  ? -42.514 38.083  20.159  1.00 60.98  ? 1498 TRP A O   1 
ATOM   6219  C  CB  . TRP A 1 902  ? -43.367 41.077  19.007  1.00 62.24  ? 1498 TRP A CB  1 
ATOM   6220  C  CG  . TRP A 1 902  ? -43.358 41.261  20.493  1.00 61.13  ? 1498 TRP A CG  1 
ATOM   6221  C  CD1 . TRP A 1 902  ? -42.443 41.957  21.227  1.00 61.15  ? 1498 TRP A CD1 1 
ATOM   6222  C  CD2 . TRP A 1 902  ? -44.326 40.764  21.425  1.00 59.45  ? 1498 TRP A CD2 1 
ATOM   6223  N  NE1 . TRP A 1 902  ? -42.775 41.917  22.559  1.00 68.96  ? 1498 TRP A NE1 1 
ATOM   6224  C  CE2 . TRP A 1 902  ? -43.926 41.188  22.707  1.00 60.67  ? 1498 TRP A CE2 1 
ATOM   6225  C  CE3 . TRP A 1 902  ? -45.487 39.996  21.299  1.00 64.37  ? 1498 TRP A CE3 1 
ATOM   6226  C  CZ2 . TRP A 1 902  ? -44.646 40.872  23.855  1.00 66.45  ? 1498 TRP A CZ2 1 
ATOM   6227  C  CZ3 . TRP A 1 902  ? -46.199 39.681  22.440  1.00 64.91  ? 1498 TRP A CZ3 1 
ATOM   6228  C  CH2 . TRP A 1 902  ? -45.778 40.120  23.701  1.00 59.64  ? 1498 TRP A CH2 1 
ATOM   6229  N  N   . CYS A 1 903  ? -44.242 38.058  18.696  1.00 50.17  ? 1499 CYS A N   1 
ATOM   6230  C  CA  . CYS A 1 903  ? -44.925 36.926  19.312  1.00 51.00  ? 1499 CYS A CA  1 
ATOM   6231  C  C   . CYS A 1 903  ? -44.086 35.653  19.342  1.00 58.90  ? 1499 CYS A C   1 
ATOM   6232  O  O   . CYS A 1 903  ? -44.371 34.740  20.114  1.00 66.93  ? 1499 CYS A O   1 
ATOM   6233  C  CB  . CYS A 1 903  ? -46.239 36.647  18.581  1.00 57.05  ? 1499 CYS A CB  1 
ATOM   6234  S  SG  . CYS A 1 903  ? -46.025 36.065  16.886  1.00 66.79  ? 1499 CYS A SG  1 
ATOM   6235  N  N   . LEU A 1 904  ? -43.054 35.590  18.507  1.00 53.38  ? 1500 LEU A N   1 
ATOM   6236  C  CA  . LEU A 1 904  ? -42.244 34.381  18.427  1.00 59.81  ? 1500 LEU A CA  1 
ATOM   6237  C  C   . LEU A 1 904  ? -41.140 34.342  19.493  1.00 54.65  ? 1500 LEU A C   1 
ATOM   6238  O  O   . LEU A 1 904  ? -40.977 33.320  20.157  1.00 59.22  ? 1500 LEU A O   1 
ATOM   6239  C  CB  . LEU A 1 904  ? -41.658 34.223  17.022  1.00 60.40  ? 1500 LEU A CB  1 
ATOM   6240  C  CG  . LEU A 1 904  ? -42.707 34.055  15.924  1.00 59.28  ? 1500 LEU A CG  1 
ATOM   6241  C  CD1 . LEU A 1 904  ? -42.050 33.736  14.593  1.00 58.51  ? 1500 LEU A CD1 1 
ATOM   6242  C  CD2 . LEU A 1 904  ? -43.705 32.972  16.300  1.00 64.64  ? 1500 LEU A CD2 1 
ATOM   6243  N  N   . PRO A 1 905  ? -40.374 35.439  19.668  1.00 55.73  ? 1501 PRO A N   1 
ATOM   6244  C  CA  . PRO A 1 905  ? -39.520 35.406  20.856  1.00 64.86  ? 1501 PRO A CA  1 
ATOM   6245  C  C   . PRO A 1 905  ? -40.323 35.527  22.145  1.00 66.57  ? 1501 PRO A C   1 
ATOM   6246  O  O   . PRO A 1 905  ? -39.827 35.122  23.197  1.00 68.83  ? 1501 PRO A O   1 
ATOM   6247  C  CB  . PRO A 1 905  ? -38.606 36.623  20.671  1.00 52.56  ? 1501 PRO A CB  1 
ATOM   6248  C  CG  . PRO A 1 905  ? -38.587 36.856  19.217  1.00 55.48  ? 1501 PRO A CG  1 
ATOM   6249  C  CD  . PRO A 1 905  ? -39.972 36.527  18.764  1.00 57.87  ? 1501 PRO A CD  1 
ATOM   6250  N  N   . HIS A 1 906  ? -41.535 36.074  22.068  1.00 67.10  ? 1502 HIS A N   1 
ATOM   6251  C  CA  . HIS A 1 906  ? -42.374 36.180  23.258  1.00 67.89  ? 1502 HIS A CA  1 
ATOM   6252  C  C   . HIS A 1 906  ? -42.633 34.819  23.901  1.00 68.67  ? 1502 HIS A C   1 
ATOM   6253  O  O   . HIS A 1 906  ? -42.417 34.640  25.099  1.00 79.48  ? 1502 HIS A O   1 
ATOM   6254  C  CB  . HIS A 1 906  ? -43.706 36.851  22.928  1.00 72.00  ? 1502 HIS A CB  1 
ATOM   6255  C  CG  . HIS A 1 906  ? -44.580 37.070  24.123  1.00 72.06  ? 1502 HIS A CG  1 
ATOM   6256  N  ND1 . HIS A 1 906  ? -45.946 36.892  24.090  1.00 65.96  ? 1502 HIS A ND1 1 
ATOM   6257  C  CD2 . HIS A 1 906  ? -44.283 37.458  25.386  1.00 71.01  ? 1502 HIS A CD2 1 
ATOM   6258  C  CE1 . HIS A 1 906  ? -46.452 37.158  25.281  1.00 73.14  ? 1502 HIS A CE1 1 
ATOM   6259  N  NE2 . HIS A 1 906  ? -45.465 37.504  26.086  1.00 99.19  ? 1502 HIS A NE2 1 
ATOM   6260  N  N   . THR A 1 907  ? -43.087 33.863  23.099  1.00 67.22  ? 1503 THR A N   1 
ATOM   6261  C  CA  . THR A 1 907  ? -43.461 32.548  23.609  1.00 56.39  ? 1503 THR A CA  1 
ATOM   6262  C  C   . THR A 1 907  ? -42.501 31.460  23.138  1.00 66.48  ? 1503 THR A C   1 
ATOM   6263  O  O   . THR A 1 907  ? -42.821 30.272  23.195  1.00 63.33  ? 1503 THR A O   1 
ATOM   6264  C  CB  . THR A 1 907  ? -44.886 32.166  23.172  1.00 63.04  ? 1503 THR A CB  1 
ATOM   6265  O  OG1 . THR A 1 907  ? -44.856 31.647  21.837  1.00 60.77  ? 1503 THR A OG1 1 
ATOM   6266  C  CG2 . THR A 1 907  ? -45.801 33.380  23.219  1.00 64.10  ? 1503 THR A CG2 1 
ATOM   6267  N  N   . GLY A 1 908  ? -41.324 31.873  22.678  1.00 66.37  ? 1504 GLY A N   1 
ATOM   6268  C  CA  . GLY A 1 908  ? -40.363 30.960  22.084  1.00 61.75  ? 1504 GLY A CA  1 
ATOM   6269  C  C   . GLY A 1 908  ? -39.911 29.818  22.971  1.00 67.03  ? 1504 GLY A C   1 
ATOM   6270  O  O   . GLY A 1 908  ? -39.989 28.654  22.577  1.00 66.66  ? 1504 GLY A O   1 
ATOM   6271  N  N   . ASN A 1 909  ? -39.440 30.154  24.169  1.00 69.35  ? 1505 ASN A N   1 
ATOM   6272  C  CA  . ASN A 1 909  ? -38.880 29.171  25.094  1.00 63.37  ? 1505 ASN A CA  1 
ATOM   6273  C  C   . ASN A 1 909  ? -39.811 28.001  25.396  1.00 69.77  ? 1505 ASN A C   1 
ATOM   6274  O  O   . ASN A 1 909  ? -39.355 26.893  25.679  1.00 63.01  ? 1505 ASN A O   1 
ATOM   6275  C  CB  . ASN A 1 909  ? -38.488 29.855  26.406  1.00 59.57  ? 1505 ASN A CB  1 
ATOM   6276  C  CG  . ASN A 1 909  ? -37.387 30.879  26.226  1.00 66.20  ? 1505 ASN A CG  1 
ATOM   6277  O  OD1 . ASN A 1 909  ? -36.504 30.716  25.385  1.00 70.46  ? 1505 ASN A OD1 1 
ATOM   6278  N  ND2 . ASN A 1 909  ? -37.434 31.945  27.018  1.00 83.01  ? 1505 ASN A ND2 1 
ATOM   6279  N  N   . ARG A 1 910  ? -41.115 28.251  25.327  1.00 66.80  ? 1506 ARG A N   1 
ATOM   6280  C  CA  . ARG A 1 910  ? -42.103 27.240  25.680  1.00 72.46  ? 1506 ARG A CA  1 
ATOM   6281  C  C   . ARG A 1 910  ? -42.516 26.369  24.497  1.00 72.13  ? 1506 ARG A C   1 
ATOM   6282  O  O   . ARG A 1 910  ? -43.068 25.285  24.684  1.00 85.34  ? 1506 ARG A O   1 
ATOM   6283  C  CB  . ARG A 1 910  ? -43.344 27.905  26.284  1.00 80.22  ? 1506 ARG A CB  1 
ATOM   6284  C  CG  . ARG A 1 910  ? -43.085 28.670  27.573  1.00 88.54  ? 1506 ARG A CG  1 
ATOM   6285  C  CD  . ARG A 1 910  ? -42.439 27.784  28.628  1.00 98.24  ? 1506 ARG A CD  1 
ATOM   6286  N  NE  . ARG A 1 910  ? -43.130 26.506  28.779  1.00 106.05 ? 1506 ARG A NE  1 
ATOM   6287  C  CZ  . ARG A 1 910  ? -44.200 26.319  29.545  1.00 92.92  ? 1506 ARG A CZ  1 
ATOM   6288  N  NH1 . ARG A 1 910  ? -44.761 25.119  29.621  1.00 77.11  ? 1506 ARG A NH1 1 
ATOM   6289  N  NH2 . ARG A 1 910  ? -44.712 27.330  30.233  1.00 101.85 ? 1506 ARG A NH2 1 
ATOM   6290  N  N   . HIS A 1 911  ? -42.250 26.838  23.283  1.00 72.54  ? 1507 HIS A N   1 
ATOM   6291  C  CA  . HIS A 1 911  ? -42.698 26.125  22.090  1.00 59.03  ? 1507 HIS A CA  1 
ATOM   6292  C  C   . HIS A 1 911  ? -41.546 25.704  21.185  1.00 67.18  ? 1507 HIS A C   1 
ATOM   6293  O  O   . HIS A 1 911  ? -41.636 25.828  19.962  1.00 72.73  ? 1507 HIS A O   1 
ATOM   6294  C  CB  . HIS A 1 911  ? -43.686 26.986  21.301  1.00 52.77  ? 1507 HIS A CB  1 
ATOM   6295  C  CG  . HIS A 1 911  ? -44.903 27.370  22.078  1.00 66.54  ? 1507 HIS A CG  1 
ATOM   6296  N  ND1 . HIS A 1 911  ? -44.895 28.366  23.036  1.00 57.92  ? 1507 HIS A ND1 1 
ATOM   6297  C  CD2 . HIS A 1 911  ? -46.170 26.895  22.047  1.00 52.48  ? 1507 HIS A CD2 1 
ATOM   6298  C  CE1 . HIS A 1 911  ? -46.101 28.486  23.554  1.00 57.72  ? 1507 HIS A CE1 1 
ATOM   6299  N  NE2 . HIS A 1 911  ? -46.896 27.603  22.972  1.00 64.87  ? 1507 HIS A NE2 1 
ATOM   6300  N  N   . ASN A 1 912  ? -40.476 25.201  21.796  1.00 70.58  ? 1508 ASN A N   1 
ATOM   6301  C  CA  . ASN A 1 912  ? -39.296 24.736  21.071  1.00 71.86  ? 1508 ASN A CA  1 
ATOM   6302  C  C   . ASN A 1 912  ? -38.771 25.773  20.079  1.00 71.47  ? 1508 ASN A C   1 
ATOM   6303  O  O   . ASN A 1 912  ? -38.383 25.434  18.959  1.00 76.32  ? 1508 ASN A O   1 
ATOM   6304  C  CB  . ASN A 1 912  ? -39.602 23.421  20.345  1.00 73.00  ? 1508 ASN A CB  1 
ATOM   6305  C  CG  . ASN A 1 912  ? -38.351 22.619  20.039  1.00 91.59  ? 1508 ASN A CG  1 
ATOM   6306  O  OD1 . ASN A 1 912  ? -37.373 22.668  20.786  1.00 80.38  ? 1508 ASN A OD1 1 
ATOM   6307  N  ND2 . ASN A 1 912  ? -38.374 21.881  18.936  1.00 87.92  ? 1508 ASN A ND2 1 
ATOM   6308  N  N   . HIS A 1 913  ? -38.788 27.037  20.497  1.00 54.80  ? 1509 HIS A N   1 
ATOM   6309  C  CA  . HIS A 1 913  ? -38.276 28.155  19.701  1.00 56.50  ? 1509 HIS A CA  1 
ATOM   6310  C  C   . HIS A 1 913  ? -38.992 28.333  18.363  1.00 58.48  ? 1509 HIS A C   1 
ATOM   6311  O  O   . HIS A 1 913  ? -38.458 28.970  17.454  1.00 65.72  ? 1509 HIS A O   1 
ATOM   6312  C  CB  . HIS A 1 913  ? -36.771 27.989  19.458  1.00 50.36  ? 1509 HIS A CB  1 
ATOM   6313  C  CG  . HIS A 1 913  ? -35.960 27.949  20.714  1.00 62.60  ? 1509 HIS A CG  1 
ATOM   6314  N  ND1 . HIS A 1 913  ? -35.935 28.991  21.615  1.00 73.19  ? 1509 HIS A ND1 1 
ATOM   6315  C  CD2 . HIS A 1 913  ? -35.141 26.995  21.217  1.00 62.31  ? 1509 HIS A CD2 1 
ATOM   6316  C  CE1 . HIS A 1 913  ? -35.136 28.681  22.620  1.00 65.85  ? 1509 HIS A CE1 1 
ATOM   6317  N  NE2 . HIS A 1 913  ? -34.641 27.475  22.403  1.00 74.13  ? 1509 HIS A NE2 1 
ATOM   6318  N  N   . TRP A 1 914  ? -40.196 27.775  18.255  1.00 62.20  ? 1510 TRP A N   1 
ATOM   6319  C  CA  . TRP A 1 914  ? -41.008 27.873  17.041  1.00 63.95  ? 1510 TRP A CA  1 
ATOM   6320  C  C   . TRP A 1 914  ? -40.243 27.469  15.786  1.00 62.85  ? 1510 TRP A C   1 
ATOM   6321  O  O   . TRP A 1 914  ? -40.258 28.185  14.785  1.00 61.86  ? 1510 TRP A O   1 
ATOM   6322  C  CB  . TRP A 1 914  ? -41.553 29.294  16.872  1.00 57.12  ? 1510 TRP A CB  1 
ATOM   6323  C  CG  . TRP A 1 914  ? -42.606 29.661  17.870  1.00 54.97  ? 1510 TRP A CG  1 
ATOM   6324  C  CD1 . TRP A 1 914  ? -42.531 30.640  18.817  1.00 56.87  ? 1510 TRP A CD1 1 
ATOM   6325  C  CD2 . TRP A 1 914  ? -43.892 29.051  18.023  1.00 57.99  ? 1510 TRP A CD2 1 
ATOM   6326  N  NE1 . TRP A 1 914  ? -43.694 30.681  19.547  1.00 56.08  ? 1510 TRP A NE1 1 
ATOM   6327  C  CE2 . TRP A 1 914  ? -44.546 29.715  19.081  1.00 49.59  ? 1510 TRP A CE2 1 
ATOM   6328  C  CE3 . TRP A 1 914  ? -44.557 28.009  17.368  1.00 55.77  ? 1510 TRP A CE3 1 
ATOM   6329  C  CZ2 . TRP A 1 914  ? -45.829 29.372  19.498  1.00 51.41  ? 1510 TRP A CZ2 1 
ATOM   6330  C  CZ3 . TRP A 1 914  ? -45.831 27.669  17.785  1.00 44.65  ? 1510 TRP A CZ3 1 
ATOM   6331  C  CH2 . TRP A 1 914  ? -46.453 28.348  18.839  1.00 54.06  ? 1510 TRP A CH2 1 
ATOM   6332  N  N   . ALA A 1 915  ? -39.573 26.325  15.850  1.00 60.16  ? 1511 ALA A N   1 
ATOM   6333  C  CA  . ALA A 1 915  ? -38.796 25.829  14.724  1.00 56.70  ? 1511 ALA A CA  1 
ATOM   6334  C  C   . ALA A 1 915  ? -39.682 25.564  13.511  1.00 65.78  ? 1511 ALA A C   1 
ATOM   6335  O  O   . ALA A 1 915  ? -40.703 24.883  13.612  1.00 57.51  ? 1511 ALA A O   1 
ATOM   6336  C  CB  . ALA A 1 915  ? -38.048 24.566  15.115  1.00 52.14  ? 1511 ALA A CB  1 
ATOM   6337  N  N   . GLY A 1 916  ? -39.291 26.116  12.366  1.00 55.47  ? 1512 GLY A N   1 
ATOM   6338  C  CA  . GLY A 1 916  ? -39.987 25.857  11.122  1.00 50.22  ? 1512 GLY A CA  1 
ATOM   6339  C  C   . GLY A 1 916  ? -40.922 26.962  10.674  1.00 53.01  ? 1512 GLY A C   1 
ATOM   6340  O  O   . GLY A 1 916  ? -41.262 27.046  9.498   1.00 46.50  ? 1512 GLY A O   1 
ATOM   6341  N  N   . LEU A 1 917  ? -41.336 27.818  11.603  1.00 55.96  ? 1513 LEU A N   1 
ATOM   6342  C  CA  . LEU A 1 917  ? -42.254 28.901  11.268  1.00 48.49  ? 1513 LEU A CA  1 
ATOM   6343  C  C   . LEU A 1 917  ? -41.565 29.937  10.385  1.00 52.77  ? 1513 LEU A C   1 
ATOM   6344  O  O   . LEU A 1 917  ? -40.424 30.321  10.644  1.00 45.19  ? 1513 LEU A O   1 
ATOM   6345  C  CB  . LEU A 1 917  ? -42.810 29.554  12.534  1.00 55.38  ? 1513 LEU A CB  1 
ATOM   6346  C  CG  . LEU A 1 917  ? -44.047 28.881  13.138  1.00 51.66  ? 1513 LEU A CG  1 
ATOM   6347  C  CD1 . LEU A 1 917  ? -43.711 27.527  13.744  1.00 57.09  ? 1513 LEU A CD1 1 
ATOM   6348  C  CD2 . LEU A 1 917  ? -44.699 29.785  14.170  1.00 46.65  ? 1513 LEU A CD2 1 
ATOM   6349  N  N   . TYR A 1 918  ? -42.275 30.379  9.347   1.00 52.90  ? 1514 TYR A N   1 
ATOM   6350  C  CA  . TYR A 1 918  ? -41.695 31.177  8.267   1.00 46.16  ? 1514 TYR A CA  1 
ATOM   6351  C  C   . TYR A 1 918  ? -40.520 30.442  7.634   1.00 50.21  ? 1514 TYR A C   1 
ATOM   6352  O  O   . TYR A 1 918  ? -39.574 31.063  7.151   1.00 52.05  ? 1514 TYR A O   1 
ATOM   6353  C  CB  . TYR A 1 918  ? -41.250 32.556  8.763   1.00 40.24  ? 1514 TYR A CB  1 
ATOM   6354  C  CG  . TYR A 1 918  ? -42.345 33.594  8.759   1.00 40.83  ? 1514 TYR A CG  1 
ATOM   6355  C  CD1 . TYR A 1 918  ? -42.651 34.302  7.604   1.00 42.61  ? 1514 TYR A CD1 1 
ATOM   6356  C  CD2 . TYR A 1 918  ? -43.069 33.870  9.909   1.00 45.67  ? 1514 TYR A CD2 1 
ATOM   6357  C  CE1 . TYR A 1 918  ? -43.651 35.255  7.595   1.00 47.15  ? 1514 TYR A CE1 1 
ATOM   6358  C  CE2 . TYR A 1 918  ? -44.069 34.821  9.910   1.00 42.72  ? 1514 TYR A CE2 1 
ATOM   6359  C  CZ  . TYR A 1 918  ? -44.356 35.509  8.752   1.00 44.98  ? 1514 TYR A CZ  1 
ATOM   6360  O  OH  . TYR A 1 918  ? -45.354 36.456  8.754   1.00 43.45  ? 1514 TYR A OH  1 
ATOM   6361  N  N   . GLY A 1 919  ? -40.587 29.115  7.647   1.00 41.28  ? 1515 GLY A N   1 
ATOM   6362  C  CA  . GLY A 1 919  ? -39.522 28.295  7.107   1.00 45.44  ? 1515 GLY A CA  1 
ATOM   6363  C  C   . GLY A 1 919  ? -39.734 27.919  5.656   1.00 47.55  ? 1515 GLY A C   1 
ATOM   6364  O  O   . GLY A 1 919  ? -40.866 27.865  5.177   1.00 37.21  ? 1515 GLY A O   1 
ATOM   6365  N  N   . ARG A 1 920  ? -38.638 27.628  4.964   1.00 41.14  ? 1516 ARG A N   1 
ATOM   6366  C  CA  . ARG A 1 920  ? -38.699 27.244  3.562   1.00 41.49  ? 1516 ARG A CA  1 
ATOM   6367  C  C   . ARG A 1 920  ? -38.568 25.740  3.395   1.00 40.95  ? 1516 ARG A C   1 
ATOM   6368  O  O   . ARG A 1 920  ? -37.834 25.082  4.132   1.00 45.17  ? 1516 ARG A O   1 
ATOM   6369  C  CB  . ARG A 1 920  ? -37.600 27.938  2.758   1.00 38.93  ? 1516 ARG A CB  1 
ATOM   6370  C  CG  . ARG A 1 920  ? -37.731 29.441  2.674   1.00 40.31  ? 1516 ARG A CG  1 
ATOM   6371  C  CD  . ARG A 1 920  ? -36.659 30.011  1.766   1.00 31.41  ? 1516 ARG A CD  1 
ATOM   6372  N  NE  . ARG A 1 920  ? -36.730 31.465  1.691   1.00 31.20  ? 1516 ARG A NE  1 
ATOM   6373  C  CZ  . ARG A 1 920  ? -37.441 32.129  0.788   1.00 31.69  ? 1516 ARG A CZ  1 
ATOM   6374  N  NH1 . ARG A 1 920  ? -37.449 33.454  0.795   1.00 39.08  ? 1516 ARG A NH1 1 
ATOM   6375  N  NH2 . ARG A 1 920  ? -38.143 31.470  -0.122  1.00 39.68  ? 1516 ARG A NH2 1 
ATOM   6376  N  N   . LEU A 1 921  ? -39.289 25.201  2.419   1.00 31.01  ? 1517 LEU A N   1 
ATOM   6377  C  CA  . LEU A 1 921  ? -39.130 23.804  2.053   1.00 35.27  ? 1517 LEU A CA  1 
ATOM   6378  C  C   . LEU A 1 921  ? -37.761 23.598  1.422   1.00 40.41  ? 1517 LEU A C   1 
ATOM   6379  O  O   . LEU A 1 921  ? -37.192 24.520  0.839   1.00 40.94  ? 1517 LEU A O   1 
ATOM   6380  C  CB  . LEU A 1 921  ? -40.232 23.364  1.090   1.00 40.48  ? 1517 LEU A CB  1 
ATOM   6381  C  CG  . LEU A 1 921  ? -41.648 23.337  1.665   1.00 37.40  ? 1517 LEU A CG  1 
ATOM   6382  C  CD1 . LEU A 1 921  ? -42.659 23.269  0.544   1.00 37.71  ? 1517 LEU A CD1 1 
ATOM   6383  C  CD2 . LEU A 1 921  ? -41.816 22.157  2.606   1.00 39.86  ? 1517 LEU A CD2 1 
ATOM   6384  N  N   . GLU A 1 922  ? -37.233 22.388  1.549   1.00 38.11  ? 1518 GLU A N   1 
ATOM   6385  C  CA  . GLU A 1 922  ? -35.950 22.056  0.948   1.00 40.39  ? 1518 GLU A CA  1 
ATOM   6386  C  C   . GLU A 1 922  ? -36.183 21.198  -0.285  1.00 43.51  ? 1518 GLU A C   1 
ATOM   6387  O  O   . GLU A 1 922  ? -37.016 20.294  -0.258  1.00 39.30  ? 1518 GLU A O   1 
ATOM   6388  C  CB  . GLU A 1 922  ? -35.059 21.328  1.953   1.00 37.86  ? 1518 GLU A CB  1 
ATOM   6389  C  CG  . GLU A 1 922  ? -35.013 21.990  3.319   1.00 59.67  ? 1518 GLU A CG  1 
ATOM   6390  C  CD  . GLU A 1 922  ? -34.349 21.119  4.364   1.00 85.15  ? 1518 GLU A CD  1 
ATOM   6391  O  OE1 . GLU A 1 922  ? -34.752 21.194  5.544   1.00 79.74  ? 1518 GLU A OE1 1 
ATOM   6392  O  OE2 . GLU A 1 922  ? -33.423 20.362  4.005   1.00 78.11  ? 1518 GLU A OE2 1 
ATOM   6393  N  N   . TRP A 1 923  ? -35.459 21.483  -1.365  1.00 40.95  ? 1519 TRP A N   1 
ATOM   6394  C  CA  . TRP A 1 923  ? -35.613 20.719  -2.601  1.00 45.73  ? 1519 TRP A CA  1 
ATOM   6395  C  C   . TRP A 1 923  ? -35.379 19.230  -2.357  1.00 39.13  ? 1519 TRP A C   1 
ATOM   6396  O  O   . TRP A 1 923  ? -36.019 18.380  -2.976  1.00 41.37  ? 1519 TRP A O   1 
ATOM   6397  C  CB  . TRP A 1 923  ? -34.655 21.222  -3.686  1.00 34.15  ? 1519 TRP A CB  1 
ATOM   6398  C  CG  . TRP A 1 923  ? -35.000 22.569  -4.259  1.00 35.72  ? 1519 TRP A CG  1 
ATOM   6399  C  CD1 . TRP A 1 923  ? -34.233 23.697  -4.216  1.00 37.40  ? 1519 TRP A CD1 1 
ATOM   6400  C  CD2 . TRP A 1 923  ? -36.195 22.927  -4.969  1.00 38.43  ? 1519 TRP A CD2 1 
ATOM   6401  N  NE1 . TRP A 1 923  ? -34.874 24.733  -4.852  1.00 29.66  ? 1519 TRP A NE1 1 
ATOM   6402  C  CE2 . TRP A 1 923  ? -36.080 24.286  -5.323  1.00 40.38  ? 1519 TRP A CE2 1 
ATOM   6403  C  CE3 . TRP A 1 923  ? -37.351 22.229  -5.337  1.00 27.30  ? 1519 TRP A CE3 1 
ATOM   6404  C  CZ2 . TRP A 1 923  ? -37.077 24.963  -6.024  1.00 33.28  ? 1519 TRP A CZ2 1 
ATOM   6405  C  CZ3 . TRP A 1 923  ? -38.339 22.904  -6.035  1.00 28.18  ? 1519 TRP A CZ3 1 
ATOM   6406  C  CH2 . TRP A 1 923  ? -38.195 24.256  -6.371  1.00 22.42  ? 1519 TRP A CH2 1 
ATOM   6407  N  N   . ASP A 1 924  ? -34.466 18.924  -1.441  1.00 36.55  ? 1520 ASP A N   1 
ATOM   6408  C  CA  . ASP A 1 924  ? -34.134 17.542  -1.119  1.00 33.74  ? 1520 ASP A CA  1 
ATOM   6409  C  C   . ASP A 1 924  ? -35.019 16.980  -0.010  1.00 32.69  ? 1520 ASP A C   1 
ATOM   6410  O  O   . ASP A 1 924  ? -34.981 15.784  0.276   1.00 36.00  ? 1520 ASP A O   1 
ATOM   6411  C  CB  . ASP A 1 924  ? -32.664 17.431  -0.707  1.00 25.74  ? 1520 ASP A CB  1 
ATOM   6412  C  CG  . ASP A 1 924  ? -31.715 17.776  -1.836  1.00 38.72  ? 1520 ASP A CG  1 
ATOM   6413  O  OD1 . ASP A 1 924  ? -32.058 17.500  -3.005  1.00 62.61  ? 1520 ASP A OD1 1 
ATOM   6414  O  OD2 . ASP A 1 924  ? -30.627 18.320  -1.555  1.00 36.78  ? 1520 ASP A OD2 1 
ATOM   6415  N  N   . GLY A 1 925  ? -35.817 17.843  0.608   1.00 26.96  ? 1521 GLY A N   1 
ATOM   6416  C  CA  . GLY A 1 925  ? -36.619 17.442  1.749   1.00 30.60  ? 1521 GLY A CA  1 
ATOM   6417  C  C   . GLY A 1 925  ? -38.034 17.031  1.394   1.00 33.52  ? 1521 GLY A C   1 
ATOM   6418  O  O   . GLY A 1 925  ? -38.311 16.612  0.271   1.00 33.07  ? 1521 GLY A O   1 
ATOM   6419  N  N   . PHE A 1 926  ? -38.934 17.150  2.363   1.00 41.10  ? 1522 PHE A N   1 
ATOM   6420  C  CA  . PHE A 1 926  ? -40.334 16.818  2.143   1.00 38.52  ? 1522 PHE A CA  1 
ATOM   6421  C  C   . PHE A 1 926  ? -41.253 17.783  2.879   1.00 34.60  ? 1522 PHE A C   1 
ATOM   6422  O  O   . PHE A 1 926  ? -40.826 18.499  3.785   1.00 38.91  ? 1522 PHE A O   1 
ATOM   6423  C  CB  . PHE A 1 926  ? -40.623 15.378  2.579   1.00 41.88  ? 1522 PHE A CB  1 
ATOM   6424  C  CG  . PHE A 1 926  ? -40.170 15.059  3.976   1.00 41.07  ? 1522 PHE A CG  1 
ATOM   6425  C  CD1 . PHE A 1 926  ? -40.989 15.318  5.064   1.00 45.27  ? 1522 PHE A CD1 1 
ATOM   6426  C  CD2 . PHE A 1 926  ? -38.928 14.491  4.201   1.00 40.44  ? 1522 PHE A CD2 1 
ATOM   6427  C  CE1 . PHE A 1 926  ? -40.572 15.021  6.348   1.00 48.29  ? 1522 PHE A CE1 1 
ATOM   6428  C  CE2 . PHE A 1 926  ? -38.508 14.191  5.481   1.00 39.19  ? 1522 PHE A CE2 1 
ATOM   6429  C  CZ  . PHE A 1 926  ? -39.331 14.456  6.556   1.00 34.52  ? 1522 PHE A CZ  1 
ATOM   6430  N  N   . PHE A 1 927  ? -42.518 17.800  2.475   1.00 39.81  ? 1523 PHE A N   1 
ATOM   6431  C  CA  . PHE A 1 927  ? -43.522 18.620  3.137   1.00 30.25  ? 1523 PHE A CA  1 
ATOM   6432  C  C   . PHE A 1 927  ? -43.787 18.127  4.549   1.00 35.01  ? 1523 PHE A C   1 
ATOM   6433  O  O   . PHE A 1 927  ? -43.882 16.924  4.787   1.00 35.41  ? 1523 PHE A O   1 
ATOM   6434  C  CB  . PHE A 1 927  ? -44.838 18.610  2.354   1.00 34.92  ? 1523 PHE A CB  1 
ATOM   6435  C  CG  . PHE A 1 927  ? -44.843 19.491  1.139   1.00 38.61  ? 1523 PHE A CG  1 
ATOM   6436  C  CD1 . PHE A 1 927  ? -44.035 19.205  0.052   1.00 36.99  ? 1523 PHE A CD1 1 
ATOM   6437  C  CD2 . PHE A 1 927  ? -45.672 20.599  1.079   1.00 34.43  ? 1523 PHE A CD2 1 
ATOM   6438  C  CE1 . PHE A 1 927  ? -44.048 20.013  -1.069  1.00 36.60  ? 1523 PHE A CE1 1 
ATOM   6439  C  CE2 . PHE A 1 927  ? -45.690 21.409  -0.039  1.00 30.13  ? 1523 PHE A CE2 1 
ATOM   6440  C  CZ  . PHE A 1 927  ? -44.877 21.115  -1.115  1.00 34.41  ? 1523 PHE A CZ  1 
ATOM   6441  N  N   . SER A 1 928  ? -43.915 19.062  5.484   1.00 46.81  ? 1524 SER A N   1 
ATOM   6442  C  CA  . SER A 1 928  ? -44.592 18.767  6.736   1.00 39.28  ? 1524 SER A CA  1 
ATOM   6443  C  C   . SER A 1 928  ? -46.045 18.564  6.333   1.00 43.67  ? 1524 SER A C   1 
ATOM   6444  O  O   . SER A 1 928  ? -46.436 19.001  5.248   1.00 55.00  ? 1524 SER A O   1 
ATOM   6445  C  CB  . SER A 1 928  ? -44.427 19.889  7.758   1.00 37.34  ? 1524 SER A CB  1 
ATOM   6446  O  OG  . SER A 1 928  ? -44.894 21.123  7.247   1.00 76.63  ? 1524 SER A OG  1 
ATOM   6447  N  N   . THR A 1 929  ? -46.839 17.908  7.178   1.00 52.82  ? 1525 THR A N   1 
ATOM   6448  C  CA  . THR A 1 929  ? -48.157 17.429  6.764   1.00 47.09  ? 1525 THR A CA  1 
ATOM   6449  C  C   . THR A 1 929  ? -48.954 18.537  6.096   1.00 45.56  ? 1525 THR A C   1 
ATOM   6450  O  O   . THR A 1 929  ? -49.075 19.637  6.634   1.00 59.53  ? 1525 THR A O   1 
ATOM   6451  C  CB  . THR A 1 929  ? -48.966 16.887  7.962   1.00 51.42  ? 1525 THR A CB  1 
ATOM   6452  O  OG1 . THR A 1 929  ? -48.299 15.748  8.517   1.00 54.38  ? 1525 THR A OG1 1 
ATOM   6453  C  CG2 . THR A 1 929  ? -50.369 16.484  7.528   1.00 38.28  ? 1525 THR A CG2 1 
ATOM   6454  N  N   . THR A 1 930  ? -49.485 18.239  4.914   1.00 51.14  ? 1526 THR A N   1 
ATOM   6455  C  CA  . THR A 1 930  ? -50.123 19.259  4.099   1.00 56.73  ? 1526 THR A CA  1 
ATOM   6456  C  C   . THR A 1 930  ? -51.392 19.706  4.792   1.00 48.18  ? 1526 THR A C   1 
ATOM   6457  O  O   . THR A 1 930  ? -52.267 18.895  5.097   1.00 45.27  ? 1526 THR A O   1 
ATOM   6458  C  CB  . THR A 1 930  ? -50.452 18.745  2.686   1.00 45.60  ? 1526 THR A CB  1 
ATOM   6459  O  OG1 . THR A 1 930  ? -49.242 18.361  2.021   1.00 42.58  ? 1526 THR A OG1 1 
ATOM   6460  C  CG2 . THR A 1 930  ? -51.149 19.824  1.876   1.00 40.92  ? 1526 THR A CG2 1 
ATOM   6461  N  N   . VAL A 1 931  ? -51.490 21.005  5.039   1.00 36.88  ? 1527 VAL A N   1 
ATOM   6462  C  CA  . VAL A 1 931  ? -52.574 21.511  5.856   1.00 53.23  ? 1527 VAL A CA  1 
ATOM   6463  C  C   . VAL A 1 931  ? -53.633 22.143  4.960   1.00 36.78  ? 1527 VAL A C   1 
ATOM   6464  O  O   . VAL A 1 931  ? -53.444 22.258  3.749   1.00 38.42  ? 1527 VAL A O   1 
ATOM   6465  C  CB  . VAL A 1 931  ? -52.040 22.530  6.896   1.00 62.47  ? 1527 VAL A CB  1 
ATOM   6466  C  CG1 . VAL A 1 931  ? -51.847 23.900  6.257   1.00 57.77  ? 1527 VAL A CG1 1 
ATOM   6467  C  CG2 . VAL A 1 931  ? -52.949 22.604  8.122   1.00 70.57  ? 1527 VAL A CG2 1 
ATOM   6468  N  N   . THR A 1 932  ? -54.739 22.564  5.562   1.00 34.30  ? 1528 THR A N   1 
ATOM   6469  C  CA  . THR A 1 932  ? -55.860 23.117  4.817   1.00 42.81  ? 1528 THR A CA  1 
ATOM   6470  C  C   . THR A 1 932  ? -55.651 24.581  4.454   1.00 48.20  ? 1528 THR A C   1 
ATOM   6471  O  O   . THR A 1 932  ? -56.172 25.059  3.452   1.00 52.91  ? 1528 THR A O   1 
ATOM   6472  C  CB  . THR A 1 932  ? -57.164 22.979  5.614   1.00 52.54  ? 1528 THR A CB  1 
ATOM   6473  O  OG1 . THR A 1 932  ? -57.099 23.799  6.788   1.00 54.32  ? 1528 THR A OG1 1 
ATOM   6474  C  CG2 . THR A 1 932  ? -57.373 21.533  6.026   1.00 44.33  ? 1528 THR A CG2 1 
ATOM   6475  N  N   . ASN A 1 933  ? -54.911 25.293  5.295   1.00 35.28  ? 1529 ASN A N   1 
ATOM   6476  C  CA  . ASN A 1 933  ? -54.680 26.718  5.101   1.00 36.33  ? 1529 ASN A CA  1 
ATOM   6477  C  C   . ASN A 1 933  ? -53.252 27.111  5.444   1.00 46.45  ? 1529 ASN A C   1 
ATOM   6478  O  O   . ASN A 1 933  ? -52.992 27.507  6.580   1.00 53.95  ? 1529 ASN A O   1 
ATOM   6479  C  CB  . ASN A 1 933  ? -55.663 27.532  5.943   1.00 32.77  ? 1529 ASN A CB  1 
ATOM   6480  C  CG  . ASN A 1 933  ? -55.591 29.016  5.650   1.00 33.47  ? 1529 ASN A CG  1 
ATOM   6481  O  OD1 . ASN A 1 933  ? -54.962 29.442  4.681   1.00 55.33  ? 1529 ASN A OD1 1 
ATOM   6482  N  ND2 . ASN A 1 933  ? -56.247 29.814  6.484   1.00 45.59  ? 1529 ASN A ND2 1 
ATOM   6483  N  N   . PRO A 1 934  ? -52.314 26.971  4.489   1.00 40.11  ? 1530 PRO A N   1 
ATOM   6484  C  CA  . PRO A 1 934  ? -50.940 27.219  4.938   1.00 38.20  ? 1530 PRO A CA  1 
ATOM   6485  C  C   . PRO A 1 934  ? -50.714 28.650  5.435   1.00 45.50  ? 1530 PRO A C   1 
ATOM   6486  O  O   . PRO A 1 934  ? -50.939 29.627  4.721   1.00 39.51  ? 1530 PRO A O   1 
ATOM   6487  C  CB  . PRO A 1 934  ? -50.116 26.955  3.673   1.00 36.60  ? 1530 PRO A CB  1 
ATOM   6488  C  CG  . PRO A 1 934  ? -51.069 27.161  2.539   1.00 34.59  ? 1530 PRO A CG  1 
ATOM   6489  C  CD  . PRO A 1 934  ? -52.397 26.689  3.047   1.00 40.86  ? 1530 PRO A CD  1 
ATOM   6490  N  N   . GLU A 1 935  ? -50.251 28.731  6.678   1.00 53.04  ? 1531 GLU A N   1 
ATOM   6491  C  CA  . GLU A 1 935  ? -49.831 29.961  7.341   1.00 44.18  ? 1531 GLU A CA  1 
ATOM   6492  C  C   . GLU A 1 935  ? -48.374 29.888  7.785   1.00 42.39  ? 1531 GLU A C   1 
ATOM   6493  O  O   . GLU A 1 935  ? -48.022 29.003  8.563   1.00 48.63  ? 1531 GLU A O   1 
ATOM   6494  C  CB  . GLU A 1 935  ? -50.742 30.278  8.528   1.00 49.92  ? 1531 GLU A CB  1 
ATOM   6495  C  CG  . GLU A 1 935  ? -52.061 30.934  8.129   1.00 49.75  ? 1531 GLU A CG  1 
ATOM   6496  C  CD  . GLU A 1 935  ? -51.874 32.304  7.489   1.00 78.42  ? 1531 GLU A CD  1 
ATOM   6497  O  OE1 . GLU A 1 935  ? -52.781 32.746  6.750   1.00 67.19  ? 1531 GLU A OE1 1 
ATOM   6498  O  OE2 . GLU A 1 935  ? -50.826 32.943  7.726   1.00 60.11  ? 1531 GLU A OE2 1 
ATOM   6499  N  N   . PRO A 1 936  ? -47.518 30.789  7.279   1.00 44.24  ? 1532 PRO A N   1 
ATOM   6500  C  CA  . PRO A 1 936  ? -46.118 30.824  7.727   1.00 40.53  ? 1532 PRO A CA  1 
ATOM   6501  C  C   . PRO A 1 936  ? -45.958 30.783  9.254   1.00 42.95  ? 1532 PRO A C   1 
ATOM   6502  O  O   . PRO A 1 936  ? -45.000 30.182  9.738   1.00 53.28  ? 1532 PRO A O   1 
ATOM   6503  C  CB  . PRO A 1 936  ? -45.612 32.158  7.172   1.00 33.49  ? 1532 PRO A CB  1 
ATOM   6504  C  CG  . PRO A 1 936  ? -46.452 32.397  5.968   1.00 33.65  ? 1532 PRO A CG  1 
ATOM   6505  C  CD  . PRO A 1 936  ? -47.810 31.842  6.291   1.00 39.47  ? 1532 PRO A CD  1 
ATOM   6506  N  N   . MET A 1 937  ? -46.873 31.404  9.995   1.00 43.47  ? 1533 MET A N   1 
ATOM   6507  C  CA  . MET A 1 937  ? -46.826 31.367  11.456  1.00 42.95  ? 1533 MET A CA  1 
ATOM   6508  C  C   . MET A 1 937  ? -47.705 30.275  12.078  1.00 46.18  ? 1533 MET A C   1 
ATOM   6509  O  O   . MET A 1 937  ? -47.837 30.204  13.299  1.00 50.36  ? 1533 MET A O   1 
ATOM   6510  C  CB  . MET A 1 937  ? -47.204 32.731  12.036  1.00 39.95  ? 1533 MET A CB  1 
ATOM   6511  C  CG  . MET A 1 937  ? -45.997 33.510  12.542  1.00 43.70  ? 1533 MET A CG  1 
ATOM   6512  S  SD  . MET A 1 937  ? -46.401 34.949  13.547  1.00 61.63  ? 1533 MET A SD  1 
ATOM   6513  C  CE  . MET A 1 937  ? -47.227 35.984  12.343  1.00 60.23  ? 1533 MET A CE  1 
ATOM   6514  N  N   . GLY A 1 938  ? -48.323 29.446  11.242  1.00 49.93  ? 1534 GLY A N   1 
ATOM   6515  C  CA  . GLY A 1 938  ? -49.114 28.327  11.729  1.00 41.90  ? 1534 GLY A CA  1 
ATOM   6516  C  C   . GLY A 1 938  ? -48.271 27.256  12.406  1.00 66.35  ? 1534 GLY A C   1 
ATOM   6517  O  O   . GLY A 1 938  ? -47.046 27.361  12.461  1.00 75.59  ? 1534 GLY A O   1 
ATOM   6518  N  N   . LYS A 1 939  ? -48.932 26.223  12.923  1.00 66.39  ? 1535 LYS A N   1 
ATOM   6519  C  CA  . LYS A 1 939  ? -48.259 25.139  13.642  1.00 83.63  ? 1535 LYS A CA  1 
ATOM   6520  C  C   . LYS A 1 939  ? -47.443 24.249  12.704  1.00 95.86  ? 1535 LYS A C   1 
ATOM   6521  O  O   . LYS A 1 939  ? -46.389 23.730  13.069  1.00 93.16  ? 1535 LYS A O   1 
ATOM   6522  C  CB  . LYS A 1 939  ? -49.293 24.301  14.402  1.00 91.61  ? 1535 LYS A CB  1 
ATOM   6523  C  CG  . LYS A 1 939  ? -48.726 23.100  15.143  1.00 114.28 ? 1535 LYS A CG  1 
ATOM   6524  C  CD  . LYS A 1 939  ? -49.814 22.384  15.930  1.00 105.05 ? 1535 LYS A CD  1 
ATOM   6525  C  CE  . LYS A 1 939  ? -49.273 21.150  16.634  1.00 107.64 ? 1535 LYS A CE  1 
ATOM   6526  N  NZ  . LYS A 1 939  ? -48.792 20.121  15.670  1.00 100.89 ? 1535 LYS A NZ  1 
ATOM   6527  N  N   . GLN A 1 940  ? -47.949 24.104  11.486  1.00 86.29  ? 1536 GLN A N   1 
ATOM   6528  C  CA  . GLN A 1 940  ? -47.350 23.303  10.420  1.00 103.69 ? 1536 GLN A CA  1 
ATOM   6529  C  C   . GLN A 1 940  ? -46.398 24.152  9.596   1.00 93.38  ? 1536 GLN A C   1 
ATOM   6530  O  O   . GLN A 1 940  ? -45.940 23.748  8.526   1.00 70.50  ? 1536 GLN A O   1 
ATOM   6531  C  CB  . GLN A 1 940  ? -48.416 22.665  9.532   1.00 89.25  ? 1536 GLN A CB  1 
ATOM   6532  C  CG  . GLN A 1 940  ? -48.884 21.312  10.050  1.00 100.30 ? 1536 GLN A CG  1 
ATOM   6533  C  CD  . GLN A 1 940  ? -47.740 20.456  10.578  1.00 113.82 ? 1536 GLN A CD  1 
ATOM   6534  O  OE1 . GLN A 1 940  ? -46.695 20.324  9.938   1.00 110.99 ? 1536 GLN A OE1 1 
ATOM   6535  N  NE2 . GLN A 1 940  ? -47.935 19.875  11.757  1.00 95.16  ? 1536 GLN A NE2 1 
ATOM   6536  N  N   . GLY A 1 941  ? -46.109 25.337  10.112  1.00 84.64  ? 1537 GLY A N   1 
ATOM   6537  C  CA  . GLY A 1 941  ? -45.865 26.536  9.345   1.00 69.03  ? 1537 GLY A CA  1 
ATOM   6538  C  C   . GLY A 1 941  ? -44.645 26.648  8.456   1.00 71.43  ? 1537 GLY A C   1 
ATOM   6539  O  O   . GLY A 1 941  ? -44.330 27.756  8.018   1.00 61.86  ? 1537 GLY A O   1 
ATOM   6540  N  N   . ARG A 1 942  ? -43.929 25.561  8.177   1.00 62.82  ? 1538 ARG A N   1 
ATOM   6541  C  CA  . ARG A 1 942  ? -42.926 25.759  7.151   1.00 66.18  ? 1538 ARG A CA  1 
ATOM   6542  C  C   . ARG A 1 942  ? -43.678 25.452  5.868   1.00 62.03  ? 1538 ARG A C   1 
ATOM   6543  O  O   . ARG A 1 942  ? -43.783 24.305  5.431   1.00 55.53  ? 1538 ARG A O   1 
ATOM   6544  C  CB  . ARG A 1 942  ? -41.763 24.784  7.392   1.00 67.33  ? 1538 ARG A CB  1 
ATOM   6545  C  CG  . ARG A 1 942  ? -40.562 24.832  6.473   1.00 68.11  ? 1538 ARG A CG  1 
ATOM   6546  C  CD  . ARG A 1 942  ? -39.616 23.696  6.868   1.00 46.22  ? 1538 ARG A CD  1 
ATOM   6547  N  NE  . ARG A 1 942  ? -38.208 23.993  6.626   1.00 80.99  ? 1538 ARG A NE  1 
ATOM   6548  C  CZ  . ARG A 1 942  ? -37.404 24.578  7.509   1.00 67.15  ? 1538 ARG A CZ  1 
ATOM   6549  N  NH1 . ARG A 1 942  ? -37.868 24.945  8.696   1.00 64.93  ? 1538 ARG A NH1 1 
ATOM   6550  N  NH2 . ARG A 1 942  ? -36.136 24.803  7.203   1.00 80.80  ? 1538 ARG A NH2 1 
ATOM   6551  N  N   . VAL A 1 943  ? -44.183 26.531  5.275   1.00 49.85  ? 1539 VAL A N   1 
ATOM   6552  C  CA  . VAL A 1 943  ? -44.870 26.544  3.988   1.00 41.50  ? 1539 VAL A CA  1 
ATOM   6553  C  C   . VAL A 1 943  ? -44.158 27.188  2.798   1.00 41.68  ? 1539 VAL A C   1 
ATOM   6554  O  O   . VAL A 1 943  ? -44.687 27.183  1.687   1.00 51.23  ? 1539 VAL A O   1 
ATOM   6555  C  CB  . VAL A 1 943  ? -46.240 27.203  4.168   1.00 47.66  ? 1539 VAL A CB  1 
ATOM   6556  C  CG1 . VAL A 1 943  ? -47.080 26.338  5.078   1.00 30.31  ? 1539 VAL A CG1 1 
ATOM   6557  C  CG2 . VAL A 1 943  ? -46.086 28.588  4.774   1.00 57.11  ? 1539 VAL A CG2 1 
ATOM   6558  N  N   . LEU A 1 944  ? -42.994 27.783  3.026   1.00 45.03  ? 1540 LEU A N   1 
ATOM   6559  C  CA  . LEU A 1 944  ? -42.446 28.698  2.025   1.00 33.56  ? 1540 LEU A CA  1 
ATOM   6560  C  C   . LEU A 1 944  ? -41.826 27.951  0.857   1.00 37.42  ? 1540 LEU A C   1 
ATOM   6561  O  O   . LEU A 1 944  ? -41.361 26.822  1.005   1.00 41.26  ? 1540 LEU A O   1 
ATOM   6562  C  CB  . LEU A 1 944  ? -41.407 29.640  2.644   1.00 39.13  ? 1540 LEU A CB  1 
ATOM   6563  C  CG  . LEU A 1 944  ? -41.848 30.607  3.748   1.00 43.31  ? 1540 LEU A CG  1 
ATOM   6564  C  CD1 . LEU A 1 944  ? -40.889 31.785  3.821   1.00 37.47  ? 1540 LEU A CD1 1 
ATOM   6565  C  CD2 . LEU A 1 944  ? -43.274 31.085  3.539   1.00 43.48  ? 1540 LEU A CD2 1 
ATOM   6566  N  N   . HIS A 1 945  ? -41.830 28.589  -0.307  1.00 35.60  ? 1541 HIS A N   1 
ATOM   6567  C  CA  . HIS A 1 945  ? -41.195 28.018  -1.482  1.00 33.64  ? 1541 HIS A CA  1 
ATOM   6568  C  C   . HIS A 1 945  ? -39.684 28.011  -1.288  1.00 37.45  ? 1541 HIS A C   1 
ATOM   6569  O  O   . HIS A 1 945  ? -39.126 28.957  -0.733  1.00 46.50  ? 1541 HIS A O   1 
ATOM   6570  C  CB  . HIS A 1 945  ? -41.575 28.806  -2.735  1.00 36.52  ? 1541 HIS A CB  1 
ATOM   6571  C  CG  . HIS A 1 945  ? -41.235 28.104  -4.014  1.00 38.03  ? 1541 HIS A CG  1 
ATOM   6572  N  ND1 . HIS A 1 945  ? -40.015 28.241  -4.635  1.00 39.22  ? 1541 HIS A ND1 1 
ATOM   6573  C  CD2 . HIS A 1 945  ? -41.956 27.248  -4.776  1.00 29.82  ? 1541 HIS A CD2 1 
ATOM   6574  C  CE1 . HIS A 1 945  ? -39.999 27.504  -5.735  1.00 32.53  ? 1541 HIS A CE1 1 
ATOM   6575  N  NE2 . HIS A 1 945  ? -41.163 26.894  -5.842  1.00 34.56  ? 1541 HIS A NE2 1 
ATOM   6576  N  N   . PRO A 1 946  ? -39.020 26.932  -1.731  1.00 39.25  ? 1542 PRO A N   1 
ATOM   6577  C  CA  . PRO A 1 946  ? -37.568 26.768  -1.593  1.00 31.67  ? 1542 PRO A CA  1 
ATOM   6578  C  C   . PRO A 1 946  ? -36.750 27.930  -2.159  1.00 37.94  ? 1542 PRO A C   1 
ATOM   6579  O  O   . PRO A 1 946  ? -35.633 28.164  -1.697  1.00 40.97  ? 1542 PRO A O   1 
ATOM   6580  C  CB  . PRO A 1 946  ? -37.292 25.486  -2.381  1.00 34.23  ? 1542 PRO A CB  1 
ATOM   6581  C  CG  . PRO A 1 946  ? -38.549 24.709  -2.261  1.00 36.21  ? 1542 PRO A CG  1 
ATOM   6582  C  CD  . PRO A 1 946  ? -39.655 25.725  -2.289  1.00 29.65  ? 1542 PRO A CD  1 
ATOM   6583  N  N   . GLU A 1 947  ? -37.294 28.639  -3.144  1.00 44.11  ? 1543 GLU A N   1 
ATOM   6584  C  CA  . GLU A 1 947  ? -36.585 29.757  -3.761  1.00 36.52  ? 1543 GLU A CA  1 
ATOM   6585  C  C   . GLU A 1 947  ? -37.419 31.035  -3.812  1.00 40.49  ? 1543 GLU A C   1 
ATOM   6586  O  O   . GLU A 1 947  ? -37.054 32.043  -3.206  1.00 48.76  ? 1543 GLU A O   1 
ATOM   6587  C  CB  . GLU A 1 947  ? -36.112 29.370  -5.162  1.00 29.60  ? 1543 GLU A CB  1 
ATOM   6588  C  CG  . GLU A 1 947  ? -34.684 28.854  -5.170  1.00 42.88  ? 1543 GLU A CG  1 
ATOM   6589  C  CD  . GLU A 1 947  ? -34.465 27.729  -6.158  1.00 48.78  ? 1543 GLU A CD  1 
ATOM   6590  O  OE1 . GLU A 1 947  ? -34.850 27.883  -7.335  1.00 72.39  ? 1543 GLU A OE1 1 
ATOM   6591  O  OE2 . GLU A 1 947  ? -33.907 26.687  -5.751  1.00 43.73  ? 1543 GLU A OE2 1 
ATOM   6592  N  N   . GLN A 1 948  ? -38.530 30.990  -4.540  1.00 40.17  ? 1544 GLN A N   1 
ATOM   6593  C  CA  . GLN A 1 948  ? -39.388 32.160  -4.725  1.00 28.29  ? 1544 GLN A CA  1 
ATOM   6594  C  C   . GLN A 1 948  ? -39.966 32.610  -3.391  1.00 42.50  ? 1544 GLN A C   1 
ATOM   6595  O  O   . GLN A 1 948  ? -40.058 31.815  -2.456  1.00 45.48  ? 1544 GLN A O   1 
ATOM   6596  C  CB  . GLN A 1 948  ? -40.519 31.842  -5.703  1.00 21.35  ? 1544 GLN A CB  1 
ATOM   6597  C  CG  . GLN A 1 948  ? -40.058 31.120  -6.956  1.00 39.23  ? 1544 GLN A CG  1 
ATOM   6598  C  CD  . GLN A 1 948  ? -41.182 30.372  -7.640  1.00 36.46  ? 1544 GLN A CD  1 
ATOM   6599  O  OE1 . GLN A 1 948  ? -42.356 30.693  -7.457  1.00 40.03  ? 1544 GLN A OE1 1 
ATOM   6600  N  NE2 . GLN A 1 948  ? -40.829 29.362  -8.426  1.00 31.76  ? 1544 GLN A NE2 1 
ATOM   6601  N  N   . HIS A 1 949  ? -40.358 33.877  -3.289  1.00 32.86  ? 1545 HIS A N   1 
ATOM   6602  C  CA  . HIS A 1 949  ? -40.900 34.343  -2.022  1.00 34.50  ? 1545 HIS A CA  1 
ATOM   6603  C  C   . HIS A 1 949  ? -42.416 34.373  -2.099  1.00 43.89  ? 1545 HIS A C   1 
ATOM   6604  O  O   . HIS A 1 949  ? -43.005 35.267  -2.708  1.00 56.92  ? 1545 HIS A O   1 
ATOM   6605  C  CB  . HIS A 1 949  ? -40.366 35.734  -1.679  1.00 35.93  ? 1545 HIS A CB  1 
ATOM   6606  C  CG  . HIS A 1 949  ? -38.934 35.945  -2.058  1.00 35.95  ? 1545 HIS A CG  1 
ATOM   6607  N  ND1 . HIS A 1 949  ? -37.903 35.211  -1.513  1.00 35.05  ? 1545 HIS A ND1 1 
ATOM   6608  C  CD2 . HIS A 1 949  ? -38.360 36.814  -2.924  1.00 33.92  ? 1545 HIS A CD2 1 
ATOM   6609  C  CE1 . HIS A 1 949  ? -36.756 35.615  -2.031  1.00 36.29  ? 1545 HIS A CE1 1 
ATOM   6610  N  NE2 . HIS A 1 949  ? -37.006 36.586  -2.889  1.00 44.60  ? 1545 HIS A NE2 1 
ATOM   6611  N  N   . ARG A 1 950  ? -43.021 33.403  -1.420  1.00 36.95  ? 1546 ARG A N   1 
ATOM   6612  C  CA  . ARG A 1 950  ? -44.463 33.185  -1.397  1.00 43.37  ? 1546 ARG A CA  1 
ATOM   6613  C  C   . ARG A 1 950  ? -44.734 31.906  -0.617  1.00 38.63  ? 1546 ARG A C   1 
ATOM   6614  O  O   . ARG A 1 950  ? -43.821 31.110  -0.393  1.00 33.85  ? 1546 ARG A O   1 
ATOM   6615  C  CB  . ARG A 1 950  ? -45.041 33.067  -2.809  1.00 29.88  ? 1546 ARG A CB  1 
ATOM   6616  C  CG  . ARG A 1 950  ? -44.397 31.975  -3.644  1.00 32.04  ? 1546 ARG A CG  1 
ATOM   6617  C  CD  . ARG A 1 950  ? -45.093 31.818  -4.978  1.00 28.46  ? 1546 ARG A CD  1 
ATOM   6618  N  NE  . ARG A 1 950  ? -44.532 30.726  -5.767  1.00 36.08  ? 1546 ARG A NE  1 
ATOM   6619  C  CZ  . ARG A 1 950  ? -44.852 29.446  -5.606  1.00 28.76  ? 1546 ARG A CZ  1 
ATOM   6620  N  NH1 . ARG A 1 950  ? -44.293 28.521  -6.374  1.00 32.10  ? 1546 ARG A NH1 1 
ATOM   6621  N  NH2 . ARG A 1 950  ? -45.729 29.088  -4.677  1.00 29.98  ? 1546 ARG A NH2 1 
ATOM   6622  N  N   . VAL A 1 951  ? -45.979 31.704  -0.203  1.00 31.62  ? 1547 VAL A N   1 
ATOM   6623  C  CA  . VAL A 1 951  ? -46.387 30.406  0.318   1.00 34.31  ? 1547 VAL A CA  1 
ATOM   6624  C  C   . VAL A 1 951  ? -46.605 29.468  -0.864  1.00 33.86  ? 1547 VAL A C   1 
ATOM   6625  O  O   . VAL A 1 951  ? -46.805 29.922  -1.992  1.00 30.06  ? 1547 VAL A O   1 
ATOM   6626  C  CB  . VAL A 1 951  ? -47.662 30.492  1.181   1.00 38.35  ? 1547 VAL A CB  1 
ATOM   6627  C  CG1 . VAL A 1 951  ? -47.649 31.764  2.013   1.00 35.96  ? 1547 VAL A CG1 1 
ATOM   6628  C  CG2 . VAL A 1 951  ? -48.911 30.428  0.315   1.00 61.18  ? 1547 VAL A CG2 1 
ATOM   6629  N  N   . VAL A 1 952  ? -46.532 28.165  -0.614  1.00 40.53  ? 1548 VAL A N   1 
ATOM   6630  C  CA  . VAL A 1 952  ? -46.750 27.178  -1.667  1.00 29.16  ? 1548 VAL A CA  1 
ATOM   6631  C  C   . VAL A 1 952  ? -48.133 27.321  -2.286  1.00 34.00  ? 1548 VAL A C   1 
ATOM   6632  O  O   . VAL A 1 952  ? -49.096 27.688  -1.611  1.00 39.43  ? 1548 VAL A O   1 
ATOM   6633  C  CB  . VAL A 1 952  ? -46.581 25.743  -1.147  1.00 28.79  ? 1548 VAL A CB  1 
ATOM   6634  C  CG1 . VAL A 1 952  ? -45.112 25.430  -0.945  1.00 31.53  ? 1548 VAL A CG1 1 
ATOM   6635  C  CG2 . VAL A 1 952  ? -47.364 25.548  0.140   1.00 30.88  ? 1548 VAL A CG2 1 
ATOM   6636  N  N   . SER A 1 953  ? -48.222 27.037  -3.579  1.00 31.74  ? 1549 SER A N   1 
ATOM   6637  C  CA  . SER A 1 953  ? -49.474 27.178  -4.302  1.00 33.19  ? 1549 SER A CA  1 
ATOM   6638  C  C   . SER A 1 953  ? -50.411 26.008  -4.032  1.00 36.39  ? 1549 SER A C   1 
ATOM   6639  O  O   . SER A 1 953  ? -50.011 25.001  -3.447  1.00 34.15  ? 1549 SER A O   1 
ATOM   6640  C  CB  . SER A 1 953  ? -49.213 27.299  -5.803  1.00 26.64  ? 1549 SER A CB  1 
ATOM   6641  O  OG  . SER A 1 953  ? -48.874 26.043  -6.360  1.00 34.53  ? 1549 SER A OG  1 
ATOM   6642  N  N   . VAL A 1 954  ? -51.661 26.151  -4.460  1.00 41.27  ? 1550 VAL A N   1 
ATOM   6643  C  CA  . VAL A 1 954  ? -52.642 25.080  -4.338  1.00 32.60  ? 1550 VAL A CA  1 
ATOM   6644  C  C   . VAL A 1 954  ? -52.193 23.874  -5.151  1.00 29.55  ? 1550 VAL A C   1 
ATOM   6645  O  O   . VAL A 1 954  ? -52.285 22.732  -4.696  1.00 43.87  ? 1550 VAL A O   1 
ATOM   6646  C  CB  . VAL A 1 954  ? -54.036 25.532  -4.808  1.00 32.40  ? 1550 VAL A CB  1 
ATOM   6647  C  CG1 . VAL A 1 954  ? -55.008 24.369  -4.776  1.00 28.75  ? 1550 VAL A CG1 1 
ATOM   6648  C  CG2 . VAL A 1 954  ? -54.540 26.672  -3.942  1.00 30.85  ? 1550 VAL A CG2 1 
ATOM   6649  N  N   . ARG A 1 955  ? -51.696 24.147  -6.353  1.00 34.97  ? 1551 ARG A N   1 
ATOM   6650  C  CA  . ARG A 1 955  ? -51.172 23.111  -7.232  1.00 30.94  ? 1551 ARG A CA  1 
ATOM   6651  C  C   . ARG A 1 955  ? -50.031 22.353  -6.566  1.00 32.34  ? 1551 ARG A C   1 
ATOM   6652  O  O   . ARG A 1 955  ? -49.930 21.138  -6.693  1.00 37.92  ? 1551 ARG A O   1 
ATOM   6653  C  CB  . ARG A 1 955  ? -50.700 23.722  -8.555  1.00 35.22  ? 1551 ARG A CB  1 
ATOM   6654  C  CG  . ARG A 1 955  ? -49.992 22.751  -9.494  1.00 34.62  ? 1551 ARG A CG  1 
ATOM   6655  C  CD  . ARG A 1 955  ? -50.835 21.516  -9.765  1.00 28.11  ? 1551 ARG A CD  1 
ATOM   6656  N  NE  . ARG A 1 955  ? -52.207 21.855  -10.127 1.00 29.30  ? 1551 ARG A NE  1 
ATOM   6657  C  CZ  . ARG A 1 955  ? -53.250 21.060  -9.913  1.00 39.39  ? 1551 ARG A CZ  1 
ATOM   6658  N  NH1 . ARG A 1 955  ? -53.076 19.879  -9.334  1.00 44.39  ? 1551 ARG A NH1 1 
ATOM   6659  N  NH2 . ARG A 1 955  ? -54.466 21.446  -10.272 1.00 40.76  ? 1551 ARG A NH2 1 
ATOM   6660  N  N   . GLU A 1 956  ? -49.181 23.078  -5.849  1.00 34.34  ? 1552 GLU A N   1 
ATOM   6661  C  CA  . GLU A 1 956  ? -48.025 22.474  -5.203  1.00 31.75  ? 1552 GLU A CA  1 
ATOM   6662  C  C   . GLU A 1 956  ? -48.436 21.582  -4.034  1.00 34.53  ? 1552 GLU A C   1 
ATOM   6663  O  O   . GLU A 1 956  ? -47.866 20.507  -3.831  1.00 29.12  ? 1552 GLU A O   1 
ATOM   6664  C  CB  . GLU A 1 956  ? -47.055 23.565  -4.747  1.00 27.23  ? 1552 GLU A CB  1 
ATOM   6665  C  CG  . GLU A 1 956  ? -46.276 24.174  -5.902  1.00 33.05  ? 1552 GLU A CG  1 
ATOM   6666  C  CD  . GLU A 1 956  ? -45.696 25.536  -5.586  1.00 37.63  ? 1552 GLU A CD  1 
ATOM   6667  O  OE1 . GLU A 1 956  ? -46.193 26.195  -4.650  1.00 42.82  ? 1552 GLU A OE1 1 
ATOM   6668  O  OE2 . GLU A 1 956  ? -44.744 25.949  -6.280  1.00 30.39  ? 1552 GLU A OE2 1 
ATOM   6669  N  N   . CYS A 1 957  ? -49.433 22.025  -3.275  1.00 37.60  ? 1553 CYS A N   1 
ATOM   6670  C  CA  . CYS A 1 957  ? -49.968 21.222  -2.181  1.00 32.93  ? 1553 CYS A CA  1 
ATOM   6671  C  C   . CYS A 1 957  ? -50.630 19.962  -2.725  1.00 30.44  ? 1553 CYS A C   1 
ATOM   6672  O  O   . CYS A 1 957  ? -50.462 18.874  -2.175  1.00 31.41  ? 1553 CYS A O   1 
ATOM   6673  C  CB  . CYS A 1 957  ? -50.968 22.028  -1.349  1.00 27.41  ? 1553 CYS A CB  1 
ATOM   6674  S  SG  . CYS A 1 957  ? -50.258 23.460  -0.511  1.00 29.15  ? 1553 CYS A SG  1 
ATOM   6675  N  N   . ALA A 1 958  ? -51.380 20.121  -3.811  1.00 35.22  ? 1554 ALA A N   1 
ATOM   6676  C  CA  . ALA A 1 958  ? -52.029 18.994  -4.469  1.00 37.68  ? 1554 ALA A CA  1 
ATOM   6677  C  C   . ALA A 1 958  ? -50.986 18.003  -4.966  1.00 31.35  ? 1554 ALA A C   1 
ATOM   6678  O  O   . ALA A 1 958  ? -51.189 16.790  -4.915  1.00 28.49  ? 1554 ALA A O   1 
ATOM   6679  C  CB  . ALA A 1 958  ? -52.898 19.477  -5.618  1.00 28.41  ? 1554 ALA A CB  1 
ATOM   6680  N  N   . ARG A 1 959  ? -49.867 18.536  -5.444  1.00 28.36  ? 1555 ARG A N   1 
ATOM   6681  C  CA  . ARG A 1 959  ? -48.746 17.720  -5.886  1.00 21.62  ? 1555 ARG A CA  1 
ATOM   6682  C  C   . ARG A 1 959  ? -48.147 16.966  -4.707  1.00 26.78  ? 1555 ARG A C   1 
ATOM   6683  O  O   . ARG A 1 959  ? -47.740 15.813  -4.840  1.00 35.81  ? 1555 ARG A O   1 
ATOM   6684  C  CB  . ARG A 1 959  ? -47.679 18.588  -6.558  1.00 25.74  ? 1555 ARG A CB  1 
ATOM   6685  C  CG  . ARG A 1 959  ? -47.992 19.001  -7.987  1.00 29.92  ? 1555 ARG A CG  1 
ATOM   6686  C  CD  . ARG A 1 959  ? -47.564 17.932  -8.976  1.00 29.66  ? 1555 ARG A CD  1 
ATOM   6687  N  NE  . ARG A 1 959  ? -47.675 18.391  -10.357 1.00 32.74  ? 1555 ARG A NE  1 
ATOM   6688  C  CZ  . ARG A 1 959  ? -46.696 18.997  -11.022 1.00 27.51  ? 1555 ARG A CZ  1 
ATOM   6689  N  NH1 . ARG A 1 959  ? -45.529 19.220  -10.432 1.00 25.57  ? 1555 ARG A NH1 1 
ATOM   6690  N  NH2 . ARG A 1 959  ? -46.884 19.379  -12.277 1.00 31.86  ? 1555 ARG A NH2 1 
ATOM   6691  N  N   . SER A 1 960  ? -48.102 17.622  -3.550  1.00 27.55  ? 1556 SER A N   1 
ATOM   6692  C  CA  . SER A 1 960  ? -47.580 16.995  -2.338  1.00 35.61  ? 1556 SER A CA  1 
ATOM   6693  C  C   . SER A 1 960  ? -48.536 15.926  -1.812  1.00 34.14  ? 1556 SER A C   1 
ATOM   6694  O  O   . SER A 1 960  ? -48.158 15.095  -0.985  1.00 33.56  ? 1556 SER A O   1 
ATOM   6695  C  CB  . SER A 1 960  ? -47.326 18.043  -1.253  1.00 26.50  ? 1556 SER A CB  1 
ATOM   6696  O  OG  . SER A 1 960  ? -48.540 18.478  -0.666  1.00 37.11  ? 1556 SER A OG  1 
ATOM   6697  N  N   . GLN A 1 961  ? -49.774 15.958  -2.295  1.00 31.00  ? 1557 GLN A N   1 
ATOM   6698  C  CA  . GLN A 1 961  ? -50.790 14.998  -1.882  1.00 29.78  ? 1557 GLN A CA  1 
ATOM   6699  C  C   . GLN A 1 961  ? -50.922 13.858  -2.884  1.00 40.16  ? 1557 GLN A C   1 
ATOM   6700  O  O   . GLN A 1 961  ? -51.680 12.917  -2.666  1.00 49.50  ? 1557 GLN A O   1 
ATOM   6701  C  CB  . GLN A 1 961  ? -52.142 15.695  -1.703  1.00 31.75  ? 1557 GLN A CB  1 
ATOM   6702  C  CG  . GLN A 1 961  ? -52.311 16.414  -0.376  1.00 32.39  ? 1557 GLN A CG  1 
ATOM   6703  C  CD  . GLN A 1 961  ? -52.581 15.461  0.773   1.00 40.20  ? 1557 GLN A CD  1 
ATOM   6704  O  OE1 . GLN A 1 961  ? -51.713 14.681  1.169   1.00 43.31  ? 1557 GLN A OE1 1 
ATOM   6705  N  NE2 . GLN A 1 961  ? -53.792 15.517  1.314   1.00 39.99  ? 1557 GLN A NE2 1 
ATOM   6706  N  N   . GLY A 1 962  ? -50.186 13.948  -3.986  1.00 28.05  ? 1558 GLY A N   1 
ATOM   6707  C  CA  . GLY A 1 962  ? -50.219 12.908  -4.998  1.00 32.61  ? 1558 GLY A CA  1 
ATOM   6708  C  C   . GLY A 1 962  ? -51.419 13.017  -5.919  1.00 33.62  ? 1558 GLY A C   1 
ATOM   6709  O  O   . GLY A 1 962  ? -51.796 12.050  -6.582  1.00 33.92  ? 1558 GLY A O   1 
ATOM   6710  N  N   . PHE A 1 963  ? -52.023 14.200  -5.958  1.00 38.87  ? 1559 PHE A N   1 
ATOM   6711  C  CA  . PHE A 1 963  ? -53.144 14.458  -6.852  1.00 25.50  ? 1559 PHE A CA  1 
ATOM   6712  C  C   . PHE A 1 963  ? -52.684 14.629  -8.289  1.00 33.07  ? 1559 PHE A C   1 
ATOM   6713  O  O   . PHE A 1 963  ? -51.743 15.375  -8.557  1.00 51.42  ? 1559 PHE A O   1 
ATOM   6714  C  CB  . PHE A 1 963  ? -53.908 15.711  -6.421  1.00 34.06  ? 1559 PHE A CB  1 
ATOM   6715  C  CG  . PHE A 1 963  ? -54.966 15.455  -5.392  1.00 37.67  ? 1559 PHE A CG  1 
ATOM   6716  C  CD1 . PHE A 1 963  ? -56.143 14.815  -5.737  1.00 41.49  ? 1559 PHE A CD1 1 
ATOM   6717  C  CD2 . PHE A 1 963  ? -54.787 15.860  -4.082  1.00 34.78  ? 1559 PHE A CD2 1 
ATOM   6718  C  CE1 . PHE A 1 963  ? -57.121 14.580  -4.793  1.00 41.21  ? 1559 PHE A CE1 1 
ATOM   6719  C  CE2 . PHE A 1 963  ? -55.761 15.629  -3.134  1.00 41.96  ? 1559 PHE A CE2 1 
ATOM   6720  C  CZ  . PHE A 1 963  ? -56.930 14.988  -3.490  1.00 45.70  ? 1559 PHE A CZ  1 
ATOM   6721  N  N   . PRO A 1 964  ? -53.348 13.934  -9.223  1.00 41.88  ? 1560 PRO A N   1 
ATOM   6722  C  CA  . PRO A 1 964  ? -53.140 14.210  -10.646 1.00 27.20  ? 1560 PRO A CA  1 
ATOM   6723  C  C   . PRO A 1 964  ? -53.453 15.668  -10.955 1.00 29.14  ? 1560 PRO A C   1 
ATOM   6724  O  O   . PRO A 1 964  ? -54.375 16.227  -10.365 1.00 35.00  ? 1560 PRO A O   1 
ATOM   6725  C  CB  . PRO A 1 964  ? -54.135 13.272  -11.338 1.00 30.88  ? 1560 PRO A CB  1 
ATOM   6726  C  CG  . PRO A 1 964  ? -54.340 12.165  -10.365 1.00 21.44  ? 1560 PRO A CG  1 
ATOM   6727  C  CD  . PRO A 1 964  ? -54.264 12.802  -9.008  1.00 43.28  ? 1560 PRO A CD  1 
ATOM   6728  N  N   . ASP A 1 965  ? -52.693 16.274  -11.860 1.00 32.99  ? 1561 ASP A N   1 
ATOM   6729  C  CA  . ASP A 1 965  ? -52.879 17.685  -12.179 1.00 29.94  ? 1561 ASP A CA  1 
ATOM   6730  C  C   . ASP A 1 965  ? -54.235 17.948  -12.824 1.00 24.74  ? 1561 ASP A C   1 
ATOM   6731  O  O   . ASP A 1 965  ? -54.732 19.073  -12.807 1.00 39.30  ? 1561 ASP A O   1 
ATOM   6732  C  CB  . ASP A 1 965  ? -51.755 18.168  -13.093 1.00 23.61  ? 1561 ASP A CB  1 
ATOM   6733  C  CG  . ASP A 1 965  ? -50.420 18.236  -12.381 1.00 41.66  ? 1561 ASP A CG  1 
ATOM   6734  O  OD1 . ASP A 1 965  ? -50.313 17.683  -11.265 1.00 43.83  ? 1561 ASP A OD1 1 
ATOM   6735  O  OD2 . ASP A 1 965  ? -49.478 18.840  -12.935 1.00 36.34  ? 1561 ASP A OD2 1 
ATOM   6736  N  N   . THR A 1 966  ? -54.832 16.902  -13.384 1.00 28.79  ? 1562 THR A N   1 
ATOM   6737  C  CA  . THR A 1 966  ? -56.139 17.021  -14.016 1.00 29.27  ? 1562 THR A CA  1 
ATOM   6738  C  C   . THR A 1 966  ? -57.272 16.852  -13.011 1.00 30.72  ? 1562 THR A C   1 
ATOM   6739  O  O   . THR A 1 966  ? -58.445 16.943  -13.372 1.00 45.97  ? 1562 THR A O   1 
ATOM   6740  C  CB  . THR A 1 966  ? -56.312 15.992  -15.145 1.00 22.05  ? 1562 THR A CB  1 
ATOM   6741  O  OG1 . THR A 1 966  ? -55.979 14.686  -14.659 1.00 42.84  ? 1562 THR A OG1 1 
ATOM   6742  C  CG2 . THR A 1 966  ? -55.408 16.335  -16.312 1.00 23.62  ? 1562 THR A CG2 1 
ATOM   6743  N  N   . TYR A 1 967  ? -56.925 16.604  -11.753 1.00 33.27  ? 1563 TYR A N   1 
ATOM   6744  C  CA  . TYR A 1 967  ? -57.942 16.470  -10.718 1.00 38.97  ? 1563 TYR A CA  1 
ATOM   6745  C  C   . TYR A 1 967  ? -58.529 17.838  -10.399 1.00 32.85  ? 1563 TYR A C   1 
ATOM   6746  O  O   . TYR A 1 967  ? -57.800 18.778  -10.078 1.00 45.48  ? 1563 TYR A O   1 
ATOM   6747  C  CB  . TYR A 1 967  ? -57.370 15.824  -9.455  1.00 31.10  ? 1563 TYR A CB  1 
ATOM   6748  C  CG  . TYR A 1 967  ? -58.434 15.216  -8.575  1.00 30.78  ? 1563 TYR A CG  1 
ATOM   6749  C  CD1 . TYR A 1 967  ? -58.838 13.900  -8.754  1.00 30.34  ? 1563 TYR A CD1 1 
ATOM   6750  C  CD2 . TYR A 1 967  ? -59.049 15.961  -7.578  1.00 35.69  ? 1563 TYR A CD2 1 
ATOM   6751  C  CE1 . TYR A 1 967  ? -59.817 13.339  -7.958  1.00 42.73  ? 1563 TYR A CE1 1 
ATOM   6752  C  CE2 . TYR A 1 967  ? -60.029 15.409  -6.777  1.00 42.33  ? 1563 TYR A CE2 1 
ATOM   6753  C  CZ  . TYR A 1 967  ? -60.409 14.098  -6.973  1.00 47.54  ? 1563 TYR A CZ  1 
ATOM   6754  O  OH  . TYR A 1 967  ? -61.386 13.543  -6.179  1.00 55.98  ? 1563 TYR A OH  1 
ATOM   6755  N  N   . ARG A 1 968  ? -59.850 17.942  -10.483 1.00 33.08  ? 1564 ARG A N   1 
ATOM   6756  C  CA  . ARG A 1 968  ? -60.519 19.232  -10.374 1.00 37.91  ? 1564 ARG A CA  1 
ATOM   6757  C  C   . ARG A 1 968  ? -60.885 19.614  -8.944  1.00 24.98  ? 1564 ARG A C   1 
ATOM   6758  O  O   . ARG A 1 968  ? -61.347 18.786  -8.160  1.00 31.63  ? 1564 ARG A O   1 
ATOM   6759  C  CB  . ARG A 1 968  ? -61.777 19.241  -11.245 1.00 46.40  ? 1564 ARG A CB  1 
ATOM   6760  C  CG  . ARG A 1 968  ? -61.485 19.163  -12.735 1.00 47.89  ? 1564 ARG A CG  1 
ATOM   6761  C  CD  . ARG A 1 968  ? -62.496 19.964  -13.536 1.00 67.08  ? 1564 ARG A CD  1 
ATOM   6762  N  NE  . ARG A 1 968  ? -63.516 19.121  -14.150 1.00 95.20  ? 1564 ARG A NE  1 
ATOM   6763  C  CZ  . ARG A 1 968  ? -64.576 19.589  -14.801 1.00 97.58  ? 1564 ARG A CZ  1 
ATOM   6764  N  NH1 . ARG A 1 968  ? -64.760 20.898  -14.915 1.00 62.01  ? 1564 ARG A NH1 1 
ATOM   6765  N  NH2 . ARG A 1 968  ? -65.454 18.750  -15.334 1.00 88.34  ? 1564 ARG A NH2 1 
ATOM   6766  N  N   . LEU A 1 969  ? -60.674 20.886  -8.624  1.00 40.44  ? 1565 LEU A N   1 
ATOM   6767  C  CA  . LEU A 1 969  ? -61.069 21.449  -7.341  1.00 30.74  ? 1565 LEU A CA  1 
ATOM   6768  C  C   . LEU A 1 969  ? -62.170 22.480  -7.581  1.00 42.88  ? 1565 LEU A C   1 
ATOM   6769  O  O   . LEU A 1 969  ? -62.569 22.709  -8.724  1.00 40.28  ? 1565 LEU A O   1 
ATOM   6770  C  CB  . LEU A 1 969  ? -59.868 22.078  -6.634  1.00 24.34  ? 1565 LEU A CB  1 
ATOM   6771  C  CG  . LEU A 1 969  ? -58.626 21.187  -6.536  1.00 31.18  ? 1565 LEU A CG  1 
ATOM   6772  C  CD1 . LEU A 1 969  ? -57.441 21.961  -5.985  1.00 24.83  ? 1565 LEU A CD1 1 
ATOM   6773  C  CD2 . LEU A 1 969  ? -58.903 19.960  -5.682  1.00 28.69  ? 1565 LEU A CD2 1 
ATOM   6774  N  N   . PHE A 1 970  ? -62.662 23.101  -6.514  1.00 43.84  ? 1566 PHE A N   1 
ATOM   6775  C  CA  . PHE A 1 970  ? -63.785 24.025  -6.640  1.00 33.86  ? 1566 PHE A CA  1 
ATOM   6776  C  C   . PHE A 1 970  ? -63.764 25.126  -5.585  1.00 37.11  ? 1566 PHE A C   1 
ATOM   6777  O  O   . PHE A 1 970  ? -63.293 24.920  -4.466  1.00 45.48  ? 1566 PHE A O   1 
ATOM   6778  C  CB  . PHE A 1 970  ? -65.106 23.253  -6.561  1.00 32.04  ? 1566 PHE A CB  1 
ATOM   6779  C  CG  . PHE A 1 970  ? -66.326 24.108  -6.759  1.00 43.85  ? 1566 PHE A CG  1 
ATOM   6780  C  CD1 . PHE A 1 970  ? -66.805 24.369  -8.031  1.00 35.10  ? 1566 PHE A CD1 1 
ATOM   6781  C  CD2 . PHE A 1 970  ? -66.999 24.643  -5.672  1.00 44.61  ? 1566 PHE A CD2 1 
ATOM   6782  C  CE1 . PHE A 1 970  ? -67.928 25.153  -8.215  1.00 41.88  ? 1566 PHE A CE1 1 
ATOM   6783  C  CE2 . PHE A 1 970  ? -68.121 25.429  -5.851  1.00 43.92  ? 1566 PHE A CE2 1 
ATOM   6784  C  CZ  . PHE A 1 970  ? -68.587 25.683  -7.123  1.00 40.33  ? 1566 PHE A CZ  1 
ATOM   6785  N  N   . GLY A 1 971  ? -64.285 26.295  -5.949  1.00 32.57  ? 1567 GLY A N   1 
ATOM   6786  C  CA  . GLY A 1 971  ? -64.429 27.395  -5.013  1.00 39.99  ? 1567 GLY A CA  1 
ATOM   6787  C  C   . GLY A 1 971  ? -63.280 28.380  -5.066  1.00 32.53  ? 1567 GLY A C   1 
ATOM   6788  O  O   . GLY A 1 971  ? -62.489 28.378  -6.008  1.00 35.38  ? 1567 GLY A O   1 
ATOM   6789  N  N   . ASN A 1 972  ? -63.190 29.231  -4.051  1.00 35.52  ? 1568 ASN A N   1 
ATOM   6790  C  CA  . ASN A 1 972  ? -62.087 30.173  -3.964  1.00 30.55  ? 1568 ASN A CA  1 
ATOM   6791  C  C   . ASN A 1 972  ? -60.820 29.464  -3.508  1.00 38.16  ? 1568 ASN A C   1 
ATOM   6792  O  O   . ASN A 1 972  ? -60.828 28.257  -3.266  1.00 46.38  ? 1568 ASN A O   1 
ATOM   6793  C  CB  . ASN A 1 972  ? -62.429 31.328  -3.023  1.00 29.77  ? 1568 ASN A CB  1 
ATOM   6794  C  CG  . ASN A 1 972  ? -62.688 30.867  -1.606  1.00 35.51  ? 1568 ASN A CG  1 
ATOM   6795  O  OD1 . ASN A 1 972  ? -61.760 30.717  -0.812  1.00 55.10  ? 1568 ASN A OD1 1 
ATOM   6796  N  ND2 . ASN A 1 972  ? -63.956 30.648  -1.276  1.00 47.01  ? 1568 ASN A ND2 1 
ATOM   6797  N  N   . ILE A 1 973  ? -59.733 30.216  -3.388  1.00 29.32  ? 1569 ILE A N   1 
ATOM   6798  C  CA  . ILE A 1 973  ? -58.422 29.626  -3.152  1.00 28.05  ? 1569 ILE A CA  1 
ATOM   6799  C  C   . ILE A 1 973  ? -58.335 28.880  -1.813  1.00 37.90  ? 1569 ILE A C   1 
ATOM   6800  O  O   . ILE A 1 973  ? -57.729 27.807  -1.732  1.00 34.72  ? 1569 ILE A O   1 
ATOM   6801  C  CB  . ILE A 1 973  ? -57.319 30.708  -3.240  1.00 30.15  ? 1569 ILE A CB  1 
ATOM   6802  C  CG1 . ILE A 1 973  ? -55.936 30.079  -3.072  1.00 38.79  ? 1569 ILE A CG1 1 
ATOM   6803  C  CG2 . ILE A 1 973  ? -57.551 31.828  -2.227  1.00 27.09  ? 1569 ILE A CG2 1 
ATOM   6804  C  CD1 . ILE A 1 973  ? -54.813 31.053  -3.289  1.00 34.09  ? 1569 ILE A CD1 1 
ATOM   6805  N  N   . LEU A 1 974  ? -58.957 29.430  -0.775  1.00 34.09  ? 1570 LEU A N   1 
ATOM   6806  C  CA  . LEU A 1 974  ? -58.958 28.788  0.534   1.00 42.66  ? 1570 LEU A CA  1 
ATOM   6807  C  C   . LEU A 1 974  ? -59.771 27.501  0.499   1.00 40.10  ? 1570 LEU A C   1 
ATOM   6808  O  O   . LEU A 1 974  ? -59.427 26.515  1.159   1.00 40.44  ? 1570 LEU A O   1 
ATOM   6809  C  CB  . LEU A 1 974  ? -59.509 29.730  1.606   1.00 26.06  ? 1570 LEU A CB  1 
ATOM   6810  C  CG  . LEU A 1 974  ? -58.620 30.916  1.980   1.00 36.27  ? 1570 LEU A CG  1 
ATOM   6811  C  CD1 . LEU A 1 974  ? -59.205 31.657  3.169   1.00 24.72  ? 1570 LEU A CD1 1 
ATOM   6812  C  CD2 . LEU A 1 974  ? -57.202 30.454  2.277   1.00 33.56  ? 1570 LEU A CD2 1 
ATOM   6813  N  N   . ASP A 1 975  ? -60.850 27.518  -0.279  1.00 37.65  ? 1571 ASP A N   1 
ATOM   6814  C  CA  . ASP A 1 975  ? -61.672 26.331  -0.470  1.00 45.35  ? 1571 ASP A CA  1 
ATOM   6815  C  C   . ASP A 1 975  ? -60.838 25.203  -1.054  1.00 41.27  ? 1571 ASP A C   1 
ATOM   6816  O  O   . ASP A 1 975  ? -60.844 24.093  -0.536  1.00 38.83  ? 1571 ASP A O   1 
ATOM   6817  C  CB  . ASP A 1 975  ? -62.865 26.627  -1.383  1.00 40.22  ? 1571 ASP A CB  1 
ATOM   6818  C  CG  . ASP A 1 975  ? -63.896 27.520  -0.726  1.00 47.15  ? 1571 ASP A CG  1 
ATOM   6819  O  OD1 . ASP A 1 975  ? -63.991 27.506  0.520   1.00 41.67  ? 1571 ASP A OD1 1 
ATOM   6820  O  OD2 . ASP A 1 975  ? -64.611 28.236  -1.456  1.00 48.44  ? 1571 ASP A OD2 1 
ATOM   6821  N  N   . LYS A 1 976  ? -60.112 25.502  -2.126  1.00 35.79  ? 1572 LYS A N   1 
ATOM   6822  C  CA  . LYS A 1 976  ? -59.271 24.510  -2.787  1.00 34.79  ? 1572 LYS A CA  1 
ATOM   6823  C  C   . LYS A 1 976  ? -58.158 24.016  -1.868  1.00 35.20  ? 1572 LYS A C   1 
ATOM   6824  O  O   . LYS A 1 976  ? -57.907 22.811  -1.778  1.00 41.70  ? 1572 LYS A O   1 
ATOM   6825  C  CB  . LYS A 1 976  ? -58.683 25.088  -4.074  1.00 31.54  ? 1572 LYS A CB  1 
ATOM   6826  C  CG  . LYS A 1 976  ? -59.733 25.460  -5.107  1.00 34.81  ? 1572 LYS A CG  1 
ATOM   6827  C  CD  . LYS A 1 976  ? -59.104 26.032  -6.364  1.00 30.17  ? 1572 LYS A CD  1 
ATOM   6828  C  CE  . LYS A 1 976  ? -60.167 26.389  -7.389  1.00 28.43  ? 1572 LYS A CE  1 
ATOM   6829  N  NZ  . LYS A 1 976  ? -59.580 27.032  -8.594  1.00 35.66  ? 1572 LYS A NZ  1 
ATOM   6830  N  N   . HIS A 1 977  ? -57.497 24.952  -1.191  1.00 28.15  ? 1573 HIS A N   1 
ATOM   6831  C  CA  . HIS A 1 977  ? -56.476 24.608  -0.204  1.00 29.65  ? 1573 HIS A CA  1 
ATOM   6832  C  C   . HIS A 1 977  ? -57.012 23.608  0.819   1.00 39.10  ? 1573 HIS A C   1 
ATOM   6833  O  O   . HIS A 1 977  ? -56.351 22.621  1.154   1.00 40.88  ? 1573 HIS A O   1 
ATOM   6834  C  CB  . HIS A 1 977  ? -55.975 25.867  0.510   1.00 30.19  ? 1573 HIS A CB  1 
ATOM   6835  C  CG  . HIS A 1 977  ? -54.716 26.436  -0.065  1.00 37.20  ? 1573 HIS A CG  1 
ATOM   6836  N  ND1 . HIS A 1 977  ? -53.534 25.730  -0.116  1.00 38.82  ? 1573 HIS A ND1 1 
ATOM   6837  C  CD2 . HIS A 1 977  ? -54.451 27.654  -0.596  1.00 34.93  ? 1573 HIS A CD2 1 
ATOM   6838  C  CE1 . HIS A 1 977  ? -52.597 26.484  -0.664  1.00 41.23  ? 1573 HIS A CE1 1 
ATOM   6839  N  NE2 . HIS A 1 977  ? -53.128 27.655  -0.964  1.00 46.60  ? 1573 HIS A NE2 1 
ATOM   6840  N  N   . ARG A 1 978  ? -58.222 23.870  1.302   1.00 38.17  ? 1574 ARG A N   1 
ATOM   6841  C  CA  . ARG A 1 978  ? -58.865 23.019  2.295   1.00 40.43  ? 1574 ARG A CA  1 
ATOM   6842  C  C   . ARG A 1 978  ? -59.215 21.643  1.730   1.00 37.50  ? 1574 ARG A C   1 
ATOM   6843  O  O   . ARG A 1 978  ? -58.985 20.622  2.378   1.00 34.55  ? 1574 ARG A O   1 
ATOM   6844  C  CB  . ARG A 1 978  ? -60.119 23.706  2.836   1.00 47.01  ? 1574 ARG A CB  1 
ATOM   6845  C  CG  . ARG A 1 978  ? -60.900 22.905  3.859   1.00 40.94  ? 1574 ARG A CG  1 
ATOM   6846  C  CD  . ARG A 1 978  ? -61.943 23.788  4.526   1.00 40.07  ? 1574 ARG A CD  1 
ATOM   6847  N  NE  . ARG A 1 978  ? -63.115 23.038  4.965   1.00 69.10  ? 1574 ARG A NE  1 
ATOM   6848  C  CZ  . ARG A 1 978  ? -64.194 23.596  5.507   1.00 63.98  ? 1574 ARG A CZ  1 
ATOM   6849  N  NH1 . ARG A 1 978  ? -64.245 24.911  5.678   1.00 43.21  ? 1574 ARG A NH1 1 
ATOM   6850  N  NH2 . ARG A 1 978  ? -65.219 22.842  5.877   1.00 60.25  ? 1574 ARG A NH2 1 
ATOM   6851  N  N   . GLN A 1 979  ? -59.775 21.628  0.522   1.00 31.12  ? 1575 GLN A N   1 
ATOM   6852  C  CA  . GLN A 1 979  ? -60.106 20.386  -0.170  1.00 30.87  ? 1575 GLN A CA  1 
ATOM   6853  C  C   . GLN A 1 979  ? -58.878 19.499  -0.290  1.00 40.11  ? 1575 GLN A C   1 
ATOM   6854  O  O   . GLN A 1 979  ? -58.933 18.302  -0.010  1.00 46.80  ? 1575 GLN A O   1 
ATOM   6855  C  CB  . GLN A 1 979  ? -60.670 20.669  -1.562  1.00 33.10  ? 1575 GLN A CB  1 
ATOM   6856  C  CG  . GLN A 1 979  ? -61.996 21.399  -1.576  1.00 32.73  ? 1575 GLN A CG  1 
ATOM   6857  C  CD  . GLN A 1 979  ? -62.378 21.862  -2.968  1.00 41.06  ? 1575 GLN A CD  1 
ATOM   6858  O  OE1 . GLN A 1 979  ? -61.854 21.364  -3.964  1.00 40.46  ? 1575 GLN A OE1 1 
ATOM   6859  N  NE2 . GLN A 1 979  ? -63.290 22.823  -3.042  1.00 38.90  ? 1575 GLN A NE2 1 
ATOM   6860  N  N   . VAL A 1 980  ? -57.772 20.102  -0.712  1.00 35.82  ? 1576 VAL A N   1 
ATOM   6861  C  CA  . VAL A 1 980  ? -56.510 19.386  -0.844  1.00 40.73  ? 1576 VAL A CA  1 
ATOM   6862  C  C   . VAL A 1 980  ? -56.013 18.887  0.511   1.00 48.27  ? 1576 VAL A C   1 
ATOM   6863  O  O   . VAL A 1 980  ? -55.567 17.744  0.637   1.00 38.06  ? 1576 VAL A O   1 
ATOM   6864  C  CB  . VAL A 1 980  ? -55.428 20.274  -1.488  1.00 29.25  ? 1576 VAL A CB  1 
ATOM   6865  C  CG1 . VAL A 1 980  ? -54.074 19.588  -1.441  1.00 31.66  ? 1576 VAL A CG1 1 
ATOM   6866  C  CG2 . VAL A 1 980  ? -55.807 20.614  -2.919  1.00 34.02  ? 1576 VAL A CG2 1 
ATOM   6867  N  N   . GLY A 1 981  ? -56.107 19.745  1.523   1.00 35.08  ? 1577 GLY A N   1 
ATOM   6868  C  CA  . GLY A 1 981  ? -55.596 19.431  2.845   1.00 33.58  ? 1577 GLY A CA  1 
ATOM   6869  C  C   . GLY A 1 981  ? -56.283 18.278  3.556   1.00 40.81  ? 1577 GLY A C   1 
ATOM   6870  O  O   . GLY A 1 981  ? -55.626 17.472  4.214   1.00 40.80  ? 1577 GLY A O   1 
ATOM   6871  N  N   . ASN A 1 982  ? -57.604 18.197  3.430   1.00 37.38  ? 1578 ASN A N   1 
ATOM   6872  C  CA  . ASN A 1 982  ? -58.379 17.178  4.135   1.00 44.16  ? 1578 ASN A CA  1 
ATOM   6873  C  C   . ASN A 1 982  ? -58.412 15.835  3.413   1.00 51.34  ? 1578 ASN A C   1 
ATOM   6874  O  O   . ASN A 1 982  ? -58.980 14.863  3.913   1.00 56.67  ? 1578 ASN A O   1 
ATOM   6875  C  CB  . ASN A 1 982  ? -59.812 17.669  4.359   1.00 43.32  ? 1578 ASN A CB  1 
ATOM   6876  C  CG  . ASN A 1 982  ? -59.902 18.734  5.432   1.00 43.16  ? 1578 ASN A CG  1 
ATOM   6877  O  OD1 . ASN A 1 982  ? -59.091 18.766  6.357   1.00 49.07  ? 1578 ASN A OD1 1 
ATOM   6878  N  ND2 . ASN A 1 982  ? -60.898 19.608  5.320   1.00 42.01  ? 1578 ASN A ND2 1 
ATOM   6879  N  N   . ALA A 1 983  ? -57.802 15.788  2.234   1.00 42.33  ? 1579 ALA A N   1 
ATOM   6880  C  CA  . ALA A 1 983  ? -57.864 14.608  1.380   1.00 29.55  ? 1579 ALA A CA  1 
ATOM   6881  C  C   . ALA A 1 983  ? -56.842 13.538  1.750   1.00 34.94  ? 1579 ALA A C   1 
ATOM   6882  O  O   . ALA A 1 983  ? -55.732 13.843  2.189   1.00 44.25  ? 1579 ALA A O   1 
ATOM   6883  C  CB  . ALA A 1 983  ? -57.683 15.013  -0.071  1.00 38.49  ? 1579 ALA A CB  1 
ATOM   6884  N  N   . VAL A 1 984  ? -57.235 12.281  1.573   1.00 35.18  ? 1580 VAL A N   1 
ATOM   6885  C  CA  . VAL A 1 984  ? -56.304 11.165  1.655   1.00 28.99  ? 1580 VAL A CA  1 
ATOM   6886  C  C   . VAL A 1 984  ? -55.455 11.163  0.396   1.00 41.57  ? 1580 VAL A C   1 
ATOM   6887  O  O   . VAL A 1 984  ? -55.995 11.275  -0.704  1.00 47.75  ? 1580 VAL A O   1 
ATOM   6888  C  CB  . VAL A 1 984  ? -57.034 9.812   1.779   1.00 28.49  ? 1580 VAL A CB  1 
ATOM   6889  C  CG1 . VAL A 1 984  ? -56.039 8.687   2.024   1.00 32.69  ? 1580 VAL A CG1 1 
ATOM   6890  C  CG2 . VAL A 1 984  ? -58.063 9.870   2.885   1.00 33.23  ? 1580 VAL A CG2 1 
ATOM   6891  N  N   . PRO A 1 985  ? -54.126 11.057  0.545   1.00 38.10  ? 1581 PRO A N   1 
ATOM   6892  C  CA  . PRO A 1 985  ? -53.266 10.993  -0.641  1.00 24.45  ? 1581 PRO A CA  1 
ATOM   6893  C  C   . PRO A 1 985  ? -53.602 9.785   -1.506  1.00 28.69  ? 1581 PRO A C   1 
ATOM   6894  O  O   . PRO A 1 985  ? -53.467 8.657   -1.035  1.00 48.43  ? 1581 PRO A O   1 
ATOM   6895  C  CB  . PRO A 1 985  ? -51.855 10.867  -0.052  1.00 26.49  ? 1581 PRO A CB  1 
ATOM   6896  C  CG  . PRO A 1 985  ? -51.969 11.399  1.332   1.00 28.13  ? 1581 PRO A CG  1 
ATOM   6897  C  CD  . PRO A 1 985  ? -53.345 11.032  1.793   1.00 31.00  ? 1581 PRO A CD  1 
ATOM   6898  N  N   . PRO A 1 986  ? -54.047 10.019  -2.752  1.00 37.56  ? 1582 PRO A N   1 
ATOM   6899  C  CA  . PRO A 1 986  ? -54.408 8.944   -3.684  1.00 32.04  ? 1582 PRO A CA  1 
ATOM   6900  C  C   . PRO A 1 986  ? -53.385 7.800   -3.818  1.00 26.89  ? 1582 PRO A C   1 
ATOM   6901  O  O   . PRO A 1 986  ? -53.823 6.674   -4.025  1.00 40.11  ? 1582 PRO A O   1 
ATOM   6902  C  CB  . PRO A 1 986  ? -54.568 9.686   -5.014  1.00 27.15  ? 1582 PRO A CB  1 
ATOM   6903  C  CG  . PRO A 1 986  ? -55.036 11.037  -4.611  1.00 29.09  ? 1582 PRO A CG  1 
ATOM   6904  C  CD  . PRO A 1 986  ? -54.307 11.351  -3.328  1.00 41.91  ? 1582 PRO A CD  1 
ATOM   6905  N  N   . PRO A 1 987  ? -52.066 8.070   -3.720  1.00 27.59  ? 1583 PRO A N   1 
ATOM   6906  C  CA  . PRO A 1 987  ? -51.159 6.913   -3.724  1.00 35.49  ? 1583 PRO A CA  1 
ATOM   6907  C  C   . PRO A 1 987  ? -51.382 5.930   -2.567  1.00 39.93  ? 1583 PRO A C   1 
ATOM   6908  O  O   . PRO A 1 987  ? -51.395 4.714   -2.786  1.00 48.43  ? 1583 PRO A O   1 
ATOM   6909  C  CB  . PRO A 1 987  ? -49.778 7.561   -3.612  1.00 32.12  ? 1583 PRO A CB  1 
ATOM   6910  C  CG  . PRO A 1 987  ? -49.943 8.866   -4.283  1.00 24.59  ? 1583 PRO A CG  1 
ATOM   6911  C  CD  . PRO A 1 987  ? -51.322 9.330   -3.916  1.00 28.01  ? 1583 PRO A CD  1 
ATOM   6912  N  N   . LEU A 1 988  ? -51.544 6.458   -1.359  1.00 35.39  ? 1584 LEU A N   1 
ATOM   6913  C  CA  . LEU A 1 988  ? -51.813 5.645   -0.173  1.00 29.94  ? 1584 LEU A CA  1 
ATOM   6914  C  C   . LEU A 1 988  ? -53.059 4.780   -0.372  1.00 35.34  ? 1584 LEU A C   1 
ATOM   6915  O  O   . LEU A 1 988  ? -53.026 3.542   -0.228  1.00 51.58  ? 1584 LEU A O   1 
ATOM   6916  C  CB  . LEU A 1 988  ? -51.985 6.552   1.046   1.00 25.31  ? 1584 LEU A CB  1 
ATOM   6917  C  CG  . LEU A 1 988  ? -52.249 5.931   2.418   1.00 38.81  ? 1584 LEU A CG  1 
ATOM   6918  C  CD1 . LEU A 1 988  ? -50.996 5.268   2.961   1.00 40.51  ? 1584 LEU A CD1 1 
ATOM   6919  C  CD2 . LEU A 1 988  ? -52.756 6.992   3.380   1.00 35.34  ? 1584 LEU A CD2 1 
ATOM   6920  N  N   . ALA A 1 989  ? -54.153 5.450   -0.723  1.00 31.54  ? 1585 ALA A N   1 
ATOM   6921  C  CA  . ALA A 1 989  ? -55.424 4.792   -0.990  1.00 37.46  ? 1585 ALA A CA  1 
ATOM   6922  C  C   . ALA A 1 989  ? -55.290 3.765   -2.108  1.00 40.50  ? 1585 ALA A C   1 
ATOM   6923  O  O   . ALA A 1 989  ? -56.001 2.765   -2.127  1.00 43.40  ? 1585 ALA A O   1 
ATOM   6924  C  CB  . ALA A 1 989  ? -56.484 5.818   -1.343  1.00 26.85  ? 1585 ALA A CB  1 
ATOM   6925  N  N   . LYS A 1 990  ? -54.378 4.020   -3.040  1.00 28.86  ? 1586 LYS A N   1 
ATOM   6926  C  CA  . LYS A 1 990  ? -54.131 3.086   -4.127  1.00 35.67  ? 1586 LYS A CA  1 
ATOM   6927  C  C   . LYS A 1 990  ? -53.466 1.827   -3.592  1.00 41.65  ? 1586 LYS A C   1 
ATOM   6928  O  O   . LYS A 1 990  ? -53.835 0.716   -3.968  1.00 39.60  ? 1586 LYS A O   1 
ATOM   6929  C  CB  . LYS A 1 990  ? -53.259 3.720   -5.211  1.00 25.93  ? 1586 LYS A CB  1 
ATOM   6930  C  CG  . LYS A 1 990  ? -52.982 2.791   -6.380  1.00 30.40  ? 1586 LYS A CG  1 
ATOM   6931  C  CD  . LYS A 1 990  ? -52.004 3.405   -7.362  1.00 23.95  ? 1586 LYS A CD  1 
ATOM   6932  C  CE  . LYS A 1 990  ? -51.753 2.476   -8.537  1.00 20.59  ? 1586 LYS A CE  1 
ATOM   6933  N  NZ  . LYS A 1 990  ? -50.774 3.062   -9.491  1.00 39.61  ? 1586 LYS A NZ  1 
ATOM   6934  N  N   . ALA A 1 991  ? -52.486 2.009   -2.712  1.00 30.82  ? 1587 ALA A N   1 
ATOM   6935  C  CA  . ALA A 1 991  ? -51.801 0.878   -2.096  1.00 33.81  ? 1587 ALA A CA  1 
ATOM   6936  C  C   . ALA A 1 991  ? -52.787 0.001   -1.319  1.00 42.31  ? 1587 ALA A C   1 
ATOM   6937  O  O   . ALA A 1 991  ? -52.881 -1.224  -1.546  1.00 46.54  ? 1587 ALA A O   1 
ATOM   6938  C  CB  . ALA A 1 991  ? -50.690 1.369   -1.187  1.00 23.75  ? 1587 ALA A CB  1 
ATOM   6939  N  N   . ILE A 1 992  ? -53.527 0.639   -0.413  1.00 34.90  ? 1588 ILE A N   1 
ATOM   6940  C  CA  . ILE A 1 992  ? -54.566 -0.060  0.343   1.00 38.55  ? 1588 ILE A CA  1 
ATOM   6941  C  C   . ILE A 1 992  ? -55.527 -0.787  -0.598  1.00 38.40  ? 1588 ILE A C   1 
ATOM   6942  O  O   . ILE A 1 992  ? -55.886 -1.954  -0.384  1.00 36.52  ? 1588 ILE A O   1 
ATOM   6943  C  CB  . ILE A 1 992  ? -55.370 0.909   1.227   1.00 31.46  ? 1588 ILE A CB  1 
ATOM   6944  C  CG1 . ILE A 1 992  ? -54.430 1.748   2.094   1.00 32.71  ? 1588 ILE A CG1 1 
ATOM   6945  C  CG2 . ILE A 1 992  ? -56.364 0.145   2.083   1.00 22.53  ? 1588 ILE A CG2 1 
ATOM   6946  C  CD1 . ILE A 1 992  ? -55.140 2.790   2.928   1.00 37.27  ? 1588 ILE A CD1 1 
ATOM   6947  N  N   . GLY A 1 993  ? -55.919 -0.084  -1.655  1.00 41.68  ? 1589 GLY A N   1 
ATOM   6948  C  CA  . GLY A 1 993  ? -56.840 -0.604  -2.645  1.00 34.65  ? 1589 GLY A CA  1 
ATOM   6949  C  C   . GLY A 1 993  ? -56.337 -1.858  -3.327  1.00 40.57  ? 1589 GLY A C   1 
ATOM   6950  O  O   . GLY A 1 993  ? -57.108 -2.776  -3.582  1.00 44.99  ? 1589 GLY A O   1 
ATOM   6951  N  N   . LEU A 1 994  ? -55.043 -1.897  -3.630  1.00 36.22  ? 1590 LEU A N   1 
ATOM   6952  C  CA  . LEU A 1 994  ? -54.440 -3.081  -4.231  1.00 40.25  ? 1590 LEU A CA  1 
ATOM   6953  C  C   . LEU A 1 994  ? -54.437 -4.221  -3.221  1.00 42.79  ? 1590 LEU A C   1 
ATOM   6954  O  O   . LEU A 1 994  ? -54.742 -5.382  -3.560  1.00 37.83  ? 1590 LEU A O   1 
ATOM   6955  C  CB  . LEU A 1 994  ? -53.020 -2.782  -4.714  1.00 32.79  ? 1590 LEU A CB  1 
ATOM   6956  C  CG  . LEU A 1 994  ? -52.907 -1.774  -5.860  1.00 29.90  ? 1590 LEU A CG  1 
ATOM   6957  C  CD1 . LEU A 1 994  ? -51.454 -1.450  -6.154  1.00 9.67   ? 1590 LEU A CD1 1 
ATOM   6958  C  CD2 . LEU A 1 994  ? -53.600 -2.305  -7.105  1.00 25.28  ? 1590 LEU A CD2 1 
ATOM   6959  N  N   . GLU A 1 995  ? -54.109 -3.881  -1.974  1.00 38.57  ? 1591 GLU A N   1 
ATOM   6960  C  CA  . GLU A 1 995  ? -54.159 -4.876  -0.906  1.00 37.94  ? 1591 GLU A CA  1 
ATOM   6961  C  C   . GLU A 1 995  ? -55.549 -5.490  -0.774  1.00 46.98  ? 1591 GLU A C   1 
ATOM   6962  O  O   . GLU A 1 995  ? -55.689 -6.652  -0.393  1.00 44.95  ? 1591 GLU A O   1 
ATOM   6963  C  CB  . GLU A 1 995  ? -53.731 -4.267  0.428   1.00 31.07  ? 1591 GLU A CB  1 
ATOM   6964  C  CG  . GLU A 1 995  ? -52.243 -4.017  0.524   1.00 44.24  ? 1591 GLU A CG  1 
ATOM   6965  C  CD  . GLU A 1 995  ? -51.423 -5.229  0.122   1.00 46.75  ? 1591 GLU A CD  1 
ATOM   6966  O  OE1 . GLU A 1 995  ? -51.781 -6.360  0.517   1.00 46.91  ? 1591 GLU A OE1 1 
ATOM   6967  O  OE2 . GLU A 1 995  ? -50.419 -5.049  -0.598  1.00 55.40  ? 1591 GLU A OE2 1 
ATOM   6968  N  N   . ILE A 1 996  ? -56.573 -4.709  -1.094  1.00 36.92  ? 1592 ILE A N   1 
ATOM   6969  C  CA  . ILE A 1 996  ? -57.937 -5.227  -1.114  1.00 36.83  ? 1592 ILE A CA  1 
ATOM   6970  C  C   . ILE A 1 996  ? -58.189 -6.054  -2.380  1.00 41.79  ? 1592 ILE A C   1 
ATOM   6971  O  O   . ILE A 1 996  ? -58.887 -7.075  -2.345  1.00 46.05  ? 1592 ILE A O   1 
ATOM   6972  C  CB  . ILE A 1 996  ? -58.958 -4.078  -1.007  1.00 43.57  ? 1592 ILE A CB  1 
ATOM   6973  C  CG1 . ILE A 1 996  ? -58.934 -3.510  0.412   1.00 30.69  ? 1592 ILE A CG1 1 
ATOM   6974  C  CG2 . ILE A 1 996  ? -60.361 -4.550  -1.363  1.00 39.34  ? 1592 ILE A CG2 1 
ATOM   6975  C  CD1 . ILE A 1 996  ? -59.570 -2.155  0.542   1.00 22.02  ? 1592 ILE A CD1 1 
ATOM   6976  N  N   . LYS A 1 997  ? -57.596 -5.618  -3.488  1.00 49.57  ? 1593 LYS A N   1 
ATOM   6977  C  CA  . LYS A 1 997  ? -57.727 -6.306  -4.769  1.00 40.49  ? 1593 LYS A CA  1 
ATOM   6978  C  C   . LYS A 1 997  ? -57.259 -7.748  -4.652  1.00 42.43  ? 1593 LYS A C   1 
ATOM   6979  O  O   . LYS A 1 997  ? -57.886 -8.663  -5.203  1.00 43.16  ? 1593 LYS A O   1 
ATOM   6980  C  CB  . LYS A 1 997  ? -56.929 -5.582  -5.855  1.00 34.45  ? 1593 LYS A CB  1 
ATOM   6981  C  CG  . LYS A 1 997  ? -57.230 -6.047  -7.271  1.00 40.40  ? 1593 LYS A CG  1 
ATOM   6982  C  CD  . LYS A 1 997  ? -56.551 -5.146  -8.290  1.00 38.93  ? 1593 LYS A CD  1 
ATOM   6983  C  CE  . LYS A 1 997  ? -56.962 -5.496  -9.709  1.00 56.23  ? 1593 LYS A CE  1 
ATOM   6984  N  NZ  . LYS A 1 997  ? -56.378 -4.547  -10.698 1.00 71.71  ? 1593 LYS A NZ  1 
ATOM   6985  N  N   . LEU A 1 998  ? -56.158 -7.946  -3.929  1.00 38.36  ? 1594 LEU A N   1 
ATOM   6986  C  CA  . LEU A 1 998  ? -55.673 -9.300  -3.663  1.00 38.58  ? 1594 LEU A CA  1 
ATOM   6987  C  C   . LEU A 1 998  ? -56.761 -10.172 -3.035  1.00 48.57  ? 1594 LEU A C   1 
ATOM   6988  O  O   . LEU A 1 998  ? -56.963 -11.321 -3.438  1.00 45.79  ? 1594 LEU A O   1 
ATOM   6989  C  CB  . LEU A 1 998  ? -54.447 -9.267  -2.751  1.00 28.64  ? 1594 LEU A CB  1 
ATOM   6990  C  CG  . LEU A 1 998  ? -53.160 -8.724  -3.369  1.00 31.36  ? 1594 LEU A CG  1 
ATOM   6991  C  CD1 . LEU A 1 998  ? -52.010 -8.846  -2.384  1.00 31.07  ? 1594 LEU A CD1 1 
ATOM   6992  C  CD2 . LEU A 1 998  ? -52.841 -9.454  -4.662  1.00 26.20  ? 1594 LEU A CD2 1 
ATOM   6993  N  N   . CYS A 1 999  ? -57.464 -9.612  -2.057  1.00 39.49  ? 1595 CYS A N   1 
ATOM   6994  C  CA  . CYS A 1 999  ? -58.530 -10.328 -1.368  1.00 39.79  ? 1595 CYS A CA  1 
ATOM   6995  C  C   . CYS A 1 999  ? -59.715 -10.592 -2.281  1.00 38.02  ? 1595 CYS A C   1 
ATOM   6996  O  O   . CYS A 1 999  ? -60.354 -11.640 -2.189  1.00 49.87  ? 1595 CYS A O   1 
ATOM   6997  C  CB  . CYS A 1 999  ? -58.987 -9.548  -0.140  1.00 34.92  ? 1595 CYS A CB  1 
ATOM   6998  S  SG  . CYS A 1 999  ? -57.700 -9.377  1.091   1.00 53.40  ? 1595 CYS A SG  1 
ATOM   6999  N  N   . MET A 1 1000 ? -60.014 -9.636  -3.153  1.00 34.09  ? 1596 MET A N   1 
ATOM   7000  C  CA  . MET A 1 1000 ? -61.073 -9.830  -4.133  1.00 45.91  ? 1596 MET A CA  1 
ATOM   7001  C  C   . MET A 1 1000 ? -60.740 -11.019 -5.023  1.00 59.94  ? 1596 MET A C   1 
ATOM   7002  O  O   . MET A 1 1000 ? -61.604 -11.846 -5.318  1.00 47.95  ? 1596 MET A O   1 
ATOM   7003  C  CB  . MET A 1 1000 ? -61.273 -8.577  -4.980  1.00 39.69  ? 1596 MET A CB  1 
ATOM   7004  C  CG  . MET A 1 1000 ? -61.761 -7.371  -4.209  1.00 37.10  ? 1596 MET A CG  1 
ATOM   7005  S  SD  . MET A 1 1000 ? -61.964 -5.949  -5.293  1.00 54.28  ? 1596 MET A SD  1 
ATOM   7006  C  CE  . MET A 1 1000 ? -63.164 -6.591  -6.455  1.00 39.62  ? 1596 MET A CE  1 
ATOM   7007  N  N   . LEU A 1 1001 ? -59.479 -11.102 -5.438  1.00 62.16  ? 1597 LEU A N   1 
ATOM   7008  C  CA  . LEU A 1 1001 ? -59.026 -12.205 -6.281  1.00 49.40  ? 1597 LEU A CA  1 
ATOM   7009  C  C   . LEU A 1 1001 ? -59.038 -13.544 -5.546  1.00 53.54  ? 1597 LEU A C   1 
ATOM   7010  O  O   . LEU A 1 1001 ? -59.377 -14.575 -6.129  1.00 61.23  ? 1597 LEU A O   1 
ATOM   7011  C  CB  . LEU A 1 1001 ? -57.619 -11.926 -6.810  1.00 51.92  ? 1597 LEU A CB  1 
ATOM   7012  C  CG  . LEU A 1 1001 ? -57.484 -10.828 -7.864  1.00 44.73  ? 1597 LEU A CG  1 
ATOM   7013  C  CD1 . LEU A 1 1001 ? -56.021 -10.504 -8.100  1.00 26.71  ? 1597 LEU A CD1 1 
ATOM   7014  C  CD2 . LEU A 1 1001 ? -58.149 -11.257 -9.161  1.00 38.36  ? 1597 LEU A CD2 1 
ATOM   7015  N  N   . ALA A 1 1002 ? -58.670 -13.526 -4.268  1.00 54.16  ? 1598 ALA A N   1 
ATOM   7016  C  CA  . ALA A 1 1002 ? -58.519 -14.758 -3.494  1.00 47.47  ? 1598 ALA A CA  1 
ATOM   7017  C  C   . ALA A 1 1002 ? -59.847 -15.467 -3.218  1.00 70.16  ? 1598 ALA A C   1 
ATOM   7018  O  O   . ALA A 1 1002 ? -59.879 -16.686 -3.050  1.00 75.46  ? 1598 ALA A O   1 
ATOM   7019  C  CB  . ALA A 1 1002 ? -57.807 -14.465 -2.186  1.00 44.65  ? 1598 ALA A CB  1 
ATOM   7020  N  N   . LYS A 1 1003 ? -60.936 -14.707 -3.159  1.00 68.96  ? 1599 LYS A N   1 
ATOM   7021  C  CA  . LYS A 1 1003 ? -62.253 -15.297 -2.941  1.00 73.67  ? 1599 LYS A CA  1 
ATOM   7022  C  C   . LYS A 1 1003 ? -62.744 -15.989 -4.211  1.00 101.19 ? 1599 LYS A C   1 
ATOM   7023  O  O   . LYS A 1 1003 ? -63.197 -15.338 -5.153  1.00 87.35  ? 1599 LYS A O   1 
ATOM   7024  C  CB  . LYS A 1 1003 ? -63.252 -14.231 -2.483  1.00 70.94  ? 1599 LYS A CB  1 
ATOM   7025  C  CG  . LYS A 1 1003 ? -64.702 -14.698 -2.422  1.00 68.29  ? 1599 LYS A CG  1 
ATOM   7026  C  CD  . LYS A 1 1003 ? -65.531 -13.778 -1.537  1.00 56.92  ? 1599 LYS A CD  1 
ATOM   7027  C  CE  . LYS A 1 1003 ? -67.022 -13.922 -1.802  1.00 51.09  ? 1599 LYS A CE  1 
ATOM   7028  N  NZ  . LYS A 1 1003 ? -67.443 -13.189 -3.030  1.00 51.10  ? 1599 LYS A NZ  1 
ATOM   7029  N  N   . ALA A 1 1004 ? -62.639 -17.314 -4.231  1.00 118.42 ? 1600 ALA A N   1 
ATOM   7030  C  CA  . ALA A 1 1004 ? -63.032 -18.095 -5.399  1.00 120.30 ? 1600 ALA A CA  1 
ATOM   7031  C  C   . ALA A 1 1004 ? -64.033 -19.183 -5.025  1.00 121.67 ? 1600 ALA A C   1 
ATOM   7032  O  O   . ALA A 1 1004 ? -65.244 -18.987 -5.131  1.00 113.01 ? 1600 ALA A O   1 
ATOM   7033  C  CB  . ALA A 1 1004 ? -61.806 -18.707 -6.061  1.00 81.41  ? 1600 ALA A CB  1 
ATOM   7034  N  N   . GLY B 2 1    ? -65.937 3.110   -46.156 1.00 107.20 ? 555  GLY C N   1 
ATOM   7035  C  CA  . GLY B 2 1    ? -67.219 3.554   -46.670 1.00 106.85 ? 555  GLY C CA  1 
ATOM   7036  C  C   . GLY B 2 1    ? -68.264 2.461   -46.625 1.00 107.43 ? 555  GLY C C   1 
ATOM   7037  O  O   . GLY B 2 1    ? -68.233 1.610   -45.736 1.00 104.79 ? 555  GLY C O   1 
ATOM   7038  N  N   . PRO B 2 2    ? -69.201 2.477   -47.586 1.00 97.06  ? 556  PRO C N   1 
ATOM   7039  C  CA  . PRO B 2 2    ? -70.260 1.466   -47.633 1.00 87.95  ? 556  PRO C CA  1 
ATOM   7040  C  C   . PRO B 2 2    ? -69.702 0.055   -47.745 1.00 91.72  ? 556  PRO C C   1 
ATOM   7041  O  O   . PRO B 2 2    ? -68.846 -0.204  -48.586 1.00 89.43  ? 556  PRO C O   1 
ATOM   7042  C  CB  . PRO B 2 2    ? -71.051 1.839   -48.893 1.00 71.91  ? 556  PRO C CB  1 
ATOM   7043  C  CG  . PRO B 2 2    ? -70.764 3.279   -49.109 1.00 76.69  ? 556  PRO C CG  1 
ATOM   7044  C  CD  . PRO B 2 2    ? -69.350 3.475   -48.658 1.00 87.65  ? 556  PRO C CD  1 
ATOM   7045  N  N   . LEU B 2 3    ? -70.194 -0.841  -46.898 1.00 92.66  ? 557  LEU C N   1 
ATOM   7046  C  CA  . LEU B 2 3    ? -69.864 -2.255  -46.995 1.00 91.94  ? 557  LEU C CA  1 
ATOM   7047  C  C   . LEU B 2 3    ? -70.727 -2.870  -48.081 1.00 84.91  ? 557  LEU C C   1 
ATOM   7048  O  O   . LEU B 2 3    ? -71.330 -2.159  -48.884 1.00 101.40 ? 557  LEU C O   1 
ATOM   7049  C  CB  . LEU B 2 3    ? -70.082 -2.986  -45.666 1.00 104.30 ? 557  LEU C CB  1 
ATOM   7050  C  CG  . LEU B 2 3    ? -68.944 -3.020  -44.642 1.00 107.89 ? 557  LEU C CG  1 
ATOM   7051  C  CD1 . LEU B 2 3    ? -69.031 -4.287  -43.801 1.00 79.47  ? 557  LEU C CD1 1 
ATOM   7052  C  CD2 . LEU B 2 3    ? -67.584 -2.913  -45.310 1.00 76.05  ? 557  LEU C CD2 1 
ATOM   7053  N  N   . GLY B 2 4    ? -70.787 -4.193  -48.111 1.00 67.50  ? 558  GLY C N   1 
ATOM   7054  C  CA  . GLY B 2 4    ? -71.575 -4.866  -49.120 1.00 66.06  ? 558  GLY C CA  1 
ATOM   7055  C  C   . GLY B 2 4    ? -72.239 -6.086  -48.528 1.00 69.62  ? 558  GLY C C   1 
ATOM   7056  O  O   . GLY B 2 4    ? -71.862 -6.546  -47.450 1.00 75.08  ? 558  GLY C O   1 
ATOM   7057  N  N   . SER B 2 5    ? -73.235 -6.601  -49.242 1.00 80.44  ? 559  SER C N   1 
ATOM   7058  C  CA  . SER B 2 5    ? -74.111 -7.653  -48.736 1.00 70.90  ? 559  SER C CA  1 
ATOM   7059  C  C   . SER B 2 5    ? -73.351 -8.860  -48.202 1.00 80.22  ? 559  SER C C   1 
ATOM   7060  O  O   . SER B 2 5    ? -73.824 -9.552  -47.302 1.00 80.55  ? 559  SER C O   1 
ATOM   7061  C  CB  . SER B 2 5    ? -75.077 -8.100  -49.836 1.00 85.73  ? 559  SER C CB  1 
ATOM   7062  O  OG  . SER B 2 5    ? -75.825 -9.232  -49.428 1.00 106.36 ? 559  SER C OG  1 
ATOM   7063  N  N   . GLU B 2 6    ? -72.168 -9.103  -48.753 1.00 67.99  ? 560  GLU C N   1 
ATOM   7064  C  CA  . GLU B 2 6    ? -71.360 -10.234 -48.325 1.00 70.43  ? 560  GLU C CA  1 
ATOM   7065  C  C   . GLU B 2 6    ? -69.869 -9.937  -48.430 1.00 68.63  ? 560  GLU C C   1 
ATOM   7066  O  O   . GLU B 2 6    ? -69.077 -10.798 -48.812 1.00 60.21  ? 560  GLU C O   1 
ATOM   7067  C  CB  . GLU B 2 6    ? -71.720 -11.472 -49.143 1.00 69.12  ? 560  GLU C CB  1 
ATOM   7068  C  CG  . GLU B 2 6    ? -71.993 -11.189 -50.607 1.00 69.24  ? 560  GLU C CG  1 
ATOM   7069  C  CD  . GLU B 2 6    ? -72.849 -12.263 -51.245 1.00 79.94  ? 560  GLU C CD  1 
ATOM   7070  O  OE1 . GLU B 2 6    ? -72.702 -12.499 -52.462 1.00 94.73  ? 560  GLU C OE1 1 
ATOM   7071  O  OE2 . GLU B 2 6    ? -73.673 -12.868 -50.526 1.00 62.76  ? 560  GLU C OE2 1 
ATOM   7072  N  N   . ALA B 2 7    ? -69.496 -8.709  -48.081 1.00 71.18  ? 561  ALA C N   1 
ATOM   7073  C  CA  . ALA B 2 7    ? -68.093 -8.321  -48.021 1.00 59.50  ? 561  ALA C CA  1 
ATOM   7074  C  C   . ALA B 2 7    ? -67.392 -9.082  -46.904 1.00 58.46  ? 561  ALA C C   1 
ATOM   7075  O  O   . ALA B 2 7    ? -66.187 -9.325  -46.959 1.00 63.85  ? 561  ALA C O   1 
ATOM   7076  C  CB  . ALA B 2 7    ? -67.961 -6.823  -47.809 1.00 54.15  ? 561  ALA C CB  1 
ATOM   7077  N  N   . HIS B 2 8    ? -68.168 -9.464  -45.896 1.00 58.80  ? 562  HIS C N   1 
ATOM   7078  C  CA  . HIS B 2 8    ? -67.652 -10.187 -44.742 1.00 58.20  ? 562  HIS C CA  1 
ATOM   7079  C  C   . HIS B 2 8    ? -67.313 -11.637 -45.078 1.00 64.82  ? 562  HIS C C   1 
ATOM   7080  O  O   . HIS B 2 8    ? -66.781 -12.365 -44.242 1.00 70.35  ? 562  HIS C O   1 
ATOM   7081  C  CB  . HIS B 2 8    ? -68.670 -10.148 -43.603 1.00 46.99  ? 562  HIS C CB  1 
ATOM   7082  C  CG  . HIS B 2 8    ? -69.936 -10.886 -43.903 1.00 59.43  ? 562  HIS C CG  1 
ATOM   7083  N  ND1 . HIS B 2 8    ? -70.836 -10.462 -44.858 1.00 67.23  ? 562  HIS C ND1 1 
ATOM   7084  C  CD2 . HIS B 2 8    ? -70.450 -12.024 -43.380 1.00 57.41  ? 562  HIS C CD2 1 
ATOM   7085  C  CE1 . HIS B 2 8    ? -71.851 -11.306 -44.907 1.00 75.46  ? 562  HIS C CE1 1 
ATOM   7086  N  NE2 . HIS B 2 8    ? -71.642 -12.262 -44.021 1.00 70.97  ? 562  HIS C NE2 1 
ATOM   7087  N  N   . LEU B 2 9    ? -67.628 -12.055 -46.300 1.00 67.04  ? 563  LEU C N   1 
ATOM   7088  C  CA  . LEU B 2 9    ? -67.361 -13.423 -46.725 1.00 67.63  ? 563  LEU C CA  1 
ATOM   7089  C  C   . LEU B 2 9    ? -66.035 -13.529 -47.465 1.00 66.21  ? 563  LEU C C   1 
ATOM   7090  O  O   . LEU B 2 9    ? -65.664 -14.603 -47.939 1.00 59.09  ? 563  LEU C O   1 
ATOM   7091  C  CB  . LEU B 2 9    ? -68.495 -13.942 -47.611 1.00 60.32  ? 563  LEU C CB  1 
ATOM   7092  C  CG  . LEU B 2 9    ? -69.877 -14.028 -46.964 1.00 72.38  ? 563  LEU C CG  1 
ATOM   7093  C  CD1 . LEU B 2 9    ? -70.839 -14.783 -47.866 1.00 55.36  ? 563  LEU C CD1 1 
ATOM   7094  C  CD2 . LEU B 2 9    ? -69.791 -14.685 -45.596 1.00 78.24  ? 563  LEU C CD2 1 
ATOM   7095  N  N   . TYR B 2 10   ? -65.323 -12.412 -47.561 1.00 65.25  ? 564  TYR C N   1 
ATOM   7096  C  CA  . TYR B 2 10   ? -64.052 -12.385 -48.272 1.00 61.17  ? 564  TYR C CA  1 
ATOM   7097  C  C   . TYR B 2 10   ? -62.882 -12.072 -47.347 1.00 56.44  ? 564  TYR C C   1 
ATOM   7098  O  O   . TYR B 2 10   ? -63.065 -11.666 -46.200 1.00 59.13  ? 564  TYR C O   1 
ATOM   7099  C  CB  . TYR B 2 10   ? -64.098 -11.365 -49.412 1.00 67.04  ? 564  TYR C CB  1 
ATOM   7100  C  CG  . TYR B 2 10   ? -64.999 -11.767 -50.556 1.00 63.26  ? 564  TYR C CG  1 
ATOM   7101  C  CD1 . TYR B 2 10   ? -66.361 -11.508 -50.517 1.00 64.92  ? 564  TYR C CD1 1 
ATOM   7102  C  CD2 . TYR B 2 10   ? -64.485 -12.406 -51.677 1.00 60.95  ? 564  TYR C CD2 1 
ATOM   7103  C  CE1 . TYR B 2 10   ? -67.188 -11.874 -51.560 1.00 58.79  ? 564  TYR C CE1 1 
ATOM   7104  C  CE2 . TYR B 2 10   ? -65.304 -12.774 -52.727 1.00 51.21  ? 564  TYR C CE2 1 
ATOM   7105  C  CZ  . TYR B 2 10   ? -66.654 -12.506 -52.662 1.00 56.21  ? 564  TYR C CZ  1 
ATOM   7106  O  OH  . TYR B 2 10   ? -67.473 -12.872 -53.705 1.00 67.65  ? 564  TYR C OH  1 
ATOM   7107  N  N   . MET B 2 11   ? -61.677 -12.270 -47.869 1.00 58.69  ? 565  MET C N   1 
ATOM   7108  C  CA  . MET B 2 11   ? -60.451 -12.018 -47.130 1.00 56.99  ? 565  MET C CA  1 
ATOM   7109  C  C   . MET B 2 11   ? -59.335 -11.680 -48.108 1.00 62.98  ? 565  MET C C   1 
ATOM   7110  O  O   . MET B 2 11   ? -59.336 -12.143 -49.254 1.00 61.90  ? 565  MET C O   1 
ATOM   7111  C  CB  . MET B 2 11   ? -60.069 -13.230 -46.279 1.00 37.20  ? 565  MET C CB  1 
ATOM   7112  C  CG  . MET B 2 11   ? -59.826 -14.498 -47.081 1.00 47.29  ? 565  MET C CG  1 
ATOM   7113  S  SD  . MET B 2 11   ? -59.313 -15.885 -46.051 1.00 49.44  ? 565  MET C SD  1 
ATOM   7114  C  CE  . MET B 2 11   ? -57.795 -15.239 -45.357 1.00 60.11  ? 565  MET C CE  1 
ATOM   7115  N  N   . GLN B 2 12   ? -58.388 -10.864 -47.658 1.00 48.29  ? 566  GLN C N   1 
ATOM   7116  C  CA  . GLN B 2 12   ? -57.261 -10.480 -48.495 1.00 40.04  ? 566  GLN C CA  1 
ATOM   7117  C  C   . GLN B 2 12   ? -56.117 -11.470 -48.349 1.00 46.54  ? 566  GLN C C   1 
ATOM   7118  O  O   . GLN B 2 12   ? -55.612 -11.693 -47.250 1.00 48.50  ? 566  GLN C O   1 
ATOM   7119  C  CB  . GLN B 2 12   ? -56.773 -9.073  -48.145 1.00 47.20  ? 566  GLN C CB  1 
ATOM   7120  C  CG  . GLN B 2 12   ? -57.872 -8.042  -48.015 1.00 47.57  ? 566  GLN C CG  1 
ATOM   7121  C  CD  . GLN B 2 12   ? -58.796 -8.029  -49.211 1.00 55.15  ? 566  GLN C CD  1 
ATOM   7122  O  OE1 . GLN B 2 12   ? -59.926 -8.510  -49.138 1.00 59.41  ? 566  GLN C OE1 1 
ATOM   7123  N  NE2 . GLN B 2 12   ? -58.322 -7.475  -50.322 1.00 56.44  ? 566  GLN C NE2 1 
ATOM   7124  N  N   . VAL B 2 13   ? -55.718 -12.071 -49.462 1.00 34.29  ? 567  VAL C N   1 
ATOM   7125  C  CA  . VAL B 2 13   ? -54.526 -12.899 -49.483 1.00 35.15  ? 567  VAL C CA  1 
ATOM   7126  C  C   . VAL B 2 13   ? -53.452 -12.185 -50.288 1.00 43.26  ? 567  VAL C C   1 
ATOM   7127  O  O   . VAL B 2 13   ? -53.576 -12.024 -51.502 1.00 55.17  ? 567  VAL C O   1 
ATOM   7128  C  CB  . VAL B 2 13   ? -54.793 -14.287 -50.079 1.00 39.35  ? 567  VAL C CB  1 
ATOM   7129  C  CG1 . VAL B 2 13   ? -53.498 -15.077 -50.160 1.00 34.51  ? 567  VAL C CG1 1 
ATOM   7130  C  CG2 . VAL B 2 13   ? -55.819 -15.029 -49.240 1.00 39.34  ? 567  VAL C CG2 1 
ATOM   7131  N  N   . GLN B 2 14   ? -52.404 -11.749 -49.601 1.00 41.38  ? 568  GLN C N   1 
ATOM   7132  C  CA  . GLN B 2 14   ? -51.349 -10.971 -50.232 1.00 43.43  ? 568  GLN C CA  1 
ATOM   7133  C  C   . GLN B 2 14   ? -50.142 -11.838 -50.573 1.00 43.35  ? 568  GLN C C   1 
ATOM   7134  O  O   . GLN B 2 14   ? -49.427 -12.303 -49.687 1.00 42.45  ? 568  GLN C O   1 
ATOM   7135  C  CB  . GLN B 2 14   ? -50.936 -9.812  -49.324 1.00 31.42  ? 568  GLN C CB  1 
ATOM   7136  C  CG  . GLN B 2 14   ? -52.077 -8.855  -49.010 1.00 45.22  ? 568  GLN C CG  1 
ATOM   7137  C  CD  . GLN B 2 14   ? -51.714 -7.837  -47.949 1.00 50.66  ? 568  GLN C CD  1 
ATOM   7138  O  OE1 . GLN B 2 14   ? -50.869 -8.090  -47.090 1.00 45.76  ? 568  GLN C OE1 1 
ATOM   7139  N  NE2 . GLN B 2 14   ? -52.353 -6.673  -48.003 1.00 36.11  ? 568  GLN C NE2 1 
ATOM   7140  N  N   . ILE B 2 15   ? -49.926 -12.054 -51.866 1.00 45.27  ? 569  ILE C N   1 
ATOM   7141  C  CA  . ILE B 2 15   ? -48.803 -12.858 -52.329 1.00 39.47  ? 569  ILE C CA  1 
ATOM   7142  C  C   . ILE B 2 15   ? -47.561 -12.004 -52.533 1.00 42.76  ? 569  ILE C C   1 
ATOM   7143  O  O   . ILE B 2 15   ? -47.600 -11.000 -53.239 1.00 47.78  ? 569  ILE C O   1 
ATOM   7144  C  CB  . ILE B 2 15   ? -49.131 -13.584 -53.646 1.00 38.18  ? 569  ILE C CB  1 
ATOM   7145  C  CG1 . ILE B 2 15   ? -50.255 -14.596 -53.430 1.00 40.29  ? 569  ILE C CG1 1 
ATOM   7146  C  CG2 . ILE B 2 15   ? -47.897 -14.281 -54.191 1.00 37.96  ? 569  ILE C CG2 1 
ATOM   7147  C  CD1 . ILE B 2 15   ? -49.912 -15.675 -52.429 1.00 37.22  ? 569  ILE C CD1 1 
ATOM   7148  N  N   . VAL B 2 16   ? -46.457 -12.401 -51.912 1.00 34.28  ? 570  VAL C N   1 
ATOM   7149  C  CA  . VAL B 2 16   ? -45.193 -11.706 -52.117 1.00 36.75  ? 570  VAL C CA  1 
ATOM   7150  C  C   . VAL B 2 16   ? -44.173 -12.649 -52.748 1.00 32.82  ? 570  VAL C C   1 
ATOM   7151  O  O   . VAL B 2 16   ? -44.047 -13.809 -52.351 1.00 47.90  ? 570  VAL C O   1 
ATOM   7152  C  CB  . VAL B 2 16   ? -44.642 -11.119 -50.796 1.00 33.08  ? 570  VAL C CB  1 
ATOM   7153  C  CG1 . VAL B 2 16   ? -44.447 -12.209 -49.751 1.00 41.90  ? 570  VAL C CG1 1 
ATOM   7154  C  CG2 . VAL B 2 16   ? -43.345 -10.368 -51.044 1.00 35.76  ? 570  VAL C CG2 1 
ATOM   7155  N  N   . ALA B 2 17   ? -43.462 -12.154 -53.754 1.00 31.77  ? 571  ALA C N   1 
ATOM   7156  C  CA  . ALA B 2 17   ? -42.458 -12.956 -54.436 1.00 34.92  ? 571  ALA C CA  1 
ATOM   7157  C  C   . ALA B 2 17   ? -41.070 -12.642 -53.896 1.00 45.27  ? 571  ALA C C   1 
ATOM   7158  O  O   . ALA B 2 17   ? -40.884 -11.672 -53.161 1.00 47.87  ? 571  ALA C O   1 
ATOM   7159  C  CB  . ALA B 2 17   ? -42.516 -12.721 -55.930 1.00 29.00  ? 571  ALA C CB  1 
ATOM   7160  N  N   . GLU B 2 18   ? -40.096 -13.461 -54.271 1.00 40.12  ? 572  GLU C N   1 
ATOM   7161  C  CA  . GLU B 2 18   ? -38.753 -13.348 -53.716 1.00 40.13  ? 572  GLU C CA  1 
ATOM   7162  C  C   . GLU B 2 18   ? -38.010 -12.116 -54.226 1.00 45.65  ? 572  GLU C C   1 
ATOM   7163  O  O   . GLU B 2 18   ? -37.035 -11.678 -53.616 1.00 59.41  ? 572  GLU C O   1 
ATOM   7164  C  CB  . GLU B 2 18   ? -37.952 -14.611 -54.030 1.00 37.67  ? 572  GLU C CB  1 
ATOM   7165  C  CG  . GLU B 2 18   ? -36.745 -14.811 -53.137 1.00 39.19  ? 572  GLU C CG  1 
ATOM   7166  C  CD  . GLU B 2 18   ? -36.271 -16.246 -53.131 1.00 53.22  ? 572  GLU C CD  1 
ATOM   7167  O  OE1 . GLU B 2 18   ? -36.908 -17.082 -53.807 1.00 55.63  ? 572  GLU C OE1 1 
ATOM   7168  O  OE2 . GLU B 2 18   ? -35.267 -16.541 -52.450 1.00 50.35  ? 572  GLU C OE2 1 
ATOM   7169  N  N   . ASP B 2 19   ? -38.474 -11.553 -55.337 1.00 44.15  ? 573  ASP C N   1 
ATOM   7170  C  CA  . ASP B 2 19   ? -37.837 -10.370 -55.907 1.00 37.79  ? 573  ASP C CA  1 
ATOM   7171  C  C   . ASP B 2 19   ? -37.978 -9.168  -54.978 1.00 47.70  ? 573  ASP C C   1 
ATOM   7172  O  O   . ASP B 2 19   ? -37.197 -8.219  -55.051 1.00 54.90  ? 573  ASP C O   1 
ATOM   7173  C  CB  . ASP B 2 19   ? -38.425 -10.042 -57.281 1.00 29.29  ? 573  ASP C CB  1 
ATOM   7174  C  CG  . ASP B 2 19   ? -39.914 -9.763  -57.226 1.00 47.40  ? 573  ASP C CG  1 
ATOM   7175  O  OD1 . ASP B 2 19   ? -40.297 -8.631  -56.862 1.00 52.38  ? 573  ASP C OD1 1 
ATOM   7176  O  OD2 . ASP B 2 19   ? -40.703 -10.676 -57.547 1.00 56.66  ? 573  ASP C OD2 1 
ATOM   7177  N  N   . GLN B 2 20   ? -38.979 -9.216  -54.105 1.00 33.79  ? 574  GLN C N   1 
ATOM   7178  C  CA  . GLN B 2 20   ? -39.216 -8.139  -53.153 1.00 40.45  ? 574  GLN C CA  1 
ATOM   7179  C  C   . GLN B 2 20   ? -38.237 -8.207  -51.987 1.00 48.32  ? 574  GLN C C   1 
ATOM   7180  O  O   . GLN B 2 20   ? -38.132 -7.268  -51.197 1.00 44.56  ? 574  GLN C O   1 
ATOM   7181  C  CB  . GLN B 2 20   ? -40.653 -8.193  -52.634 1.00 36.80  ? 574  GLN C CB  1 
ATOM   7182  C  CG  . GLN B 2 20   ? -41.705 -8.073  -53.721 1.00 50.28  ? 574  GLN C CG  1 
ATOM   7183  C  CD  . GLN B 2 20   ? -41.654 -6.735  -54.430 1.00 50.76  ? 574  GLN C CD  1 
ATOM   7184  O  OE1 . GLN B 2 20   ? -42.037 -5.708  -53.869 1.00 53.75  ? 574  GLN C OE1 1 
ATOM   7185  N  NE2 . GLN B 2 20   ? -41.177 -6.738  -55.669 1.00 45.77  ? 574  GLN C NE2 1 
ATOM   7186  N  N   . PHE B 2 21   ? -37.520 -9.320  -51.883 1.00 35.98  ? 575  PHE C N   1 
ATOM   7187  C  CA  . PHE B 2 21   ? -36.578 -9.510  -50.788 1.00 39.57  ? 575  PHE C CA  1 
ATOM   7188  C  C   . PHE B 2 21   ? -35.246 -8.853  -51.118 1.00 44.58  ? 575  PHE C C   1 
ATOM   7189  O  O   . PHE B 2 21   ? -34.500 -8.458  -50.223 1.00 58.58  ? 575  PHE C O   1 
ATOM   7190  C  CB  . PHE B 2 21   ? -36.371 -11.000 -50.491 1.00 30.12  ? 575  PHE C CB  1 
ATOM   7191  C  CG  . PHE B 2 21   ? -37.603 -11.701 -49.985 1.00 33.77  ? 575  PHE C CG  1 
ATOM   7192  C  CD1 . PHE B 2 21   ? -38.756 -10.994 -49.680 1.00 33.40  ? 575  PHE C CD1 1 
ATOM   7193  C  CD2 . PHE B 2 21   ? -37.601 -13.073 -49.801 1.00 34.49  ? 575  PHE C CD2 1 
ATOM   7194  C  CE1 . PHE B 2 21   ? -39.884 -11.644 -49.216 1.00 28.23  ? 575  PHE C CE1 1 
ATOM   7195  C  CE2 . PHE B 2 21   ? -38.725 -13.727 -49.333 1.00 29.56  ? 575  PHE C CE2 1 
ATOM   7196  C  CZ  . PHE B 2 21   ? -39.868 -13.011 -49.040 1.00 31.86  ? 575  PHE C CZ  1 
ATOM   7197  N  N   . CYS B 2 22   ? -34.952 -8.743  -52.409 1.00 39.28  ? 576  CYS C N   1 
ATOM   7198  C  CA  . CYS B 2 22   ? -33.714 -8.119  -52.859 1.00 38.78  ? 576  CYS C CA  1 
ATOM   7199  C  C   . CYS B 2 22   ? -33.717 -6.628  -52.555 1.00 38.06  ? 576  CYS C C   1 
ATOM   7200  O  O   . CYS B 2 22   ? -34.703 -5.937  -52.808 1.00 53.42  ? 576  CYS C O   1 
ATOM   7201  C  CB  . CYS B 2 22   ? -33.507 -8.342  -54.358 1.00 26.45  ? 576  CYS C CB  1 
ATOM   7202  S  SG  . CYS B 2 22   ? -33.529 -10.071 -54.875 1.00 54.83  ? 576  CYS C SG  1 
ATOM   7203  N  N   . GLY B 2 23   ? -32.613 -6.137  -52.004 1.00 44.74  ? 577  GLY C N   1 
ATOM   7204  C  CA  . GLY B 2 23   ? -32.450 -4.715  -51.766 1.00 34.74  ? 577  GLY C CA  1 
ATOM   7205  C  C   . GLY B 2 23   ? -32.877 -4.248  -50.388 1.00 47.52  ? 577  GLY C C   1 
ATOM   7206  O  O   . GLY B 2 23   ? -32.552 -3.131  -49.985 1.00 54.81  ? 577  GLY C O   1 
ATOM   7207  N  N   . HIS B 2 24   ? -33.604 -5.093  -49.663 1.00 42.55  ? 578  HIS C N   1 
ATOM   7208  C  CA  . HIS B 2 24   ? -34.079 -4.721  -48.335 1.00 40.27  ? 578  HIS C CA  1 
ATOM   7209  C  C   . HIS B 2 24   ? -32.914 -4.562  -47.361 1.00 42.84  ? 578  HIS C C   1 
ATOM   7210  O  O   . HIS B 2 24   ? -32.115 -5.479  -47.177 1.00 44.18  ? 578  HIS C O   1 
ATOM   7211  C  CB  . HIS B 2 24   ? -35.067 -5.759  -47.805 1.00 32.43  ? 578  HIS C CB  1 
ATOM   7212  C  CG  . HIS B 2 24   ? -35.604 -5.438  -46.446 1.00 36.01  ? 578  HIS C CG  1 
ATOM   7213  N  ND1 . HIS B 2 24   ? -36.122 -4.202  -46.125 1.00 39.79  ? 578  HIS C ND1 1 
ATOM   7214  C  CD2 . HIS B 2 24   ? -35.699 -6.189  -45.324 1.00 40.15  ? 578  HIS C CD2 1 
ATOM   7215  C  CE1 . HIS B 2 24   ? -36.515 -4.206  -44.864 1.00 34.28  ? 578  HIS C CE1 1 
ATOM   7216  N  NE2 . HIS B 2 24   ? -36.270 -5.399  -44.355 1.00 34.32  ? 578  HIS C NE2 1 
ATOM   7217  N  N   . GLN B 2 25   ? -32.827 -3.389  -46.742 1.00 51.22  ? 579  GLN C N   1 
ATOM   7218  C  CA  . GLN B 2 25   ? -31.717 -3.067  -45.852 1.00 43.01  ? 579  GLN C CA  1 
ATOM   7219  C  C   . GLN B 2 25   ? -32.056 -3.273  -44.381 1.00 41.50  ? 579  GLN C C   1 
ATOM   7220  O  O   . GLN B 2 25   ? -31.210 -3.077  -43.509 1.00 48.35  ? 579  GLN C O   1 
ATOM   7221  C  CB  . GLN B 2 25   ? -31.268 -1.624  -46.077 1.00 40.67  ? 579  GLN C CB  1 
ATOM   7222  C  CG  . GLN B 2 25   ? -30.723 -1.370  -47.467 1.00 39.91  ? 579  GLN C CG  1 
ATOM   7223  C  CD  . GLN B 2 25   ? -29.460 -2.159  -47.741 1.00 40.60  ? 579  GLN C CD  1 
ATOM   7224  O  OE1 . GLN B 2 25   ? -28.410 -1.893  -47.157 1.00 48.95  ? 579  GLN C OE1 1 
ATOM   7225  N  NE2 . GLN B 2 25   ? -29.557 -3.142  -48.629 1.00 36.61  ? 579  GLN C NE2 1 
ATOM   7226  N  N   . GLY B 2 26   ? -33.294 -3.665  -44.106 1.00 35.82  ? 580  GLY C N   1 
ATOM   7227  C  CA  . GLY B 2 26   ? -33.748 -3.786  -42.736 1.00 40.73  ? 580  GLY C CA  1 
ATOM   7228  C  C   . GLY B 2 26   ? -33.886 -5.212  -42.248 1.00 35.76  ? 580  GLY C C   1 
ATOM   7229  O  O   . GLY B 2 26   ? -33.381 -6.150  -42.865 1.00 36.47  ? 580  GLY C O   1 
ATOM   7230  N  N   . ASN B 2 27   ? -34.571 -5.365  -41.121 1.00 42.50  ? 581  ASN C N   1 
ATOM   7231  C  CA  . ASN B 2 27   ? -34.814 -6.674  -40.533 1.00 33.20  ? 581  ASN C CA  1 
ATOM   7232  C  C   . ASN B 2 27   ? -35.889 -7.474  -41.264 1.00 32.54  ? 581  ASN C C   1 
ATOM   7233  O  O   . ASN B 2 27   ? -36.698 -6.924  -42.010 1.00 39.55  ? 581  ASN C O   1 
ATOM   7234  C  CB  . ASN B 2 27   ? -35.182 -6.531  -39.057 1.00 49.59  ? 581  ASN C CB  1 
ATOM   7235  C  CG  . ASN B 2 27   ? -33.993 -6.144  -38.197 1.00 39.26  ? 581  ASN C CG  1 
ATOM   7236  O  OD1 . ASN B 2 27   ? -33.112 -6.962  -37.933 1.00 41.42  ? 581  ASN C OD1 1 
ATOM   7237  N  ND2 . ASN B 2 27   ? -33.968 -4.894  -37.749 1.00 38.51  ? 581  ASN C ND2 1 
ATOM   7238  N  N   . ASP B 2 28   ? -35.870 -8.780  -41.024 1.00 35.48  ? 582  ASP C N   1 
ATOM   7239  C  CA  . ASP B 2 28   ? -36.695 -9.769  -41.716 1.00 40.59  ? 582  ASP C CA  1 
ATOM   7240  C  C   . ASP B 2 28   ? -36.545 -9.744  -43.236 1.00 36.11  ? 582  ASP C C   1 
ATOM   7241  O  O   . ASP B 2 28   ? -35.468 -9.466  -43.762 1.00 43.42  ? 582  ASP C O   1 
ATOM   7242  C  CB  . ASP B 2 28   ? -38.174 -9.573  -41.356 1.00 34.02  ? 582  ASP C CB  1 
ATOM   7243  C  CG  . ASP B 2 28   ? -38.471 -9.879  -39.901 1.00 42.51  ? 582  ASP C CG  1 
ATOM   7244  O  OD1 . ASP B 2 28   ? -37.639 -10.540 -39.245 1.00 43.04  ? 582  ASP C OD1 1 
ATOM   7245  O  OD2 . ASP B 2 28   ? -39.547 -9.467  -39.416 1.00 35.82  ? 582  ASP C OD2 1 
ATOM   7246  N  N   . MET B 2 29   ? -37.643 -10.028 -43.931 1.00 36.16  ? 583  MET C N   1 
ATOM   7247  C  CA  . MET B 2 29   ? -37.626 -10.154 -45.387 1.00 34.23  ? 583  MET C CA  1 
ATOM   7248  C  C   . MET B 2 29   ? -37.810 -8.844  -46.149 1.00 43.48  ? 583  MET C C   1 
ATOM   7249  O  O   . MET B 2 29   ? -37.116 -8.586  -47.134 1.00 43.28  ? 583  MET C O   1 
ATOM   7250  C  CB  . MET B 2 29   ? -38.692 -11.159 -45.824 1.00 42.52  ? 583  MET C CB  1 
ATOM   7251  C  CG  . MET B 2 29   ? -38.631 -12.465 -45.055 1.00 44.27  ? 583  MET C CG  1 
ATOM   7252  S  SD  . MET B 2 29   ? -36.930 -13.023 -44.851 1.00 59.29  ? 583  MET C SD  1 
ATOM   7253  C  CE  . MET B 2 29   ? -37.155 -14.389 -43.719 1.00 32.06  ? 583  MET C CE  1 
ATOM   7254  N  N   . TYR B 2 30   ? -38.752 -8.023  -45.696 1.00 38.93  ? 584  TYR C N   1 
ATOM   7255  C  CA  . TYR B 2 30   ? -39.149 -6.840  -46.451 1.00 33.41  ? 584  TYR C CA  1 
ATOM   7256  C  C   . TYR B 2 30   ? -39.746 -5.757  -45.565 1.00 35.47  ? 584  TYR C C   1 
ATOM   7257  O  O   . TYR B 2 30   ? -40.130 -6.013  -44.425 1.00 37.62  ? 584  TYR C O   1 
ATOM   7258  C  CB  . TYR B 2 30   ? -40.154 -7.220  -47.547 1.00 30.63  ? 584  TYR C CB  1 
ATOM   7259  C  CG  . TYR B 2 30   ? -41.353 -8.004  -47.053 1.00 29.96  ? 584  TYR C CG  1 
ATOM   7260  C  CD1 . TYR B 2 30   ? -42.453 -7.361  -46.500 1.00 39.35  ? 584  TYR C CD1 1 
ATOM   7261  C  CD2 . TYR B 2 30   ? -41.388 -9.389  -47.150 1.00 37.98  ? 584  TYR C CD2 1 
ATOM   7262  C  CE1 . TYR B 2 30   ? -43.548 -8.076  -46.051 1.00 45.54  ? 584  TYR C CE1 1 
ATOM   7263  C  CE2 . TYR B 2 30   ? -42.478 -10.112 -46.706 1.00 28.52  ? 584  TYR C CE2 1 
ATOM   7264  C  CZ  . TYR B 2 30   ? -43.554 -9.451  -46.157 1.00 33.65  ? 584  TYR C CZ  1 
ATOM   7265  O  OH  . TYR B 2 30   ? -44.643 -10.167 -45.712 1.00 38.49  ? 584  TYR C OH  1 
ATOM   7266  N  N   . ASP B 2 31   ? -39.811 -4.543  -46.101 1.00 41.16  ? 585  ASP C N   1 
ATOM   7267  C  CA  . ASP B 2 31   ? -40.480 -3.438  -45.430 1.00 35.64  ? 585  ASP C CA  1 
ATOM   7268  C  C   . ASP B 2 31   ? -41.963 -3.485  -45.768 1.00 46.02  ? 585  ASP C C   1 
ATOM   7269  O  O   . ASP B 2 31   ? -42.336 -3.512  -46.941 1.00 58.40  ? 585  ASP C O   1 
ATOM   7270  C  CB  . ASP B 2 31   ? -39.872 -2.099  -45.849 1.00 52.59  ? 585  ASP C CB  1 
ATOM   7271  C  CG  . ASP B 2 31   ? -40.282 -0.957  -44.938 1.00 54.01  ? 585  ASP C CG  1 
ATOM   7272  O  OD1 . ASP B 2 31   ? -41.281 -1.100  -44.201 1.00 55.89  ? 585  ASP C OD1 1 
ATOM   7273  O  OD2 . ASP B 2 31   ? -39.601 0.089   -44.963 1.00 62.21  ? 585  ASP C OD2 1 
ATOM   7274  N  N   . GLU B 2 32   ? -42.804 -3.497  -44.739 1.00 46.78  ? 586  GLU C N   1 
ATOM   7275  C  CA  . GLU B 2 32   ? -44.247 -3.603  -44.925 1.00 49.51  ? 586  GLU C CA  1 
ATOM   7276  C  C   . GLU B 2 32   ? -44.796 -2.436  -45.741 1.00 51.57  ? 586  GLU C C   1 
ATOM   7277  O  O   . GLU B 2 32   ? -45.776 -2.582  -46.472 1.00 57.10  ? 586  GLU C O   1 
ATOM   7278  C  CB  . GLU B 2 32   ? -44.955 -3.671  -43.570 1.00 50.82  ? 586  GLU C CB  1 
ATOM   7279  C  CG  . GLU B 2 32   ? -46.435 -4.004  -43.660 1.00 58.08  ? 586  GLU C CG  1 
ATOM   7280  C  CD  . GLU B 2 32   ? -46.683 -5.427  -44.119 1.00 72.75  ? 586  GLU C CD  1 
ATOM   7281  O  OE1 . GLU B 2 32   ? -45.959 -6.334  -43.656 1.00 72.83  ? 586  GLU C OE1 1 
ATOM   7282  O  OE2 . GLU B 2 32   ? -47.596 -5.638  -44.945 1.00 54.80  ? 586  GLU C OE2 1 
ATOM   7283  N  N   . GLU B 2 33   ? -44.151 -1.280  -45.617 1.00 64.62  ? 587  GLU C N   1 
ATOM   7284  C  CA  . GLU B 2 33   ? -44.592 -0.080  -46.316 1.00 56.67  ? 587  GLU C CA  1 
ATOM   7285  C  C   . GLU B 2 33   ? -44.167 -0.069  -47.783 1.00 57.27  ? 587  GLU C C   1 
ATOM   7286  O  O   . GLU B 2 33   ? -44.896 0.427   -48.640 1.00 76.14  ? 587  GLU C O   1 
ATOM   7287  C  CB  . GLU B 2 33   ? -44.052 1.167   -45.612 1.00 57.29  ? 587  GLU C CB  1 
ATOM   7288  C  CG  . GLU B 2 33   ? -44.447 1.273   -44.147 1.00 74.96  ? 587  GLU C CG  1 
ATOM   7289  C  CD  . GLU B 2 33   ? -45.943 1.423   -43.956 1.00 92.67  ? 587  GLU C CD  1 
ATOM   7290  O  OE1 . GLU B 2 33   ? -46.489 0.806   -43.016 1.00 77.96  ? 587  GLU C OE1 1 
ATOM   7291  O  OE2 . GLU B 2 33   ? -46.572 2.163   -44.742 1.00 103.57 ? 587  GLU C OE2 1 
ATOM   7292  N  N   . LYS B 2 34   ? -42.983 -0.605  -48.066 1.00 61.70  ? 588  LYS C N   1 
ATOM   7293  C  CA  . LYS B 2 34   ? -42.412 -0.532  -49.410 1.00 55.72  ? 588  LYS C CA  1 
ATOM   7294  C  C   . LYS B 2 34   ? -42.639 -1.776  -50.267 1.00 48.20  ? 588  LYS C C   1 
ATOM   7295  O  O   . LYS B 2 34   ? -42.255 -1.802  -51.436 1.00 52.44  ? 588  LYS C O   1 
ATOM   7296  C  CB  . LYS B 2 34   ? -40.909 -0.257  -49.318 1.00 47.05  ? 588  LYS C CB  1 
ATOM   7297  C  CG  . LYS B 2 34   ? -40.558 1.059   -48.649 1.00 60.42  ? 588  LYS C CG  1 
ATOM   7298  C  CD  . LYS B 2 34   ? -39.054 1.209   -48.490 1.00 71.44  ? 588  LYS C CD  1 
ATOM   7299  C  CE  . LYS B 2 34   ? -38.703 2.494   -47.757 1.00 63.65  ? 588  LYS C CE  1 
ATOM   7300  N  NZ  . LYS B 2 34   ? -37.240 2.602   -47.500 1.00 57.90  ? 588  LYS C NZ  1 
ATOM   7301  N  N   . VAL B 2 35   ? -43.261 -2.803  -49.698 1.00 53.76  ? 589  VAL C N   1 
ATOM   7302  C  CA  . VAL B 2 35   ? -43.414 -4.067  -50.413 1.00 49.01  ? 589  VAL C CA  1 
ATOM   7303  C  C   . VAL B 2 35   ? -44.560 -4.007  -51.426 1.00 52.05  ? 589  VAL C C   1 
ATOM   7304  O  O   . VAL B 2 35   ? -45.598 -3.394  -51.176 1.00 64.83  ? 589  VAL C O   1 
ATOM   7305  C  CB  . VAL B 2 35   ? -43.638 -5.248  -49.431 1.00 38.83  ? 589  VAL C CB  1 
ATOM   7306  C  CG1 . VAL B 2 35   ? -44.975 -5.124  -48.717 1.00 39.18  ? 589  VAL C CG1 1 
ATOM   7307  C  CG2 . VAL B 2 35   ? -43.538 -6.580  -50.157 1.00 41.42  ? 589  VAL C CG2 1 
ATOM   7308  N  N   . LYS B 2 36   ? -44.349 -4.629  -52.582 1.00 49.59  ? 590  LYS C N   1 
ATOM   7309  C  CA  . LYS B 2 36   ? -45.393 -4.741  -53.594 1.00 53.65  ? 590  LYS C CA  1 
ATOM   7310  C  C   . LYS B 2 36   ? -46.005 -6.137  -53.583 1.00 42.22  ? 590  LYS C C   1 
ATOM   7311  O  O   . LYS B 2 36   ? -45.315 -7.131  -53.807 1.00 40.43  ? 590  LYS C O   1 
ATOM   7312  C  CB  . LYS B 2 36   ? -44.846 -4.425  -54.987 1.00 51.92  ? 590  LYS C CB  1 
ATOM   7313  C  CG  . LYS B 2 36   ? -44.827 -2.947  -55.338 1.00 76.46  ? 590  LYS C CG  1 
ATOM   7314  C  CD  . LYS B 2 36   ? -43.457 -2.333  -55.115 1.00 84.58  ? 590  LYS C CD  1 
ATOM   7315  C  CE  . LYS B 2 36   ? -43.370 -0.955  -55.751 1.00 81.02  ? 590  LYS C CE  1 
ATOM   7316  N  NZ  . LYS B 2 36   ? -41.993 -0.393  -55.674 1.00 73.07  ? 590  LYS C NZ  1 
ATOM   7317  N  N   . TYR B 2 37   ? -47.306 -6.202  -53.324 1.00 33.42  ? 591  TYR C N   1 
ATOM   7318  C  CA  . TYR B 2 37   ? -48.009 -7.476  -53.264 1.00 41.13  ? 591  TYR C CA  1 
ATOM   7319  C  C   . TYR B 2 37   ? -48.746 -7.795  -54.558 1.00 43.19  ? 591  TYR C C   1 
ATOM   7320  O  O   . TYR B 2 37   ? -48.939 -6.933  -55.415 1.00 45.51  ? 591  TYR C O   1 
ATOM   7321  C  CB  . TYR B 2 37   ? -49.016 -7.482  -52.113 1.00 46.18  ? 591  TYR C CB  1 
ATOM   7322  C  CG  . TYR B 2 37   ? -48.417 -7.517  -50.726 1.00 46.98  ? 591  TYR C CG  1 
ATOM   7323  C  CD1 . TYR B 2 37   ? -47.354 -8.357  -50.422 1.00 46.73  ? 591  TYR C CD1 1 
ATOM   7324  C  CD2 . TYR B 2 37   ? -48.925 -6.711  -49.717 1.00 35.89  ? 591  TYR C CD2 1 
ATOM   7325  C  CE1 . TYR B 2 37   ? -46.814 -8.389  -49.148 1.00 49.67  ? 591  TYR C CE1 1 
ATOM   7326  C  CE2 . TYR B 2 37   ? -48.392 -6.734  -48.447 1.00 36.77  ? 591  TYR C CE2 1 
ATOM   7327  C  CZ  . TYR B 2 37   ? -47.338 -7.574  -48.165 1.00 37.97  ? 591  TYR C CZ  1 
ATOM   7328  O  OH  . TYR B 2 37   ? -46.807 -7.596  -46.897 1.00 53.42  ? 591  TYR C OH  1 
ATOM   7329  N  N   . THR B 2 38   ? -49.145 -9.054  -54.685 1.00 49.99  ? 592  THR C N   1 
ATOM   7330  C  CA  . THR B 2 38   ? -50.169 -9.461  -55.633 1.00 37.11  ? 592  THR C CA  1 
ATOM   7331  C  C   . THR B 2 38   ? -51.372 -9.869  -54.796 1.00 39.50  ? 592  THR C C   1 
ATOM   7332  O  O   . THR B 2 38   ? -51.356 -10.909 -54.135 1.00 51.14  ? 592  THR C O   1 
ATOM   7333  C  CB  . THR B 2 38   ? -49.715 -10.617 -56.537 1.00 37.70  ? 592  THR C CB  1 
ATOM   7334  O  OG1 . THR B 2 38   ? -48.602 -10.194 -57.334 1.00 34.84  ? 592  THR C OG1 1 
ATOM   7335  C  CG2 . THR B 2 38   ? -50.849 -11.046 -57.454 1.00 33.10  ? 592  THR C CG2 1 
ATOM   7336  N  N   . VAL B 2 39   ? -52.403 -9.032  -54.807 1.00 41.20  ? 593  VAL C N   1 
ATOM   7337  C  CA  . VAL B 2 39   ? -53.507 -9.171  -53.866 1.00 38.69  ? 593  VAL C CA  1 
ATOM   7338  C  C   . VAL B 2 39   ? -54.682 -9.961  -54.433 1.00 38.94  ? 593  VAL C C   1 
ATOM   7339  O  O   . VAL B 2 39   ? -55.116 -9.730  -55.562 1.00 44.12  ? 593  VAL C O   1 
ATOM   7340  C  CB  . VAL B 2 39   ? -54.012 -7.791  -53.409 1.00 43.15  ? 593  VAL C CB  1 
ATOM   7341  C  CG1 . VAL B 2 39   ? -54.983 -7.937  -52.251 1.00 37.78  ? 593  VAL C CG1 1 
ATOM   7342  C  CG2 . VAL B 2 39   ? -52.841 -6.909  -53.012 1.00 35.74  ? 593  VAL C CG2 1 
ATOM   7343  N  N   . PHE B 2 40   ? -55.193 -10.890 -53.632 1.00 44.78  ? 594  PHE C N   1 
ATOM   7344  C  CA  . PHE B 2 40   ? -56.349 -11.692 -54.011 1.00 36.47  ? 594  PHE C CA  1 
ATOM   7345  C  C   . PHE B 2 40   ? -57.498 -11.508 -53.027 1.00 44.59  ? 594  PHE C C   1 
ATOM   7346  O  O   . PHE B 2 40   ? -57.336 -11.732 -51.829 1.00 54.82  ? 594  PHE C O   1 
ATOM   7347  C  CB  . PHE B 2 40   ? -55.977 -13.174 -54.084 1.00 35.18  ? 594  PHE C CB  1 
ATOM   7348  C  CG  . PHE B 2 40   ? -55.024 -13.510 -55.192 1.00 38.40  ? 594  PHE C CG  1 
ATOM   7349  C  CD1 . PHE B 2 40   ? -53.656 -13.404 -55.006 1.00 45.71  ? 594  PHE C CD1 1 
ATOM   7350  C  CD2 . PHE B 2 40   ? -55.496 -13.947 -56.418 1.00 38.17  ? 594  PHE C CD2 1 
ATOM   7351  C  CE1 . PHE B 2 40   ? -52.778 -13.718 -56.025 1.00 50.17  ? 594  PHE C CE1 1 
ATOM   7352  C  CE2 . PHE B 2 40   ? -54.624 -14.262 -57.441 1.00 43.77  ? 594  PHE C CE2 1 
ATOM   7353  C  CZ  . PHE B 2 40   ? -53.263 -14.147 -57.245 1.00 48.82  ? 594  PHE C CZ  1 
ATOM   7354  N  N   . LYS B 2 41   ? -58.657 -11.100 -53.531 1.00 47.32  ? 595  LYS C N   1 
ATOM   7355  C  CA  . LYS B 2 41   ? -59.864 -11.080 -52.714 1.00 49.26  ? 595  LYS C CA  1 
ATOM   7356  C  C   . LYS B 2 41   ? -60.532 -12.446 -52.814 1.00 51.33  ? 595  LYS C C   1 
ATOM   7357  O  O   . LYS B 2 41   ? -61.078 -12.802 -53.858 1.00 61.68  ? 595  LYS C O   1 
ATOM   7358  C  CB  . LYS B 2 41   ? -60.813 -9.964  -53.157 1.00 43.92  ? 595  LYS C CB  1 
ATOM   7359  C  CG  . LYS B 2 41   ? -62.041 -9.813  -52.274 1.00 54.01  ? 595  LYS C CG  1 
ATOM   7360  C  CD  . LYS B 2 41   ? -62.527 -8.373  -52.248 1.00 48.79  ? 595  LYS C CD  1 
ATOM   7361  C  CE  . LYS B 2 41   ? -61.463 -7.454  -51.673 1.00 48.05  ? 595  LYS C CE  1 
ATOM   7362  N  NZ  . LYS B 2 41   ? -61.950 -6.062  -51.479 1.00 68.11  ? 595  LYS C NZ  1 
ATOM   7363  N  N   . VAL B 2 42   ? -60.479 -13.213 -51.729 1.00 45.72  ? 596  VAL C N   1 
ATOM   7364  C  CA  . VAL B 2 42   ? -60.855 -14.623 -51.781 1.00 39.30  ? 596  VAL C CA  1 
ATOM   7365  C  C   . VAL B 2 42   ? -61.935 -14.989 -50.767 1.00 52.08  ? 596  VAL C C   1 
ATOM   7366  O  O   . VAL B 2 42   ? -61.900 -14.535 -49.628 1.00 61.57  ? 596  VAL C O   1 
ATOM   7367  C  CB  . VAL B 2 42   ? -59.613 -15.518 -51.550 1.00 44.43  ? 596  VAL C CB  1 
ATOM   7368  C  CG1 . VAL B 2 42   ? -60.001 -16.982 -51.422 1.00 60.27  ? 596  VAL C CG1 1 
ATOM   7369  C  CG2 . VAL B 2 42   ? -58.612 -15.331 -52.676 1.00 45.06  ? 596  VAL C CG2 1 
ATOM   7370  N  N   . LEU B 2 43   ? -62.897 -15.805 -51.191 1.00 50.76  ? 597  LEU C N   1 
ATOM   7371  C  CA  . LEU B 2 43   ? -63.893 -16.358 -50.278 1.00 54.60  ? 597  LEU C CA  1 
ATOM   7372  C  C   . LEU B 2 43   ? -63.214 -17.093 -49.128 1.00 64.34  ? 597  LEU C C   1 
ATOM   7373  O  O   . LEU B 2 43   ? -62.322 -17.911 -49.349 1.00 60.57  ? 597  LEU C O   1 
ATOM   7374  C  CB  . LEU B 2 43   ? -64.841 -17.304 -51.018 1.00 35.92  ? 597  LEU C CB  1 
ATOM   7375  C  CG  . LEU B 2 43   ? -65.809 -16.674 -52.019 1.00 31.54  ? 597  LEU C CG  1 
ATOM   7376  C  CD1 . LEU B 2 43   ? -66.592 -17.750 -52.749 1.00 20.00  ? 597  LEU C CD1 1 
ATOM   7377  C  CD2 . LEU B 2 43   ? -66.751 -15.721 -51.308 1.00 34.05  ? 597  LEU C CD2 1 
ATOM   7378  N  N   . LYS B 2 44   ? -63.634 -16.792 -47.903 1.00 61.48  ? 598  LYS C N   1 
ATOM   7379  C  CA  . LYS B 2 44   ? -63.049 -17.407 -46.715 1.00 54.48  ? 598  LYS C CA  1 
ATOM   7380  C  C   . LYS B 2 44   ? -63.179 -18.925 -46.737 1.00 59.94  ? 598  LYS C C   1 
ATOM   7381  O  O   . LYS B 2 44   ? -62.329 -19.638 -46.207 1.00 66.63  ? 598  LYS C O   1 
ATOM   7382  C  CB  . LYS B 2 44   ? -63.703 -16.852 -45.447 1.00 53.20  ? 598  LYS C CB  1 
ATOM   7383  C  CG  . LYS B 2 44   ? -63.427 -15.384 -45.181 1.00 45.90  ? 598  LYS C CG  1 
ATOM   7384  C  CD  . LYS B 2 44   ? -64.117 -14.931 -43.906 1.00 48.19  ? 598  LYS C CD  1 
ATOM   7385  C  CE  . LYS B 2 44   ? -63.820 -13.474 -43.594 1.00 58.44  ? 598  LYS C CE  1 
ATOM   7386  N  NZ  . LYS B 2 44   ? -64.533 -13.017 -42.368 1.00 52.26  ? 598  LYS C NZ  1 
ATOM   7387  N  N   . ASN B 2 45   ? -64.247 -19.414 -47.360 1.00 72.55  ? 599  ASN C N   1 
ATOM   7388  C  CA  . ASN B 2 45   ? -64.530 -20.843 -47.392 1.00 72.01  ? 599  ASN C CA  1 
ATOM   7389  C  C   . ASN B 2 45   ? -63.846 -21.558 -48.551 1.00 65.97  ? 599  ASN C C   1 
ATOM   7390  O  O   . ASN B 2 45   ? -63.955 -22.777 -48.688 1.00 68.10  ? 599  ASN C O   1 
ATOM   7391  C  CB  . ASN B 2 45   ? -66.038 -21.076 -47.460 1.00 67.66  ? 599  ASN C CB  1 
ATOM   7392  C  CG  . ASN B 2 45   ? -66.789 -20.336 -46.373 1.00 91.02  ? 599  ASN C CG  1 
ATOM   7393  O  OD1 . ASN B 2 45   ? -66.907 -20.817 -45.247 1.00 83.74  ? 599  ASN C OD1 1 
ATOM   7394  N  ND2 . ASN B 2 45   ? -67.301 -19.156 -46.706 1.00 99.68  ? 599  ASN C ND2 1 
ATOM   7395  N  N   . SER B 2 46   ? -63.147 -20.794 -49.386 1.00 64.29  ? 600  SER C N   1 
ATOM   7396  C  CA  . SER B 2 46   ? -62.415 -21.366 -50.511 1.00 66.18  ? 600  SER C CA  1 
ATOM   7397  C  C   . SER B 2 46   ? -61.351 -22.339 -50.019 1.00 58.85  ? 600  SER C C   1 
ATOM   7398  O  O   . SER B 2 46   ? -60.719 -22.109 -48.988 1.00 64.85  ? 600  SER C O   1 
ATOM   7399  C  CB  . SER B 2 46   ? -61.773 -20.262 -51.355 1.00 61.46  ? 600  SER C CB  1 
ATOM   7400  O  OG  . SER B 2 46   ? -60.862 -20.801 -52.296 1.00 71.62  ? 600  SER C OG  1 
ATOM   7401  N  N   . SER B 2 47   ? -61.165 -23.431 -50.751 1.00 48.59  ? 601  SER C N   1 
ATOM   7402  C  CA  . SER B 2 47   ? -60.160 -24.417 -50.382 1.00 53.37  ? 601  SER C CA  1 
ATOM   7403  C  C   . SER B 2 47   ? -58.781 -23.924 -50.790 1.00 60.72  ? 601  SER C C   1 
ATOM   7404  O  O   . SER B 2 47   ? -58.655 -23.030 -51.628 1.00 51.44  ? 601  SER C O   1 
ATOM   7405  C  CB  . SER B 2 47   ? -60.450 -25.769 -51.036 1.00 56.63  ? 601  SER C CB  1 
ATOM   7406  O  OG  . SER B 2 47   ? -59.708 -25.925 -52.233 1.00 53.72  ? 601  SER C OG  1 
ATOM   7407  N  N   . LEU B 2 48   ? -57.748 -24.506 -50.191 1.00 47.31  ? 602  LEU C N   1 
ATOM   7408  C  CA  . LEU B 2 48   ? -56.380 -24.170 -50.554 1.00 41.16  ? 602  LEU C CA  1 
ATOM   7409  C  C   . LEU B 2 48   ? -56.118 -24.549 -52.006 1.00 56.73  ? 602  LEU C C   1 
ATOM   7410  O  O   . LEU B 2 48   ? -55.470 -23.808 -52.740 1.00 55.42  ? 602  LEU C O   1 
ATOM   7411  C  CB  . LEU B 2 48   ? -55.383 -24.874 -49.634 1.00 41.76  ? 602  LEU C CB  1 
ATOM   7412  C  CG  . LEU B 2 48   ? -53.907 -24.648 -49.969 1.00 51.35  ? 602  LEU C CG  1 
ATOM   7413  C  CD1 . LEU B 2 48   ? -53.544 -23.179 -49.819 1.00 49.46  ? 602  LEU C CD1 1 
ATOM   7414  C  CD2 . LEU B 2 48   ? -53.017 -25.519 -49.098 1.00 52.49  ? 602  LEU C CD2 1 
ATOM   7415  N  N   . ALA B 2 49   ? -56.642 -25.702 -52.413 1.00 55.61  ? 603  ALA C N   1 
ATOM   7416  C  CA  . ALA B 2 49   ? -56.438 -26.210 -53.765 1.00 44.30  ? 603  ALA C CA  1 
ATOM   7417  C  C   . ALA B 2 49   ? -57.031 -25.278 -54.816 1.00 45.16  ? 603  ALA C C   1 
ATOM   7418  O  O   . ALA B 2 49   ? -56.414 -25.030 -55.853 1.00 47.60  ? 603  ALA C O   1 
ATOM   7419  C  CB  . ALA B 2 49   ? -57.034 -27.599 -53.898 1.00 45.80  ? 603  ALA C CB  1 
ATOM   7420  N  N   . GLU B 2 50   ? -58.226 -24.768 -54.543 1.00 48.72  ? 604  GLU C N   1 
ATOM   7421  C  CA  . GLU B 2 50   ? -58.892 -23.845 -55.455 1.00 52.96  ? 604  GLU C CA  1 
ATOM   7422  C  C   . GLU B 2 50   ? -58.062 -22.579 -55.633 1.00 51.21  ? 604  GLU C C   1 
ATOM   7423  O  O   . GLU B 2 50   ? -57.931 -22.053 -56.742 1.00 44.17  ? 604  GLU C O   1 
ATOM   7424  C  CB  . GLU B 2 50   ? -60.292 -23.497 -54.943 1.00 45.53  ? 604  GLU C CB  1 
ATOM   7425  C  CG  . GLU B 2 50   ? -61.200 -24.704 -54.768 1.00 72.13  ? 604  GLU C CG  1 
ATOM   7426  C  CD  . GLU B 2 50   ? -62.531 -24.349 -54.134 1.00 82.97  ? 604  GLU C CD  1 
ATOM   7427  O  OE1 . GLU B 2 50   ? -62.917 -23.162 -54.182 1.00 75.32  ? 604  GLU C OE1 1 
ATOM   7428  O  OE2 . GLU B 2 50   ? -63.190 -25.258 -53.584 1.00 67.74  ? 604  GLU C OE2 1 
ATOM   7429  N  N   . PHE B 2 51   ? -57.490 -22.104 -54.531 1.00 55.75  ? 605  PHE C N   1 
ATOM   7430  C  CA  . PHE B 2 51   ? -56.658 -20.911 -54.559 1.00 46.80  ? 605  PHE C CA  1 
ATOM   7431  C  C   . PHE B 2 51   ? -55.331 -21.171 -55.262 1.00 47.13  ? 605  PHE C C   1 
ATOM   7432  O  O   . PHE B 2 51   ? -54.753 -20.264 -55.853 1.00 54.39  ? 605  PHE C O   1 
ATOM   7433  C  CB  . PHE B 2 51   ? -56.402 -20.395 -53.143 1.00 54.14  ? 605  PHE C CB  1 
ATOM   7434  C  CG  . PHE B 2 51   ? -55.451 -19.236 -53.089 1.00 54.42  ? 605  PHE C CG  1 
ATOM   7435  C  CD1 . PHE B 2 51   ? -55.876 -17.961 -53.421 1.00 50.07  ? 605  PHE C CD1 1 
ATOM   7436  C  CD2 . PHE B 2 51   ? -54.130 -19.422 -52.717 1.00 47.80  ? 605  PHE C CD2 1 
ATOM   7437  C  CE1 . PHE B 2 51   ? -55.004 -16.893 -53.380 1.00 50.81  ? 605  PHE C CE1 1 
ATOM   7438  C  CE2 . PHE B 2 51   ? -53.254 -18.357 -52.672 1.00 48.63  ? 605  PHE C CE2 1 
ATOM   7439  C  CZ  . PHE B 2 51   ? -53.690 -17.091 -53.005 1.00 51.73  ? 605  PHE C CZ  1 
ATOM   7440  N  N   . VAL B 2 52   ? -54.845 -22.406 -55.189 1.00 41.37  ? 606  VAL C N   1 
ATOM   7441  C  CA  . VAL B 2 52   ? -53.597 -22.768 -55.850 1.00 42.99  ? 606  VAL C CA  1 
ATOM   7442  C  C   . VAL B 2 52   ? -53.819 -22.850 -57.356 1.00 48.69  ? 606  VAL C C   1 
ATOM   7443  O  O   . VAL B 2 52   ? -52.967 -22.435 -58.143 1.00 47.76  ? 606  VAL C O   1 
ATOM   7444  C  CB  . VAL B 2 52   ? -53.034 -24.105 -55.320 1.00 41.77  ? 606  VAL C CB  1 
ATOM   7445  C  CG1 . VAL B 2 52   ? -51.893 -24.598 -56.194 1.00 52.25  ? 606  VAL C CG1 1 
ATOM   7446  C  CG2 . VAL B 2 52   ? -52.561 -23.943 -53.889 1.00 44.01  ? 606  VAL C CG2 1 
ATOM   7447  N  N   . GLN B 2 53   ? -54.973 -23.376 -57.753 1.00 45.22  ? 607  GLN C N   1 
ATOM   7448  C  CA  . GLN B 2 53   ? -55.349 -23.396 -59.160 1.00 44.66  ? 607  GLN C CA  1 
ATOM   7449  C  C   . GLN B 2 53   ? -55.468 -21.967 -59.675 1.00 45.73  ? 607  GLN C C   1 
ATOM   7450  O  O   . GLN B 2 53   ? -54.863 -21.606 -60.690 1.00 53.58  ? 607  GLN C O   1 
ATOM   7451  C  CB  . GLN B 2 53   ? -56.666 -24.155 -59.363 1.00 45.35  ? 607  GLN C CB  1 
ATOM   7452  C  CG  . GLN B 2 53   ? -57.098 -24.308 -60.819 1.00 60.32  ? 607  GLN C CG  1 
ATOM   7453  C  CD  . GLN B 2 53   ? -57.843 -23.094 -61.350 1.00 72.79  ? 607  GLN C CD  1 
ATOM   7454  O  OE1 . GLN B 2 53   ? -58.513 -22.383 -60.600 1.00 54.14  ? 607  GLN C OE1 1 
ATOM   7455  N  NE2 . GLN B 2 53   ? -57.722 -22.848 -62.650 1.00 48.35  ? 607  GLN C NE2 1 
ATOM   7456  N  N   . SER B 2 54   ? -56.247 -21.160 -58.959 1.00 38.93  ? 608  SER C N   1 
ATOM   7457  C  CA  . SER B 2 54   ? -56.489 -19.772 -59.341 1.00 42.73  ? 608  SER C CA  1 
ATOM   7458  C  C   . SER B 2 54   ? -55.193 -18.979 -59.454 1.00 49.49  ? 608  SER C C   1 
ATOM   7459  O  O   . SER B 2 54   ? -54.996 -18.231 -60.410 1.00 55.81  ? 608  SER C O   1 
ATOM   7460  C  CB  . SER B 2 54   ? -57.422 -19.099 -58.333 1.00 45.90  ? 608  SER C CB  1 
ATOM   7461  O  OG  . SER B 2 54   ? -57.646 -17.743 -58.676 1.00 46.85  ? 608  SER C OG  1 
ATOM   7462  N  N   . LEU B 2 55   ? -54.315 -19.152 -58.472 1.00 43.89  ? 609  LEU C N   1 
ATOM   7463  C  CA  . LEU B 2 55   ? -53.038 -18.452 -58.442 1.00 41.69  ? 609  LEU C CA  1 
ATOM   7464  C  C   . LEU B 2 55   ? -52.147 -18.904 -59.588 1.00 49.08  ? 609  LEU C C   1 
ATOM   7465  O  O   . LEU B 2 55   ? -51.560 -18.080 -60.284 1.00 61.31  ? 609  LEU C O   1 
ATOM   7466  C  CB  . LEU B 2 55   ? -52.330 -18.681 -57.103 1.00 47.53  ? 609  LEU C CB  1 
ATOM   7467  C  CG  . LEU B 2 55   ? -51.120 -17.818 -56.729 1.00 45.68  ? 609  LEU C CG  1 
ATOM   7468  C  CD1 . LEU B 2 55   ? -50.937 -17.837 -55.228 1.00 51.64  ? 609  LEU C CD1 1 
ATOM   7469  C  CD2 . LEU B 2 55   ? -49.836 -18.284 -57.403 1.00 54.70  ? 609  LEU C CD2 1 
ATOM   7470  N  N   . SER B 2 56   ? -52.036 -20.217 -59.764 1.00 41.78  ? 610  SER C N   1 
ATOM   7471  C  CA  . SER B 2 56   ? -51.167 -20.778 -60.790 1.00 47.97  ? 610  SER C CA  1 
ATOM   7472  C  C   . SER B 2 56   ? -51.590 -20.293 -62.169 1.00 60.02  ? 610  SER C C   1 
ATOM   7473  O  O   . SER B 2 56   ? -50.752 -19.943 -63.001 1.00 59.50  ? 610  SER C O   1 
ATOM   7474  C  CB  . SER B 2 56   ? -51.189 -22.305 -60.743 1.00 60.01  ? 610  SER C CB  1 
ATOM   7475  O  OG  . SER B 2 56   ? -52.199 -22.824 -61.591 1.00 88.90  ? 610  SER C OG  1 
ATOM   7476  N  N   . GLN B 2 57   ? -52.898 -20.269 -62.401 1.00 59.38  ? 611  GLN C N   1 
ATOM   7477  C  CA  . GLN B 2 57   ? -53.436 -19.810 -63.674 1.00 65.31  ? 611  GLN C CA  1 
ATOM   7478  C  C   . GLN B 2 57   ? -53.252 -18.307 -63.866 1.00 62.91  ? 611  GLN C C   1 
ATOM   7479  O  O   . GLN B 2 57   ? -52.876 -17.852 -64.946 1.00 66.47  ? 611  GLN C O   1 
ATOM   7480  C  CB  . GLN B 2 57   ? -54.919 -20.175 -63.783 1.00 64.71  ? 611  GLN C CB  1 
ATOM   7481  C  CG  . GLN B 2 57   ? -55.703 -19.361 -64.806 1.00 79.13  ? 611  GLN C CG  1 
ATOM   7482  C  CD  . GLN B 2 57   ? -55.307 -19.655 -66.244 1.00 97.10  ? 611  GLN C CD  1 
ATOM   7483  O  OE1 . GLN B 2 57   ? -54.484 -20.532 -66.515 1.00 72.37  ? 611  GLN C OE1 1 
ATOM   7484  N  NE2 . GLN B 2 57   ? -55.900 -18.918 -67.178 1.00 86.77  ? 611  GLN C NE2 1 
ATOM   7485  N  N   . THR B 2 58   ? -53.511 -17.542 -62.811 1.00 53.61  ? 612  THR C N   1 
ATOM   7486  C  CA  . THR B 2 58   ? -53.458 -16.086 -62.890 1.00 54.74  ? 612  THR C CA  1 
ATOM   7487  C  C   . THR B 2 58   ? -52.037 -15.560 -63.090 1.00 61.93  ? 612  THR C C   1 
ATOM   7488  O  O   . THR B 2 58   ? -51.804 -14.673 -63.912 1.00 62.02  ? 612  THR C O   1 
ATOM   7489  C  CB  . THR B 2 58   ? -54.050 -15.435 -61.624 1.00 58.05  ? 612  THR C CB  1 
ATOM   7490  O  OG1 . THR B 2 58   ? -55.389 -15.905 -61.423 1.00 66.03  ? 612  THR C OG1 1 
ATOM   7491  C  CG2 . THR B 2 58   ? -54.064 -13.923 -61.758 1.00 51.93  ? 612  THR C CG2 1 
ATOM   7492  N  N   . MET B 2 59   ? -51.091 -16.110 -62.337 1.00 59.19  ? 613  MET C N   1 
ATOM   7493  C  CA  . MET B 2 59   ? -49.723 -15.605 -62.342 1.00 52.26  ? 613  MET C CA  1 
ATOM   7494  C  C   . MET B 2 59   ? -48.836 -16.348 -63.337 1.00 54.78  ? 613  MET C C   1 
ATOM   7495  O  O   . MET B 2 59   ? -47.692 -15.960 -63.568 1.00 56.08  ? 613  MET C O   1 
ATOM   7496  C  CB  . MET B 2 59   ? -49.123 -15.690 -60.939 1.00 49.83  ? 613  MET C CB  1 
ATOM   7497  C  CG  . MET B 2 59   ? -49.964 -15.007 -59.872 1.00 67.54  ? 613  MET C CG  1 
ATOM   7498  S  SD  . MET B 2 59   ? -49.067 -14.772 -58.327 1.00 77.34  ? 613  MET C SD  1 
ATOM   7499  C  CE  . MET B 2 59   ? -47.806 -13.619 -58.859 1.00 58.51  ? 613  MET C CE  1 
ATOM   7500  N  N   . GLY B 2 60   ? -49.365 -17.421 -63.917 1.00 50.42  ? 614  GLY C N   1 
ATOM   7501  C  CA  . GLY B 2 60   ? -48.671 -18.131 -64.976 1.00 56.25  ? 614  GLY C CA  1 
ATOM   7502  C  C   . GLY B 2 60   ? -47.642 -19.144 -64.508 1.00 56.24  ? 614  GLY C C   1 
ATOM   7503  O  O   . GLY B 2 60   ? -46.464 -19.049 -64.852 1.00 64.57  ? 614  GLY C O   1 
ATOM   7504  N  N   . PHE B 2 61   ? -48.090 -20.120 -63.727 1.00 61.35  ? 615  PHE C N   1 
ATOM   7505  C  CA  . PHE B 2 61   ? -47.231 -21.217 -63.293 1.00 60.88  ? 615  PHE C CA  1 
ATOM   7506  C  C   . PHE B 2 61   ? -48.001 -22.531 -63.277 1.00 63.67  ? 615  PHE C C   1 
ATOM   7507  O  O   . PHE B 2 61   ? -49.218 -22.534 -63.110 1.00 72.77  ? 615  PHE C O   1 
ATOM   7508  C  CB  . PHE B 2 61   ? -46.658 -20.952 -61.897 1.00 54.24  ? 615  PHE C CB  1 
ATOM   7509  C  CG  . PHE B 2 61   ? -45.831 -19.703 -61.798 1.00 49.56  ? 615  PHE C CG  1 
ATOM   7510  C  CD1 . PHE B 2 61   ? -44.541 -19.667 -62.300 1.00 54.95  ? 615  PHE C CD1 1 
ATOM   7511  C  CD2 . PHE B 2 61   ? -46.335 -18.571 -61.179 1.00 57.67  ? 615  PHE C CD2 1 
ATOM   7512  C  CE1 . PHE B 2 61   ? -43.776 -18.519 -62.202 1.00 64.93  ? 615  PHE C CE1 1 
ATOM   7513  C  CE2 . PHE B 2 61   ? -45.576 -17.421 -61.077 1.00 49.78  ? 615  PHE C CE2 1 
ATOM   7514  C  CZ  . PHE B 2 61   ? -44.295 -17.395 -61.589 1.00 44.79  ? 615  PHE C CZ  1 
ATOM   7515  N  N   . PRO B 2 62   ? -47.297 -23.653 -63.469 1.00 51.12  ? 616  PRO C N   1 
ATOM   7516  C  CA  . PRO B 2 62   ? -47.904 -24.958 -63.190 1.00 53.09  ? 616  PRO C CA  1 
ATOM   7517  C  C   . PRO B 2 62   ? -48.051 -25.161 -61.685 1.00 52.84  ? 616  PRO C C   1 
ATOM   7518  O  O   . PRO B 2 62   ? -47.180 -24.722 -60.934 1.00 58.81  ? 616  PRO C O   1 
ATOM   7519  C  CB  . PRO B 2 62   ? -46.906 -25.953 -63.795 1.00 46.42  ? 616  PRO C CB  1 
ATOM   7520  C  CG  . PRO B 2 62   ? -46.108 -25.149 -64.775 1.00 45.55  ? 616  PRO C CG  1 
ATOM   7521  C  CD  . PRO B 2 62   ? -46.009 -23.786 -64.169 1.00 51.07  ? 616  PRO C CD  1 
ATOM   7522  N  N   . GLN B 2 63   ? -49.128 -25.810 -61.257 1.00 50.81  ? 617  GLN C N   1 
ATOM   7523  C  CA  . GLN B 2 63   ? -49.429 -25.954 -59.835 1.00 48.06  ? 617  GLN C CA  1 
ATOM   7524  C  C   . GLN B 2 63   ? -48.348 -26.719 -59.075 1.00 50.77  ? 617  GLN C C   1 
ATOM   7525  O  O   . GLN B 2 63   ? -48.194 -26.553 -57.865 1.00 53.16  ? 617  GLN C O   1 
ATOM   7526  C  CB  . GLN B 2 63   ? -50.780 -26.647 -59.648 1.00 52.83  ? 617  GLN C CB  1 
ATOM   7527  C  CG  . GLN B 2 63   ? -51.934 -25.936 -60.328 1.00 57.97  ? 617  GLN C CG  1 
ATOM   7528  C  CD  . GLN B 2 63   ? -53.276 -26.552 -59.990 1.00 67.23  ? 617  GLN C CD  1 
ATOM   7529  O  OE1 . GLN B 2 63   ? -53.400 -27.304 -59.023 1.00 65.62  ? 617  GLN C OE1 1 
ATOM   7530  N  NE2 . GLN B 2 63   ? -54.289 -26.237 -60.788 1.00 58.30  ? 617  GLN C NE2 1 
ATOM   7531  N  N   . ASP B 2 64   ? -47.602 -27.556 -59.788 1.00 63.48  ? 618  ASP C N   1 
ATOM   7532  C  CA  . ASP B 2 64   ? -46.537 -28.334 -59.172 1.00 53.15  ? 618  ASP C CA  1 
ATOM   7533  C  C   . ASP B 2 64   ? -45.198 -27.604 -59.266 1.00 53.34  ? 618  ASP C C   1 
ATOM   7534  O  O   . ASP B 2 64   ? -44.158 -28.151 -58.900 1.00 66.75  ? 618  ASP C O   1 
ATOM   7535  C  CB  . ASP B 2 64   ? -46.440 -29.725 -59.809 1.00 60.14  ? 618  ASP C CB  1 
ATOM   7536  C  CG  . ASP B 2 64   ? -46.020 -29.680 -61.267 1.00 67.43  ? 618  ASP C CG  1 
ATOM   7537  O  OD1 . ASP B 2 64   ? -46.302 -28.669 -61.941 1.00 86.01  ? 618  ASP C OD1 1 
ATOM   7538  O  OD2 . ASP B 2 64   ? -45.411 -30.664 -61.734 1.00 79.11  ? 618  ASP C OD2 1 
ATOM   7539  N  N   . GLN B 2 65   ? -45.230 -26.372 -59.766 1.00 46.83  ? 619  GLN C N   1 
ATOM   7540  C  CA  . GLN B 2 65   ? -44.019 -25.564 -59.871 1.00 49.38  ? 619  GLN C CA  1 
ATOM   7541  C  C   . GLN B 2 65   ? -43.955 -24.447 -58.830 1.00 63.05  ? 619  GLN C C   1 
ATOM   7542  O  O   . GLN B 2 65   ? -42.984 -23.692 -58.786 1.00 71.27  ? 619  GLN C O   1 
ATOM   7543  C  CB  . GLN B 2 65   ? -43.900 -24.964 -61.272 1.00 63.59  ? 619  GLN C CB  1 
ATOM   7544  C  CG  . GLN B 2 65   ? -43.467 -25.960 -62.327 1.00 65.71  ? 619  GLN C CG  1 
ATOM   7545  C  CD  . GLN B 2 65   ? -42.114 -26.567 -62.021 1.00 83.28  ? 619  GLN C CD  1 
ATOM   7546  O  OE1 . GLN B 2 65   ? -42.022 -27.648 -61.438 1.00 77.37  ? 619  GLN C OE1 1 
ATOM   7547  N  NE2 . GLN B 2 65   ? -41.051 -25.871 -62.411 1.00 81.27  ? 619  GLN C NE2 1 
ATOM   7548  N  N   . ILE B 2 66   ? -44.984 -24.335 -57.997 1.00 55.36  ? 620  ILE C N   1 
ATOM   7549  C  CA  . ILE B 2 66   ? -44.983 -23.321 -56.946 1.00 47.82  ? 620  ILE C CA  1 
ATOM   7550  C  C   . ILE B 2 66   ? -45.125 -23.928 -55.556 1.00 58.07  ? 620  ILE C C   1 
ATOM   7551  O  O   . ILE B 2 66   ? -45.735 -24.984 -55.383 1.00 55.63  ? 620  ILE C O   1 
ATOM   7552  C  CB  . ILE B 2 66   ? -46.110 -22.289 -57.144 1.00 46.27  ? 620  ILE C CB  1 
ATOM   7553  C  CG1 . ILE B 2 66   ? -47.479 -22.969 -57.097 1.00 48.36  ? 620  ILE C CG1 1 
ATOM   7554  C  CG2 . ILE B 2 66   ? -45.922 -21.534 -58.447 1.00 45.95  ? 620  ILE C CG2 1 
ATOM   7555  C  CD1 . ILE B 2 66   ? -48.642 -22.012 -57.228 1.00 47.45  ? 620  ILE C CD1 1 
ATOM   7556  N  N   . ARG B 2 67   ? -44.548 -23.253 -54.568 1.00 59.11  ? 621  ARG C N   1 
ATOM   7557  C  CA  . ARG B 2 67   ? -44.724 -23.635 -53.174 1.00 49.22  ? 621  ARG C CA  1 
ATOM   7558  C  C   . ARG B 2 67   ? -45.157 -22.422 -52.365 1.00 40.62  ? 621  ARG C C   1 
ATOM   7559  O  O   . ARG B 2 67   ? -44.670 -21.311 -52.583 1.00 51.83  ? 621  ARG C O   1 
ATOM   7560  C  CB  . ARG B 2 67   ? -43.439 -24.232 -52.598 1.00 54.34  ? 621  ARG C CB  1 
ATOM   7561  C  CG  . ARG B 2 67   ? -43.565 -24.694 -51.150 1.00 57.84  ? 621  ARG C CG  1 
ATOM   7562  C  CD  . ARG B 2 67   ? -43.095 -26.128 -50.987 1.00 64.67  ? 621  ARG C CD  1 
ATOM   7563  N  NE  . ARG B 2 67   ? -41.774 -26.332 -51.574 1.00 73.98  ? 621  ARG C NE  1 
ATOM   7564  C  CZ  . ARG B 2 67   ? -41.360 -27.481 -52.096 1.00 75.83  ? 621  ARG C CZ  1 
ATOM   7565  N  NH1 . ARG B 2 67   ? -42.167 -28.534 -52.109 1.00 65.46  ? 621  ARG C NH1 1 
ATOM   7566  N  NH2 . ARG B 2 67   ? -40.143 -27.577 -52.612 1.00 90.52  ? 621  ARG C NH2 1 
ATOM   7567  N  N   . LEU B 2 68   ? -46.081 -22.642 -51.436 1.00 31.23  ? 622  LEU C N   1 
ATOM   7568  C  CA  . LEU B 2 68   ? -46.610 -21.565 -50.611 1.00 41.12  ? 622  LEU C CA  1 
ATOM   7569  C  C   . LEU B 2 68   ? -46.032 -21.596 -49.199 1.00 43.62  ? 622  LEU C C   1 
ATOM   7570  O  O   . LEU B 2 68   ? -46.138 -22.599 -48.495 1.00 55.40  ? 622  LEU C O   1 
ATOM   7571  C  CB  . LEU B 2 68   ? -48.137 -21.645 -50.559 1.00 42.17  ? 622  LEU C CB  1 
ATOM   7572  C  CG  . LEU B 2 68   ? -48.921 -20.788 -51.555 1.00 37.24  ? 622  LEU C CG  1 
ATOM   7573  C  CD1 . LEU B 2 68   ? -48.243 -20.749 -52.911 1.00 36.08  ? 622  LEU C CD1 1 
ATOM   7574  C  CD2 . LEU B 2 68   ? -50.339 -21.315 -51.690 1.00 37.17  ? 622  LEU C CD2 1 
ATOM   7575  N  N   . TRP B 2 69   ? -45.416 -20.491 -48.797 1.00 42.27  ? 623  TRP C N   1 
ATOM   7576  C  CA  . TRP B 2 69   ? -44.866 -20.353 -47.454 1.00 34.66  ? 623  TRP C CA  1 
ATOM   7577  C  C   . TRP B 2 69   ? -45.503 -19.168 -46.736 1.00 39.42  ? 623  TRP C C   1 
ATOM   7578  O  O   . TRP B 2 69   ? -44.984 -18.057 -46.809 1.00 49.34  ? 623  TRP C O   1 
ATOM   7579  C  CB  . TRP B 2 69   ? -43.349 -20.159 -47.496 1.00 33.96  ? 623  TRP C CB  1 
ATOM   7580  C  CG  . TRP B 2 69   ? -42.584 -21.246 -48.184 1.00 53.81  ? 623  TRP C CG  1 
ATOM   7581  C  CD1 . TRP B 2 69   ? -42.352 -21.364 -49.523 1.00 57.64  ? 623  TRP C CD1 1 
ATOM   7582  C  CD2 . TRP B 2 69   ? -41.919 -22.354 -47.564 1.00 50.59  ? 623  TRP C CD2 1 
ATOM   7583  N  NE1 . TRP B 2 69   ? -41.596 -22.482 -49.777 1.00 51.75  ? 623  TRP C NE1 1 
ATOM   7584  C  CE2 . TRP B 2 69   ? -41.317 -23.107 -48.590 1.00 42.29  ? 623  TRP C CE2 1 
ATOM   7585  C  CE3 . TRP B 2 69   ? -41.781 -22.783 -46.240 1.00 45.42  ? 623  TRP C CE3 1 
ATOM   7586  C  CZ2 . TRP B 2 69   ? -40.589 -24.266 -48.335 1.00 48.28  ? 623  TRP C CZ2 1 
ATOM   7587  C  CZ3 . TRP B 2 69   ? -41.058 -23.934 -45.990 1.00 50.81  ? 623  TRP C CZ3 1 
ATOM   7588  C  CH2 . TRP B 2 69   ? -40.471 -24.662 -47.032 1.00 52.76  ? 623  TRP C CH2 1 
ATOM   7589  N  N   . PRO B 2 70   ? -46.620 -19.404 -46.031 1.00 43.38  ? 624  PRO C N   1 
ATOM   7590  C  CA  . PRO B 2 70   ? -47.384 -18.348 -45.354 1.00 45.47  ? 624  PRO C CA  1 
ATOM   7591  C  C   . PRO B 2 70   ? -46.521 -17.475 -44.449 1.00 47.97  ? 624  PRO C C   1 
ATOM   7592  O  O   . PRO B 2 70   ? -45.755 -17.996 -43.638 1.00 38.75  ? 624  PRO C O   1 
ATOM   7593  C  CB  . PRO B 2 70   ? -48.408 -19.131 -44.527 1.00 36.37  ? 624  PRO C CB  1 
ATOM   7594  C  CG  . PRO B 2 70   ? -48.552 -20.425 -45.237 1.00 41.37  ? 624  PRO C CG  1 
ATOM   7595  C  CD  . PRO B 2 70   ? -47.191 -20.736 -45.782 1.00 41.22  ? 624  PRO C CD  1 
ATOM   7596  N  N   . MET B 2 71   ? -46.639 -16.161 -44.602 1.00 46.16  ? 625  MET C N   1 
ATOM   7597  C  CA  . MET B 2 71   ? -45.894 -15.232 -43.765 1.00 37.96  ? 625  MET C CA  1 
ATOM   7598  C  C   . MET B 2 71   ? -46.511 -15.208 -42.372 1.00 42.65  ? 625  MET C C   1 
ATOM   7599  O  O   . MET B 2 71   ? -47.644 -14.764 -42.187 1.00 48.26  ? 625  MET C O   1 
ATOM   7600  C  CB  . MET B 2 71   ? -45.879 -13.834 -44.382 1.00 32.94  ? 625  MET C CB  1 
ATOM   7601  C  CG  . MET B 2 71   ? -44.619 -13.043 -44.075 1.00 62.11  ? 625  MET C CG  1 
ATOM   7602  S  SD  . MET B 2 71   ? -43.138 -13.852 -44.710 1.00 45.90  ? 625  MET C SD  1 
ATOM   7603  C  CE  . MET B 2 71   ? -43.554 -13.954 -46.443 1.00 40.14  ? 625  MET C CE  1 
ATOM   7604  N  N   . GLN B 2 72   ? -45.752 -15.693 -41.398 1.00 43.21  ? 626  GLN C N   1 
ATOM   7605  C  CA  . GLN B 2 72   ? -46.269 -15.936 -40.060 1.00 48.39  ? 626  GLN C CA  1 
ATOM   7606  C  C   . GLN B 2 72   ? -45.523 -15.120 -39.009 1.00 46.74  ? 626  GLN C C   1 
ATOM   7607  O  O   . GLN B 2 72   ? -44.295 -15.023 -39.038 1.00 47.48  ? 626  GLN C O   1 
ATOM   7608  C  CB  . GLN B 2 72   ? -46.179 -17.429 -39.739 1.00 47.37  ? 626  GLN C CB  1 
ATOM   7609  C  CG  . GLN B 2 72   ? -46.976 -17.875 -38.532 1.00 66.73  ? 626  GLN C CG  1 
ATOM   7610  C  CD  . GLN B 2 72   ? -47.066 -19.385 -38.440 1.00 84.82  ? 626  GLN C CD  1 
ATOM   7611  O  OE1 . GLN B 2 72   ? -47.863 -20.013 -39.140 1.00 82.33  ? 626  GLN C OE1 1 
ATOM   7612  N  NE2 . GLN B 2 72   ? -46.239 -19.978 -37.587 1.00 63.28  ? 626  GLN C NE2 1 
ATOM   7613  N  N   . ALA B 2 73   ? -46.275 -14.538 -38.081 1.00 36.14  ? 627  ALA C N   1 
ATOM   7614  C  CA  . ALA B 2 73   ? -45.697 -13.689 -37.046 1.00 40.82  ? 627  ALA C CA  1 
ATOM   7615  C  C   . ALA B 2 73   ? -45.222 -14.505 -35.848 1.00 48.22  ? 627  ALA C C   1 
ATOM   7616  O  O   . ALA B 2 73   ? -45.866 -15.474 -35.446 1.00 30.59  ? 627  ALA C O   1 
ATOM   7617  C  CB  . ALA B 2 73   ? -46.703 -12.641 -36.603 1.00 34.26  ? 627  ALA C CB  1 
ATOM   7618  N  N   . ARG B 2 74   ? -44.091 -14.099 -35.282 1.00 43.32  ? 628  ARG C N   1 
ATOM   7619  C  CA  . ARG B 2 74   ? -43.530 -14.770 -34.119 1.00 36.46  ? 628  ARG C CA  1 
ATOM   7620  C  C   . ARG B 2 74   ? -43.714 -13.913 -32.870 1.00 53.05  ? 628  ARG C C   1 
ATOM   7621  O  O   . ARG B 2 74   ? -44.082 -12.742 -32.964 1.00 54.17  ? 628  ARG C O   1 
ATOM   7622  C  CB  . ARG B 2 74   ? -42.052 -15.088 -34.350 1.00 29.47  ? 628  ARG C CB  1 
ATOM   7623  C  CG  . ARG B 2 74   ? -41.812 -15.992 -35.548 1.00 36.20  ? 628  ARG C CG  1 
ATOM   7624  C  CD  . ARG B 2 74   ? -40.332 -16.206 -35.816 1.00 44.99  ? 628  ARG C CD  1 
ATOM   7625  N  NE  . ARG B 2 74   ? -40.118 -17.132 -36.925 1.00 37.92  ? 628  ARG C NE  1 
ATOM   7626  C  CZ  . ARG B 2 74   ? -38.925 -17.557 -37.325 1.00 31.19  ? 628  ARG C CZ  1 
ATOM   7627  N  NH1 . ARG B 2 74   ? -37.829 -17.139 -36.709 1.00 41.57  ? 628  ARG C NH1 1 
ATOM   7628  N  NH2 . ARG B 2 74   ? -38.827 -18.401 -38.343 1.00 42.07  ? 628  ARG C NH2 1 
ATOM   7629  N  N   . SER B 2 75   ? -43.460 -14.506 -31.707 1.00 50.56  ? 629  SER C N   1 
ATOM   7630  C  CA  . SER B 2 75   ? -43.678 -13.830 -30.430 1.00 48.58  ? 629  SER C CA  1 
ATOM   7631  C  C   . SER B 2 75   ? -42.830 -12.572 -30.290 1.00 46.38  ? 629  SER C C   1 
ATOM   7632  O  O   . SER B 2 75   ? -43.275 -11.571 -29.730 1.00 43.97  ? 629  SER C O   1 
ATOM   7633  C  CB  . SER B 2 75   ? -43.383 -14.781 -29.270 1.00 47.18  ? 629  SER C CB  1 
ATOM   7634  O  OG  . SER B 2 75   ? -44.108 -15.990 -29.406 1.00 65.19  ? 629  SER C OG  1 
ATOM   7635  N  N   . ASN B 2 76   ? -41.608 -12.632 -30.807 1.00 46.74  ? 630  ASN C N   1 
ATOM   7636  C  CA  . ASN B 2 76   ? -40.671 -11.521 -30.704 1.00 38.21  ? 630  ASN C CA  1 
ATOM   7637  C  C   . ASN B 2 76   ? -41.087 -10.313 -31.539 1.00 50.89  ? 630  ASN C C   1 
ATOM   7638  O  O   . ASN B 2 76   ? -40.521 -9.229  -31.400 1.00 52.85  ? 630  ASN C O   1 
ATOM   7639  C  CB  . ASN B 2 76   ? -39.275 -11.984 -31.117 1.00 41.11  ? 630  ASN C CB  1 
ATOM   7640  C  CG  . ASN B 2 76   ? -39.281 -12.754 -32.423 1.00 50.76  ? 630  ASN C CG  1 
ATOM   7641  O  OD1 . ASN B 2 76   ? -40.200 -12.622 -33.232 1.00 47.75  ? 630  ASN C OD1 1 
ATOM   7642  N  ND2 . ASN B 2 76   ? -38.254 -13.569 -32.632 1.00 45.19  ? 630  ASN C ND2 1 
ATOM   7643  N  N   . GLY B 2 77   ? -42.077 -10.505 -32.406 1.00 41.23  ? 631  GLY C N   1 
ATOM   7644  C  CA  . GLY B 2 77   ? -42.586 -9.425  -33.231 1.00 41.28  ? 631  GLY C CA  1 
ATOM   7645  C  C   . GLY B 2 77   ? -42.121 -9.519  -34.670 1.00 46.03  ? 631  GLY C C   1 
ATOM   7646  O  O   . GLY B 2 77   ? -42.502 -8.704  -35.511 1.00 44.39  ? 631  GLY C O   1 
ATOM   7647  N  N   . THR B 2 78   ? -41.290 -10.516 -34.952 1.00 44.22  ? 632  THR C N   1 
ATOM   7648  C  CA  . THR B 2 78   ? -40.810 -10.743 -36.308 1.00 36.32  ? 632  THR C CA  1 
ATOM   7649  C  C   . THR B 2 78   ? -41.882 -11.418 -37.148 1.00 42.82  ? 632  THR C C   1 
ATOM   7650  O  O   . THR B 2 78   ? -42.881 -11.907 -36.620 1.00 49.71  ? 632  THR C O   1 
ATOM   7651  C  CB  . THR B 2 78   ? -39.542 -11.610 -36.327 1.00 41.80  ? 632  THR C CB  1 
ATOM   7652  O  OG1 . THR B 2 78   ? -39.816 -12.878 -35.718 1.00 47.94  ? 632  THR C OG1 1 
ATOM   7653  C  CG2 . THR B 2 78   ? -38.426 -10.923 -35.570 1.00 39.17  ? 632  THR C CG2 1 
ATOM   7654  N  N   . LYS B 2 79   ? -41.670 -11.440 -38.458 1.00 49.45  ? 633  LYS C N   1 
ATOM   7655  C  CA  . LYS B 2 79   ? -42.583 -12.118 -39.367 1.00 46.12  ? 633  LYS C CA  1 
ATOM   7656  C  C   . LYS B 2 79   ? -41.789 -12.874 -40.427 1.00 46.38  ? 633  LYS C C   1 
ATOM   7657  O  O   . LYS B 2 79   ? -41.140 -12.271 -41.281 1.00 48.22  ? 633  LYS C O   1 
ATOM   7658  C  CB  . LYS B 2 79   ? -43.543 -11.118 -40.013 1.00 29.45  ? 633  LYS C CB  1 
ATOM   7659  C  CG  . LYS B 2 79   ? -44.750 -11.759 -40.671 1.00 40.22  ? 633  LYS C CG  1 
ATOM   7660  C  CD  . LYS B 2 79   ? -45.779 -10.716 -41.069 1.00 48.99  ? 633  LYS C CD  1 
ATOM   7661  C  CE  . LYS B 2 79   ? -47.024 -11.365 -41.649 1.00 44.11  ? 633  LYS C CE  1 
ATOM   7662  N  NZ  . LYS B 2 79   ? -48.074 -10.360 -41.974 1.00 37.89  ? 633  LYS C NZ  1 
ATOM   7663  N  N   . ARG B 2 80   ? -41.838 -14.200 -40.356 1.00 39.33  ? 634  ARG C N   1 
ATOM   7664  C  CA  . ARG B 2 80   ? -41.034 -15.050 -41.225 1.00 32.41  ? 634  ARG C CA  1 
ATOM   7665  C  C   . ARG B 2 80   ? -41.900 -16.075 -41.949 1.00 38.96  ? 634  ARG C C   1 
ATOM   7666  O  O   . ARG B 2 80   ? -42.973 -16.428 -41.467 1.00 44.98  ? 634  ARG C O   1 
ATOM   7667  C  CB  . ARG B 2 80   ? -39.954 -15.766 -40.411 1.00 36.61  ? 634  ARG C CB  1 
ATOM   7668  C  CG  . ARG B 2 80   ? -39.164 -14.863 -39.484 1.00 34.16  ? 634  ARG C CG  1 
ATOM   7669  C  CD  . ARG B 2 80   ? -38.243 -13.936 -40.253 1.00 34.98  ? 634  ARG C CD  1 
ATOM   7670  N  NE  . ARG B 2 80   ? -37.343 -13.212 -39.361 1.00 36.68  ? 634  ARG C NE  1 
ATOM   7671  C  CZ  . ARG B 2 80   ? -36.221 -13.719 -38.863 1.00 39.60  ? 634  ARG C CZ  1 
ATOM   7672  N  NH1 . ARG B 2 80   ? -35.859 -14.958 -39.167 1.00 40.87  ? 634  ARG C NH1 1 
ATOM   7673  N  NH2 . ARG B 2 80   ? -35.461 -12.990 -38.058 1.00 53.36  ? 634  ARG C NH2 1 
ATOM   7674  N  N   . PRO B 2 81   ? -41.436 -16.556 -43.115 1.00 46.29  ? 635  PRO C N   1 
ATOM   7675  C  CA  . PRO B 2 81   ? -42.139 -17.619 -43.841 1.00 37.01  ? 635  PRO C CA  1 
ATOM   7676  C  C   . PRO B 2 81   ? -42.291 -18.893 -43.015 1.00 44.00  ? 635  PRO C C   1 
ATOM   7677  O  O   . PRO B 2 81   ? -41.342 -19.317 -42.357 1.00 52.05  ? 635  PRO C O   1 
ATOM   7678  C  CB  . PRO B 2 81   ? -41.239 -17.870 -45.054 1.00 34.21  ? 635  PRO C CB  1 
ATOM   7679  C  CG  . PRO B 2 81   ? -40.524 -16.586 -45.258 1.00 41.60  ? 635  PRO C CG  1 
ATOM   7680  C  CD  . PRO B 2 81   ? -40.296 -16.029 -43.885 1.00 46.28  ? 635  PRO C CD  1 
ATOM   7681  N  N   . ALA B 2 82   ? -43.479 -19.488 -43.052 1.00 49.06  ? 636  ALA C N   1 
ATOM   7682  C  CA  . ALA B 2 82   ? -43.735 -20.733 -42.341 1.00 37.00  ? 636  ALA C CA  1 
ATOM   7683  C  C   . ALA B 2 82   ? -44.069 -21.843 -43.328 1.00 52.24  ? 636  ALA C C   1 
ATOM   7684  O  O   . ALA B 2 82   ? -44.297 -21.584 -44.509 1.00 53.20  ? 636  ALA C O   1 
ATOM   7685  C  CB  . ALA B 2 82   ? -44.861 -20.553 -41.340 1.00 33.80  ? 636  ALA C CB  1 
ATOM   7686  N  N   . MET B 2 83   ? -44.102 -23.080 -42.844 1.00 51.96  ? 637  MET C N   1 
ATOM   7687  C  CA  . MET B 2 83   ? -44.337 -24.223 -43.716 1.00 38.33  ? 637  MET C CA  1 
ATOM   7688  C  C   . MET B 2 83   ? -45.820 -24.474 -43.959 1.00 44.38  ? 637  MET C C   1 
ATOM   7689  O  O   . MET B 2 83   ? -46.634 -24.408 -43.038 1.00 47.13  ? 637  MET C O   1 
ATOM   7690  C  CB  . MET B 2 83   ? -43.695 -25.482 -43.135 1.00 43.96  ? 637  MET C CB  1 
ATOM   7691  C  CG  . MET B 2 83   ? -43.784 -26.689 -44.054 1.00 46.15  ? 637  MET C CG  1 
ATOM   7692  S  SD  . MET B 2 83   ? -44.328 -28.180 -43.203 1.00 83.38  ? 637  MET C SD  1 
ATOM   7693  C  CE  . MET B 2 83   ? -45.953 -27.682 -42.638 1.00 57.71  ? 637  MET C CE  1 
ATOM   7694  N  N   . LEU B 2 84   ? -46.159 -24.762 -45.210 1.00 49.98  ? 638  LEU C N   1 
ATOM   7695  C  CA  . LEU B 2 84   ? -47.512 -25.157 -45.577 1.00 56.31  ? 638  LEU C CA  1 
ATOM   7696  C  C   . LEU B 2 84   ? -47.456 -26.369 -46.493 1.00 65.03  ? 638  LEU C C   1 
ATOM   7697  O  O   . LEU B 2 84   ? -46.713 -26.379 -47.474 1.00 68.34  ? 638  LEU C O   1 
ATOM   7698  C  CB  . LEU B 2 84   ? -48.249 -24.010 -46.267 1.00 50.62  ? 638  LEU C CB  1 
ATOM   7699  C  CG  . LEU B 2 84   ? -49.659 -24.288 -46.789 1.00 45.74  ? 638  LEU C CG  1 
ATOM   7700  C  CD1 . LEU B 2 84   ? -50.610 -24.585 -45.642 1.00 48.79  ? 638  LEU C CD1 1 
ATOM   7701  C  CD2 . LEU B 2 84   ? -50.159 -23.114 -47.614 1.00 40.03  ? 638  LEU C CD2 1 
ATOM   7702  N  N   . ASP B 2 85   ? -48.240 -27.394 -46.174 1.00 74.89  ? 639  ASP C N   1 
ATOM   7703  C  CA  . ASP B 2 85   ? -48.275 -28.584 -47.009 1.00 76.11  ? 639  ASP C CA  1 
ATOM   7704  C  C   . ASP B 2 85   ? -49.401 -28.464 -48.026 1.00 69.15  ? 639  ASP C C   1 
ATOM   7705  O  O   . ASP B 2 85   ? -50.581 -28.477 -47.674 1.00 59.58  ? 639  ASP C O   1 
ATOM   7706  C  CB  . ASP B 2 85   ? -48.447 -29.845 -46.161 1.00 81.14  ? 639  ASP C CB  1 
ATOM   7707  C  CG  . ASP B 2 85   ? -47.885 -31.081 -46.839 1.00 84.27  ? 639  ASP C CG  1 
ATOM   7708  O  OD1 . ASP B 2 85   ? -47.698 -31.051 -48.074 1.00 67.11  ? 639  ASP C OD1 1 
ATOM   7709  O  OD2 . ASP B 2 85   ? -47.629 -32.082 -46.137 1.00 83.29  ? 639  ASP C OD2 1 
ATOM   7710  N  N   . ASN B 2 86   ? -49.016 -28.345 -49.292 1.00 74.93  ? 640  ASN C N   1 
ATOM   7711  C  CA  . ASN B 2 86   ? -49.961 -28.140 -50.380 1.00 67.41  ? 640  ASN C CA  1 
ATOM   7712  C  C   . ASN B 2 86   ? -50.908 -29.323 -50.541 1.00 75.24  ? 640  ASN C C   1 
ATOM   7713  O  O   . ASN B 2 86   ? -52.089 -29.154 -50.844 1.00 72.38  ? 640  ASN C O   1 
ATOM   7714  C  CB  . ASN B 2 86   ? -49.201 -27.886 -51.682 1.00 65.85  ? 640  ASN C CB  1 
ATOM   7715  C  CG  . ASN B 2 86   ? -50.004 -27.081 -52.679 1.00 79.06  ? 640  ASN C CG  1 
ATOM   7716  O  OD1 . ASN B 2 86   ? -51.194 -27.322 -52.878 1.00 96.65  ? 640  ASN C OD1 1 
ATOM   7717  N  ND2 . ASN B 2 86   ? -49.355 -26.109 -53.309 1.00 67.85  ? 640  ASN C ND2 1 
ATOM   7718  N  N   . GLU B 2 87   ? -50.379 -30.523 -50.329 1.00 76.44  ? 641  GLU C N   1 
ATOM   7719  C  CA  . GLU B 2 87   ? -51.159 -31.747 -50.446 1.00 79.96  ? 641  GLU C CA  1 
ATOM   7720  C  C   . GLU B 2 87   ? -52.054 -31.972 -49.231 1.00 86.51  ? 641  GLU C C   1 
ATOM   7721  O  O   . GLU B 2 87   ? -53.279 -32.015 -49.353 1.00 92.65  ? 641  GLU C O   1 
ATOM   7722  C  CB  . GLU B 2 87   ? -50.233 -32.948 -50.646 1.00 82.57  ? 641  GLU C CB  1 
ATOM   7723  C  CG  . GLU B 2 87   ? -49.526 -32.960 -51.991 1.00 79.00  ? 641  GLU C CG  1 
ATOM   7724  C  CD  . GLU B 2 87   ? -50.488 -33.135 -53.151 1.00 119.09 ? 641  GLU C CD  1 
ATOM   7725  O  OE1 . GLU B 2 87   ? -51.245 -34.129 -53.152 1.00 120.15 ? 641  GLU C OE1 1 
ATOM   7726  O  OE2 . GLU B 2 87   ? -50.491 -32.277 -54.060 1.00 101.76 ? 641  GLU C OE2 1 
ATOM   7727  N  N   . ALA B 2 88   ? -51.432 -32.132 -48.066 1.00 64.40  ? 642  ALA C N   1 
ATOM   7728  C  CA  . ALA B 2 88   ? -52.146 -32.460 -46.835 1.00 73.05  ? 642  ALA C CA  1 
ATOM   7729  C  C   . ALA B 2 88   ? -53.237 -31.450 -46.479 1.00 78.23  ? 642  ALA C C   1 
ATOM   7730  O  O   . ALA B 2 88   ? -54.353 -31.832 -46.125 1.00 72.68  ? 642  ALA C O   1 
ATOM   7731  C  CB  . ALA B 2 88   ? -51.157 -32.581 -45.682 1.00 72.20  ? 642  ALA C CB  1 
ATOM   7732  N  N   . ASP B 2 89   ? -52.911 -30.166 -46.572 1.00 84.25  ? 643  ASP C N   1 
ATOM   7733  C  CA  . ASP B 2 89   ? -53.815 -29.107 -46.131 1.00 82.54  ? 643  ASP C CA  1 
ATOM   7734  C  C   . ASP B 2 89   ? -54.662 -28.517 -47.261 1.00 75.96  ? 643  ASP C C   1 
ATOM   7735  O  O   . ASP B 2 89   ? -55.414 -27.566 -47.047 1.00 64.53  ? 643  ASP C O   1 
ATOM   7736  C  CB  . ASP B 2 89   ? -53.014 -27.994 -45.454 1.00 87.04  ? 643  ASP C CB  1 
ATOM   7737  C  CG  . ASP B 2 89   ? -52.145 -28.509 -44.323 1.00 83.05  ? 643  ASP C CG  1 
ATOM   7738  O  OD1 . ASP B 2 89   ? -52.573 -29.456 -43.630 1.00 82.27  ? 643  ASP C OD1 1 
ATOM   7739  O  OD2 . ASP B 2 89   ? -51.035 -27.970 -44.128 1.00 83.55  ? 643  ASP C OD2 1 
ATOM   7740  N  N   . GLY B 2 90   ? -54.534 -29.083 -48.457 1.00 76.28  ? 644  GLY C N   1 
ATOM   7741  C  CA  . GLY B 2 90   ? -55.191 -28.549 -49.639 1.00 57.08  ? 644  GLY C CA  1 
ATOM   7742  C  C   . GLY B 2 90   ? -56.705 -28.424 -49.585 1.00 58.20  ? 644  GLY C C   1 
ATOM   7743  O  O   . GLY B 2 90   ? -57.288 -27.628 -50.322 1.00 58.35  ? 644  GLY C O   1 
ATOM   7744  N  N   . ASN B 2 91   ? -57.348 -29.206 -48.722 1.00 73.88  ? 645  ASN C N   1 
ATOM   7745  C  CA  . ASN B 2 91   ? -58.807 -29.213 -48.634 1.00 72.03  ? 645  ASN C CA  1 
ATOM   7746  C  C   . ASN B 2 91   ? -59.366 -28.306 -47.543 1.00 77.67  ? 645  ASN C C   1 
ATOM   7747  O  O   . ASN B 2 91   ? -60.579 -28.244 -47.340 1.00 71.39  ? 645  ASN C O   1 
ATOM   7748  C  CB  . ASN B 2 91   ? -59.311 -30.638 -48.411 1.00 58.64  ? 645  ASN C CB  1 
ATOM   7749  C  CG  . ASN B 2 91   ? -59.015 -31.547 -49.581 1.00 90.51  ? 645  ASN C CG  1 
ATOM   7750  O  OD1 . ASN B 2 91   ? -58.287 -32.528 -49.450 1.00 100.29 ? 645  ASN C OD1 1 
ATOM   7751  N  ND2 . ASN B 2 91   ? -59.581 -31.225 -50.739 1.00 68.83  ? 645  ASN C ND2 1 
ATOM   7752  N  N   . LYS B 2 92   ? -58.482 -27.607 -46.841 1.00 59.70  ? 646  LYS C N   1 
ATOM   7753  C  CA  . LYS B 2 92   ? -58.900 -26.738 -45.750 1.00 55.16  ? 646  LYS C CA  1 
ATOM   7754  C  C   . LYS B 2 92   ? -59.276 -25.352 -46.258 1.00 61.41  ? 646  LYS C C   1 
ATOM   7755  O  O   . LYS B 2 92   ? -58.671 -24.845 -47.203 1.00 63.75  ? 646  LYS C O   1 
ATOM   7756  C  CB  . LYS B 2 92   ? -57.794 -26.627 -44.701 1.00 74.79  ? 646  LYS C CB  1 
ATOM   7757  C  CG  . LYS B 2 92   ? -57.216 -27.962 -44.269 1.00 79.77  ? 646  LYS C CG  1 
ATOM   7758  C  CD  . LYS B 2 92   ? -57.017 -28.006 -42.765 1.00 75.31  ? 646  LYS C CD  1 
ATOM   7759  C  CE  . LYS B 2 92   ? -56.239 -29.241 -42.347 1.00 81.97  ? 646  LYS C CE  1 
ATOM   7760  N  NZ  . LYS B 2 92   ? -54.833 -29.183 -42.829 1.00 94.75  ? 646  LYS C NZ  1 
ATOM   7761  N  N   . THR B 2 93   ? -60.286 -24.750 -45.637 1.00 56.98  ? 647  THR C N   1 
ATOM   7762  C  CA  . THR B 2 93   ? -60.688 -23.389 -45.975 1.00 62.42  ? 647  THR C CA  1 
ATOM   7763  C  C   . THR B 2 93   ? -59.527 -22.430 -45.747 1.00 71.74  ? 647  THR C C   1 
ATOM   7764  O  O   . THR B 2 93   ? -58.702 -22.644 -44.859 1.00 71.86  ? 647  THR C O   1 
ATOM   7765  C  CB  . THR B 2 93   ? -61.898 -22.923 -45.144 1.00 67.95  ? 647  THR C CB  1 
ATOM   7766  O  OG1 . THR B 2 93   ? -61.525 -22.822 -43.764 1.00 67.10  ? 647  THR C OG1 1 
ATOM   7767  C  CG2 . THR B 2 93   ? -63.053 -23.902 -45.285 1.00 67.63  ? 647  THR C CG2 1 
ATOM   7768  N  N   . MET B 2 94   ? -59.462 -21.375 -46.552 1.00 67.58  ? 648  MET C N   1 
ATOM   7769  C  CA  . MET B 2 94   ? -58.382 -20.402 -46.437 1.00 59.04  ? 648  MET C CA  1 
ATOM   7770  C  C   . MET B 2 94   ? -58.435 -19.669 -45.104 1.00 60.67  ? 648  MET C C   1 
ATOM   7771  O  O   . MET B 2 94   ? -57.409 -19.231 -44.587 1.00 67.91  ? 648  MET C O   1 
ATOM   7772  C  CB  . MET B 2 94   ? -58.439 -19.397 -47.589 1.00 54.51  ? 648  MET C CB  1 
ATOM   7773  C  CG  . MET B 2 94   ? -58.193 -20.008 -48.957 1.00 49.09  ? 648  MET C CG  1 
ATOM   7774  S  SD  . MET B 2 94   ? -56.464 -20.432 -49.241 1.00 52.71  ? 648  MET C SD  1 
ATOM   7775  C  CE  . MET B 2 94   ? -55.758 -18.805 -49.484 1.00 44.37  ? 648  MET C CE  1 
ATOM   7776  N  N   . ILE B 2 95   ? -59.635 -19.544 -44.548 1.00 60.47  ? 649  ILE C N   1 
ATOM   7777  C  CA  . ILE B 2 95   ? -59.820 -18.797 -43.310 1.00 55.37  ? 649  ILE C CA  1 
ATOM   7778  C  C   . ILE B 2 95   ? -59.334 -19.584 -42.092 1.00 61.63  ? 649  ILE C C   1 
ATOM   7779  O  O   . ILE B 2 95   ? -58.954 -18.995 -41.079 1.00 65.87  ? 649  ILE C O   1 
ATOM   7780  C  CB  . ILE B 2 95   ? -61.301 -18.394 -43.115 1.00 50.73  ? 649  ILE C CB  1 
ATOM   7781  C  CG1 . ILE B 2 95   ? -61.434 -17.365 -41.990 1.00 53.29  ? 649  ILE C CG1 1 
ATOM   7782  C  CG2 . ILE B 2 95   ? -62.174 -19.617 -42.857 1.00 55.40  ? 649  ILE C CG2 1 
ATOM   7783  C  CD1 . ILE B 2 95   ? -60.588 -16.130 -42.199 1.00 63.10  ? 649  ILE C CD1 1 
ATOM   7784  N  N   . GLU B 2 96   ? -59.331 -20.910 -42.188 1.00 56.14  ? 650  GLU C N   1 
ATOM   7785  C  CA  . GLU B 2 96   ? -58.852 -21.725 -41.079 1.00 59.58  ? 650  GLU C CA  1 
ATOM   7786  C  C   . GLU B 2 96   ? -57.340 -21.900 -41.176 1.00 61.48  ? 650  GLU C C   1 
ATOM   7787  O  O   . GLU B 2 96   ? -56.656 -22.032 -40.161 1.00 73.59  ? 650  GLU C O   1 
ATOM   7788  C  CB  . GLU B 2 96   ? -59.555 -23.089 -41.042 1.00 52.54  ? 650  GLU C CB  1 
ATOM   7789  C  CG  . GLU B 2 96   ? -59.043 -24.106 -42.050 1.00 76.04  ? 650  GLU C CG  1 
ATOM   7790  C  CD  . GLU B 2 96   ? -59.523 -25.512 -41.748 1.00 87.07  ? 650  GLU C CD  1 
ATOM   7791  O  OE1 . GLU B 2 96   ? -59.115 -26.070 -40.707 1.00 82.47  ? 650  GLU C OE1 1 
ATOM   7792  O  OE2 . GLU B 2 96   ? -60.311 -26.057 -42.549 1.00 79.09  ? 650  GLU C OE2 1 
ATOM   7793  N  N   . LEU B 2 97   ? -56.820 -21.887 -42.399 1.00 62.80  ? 651  LEU C N   1 
ATOM   7794  C  CA  . LEU B 2 97   ? -55.381 -21.971 -42.605 1.00 64.97  ? 651  LEU C CA  1 
ATOM   7795  C  C   . LEU B 2 97   ? -54.728 -20.658 -42.195 1.00 64.48  ? 651  LEU C C   1 
ATOM   7796  O  O   . LEU B 2 97   ? -53.613 -20.642 -41.675 1.00 65.32  ? 651  LEU C O   1 
ATOM   7797  C  CB  . LEU B 2 97   ? -55.051 -22.301 -44.062 1.00 64.06  ? 651  LEU C CB  1 
ATOM   7798  C  CG  . LEU B 2 97   ? -55.416 -23.704 -44.551 1.00 54.42  ? 651  LEU C CG  1 
ATOM   7799  C  CD1 . LEU B 2 97   ? -54.949 -23.902 -45.982 1.00 52.84  ? 651  LEU C CD1 1 
ATOM   7800  C  CD2 . LEU B 2 97   ? -54.817 -24.763 -43.641 1.00 52.06  ? 651  LEU C CD2 1 
ATOM   7801  N  N   . SER B 2 98   ? -55.438 -19.558 -42.428 1.00 54.53  ? 652  SER C N   1 
ATOM   7802  C  CA  . SER B 2 98   ? -54.950 -18.238 -42.057 1.00 57.95  ? 652  SER C CA  1 
ATOM   7803  C  C   . SER B 2 98   ? -55.120 -18.003 -40.563 1.00 70.11  ? 652  SER C C   1 
ATOM   7804  O  O   . SER B 2 98   ? -54.548 -17.065 -40.010 1.00 64.43  ? 652  SER C O   1 
ATOM   7805  C  CB  . SER B 2 98   ? -55.685 -17.148 -42.840 1.00 55.90  ? 652  SER C CB  1 
ATOM   7806  O  OG  . SER B 2 98   ? -57.044 -17.058 -42.445 1.00 54.62  ? 652  SER C OG  1 
ATOM   7807  N  N   . ASP B 2 99   ? -55.905 -18.868 -39.923 1.00 68.68  ? 653  ASP C N   1 
ATOM   7808  C  CA  . ASP B 2 99   ? -56.252 -18.730 -38.512 1.00 75.14  ? 653  ASP C CA  1 
ATOM   7809  C  C   . ASP B 2 99   ? -56.963 -17.401 -38.272 1.00 63.58  ? 653  ASP C C   1 
ATOM   7810  O  O   . ASP B 2 99   ? -56.583 -16.630 -37.388 1.00 54.69  ? 653  ASP C O   1 
ATOM   7811  C  CB  . ASP B 2 99   ? -55.001 -18.854 -37.631 1.00 77.54  ? 653  ASP C CB  1 
ATOM   7812  C  CG  . ASP B 2 99   ? -55.331 -18.978 -36.158 1.00 81.93  ? 653  ASP C CG  1 
ATOM   7813  O  OD1 . ASP B 2 99   ? -56.467 -19.390 -35.835 1.00 75.00  ? 653  ASP C OD1 1 
ATOM   7814  O  OD2 . ASP B 2 99   ? -54.455 -18.670 -35.324 1.00 78.41  ? 653  ASP C OD2 1 
ATOM   7815  N  N   . ASN B 2 100  ? -57.971 -17.131 -39.101 1.00 76.93  ? 654  ASN C N   1 
ATOM   7816  C  CA  . ASN B 2 100  ? -58.825 -15.948 -38.980 1.00 69.50  ? 654  ASN C CA  1 
ATOM   7817  C  C   . ASN B 2 100  ? -58.090 -14.636 -39.239 1.00 64.35  ? 654  ASN C C   1 
ATOM   7818  O  O   . ASN B 2 100  ? -58.693 -13.562 -39.228 1.00 66.72  ? 654  ASN C O   1 
ATOM   7819  C  CB  . ASN B 2 100  ? -59.502 -15.912 -37.608 1.00 63.20  ? 654  ASN C CB  1 
ATOM   7820  C  CG  . ASN B 2 100  ? -60.971 -16.256 -37.685 1.00 85.25  ? 654  ASN C CG  1 
ATOM   7821  O  OD1 . ASN B 2 100  ? -61.825 -15.371 -37.694 1.00 88.97  ? 654  ASN C OD1 1 
ATOM   7822  N  ND2 . ASN B 2 100  ? -61.276 -17.547 -37.752 1.00 70.92  ? 654  ASN C ND2 1 
ATOM   7823  N  N   . GLU B 2 101  ? -56.784 -14.732 -39.459 1.00 60.94  ? 655  GLU C N   1 
ATOM   7824  C  CA  . GLU B 2 101  ? -55.980 -13.583 -39.844 1.00 61.95  ? 655  GLU C CA  1 
ATOM   7825  C  C   . GLU B 2 101  ? -56.466 -13.053 -41.186 1.00 62.39  ? 655  GLU C C   1 
ATOM   7826  O  O   . GLU B 2 101  ? -56.920 -13.821 -42.035 1.00 68.36  ? 655  GLU C O   1 
ATOM   7827  C  CB  . GLU B 2 101  ? -54.499 -13.968 -39.916 1.00 62.20  ? 655  GLU C CB  1 
ATOM   7828  C  CG  . GLU B 2 101  ? -53.529 -12.825 -40.145 1.00 72.49  ? 655  GLU C CG  1 
ATOM   7829  C  CD  . GLU B 2 101  ? -52.085 -13.294 -40.166 1.00 79.96  ? 655  GLU C CD  1 
ATOM   7830  O  OE1 . GLU B 2 101  ? -51.850 -14.512 -40.009 1.00 70.93  ? 655  GLU C OE1 1 
ATOM   7831  O  OE2 . GLU B 2 101  ? -51.186 -12.445 -40.337 1.00 70.40  ? 655  GLU C OE2 1 
ATOM   7832  N  N   . ASN B 2 102  ? -56.342 -11.743 -41.375 1.00 63.32  ? 656  ASN C N   1 
ATOM   7833  C  CA  . ASN B 2 102  ? -56.740 -11.077 -42.609 1.00 42.06  ? 656  ASN C CA  1 
ATOM   7834  C  C   . ASN B 2 102  ? -56.360 -9.606  -42.511 1.00 44.02  ? 656  ASN C C   1 
ATOM   7835  O  O   . ASN B 2 102  ? -56.702 -8.943  -41.533 1.00 63.42  ? 656  ASN C O   1 
ATOM   7836  C  CB  . ASN B 2 102  ? -58.253 -11.233 -42.834 1.00 49.24  ? 656  ASN C CB  1 
ATOM   7837  C  CG  . ASN B 2 102  ? -58.772 -10.420 -44.007 1.00 56.16  ? 656  ASN C CG  1 
ATOM   7838  O  OD1 . ASN B 2 102  ? -58.122 -10.308 -45.044 1.00 72.98  ? 656  ASN C OD1 1 
ATOM   7839  N  ND2 . ASN B 2 102  ? -59.964 -9.852  -43.846 1.00 33.50  ? 656  ASN C ND2 1 
ATOM   7840  N  N   . PRO B 2 103  ? -55.662 -9.077  -43.533 1.00 41.73  ? 657  PRO C N   1 
ATOM   7841  C  CA  . PRO B 2 103  ? -55.092 -9.763  -44.703 1.00 41.90  ? 657  PRO C CA  1 
ATOM   7842  C  C   . PRO B 2 103  ? -54.072 -10.846 -44.345 1.00 48.35  ? 657  PRO C C   1 
ATOM   7843  O  O   . PRO B 2 103  ? -53.431 -10.770 -43.297 1.00 45.36  ? 657  PRO C O   1 
ATOM   7844  C  CB  . PRO B 2 103  ? -54.407 -8.628  -45.472 1.00 39.01  ? 657  PRO C CB  1 
ATOM   7845  C  CG  . PRO B 2 103  ? -54.078 -7.626  -44.428 1.00 25.55  ? 657  PRO C CG  1 
ATOM   7846  C  CD  . PRO B 2 103  ? -55.237 -7.668  -43.479 1.00 43.91  ? 657  PRO C CD  1 
ATOM   7847  N  N   . TRP B 2 104  ? -53.940 -11.845 -45.212 1.00 45.90  ? 658  TRP C N   1 
ATOM   7848  C  CA  . TRP B 2 104  ? -53.053 -12.975 -44.967 1.00 39.56  ? 658  TRP C CA  1 
ATOM   7849  C  C   . TRP B 2 104  ? -51.933 -13.011 -46.001 1.00 42.90  ? 658  TRP C C   1 
ATOM   7850  O  O   . TRP B 2 104  ? -52.178 -13.249 -47.183 1.00 51.16  ? 658  TRP C O   1 
ATOM   7851  C  CB  . TRP B 2 104  ? -53.846 -14.283 -44.993 1.00 41.90  ? 658  TRP C CB  1 
ATOM   7852  C  CG  . TRP B 2 104  ? -53.050 -15.502 -44.641 1.00 40.49  ? 658  TRP C CG  1 
ATOM   7853  C  CD1 . TRP B 2 104  ? -52.003 -15.578 -43.769 1.00 51.62  ? 658  TRP C CD1 1 
ATOM   7854  C  CD2 . TRP B 2 104  ? -53.236 -16.823 -45.160 1.00 45.17  ? 658  TRP C CD2 1 
ATOM   7855  N  NE1 . TRP B 2 104  ? -51.531 -16.867 -43.709 1.00 44.11  ? 658  TRP C NE1 1 
ATOM   7856  C  CE2 . TRP B 2 104  ? -52.271 -17.651 -44.554 1.00 49.52  ? 658  TRP C CE2 1 
ATOM   7857  C  CE3 . TRP B 2 104  ? -54.130 -17.388 -46.075 1.00 43.59  ? 658  TRP C CE3 1 
ATOM   7858  C  CZ2 . TRP B 2 104  ? -52.172 -19.012 -44.837 1.00 45.65  ? 658  TRP C CZ2 1 
ATOM   7859  C  CZ3 . TRP B 2 104  ? -54.031 -18.738 -46.353 1.00 46.44  ? 658  TRP C CZ3 1 
ATOM   7860  C  CH2 . TRP B 2 104  ? -53.059 -19.535 -45.737 1.00 45.68  ? 658  TRP C CH2 1 
ATOM   7861  N  N   . THR B 2 105  ? -50.704 -12.775 -45.552 1.00 43.86  ? 659  THR C N   1 
ATOM   7862  C  CA  . THR B 2 105  ? -49.566 -12.700 -46.462 1.00 40.75  ? 659  THR C CA  1 
ATOM   7863  C  C   . THR B 2 105  ? -48.897 -14.060 -46.649 1.00 42.38  ? 659  THR C C   1 
ATOM   7864  O  O   . THR B 2 105  ? -48.695 -14.805 -45.690 1.00 38.36  ? 659  THR C O   1 
ATOM   7865  C  CB  . THR B 2 105  ? -48.518 -11.687 -45.965 1.00 45.50  ? 659  THR C CB  1 
ATOM   7866  O  OG1 . THR B 2 105  ? -49.163 -10.455 -45.620 1.00 44.72  ? 659  THR C OG1 1 
ATOM   7867  C  CG2 . THR B 2 105  ? -47.477 -11.423 -47.042 1.00 31.67  ? 659  THR C CG2 1 
ATOM   7868  N  N   . ILE B 2 106  ? -48.558 -14.375 -47.896 1.00 41.81  ? 660  ILE C N   1 
ATOM   7869  C  CA  . ILE B 2 106  ? -47.903 -15.634 -48.227 1.00 36.24  ? 660  ILE C CA  1 
ATOM   7870  C  C   . ILE B 2 106  ? -46.687 -15.413 -49.125 1.00 44.77  ? 660  ILE C C   1 
ATOM   7871  O  O   . ILE B 2 106  ? -46.757 -14.673 -50.107 1.00 45.16  ? 660  ILE C O   1 
ATOM   7872  C  CB  . ILE B 2 106  ? -48.870 -16.605 -48.939 1.00 33.09  ? 660  ILE C CB  1 
ATOM   7873  C  CG1 . ILE B 2 106  ? -50.089 -16.899 -48.065 1.00 34.09  ? 660  ILE C CG1 1 
ATOM   7874  C  CG2 . ILE B 2 106  ? -48.158 -17.899 -49.304 1.00 41.71  ? 660  ILE C CG2 1 
ATOM   7875  C  CD1 . ILE B 2 106  ? -51.051 -17.888 -48.683 1.00 34.24  ? 660  ILE C CD1 1 
ATOM   7876  N  N   . PHE B 2 107  ? -45.573 -16.049 -48.781 1.00 35.07  ? 661  PHE C N   1 
ATOM   7877  C  CA  . PHE B 2 107  ? -44.409 -16.076 -49.659 1.00 39.96  ? 661  PHE C CA  1 
ATOM   7878  C  C   . PHE B 2 107  ? -44.634 -17.076 -50.782 1.00 46.89  ? 661  PHE C C   1 
ATOM   7879  O  O   . PHE B 2 107  ? -45.046 -18.208 -50.541 1.00 45.35  ? 661  PHE C O   1 
ATOM   7880  C  CB  . PHE B 2 107  ? -43.140 -16.433 -48.883 1.00 42.30  ? 661  PHE C CB  1 
ATOM   7881  C  CG  . PHE B 2 107  ? -41.925 -16.608 -49.751 1.00 35.33  ? 661  PHE C CG  1 
ATOM   7882  C  CD1 . PHE B 2 107  ? -41.564 -15.633 -50.665 1.00 37.46  ? 661  PHE C CD1 1 
ATOM   7883  C  CD2 . PHE B 2 107  ? -41.135 -17.740 -49.639 1.00 34.11  ? 661  PHE C CD2 1 
ATOM   7884  C  CE1 . PHE B 2 107  ? -40.445 -15.790 -51.461 1.00 44.79  ? 661  PHE C CE1 1 
ATOM   7885  C  CE2 . PHE B 2 107  ? -40.014 -17.901 -50.431 1.00 38.23  ? 661  PHE C CE2 1 
ATOM   7886  C  CZ  . PHE B 2 107  ? -39.669 -16.924 -51.342 1.00 39.84  ? 661  PHE C CZ  1 
ATOM   7887  N  N   . LEU B 2 108  ? -44.367 -16.648 -52.010 1.00 51.01  ? 662  LEU C N   1 
ATOM   7888  C  CA  . LEU B 2 108  ? -44.508 -17.524 -53.163 1.00 45.69  ? 662  LEU C CA  1 
ATOM   7889  C  C   . LEU B 2 108  ? -43.141 -17.966 -53.658 1.00 47.02  ? 662  LEU C C   1 
ATOM   7890  O  O   . LEU B 2 108  ? -42.379 -17.160 -54.192 1.00 50.67  ? 662  LEU C O   1 
ATOM   7891  C  CB  . LEU B 2 108  ? -45.276 -16.823 -54.283 1.00 35.34  ? 662  LEU C CB  1 
ATOM   7892  C  CG  . LEU B 2 108  ? -45.415 -17.593 -55.597 1.00 45.55  ? 662  LEU C CG  1 
ATOM   7893  C  CD1 . LEU B 2 108  ? -46.137 -18.910 -55.370 1.00 51.62  ? 662  LEU C CD1 1 
ATOM   7894  C  CD2 . LEU B 2 108  ? -46.141 -16.751 -56.632 1.00 40.58  ? 662  LEU C CD2 1 
ATOM   7895  N  N   . GLU B 2 109  ? -42.824 -19.243 -53.474 1.00 46.47  ? 663  GLU C N   1 
ATOM   7896  C  CA  . GLU B 2 109  ? -41.553 -19.765 -53.955 1.00 48.13  ? 663  GLU C CA  1 
ATOM   7897  C  C   . GLU B 2 109  ? -41.721 -20.458 -55.297 1.00 54.40  ? 663  GLU C C   1 
ATOM   7898  O  O   . GLU B 2 109  ? -42.442 -21.448 -55.410 1.00 63.37  ? 663  GLU C O   1 
ATOM   7899  C  CB  . GLU B 2 109  ? -40.938 -20.737 -52.953 1.00 55.54  ? 663  GLU C CB  1 
ATOM   7900  C  CG  . GLU B 2 109  ? -39.557 -21.211 -53.374 1.00 56.37  ? 663  GLU C CG  1 
ATOM   7901  C  CD  . GLU B 2 109  ? -39.094 -22.426 -52.606 1.00 60.98  ? 663  GLU C CD  1 
ATOM   7902  O  OE1 . GLU B 2 109  ? -39.912 -23.007 -51.860 1.00 67.80  ? 663  GLU C OE1 1 
ATOM   7903  O  OE2 . GLU B 2 109  ? -37.913 -22.806 -52.751 1.00 50.40  ? 663  GLU C OE2 1 
ATOM   7904  N  N   . THR B 2 110  ? -41.050 -19.929 -56.314 1.00 51.35  ? 664  THR C N   1 
ATOM   7905  C  CA  . THR B 2 110  ? -41.079 -20.530 -57.638 1.00 56.60  ? 664  THR C CA  1 
ATOM   7906  C  C   . THR B 2 110  ? -39.664 -20.846 -58.098 1.00 60.04  ? 664  THR C C   1 
ATOM   7907  O  O   . THR B 2 110  ? -38.691 -20.389 -57.498 1.00 66.26  ? 664  THR C O   1 
ATOM   7908  C  CB  . THR B 2 110  ? -41.747 -19.606 -58.674 1.00 56.29  ? 664  THR C CB  1 
ATOM   7909  O  OG1 . THR B 2 110  ? -40.815 -18.600 -59.092 1.00 42.64  ? 664  THR C OG1 1 
ATOM   7910  C  CG2 . THR B 2 110  ? -42.982 -18.943 -58.087 1.00 53.60  ? 664  THR C CG2 1 
ATOM   7911  N  N   . VAL B 2 111  ? -39.554 -21.633 -59.161 1.00 59.71  ? 665  VAL C N   1 
ATOM   7912  C  CA  . VAL B 2 111  ? -38.262 -21.885 -59.775 1.00 81.96  ? 665  VAL C CA  1 
ATOM   7913  C  C   . VAL B 2 111  ? -37.923 -20.721 -60.693 1.00 91.18  ? 665  VAL C C   1 
ATOM   7914  O  O   . VAL B 2 111  ? -38.807 -20.178 -61.356 1.00 84.50  ? 665  VAL C O   1 
ATOM   7915  C  CB  . VAL B 2 111  ? -38.252 -23.195 -60.580 1.00 92.44  ? 665  VAL C CB  1 
ATOM   7916  C  CG1 . VAL B 2 111  ? -36.821 -23.641 -60.837 1.00 79.78  ? 665  VAL C CG1 1 
ATOM   7917  C  CG2 . VAL B 2 111  ? -39.025 -24.273 -59.840 1.00 80.31  ? 665  VAL C CG2 1 
ATOM   7918  N  N   . ASP B 2 112  ? -36.653 -20.328 -60.715 1.00 96.03  ? 666  ASP C N   1 
ATOM   7919  C  CA  . ASP B 2 112  ? -36.199 -19.264 -61.602 1.00 106.31 ? 666  ASP C CA  1 
ATOM   7920  C  C   . ASP B 2 112  ? -36.518 -19.641 -63.044 1.00 115.48 ? 666  ASP C C   1 
ATOM   7921  O  O   . ASP B 2 112  ? -36.005 -20.637 -63.554 1.00 116.25 ? 666  ASP C O   1 
ATOM   7922  C  CB  . ASP B 2 112  ? -34.698 -19.013 -61.427 1.00 108.67 ? 666  ASP C CB  1 
ATOM   7923  C  CG  . ASP B 2 112  ? -34.241 -17.705 -62.054 1.00 112.08 ? 666  ASP C CG  1 
ATOM   7924  O  OD1 . ASP B 2 112  ? -34.809 -17.292 -63.087 1.00 113.68 ? 666  ASP C OD1 1 
ATOM   7925  O  OD2 . ASP B 2 112  ? -33.303 -17.088 -61.507 1.00 95.90  ? 666  ASP C OD2 1 
ATOM   7926  N  N   . PRO B 2 113  ? -37.377 -18.845 -63.702 1.00 123.40 ? 667  PRO C N   1 
ATOM   7927  C  CA  . PRO B 2 113  ? -37.823 -19.117 -65.074 1.00 123.32 ? 667  PRO C CA  1 
ATOM   7928  C  C   . PRO B 2 113  ? -36.665 -19.235 -66.060 1.00 121.40 ? 667  PRO C C   1 
ATOM   7929  O  O   . PRO B 2 113  ? -36.813 -19.867 -67.107 1.00 119.01 ? 667  PRO C O   1 
ATOM   7930  C  CB  . PRO B 2 113  ? -38.699 -17.904 -65.405 1.00 126.65 ? 667  PRO C CB  1 
ATOM   7931  C  CG  . PRO B 2 113  ? -39.162 -17.403 -64.081 1.00 130.58 ? 667  PRO C CG  1 
ATOM   7932  C  CD  . PRO B 2 113  ? -38.010 -17.634 -63.151 1.00 119.50 ? 667  PRO C CD  1 
ATOM   7933  N  N   . GLU B 2 114  ? -35.526 -18.637 -65.725 1.00 116.99 ? 668  GLU C N   1 
ATOM   7934  C  CA  . GLU B 2 114  ? -34.344 -18.729 -66.571 1.00 107.76 ? 668  GLU C CA  1 
ATOM   7935  C  C   . GLU B 2 114  ? -33.548 -19.997 -66.282 1.00 103.54 ? 668  GLU C C   1 
ATOM   7936  O  O   . GLU B 2 114  ? -32.706 -20.404 -67.081 1.00 114.30 ? 668  GLU C O   1 
ATOM   7937  C  CB  . GLU B 2 114  ? -33.459 -17.497 -66.390 1.00 111.26 ? 668  GLU C CB  1 
ATOM   7938  C  CG  . GLU B 2 114  ? -34.051 -16.234 -66.981 1.00 119.45 ? 668  GLU C CG  1 
ATOM   7939  C  CD  . GLU B 2 114  ? -33.007 -15.362 -67.645 1.00 123.34 ? 668  GLU C CD  1 
ATOM   7940  O  OE1 . GLU B 2 114  ? -31.855 -15.342 -67.163 1.00 100.05 ? 668  GLU C OE1 1 
ATOM   7941  O  OE2 . GLU B 2 114  ? -33.335 -14.707 -68.657 1.00 113.76 ? 668  GLU C OE2 1 
ATOM   7942  N  N   . LEU B 2 115  ? -33.813 -20.616 -65.136 1.00 101.87 ? 669  LEU C N   1 
ATOM   7943  C  CA  . LEU B 2 115  ? -33.195 -21.895 -64.808 1.00 105.54 ? 669  LEU C CA  1 
ATOM   7944  C  C   . LEU B 2 115  ? -34.191 -23.034 -64.994 1.00 101.44 ? 669  LEU C C   1 
ATOM   7945  O  O   . LEU B 2 115  ? -33.855 -24.201 -64.806 1.00 99.07  ? 669  LEU C O   1 
ATOM   7946  C  CB  . LEU B 2 115  ? -32.657 -21.897 -63.374 1.00 103.80 ? 669  LEU C CB  1 
ATOM   7947  C  CG  . LEU B 2 115  ? -31.283 -21.267 -63.138 1.00 105.98 ? 669  LEU C CG  1 
ATOM   7948  C  CD1 . LEU B 2 115  ? -31.375 -19.751 -63.042 1.00 102.95 ? 669  LEU C CD1 1 
ATOM   7949  C  CD2 . LEU B 2 115  ? -30.631 -21.853 -61.894 1.00 99.53  ? 669  LEU C CD2 1 
ATOM   7950  N  N   . ALA B 2 116  ? -35.419 -22.686 -65.366 1.00 102.38 ? 670  ALA C N   1 
ATOM   7951  C  CA  . ALA B 2 116  ? -36.465 -23.680 -65.580 1.00 108.52 ? 670  ALA C CA  1 
ATOM   7952  C  C   . ALA B 2 116  ? -36.635 -23.984 -67.065 1.00 120.10 ? 670  ALA C C   1 
ATOM   7953  O  O   . ALA B 2 116  ? -37.031 -25.088 -67.441 1.00 110.53 ? 670  ALA C O   1 
ATOM   7954  C  CB  . ALA B 2 116  ? -37.778 -23.207 -64.981 1.00 98.35  ? 670  ALA C CB  1 
ATOM   7955  N  N   . ALA B 2 117  ? -36.334 -22.998 -67.905 1.00 119.57 ? 671  ALA C N   1 
ATOM   7956  C  CA  . ALA B 2 117  ? -36.332 -23.199 -69.349 1.00 118.57 ? 671  ALA C CA  1 
ATOM   7957  C  C   . ALA B 2 117  ? -35.233 -24.186 -69.721 1.00 123.57 ? 671  ALA C C   1 
ATOM   7958  O  O   . ALA B 2 117  ? -35.297 -24.853 -70.755 1.00 117.41 ? 671  ALA C O   1 
ATOM   7959  C  CB  . ALA B 2 117  ? -36.138 -21.878 -70.077 1.00 100.55 ? 671  ALA C CB  1 
ATOM   7960  N  N   . SER B 2 118  ? -34.227 -24.272 -68.857 1.00 124.49 ? 672  SER C N   1 
ATOM   7961  C  CA  . SER B 2 118  ? -33.139 -25.225 -69.017 1.00 114.70 ? 672  SER C CA  1 
ATOM   7962  C  C   . SER B 2 118  ? -33.537 -26.589 -68.457 1.00 118.18 ? 672  SER C C   1 
ATOM   7963  O  O   . SER B 2 118  ? -32.771 -27.549 -68.535 1.00 105.42 ? 672  SER C O   1 
ATOM   7964  C  CB  . SER B 2 118  ? -31.874 -24.710 -68.331 1.00 111.59 ? 672  SER C CB  1 
ATOM   7965  O  OG  . SER B 2 118  ? -31.627 -23.356 -68.676 1.00 109.89 ? 672  SER C OG  1 
ATOM   7966  N  N   . GLY B 2 119  ? -34.742 -26.667 -67.893 1.00 111.33 ? 673  GLY C N   1 
ATOM   7967  C  CA  . GLY B 2 119  ? -35.316 -27.937 -67.480 1.00 111.64 ? 673  GLY C CA  1 
ATOM   7968  C  C   . GLY B 2 119  ? -35.451 -28.242 -65.996 1.00 108.33 ? 673  GLY C C   1 
ATOM   7969  O  O   . GLY B 2 119  ? -36.067 -29.244 -65.634 1.00 100.29 ? 673  GLY C O   1 
ATOM   7970  N  N   . ALA B 2 120  ? -34.890 -27.399 -65.133 1.00 125.96 ? 674  ALA C N   1 
ATOM   7971  C  CA  . ALA B 2 120  ? -34.947 -27.651 -63.692 1.00 122.62 ? 674  ALA C CA  1 
ATOM   7972  C  C   . ALA B 2 120  ? -36.351 -27.434 -63.125 1.00 108.37 ? 674  ALA C C   1 
ATOM   7973  O  O   . ALA B 2 120  ? -37.137 -26.656 -63.667 1.00 107.90 ? 674  ALA C O   1 
ATOM   7974  C  CB  . ALA B 2 120  ? -33.942 -26.775 -62.960 1.00 102.56 ? 674  ALA C CB  1 
ATOM   7975  N  N   . THR B 2 121  ? -36.658 -28.129 -62.033 1.00 91.02  ? 675  THR C N   1 
ATOM   7976  C  CA  . THR B 2 121  ? -37.973 -28.036 -61.402 1.00 89.27  ? 675  THR C CA  1 
ATOM   7977  C  C   . THR B 2 121  ? -37.874 -27.763 -59.902 1.00 83.00  ? 675  THR C C   1 
ATOM   7978  O  O   . THR B 2 121  ? -36.784 -27.564 -59.365 1.00 83.74  ? 675  THR C O   1 
ATOM   7979  C  CB  . THR B 2 121  ? -38.796 -29.321 -61.616 1.00 96.59  ? 675  THR C CB  1 
ATOM   7980  O  OG1 . THR B 2 121  ? -38.087 -30.444 -61.080 1.00 96.30  ? 675  THR C OG1 1 
ATOM   7981  C  CG2 . THR B 2 121  ? -39.059 -29.550 -63.098 1.00 82.07  ? 675  THR C CG2 1 
ATOM   7982  N  N   . LEU B 2 122  ? -39.024 -27.763 -59.234 1.00 75.33  ? 676  LEU C N   1 
ATOM   7983  C  CA  . LEU B 2 122  ? -39.100 -27.440 -57.812 1.00 71.27  ? 676  LEU C CA  1 
ATOM   7984  C  C   . LEU B 2 122  ? -38.632 -28.599 -56.936 1.00 77.49  ? 676  LEU C C   1 
ATOM   7985  O  O   . LEU B 2 122  ? -39.228 -29.676 -56.955 1.00 88.74  ? 676  LEU C O   1 
ATOM   7986  C  CB  . LEU B 2 122  ? -40.530 -27.045 -57.437 1.00 75.90  ? 676  LEU C CB  1 
ATOM   7987  C  CG  . LEU B 2 122  ? -40.753 -26.427 -56.055 1.00 81.06  ? 676  LEU C CG  1 
ATOM   7988  C  CD1 . LEU B 2 122  ? -40.027 -25.095 -55.939 1.00 57.80  ? 676  LEU C CD1 1 
ATOM   7989  C  CD2 . LEU B 2 122  ? -42.239 -26.254 -55.786 1.00 71.78  ? 676  LEU C CD2 1 
ATOM   7990  N  N   . PRO B 2 123  ? -37.561 -28.373 -56.157 1.00 78.24  ? 677  PRO C N   1 
ATOM   7991  C  CA  . PRO B 2 123  ? -36.969 -29.377 -55.263 1.00 73.25  ? 677  PRO C CA  1 
ATOM   7992  C  C   . PRO B 2 123  ? -37.954 -29.901 -54.224 1.00 78.27  ? 677  PRO C C   1 
ATOM   7993  O  O   . PRO B 2 123  ? -38.899 -29.200 -53.863 1.00 88.71  ? 677  PRO C O   1 
ATOM   7994  C  CB  . PRO B 2 123  ? -35.829 -28.612 -54.580 1.00 58.90  ? 677  PRO C CB  1 
ATOM   7995  C  CG  . PRO B 2 123  ? -35.504 -27.505 -55.516 1.00 57.25  ? 677  PRO C CG  1 
ATOM   7996  C  CD  . PRO B 2 123  ? -36.809 -27.107 -56.129 1.00 70.59  ? 677  PRO C CD  1 
ATOM   7997  N  N   . LYS B 2 124  ? -37.733 -31.124 -53.754 1.00 79.47  ? 678  LYS C N   1 
ATOM   7998  C  CA  . LYS B 2 124  ? -38.584 -31.708 -52.726 1.00 94.11  ? 678  LYS C CA  1 
ATOM   7999  C  C   . LYS B 2 124  ? -38.203 -31.166 -51.355 1.00 89.05  ? 678  LYS C C   1 
ATOM   8000  O  O   . LYS B 2 124  ? -37.060 -30.765 -51.133 1.00 92.44  ? 678  LYS C O   1 
ATOM   8001  C  CB  . LYS B 2 124  ? -38.488 -33.235 -52.743 1.00 90.25  ? 678  LYS C CB  1 
ATOM   8002  C  CG  . LYS B 2 124  ? -39.657 -33.932 -52.068 1.00 97.07  ? 678  LYS C CG  1 
ATOM   8003  C  CD  . LYS B 2 124  ? -40.973 -33.512 -52.706 1.00 113.86 ? 678  LYS C CD  1 
ATOM   8004  C  CE  . LYS B 2 124  ? -42.159 -34.185 -52.036 1.00 131.35 ? 678  LYS C CE  1 
ATOM   8005  N  NZ  . LYS B 2 124  ? -43.441 -33.855 -52.720 1.00 106.35 ? 678  LYS C NZ  1 
ATOM   8006  N  N   . PHE B 2 125  ? -39.164 -31.152 -50.439 1.00 74.61  ? 679  PHE C N   1 
ATOM   8007  C  CA  . PHE B 2 125  ? -38.933 -30.629 -49.099 1.00 66.19  ? 679  PHE C CA  1 
ATOM   8008  C  C   . PHE B 2 125  ? -39.506 -31.570 -48.046 1.00 64.65  ? 679  PHE C C   1 
ATOM   8009  O  O   . PHE B 2 125  ? -40.708 -31.834 -48.028 1.00 65.54  ? 679  PHE C O   1 
ATOM   8010  C  CB  . PHE B 2 125  ? -39.551 -29.235 -48.966 1.00 70.54  ? 679  PHE C CB  1 
ATOM   8011  C  CG  . PHE B 2 125  ? -39.241 -28.549 -47.667 1.00 55.69  ? 679  PHE C CG  1 
ATOM   8012  C  CD1 . PHE B 2 125  ? -38.037 -27.890 -47.489 1.00 58.76  ? 679  PHE C CD1 1 
ATOM   8013  C  CD2 . PHE B 2 125  ? -40.159 -28.550 -46.631 1.00 55.39  ? 679  PHE C CD2 1 
ATOM   8014  C  CE1 . PHE B 2 125  ? -37.750 -27.255 -46.298 1.00 54.43  ? 679  PHE C CE1 1 
ATOM   8015  C  CE2 . PHE B 2 125  ? -39.878 -27.915 -45.438 1.00 58.44  ? 679  PHE C CE2 1 
ATOM   8016  C  CZ  . PHE B 2 125  ? -38.672 -27.266 -45.272 1.00 58.41  ? 679  PHE C CZ  1 
ATOM   8017  N  N   . ASP B 2 126  ? -38.645 -32.075 -47.168 1.00 66.30  ? 680  ASP C N   1 
ATOM   8018  C  CA  . ASP B 2 126  ? -39.091 -32.954 -46.095 1.00 80.68  ? 680  ASP C CA  1 
ATOM   8019  C  C   . ASP B 2 126  ? -39.401 -32.128 -44.857 1.00 72.43  ? 680  ASP C C   1 
ATOM   8020  O  O   . ASP B 2 126  ? -38.510 -31.542 -44.247 1.00 75.45  ? 680  ASP C O   1 
ATOM   8021  C  CB  . ASP B 2 126  ? -38.038 -34.018 -45.776 1.00 100.30 ? 680  ASP C CB  1 
ATOM   8022  C  CG  . ASP B 2 126  ? -38.550 -35.070 -44.810 1.00 109.17 ? 680  ASP C CG  1 
ATOM   8023  O  OD1 . ASP B 2 126  ? -38.603 -34.791 -43.593 1.00 97.50  ? 680  ASP C OD1 1 
ATOM   8024  O  OD2 . ASP B 2 126  ? -38.898 -36.178 -45.269 1.00 100.78 ? 680  ASP C OD2 1 
ATOM   8025  N  N   . LYS B 2 127  ? -40.675 -32.099 -44.490 1.00 72.27  ? 681  LYS C N   1 
ATOM   8026  C  CA  . LYS B 2 127  ? -41.166 -31.219 -43.439 1.00 84.63  ? 681  LYS C CA  1 
ATOM   8027  C  C   . LYS B 2 127  ? -40.521 -31.485 -42.083 1.00 84.62  ? 681  LYS C C   1 
ATOM   8028  O  O   . LYS B 2 127  ? -40.290 -30.561 -41.303 1.00 88.05  ? 681  LYS C O   1 
ATOM   8029  C  CB  . LYS B 2 127  ? -42.684 -31.356 -43.338 1.00 85.10  ? 681  LYS C CB  1 
ATOM   8030  C  CG  . LYS B 2 127  ? -43.369 -31.276 -44.690 1.00 100.91 ? 681  LYS C CG  1 
ATOM   8031  C  CD  . LYS B 2 127  ? -44.354 -32.411 -44.894 1.00 95.47  ? 681  LYS C CD  1 
ATOM   8032  C  CE  . LYS B 2 127  ? -44.443 -32.783 -46.365 1.00 100.52 ? 681  LYS C CE  1 
ATOM   8033  N  NZ  . LYS B 2 127  ? -44.572 -31.580 -47.234 1.00 70.85  ? 681  LYS C NZ  1 
ATOM   8034  N  N   . ASP B 2 128  ? -40.234 -32.751 -41.809 1.00 92.60  ? 682  ASP C N   1 
ATOM   8035  C  CA  . ASP B 2 128  ? -39.694 -33.150 -40.516 1.00 97.78  ? 682  ASP C CA  1 
ATOM   8036  C  C   . ASP B 2 128  ? -38.190 -32.927 -40.372 1.00 86.94  ? 682  ASP C C   1 
ATOM   8037  O  O   . ASP B 2 128  ? -37.715 -32.587 -39.290 1.00 76.26  ? 682  ASP C O   1 
ATOM   8038  C  CB  . ASP B 2 128  ? -40.023 -34.620 -40.250 1.00 112.13 ? 682  ASP C CB  1 
ATOM   8039  C  CG  . ASP B 2 128  ? -41.489 -34.837 -39.937 1.00 115.74 ? 682  ASP C CG  1 
ATOM   8040  O  OD1 . ASP B 2 128  ? -42.043 -34.061 -39.130 1.00 105.01 ? 682  ASP C OD1 1 
ATOM   8041  O  OD2 . ASP B 2 128  ? -42.088 -35.776 -40.501 1.00 102.37 ? 682  ASP C OD2 1 
ATOM   8042  N  N   . HIS B 2 129  ? -37.443 -33.113 -41.456 1.00 86.00  ? 683  HIS C N   1 
ATOM   8043  C  CA  . HIS B 2 129  ? -35.984 -33.110 -41.363 1.00 89.67  ? 683  HIS C CA  1 
ATOM   8044  C  C   . HIS B 2 129  ? -35.308 -31.975 -42.131 1.00 82.19  ? 683  HIS C C   1 
ATOM   8045  O  O   . HIS B 2 129  ? -34.114 -31.733 -41.957 1.00 72.27  ? 683  HIS C O   1 
ATOM   8046  C  CB  . HIS B 2 129  ? -35.429 -34.450 -41.851 1.00 88.03  ? 683  HIS C CB  1 
ATOM   8047  C  CG  . HIS B 2 129  ? -36.093 -35.639 -41.233 1.00 104.16 ? 683  HIS C CG  1 
ATOM   8048  N  ND1 . HIS B 2 129  ? -36.898 -36.497 -41.951 1.00 110.23 ? 683  HIS C ND1 1 
ATOM   8049  C  CD2 . HIS B 2 129  ? -36.079 -36.111 -39.964 1.00 100.02 ? 683  HIS C CD2 1 
ATOM   8050  C  CE1 . HIS B 2 129  ? -37.347 -37.448 -41.152 1.00 96.68  ? 683  HIS C CE1 1 
ATOM   8051  N  NE2 . HIS B 2 129  ? -36.865 -37.237 -39.940 1.00 93.85  ? 683  HIS C NE2 1 
ATOM   8052  N  N   . ASP B 2 130  ? -36.058 -31.288 -42.985 1.00 76.70  ? 684  ASP C N   1 
ATOM   8053  C  CA  . ASP B 2 130  ? -35.499 -30.157 -43.716 1.00 68.84  ? 684  ASP C CA  1 
ATOM   8054  C  C   . ASP B 2 130  ? -35.955 -28.826 -43.133 1.00 68.66  ? 684  ASP C C   1 
ATOM   8055  O  O   . ASP B 2 130  ? -36.902 -28.762 -42.349 1.00 60.03  ? 684  ASP C O   1 
ATOM   8056  C  CB  . ASP B 2 130  ? -35.873 -30.222 -45.200 1.00 70.21  ? 684  ASP C CB  1 
ATOM   8057  C  CG  . ASP B 2 130  ? -35.033 -31.219 -45.973 1.00 82.52  ? 684  ASP C CG  1 
ATOM   8058  O  OD1 . ASP B 2 130  ? -33.997 -31.666 -45.437 1.00 76.66  ? 684  ASP C OD1 1 
ATOM   8059  O  OD2 . ASP B 2 130  ? -35.401 -31.544 -47.121 1.00 73.78  ? 684  ASP C OD2 1 
ATOM   8060  N  N   . VAL B 2 131  ? -35.262 -27.765 -43.530 1.00 66.21  ? 685  VAL C N   1 
ATOM   8061  C  CA  . VAL B 2 131  ? -35.600 -26.413 -43.117 1.00 65.44  ? 685  VAL C CA  1 
ATOM   8062  C  C   . VAL B 2 131  ? -35.204 -25.450 -44.232 1.00 57.98  ? 685  VAL C C   1 
ATOM   8063  O  O   . VAL B 2 131  ? -34.300 -25.739 -45.025 1.00 62.93  ? 685  VAL C O   1 
ATOM   8064  C  CB  . VAL B 2 131  ? -34.900 -26.027 -41.794 1.00 63.96  ? 685  VAL C CB  1 
ATOM   8065  C  CG1 . VAL B 2 131  ? -33.434 -25.693 -42.035 1.00 51.39  ? 685  VAL C CG1 1 
ATOM   8066  C  CG2 . VAL B 2 131  ? -35.613 -24.860 -41.130 1.00 61.64  ? 685  VAL C CG2 1 
ATOM   8067  N  N   . MET B 2 132  ? -35.897 -24.320 -44.312 1.00 52.68  ? 686  MET C N   1 
ATOM   8068  C  CA  . MET B 2 132  ? -35.573 -23.311 -45.310 1.00 61.41  ? 686  MET C CA  1 
ATOM   8069  C  C   . MET B 2 132  ? -34.877 -22.124 -44.659 1.00 51.96  ? 686  MET C C   1 
ATOM   8070  O  O   . MET B 2 132  ? -35.489 -21.371 -43.900 1.00 56.39  ? 686  MET C O   1 
ATOM   8071  C  CB  . MET B 2 132  ? -36.830 -22.851 -46.051 1.00 56.01  ? 686  MET C CB  1 
ATOM   8072  C  CG  . MET B 2 132  ? -36.535 -21.983 -47.266 1.00 54.29  ? 686  MET C CG  1 
ATOM   8073  S  SD  . MET B 2 132  ? -38.003 -21.589 -48.236 1.00 66.39  ? 686  MET C SD  1 
ATOM   8074  C  CE  . MET B 2 132  ? -38.963 -20.674 -47.033 1.00 53.35  ? 686  MET C CE  1 
ATOM   8075  N  N   . LEU B 2 133  ? -33.591 -21.969 -44.955 1.00 47.74  ? 687  LEU C N   1 
ATOM   8076  C  CA  . LEU B 2 133  ? -32.810 -20.865 -44.410 1.00 42.61  ? 687  LEU C CA  1 
ATOM   8077  C  C   . LEU B 2 133  ? -32.718 -19.717 -45.399 1.00 52.69  ? 687  LEU C C   1 
ATOM   8078  O  O   . LEU B 2 133  ? -32.615 -19.936 -46.601 1.00 46.90  ? 687  LEU C O   1 
ATOM   8079  C  CB  . LEU B 2 133  ? -31.401 -21.328 -44.038 1.00 50.04  ? 687  LEU C CB  1 
ATOM   8080  C  CG  . LEU B 2 133  ? -31.185 -21.930 -42.652 1.00 51.21  ? 687  LEU C CG  1 
ATOM   8081  C  CD1 . LEU B 2 133  ? -29.722 -22.286 -42.468 1.00 59.65  ? 687  LEU C CD1 1 
ATOM   8082  C  CD2 . LEU B 2 133  ? -31.638 -20.959 -41.576 1.00 62.24  ? 687  LEU C CD2 1 
ATOM   8083  N  N   . PHE B 2 134  ? -32.750 -18.492 -44.889 1.00 41.38  ? 688  PHE C N   1 
ATOM   8084  C  CA  . PHE B 2 134  ? -32.533 -17.323 -45.730 1.00 49.38  ? 688  PHE C CA  1 
ATOM   8085  C  C   . PHE B 2 134  ? -31.158 -16.735 -45.453 1.00 45.51  ? 688  PHE C C   1 
ATOM   8086  O  O   . PHE B 2 134  ? -30.723 -16.668 -44.305 1.00 44.35  ? 688  PHE C O   1 
ATOM   8087  C  CB  . PHE B 2 134  ? -33.628 -16.283 -45.507 1.00 35.56  ? 688  PHE C CB  1 
ATOM   8088  C  CG  . PHE B 2 134  ? -34.944 -16.657 -46.124 1.00 45.99  ? 688  PHE C CG  1 
ATOM   8089  C  CD1 . PHE B 2 134  ? -35.827 -17.486 -45.454 1.00 39.16  ? 688  PHE C CD1 1 
ATOM   8090  C  CD2 . PHE B 2 134  ? -35.292 -16.189 -47.380 1.00 47.86  ? 688  PHE C CD2 1 
ATOM   8091  C  CE1 . PHE B 2 134  ? -37.037 -17.835 -46.023 1.00 41.54  ? 688  PHE C CE1 1 
ATOM   8092  C  CE2 . PHE B 2 134  ? -36.501 -16.536 -47.953 1.00 39.84  ? 688  PHE C CE2 1 
ATOM   8093  C  CZ  . PHE B 2 134  ? -37.374 -17.360 -47.273 1.00 34.99  ? 688  PHE C CZ  1 
ATOM   8094  N  N   . LEU B 2 135  ? -30.473 -16.315 -46.510 1.00 34.57  ? 689  LEU C N   1 
ATOM   8095  C  CA  . LEU B 2 135  ? -29.086 -15.891 -46.388 1.00 37.91  ? 689  LEU C CA  1 
ATOM   8096  C  C   . LEU B 2 135  ? -28.888 -14.435 -46.781 1.00 36.63  ? 689  LEU C C   1 
ATOM   8097  O  O   . LEU B 2 135  ? -29.282 -14.016 -47.870 1.00 44.36  ? 689  LEU C O   1 
ATOM   8098  C  CB  . LEU B 2 135  ? -28.190 -16.783 -47.247 1.00 43.30  ? 689  LEU C CB  1 
ATOM   8099  C  CG  . LEU B 2 135  ? -28.376 -18.288 -47.056 1.00 37.87  ? 689  LEU C CG  1 
ATOM   8100  C  CD1 . LEU B 2 135  ? -27.513 -19.062 -48.037 1.00 30.75  ? 689  LEU C CD1 1 
ATOM   8101  C  CD2 . LEU B 2 135  ? -28.055 -18.686 -45.627 1.00 44.99  ? 689  LEU C CD2 1 
ATOM   8102  N  N   . LYS B 2 136  ? -28.272 -13.666 -45.890 1.00 34.37  ? 690  LYS C N   1 
ATOM   8103  C  CA  . LYS B 2 136  ? -27.929 -12.282 -46.196 1.00 29.37  ? 690  LYS C CA  1 
ATOM   8104  C  C   . LYS B 2 136  ? -26.425 -12.084 -46.092 1.00 33.59  ? 690  LYS C C   1 
ATOM   8105  O  O   . LYS B 2 136  ? -25.768 -12.735 -45.285 1.00 44.25  ? 690  LYS C O   1 
ATOM   8106  C  CB  . LYS B 2 136  ? -28.653 -11.319 -45.255 1.00 26.81  ? 690  LYS C CB  1 
ATOM   8107  C  CG  . LYS B 2 136  ? -30.166 -11.413 -45.303 1.00 23.41  ? 690  LYS C CG  1 
ATOM   8108  C  CD  . LYS B 2 136  ? -30.797 -10.434 -44.328 1.00 38.07  ? 690  LYS C CD  1 
ATOM   8109  C  CE  . LYS B 2 136  ? -32.314 -10.513 -44.361 1.00 37.19  ? 690  LYS C CE  1 
ATOM   8110  N  NZ  . LYS B 2 136  ? -32.931 -9.526  -43.432 1.00 46.60  ? 690  LYS C NZ  1 
ATOM   8111  N  N   . MET B 2 137  ? -25.878 -11.192 -46.909 1.00 35.23  ? 691  MET C N   1 
ATOM   8112  C  CA  . MET B 2 137  ? -24.459 -10.872 -46.815 1.00 37.55  ? 691  MET C CA  1 
ATOM   8113  C  C   . MET B 2 137  ? -24.264 -9.419  -46.407 1.00 46.49  ? 691  MET C C   1 
ATOM   8114  O  O   . MET B 2 137  ? -24.786 -8.512  -47.050 1.00 44.13  ? 691  MET C O   1 
ATOM   8115  C  CB  . MET B 2 137  ? -23.746 -11.149 -48.142 1.00 41.81  ? 691  MET C CB  1 
ATOM   8116  C  CG  . MET B 2 137  ? -22.235 -10.951 -48.089 1.00 37.71  ? 691  MET C CG  1 
ATOM   8117  S  SD  . MET B 2 137  ? -21.702 -9.287  -48.535 1.00 49.22  ? 691  MET C SD  1 
ATOM   8118  C  CE  . MET B 2 137  ? -22.004 -9.298  -50.300 1.00 39.14  ? 691  MET C CE  1 
ATOM   8119  N  N   . TYR B 2 138  ? -23.515 -9.197  -45.333 1.00 45.41  ? 692  TYR C N   1 
ATOM   8120  C  CA  . TYR B 2 138  ? -23.231 -7.839  -44.897 1.00 42.50  ? 692  TYR C CA  1 
ATOM   8121  C  C   . TYR B 2 138  ? -21.897 -7.359  -45.444 1.00 43.38  ? 692  TYR C C   1 
ATOM   8122  O  O   . TYR B 2 138  ? -20.871 -8.020  -45.285 1.00 44.92  ? 692  TYR C O   1 
ATOM   8123  C  CB  . TYR B 2 138  ? -23.228 -7.736  -43.372 1.00 39.53  ? 692  TYR C CB  1 
ATOM   8124  C  CG  . TYR B 2 138  ? -22.831 -6.365  -42.874 1.00 45.25  ? 692  TYR C CG  1 
ATOM   8125  C  CD1 . TYR B 2 138  ? -23.643 -5.263  -43.105 1.00 44.37  ? 692  TYR C CD1 1 
ATOM   8126  C  CD2 . TYR B 2 138  ? -21.644 -6.172  -42.181 1.00 47.91  ? 692  TYR C CD2 1 
ATOM   8127  C  CE1 . TYR B 2 138  ? -23.287 -4.007  -42.660 1.00 37.25  ? 692  TYR C CE1 1 
ATOM   8128  C  CE2 . TYR B 2 138  ? -21.280 -4.917  -41.728 1.00 43.58  ? 692  TYR C CE2 1 
ATOM   8129  C  CZ  . TYR B 2 138  ? -22.106 -3.840  -41.972 1.00 39.33  ? 692  TYR C CZ  1 
ATOM   8130  O  OH  . TYR B 2 138  ? -21.751 -2.589  -41.527 1.00 52.52  ? 692  TYR C OH  1 
ATOM   8131  N  N   . ASP B 2 139  ? -21.927 -6.208  -46.103 1.00 45.60  ? 693  ASP C N   1 
ATOM   8132  C  CA  . ASP B 2 139  ? -20.718 -5.544  -46.550 1.00 41.64  ? 693  ASP C CA  1 
ATOM   8133  C  C   . ASP B 2 139  ? -20.462 -4.344  -45.657 1.00 39.66  ? 693  ASP C C   1 
ATOM   8134  O  O   . ASP B 2 139  ? -21.195 -3.360  -45.710 1.00 41.28  ? 693  ASP C O   1 
ATOM   8135  C  CB  . ASP B 2 139  ? -20.833 -5.117  -48.010 1.00 48.77  ? 693  ASP C CB  1 
ATOM   8136  C  CG  . ASP B 2 139  ? -19.587 -4.418  -48.511 1.00 50.39  ? 693  ASP C CG  1 
ATOM   8137  O  OD1 . ASP B 2 139  ? -18.476 -4.754  -48.045 1.00 49.43  ? 693  ASP C OD1 1 
ATOM   8138  O  OD2 . ASP B 2 139  ? -19.722 -3.528  -49.375 1.00 61.05  ? 693  ASP C OD2 1 
ATOM   8139  N  N   . PRO B 2 140  ? -19.429 -4.445  -44.810 1.00 47.50  ? 694  PRO C N   1 
ATOM   8140  C  CA  . PRO B 2 140  ? -18.977 -3.400  -43.885 1.00 46.54  ? 694  PRO C CA  1 
ATOM   8141  C  C   . PRO B 2 140  ? -18.501 -2.138  -44.595 1.00 36.29  ? 694  PRO C C   1 
ATOM   8142  O  O   . PRO B 2 140  ? -18.717 -1.031  -44.099 1.00 51.03  ? 694  PRO C O   1 
ATOM   8143  C  CB  . PRO B 2 140  ? -17.813 -4.070  -43.145 1.00 47.35  ? 694  PRO C CB  1 
ATOM   8144  C  CG  . PRO B 2 140  ? -18.088 -5.532  -43.246 1.00 42.48  ? 694  PRO C CG  1 
ATOM   8145  C  CD  . PRO B 2 140  ? -18.702 -5.709  -44.603 1.00 45.27  ? 694  PRO C CD  1 
ATOM   8146  N  N   . LYS B 2 141  ? -17.853 -2.306  -45.742 1.00 53.92  ? 695  LYS C N   1 
ATOM   8147  C  CA  . LYS B 2 141  ? -17.305 -1.170  -46.468 1.00 63.74  ? 695  LYS C CA  1 
ATOM   8148  C  C   . LYS B 2 141  ? -18.413 -0.230  -46.925 1.00 52.10  ? 695  LYS C C   1 
ATOM   8149  O  O   . LYS B 2 141  ? -18.327 0.981   -46.733 1.00 48.46  ? 695  LYS C O   1 
ATOM   8150  C  CB  . LYS B 2 141  ? -16.484 -1.636  -47.667 1.00 59.76  ? 695  LYS C CB  1 
ATOM   8151  C  CG  . LYS B 2 141  ? -15.467 -0.606  -48.115 1.00 89.11  ? 695  LYS C CG  1 
ATOM   8152  C  CD  . LYS B 2 141  ? -14.991 -0.847  -49.534 1.00 104.00 ? 695  LYS C CD  1 
ATOM   8153  C  CE  . LYS B 2 141  ? -14.048 0.262   -49.968 1.00 101.27 ? 695  LYS C CE  1 
ATOM   8154  N  NZ  . LYS B 2 141  ? -14.625 1.607   -49.682 1.00 73.16  ? 695  LYS C NZ  1 
ATOM   8155  N  N   . THR B 2 142  ? -19.453 -0.793  -47.530 1.00 47.10  ? 696  THR C N   1 
ATOM   8156  C  CA  . THR B 2 142  ? -20.592 0.002   -47.967 1.00 46.69  ? 696  THR C CA  1 
ATOM   8157  C  C   . THR B 2 142  ? -21.645 0.088   -46.874 1.00 49.74  ? 696  THR C C   1 
ATOM   8158  O  O   . THR B 2 142  ? -22.618 0.832   -46.999 1.00 48.70  ? 696  THR C O   1 
ATOM   8159  C  CB  . THR B 2 142  ? -21.237 -0.575  -49.237 1.00 43.39  ? 696  THR C CB  1 
ATOM   8160  O  OG1 . THR B 2 142  ? -21.579 -1.948  -49.016 1.00 54.43  ? 696  THR C OG1 1 
ATOM   8161  C  CG2 . THR B 2 142  ? -20.278 -0.478  -50.406 1.00 40.11  ? 696  THR C CG2 1 
ATOM   8162  N  N   . ARG B 2 143  ? -21.438 -0.681  -45.806 1.00 48.55  ? 697  ARG C N   1 
ATOM   8163  C  CA  . ARG B 2 143  ? -22.393 -0.764  -44.704 1.00 51.61  ? 697  ARG C CA  1 
ATOM   8164  C  C   . ARG B 2 143  ? -23.779 -1.129  -45.219 1.00 50.41  ? 697  ARG C C   1 
ATOM   8165  O  O   . ARG B 2 143  ? -24.738 -0.390  -45.005 1.00 44.98  ? 697  ARG C O   1 
ATOM   8166  C  CB  . ARG B 2 143  ? -22.442 0.552   -43.931 1.00 53.27  ? 697  ARG C CB  1 
ATOM   8167  C  CG  . ARG B 2 143  ? -21.120 0.929   -43.297 1.00 58.57  ? 697  ARG C CG  1 
ATOM   8168  C  CD  . ARG B 2 143  ? -21.100 2.388   -42.881 1.00 72.41  ? 697  ARG C CD  1 
ATOM   8169  N  NE  . ARG B 2 143  ? -21.462 3.282   -43.978 1.00 87.26  ? 697  ARG C NE  1 
ATOM   8170  C  CZ  . ARG B 2 143  ? -20.643 3.630   -44.966 1.00 73.72  ? 697  ARG C CZ  1 
ATOM   8171  N  NH1 . ARG B 2 143  ? -19.406 3.153   -45.008 1.00 79.75  ? 697  ARG C NH1 1 
ATOM   8172  N  NH2 . ARG B 2 143  ? -21.064 4.452   -45.918 1.00 62.49  ? 697  ARG C NH2 1 
ATOM   8173  N  N   . SER B 2 144  ? -23.887 -2.263  -45.907 1.00 50.40  ? 698  SER C N   1 
ATOM   8174  C  CA  . SER B 2 144  ? -25.170 -2.641  -46.489 1.00 41.96  ? 698  SER C CA  1 
ATOM   8175  C  C   . SER B 2 144  ? -25.415 -4.142  -46.523 1.00 39.95  ? 698  SER C C   1 
ATOM   8176  O  O   . SER B 2 144  ? -24.494 -4.946  -46.389 1.00 41.32  ? 698  SER C O   1 
ATOM   8177  C  CB  . SER B 2 144  ? -25.293 -2.073  -47.906 1.00 42.25  ? 698  SER C CB  1 
ATOM   8178  O  OG  . SER B 2 144  ? -24.308 -2.606  -48.772 1.00 57.90  ? 698  SER C OG  1 
ATOM   8179  N  N   . LEU B 2 145  ? -26.681 -4.499  -46.710 1.00 36.72  ? 699  LEU C N   1 
ATOM   8180  C  CA  . LEU B 2 145  ? -27.097 -5.890  -46.800 1.00 37.27  ? 699  LEU C CA  1 
ATOM   8181  C  C   . LEU B 2 145  ? -27.372 -6.279  -48.242 1.00 42.00  ? 699  LEU C C   1 
ATOM   8182  O  O   . LEU B 2 145  ? -27.934 -5.499  -49.010 1.00 54.35  ? 699  LEU C O   1 
ATOM   8183  C  CB  . LEU B 2 145  ? -28.348 -6.137  -45.956 1.00 38.54  ? 699  LEU C CB  1 
ATOM   8184  C  CG  . LEU B 2 145  ? -28.226 -6.142  -44.435 1.00 35.75  ? 699  LEU C CG  1 
ATOM   8185  C  CD1 . LEU B 2 145  ? -29.594 -6.357  -43.822 1.00 37.24  ? 699  LEU C CD1 1 
ATOM   8186  C  CD2 . LEU B 2 145  ? -27.264 -7.226  -43.989 1.00 51.85  ? 699  LEU C CD2 1 
ATOM   8187  N  N   . ASN B 2 146  ? -26.977 -7.494  -48.599 1.00 47.93  ? 700  ASN C N   1 
ATOM   8188  C  CA  . ASN B 2 146  ? -27.258 -8.048  -49.914 1.00 40.48  ? 700  ASN C CA  1 
ATOM   8189  C  C   . ASN B 2 146  ? -27.982 -9.380  -49.776 1.00 39.40  ? 700  ASN C C   1 
ATOM   8190  O  O   . ASN B 2 146  ? -27.440 -10.334 -49.214 1.00 45.54  ? 700  ASN C O   1 
ATOM   8191  C  CB  . ASN B 2 146  ? -25.968 -8.224  -50.714 1.00 36.85  ? 700  ASN C CB  1 
ATOM   8192  C  CG  . ASN B 2 146  ? -25.106 -6.979  -50.709 1.00 54.54  ? 700  ASN C CG  1 
ATOM   8193  O  OD1 . ASN B 2 146  ? -24.176 -6.858  -49.911 1.00 59.24  ? 700  ASN C OD1 1 
ATOM   8194  N  ND2 . ASN B 2 146  ? -25.417 -6.040  -51.595 1.00 51.26  ? 700  ASN C ND2 1 
ATOM   8195  N  N   . TYR B 2 147  ? -29.212 -9.433  -50.277 1.00 40.19  ? 701  TYR C N   1 
ATOM   8196  C  CA  . TYR B 2 147  ? -30.016 -10.646 -50.203 1.00 36.46  ? 701  TYR C CA  1 
ATOM   8197  C  C   . TYR B 2 147  ? -29.397 -11.750 -51.051 1.00 34.23  ? 701  TYR C C   1 
ATOM   8198  O  O   . TYR B 2 147  ? -29.146 -11.564 -52.241 1.00 43.48  ? 701  TYR C O   1 
ATOM   8199  C  CB  . TYR B 2 147  ? -31.452 -10.365 -50.654 1.00 32.14  ? 701  TYR C CB  1 
ATOM   8200  C  CG  . TYR B 2 147  ? -32.373 -11.559 -50.554 1.00 33.86  ? 701  TYR C CG  1 
ATOM   8201  C  CD1 . TYR B 2 147  ? -32.748 -12.069 -49.318 1.00 27.18  ? 701  TYR C CD1 1 
ATOM   8202  C  CD2 . TYR B 2 147  ? -32.875 -12.169 -51.695 1.00 40.48  ? 701  TYR C CD2 1 
ATOM   8203  C  CE1 . TYR B 2 147  ? -33.591 -13.159 -49.222 1.00 36.93  ? 701  TYR C CE1 1 
ATOM   8204  C  CE2 . TYR B 2 147  ? -33.721 -13.257 -51.609 1.00 39.36  ? 701  TYR C CE2 1 
ATOM   8205  C  CZ  . TYR B 2 147  ? -34.075 -13.749 -50.371 1.00 41.74  ? 701  TYR C CZ  1 
ATOM   8206  O  OH  . TYR B 2 147  ? -34.915 -14.834 -50.281 1.00 46.72  ? 701  TYR C OH  1 
ATOM   8207  N  N   . CYS B 2 148  ? -29.143 -12.895 -50.428 1.00 31.89  ? 702  CYS C N   1 
ATOM   8208  C  CA  . CYS B 2 148  ? -28.512 -14.013 -51.116 1.00 36.96  ? 702  CYS C CA  1 
ATOM   8209  C  C   . CYS B 2 148  ? -29.435 -15.224 -51.185 1.00 47.27  ? 702  CYS C C   1 
ATOM   8210  O  O   . CYS B 2 148  ? -28.987 -16.363 -51.064 1.00 47.80  ? 702  CYS C O   1 
ATOM   8211  C  CB  . CYS B 2 148  ? -27.199 -14.393 -50.426 1.00 37.92  ? 702  CYS C CB  1 
ATOM   8212  S  SG  . CYS B 2 148  ? -25.895 -13.144 -50.568 1.00 46.67  ? 702  CYS C SG  1 
ATOM   8213  N  N   . GLY B 2 149  ? -30.725 -14.969 -51.373 1.00 32.76  ? 703  GLY C N   1 
ATOM   8214  C  CA  . GLY B 2 149  ? -31.691 -16.032 -51.582 1.00 38.14  ? 703  GLY C CA  1 
ATOM   8215  C  C   . GLY B 2 149  ? -31.860 -16.973 -50.407 1.00 48.55  ? 703  GLY C C   1 
ATOM   8216  O  O   . GLY B 2 149  ? -31.408 -16.692 -49.296 1.00 57.28  ? 703  GLY C O   1 
ATOM   8217  N  N   . HIS B 2 150  ? -32.516 -18.099 -50.661 1.00 43.06  ? 704  HIS C N   1 
ATOM   8218  C  CA  . HIS B 2 150  ? -32.783 -19.084 -49.622 1.00 38.15  ? 704  HIS C CA  1 
ATOM   8219  C  C   . HIS B 2 150  ? -32.255 -20.455 -50.022 1.00 48.85  ? 704  HIS C C   1 
ATOM   8220  O  O   . HIS B 2 150  ? -31.863 -20.668 -51.169 1.00 47.82  ? 704  HIS C O   1 
ATOM   8221  C  CB  . HIS B 2 150  ? -34.281 -19.167 -49.336 1.00 44.52  ? 704  HIS C CB  1 
ATOM   8222  C  CG  . HIS B 2 150  ? -35.083 -19.700 -50.481 1.00 47.86  ? 704  HIS C CG  1 
ATOM   8223  N  ND1 . HIS B 2 150  ? -35.358 -18.954 -51.608 1.00 49.86  ? 704  HIS C ND1 1 
ATOM   8224  C  CD2 . HIS B 2 150  ? -35.665 -20.906 -50.678 1.00 47.22  ? 704  HIS C CD2 1 
ATOM   8225  C  CE1 . HIS B 2 150  ? -36.076 -19.676 -52.447 1.00 48.10  ? 704  HIS C CE1 1 
ATOM   8226  N  NE2 . HIS B 2 150  ? -36.278 -20.865 -51.908 1.00 50.43  ? 704  HIS C NE2 1 
ATOM   8227  N  N   . ILE B 2 151  ? -32.245 -21.379 -49.066 1.00 52.67  ? 705  ILE C N   1 
ATOM   8228  C  CA  . ILE B 2 151  ? -31.810 -22.748 -49.313 1.00 41.19  ? 705  ILE C CA  1 
ATOM   8229  C  C   . ILE B 2 151  ? -32.644 -23.752 -48.528 1.00 59.35  ? 705  ILE C C   1 
ATOM   8230  O  O   . ILE B 2 151  ? -33.108 -23.468 -47.419 1.00 62.86  ? 705  ILE C O   1 
ATOM   8231  C  CB  . ILE B 2 151  ? -30.323 -22.965 -48.937 1.00 49.58  ? 705  ILE C CB  1 
ATOM   8232  C  CG1 . ILE B 2 151  ? -30.062 -22.531 -47.493 1.00 52.18  ? 705  ILE C CG1 1 
ATOM   8233  C  CG2 . ILE B 2 151  ? -29.400 -22.229 -49.896 1.00 55.21  ? 705  ILE C CG2 1 
ATOM   8234  C  CD1 . ILE B 2 151  ? -28.655 -22.815 -47.016 1.00 38.40  ? 705  ILE C CD1 1 
ATOM   8235  N  N   . TYR B 2 152  ? -32.840 -24.925 -49.122 1.00 68.99  ? 706  TYR C N   1 
ATOM   8236  C  CA  . TYR B 2 152  ? -33.351 -26.077 -48.396 1.00 63.60  ? 706  TYR C CA  1 
ATOM   8237  C  C   . TYR B 2 152  ? -32.163 -26.819 -47.810 1.00 60.81  ? 706  TYR C C   1 
ATOM   8238  O  O   . TYR B 2 152  ? -31.196 -27.097 -48.519 1.00 61.73  ? 706  TYR C O   1 
ATOM   8239  C  CB  . TYR B 2 152  ? -34.145 -27.015 -49.303 1.00 51.75  ? 706  TYR C CB  1 
ATOM   8240  C  CG  . TYR B 2 152  ? -35.457 -26.474 -49.821 1.00 59.35  ? 706  TYR C CG  1 
ATOM   8241  C  CD1 . TYR B 2 152  ? -35.996 -25.288 -49.339 1.00 61.89  ? 706  TYR C CD1 1 
ATOM   8242  C  CD2 . TYR B 2 152  ? -36.165 -27.167 -50.791 1.00 80.30  ? 706  TYR C CD2 1 
ATOM   8243  C  CE1 . TYR B 2 152  ? -37.201 -24.805 -49.819 1.00 65.44  ? 706  TYR C CE1 1 
ATOM   8244  C  CE2 . TYR B 2 152  ? -37.364 -26.696 -51.275 1.00 81.89  ? 706  TYR C CE2 1 
ATOM   8245  C  CZ  . TYR B 2 152  ? -37.880 -25.518 -50.789 1.00 68.05  ? 706  TYR C CZ  1 
ATOM   8246  O  OH  . TYR B 2 152  ? -39.079 -25.059 -51.278 1.00 70.17  ? 706  TYR C OH  1 
ATOM   8247  N  N   . THR B 2 153  ? -32.222 -27.145 -46.525 1.00 66.11  ? 707  THR C N   1 
ATOM   8248  C  CA  . THR B 2 153  ? -31.132 -27.894 -45.914 1.00 53.49  ? 707  THR C CA  1 
ATOM   8249  C  C   . THR B 2 153  ? -31.610 -28.765 -44.763 1.00 60.66  ? 707  THR C C   1 
ATOM   8250  O  O   . THR B 2 153  ? -32.486 -28.371 -44.000 1.00 65.24  ? 707  THR C O   1 
ATOM   8251  C  CB  . THR B 2 153  ? -30.016 -26.958 -45.406 1.00 56.18  ? 707  THR C CB  1 
ATOM   8252  O  OG1 . THR B 2 153  ? -29.022 -27.726 -44.718 1.00 58.30  ? 707  THR C OG1 1 
ATOM   8253  C  CG2 . THR B 2 153  ? -30.582 -25.908 -44.463 1.00 59.19  ? 707  THR C CG2 1 
ATOM   8254  N  N   . PRO B 2 154  ? -31.038 -29.971 -44.651 1.00 60.62  ? 708  PRO C N   1 
ATOM   8255  C  CA  . PRO B 2 154  ? -31.332 -30.854 -43.520 1.00 62.57  ? 708  PRO C CA  1 
ATOM   8256  C  C   . PRO B 2 154  ? -30.939 -30.220 -42.192 1.00 58.32  ? 708  PRO C C   1 
ATOM   8257  O  O   . PRO B 2 154  ? -29.918 -29.536 -42.114 1.00 52.89  ? 708  PRO C O   1 
ATOM   8258  C  CB  . PRO B 2 154  ? -30.478 -32.093 -43.810 1.00 55.54  ? 708  PRO C CB  1 
ATOM   8259  C  CG  . PRO B 2 154  ? -30.293 -32.076 -45.287 1.00 49.26  ? 708  PRO C CG  1 
ATOM   8260  C  CD  . PRO B 2 154  ? -30.186 -30.630 -45.654 1.00 54.94  ? 708  PRO C CD  1 
ATOM   8261  N  N   . ILE B 2 155  ? -31.756 -30.442 -41.168 1.00 61.73  ? 709  ILE C N   1 
ATOM   8262  C  CA  . ILE B 2 155  ? -31.493 -29.933 -39.828 1.00 62.30  ? 709  ILE C CA  1 
ATOM   8263  C  C   . ILE B 2 155  ? -30.136 -30.402 -39.306 1.00 67.27  ? 709  ILE C C   1 
ATOM   8264  O  O   . ILE B 2 155  ? -29.414 -29.653 -38.644 1.00 58.99  ? 709  ILE C O   1 
ATOM   8265  C  CB  . ILE B 2 155  ? -32.596 -30.381 -38.849 1.00 54.83  ? 709  ILE C CB  1 
ATOM   8266  C  CG1 . ILE B 2 155  ? -33.963 -29.904 -39.335 1.00 78.70  ? 709  ILE C CG1 1 
ATOM   8267  C  CG2 . ILE B 2 155  ? -32.324 -29.859 -37.454 1.00 75.37  ? 709  ILE C CG2 1 
ATOM   8268  C  CD1 . ILE B 2 155  ? -35.116 -30.606 -38.663 1.00 79.45  ? 709  ILE C CD1 1 
ATOM   8269  N  N   . SER B 2 156  ? -29.787 -31.641 -39.634 1.00 69.59  ? 710  SER C N   1 
ATOM   8270  C  CA  . SER B 2 156  ? -28.576 -32.273 -39.124 1.00 63.72  ? 710  SER C CA  1 
ATOM   8271  C  C   . SER B 2 156  ? -27.304 -31.821 -39.840 1.00 67.31  ? 710  SER C C   1 
ATOM   8272  O  O   . SER B 2 156  ? -26.202 -32.200 -39.445 1.00 68.43  ? 710  SER C O   1 
ATOM   8273  C  CB  . SER B 2 156  ? -28.707 -33.794 -39.220 1.00 69.87  ? 710  SER C CB  1 
ATOM   8274  O  OG  . SER B 2 156  ? -29.107 -34.191 -40.521 1.00 64.07  ? 710  SER C OG  1 
ATOM   8275  N  N   . CYS B 2 157  ? -27.456 -31.028 -40.896 1.00 65.61  ? 711  CYS C N   1 
ATOM   8276  C  CA  . CYS B 2 157  ? -26.309 -30.520 -41.643 1.00 62.92  ? 711  CYS C CA  1 
ATOM   8277  C  C   . CYS B 2 157  ? -25.424 -29.650 -40.754 1.00 59.78  ? 711  CYS C C   1 
ATOM   8278  O  O   . CYS B 2 157  ? -25.915 -28.973 -39.852 1.00 66.60  ? 711  CYS C O   1 
ATOM   8279  C  CB  . CYS B 2 157  ? -26.772 -29.725 -42.867 1.00 67.01  ? 711  CYS C CB  1 
ATOM   8280  S  SG  . CYS B 2 157  ? -25.434 -29.067 -43.891 1.00 74.63  ? 711  CYS C SG  1 
ATOM   8281  N  N   . LYS B 2 158  ? -24.120 -29.677 -41.008 1.00 61.79  ? 712  LYS C N   1 
ATOM   8282  C  CA  . LYS B 2 158  ? -23.179 -28.885 -40.226 1.00 65.00  ? 712  LYS C CA  1 
ATOM   8283  C  C   . LYS B 2 158  ? -23.018 -27.482 -40.805 1.00 57.84  ? 712  LYS C C   1 
ATOM   8284  O  O   . LYS B 2 158  ? -23.037 -27.297 -42.022 1.00 61.51  ? 712  LYS C O   1 
ATOM   8285  C  CB  . LYS B 2 158  ? -21.819 -29.585 -40.147 1.00 64.73  ? 712  LYS C CB  1 
ATOM   8286  C  CG  . LYS B 2 158  ? -21.815 -30.833 -39.273 1.00 80.76  ? 712  LYS C CG  1 
ATOM   8287  C  CD  . LYS B 2 158  ? -20.401 -31.233 -38.872 1.00 95.07  ? 712  LYS C CD  1 
ATOM   8288  C  CE  . LYS B 2 158  ? -19.642 -31.863 -40.029 1.00 108.97 ? 712  LYS C CE  1 
ATOM   8289  N  NZ  . LYS B 2 158  ? -20.226 -33.175 -40.422 1.00 85.67  ? 712  LYS C NZ  1 
ATOM   8290  N  N   . ILE B 2 159  ? -22.867 -26.502 -39.916 1.00 56.07  ? 713  ILE C N   1 
ATOM   8291  C  CA  . ILE B 2 159  ? -22.676 -25.105 -40.298 1.00 58.40  ? 713  ILE C CA  1 
ATOM   8292  C  C   . ILE B 2 159  ? -21.553 -24.944 -41.317 1.00 69.12  ? 713  ILE C C   1 
ATOM   8293  O  O   . ILE B 2 159  ? -21.684 -24.206 -42.295 1.00 76.49  ? 713  ILE C O   1 
ATOM   8294  C  CB  . ILE B 2 159  ? -22.358 -24.231 -39.068 1.00 57.35  ? 713  ILE C CB  1 
ATOM   8295  C  CG1 . ILE B 2 159  ? -23.549 -24.198 -38.111 1.00 53.04  ? 713  ILE C CG1 1 
ATOM   8296  C  CG2 . ILE B 2 159  ? -21.995 -22.819 -39.494 1.00 48.33  ? 713  ILE C CG2 1 
ATOM   8297  C  CD1 . ILE B 2 159  ? -24.671 -23.306 -38.574 1.00 43.57  ? 713  ILE C CD1 1 
ATOM   8298  N  N   . ARG B 2 160  ? -20.456 -25.658 -41.081 1.00 62.81  ? 714  ARG C N   1 
ATOM   8299  C  CA  . ARG B 2 160  ? -19.284 -25.622 -41.948 1.00 76.06  ? 714  ARG C CA  1 
ATOM   8300  C  C   . ARG B 2 160  ? -19.619 -25.983 -43.396 1.00 76.95  ? 714  ARG C C   1 
ATOM   8301  O  O   . ARG B 2 160  ? -18.945 -25.545 -44.330 1.00 65.75  ? 714  ARG C O   1 
ATOM   8302  C  CB  . ARG B 2 160  ? -18.209 -26.563 -41.387 1.00 77.86  ? 714  ARG C CB  1 
ATOM   8303  C  CG  . ARG B 2 160  ? -17.081 -26.903 -42.340 1.00 77.41  ? 714  ARG C CG  1 
ATOM   8304  C  CD  . ARG B 2 160  ? -15.752 -27.014 -41.613 1.00 73.65  ? 714  ARG C CD  1 
ATOM   8305  N  NE  . ARG B 2 160  ? -15.177 -25.701 -41.334 1.00 86.80  ? 714  ARG C NE  1 
ATOM   8306  C  CZ  . ARG B 2 160  ? -15.082 -25.164 -40.123 1.00 77.32  ? 714  ARG C CZ  1 
ATOM   8307  N  NH1 . ARG B 2 160  ? -15.517 -25.828 -39.061 1.00 70.52  ? 714  ARG C NH1 1 
ATOM   8308  N  NH2 . ARG B 2 160  ? -14.544 -23.961 -39.973 1.00 71.57  ? 714  ARG C NH2 1 
ATOM   8309  N  N   . ASP B 2 161  ? -20.679 -26.762 -43.578 1.00 72.21  ? 715  ASP C N   1 
ATOM   8310  C  CA  . ASP B 2 161  ? -21.081 -27.209 -44.907 1.00 83.07  ? 715  ASP C CA  1 
ATOM   8311  C  C   . ASP B 2 161  ? -21.917 -26.176 -45.658 1.00 78.63  ? 715  ASP C C   1 
ATOM   8312  O  O   . ASP B 2 161  ? -22.133 -26.302 -46.863 1.00 82.38  ? 715  ASP C O   1 
ATOM   8313  C  CB  . ASP B 2 161  ? -21.856 -28.522 -44.805 1.00 74.64  ? 715  ASP C CB  1 
ATOM   8314  C  CG  . ASP B 2 161  ? -21.002 -29.657 -44.287 1.00 89.86  ? 715  ASP C CG  1 
ATOM   8315  O  OD1 . ASP B 2 161  ? -19.804 -29.700 -44.634 1.00 90.65  ? 715  ASP C OD1 1 
ATOM   8316  O  OD2 . ASP B 2 161  ? -21.523 -30.504 -43.532 1.00 98.40  ? 715  ASP C OD2 1 
ATOM   8317  N  N   . LEU B 2 162  ? -22.392 -25.160 -44.947 1.00 73.56  ? 716  LEU C N   1 
ATOM   8318  C  CA  . LEU B 2 162  ? -23.198 -24.117 -45.572 1.00 62.07  ? 716  LEU C CA  1 
ATOM   8319  C  C   . LEU B 2 162  ? -22.325 -22.986 -46.108 1.00 60.79  ? 716  LEU C C   1 
ATOM   8320  O  O   . LEU B 2 162  ? -22.783 -22.156 -46.891 1.00 59.33  ? 716  LEU C O   1 
ATOM   8321  C  CB  . LEU B 2 162  ? -24.224 -23.562 -44.582 1.00 52.25  ? 716  LEU C CB  1 
ATOM   8322  C  CG  . LEU B 2 162  ? -25.344 -24.514 -44.164 1.00 59.17  ? 716  LEU C CG  1 
ATOM   8323  C  CD1 . LEU B 2 162  ? -26.326 -23.805 -43.247 1.00 52.83  ? 716  LEU C CD1 1 
ATOM   8324  C  CD2 . LEU B 2 162  ? -26.057 -25.073 -45.385 1.00 41.96  ? 716  LEU C CD2 1 
ATOM   8325  N  N   . LEU B 2 163  ? -21.065 -22.969 -45.685 1.00 60.43  ? 717  LEU C N   1 
ATOM   8326  C  CA  . LEU B 2 163  ? -20.121 -21.922 -46.073 1.00 57.86  ? 717  LEU C CA  1 
ATOM   8327  C  C   . LEU B 2 163  ? -19.868 -21.783 -47.584 1.00 60.38  ? 717  LEU C C   1 
ATOM   8328  O  O   . LEU B 2 163  ? -19.849 -20.657 -48.090 1.00 49.36  ? 717  LEU C O   1 
ATOM   8329  C  CB  . LEU B 2 163  ? -18.784 -22.139 -45.358 1.00 57.68  ? 717  LEU C CB  1 
ATOM   8330  C  CG  . LEU B 2 163  ? -18.817 -21.993 -43.838 1.00 62.97  ? 717  LEU C CG  1 
ATOM   8331  C  CD1 . LEU B 2 163  ? -17.455 -22.302 -43.240 1.00 53.86  ? 717  LEU C CD1 1 
ATOM   8332  C  CD2 . LEU B 2 163  ? -19.268 -20.595 -43.448 1.00 54.19  ? 717  LEU C CD2 1 
ATOM   8333  N  N   . PRO B 2 164  ? -19.656 -22.906 -48.308 1.00 63.03  ? 718  PRO C N   1 
ATOM   8334  C  CA  . PRO B 2 164  ? -19.406 -22.747 -49.746 1.00 64.35  ? 718  PRO C CA  1 
ATOM   8335  C  C   . PRO B 2 164  ? -20.568 -22.073 -50.467 1.00 63.72  ? 718  PRO C C   1 
ATOM   8336  O  O   . PRO B 2 164  ? -20.353 -21.224 -51.342 1.00 66.54  ? 718  PRO C O   1 
ATOM   8337  C  CB  . PRO B 2 164  ? -19.228 -24.189 -50.235 1.00 45.95  ? 718  PRO C CB  1 
ATOM   8338  C  CG  . PRO B 2 164  ? -18.813 -24.943 -49.046 1.00 64.69  ? 718  PRO C CG  1 
ATOM   8339  C  CD  . PRO B 2 164  ? -19.564 -24.323 -47.910 1.00 59.98  ? 718  PRO C CD  1 
ATOM   8340  N  N   . VAL B 2 165  ? -21.784 -22.456 -50.090 1.00 53.91  ? 719  VAL C N   1 
ATOM   8341  C  CA  . VAL B 2 165  ? -22.992 -21.852 -50.634 1.00 49.10  ? 719  VAL C CA  1 
ATOM   8342  C  C   . VAL B 2 165  ? -22.980 -20.346 -50.423 1.00 54.50  ? 719  VAL C C   1 
ATOM   8343  O  O   . VAL B 2 165  ? -23.099 -19.581 -51.377 1.00 54.11  ? 719  VAL C O   1 
ATOM   8344  C  CB  . VAL B 2 165  ? -24.259 -22.436 -49.989 1.00 57.75  ? 719  VAL C CB  1 
ATOM   8345  C  CG1 . VAL B 2 165  ? -25.476 -22.121 -50.842 1.00 42.93  ? 719  VAL C CG1 1 
ATOM   8346  C  CG2 . VAL B 2 165  ? -24.110 -23.938 -49.801 1.00 52.28  ? 719  VAL C CG2 1 
ATOM   8347  N  N   . MET B 2 166  ? -22.825 -19.934 -49.168 1.00 53.56  ? 720  MET C N   1 
ATOM   8348  C  CA  . MET B 2 166  ? -22.778 -18.521 -48.811 1.00 43.22  ? 720  MET C CA  1 
ATOM   8349  C  C   . MET B 2 166  ? -21.723 -17.783 -49.618 1.00 49.01  ? 720  MET C C   1 
ATOM   8350  O  O   . MET B 2 166  ? -21.945 -16.658 -50.065 1.00 52.07  ? 720  MET C O   1 
ATOM   8351  C  CB  . MET B 2 166  ? -22.497 -18.355 -47.318 1.00 40.40  ? 720  MET C CB  1 
ATOM   8352  C  CG  . MET B 2 166  ? -23.518 -19.018 -46.421 1.00 50.79  ? 720  MET C CG  1 
ATOM   8353  S  SD  . MET B 2 166  ? -23.055 -18.917 -44.685 1.00 51.07  ? 720  MET C SD  1 
ATOM   8354  C  CE  . MET B 2 166  ? -24.428 -19.786 -43.937 1.00 40.93  ? 720  MET C CE  1 
ATOM   8355  N  N   . CYS B 2 167  ? -20.579 -18.429 -49.808 1.00 48.76  ? 721  CYS C N   1 
ATOM   8356  C  CA  . CYS B 2 167  ? -19.484 -17.827 -50.552 1.00 48.84  ? 721  CYS C CA  1 
ATOM   8357  C  C   . CYS B 2 167  ? -19.842 -17.586 -52.014 1.00 50.71  ? 721  CYS C C   1 
ATOM   8358  O  O   . CYS B 2 167  ? -19.705 -16.469 -52.510 1.00 53.29  ? 721  CYS C O   1 
ATOM   8359  C  CB  . CYS B 2 167  ? -18.231 -18.698 -50.458 1.00 56.26  ? 721  CYS C CB  1 
ATOM   8360  S  SG  . CYS B 2 167  ? -17.363 -18.574 -48.881 1.00 53.50  ? 721  CYS C SG  1 
ATOM   8361  N  N   . ASP B 2 168  ? -20.308 -18.620 -52.707 1.00 55.23  ? 722  ASP C N   1 
ATOM   8362  C  CA  . ASP B 2 168  ? -20.527 -18.478 -54.145 1.00 79.69  ? 722  ASP C CA  1 
ATOM   8363  C  C   . ASP B 2 168  ? -21.851 -17.780 -54.467 1.00 59.87  ? 722  ASP C C   1 
ATOM   8364  O  O   . ASP B 2 168  ? -22.090 -17.387 -55.609 1.00 54.07  ? 722  ASP C O   1 
ATOM   8365  C  CB  . ASP B 2 168  ? -20.461 -19.842 -54.841 1.00 73.13  ? 722  ASP C CB  1 
ATOM   8366  C  CG  . ASP B 2 168  ? -21.758 -20.615 -54.742 1.00 77.08  ? 722  ASP C CG  1 
ATOM   8367  O  OD1 . ASP B 2 168  ? -22.622 -20.450 -55.631 1.00 71.64  ? 722  ASP C OD1 1 
ATOM   8368  O  OD2 . ASP B 2 168  ? -21.911 -21.399 -53.783 1.00 85.21  ? 722  ASP C OD2 1 
ATOM   8369  N  N   . ARG B 2 169  ? -22.704 -17.622 -53.461 1.00 54.92  ? 723  ARG C N   1 
ATOM   8370  C  CA  . ARG B 2 169  ? -23.972 -16.921 -53.640 1.00 51.29  ? 723  ARG C CA  1 
ATOM   8371  C  C   . ARG B 2 169  ? -23.769 -15.416 -53.509 1.00 53.15  ? 723  ARG C C   1 
ATOM   8372  O  O   . ARG B 2 169  ? -24.616 -14.625 -53.924 1.00 50.12  ? 723  ARG C O   1 
ATOM   8373  C  CB  . ARG B 2 169  ? -25.008 -17.404 -52.622 1.00 36.27  ? 723  ARG C CB  1 
ATOM   8374  C  CG  . ARG B 2 169  ? -26.234 -18.071 -53.233 1.00 37.04  ? 723  ARG C CG  1 
ATOM   8375  C  CD  . ARG B 2 169  ? -27.119 -18.655 -52.144 1.00 60.29  ? 723  ARG C CD  1 
ATOM   8376  N  NE  . ARG B 2 169  ? -28.451 -19.011 -52.625 1.00 47.08  ? 723  ARG C NE  1 
ATOM   8377  C  CZ  . ARG B 2 169  ? -28.804 -20.233 -53.011 1.00 51.14  ? 723  ARG C CZ  1 
ATOM   8378  N  NH1 . ARG B 2 169  ? -27.921 -21.221 -52.979 1.00 64.31  ? 723  ARG C NH1 1 
ATOM   8379  N  NH2 . ARG B 2 169  ? -30.041 -20.467 -53.429 1.00 71.35  ? 723  ARG C NH2 1 
ATOM   8380  N  N   . ALA B 2 170  ? -22.637 -15.033 -52.927 1.00 59.71  ? 724  ALA C N   1 
ATOM   8381  C  CA  . ALA B 2 170  ? -22.315 -13.629 -52.708 1.00 46.16  ? 724  ALA C CA  1 
ATOM   8382  C  C   . ALA B 2 170  ? -21.211 -13.163 -53.649 1.00 56.36  ? 724  ALA C C   1 
ATOM   8383  O  O   . ALA B 2 170  ? -20.852 -11.986 -53.665 1.00 52.51  ? 724  ALA C O   1 
ATOM   8384  C  CB  . ALA B 2 170  ? -21.907 -13.401 -51.263 1.00 51.23  ? 724  ALA C CB  1 
ATOM   8385  N  N   . GLY B 2 171  ? -20.674 -14.095 -54.430 1.00 58.44  ? 725  GLY C N   1 
ATOM   8386  C  CA  . GLY B 2 171  ? -19.612 -13.781 -55.366 1.00 39.40  ? 725  GLY C CA  1 
ATOM   8387  C  C   . GLY B 2 171  ? -18.249 -13.792 -54.706 1.00 51.95  ? 725  GLY C C   1 
ATOM   8388  O  O   . GLY B 2 171  ? -17.320 -13.131 -55.165 1.00 65.01  ? 725  GLY C O   1 
ATOM   8389  N  N   . PHE B 2 172  ? -18.132 -14.549 -53.619 1.00 59.08  ? 726  PHE C N   1 
ATOM   8390  C  CA  . PHE B 2 172  ? -16.873 -14.663 -52.892 1.00 53.72  ? 726  PHE C CA  1 
ATOM   8391  C  C   . PHE B 2 172  ? -15.998 -15.765 -53.466 1.00 55.35  ? 726  PHE C C   1 
ATOM   8392  O  O   . PHE B 2 172  ? -16.500 -16.796 -53.918 1.00 56.97  ? 726  PHE C O   1 
ATOM   8393  C  CB  . PHE B 2 172  ? -17.122 -14.936 -51.407 1.00 61.00  ? 726  PHE C CB  1 
ATOM   8394  C  CG  . PHE B 2 172  ? -17.651 -13.755 -50.647 1.00 56.74  ? 726  PHE C CG  1 
ATOM   8395  C  CD1 . PHE B 2 172  ? -17.689 -12.498 -51.223 1.00 59.35  ? 726  PHE C CD1 1 
ATOM   8396  C  CD2 . PHE B 2 172  ? -18.099 -13.904 -49.346 1.00 64.67  ? 726  PHE C CD2 1 
ATOM   8397  C  CE1 . PHE B 2 172  ? -18.174 -11.413 -50.519 1.00 53.37  ? 726  PHE C CE1 1 
ATOM   8398  C  CE2 . PHE B 2 172  ? -18.584 -12.824 -48.637 1.00 52.30  ? 726  PHE C CE2 1 
ATOM   8399  C  CZ  . PHE B 2 172  ? -18.621 -11.576 -49.225 1.00 58.99  ? 726  PHE C CZ  1 
ATOM   8400  N  N   . ILE B 2 173  ? -14.689 -15.534 -53.458 1.00 64.73  ? 727  ILE C N   1 
ATOM   8401  C  CA  . ILE B 2 173  ? -13.729 -16.579 -53.782 1.00 58.78  ? 727  ILE C CA  1 
ATOM   8402  C  C   . ILE B 2 173  ? -13.955 -17.718 -52.801 1.00 69.55  ? 727  ILE C C   1 
ATOM   8403  O  O   . ILE B 2 173  ? -14.228 -17.472 -51.627 1.00 76.06  ? 727  ILE C O   1 
ATOM   8404  C  CB  . ILE B 2 173  ? -12.272 -16.081 -53.682 1.00 73.90  ? 727  ILE C CB  1 
ATOM   8405  C  CG1 . ILE B 2 173  ? -12.199 -14.559 -53.857 1.00 93.69  ? 727  ILE C CG1 1 
ATOM   8406  C  CG2 . ILE B 2 173  ? -11.393 -16.800 -54.693 1.00 56.98  ? 727  ILE C CG2 1 
ATOM   8407  C  CD1 . ILE B 2 173  ? -12.432 -14.083 -55.278 1.00 77.29  ? 727  ILE C CD1 1 
ATOM   8408  N  N   . GLN B 2 174  ? -13.870 -18.959 -53.268 1.00 75.50  ? 728  GLN C N   1 
ATOM   8409  C  CA  . GLN B 2 174  ? -14.157 -20.091 -52.394 1.00 70.82  ? 728  GLN C CA  1 
ATOM   8410  C  C   . GLN B 2 174  ? -13.121 -20.222 -51.287 1.00 75.38  ? 728  GLN C C   1 
ATOM   8411  O  O   . GLN B 2 174  ? -11.992 -19.745 -51.421 1.00 70.06  ? 728  GLN C O   1 
ATOM   8412  C  CB  . GLN B 2 174  ? -14.245 -21.394 -53.191 1.00 84.58  ? 728  GLN C CB  1 
ATOM   8413  C  CG  . GLN B 2 174  ? -15.675 -21.816 -53.503 1.00 105.64 ? 728  GLN C CG  1 
ATOM   8414  C  CD  . GLN B 2 174  ? -16.564 -21.857 -52.266 1.00 105.29 ? 728  GLN C CD  1 
ATOM   8415  O  OE1 . GLN B 2 174  ? -16.120 -22.214 -51.174 1.00 103.63 ? 728  GLN C OE1 1 
ATOM   8416  N  NE2 . GLN B 2 174  ? -17.829 -21.484 -52.437 1.00 73.57  ? 728  GLN C NE2 1 
ATOM   8417  N  N   . ASP B 2 175  ? -13.533 -20.864 -50.198 1.00 79.97  ? 729  ASP C N   1 
ATOM   8418  C  CA  . ASP B 2 175  ? -12.725 -20.986 -48.988 1.00 82.18  ? 729  ASP C CA  1 
ATOM   8419  C  C   . ASP B 2 175  ? -12.362 -19.615 -48.420 1.00 77.56  ? 729  ASP C C   1 
ATOM   8420  O  O   . ASP B 2 175  ? -11.277 -19.426 -47.871 1.00 83.30  ? 729  ASP C O   1 
ATOM   8421  C  CB  . ASP B 2 175  ? -11.462 -21.807 -49.261 1.00 72.91  ? 729  ASP C CB  1 
ATOM   8422  C  CG  . ASP B 2 175  ? -11.769 -23.263 -49.543 1.00 91.42  ? 729  ASP C CG  1 
ATOM   8423  O  OD1 . ASP B 2 175  ? -12.519 -23.876 -48.755 1.00 87.40  ? 729  ASP C OD1 1 
ATOM   8424  O  OD2 . ASP B 2 175  ? -11.257 -23.799 -50.548 1.00 87.61  ? 729  ASP C OD2 1 
ATOM   8425  N  N   . THR B 2 176  ? -13.279 -18.663 -48.565 1.00 68.71  ? 730  THR C N   1 
ATOM   8426  C  CA  . THR B 2 176  ? -13.146 -17.362 -47.922 1.00 61.58  ? 730  THR C CA  1 
ATOM   8427  C  C   . THR B 2 176  ? -13.669 -17.460 -46.496 1.00 51.97  ? 730  THR C C   1 
ATOM   8428  O  O   . THR B 2 176  ? -14.762 -17.977 -46.267 1.00 57.28  ? 730  THR C O   1 
ATOM   8429  C  CB  . THR B 2 176  ? -13.915 -16.261 -48.681 1.00 56.24  ? 730  THR C CB  1 
ATOM   8430  O  OG1 . THR B 2 176  ? -13.414 -16.161 -50.019 1.00 68.14  ? 730  THR C OG1 1 
ATOM   8431  C  CG2 . THR B 2 176  ? -13.754 -14.919 -47.985 1.00 48.99  ? 730  THR C CG2 1 
ATOM   8432  N  N   . SER B 2 177  ? -12.884 -16.978 -45.539 1.00 54.93  ? 731  SER C N   1 
ATOM   8433  C  CA  . SER B 2 177  ? -13.275 -17.032 -44.134 1.00 61.54  ? 731  SER C CA  1 
ATOM   8434  C  C   . SER B 2 177  ? -14.472 -16.128 -43.869 1.00 59.56  ? 731  SER C C   1 
ATOM   8435  O  O   . SER B 2 177  ? -14.469 -14.954 -44.238 1.00 57.72  ? 731  SER C O   1 
ATOM   8436  C  CB  . SER B 2 177  ? -12.103 -16.634 -43.236 1.00 76.53  ? 731  SER C CB  1 
ATOM   8437  O  OG  . SER B 2 177  ? -10.980 -17.466 -43.470 1.00 83.51  ? 731  SER C OG  1 
ATOM   8438  N  N   . LEU B 2 178  ? -15.496 -16.682 -43.226 1.00 50.05  ? 732  LEU C N   1 
ATOM   8439  C  CA  . LEU B 2 178  ? -16.736 -15.950 -43.010 1.00 47.93  ? 732  LEU C CA  1 
ATOM   8440  C  C   . LEU B 2 178  ? -17.141 -15.859 -41.544 1.00 54.37  ? 732  LEU C C   1 
ATOM   8441  O  O   . LEU B 2 178  ? -17.002 -16.816 -40.783 1.00 51.89  ? 732  LEU C O   1 
ATOM   8442  C  CB  . LEU B 2 178  ? -17.873 -16.594 -43.803 1.00 39.13  ? 732  LEU C CB  1 
ATOM   8443  C  CG  . LEU B 2 178  ? -17.776 -16.530 -45.325 1.00 37.39  ? 732  LEU C CG  1 
ATOM   8444  C  CD1 . LEU B 2 178  ? -19.001 -17.173 -45.948 1.00 36.65  ? 732  LEU C CD1 1 
ATOM   8445  C  CD2 . LEU B 2 178  ? -17.628 -15.091 -45.791 1.00 40.41  ? 732  LEU C CD2 1 
ATOM   8446  N  N   . ILE B 2 179  ? -17.645 -14.691 -41.163 1.00 52.08  ? 733  ILE C N   1 
ATOM   8447  C  CA  . ILE B 2 179  ? -18.264 -14.501 -39.863 1.00 45.76  ? 733  ILE C CA  1 
ATOM   8448  C  C   . ILE B 2 179  ? -19.772 -14.641 -40.009 1.00 45.85  ? 733  ILE C C   1 
ATOM   8449  O  O   . ILE B 2 179  ? -20.395 -13.944 -40.818 1.00 44.26  ? 733  ILE C O   1 
ATOM   8450  C  CB  . ILE B 2 179  ? -17.933 -13.131 -39.261 1.00 44.07  ? 733  ILE C CB  1 
ATOM   8451  C  CG1 . ILE B 2 179  ? -16.426 -12.877 -39.307 1.00 55.70  ? 733  ILE C CG1 1 
ATOM   8452  C  CG2 . ILE B 2 179  ? -18.450 -13.048 -37.836 1.00 49.51  ? 733  ILE C CG2 1 
ATOM   8453  C  CD1 . ILE B 2 179  ? -16.026 -11.507 -38.812 1.00 44.50  ? 733  ILE C CD1 1 
ATOM   8454  N  N   . LEU B 2 180  ? -20.344 -15.549 -39.223 1.00 48.03  ? 734  LEU C N   1 
ATOM   8455  C  CA  . LEU B 2 180  ? -21.764 -15.863 -39.301 1.00 40.92  ? 734  LEU C CA  1 
ATOM   8456  C  C   . LEU B 2 180  ? -22.545 -15.382 -38.084 1.00 45.50  ? 734  LEU C C   1 
ATOM   8457  O  O   . LEU B 2 180  ? -22.112 -15.538 -36.943 1.00 51.09  ? 734  LEU C O   1 
ATOM   8458  C  CB  . LEU B 2 180  ? -21.968 -17.371 -39.469 1.00 44.77  ? 734  LEU C CB  1 
ATOM   8459  C  CG  . LEU B 2 180  ? -22.034 -17.930 -40.893 1.00 52.30  ? 734  LEU C CG  1 
ATOM   8460  C  CD1 . LEU B 2 180  ? -20.727 -17.712 -41.638 1.00 51.88  ? 734  LEU C CD1 1 
ATOM   8461  C  CD2 . LEU B 2 180  ? -22.397 -19.406 -40.859 1.00 35.11  ? 734  LEU C CD2 1 
ATOM   8462  N  N   . TYR B 2 181  ? -23.704 -14.797 -38.354 1.00 44.69  ? 735  TYR C N   1 
ATOM   8463  C  CA  . TYR B 2 181  ? -24.657 -14.388 -37.336 1.00 44.73  ? 735  TYR C CA  1 
ATOM   8464  C  C   . TYR B 2 181  ? -26.022 -14.962 -37.681 1.00 44.69  ? 735  TYR C C   1 
ATOM   8465  O  O   . TYR B 2 181  ? -26.289 -15.296 -38.837 1.00 49.47  ? 735  TYR C O   1 
ATOM   8466  C  CB  . TYR B 2 181  ? -24.766 -12.866 -37.249 1.00 39.89  ? 735  TYR C CB  1 
ATOM   8467  C  CG  . TYR B 2 181  ? -23.501 -12.130 -36.876 1.00 47.76  ? 735  TYR C CG  1 
ATOM   8468  C  CD1 . TYR B 2 181  ? -22.533 -11.845 -37.830 1.00 39.77  ? 735  TYR C CD1 1 
ATOM   8469  C  CD2 . TYR B 2 181  ? -23.293 -11.684 -35.578 1.00 41.51  ? 735  TYR C CD2 1 
ATOM   8470  C  CE1 . TYR B 2 181  ? -21.382 -11.158 -37.497 1.00 35.29  ? 735  TYR C CE1 1 
ATOM   8471  C  CE2 . TYR B 2 181  ? -22.146 -10.997 -35.234 1.00 42.19  ? 735  TYR C CE2 1 
ATOM   8472  C  CZ  . TYR B 2 181  ? -21.192 -10.736 -36.197 1.00 50.79  ? 735  TYR C CZ  1 
ATOM   8473  O  OH  . TYR B 2 181  ? -20.047 -10.052 -35.861 1.00 55.84  ? 735  TYR C OH  1 
ATOM   8474  N  N   . GLU B 2 182  ? -26.884 -15.077 -36.679 1.00 37.16  ? 736  GLU C N   1 
ATOM   8475  C  CA  . GLU B 2 182  ? -28.299 -15.273 -36.928 1.00 36.30  ? 736  GLU C CA  1 
ATOM   8476  C  C   . GLU B 2 182  ? -29.006 -13.970 -36.614 1.00 44.17  ? 736  GLU C C   1 
ATOM   8477  O  O   . GLU B 2 182  ? -28.816 -13.393 -35.537 1.00 48.98  ? 736  GLU C O   1 
ATOM   8478  C  CB  . GLU B 2 182  ? -28.885 -16.406 -36.086 1.00 37.30  ? 736  GLU C CB  1 
ATOM   8479  C  CG  . GLU B 2 182  ? -30.359 -16.659 -36.377 1.00 38.96  ? 736  GLU C CG  1 
ATOM   8480  C  CD  . GLU B 2 182  ? -31.074 -17.372 -35.249 1.00 55.19  ? 736  GLU C CD  1 
ATOM   8481  O  OE1 . GLU B 2 182  ? -30.470 -17.539 -34.168 1.00 71.26  ? 736  GLU C OE1 1 
ATOM   8482  O  OE2 . GLU B 2 182  ? -32.245 -17.762 -35.442 1.00 54.30  ? 736  GLU C OE2 1 
ATOM   8483  N  N   . GLU B 2 183  ? -29.797 -13.494 -37.568 1.00 39.03  ? 737  GLU C N   1 
ATOM   8484  C  CA  . GLU B 2 183  ? -30.652 -12.346 -37.328 1.00 30.36  ? 737  GLU C CA  1 
ATOM   8485  C  C   . GLU B 2 183  ? -31.896 -12.842 -36.618 1.00 36.02  ? 737  GLU C C   1 
ATOM   8486  O  O   . GLU B 2 183  ? -32.872 -13.228 -37.261 1.00 47.89  ? 737  GLU C O   1 
ATOM   8487  C  CB  . GLU B 2 183  ? -31.017 -11.642 -38.634 1.00 32.96  ? 737  GLU C CB  1 
ATOM   8488  C  CG  . GLU B 2 183  ? -31.894 -10.419 -38.443 1.00 36.08  ? 737  GLU C CG  1 
ATOM   8489  C  CD  . GLU B 2 183  ? -32.627 -10.026 -39.706 1.00 46.40  ? 737  GLU C CD  1 
ATOM   8490  O  OE1 . GLU B 2 183  ? -32.056 -10.186 -40.807 1.00 45.99  ? 737  GLU C OE1 1 
ATOM   8491  O  OE2 . GLU B 2 183  ? -33.784 -9.569  -39.595 1.00 47.05  ? 737  GLU C OE2 1 
ATOM   8492  N  N   . VAL B 2 184  ? -31.858 -12.858 -35.290 1.00 39.79  ? 738  VAL C N   1 
ATOM   8493  C  CA  . VAL B 2 184  ? -32.964 -13.431 -34.538 1.00 37.88  ? 738  VAL C CA  1 
ATOM   8494  C  C   . VAL B 2 184  ? -34.172 -12.511 -34.609 1.00 35.63  ? 738  VAL C C   1 
ATOM   8495  O  O   . VAL B 2 184  ? -35.296 -12.948 -34.858 1.00 36.58  ? 738  VAL C O   1 
ATOM   8496  C  CB  . VAL B 2 184  ? -32.590 -13.673 -33.070 1.00 42.51  ? 738  VAL C CB  1 
ATOM   8497  C  CG1 . VAL B 2 184  ? -33.711 -14.411 -32.362 1.00 42.28  ? 738  VAL C CG1 1 
ATOM   8498  C  CG2 . VAL B 2 184  ? -31.297 -14.464 -32.982 1.00 38.27  ? 738  VAL C CG2 1 
ATOM   8499  N  N   . LYS B 2 185  ? -33.916 -11.227 -34.400 1.00 39.15  ? 739  LYS C N   1 
ATOM   8500  C  CA  . LYS B 2 185  ? -34.949 -10.207 -34.411 1.00 40.46  ? 739  LYS C CA  1 
ATOM   8501  C  C   . LYS B 2 185  ? -34.247 -8.860  -34.439 1.00 33.20  ? 739  LYS C C   1 
ATOM   8502  O  O   . LYS B 2 185  ? -33.024 -8.804  -34.303 1.00 29.18  ? 739  LYS C O   1 
ATOM   8503  C  CB  . LYS B 2 185  ? -35.860 -10.338 -33.188 1.00 32.90  ? 739  LYS C CB  1 
ATOM   8504  C  CG  . LYS B 2 185  ? -35.177 -10.048 -31.869 1.00 36.58  ? 739  LYS C CG  1 
ATOM   8505  C  CD  . LYS B 2 185  ? -36.117 -10.286 -30.703 1.00 45.56  ? 739  LYS C CD  1 
ATOM   8506  C  CE  . LYS B 2 185  ? -35.439 -9.998  -29.376 1.00 43.32  ? 739  LYS C CE  1 
ATOM   8507  N  NZ  . LYS B 2 185  ? -36.340 -10.296 -28.229 1.00 60.98  ? 739  LYS C NZ  1 
ATOM   8508  N  N   . PRO B 2 186  ? -35.004 -7.771  -34.649 1.00 27.46  ? 740  PRO C N   1 
ATOM   8509  C  CA  . PRO B 2 186  ? -34.402 -6.448  -34.482 1.00 40.42  ? 740  PRO C CA  1 
ATOM   8510  C  C   . PRO B 2 186  ? -33.697 -6.312  -33.136 1.00 38.92  ? 740  PRO C C   1 
ATOM   8511  O  O   . PRO B 2 186  ? -34.243 -6.740  -32.117 1.00 42.94  ? 740  PRO C O   1 
ATOM   8512  C  CB  . PRO B 2 186  ? -35.605 -5.509  -34.581 1.00 24.42  ? 740  PRO C CB  1 
ATOM   8513  C  CG  . PRO B 2 186  ? -36.511 -6.210  -35.532 1.00 17.35  ? 740  PRO C CG  1 
ATOM   8514  C  CD  . PRO B 2 186  ? -36.346 -7.685  -35.254 1.00 26.49  ? 740  PRO C CD  1 
ATOM   8515  N  N   . ASN B 2 187  ? -32.486 -5.757  -33.162 1.00 35.67  ? 741  ASN C N   1 
ATOM   8516  C  CA  . ASN B 2 187  ? -31.643 -5.570  -31.980 1.00 34.90  ? 741  ASN C CA  1 
ATOM   8517  C  C   . ASN B 2 187  ? -31.148 -6.888  -31.374 1.00 44.25  ? 741  ASN C C   1 
ATOM   8518  O  O   . ASN B 2 187  ? -30.643 -6.911  -30.253 1.00 41.85  ? 741  ASN C O   1 
ATOM   8519  C  CB  . ASN B 2 187  ? -32.383 -4.743  -30.917 1.00 33.12  ? 741  ASN C CB  1 
ATOM   8520  C  CG  . ASN B 2 187  ? -31.447 -4.140  -29.888 1.00 51.55  ? 741  ASN C CG  1 
ATOM   8521  O  OD1 . ASN B 2 187  ? -30.267 -3.920  -30.164 1.00 49.28  ? 741  ASN C OD1 1 
ATOM   8522  N  ND2 . ASN B 2 187  ? -31.966 -3.873  -28.695 1.00 47.72  ? 741  ASN C ND2 1 
ATOM   8523  N  N   . LEU B 2 188  ? -31.284 -7.985  -32.112 1.00 44.73  ? 742  LEU C N   1 
ATOM   8524  C  CA  . LEU B 2 188  ? -30.706 -9.248  -31.663 1.00 40.11  ? 742  LEU C CA  1 
ATOM   8525  C  C   . LEU B 2 188  ? -30.068 -10.027 -32.810 1.00 43.90  ? 742  LEU C C   1 
ATOM   8526  O  O   . LEU B 2 188  ? -30.734 -10.785 -33.528 1.00 46.73  ? 742  LEU C O   1 
ATOM   8527  C  CB  . LEU B 2 188  ? -31.753 -10.116 -30.965 1.00 48.46  ? 742  LEU C CB  1 
ATOM   8528  C  CG  . LEU B 2 188  ? -31.176 -11.361 -30.287 1.00 46.40  ? 742  LEU C CG  1 
ATOM   8529  C  CD1 . LEU B 2 188  ? -30.141 -10.967 -29.246 1.00 46.05  ? 742  LEU C CD1 1 
ATOM   8530  C  CD2 . LEU B 2 188  ? -32.274 -12.203 -29.660 1.00 35.17  ? 742  LEU C CD2 1 
ATOM   8531  N  N   . THR B 2 189  ? -28.763 -9.827  -32.965 1.00 38.42  ? 743  THR C N   1 
ATOM   8532  C  CA  . THR B 2 189  ? -27.968 -10.518 -33.970 1.00 39.43  ? 743  THR C CA  1 
ATOM   8533  C  C   . THR B 2 189  ? -26.908 -11.349 -33.257 1.00 42.72  ? 743  THR C C   1 
ATOM   8534  O  O   . THR B 2 189  ? -25.999 -10.792 -32.644 1.00 33.90  ? 743  THR C O   1 
ATOM   8535  C  CB  . THR B 2 189  ? -27.292 -9.526  -34.934 1.00 41.01  ? 743  THR C CB  1 
ATOM   8536  O  OG1 . THR B 2 189  ? -28.194 -8.451  -35.227 1.00 49.12  ? 743  THR C OG1 1 
ATOM   8537  C  CG2 . THR B 2 189  ? -26.884 -10.214 -36.226 1.00 35.20  ? 743  THR C CG2 1 
ATOM   8538  N  N   . GLU B 2 190  ? -27.019 -12.673 -33.328 1.00 42.80  ? 744  GLU C N   1 
ATOM   8539  C  CA  . GLU B 2 190  ? -26.151 -13.536 -32.522 1.00 36.92  ? 744  GLU C CA  1 
ATOM   8540  C  C   . GLU B 2 190  ? -25.098 -14.290 -33.330 1.00 51.84  ? 744  GLU C C   1 
ATOM   8541  O  O   . GLU B 2 190  ? -25.423 -15.079 -34.211 1.00 54.67  ? 744  GLU C O   1 
ATOM   8542  C  CB  . GLU B 2 190  ? -26.994 -14.536 -31.730 1.00 46.50  ? 744  GLU C CB  1 
ATOM   8543  C  CG  . GLU B 2 190  ? -27.741 -13.920 -30.562 1.00 53.84  ? 744  GLU C CG  1 
ATOM   8544  C  CD  . GLU B 2 190  ? -28.503 -14.950 -29.758 1.00 68.62  ? 744  GLU C CD  1 
ATOM   8545  O  OE1 . GLU B 2 190  ? -28.848 -16.008 -30.325 1.00 64.37  ? 744  GLU C OE1 1 
ATOM   8546  O  OE2 . GLU B 2 190  ? -28.751 -14.706 -28.559 1.00 94.15  ? 744  GLU C OE2 1 
ATOM   8547  N  N   . ARG B 2 191  ? -23.832 -14.056 -32.999 1.00 51.59  ? 745  ARG C N   1 
ATOM   8548  C  CA  . ARG B 2 191  ? -22.716 -14.672 -33.710 1.00 49.90  ? 745  ARG C CA  1 
ATOM   8549  C  C   . ARG B 2 191  ? -22.666 -16.185 -33.500 1.00 52.74  ? 745  ARG C C   1 
ATOM   8550  O  O   . ARG B 2 191  ? -22.941 -16.679 -32.407 1.00 58.60  ? 745  ARG C O   1 
ATOM   8551  C  CB  . ARG B 2 191  ? -21.397 -14.032 -33.263 1.00 41.56  ? 745  ARG C CB  1 
ATOM   8552  C  CG  . ARG B 2 191  ? -20.172 -14.470 -34.051 1.00 44.01  ? 745  ARG C CG  1 
ATOM   8553  C  CD  . ARG B 2 191  ? -19.025 -13.490 -33.849 1.00 52.59  ? 745  ARG C CD  1 
ATOM   8554  N  NE  . ARG B 2 191  ? -17.812 -13.893 -34.557 1.00 59.16  ? 745  ARG C NE  1 
ATOM   8555  C  CZ  . ARG B 2 191  ? -16.745 -13.117 -34.709 1.00 62.26  ? 745  ARG C CZ  1 
ATOM   8556  N  NH1 . ARG B 2 191  ? -16.739 -11.887 -34.211 1.00 53.30  ? 745  ARG C NH1 1 
ATOM   8557  N  NH2 . ARG B 2 191  ? -15.684 -13.565 -35.366 1.00 70.33  ? 745  ARG C NH2 1 
ATOM   8558  N  N   . ILE B 2 192  ? -22.326 -16.913 -34.560 1.00 51.22  ? 746  ILE C N   1 
ATOM   8559  C  CA  . ILE B 2 192  ? -22.152 -18.360 -34.484 1.00 47.63  ? 746  ILE C CA  1 
ATOM   8560  C  C   . ILE B 2 192  ? -20.683 -18.702 -34.265 1.00 58.31  ? 746  ILE C C   1 
ATOM   8561  O  O   . ILE B 2 192  ? -19.855 -18.531 -35.161 1.00 64.19  ? 746  ILE C O   1 
ATOM   8562  C  CB  . ILE B 2 192  ? -22.651 -19.066 -35.757 1.00 55.00  ? 746  ILE C CB  1 
ATOM   8563  C  CG1 . ILE B 2 192  ? -24.136 -18.777 -35.982 1.00 49.25  ? 746  ILE C CG1 1 
ATOM   8564  C  CG2 . ILE B 2 192  ? -22.407 -20.564 -35.663 1.00 52.85  ? 746  ILE C CG2 1 
ATOM   8565  C  CD1 . ILE B 2 192  ? -24.698 -19.412 -37.234 1.00 37.19  ? 746  ILE C CD1 1 
ATOM   8566  N  N   . GLN B 2 193  ? -20.365 -19.176 -33.067 1.00 74.44  ? 747  GLN C N   1 
ATOM   8567  C  CA  . GLN B 2 193  ? -18.981 -19.436 -32.687 1.00 77.07  ? 747  GLN C CA  1 
ATOM   8568  C  C   . GLN B 2 193  ? -18.425 -20.775 -33.177 1.00 70.46  ? 747  GLN C C   1 
ATOM   8569  O  O   . GLN B 2 193  ? -17.235 -20.880 -33.471 1.00 81.55  ? 747  GLN C O   1 
ATOM   8570  C  CB  . GLN B 2 193  ? -18.844 -19.335 -31.167 1.00 72.23  ? 747  GLN C CB  1 
ATOM   8571  C  CG  . GLN B 2 193  ? -18.839 -17.895 -30.679 1.00 68.33  ? 747  GLN C CG  1 
ATOM   8572  C  CD  . GLN B 2 193  ? -19.172 -17.763 -29.209 1.00 91.80  ? 747  GLN C CD  1 
ATOM   8573  O  OE1 . GLN B 2 193  ? -19.338 -18.758 -28.504 1.00 101.07 ? 747  GLN C OE1 1 
ATOM   8574  N  NE2 . GLN B 2 193  ? -19.280 -16.525 -28.738 1.00 82.28  ? 747  GLN C NE2 1 
ATOM   8575  N  N   . ASP B 2 194  ? -19.274 -21.793 -33.268 1.00 62.96  ? 748  ASP C N   1 
ATOM   8576  C  CA  . ASP B 2 194  ? -18.810 -23.116 -33.684 1.00 63.37  ? 748  ASP C CA  1 
ATOM   8577  C  C   . ASP B 2 194  ? -19.430 -23.551 -35.011 1.00 76.44  ? 748  ASP C C   1 
ATOM   8578  O  O   . ASP B 2 194  ? -20.645 -23.718 -35.110 1.00 75.71  ? 748  ASP C O   1 
ATOM   8579  C  CB  . ASP B 2 194  ? -19.116 -24.154 -32.603 1.00 80.03  ? 748  ASP C CB  1 
ATOM   8580  C  CG  . ASP B 2 194  ? -18.188 -25.353 -32.664 1.00 78.88  ? 748  ASP C CG  1 
ATOM   8581  O  OD1 . ASP B 2 194  ? -18.377 -26.209 -33.552 1.00 77.16  ? 748  ASP C OD1 1 
ATOM   8582  O  OD2 . ASP B 2 194  ? -17.271 -25.436 -31.820 1.00 88.75  ? 748  ASP C OD2 1 
ATOM   8583  N  N   . TYR B 2 195  ? -18.590 -23.740 -36.025 1.00 70.02  ? 749  TYR C N   1 
ATOM   8584  C  CA  . TYR B 2 195  ? -19.065 -24.136 -37.348 1.00 60.23  ? 749  TYR C CA  1 
ATOM   8585  C  C   . TYR B 2 195  ? -19.141 -25.653 -37.501 1.00 73.73  ? 749  TYR C C   1 
ATOM   8586  O  O   . TYR B 2 195  ? -19.651 -26.157 -38.500 1.00 69.53  ? 749  TYR C O   1 
ATOM   8587  C  CB  . TYR B 2 195  ? -18.161 -23.560 -38.442 1.00 50.40  ? 749  TYR C CB  1 
ATOM   8588  C  CG  . TYR B 2 195  ? -18.182 -22.052 -38.553 1.00 49.28  ? 749  TYR C CG  1 
ATOM   8589  C  CD1 . TYR B 2 195  ? -19.163 -21.299 -37.920 1.00 53.91  ? 749  TYR C CD1 1 
ATOM   8590  C  CD2 . TYR B 2 195  ? -17.222 -21.383 -39.299 1.00 46.06  ? 749  TYR C CD2 1 
ATOM   8591  C  CE1 . TYR B 2 195  ? -19.181 -19.922 -38.024 1.00 45.65  ? 749  TYR C CE1 1 
ATOM   8592  C  CE2 . TYR B 2 195  ? -17.233 -20.008 -39.409 1.00 45.90  ? 749  TYR C CE2 1 
ATOM   8593  C  CZ  . TYR B 2 195  ? -18.214 -19.282 -38.769 1.00 45.88  ? 749  TYR C CZ  1 
ATOM   8594  O  OH  . TYR B 2 195  ? -18.225 -17.911 -38.879 1.00 53.00  ? 749  TYR C OH  1 
ATOM   8595  N  N   . ASP B 2 196  ? -18.628 -26.374 -36.509 1.00 74.84  ? 750  ASP C N   1 
ATOM   8596  C  CA  . ASP B 2 196  ? -18.572 -27.833 -36.565 1.00 62.85  ? 750  ASP C CA  1 
ATOM   8597  C  C   . ASP B 2 196  ? -19.804 -28.493 -35.949 1.00 65.32  ? 750  ASP C C   1 
ATOM   8598  O  O   . ASP B 2 196  ? -19.864 -29.716 -35.824 1.00 74.31  ? 750  ASP C O   1 
ATOM   8599  C  CB  . ASP B 2 196  ? -17.308 -28.342 -35.871 1.00 74.26  ? 750  ASP C CB  1 
ATOM   8600  C  CG  . ASP B 2 196  ? -16.043 -27.978 -36.625 1.00 88.29  ? 750  ASP C CG  1 
ATOM   8601  O  OD1 . ASP B 2 196  ? -16.086 -27.932 -37.872 1.00 68.93  ? 750  ASP C OD1 1 
ATOM   8602  O  OD2 . ASP B 2 196  ? -15.008 -27.738 -35.970 1.00 98.76  ? 750  ASP C OD2 1 
ATOM   8603  N  N   . VAL B 2 197  ? -20.778 -27.679 -35.557 1.00 64.45  ? 751  VAL C N   1 
ATOM   8604  C  CA  . VAL B 2 197  ? -22.005 -28.190 -34.954 1.00 73.41  ? 751  VAL C CA  1 
ATOM   8605  C  C   . VAL B 2 197  ? -23.169 -28.125 -35.941 1.00 67.57  ? 751  VAL C C   1 
ATOM   8606  O  O   . VAL B 2 197  ? -23.194 -27.272 -36.828 1.00 75.01  ? 751  VAL C O   1 
ATOM   8607  C  CB  . VAL B 2 197  ? -22.378 -27.413 -33.673 1.00 61.20  ? 751  VAL C CB  1 
ATOM   8608  C  CG1 . VAL B 2 197  ? -21.252 -27.498 -32.657 1.00 70.59  ? 751  VAL C CG1 1 
ATOM   8609  C  CG2 . VAL B 2 197  ? -22.694 -25.964 -33.997 1.00 68.36  ? 751  VAL C CG2 1 
ATOM   8610  N  N   . SER B 2 198  ? -24.114 -29.050 -35.802 1.00 66.67  ? 752  SER C N   1 
ATOM   8611  C  CA  . SER B 2 198  ? -25.285 -29.084 -36.673 1.00 68.57  ? 752  SER C CA  1 
ATOM   8612  C  C   . SER B 2 198  ? -26.142 -27.831 -36.507 1.00 75.72  ? 752  SER C C   1 
ATOM   8613  O  O   . SER B 2 198  ? -26.002 -27.098 -35.527 1.00 67.47  ? 752  SER C O   1 
ATOM   8614  C  CB  . SER B 2 198  ? -26.129 -30.328 -36.392 1.00 74.08  ? 752  SER C CB  1 
ATOM   8615  O  OG  . SER B 2 198  ? -26.962 -30.133 -35.262 1.00 75.91  ? 752  SER C OG  1 
ATOM   8616  N  N   . LEU B 2 199  ? -27.027 -27.594 -37.473 1.00 78.37  ? 753  LEU C N   1 
ATOM   8617  C  CA  . LEU B 2 199  ? -27.924 -26.441 -37.443 1.00 58.34  ? 753  LEU C CA  1 
ATOM   8618  C  C   . LEU B 2 199  ? -28.807 -26.435 -36.203 1.00 55.73  ? 753  LEU C C   1 
ATOM   8619  O  O   . LEU B 2 199  ? -29.041 -25.385 -35.606 1.00 58.84  ? 753  LEU C O   1 
ATOM   8620  C  CB  . LEU B 2 199  ? -28.807 -26.415 -38.692 1.00 70.20  ? 753  LEU C CB  1 
ATOM   8621  C  CG  . LEU B 2 199  ? -28.246 -25.766 -39.956 1.00 51.66  ? 753  LEU C CG  1 
ATOM   8622  C  CD1 . LEU B 2 199  ? -29.251 -25.885 -41.085 1.00 66.39  ? 753  LEU C CD1 1 
ATOM   8623  C  CD2 . LEU B 2 199  ? -27.914 -24.311 -39.699 1.00 60.78  ? 753  LEU C CD2 1 
ATOM   8624  N  N   . ASP B 2 200  ? -29.300 -27.614 -35.834 1.00 64.30  ? 754  ASP C N   1 
ATOM   8625  C  CA  . ASP B 2 200  ? -30.157 -27.772 -34.665 1.00 64.21  ? 754  ASP C CA  1 
ATOM   8626  C  C   . ASP B 2 200  ? -29.478 -27.240 -33.409 1.00 64.91  ? 754  ASP C C   1 
ATOM   8627  O  O   . ASP B 2 200  ? -30.068 -26.474 -32.646 1.00 73.58  ? 754  ASP C O   1 
ATOM   8628  C  CB  . ASP B 2 200  ? -30.525 -29.244 -34.469 1.00 65.25  ? 754  ASP C CB  1 
ATOM   8629  C  CG  . ASP B 2 200  ? -31.694 -29.435 -33.524 1.00 100.68 ? 754  ASP C CG  1 
ATOM   8630  O  OD1 . ASP B 2 200  ? -32.151 -28.441 -32.920 1.00 98.70  ? 754  ASP C OD1 1 
ATOM   8631  O  OD2 . ASP B 2 200  ? -32.157 -30.586 -33.381 1.00 101.76 ? 754  ASP C OD2 1 
ATOM   8632  N  N   . LYS B 2 201  ? -28.233 -27.653 -33.206 1.00 59.56  ? 755  LYS C N   1 
ATOM   8633  C  CA  . LYS B 2 201  ? -27.478 -27.262 -32.024 1.00 67.37  ? 755  LYS C CA  1 
ATOM   8634  C  C   . LYS B 2 201  ? -27.081 -25.791 -32.068 1.00 52.95  ? 755  LYS C C   1 
ATOM   8635  O  O   . LYS B 2 201  ? -27.152 -25.091 -31.059 1.00 60.21  ? 755  LYS C O   1 
ATOM   8636  C  CB  . LYS B 2 201  ? -26.234 -28.142 -31.881 1.00 78.09  ? 755  LYS C CB  1 
ATOM   8637  C  CG  . LYS B 2 201  ? -26.531 -29.575 -31.458 1.00 77.95  ? 755  LYS C CG  1 
ATOM   8638  C  CD  . LYS B 2 201  ? -25.288 -30.450 -31.543 1.00 75.63  ? 755  LYS C CD  1 
ATOM   8639  C  CE  . LYS B 2 201  ? -25.179 -31.125 -32.901 1.00 85.09  ? 755  LYS C CE  1 
ATOM   8640  N  NZ  . LYS B 2 201  ? -23.805 -31.625 -33.184 1.00 74.61  ? 755  LYS C NZ  1 
ATOM   8641  N  N   . ALA B 2 202  ? -26.671 -25.329 -33.245 1.00 61.72  ? 756  ALA C N   1 
ATOM   8642  C  CA  . ALA B 2 202  ? -26.167 -23.970 -33.411 1.00 58.38  ? 756  ALA C CA  1 
ATOM   8643  C  C   . ALA B 2 202  ? -27.243 -22.912 -33.181 1.00 62.38  ? 756  ALA C C   1 
ATOM   8644  O  O   . ALA B 2 202  ? -26.962 -21.835 -32.654 1.00 52.03  ? 756  ALA C O   1 
ATOM   8645  C  CB  . ALA B 2 202  ? -25.563 -23.803 -34.797 1.00 56.26  ? 756  ALA C CB  1 
ATOM   8646  N  N   . LEU B 2 203  ? -28.473 -23.220 -33.581 1.00 59.54  ? 757  LEU C N   1 
ATOM   8647  C  CA  . LEU B 2 203  ? -29.562 -22.252 -33.521 1.00 39.84  ? 757  LEU C CA  1 
ATOM   8648  C  C   . LEU B 2 203  ? -30.685 -22.697 -32.591 1.00 48.55  ? 757  LEU C C   1 
ATOM   8649  O  O   . LEU B 2 203  ? -31.400 -23.655 -32.883 1.00 55.07  ? 757  LEU C O   1 
ATOM   8650  C  CB  . LEU B 2 203  ? -30.126 -22.003 -34.923 1.00 49.20  ? 757  LEU C CB  1 
ATOM   8651  C  CG  . LEU B 2 203  ? -29.527 -20.888 -35.787 1.00 53.78  ? 757  LEU C CG  1 
ATOM   8652  C  CD1 . LEU B 2 203  ? -28.012 -20.976 -35.875 1.00 53.07  ? 757  LEU C CD1 1 
ATOM   8653  C  CD2 . LEU B 2 203  ? -30.136 -20.941 -37.176 1.00 57.82  ? 757  LEU C CD2 1 
ATOM   8654  N  N   . ASP B 2 204  ? -30.839 -21.995 -31.473 1.00 59.78  ? 758  ASP C N   1 
ATOM   8655  C  CA  . ASP B 2 204  ? -31.938 -22.267 -30.553 1.00 59.26  ? 758  ASP C CA  1 
ATOM   8656  C  C   . ASP B 2 204  ? -33.273 -22.002 -31.237 1.00 61.78  ? 758  ASP C C   1 
ATOM   8657  O  O   . ASP B 2 204  ? -33.433 -20.987 -31.917 1.00 79.51  ? 758  ASP C O   1 
ATOM   8658  C  CB  . ASP B 2 204  ? -31.818 -21.416 -29.288 1.00 55.76  ? 758  ASP C CB  1 
ATOM   8659  C  CG  . ASP B 2 204  ? -30.590 -21.755 -28.471 1.00 86.49  ? 758  ASP C CG  1 
ATOM   8660  O  OD1 . ASP B 2 204  ? -29.928 -22.768 -28.782 1.00 74.04  ? 758  ASP C OD1 1 
ATOM   8661  O  OD2 . ASP B 2 204  ? -30.294 -21.013 -27.511 1.00 83.34  ? 758  ASP C OD2 1 
ATOM   8662  N  N   . GLU B 2 205  ? -34.218 -22.921 -31.051 1.00 63.50  ? 759  GLU C N   1 
ATOM   8663  C  CA  . GLU B 2 205  ? -35.533 -22.847 -31.685 1.00 52.66  ? 759  GLU C CA  1 
ATOM   8664  C  C   . GLU B 2 205  ? -35.406 -22.661 -33.195 1.00 58.94  ? 759  GLU C C   1 
ATOM   8665  O  O   . GLU B 2 205  ? -35.854 -21.655 -33.742 1.00 61.45  ? 759  GLU C O   1 
ATOM   8666  C  CB  . GLU B 2 205  ? -36.362 -21.709 -31.083 1.00 59.91  ? 759  GLU C CB  1 
ATOM   8667  C  CG  . GLU B 2 205  ? -36.538 -21.797 -29.573 1.00 81.90  ? 759  GLU C CG  1 
ATOM   8668  C  CD  . GLU B 2 205  ? -37.201 -20.565 -28.982 1.00 89.23  ? 759  GLU C CD  1 
ATOM   8669  O  OE1 . GLU B 2 205  ? -36.551 -19.882 -28.169 1.00 72.94  ? 759  GLU C OE1 1 
ATOM   8670  O  OE2 . GLU B 2 205  ? -38.370 -20.283 -29.321 1.00 79.83  ? 759  GLU C OE2 1 
ATOM   8671  N  N   . LEU B 2 206  ? -34.807 -23.641 -33.865 1.00 57.76  ? 760  LEU C N   1 
ATOM   8672  C  CA  . LEU B 2 206  ? -34.564 -23.545 -35.300 1.00 44.14  ? 760  LEU C CA  1 
ATOM   8673  C  C   . LEU B 2 206  ? -35.858 -23.737 -36.072 1.00 48.45  ? 760  LEU C C   1 
ATOM   8674  O  O   . LEU B 2 206  ? -36.527 -24.759 -35.931 1.00 66.48  ? 760  LEU C O   1 
ATOM   8675  C  CB  . LEU B 2 206  ? -33.530 -24.582 -35.743 1.00 51.06  ? 760  LEU C CB  1 
ATOM   8676  C  CG  . LEU B 2 206  ? -33.373 -24.787 -37.252 1.00 43.93  ? 760  LEU C CG  1 
ATOM   8677  C  CD1 . LEU B 2 206  ? -32.700 -23.593 -37.913 1.00 47.71  ? 760  LEU C CD1 1 
ATOM   8678  C  CD2 . LEU B 2 206  ? -32.603 -26.066 -37.538 1.00 52.02  ? 760  LEU C CD2 1 
ATOM   8679  N  N   . MET B 2 207  ? -36.204 -22.751 -36.891 1.00 47.30  ? 761  MET C N   1 
ATOM   8680  C  CA  . MET B 2 207  ? -37.453 -22.786 -37.641 1.00 44.23  ? 761  MET C CA  1 
ATOM   8681  C  C   . MET B 2 207  ? -37.238 -22.458 -39.109 1.00 58.62  ? 761  MET C C   1 
ATOM   8682  O  O   . MET B 2 207  ? -36.177 -21.972 -39.501 1.00 59.68  ? 761  MET C O   1 
ATOM   8683  C  CB  . MET B 2 207  ? -38.464 -21.800 -37.057 1.00 44.16  ? 761  MET C CB  1 
ATOM   8684  C  CG  . MET B 2 207  ? -38.595 -21.828 -35.550 1.00 56.70  ? 761  MET C CG  1 
ATOM   8685  S  SD  . MET B 2 207  ? -39.923 -20.742 -35.007 1.00 67.52  ? 761  MET C SD  1 
ATOM   8686  C  CE  . MET B 2 207  ? -41.307 -21.452 -35.897 1.00 86.30  ? 761  MET C CE  1 
ATOM   8687  N  N   . ASP B 2 208  ? -38.256 -22.729 -39.919 1.00 59.10  ? 762  ASP C N   1 
ATOM   8688  C  CA  . ASP B 2 208  ? -38.267 -22.262 -41.297 1.00 53.17  ? 762  ASP C CA  1 
ATOM   8689  C  C   . ASP B 2 208  ? -38.446 -20.749 -41.299 1.00 55.27  ? 762  ASP C C   1 
ATOM   8690  O  O   . ASP B 2 208  ? -39.262 -20.213 -40.549 1.00 47.26  ? 762  ASP C O   1 
ATOM   8691  C  CB  . ASP B 2 208  ? -39.382 -22.935 -42.101 1.00 48.77  ? 762  ASP C CB  1 
ATOM   8692  C  CG  . ASP B 2 208  ? -39.210 -24.438 -42.195 1.00 56.48  ? 762  ASP C CG  1 
ATOM   8693  O  OD1 . ASP B 2 208  ? -38.461 -24.896 -43.082 1.00 55.25  ? 762  ASP C OD1 1 
ATOM   8694  O  OD2 . ASP B 2 208  ? -39.828 -25.160 -41.385 1.00 69.95  ? 762  ASP C OD2 1 
ATOM   8695  N  N   . GLY B 2 209  ? -37.677 -20.062 -42.136 1.00 47.23  ? 763  GLY C N   1 
ATOM   8696  C  CA  . GLY B 2 209  ? -37.756 -18.616 -42.214 1.00 34.77  ? 763  GLY C CA  1 
ATOM   8697  C  C   . GLY B 2 209  ? -36.666 -17.931 -41.414 1.00 41.39  ? 763  GLY C C   1 
ATOM   8698  O  O   . GLY B 2 209  ? -36.600 -16.702 -41.368 1.00 38.80  ? 763  GLY C O   1 
ATOM   8699  N  N   . ASP B 2 210  ? -35.810 -18.725 -40.777 1.00 33.48  ? 764  ASP C N   1 
ATOM   8700  C  CA  . ASP B 2 210  ? -34.691 -18.177 -40.019 1.00 42.07  ? 764  ASP C CA  1 
ATOM   8701  C  C   . ASP B 2 210  ? -33.666 -17.554 -40.956 1.00 36.31  ? 764  ASP C C   1 
ATOM   8702  O  O   . ASP B 2 210  ? -33.540 -17.958 -42.111 1.00 41.93  ? 764  ASP C O   1 
ATOM   8703  C  CB  . ASP B 2 210  ? -34.036 -19.254 -39.154 1.00 50.03  ? 764  ASP C CB  1 
ATOM   8704  C  CG  . ASP B 2 210  ? -34.843 -19.573 -37.911 1.00 53.15  ? 764  ASP C CG  1 
ATOM   8705  O  OD1 . ASP B 2 210  ? -35.790 -18.817 -37.609 1.00 50.13  ? 764  ASP C OD1 1 
ATOM   8706  O  OD2 . ASP B 2 210  ? -34.527 -20.571 -37.230 1.00 48.12  ? 764  ASP C OD2 1 
ATOM   8707  N  N   . ILE B 2 211  ? -32.933 -16.569 -40.448 1.00 37.42  ? 765  ILE C N   1 
ATOM   8708  C  CA  . ILE B 2 211  ? -32.012 -15.802 -41.276 1.00 27.16  ? 765  ILE C CA  1 
ATOM   8709  C  C   . ILE B 2 211  ? -30.577 -15.846 -40.769 1.00 32.44  ? 765  ILE C C   1 
ATOM   8710  O  O   . ILE B 2 211  ? -30.301 -15.510 -39.615 1.00 45.88  ? 765  ILE C O   1 
ATOM   8711  C  CB  . ILE B 2 211  ? -32.440 -14.328 -41.365 1.00 29.40  ? 765  ILE C CB  1 
ATOM   8712  C  CG1 . ILE B 2 211  ? -33.881 -14.217 -41.860 1.00 32.50  ? 765  ILE C CG1 1 
ATOM   8713  C  CG2 . ILE B 2 211  ? -31.496 -13.555 -42.271 1.00 27.74  ? 765  ILE C CG2 1 
ATOM   8714  C  CD1 . ILE B 2 211  ? -34.415 -12.803 -41.845 1.00 43.21  ? 765  ILE C CD1 1 
ATOM   8715  N  N   . ILE B 2 212  ? -29.664 -16.248 -41.645 1.00 31.48  ? 766  ILE C N   1 
ATOM   8716  C  CA  . ILE B 2 212  ? -28.243 -16.181 -41.344 1.00 29.49  ? 766  ILE C CA  1 
ATOM   8717  C  C   . ILE B 2 212  ? -27.572 -15.063 -42.140 1.00 35.12  ? 766  ILE C C   1 
ATOM   8718  O  O   . ILE B 2 212  ? -27.625 -15.033 -43.374 1.00 38.85  ? 766  ILE C O   1 
ATOM   8719  C  CB  . ILE B 2 212  ? -27.537 -17.515 -41.632 1.00 35.02  ? 766  ILE C CB  1 
ATOM   8720  C  CG1 . ILE B 2 212  ? -27.985 -18.576 -40.625 1.00 28.39  ? 766  ILE C CG1 1 
ATOM   8721  C  CG2 . ILE B 2 212  ? -26.029 -17.341 -41.570 1.00 33.63  ? 766  ILE C CG2 1 
ATOM   8722  C  CD1 . ILE B 2 212  ? -27.271 -19.901 -40.776 1.00 29.69  ? 766  ILE C CD1 1 
ATOM   8723  N  N   . VAL B 2 213  ? -26.959 -14.134 -41.416 1.00 31.90  ? 767  VAL C N   1 
ATOM   8724  C  CA  . VAL B 2 213  ? -26.195 -13.056 -42.023 1.00 28.13  ? 767  VAL C CA  1 
ATOM   8725  C  C   . VAL B 2 213  ? -24.725 -13.440 -41.994 1.00 37.16  ? 767  VAL C C   1 
ATOM   8726  O  O   . VAL B 2 213  ? -24.260 -13.990 -41.010 1.00 46.50  ? 767  VAL C O   1 
ATOM   8727  C  CB  . VAL B 2 213  ? -26.397 -11.724 -41.279 1.00 27.50  ? 767  VAL C CB  1 
ATOM   8728  C  CG1 . VAL B 2 213  ? -25.885 -10.565 -42.115 1.00 29.36  ? 767  VAL C CG1 1 
ATOM   8729  C  CG2 . VAL B 2 213  ? -27.863 -11.531 -40.937 1.00 31.61  ? 767  VAL C CG2 1 
ATOM   8730  N  N   . PHE B 2 214  ? -23.987 -13.171 -43.063 1.00 37.12  ? 768  PHE C N   1 
ATOM   8731  C  CA  . PHE B 2 214  ? -22.567 -13.497 -43.057 1.00 38.73  ? 768  PHE C CA  1 
ATOM   8732  C  C   . PHE B 2 214  ? -21.735 -12.408 -43.712 1.00 30.83  ? 768  PHE C C   1 
ATOM   8733  O  O   . PHE B 2 214  ? -22.213 -11.686 -44.587 1.00 42.95  ? 768  PHE C O   1 
ATOM   8734  C  CB  . PHE B 2 214  ? -22.312 -14.843 -43.746 1.00 49.64  ? 768  PHE C CB  1 
ATOM   8735  C  CG  . PHE B 2 214  ? -22.773 -14.895 -45.174 1.00 46.71  ? 768  PHE C CG  1 
ATOM   8736  C  CD1 . PHE B 2 214  ? -21.923 -14.533 -46.206 1.00 45.02  ? 768  PHE C CD1 1 
ATOM   8737  C  CD2 . PHE B 2 214  ? -24.052 -15.322 -45.484 1.00 39.21  ? 768  PHE C CD2 1 
ATOM   8738  C  CE1 . PHE B 2 214  ? -22.346 -14.586 -47.520 1.00 52.68  ? 768  PHE C CE1 1 
ATOM   8739  C  CE2 . PHE B 2 214  ? -24.481 -15.377 -46.797 1.00 45.47  ? 768  PHE C CE2 1 
ATOM   8740  C  CZ  . PHE B 2 214  ? -23.626 -15.009 -47.816 1.00 46.08  ? 768  PHE C CZ  1 
ATOM   8741  N  N   . GLN B 2 215  ? -20.485 -12.289 -43.279 1.00 41.46  ? 769  GLN C N   1 
ATOM   8742  C  CA  . GLN B 2 215  ? -19.589 -11.294 -43.855 1.00 40.55  ? 769  GLN C CA  1 
ATOM   8743  C  C   . GLN B 2 215  ? -18.173 -11.836 -43.965 1.00 53.53  ? 769  GLN C C   1 
ATOM   8744  O  O   . GLN B 2 215  ? -17.841 -12.846 -43.354 1.00 52.60  ? 769  GLN C O   1 
ATOM   8745  C  CB  . GLN B 2 215  ? -19.597 -10.016 -43.016 1.00 43.53  ? 769  GLN C CB  1 
ATOM   8746  C  CG  . GLN B 2 215  ? -19.154 -10.216 -41.579 1.00 33.69  ? 769  GLN C CG  1 
ATOM   8747  C  CD  . GLN B 2 215  ? -19.327 -8.967  -40.740 1.00 40.18  ? 769  GLN C CD  1 
ATOM   8748  O  OE1 . GLN B 2 215  ? -20.274 -8.857  -39.963 1.00 50.52  ? 769  GLN C OE1 1 
ATOM   8749  N  NE2 . GLN B 2 215  ? -18.413 -8.017  -40.895 1.00 38.83  ? 769  GLN C NE2 1 
ATOM   8750  N  N   . LYS B 2 216  ? -17.342 -11.168 -44.759 1.00 53.74  ? 770  LYS C N   1 
ATOM   8751  C  CA  . LYS B 2 216  ? -15.932 -11.523 -44.838 1.00 44.93  ? 770  LYS C CA  1 
ATOM   8752  C  C   . LYS B 2 216  ? -15.277 -11.361 -43.476 1.00 54.63  ? 770  LYS C C   1 
ATOM   8753  O  O   . LYS B 2 216  ? -15.616 -10.449 -42.724 1.00 64.31  ? 770  LYS C O   1 
ATOM   8754  C  CB  . LYS B 2 216  ? -15.195 -10.653 -45.858 1.00 50.91  ? 770  LYS C CB  1 
ATOM   8755  C  CG  . LYS B 2 216  ? -15.375 -11.038 -47.314 1.00 51.68  ? 770  LYS C CG  1 
ATOM   8756  C  CD  . LYS B 2 216  ? -14.429 -10.209 -48.172 1.00 47.75  ? 770  LYS C CD  1 
ATOM   8757  C  CE  . LYS B 2 216  ? -14.738 -10.319 -49.653 1.00 56.73  ? 770  LYS C CE  1 
ATOM   8758  N  NZ  . LYS B 2 216  ? -13.878 -9.392  -50.444 1.00 56.13  ? 770  LYS C NZ  1 
ATOM   8759  N  N   . ASP B 2 217  ? -14.345 -12.250 -43.154 1.00 60.02  ? 771  ASP C N   1 
ATOM   8760  C  CA  . ASP B 2 217  ? -13.471 -12.022 -42.015 1.00 54.93  ? 771  ASP C CA  1 
ATOM   8761  C  C   . ASP B 2 217  ? -12.238 -11.301 -42.537 1.00 58.73  ? 771  ASP C C   1 
ATOM   8762  O  O   . ASP B 2 217  ? -11.367 -11.910 -43.156 1.00 57.90  ? 771  ASP C O   1 
ATOM   8763  C  CB  . ASP B 2 217  ? -13.096 -13.329 -41.317 1.00 73.71  ? 771  ASP C CB  1 
ATOM   8764  C  CG  . ASP B 2 217  ? -12.448 -13.098 -39.965 1.00 79.80  ? 771  ASP C CG  1 
ATOM   8765  O  OD1 . ASP B 2 217  ? -12.675 -12.021 -39.371 1.00 72.16  ? 771  ASP C OD1 1 
ATOM   8766  O  OD2 . ASP B 2 217  ? -11.718 -13.994 -39.495 1.00 80.20  ? 771  ASP C OD2 1 
ATOM   8767  N  N   . ASP B 2 218  ? -12.183 -9.996  -42.297 1.00 66.10  ? 772  ASP C N   1 
ATOM   8768  C  CA  . ASP B 2 218  ? -11.179 -9.143  -42.917 1.00 56.47  ? 772  ASP C CA  1 
ATOM   8769  C  C   . ASP B 2 218  ? -10.892 -7.942  -42.024 1.00 61.80  ? 772  ASP C C   1 
ATOM   8770  O  O   . ASP B 2 218  ? -11.815 -7.245  -41.610 1.00 68.96  ? 772  ASP C O   1 
ATOM   8771  C  CB  . ASP B 2 218  ? -11.663 -8.690  -44.300 1.00 64.97  ? 772  ASP C CB  1 
ATOM   8772  C  CG  . ASP B 2 218  ? -10.557 -8.093  -45.153 1.00 90.77  ? 772  ASP C CG  1 
ATOM   8773  O  OD1 . ASP B 2 218  ? -9.771  -7.267  -44.645 1.00 78.07  ? 772  ASP C OD1 1 
ATOM   8774  O  OD2 . ASP B 2 218  ? -10.482 -8.453  -46.346 1.00 80.82  ? 772  ASP C OD2 1 
ATOM   8775  N  N   . PRO B 2 219  ? -9.606  -7.703  -41.718 1.00 71.02  ? 773  PRO C N   1 
ATOM   8776  C  CA  . PRO B 2 219  ? -9.171  -6.567  -40.893 1.00 75.33  ? 773  PRO C CA  1 
ATOM   8777  C  C   . PRO B 2 219  ? -9.692  -5.217  -41.390 1.00 70.36  ? 773  PRO C C   1 
ATOM   8778  O  O   . PRO B 2 219  ? -9.979  -4.336  -40.573 1.00 74.60  ? 773  PRO C O   1 
ATOM   8779  C  CB  . PRO B 2 219  ? -7.637  -6.627  -40.987 1.00 71.96  ? 773  PRO C CB  1 
ATOM   8780  C  CG  . PRO B 2 219  ? -7.331  -7.613  -42.085 1.00 62.56  ? 773  PRO C CG  1 
ATOM   8781  C  CD  . PRO B 2 219  ? -8.476  -8.565  -42.093 1.00 58.76  ? 773  PRO C CD  1 
ATOM   8782  N  N   . GLU B 2 220  ? -9.831  -5.072  -42.706 1.00 69.85  ? 774  GLU C N   1 
ATOM   8783  C  CA  . GLU B 2 220  ? -10.343 -3.841  -43.308 1.00 84.48  ? 774  GLU C CA  1 
ATOM   8784  C  C   . GLU B 2 220  ? -11.676 -3.404  -42.711 1.00 88.93  ? 774  GLU C C   1 
ATOM   8785  O  O   . GLU B 2 220  ? -11.995 -2.213  -42.688 1.00 81.13  ? 774  GLU C O   1 
ATOM   8786  C  CB  . GLU B 2 220  ? -10.494 -4.014  -44.822 1.00 78.94  ? 774  GLU C CB  1 
ATOM   8787  C  CG  . GLU B 2 220  ? -9.326  -3.489  -45.640 1.00 99.43  ? 774  GLU C CG  1 
ATOM   8788  C  CD  . GLU B 2 220  ? -9.414  -1.995  -45.908 1.00 116.62 ? 774  GLU C CD  1 
ATOM   8789  O  OE1 . GLU B 2 220  ? -9.066  -1.575  -47.032 1.00 123.42 ? 774  GLU C OE1 1 
ATOM   8790  O  OE2 . GLU B 2 220  ? -9.826  -1.239  -45.002 1.00 100.82 ? 774  GLU C OE2 1 
ATOM   8791  N  N   . ASN B 2 221  ? -12.445 -4.374  -42.224 1.00 84.12  ? 775  ASN C N   1 
ATOM   8792  C  CA  . ASN B 2 221  ? -13.746 -4.107  -41.623 1.00 66.41  ? 775  ASN C CA  1 
ATOM   8793  C  C   . ASN B 2 221  ? -13.675 -3.136  -40.452 1.00 72.04  ? 775  ASN C C   1 
ATOM   8794  O  O   . ASN B 2 221  ? -14.658 -2.467  -40.137 1.00 79.05  ? 775  ASN C O   1 
ATOM   8795  C  CB  . ASN B 2 221  ? -14.396 -5.413  -41.159 1.00 62.15  ? 775  ASN C CB  1 
ATOM   8796  C  CG  . ASN B 2 221  ? -14.673 -6.364  -42.304 1.00 66.66  ? 775  ASN C CG  1 
ATOM   8797  O  OD1 . ASN B 2 221  ? -14.764 -5.951  -43.460 1.00 60.04  ? 775  ASN C OD1 1 
ATOM   8798  N  ND2 . ASN B 2 221  ? -14.813 -7.646  -41.987 1.00 50.49  ? 775  ASN C ND2 1 
ATOM   8799  N  N   . ASP B 2 222  ? -12.512 -3.052  -39.814 1.00 69.16  ? 776  ASP C N   1 
ATOM   8800  C  CA  . ASP B 2 222  ? -12.357 -2.172  -38.661 1.00 75.23  ? 776  ASP C CA  1 
ATOM   8801  C  C   . ASP B 2 222  ? -12.220 -0.709  -39.068 1.00 75.48  ? 776  ASP C C   1 
ATOM   8802  O  O   . ASP B 2 222  ? -12.134 0.175   -38.216 1.00 72.32  ? 776  ASP C O   1 
ATOM   8803  C  CB  . ASP B 2 222  ? -11.153 -2.598  -37.821 1.00 62.35  ? 776  ASP C CB  1 
ATOM   8804  C  CG  . ASP B 2 222  ? -11.349 -3.953  -37.177 1.00 74.01  ? 776  ASP C CG  1 
ATOM   8805  O  OD1 . ASP B 2 222  ? -12.085 -4.030  -36.170 1.00 78.41  ? 776  ASP C OD1 1 
ATOM   8806  O  OD2 . ASP B 2 222  ? -10.772 -4.940  -37.676 1.00 72.61  ? 776  ASP C OD2 1 
ATOM   8807  N  N   . ASN B 2 223  ? -12.198 -0.457  -40.372 1.00 76.15  ? 777  ASN C N   1 
ATOM   8808  C  CA  . ASN B 2 223  ? -12.177 0.910   -40.878 1.00 81.13  ? 777  ASN C CA  1 
ATOM   8809  C  C   . ASN B 2 223  ? -13.593 1.430   -41.080 1.00 80.82  ? 777  ASN C C   1 
ATOM   8810  O  O   . ASN B 2 223  ? -13.825 2.638   -41.143 1.00 79.70  ? 777  ASN C O   1 
ATOM   8811  C  CB  . ASN B 2 223  ? -11.390 0.988   -42.185 1.00 84.95  ? 777  ASN C CB  1 
ATOM   8812  C  CG  . ASN B 2 223  ? -9.929  0.638   -42.003 1.00 97.98  ? 777  ASN C CG  1 
ATOM   8813  O  OD1 . ASN B 2 223  ? -9.356  0.856   -40.935 1.00 87.24  ? 777  ASN C OD1 1 
ATOM   8814  N  ND2 . ASN B 2 223  ? -9.315  0.093   -43.047 1.00 88.52  ? 777  ASN C ND2 1 
ATOM   8815  N  N   . SER B 2 224  ? -14.536 0.501   -41.185 1.00 81.01  ? 778  SER C N   1 
ATOM   8816  C  CA  . SER B 2 224  ? -15.944 0.848   -41.294 1.00 64.10  ? 778  SER C CA  1 
ATOM   8817  C  C   . SER B 2 224  ? -16.466 1.330   -39.950 1.00 65.81  ? 778  SER C C   1 
ATOM   8818  O  O   . SER B 2 224  ? -15.999 0.885   -38.902 1.00 71.70  ? 778  SER C O   1 
ATOM   8819  C  CB  . SER B 2 224  ? -16.757 -0.353  -41.776 1.00 65.68  ? 778  SER C CB  1 
ATOM   8820  O  OG  . SER B 2 224  ? -18.142 -0.054  -41.799 1.00 59.89  ? 778  SER C OG  1 
ATOM   8821  N  N   . GLU B 2 225  ? -17.432 2.241   -39.978 1.00 57.91  ? 779  GLU C N   1 
ATOM   8822  C  CA  . GLU B 2 225  ? -18.038 2.719   -38.743 1.00 63.85  ? 779  GLU C CA  1 
ATOM   8823  C  C   . GLU B 2 225  ? -18.989 1.660   -38.190 1.00 59.67  ? 779  GLU C C   1 
ATOM   8824  O  O   . GLU B 2 225  ? -19.385 1.713   -37.027 1.00 70.59  ? 779  GLU C O   1 
ATOM   8825  C  CB  . GLU B 2 225  ? -18.764 4.046   -38.973 1.00 66.55  ? 779  GLU C CB  1 
ATOM   8826  C  CG  . GLU B 2 225  ? -19.833 3.998   -40.044 1.00 88.28  ? 779  GLU C CG  1 
ATOM   8827  C  CD  . GLU B 2 225  ? -20.376 5.372   -40.381 1.00 111.25 ? 779  GLU C CD  1 
ATOM   8828  O  OE1 . GLU B 2 225  ? -19.666 6.369   -40.132 1.00 121.42 ? 779  GLU C OE1 1 
ATOM   8829  O  OE2 . GLU B 2 225  ? -21.513 5.457   -40.892 1.00 88.81  ? 779  GLU C OE2 1 
ATOM   8830  N  N   . LEU B 2 226  ? -19.342 0.696   -39.036 1.00 55.90  ? 780  LEU C N   1 
ATOM   8831  C  CA  . LEU B 2 226  ? -20.123 -0.464  -38.616 1.00 46.54  ? 780  LEU C CA  1 
ATOM   8832  C  C   . LEU B 2 226  ? -19.456 -1.752  -39.095 1.00 46.33  ? 780  LEU C C   1 
ATOM   8833  O  O   . LEU B 2 226  ? -19.889 -2.352  -40.078 1.00 47.70  ? 780  LEU C O   1 
ATOM   8834  C  CB  . LEU B 2 226  ? -21.552 -0.378  -39.152 1.00 46.49  ? 780  LEU C CB  1 
ATOM   8835  C  CG  . LEU B 2 226  ? -22.387 0.826   -38.715 1.00 50.29  ? 780  LEU C CG  1 
ATOM   8836  C  CD1 . LEU B 2 226  ? -23.743 0.800   -39.397 1.00 43.78  ? 780  LEU C CD1 1 
ATOM   8837  C  CD2 . LEU B 2 226  ? -22.549 0.850   -37.205 1.00 37.57  ? 780  LEU C CD2 1 
ATOM   8838  N  N   . PRO B 2 227  ? -18.392 -2.179  -38.396 1.00 54.22  ? 781  PRO C N   1 
ATOM   8839  C  CA  . PRO B 2 227  ? -17.552 -3.316  -38.792 1.00 46.07  ? 781  PRO C CA  1 
ATOM   8840  C  C   . PRO B 2 227  ? -18.295 -4.643  -38.926 1.00 51.04  ? 781  PRO C C   1 
ATOM   8841  O  O   . PRO B 2 227  ? -17.909 -5.470  -39.750 1.00 61.44  ? 781  PRO C O   1 
ATOM   8842  C  CB  . PRO B 2 227  ? -16.526 -3.398  -37.657 1.00 50.05  ? 781  PRO C CB  1 
ATOM   8843  C  CG  . PRO B 2 227  ? -16.472 -2.022  -37.103 1.00 60.34  ? 781  PRO C CG  1 
ATOM   8844  C  CD  . PRO B 2 227  ? -17.880 -1.523  -37.181 1.00 60.98  ? 781  PRO C CD  1 
ATOM   8845  N  N   . THR B 2 228  ? -19.338 -4.846  -38.126 1.00 52.24  ? 782  THR C N   1 
ATOM   8846  C  CA  . THR B 2 228  ? -20.055 -6.118  -38.131 1.00 40.89  ? 782  THR C CA  1 
ATOM   8847  C  C   . THR B 2 228  ? -21.551 -5.943  -38.360 1.00 38.34  ? 782  THR C C   1 
ATOM   8848  O  O   . THR B 2 228  ? -22.097 -4.856  -38.176 1.00 39.99  ? 782  THR C O   1 
ATOM   8849  C  CB  . THR B 2 228  ? -19.845 -6.883  -36.813 1.00 49.68  ? 782  THR C CB  1 
ATOM   8850  O  OG1 . THR B 2 228  ? -20.266 -6.069  -35.712 1.00 65.64  ? 782  THR C OG1 1 
ATOM   8851  C  CG2 . THR B 2 228  ? -18.381 -7.250  -36.637 1.00 37.13  ? 782  THR C CG2 1 
ATOM   8852  N  N   . ALA B 2 229  ? -22.206 -7.030  -38.758 1.00 41.32  ? 783  ALA C N   1 
ATOM   8853  C  CA  . ALA B 2 229  ? -23.646 -7.027  -38.982 1.00 46.41  ? 783  ALA C CA  1 
ATOM   8854  C  C   . ALA B 2 229  ? -24.396 -6.766  -37.681 1.00 45.85  ? 783  ALA C C   1 
ATOM   8855  O  O   . ALA B 2 229  ? -25.493 -6.208  -37.683 1.00 50.69  ? 783  ALA C O   1 
ATOM   8856  C  CB  . ALA B 2 229  ? -24.089 -8.343  -39.595 1.00 32.76  ? 783  ALA C CB  1 
ATOM   8857  N  N   . LYS B 2 230  ? -23.790 -7.179  -36.573 1.00 41.94  ? 784  LYS C N   1 
ATOM   8858  C  CA  . LYS B 2 230  ? -24.340 -6.946  -35.245 1.00 42.52  ? 784  LYS C CA  1 
ATOM   8859  C  C   . LYS B 2 230  ? -24.498 -5.449  -34.988 1.00 47.21  ? 784  LYS C C   1 
ATOM   8860  O  O   . LYS B 2 230  ? -25.592 -4.963  -34.672 1.00 48.97  ? 784  LYS C O   1 
ATOM   8861  C  CB  . LYS B 2 230  ? -23.434 -7.585  -34.191 1.00 38.78  ? 784  LYS C CB  1 
ATOM   8862  C  CG  . LYS B 2 230  ? -24.012 -7.653  -32.792 1.00 54.63  ? 784  LYS C CG  1 
ATOM   8863  C  CD  . LYS B 2 230  ? -23.130 -8.514  -31.901 1.00 42.19  ? 784  LYS C CD  1 
ATOM   8864  C  CE  . LYS B 2 230  ? -23.652 -8.562  -30.478 1.00 55.41  ? 784  LYS C CE  1 
ATOM   8865  N  NZ  . LYS B 2 230  ? -25.061 -9.039  -30.423 1.00 75.76  ? 784  LYS C NZ  1 
ATOM   8866  N  N   . GLU B 2 231  ? -23.397 -4.722  -35.147 1.00 39.16  ? 785  GLU C N   1 
ATOM   8867  C  CA  . GLU B 2 231  ? -23.395 -3.279  -34.958 1.00 48.32  ? 785  GLU C CA  1 
ATOM   8868  C  C   . GLU B 2 231  ? -24.266 -2.580  -35.992 1.00 50.34  ? 785  GLU C C   1 
ATOM   8869  O  O   . GLU B 2 231  ? -24.858 -1.540  -35.705 1.00 50.58  ? 785  GLU C O   1 
ATOM   8870  C  CB  . GLU B 2 231  ? -21.969 -2.735  -35.019 1.00 44.67  ? 785  GLU C CB  1 
ATOM   8871  C  CG  . GLU B 2 231  ? -21.067 -3.261  -33.922 1.00 56.79  ? 785  GLU C CG  1 
ATOM   8872  C  CD  . GLU B 2 231  ? -19.657 -2.721  -34.022 1.00 87.96  ? 785  GLU C CD  1 
ATOM   8873  O  OE1 . GLU B 2 231  ? -19.497 -1.524  -34.343 1.00 92.91  ? 785  GLU C OE1 1 
ATOM   8874  O  OE2 . GLU B 2 231  ? -18.708 -3.497  -33.786 1.00 101.14 ? 785  GLU C OE2 1 
ATOM   8875  N  N   . TYR B 2 232  ? -24.339 -3.148  -37.192 1.00 45.04  ? 786  TYR C N   1 
ATOM   8876  C  CA  . TYR B 2 232  ? -25.197 -2.590  -38.231 1.00 42.00  ? 786  TYR C CA  1 
ATOM   8877  C  C   . TYR B 2 232  ? -26.655 -2.639  -37.810 1.00 41.53  ? 786  TYR C C   1 
ATOM   8878  O  O   . TYR B 2 232  ? -27.358 -1.635  -37.868 1.00 42.28  ? 786  TYR C O   1 
ATOM   8879  C  CB  . TYR B 2 232  ? -25.028 -3.329  -39.561 1.00 39.51  ? 786  TYR C CB  1 
ATOM   8880  C  CG  . TYR B 2 232  ? -26.115 -2.978  -40.555 1.00 35.90  ? 786  TYR C CG  1 
ATOM   8881  C  CD1 . TYR B 2 232  ? -26.110 -1.755  -41.213 1.00 37.74  ? 786  TYR C CD1 1 
ATOM   8882  C  CD2 . TYR B 2 232  ? -27.161 -3.856  -40.815 1.00 32.52  ? 786  TYR C CD2 1 
ATOM   8883  C  CE1 . TYR B 2 232  ? -27.105 -1.422  -42.111 1.00 33.30  ? 786  TYR C CE1 1 
ATOM   8884  C  CE2 . TYR B 2 232  ? -28.161 -3.531  -41.713 1.00 36.91  ? 786  TYR C CE2 1 
ATOM   8885  C  CZ  . TYR B 2 232  ? -28.127 -2.312  -42.357 1.00 33.91  ? 786  TYR C CZ  1 
ATOM   8886  O  OH  . TYR B 2 232  ? -29.119 -1.982  -43.252 1.00 39.95  ? 786  TYR C OH  1 
ATOM   8887  N  N   . PHE B 2 233  ? -27.109 -3.817  -37.394 1.00 32.19  ? 787  PHE C N   1 
ATOM   8888  C  CA  . PHE B 2 233  ? -28.496 -3.988  -36.984 1.00 34.65  ? 787  PHE C CA  1 
ATOM   8889  C  C   . PHE B 2 233  ? -28.795 -3.206  -35.712 1.00 42.80  ? 787  PHE C C   1 
ATOM   8890  O  O   . PHE B 2 233  ? -29.933 -2.790  -35.484 1.00 39.62  ? 787  PHE C O   1 
ATOM   8891  C  CB  . PHE B 2 233  ? -28.826 -5.469  -36.789 1.00 30.01  ? 787  PHE C CB  1 
ATOM   8892  C  CG  . PHE B 2 233  ? -29.112 -6.195  -38.072 1.00 41.02  ? 787  PHE C CG  1 
ATOM   8893  C  CD1 . PHE B 2 233  ? -30.188 -5.827  -38.864 1.00 38.66  ? 787  PHE C CD1 1 
ATOM   8894  C  CD2 . PHE B 2 233  ? -28.313 -7.249  -38.484 1.00 40.40  ? 787  PHE C CD2 1 
ATOM   8895  C  CE1 . PHE B 2 233  ? -30.458 -6.492  -40.044 1.00 38.01  ? 787  PHE C CE1 1 
ATOM   8896  C  CE2 . PHE B 2 233  ? -28.579 -7.918  -39.664 1.00 38.28  ? 787  PHE C CE2 1 
ATOM   8897  C  CZ  . PHE B 2 233  ? -29.653 -7.539  -40.444 1.00 43.16  ? 787  PHE C CZ  1 
ATOM   8898  N  N   . ARG B 2 234  ? -27.771 -3.001  -34.890 1.00 45.20  ? 788  ARG C N   1 
ATOM   8899  C  CA  . ARG B 2 234  ? -27.930 -2.186  -33.693 1.00 33.41  ? 788  ARG C CA  1 
ATOM   8900  C  C   . ARG B 2 234  ? -28.165 -0.722  -34.057 1.00 45.61  ? 788  ARG C C   1 
ATOM   8901  O  O   . ARG B 2 234  ? -29.155 -0.121  -33.637 1.00 50.17  ? 788  ARG C O   1 
ATOM   8902  C  CB  . ARG B 2 234  ? -26.708 -2.313  -32.786 1.00 44.70  ? 788  ARG C CB  1 
ATOM   8903  C  CG  . ARG B 2 234  ? -26.776 -1.442  -31.545 1.00 56.44  ? 788  ARG C CG  1 
ATOM   8904  C  CD  . ARG B 2 234  ? -25.654 -1.774  -30.582 1.00 50.33  ? 788  ARG C CD  1 
ATOM   8905  N  NE  . ARG B 2 234  ? -25.787 -3.126  -30.050 1.00 71.05  ? 788  ARG C NE  1 
ATOM   8906  C  CZ  . ARG B 2 234  ? -24.824 -3.772  -29.404 1.00 83.55  ? 788  ARG C CZ  1 
ATOM   8907  N  NH1 . ARG B 2 234  ? -23.646 -3.193  -29.214 1.00 79.85  ? 788  ARG C NH1 1 
ATOM   8908  N  NH2 . ARG B 2 234  ? -25.035 -5.002  -28.954 1.00 61.36  ? 788  ARG C NH2 1 
ATOM   8909  N  N   . ASP B 2 235  ? -27.249 -0.159  -34.842 1.00 38.64  ? 789  ASP C N   1 
ATOM   8910  C  CA  . ASP B 2 235  ? -27.349 1.226   -35.294 1.00 41.75  ? 789  ASP C CA  1 
ATOM   8911  C  C   . ASP B 2 235  ? -28.640 1.459   -36.073 1.00 43.52  ? 789  ASP C C   1 
ATOM   8912  O  O   . ASP B 2 235  ? -29.250 2.524   -35.982 1.00 46.30  ? 789  ASP C O   1 
ATOM   8913  C  CB  . ASP B 2 235  ? -26.138 1.593   -36.157 1.00 51.40  ? 789  ASP C CB  1 
ATOM   8914  C  CG  . ASP B 2 235  ? -26.228 2.995   -36.729 1.00 49.90  ? 789  ASP C CG  1 
ATOM   8915  O  OD1 . ASP B 2 235  ? -25.820 3.950   -36.034 1.00 55.52  ? 789  ASP C OD1 1 
ATOM   8916  O  OD2 . ASP B 2 235  ? -26.701 3.142   -37.875 1.00 48.90  ? 789  ASP C OD2 1 
ATOM   8917  N  N   . LEU B 2 236  ? -29.050 0.449   -36.833 1.00 49.35  ? 790  LEU C N   1 
ATOM   8918  C  CA  . LEU B 2 236  ? -30.289 0.509   -37.597 1.00 52.34  ? 790  LEU C CA  1 
ATOM   8919  C  C   . LEU B 2 236  ? -31.496 0.510   -36.669 1.00 45.71  ? 790  LEU C C   1 
ATOM   8920  O  O   . LEU B 2 236  ? -32.482 1.206   -36.918 1.00 48.22  ? 790  LEU C O   1 
ATOM   8921  C  CB  . LEU B 2 236  ? -30.377 -0.666  -38.572 1.00 41.68  ? 790  LEU C CB  1 
ATOM   8922  C  CG  . LEU B 2 236  ? -31.682 -0.804  -39.359 1.00 34.98  ? 790  LEU C CG  1 
ATOM   8923  C  CD1 . LEU B 2 236  ? -31.869 0.374   -40.302 1.00 33.22  ? 790  LEU C CD1 1 
ATOM   8924  C  CD2 . LEU B 2 236  ? -31.716 -2.117  -40.121 1.00 41.09  ? 790  LEU C CD2 1 
ATOM   8925  N  N   . TYR B 2 237  ? -31.411 -0.275  -35.599 1.00 39.17  ? 791  TYR C N   1 
ATOM   8926  C  CA  . TYR B 2 237  ? -32.492 -0.363  -34.624 1.00 28.42  ? 791  TYR C CA  1 
ATOM   8927  C  C   . TYR B 2 237  ? -32.759 0.982   -33.957 1.00 44.50  ? 791  TYR C C   1 
ATOM   8928  O  O   . TYR B 2 237  ? -33.894 1.289   -33.600 1.00 48.82  ? 791  TYR C O   1 
ATOM   8929  C  CB  . TYR B 2 237  ? -32.168 -1.419  -33.566 1.00 40.02  ? 791  TYR C CB  1 
ATOM   8930  C  CG  . TYR B 2 237  ? -33.245 -1.603  -32.521 1.00 42.06  ? 791  TYR C CG  1 
ATOM   8931  C  CD1 . TYR B 2 237  ? -34.411 -2.297  -32.814 1.00 45.36  ? 791  TYR C CD1 1 
ATOM   8932  C  CD2 . TYR B 2 237  ? -33.094 -1.086  -31.241 1.00 46.30  ? 791  TYR C CD2 1 
ATOM   8933  C  CE1 . TYR B 2 237  ? -35.396 -2.471  -31.864 1.00 48.53  ? 791  TYR C CE1 1 
ATOM   8934  C  CE2 . TYR B 2 237  ? -34.074 -1.256  -30.282 1.00 49.56  ? 791  TYR C CE2 1 
ATOM   8935  C  CZ  . TYR B 2 237  ? -35.223 -1.949  -30.600 1.00 47.26  ? 791  TYR C CZ  1 
ATOM   8936  O  OH  . TYR B 2 237  ? -36.202 -2.120  -29.650 1.00 47.83  ? 791  TYR C OH  1 
ATOM   8937  N  N   . HIS B 2 238  ? -31.708 1.781   -33.803 1.00 52.05  ? 792  HIS C N   1 
ATOM   8938  C  CA  . HIS B 2 238  ? -31.805 3.070   -33.126 1.00 47.74  ? 792  HIS C CA  1 
ATOM   8939  C  C   . HIS B 2 238  ? -31.859 4.240   -34.105 1.00 46.89  ? 792  HIS C C   1 
ATOM   8940  O  O   . HIS B 2 238  ? -31.915 5.400   -33.696 1.00 53.90  ? 792  HIS C O   1 
ATOM   8941  C  CB  . HIS B 2 238  ? -30.626 3.255   -32.168 1.00 37.28  ? 792  HIS C CB  1 
ATOM   8942  C  CG  . HIS B 2 238  ? -30.668 2.351   -30.979 1.00 39.08  ? 792  HIS C CG  1 
ATOM   8943  N  ND1 . HIS B 2 238  ? -31.509 2.572   -29.907 1.00 45.89  ? 792  HIS C ND1 1 
ATOM   8944  C  CD2 . HIS B 2 238  ? -29.974 1.228   -30.681 1.00 45.93  ? 792  HIS C CD2 1 
ATOM   8945  C  CE1 . HIS B 2 238  ? -31.332 1.626   -29.007 1.00 40.47  ? 792  HIS C CE1 1 
ATOM   8946  N  NE2 . HIS B 2 238  ? -30.404 0.795   -29.451 1.00 46.90  ? 792  HIS C NE2 1 
ATOM   8947  N  N   . ARG B 2 239  ? -31.831 3.930   -35.397 1.00 48.80  ? 793  ARG C N   1 
ATOM   8948  C  CA  . ARG B 2 239  ? -31.889 4.954   -36.431 1.00 40.34  ? 793  ARG C CA  1 
ATOM   8949  C  C   . ARG B 2 239  ? -33.309 5.501   -36.544 1.00 41.70  ? 793  ARG C C   1 
ATOM   8950  O  O   . ARG B 2 239  ? -34.280 4.750   -36.448 1.00 48.09  ? 793  ARG C O   1 
ATOM   8951  C  CB  . ARG B 2 239  ? -31.419 4.384   -37.773 1.00 42.31  ? 793  ARG C CB  1 
ATOM   8952  C  CG  . ARG B 2 239  ? -30.631 5.360   -38.630 1.00 50.97  ? 793  ARG C CG  1 
ATOM   8953  C  CD  . ARG B 2 239  ? -30.075 4.683   -39.876 1.00 64.46  ? 793  ARG C CD  1 
ATOM   8954  N  NE  . ARG B 2 239  ? -29.161 3.590   -39.551 1.00 74.33  ? 793  ARG C NE  1 
ATOM   8955  C  CZ  . ARG B 2 239  ? -28.510 2.866   -40.457 1.00 84.79  ? 793  ARG C CZ  1 
ATOM   8956  N  NH1 . ARG B 2 239  ? -28.668 3.118   -41.750 1.00 66.12  ? 793  ARG C NH1 1 
ATOM   8957  N  NH2 . ARG B 2 239  ? -27.699 1.890   -40.071 1.00 59.50  ? 793  ARG C NH2 1 
ATOM   8958  N  N   . VAL B 2 240  ? -33.433 6.811   -36.735 1.00 43.38  ? 794  VAL C N   1 
ATOM   8959  C  CA  . VAL B 2 240  ? -34.749 7.440   -36.839 1.00 43.60  ? 794  VAL C CA  1 
ATOM   8960  C  C   . VAL B 2 240  ? -34.687 8.728   -37.663 1.00 51.76  ? 794  VAL C C   1 
ATOM   8961  O  O   . VAL B 2 240  ? -33.727 9.485   -37.571 1.00 51.28  ? 794  VAL C O   1 
ATOM   8962  C  CB  . VAL B 2 240  ? -35.338 7.735   -35.438 1.00 33.57  ? 794  VAL C CB  1 
ATOM   8963  C  CG1 . VAL B 2 240  ? -34.457 8.712   -34.671 1.00 46.55  ? 794  VAL C CG1 1 
ATOM   8964  C  CG2 . VAL B 2 240  ? -36.756 8.265   -35.549 1.00 43.71  ? 794  VAL C CG2 1 
ATOM   8965  N  N   . ASP B 2 241  ? -35.709 8.965   -38.478 1.00 36.70  ? 795  ASP C N   1 
ATOM   8966  C  CA  . ASP B 2 241  ? -35.759 10.165  -39.307 1.00 45.09  ? 795  ASP C CA  1 
ATOM   8967  C  C   . ASP B 2 241  ? -36.628 11.251  -38.683 1.00 51.95  ? 795  ASP C C   1 
ATOM   8968  O  O   . ASP B 2 241  ? -37.842 11.095  -38.560 1.00 58.48  ? 795  ASP C O   1 
ATOM   8969  C  CB  . ASP B 2 241  ? -36.272 9.823   -40.706 1.00 58.44  ? 795  ASP C CB  1 
ATOM   8970  C  CG  . ASP B 2 241  ? -35.250 9.068   -41.531 1.00 66.92  ? 795  ASP C CG  1 
ATOM   8971  O  OD1 . ASP B 2 241  ? -34.289 8.526   -40.945 1.00 62.55  ? 795  ASP C OD1 1 
ATOM   8972  O  OD2 . ASP B 2 241  ? -35.409 9.015   -42.768 1.00 74.27  ? 795  ASP C OD2 1 
ATOM   8973  N  N   . VAL B 2 242  ? -35.997 12.358  -38.304 1.00 44.69  ? 796  VAL C N   1 
ATOM   8974  C  CA  . VAL B 2 242  ? -36.685 13.444  -37.617 1.00 38.65  ? 796  VAL C CA  1 
ATOM   8975  C  C   . VAL B 2 242  ? -36.921 14.644  -38.527 1.00 48.17  ? 796  VAL C C   1 
ATOM   8976  O  O   . VAL B 2 242  ? -36.013 15.092  -39.225 1.00 57.06  ? 796  VAL C O   1 
ATOM   8977  C  CB  . VAL B 2 242  ? -35.893 13.909  -36.383 1.00 55.61  ? 796  VAL C CB  1 
ATOM   8978  C  CG1 . VAL B 2 242  ? -36.647 15.003  -35.646 1.00 54.94  ? 796  VAL C CG1 1 
ATOM   8979  C  CG2 . VAL B 2 242  ? -35.617 12.736  -35.463 1.00 51.93  ? 796  VAL C CG2 1 
ATOM   8980  N  N   . ILE B 2 243  ? -38.146 15.163  -38.511 1.00 56.46  ? 797  ILE C N   1 
ATOM   8981  C  CA  . ILE B 2 243  ? -38.480 16.367  -39.261 1.00 51.36  ? 797  ILE C CA  1 
ATOM   8982  C  C   . ILE B 2 243  ? -38.469 17.596  -38.360 1.00 48.74  ? 797  ILE C C   1 
ATOM   8983  O  O   . ILE B 2 243  ? -39.351 17.764  -37.520 1.00 49.14  ? 797  ILE C O   1 
ATOM   8984  C  CB  . ILE B 2 243  ? -39.861 16.259  -39.928 1.00 53.36  ? 797  ILE C CB  1 
ATOM   8985  C  CG1 . ILE B 2 243  ? -39.934 15.011  -40.807 1.00 60.34  ? 797  ILE C CG1 1 
ATOM   8986  C  CG2 . ILE B 2 243  ? -40.155 17.512  -40.740 1.00 53.98  ? 797  ILE C CG2 1 
ATOM   8987  C  CD1 . ILE B 2 243  ? -41.291 14.790  -41.435 1.00 62.11  ? 797  ILE C CD1 1 
ATOM   8988  N  N   . PHE B 2 244  ? -37.472 18.455  -38.538 1.00 50.17  ? 798  PHE C N   1 
ATOM   8989  C  CA  . PHE B 2 244  ? -37.380 19.679  -37.752 1.00 47.03  ? 798  PHE C CA  1 
ATOM   8990  C  C   . PHE B 2 244  ? -38.103 20.831  -38.438 1.00 54.32  ? 798  PHE C C   1 
ATOM   8991  O  O   . PHE B 2 244  ? -37.889 21.092  -39.625 1.00 60.09  ? 798  PHE C O   1 
ATOM   8992  C  CB  . PHE B 2 244  ? -35.919 20.049  -37.500 1.00 41.55  ? 798  PHE C CB  1 
ATOM   8993  C  CG  . PHE B 2 244  ? -35.169 19.026  -36.700 1.00 57.95  ? 798  PHE C CG  1 
ATOM   8994  C  CD1 . PHE B 2 244  ? -35.209 19.043  -35.316 1.00 62.98  ? 798  PHE C CD1 1 
ATOM   8995  C  CD2 . PHE B 2 244  ? -34.428 18.041  -37.331 1.00 58.69  ? 798  PHE C CD2 1 
ATOM   8996  C  CE1 . PHE B 2 244  ? -34.521 18.098  -34.577 1.00 54.79  ? 798  PHE C CE1 1 
ATOM   8997  C  CE2 . PHE B 2 244  ? -33.738 17.097  -36.597 1.00 58.78  ? 798  PHE C CE2 1 
ATOM   8998  C  CZ  . PHE B 2 244  ? -33.784 17.125  -35.219 1.00 46.59  ? 798  PHE C CZ  1 
ATOM   8999  N  N   . CYS B 2 245  ? -38.955 21.514  -37.675 1.00 58.30  ? 799  CYS C N   1 
ATOM   9000  C  CA  . CYS B 2 245  ? -39.783 22.598  -38.194 1.00 56.55  ? 799  CYS C CA  1 
ATOM   9001  C  C   . CYS B 2 245  ? -39.711 23.850  -37.327 1.00 55.73  ? 799  CYS C C   1 
ATOM   9002  O  O   . CYS B 2 245  ? -39.734 23.772  -36.099 1.00 63.01  ? 799  CYS C O   1 
ATOM   9003  C  CB  . CYS B 2 245  ? -41.240 22.145  -38.309 1.00 42.09  ? 799  CYS C CB  1 
ATOM   9004  S  SG  . CYS B 2 245  ? -41.503 20.753  -39.416 1.00 61.74  ? 799  CYS C SG  1 
ATOM   9005  N  N   . ASP B 2 246  ? -39.633 25.005  -37.978 1.00 64.62  ? 800  ASP C N   1 
ATOM   9006  C  CA  . ASP B 2 246  ? -39.635 26.287  -37.284 1.00 57.80  ? 800  ASP C CA  1 
ATOM   9007  C  C   . ASP B 2 246  ? -41.072 26.701  -36.980 1.00 57.96  ? 800  ASP C C   1 
ATOM   9008  O  O   . ASP B 2 246  ? -41.892 26.828  -37.888 1.00 57.05  ? 800  ASP C O   1 
ATOM   9009  C  CB  . ASP B 2 246  ? -38.926 27.349  -38.128 1.00 55.66  ? 800  ASP C CB  1 
ATOM   9010  C  CG  . ASP B 2 246  ? -38.619 28.615  -37.350 1.00 59.89  ? 800  ASP C CG  1 
ATOM   9011  O  OD1 . ASP B 2 246  ? -39.514 29.129  -36.649 1.00 65.53  ? 800  ASP C OD1 1 
ATOM   9012  O  OD2 . ASP B 2 246  ? -37.471 29.100  -37.442 1.00 60.28  ? 800  ASP C OD2 1 
ATOM   9013  N  N   . LYS B 2 247  ? -41.373 26.915  -35.702 1.00 56.10  ? 801  LYS C N   1 
ATOM   9014  C  CA  . LYS B 2 247  ? -42.739 27.219  -35.282 1.00 65.43  ? 801  LYS C CA  1 
ATOM   9015  C  C   . LYS B 2 247  ? -43.189 28.602  -35.739 1.00 65.28  ? 801  LYS C C   1 
ATOM   9016  O  O   . LYS B 2 247  ? -44.386 28.874  -35.827 1.00 70.95  ? 801  LYS C O   1 
ATOM   9017  C  CB  . LYS B 2 247  ? -42.872 27.111  -33.761 1.00 62.31  ? 801  LYS C CB  1 
ATOM   9018  C  CG  . LYS B 2 247  ? -42.057 28.133  -32.990 1.00 63.76  ? 801  LYS C CG  1 
ATOM   9019  C  CD  . LYS B 2 247  ? -42.485 28.187  -31.535 1.00 54.86  ? 801  LYS C CD  1 
ATOM   9020  C  CE  . LYS B 2 247  ? -43.938 28.610  -31.407 1.00 69.87  ? 801  LYS C CE  1 
ATOM   9021  N  NZ  . LYS B 2 247  ? -44.374 28.669  -29.985 1.00 65.34  ? 801  LYS C NZ  1 
ATOM   9022  N  N   . THR B 2 248  ? -42.229 29.475  -36.025 1.00 64.53  ? 802  THR C N   1 
ATOM   9023  C  CA  . THR B 2 248  ? -42.541 30.818  -36.496 1.00 67.00  ? 802  THR C CA  1 
ATOM   9024  C  C   . THR B 2 248  ? -42.998 30.779  -37.949 1.00 69.66  ? 802  THR C C   1 
ATOM   9025  O  O   . THR B 2 248  ? -43.960 31.448  -38.327 1.00 74.76  ? 802  THR C O   1 
ATOM   9026  C  CB  . THR B 2 248  ? -41.332 31.761  -36.367 1.00 72.64  ? 802  THR C CB  1 
ATOM   9027  O  OG1 . THR B 2 248  ? -40.297 31.343  -37.266 1.00 70.50  ? 802  THR C OG1 1 
ATOM   9028  C  CG2 . THR B 2 248  ? -40.800 31.747  -34.945 1.00 60.07  ? 802  THR C CG2 1 
ATOM   9029  N  N   . ILE B 2 249  ? -42.301 29.986  -38.757 1.00 69.32  ? 803  ILE C N   1 
ATOM   9030  C  CA  . ILE B 2 249  ? -42.621 29.849  -40.172 1.00 63.94  ? 803  ILE C CA  1 
ATOM   9031  C  C   . ILE B 2 249  ? -43.938 29.114  -40.374 1.00 60.08  ? 803  ILE C C   1 
ATOM   9032  O  O   . ILE B 2 249  ? -44.085 27.966  -39.953 1.00 63.51  ? 803  ILE C O   1 
ATOM   9033  C  CB  . ILE B 2 249  ? -41.517 29.096  -40.933 1.00 59.33  ? 803  ILE C CB  1 
ATOM   9034  C  CG1 . ILE B 2 249  ? -40.141 29.672  -40.594 1.00 53.21  ? 803  ILE C CG1 1 
ATOM   9035  C  CG2 . ILE B 2 249  ? -41.775 29.148  -42.430 1.00 56.81  ? 803  ILE C CG2 1 
ATOM   9036  C  CD1 . ILE B 2 249  ? -39.970 31.116  -40.997 1.00 69.34  ? 803  ILE C CD1 1 
ATOM   9037  N  N   . PRO B 2 250  ? -44.910 29.779  -41.015 1.00 81.83  ? 804  PRO C N   1 
ATOM   9038  C  CA  . PRO B 2 250  ? -46.202 29.145  -41.289 1.00 83.60  ? 804  PRO C CA  1 
ATOM   9039  C  C   . PRO B 2 250  ? -46.069 27.996  -42.280 1.00 79.15  ? 804  PRO C C   1 
ATOM   9040  O  O   . PRO B 2 250  ? -45.444 28.170  -43.326 1.00 85.67  ? 804  PRO C O   1 
ATOM   9041  C  CB  . PRO B 2 250  ? -47.039 30.284  -41.888 1.00 75.06  ? 804  PRO C CB  1 
ATOM   9042  C  CG  . PRO B 2 250  ? -46.327 31.539  -41.503 1.00 76.69  ? 804  PRO C CG  1 
ATOM   9043  C  CD  . PRO B 2 250  ? -44.879 31.178  -41.469 1.00 77.57  ? 804  PRO C CD  1 
ATOM   9044  N  N   . ASN B 2 251  ? -46.656 26.849  -41.948 1.00 70.40  ? 805  ASN C N   1 
ATOM   9045  C  CA  . ASN B 2 251  ? -46.648 25.677  -42.817 1.00 79.04  ? 805  ASN C CA  1 
ATOM   9046  C  C   . ASN B 2 251  ? -45.258 25.279  -43.297 1.00 83.84  ? 805  ASN C C   1 
ATOM   9047  O  O   . ASN B 2 251  ? -45.097 24.805  -44.423 1.00 85.57  ? 805  ASN C O   1 
ATOM   9048  C  CB  . ASN B 2 251  ? -47.551 25.915  -44.027 1.00 75.89  ? 805  ASN C CB  1 
ATOM   9049  C  CG  . ASN B 2 251  ? -48.987 26.183  -43.636 1.00 91.02  ? 805  ASN C CG  1 
ATOM   9050  O  OD1 . ASN B 2 251  ? -49.336 27.294  -43.235 1.00 96.10  ? 805  ASN C OD1 1 
ATOM   9051  N  ND2 . ASN B 2 251  ? -49.832 25.165  -43.752 1.00 66.81  ? 805  ASN C ND2 1 
ATOM   9052  N  N   . ASP B 2 252  ? -44.256 25.484  -42.449 1.00 75.27  ? 806  ASP C N   1 
ATOM   9053  C  CA  . ASP B 2 252  ? -42.899 25.071  -42.771 1.00 53.68  ? 806  ASP C CA  1 
ATOM   9054  C  C   . ASP B 2 252  ? -42.874 23.563  -42.957 1.00 71.97  ? 806  ASP C C   1 
ATOM   9055  O  O   . ASP B 2 252  ? -43.171 22.817  -42.023 1.00 85.26  ? 806  ASP C O   1 
ATOM   9056  C  CB  . ASP B 2 252  ? -41.924 25.498  -41.671 1.00 56.84  ? 806  ASP C CB  1 
ATOM   9057  C  CG  . ASP B 2 252  ? -40.506 25.013  -41.916 1.00 63.09  ? 806  ASP C CG  1 
ATOM   9058  O  OD1 . ASP B 2 252  ? -40.148 24.753  -43.084 1.00 72.41  ? 806  ASP C OD1 1 
ATOM   9059  O  OD2 . ASP B 2 252  ? -39.745 24.897  -40.933 1.00 68.26  ? 806  ASP C OD2 1 
ATOM   9060  N  N   . PRO B 2 253  ? -42.528 23.107  -44.170 1.00 80.37  ? 807  PRO C N   1 
ATOM   9061  C  CA  . PRO B 2 253  ? -42.438 21.668  -44.426 1.00 72.79  ? 807  PRO C CA  1 
ATOM   9062  C  C   . PRO B 2 253  ? -41.326 21.047  -43.598 1.00 68.70  ? 807  PRO C C   1 
ATOM   9063  O  O   . PRO B 2 253  ? -41.306 19.835  -43.383 1.00 59.95  ? 807  PRO C O   1 
ATOM   9064  C  CB  . PRO B 2 253  ? -42.126 21.591  -45.923 1.00 75.35  ? 807  PRO C CB  1 
ATOM   9065  C  CG  . PRO B 2 253  ? -41.488 22.900  -46.241 1.00 74.01  ? 807  PRO C CG  1 
ATOM   9066  C  CD  . PRO B 2 253  ? -42.169 23.902  -45.357 1.00 68.38  ? 807  PRO C CD  1 
ATOM   9067  N  N   . GLY B 2 254  ? -40.407 21.889  -43.140 1.00 60.48  ? 808  GLY C N   1 
ATOM   9068  C  CA  . GLY B 2 254  ? -39.319 21.452  -42.291 1.00 59.17  ? 808  GLY C CA  1 
ATOM   9069  C  C   . GLY B 2 254  ? -38.301 20.632  -43.049 1.00 58.66  ? 808  GLY C C   1 
ATOM   9070  O  O   . GLY B 2 254  ? -38.501 20.305  -44.219 1.00 62.14  ? 808  GLY C O   1 
ATOM   9071  N  N   . PHE B 2 255  ? -37.201 20.293  -42.387 1.00 52.99  ? 809  PHE C N   1 
ATOM   9072  C  CA  . PHE B 2 255  ? -36.185 19.480  -43.044 1.00 43.15  ? 809  PHE C CA  1 
ATOM   9073  C  C   . PHE B 2 255  ? -35.939 18.184  -42.281 1.00 56.28  ? 809  PHE C C   1 
ATOM   9074  O  O   . PHE B 2 255  ? -36.067 18.133  -41.058 1.00 63.59  ? 809  PHE C O   1 
ATOM   9075  C  CB  . PHE B 2 255  ? -34.883 20.267  -43.210 1.00 40.03  ? 809  PHE C CB  1 
ATOM   9076  C  CG  . PHE B 2 255  ? -34.269 20.716  -41.919 1.00 46.52  ? 809  PHE C CG  1 
ATOM   9077  C  CD1 . PHE B 2 255  ? -34.699 21.875  -41.297 1.00 47.40  ? 809  PHE C CD1 1 
ATOM   9078  C  CD2 . PHE B 2 255  ? -33.247 19.989  -41.335 1.00 48.47  ? 809  PHE C CD2 1 
ATOM   9079  C  CE1 . PHE B 2 255  ? -34.132 22.292  -40.112 1.00 42.91  ? 809  PHE C CE1 1 
ATOM   9080  C  CE2 . PHE B 2 255  ? -32.673 20.403  -40.150 1.00 45.23  ? 809  PHE C CE2 1 
ATOM   9081  C  CZ  . PHE B 2 255  ? -33.116 21.556  -39.538 1.00 45.65  ? 809  PHE C CZ  1 
ATOM   9082  N  N   . VAL B 2 256  ? -35.595 17.135  -43.020 1.00 58.90  ? 810  VAL C N   1 
ATOM   9083  C  CA  . VAL B 2 256  ? -35.446 15.807  -42.442 1.00 51.63  ? 810  VAL C CA  1 
ATOM   9084  C  C   . VAL B 2 256  ? -33.988 15.451  -42.191 1.00 48.92  ? 810  VAL C C   1 
ATOM   9085  O  O   . VAL B 2 256  ? -33.156 15.510  -43.096 1.00 57.85  ? 810  VAL C O   1 
ATOM   9086  C  CB  . VAL B 2 256  ? -36.066 14.730  -43.349 1.00 49.37  ? 810  VAL C CB  1 
ATOM   9087  C  CG1 . VAL B 2 256  ? -35.984 13.368  -42.681 1.00 50.65  ? 810  VAL C CG1 1 
ATOM   9088  C  CG2 . VAL B 2 256  ? -37.507 15.079  -43.673 1.00 53.00  ? 810  VAL C CG2 1 
ATOM   9089  N  N   . VAL B 2 257  ? -33.686 15.082  -40.951 1.00 52.90  ? 811  VAL C N   1 
ATOM   9090  C  CA  . VAL B 2 257  ? -32.354 14.621  -40.592 1.00 54.72  ? 811  VAL C CA  1 
ATOM   9091  C  C   . VAL B 2 257  ? -32.428 13.214  -40.016 1.00 58.09  ? 811  VAL C C   1 
ATOM   9092  O  O   . VAL B 2 257  ? -33.305 12.915  -39.207 1.00 58.18  ? 811  VAL C O   1 
ATOM   9093  C  CB  . VAL B 2 257  ? -31.681 15.545  -39.563 1.00 57.58  ? 811  VAL C CB  1 
ATOM   9094  C  CG1 . VAL B 2 257  ? -30.179 15.319  -39.558 1.00 63.84  ? 811  VAL C CG1 1 
ATOM   9095  C  CG2 . VAL B 2 257  ? -31.994 16.993  -39.870 1.00 59.38  ? 811  VAL C CG2 1 
ATOM   9096  N  N   . THR B 2 258  ? -31.509 12.351  -40.437 1.00 64.00  ? 812  THR C N   1 
ATOM   9097  C  CA  . THR B 2 258  ? -31.437 11.000  -39.898 1.00 56.53  ? 812  THR C CA  1 
ATOM   9098  C  C   . THR B 2 258  ? -30.526 10.970  -38.676 1.00 59.87  ? 812  THR C C   1 
ATOM   9099  O  O   . THR B 2 258  ? -29.335 11.265  -38.764 1.00 68.59  ? 812  THR C O   1 
ATOM   9100  C  CB  . THR B 2 258  ? -30.933 9.996   -40.947 1.00 51.93  ? 812  THR C CB  1 
ATOM   9101  O  OG1 . THR B 2 258  ? -31.877 9.913   -42.020 1.00 58.70  ? 812  THR C OG1 1 
ATOM   9102  C  CG2 . THR B 2 258  ? -30.764 8.621   -40.325 1.00 54.60  ? 812  THR C CG2 1 
ATOM   9103  N  N   . LEU B 2 259  ? -31.101 10.613  -37.533 1.00 51.06  ? 813  LEU C N   1 
ATOM   9104  C  CA  . LEU B 2 259  ? -30.398 10.659  -36.259 1.00 51.70  ? 813  LEU C CA  1 
ATOM   9105  C  C   . LEU B 2 259  ? -30.524 9.352   -35.482 1.00 53.77  ? 813  LEU C C   1 
ATOM   9106  O  O   . LEU B 2 259  ? -31.102 8.376   -35.966 1.00 48.57  ? 813  LEU C O   1 
ATOM   9107  C  CB  . LEU B 2 259  ? -30.929 11.815  -35.410 1.00 52.73  ? 813  LEU C CB  1 
ATOM   9108  C  CG  . LEU B 2 259  ? -30.915 13.203  -36.051 1.00 57.71  ? 813  LEU C CG  1 
ATOM   9109  C  CD1 . LEU B 2 259  ? -31.572 14.220  -35.132 1.00 40.64  ? 813  LEU C CD1 1 
ATOM   9110  C  CD2 . LEU B 2 259  ? -29.493 13.617  -36.387 1.00 71.21  ? 813  LEU C CD2 1 
ATOM   9111  N  N   . SER B 2 260  ? -29.984 9.351   -34.268 1.00 40.39  ? 814  SER C N   1 
ATOM   9112  C  CA  . SER B 2 260  ? -30.019 8.178   -33.405 1.00 43.47  ? 814  SER C CA  1 
ATOM   9113  C  C   . SER B 2 260  ? -30.977 8.373   -32.234 1.00 43.53  ? 814  SER C C   1 
ATOM   9114  O  O   . SER B 2 260  ? -31.117 9.479   -31.713 1.00 45.45  ? 814  SER C O   1 
ATOM   9115  C  CB  . SER B 2 260  ? -28.618 7.859   -32.882 1.00 42.90  ? 814  SER C CB  1 
ATOM   9116  O  OG  . SER B 2 260  ? -28.649 6.781   -31.964 1.00 46.66  ? 814  SER C OG  1 
ATOM   9117  N  N   . ASN B 2 261  ? -31.630 7.289   -31.824 1.00 48.00  ? 815  ASN C N   1 
ATOM   9118  C  CA  . ASN B 2 261  ? -32.526 7.317   -30.672 1.00 50.41  ? 815  ASN C CA  1 
ATOM   9119  C  C   . ASN B 2 261  ? -31.819 7.741   -29.389 1.00 52.21  ? 815  ASN C C   1 
ATOM   9120  O  O   . ASN B 2 261  ? -32.431 8.331   -28.499 1.00 52.59  ? 815  ASN C O   1 
ATOM   9121  C  CB  . ASN B 2 261  ? -33.170 5.944   -30.462 1.00 41.51  ? 815  ASN C CB  1 
ATOM   9122  C  CG  . ASN B 2 261  ? -34.484 5.794   -31.200 1.00 56.17  ? 815  ASN C CG  1 
ATOM   9123  O  OD1 . ASN B 2 261  ? -35.138 6.781   -31.536 1.00 56.38  ? 815  ASN C OD1 1 
ATOM   9124  N  ND2 . ASN B 2 261  ? -34.885 4.551   -31.445 1.00 68.96  ? 815  ASN C ND2 1 
ATOM   9125  N  N   . ARG B 2 262  ? -30.527 7.441   -29.307 1.00 45.97  ? 816  ARG C N   1 
ATOM   9126  C  CA  . ARG B 2 262  ? -29.765 7.621   -28.075 1.00 54.75  ? 816  ARG C CA  1 
ATOM   9127  C  C   . ARG B 2 262  ? -29.327 9.061   -27.818 1.00 42.49  ? 816  ARG C C   1 
ATOM   9128  O  O   . ARG B 2 262  ? -28.927 9.398   -26.704 1.00 47.66  ? 816  ARG C O   1 
ATOM   9129  C  CB  . ARG B 2 262  ? -28.527 6.723   -28.094 1.00 44.91  ? 816  ARG C CB  1 
ATOM   9130  C  CG  . ARG B 2 262  ? -28.815 5.237   -28.185 1.00 45.95  ? 816  ARG C CG  1 
ATOM   9131  C  CD  . ARG B 2 262  ? -27.513 4.455   -28.104 1.00 71.13  ? 816  ARG C CD  1 
ATOM   9132  N  NE  . ARG B 2 262  ? -27.719 3.019   -27.941 1.00 61.73  ? 816  ARG C NE  1 
ATOM   9133  C  CZ  . ARG B 2 262  ? -27.326 2.104   -28.820 1.00 66.77  ? 816  ARG C CZ  1 
ATOM   9134  N  NH1 . ARG B 2 262  ? -26.705 2.474   -29.933 1.00 70.69  ? 816  ARG C NH1 1 
ATOM   9135  N  NH2 . ARG B 2 262  ? -27.549 0.819   -28.587 1.00 75.01  ? 816  ARG C NH2 1 
ATOM   9136  N  N   . MET B 2 263  ? -29.397 9.899   -28.847 1.00 36.00  ? 817  MET C N   1 
ATOM   9137  C  CA  . MET B 2 263  ? -28.847 11.250  -28.775 1.00 44.03  ? 817  MET C CA  1 
ATOM   9138  C  C   . MET B 2 263  ? -29.466 12.096  -27.667 1.00 48.66  ? 817  MET C C   1 
ATOM   9139  O  O   . MET B 2 263  ? -30.672 12.037  -27.427 1.00 49.21  ? 817  MET C O   1 
ATOM   9140  C  CB  . MET B 2 263  ? -29.016 11.956  -30.123 1.00 35.31  ? 817  MET C CB  1 
ATOM   9141  C  CG  . MET B 2 263  ? -28.210 11.327  -31.248 1.00 33.76  ? 817  MET C CG  1 
ATOM   9142  S  SD  . MET B 2 263  ? -28.493 12.107  -32.849 1.00 59.90  ? 817  MET C SD  1 
ATOM   9143  C  CE  . MET B 2 263  ? -27.926 13.775  -32.533 1.00 45.40  ? 817  MET C CE  1 
ATOM   9144  N  N   . ASN B 2 264  ? -28.629 12.876  -26.990 1.00 39.43  ? 818  ASN C N   1 
ATOM   9145  C  CA  . ASN B 2 264  ? -29.103 13.786  -25.956 1.00 33.90  ? 818  ASN C CA  1 
ATOM   9146  C  C   . ASN B 2 264  ? -29.445 15.150  -26.547 1.00 42.20  ? 818  ASN C C   1 
ATOM   9147  O  O   . ASN B 2 264  ? -29.430 15.324  -27.765 1.00 52.27  ? 818  ASN C O   1 
ATOM   9148  C  CB  . ASN B 2 264  ? -28.064 13.926  -24.838 1.00 43.17  ? 818  ASN C CB  1 
ATOM   9149  C  CG  . ASN B 2 264  ? -26.695 14.350  -25.349 1.00 46.22  ? 818  ASN C CG  1 
ATOM   9150  O  OD1 . ASN B 2 264  ? -26.568 14.948  -26.417 1.00 48.73  ? 818  ASN C OD1 1 
ATOM   9151  N  ND2 . ASN B 2 264  ? -25.660 14.043  -24.575 1.00 39.71  ? 818  ASN C ND2 1 
ATOM   9152  N  N   . TYR B 2 265  ? -29.747 16.115  -25.685 1.00 38.93  ? 819  TYR C N   1 
ATOM   9153  C  CA  . TYR B 2 265  ? -30.124 17.449  -26.140 1.00 38.43  ? 819  TYR C CA  1 
ATOM   9154  C  C   . TYR B 2 265  ? -28.964 18.146  -26.844 1.00 50.12  ? 819  TYR C C   1 
ATOM   9155  O  O   . TYR B 2 265  ? -29.144 18.760  -27.896 1.00 54.10  ? 819  TYR C O   1 
ATOM   9156  C  CB  . TYR B 2 265  ? -30.610 18.297  -24.963 1.00 41.80  ? 819  TYR C CB  1 
ATOM   9157  C  CG  . TYR B 2 265  ? -31.080 19.680  -25.354 1.00 41.75  ? 819  TYR C CG  1 
ATOM   9158  C  CD1 . TYR B 2 265  ? -32.381 19.893  -25.788 1.00 29.51  ? 819  TYR C CD1 1 
ATOM   9159  C  CD2 . TYR B 2 265  ? -30.225 20.773  -25.283 1.00 46.48  ? 819  TYR C CD2 1 
ATOM   9160  C  CE1 . TYR B 2 265  ? -32.817 21.155  -26.144 1.00 42.36  ? 819  TYR C CE1 1 
ATOM   9161  C  CE2 . TYR B 2 265  ? -30.651 22.039  -25.638 1.00 44.27  ? 819  TYR C CE2 1 
ATOM   9162  C  CZ  . TYR B 2 265  ? -31.948 22.224  -26.067 1.00 47.01  ? 819  TYR C CZ  1 
ATOM   9163  O  OH  . TYR B 2 265  ? -32.380 23.482  -26.421 1.00 44.94  ? 819  TYR C OH  1 
ATOM   9164  N  N   . PHE B 2 266  ? -27.779 18.045  -26.251 1.00 52.34  ? 820  PHE C N   1 
ATOM   9165  C  CA  . PHE B 2 266  ? -26.576 18.685  -26.775 1.00 58.97  ? 820  PHE C CA  1 
ATOM   9166  C  C   . PHE B 2 266  ? -26.279 18.264  -28.214 1.00 57.97  ? 820  PHE C C   1 
ATOM   9167  O  O   . PHE B 2 266  ? -26.013 19.103  -29.077 1.00 58.83  ? 820  PHE C O   1 
ATOM   9168  C  CB  . PHE B 2 266  ? -25.383 18.363  -25.868 1.00 67.80  ? 820  PHE C CB  1 
ATOM   9169  C  CG  . PHE B 2 266  ? -24.062 18.843  -26.398 1.00 84.21  ? 820  PHE C CG  1 
ATOM   9170  C  CD1 . PHE B 2 266  ? -23.666 20.159  -26.223 1.00 91.63  ? 820  PHE C CD1 1 
ATOM   9171  C  CD2 . PHE B 2 266  ? -23.208 17.974  -27.059 1.00 95.42  ? 820  PHE C CD2 1 
ATOM   9172  C  CE1 . PHE B 2 266  ? -22.448 20.600  -26.705 1.00 87.10  ? 820  PHE C CE1 1 
ATOM   9173  C  CE2 . PHE B 2 266  ? -21.990 18.410  -27.542 1.00 88.69  ? 820  PHE C CE2 1 
ATOM   9174  C  CZ  . PHE B 2 266  ? -21.609 19.724  -27.366 1.00 84.28  ? 820  PHE C CZ  1 
ATOM   9175  N  N   . GLN B 2 267  ? -26.336 16.961  -28.466 1.00 51.12  ? 821  GLN C N   1 
ATOM   9176  C  CA  . GLN B 2 267  ? -26.029 16.419  -29.784 1.00 53.64  ? 821  GLN C CA  1 
ATOM   9177  C  C   . GLN B 2 267  ? -27.049 16.854  -30.836 1.00 55.20  ? 821  GLN C C   1 
ATOM   9178  O  O   . GLN B 2 267  ? -26.681 17.257  -31.944 1.00 57.97  ? 821  GLN C O   1 
ATOM   9179  C  CB  . GLN B 2 267  ? -25.950 14.894  -29.713 1.00 44.58  ? 821  GLN C CB  1 
ATOM   9180  C  CG  . GLN B 2 267  ? -24.719 14.390  -28.975 1.00 59.58  ? 821  GLN C CG  1 
ATOM   9181  C  CD  . GLN B 2 267  ? -24.895 12.990  -28.423 1.00 61.72  ? 821  GLN C CD  1 
ATOM   9182  O  OE1 . GLN B 2 267  ? -26.015 12.532  -28.206 1.00 56.82  ? 821  GLN C OE1 1 
ATOM   9183  N  NE2 . GLN B 2 267  ? -23.784 12.302  -28.189 1.00 63.59  ? 821  GLN C NE2 1 
ATOM   9184  N  N   . VAL B 2 268  ? -28.328 16.777  -30.480 1.00 49.22  ? 822  VAL C N   1 
ATOM   9185  C  CA  . VAL B 2 268  ? -29.406 17.205  -31.367 1.00 45.64  ? 822  VAL C CA  1 
ATOM   9186  C  C   . VAL B 2 268  ? -29.265 18.680  -31.730 1.00 49.30  ? 822  VAL C C   1 
ATOM   9187  O  O   . VAL B 2 268  ? -29.279 19.053  -32.912 1.00 54.02  ? 822  VAL C O   1 
ATOM   9188  C  CB  . VAL B 2 268  ? -30.789 16.975  -30.727 1.00 38.16  ? 822  VAL C CB  1 
ATOM   9189  C  CG1 . VAL B 2 268  ? -31.877 17.612  -31.574 1.00 34.54  ? 822  VAL C CG1 1 
ATOM   9190  C  CG2 . VAL B 2 268  ? -31.050 15.489  -30.545 1.00 30.89  ? 822  VAL C CG2 1 
ATOM   9191  N  N   . ALA B 2 269  ? -29.128 19.511  -30.700 1.00 40.61  ? 823  ALA C N   1 
ATOM   9192  C  CA  . ALA B 2 269  ? -28.965 20.947  -30.875 1.00 49.31  ? 823  ALA C CA  1 
ATOM   9193  C  C   . ALA B 2 269  ? -27.772 21.247  -31.769 1.00 53.63  ? 823  ALA C C   1 
ATOM   9194  O  O   . ALA B 2 269  ? -27.860 22.084  -32.668 1.00 53.94  ? 823  ALA C O   1 
ATOM   9195  C  CB  . ALA B 2 269  ? -28.805 21.633  -29.529 1.00 38.21  ? 823  ALA C CB  1 
ATOM   9196  N  N   . LYS B 2 270  ? -26.662 20.555  -31.522 1.00 53.27  ? 824  LYS C N   1 
ATOM   9197  C  CA  . LYS B 2 270  ? -25.472 20.707  -32.349 1.00 63.65  ? 824  LYS C CA  1 
ATOM   9198  C  C   . LYS B 2 270  ? -25.781 20.408  -33.810 1.00 58.66  ? 824  LYS C C   1 
ATOM   9199  O  O   . LYS B 2 270  ? -25.457 21.200  -34.689 1.00 62.87  ? 824  LYS C O   1 
ATOM   9200  C  CB  . LYS B 2 270  ? -24.345 19.799  -31.852 1.00 62.52  ? 824  LYS C CB  1 
ATOM   9201  C  CG  . LYS B 2 270  ? -23.518 20.396  -30.724 1.00 90.82  ? 824  LYS C CG  1 
ATOM   9202  C  CD  . LYS B 2 270  ? -22.710 21.592  -31.207 1.00 114.07 ? 824  LYS C CD  1 
ATOM   9203  C  CE  . LYS B 2 270  ? -21.999 22.285  -30.054 1.00 112.60 ? 824  LYS C CE  1 
ATOM   9204  N  NZ  . LYS B 2 270  ? -21.294 23.521  -30.496 1.00 82.56  ? 824  LYS C NZ  1 
ATOM   9205  N  N   . THR B 2 271  ? -26.426 19.272  -34.056 1.00 46.28  ? 825  THR C N   1 
ATOM   9206  C  CA  . THR B 2 271  ? -26.768 18.852  -35.414 1.00 43.72  ? 825  THR C CA  1 
ATOM   9207  C  C   . THR B 2 271  ? -27.623 19.880  -36.159 1.00 60.39  ? 825  THR C C   1 
ATOM   9208  O  O   . THR B 2 271  ? -27.257 20.344  -37.252 1.00 61.83  ? 825  THR C O   1 
ATOM   9209  C  CB  . THR B 2 271  ? -27.513 17.505  -35.399 1.00 55.40  ? 825  THR C CB  1 
ATOM   9210  O  OG1 . THR B 2 271  ? -26.627 16.472  -34.950 1.00 42.39  ? 825  THR C OG1 1 
ATOM   9211  C  CG2 . THR B 2 271  ? -28.021 17.160  -36.790 1.00 49.17  ? 825  THR C CG2 1 
ATOM   9212  N  N   . VAL B 2 272  ? -28.763 20.229  -35.566 1.00 60.13  ? 826  VAL C N   1 
ATOM   9213  C  CA  . VAL B 2 272  ? -29.675 21.192  -36.179 1.00 56.99  ? 826  VAL C CA  1 
ATOM   9214  C  C   . VAL B 2 272  ? -28.975 22.526  -36.417 1.00 52.45  ? 826  VAL C C   1 
ATOM   9215  O  O   . VAL B 2 272  ? -29.126 23.142  -37.476 1.00 62.13  ? 826  VAL C O   1 
ATOM   9216  C  CB  . VAL B 2 272  ? -30.927 21.414  -35.309 1.00 52.66  ? 826  VAL C CB  1 
ATOM   9217  C  CG1 . VAL B 2 272  ? -31.757 22.569  -35.845 1.00 52.75  ? 826  VAL C CG1 1 
ATOM   9218  C  CG2 . VAL B 2 272  ? -31.755 20.147  -35.253 1.00 50.13  ? 826  VAL C CG2 1 
ATOM   9219  N  N   . ALA B 2 273  ? -28.196 22.957  -35.430 1.00 46.24  ? 827  ALA C N   1 
ATOM   9220  C  CA  . ALA B 2 273  ? -27.428 24.189  -35.547 1.00 54.26  ? 827  ALA C CA  1 
ATOM   9221  C  C   . ALA B 2 273  ? -26.458 24.126  -36.721 1.00 71.43  ? 827  ALA C C   1 
ATOM   9222  O  O   . ALA B 2 273  ? -26.227 25.129  -37.396 1.00 69.62  ? 827  ALA C O   1 
ATOM   9223  C  CB  . ALA B 2 273  ? -26.678 24.467  -34.263 1.00 59.25  ? 827  ALA C CB  1 
ATOM   9224  N  N   . GLN B 2 274  ? -25.892 22.946  -36.961 1.00 77.35  ? 828  GLN C N   1 
ATOM   9225  C  CA  . GLN B 2 274  ? -24.990 22.762  -38.090 1.00 81.25  ? 828  GLN C CA  1 
ATOM   9226  C  C   . GLN B 2 274  ? -25.741 22.912  -39.404 1.00 66.69  ? 828  GLN C C   1 
ATOM   9227  O  O   . GLN B 2 274  ? -25.314 23.659  -40.283 1.00 74.42  ? 828  GLN C O   1 
ATOM   9228  C  CB  . GLN B 2 274  ? -24.298 21.395  -38.042 1.00 66.35  ? 828  GLN C CB  1 
ATOM   9229  C  CG  . GLN B 2 274  ? -23.323 21.205  -36.889 1.00 89.97  ? 828  GLN C CG  1 
ATOM   9230  C  CD  . GLN B 2 274  ? -22.848 22.515  -36.287 1.00 112.25 ? 828  GLN C CD  1 
ATOM   9231  O  OE1 . GLN B 2 274  ? -22.049 23.236  -36.885 1.00 114.21 ? 828  GLN C OE1 1 
ATOM   9232  N  NE2 . GLN B 2 274  ? -23.342 22.828  -35.093 1.00 82.36  ? 828  GLN C NE2 1 
ATOM   9233  N  N   . ARG B 2 275  ? -26.866 22.214  -39.537 1.00 60.03  ? 829  ARG C N   1 
ATOM   9234  C  CA  . ARG B 2 275  ? -27.616 22.275  -40.791 1.00 66.21  ? 829  ARG C CA  1 
ATOM   9235  C  C   . ARG B 2 275  ? -28.312 23.631  -40.969 1.00 67.29  ? 829  ARG C C   1 
ATOM   9236  O  O   . ARG B 2 275  ? -28.867 23.923  -42.029 1.00 67.29  ? 829  ARG C O   1 
ATOM   9237  C  CB  . ARG B 2 275  ? -28.635 21.132  -40.871 1.00 73.31  ? 829  ARG C CB  1 
ATOM   9238  C  CG  . ARG B 2 275  ? -29.209 20.917  -42.270 1.00 78.96  ? 829  ARG C CG  1 
ATOM   9239  C  CD  . ARG B 2 275  ? -29.914 19.579  -42.423 1.00 87.46  ? 829  ARG C CD  1 
ATOM   9240  N  NE  . ARG B 2 275  ? -30.691 19.528  -43.659 1.00 84.92  ? 829  ARG C NE  1 
ATOM   9241  C  CZ  . ARG B 2 275  ? -31.294 18.438  -44.123 1.00 97.55  ? 829  ARG C CZ  1 
ATOM   9242  N  NH1 . ARG B 2 275  ? -31.205 17.295  -43.456 1.00 78.36  ? 829  ARG C NH1 1 
ATOM   9243  N  NH2 . ARG B 2 275  ? -31.982 18.489  -45.256 1.00 85.23  ? 829  ARG C NH2 1 
ATOM   9244  N  N   . LEU B 2 276  ? -28.269 24.464  -39.935 1.00 66.02  ? 830  LEU C N   1 
ATOM   9245  C  CA  . LEU B 2 276  ? -28.858 25.798  -40.015 1.00 63.66  ? 830  LEU C CA  1 
ATOM   9246  C  C   . LEU B 2 276  ? -27.809 26.906  -39.977 1.00 76.60  ? 830  LEU C C   1 
ATOM   9247  O  O   . LEU B 2 276  ? -28.144 28.089  -40.073 1.00 72.69  ? 830  LEU C O   1 
ATOM   9248  C  CB  . LEU B 2 276  ? -29.864 26.001  -38.883 1.00 64.21  ? 830  LEU C CB  1 
ATOM   9249  C  CG  . LEU B 2 276  ? -31.337 25.927  -39.277 1.00 62.42  ? 830  LEU C CG  1 
ATOM   9250  C  CD1 . LEU B 2 276  ? -31.598 24.731  -40.174 1.00 68.87  ? 830  LEU C CD1 1 
ATOM   9251  C  CD2 . LEU B 2 276  ? -32.191 25.851  -38.032 1.00 60.55  ? 830  LEU C CD2 1 
ATOM   9252  N  N   . ASN B 2 277  ? -26.546 26.514  -39.830 1.00 80.56  ? 831  ASN C N   1 
ATOM   9253  C  CA  . ASN B 2 277  ? -25.424 27.452  -39.786 1.00 80.62  ? 831  ASN C CA  1 
ATOM   9254  C  C   . ASN B 2 277  ? -25.539 28.483  -38.666 1.00 76.94  ? 831  ASN C C   1 
ATOM   9255  O  O   . ASN B 2 277  ? -25.357 29.679  -38.893 1.00 84.11  ? 831  ASN C O   1 
ATOM   9256  C  CB  . ASN B 2 277  ? -25.280 28.170  -41.130 1.00 97.95  ? 831  ASN C CB  1 
ATOM   9257  C  CG  . ASN B 2 277  ? -23.993 27.819  -41.842 1.00 99.93  ? 831  ASN C CG  1 
ATOM   9258  O  OD1 . ASN B 2 277  ? -23.936 26.858  -42.609 1.00 91.34  ? 831  ASN C OD1 1 
ATOM   9259  N  ND2 . ASN B 2 277  ? -22.948 28.599  -41.593 1.00 88.73  ? 831  ASN C ND2 1 
ATOM   9260  N  N   . THR B 2 278  ? -25.845 28.017  -37.459 1.00 71.18  ? 832  THR C N   1 
ATOM   9261  C  CA  . THR B 2 278  ? -25.955 28.904  -36.306 1.00 72.99  ? 832  THR C CA  1 
ATOM   9262  C  C   . THR B 2 278  ? -25.398 28.264  -35.037 1.00 61.19  ? 832  THR C C   1 
ATOM   9263  O  O   . THR B 2 278  ? -25.096 27.073  -35.012 1.00 63.02  ? 832  THR C O   1 
ATOM   9264  C  CB  . THR B 2 278  ? -27.414 29.322  -36.053 1.00 65.98  ? 832  THR C CB  1 
ATOM   9265  O  OG1 . THR B 2 278  ? -27.469 30.205  -34.926 1.00 73.97  ? 832  THR C OG1 1 
ATOM   9266  C  CG2 . THR B 2 278  ? -28.272 28.101  -35.777 1.00 72.04  ? 832  THR C CG2 1 
ATOM   9267  N  N   . ASP B 2 279  ? -25.246 29.075  -33.995 1.00 63.83  ? 833  ASP C N   1 
ATOM   9268  C  CA  . ASP B 2 279  ? -24.825 28.593  -32.683 1.00 63.97  ? 833  ASP C CA  1 
ATOM   9269  C  C   . ASP B 2 279  ? -25.975 27.860  -31.993 1.00 67.67  ? 833  ASP C C   1 
ATOM   9270  O  O   . ASP B 2 279  ? -27.080 28.396  -31.901 1.00 67.54  ? 833  ASP C O   1 
ATOM   9271  C  CB  . ASP B 2 279  ? -24.340 29.766  -31.825 1.00 66.53  ? 833  ASP C CB  1 
ATOM   9272  C  CG  . ASP B 2 279  ? -23.957 29.353  -30.414 1.00 70.36  ? 833  ASP C CG  1 
ATOM   9273  O  OD1 . ASP B 2 279  ? -23.325 28.292  -30.240 1.00 62.44  ? 833  ASP C OD1 1 
ATOM   9274  O  OD2 . ASP B 2 279  ? -24.286 30.105  -29.473 1.00 66.58  ? 833  ASP C OD2 1 
ATOM   9275  N  N   . PRO B 2 280  ? -25.720 26.626  -31.520 1.00 61.49  ? 834  PRO C N   1 
ATOM   9276  C  CA  . PRO B 2 280  ? -26.709 25.796  -30.818 1.00 64.42  ? 834  PRO C CA  1 
ATOM   9277  C  C   . PRO B 2 280  ? -27.461 26.532  -29.713 1.00 58.81  ? 834  PRO C C   1 
ATOM   9278  O  O   . PRO B 2 280  ? -28.648 26.279  -29.506 1.00 58.26  ? 834  PRO C O   1 
ATOM   9279  C  CB  . PRO B 2 280  ? -25.855 24.675  -30.225 1.00 57.90  ? 834  PRO C CB  1 
ATOM   9280  C  CG  . PRO B 2 280  ? -24.743 24.526  -31.186 1.00 63.78  ? 834  PRO C CG  1 
ATOM   9281  C  CD  . PRO B 2 280  ? -24.454 25.901  -31.730 1.00 62.27  ? 834  PRO C CD  1 
ATOM   9282  N  N   . MET B 2 281  ? -26.776 27.436  -29.019 1.00 63.76  ? 835  MET C N   1 
ATOM   9283  C  CA  . MET B 2 281  ? -27.384 28.200  -27.935 1.00 60.19  ? 835  MET C CA  1 
ATOM   9284  C  C   . MET B 2 281  ? -28.455 29.155  -28.455 1.00 58.30  ? 835  MET C C   1 
ATOM   9285  O  O   . MET B 2 281  ? -29.322 29.596  -27.702 1.00 59.82  ? 835  MET C O   1 
ATOM   9286  C  CB  . MET B 2 281  ? -26.314 28.980  -27.170 1.00 53.72  ? 835  MET C CB  1 
ATOM   9287  C  CG  . MET B 2 281  ? -25.127 28.142  -26.704 1.00 51.86  ? 835  MET C CG  1 
ATOM   9288  S  SD  . MET B 2 281  ? -25.320 27.425  -25.058 1.00 103.49 ? 835  MET C SD  1 
ATOM   9289  C  CE  . MET B 2 281  ? -26.272 25.948  -25.409 1.00 67.64  ? 835  MET C CE  1 
ATOM   9290  N  N   . LEU B 2 282  ? -28.392 29.472  -29.745 1.00 55.67  ? 836  LEU C N   1 
ATOM   9291  C  CA  . LEU B 2 282  ? -29.388 30.335  -30.369 1.00 61.07  ? 836  LEU C CA  1 
ATOM   9292  C  C   . LEU B 2 282  ? -30.546 29.517  -30.933 1.00 60.86  ? 836  LEU C C   1 
ATOM   9293  O  O   . LEU B 2 282  ? -31.144 29.881  -31.946 1.00 61.54  ? 836  LEU C O   1 
ATOM   9294  C  CB  . LEU B 2 282  ? -28.758 31.183  -31.477 1.00 62.33  ? 836  LEU C CB  1 
ATOM   9295  C  CG  . LEU B 2 282  ? -28.122 32.514  -31.066 1.00 66.41  ? 836  LEU C CG  1 
ATOM   9296  C  CD1 . LEU B 2 282  ? -26.851 32.303  -30.258 1.00 60.95  ? 836  LEU C CD1 1 
ATOM   9297  C  CD2 . LEU B 2 282  ? -27.847 33.367  -32.293 1.00 78.82  ? 836  LEU C CD2 1 
ATOM   9298  N  N   . LEU B 2 283  ? -30.851 28.407  -30.271 1.00 57.31  ? 837  LEU C N   1 
ATOM   9299  C  CA  . LEU B 2 283  ? -31.956 27.549  -30.673 1.00 52.72  ? 837  LEU C CA  1 
ATOM   9300  C  C   . LEU B 2 283  ? -32.791 27.139  -29.469 1.00 54.21  ? 837  LEU C C   1 
ATOM   9301  O  O   . LEU B 2 283  ? -32.249 26.732  -28.441 1.00 55.74  ? 837  LEU C O   1 
ATOM   9302  C  CB  . LEU B 2 283  ? -31.440 26.301  -31.391 1.00 41.21  ? 837  LEU C CB  1 
ATOM   9303  C  CG  . LEU B 2 283  ? -30.869 26.470  -32.799 1.00 50.99  ? 837  LEU C CG  1 
ATOM   9304  C  CD1 . LEU B 2 283  ? -30.280 25.158  -33.285 1.00 52.51  ? 837  LEU C CD1 1 
ATOM   9305  C  CD2 . LEU B 2 283  ? -31.945 26.958  -33.753 1.00 58.13  ? 837  LEU C CD2 1 
ATOM   9306  N  N   . GLN B 2 284  ? -34.108 27.253  -29.593 1.00 44.38  ? 838  GLN C N   1 
ATOM   9307  C  CA  . GLN B 2 284  ? -34.997 26.706  -28.575 1.00 41.55  ? 838  GLN C CA  1 
ATOM   9308  C  C   . GLN B 2 284  ? -35.852 25.618  -29.198 1.00 53.87  ? 838  GLN C C   1 
ATOM   9309  O  O   . GLN B 2 284  ? -36.375 25.793  -30.291 1.00 54.34  ? 838  GLN C O   1 
ATOM   9310  C  CB  . GLN B 2 284  ? -35.880 27.790  -27.959 1.00 40.93  ? 838  GLN C CB  1 
ATOM   9311  C  CG  . GLN B 2 284  ? -36.740 27.281  -26.813 1.00 44.36  ? 838  GLN C CG  1 
ATOM   9312  C  CD  . GLN B 2 284  ? -37.653 28.345  -26.244 1.00 43.09  ? 838  GLN C CD  1 
ATOM   9313  O  OE1 . GLN B 2 284  ? -38.243 29.133  -26.982 1.00 60.91  ? 838  GLN C OE1 1 
ATOM   9314  N  NE2 . GLN B 2 284  ? -37.772 28.377  -24.921 1.00 44.43  ? 838  GLN C NE2 1 
ATOM   9315  N  N   . PHE B 2 285  ? -35.994 24.494  -28.506 1.00 54.53  ? 839  PHE C N   1 
ATOM   9316  C  CA  . PHE B 2 285  ? -36.722 23.363  -29.064 1.00 40.96  ? 839  PHE C CA  1 
ATOM   9317  C  C   . PHE B 2 285  ? -38.072 23.143  -28.397 1.00 33.55  ? 839  PHE C C   1 
ATOM   9318  O  O   . PHE B 2 285  ? -38.267 23.464  -27.226 1.00 47.78  ? 839  PHE C O   1 
ATOM   9319  C  CB  . PHE B 2 285  ? -35.880 22.089  -28.967 1.00 45.38  ? 839  PHE C CB  1 
ATOM   9320  C  CG  . PHE B 2 285  ? -34.690 22.083  -29.882 1.00 45.92  ? 839  PHE C CG  1 
ATOM   9321  C  CD1 . PHE B 2 285  ? -33.478 22.607  -29.468 1.00 44.04  ? 839  PHE C CD1 1 
ATOM   9322  C  CD2 . PHE B 2 285  ? -34.787 21.561  -31.161 1.00 43.45  ? 839  PHE C CD2 1 
ATOM   9323  C  CE1 . PHE B 2 285  ? -32.382 22.605  -30.310 1.00 46.00  ? 839  PHE C CE1 1 
ATOM   9324  C  CE2 . PHE B 2 285  ? -33.695 21.556  -32.008 1.00 37.13  ? 839  PHE C CE2 1 
ATOM   9325  C  CZ  . PHE B 2 285  ? -32.491 22.079  -31.582 1.00 40.31  ? 839  PHE C CZ  1 
ATOM   9326  N  N   . PHE B 2 286  ? -38.999 22.589  -29.167 1.00 39.63  ? 840  PHE C N   1 
ATOM   9327  C  CA  . PHE B 2 286  ? -40.334 22.278  -28.689 1.00 32.77  ? 840  PHE C CA  1 
ATOM   9328  C  C   . PHE B 2 286  ? -40.679 20.836  -29.023 1.00 38.85  ? 840  PHE C C   1 
ATOM   9329  O  O   . PHE B 2 286  ? -40.599 20.418  -30.185 1.00 45.75  ? 840  PHE C O   1 
ATOM   9330  C  CB  . PHE B 2 286  ? -41.372 23.212  -29.313 1.00 40.96  ? 840  PHE C CB  1 
ATOM   9331  C  CG  . PHE B 2 286  ? -41.150 24.662  -29.004 1.00 34.27  ? 840  PHE C CG  1 
ATOM   9332  C  CD1 . PHE B 2 286  ? -40.253 25.415  -29.743 1.00 39.89  ? 840  PHE C CD1 1 
ATOM   9333  C  CD2 . PHE B 2 286  ? -41.854 25.279  -27.985 1.00 42.57  ? 840  PHE C CD2 1 
ATOM   9334  C  CE1 . PHE B 2 286  ? -40.052 26.751  -29.462 1.00 45.03  ? 840  PHE C CE1 1 
ATOM   9335  C  CE2 . PHE B 2 286  ? -41.660 26.615  -27.701 1.00 48.42  ? 840  PHE C CE2 1 
ATOM   9336  C  CZ  . PHE B 2 286  ? -40.758 27.352  -28.441 1.00 50.30  ? 840  PHE C CZ  1 
ATOM   9337  N  N   . LYS B 2 287  ? -41.052 20.081  -27.994 1.00 36.73  ? 841  LYS C N   1 
ATOM   9338  C  CA  . LYS B 2 287  ? -41.600 18.747  -28.177 1.00 39.63  ? 841  LYS C CA  1 
ATOM   9339  C  C   . LYS B 2 287  ? -42.898 18.898  -28.953 1.00 36.76  ? 841  LYS C C   1 
ATOM   9340  O  O   . LYS B 2 287  ? -43.516 19.956  -28.918 1.00 42.87  ? 841  LYS C O   1 
ATOM   9341  C  CB  . LYS B 2 287  ? -41.839 18.065  -26.828 1.00 44.78  ? 841  LYS C CB  1 
ATOM   9342  C  CG  . LYS B 2 287  ? -42.082 16.565  -26.890 1.00 39.19  ? 841  LYS C CG  1 
ATOM   9343  C  CD  . LYS B 2 287  ? -42.595 16.068  -25.548 1.00 43.55  ? 841  LYS C CD  1 
ATOM   9344  C  CE  . LYS B 2 287  ? -42.669 14.556  -25.485 1.00 64.93  ? 841  LYS C CE  1 
ATOM   9345  N  NZ  . LYS B 2 287  ? -43.363 14.097  -24.250 1.00 54.63  ? 841  LYS C NZ  1 
ATOM   9346  N  N   . SER B 2 288  ? -43.309 17.859  -29.665 1.00 41.38  ? 842  SER C N   1 
ATOM   9347  C  CA  . SER B 2 288  ? -44.551 17.937  -30.419 1.00 36.09  ? 842  SER C CA  1 
ATOM   9348  C  C   . SER B 2 288  ? -45.754 17.806  -29.497 1.00 42.74  ? 842  SER C C   1 
ATOM   9349  O  O   . SER B 2 288  ? -45.668 17.195  -28.435 1.00 48.17  ? 842  SER C O   1 
ATOM   9350  C  CB  . SER B 2 288  ? -44.597 16.856  -31.497 1.00 45.39  ? 842  SER C CB  1 
ATOM   9351  O  OG  . SER B 2 288  ? -45.872 16.802  -32.115 1.00 42.56  ? 842  SER C OG  1 
ATOM   9352  N  N   . GLN B 2 289  ? -46.869 18.404  -29.899 1.00 47.86  ? 843  GLN C N   1 
ATOM   9353  C  CA  . GLN B 2 289  ? -48.137 18.192  -29.217 1.00 41.30  ? 843  GLN C CA  1 
ATOM   9354  C  C   . GLN B 2 289  ? -48.459 16.704  -29.310 1.00 53.99  ? 843  GLN C C   1 
ATOM   9355  O  O   . GLN B 2 289  ? -48.747 16.039  -28.314 1.00 57.44  ? 843  GLN C O   1 
ATOM   9356  C  CB  . GLN B 2 289  ? -49.233 19.045  -29.855 1.00 48.77  ? 843  GLN C CB  1 
ATOM   9357  C  CG  . GLN B 2 289  ? -50.260 19.584  -28.887 1.00 57.96  ? 843  GLN C CG  1 
ATOM   9358  C  CD  . GLN B 2 289  ? -50.608 21.033  -29.169 1.00 67.57  ? 843  GLN C CD  1 
ATOM   9359  O  OE1 . GLN B 2 289  ? -49.768 21.807  -29.629 1.00 50.25  ? 843  GLN C OE1 1 
ATOM   9360  N  NE2 . GLN B 2 289  ? -51.853 21.406  -28.898 1.00 75.59  ? 843  GLN C NE2 1 
ATOM   9361  N  N   . GLY B 2 290  ? -48.403 16.208  -30.539 1.00 56.35  ? 844  GLY C N   1 
ATOM   9362  C  CA  . GLY B 2 290  ? -48.380 14.792  -30.849 1.00 51.04  ? 844  GLY C CA  1 
ATOM   9363  C  C   . GLY B 2 290  ? -49.702 14.104  -31.130 1.00 73.68  ? 844  GLY C C   1 
ATOM   9364  O  O   . GLY B 2 290  ? -49.722 13.128  -31.879 1.00 95.60  ? 844  GLY C O   1 
ATOM   9365  N  N   . TYR B 2 291  ? -50.805 14.579  -30.559 1.00 70.62  ? 845  TYR C N   1 
ATOM   9366  C  CA  . TYR B 2 291  ? -52.103 14.207  -31.108 1.00 67.26  ? 845  TYR C CA  1 
ATOM   9367  C  C   . TYR B 2 291  ? -52.417 15.160  -32.256 1.00 73.24  ? 845  TYR C C   1 
ATOM   9368  O  O   . TYR B 2 291  ? -52.762 14.742  -33.361 1.00 80.74  ? 845  TYR C O   1 
ATOM   9369  C  CB  . TYR B 2 291  ? -53.203 14.217  -30.035 1.00 72.39  ? 845  TYR C CB  1 
ATOM   9370  C  CG  . TYR B 2 291  ? -53.422 15.528  -29.310 1.00 83.86  ? 845  TYR C CG  1 
ATOM   9371  C  CD1 . TYR B 2 291  ? -52.641 15.879  -28.216 1.00 89.99  ? 845  TYR C CD1 1 
ATOM   9372  C  CD2 . TYR B 2 291  ? -54.430 16.400  -29.702 1.00 76.69  ? 845  TYR C CD2 1 
ATOM   9373  C  CE1 . TYR B 2 291  ? -52.847 17.071  -27.544 1.00 77.47  ? 845  TYR C CE1 1 
ATOM   9374  C  CE2 . TYR B 2 291  ? -54.642 17.593  -29.039 1.00 90.60  ? 845  TYR C CE2 1 
ATOM   9375  C  CZ  . TYR B 2 291  ? -53.849 17.924  -27.961 1.00 88.15  ? 845  TYR C CZ  1 
ATOM   9376  O  OH  . TYR B 2 291  ? -54.060 19.110  -27.298 1.00 90.92  ? 845  TYR C OH  1 
ATOM   9377  N  N   . ARG B 2 292  ? -52.283 16.450  -31.968 1.00 75.31  ? 846  ARG C N   1 
ATOM   9378  C  CA  . ARG B 2 292  ? -52.292 17.504  -32.970 1.00 72.15  ? 846  ARG C CA  1 
ATOM   9379  C  C   . ARG B 2 292  ? -50.898 17.660  -33.560 1.00 66.58  ? 846  ARG C C   1 
ATOM   9380  O  O   . ARG B 2 292  ? -49.910 17.292  -32.926 1.00 64.03  ? 846  ARG C O   1 
ATOM   9381  C  CB  . ARG B 2 292  ? -52.772 18.822  -32.365 1.00 73.19  ? 846  ARG C CB  1 
ATOM   9382  C  CG  . ARG B 2 292  ? -53.400 19.770  -33.368 1.00 95.57  ? 846  ARG C CG  1 
ATOM   9383  C  CD  . ARG B 2 292  ? -54.018 20.962  -32.666 1.00 81.21  ? 846  ARG C CD  1 
ATOM   9384  N  NE  . ARG B 2 292  ? -54.728 20.565  -31.454 1.00 94.95  ? 846  ARG C NE  1 
ATOM   9385  C  CZ  . ARG B 2 292  ? -55.413 21.402  -30.682 1.00 113.53 ? 846  ARG C CZ  1 
ATOM   9386  N  NH1 . ARG B 2 292  ? -55.486 22.688  -30.997 1.00 106.54 ? 846  ARG C NH1 1 
ATOM   9387  N  NH2 . ARG B 2 292  ? -56.027 20.952  -29.597 1.00 95.13  ? 846  ARG C NH2 1 
ATOM   9388  N  N   . ASP B 2 293  ? -50.810 18.202  -34.768 1.00 76.19  ? 847  ASP C N   1 
ATOM   9389  C  CA  . ASP B 2 293  ? -49.507 18.539  -35.321 1.00 80.82  ? 847  ASP C CA  1 
ATOM   9390  C  C   . ASP B 2 293  ? -49.180 19.989  -34.982 1.00 83.65  ? 847  ASP C C   1 
ATOM   9391  O  O   . ASP B 2 293  ? -49.787 20.916  -35.519 1.00 94.59  ? 847  ASP C O   1 
ATOM   9392  C  CB  . ASP B 2 293  ? -49.487 18.319  -36.834 1.00 70.98  ? 847  ASP C CB  1 
ATOM   9393  C  CG  . ASP B 2 293  ? -48.099 18.443  -37.420 1.00 87.13  ? 847  ASP C CG  1 
ATOM   9394  O  OD1 . ASP B 2 293  ? -47.309 17.489  -37.268 1.00 94.21  ? 847  ASP C OD1 1 
ATOM   9395  O  OD2 . ASP B 2 293  ? -47.799 19.490  -38.033 1.00 82.66  ? 847  ASP C OD2 1 
ATOM   9396  N  N   . GLY B 2 294  ? -48.214 20.179  -34.089 1.00 66.26  ? 848  GLY C N   1 
ATOM   9397  C  CA  . GLY B 2 294  ? -47.840 21.506  -33.638 1.00 46.48  ? 848  GLY C CA  1 
ATOM   9398  C  C   . GLY B 2 294  ? -46.928 21.467  -32.426 1.00 48.65  ? 848  GLY C C   1 
ATOM   9399  O  O   . GLY B 2 294  ? -46.812 20.435  -31.767 1.00 45.39  ? 848  GLY C O   1 
ATOM   9400  N  N   . PRO B 2 295  ? -46.274 22.598  -32.126 1.00 47.86  ? 849  PRO C N   1 
ATOM   9401  C  CA  . PRO B 2 295  ? -45.306 22.689  -31.025 1.00 45.21  ? 849  PRO C CA  1 
ATOM   9402  C  C   . PRO B 2 295  ? -45.932 22.538  -29.639 1.00 47.70  ? 849  PRO C C   1 
ATOM   9403  O  O   . PRO B 2 295  ? -46.926 23.191  -29.322 1.00 55.46  ? 849  PRO C O   1 
ATOM   9404  C  CB  . PRO B 2 295  ? -44.711 24.090  -31.199 1.00 54.57  ? 849  PRO C CB  1 
ATOM   9405  C  CG  . PRO B 2 295  ? -45.749 24.854  -31.943 1.00 60.86  ? 849  PRO C CG  1 
ATOM   9406  C  CD  . PRO B 2 295  ? -46.399 23.868  -32.860 1.00 50.84  ? 849  PRO C CD  1 
ATOM   9407  N  N   . GLY B 2 296  ? -45.331 21.672  -28.830 1.00 54.53  ? 850  GLY C N   1 
ATOM   9408  C  CA  . GLY B 2 296  ? -45.745 21.438  -27.457 1.00 40.54  ? 850  GLY C CA  1 
ATOM   9409  C  C   . GLY B 2 296  ? -44.836 22.124  -26.455 1.00 44.75  ? 850  GLY C C   1 
ATOM   9410  O  O   . GLY B 2 296  ? -44.349 23.229  -26.697 1.00 44.95  ? 850  GLY C O   1 
ATOM   9411  N  N   . ASN B 2 297  ? -44.634 21.464  -25.315 1.00 48.45  ? 851  ASN C N   1 
ATOM   9412  C  CA  . ASN B 2 297  ? -43.740 21.945  -24.263 1.00 41.14  ? 851  ASN C CA  1 
ATOM   9413  C  C   . ASN B 2 297  ? -42.361 22.346  -24.771 1.00 40.70  ? 851  ASN C C   1 
ATOM   9414  O  O   . ASN B 2 297  ? -41.728 21.599  -25.518 1.00 53.53  ? 851  ASN C O   1 
ATOM   9415  C  CB  . ASN B 2 297  ? -43.564 20.873  -23.184 1.00 40.91  ? 851  ASN C CB  1 
ATOM   9416  C  CG  . ASN B 2 297  ? -44.878 20.407  -22.601 1.00 45.59  ? 851  ASN C CG  1 
ATOM   9417  O  OD1 . ASN B 2 297  ? -45.811 21.192  -22.430 1.00 43.31  ? 851  ASN C OD1 1 
ATOM   9418  N  ND2 . ASN B 2 297  ? -44.959 19.118  -22.288 1.00 36.50  ? 851  ASN C ND2 1 
ATOM   9419  N  N   . PRO B 2 298  ? -41.889 23.532  -24.364 1.00 36.03  ? 852  PRO C N   1 
ATOM   9420  C  CA  . PRO B 2 298  ? -40.527 23.965  -24.685 1.00 35.26  ? 852  PRO C CA  1 
ATOM   9421  C  C   . PRO B 2 298  ? -39.510 23.162  -23.894 1.00 37.99  ? 852  PRO C C   1 
ATOM   9422  O  O   . PRO B 2 298  ? -39.822 22.694  -22.800 1.00 50.18  ? 852  PRO C O   1 
ATOM   9423  C  CB  . PRO B 2 298  ? -40.506 25.440  -24.261 1.00 37.72  ? 852  PRO C CB  1 
ATOM   9424  C  CG  . PRO B 2 298  ? -41.941 25.819  -24.064 1.00 45.21  ? 852  PRO C CG  1 
ATOM   9425  C  CD  . PRO B 2 298  ? -42.631 24.570  -23.634 1.00 40.55  ? 852  PRO C CD  1 
ATOM   9426  N  N   . LEU B 2 299  ? -38.309 23.003  -24.436 1.00 40.48  ? 853  LEU C N   1 
ATOM   9427  C  CA  . LEU B 2 299  ? -37.268 22.265  -23.738 1.00 28.71  ? 853  LEU C CA  1 
ATOM   9428  C  C   . LEU B 2 299  ? -36.292 23.223  -23.071 1.00 34.05  ? 853  LEU C C   1 
ATOM   9429  O  O   . LEU B 2 299  ? -35.839 24.189  -23.685 1.00 47.58  ? 853  LEU C O   1 
ATOM   9430  C  CB  . LEU B 2 299  ? -36.518 21.337  -24.697 1.00 41.18  ? 853  LEU C CB  1 
ATOM   9431  C  CG  . LEU B 2 299  ? -37.357 20.313  -25.466 1.00 43.19  ? 853  LEU C CG  1 
ATOM   9432  C  CD1 . LEU B 2 299  ? -36.474 19.474  -26.378 1.00 40.93  ? 853  LEU C CD1 1 
ATOM   9433  C  CD2 . LEU B 2 299  ? -38.140 19.430  -24.508 1.00 37.44  ? 853  LEU C CD2 1 
ATOM   9434  N  N   . ARG B 2 300  ? -35.976 22.957  -21.809 1.00 38.24  ? 854  ARG C N   1 
ATOM   9435  C  CA  . ARG B 2 300  ? -34.928 23.704  -21.125 1.00 27.27  ? 854  ARG C CA  1 
ATOM   9436  C  C   . ARG B 2 300  ? -33.579 23.275  -21.677 1.00 36.57  ? 854  ARG C C   1 
ATOM   9437  O  O   . ARG B 2 300  ? -33.448 22.175  -22.212 1.00 42.54  ? 854  ARG C O   1 
ATOM   9438  C  CB  . ARG B 2 300  ? -34.978 23.479  -19.616 1.00 30.33  ? 854  ARG C CB  1 
ATOM   9439  C  CG  . ARG B 2 300  ? -35.985 24.343  -18.883 1.00 45.60  ? 854  ARG C CG  1 
ATOM   9440  C  CD  . ARG B 2 300  ? -36.278 23.786  -17.497 1.00 59.21  ? 854  ARG C CD  1 
ATOM   9441  N  NE  . ARG B 2 300  ? -37.413 22.868  -17.512 1.00 74.04  ? 854  ARG C NE  1 
ATOM   9442  C  CZ  . ARG B 2 300  ? -38.619 23.151  -17.021 1.00 56.99  ? 854  ARG C CZ  1 
ATOM   9443  N  NH1 . ARG B 2 300  ? -39.588 22.247  -17.083 1.00 49.75  ? 854  ARG C NH1 1 
ATOM   9444  N  NH2 . ARG B 2 300  ? -38.857 24.328  -16.456 1.00 66.50  ? 854  ARG C NH2 1 
ATOM   9445  N  N   . HIS B 2 301  ? -32.580 24.144  -21.552 1.00 43.89  ? 855  HIS C N   1 
ATOM   9446  C  CA  . HIS B 2 301  ? -31.229 23.829  -22.011 1.00 46.91  ? 855  HIS C CA  1 
ATOM   9447  C  C   . HIS B 2 301  ? -30.655 22.612  -21.284 1.00 50.96  ? 855  HIS C C   1 
ATOM   9448  O  O   . HIS B 2 301  ? -29.810 21.890  -21.818 1.00 46.03  ? 855  HIS C O   1 
ATOM   9449  C  CB  . HIS B 2 301  ? -30.305 25.035  -21.817 1.00 48.06  ? 855  HIS C CB  1 
ATOM   9450  C  CG  . HIS B 2 301  ? -29.979 25.326  -20.381 1.00 54.30  ? 855  HIS C CG  1 
ATOM   9451  N  ND1 . HIS B 2 301  ? -30.745 26.160  -19.601 1.00 53.46  ? 855  HIS C ND1 1 
ATOM   9452  C  CD2 . HIS B 2 301  ? -28.968 24.888  -19.593 1.00 44.30  ? 855  HIS C CD2 1 
ATOM   9453  C  CE1 . HIS B 2 301  ? -30.220 26.227  -18.386 1.00 56.13  ? 855  HIS C CE1 1 
ATOM   9454  N  NE2 . HIS B 2 301  ? -29.146 25.466  -18.356 1.00 55.96  ? 855  HIS C NE2 1 
ATOM   9455  N  N   . ASN B 2 302  ? -31.127 22.396  -20.061 1.00 43.77  ? 856  ASN C N   1 
ATOM   9456  C  CA  . ASN B 2 302  ? -30.645 21.310  -19.223 1.00 47.80  ? 856  ASN C CA  1 
ATOM   9457  C  C   . ASN B 2 302  ? -31.446 20.018  -19.375 1.00 43.13  ? 856  ASN C C   1 
ATOM   9458  O  O   . ASN B 2 302  ? -31.253 19.085  -18.599 1.00 47.21  ? 856  ASN C O   1 
ATOM   9459  C  CB  . ASN B 2 302  ? -30.621 21.744  -17.751 1.00 38.18  ? 856  ASN C CB  1 
ATOM   9460  C  CG  . ASN B 2 302  ? -31.986 22.172  -17.232 1.00 47.09  ? 856  ASN C CG  1 
ATOM   9461  O  OD1 . ASN B 2 302  ? -33.023 21.852  -17.812 1.00 55.68  ? 856  ASN C OD1 1 
ATOM   9462  N  ND2 . ASN B 2 302  ? -31.986 22.895  -16.118 1.00 50.19  ? 856  ASN C ND2 1 
ATOM   9463  N  N   . TYR B 2 303  ? -32.358 19.980  -20.347 1.00 33.26  ? 857  TYR C N   1 
ATOM   9464  C  CA  . TYR B 2 303  ? -33.225 18.815  -20.548 1.00 35.40  ? 857  TYR C CA  1 
ATOM   9465  C  C   . TYR B 2 303  ? -32.404 17.532  -20.658 1.00 33.01  ? 857  TYR C C   1 
ATOM   9466  O  O   . TYR B 2 303  ? -31.518 17.417  -21.504 1.00 50.52  ? 857  TYR C O   1 
ATOM   9467  C  CB  . TYR B 2 303  ? -34.084 19.010  -21.804 1.00 26.15  ? 857  TYR C CB  1 
ATOM   9468  C  CG  . TYR B 2 303  ? -34.828 17.774  -22.267 1.00 42.46  ? 857  TYR C CG  1 
ATOM   9469  C  CD1 . TYR B 2 303  ? -35.985 17.354  -21.625 1.00 38.58  ? 857  TYR C CD1 1 
ATOM   9470  C  CD2 . TYR B 2 303  ? -34.382 17.040  -23.360 1.00 42.56  ? 857  TYR C CD2 1 
ATOM   9471  C  CE1 . TYR B 2 303  ? -36.670 16.231  -22.047 1.00 32.61  ? 857  TYR C CE1 1 
ATOM   9472  C  CE2 . TYR B 2 303  ? -35.061 15.916  -23.790 1.00 24.89  ? 857  TYR C CE2 1 
ATOM   9473  C  CZ  . TYR B 2 303  ? -36.203 15.516  -23.129 1.00 39.15  ? 857  TYR C CZ  1 
ATOM   9474  O  OH  . TYR B 2 303  ? -36.884 14.397  -23.551 1.00 41.65  ? 857  TYR C OH  1 
ATOM   9475  N  N   . GLU B 2 304  ? -32.715 16.571  -19.792 1.00 31.43  ? 858  GLU C N   1 
ATOM   9476  C  CA  . GLU B 2 304  ? -31.880 15.385  -19.614 1.00 39.93  ? 858  GLU C CA  1 
ATOM   9477  C  C   . GLU B 2 304  ? -32.357 14.158  -20.387 1.00 34.65  ? 858  GLU C C   1 
ATOM   9478  O  O   . GLU B 2 304  ? -31.764 13.087  -20.276 1.00 47.35  ? 858  GLU C O   1 
ATOM   9479  C  CB  . GLU B 2 304  ? -31.778 15.041  -18.126 1.00 40.81  ? 858  GLU C CB  1 
ATOM   9480  C  CG  . GLU B 2 304  ? -31.079 16.104  -17.294 1.00 47.59  ? 858  GLU C CG  1 
ATOM   9481  C  CD  . GLU B 2 304  ? -30.916 15.699  -15.842 1.00 57.43  ? 858  GLU C CD  1 
ATOM   9482  O  OE1 . GLU B 2 304  ? -31.084 14.501  -15.534 1.00 75.17  ? 858  GLU C OE1 1 
ATOM   9483  O  OE2 . GLU B 2 304  ? -30.620 16.581  -15.008 1.00 65.85  ? 858  GLU C OE2 1 
ATOM   9484  N  N   . GLY B 2 305  ? -33.431 14.306  -21.154 1.00 36.15  ? 859  GLY C N   1 
ATOM   9485  C  CA  . GLY B 2 305  ? -33.967 13.191  -21.911 1.00 32.84  ? 859  GLY C CA  1 
ATOM   9486  C  C   . GLY B 2 305  ? -33.222 12.946  -23.210 1.00 36.86  ? 859  GLY C C   1 
ATOM   9487  O  O   . GLY B 2 305  ? -32.245 13.630  -23.518 1.00 42.84  ? 859  GLY C O   1 
ATOM   9488  N  N   . THR B 2 306  ? -33.685 11.961  -23.973 1.00 39.57  ? 860  THR C N   1 
ATOM   9489  C  CA  . THR B 2 306  ? -33.095 11.650  -25.270 1.00 38.73  ? 860  THR C CA  1 
ATOM   9490  C  C   . THR B 2 306  ? -34.093 11.905  -26.393 1.00 44.26  ? 860  THR C C   1 
ATOM   9491  O  O   . THR B 2 306  ? -35.235 12.290  -26.145 1.00 52.77  ? 860  THR C O   1 
ATOM   9492  C  CB  . THR B 2 306  ? -32.616 10.190  -25.342 1.00 42.52  ? 860  THR C CB  1 
ATOM   9493  O  OG1 . THR B 2 306  ? -33.702 9.313   -25.020 1.00 50.16  ? 860  THR C OG1 1 
ATOM   9494  C  CG2 . THR B 2 306  ? -31.477 9.956   -24.365 1.00 50.72  ? 860  THR C CG2 1 
ATOM   9495  N  N   . LEU B 2 307  ? -33.655 11.685  -27.628 1.00 38.16  ? 861  LEU C N   1 
ATOM   9496  C  CA  . LEU B 2 307  ? -34.506 11.903  -28.791 1.00 51.46  ? 861  LEU C CA  1 
ATOM   9497  C  C   . LEU B 2 307  ? -35.694 10.942  -28.791 1.00 51.75  ? 861  LEU C C   1 
ATOM   9498  O  O   . LEU B 2 307  ? -36.807 11.311  -29.177 1.00 48.58  ? 861  LEU C O   1 
ATOM   9499  C  CB  . LEU B 2 307  ? -33.696 11.751  -30.079 1.00 45.34  ? 861  LEU C CB  1 
ATOM   9500  C  CG  . LEU B 2 307  ? -34.424 12.045  -31.390 1.00 38.79  ? 861  LEU C CG  1 
ATOM   9501  C  CD1 . LEU B 2 307  ? -34.997 13.451  -31.375 1.00 56.05  ? 861  LEU C CD1 1 
ATOM   9502  C  CD2 . LEU B 2 307  ? -33.485 11.863  -32.569 1.00 52.83  ? 861  LEU C CD2 1 
ATOM   9503  N  N   . ARG B 2 308  ? -35.450 9.712   -28.347 1.00 32.56  ? 862  ARG C N   1 
ATOM   9504  C  CA  . ARG B 2 308  ? -36.501 8.705   -28.279 1.00 37.96  ? 862  ARG C CA  1 
ATOM   9505  C  C   . ARG B 2 308  ? -37.611 9.147   -27.333 1.00 47.19  ? 862  ARG C C   1 
ATOM   9506  O  O   . ARG B 2 308  ? -38.792 8.965   -27.625 1.00 45.47  ? 862  ARG C O   1 
ATOM   9507  C  CB  . ARG B 2 308  ? -35.933 7.355   -27.838 1.00 41.38  ? 862  ARG C CB  1 
ATOM   9508  C  CG  . ARG B 2 308  ? -36.963 6.236   -27.834 1.00 53.08  ? 862  ARG C CG  1 
ATOM   9509  C  CD  . ARG B 2 308  ? -36.329 4.877   -28.087 1.00 46.39  ? 862  ARG C CD  1 
ATOM   9510  N  NE  . ARG B 2 308  ? -36.214 4.077   -26.871 1.00 65.76  ? 862  ARG C NE  1 
ATOM   9511  C  CZ  . ARG B 2 308  ? -35.889 2.788   -26.858 1.00 76.56  ? 862  ARG C CZ  1 
ATOM   9512  N  NH1 . ARG B 2 308  ? -35.651 2.152   -27.997 1.00 56.97  ? 862  ARG C NH1 1 
ATOM   9513  N  NH2 . ARG B 2 308  ? -35.807 2.133   -25.708 1.00 87.87  ? 862  ARG C NH2 1 
ATOM   9514  N  N   . ASP B 2 309  ? -37.222 9.733   -26.204 1.00 53.75  ? 863  ASP C N   1 
ATOM   9515  C  CA  . ASP B 2 309  ? -38.183 10.273  -25.248 1.00 42.94  ? 863  ASP C CA  1 
ATOM   9516  C  C   . ASP B 2 309  ? -39.039 11.351  -25.894 1.00 40.82  ? 863  ASP C C   1 
ATOM   9517  O  O   . ASP B 2 309  ? -40.235 11.455  -25.627 1.00 54.75  ? 863  ASP C O   1 
ATOM   9518  C  CB  . ASP B 2 309  ? -37.468 10.844  -24.022 1.00 39.38  ? 863  ASP C CB  1 
ATOM   9519  C  CG  . ASP B 2 309  ? -36.813 9.773   -23.178 1.00 52.97  ? 863  ASP C CG  1 
ATOM   9520  O  OD1 . ASP B 2 309  ? -37.270 8.611   -23.230 1.00 74.81  ? 863  ASP C OD1 1 
ATOM   9521  O  OD2 . ASP B 2 309  ? -35.843 10.093  -22.459 1.00 47.07  ? 863  ASP C OD2 1 
ATOM   9522  N  N   . LEU B 2 310  ? -38.412 12.151  -26.750 1.00 39.52  ? 864  LEU C N   1 
ATOM   9523  C  CA  . LEU B 2 310  ? -39.098 13.245  -27.420 1.00 42.44  ? 864  LEU C CA  1 
ATOM   9524  C  C   . LEU B 2 310  ? -40.037 12.746  -28.511 1.00 50.20  ? 864  LEU C C   1 
ATOM   9525  O  O   . LEU B 2 310  ? -41.028 13.402  -28.831 1.00 62.18  ? 864  LEU C O   1 
ATOM   9526  C  CB  . LEU B 2 310  ? -38.083 14.224  -28.015 1.00 39.01  ? 864  LEU C CB  1 
ATOM   9527  C  CG  . LEU B 2 310  ? -37.234 15.018  -27.022 1.00 39.53  ? 864  LEU C CG  1 
ATOM   9528  C  CD1 . LEU B 2 310  ? -36.202 15.857  -27.755 1.00 29.80  ? 864  LEU C CD1 1 
ATOM   9529  C  CD2 . LEU B 2 310  ? -38.116 15.901  -26.155 1.00 33.17  ? 864  LEU C CD2 1 
ATOM   9530  N  N   . LEU B 2 311  ? -39.730 11.584  -29.079 1.00 52.88  ? 865  LEU C N   1 
ATOM   9531  C  CA  . LEU B 2 311  ? -40.516 11.067  -30.197 1.00 49.72  ? 865  LEU C CA  1 
ATOM   9532  C  C   . LEU B 2 311  ? -41.369 9.845   -29.850 1.00 51.29  ? 865  LEU C C   1 
ATOM   9533  O  O   . LEU B 2 311  ? -41.987 9.251   -30.734 1.00 55.42  ? 865  LEU C O   1 
ATOM   9534  C  CB  . LEU B 2 311  ? -39.591 10.709  -31.362 1.00 44.70  ? 865  LEU C CB  1 
ATOM   9535  C  CG  . LEU B 2 311  ? -38.593 11.760  -31.846 1.00 45.13  ? 865  LEU C CG  1 
ATOM   9536  C  CD1 . LEU B 2 311  ? -37.715 11.174  -32.937 1.00 44.96  ? 865  LEU C CD1 1 
ATOM   9537  C  CD2 . LEU B 2 311  ? -39.308 13.003  -32.344 1.00 45.84  ? 865  LEU C CD2 1 
ATOM   9538  N  N   . GLN B 2 312  ? -41.416 9.475   -28.574 1.00 51.26  ? 866  GLN C N   1 
ATOM   9539  C  CA  . GLN B 2 312  ? -41.981 8.182   -28.187 1.00 59.17  ? 866  GLN C CA  1 
ATOM   9540  C  C   . GLN B 2 312  ? -43.493 8.066   -28.379 1.00 61.89  ? 866  GLN C C   1 
ATOM   9541  O  O   . GLN B 2 312  ? -44.011 6.963   -28.549 1.00 66.80  ? 866  GLN C O   1 
ATOM   9542  C  CB  . GLN B 2 312  ? -41.630 7.866   -26.729 1.00 53.95  ? 866  GLN C CB  1 
ATOM   9543  C  CG  . GLN B 2 312  ? -42.310 8.751   -25.704 1.00 65.77  ? 866  GLN C CG  1 
ATOM   9544  C  CD  . GLN B 2 312  ? -42.115 8.235   -24.293 1.00 76.55  ? 866  GLN C CD  1 
ATOM   9545  O  OE1 . GLN B 2 312  ? -41.502 7.187   -24.086 1.00 70.16  ? 866  GLN C OE1 1 
ATOM   9546  N  NE2 . GLN B 2 312  ? -42.635 8.965   -23.315 1.00 86.64  ? 866  GLN C NE2 1 
ATOM   9547  N  N   . PHE B 2 313  ? -44.203 9.187   -28.349 1.00 63.02  ? 867  PHE C N   1 
ATOM   9548  C  CA  . PHE B 2 313  ? -45.661 9.148   -28.479 1.00 71.36  ? 867  PHE C CA  1 
ATOM   9549  C  C   . PHE B 2 313  ? -46.146 9.353   -29.919 1.00 61.08  ? 867  PHE C C   1 
ATOM   9550  O  O   . PHE B 2 313  ? -47.346 9.480   -30.163 1.00 67.30  ? 867  PHE C O   1 
ATOM   9551  C  CB  . PHE B 2 313  ? -46.347 10.145  -27.515 1.00 75.65  ? 867  PHE C CB  1 
ATOM   9552  C  CG  . PHE B 2 313  ? -45.940 11.597  -27.673 1.00 94.96  ? 867  PHE C CG  1 
ATOM   9553  C  CD1 . PHE B 2 313  ? -44.742 11.973  -28.262 1.00 88.31  ? 867  PHE C CD1 1 
ATOM   9554  C  CD2 . PHE B 2 313  ? -46.773 12.592  -27.184 1.00 107.82 ? 867  PHE C CD2 1 
ATOM   9555  C  CE1 . PHE B 2 313  ? -44.399 13.302  -28.374 1.00 84.58  ? 867  PHE C CE1 1 
ATOM   9556  C  CE2 . PHE B 2 313  ? -46.434 13.922  -27.295 1.00 96.17  ? 867  PHE C CE2 1 
ATOM   9557  C  CZ  . PHE B 2 313  ? -45.246 14.276  -27.890 1.00 79.66  ? 867  PHE C CZ  1 
ATOM   9558  N  N   . PHE B 2 314  ? -45.214 9.393   -30.866 1.00 66.28  ? 868  PHE C N   1 
ATOM   9559  C  CA  . PHE B 2 314  ? -45.569 9.259   -32.277 1.00 67.45  ? 868  PHE C CA  1 
ATOM   9560  C  C   . PHE B 2 314  ? -45.838 7.797   -32.615 1.00 69.49  ? 868  PHE C C   1 
ATOM   9561  O  O   . PHE B 2 314  ? -45.181 6.903   -32.084 1.00 58.76  ? 868  PHE C O   1 
ATOM   9562  C  CB  . PHE B 2 314  ? -44.463 9.789   -33.188 1.00 59.83  ? 868  PHE C CB  1 
ATOM   9563  C  CG  . PHE B 2 314  ? -44.363 11.280  -33.224 1.00 59.06  ? 868  PHE C CG  1 
ATOM   9564  C  CD1 . PHE B 2 314  ? -45.285 12.030  -33.932 1.00 57.61  ? 868  PHE C CD1 1 
ATOM   9565  C  CD2 . PHE B 2 314  ? -43.334 11.931  -32.570 1.00 58.48  ? 868  PHE C CD2 1 
ATOM   9566  C  CE1 . PHE B 2 314  ? -45.191 13.404  -33.974 1.00 60.80  ? 868  PHE C CE1 1 
ATOM   9567  C  CE2 . PHE B 2 314  ? -43.233 13.304  -32.610 1.00 58.44  ? 868  PHE C CE2 1 
ATOM   9568  C  CZ  . PHE B 2 314  ? -44.162 14.042  -33.315 1.00 45.12  ? 868  PHE C CZ  1 
ATOM   9569  N  N   . LYS B 2 315  ? -46.795 7.558   -33.505 1.00 77.73  ? 869  LYS C N   1 
ATOM   9570  C  CA  . LYS B 2 315  ? -47.041 6.213   -34.012 1.00 90.43  ? 869  LYS C CA  1 
ATOM   9571  C  C   . LYS B 2 315  ? -45.927 5.839   -34.986 1.00 95.63  ? 869  LYS C C   1 
ATOM   9572  O  O   . LYS B 2 315  ? -45.329 6.720   -35.607 1.00 95.25  ? 869  LYS C O   1 
ATOM   9573  C  CB  . LYS B 2 315  ? -48.405 6.132   -34.701 1.00 90.08  ? 869  LYS C CB  1 
ATOM   9574  C  CG  . LYS B 2 315  ? -49.564 6.680   -33.884 1.00 87.32  ? 869  LYS C CG  1 
ATOM   9575  C  CD  . LYS B 2 315  ? -49.928 5.773   -32.720 1.00 84.96  ? 869  LYS C CD  1 
ATOM   9576  C  CE  . LYS B 2 315  ? -51.145 6.311   -31.978 1.00 100.66 ? 869  LYS C CE  1 
ATOM   9577  N  NZ  . LYS B 2 315  ? -51.603 5.401   -30.891 1.00 85.49  ? 869  LYS C NZ  1 
ATOM   9578  N  N   . PRO B 2 316  ? -45.638 4.533   -35.125 1.00 101.76 ? 870  PRO C N   1 
ATOM   9579  C  CA  . PRO B 2 316  ? -44.622 4.100   -36.093 1.00 105.71 ? 870  PRO C CA  1 
ATOM   9580  C  C   . PRO B 2 316  ? -45.003 4.466   -37.526 1.00 102.43 ? 870  PRO C C   1 
ATOM   9581  O  O   . PRO B 2 316  ? -44.144 4.524   -38.408 1.00 86.68  ? 870  PRO C O   1 
ATOM   9582  C  CB  . PRO B 2 316  ? -44.580 2.579   -35.908 1.00 96.49  ? 870  PRO C CB  1 
ATOM   9583  C  CG  . PRO B 2 316  ? -45.888 2.230   -35.282 1.00 98.37  ? 870  PRO C CG  1 
ATOM   9584  C  CD  . PRO B 2 316  ? -46.230 3.395   -34.404 1.00 90.11  ? 870  PRO C CD  1 
ATOM   9585  N  N   . ARG B 2 317  ? -46.291 4.708   -37.744 1.00 109.84 ? 871  ARG C N   1 
ATOM   9586  C  CA  . ARG B 2 317  ? -46.791 5.161   -39.034 1.00 103.18 ? 871  ARG C CA  1 
ATOM   9587  C  C   . ARG B 2 317  ? -46.533 6.654   -39.215 1.00 87.40  ? 871  ARG C C   1 
ATOM   9588  O  O   . ARG B 2 317  ? -46.202 7.110   -40.309 1.00 61.33  ? 871  ARG C O   1 
ATOM   9589  C  CB  . ARG B 2 317  ? -48.287 4.868   -39.153 1.00 109.16 ? 871  ARG C CB  1 
ATOM   9590  C  CG  . ARG B 2 317  ? -48.755 3.712   -38.280 1.00 109.18 ? 871  ARG C CG  1 
ATOM   9591  C  CD  . ARG B 2 317  ? -49.916 4.128   -37.388 1.00 112.52 ? 871  ARG C CD  1 
ATOM   9592  N  NE  . ARG B 2 317  ? -49.817 3.543   -36.053 1.00 127.30 ? 871  ARG C NE  1 
ATOM   9593  C  CZ  . ARG B 2 317  ? -50.781 2.841   -35.464 1.00 128.03 ? 871  ARG C CZ  1 
ATOM   9594  N  NH1 . ARG B 2 317  ? -51.929 2.630   -36.092 1.00 121.09 ? 871  ARG C NH1 1 
ATOM   9595  N  NH2 . ARG B 2 317  ? -50.596 2.353   -34.245 1.00 103.07 ? 871  ARG C NH2 1 
ATOM   9596  N  N   . GLN B 2 318  ? -46.679 7.405   -38.127 1.00 100.66 ? 872  GLN C N   1 
ATOM   9597  C  CA  . GLN B 2 318  ? -46.609 8.861   -38.167 1.00 83.30  ? 872  GLN C CA  1 
ATOM   9598  C  C   . GLN B 2 318  ? -45.221 9.412   -38.465 1.00 75.77  ? 872  GLN C C   1 
ATOM   9599  O  O   . GLN B 2 318  ? -44.214 8.853   -38.031 1.00 68.27  ? 872  GLN C O   1 
ATOM   9600  C  CB  . GLN B 2 318  ? -47.092 9.450   -36.840 1.00 77.55  ? 872  GLN C CB  1 
ATOM   9601  C  CG  . GLN B 2 318  ? -48.558 9.222   -36.537 1.00 87.67  ? 872  GLN C CG  1 
ATOM   9602  C  CD  . GLN B 2 318  ? -49.093 10.218  -35.526 1.00 95.71  ? 872  GLN C CD  1 
ATOM   9603  O  OE1 . GLN B 2 318  ? -49.572 9.842   -34.457 1.00 87.39  ? 872  GLN C OE1 1 
ATOM   9604  N  NE2 . GLN B 2 318  ? -49.012 11.500  -35.863 1.00 71.34  ? 872  GLN C NE2 1 
ATOM   9605  N  N   . PRO B 2 319  ? -45.172 10.525  -39.210 1.00 70.32  ? 873  PRO C N   1 
ATOM   9606  C  CA  . PRO B 2 319  ? -43.942 11.301  -39.386 1.00 71.07  ? 873  PRO C CA  1 
ATOM   9607  C  C   . PRO B 2 319  ? -43.543 11.946  -38.066 1.00 67.93  ? 873  PRO C C   1 
ATOM   9608  O  O   . PRO B 2 319  ? -44.385 12.560  -37.412 1.00 68.03  ? 873  PRO C O   1 
ATOM   9609  C  CB  . PRO B 2 319  ? -44.329 12.359  -40.428 1.00 66.92  ? 873  PRO C CB  1 
ATOM   9610  C  CG  . PRO B 2 319  ? -45.571 11.832  -41.077 1.00 60.12  ? 873  PRO C CG  1 
ATOM   9611  C  CD  . PRO B 2 319  ? -46.281 11.068  -40.010 1.00 71.10  ? 873  PRO C CD  1 
ATOM   9612  N  N   . LYS B 2 320  ? -42.280 11.807  -37.683 1.00 62.97  ? 874  LYS C N   1 
ATOM   9613  C  CA  . LYS B 2 320  ? -41.827 12.266  -36.376 1.00 55.69  ? 874  LYS C CA  1 
ATOM   9614  C  C   . LYS B 2 320  ? -41.226 13.661  -36.442 1.00 53.33  ? 874  LYS C C   1 
ATOM   9615  O  O   . LYS B 2 320  ? -40.099 13.847  -36.905 1.00 53.51  ? 874  LYS C O   1 
ATOM   9616  C  CB  . LYS B 2 320  ? -40.819 11.274  -35.799 1.00 46.55  ? 874  LYS C CB  1 
ATOM   9617  C  CG  . LYS B 2 320  ? -41.424 9.910   -35.537 1.00 45.63  ? 874  LYS C CG  1 
ATOM   9618  C  CD  . LYS B 2 320  ? -40.378 8.817   -35.547 1.00 53.15  ? 874  LYS C CD  1 
ATOM   9619  C  CE  . LYS B 2 320  ? -41.021 7.463   -35.314 1.00 68.17  ? 874  LYS C CE  1 
ATOM   9620  N  NZ  . LYS B 2 320  ? -42.188 7.254   -36.217 1.00 82.03  ? 874  LYS C NZ  1 
ATOM   9621  N  N   . LYS B 2 321  ? -41.988 14.639  -35.967 1.00 56.07  ? 875  LYS C N   1 
ATOM   9622  C  CA  . LYS B 2 321  ? -41.578 16.030  -36.054 1.00 54.49  ? 875  LYS C CA  1 
ATOM   9623  C  C   . LYS B 2 321  ? -41.063 16.570  -34.725 1.00 46.63  ? 875  LYS C C   1 
ATOM   9624  O  O   . LYS B 2 321  ? -41.425 16.089  -33.652 1.00 48.80  ? 875  LYS C O   1 
ATOM   9625  C  CB  . LYS B 2 321  ? -42.738 16.892  -36.562 1.00 52.81  ? 875  LYS C CB  1 
ATOM   9626  C  CG  . LYS B 2 321  ? -43.092 16.620  -38.017 1.00 72.25  ? 875  LYS C CG  1 
ATOM   9627  C  CD  . LYS B 2 321  ? -44.408 17.262  -38.423 1.00 89.02  ? 875  LYS C CD  1 
ATOM   9628  C  CE  . LYS B 2 321  ? -44.197 18.586  -39.133 1.00 69.47  ? 875  LYS C CE  1 
ATOM   9629  N  NZ  . LYS B 2 321  ? -45.468 19.123  -39.690 1.00 72.61  ? 875  LYS C NZ  1 
ATOM   9630  N  N   . LEU B 2 322  ? -40.203 17.575  -34.824 1.00 56.92  ? 876  LEU C N   1 
ATOM   9631  C  CA  . LEU B 2 322  ? -39.600 18.220  -33.670 1.00 39.65  ? 876  LEU C CA  1 
ATOM   9632  C  C   . LEU B 2 322  ? -39.545 19.709  -33.972 1.00 43.33  ? 876  LEU C C   1 
ATOM   9633  O  O   . LEU B 2 322  ? -39.019 20.110  -35.008 1.00 54.95  ? 876  LEU C O   1 
ATOM   9634  C  CB  . LEU B 2 322  ? -38.203 17.654  -33.403 1.00 48.83  ? 876  LEU C CB  1 
ATOM   9635  C  CG  . LEU B 2 322  ? -37.609 17.677  -31.991 1.00 44.29  ? 876  LEU C CG  1 
ATOM   9636  C  CD1 . LEU B 2 322  ? -37.310 19.093  -31.529 1.00 57.32  ? 876  LEU C CD1 1 
ATOM   9637  C  CD2 . LEU B 2 322  ? -38.539 16.977  -31.013 1.00 47.79  ? 876  LEU C CD2 1 
ATOM   9638  N  N   . TYR B 2 323  ? -40.088 20.535  -33.087 1.00 49.79  ? 877  TYR C N   1 
ATOM   9639  C  CA  . TYR B 2 323  ? -40.195 21.953  -33.406 1.00 43.06  ? 877  TYR C CA  1 
ATOM   9640  C  C   . TYR B 2 323  ? -39.051 22.754  -32.807 1.00 41.49  ? 877  TYR C C   1 
ATOM   9641  O  O   . TYR B 2 323  ? -38.335 22.267  -31.936 1.00 44.85  ? 877  TYR C O   1 
ATOM   9642  C  CB  . TYR B 2 323  ? -41.548 22.494  -32.946 1.00 42.60  ? 877  TYR C CB  1 
ATOM   9643  C  CG  . TYR B 2 323  ? -42.695 21.882  -33.712 1.00 47.66  ? 877  TYR C CG  1 
ATOM   9644  C  CD1 . TYR B 2 323  ? -43.285 20.700  -33.288 1.00 37.81  ? 877  TYR C CD1 1 
ATOM   9645  C  CD2 . TYR B 2 323  ? -43.168 22.471  -34.878 1.00 52.86  ? 877  TYR C CD2 1 
ATOM   9646  C  CE1 . TYR B 2 323  ? -44.324 20.128  -33.994 1.00 51.08  ? 877  TYR C CE1 1 
ATOM   9647  C  CE2 . TYR B 2 323  ? -44.209 21.907  -35.590 1.00 43.31  ? 877  TYR C CE2 1 
ATOM   9648  C  CZ  . TYR B 2 323  ? -44.783 20.737  -35.143 1.00 58.81  ? 877  TYR C CZ  1 
ATOM   9649  O  OH  . TYR B 2 323  ? -45.819 20.170  -35.848 1.00 61.79  ? 877  TYR C OH  1 
ATOM   9650  N  N   . TYR B 2 324  ? -38.870 23.974  -33.301 1.00 43.85  ? 878  TYR C N   1 
ATOM   9651  C  CA  . TYR B 2 324  ? -37.792 24.833  -32.833 1.00 43.25  ? 878  TYR C CA  1 
ATOM   9652  C  C   . TYR B 2 324  ? -38.000 26.278  -33.266 1.00 48.39  ? 878  TYR C C   1 
ATOM   9653  O  O   . TYR B 2 324  ? -38.845 26.568  -34.114 1.00 40.51  ? 878  TYR C O   1 
ATOM   9654  C  CB  . TYR B 2 324  ? -36.436 24.333  -33.346 1.00 45.80  ? 878  TYR C CB  1 
ATOM   9655  C  CG  . TYR B 2 324  ? -36.187 24.627  -34.810 1.00 59.64  ? 878  TYR C CG  1 
ATOM   9656  C  CD1 . TYR B 2 324  ? -36.622 23.754  -35.799 1.00 62.42  ? 878  TYR C CD1 1 
ATOM   9657  C  CD2 . TYR B 2 324  ? -35.513 25.777  -35.203 1.00 65.05  ? 878  TYR C CD2 1 
ATOM   9658  C  CE1 . TYR B 2 324  ? -36.397 24.021  -37.136 1.00 62.74  ? 878  TYR C CE1 1 
ATOM   9659  C  CE2 . TYR B 2 324  ? -35.289 26.053  -36.534 1.00 73.30  ? 878  TYR C CE2 1 
ATOM   9660  C  CZ  . TYR B 2 324  ? -35.730 25.172  -37.497 1.00 66.89  ? 878  TYR C CZ  1 
ATOM   9661  O  OH  . TYR B 2 324  ? -35.503 25.443  -38.826 1.00 62.33  ? 878  TYR C OH  1 
ATOM   9662  N  N   . GLN B 2 325  ? -37.219 27.178  -32.679 1.00 51.44  ? 879  GLN C N   1 
ATOM   9663  C  CA  . GLN B 2 325  ? -37.160 28.559  -33.136 1.00 39.78  ? 879  GLN C CA  1 
ATOM   9664  C  C   . GLN B 2 325  ? -35.767 29.128  -32.891 1.00 51.88  ? 879  GLN C C   1 
ATOM   9665  O  O   . GLN B 2 325  ? -35.086 28.756  -31.927 1.00 57.07  ? 879  GLN C O   1 
ATOM   9666  C  CB  . GLN B 2 325  ? -38.223 29.419  -32.445 1.00 34.14  ? 879  GLN C CB  1 
ATOM   9667  C  CG  . GLN B 2 325  ? -37.982 29.683  -30.968 1.00 51.77  ? 879  GLN C CG  1 
ATOM   9668  C  CD  . GLN B 2 325  ? -38.932 30.725  -30.404 1.00 56.52  ? 879  GLN C CD  1 
ATOM   9669  O  OE1 . GLN B 2 325  ? -39.746 31.296  -31.131 1.00 53.39  ? 879  GLN C OE1 1 
ATOM   9670  N  NE2 . GLN B 2 325  ? -38.830 30.980  -29.105 1.00 44.78  ? 879  GLN C NE2 1 
ATOM   9671  N  N   . GLN B 2 326  ? -35.343 30.017  -33.785 1.00 53.64  ? 880  GLN C N   1 
ATOM   9672  C  CA  . GLN B 2 326  ? -34.049 30.673  -33.667 1.00 44.02  ? 880  GLN C CA  1 
ATOM   9673  C  C   . GLN B 2 326  ? -34.160 31.869  -32.736 1.00 52.13  ? 880  GLN C C   1 
ATOM   9674  O  O   . GLN B 2 326  ? -35.141 32.612  -32.781 1.00 58.14  ? 880  GLN C O   1 
ATOM   9675  C  CB  . GLN B 2 326  ? -33.533 31.110  -35.039 1.00 62.27  ? 880  GLN C CB  1 
ATOM   9676  C  CG  . GLN B 2 326  ? -33.430 29.983  -36.052 1.00 56.99  ? 880  GLN C CG  1 
ATOM   9677  C  CD  . GLN B 2 326  ? -32.110 29.994  -36.796 1.00 64.03  ? 880  GLN C CD  1 
ATOM   9678  O  OE1 . GLN B 2 326  ? -31.084 30.409  -36.257 1.00 61.51  ? 880  GLN C OE1 1 
ATOM   9679  N  NE2 . GLN B 2 326  ? -32.129 29.540  -38.044 1.00 69.45  ? 880  GLN C NE2 1 
ATOM   9680  N  N   . LEU B 2 327  ? -33.148 32.056  -31.896 1.00 54.70  ? 881  LEU C N   1 
ATOM   9681  C  CA  . LEU B 2 327  ? -33.205 33.074  -30.857 1.00 58.61  ? 881  LEU C CA  1 
ATOM   9682  C  C   . LEU B 2 327  ? -32.266 34.245  -31.124 1.00 56.62  ? 881  LEU C C   1 
ATOM   9683  O  O   . LEU B 2 327  ? -31.267 34.108  -31.829 1.00 66.16  ? 881  LEU C O   1 
ATOM   9684  C  CB  . LEU B 2 327  ? -32.878 32.451  -29.500 1.00 49.41  ? 881  LEU C CB  1 
ATOM   9685  C  CG  . LEU B 2 327  ? -33.720 31.236  -29.113 1.00 42.48  ? 881  LEU C CG  1 
ATOM   9686  C  CD1 . LEU B 2 327  ? -33.341 30.752  -27.725 1.00 65.19  ? 881  LEU C CD1 1 
ATOM   9687  C  CD2 . LEU B 2 327  ? -35.201 31.566  -29.181 1.00 40.82  ? 881  LEU C CD2 1 
ATOM   9688  N  N   . LYS B 2 328  ? -32.600 35.397  -30.554 1.00 68.01  ? 882  LYS C N   1 
ATOM   9689  C  CA  . LYS B 2 328  ? -31.769 36.587  -30.670 1.00 61.90  ? 882  LYS C CA  1 
ATOM   9690  C  C   . LYS B 2 328  ? -30.781 36.673  -29.513 1.00 63.21  ? 882  LYS C C   1 
ATOM   9691  O  O   . LYS B 2 328  ? -29.885 37.516  -29.508 1.00 72.66  ? 882  LYS C O   1 
ATOM   9692  C  CB  . LYS B 2 328  ? -32.638 37.843  -30.716 1.00 73.84  ? 882  LYS C CB  1 
ATOM   9693  C  CG  . LYS B 2 328  ? -33.610 37.874  -31.883 1.00 81.41  ? 882  LYS C CG  1 
ATOM   9694  C  CD  . LYS B 2 328  ? -32.873 37.810  -33.210 1.00 80.17  ? 882  LYS C CD  1 
ATOM   9695  C  CE  . LYS B 2 328  ? -33.838 37.823  -34.384 1.00 70.38  ? 882  LYS C CE  1 
ATOM   9696  N  NZ  . LYS B 2 328  ? -33.119 37.820  -35.688 1.00 61.74  ? 882  LYS C NZ  1 
ATOM   9697  N  N   . MET B 2 329  ? -30.955 35.791  -28.535 1.00 61.62  ? 883  MET C N   1 
ATOM   9698  C  CA  . MET B 2 329  ? -30.087 35.747  -27.365 1.00 63.51  ? 883  MET C CA  1 
ATOM   9699  C  C   . MET B 2 329  ? -29.864 34.298  -26.958 1.00 62.42  ? 883  MET C C   1 
ATOM   9700  O  O   . MET B 2 329  ? -30.694 33.439  -27.255 1.00 68.46  ? 883  MET C O   1 
ATOM   9701  C  CB  . MET B 2 329  ? -30.697 36.547  -26.213 1.00 57.60  ? 883  MET C CB  1 
ATOM   9702  C  CG  . MET B 2 329  ? -32.021 35.995  -25.708 1.00 53.19  ? 883  MET C CG  1 
ATOM   9703  S  SD  . MET B 2 329  ? -33.027 37.239  -24.877 1.00 52.74  ? 883  MET C SD  1 
ATOM   9704  C  CE  . MET B 2 329  ? -31.847 37.912  -23.712 1.00 42.47  ? 883  MET C CE  1 
ATOM   9705  N  N   . LYS B 2 330  ? -28.749 34.020  -26.288 1.00 55.94  ? 884  LYS C N   1 
ATOM   9706  C  CA  . LYS B 2 330  ? -28.440 32.646  -25.909 1.00 57.17  ? 884  LYS C CA  1 
ATOM   9707  C  C   . LYS B 2 330  ? -29.516 32.108  -24.972 1.00 57.89  ? 884  LYS C C   1 
ATOM   9708  O  O   . LYS B 2 330  ? -30.007 32.820  -24.095 1.00 66.12  ? 884  LYS C O   1 
ATOM   9709  C  CB  . LYS B 2 330  ? -27.045 32.544  -25.277 1.00 54.74  ? 884  LYS C CB  1 
ATOM   9710  C  CG  . LYS B 2 330  ? -26.821 33.365  -24.019 1.00 73.42  ? 884  LYS C CG  1 
ATOM   9711  C  CD  . LYS B 2 330  ? -25.407 33.136  -23.493 1.00 81.85  ? 884  LYS C CD  1 
ATOM   9712  C  CE  . LYS B 2 330  ? -25.195 33.786  -22.137 1.00 77.36  ? 884  LYS C CE  1 
ATOM   9713  N  NZ  . LYS B 2 330  ? -23.853 33.466  -21.580 1.00 71.64  ? 884  LYS C NZ  1 
ATOM   9714  N  N   . ILE B 2 331  ? -29.877 30.846  -25.186 1.00 63.24  ? 885  ILE C N   1 
ATOM   9715  C  CA  . ILE B 2 331  ? -31.097 30.259  -24.632 1.00 54.13  ? 885  ILE C CA  1 
ATOM   9716  C  C   . ILE B 2 331  ? -31.243 30.405  -23.113 1.00 52.58  ? 885  ILE C C   1 
ATOM   9717  O  O   . ILE B 2 331  ? -32.359 30.476  -22.604 1.00 54.00  ? 885  ILE C O   1 
ATOM   9718  C  CB  . ILE B 2 331  ? -31.196 28.763  -25.019 1.00 41.90  ? 885  ILE C CB  1 
ATOM   9719  C  CG1 . ILE B 2 331  ? -32.566 28.195  -24.636 1.00 39.95  ? 885  ILE C CG1 1 
ATOM   9720  C  CG2 . ILE B 2 331  ? -30.063 27.960  -24.393 1.00 43.10  ? 885  ILE C CG2 1 
ATOM   9721  C  CD1 . ILE B 2 331  ? -32.802 26.791  -25.126 1.00 40.09  ? 885  ILE C CD1 1 
ATOM   9722  N  N   . THR B 2 332  ? -30.128 30.467  -22.392 1.00 52.24  ? 886  THR C N   1 
ATOM   9723  C  CA  . THR B 2 332  ? -30.190 30.662  -20.947 1.00 65.10  ? 886  THR C CA  1 
ATOM   9724  C  C   . THR B 2 332  ? -30.730 32.048  -20.611 1.00 54.91  ? 886  THR C C   1 
ATOM   9725  O  O   . THR B 2 332  ? -31.625 32.189  -19.776 1.00 61.35  ? 886  THR C O   1 
ATOM   9726  C  CB  . THR B 2 332  ? -28.814 30.474  -20.277 1.00 58.56  ? 886  THR C CB  1 
ATOM   9727  O  OG1 . THR B 2 332  ? -27.786 30.947  -21.154 1.00 59.17  ? 886  THR C OG1 1 
ATOM   9728  C  CG2 . THR B 2 332  ? -28.573 29.006  -19.978 1.00 46.85  ? 886  THR C CG2 1 
ATOM   9729  N  N   . ASP B 2 333  ? -30.188 33.066  -21.271 1.00 57.00  ? 887  ASP C N   1 
ATOM   9730  C  CA  . ASP B 2 333  ? -30.673 34.430  -21.106 1.00 57.71  ? 887  ASP C CA  1 
ATOM   9731  C  C   . ASP B 2 333  ? -32.134 34.524  -21.523 1.00 63.27  ? 887  ASP C C   1 
ATOM   9732  O  O   . ASP B 2 333  ? -32.907 35.296  -20.955 1.00 70.45  ? 887  ASP C O   1 
ATOM   9733  C  CB  . ASP B 2 333  ? -29.833 35.412  -21.926 1.00 66.31  ? 887  ASP C CB  1 
ATOM   9734  C  CG  . ASP B 2 333  ? -28.482 35.689  -21.301 1.00 69.63  ? 887  ASP C CG  1 
ATOM   9735  O  OD1 . ASP B 2 333  ? -28.379 35.673  -20.056 1.00 71.59  ? 887  ASP C OD1 1 
ATOM   9736  O  OD2 . ASP B 2 333  ? -27.522 35.932  -22.060 1.00 72.21  ? 887  ASP C OD2 1 
ATOM   9737  N  N   . PHE B 2 334  ? -32.501 33.725  -22.518 1.00 62.41  ? 888  PHE C N   1 
ATOM   9738  C  CA  . PHE B 2 334  ? -33.867 33.689  -23.022 1.00 52.71  ? 888  PHE C CA  1 
ATOM   9739  C  C   . PHE B 2 334  ? -34.805 33.054  -22.001 1.00 47.43  ? 888  PHE C C   1 
ATOM   9740  O  O   . PHE B 2 334  ? -35.990 33.379  -21.944 1.00 46.42  ? 888  PHE C O   1 
ATOM   9741  C  CB  . PHE B 2 334  ? -33.919 32.922  -24.346 1.00 38.81  ? 888  PHE C CB  1 
ATOM   9742  C  CG  . PHE B 2 334  ? -35.234 33.031  -25.062 1.00 42.82  ? 888  PHE C CG  1 
ATOM   9743  C  CD1 . PHE B 2 334  ? -35.515 34.128  -25.859 1.00 50.17  ? 888  PHE C CD1 1 
ATOM   9744  C  CD2 . PHE B 2 334  ? -36.184 32.031  -24.950 1.00 50.99  ? 888  PHE C CD2 1 
ATOM   9745  C  CE1 . PHE B 2 334  ? -36.723 34.229  -26.524 1.00 49.86  ? 888  PHE C CE1 1 
ATOM   9746  C  CE2 . PHE B 2 334  ? -37.394 32.126  -25.613 1.00 55.41  ? 888  PHE C CE2 1 
ATOM   9747  C  CZ  . PHE B 2 334  ? -37.663 33.228  -26.401 1.00 42.27  ? 888  PHE C CZ  1 
ATOM   9748  N  N   . GLU B 2 335  ? -34.261 32.147  -21.195 1.00 53.07  ? 889  GLU C N   1 
ATOM   9749  C  CA  . GLU B 2 335  ? -35.038 31.467  -20.164 1.00 41.63  ? 889  GLU C CA  1 
ATOM   9750  C  C   . GLU B 2 335  ? -35.180 32.328  -18.916 1.00 48.16  ? 889  GLU C C   1 
ATOM   9751  O  O   . GLU B 2 335  ? -36.023 32.059  -18.062 1.00 62.42  ? 889  GLU C O   1 
ATOM   9752  C  CB  . GLU B 2 335  ? -34.393 30.126  -19.805 1.00 40.30  ? 889  GLU C CB  1 
ATOM   9753  C  CG  . GLU B 2 335  ? -34.540 29.060  -20.874 1.00 47.43  ? 889  GLU C CG  1 
ATOM   9754  C  CD  . GLU B 2 335  ? -33.704 27.830  -20.590 1.00 43.44  ? 889  GLU C CD  1 
ATOM   9755  O  OE1 . GLU B 2 335  ? -32.979 27.822  -19.573 1.00 48.16  ? 889  GLU C OE1 1 
ATOM   9756  O  OE2 . GLU B 2 335  ? -33.771 26.870  -21.386 1.00 51.52  ? 889  GLU C OE2 1 
ATOM   9757  N  N   . ASN B 2 336  ? -34.352 33.364  -18.818 1.00 51.44  ? 890  ASN C N   1 
ATOM   9758  C  CA  . ASN B 2 336  ? -34.383 34.271  -17.676 1.00 58.21  ? 890  ASN C CA  1 
ATOM   9759  C  C   . ASN B 2 336  ? -35.174 35.540  -17.969 1.00 52.66  ? 890  ASN C C   1 
ATOM   9760  O  O   . ASN B 2 336  ? -34.989 36.567  -17.314 1.00 54.53  ? 890  ASN C O   1 
ATOM   9761  C  CB  . ASN B 2 336  ? -32.962 34.633  -17.245 1.00 63.01  ? 890  ASN C CB  1 
ATOM   9762  C  CG  . ASN B 2 336  ? -32.235 33.467  -16.606 1.00 74.95  ? 890  ASN C CG  1 
ATOM   9763  O  OD1 . ASN B 2 336  ? -32.470 33.141  -15.443 1.00 83.26  ? 890  ASN C OD1 1 
ATOM   9764  N  ND2 . ASN B 2 336  ? -31.343 32.837  -17.362 1.00 73.49  ? 890  ASN C ND2 1 
ATOM   9765  N  N   . ARG B 2 337  ? -36.046 35.463  -18.967 1.00 50.96  ? 891  ARG C N   1 
ATOM   9766  C  CA  . ARG B 2 337  ? -36.942 36.564  -19.293 1.00 38.07  ? 891  ARG C CA  1 
ATOM   9767  C  C   . ARG B 2 337  ? -38.178 36.508  -18.403 1.00 40.97  ? 891  ARG C C   1 
ATOM   9768  O  O   . ARG B 2 337  ? -38.684 35.430  -18.094 1.00 49.76  ? 891  ARG C O   1 
ATOM   9769  C  CB  . ARG B 2 337  ? -37.338 36.520  -20.772 1.00 44.31  ? 891  ARG C CB  1 
ATOM   9770  C  CG  . ARG B 2 337  ? -36.239 36.976  -21.716 1.00 44.48  ? 891  ARG C CG  1 
ATOM   9771  C  CD  . ARG B 2 337  ? -36.372 36.353  -23.101 1.00 49.54  ? 891  ARG C CD  1 
ATOM   9772  N  NE  . ARG B 2 337  ? -37.483 36.892  -23.882 1.00 50.86  ? 891  ARG C NE  1 
ATOM   9773  C  CZ  . ARG B 2 337  ? -38.581 36.211  -24.194 1.00 56.66  ? 891  ARG C CZ  1 
ATOM   9774  N  NH1 . ARG B 2 337  ? -39.535 36.782  -24.917 1.00 59.72  ? 891  ARG C NH1 1 
ATOM   9775  N  NH2 . ARG B 2 337  ? -38.724 34.956  -23.789 1.00 46.90  ? 891  ARG C NH2 1 
ATOM   9776  N  N   . ARG B 2 338  ? -38.654 37.676  -17.989 1.00 44.50  ? 892  ARG C N   1 
ATOM   9777  C  CA  . ARG B 2 338  ? -39.819 37.773  -17.120 1.00 52.42  ? 892  ARG C CA  1 
ATOM   9778  C  C   . ARG B 2 338  ? -41.037 38.248  -17.902 1.00 55.75  ? 892  ARG C C   1 
ATOM   9779  O  O   . ARG B 2 338  ? -41.021 39.327  -18.495 1.00 50.91  ? 892  ARG C O   1 
ATOM   9780  C  CB  . ARG B 2 338  ? -39.540 38.726  -15.955 1.00 49.90  ? 892  ARG C CB  1 
ATOM   9781  C  CG  . ARG B 2 338  ? -40.628 38.782  -14.888 1.00 38.13  ? 892  ARG C CG  1 
ATOM   9782  C  CD  . ARG B 2 338  ? -40.456 40.032  -14.035 1.00 64.52  ? 892  ARG C CD  1 
ATOM   9783  N  NE  . ARG B 2 338  ? -41.124 39.954  -12.737 1.00 71.30  ? 892  ARG C NE  1 
ATOM   9784  C  CZ  . ARG B 2 338  ? -42.393 40.282  -12.523 1.00 58.84  ? 892  ARG C CZ  1 
ATOM   9785  N  NH1 . ARG B 2 338  ? -42.907 40.189  -11.306 1.00 71.47  ? 892  ARG C NH1 1 
ATOM   9786  N  NH2 . ARG B 2 338  ? -43.153 40.700  -13.524 1.00 80.30  ? 892  ARG C NH2 1 
ATOM   9787  N  N   . SER B 2 339  ? -42.087 37.434  -17.906 1.00 59.43  ? 893  SER C N   1 
ATOM   9788  C  CA  . SER B 2 339  ? -43.350 37.826  -18.517 1.00 47.40  ? 893  SER C CA  1 
ATOM   9789  C  C   . SER B 2 339  ? -43.969 38.986  -17.748 1.00 53.11  ? 893  SER C C   1 
ATOM   9790  O  O   . SER B 2 339  ? -44.394 38.828  -16.604 1.00 63.30  ? 893  SER C O   1 
ATOM   9791  C  CB  . SER B 2 339  ? -44.319 36.644  -18.565 1.00 60.35  ? 893  SER C CB  1 
ATOM   9792  O  OG  . SER B 2 339  ? -45.635 37.078  -18.860 1.00 66.68  ? 893  SER C OG  1 
ATOM   9793  N  N   . PHE B 2 340  ? -44.017 40.153  -18.382 1.00 45.82  ? 894  PHE C N   1 
ATOM   9794  C  CA  . PHE B 2 340  ? -44.533 41.353  -17.736 1.00 44.92  ? 894  PHE C CA  1 
ATOM   9795  C  C   . PHE B 2 340  ? -45.693 41.947  -18.529 1.00 50.37  ? 894  PHE C C   1 
ATOM   9796  O  O   . PHE B 2 340  ? -45.485 42.582  -19.565 1.00 46.28  ? 894  PHE C O   1 
ATOM   9797  C  CB  . PHE B 2 340  ? -43.417 42.389  -17.576 1.00 47.82  ? 894  PHE C CB  1 
ATOM   9798  C  CG  . PHE B 2 340  ? -43.654 43.375  -16.467 1.00 45.29  ? 894  PHE C CG  1 
ATOM   9799  C  CD1 . PHE B 2 340  ? -44.550 44.419  -16.625 1.00 56.97  ? 894  PHE C CD1 1 
ATOM   9800  C  CD2 . PHE B 2 340  ? -42.968 43.265  -15.271 1.00 37.25  ? 894  PHE C CD2 1 
ATOM   9801  C  CE1 . PHE B 2 340  ? -44.765 45.326  -15.606 1.00 55.07  ? 894  PHE C CE1 1 
ATOM   9802  C  CE2 . PHE B 2 340  ? -43.178 44.168  -14.248 1.00 42.84  ? 894  PHE C CE2 1 
ATOM   9803  C  CZ  . PHE B 2 340  ? -44.076 45.200  -14.416 1.00 53.47  ? 894  PHE C CZ  1 
ATOM   9804  N  N   . LYS B 2 341  ? -46.912 41.736  -18.043 1.00 47.49  ? 895  LYS C N   1 
ATOM   9805  C  CA  . LYS B 2 341  ? -48.094 42.297  -18.687 1.00 51.83  ? 895  LYS C CA  1 
ATOM   9806  C  C   . LYS B 2 341  ? -48.369 43.705  -18.183 1.00 49.61  ? 895  LYS C C   1 
ATOM   9807  O  O   . LYS B 2 341  ? -48.491 43.937  -16.980 1.00 45.85  ? 895  LYS C O   1 
ATOM   9808  C  CB  . LYS B 2 341  ? -49.322 41.416  -18.454 1.00 49.99  ? 895  LYS C CB  1 
ATOM   9809  C  CG  . LYS B 2 341  ? -49.240 40.043  -19.096 1.00 60.23  ? 895  LYS C CG  1 
ATOM   9810  C  CD  . LYS B 2 341  ? -50.623 39.533  -19.476 1.00 57.66  ? 895  LYS C CD  1 
ATOM   9811  C  CE  . LYS B 2 341  ? -51.590 39.607  -18.303 1.00 74.32  ? 895  LYS C CE  1 
ATOM   9812  N  NZ  . LYS B 2 341  ? -52.961 39.170  -18.687 1.00 72.49  ? 895  LYS C NZ  1 
ATOM   9813  N  N   . CYS B 2 342  ? -48.466 44.643  -19.116 1.00 52.24  ? 896  CYS C N   1 
ATOM   9814  C  CA  . CYS B 2 342  ? -48.744 46.029  -18.782 1.00 42.29  ? 896  CYS C CA  1 
ATOM   9815  C  C   . CYS B 2 342  ? -49.537 46.709  -19.891 1.00 52.47  ? 896  CYS C C   1 
ATOM   9816  O  O   . CYS B 2 342  ? -49.890 46.084  -20.891 1.00 60.28  ? 896  CYS C O   1 
ATOM   9817  C  CB  . CYS B 2 342  ? -47.440 46.785  -18.516 1.00 39.98  ? 896  CYS C CB  1 
ATOM   9818  S  SG  . CYS B 2 342  ? -46.168 46.559  -19.774 1.00 56.92  ? 896  CYS C SG  1 
ATOM   9819  N  N   . ILE B 2 343  ? -49.810 47.994  -19.701 1.00 44.52  ? 897  ILE C N   1 
ATOM   9820  C  CA  . ILE B 2 343  ? -50.611 48.770  -20.640 1.00 37.44  ? 897  ILE C CA  1 
ATOM   9821  C  C   . ILE B 2 343  ? -49.773 49.828  -21.348 1.00 44.95  ? 897  ILE C C   1 
ATOM   9822  O  O   . ILE B 2 343  ? -49.051 50.579  -20.711 1.00 56.27  ? 897  ILE C O   1 
ATOM   9823  C  CB  . ILE B 2 343  ? -51.791 49.460  -19.921 1.00 49.73  ? 897  ILE C CB  1 
ATOM   9824  C  CG1 . ILE B 2 343  ? -52.837 48.431  -19.486 1.00 53.73  ? 897  ILE C CG1 1 
ATOM   9825  C  CG2 . ILE B 2 343  ? -52.428 50.518  -20.807 1.00 53.14  ? 897  ILE C CG2 1 
ATOM   9826  C  CD1 . ILE B 2 343  ? -54.116 49.055  -18.957 1.00 76.22  ? 897  ILE C CD1 1 
ATOM   9827  N  N   . TRP B 2 344  ? -49.872 49.885  -22.670 1.00 53.86  ? 898  TRP C N   1 
ATOM   9828  C  CA  . TRP B 2 344  ? -49.180 50.905  -23.446 1.00 54.23  ? 898  TRP C CA  1 
ATOM   9829  C  C   . TRP B 2 344  ? -50.124 52.051  -23.810 1.00 52.12  ? 898  TRP C C   1 
ATOM   9830  O  O   . TRP B 2 344  ? -51.212 51.826  -24.349 1.00 43.23  ? 898  TRP C O   1 
ATOM   9831  C  CB  . TRP B 2 344  ? -48.572 50.285  -24.706 1.00 41.18  ? 898  TRP C CB  1 
ATOM   9832  C  CG  . TRP B 2 344  ? -48.246 51.271  -25.779 1.00 52.53  ? 898  TRP C CG  1 
ATOM   9833  C  CD1 . TRP B 2 344  ? -48.797 51.332  -27.025 1.00 57.73  ? 898  TRP C CD1 1 
ATOM   9834  C  CD2 . TRP B 2 344  ? -47.299 52.344  -25.705 1.00 57.80  ? 898  TRP C CD2 1 
ATOM   9835  N  NE1 . TRP B 2 344  ? -48.250 52.373  -27.734 1.00 59.80  ? 898  TRP C NE1 1 
ATOM   9836  C  CE2 . TRP B 2 344  ? -47.328 53.011  -26.946 1.00 53.20  ? 898  TRP C CE2 1 
ATOM   9837  C  CE3 . TRP B 2 344  ? -46.430 52.805  -24.711 1.00 59.17  ? 898  TRP C CE3 1 
ATOM   9838  C  CZ2 . TRP B 2 344  ? -46.523 54.114  -27.220 1.00 50.43  ? 898  TRP C CZ2 1 
ATOM   9839  C  CZ3 . TRP B 2 344  ? -45.630 53.901  -24.986 1.00 61.75  ? 898  TRP C CZ3 1 
ATOM   9840  C  CH2 . TRP B 2 344  ? -45.682 54.542  -26.231 1.00 51.79  ? 898  TRP C CH2 1 
ATOM   9841  N  N   . LEU B 2 345  ? -49.711 53.277  -23.494 1.00 59.97  ? 899  LEU C N   1 
ATOM   9842  C  CA  . LEU B 2 345  ? -50.502 54.454  -23.846 1.00 59.55  ? 899  LEU C CA  1 
ATOM   9843  C  C   . LEU B 2 345  ? -49.910 55.139  -25.074 1.00 60.46  ? 899  LEU C C   1 
ATOM   9844  O  O   . LEU B 2 345  ? -48.733 55.498  -25.087 1.00 61.27  ? 899  LEU C O   1 
ATOM   9845  C  CB  . LEU B 2 345  ? -50.574 55.432  -22.671 1.00 50.73  ? 899  LEU C CB  1 
ATOM   9846  C  CG  . LEU B 2 345  ? -51.590 56.572  -22.797 1.00 59.37  ? 899  LEU C CG  1 
ATOM   9847  C  CD1 . LEU B 2 345  ? -53.016 56.040  -22.759 1.00 56.03  ? 899  LEU C CD1 1 
ATOM   9848  C  CD2 . LEU B 2 345  ? -51.375 57.607  -21.706 1.00 65.64  ? 899  LEU C CD2 1 
ATOM   9849  N  N   . ASN B 2 346  ? -50.729 55.321  -26.104 1.00 62.60  ? 900  ASN C N   1 
ATOM   9850  C  CA  . ASN B 2 346  ? -50.241 55.833  -27.380 1.00 70.97  ? 900  ASN C CA  1 
ATOM   9851  C  C   . ASN B 2 346  ? -50.415 57.340  -27.554 1.00 72.67  ? 900  ASN C C   1 
ATOM   9852  O  O   . ASN B 2 346  ? -50.871 58.037  -26.647 1.00 67.93  ? 900  ASN C O   1 
ATOM   9853  C  CB  . ASN B 2 346  ? -50.936 55.100  -28.532 1.00 70.88  ? 900  ASN C CB  1 
ATOM   9854  C  CG  . ASN B 2 346  ? -52.446 55.067  -28.377 1.00 78.97  ? 900  ASN C CG  1 
ATOM   9855  O  OD1 . ASN B 2 346  ? -53.040 55.948  -27.754 1.00 83.13  ? 900  ASN C OD1 1 
ATOM   9856  N  ND2 . ASN B 2 346  ? -53.075 54.045  -28.945 1.00 73.89  ? 900  ASN C ND2 1 
ATOM   9857  N  N   . SER B 2 347  ? -50.051 57.827  -28.737 1.00 89.59  ? 901  SER C N   1 
ATOM   9858  C  CA  . SER B 2 347  ? -50.139 59.246  -29.066 1.00 86.55  ? 901  SER C CA  1 
ATOM   9859  C  C   . SER B 2 347  ? -51.581 59.734  -29.036 1.00 87.16  ? 901  SER C C   1 
ATOM   9860  O  O   . SER B 2 347  ? -51.846 60.923  -28.864 1.00 83.82  ? 901  SER C O   1 
ATOM   9861  C  CB  . SER B 2 347  ? -49.533 59.510  -30.446 1.00 64.80  ? 901  SER C CB  1 
ATOM   9862  O  OG  . SER B 2 347  ? -48.343 58.763  -30.632 1.00 83.00  ? 901  SER C OG  1 
ATOM   9863  N  N   . GLN B 2 348  ? -52.509 58.799  -29.207 1.00 72.73  ? 902  GLN C N   1 
ATOM   9864  C  CA  . GLN B 2 348  ? -53.925 59.117  -29.298 1.00 64.17  ? 902  GLN C CA  1 
ATOM   9865  C  C   . GLN B 2 348  ? -54.599 59.068  -27.931 1.00 76.48  ? 902  GLN C C   1 
ATOM   9866  O  O   . GLN B 2 348  ? -55.822 59.189  -27.835 1.00 80.14  ? 902  GLN C O   1 
ATOM   9867  C  CB  . GLN B 2 348  ? -54.621 58.156  -30.265 1.00 69.15  ? 902  GLN C CB  1 
ATOM   9868  C  CG  . GLN B 2 348  ? -53.682 57.472  -31.255 1.00 94.72  ? 902  GLN C CG  1 
ATOM   9869  C  CD  . GLN B 2 348  ? -52.987 58.444  -32.194 1.00 107.46 ? 902  GLN C CD  1 
ATOM   9870  O  OE1 . GLN B 2 348  ? -53.480 59.542  -32.453 1.00 103.40 ? 902  GLN C OE1 1 
ATOM   9871  N  NE2 . GLN B 2 348  ? -51.829 58.042  -32.707 1.00 89.26  ? 902  GLN C NE2 1 
ATOM   9872  N  N   . PHE B 2 349  ? -53.796 58.867  -26.886 1.00 67.92  ? 903  PHE C N   1 
ATOM   9873  C  CA  . PHE B 2 349  ? -54.290 58.787  -25.512 1.00 57.83  ? 903  PHE C CA  1 
ATOM   9874  C  C   . PHE B 2 349  ? -55.242 57.601  -25.379 1.00 65.96  ? 903  PHE C C   1 
ATOM   9875  O  O   . PHE B 2 349  ? -56.303 57.696  -24.766 1.00 73.89  ? 903  PHE C O   1 
ATOM   9876  C  CB  . PHE B 2 349  ? -54.969 60.105  -25.105 1.00 62.47  ? 903  PHE C CB  1 
ATOM   9877  C  CG  . PHE B 2 349  ? -55.285 60.207  -23.638 1.00 68.69  ? 903  PHE C CG  1 
ATOM   9878  C  CD1 . PHE B 2 349  ? -54.271 60.254  -22.696 1.00 68.70  ? 903  PHE C CD1 1 
ATOM   9879  C  CD2 . PHE B 2 349  ? -56.599 60.282  -23.205 1.00 92.35  ? 903  PHE C CD2 1 
ATOM   9880  C  CE1 . PHE B 2 349  ? -54.563 60.355  -21.348 1.00 72.88  ? 903  PHE C CE1 1 
ATOM   9881  C  CE2 . PHE B 2 349  ? -56.897 60.383  -21.859 1.00 91.91  ? 903  PHE C CE2 1 
ATOM   9882  C  CZ  . PHE B 2 349  ? -55.877 60.420  -20.929 1.00 81.46  ? 903  PHE C CZ  1 
ATOM   9883  N  N   . ARG B 2 350  ? -54.847 56.477  -25.968 1.00 70.88  ? 904  ARG C N   1 
ATOM   9884  C  CA  . ARG B 2 350  ? -55.665 55.270  -25.948 1.00 67.15  ? 904  ARG C CA  1 
ATOM   9885  C  C   . ARG B 2 350  ? -54.891 54.079  -25.392 1.00 71.67  ? 904  ARG C C   1 
ATOM   9886  O  O   . ARG B 2 350  ? -53.709 53.898  -25.688 1.00 62.43  ? 904  ARG C O   1 
ATOM   9887  C  CB  . ARG B 2 350  ? -56.184 54.961  -27.353 1.00 74.41  ? 904  ARG C CB  1 
ATOM   9888  C  CG  . ARG B 2 350  ? -57.550 55.560  -27.639 1.00 89.13  ? 904  ARG C CG  1 
ATOM   9889  C  CD  . ARG B 2 350  ? -57.806 55.696  -29.130 1.00 89.00  ? 904  ARG C CD  1 
ATOM   9890  N  NE  . ARG B 2 350  ? -59.234 55.761  -29.428 1.00 112.39 ? 904  ARG C NE  1 
ATOM   9891  C  CZ  . ARG B 2 350  ? -59.995 56.835  -29.239 1.00 122.21 ? 904  ARG C CZ  1 
ATOM   9892  N  NH1 . ARG B 2 350  ? -59.470 57.948  -28.743 1.00 106.08 ? 904  ARG C NH1 1 
ATOM   9893  N  NH2 . ARG B 2 350  ? -61.285 56.794  -29.541 1.00 92.08  ? 904  ARG C NH2 1 
ATOM   9894  N  N   . GLU B 2 351  ? -55.570 53.268  -24.587 1.00 65.71  ? 905  GLU C N   1 
ATOM   9895  C  CA  . GLU B 2 351  ? -54.935 52.151  -23.894 1.00 54.88  ? 905  GLU C CA  1 
ATOM   9896  C  C   . GLU B 2 351  ? -54.828 50.894  -24.749 1.00 54.41  ? 905  GLU C C   1 
ATOM   9897  O  O   . GLU B 2 351  ? -55.786 50.500  -25.413 1.00 58.77  ? 905  GLU C O   1 
ATOM   9898  C  CB  . GLU B 2 351  ? -55.702 51.824  -22.612 1.00 58.53  ? 905  GLU C CB  1 
ATOM   9899  C  CG  . GLU B 2 351  ? -55.608 52.888  -21.538 1.00 52.36  ? 905  GLU C CG  1 
ATOM   9900  C  CD  . GLU B 2 351  ? -56.385 52.519  -20.290 1.00 72.35  ? 905  GLU C CD  1 
ATOM   9901  O  OE1 . GLU B 2 351  ? -57.460 51.895  -20.420 1.00 71.42  ? 905  GLU C OE1 1 
ATOM   9902  O  OE2 . GLU B 2 351  ? -55.918 52.846  -19.180 1.00 89.52  ? 905  GLU C OE2 1 
ATOM   9903  N  N   . GLU B 2 352  ? -53.657 50.265  -24.720 1.00 56.64  ? 906  GLU C N   1 
ATOM   9904  C  CA  . GLU B 2 352  ? -53.465 48.982  -25.386 1.00 51.98  ? 906  GLU C CA  1 
ATOM   9905  C  C   . GLU B 2 352  ? -52.886 47.965  -24.408 1.00 48.29  ? 906  GLU C C   1 
ATOM   9906  O  O   . GLU B 2 352  ? -52.098 48.318  -23.541 1.00 56.59  ? 906  GLU C O   1 
ATOM   9907  C  CB  . GLU B 2 352  ? -52.547 49.132  -26.600 1.00 49.96  ? 906  GLU C CB  1 
ATOM   9908  C  CG  . GLU B 2 352  ? -52.968 50.228  -27.564 1.00 55.71  ? 906  GLU C CG  1 
ATOM   9909  C  CD  . GLU B 2 352  ? -52.160 50.215  -28.843 1.00 64.60  ? 906  GLU C CD  1 
ATOM   9910  O  OE1 . GLU B 2 352  ? -51.634 49.141  -29.201 1.00 61.84  ? 906  GLU C OE1 1 
ATOM   9911  O  OE2 . GLU B 2 352  ? -52.050 51.277  -29.490 1.00 81.21  ? 906  GLU C OE2 1 
ATOM   9912  N  N   . GLU B 2 353  ? -53.284 46.705  -24.536 1.00 42.02  ? 907  GLU C N   1 
ATOM   9913  C  CA  . GLU B 2 353  ? -52.712 45.655  -23.701 1.00 39.31  ? 907  GLU C CA  1 
ATOM   9914  C  C   . GLU B 2 353  ? -51.442 45.113  -24.343 1.00 45.00  ? 907  GLU C C   1 
ATOM   9915  O  O   . GLU B 2 353  ? -51.461 44.670  -25.490 1.00 51.87  ? 907  GLU C O   1 
ATOM   9916  C  CB  . GLU B 2 353  ? -53.716 44.524  -23.479 1.00 40.08  ? 907  GLU C CB  1 
ATOM   9917  C  CG  . GLU B 2 353  ? -54.956 44.926  -22.698 1.00 44.67  ? 907  GLU C CG  1 
ATOM   9918  C  CD  . GLU B 2 353  ? -54.740 44.894  -21.198 1.00 55.47  ? 907  GLU C CD  1 
ATOM   9919  O  OE1 . GLU B 2 353  ? -53.698 44.365  -20.756 1.00 53.95  ? 907  GLU C OE1 1 
ATOM   9920  O  OE2 . GLU B 2 353  ? -55.617 45.391  -20.460 1.00 49.20  ? 907  GLU C OE2 1 
ATOM   9921  N  N   . ILE B 2 354  ? -50.336 45.154  -23.606 1.00 47.04  ? 908  ILE C N   1 
ATOM   9922  C  CA  . ILE B 2 354  ? -49.070 44.656  -24.130 1.00 45.60  ? 908  ILE C CA  1 
ATOM   9923  C  C   . ILE B 2 354  ? -48.362 43.766  -23.111 1.00 43.55  ? 908  ILE C C   1 
ATOM   9924  O  O   . ILE B 2 354  ? -48.560 43.900  -21.905 1.00 42.96  ? 908  ILE C O   1 
ATOM   9925  C  CB  . ILE B 2 354  ? -48.134 45.817  -24.552 1.00 44.62  ? 908  ILE C CB  1 
ATOM   9926  C  CG1 . ILE B 2 354  ? -47.072 45.322  -25.538 1.00 42.03  ? 908  ILE C CG1 1 
ATOM   9927  C  CG2 . ILE B 2 354  ? -47.495 46.479  -23.337 1.00 44.70  ? 908  ILE C CG2 1 
ATOM   9928  C  CD1 . ILE B 2 354  ? -46.110 46.393  -25.989 1.00 40.22  ? 908  ILE C CD1 1 
ATOM   9929  N  N   . THR B 2 355  ? -47.553 42.839  -23.609 1.00 48.30  ? 909  THR C N   1 
ATOM   9930  C  CA  . THR B 2 355  ? -46.777 41.955  -22.750 1.00 48.04  ? 909  THR C CA  1 
ATOM   9931  C  C   . THR B 2 355  ? -45.318 41.967  -23.179 1.00 50.57  ? 909  THR C C   1 
ATOM   9932  O  O   . THR B 2 355  ? -44.990 41.600  -24.307 1.00 49.91  ? 909  THR C O   1 
ATOM   9933  C  CB  . THR B 2 355  ? -47.309 40.514  -22.783 1.00 44.46  ? 909  THR C CB  1 
ATOM   9934  O  OG1 . THR B 2 355  ? -48.649 40.490  -22.275 1.00 51.07  ? 909  THR C OG1 1 
ATOM   9935  C  CG2 . THR B 2 355  ? -46.433 39.607  -21.936 1.00 37.09  ? 909  THR C CG2 1 
ATOM   9936  N  N   . LEU B 2 356  ? -44.446 42.393  -22.273 1.00 48.66  ? 910  LEU C N   1 
ATOM   9937  C  CA  . LEU B 2 356  ? -43.032 42.529  -22.587 1.00 41.10  ? 910  LEU C CA  1 
ATOM   9938  C  C   . LEU B 2 356  ? -42.192 41.544  -21.789 1.00 49.05  ? 910  LEU C C   1 
ATOM   9939  O  O   . LEU B 2 356  ? -42.605 41.082  -20.727 1.00 38.34  ? 910  LEU C O   1 
ATOM   9940  C  CB  . LEU B 2 356  ? -42.574 43.959  -22.320 1.00 38.37  ? 910  LEU C CB  1 
ATOM   9941  C  CG  . LEU B 2 356  ? -43.373 45.009  -23.090 1.00 40.37  ? 910  LEU C CG  1 
ATOM   9942  C  CD1 . LEU B 2 356  ? -43.245 46.361  -22.425 1.00 49.61  ? 910  LEU C CD1 1 
ATOM   9943  C  CD2 . LEU B 2 356  ? -42.907 45.076  -24.535 1.00 38.32  ? 910  LEU C CD2 1 
ATOM   9944  N  N   . TYR B 2 357  ? -41.007 41.232  -22.302 1.00 55.26  ? 911  TYR C N   1 
ATOM   9945  C  CA  . TYR B 2 357  ? -40.148 40.243  -21.664 1.00 42.67  ? 911  TYR C CA  1 
ATOM   9946  C  C   . TYR B 2 357  ? -38.755 40.779  -21.357 1.00 35.25  ? 911  TYR C C   1 
ATOM   9947  O  O   . TYR B 2 357  ? -37.781 40.385  -21.999 1.00 43.99  ? 911  TYR C O   1 
ATOM   9948  C  CB  . TYR B 2 357  ? -40.032 39.001  -22.547 1.00 41.28  ? 911  TYR C CB  1 
ATOM   9949  C  CG  . TYR B 2 357  ? -41.351 38.324  -22.839 1.00 42.22  ? 911  TYR C CG  1 
ATOM   9950  C  CD1 . TYR B 2 357  ? -42.164 38.761  -23.877 1.00 40.79  ? 911  TYR C CD1 1 
ATOM   9951  C  CD2 . TYR B 2 357  ? -41.780 37.244  -22.080 1.00 43.42  ? 911  TYR C CD2 1 
ATOM   9952  C  CE1 . TYR B 2 357  ? -43.367 38.144  -24.149 1.00 38.31  ? 911  TYR C CE1 1 
ATOM   9953  C  CE2 . TYR B 2 357  ? -42.982 36.620  -22.345 1.00 47.26  ? 911  TYR C CE2 1 
ATOM   9954  C  CZ  . TYR B 2 357  ? -43.772 37.074  -23.381 1.00 44.68  ? 911  TYR C CZ  1 
ATOM   9955  O  OH  . TYR B 2 357  ? -44.971 36.456  -23.651 1.00 48.13  ? 911  TYR C OH  1 
ATOM   9956  N  N   . PRO B 2 358  ? -38.653 41.679  -20.368 1.00 42.89  ? 912  PRO C N   1 
ATOM   9957  C  CA  . PRO B 2 358  ? -37.336 42.150  -19.936 1.00 38.36  ? 912  PRO C CA  1 
ATOM   9958  C  C   . PRO B 2 358  ? -36.637 41.066  -19.131 1.00 41.90  ? 912  PRO C C   1 
ATOM   9959  O  O   . PRO B 2 358  ? -37.295 40.107  -18.732 1.00 46.51  ? 912  PRO C O   1 
ATOM   9960  C  CB  . PRO B 2 358  ? -37.668 43.357  -19.062 1.00 36.09  ? 912  PRO C CB  1 
ATOM   9961  C  CG  . PRO B 2 358  ? -38.999 43.018  -18.481 1.00 34.18  ? 912  PRO C CG  1 
ATOM   9962  C  CD  . PRO B 2 358  ? -39.736 42.254  -19.550 1.00 48.08  ? 912  PRO C CD  1 
ATOM   9963  N  N   . ASP B 2 359  ? -35.338 41.204  -18.897 1.00 50.07  ? 913  ASP C N   1 
ATOM   9964  C  CA  . ASP B 2 359  ? -34.640 40.236  -18.065 1.00 45.73  ? 913  ASP C CA  1 
ATOM   9965  C  C   . ASP B 2 359  ? -35.210 40.275  -16.654 1.00 47.76  ? 913  ASP C C   1 
ATOM   9966  O  O   . ASP B 2 359  ? -35.525 41.342  -16.129 1.00 51.37  ? 913  ASP C O   1 
ATOM   9967  C  CB  . ASP B 2 359  ? -33.136 40.500  -18.047 1.00 58.52  ? 913  ASP C CB  1 
ATOM   9968  C  CG  . ASP B 2 359  ? -32.392 39.542  -17.135 1.00 53.65  ? 913  ASP C CG  1 
ATOM   9969  O  OD1 . ASP B 2 359  ? -32.219 38.364  -17.517 1.00 43.33  ? 913  ASP C OD1 1 
ATOM   9970  O  OD2 . ASP B 2 359  ? -31.991 39.965  -16.031 1.00 72.44  ? 913  ASP C OD2 1 
ATOM   9971  N  N   . LYS B 2 360  ? -35.349 39.098  -16.056 1.00 53.13  ? 914  LYS C N   1 
ATOM   9972  C  CA  . LYS B 2 360  ? -35.967 38.944  -14.744 1.00 46.99  ? 914  LYS C CA  1 
ATOM   9973  C  C   . LYS B 2 360  ? -35.252 39.744  -13.655 1.00 50.46  ? 914  LYS C C   1 
ATOM   9974  O  O   . LYS B 2 360  ? -35.878 40.204  -12.697 1.00 53.47  ? 914  LYS C O   1 
ATOM   9975  C  CB  . LYS B 2 360  ? -36.014 37.456  -14.389 1.00 51.79  ? 914  LYS C CB  1 
ATOM   9976  C  CG  . LYS B 2 360  ? -35.898 37.120  -12.918 1.00 58.21  ? 914  LYS C CG  1 
ATOM   9977  C  CD  . LYS B 2 360  ? -35.673 35.629  -12.754 1.00 68.13  ? 914  LYS C CD  1 
ATOM   9978  C  CE  . LYS B 2 360  ? -34.514 35.166  -13.624 1.00 62.48  ? 914  LYS C CE  1 
ATOM   9979  N  NZ  . LYS B 2 360  ? -34.359 33.687  -13.617 1.00 84.84  ? 914  LYS C NZ  1 
ATOM   9980  N  N   . HIS B 2 361  ? -33.946 39.924  -13.815 1.00 52.80  ? 915  HIS C N   1 
ATOM   9981  C  CA  . HIS B 2 361  ? -33.151 40.670  -12.843 1.00 62.40  ? 915  HIS C CA  1 
ATOM   9982  C  C   . HIS B 2 361  ? -32.988 42.140  -13.226 1.00 54.89  ? 915  HIS C C   1 
ATOM   9983  O  O   . HIS B 2 361  ? -32.348 42.908  -12.508 1.00 62.95  ? 915  HIS C O   1 
ATOM   9984  C  CB  . HIS B 2 361  ? -31.774 40.024  -12.678 1.00 57.39  ? 915  HIS C CB  1 
ATOM   9985  C  CG  . HIS B 2 361  ? -31.825 38.605  -12.207 1.00 70.08  ? 915  HIS C CG  1 
ATOM   9986  N  ND1 . HIS B 2 361  ? -32.406 38.237  -11.012 1.00 52.97  ? 915  HIS C ND1 1 
ATOM   9987  C  CD2 . HIS B 2 361  ? -31.363 37.462  -12.767 1.00 64.23  ? 915  HIS C CD2 1 
ATOM   9988  C  CE1 . HIS B 2 361  ? -32.303 36.930  -10.859 1.00 57.38  ? 915  HIS C CE1 1 
ATOM   9989  N  NE2 . HIS B 2 361  ? -31.673 36.435  -11.909 1.00 62.49  ? 915  HIS C NE2 1 
ATOM   9990  N  N   . GLY B 2 362  ? -33.568 42.527  -14.357 1.00 59.20  ? 916  GLY C N   1 
ATOM   9991  C  CA  . GLY B 2 362  ? -33.402 43.874  -14.874 1.00 61.84  ? 916  GLY C CA  1 
ATOM   9992  C  C   . GLY B 2 362  ? -34.115 44.951  -14.077 1.00 53.40  ? 916  GLY C C   1 
ATOM   9993  O  O   . GLY B 2 362  ? -34.785 44.669  -13.084 1.00 46.49  ? 916  GLY C O   1 
ATOM   9994  N  N   . CYS B 2 363  ? -33.965 46.197  -14.520 1.00 55.24  ? 917  CYS C N   1 
ATOM   9995  C  CA  . CYS B 2 363  ? -34.604 47.334  -13.867 1.00 60.04  ? 917  CYS C CA  1 
ATOM   9996  C  C   . CYS B 2 363  ? -35.785 47.833  -14.688 1.00 59.24  ? 917  CYS C C   1 
ATOM   9997  O  O   . CYS B 2 363  ? -36.053 47.323  -15.777 1.00 52.41  ? 917  CYS C O   1 
ATOM   9998  C  CB  . CYS B 2 363  ? -33.601 48.471  -13.655 1.00 52.00  ? 917  CYS C CB  1 
ATOM   9999  S  SG  . CYS B 2 363  ? -32.084 47.999  -12.796 1.00 71.37  ? 917  CYS C SG  1 
ATOM   10000 N  N   . VAL B 2 364  ? -36.487 48.831  -14.156 1.00 52.15  ? 918  VAL C N   1 
ATOM   10001 C  CA  . VAL B 2 364  ? -37.592 49.478  -14.860 1.00 52.64  ? 918  VAL C CA  1 
ATOM   10002 C  C   . VAL B 2 364  ? -37.135 49.968  -16.232 1.00 60.19  ? 918  VAL C C   1 
ATOM   10003 O  O   . VAL B 2 364  ? -37.860 49.857  -17.228 1.00 60.14  ? 918  VAL C O   1 
ATOM   10004 C  CB  . VAL B 2 364  ? -38.156 50.659  -14.040 1.00 43.61  ? 918  VAL C CB  1 
ATOM   10005 C  CG1 . VAL B 2 364  ? -39.042 51.548  -14.900 1.00 59.67  ? 918  VAL C CG1 1 
ATOM   10006 C  CG2 . VAL B 2 364  ? -38.917 50.145  -12.828 1.00 39.75  ? 918  VAL C CG2 1 
ATOM   10007 N  N   . ARG B 2 365  ? -35.914 50.493  -16.262 1.00 58.63  ? 919  ARG C N   1 
ATOM   10008 C  CA  . ARG B 2 365  ? -35.264 50.953  -17.483 1.00 50.85  ? 919  ARG C CA  1 
ATOM   10009 C  C   . ARG B 2 365  ? -35.341 49.937  -18.618 1.00 51.26  ? 919  ARG C C   1 
ATOM   10010 O  O   . ARG B 2 365  ? -35.646 50.289  -19.757 1.00 59.20  ? 919  ARG C O   1 
ATOM   10011 C  CB  . ARG B 2 365  ? -33.802 51.282  -17.189 1.00 51.50  ? 919  ARG C CB  1 
ATOM   10012 C  CG  . ARG B 2 365  ? -32.961 51.570  -18.414 1.00 40.70  ? 919  ARG C CG  1 
ATOM   10013 C  CD  . ARG B 2 365  ? -31.483 51.406  -18.103 1.00 61.85  ? 919  ARG C CD  1 
ATOM   10014 N  NE  . ARG B 2 365  ? -31.110 52.071  -16.857 1.00 82.18  ? 919  ARG C NE  1 
ATOM   10015 C  CZ  . ARG B 2 365  ? -30.738 51.434  -15.751 1.00 71.33  ? 919  ARG C CZ  1 
ATOM   10016 N  NH1 . ARG B 2 365  ? -30.678 50.109  -15.732 1.00 67.59  ? 919  ARG C NH1 1 
ATOM   10017 N  NH2 . ARG B 2 365  ? -30.419 52.123  -14.664 1.00 74.57  ? 919  ARG C NH2 1 
ATOM   10018 N  N   . ASP B 2 366  ? -35.065 48.676  -18.301 1.00 48.23  ? 920  ASP C N   1 
ATOM   10019 C  CA  . ASP B 2 366  ? -35.055 47.619  -19.305 1.00 57.03  ? 920  ASP C CA  1 
ATOM   10020 C  C   . ASP B 2 366  ? -36.459 47.348  -19.839 1.00 56.16  ? 920  ASP C C   1 
ATOM   10021 O  O   . ASP B 2 366  ? -36.645 47.107  -21.036 1.00 59.22  ? 920  ASP C O   1 
ATOM   10022 C  CB  . ASP B 2 366  ? -34.449 46.344  -18.720 1.00 56.11  ? 920  ASP C CB  1 
ATOM   10023 C  CG  . ASP B 2 366  ? -33.013 46.539  -18.273 1.00 63.69  ? 920  ASP C CG  1 
ATOM   10024 O  OD1 . ASP B 2 366  ? -32.267 47.256  -18.972 1.00 55.33  ? 920  ASP C OD1 1 
ATOM   10025 O  OD2 . ASP B 2 366  ? -32.632 45.983  -17.221 1.00 64.42  ? 920  ASP C OD2 1 
ATOM   10026 N  N   . LEU B 2 367  ? -37.441 47.392  -18.945 1.00 50.13  ? 921  LEU C N   1 
ATOM   10027 C  CA  . LEU B 2 367  ? -38.839 47.246  -19.331 1.00 38.71  ? 921  LEU C CA  1 
ATOM   10028 C  C   . LEU B 2 367  ? -39.234 48.345  -20.313 1.00 51.44  ? 921  LEU C C   1 
ATOM   10029 O  O   . LEU B 2 367  ? -39.775 48.076  -21.393 1.00 57.42  ? 921  LEU C O   1 
ATOM   10030 C  CB  . LEU B 2 367  ? -39.741 47.286  -18.096 1.00 39.33  ? 921  LEU C CB  1 
ATOM   10031 C  CG  . LEU B 2 367  ? -41.244 47.135  -18.330 1.00 48.36  ? 921  LEU C CG  1 
ATOM   10032 C  CD1 . LEU B 2 367  ? -41.572 45.731  -18.815 1.00 45.58  ? 921  LEU C CD1 1 
ATOM   10033 C  CD2 . LEU B 2 367  ? -42.017 47.467  -17.062 1.00 34.25  ? 921  LEU C CD2 1 
ATOM   10034 N  N   . LEU B 2 368  ? -38.945 49.587  -19.931 1.00 52.98  ? 922  LEU C N   1 
ATOM   10035 C  CA  . LEU B 2 368  ? -39.229 50.738  -20.780 1.00 44.02  ? 922  LEU C CA  1 
ATOM   10036 C  C   . LEU B 2 368  ? -38.511 50.628  -22.119 1.00 54.00  ? 922  LEU C C   1 
ATOM   10037 O  O   . LEU B 2 368  ? -39.022 51.077  -23.146 1.00 63.55  ? 922  LEU C O   1 
ATOM   10038 C  CB  . LEU B 2 368  ? -38.822 52.035  -20.082 1.00 40.58  ? 922  LEU C CB  1 
ATOM   10039 C  CG  . LEU B 2 368  ? -39.558 52.381  -18.789 1.00 50.61  ? 922  LEU C CG  1 
ATOM   10040 C  CD1 . LEU B 2 368  ? -39.089 53.726  -18.261 1.00 44.21  ? 922  LEU C CD1 1 
ATOM   10041 C  CD2 . LEU B 2 368  ? -41.059 52.387  -19.017 1.00 47.60  ? 922  LEU C CD2 1 
ATOM   10042 N  N   . GLU B 2 369  ? -37.325 50.031  -22.103 1.00 47.49  ? 923  GLU C N   1 
ATOM   10043 C  CA  . GLU B 2 369  ? -36.547 49.863  -23.320 1.00 49.04  ? 923  GLU C CA  1 
ATOM   10044 C  C   . GLU B 2 369  ? -37.223 48.859  -24.246 1.00 54.75  ? 923  GLU C C   1 
ATOM   10045 O  O   . GLU B 2 369  ? -37.279 49.061  -25.462 1.00 65.03  ? 923  GLU C O   1 
ATOM   10046 C  CB  . GLU B 2 369  ? -35.121 49.417  -22.994 1.00 54.95  ? 923  GLU C CB  1 
ATOM   10047 C  CG  . GLU B 2 369  ? -34.177 49.478  -24.180 1.00 76.26  ? 923  GLU C CG  1 
ATOM   10048 C  CD  . GLU B 2 369  ? -34.030 50.883  -24.735 1.00 109.02 ? 923  GLU C CD  1 
ATOM   10049 O  OE1 . GLU B 2 369  ? -34.130 51.851  -23.950 1.00 99.31  ? 923  GLU C OE1 1 
ATOM   10050 O  OE2 . GLU B 2 369  ? -33.818 51.019  -25.958 1.00 103.14 ? 923  GLU C OE2 1 
ATOM   10051 N  N   . GLU B 2 370  ? -37.738 47.780  -23.665 1.00 50.65  ? 924  GLU C N   1 
ATOM   10052 C  CA  . GLU B 2 370  ? -38.505 46.802  -24.430 1.00 54.29  ? 924  GLU C CA  1 
ATOM   10053 C  C   . GLU B 2 370  ? -39.724 47.460  -25.067 1.00 55.98  ? 924  GLU C C   1 
ATOM   10054 O  O   . GLU B 2 370  ? -39.980 47.300  -26.269 1.00 55.49  ? 924  GLU C O   1 
ATOM   10055 C  CB  . GLU B 2 370  ? -38.937 45.637  -23.538 1.00 48.90  ? 924  GLU C CB  1 
ATOM   10056 C  CG  . GLU B 2 370  ? -37.805 44.700  -23.152 1.00 44.15  ? 924  GLU C CG  1 
ATOM   10057 C  CD  . GLU B 2 370  ? -37.266 43.925  -24.338 1.00 54.30  ? 924  GLU C CD  1 
ATOM   10058 O  OE1 . GLU B 2 370  ? -38.060 43.599  -25.246 1.00 73.47  ? 924  GLU C OE1 1 
ATOM   10059 O  OE2 . GLU B 2 370  ? -36.050 43.646  -24.364 1.00 56.20  ? 924  GLU C OE2 1 
ATOM   10060 N  N   . CYS B 2 371  ? -40.463 48.214  -24.257 1.00 58.40  ? 925  CYS C N   1 
ATOM   10061 C  CA  . CYS B 2 371  ? -41.656 48.894  -24.748 1.00 44.34  ? 925  CYS C CA  1 
ATOM   10062 C  C   . CYS B 2 371  ? -41.318 49.884  -25.856 1.00 51.73  ? 925  CYS C C   1 
ATOM   10063 O  O   . CYS B 2 371  ? -42.105 50.079  -26.782 1.00 52.72  ? 925  CYS C O   1 
ATOM   10064 C  CB  . CYS B 2 371  ? -42.378 49.618  -23.613 1.00 44.52  ? 925  CYS C CB  1 
ATOM   10065 S  SG  . CYS B 2 371  ? -44.006 50.242  -24.084 1.00 51.76  ? 925  CYS C SG  1 
ATOM   10066 N  N   . LYS B 2 372  ? -40.147 50.506  -25.759 1.00 62.21  ? 926  LYS C N   1 
ATOM   10067 C  CA  . LYS B 2 372  ? -39.697 51.429  -26.794 1.00 56.32  ? 926  LYS C CA  1 
ATOM   10068 C  C   . LYS B 2 372  ? -39.371 50.674  -28.074 1.00 50.35  ? 926  LYS C C   1 
ATOM   10069 O  O   . LYS B 2 372  ? -39.647 51.151  -29.175 1.00 63.95  ? 926  LYS C O   1 
ATOM   10070 C  CB  . LYS B 2 372  ? -38.479 52.227  -26.327 1.00 59.30  ? 926  LYS C CB  1 
ATOM   10071 C  CG  . LYS B 2 372  ? -38.067 53.325  -27.295 1.00 57.48  ? 926  LYS C CG  1 
ATOM   10072 C  CD  . LYS B 2 372  ? -37.124 54.327  -26.648 1.00 77.93  ? 926  LYS C CD  1 
ATOM   10073 C  CE  . LYS B 2 372  ? -35.790 53.695  -26.288 1.00 100.39 ? 926  LYS C CE  1 
ATOM   10074 N  NZ  . LYS B 2 372  ? -34.836 54.702  -25.743 1.00 77.31  ? 926  LYS C NZ  1 
ATOM   10075 N  N   . LYS B 2 373  ? -38.785 49.490  -27.926 1.00 50.04  ? 927  LYS C N   1 
ATOM   10076 C  CA  . LYS B 2 373  ? -38.495 48.645  -29.079 1.00 46.92  ? 927  LYS C CA  1 
ATOM   10077 C  C   . LYS B 2 373  ? -39.773 48.144  -29.741 1.00 51.20  ? 927  LYS C C   1 
ATOM   10078 O  O   . LYS B 2 373  ? -39.773 47.801  -30.923 1.00 54.32  ? 927  LYS C O   1 
ATOM   10079 C  CB  . LYS B 2 373  ? -37.624 47.453  -28.674 1.00 54.91  ? 927  LYS C CB  1 
ATOM   10080 C  CG  . LYS B 2 373  ? -36.158 47.789  -28.477 1.00 57.47  ? 927  LYS C CG  1 
ATOM   10081 C  CD  . LYS B 2 373  ? -35.315 46.531  -28.327 1.00 53.16  ? 927  LYS C CD  1 
ATOM   10082 C  CE  . LYS B 2 373  ? -35.685 45.757  -27.072 1.00 60.33  ? 927  LYS C CE  1 
ATOM   10083 N  NZ  . LYS B 2 373  ? -34.778 44.596  -26.856 1.00 59.42  ? 927  LYS C NZ  1 
ATOM   10084 N  N   . ALA B 2 374  ? -40.862 48.106  -28.979 1.00 56.31  ? 928  ALA C N   1 
ATOM   10085 C  CA  . ALA B 2 374  ? -42.103 47.508  -29.468 1.00 54.74  ? 928  ALA C CA  1 
ATOM   10086 C  C   . ALA B 2 374  ? -43.040 48.474  -30.203 1.00 54.68  ? 928  ALA C C   1 
ATOM   10087 O  O   . ALA B 2 374  ? -43.847 48.043  -31.027 1.00 55.03  ? 928  ALA C O   1 
ATOM   10088 C  CB  . ALA B 2 374  ? -42.847 46.860  -28.311 1.00 47.44  ? 928  ALA C CB  1 
ATOM   10089 N  N   . VAL B 2 375  ? -42.944 49.768  -29.911 1.00 56.22  ? 929  VAL C N   1 
ATOM   10090 C  CA  . VAL B 2 375  ? -43.945 50.719  -30.398 1.00 57.16  ? 929  VAL C CA  1 
ATOM   10091 C  C   . VAL B 2 375  ? -43.391 51.843  -31.270 1.00 63.74  ? 929  VAL C C   1 
ATOM   10092 O  O   . VAL B 2 375  ? -42.181 51.962  -31.465 1.00 68.54  ? 929  VAL C O   1 
ATOM   10093 C  CB  . VAL B 2 375  ? -44.692 51.376  -29.222 1.00 55.38  ? 929  VAL C CB  1 
ATOM   10094 C  CG1 . VAL B 2 375  ? -45.256 50.317  -28.294 1.00 53.19  ? 929  VAL C CG1 1 
ATOM   10095 C  CG2 . VAL B 2 375  ? -43.761 52.309  -28.464 1.00 51.60  ? 929  VAL C CG2 1 
ATOM   10096 N  N   . GLU B 2 376  ? -44.298 52.668  -31.790 1.00 57.94  ? 930  GLU C N   1 
ATOM   10097 C  CA  . GLU B 2 376  ? -43.920 53.915  -32.443 1.00 71.07  ? 930  GLU C CA  1 
ATOM   10098 C  C   . GLU B 2 376  ? -44.351 55.087  -31.568 1.00 71.12  ? 930  GLU C C   1 
ATOM   10099 O  O   . GLU B 2 376  ? -45.363 55.014  -30.870 1.00 59.01  ? 930  GLU C O   1 
ATOM   10100 C  CB  . GLU B 2 376  ? -44.538 54.031  -33.842 1.00 67.86  ? 930  GLU C CB  1 
ATOM   10101 C  CG  . GLU B 2 376  ? -45.993 54.485  -33.877 1.00 92.31  ? 930  GLU C CG  1 
ATOM   10102 C  CD  . GLU B 2 376  ? -46.410 55.008  -35.242 1.00 103.82 ? 930  GLU C CD  1 
ATOM   10103 O  OE1 . GLU B 2 376  ? -45.646 55.795  -35.841 1.00 105.33 ? 930  GLU C OE1 1 
ATOM   10104 O  OE2 . GLU B 2 376  ? -47.501 54.629  -35.719 1.00 92.63  ? 930  GLU C OE2 1 
ATOM   10105 N  N   . LEU B 2 377  ? -43.574 56.161  -31.598 1.00 68.95  ? 931  LEU C N   1 
ATOM   10106 C  CA  . LEU B 2 377  ? -43.864 57.324  -30.770 1.00 70.06  ? 931  LEU C CA  1 
ATOM   10107 C  C   . LEU B 2 377  ? -44.539 58.416  -31.595 1.00 80.44  ? 931  LEU C C   1 
ATOM   10108 O  O   . LEU B 2 377  ? -44.781 58.237  -32.789 1.00 97.02  ? 931  LEU C O   1 
ATOM   10109 C  CB  . LEU B 2 377  ? -42.579 57.846  -30.124 1.00 73.89  ? 931  LEU C CB  1 
ATOM   10110 C  CG  . LEU B 2 377  ? -41.777 56.784  -29.365 1.00 64.84  ? 931  LEU C CG  1 
ATOM   10111 C  CD1 . LEU B 2 377  ? -40.526 57.382  -28.742 1.00 67.50  ? 931  LEU C CD1 1 
ATOM   10112 C  CD2 . LEU B 2 377  ? -42.636 56.113  -28.304 1.00 66.21  ? 931  LEU C CD2 1 
ATOM   10113 N  N   . GLY B 2 378  ? -44.853 59.539  -30.956 1.00 74.53  ? 932  GLY C N   1 
ATOM   10114 C  CA  . GLY B 2 378  ? -45.505 60.642  -31.638 1.00 88.78  ? 932  GLY C CA  1 
ATOM   10115 C  C   . GLY B 2 378  ? -44.598 61.268  -32.678 1.00 108.17 ? 932  GLY C C   1 
ATOM   10116 O  O   . GLY B 2 378  ? -43.386 61.056  -32.638 1.00 98.85  ? 932  GLY C O   1 
ATOM   10117 N  N   . GLU B 2 379  ? -45.183 62.035  -33.600 1.00 113.69 ? 933  GLU C N   1 
ATOM   10118 C  CA  . GLU B 2 379  ? -44.426 62.692  -34.666 1.00 106.45 ? 933  GLU C CA  1 
ATOM   10119 C  C   . GLU B 2 379  ? -43.243 63.446  -34.084 1.00 106.05 ? 933  GLU C C   1 
ATOM   10120 O  O   . GLU B 2 379  ? -42.097 63.228  -34.479 1.00 85.62  ? 933  GLU C O   1 
ATOM   10121 C  CB  . GLU B 2 379  ? -45.316 63.650  -35.458 1.00 100.31 ? 933  GLU C CB  1 
ATOM   10122 C  CG  . GLU B 2 379  ? -44.553 64.506  -36.458 1.00 115.65 ? 933  GLU C CG  1 
ATOM   10123 C  CD  . GLU B 2 379  ? -45.364 65.686  -36.953 1.00 119.64 ? 933  GLU C CD  1 
ATOM   10124 O  OE1 . GLU B 2 379  ? -45.362 66.736  -36.275 1.00 93.77  ? 933  GLU C OE1 1 
ATOM   10125 O  OE2 . GLU B 2 379  ? -46.004 65.566  -38.019 1.00 100.39 ? 933  GLU C OE2 1 
ATOM   10126 N  N   . LYS B 2 380  ? -43.527 64.335  -33.141 1.00 95.22  ? 934  LYS C N   1 
ATOM   10127 C  CA  . LYS B 2 380  ? -42.484 64.824  -32.259 1.00 100.78 ? 934  LYS C CA  1 
ATOM   10128 C  C   . LYS B 2 380  ? -42.988 64.938  -30.828 1.00 110.09 ? 934  LYS C C   1 
ATOM   10129 O  O   . LYS B 2 380  ? -43.973 65.619  -30.543 1.00 100.44 ? 934  LYS C O   1 
ATOM   10130 C  CB  . LYS B 2 380  ? -41.934 66.166  -32.738 1.00 107.14 ? 934  LYS C CB  1 
ATOM   10131 C  CG  . LYS B 2 380  ? -40.551 66.467  -32.176 1.00 108.83 ? 934  LYS C CG  1 
ATOM   10132 C  CD  . LYS B 2 380  ? -39.704 65.195  -32.135 1.00 119.67 ? 934  LYS C CD  1 
ATOM   10133 C  CE  . LYS B 2 380  ? -38.240 65.484  -31.839 1.00 116.60 ? 934  LYS C CE  1 
ATOM   10134 N  NZ  . LYS B 2 380  ? -38.042 66.130  -30.514 1.00 113.20 ? 934  LYS C NZ  1 
ATOM   10135 N  N   . ALA B 2 381  ? -42.293 64.242  -29.939 1.00 107.17 ? 935  ALA C N   1 
ATOM   10136 C  CA  . ALA B 2 381  ? -42.510 64.330  -28.507 1.00 105.27 ? 935  ALA C CA  1 
ATOM   10137 C  C   . ALA B 2 381  ? -41.150 64.133  -27.861 1.00 93.54  ? 935  ALA C C   1 
ATOM   10138 O  O   . ALA B 2 381  ? -40.132 64.192  -28.550 1.00 96.05  ? 935  ALA C O   1 
ATOM   10139 C  CB  . ALA B 2 381  ? -43.511 63.296  -28.029 1.00 91.31  ? 935  ALA C CB  1 
ATOM   10140 N  N   . SER B 2 382  ? -41.124 63.923  -26.550 1.00 80.46  ? 936  SER C N   1 
ATOM   10141 C  CA  . SER B 2 382  ? -39.865 63.716  -25.844 1.00 81.26  ? 936  SER C CA  1 
ATOM   10142 C  C   . SER B 2 382  ? -39.035 62.588  -26.444 1.00 76.41  ? 936  SER C C   1 
ATOM   10143 O  O   . SER B 2 382  ? -37.842 62.752  -26.702 1.00 64.40  ? 936  SER C O   1 
ATOM   10144 C  CB  . SER B 2 382  ? -40.123 63.415  -24.370 1.00 75.57  ? 936  SER C CB  1 
ATOM   10145 O  OG  . SER B 2 382  ? -40.953 62.276  -24.220 1.00 78.75  ? 936  SER C OG  1 
ATOM   10146 N  N   . GLY B 2 383  ? -39.674 61.446  -26.669 1.00 82.91  ? 937  GLY C N   1 
ATOM   10147 C  CA  . GLY B 2 383  ? -38.961 60.249  -27.069 1.00 82.91  ? 937  GLY C CA  1 
ATOM   10148 C  C   . GLY B 2 383  ? -38.472 59.539  -25.824 1.00 90.01  ? 937  GLY C C   1 
ATOM   10149 O  O   . GLY B 2 383  ? -37.687 58.592  -25.891 1.00 84.31  ? 937  GLY C O   1 
ATOM   10150 N  N   . LYS B 2 384  ? -38.942 60.017  -24.676 1.00 65.23  ? 938  LYS C N   1 
ATOM   10151 C  CA  . LYS B 2 384  ? -38.602 59.428  -23.389 1.00 73.46  ? 938  LYS C CA  1 
ATOM   10152 C  C   . LYS B 2 384  ? -39.850 58.818  -22.763 1.00 74.85  ? 938  LYS C C   1 
ATOM   10153 O  O   . LYS B 2 384  ? -40.919 59.428  -22.769 1.00 68.53  ? 938  LYS C O   1 
ATOM   10154 C  CB  . LYS B 2 384  ? -37.985 60.478  -22.462 1.00 77.89  ? 938  LYS C CB  1 
ATOM   10155 C  CG  . LYS B 2 384  ? -36.780 61.189  -23.064 1.00 82.15  ? 938  LYS C CG  1 
ATOM   10156 C  CD  . LYS B 2 384  ? -36.148 62.167  -22.084 1.00 105.04 ? 938  LYS C CD  1 
ATOM   10157 C  CE  . LYS B 2 384  ? -34.927 62.843  -22.695 1.00 103.07 ? 938  LYS C CE  1 
ATOM   10158 N  NZ  . LYS B 2 384  ? -34.245 63.761  -21.739 1.00 74.59  ? 938  LYS C NZ  1 
ATOM   10159 N  N   . LEU B 2 385  ? -39.711 57.608  -22.232 1.00 76.77  ? 939  LEU C N   1 
ATOM   10160 C  CA  . LEU B 2 385  ? -40.848 56.874  -21.687 1.00 63.90  ? 939  LEU C CA  1 
ATOM   10161 C  C   . LEU B 2 385  ? -40.826 56.831  -20.166 1.00 62.09  ? 939  LEU C C   1 
ATOM   10162 O  O   . LEU B 2 385  ? -39.794 57.079  -19.542 1.00 59.20  ? 939  LEU C O   1 
ATOM   10163 C  CB  . LEU B 2 385  ? -40.870 55.448  -22.239 1.00 51.66  ? 939  LEU C CB  1 
ATOM   10164 C  CG  . LEU B 2 385  ? -41.029 55.279  -23.749 1.00 52.50  ? 939  LEU C CG  1 
ATOM   10165 C  CD1 . LEU B 2 385  ? -40.761 53.842  -24.134 1.00 59.80  ? 939  LEU C CD1 1 
ATOM   10166 C  CD2 . LEU B 2 385  ? -42.419 55.685  -24.187 1.00 55.93  ? 939  LEU C CD2 1 
ATOM   10167 N  N   . ARG B 2 386  ? -41.971 56.506  -19.572 1.00 53.91  ? 940  ARG C N   1 
ATOM   10168 C  CA  . ARG B 2 386  ? -42.053 56.365  -18.124 1.00 63.04  ? 940  ARG C CA  1 
ATOM   10169 C  C   . ARG B 2 386  ? -43.100 55.336  -17.701 1.00 63.81  ? 940  ARG C C   1 
ATOM   10170 O  O   . ARG B 2 386  ? -44.005 54.982  -18.477 1.00 61.05  ? 940  ARG C O   1 
ATOM   10171 C  CB  . ARG B 2 386  ? -42.350 57.716  -17.470 1.00 54.36  ? 940  ARG C CB  1 
ATOM   10172 C  CG  . ARG B 2 386  ? -43.711 58.297  -17.805 1.00 63.98  ? 940  ARG C CG  1 
ATOM   10173 C  CD  . ARG B 2 386  ? -43.870 59.677  -17.189 1.00 62.76  ? 940  ARG C CD  1 
ATOM   10174 N  NE  . ARG B 2 386  ? -45.183 60.254  -17.460 1.00 73.68  ? 940  ARG C NE  1 
ATOM   10175 C  CZ  . ARG B 2 386  ? -45.524 61.502  -17.157 1.00 72.08  ? 940  ARG C CZ  1 
ATOM   10176 N  NH1 . ARG B 2 386  ? -44.646 62.308  -16.577 1.00 73.51  ? 940  ARG C NH1 1 
ATOM   10177 N  NH2 . ARG B 2 386  ? -46.741 61.946  -17.439 1.00 73.28  ? 940  ARG C NH2 1 
ATOM   10178 N  N   . LEU B 2 387  ? -42.959 54.876  -16.458 1.00 48.16  ? 941  LEU C N   1 
ATOM   10179 C  CA  . LEU B 2 387  ? -43.783 53.806  -15.904 1.00 44.66  ? 941  LEU C CA  1 
ATOM   10180 C  C   . LEU B 2 387  ? -44.627 54.266  -14.712 1.00 54.29  ? 941  LEU C C   1 
ATOM   10181 O  O   . LEU B 2 387  ? -44.106 54.585  -13.633 1.00 51.54  ? 941  LEU C O   1 
ATOM   10182 C  CB  . LEU B 2 387  ? -42.901 52.626  -15.488 1.00 44.26  ? 941  LEU C CB  1 
ATOM   10183 C  CG  . LEU B 2 387  ? -43.589 51.418  -14.848 1.00 50.14  ? 941  LEU C CG  1 
ATOM   10184 C  CD1 . LEU B 2 387  ? -44.535 50.738  -15.827 1.00 41.35  ? 941  LEU C CD1 1 
ATOM   10185 C  CD2 . LEU B 2 387  ? -42.554 50.433  -14.329 1.00 39.11  ? 941  LEU C CD2 1 
ATOM   10186 N  N   . LEU B 2 388  ? -45.937 54.281  -14.933 1.00 55.97  ? 942  LEU C N   1 
ATOM   10187 C  CA  . LEU B 2 388  ? -46.930 54.661  -13.940 1.00 54.10  ? 942  LEU C CA  1 
ATOM   10188 C  C   . LEU B 2 388  ? -47.523 53.431  -13.262 1.00 59.58  ? 942  LEU C C   1 
ATOM   10189 O  O   . LEU B 2 388  ? -47.638 52.372  -13.879 1.00 64.37  ? 942  LEU C O   1 
ATOM   10190 C  CB  . LEU B 2 388  ? -48.057 55.467  -14.594 1.00 53.65  ? 942  LEU C CB  1 
ATOM   10191 C  CG  . LEU B 2 388  ? -47.867 56.931  -15.007 1.00 57.53  ? 942  LEU C CG  1 
ATOM   10192 C  CD1 . LEU B 2 388  ? -47.605 57.784  -13.787 1.00 65.56  ? 942  LEU C CD1 1 
ATOM   10193 C  CD2 . LEU B 2 388  ? -46.760 57.114  -16.038 1.00 55.33  ? 942  LEU C CD2 1 
ATOM   10194 N  N   . GLU B 2 389  ? -47.911 53.578  -12.000 1.00 49.96  ? 943  GLU C N   1 
ATOM   10195 C  CA  . GLU B 2 389  ? -48.655 52.545  -11.294 1.00 52.84  ? 943  GLU C CA  1 
ATOM   10196 C  C   . GLU B 2 389  ? -50.023 53.069  -10.868 1.00 58.09  ? 943  GLU C C   1 
ATOM   10197 O  O   . GLU B 2 389  ? -50.129 54.071  -10.129 1.00 60.53  ? 943  GLU C O   1 
ATOM   10198 C  CB  . GLU B 2 389  ? -47.887 52.037  -10.078 1.00 60.84  ? 943  GLU C CB  1 
ATOM   10199 C  CG  . GLU B 2 389  ? -48.608 50.910  -9.368  1.00 58.81  ? 943  GLU C CG  1 
ATOM   10200 C  CD  . GLU B 2 389  ? -47.844 50.382  -8.177  1.00 64.77  ? 943  GLU C CD  1 
ATOM   10201 O  OE1 . GLU B 2 389  ? -46.664 50.755  -8.005  1.00 82.43  ? 943  GLU C OE1 1 
ATOM   10202 O  OE2 . GLU B 2 389  ? -48.430 49.593  -7.409  1.00 65.53  ? 943  GLU C OE2 1 
ATOM   10203 N  N   . ILE B 2 390  ? -51.050 52.357  -11.332 1.00 52.74  ? 944  ILE C N   1 
ATOM   10204 C  CA  . ILE B 2 390  ? -52.442 52.778  -11.267 1.00 62.51  ? 944  ILE C CA  1 
ATOM   10205 C  C   . ILE B 2 390  ? -53.293 51.770  -10.505 1.00 57.92  ? 944  ILE C C   1 
ATOM   10206 O  O   . ILE B 2 390  ? -53.264 50.579  -10.813 1.00 65.43  ? 944  ILE C O   1 
ATOM   10207 C  CB  . ILE B 2 390  ? -53.047 52.932  -12.676 1.00 56.89  ? 944  ILE C CB  1 
ATOM   10208 C  CG1 . ILE B 2 390  ? -52.132 53.753  -13.587 1.00 61.55  ? 944  ILE C CG1 1 
ATOM   10209 C  CG2 . ILE B 2 390  ? -54.457 53.510  -12.596 1.00 59.04  ? 944  ILE C CG2 1 
ATOM   10210 C  CD1 . ILE B 2 390  ? -52.638 53.836  -15.001 1.00 64.64  ? 944  ILE C CD1 1 
ATOM   10211 N  N   . VAL B 2 391  ? -54.051 52.244  -9.519  1.00 63.00  ? 945  VAL C N   1 
ATOM   10212 C  CA  . VAL B 2 391  ? -55.004 51.398  -8.795  1.00 70.16  ? 945  VAL C CA  1 
ATOM   10213 C  C   . VAL B 2 391  ? -56.333 52.137  -8.634  1.00 72.47  ? 945  VAL C C   1 
ATOM   10214 O  O   . VAL B 2 391  ? -56.341 53.320  -8.295  1.00 69.25  ? 945  VAL C O   1 
ATOM   10215 C  CB  . VAL B 2 391  ? -54.474 50.985  -7.401  1.00 62.34  ? 945  VAL C CB  1 
ATOM   10216 C  CG1 . VAL B 2 391  ? -55.530 50.201  -6.623  1.00 58.76  ? 945  VAL C CG1 1 
ATOM   10217 C  CG2 . VAL B 2 391  ? -53.203 50.167  -7.535  1.00 78.92  ? 945  VAL C CG2 1 
ATOM   10218 N  N   . SER B 2 392  ? -57.443 51.442  -8.882  1.00 79.84  ? 946  SER C N   1 
ATOM   10219 C  CA  . SER B 2 392  ? -58.781 52.033  -8.799  1.00 68.74  ? 946  SER C CA  1 
ATOM   10220 C  C   . SER B 2 392  ? -58.911 53.244  -9.716  1.00 66.18  ? 946  SER C C   1 
ATOM   10221 O  O   . SER B 2 392  ? -59.482 54.267  -9.332  1.00 72.43  ? 946  SER C O   1 
ATOM   10222 C  CB  . SER B 2 392  ? -59.116 52.430  -7.357  1.00 59.10  ? 946  SER C CB  1 
ATOM   10223 O  OG  . SER B 2 392  ? -59.052 51.310  -6.494  1.00 76.70  ? 946  SER C OG  1 
ATOM   10224 N  N   . TYR B 2 393  ? -58.361 53.115  -10.922 1.00 70.21  ? 947  TYR C N   1 
ATOM   10225 C  CA  . TYR B 2 393  ? -58.377 54.173  -11.930 1.00 66.38  ? 947  TYR C CA  1 
ATOM   10226 C  C   . TYR B 2 393  ? -57.696 55.449  -11.436 1.00 68.65  ? 947  TYR C C   1 
ATOM   10227 O  O   . TYR B 2 393  ? -57.974 56.542  -11.926 1.00 73.83  ? 947  TYR C O   1 
ATOM   10228 C  CB  . TYR B 2 393  ? -59.815 54.473  -12.369 1.00 71.45  ? 947  TYR C CB  1 
ATOM   10229 C  CG  . TYR B 2 393  ? -60.567 53.255  -12.854 1.00 75.50  ? 947  TYR C CG  1 
ATOM   10230 C  CD1 . TYR B 2 393  ? -60.455 52.824  -14.169 1.00 65.04  ? 947  TYR C CD1 1 
ATOM   10231 C  CD2 . TYR B 2 393  ? -61.387 52.533  -11.995 1.00 73.03  ? 947  TYR C CD2 1 
ATOM   10232 C  CE1 . TYR B 2 393  ? -61.139 51.710  -14.617 1.00 69.27  ? 947  TYR C CE1 1 
ATOM   10233 C  CE2 . TYR B 2 393  ? -62.075 51.418  -12.433 1.00 75.64  ? 947  TYR C CE2 1 
ATOM   10234 C  CZ  . TYR B 2 393  ? -61.948 51.011  -13.745 1.00 80.91  ? 947  TYR C CZ  1 
ATOM   10235 O  OH  . TYR B 2 393  ? -62.631 49.901  -14.187 1.00 72.75  ? 947  TYR C OH  1 
ATOM   10236 N  N   . LYS B 2 394  ? -56.803 55.299  -10.461 1.00 68.85  ? 948  LYS C N   1 
ATOM   10237 C  CA  . LYS B 2 394  ? -56.021 56.418  -9.949  1.00 67.71  ? 948  LYS C CA  1 
ATOM   10238 C  C   . LYS B 2 394  ? -54.537 56.102  -10.029 1.00 67.72  ? 948  LYS C C   1 
ATOM   10239 O  O   . LYS B 2 394  ? -54.116 54.991  -9.714  1.00 75.05  ? 948  LYS C O   1 
ATOM   10240 C  CB  . LYS B 2 394  ? -56.391 56.739  -8.500  1.00 75.94  ? 948  LYS C CB  1 
ATOM   10241 C  CG  . LYS B 2 394  ? -57.852 57.058  -8.267  1.00 78.82  ? 948  LYS C CG  1 
ATOM   10242 C  CD  . LYS B 2 394  ? -58.088 57.433  -6.812  1.00 77.65  ? 948  LYS C CD  1 
ATOM   10243 C  CE  . LYS B 2 394  ? -57.611 56.334  -5.874  1.00 92.08  ? 948  LYS C CE  1 
ATOM   10244 N  NZ  . LYS B 2 394  ? -57.695 56.739  -4.442  1.00 85.37  ? 948  LYS C NZ  1 
ATOM   10245 N  N   . ILE B 2 395  ? -53.743 57.081  -10.445 1.00 72.18  ? 949  ILE C N   1 
ATOM   10246 C  CA  . ILE B 2 395  ? -52.298 56.913  -10.449 1.00 66.76  ? 949  ILE C CA  1 
ATOM   10247 C  C   . ILE B 2 395  ? -51.763 56.994  -9.029  1.00 63.34  ? 949  ILE C C   1 
ATOM   10248 O  O   . ILE B 2 395  ? -51.814 58.051  -8.401  1.00 61.75  ? 949  ILE C O   1 
ATOM   10249 C  CB  . ILE B 2 395  ? -51.598 57.971  -11.316 1.00 67.26  ? 949  ILE C CB  1 
ATOM   10250 C  CG1 . ILE B 2 395  ? -51.995 57.800  -12.781 1.00 66.72  ? 949  ILE C CG1 1 
ATOM   10251 C  CG2 . ILE B 2 395  ? -50.088 57.874  -11.152 1.00 56.66  ? 949  ILE C CG2 1 
ATOM   10252 C  CD1 . ILE B 2 395  ? -51.322 58.773  -13.717 1.00 50.13  ? 949  ILE C CD1 1 
ATOM   10253 N  N   . ILE B 2 396  ? -51.255 55.879  -8.518  1.00 54.79  ? 950  ILE C N   1 
ATOM   10254 C  CA  . ILE B 2 396  ? -50.688 55.879  -7.180  1.00 57.74  ? 950  ILE C CA  1 
ATOM   10255 C  C   . ILE B 2 396  ? -49.175 56.071  -7.218  1.00 66.09  ? 950  ILE C C   1 
ATOM   10256 O  O   . ILE B 2 396  ? -48.546 56.236  -6.166  1.00 61.84  ? 950  ILE C O   1 
ATOM   10257 C  CB  . ILE B 2 396  ? -51.018 54.585  -6.422  1.00 46.29  ? 950  ILE C CB  1 
ATOM   10258 C  CG1 . ILE B 2 396  ? -50.226 53.410  -6.993  1.00 64.62  ? 950  ILE C CG1 1 
ATOM   10259 C  CG2 . ILE B 2 396  ? -52.522 54.324  -6.448  1.00 49.69  ? 950  ILE C CG2 1 
ATOM   10260 C  CD1 . ILE B 2 396  ? -50.390 52.134  -6.198  1.00 64.12  ? 950  ILE C CD1 1 
ATOM   10261 N  N   . GLY B 2 397  ? -48.575 56.050  -8.408  1.00 62.86  ? 951  GLY C N   1 
ATOM   10262 C  CA  . GLY B 2 397  ? -47.168 56.425  -8.461  1.00 50.96  ? 951  GLY C CA  1 
ATOM   10263 C  C   . GLY B 2 397  ? -46.404 56.410  -9.772  1.00 53.61  ? 951  GLY C C   1 
ATOM   10264 O  O   . GLY B 2 397  ? -46.859 55.876  -10.770 1.00 62.17  ? 951  GLY C O   1 
ATOM   10265 N  N   . VAL B 2 398  ? -45.224 57.021  -9.758  1.00 51.09  ? 952  VAL C N   1 
ATOM   10266 C  CA  . VAL B 2 398  ? -44.290 56.920  -10.869 1.00 50.47  ? 952  VAL C CA  1 
ATOM   10267 C  C   . VAL B 2 398  ? -43.050 56.182  -10.394 1.00 59.45  ? 952  VAL C C   1 
ATOM   10268 O  O   . VAL B 2 398  ? -42.503 56.507  -9.340  1.00 61.89  ? 952  VAL C O   1 
ATOM   10269 C  CB  . VAL B 2 398  ? -43.879 58.288  -11.407 1.00 55.52  ? 952  VAL C CB  1 
ATOM   10270 C  CG1 . VAL B 2 398  ? -43.062 58.112  -12.668 1.00 55.78  ? 952  VAL C CG1 1 
ATOM   10271 C  CG2 . VAL B 2 398  ? -45.107 59.145  -11.668 1.00 61.43  ? 952  VAL C CG2 1 
ATOM   10272 N  N   . HIS B 2 399  ? -42.608 55.191  -11.161 1.00 59.56  ? 953  HIS C N   1 
ATOM   10273 C  CA  . HIS B 2 399  ? -41.431 54.425  -10.766 1.00 56.25  ? 953  HIS C CA  1 
ATOM   10274 C  C   . HIS B 2 399  ? -40.164 54.913  -11.461 1.00 57.93  ? 953  HIS C C   1 
ATOM   10275 O  O   . HIS B 2 399  ? -40.107 55.001  -12.688 1.00 64.02  ? 953  HIS C O   1 
ATOM   10276 C  CB  . HIS B 2 399  ? -41.652 52.938  -11.043 1.00 48.89  ? 953  HIS C CB  1 
ATOM   10277 C  CG  . HIS B 2 399  ? -42.692 52.315  -10.163 1.00 47.40  ? 953  HIS C CG  1 
ATOM   10278 N  ND1 . HIS B 2 399  ? -42.374 51.516  -9.089  1.00 57.77  ? 953  HIS C ND1 1 
ATOM   10279 C  CD2 . HIS B 2 399  ? -44.044 52.394  -10.192 1.00 52.77  ? 953  HIS C CD2 1 
ATOM   10280 C  CE1 . HIS B 2 399  ? -43.489 51.119  -8.495  1.00 54.47  ? 953  HIS C CE1 1 
ATOM   10281 N  NE2 . HIS B 2 399  ? -44.512 51.638  -9.145  1.00 59.87  ? 953  HIS C NE2 1 
ATOM   10282 N  N   . GLN B 2 400  ? -39.153 55.235  -10.658 1.00 60.69  ? 954  GLN C N   1 
ATOM   10283 C  CA  . GLN B 2 400  ? -37.870 55.697  -11.172 1.00 61.92  ? 954  GLN C CA  1 
ATOM   10284 C  C   . GLN B 2 400  ? -37.187 54.564  -11.930 1.00 66.33  ? 954  GLN C C   1 
ATOM   10285 O  O   . GLN B 2 400  ? -37.239 53.409  -11.511 1.00 58.33  ? 954  GLN C O   1 
ATOM   10286 C  CB  . GLN B 2 400  ? -36.988 56.209  -10.032 1.00 63.38  ? 954  GLN C CB  1 
ATOM   10287 C  CG  . GLN B 2 400  ? -35.852 57.111  -10.481 1.00 59.13  ? 954  GLN C CG  1 
ATOM   10288 C  CD  . GLN B 2 400  ? -34.555 56.359  -10.679 1.00 70.38  ? 954  GLN C CD  1 
ATOM   10289 O  OE1 . GLN B 2 400  ? -34.248 55.427  -9.937  1.00 71.32  ? 954  GLN C OE1 1 
ATOM   10290 N  NE2 . GLN B 2 400  ? -33.783 56.761  -11.683 1.00 71.08  ? 954  GLN C NE2 1 
ATOM   10291 N  N   . GLU B 2 401  ? -36.545 54.898  -13.044 1.00 65.88  ? 955  GLU C N   1 
ATOM   10292 C  CA  . GLU B 2 401  ? -36.101 53.887  -14.000 1.00 58.78  ? 955  GLU C CA  1 
ATOM   10293 C  C   . GLU B 2 401  ? -34.988 52.971  -13.489 1.00 57.51  ? 955  GLU C C   1 
ATOM   10294 O  O   . GLU B 2 401  ? -34.659 51.979  -14.137 1.00 67.09  ? 955  GLU C O   1 
ATOM   10295 C  CB  . GLU B 2 401  ? -35.657 54.562  -15.301 1.00 69.98  ? 955  GLU C CB  1 
ATOM   10296 C  CG  . GLU B 2 401  ? -34.431 55.448  -15.181 1.00 86.45  ? 955  GLU C CG  1 
ATOM   10297 C  CD  . GLU B 2 401  ? -34.138 56.179  -16.475 1.00 111.05 ? 955  GLU C CD  1 
ATOM   10298 O  OE1 . GLU B 2 401  ? -35.097 56.673  -17.107 1.00 99.21  ? 955  GLU C OE1 1 
ATOM   10299 O  OE2 . GLU B 2 401  ? -32.956 56.248  -16.869 1.00 108.73 ? 955  GLU C OE2 1 
ATOM   10300 N  N   . ASP B 2 402  ? -34.409 53.290  -12.336 1.00 52.53  ? 956  ASP C N   1 
ATOM   10301 C  CA  . ASP B 2 402  ? -33.387 52.424  -11.756 1.00 57.48  ? 956  ASP C CA  1 
ATOM   10302 C  C   . ASP B 2 402  ? -33.986 51.386  -10.810 1.00 57.94  ? 956  ASP C C   1 
ATOM   10303 O  O   . ASP B 2 402  ? -33.284 50.486  -10.349 1.00 56.60  ? 956  ASP C O   1 
ATOM   10304 C  CB  . ASP B 2 402  ? -32.329 53.247  -11.016 1.00 58.99  ? 956  ASP C CB  1 
ATOM   10305 C  CG  . ASP B 2 402  ? -31.472 54.075  -11.950 1.00 73.02  ? 956  ASP C CG  1 
ATOM   10306 O  OD1 . ASP B 2 402  ? -31.192 53.607  -13.073 1.00 71.73  ? 956  ASP C OD1 1 
ATOM   10307 O  OD2 . ASP B 2 402  ? -31.077 55.194  -11.559 1.00 74.62  ? 956  ASP C OD2 1 
ATOM   10308 N  N   . GLU B 2 403  ? -35.279 51.513  -10.523 1.00 46.95  ? 957  GLU C N   1 
ATOM   10309 C  CA  . GLU B 2 403  ? -35.955 50.588  -9.616  1.00 43.19  ? 957  GLU C CA  1 
ATOM   10310 C  C   . GLU B 2 403  ? -35.944 49.163  -10.159 1.00 52.68  ? 957  GLU C C   1 
ATOM   10311 O  O   . GLU B 2 403  ? -36.015 48.948  -11.368 1.00 57.78  ? 957  GLU C O   1 
ATOM   10312 C  CB  . GLU B 2 403  ? -37.395 51.034  -9.356  1.00 48.28  ? 957  GLU C CB  1 
ATOM   10313 C  CG  . GLU B 2 403  ? -37.525 52.318  -8.550  1.00 65.33  ? 957  GLU C CG  1 
ATOM   10314 C  CD  . GLU B 2 403  ? -38.962 52.615  -8.160  1.00 69.62  ? 957  GLU C CD  1 
ATOM   10315 O  OE1 . GLU B 2 403  ? -39.774 51.666  -8.107  1.00 63.85  ? 957  GLU C OE1 1 
ATOM   10316 O  OE2 . GLU B 2 403  ? -39.282 53.797  -7.910  1.00 60.63  ? 957  GLU C OE2 1 
ATOM   10317 N  N   . LEU B 2 404  ? -35.860 48.191  -9.255  1.00 53.01  ? 958  LEU C N   1 
ATOM   10318 C  CA  . LEU B 2 404  ? -35.791 46.786  -9.639  1.00 46.69  ? 958  LEU C CA  1 
ATOM   10319 C  C   . LEU B 2 404  ? -37.143 46.238  -10.077 1.00 56.44  ? 958  LEU C C   1 
ATOM   10320 O  O   . LEU B 2 404  ? -38.177 46.572  -9.502  1.00 58.30  ? 958  LEU C O   1 
ATOM   10321 C  CB  . LEU B 2 404  ? -35.248 45.948  -8.482  1.00 56.06  ? 958  LEU C CB  1 
ATOM   10322 C  CG  . LEU B 2 404  ? -33.783 46.165  -8.114  1.00 48.97  ? 958  LEU C CG  1 
ATOM   10323 C  CD1 . LEU B 2 404  ? -33.388 45.227  -6.991  1.00 43.71  ? 958  LEU C CD1 1 
ATOM   10324 C  CD2 . LEU B 2 404  ? -32.899 45.949  -9.328  1.00 47.00  ? 958  LEU C CD2 1 
ATOM   10325 N  N   . LEU B 2 405  ? -37.123 45.383  -11.095 1.00 56.48  ? 959  LEU C N   1 
ATOM   10326 C  CA  . LEU B 2 405  ? -38.343 44.774  -11.610 1.00 48.41  ? 959  LEU C CA  1 
ATOM   10327 C  C   . LEU B 2 405  ? -38.906 43.733  -10.650 1.00 64.26  ? 959  LEU C C   1 
ATOM   10328 O  O   . LEU B 2 405  ? -40.094 43.417  -10.693 1.00 59.24  ? 959  LEU C O   1 
ATOM   10329 C  CB  . LEU B 2 405  ? -38.086 44.133  -12.973 1.00 40.41  ? 959  LEU C CB  1 
ATOM   10330 C  CG  . LEU B 2 405  ? -37.862 45.093  -14.139 1.00 47.78  ? 959  LEU C CG  1 
ATOM   10331 C  CD1 . LEU B 2 405  ? -37.490 44.322  -15.392 1.00 42.57  ? 959  LEU C CD1 1 
ATOM   10332 C  CD2 . LEU B 2 405  ? -39.102 45.940  -14.378 1.00 50.04  ? 959  LEU C CD2 1 
ATOM   10333 N  N   . GLU B 2 406  ? -38.049 43.202  -9.784  1.00 65.45  ? 960  GLU C N   1 
ATOM   10334 C  CA  . GLU B 2 406  ? -38.462 42.162  -8.849  1.00 66.74  ? 960  GLU C CA  1 
ATOM   10335 C  C   . GLU B 2 406  ? -39.289 42.741  -7.701  1.00 60.45  ? 960  GLU C C   1 
ATOM   10336 O  O   . GLU B 2 406  ? -39.909 42.003  -6.935  1.00 55.97  ? 960  GLU C O   1 
ATOM   10337 C  CB  . GLU B 2 406  ? -37.237 41.423  -8.304  1.00 66.62  ? 960  GLU C CB  1 
ATOM   10338 C  CG  . GLU B 2 406  ? -37.555 40.085  -7.659  1.00 87.67  ? 960  GLU C CG  1 
ATOM   10339 C  CD  . GLU B 2 406  ? -36.319 39.382  -7.135  1.00 120.25 ? 960  GLU C CD  1 
ATOM   10340 O  OE1 . GLU B 2 406  ? -35.202 39.743  -7.564  1.00 98.21  ? 960  GLU C OE1 1 
ATOM   10341 O  OE2 . GLU B 2 406  ? -36.466 38.472  -6.292  1.00 117.35 ? 960  GLU C OE2 1 
ATOM   10342 N  N   . CYS B 2 407  ? -39.300 44.065  -7.591  1.00 64.23  ? 961  CYS C N   1 
ATOM   10343 C  CA  . CYS B 2 407  ? -40.059 44.740  -6.543  1.00 61.45  ? 961  CYS C CA  1 
ATOM   10344 C  C   . CYS B 2 407  ? -41.451 45.136  -7.024  1.00 69.07  ? 961  CYS C C   1 
ATOM   10345 O  O   . CYS B 2 407  ? -42.166 45.874  -6.345  1.00 74.28  ? 961  CYS C O   1 
ATOM   10346 C  CB  . CYS B 2 407  ? -39.306 45.977  -6.050  1.00 55.34  ? 961  CYS C CB  1 
ATOM   10347 S  SG  . CYS B 2 407  ? -37.733 45.622  -5.234  1.00 77.44  ? 961  CYS C SG  1 
ATOM   10348 N  N   . LEU B 2 408  ? -41.831 44.639  -8.195  1.00 75.61  ? 962  LEU C N   1 
ATOM   10349 C  CA  . LEU B 2 408  ? -43.118 44.978  -8.790  1.00 62.24  ? 962  LEU C CA  1 
ATOM   10350 C  C   . LEU B 2 408  ? -44.027 43.761  -8.889  1.00 83.21  ? 962  LEU C C   1 
ATOM   10351 O  O   . LEU B 2 408  ? -43.608 42.697  -9.346  1.00 90.90  ? 962  LEU C O   1 
ATOM   10352 C  CB  . LEU B 2 408  ? -42.916 45.591  -10.175 1.00 67.07  ? 962  LEU C CB  1 
ATOM   10353 C  CG  . LEU B 2 408  ? -41.978 46.795  -10.237 1.00 48.37  ? 962  LEU C CG  1 
ATOM   10354 C  CD1 . LEU B 2 408  ? -41.776 47.237  -11.675 1.00 52.60  ? 962  LEU C CD1 1 
ATOM   10355 C  CD2 . LEU B 2 408  ? -42.527 47.933  -9.399  1.00 51.61  ? 962  LEU C CD2 1 
ATOM   10356 N  N   . SER B 2 409  ? -45.275 43.927  -8.466  1.00 92.02  ? 963  SER C N   1 
ATOM   10357 C  CA  . SER B 2 409  ? -46.243 42.839  -8.507  1.00 96.96  ? 963  SER C CA  1 
ATOM   10358 C  C   . SER B 2 409  ? -47.479 43.238  -9.304  1.00 88.13  ? 963  SER C C   1 
ATOM   10359 O  O   . SER B 2 409  ? -48.419 43.810  -8.752  1.00 106.40 ? 963  SER C O   1 
ATOM   10360 C  CB  . SER B 2 409  ? -46.639 42.416  -7.091  1.00 79.70  ? 963  SER C CB  1 
ATOM   10361 O  OG  . SER B 2 409  ? -47.234 43.489  -6.384  1.00 110.45 ? 963  SER C OG  1 
ATOM   10362 N  N   . PRO B 2 410  ? -47.480 42.934  -10.613 1.00 94.33  ? 964  PRO C N   1 
ATOM   10363 C  CA  . PRO B 2 410  ? -48.613 43.237  -11.496 1.00 87.63  ? 964  PRO C CA  1 
ATOM   10364 C  C   . PRO B 2 410  ? -49.842 42.419  -11.114 1.00 93.31  ? 964  PRO C C   1 
ATOM   10365 O  O   . PRO B 2 410  ? -50.211 41.457  -11.787 1.00 94.01  ? 964  PRO C O   1 
ATOM   10366 C  CB  . PRO B 2 410  ? -48.093 42.854  -12.886 1.00 75.83  ? 964  PRO C CB  1 
ATOM   10367 C  CG  . PRO B 2 410  ? -46.987 41.890  -12.630 1.00 86.15  ? 964  PRO C CG  1 
ATOM   10368 C  CD  . PRO B 2 410  ? -46.357 42.324  -11.343 1.00 94.92  ? 964  PRO C CD  1 
ATOM   10369 N  N   . ALA B 2 411  ? -50.465 42.837  -10.018 1.00 102.91 ? 965  ALA C N   1 
ATOM   10370 C  CA  . ALA B 2 411  ? -51.581 42.143  -9.385  1.00 88.32  ? 965  ALA C CA  1 
ATOM   10371 C  C   . ALA B 2 411  ? -52.913 42.453  -10.059 1.00 75.88  ? 965  ALA C C   1 
ATOM   10372 O  O   . ALA B 2 411  ? -52.958 42.936  -11.192 1.00 80.83  ? 965  ALA C O   1 
ATOM   10373 C  CB  . ALA B 2 411  ? -51.645 42.493  -7.906  1.00 74.00  ? 965  ALA C CB  1 
ATOM   10374 N  N   . THR B 2 412  ? -53.997 42.151  -9.351  1.00 101.40 ? 966  THR C N   1 
ATOM   10375 C  CA  . THR B 2 412  ? -55.344 42.271  -9.889  1.00 115.36 ? 966  THR C CA  1 
ATOM   10376 C  C   . THR B 2 412  ? -55.721 43.734  -10.110 1.00 106.01 ? 966  THR C C   1 
ATOM   10377 O  O   . THR B 2 412  ? -55.931 44.159  -11.247 1.00 94.93  ? 966  THR C O   1 
ATOM   10378 C  CB  . THR B 2 412  ? -56.381 41.627  -8.943  1.00 101.19 ? 966  THR C CB  1 
ATOM   10379 O  OG1 . THR B 2 412  ? -56.045 40.251  -8.721  1.00 87.31  ? 966  THR C OG1 1 
ATOM   10380 C  CG2 . THR B 2 412  ? -57.780 41.720  -9.534  1.00 101.46 ? 966  THR C CG2 1 
ATOM   10381 N  N   . SER B 2 413  ? -55.810 44.501  -9.029  1.00 76.07  ? 967  SER C N   1 
ATOM   10382 C  CA  . SER B 2 413  ? -56.159 45.913  -9.133  1.00 84.67  ? 967  SER C CA  1 
ATOM   10383 C  C   . SER B 2 413  ? -54.974 46.762  -9.586  1.00 87.65  ? 967  SER C C   1 
ATOM   10384 O  O   . SER B 2 413  ? -55.150 47.896  -10.030 1.00 96.49  ? 967  SER C O   1 
ATOM   10385 C  CB  . SER B 2 413  ? -56.682 46.435  -7.794  1.00 95.09  ? 967  SER C CB  1 
ATOM   10386 O  OG  . SER B 2 413  ? -55.650 46.473  -6.824  1.00 101.30 ? 967  SER C OG  1 
ATOM   10387 N  N   . ARG B 2 414  ? -53.770 46.211  -9.473  1.00 79.55  ? 968  ARG C N   1 
ATOM   10388 C  CA  . ARG B 2 414  ? -52.564 46.957  -9.807  1.00 84.91  ? 968  ARG C CA  1 
ATOM   10389 C  C   . ARG B 2 414  ? -52.272 46.900  -11.301 1.00 69.48  ? 968  ARG C C   1 
ATOM   10390 O  O   . ARG B 2 414  ? -52.024 45.831  -11.862 1.00 78.99  ? 968  ARG C O   1 
ATOM   10391 C  CB  . ARG B 2 414  ? -51.370 46.430  -9.010  1.00 88.38  ? 968  ARG C CB  1 
ATOM   10392 C  CG  . ARG B 2 414  ? -51.720 46.058  -7.580  1.00 97.09  ? 968  ARG C CG  1 
ATOM   10393 C  CD  . ARG B 2 414  ? -50.486 45.953  -6.702  1.00 84.27  ? 968  ARG C CD  1 
ATOM   10394 N  NE  . ARG B 2 414  ? -50.052 47.263  -6.228  1.00 108.25 ? 968  ARG C NE  1 
ATOM   10395 C  CZ  . ARG B 2 414  ? -50.587 47.893  -5.187  1.00 104.04 ? 968  ARG C CZ  1 
ATOM   10396 N  NH1 . ARG B 2 414  ? -51.582 47.332  -4.511  1.00 86.17  ? 968  ARG C NH1 1 
ATOM   10397 N  NH2 . ARG B 2 414  ? -50.132 49.083  -4.821  1.00 88.62  ? 968  ARG C NH2 1 
ATOM   10398 N  N   . THR B 2 415  ? -52.311 48.066  -11.935 1.00 59.75  ? 969  THR C N   1 
ATOM   10399 C  CA  . THR B 2 415  ? -52.052 48.177  -13.363 1.00 57.24  ? 969  THR C CA  1 
ATOM   10400 C  C   . THR B 2 415  ? -50.838 49.054  -13.634 1.00 63.93  ? 969  THR C C   1 
ATOM   10401 O  O   . THR B 2 415  ? -50.782 50.201  -13.199 1.00 69.82  ? 969  THR C O   1 
ATOM   10402 C  CB  . THR B 2 415  ? -53.270 48.750  -14.111 1.00 53.84  ? 969  THR C CB  1 
ATOM   10403 O  OG1 . THR B 2 415  ? -54.338 47.796  -14.086 1.00 81.80  ? 969  THR C OG1 1 
ATOM   10404 C  CG2 . THR B 2 415  ? -52.915 49.061  -15.556 1.00 54.39  ? 969  THR C CG2 1 
ATOM   10405 N  N   . PHE B 2 416  ? -49.867 48.500  -14.351 1.00 57.74  ? 970  PHE C N   1 
ATOM   10406 C  CA  . PHE B 2 416  ? -48.676 49.242  -14.742 1.00 49.67  ? 970  PHE C CA  1 
ATOM   10407 C  C   . PHE B 2 416  ? -48.817 49.792  -16.153 1.00 48.32  ? 970  PHE C C   1 
ATOM   10408 O  O   . PHE B 2 416  ? -49.052 49.049  -17.103 1.00 61.81  ? 970  PHE C O   1 
ATOM   10409 C  CB  . PHE B 2 416  ? -47.435 48.355  -14.641 1.00 52.08  ? 970  PHE C CB  1 
ATOM   10410 C  CG  . PHE B 2 416  ? -47.047 48.027  -13.231 1.00 47.63  ? 970  PHE C CG  1 
ATOM   10411 C  CD1 . PHE B 2 416  ? -46.258 48.898  -12.498 1.00 56.69  ? 970  PHE C CD1 1 
ATOM   10412 C  CD2 . PHE B 2 416  ? -47.476 46.856  -12.634 1.00 52.85  ? 970  PHE C CD2 1 
ATOM   10413 C  CE1 . PHE B 2 416  ? -45.902 48.603  -11.195 1.00 52.61  ? 970  PHE C CE1 1 
ATOM   10414 C  CE2 . PHE B 2 416  ? -47.121 46.556  -11.331 1.00 77.15  ? 970  PHE C CE2 1 
ATOM   10415 C  CZ  . PHE B 2 416  ? -46.333 47.431  -10.611 1.00 60.40  ? 970  PHE C CZ  1 
ATOM   10416 N  N   . ARG B 2 417  ? -48.672 51.104  -16.281 1.00 52.31  ? 971  ARG C N   1 
ATOM   10417 C  CA  . ARG B 2 417  ? -48.820 51.758  -17.570 1.00 45.46  ? 971  ARG C CA  1 
ATOM   10418 C  C   . ARG B 2 417  ? -47.484 52.323  -18.031 1.00 49.34  ? 971  ARG C C   1 
ATOM   10419 O  O   . ARG B 2 417  ? -46.678 52.763  -17.224 1.00 57.18  ? 971  ARG C O   1 
ATOM   10420 C  CB  . ARG B 2 417  ? -49.873 52.866  -17.484 1.00 48.44  ? 971  ARG C CB  1 
ATOM   10421 C  CG  . ARG B 2 417  ? -50.443 53.289  -18.825 1.00 67.20  ? 971  ARG C CG  1 
ATOM   10422 C  CD  . ARG B 2 417  ? -51.600 54.265  -18.653 1.00 61.66  ? 971  ARG C CD  1 
ATOM   10423 N  NE  . ARG B 2 417  ? -51.145 55.617  -18.344 1.00 57.67  ? 971  ARG C NE  1 
ATOM   10424 C  CZ  . ARG B 2 417  ? -51.901 56.549  -17.773 1.00 65.43  ? 971  A