data_4YQW
# 
_entry.id   4YQW 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YQW         
WWPDB D_1000207842 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 4YR0 PDB . 
unspecified 4YR3 PDB . 
unspecified 4YR2 PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YQW 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-13 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Su, Y.'           1 
'Patra, A.'        2 
'Harp, J.M.'       3 
'Egli, M.'         4 
'Guengerich, F.P.' 5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                15921 
_citation.page_last                 15933 
_citation.title                     
;Roles of Residues Arg-61 and Gln-38 of Human DNA Polymerase eta in Bypass of Deoxyguanosine and 7,8-Dihydro-8-oxo-2'-deoxyguanosine.
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M115.653691 
_citation.pdbx_database_id_PubMed   25947374 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Su, Y.'           1 ? 
primary 'Patra, A.'        2 ? 
primary 'Harp, J.M.'       3 ? 
primary 'Egli, M.'         4 ? 
primary 'Guengerich, F.P.' 5 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4YQW 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     99.238 
_cell.length_a_esd                 ? 
_cell.length_b                     99.238 
_cell.length_b_esd                 ? 
_cell.length_c                     82.378 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4YQW 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                              48474.539 1   2.7.7.7 'Q38A, R61A' ? ? 
2 polymer     syn 
;DNA (5'-D(*AP*TP*GP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3662.404  1   ?       ?            ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*T)-3')
;
2426.617  1   ?       ?            ? ? 
4 non-polymer syn "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"                467.157   1   ?       ?            ? ? 
5 non-polymer syn 'CALCIUM ION'                                     40.078    2   ?       ?            ? ? 
6 non-polymer syn GLYCEROL                                          92.094    2   ?       ?            ? ? 
7 water       nat water                                             18.015    297 ?       ?            ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVAYKSWKGGGIIAVSYEARAFGVTASMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVAYKSWKGGGIIAVSYEARAFGVTASMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DG)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATGATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)' AGCGTCAT P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  ALA n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ALA n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     866768 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'synthetic construct' ? 32630 ? 
3 1 sample 1 8  'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 4YQW       4YQW   ? 2 ? 1 
3 PDB 4YQW       4YQW   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YQW A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 4YQW T 1 ? 12  ? 4YQW   1 ? 12  ? 1 12  
3 3 4YQW P 1 ? 8   ? 4YQW   1 ? 8   ? 1 8   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4YQW GLY A 1  ? UNP Q9Y253 ?   ?  'expression tag'      -2 1 
1 4YQW PRO A 2  ? UNP Q9Y253 ?   ?  'expression tag'      -1 2 
1 4YQW HIS A 3  ? UNP Q9Y253 ?   ?  'expression tag'      0  3 
1 4YQW ALA A 41 ? UNP Q9Y253 GLN 38 'engineered mutation' 38 4 
1 4YQW ALA A 64 ? UNP Q9Y253 ARG 61 'engineered mutation' 61 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'       133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'             40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'   307.197 
DCP non-polymer         . "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE"   ?                               'C9 H16 N3 O13 P3' 467.157 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YQW 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.15 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         42.69 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'NaMES (pH 6.0), polyethylene glycol monomethyl ether 2000, and calcium chloride' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-06-21 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97856 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-G' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97856 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-G 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4YQW 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.06 
_reflns.d_resolution_low                 50.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       28389 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.5 
_reflns.pdbx_Rmerge_I_obs                0.149 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.Rmerge_I_obs                0.964 
_reflns_shell.d_res_high                  2.06 
_reflns_shell.d_res_low                   2.1 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_sigI_obs         1.29 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_diffrn_id              ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_redundancy             3.9 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.percent_possible_all        85.6 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.percent_possible_obs        ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4YQW 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.064 
_refine.ls_d_res_low                             42.971 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     28355 
_refine.ls_number_reflns_R_free                  1461 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.77 
_refine.ls_percent_reflns_R_free                 5.15 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1770 
_refine.ls_R_factor_R_free                       0.2270 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1742 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 4O3N' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.45 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.24 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3249 
_refine_hist.pdbx_number_atoms_nucleic_acid   373 
_refine_hist.pdbx_number_atoms_ligand         42 
_refine_hist.number_atoms_solvent             297 
_refine_hist.number_atoms_total               3961 
_refine_hist.d_res_high                       2.064 
_refine_hist.d_res_low                        42.971 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  ? 3865 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.108  ? 5325 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.910 ? 1465 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.045  ? 601  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 609  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.0639 2.1377  . . 153 2617 98.00  . . . 0.3282 . 0.2525 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1377 2.2232  . . 153 2688 100.00 . . . 0.2878 . 0.2113 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2232 2.3244  . . 143 2674 100.00 . . . 0.2453 . 0.1890 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3244 2.4470  . . 131 2692 100.00 . . . 0.2949 . 0.1831 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4470 2.6003  . . 144 2697 100.00 . . . 0.2738 . 0.1900 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6003 2.8010  . . 137 2696 100.00 . . . 0.2629 . 0.1808 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8010 3.0828  . . 160 2682 100.00 . . . 0.2494 . 0.1828 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0828 3.5287  . . 134 2709 100.00 . . . 0.2115 . 0.1625 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5287 4.4451  . . 149 2701 100.00 . . . 0.1792 . 0.1413 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4451 42.9806 . . 157 2738 100.00 . . . 0.1918 . 0.1708 . . . . . . . . . . 
# 
_struct.entry_id                     4YQW 
_struct.title                        'Mutant Human DNA Polymerase Eta Q38A/R61A Inserting dCTP Opposite Template G' 
_struct.pdbx_descriptor              'Mutant Human DNA Polymerase Eta Q38A/R61A/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YQW 
_struct_keywords.text            'dCTP Template G, Transferase-DNA Complex' 
_struct_keywords.pdbx_keywords   Transferase/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 7 ? 
J N N 7 ? 
K N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? ALA A 110 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  AA6 LEU A 124 ? LYS A 134 ? LEU A 121 LYS A 131 1 ? 11 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 AB2 SER A 242 ? GLY A 244 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P12 AB3 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 AB4 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 AB5 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 AB6 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 AB7 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 AB8 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 AB9 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 AC1 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 AC2 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 AC3 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 E CA  . CA ? ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.501 ? 
metalc2  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 F CA  . CA ? ? A ASP 13  A CA  503 1_555 ? ? ? ? ? ? ?            2.321 ? 
metalc3  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 E CA  . CA ? ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.457 ? 
metalc4  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA ? ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc5  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 F CA  . CA ? ? A ASP 115 A CA  503 1_555 ? ? ? ? ? ? ?            2.356 ? 
metalc6  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E CA  . CA ? ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.382 ? 
metalc7  metalc ? ? A GLU 119 OE2   ? ? ? 1_555 F CA  . CA ? ? A GLU 116 A CA  503 1_555 ? ? ? ? ? ? ?            2.237 ? 
metalc8  metalc ? ? C DT  8   "O3'" ? ? ? 1_555 F CA  . CA ? ? P DT  8   A CA  503 1_555 ? ? ? ? ? ? ?            2.408 ? 
metalc9  metalc ? ? D DCP .   O1A   ? ? ? 1_555 F CA  . CA ? ? A DCP 501 A CA  503 1_555 ? ? ? ? ? ? ?            2.497 ? 
metalc10 metalc ? ? D DCP .   O1A   ? ? ? 1_555 E CA  . CA ? ? A DCP 501 A CA  502 1_555 ? ? ? ? ? ? ?            2.219 ? 
metalc11 metalc ? ? D DCP .   O1B   ? ? ? 1_555 E CA  . CA ? ? A DCP 501 A CA  502 1_555 ? ? ? ? ? ? ?            2.276 ? 
metalc12 metalc ? ? D DCP .   O1G   ? ? ? 1_555 E CA  . CA ? ? A DCP 501 A CA  502 1_555 ? ? ? ? ? ? ?            2.233 ? 
metalc13 metalc ? ? F CA  .   CA    ? ? ? 1_555 I HOH . O  ? ? A CA  503 A HOH 858 1_555 ? ? ? ? ? ? ?            2.456 ? 
hydrog1  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3 ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4 ? ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6 ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4 ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4 ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2 ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4 ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2 ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6 ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 2.71  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -1.98 
3 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -3.30 
4 ALA 434 A . ? ALA 431 A SER 435 A ? SER 432 A 1 -0.35 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? ALA A 41  ? CYS A 34  ALA A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? SER A 433 ? GLU A 414 SER A 430 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? SER A 433 ? GLU A 414 SER A 430 
AA5 3 VAL A 365 ? VAL A 375 ? VAL A 362 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 113 ? N GLU A 110 O TYR A 121 ? O TYR A 118 
AA1 2 3 O ALA A 120 ? O ALA A 117 N VAL A 15  ? N VAL A 12  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N ILE A 322 ? N ILE A 319 O ALA A 429 ? O ALA A 426 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A DCP 501 ? 25 'binding site for residue DCP A 501' 
AC2 Software A CA  502 ? 5  'binding site for residue CA A 502'  
AC3 Software A CA  503 ? 7  'binding site for residue CA A 503'  
AC4 Software A GOL 504 ? 8  'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 7  'binding site for residue GOL A 505' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 25 ASP A 16  ? ASP A 13  . ? 1_555 ? 
2  AC1 25 MET A 17  ? MET A 14  . ? 1_555 ? 
3  AC1 25 ASP A 18  ? ASP A 15  . ? 1_555 ? 
4  AC1 25 CYS A 19  ? CYS A 16  . ? 1_555 ? 
5  AC1 25 PHE A 20  ? PHE A 17  . ? 1_555 ? 
6  AC1 25 PHE A 21  ? PHE A 18  . ? 1_555 ? 
7  AC1 25 ILE A 51  ? ILE A 48  . ? 1_555 ? 
8  AC1 25 ALA A 52  ? ALA A 49  . ? 1_555 ? 
9  AC1 25 TYR A 55  ? TYR A 52  . ? 1_555 ? 
10 AC1 25 ARG A 58  ? ARG A 55  . ? 1_555 ? 
11 AC1 25 ASP A 118 ? ASP A 115 . ? 1_555 ? 
12 AC1 25 LYS A 234 ? LYS A 231 . ? 1_555 ? 
13 AC1 25 CA  E .   ? CA  A 502 . ? 1_555 ? 
14 AC1 25 CA  F .   ? CA  A 503 . ? 1_555 ? 
15 AC1 25 HOH I .   ? HOH A 746 . ? 1_555 ? 
16 AC1 25 HOH I .   ? HOH A 752 . ? 1_555 ? 
17 AC1 25 HOH I .   ? HOH A 753 . ? 1_555 ? 
18 AC1 25 HOH I .   ? HOH A 796 . ? 1_555 ? 
19 AC1 25 HOH I .   ? HOH A 797 . ? 1_555 ? 
20 AC1 25 HOH I .   ? HOH A 801 . ? 1_555 ? 
21 AC1 25 HOH I .   ? HOH A 858 . ? 1_555 ? 
22 AC1 25 DT  C 8   ? DT  P 8   . ? 1_555 ? 
23 AC1 25 DT  B 3   ? DT  T 3   . ? 1_555 ? 
24 AC1 25 DG  B 4   ? DG  T 4   . ? 1_555 ? 
25 AC1 25 DA  B 5   ? DA  T 5   . ? 1_555 ? 
26 AC2 5  ASP A 16  ? ASP A 13  . ? 1_555 ? 
27 AC2 5  MET A 17  ? MET A 14  . ? 1_555 ? 
28 AC2 5  ASP A 118 ? ASP A 115 . ? 1_555 ? 
29 AC2 5  DCP D .   ? DCP A 501 . ? 1_555 ? 
30 AC2 5  CA  F .   ? CA  A 503 . ? 1_555 ? 
31 AC3 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
32 AC3 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
33 AC3 7  GLU A 119 ? GLU A 116 . ? 1_555 ? 
34 AC3 7  DCP D .   ? DCP A 501 . ? 1_555 ? 
35 AC3 7  CA  E .   ? CA  A 502 . ? 1_555 ? 
36 AC3 7  HOH I .   ? HOH A 858 . ? 1_555 ? 
37 AC3 7  DT  C 8   ? DT  P 8   . ? 1_555 ? 
38 AC4 8  PRO A 247 ? PRO A 244 . ? 1_555 ? 
39 AC4 8  SER A 251 ? SER A 248 . ? 1_555 ? 
40 AC4 8  GLY A 279 ? GLY A 276 . ? 1_555 ? 
41 AC4 8  GLU A 280 ? GLU A 277 . ? 1_555 ? 
42 AC4 8  HOH I .   ? HOH A 612 . ? 1_555 ? 
43 AC4 8  HOH I .   ? HOH A 627 . ? 1_555 ? 
44 AC4 8  HOH I .   ? HOH A 637 . ? 1_555 ? 
45 AC4 8  HOH I .   ? HOH A 652 . ? 1_555 ? 
46 AC5 7  GLU A 97  ? GLU A 94  . ? 1_555 ? 
47 AC5 7  ALA A 98  ? ALA A 95  . ? 1_555 ? 
48 AC5 7  GLU A 101 ? GLU A 98  . ? 1_555 ? 
49 AC5 7  HOH I .   ? HOH A 633 . ? 1_555 ? 
50 AC5 7  HOH I .   ? HOH A 642 . ? 1_555 ? 
51 AC5 7  HOH I .   ? HOH A 666 . ? 1_555 ? 
52 AC5 7  HOH I .   ? HOH A 756 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YQW 
_atom_sites.fract_transf_matrix[1][1]   0.010077 
_atom_sites.fract_transf_matrix[1][2]   0.005818 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011636 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012139 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    C  CA    . GLY A 1 1   ? 167.218 138.357 -12.592 1.00 59.05 ? -2  GLY A CA    1 
ATOM   2    C  C     . GLY A 1 1   ? 167.414 139.063 -13.922 1.00 60.06 ? -2  GLY A C     1 
ATOM   3    O  O     . GLY A 1 1   ? 167.112 140.254 -14.038 1.00 55.29 ? -2  GLY A O     1 
ATOM   4    N  N     . PRO A 1 2   ? 167.915 138.329 -14.936 1.00 53.20 ? -1  PRO A N     1 
ATOM   5    C  CA    . PRO A 1 2   ? 168.249 138.882 -16.260 1.00 55.87 ? -1  PRO A CA    1 
ATOM   6    C  C     . PRO A 1 2   ? 167.043 139.343 -17.085 1.00 55.13 ? -1  PRO A C     1 
ATOM   7    O  O     . PRO A 1 2   ? 167.211 140.100 -18.045 1.00 55.52 ? -1  PRO A O     1 
ATOM   8    C  CB    . PRO A 1 2   ? 168.958 137.715 -16.961 1.00 41.13 ? -1  PRO A CB    1 
ATOM   9    C  CG    . PRO A 1 2   ? 168.481 136.485 -16.249 1.00 44.74 ? -1  PRO A CG    1 
ATOM   10   C  CD    . PRO A 1 2   ? 168.266 136.901 -14.827 1.00 53.74 ? -1  PRO A CD    1 
ATOM   11   N  N     . HIS A 1 3   ? 165.847 138.898 -16.718 1.00 55.44 ? 0   HIS A N     1 
ATOM   12   C  CA    . HIS A 1 3   ? 164.650 139.235 -17.486 1.00 50.62 ? 0   HIS A CA    1 
ATOM   13   C  C     . HIS A 1 3   ? 163.662 140.090 -16.701 1.00 52.78 ? 0   HIS A C     1 
ATOM   14   O  O     . HIS A 1 3   ? 162.581 140.399 -17.192 1.00 49.65 ? 0   HIS A O     1 
ATOM   15   C  CB    . HIS A 1 3   ? 163.959 137.955 -17.971 1.00 46.39 ? 0   HIS A CB    1 
ATOM   16   C  CG    . HIS A 1 3   ? 164.834 137.094 -18.826 1.00 37.64 ? 0   HIS A CG    1 
ATOM   17   N  ND1   . HIS A 1 3   ? 165.381 137.539 -20.010 1.00 31.83 ? 0   HIS A ND1   1 
ATOM   18   C  CD2   . HIS A 1 3   ? 165.262 135.818 -18.668 1.00 36.40 ? 0   HIS A CD2   1 
ATOM   19   C  CE1   . HIS A 1 3   ? 166.105 136.572 -20.548 1.00 37.68 ? 0   HIS A CE1   1 
ATOM   20   N  NE2   . HIS A 1 3   ? 166.051 135.518 -19.754 1.00 37.01 ? 0   HIS A NE2   1 
ATOM   21   N  N     . MET A 1 4   ? 164.037 140.470 -15.483 1.00 52.67 ? 1   MET A N     1 
ATOM   22   C  CA    . MET A 1 4   ? 163.166 141.274 -14.633 1.00 56.48 ? 1   MET A CA    1 
ATOM   23   C  C     . MET A 1 4   ? 163.464 142.765 -14.785 1.00 50.95 ? 1   MET A C     1 
ATOM   24   O  O     . MET A 1 4   ? 164.564 143.224 -14.465 1.00 52.75 ? 1   MET A O     1 
ATOM   25   C  CB    . MET A 1 4   ? 163.311 140.849 -13.171 1.00 56.41 ? 1   MET A CB    1 
ATOM   26   N  N     . ALA A 1 5   ? 162.478 143.516 -15.277 1.00 52.02 ? 2   ALA A N     1 
ATOM   27   C  CA    . ALA A 1 5   ? 162.632 144.957 -15.493 1.00 49.78 ? 2   ALA A CA    1 
ATOM   28   C  C     . ALA A 1 5   ? 162.677 145.726 -14.170 1.00 40.62 ? 2   ALA A C     1 
ATOM   29   O  O     . ALA A 1 5   ? 162.027 145.347 -13.197 1.00 45.14 ? 2   ALA A O     1 
ATOM   30   C  CB    . ALA A 1 5   ? 161.515 145.480 -16.373 1.00 46.70 ? 2   ALA A CB    1 
ATOM   31   N  N     . THR A 1 6   ? 163.458 146.802 -14.138 1.00 32.26 ? 3   THR A N     1 
ATOM   32   C  CA    . THR A 1 6   ? 163.735 147.504 -12.885 1.00 31.08 ? 3   THR A CA    1 
ATOM   33   C  C     . THR A 1 6   ? 163.314 148.979 -12.886 1.00 24.99 ? 3   THR A C     1 
ATOM   34   O  O     . THR A 1 6   ? 163.596 149.706 -11.935 1.00 32.61 ? 3   THR A O     1 
ATOM   35   C  CB    . THR A 1 6   ? 165.228 147.427 -12.544 1.00 34.18 ? 3   THR A CB    1 
ATOM   36   O  OG1   . THR A 1 6   ? 165.985 148.082 -13.567 1.00 32.15 ? 3   THR A OG1   1 
ATOM   37   C  CG2   . THR A 1 6   ? 165.684 145.963 -12.436 1.00 29.85 ? 3   THR A CG2   1 
ATOM   38   N  N     . GLY A 1 7   ? 162.643 149.415 -13.951 1.00 29.37 ? 4   GLY A N     1 
ATOM   39   C  CA    . GLY A 1 7   ? 162.106 150.768 -14.017 1.00 25.97 ? 4   GLY A CA    1 
ATOM   40   C  C     . GLY A 1 7   ? 163.185 151.831 -13.940 1.00 25.06 ? 4   GLY A C     1 
ATOM   41   O  O     . GLY A 1 7   ? 163.036 152.825 -13.235 1.00 25.97 ? 4   GLY A O     1 
ATOM   42   N  N     . GLN A 1 8   ? 164.277 151.609 -14.670 1.00 25.01 ? 5   GLN A N     1 
ATOM   43   C  CA    . GLN A 1 8   ? 165.434 152.505 -14.659 1.00 26.36 ? 5   GLN A CA    1 
ATOM   44   C  C     . GLN A 1 8   ? 165.732 153.080 -16.047 1.00 21.40 ? 5   GLN A C     1 
ATOM   45   O  O     . GLN A 1 8   ? 166.828 153.590 -16.316 1.00 23.93 ? 5   GLN A O     1 
ATOM   46   C  CB    . GLN A 1 8   ? 166.645 151.755 -14.125 1.00 24.16 ? 5   GLN A CB    1 
ATOM   47   C  CG    . GLN A 1 8   ? 166.533 151.426 -12.644 1.00 26.23 ? 5   GLN A CG    1 
ATOM   48   C  CD    . GLN A 1 8   ? 167.772 150.729 -12.147 1.00 30.46 ? 5   GLN A CD    1 
ATOM   49   O  OE1   . GLN A 1 8   ? 168.018 149.576 -12.489 1.00 32.64 ? 5   GLN A OE1   1 
ATOM   50   N  NE2   . GLN A 1 8   ? 168.575 151.431 -11.361 1.00 23.53 ? 5   GLN A NE2   1 
ATOM   51   N  N     . ASP A 1 9   ? 164.724 153.011 -16.910 1.00 29.74 ? 6   ASP A N     1 
ATOM   52   C  CA    . ASP A 1 9   ? 164.828 153.378 -18.323 1.00 31.88 ? 6   ASP A CA    1 
ATOM   53   C  C     . ASP A 1 9   ? 164.746 154.889 -18.609 1.00 30.36 ? 6   ASP A C     1 
ATOM   54   O  O     . ASP A 1 9   ? 165.132 155.337 -19.682 1.00 29.33 ? 6   ASP A O     1 
ATOM   55   C  CB    . ASP A 1 9   ? 163.726 152.655 -19.106 1.00 22.44 ? 6   ASP A CB    1 
ATOM   56   C  CG    . ASP A 1 9   ? 162.325 152.896 -18.516 1.00 28.26 ? 6   ASP A CG    1 
ATOM   57   O  OD1   . ASP A 1 9   ? 162.024 152.372 -17.419 1.00 30.84 ? 6   ASP A OD1   1 
ATOM   58   O  OD2   . ASP A 1 9   ? 161.514 153.604 -19.153 1.00 35.71 ? 6   ASP A OD2   1 
ATOM   59   N  N     . ARG A 1 10  ? 164.231 155.668 -17.663 1.00 25.54 ? 7   ARG A N     1 
ATOM   60   C  CA    . ARG A 1 10  ? 164.081 157.104 -17.879 1.00 20.99 ? 7   ARG A CA    1 
ATOM   61   C  C     . ARG A 1 10  ? 164.721 157.936 -16.778 1.00 24.78 ? 7   ARG A C     1 
ATOM   62   O  O     . ARG A 1 10  ? 164.995 157.447 -15.682 1.00 21.21 ? 7   ARG A O     1 
ATOM   63   C  CB    . ARG A 1 10  ? 162.595 157.486 -17.981 1.00 19.32 ? 7   ARG A CB    1 
ATOM   64   C  CG    . ARG A 1 10  ? 161.828 156.865 -19.147 1.00 23.63 ? 7   ARG A CG    1 
ATOM   65   C  CD    . ARG A 1 10  ? 160.354 157.240 -19.026 1.00 23.51 ? 7   ARG A CD    1 
ATOM   66   N  NE    . ARG A 1 10  ? 159.722 156.575 -17.881 1.00 22.00 ? 7   ARG A NE    1 
ATOM   67   C  CZ    . ARG A 1 10  ? 158.572 156.942 -17.331 1.00 21.13 ? 7   ARG A CZ    1 
ATOM   68   N  NH1   . ARG A 1 10  ? 157.912 158.000 -17.794 1.00 22.03 ? 7   ARG A NH1   1 
ATOM   69   N  NH2   . ARG A 1 10  ? 158.077 156.246 -16.311 1.00 19.47 ? 7   ARG A NH2   1 
ATOM   70   N  N     . VAL A 1 11  ? 164.945 159.204 -17.087 1.00 19.80 ? 8   VAL A N     1 
ATOM   71   C  CA    . VAL A 1 11  ? 165.237 160.195 -16.077 1.00 14.71 ? 8   VAL A CA    1 
ATOM   72   C  C     . VAL A 1 11  ? 164.094 161.203 -16.105 1.00 26.08 ? 8   VAL A C     1 
ATOM   73   O  O     . VAL A 1 11  ? 163.855 161.859 -17.118 1.00 17.71 ? 8   VAL A O     1 
ATOM   74   C  CB    . VAL A 1 11  ? 166.581 160.893 -16.318 1.00 22.28 ? 8   VAL A CB    1 
ATOM   75   C  CG1   . VAL A 1 11  ? 166.784 161.999 -15.295 1.00 16.95 ? 8   VAL A CG1   1 
ATOM   76   C  CG2   . VAL A 1 11  ? 167.722 159.878 -16.260 1.00 24.26 ? 8   VAL A CG2   1 
ATOM   77   N  N     . VAL A 1 12  ? 163.372 161.305 -15.001 1.00 18.49 ? 9   VAL A N     1 
ATOM   78   C  CA    . VAL A 1 12  ? 162.202 162.176 -14.926 1.00 18.62 ? 9   VAL A CA    1 
ATOM   79   C  C     . VAL A 1 12  ? 162.355 163.140 -13.750 1.00 22.54 ? 9   VAL A C     1 
ATOM   80   O  O     . VAL A 1 12  ? 162.725 162.733 -12.658 1.00 18.54 ? 9   VAL A O     1 
ATOM   81   C  CB    . VAL A 1 12  ? 160.892 161.354 -14.764 1.00 19.67 ? 9   VAL A CB    1 
ATOM   82   C  CG1   . VAL A 1 12  ? 159.690 162.273 -14.529 1.00 24.06 ? 9   VAL A CG1   1 
ATOM   83   C  CG2   . VAL A 1 12  ? 160.648 160.459 -15.990 1.00 16.32 ? 9   VAL A CG2   1 
ATOM   84   N  N     . ALA A 1 13  ? 162.076 164.419 -13.975 1.00 19.83 ? 10  ALA A N     1 
ATOM   85   C  CA    . ALA A 1 13  ? 162.081 165.392 -12.895 1.00 18.89 ? 10  ALA A CA    1 
ATOM   86   C  C     . ALA A 1 13  ? 160.692 165.969 -12.736 1.00 20.20 ? 10  ALA A C     1 
ATOM   87   O  O     . ALA A 1 13  ? 159.937 166.073 -13.703 1.00 21.14 ? 10  ALA A O     1 
ATOM   88   C  CB    . ALA A 1 13  ? 163.090 166.505 -13.165 1.00 11.68 ? 10  ALA A CB    1 
ATOM   89   N  N     . LEU A 1 14  ? 160.364 166.336 -11.507 1.00 15.12 ? 11  LEU A N     1 
ATOM   90   C  CA    . LEU A 1 14  ? 159.189 167.126 -11.208 1.00 13.00 ? 11  LEU A CA    1 
ATOM   91   C  C     . LEU A 1 14  ? 159.672 168.410 -10.549 1.00 23.16 ? 11  LEU A C     1 
ATOM   92   O  O     . LEU A 1 14  ? 160.355 168.383 -9.508  1.00 21.18 ? 11  LEU A O     1 
ATOM   93   C  CB    . LEU A 1 14  ? 158.217 166.360 -10.312 1.00 13.51 ? 11  LEU A CB    1 
ATOM   94   C  CG    . LEU A 1 14  ? 156.838 166.939 -9.926  1.00 24.97 ? 11  LEU A CG    1 
ATOM   95   C  CD1   . LEU A 1 14  ? 156.867 167.699 -8.575  1.00 17.16 ? 11  LEU A CD1   1 
ATOM   96   C  CD2   . LEU A 1 14  ? 156.270 167.837 -11.028 1.00 19.02 ? 11  LEU A CD2   1 
ATOM   97   N  N     . VAL A 1 15  ? 159.359 169.532 -11.184 1.00 16.92 ? 12  VAL A N     1 
ATOM   98   C  CA    . VAL A 1 15  ? 159.696 170.837 -10.630 1.00 15.73 ? 12  VAL A CA    1 
ATOM   99   C  C     . VAL A 1 15  ? 158.447 171.489 -10.032 1.00 20.68 ? 12  VAL A C     1 
ATOM   100  O  O     . VAL A 1 15  ? 157.411 171.556 -10.684 1.00 15.79 ? 12  VAL A O     1 
ATOM   101  C  CB    . VAL A 1 15  ? 160.316 171.757 -11.705 1.00 14.97 ? 12  VAL A CB    1 
ATOM   102  C  CG1   . VAL A 1 15  ? 160.666 173.098 -11.112 1.00 16.92 ? 12  VAL A CG1   1 
ATOM   103  C  CG2   . VAL A 1 15  ? 161.564 171.095 -12.273 1.00 15.23 ? 12  VAL A CG2   1 
ATOM   104  N  N     . ASP A 1 16  ? 158.536 171.945 -8.782  1.00 16.49 ? 13  ASP A N     1 
ATOM   105  C  CA    . ASP A 1 16  ? 157.405 172.621 -8.152  1.00 18.24 ? 13  ASP A CA    1 
ATOM   106  C  C     . ASP A 1 16  ? 157.813 173.932 -7.465  1.00 16.36 ? 13  ASP A C     1 
ATOM   107  O  O     . ASP A 1 16  ? 158.730 173.954 -6.663  1.00 19.29 ? 13  ASP A O     1 
ATOM   108  C  CB    . ASP A 1 16  ? 156.742 171.685 -7.140  1.00 22.44 ? 13  ASP A CB    1 
ATOM   109  C  CG    . ASP A 1 16  ? 155.827 172.417 -6.187  1.00 19.44 ? 13  ASP A CG    1 
ATOM   110  O  OD1   . ASP A 1 16  ? 156.299 172.880 -5.130  1.00 30.99 ? 13  ASP A OD1   1 
ATOM   111  O  OD2   . ASP A 1 16  ? 154.634 172.537 -6.482  1.00 24.09 ? 13  ASP A OD2   1 
ATOM   112  N  N     . MET A 1 17  ? 157.106 175.020 -7.744  1.00 19.24 ? 14  MET A N     1 
ATOM   113  C  CA    A MET A 1 17  ? 157.453 176.321 -7.177  0.25 17.81 ? 14  MET A CA    1 
ATOM   114  C  CA    B MET A 1 17  ? 157.476 176.312 -7.180  0.75 17.88 ? 14  MET A CA    1 
ATOM   115  C  C     . MET A 1 17  ? 157.192 176.357 -5.669  1.00 14.41 ? 14  MET A C     1 
ATOM   116  O  O     . MET A 1 17  ? 156.199 175.822 -5.196  1.00 14.20 ? 14  MET A O     1 
ATOM   117  C  CB    A MET A 1 17  ? 156.662 177.439 -7.863  0.25 17.60 ? 14  MET A CB    1 
ATOM   118  C  CB    B MET A 1 17  ? 156.731 177.439 -7.900  0.75 17.72 ? 14  MET A CB    1 
ATOM   119  C  CG    A MET A 1 17  ? 156.765 177.457 -9.388  0.25 17.87 ? 14  MET A CG    1 
ATOM   120  C  CG    B MET A 1 17  ? 156.734 177.286 -9.431  0.75 17.80 ? 14  MET A CG    1 
ATOM   121  S  SD    A MET A 1 17  ? 158.437 177.774 -9.988  0.25 17.49 ? 14  MET A SD    1 
ATOM   122  S  SD    B MET A 1 17  ? 158.419 177.271 -10.090 0.75 19.60 ? 14  MET A SD    1 
ATOM   123  C  CE    A MET A 1 17  ? 158.833 176.178 -10.696 0.25 18.68 ? 14  MET A CE    1 
ATOM   124  C  CE    B MET A 1 17  ? 158.991 178.885 -9.585  0.75 14.95 ? 14  MET A CE    1 
ATOM   125  N  N     . ASP A 1 18  ? 158.082 176.996 -4.928  1.00 15.22 ? 15  ASP A N     1 
ATOM   126  C  CA    . ASP A 1 18  ? 157.893 177.173 -3.486  1.00 17.86 ? 15  ASP A CA    1 
ATOM   127  C  C     . ASP A 1 18  ? 156.824 178.233 -3.220  1.00 22.29 ? 15  ASP A C     1 
ATOM   128  O  O     . ASP A 1 18  ? 156.851 179.284 -3.857  1.00 17.61 ? 15  ASP A O     1 
ATOM   129  C  CB    . ASP A 1 18  ? 159.220 177.571 -2.818  1.00 14.86 ? 15  ASP A CB    1 
ATOM   130  C  CG    . ASP A 1 18  ? 160.297 176.508 -2.985  1.00 16.99 ? 15  ASP A CG    1 
ATOM   131  O  OD1   . ASP A 1 18  ? 159.952 175.315 -3.068  1.00 17.65 ? 15  ASP A OD1   1 
ATOM   132  O  OD2   . ASP A 1 18  ? 161.495 176.858 -3.015  1.00 20.94 ? 15  ASP A OD2   1 
ATOM   133  N  N     . CYS A 1 19  ? 155.914 177.949 -2.277  1.00 18.29 ? 16  CYS A N     1 
ATOM   134  C  CA    . CYS A 1 19  ? 154.781 178.814 -1.914  1.00 18.55 ? 16  CYS A CA    1 
ATOM   135  C  C     . CYS A 1 19  ? 154.394 179.797 -3.021  1.00 16.16 ? 16  CYS A C     1 
ATOM   136  O  O     . CYS A 1 19  ? 154.553 181.007 -2.874  1.00 13.52 ? 16  CYS A O     1 
ATOM   137  C  CB    . CYS A 1 19  ? 155.083 179.584 -0.614  1.00 18.53 ? 16  CYS A CB    1 
ATOM   138  S  SG    . CYS A 1 19  ? 156.652 180.497 -0.504  1.00 19.62 ? 16  CYS A SG    1 
ATOM   139  N  N     . PHE A 1 20  ? 153.892 179.260 -4.124  1.00 19.28 ? 17  PHE A N     1 
ATOM   140  C  CA    . PHE A 1 20  ? 153.905 179.987 -5.390  1.00 14.90 ? 17  PHE A CA    1 
ATOM   141  C  C     . PHE A 1 20  ? 153.161 181.329 -5.383  1.00 16.18 ? 17  PHE A C     1 
ATOM   142  O  O     . PHE A 1 20  ? 153.744 182.337 -5.780  1.00 16.35 ? 17  PHE A O     1 
ATOM   143  C  CB    . PHE A 1 20  ? 153.349 179.094 -6.490  1.00 13.61 ? 17  PHE A CB    1 
ATOM   144  C  CG    . PHE A 1 20  ? 153.408 179.714 -7.859  1.00 18.89 ? 17  PHE A CG    1 
ATOM   145  C  CD1   . PHE A 1 20  ? 154.606 180.228 -8.350  1.00 13.81 ? 17  PHE A CD1   1 
ATOM   146  C  CD2   . PHE A 1 20  ? 152.270 179.796 -8.650  1.00 17.16 ? 17  PHE A CD2   1 
ATOM   147  C  CE1   . PHE A 1 20  ? 154.669 180.816 -9.605  1.00 15.32 ? 17  PHE A CE1   1 
ATOM   148  C  CE2   . PHE A 1 20  ? 152.332 180.383 -9.925  1.00 16.13 ? 17  PHE A CE2   1 
ATOM   149  C  CZ    . PHE A 1 20  ? 153.540 180.886 -10.391 1.00 11.19 ? 17  PHE A CZ    1 
ATOM   150  N  N     . PHE A 1 21  ? 151.890 181.364 -4.964  1.00 16.36 ? 18  PHE A N     1 
ATOM   151  C  CA    . PHE A 1 21  ? 151.141 182.626 -5.068  1.00 13.79 ? 18  PHE A CA    1 
ATOM   152  C  C     . PHE A 1 21  ? 151.828 183.682 -4.195  1.00 19.19 ? 18  PHE A C     1 
ATOM   153  O  O     . PHE A 1 21  ? 151.848 184.861 -4.539  1.00 17.12 ? 18  PHE A O     1 
ATOM   154  C  CB    . PHE A 1 21  ? 149.673 182.492 -4.673  1.00 14.87 ? 18  PHE A CB    1 
ATOM   155  C  CG    . PHE A 1 21  ? 148.813 181.756 -5.678  1.00 22.01 ? 18  PHE A CG    1 
ATOM   156  C  CD1   . PHE A 1 21  ? 149.374 180.976 -6.688  1.00 14.84 ? 18  PHE A CD1   1 
ATOM   157  C  CD2   . PHE A 1 21  ? 147.429 181.820 -5.580  1.00 23.21 ? 18  PHE A CD2   1 
ATOM   158  C  CE1   . PHE A 1 21  ? 148.571 180.295 -7.588  1.00 22.39 ? 18  PHE A CE1   1 
ATOM   159  C  CE2   . PHE A 1 21  ? 146.617 181.145 -6.475  1.00 24.13 ? 18  PHE A CE2   1 
ATOM   160  C  CZ    . PHE A 1 21  ? 147.181 180.378 -7.481  1.00 22.50 ? 18  PHE A CZ    1 
ATOM   161  N  N     . VAL A 1 22  ? 152.440 183.240 -3.097  1.00 19.61 ? 19  VAL A N     1 
ATOM   162  C  CA    . VAL A 1 22  ? 153.145 184.152 -2.205  1.00 16.95 ? 19  VAL A CA    1 
ATOM   163  C  C     . VAL A 1 22  ? 154.395 184.759 -2.870  1.00 18.71 ? 19  VAL A C     1 
ATOM   164  O  O     . VAL A 1 22  ? 154.590 185.971 -2.831  1.00 16.11 ? 19  VAL A O     1 
ATOM   165  C  CB    . VAL A 1 22  ? 153.540 183.443 -0.897  1.00 17.63 ? 19  VAL A CB    1 
ATOM   166  C  CG1   . VAL A 1 22  ? 154.588 184.232 -0.191  1.00 10.01 ? 19  VAL A CG1   1 
ATOM   167  C  CG2   . VAL A 1 22  ? 152.303 183.246 0.018   1.00 16.66 ? 19  VAL A CG2   1 
ATOM   168  N  N     . GLN A 1 23  ? 155.241 183.927 -3.482  1.00 18.09 ? 20  GLN A N     1 
ATOM   169  C  CA    . GLN A 1 23  ? 156.362 184.458 -4.264  1.00 15.83 ? 20  GLN A CA    1 
ATOM   170  C  C     . GLN A 1 23  ? 155.933 185.468 -5.348  1.00 19.36 ? 20  GLN A C     1 
ATOM   171  O  O     . GLN A 1 23  ? 156.665 186.432 -5.619  1.00 18.41 ? 20  GLN A O     1 
ATOM   172  C  CB    . GLN A 1 23  ? 157.137 183.327 -4.925  1.00 22.88 ? 20  GLN A CB    1 
ATOM   173  C  CG    . GLN A 1 23  ? 158.119 182.626 -4.013  1.00 18.70 ? 20  GLN A CG    1 
ATOM   174  C  CD    . GLN A 1 23  ? 159.148 181.879 -4.809  1.00 19.57 ? 20  GLN A CD    1 
ATOM   175  O  OE1   . GLN A 1 23  ? 160.218 182.411 -5.108  1.00 23.88 ? 20  GLN A OE1   1 
ATOM   176  N  NE2   . GLN A 1 23  ? 158.827 180.648 -5.188  1.00 17.85 ? 20  GLN A NE2   1 
ATOM   177  N  N     . VAL A 1 24  ? 154.775 185.248 -5.972  1.00 16.29 ? 21  VAL A N     1 
ATOM   178  C  CA    . VAL A 1 24  ? 154.333 186.133 -7.073  1.00 20.91 ? 21  VAL A CA    1 
ATOM   179  C  C     . VAL A 1 24  ? 154.068 187.519 -6.467  1.00 24.98 ? 21  VAL A C     1 
ATOM   180  O  O     . VAL A 1 24  ? 154.546 188.560 -6.968  1.00 18.39 ? 21  VAL A O     1 
ATOM   181  C  CB    . VAL A 1 24  ? 153.080 185.580 -7.812  1.00 18.59 ? 21  VAL A CB    1 
ATOM   182  C  CG1   . VAL A 1 24  ? 152.506 186.586 -8.827  1.00 12.61 ? 21  VAL A CG1   1 
ATOM   183  C  CG2   . VAL A 1 24  ? 153.402 184.254 -8.521  1.00 15.99 ? 21  VAL A CG2   1 
ATOM   184  N  N     . GLU A 1 25  ? 153.370 187.511 -5.340  1.00 15.50 ? 22  GLU A N     1 
ATOM   185  C  CA    . GLU A 1 25  ? 153.072 188.739 -4.616  1.00 17.80 ? 22  GLU A CA    1 
ATOM   186  C  C     . GLU A 1 25  ? 154.320 189.390 -4.000  1.00 18.88 ? 22  GLU A C     1 
ATOM   187  O  O     . GLU A 1 25  ? 154.415 190.627 -3.966  1.00 14.54 ? 22  GLU A O     1 
ATOM   188  C  CB    . GLU A 1 25  ? 152.018 188.462 -3.521  1.00 15.48 ? 22  GLU A CB    1 
ATOM   189  C  CG    . GLU A 1 25  ? 150.666 187.992 -4.067  1.00 15.80 ? 22  GLU A CG    1 
ATOM   190  C  CD    . GLU A 1 25  ? 150.013 189.009 -5.012  1.00 25.21 ? 22  GLU A CD    1 
ATOM   191  O  OE1   . GLU A 1 25  ? 150.317 190.213 -4.902  1.00 26.17 ? 22  GLU A OE1   1 
ATOM   192  O  OE2   . GLU A 1 25  ? 149.197 188.609 -5.872  1.00 22.97 ? 22  GLU A OE2   1 
ATOM   193  N  N     . GLN A 1 26  ? 155.264 188.580 -3.507  1.00 16.73 ? 23  GLN A N     1 
ATOM   194  C  CA    . GLN A 1 26  ? 156.511 189.129 -2.933  1.00 19.71 ? 23  GLN A CA    1 
ATOM   195  C  C     . GLN A 1 26  ? 157.455 189.740 -3.986  1.00 18.23 ? 23  GLN A C     1 
ATOM   196  O  O     . GLN A 1 26  ? 158.171 190.706 -3.712  1.00 19.76 ? 23  GLN A O     1 
ATOM   197  C  CB    . GLN A 1 26  ? 157.276 188.060 -2.165  1.00 19.33 ? 23  GLN A CB    1 
ATOM   198  C  CG    . GLN A 1 26  ? 156.632 187.597 -0.858  1.00 19.96 ? 23  GLN A CG    1 
ATOM   199  C  CD    . GLN A 1 26  ? 157.409 186.446 -0.212  1.00 22.85 ? 23  GLN A CD    1 
ATOM   200  O  OE1   . GLN A 1 26  ? 157.816 185.503 -0.890  1.00 23.25 ? 23  GLN A OE1   1 
ATOM   201  N  NE2   . GLN A 1 26  ? 157.637 186.537 1.092   1.00 20.81 ? 23  GLN A NE2   1 
ATOM   202  N  N     . ARG A 1 27  ? 157.487 189.166 -5.179  1.00 15.48 ? 24  ARG A N     1 
ATOM   203  C  CA    . ARG A 1 27  ? 158.262 189.776 -6.260  1.00 18.40 ? 24  ARG A CA    1 
ATOM   204  C  C     . ARG A 1 27  ? 157.742 191.195 -6.542  1.00 18.96 ? 24  ARG A C     1 
ATOM   205  O  O     . ARG A 1 27  ? 158.515 192.157 -6.628  1.00 16.67 ? 24  ARG A O     1 
ATOM   206  C  CB    . ARG A 1 27  ? 158.198 188.940 -7.533  1.00 13.42 ? 24  ARG A CB    1 
ATOM   207  C  CG    . ARG A 1 27  ? 159.123 189.487 -8.629  1.00 17.24 ? 24  ARG A CG    1 
ATOM   208  C  CD    . ARG A 1 27  ? 159.129 188.602 -9.868  1.00 20.48 ? 24  ARG A CD    1 
ATOM   209  N  NE    . ARG A 1 27  ? 157.824 188.577 -10.512 1.00 16.84 ? 24  ARG A NE    1 
ATOM   210  C  CZ    . ARG A 1 27  ? 157.578 188.022 -11.689 1.00 20.12 ? 24  ARG A CZ    1 
ATOM   211  N  NH1   . ARG A 1 27  ? 158.560 187.411 -12.359 1.00 18.05 ? 24  ARG A NH1   1 
ATOM   212  N  NH2   . ARG A 1 27  ? 156.345 188.070 -12.185 1.00 14.04 ? 24  ARG A NH2   1 
ATOM   213  N  N     . GLN A 1 28  ? 156.425 191.302 -6.657  1.00 16.68 ? 25  GLN A N     1 
ATOM   214  C  CA    . GLN A 1 28  ? 155.751 192.570 -6.965  1.00 21.68 ? 25  GLN A CA    1 
ATOM   215  C  C     . GLN A 1 28  ? 155.796 193.619 -5.849  1.00 20.98 ? 25  GLN A C     1 
ATOM   216  O  O     . GLN A 1 28  ? 155.850 194.834 -6.117  1.00 14.36 ? 25  GLN A O     1 
ATOM   217  C  CB    . GLN A 1 28  ? 154.293 192.300 -7.314  1.00 20.03 ? 25  GLN A CB    1 
ATOM   218  C  CG    . GLN A 1 28  ? 153.520 193.531 -7.778  1.00 19.67 ? 25  GLN A CG    1 
ATOM   219  C  CD    . GLN A 1 28  ? 152.014 193.270 -7.822  1.00 33.68 ? 25  GLN A CD    1 
ATOM   220  O  OE1   . GLN A 1 28  ? 151.564 192.217 -8.284  1.00 28.85 ? 25  GLN A OE1   1 
ATOM   221  N  NE2   . GLN A 1 28  ? 151.233 194.223 -7.317  1.00 34.55 ? 25  GLN A NE2   1 
ATOM   222  N  N     . ASN A 1 29  ? 155.735 193.150 -4.605  1.00 15.16 ? 26  ASN A N     1 
ATOM   223  C  CA    . ASN A 1 29  ? 155.784 194.037 -3.445  1.00 21.10 ? 26  ASN A CA    1 
ATOM   224  C  C     . ASN A 1 29  ? 156.915 193.653 -2.501  1.00 19.01 ? 26  ASN A C     1 
ATOM   225  O  O     . ASN A 1 29  ? 156.734 192.819 -1.622  1.00 19.02 ? 26  ASN A O     1 
ATOM   226  C  CB    . ASN A 1 29  ? 154.454 194.016 -2.693  1.00 21.38 ? 26  ASN A CB    1 
ATOM   227  C  CG    . ASN A 1 29  ? 154.422 195.000 -1.519  1.00 28.36 ? 26  ASN A CG    1 
ATOM   228  O  OD1   . ASN A 1 29  ? 155.439 195.598 -1.146  1.00 23.21 ? 26  ASN A OD1   1 
ATOM   229  N  ND2   . ASN A 1 29  ? 153.251 195.151 -0.921  1.00 28.35 ? 26  ASN A ND2   1 
ATOM   230  N  N     . PRO A 1 30  ? 158.088 194.284 -2.671  1.00 22.00 ? 27  PRO A N     1 
ATOM   231  C  CA    . PRO A 1 30  ? 159.306 193.996 -1.899  1.00 17.14 ? 27  PRO A CA    1 
ATOM   232  C  C     . PRO A 1 30  ? 159.111 194.026 -0.372  1.00 23.37 ? 27  PRO A C     1 
ATOM   233  O  O     . PRO A 1 30  ? 159.839 193.336 0.352   1.00 19.14 ? 27  PRO A O     1 
ATOM   234  C  CB    . PRO A 1 30  ? 160.260 195.106 -2.337  1.00 22.07 ? 27  PRO A CB    1 
ATOM   235  C  CG    . PRO A 1 30  ? 159.802 195.475 -3.704  1.00 26.32 ? 27  PRO A CG    1 
ATOM   236  C  CD    . PRO A 1 30  ? 158.304 195.332 -3.680  1.00 16.62 ? 27  PRO A CD    1 
ATOM   237  N  N     . HIS A 1 31  ? 158.137 194.793 0.113   1.00 26.87 ? 28  HIS A N     1 
ATOM   238  C  CA    . HIS A 1 31  ? 157.838 194.834 1.557   1.00 26.13 ? 28  HIS A CA    1 
ATOM   239  C  C     . HIS A 1 31  ? 157.454 193.470 2.118   1.00 19.78 ? 28  HIS A C     1 
ATOM   240  O  O     . HIS A 1 31  ? 157.584 193.228 3.311   1.00 25.29 ? 28  HIS A O     1 
ATOM   241  C  CB    . HIS A 1 31  ? 156.691 195.809 1.858   1.00 29.33 ? 28  HIS A CB    1 
ATOM   242  C  CG    . HIS A 1 31  ? 157.074 197.250 1.748   1.00 40.29 ? 28  HIS A CG    1 
ATOM   243  N  ND1   . HIS A 1 31  ? 158.203 197.765 2.347   1.00 28.94 ? 28  HIS A ND1   1 
ATOM   244  C  CD2   . HIS A 1 31  ? 156.468 198.289 1.124   1.00 39.50 ? 28  HIS A CD2   1 
ATOM   245  C  CE1   . HIS A 1 31  ? 158.283 199.058 2.084   1.00 43.06 ? 28  HIS A CE1   1 
ATOM   246  N  NE2   . HIS A 1 31  ? 157.241 199.401 1.348   1.00 44.92 ? 28  HIS A NE2   1 
ATOM   247  N  N     . LEU A 1 32  ? 156.956 192.595 1.256   1.00 22.67 ? 29  LEU A N     1 
ATOM   248  C  CA    . LEU A 1 32  ? 156.495 191.265 1.665   1.00 18.14 ? 29  LEU A CA    1 
ATOM   249  C  C     . LEU A 1 32  ? 157.634 190.238 1.709   1.00 24.57 ? 29  LEU A C     1 
ATOM   250  O  O     . LEU A 1 32  ? 157.488 189.135 2.269   1.00 23.61 ? 29  LEU A O     1 
ATOM   251  C  CB    . LEU A 1 32  ? 155.395 190.782 0.708   1.00 18.62 ? 29  LEU A CB    1 
ATOM   252  C  CG    . LEU A 1 32  ? 154.128 191.632 0.581   1.00 25.24 ? 29  LEU A CG    1 
ATOM   253  C  CD1   . LEU A 1 32  ? 153.124 191.014 -0.403  1.00 19.92 ? 29  LEU A CD1   1 
ATOM   254  C  CD2   . LEU A 1 32  ? 153.462 191.860 1.933   1.00 22.54 ? 29  LEU A CD2   1 
ATOM   255  N  N     . ARG A 1 33  ? 158.773 190.601 1.128   1.00 18.52 ? 30  ARG A N     1 
ATOM   256  C  CA    . ARG A 1 33  ? 159.867 189.656 0.972   1.00 19.19 ? 30  ARG A CA    1 
ATOM   257  C  C     . ARG A 1 33  ? 160.470 189.268 2.319   1.00 24.73 ? 30  ARG A C     1 
ATOM   258  O  O     . ARG A 1 33  ? 160.608 190.110 3.197   1.00 22.51 ? 30  ARG A O     1 
ATOM   259  C  CB    . ARG A 1 33  ? 160.942 190.233 0.050   1.00 19.32 ? 30  ARG A CB    1 
ATOM   260  C  CG    . ARG A 1 33  ? 160.448 190.466 -1.378  1.00 19.62 ? 30  ARG A CG    1 
ATOM   261  C  CD    . ARG A 1 33  ? 161.523 191.092 -2.244  1.00 23.24 ? 30  ARG A CD    1 
ATOM   262  N  NE    . ARG A 1 33  ? 161.073 191.272 -3.624  1.00 19.68 ? 30  ARG A NE    1 
ATOM   263  C  CZ    . ARG A 1 33  ? 161.823 191.833 -4.566  1.00 23.72 ? 30  ARG A CZ    1 
ATOM   264  N  NH1   . ARG A 1 33  ? 163.037 192.264 -4.259  1.00 18.26 ? 30  ARG A NH1   1 
ATOM   265  N  NH2   . ARG A 1 33  ? 161.370 191.964 -5.808  1.00 23.47 ? 30  ARG A NH2   1 
ATOM   266  N  N     . ASN A 1 34  ? 160.797 187.980 2.472   1.00 20.03 ? 31  ASN A N     1 
ATOM   267  C  CA    . ASN A 1 34  ? 161.430 187.446 3.689   1.00 29.39 ? 31  ASN A CA    1 
ATOM   268  C  C     . ASN A 1 34  ? 160.658 187.736 4.962   1.00 26.40 ? 31  ASN A C     1 
ATOM   269  O  O     . ASN A 1 34  ? 161.244 187.970 6.022   1.00 30.25 ? 31  ASN A O     1 
ATOM   270  C  CB    . ASN A 1 34  ? 162.858 187.984 3.818   1.00 26.69 ? 31  ASN A CB    1 
ATOM   271  C  CG    . ASN A 1 34  ? 163.665 187.752 2.557   1.00 34.40 ? 31  ASN A CG    1 
ATOM   272  O  OD1   . ASN A 1 34  ? 163.955 186.611 2.197   1.00 37.03 ? 31  ASN A OD1   1 
ATOM   273  N  ND2   . ASN A 1 34  ? 164.001 188.829 1.862   1.00 24.11 ? 31  ASN A ND2   1 
ATOM   274  N  N     . LYS A 1 35  ? 159.337 187.728 4.849   1.00 22.24 ? 32  LYS A N     1 
ATOM   275  C  CA    . LYS A 1 35  ? 158.473 187.982 5.991   1.00 22.22 ? 32  LYS A CA    1 
ATOM   276  C  C     . LYS A 1 35  ? 157.466 186.859 6.124   1.00 22.76 ? 32  LYS A C     1 
ATOM   277  O  O     . LYS A 1 35  ? 157.232 186.128 5.161   1.00 23.14 ? 32  LYS A O     1 
ATOM   278  C  CB    . LYS A 1 35  ? 157.756 189.327 5.837   1.00 24.83 ? 32  LYS A CB    1 
ATOM   279  C  CG    . LYS A 1 35  ? 158.699 190.524 5.686   1.00 23.93 ? 32  LYS A CG    1 
ATOM   280  C  CD    . LYS A 1 35  ? 159.218 190.980 7.009   1.00 38.09 ? 32  LYS A CD    1 
ATOM   281  C  CE    . LYS A 1 35  ? 159.812 192.382 6.895   1.00 42.78 ? 32  LYS A CE    1 
ATOM   282  N  NZ    . LYS A 1 35  ? 159.803 193.061 8.226   1.00 46.31 ? 32  LYS A NZ    1 
ATOM   283  N  N     . PRO A 1 36  ? 156.874 186.706 7.318   1.00 23.40 ? 33  PRO A N     1 
ATOM   284  C  CA    . PRO A 1 36  ? 155.737 185.791 7.404   1.00 17.93 ? 33  PRO A CA    1 
ATOM   285  C  C     . PRO A 1 36  ? 154.583 186.422 6.610   1.00 27.20 ? 33  PRO A C     1 
ATOM   286  O  O     . PRO A 1 36  ? 154.104 187.516 6.942   1.00 21.22 ? 33  PRO A O     1 
ATOM   287  C  CB    . PRO A 1 36  ? 155.448 185.716 8.909   1.00 20.94 ? 33  PRO A CB    1 
ATOM   288  C  CG    . PRO A 1 36  ? 155.960 187.008 9.460   1.00 24.73 ? 33  PRO A CG    1 
ATOM   289  C  CD    . PRO A 1 36  ? 157.131 187.404 8.596   1.00 24.92 ? 33  PRO A CD    1 
ATOM   290  N  N     . CYS A 1 37  ? 154.164 185.773 5.534   1.00 17.57 ? 34  CYS A N     1 
ATOM   291  C  CA    A CYS A 1 37  ? 153.192 186.351 4.614   0.38 18.57 ? 34  CYS A CA    1 
ATOM   292  C  CA    B CYS A 1 37  ? 153.060 186.341 4.788   0.62 18.49 ? 34  CYS A CA    1 
ATOM   293  C  C     . CYS A 1 37  ? 152.231 185.279 4.109   1.00 18.30 ? 34  CYS A C     1 
ATOM   294  O  O     . CYS A 1 37  ? 152.615 184.118 4.016   1.00 20.53 ? 34  CYS A O     1 
ATOM   295  C  CB    A CYS A 1 37  ? 153.929 187.023 3.441   0.38 19.30 ? 34  CYS A CB    1 
ATOM   296  C  CB    B CYS A 1 37  ? 153.563 187.362 3.769   0.62 20.29 ? 34  CYS A CB    1 
ATOM   297  S  SG    A CYS A 1 37  ? 152.902 187.791 2.147   0.38 20.01 ? 34  CYS A SG    1 
ATOM   298  S  SG    B CYS A 1 37  ? 154.629 186.686 2.524   0.62 19.25 ? 34  CYS A SG    1 
ATOM   299  N  N     . ALA A 1 38  ? 151.027 185.679 3.728   1.00 19.29 ? 35  ALA A N     1 
ATOM   300  C  CA    . ALA A 1 38  ? 150.078 184.763 3.118   1.00 14.94 ? 35  ALA A CA    1 
ATOM   301  C  C     . ALA A 1 38  ? 149.227 185.476 2.093   1.00 17.48 ? 35  ALA A C     1 
ATOM   302  O  O     . ALA A 1 38  ? 149.095 186.704 2.121   1.00 16.32 ? 35  ALA A O     1 
ATOM   303  C  CB    . ALA A 1 38  ? 149.197 184.120 4.168   1.00 14.74 ? 35  ALA A CB    1 
ATOM   304  N  N     . VAL A 1 39  ? 148.620 184.685 1.214   1.00 18.86 ? 36  VAL A N     1 
ATOM   305  C  CA    . VAL A 1 39  ? 147.721 185.203 0.204   1.00 18.09 ? 36  VAL A CA    1 
ATOM   306  C  C     . VAL A 1 39  ? 146.306 184.760 0.521   1.00 19.11 ? 36  VAL A C     1 
ATOM   307  O  O     . VAL A 1 39  ? 146.071 183.596 0.856   1.00 20.04 ? 36  VAL A O     1 
ATOM   308  C  CB    . VAL A 1 39  ? 148.150 184.724 -1.206  1.00 20.47 ? 36  VAL A CB    1 
ATOM   309  C  CG1   . VAL A 1 39  ? 147.156 185.194 -2.296  1.00 20.34 ? 36  VAL A CG1   1 
ATOM   310  C  CG2   . VAL A 1 39  ? 149.552 185.213 -1.486  1.00 15.97 ? 36  VAL A CG2   1 
ATOM   311  N  N     . VAL A 1 40  ? 145.365 185.698 0.458   1.00 22.10 ? 37  VAL A N     1 
ATOM   312  C  CA    . VAL A 1 40  ? 143.988 185.423 0.859   1.00 22.90 ? 37  VAL A CA    1 
ATOM   313  C  C     . VAL A 1 40  ? 143.044 185.745 -0.280  1.00 23.91 ? 37  VAL A C     1 
ATOM   314  O  O     . VAL A 1 40  ? 143.308 186.642 -1.088  1.00 21.95 ? 37  VAL A O     1 
ATOM   315  C  CB    . VAL A 1 40  ? 143.533 186.245 2.123   1.00 31.76 ? 37  VAL A CB    1 
ATOM   316  C  CG1   . VAL A 1 40  ? 144.324 185.855 3.384   1.00 25.94 ? 37  VAL A CG1   1 
ATOM   317  C  CG2   . VAL A 1 40  ? 143.606 187.745 1.868   1.00 22.85 ? 37  VAL A CG2   1 
ATOM   318  N  N     . ALA A 1 41  ? 141.959 184.987 -0.347  1.00 22.35 ? 38  ALA A N     1 
ATOM   319  C  CA    . ALA A 1 41  ? 140.864 185.275 -1.252  1.00 28.54 ? 38  ALA A CA    1 
ATOM   320  C  C     . ALA A 1 41  ? 139.721 185.864 -0.436  1.00 32.31 ? 38  ALA A C     1 
ATOM   321  O  O     . ALA A 1 41  ? 139.281 185.253 0.551   1.00 33.91 ? 38  ALA A O     1 
ATOM   322  C  CB    . ALA A 1 41  ? 140.417 184.021 -1.975  1.00 25.21 ? 38  ALA A CB    1 
ATOM   323  N  N     . TYR A 1 42  ? 139.268 187.050 -0.847  1.00 28.91 ? 39  TYR A N     1 
ATOM   324  C  CA    . TYR A 1 42  ? 138.199 187.804 -0.183  1.00 34.94 ? 39  TYR A CA    1 
ATOM   325  C  C     . TYR A 1 42  ? 138.640 188.288 1.209   1.00 33.83 ? 39  TYR A C     1 
ATOM   326  O  O     . TYR A 1 42  ? 139.725 187.949 1.671   1.00 38.72 ? 39  TYR A O     1 
ATOM   327  C  CB    . TYR A 1 42  ? 136.924 186.963 -0.110  1.00 26.56 ? 39  TYR A CB    1 
ATOM   328  C  CG    . TYR A 1 42  ? 136.521 186.391 -1.461  1.00 31.05 ? 39  TYR A CG    1 
ATOM   329  C  CD1   . TYR A 1 42  ? 136.030 187.219 -2.467  1.00 31.59 ? 39  TYR A CD1   1 
ATOM   330  C  CD2   . TYR A 1 42  ? 136.618 185.029 -1.723  1.00 29.91 ? 39  TYR A CD2   1 
ATOM   331  C  CE1   . TYR A 1 42  ? 135.654 186.708 -3.697  1.00 34.48 ? 39  TYR A CE1   1 
ATOM   332  C  CE2   . TYR A 1 42  ? 136.240 184.505 -2.949  1.00 29.58 ? 39  TYR A CE2   1 
ATOM   333  C  CZ    . TYR A 1 42  ? 135.763 185.349 -3.935  1.00 30.12 ? 39  TYR A CZ    1 
ATOM   334  O  OH    . TYR A 1 42  ? 135.385 184.839 -5.159  1.00 28.77 ? 39  TYR A OH    1 
ATOM   335  N  N     . LYS A 1 43  ? 137.822 189.113 1.855   1.00 36.51 ? 40  LYS A N     1 
ATOM   336  C  CA    . LYS A 1 43  ? 138.240 189.780 3.092   1.00 32.52 ? 40  LYS A CA    1 
ATOM   337  C  C     . LYS A 1 43  ? 137.134 189.812 4.133   1.00 38.96 ? 40  LYS A C     1 
ATOM   338  O  O     . LYS A 1 43  ? 137.404 189.763 5.333   1.00 32.07 ? 40  LYS A O     1 
ATOM   339  C  CB    . LYS A 1 43  ? 138.700 191.219 2.812   1.00 36.57 ? 40  LYS A CB    1 
ATOM   340  C  CG    . LYS A 1 43  ? 140.009 191.354 2.042   0.44 35.90 ? 40  LYS A CG    1 
ATOM   341  C  CD    . LYS A 1 43  ? 141.216 190.885 2.852   0.65 33.17 ? 40  LYS A CD    1 
ATOM   342  C  CE    . LYS A 1 43  ? 141.268 191.531 4.225   0.52 36.77 ? 40  LYS A CE    1 
ATOM   343  N  NZ    . LYS A 1 43  ? 142.356 190.941 5.054   1.00 29.98 ? 40  LYS A NZ    1 
ATOM   344  N  N     . SER A 1 44  ? 135.892 189.895 3.660   1.00 29.57 ? 41  SER A N     1 
ATOM   345  C  CA    . SER A 1 44  ? 134.741 190.111 4.527   1.00 37.63 ? 41  SER A CA    1 
ATOM   346  C  C     . SER A 1 44  ? 134.594 189.050 5.607   1.00 41.42 ? 41  SER A C     1 
ATOM   347  O  O     . SER A 1 44  ? 134.490 189.373 6.792   1.00 49.73 ? 41  SER A O     1 
ATOM   348  C  CB    . SER A 1 44  ? 133.460 190.165 3.696   1.00 39.72 ? 41  SER A CB    1 
ATOM   349  O  OG    . SER A 1 44  ? 133.409 189.080 2.784   1.00 52.10 ? 41  SER A OG    1 
ATOM   350  N  N     . TRP A 1 45  ? 134.594 187.788 5.200   1.00 27.19 ? 42  TRP A N     1 
ATOM   351  C  CA    . TRP A 1 45  ? 134.323 186.692 6.127   1.00 35.48 ? 42  TRP A CA    1 
ATOM   352  C  C     . TRP A 1 45  ? 135.604 186.226 6.822   1.00 38.43 ? 42  TRP A C     1 
ATOM   353  O  O     . TRP A 1 45  ? 136.449 185.560 6.211   1.00 28.19 ? 42  TRP A O     1 
ATOM   354  C  CB    . TRP A 1 45  ? 133.646 185.530 5.386   1.00 38.18 ? 42  TRP A CB    1 
ATOM   355  C  CG    . TRP A 1 45  ? 133.286 184.350 6.251   1.00 44.34 ? 42  TRP A CG    1 
ATOM   356  C  CD1   . TRP A 1 45  ? 134.059 183.248 6.500   1.00 42.88 ? 42  TRP A CD1   1 
ATOM   357  C  CD2   . TRP A 1 45  ? 132.056 184.141 6.962   1.00 49.08 ? 42  TRP A CD2   1 
ATOM   358  N  NE1   . TRP A 1 45  ? 133.395 182.375 7.334   1.00 42.33 ? 42  TRP A NE1   1 
ATOM   359  C  CE2   . TRP A 1 45  ? 132.162 182.896 7.627   1.00 50.94 ? 42  TRP A CE2   1 
ATOM   360  C  CE3   . TRP A 1 45  ? 130.883 184.886 7.108   1.00 49.51 ? 42  TRP A CE3   1 
ATOM   361  C  CZ2   . TRP A 1 45  ? 131.137 182.382 8.419   1.00 49.53 ? 42  TRP A CZ2   1 
ATOM   362  C  CZ3   . TRP A 1 45  ? 129.865 184.374 7.903   1.00 57.50 ? 42  TRP A CZ3   1 
ATOM   363  C  CH2   . TRP A 1 45  ? 130.000 183.134 8.546   1.00 54.09 ? 42  TRP A CH2   1 
ATOM   364  N  N     . LYS A 1 46  ? 135.737 186.611 8.092   1.00 33.54 ? 43  LYS A N     1 
ATOM   365  C  CA    . LYS A 1 46  ? 136.859 186.228 8.958   1.00 28.04 ? 43  LYS A CA    1 
ATOM   366  C  C     . LYS A 1 46  ? 138.235 186.590 8.397   1.00 24.65 ? 43  LYS A C     1 
ATOM   367  O  O     . LYS A 1 46  ? 139.220 185.879 8.623   1.00 27.09 ? 43  LYS A O     1 
ATOM   368  C  CB    . LYS A 1 46  ? 136.795 184.735 9.256   1.00 31.11 ? 43  LYS A CB    1 
ATOM   369  C  CG    . LYS A 1 46  ? 135.594 184.344 10.109  1.00 43.32 ? 43  LYS A CG    1 
ATOM   370  C  CD    . LYS A 1 46  ? 135.543 182.844 10.354  1.00 46.20 ? 43  LYS A CD    1 
ATOM   371  C  CE    . LYS A 1 46  ? 134.390 182.465 11.268  1.00 49.14 ? 43  LYS A CE    1 
ATOM   372  N  NZ    . LYS A 1 46  ? 134.225 180.983 11.306  1.00 48.69 ? 43  LYS A NZ    1 
ATOM   373  N  N     . GLY A 1 47  ? 138.296 187.706 7.679   1.00 23.97 ? 44  GLY A N     1 
ATOM   374  C  CA    . GLY A 1 47  ? 139.547 188.227 7.164   1.00 20.64 ? 44  GLY A CA    1 
ATOM   375  C  C     . GLY A 1 47  ? 139.988 187.587 5.856   1.00 26.68 ? 44  GLY A C     1 
ATOM   376  O  O     . GLY A 1 47  ? 141.031 187.953 5.295   1.00 26.18 ? 44  GLY A O     1 
ATOM   377  N  N     . GLY A 1 48  ? 139.207 186.627 5.370   1.00 25.28 ? 45  GLY A N     1 
ATOM   378  C  CA    . GLY A 1 48  ? 139.491 185.993 4.088   1.00 27.74 ? 45  GLY A CA    1 
ATOM   379  C  C     . GLY A 1 48  ? 140.149 184.632 4.234   1.00 23.72 ? 45  GLY A C     1 
ATOM   380  O  O     . GLY A 1 48  ? 140.765 184.339 5.252   1.00 24.14 ? 45  GLY A O     1 
ATOM   381  N  N     . GLY A 1 49  ? 140.032 183.796 3.209   1.00 27.37 ? 46  GLY A N     1 
ATOM   382  C  CA    . GLY A 1 49  ? 140.575 182.451 3.288   1.00 24.97 ? 46  GLY A CA    1 
ATOM   383  C  C     . GLY A 1 49  ? 141.977 182.375 2.736   1.00 25.16 ? 46  GLY A C     1 
ATOM   384  O  O     . GLY A 1 49  ? 142.225 182.811 1.613   1.00 25.82 ? 46  GLY A O     1 
ATOM   385  N  N     . ILE A 1 50  ? 142.890 181.824 3.533   1.00 21.63 ? 47  ILE A N     1 
ATOM   386  C  CA    . ILE A 1 50  ? 144.298 181.745 3.169   1.00 18.13 ? 47  ILE A CA    1 
ATOM   387  C  C     . ILE A 1 50  ? 144.520 180.649 2.133   1.00 22.09 ? 47  ILE A C     1 
ATOM   388  O  O     . ILE A 1 50  ? 144.120 179.504 2.319   1.00 18.28 ? 47  ILE A O     1 
ATOM   389  C  CB    . ILE A 1 50  ? 145.186 181.493 4.409   1.00 18.62 ? 47  ILE A CB    1 
ATOM   390  C  CG1   . ILE A 1 50  ? 145.211 182.740 5.294   1.00 23.85 ? 47  ILE A CG1   1 
ATOM   391  C  CG2   . ILE A 1 50  ? 146.600 181.136 3.996   1.00 16.79 ? 47  ILE A CG2   1 
ATOM   392  C  CD1   . ILE A 1 50  ? 146.093 182.578 6.515   1.00 28.04 ? 47  ILE A CD1   1 
ATOM   393  N  N     . ILE A 1 51  ? 145.182 181.010 1.041   1.00 20.50 ? 48  ILE A N     1 
ATOM   394  C  CA    . ILE A 1 51  ? 145.311 180.111 -0.087  1.00 18.30 ? 48  ILE A CA    1 
ATOM   395  C  C     . ILE A 1 51  ? 146.762 179.692 -0.270  1.00 25.17 ? 48  ILE A C     1 
ATOM   396  O  O     . ILE A 1 51  ? 147.053 178.705 -0.955  1.00 26.13 ? 48  ILE A O     1 
ATOM   397  C  CB    . ILE A 1 51  ? 144.760 180.789 -1.372  1.00 26.29 ? 48  ILE A CB    1 
ATOM   398  C  CG1   . ILE A 1 51  ? 144.700 179.834 -2.551  1.00 35.87 ? 48  ILE A CG1   1 
ATOM   399  C  CG2   . ILE A 1 51  ? 145.600 182.001 -1.766  1.00 24.80 ? 48  ILE A CG2   1 
ATOM   400  C  CD1   . ILE A 1 51  ? 144.452 180.581 -3.841  1.00 33.77 ? 48  ILE A CD1   1 
ATOM   401  N  N     . ALA A 1 52  ? 147.666 180.451 0.348   1.00 20.64 ? 49  ALA A N     1 
ATOM   402  C  CA    . ALA A 1 52  ? 149.098 180.222 0.210   1.00 17.77 ? 49  ALA A CA    1 
ATOM   403  C  C     . ALA A 1 52  ? 149.864 180.914 1.339   1.00 17.39 ? 49  ALA A C     1 
ATOM   404  O  O     . ALA A 1 52  ? 149.505 182.022 1.750   1.00 17.80 ? 49  ALA A O     1 
ATOM   405  C  CB    . ALA A 1 52  ? 149.598 180.719 -1.161  1.00 20.10 ? 49  ALA A CB    1 
ATOM   406  N  N     . VAL A 1 53  ? 150.936 180.273 1.809   1.00 16.86 ? 50  VAL A N     1 
ATOM   407  C  CA    . VAL A 1 53  ? 151.607 180.666 3.048   1.00 13.44 ? 50  VAL A CA    1 
ATOM   408  C  C     . VAL A 1 53  ? 153.130 180.612 2.905   1.00 16.76 ? 50  VAL A C     1 
ATOM   409  O  O     . VAL A 1 53  ? 153.680 179.564 2.550   1.00 17.51 ? 50  VAL A O     1 
ATOM   410  C  CB    . VAL A 1 53  ? 151.204 179.733 4.219   1.00 16.73 ? 50  VAL A CB    1 
ATOM   411  C  CG1   . VAL A 1 53  ? 151.766 180.261 5.543   1.00 16.47 ? 50  VAL A CG1   1 
ATOM   412  C  CG2   . VAL A 1 53  ? 149.716 179.601 4.311   1.00 19.43 ? 50  VAL A CG2   1 
ATOM   413  N  N     . SER A 1 54  ? 153.821 181.716 3.187   1.00 15.64 ? 51  SER A N     1 
ATOM   414  C  CA    . SER A 1 54  ? 155.294 181.714 3.121   1.00 15.61 ? 51  SER A CA    1 
ATOM   415  C  C     . SER A 1 54  ? 155.883 180.781 4.187   1.00 19.73 ? 51  SER A C     1 
ATOM   416  O  O     . SER A 1 54  ? 155.218 180.463 5.178   1.00 18.84 ? 51  SER A O     1 
ATOM   417  C  CB    . SER A 1 54  ? 155.859 183.125 3.294   1.00 18.19 ? 51  SER A CB    1 
ATOM   418  O  OG    . SER A 1 54  ? 155.843 183.525 4.657   1.00 26.91 ? 51  SER A OG    1 
ATOM   419  N  N     . TYR A 1 55  ? 157.116 180.327 3.983   1.00 14.40 ? 52  TYR A N     1 
ATOM   420  C  CA    . TYR A 1 55  ? 157.735 179.413 4.935   1.00 18.53 ? 52  TYR A CA    1 
ATOM   421  C  C     . TYR A 1 55  ? 157.987 180.087 6.296   1.00 19.43 ? 52  TYR A C     1 
ATOM   422  O  O     . TYR A 1 55  ? 157.903 179.433 7.329   1.00 19.65 ? 52  TYR A O     1 
ATOM   423  C  CB    . TYR A 1 55  ? 159.027 178.820 4.343   1.00 15.77 ? 52  TYR A CB    1 
ATOM   424  C  CG    . TYR A 1 55  ? 158.692 177.720 3.356   1.00 22.09 ? 52  TYR A CG    1 
ATOM   425  C  CD1   . TYR A 1 55  ? 158.275 178.020 2.055   1.00 20.05 ? 52  TYR A CD1   1 
ATOM   426  C  CD2   . TYR A 1 55  ? 158.718 176.393 3.739   1.00 23.45 ? 52  TYR A CD2   1 
ATOM   427  C  CE1   . TYR A 1 55  ? 157.927 177.014 1.158   1.00 16.80 ? 52  TYR A CE1   1 
ATOM   428  C  CE2   . TYR A 1 55  ? 158.372 175.376 2.855   1.00 19.42 ? 52  TYR A CE2   1 
ATOM   429  C  CZ    . TYR A 1 55  ? 157.978 175.688 1.565   1.00 24.39 ? 52  TYR A CZ    1 
ATOM   430  O  OH    . TYR A 1 55  ? 157.627 174.669 0.695   1.00 17.58 ? 52  TYR A OH    1 
ATOM   431  N  N     . GLU A 1 56  ? 158.236 181.395 6.294   1.00 19.81 ? 53  GLU A N     1 
ATOM   432  C  CA    . GLU A 1 56  ? 158.372 182.143 7.539   1.00 19.30 ? 53  GLU A CA    1 
ATOM   433  C  C     . GLU A 1 56  ? 157.072 182.060 8.330   1.00 21.37 ? 53  GLU A C     1 
ATOM   434  O  O     . GLU A 1 56  ? 157.093 181.933 9.540   1.00 20.92 ? 53  GLU A O     1 
ATOM   435  C  CB    . GLU A 1 56  ? 158.740 183.612 7.273   1.00 23.00 ? 53  GLU A CB    1 
ATOM   436  C  CG    . GLU A 1 56  ? 160.123 183.869 6.642   1.00 26.25 ? 53  GLU A CG    1 
ATOM   437  C  CD    . GLU A 1 56  ? 160.147 183.733 5.109   1.00 27.89 ? 53  GLU A CD    1 
ATOM   438  O  OE1   . GLU A 1 56  ? 159.129 183.346 4.508   1.00 25.42 ? 53  GLU A OE1   1 
ATOM   439  O  OE2   . GLU A 1 56  ? 161.204 184.007 4.502   1.00 34.17 ? 53  GLU A OE2   1 
ATOM   440  N  N     . ALA A 1 57  ? 155.924 182.131 7.657   1.00 19.14 ? 54  ALA A N     1 
ATOM   441  C  CA    . ALA A 1 57  ? 154.670 182.068 8.403   1.00 19.76 ? 54  ALA A CA    1 
ATOM   442  C  C     . ALA A 1 57  ? 154.327 180.635 8.816   1.00 18.26 ? 54  ALA A C     1 
ATOM   443  O  O     . ALA A 1 57  ? 153.721 180.414 9.878   1.00 19.53 ? 54  ALA A O     1 
ATOM   444  C  CB    . ALA A 1 57  ? 153.535 182.673 7.609   1.00 19.92 ? 54  ALA A CB    1 
ATOM   445  N  N     . ARG A 1 58  ? 154.717 179.655 7.999   1.00 22.20 ? 55  ARG A N     1 
ATOM   446  C  CA    . ARG A 1 58  ? 154.476 178.256 8.359   1.00 18.55 ? 55  ARG A CA    1 
ATOM   447  C  C     . ARG A 1 58  ? 155.177 177.909 9.686   1.00 22.73 ? 55  ARG A C     1 
ATOM   448  O  O     . ARG A 1 58  ? 154.735 177.017 10.421  1.00 16.51 ? 55  ARG A O     1 
ATOM   449  C  CB    . ARG A 1 58  ? 154.944 177.301 7.252   1.00 17.93 ? 55  ARG A CB    1 
ATOM   450  C  CG    . ARG A 1 58  ? 154.201 177.477 5.921   1.00 21.81 ? 55  ARG A CG    1 
ATOM   451  C  CD    . ARG A 1 58  ? 154.698 176.501 4.850   1.00 22.95 ? 55  ARG A CD    1 
ATOM   452  N  NE    . ARG A 1 58  ? 154.319 176.957 3.510   1.00 23.33 ? 55  ARG A NE    1 
ATOM   453  C  CZ    . ARG A 1 58  ? 154.380 176.215 2.411   1.00 25.87 ? 55  ARG A CZ    1 
ATOM   454  N  NH1   . ARG A 1 58  ? 154.826 174.963 2.470   1.00 21.33 ? 55  ARG A NH1   1 
ATOM   455  N  NH2   . ARG A 1 58  ? 154.004 176.739 1.248   1.00 22.88 ? 55  ARG A NH2   1 
ATOM   456  N  N     . ALA A 1 59  ? 156.257 178.618 9.995   1.00 22.65 ? 56  ALA A N     1 
ATOM   457  C  CA    . ALA A 1 59  ? 157.006 178.336 11.222  1.00 21.90 ? 56  ALA A CA    1 
ATOM   458  C  C     . ALA A 1 59  ? 156.190 178.705 12.470  1.00 31.54 ? 56  ALA A C     1 
ATOM   459  O  O     . ALA A 1 59  ? 156.466 178.194 13.558  1.00 29.39 ? 56  ALA A O     1 
ATOM   460  C  CB    . ALA A 1 59  ? 158.344 179.068 11.216  1.00 24.54 ? 56  ALA A CB    1 
ATOM   461  N  N     . PHE A 1 60  ? 155.185 179.573 12.301  1.00 21.48 ? 57  PHE A N     1 
ATOM   462  C  CA    . PHE A 1 60  ? 154.222 179.890 13.360  1.00 25.22 ? 57  PHE A CA    1 
ATOM   463  C  C     . PHE A 1 60  ? 153.027 178.926 13.387  1.00 27.46 ? 57  PHE A C     1 
ATOM   464  O  O     . PHE A 1 60  ? 152.173 179.031 14.261  1.00 25.39 ? 57  PHE A O     1 
ATOM   465  C  CB    . PHE A 1 60  ? 153.676 181.324 13.205  1.00 24.87 ? 57  PHE A CB    1 
ATOM   466  C  CG    . PHE A 1 60  ? 154.683 182.418 13.500  1.00 23.03 ? 57  PHE A CG    1 
ATOM   467  C  CD1   . PHE A 1 60  ? 155.660 182.745 12.582  1.00 23.11 ? 57  PHE A CD1   1 
ATOM   468  C  CD2   . PHE A 1 60  ? 154.614 183.142 14.672  1.00 26.04 ? 57  PHE A CD2   1 
ATOM   469  C  CE1   . PHE A 1 60  ? 156.567 183.761 12.834  1.00 27.90 ? 57  PHE A CE1   1 
ATOM   470  C  CE2   . PHE A 1 60  ? 155.522 184.166 14.939  1.00 30.73 ? 57  PHE A CE2   1 
ATOM   471  C  CZ    . PHE A 1 60  ? 156.502 184.469 14.023  1.00 32.10 ? 57  PHE A CZ    1 
ATOM   472  N  N     . GLY A 1 61  ? 152.940 178.020 12.415  1.00 23.50 ? 58  GLY A N     1 
ATOM   473  C  CA    . GLY A 1 61  ? 151.827 177.084 12.359  1.00 21.85 ? 58  GLY A CA    1 
ATOM   474  C  C     . GLY A 1 61  ? 150.696 177.516 11.434  1.00 25.34 ? 58  GLY A C     1 
ATOM   475  O  O     . GLY A 1 61  ? 149.636 176.893 11.406  1.00 20.18 ? 58  GLY A O     1 
ATOM   476  N  N     . VAL A 1 62  ? 150.905 178.591 10.678  1.00 18.28 ? 59  VAL A N     1 
ATOM   477  C  CA    . VAL A 1 62  ? 149.872 179.077 9.765   1.00 15.33 ? 59  VAL A CA    1 
ATOM   478  C  C     . VAL A 1 62  ? 149.783 178.133 8.576   1.00 19.10 ? 59  VAL A C     1 
ATOM   479  O  O     . VAL A 1 62  ? 150.803 177.745 8.034   1.00 19.43 ? 59  VAL A O     1 
ATOM   480  C  CB    . VAL A 1 62  ? 150.166 180.513 9.263   1.00 20.52 ? 59  VAL A CB    1 
ATOM   481  C  CG1   . VAL A 1 62  ? 149.074 180.980 8.307   1.00 23.66 ? 59  VAL A CG1   1 
ATOM   482  C  CG2   . VAL A 1 62  ? 150.289 181.487 10.442  1.00 20.66 ? 59  VAL A CG2   1 
ATOM   483  N  N     . THR A 1 63  ? 148.572 177.753 8.182   1.00 22.51 ? 60  THR A N     1 
ATOM   484  C  CA    . THR A 1 63  ? 148.384 176.883 7.027   1.00 20.34 ? 60  THR A CA    1 
ATOM   485  C  C     . THR A 1 63  ? 147.310 177.418 6.093   1.00 23.26 ? 60  THR A C     1 
ATOM   486  O  O     . THR A 1 63  ? 146.514 178.264 6.483   1.00 24.68 ? 60  THR A O     1 
ATOM   487  C  CB    . THR A 1 63  ? 147.971 175.465 7.435   1.00 21.82 ? 60  THR A CB    1 
ATOM   488  O  OG1   . THR A 1 63  ? 146.626 175.498 7.922   1.00 25.80 ? 60  THR A OG1   1 
ATOM   489  C  CG2   . THR A 1 63  ? 148.900 174.905 8.510   1.00 22.71 ? 60  THR A CG2   1 
ATOM   490  N  N     . ALA A 1 64  ? 147.274 176.888 4.873   1.00 20.45 ? 61  ALA A N     1 
ATOM   491  C  CA    . ALA A 1 64  ? 146.172 177.140 3.952   1.00 27.05 ? 61  ALA A CA    1 
ATOM   492  C  C     . ALA A 1 64  ? 144.881 176.592 4.540   1.00 28.16 ? 61  ALA A C     1 
ATOM   493  O  O     . ALA A 1 64  ? 144.906 175.748 5.438   1.00 28.04 ? 61  ALA A O     1 
ATOM   494  C  CB    . ALA A 1 64  ? 146.450 176.510 2.578   1.00 26.27 ? 61  ALA A CB    1 
ATOM   495  N  N     . SER A 1 65  ? 143.761 177.096 4.039   1.00 30.88 ? 62  SER A N     1 
ATOM   496  C  CA    . SER A 1 65  ? 142.435 176.775 4.561   1.00 35.47 ? 62  SER A CA    1 
ATOM   497  C  C     . SER A 1 65  ? 142.178 177.300 5.980   1.00 39.99 ? 62  SER A C     1 
ATOM   498  O  O     . SER A 1 65  ? 141.121 177.042 6.545   1.00 42.83 ? 62  SER A O     1 
ATOM   499  C  CB    . SER A 1 65  ? 142.183 175.269 4.541   1.00 34.99 ? 62  SER A CB    1 
ATOM   500  O  OG    . SER A 1 65  ? 142.455 174.715 5.815   1.00 45.00 ? 62  SER A OG    1 
ATOM   501  N  N     . MET A 1 66  ? 143.135 178.017 6.561   1.00 35.36 ? 63  MET A N     1 
ATOM   502  C  CA    . MET A 1 66  ? 142.833 178.831 7.734   1.00 32.54 ? 63  MET A CA    1 
ATOM   503  C  C     . MET A 1 66  ? 142.185 180.136 7.312   1.00 33.68 ? 63  MET A C     1 
ATOM   504  O  O     . MET A 1 66  ? 142.542 180.696 6.277   1.00 27.02 ? 63  MET A O     1 
ATOM   505  C  CB    . MET A 1 66  ? 144.085 179.168 8.542   1.00 30.82 ? 63  MET A CB    1 
ATOM   506  C  CG    . MET A 1 66  ? 144.653 178.074 9.365   1.00 32.74 ? 63  MET A CG    1 
ATOM   507  S  SD    . MET A 1 66  ? 145.923 178.803 10.411  1.00 31.50 ? 63  MET A SD    1 
ATOM   508  C  CE    . MET A 1 66  ? 146.434 177.346 11.306  1.00 31.79 ? 63  MET A CE    1 
ATOM   509  N  N     . TRP A 1 67  ? 141.254 180.623 8.129   1.00 29.11 ? 64  TRP A N     1 
ATOM   510  C  CA    . TRP A 1 67  ? 140.808 182.003 8.045   1.00 27.11 ? 64  TRP A CA    1 
ATOM   511  C  C     . TRP A 1 67  ? 141.923 182.945 8.481   1.00 27.12 ? 64  TRP A C     1 
ATOM   512  O  O     . TRP A 1 67  ? 142.642 182.662 9.444   1.00 20.31 ? 64  TRP A O     1 
ATOM   513  C  CB    . TRP A 1 67  ? 139.574 182.221 8.921   1.00 33.08 ? 64  TRP A CB    1 
ATOM   514  C  CG    . TRP A 1 67  ? 138.437 181.363 8.527   1.00 35.95 ? 64  TRP A CG    1 
ATOM   515  C  CD1   . TRP A 1 67  ? 137.857 180.354 9.259   1.00 33.81 ? 64  TRP A CD1   1 
ATOM   516  C  CD2   . TRP A 1 67  ? 137.740 181.412 7.285   1.00 33.88 ? 64  TRP A CD2   1 
ATOM   517  N  NE1   . TRP A 1 67  ? 136.827 179.790 8.541   1.00 36.79 ? 64  TRP A NE1   1 
ATOM   518  C  CE2   . TRP A 1 67  ? 136.737 180.419 7.326   1.00 39.64 ? 64  TRP A CE2   1 
ATOM   519  C  CE3   . TRP A 1 67  ? 137.864 182.202 6.140   1.00 32.69 ? 64  TRP A CE3   1 
ATOM   520  C  CZ2   . TRP A 1 67  ? 135.865 180.197 6.262   1.00 45.25 ? 64  TRP A CZ2   1 
ATOM   521  C  CZ3   . TRP A 1 67  ? 136.988 181.993 5.098   1.00 39.91 ? 64  TRP A CZ3   1 
ATOM   522  C  CH2   . TRP A 1 67  ? 136.009 180.989 5.156   1.00 35.95 ? 64  TRP A CH2   1 
ATOM   523  N  N     . ALA A 1 68  ? 142.059 184.069 7.783   1.00 25.36 ? 65  ALA A N     1 
ATOM   524  C  CA    . ALA A 1 68  ? 143.096 185.052 8.112   1.00 23.15 ? 65  ALA A CA    1 
ATOM   525  C  C     . ALA A 1 68  ? 143.016 185.505 9.574   1.00 23.25 ? 65  ALA A C     1 
ATOM   526  O  O     . ALA A 1 68  ? 144.046 185.673 10.225  1.00 21.48 ? 65  ALA A O     1 
ATOM   527  C  CB    . ALA A 1 68  ? 143.001 186.251 7.187   1.00 19.94 ? 65  ALA A CB    1 
ATOM   528  N  N     . ASP A 1 69  ? 141.803 185.694 10.093  1.00 25.78 ? 66  ASP A N     1 
ATOM   529  C  CA    . ASP A 1 69  ? 141.648 186.137 11.490  1.00 24.00 ? 66  ASP A CA    1 
ATOM   530  C  C     . ASP A 1 69  ? 142.197 185.089 12.450  1.00 21.10 ? 66  ASP A C     1 
ATOM   531  O  O     . ASP A 1 69  ? 142.739 185.419 13.499  1.00 20.48 ? 66  ASP A O     1 
ATOM   532  C  CB    . ASP A 1 69  ? 140.180 186.433 11.832  1.00 21.48 ? 66  ASP A CB    1 
ATOM   533  C  CG    . ASP A 1 69  ? 139.655 187.700 11.159  1.00 32.09 ? 66  ASP A CG    1 
ATOM   534  O  OD1   . ASP A 1 69  ? 140.474 188.499 10.637  1.00 27.56 ? 66  ASP A OD1   1 
ATOM   535  O  OD2   . ASP A 1 69  ? 138.420 187.900 11.173  1.00 26.15 ? 66  ASP A OD2   1 
ATOM   536  N  N     . ASP A 1 70  ? 142.069 183.819 12.094  1.00 19.97 ? 67  ASP A N     1 
ATOM   537  C  CA    . ASP A 1 70  ? 142.582 182.767 12.966  1.00 21.67 ? 67  ASP A CA    1 
ATOM   538  C  C     . ASP A 1 70  ? 144.090 182.629 12.836  1.00 19.21 ? 67  ASP A C     1 
ATOM   539  O  O     . ASP A 1 70  ? 144.789 182.384 13.818  1.00 20.11 ? 67  ASP A O     1 
ATOM   540  C  CB    . ASP A 1 70  ? 141.884 181.440 12.658  1.00 25.12 ? 67  ASP A CB    1 
ATOM   541  C  CG    . ASP A 1 70  ? 140.376 181.511 12.890  1.00 31.95 ? 67  ASP A CG    1 
ATOM   542  O  OD1   . ASP A 1 70  ? 139.927 182.374 13.687  1.00 26.44 ? 67  ASP A OD1   1 
ATOM   543  O  OD2   . ASP A 1 70  ? 139.648 180.701 12.282  1.00 29.22 ? 67  ASP A OD2   1 
ATOM   544  N  N     . ALA A 1 71  ? 144.593 182.783 11.614  1.00 24.45 ? 68  ALA A N     1 
ATOM   545  C  CA    . ALA A 1 71  ? 146.031 182.807 11.379  1.00 21.42 ? 68  ALA A CA    1 
ATOM   546  C  C     . ALA A 1 71  ? 146.723 183.882 12.206  1.00 17.65 ? 68  ALA A C     1 
ATOM   547  O  O     . ALA A 1 71  ? 147.823 183.666 12.689  1.00 24.59 ? 68  ALA A O     1 
ATOM   548  C  CB    . ALA A 1 71  ? 146.327 183.034 9.889   1.00 20.54 ? 68  ALA A CB    1 
ATOM   549  N  N     . LYS A 1 72  ? 146.081 185.044 12.313  1.00 19.13 ? 69  LYS A N     1 
ATOM   550  C  CA    . LYS A 1 72  ? 146.583 186.185 13.089  1.00 27.75 ? 69  LYS A CA    1 
ATOM   551  C  C     . LYS A 1 72  ? 146.786 185.850 14.573  1.00 26.36 ? 69  LYS A C     1 
ATOM   552  O  O     . LYS A 1 72  ? 147.649 186.429 15.237  1.00 18.78 ? 69  LYS A O     1 
ATOM   553  C  CB    . LYS A 1 72  ? 145.624 187.384 12.955  1.00 28.19 ? 69  LYS A CB    1 
ATOM   554  C  CG    . LYS A 1 72  ? 145.735 188.172 11.630  1.00 26.56 ? 69  LYS A CG    1 
ATOM   555  C  CD    . LYS A 1 72  ? 147.086 188.879 11.566  1.00 33.90 ? 69  LYS A CD    1 
ATOM   556  C  CE    . LYS A 1 72  ? 147.117 190.050 10.587  1.00 34.90 ? 69  LYS A CE    1 
ATOM   557  N  NZ    . LYS A 1 72  ? 148.377 190.877 10.822  1.00 33.89 ? 69  LYS A NZ    1 
ATOM   558  N  N     . LYS A 1 73  ? 145.996 184.906 15.078  1.00 20.89 ? 70  LYS A N     1 
ATOM   559  C  CA    . LYS A 1 73  ? 146.113 184.464 16.466  1.00 31.62 ? 70  LYS A CA    1 
ATOM   560  C  C     . LYS A 1 73  ? 147.428 183.705 16.686  1.00 19.33 ? 70  LYS A C     1 
ATOM   561  O  O     . LYS A 1 73  ? 148.049 183.817 17.727  1.00 26.62 ? 70  LYS A O     1 
ATOM   562  C  CB    . LYS A 1 73  ? 144.893 183.607 16.842  1.00 18.60 ? 70  LYS A CB    1 
ATOM   563  C  CG    . LYS A 1 73  ? 143.568 184.368 16.678  1.00 21.89 ? 70  LYS A CG    1 
ATOM   564  C  CD    . LYS A 1 73  ? 142.352 183.447 16.693  1.00 19.89 ? 70  LYS A CD    1 
ATOM   565  C  CE    . LYS A 1 73  ? 141.074 184.268 16.489  1.00 20.12 ? 70  LYS A CE    1 
ATOM   566  N  NZ    . LYS A 1 73  ? 139.855 183.405 16.501  1.00 30.07 ? 70  LYS A NZ    1 
ATOM   567  N  N     . LEU A 1 74  ? 147.861 182.951 15.682  1.00 25.43 ? 71  LEU A N     1 
ATOM   568  C  CA    . LEU A 1 74  ? 149.146 182.245 15.747  1.00 26.08 ? 71  LEU A CA    1 
ATOM   569  C  C     . LEU A 1 74  ? 150.303 183.175 15.378  1.00 22.56 ? 71  LEU A C     1 
ATOM   570  O  O     . LEU A 1 74  ? 151.410 183.055 15.892  1.00 25.68 ? 71  LEU A O     1 
ATOM   571  C  CB    . LEU A 1 74  ? 149.150 181.042 14.795  1.00 22.14 ? 71  LEU A CB    1 
ATOM   572  C  CG    . LEU A 1 74  ? 148.053 179.987 14.926  1.00 24.53 ? 71  LEU A CG    1 
ATOM   573  C  CD1   . LEU A 1 74  ? 148.361 178.819 14.014  1.00 28.20 ? 71  LEU A CD1   1 
ATOM   574  C  CD2   . LEU A 1 74  ? 147.940 179.512 16.355  1.00 23.11 ? 71  LEU A CD2   1 
ATOM   575  N  N     . CYS A 1 75  ? 150.037 184.102 14.464  1.00 24.00 ? 72  CYS A N     1 
ATOM   576  C  CA    . CYS A 1 75  ? 151.097 184.935 13.896  1.00 23.87 ? 72  CYS A CA    1 
ATOM   577  C  C     . CYS A 1 75  ? 150.597 186.369 13.764  1.00 26.96 ? 72  CYS A C     1 
ATOM   578  O  O     . CYS A 1 75  ? 150.049 186.757 12.738  1.00 23.14 ? 72  CYS A O     1 
ATOM   579  C  CB    . CYS A 1 75  ? 151.545 184.373 12.547  1.00 23.94 ? 72  CYS A CB    1 
ATOM   580  S  SG    . CYS A 1 75  ? 152.906 185.264 11.757  1.00 25.56 ? 72  CYS A SG    1 
ATOM   581  N  N     . PRO A 1 76  ? 150.751 187.153 14.836  1.00 29.25 ? 73  PRO A N     1 
ATOM   582  C  CA    . PRO A 1 76  ? 150.192 188.508 14.923  1.00 24.72 ? 73  PRO A CA    1 
ATOM   583  C  C     . PRO A 1 76  ? 150.780 189.478 13.888  1.00 28.74 ? 73  PRO A C     1 
ATOM   584  O  O     . PRO A 1 76  ? 150.066 190.371 13.431  1.00 27.19 ? 73  PRO A O     1 
ATOM   585  C  CB    . PRO A 1 76  ? 150.553 188.942 16.350  1.00 24.87 ? 73  PRO A CB    1 
ATOM   586  C  CG    . PRO A 1 76  ? 150.744 187.654 17.094  1.00 28.15 ? 73  PRO A CG    1 
ATOM   587  C  CD    . PRO A 1 76  ? 151.359 186.718 16.109  1.00 20.78 ? 73  PRO A CD    1 
ATOM   588  N  N     . ASP A 1 77  ? 152.046 189.299 13.520  1.00 27.11 ? 74  ASP A N     1 
ATOM   589  C  CA    . ASP A 1 77  ? 152.667 190.149 12.506  1.00 24.69 ? 74  ASP A CA    1 
ATOM   590  C  C     . ASP A 1 77  ? 152.441 189.695 11.065  1.00 30.31 ? 74  ASP A C     1 
ATOM   591  O  O     . ASP A 1 77  ? 153.045 190.269 10.148  1.00 22.64 ? 74  ASP A O     1 
ATOM   592  C  CB    . ASP A 1 77  ? 154.174 190.231 12.723  1.00 27.20 ? 74  ASP A CB    1 
ATOM   593  C  CG    . ASP A 1 77  ? 154.540 191.007 13.957  1.00 45.08 ? 74  ASP A CG    1 
ATOM   594  O  OD1   . ASP A 1 77  ? 153.737 191.873 14.373  1.00 42.11 ? 74  ASP A OD1   1 
ATOM   595  O  OD2   . ASP A 1 77  ? 155.629 190.747 14.509  1.00 53.74 ? 74  ASP A OD2   1 
ATOM   596  N  N     . LEU A 1 78  ? 151.608 188.670 10.867  1.00 23.02 ? 75  LEU A N     1 
ATOM   597  C  CA    . LEU A 1 78  ? 151.408 188.073 9.537   1.00 20.87 ? 75  LEU A CA    1 
ATOM   598  C  C     . LEU A 1 78  ? 151.026 189.145 8.500   1.00 22.76 ? 75  LEU A C     1 
ATOM   599  O  O     . LEU A 1 78  ? 150.115 189.925 8.718   1.00 21.40 ? 75  LEU A O     1 
ATOM   600  C  CB    . LEU A 1 78  ? 150.327 186.981 9.591   1.00 16.08 ? 75  LEU A CB    1 
ATOM   601  C  CG    . LEU A 1 78  ? 149.986 186.202 8.306   1.00 22.61 ? 75  LEU A CG    1 
ATOM   602  C  CD1   . LEU A 1 78  ? 151.144 185.320 7.812   1.00 14.92 ? 75  LEU A CD1   1 
ATOM   603  C  CD2   . LEU A 1 78  ? 148.740 185.367 8.532   1.00 18.92 ? 75  LEU A CD2   1 
ATOM   604  N  N     . LEU A 1 79  ? 151.727 189.184 7.372   1.00 21.23 ? 76  LEU A N     1 
ATOM   605  C  CA    . LEU A 1 79  ? 151.376 190.138 6.331   1.00 19.23 ? 76  LEU A CA    1 
ATOM   606  C  C     . LEU A 1 79  ? 150.479 189.458 5.283   1.00 25.50 ? 76  LEU A C     1 
ATOM   607  O  O     . LEU A 1 79  ? 150.600 188.273 5.023   1.00 17.71 ? 76  LEU A O     1 
ATOM   608  C  CB    . LEU A 1 79  ? 152.640 190.722 5.692   1.00 17.68 ? 76  LEU A CB    1 
ATOM   609  C  CG    . LEU A 1 79  ? 153.599 191.466 6.646   1.00 21.91 ? 76  LEU A CG    1 
ATOM   610  C  CD1   . LEU A 1 79  ? 154.818 192.011 5.894   1.00 19.90 ? 76  LEU A CD1   1 
ATOM   611  C  CD2   . LEU A 1 79  ? 152.891 192.596 7.391   1.00 18.40 ? 76  LEU A CD2   1 
ATOM   612  N  N     . LEU A 1 80  ? 149.586 190.220 4.668   1.00 22.67 ? 77  LEU A N     1 
ATOM   613  C  CA    . LEU A 1 80  ? 148.632 189.632 3.747   1.00 22.99 ? 77  LEU A CA    1 
ATOM   614  C  C     . LEU A 1 80  ? 148.621 190.328 2.395   1.00 23.99 ? 77  LEU A C     1 
ATOM   615  O  O     . LEU A 1 80  ? 148.668 191.558 2.322   1.00 23.95 ? 77  LEU A O     1 
ATOM   616  C  CB    . LEU A 1 80  ? 147.227 189.667 4.353   1.00 23.97 ? 77  LEU A CB    1 
ATOM   617  C  CG    . LEU A 1 80  ? 147.059 188.899 5.662   1.00 27.32 ? 77  LEU A CG    1 
ATOM   618  C  CD1   . LEU A 1 80  ? 145.656 189.086 6.229   1.00 25.23 ? 77  LEU A CD1   1 
ATOM   619  C  CD2   . LEU A 1 80  ? 147.372 187.417 5.424   1.00 22.46 ? 77  LEU A CD2   1 
ATOM   620  N  N     . ALA A 1 81  ? 148.565 189.530 1.330   1.00 23.06 ? 78  ALA A N     1 
ATOM   621  C  CA    . ALA A 1 81  ? 148.246 190.042 0.001   1.00 19.67 ? 78  ALA A CA    1 
ATOM   622  C  C     . ALA A 1 81  ? 146.949 189.402 -0.441  1.00 21.15 ? 78  ALA A C     1 
ATOM   623  O  O     . ALA A 1 81  ? 146.688 188.224 -0.154  1.00 22.55 ? 78  ALA A O     1 
ATOM   624  C  CB    . ALA A 1 81  ? 149.374 189.748 -0.986  1.00 23.69 ? 78  ALA A CB    1 
ATOM   625  N  N     . GLN A 1 82  ? 146.096 190.155 -1.114  1.00 22.65 ? 79  GLN A N     1 
ATOM   626  C  CA    . GLN A 1 82  ? 144.851 189.540 -1.530  1.00 26.88 ? 79  GLN A CA    1 
ATOM   627  C  C     . GLN A 1 82  ? 144.750 189.361 -3.034  1.00 18.47 ? 79  GLN A C     1 
ATOM   628  O  O     . GLN A 1 82  ? 145.262 190.154 -3.829  1.00 23.61 ? 79  GLN A O     1 
ATOM   629  C  CB    . GLN A 1 82  ? 143.646 190.323 -1.011  1.00 31.88 ? 79  GLN A CB    1 
ATOM   630  C  CG    . GLN A 1 82  ? 143.553 191.758 -1.404  1.00 32.76 ? 79  GLN A CG    1 
ATOM   631  C  CD    . GLN A 1 82  ? 142.578 192.498 -0.494  1.00 47.36 ? 79  GLN A CD    1 
ATOM   632  O  OE1   . GLN A 1 82  ? 141.372 192.486 -0.723  1.00 50.48 ? 79  GLN A OE1   1 
ATOM   633  N  NE2   . GLN A 1 82  ? 143.097 193.098 0.573   1.00 35.55 ? 79  GLN A NE2   1 
ATOM   634  N  N     . VAL A 1 83  ? 144.098 188.271 -3.397  1.00 17.73 ? 80  VAL A N     1 
ATOM   635  C  CA    . VAL A 1 83  ? 143.851 187.934 -4.782  1.00 23.96 ? 80  VAL A CA    1 
ATOM   636  C  C     . VAL A 1 83  ? 143.033 189.045 -5.426  1.00 25.62 ? 80  VAL A C     1 
ATOM   637  O  O     . VAL A 1 83  ? 142.117 189.584 -4.807  1.00 20.39 ? 80  VAL A O     1 
ATOM   638  C  CB    . VAL A 1 83  ? 143.129 186.588 -4.875  1.00 19.63 ? 80  VAL A CB    1 
ATOM   639  C  CG1   . VAL A 1 83  ? 142.689 186.304 -6.298  1.00 22.51 ? 80  VAL A CG1   1 
ATOM   640  C  CG2   . VAL A 1 83  ? 144.054 185.476 -4.335  1.00 20.24 ? 80  VAL A CG2   1 
ATOM   641  N  N     . ARG A 1 84  ? 143.388 189.409 -6.652  1.00 24.16 ? 81  ARG A N     1 
ATOM   642  C  CA    . ARG A 1 84  ? 142.615 190.394 -7.390  1.00 27.21 ? 81  ARG A CA    1 
ATOM   643  C  C     . ARG A 1 84  ? 141.153 189.962 -7.459  1.00 30.58 ? 81  ARG A C     1 
ATOM   644  O  O     . ARG A 1 84  ? 140.853 188.776 -7.607  1.00 32.90 ? 81  ARG A O     1 
ATOM   645  C  CB    . ARG A 1 84  ? 143.173 190.575 -8.799  1.00 31.75 ? 81  ARG A CB    1 
ATOM   646  C  CG    . ARG A 1 84  ? 142.224 191.312 -9.761  1.00 32.30 ? 81  ARG A CG    1 
ATOM   647  C  CD    . ARG A 1 84  ? 142.838 191.408 -11.146 1.00 33.93 ? 81  ARG A CD    1 
ATOM   648  N  NE    . ARG A 1 84  ? 141.882 191.761 -12.189 1.00 47.63 ? 81  ARG A NE    1 
ATOM   649  C  CZ    . ARG A 1 84  ? 142.089 191.556 -13.489 0.42 44.12 ? 81  ARG A CZ    1 
ATOM   650  N  NH1   . ARG A 1 84  ? 143.219 190.992 -13.910 0.65 32.38 ? 81  ARG A NH1   1 
ATOM   651  N  NH2   . ARG A 1 84  ? 141.160 191.907 -14.368 0.59 41.80 ? 81  ARG A NH2   1 
ATOM   652  N  N     . GLU A 1 85  ? 140.247 190.922 -7.345  1.00 27.88 ? 82  GLU A N     1 
ATOM   653  C  CA    . GLU A 1 85  ? 138.823 190.633 -7.442  1.00 29.25 ? 82  GLU A CA    1 
ATOM   654  C  C     . GLU A 1 85  ? 138.214 191.324 -8.674  1.00 30.31 ? 82  GLU A C     1 
ATOM   655  O  O     . GLU A 1 85  ? 138.342 192.532 -8.824  1.00 31.06 ? 82  GLU A O     1 
ATOM   656  C  CB    . GLU A 1 85  ? 138.128 191.084 -6.166  1.00 30.96 ? 82  GLU A CB    1 
ATOM   657  C  CG    . GLU A 1 85  ? 136.756 190.500 -5.964  1.00 41.21 ? 82  GLU A CG    1 
ATOM   658  C  CD    . GLU A 1 85  ? 136.276 190.672 -4.539  1.00 45.51 ? 82  GLU A CD    1 
ATOM   659  O  OE1   . GLU A 1 85  ? 137.136 190.800 -3.634  1.00 44.44 ? 82  GLU A OE1   1 
ATOM   660  O  OE2   . GLU A 1 85  ? 135.043 190.683 -4.328  1.00 40.23 ? 82  GLU A OE2   1 
ATOM   661  N  N     . SER A 1 86  ? 137.572 190.560 -9.558  1.00 26.01 ? 83  SER A N     1 
ATOM   662  C  CA    . SER A 1 86  ? 136.921 191.142 -10.740 1.00 32.28 ? 83  SER A CA    1 
ATOM   663  C  C     . SER A 1 86  ? 135.541 190.560 -10.949 1.00 27.74 ? 83  SER A C     1 
ATOM   664  O  O     . SER A 1 86  ? 135.365 189.354 -10.881 1.00 28.54 ? 83  SER A O     1 
ATOM   665  C  CB    . SER A 1 86  ? 137.757 190.926 -12.005 1.00 31.74 ? 83  SER A CB    1 
ATOM   666  O  OG    . SER A 1 86  ? 139.041 191.495 -11.851 1.00 42.17 ? 83  SER A OG    1 
ATOM   667  N  N     . ARG A 1 87  ? 134.571 191.434 -11.201 1.00 31.25 ? 84  ARG A N     1 
ATOM   668  C  CA    . ARG A 1 87  ? 133.167 191.051 -11.359 1.00 32.86 ? 84  ARG A CA    1 
ATOM   669  C  C     . ARG A 1 87  ? 132.622 190.303 -10.155 1.00 30.46 ? 84  ARG A C     1 
ATOM   670  O  O     . ARG A 1 87  ? 131.761 189.430 -10.283 1.00 34.02 ? 84  ARG A O     1 
ATOM   671  C  CB    . ARG A 1 87  ? 132.983 190.205 -12.609 1.00 27.15 ? 84  ARG A CB    1 
ATOM   672  C  CG    . ARG A 1 87  ? 133.495 190.871 -13.846 1.00 30.98 ? 84  ARG A CG    1 
ATOM   673  C  CD    . ARG A 1 87  ? 133.239 190.007 -15.059 1.00 33.83 ? 84  ARG A CD    1 
ATOM   674  N  NE    . ARG A 1 87  ? 133.406 190.800 -16.266 1.00 42.52 ? 84  ARG A NE    1 
ATOM   675  C  CZ    . ARG A 1 87  ? 134.535 190.880 -16.957 1.00 38.05 ? 84  ARG A CZ    1 
ATOM   676  N  NH1   . ARG A 1 87  ? 135.599 190.186 -16.571 1.00 41.21 ? 84  ARG A NH1   1 
ATOM   677  N  NH2   . ARG A 1 87  ? 134.589 191.653 -18.038 1.00 39.63 ? 84  ARG A NH2   1 
ATOM   678  N  N     . GLY A 1 88  ? 133.134 190.638 -8.984  1.00 28.39 ? 85  GLY A N     1 
ATOM   679  C  CA    . GLY A 1 88  ? 132.649 190.036 -7.763  1.00 30.08 ? 85  GLY A CA    1 
ATOM   680  C  C     . GLY A 1 88  ? 133.274 188.697 -7.464  1.00 28.87 ? 85  GLY A C     1 
ATOM   681  O  O     . GLY A 1 88  ? 132.783 187.972 -6.608  1.00 28.77 ? 85  GLY A O     1 
ATOM   682  N  N     . LYS A 1 89  ? 134.355 188.353 -8.159  1.00 25.57 ? 86  LYS A N     1 
ATOM   683  C  CA    . LYS A 1 89  ? 134.988 187.071 -7.904  1.00 21.66 ? 86  LYS A CA    1 
ATOM   684  C  C     . LYS A 1 89  ? 136.509 187.150 -7.958  1.00 26.40 ? 86  LYS A C     1 
ATOM   685  O  O     . LYS A 1 89  ? 137.088 188.075 -8.541  1.00 21.94 ? 86  LYS A O     1 
ATOM   686  C  CB    . LYS A 1 89  ? 134.479 186.012 -8.896  1.00 26.27 ? 86  LYS A CB    1 
ATOM   687  C  CG    . LYS A 1 89  ? 134.989 186.174 -10.327 1.00 27.99 ? 86  LYS A CG    1 
ATOM   688  C  CD    . LYS A 1 89  ? 134.500 185.033 -11.205 1.00 30.92 ? 86  LYS A CD    1 
ATOM   689  C  CE    . LYS A 1 89  ? 135.080 183.699 -10.768 1.00 21.95 ? 86  LYS A CE    1 
ATOM   690  N  NZ    . LYS A 1 89  ? 136.558 183.621 -11.079 1.00 25.88 ? 86  LYS A NZ    1 
ATOM   691  N  N     . ALA A 1 90  ? 137.149 186.160 -7.351  1.00 21.70 ? 87  ALA A N     1 
ATOM   692  C  CA    . ALA A 1 90  ? 138.604 186.077 -7.346  1.00 29.32 ? 87  ALA A CA    1 
ATOM   693  C  C     . ALA A 1 90  ? 139.098 185.774 -8.755  1.00 29.50 ? 87  ALA A C     1 
ATOM   694  O  O     . ALA A 1 90  ? 138.521 184.947 -9.462  1.00 26.87 ? 87  ALA A O     1 
ATOM   695  C  CB    . ALA A 1 90  ? 139.081 185.018 -6.361  1.00 34.02 ? 87  ALA A CB    1 
ATOM   696  N  N     . ASN A 1 91  ? 140.147 186.483 -9.164  1.00 26.44 ? 88  ASN A N     1 
ATOM   697  C  CA    . ASN A 1 91  ? 140.708 186.363 -10.506 1.00 27.14 ? 88  ASN A CA    1 
ATOM   698  C  C     . ASN A 1 91  ? 142.166 185.943 -10.434 1.00 29.46 ? 88  ASN A C     1 
ATOM   699  O  O     . ASN A 1 91  ? 142.988 186.650 -9.850  1.00 20.27 ? 88  ASN A O     1 
ATOM   700  C  CB    . ASN A 1 91  ? 140.586 187.689 -11.260 1.00 30.29 ? 88  ASN A CB    1 
ATOM   701  C  CG    . ASN A 1 91  ? 140.883 187.549 -12.753 1.00 35.46 ? 88  ASN A CG    1 
ATOM   702  O  OD1   . ASN A 1 91  ? 141.985 187.181 -13.149 1.00 32.15 ? 88  ASN A OD1   1 
ATOM   703  N  ND2   . ASN A 1 91  ? 139.896 187.865 -13.584 1.00 42.29 ? 88  ASN A ND2   1 
ATOM   704  N  N     . LEU A 1 92  ? 142.497 184.809 -11.043 1.00 25.35 ? 89  LEU A N     1 
ATOM   705  C  CA    . LEU A 1 92  ? 143.834 184.232 -10.862 1.00 26.25 ? 89  LEU A CA    1 
ATOM   706  C  C     . LEU A 1 92  ? 144.821 184.594 -11.970 1.00 23.92 ? 89  LEU A C     1 
ATOM   707  O  O     . LEU A 1 92  ? 145.909 184.030 -12.027 1.00 18.23 ? 89  LEU A O     1 
ATOM   708  C  CB    . LEU A 1 92  ? 143.734 182.708 -10.752 1.00 25.49 ? 89  LEU A CB    1 
ATOM   709  C  CG    . LEU A 1 92  ? 142.668 182.243 -9.760  1.00 19.84 ? 89  LEU A CG    1 
ATOM   710  C  CD1   . LEU A 1 92  ? 142.587 180.719 -9.750  1.00 35.80 ? 89  LEU A CD1   1 
ATOM   711  C  CD2   . LEU A 1 92  ? 142.977 182.782 -8.374  1.00 20.95 ? 89  LEU A CD2   1 
ATOM   712  N  N     . THR A 1 93  ? 144.448 185.530 -12.838 1.00 16.55 ? 90  THR A N     1 
ATOM   713  C  CA    . THR A 1 93  ? 145.291 185.879 -13.987 1.00 20.11 ? 90  THR A CA    1 
ATOM   714  C  C     . THR A 1 93  ? 146.773 186.144 -13.642 1.00 21.29 ? 90  THR A C     1 
ATOM   715  O  O     . THR A 1 93  ? 147.673 185.689 -14.355 1.00 21.30 ? 90  THR A O     1 
ATOM   716  C  CB    . THR A 1 93  ? 144.730 187.126 -14.723 1.00 23.90 ? 90  THR A CB    1 
ATOM   717  O  OG1   . THR A 1 93  ? 143.337 186.931 -15.001 1.00 23.07 ? 90  THR A OG1   1 
ATOM   718  C  CG2   . THR A 1 93  ? 145.460 187.348 -16.022 1.00 16.23 ? 90  THR A CG2   1 
ATOM   719  N  N     . LYS A 1 94  ? 147.034 186.857 -12.551 1.00 20.03 ? 91  LYS A N     1 
ATOM   720  C  CA    . LYS A 1 94  ? 148.415 187.186 -12.187 1.00 19.52 ? 91  LYS A CA    1 
ATOM   721  C  C     . LYS A 1 94  ? 149.270 185.938 -12.004 1.00 20.52 ? 91  LYS A C     1 
ATOM   722  O  O     . LYS A 1 94  ? 150.444 185.918 -12.389 1.00 22.91 ? 91  LYS A O     1 
ATOM   723  C  CB    . LYS A 1 94  ? 148.466 188.020 -10.904 1.00 17.50 ? 91  LYS A CB    1 
ATOM   724  C  CG    . LYS A 1 94  ? 149.817 188.701 -10.672 1.00 24.23 ? 91  LYS A CG    1 
ATOM   725  C  CD    . LYS A 1 94  ? 149.971 189.202 -9.218  1.00 19.39 ? 91  LYS A CD    1 
ATOM   726  C  CE    . LYS A 1 94  ? 148.961 190.288 -8.888  1.00 23.85 ? 91  LYS A CE    1 
ATOM   727  N  NZ    . LYS A 1 94  ? 149.318 190.973 -7.618  1.00 25.38 ? 91  LYS A NZ    1 
ATOM   728  N  N     . TYR A 1 95  ? 148.661 184.896 -11.437 1.00 17.12 ? 92  TYR A N     1 
ATOM   729  C  CA    . TYR A 1 95  ? 149.368 183.663 -11.113 1.00 21.05 ? 92  TYR A CA    1 
ATOM   730  C  C     . TYR A 1 95  ? 149.468 182.781 -12.349 1.00 19.01 ? 92  TYR A C     1 
ATOM   731  O  O     . TYR A 1 95  ? 150.477 182.093 -12.547 1.00 17.02 ? 92  TYR A O     1 
ATOM   732  C  CB    . TYR A 1 95  ? 148.665 182.941 -9.952  1.00 15.10 ? 92  TYR A CB    1 
ATOM   733  C  CG    . TYR A 1 95  ? 148.354 183.915 -8.838  1.00 19.85 ? 92  TYR A CG    1 
ATOM   734  C  CD1   . TYR A 1 95  ? 149.372 184.517 -8.115  1.00 14.87 ? 92  TYR A CD1   1 
ATOM   735  C  CD2   . TYR A 1 95  ? 147.043 184.285 -8.560  1.00 25.14 ? 92  TYR A CD2   1 
ATOM   736  C  CE1   . TYR A 1 95  ? 149.089 185.454 -7.123  1.00 21.87 ? 92  TYR A CE1   1 
ATOM   737  C  CE2   . TYR A 1 95  ? 146.749 185.212 -7.578  1.00 21.64 ? 92  TYR A CE2   1 
ATOM   738  C  CZ    . TYR A 1 95  ? 147.766 185.792 -6.863  1.00 20.65 ? 92  TYR A CZ    1 
ATOM   739  O  OH    . TYR A 1 95  ? 147.454 186.720 -5.899  1.00 24.69 ? 92  TYR A OH    1 
ATOM   740  N  N     . ARG A 1 96  ? 148.431 182.803 -13.189 1.00 18.42 ? 93  ARG A N     1 
ATOM   741  C  CA    . ARG A 1 96  ? 148.492 182.074 -14.459 1.00 24.52 ? 93  ARG A CA    1 
ATOM   742  C  C     . ARG A 1 96  ? 149.597 182.641 -15.357 1.00 20.06 ? 93  ARG A C     1 
ATOM   743  O  O     . ARG A 1 96  ? 150.290 181.909 -16.070 1.00 22.43 ? 93  ARG A O     1 
ATOM   744  C  CB    . ARG A 1 96  ? 147.149 182.128 -15.186 1.00 26.06 ? 93  ARG A CB    1 
ATOM   745  C  CG    . ARG A 1 96  ? 146.036 181.378 -14.478 1.00 26.68 ? 93  ARG A CG    1 
ATOM   746  C  CD    . ARG A 1 96  ? 144.899 181.051 -15.438 1.00 26.14 ? 93  ARG A CD    1 
ATOM   747  N  NE    . ARG A 1 96  ? 143.832 180.349 -14.745 1.00 30.54 ? 93  ARG A NE    1 
ATOM   748  C  CZ    . ARG A 1 96  ? 142.761 180.949 -14.233 1.00 27.97 ? 93  ARG A CZ    1 
ATOM   749  N  NH1   . ARG A 1 96  ? 142.610 182.263 -14.364 1.00 23.66 ? 93  ARG A NH1   1 
ATOM   750  N  NH2   . ARG A 1 96  ? 141.839 180.232 -13.598 1.00 32.94 ? 93  ARG A NH2   1 
ATOM   751  N  N     . GLU A 1 97  ? 149.752 183.957 -15.326 1.00 21.21 ? 94  GLU A N     1 
ATOM   752  C  CA    . GLU A 1 97  ? 150.772 184.601 -16.134 1.00 18.15 ? 94  GLU A CA    1 
ATOM   753  C  C     . GLU A 1 97  ? 152.171 184.343 -15.594 1.00 20.56 ? 94  GLU A C     1 
ATOM   754  O  O     . GLU A 1 97  ? 153.102 184.116 -16.375 1.00 23.18 ? 94  GLU A O     1 
ATOM   755  C  CB    . GLU A 1 97  ? 150.484 186.091 -16.243 1.00 22.58 ? 94  GLU A CB    1 
ATOM   756  C  CG    . GLU A 1 97  ? 149.359 186.345 -17.232 1.00 29.37 ? 94  GLU A CG    1 
ATOM   757  C  CD    . GLU A 1 97  ? 149.026 187.812 -17.407 1.00 39.01 ? 94  GLU A CD    1 
ATOM   758  O  OE1   . GLU A 1 97  ? 149.577 188.656 -16.663 1.00 49.22 ? 94  GLU A OE1   1 
ATOM   759  O  OE2   . GLU A 1 97  ? 148.209 188.117 -18.302 1.00 42.59 ? 94  GLU A OE2   1 
ATOM   760  N  N     . ALA A 1 98  ? 152.323 184.344 -14.271 1.00 18.56 ? 95  ALA A N     1 
ATOM   761  C  CA    . ALA A 1 98  ? 153.609 184.021 -13.680 1.00 21.04 ? 95  ALA A CA    1 
ATOM   762  C  C     . ALA A 1 98  ? 153.947 182.570 -14.005 1.00 16.88 ? 95  ALA A C     1 
ATOM   763  O  O     . ALA A 1 98  ? 155.109 182.222 -14.224 1.00 17.77 ? 95  ALA A O     1 
ATOM   764  C  CB    . ALA A 1 98  ? 153.596 184.259 -12.149 1.00 14.67 ? 95  ALA A CB    1 
ATOM   765  N  N     . SER A 1 99  ? 152.924 181.722 -14.009 1.00 15.81 ? 96  SER A N     1 
ATOM   766  C  CA    . SER A 1 99  ? 153.079 180.317 -14.414 1.00 16.68 ? 96  SER A CA    1 
ATOM   767  C  C     . SER A 1 99  ? 153.672 180.160 -15.821 1.00 24.23 ? 96  SER A C     1 
ATOM   768  O  O     . SER A 1 99  ? 154.581 179.349 -16.058 1.00 15.06 ? 96  SER A O     1 
ATOM   769  C  CB    . SER A 1 99  ? 151.726 179.605 -14.366 1.00 19.60 ? 96  SER A CB    1 
ATOM   770  O  OG    . SER A 1 99  ? 151.872 178.213 -14.612 1.00 20.40 ? 96  SER A OG    1 
ATOM   771  N  N     . VAL A 1 100 ? 153.127 180.911 -16.766 1.00 21.51 ? 97  VAL A N     1 
ATOM   772  C  CA    . VAL A 1 100 ? 153.650 180.879 -18.122 1.00 19.03 ? 97  VAL A CA    1 
ATOM   773  C  C     . VAL A 1 100 ? 155.130 181.268 -18.160 1.00 18.57 ? 97  VAL A C     1 
ATOM   774  O  O     . VAL A 1 100 ? 155.914 180.615 -18.829 1.00 19.85 ? 97  VAL A O     1 
ATOM   775  C  CB    . VAL A 1 100 ? 152.840 181.796 -19.046 1.00 13.06 ? 97  VAL A CB    1 
ATOM   776  C  CG1   . VAL A 1 100 ? 153.567 181.993 -20.395 1.00 19.98 ? 97  VAL A CG1   1 
ATOM   777  C  CG2   . VAL A 1 100 ? 151.435 181.220 -19.248 1.00 19.11 ? 97  VAL A CG2   1 
ATOM   778  N  N     . GLU A 1 101 ? 155.520 182.314 -17.431 1.00 20.04 ? 98  GLU A N     1 
ATOM   779  C  CA    . GLU A 1 101 ? 156.947 182.648 -17.303 1.00 19.65 ? 98  GLU A CA    1 
ATOM   780  C  C     . GLU A 1 101 ? 157.801 181.416 -17.034 1.00 22.97 ? 98  GLU A C     1 
ATOM   781  O  O     . GLU A 1 101 ? 158.802 181.166 -17.716 1.00 21.21 ? 98  GLU A O     1 
ATOM   782  C  CB    . GLU A 1 101 ? 157.183 183.659 -16.176 1.00 21.60 ? 98  GLU A CB    1 
ATOM   783  C  CG    . GLU A 1 101 ? 156.724 185.067 -16.495 1.00 22.90 ? 98  GLU A CG    1 
ATOM   784  C  CD    . GLU A 1 101 ? 157.088 186.059 -15.396 1.00 28.67 ? 98  GLU A CD    1 
ATOM   785  O  OE1   . GLU A 1 101 ? 158.299 186.360 -15.219 1.00 20.66 ? 98  GLU A OE1   1 
ATOM   786  O  OE2   . GLU A 1 101 ? 156.152 186.528 -14.708 1.00 21.83 ? 98  GLU A OE2   1 
ATOM   787  N  N     . VAL A 1 102 ? 157.383 180.639 -16.039 1.00 21.03 ? 99  VAL A N     1 
ATOM   788  C  CA    . VAL A 1 102 ? 158.179 179.523 -15.574 1.00 18.68 ? 99  VAL A CA    1 
ATOM   789  C  C     . VAL A 1 102 ? 158.157 178.375 -16.552 1.00 18.23 ? 99  VAL A C     1 
ATOM   790  O  O     . VAL A 1 102 ? 159.202 177.786 -16.847 1.00 21.01 ? 99  VAL A O     1 
ATOM   791  C  CB    . VAL A 1 102 ? 157.699 179.015 -14.213 1.00 22.31 ? 99  VAL A CB    1 
ATOM   792  C  CG1   . VAL A 1 102 ? 158.432 177.741 -13.875 1.00 28.66 ? 99  VAL A CG1   1 
ATOM   793  C  CG2   . VAL A 1 102 ? 157.947 180.086 -13.141 1.00 20.57 ? 99  VAL A CG2   1 
ATOM   794  N  N     . MET A 1 103 ? 156.967 178.068 -17.062 1.00 17.52 ? 100 MET A N     1 
ATOM   795  C  CA    . MET A 1 103 ? 156.811 176.965 -18.017 1.00 26.17 ? 100 MET A CA    1 
ATOM   796  C  C     . MET A 1 103 ? 157.630 177.186 -19.284 1.00 22.17 ? 100 MET A C     1 
ATOM   797  O  O     . MET A 1 103 ? 158.149 176.241 -19.864 1.00 20.91 ? 100 MET A O     1 
ATOM   798  C  CB    . MET A 1 103 ? 155.334 176.770 -18.388 1.00 22.13 ? 100 MET A CB    1 
ATOM   799  C  CG    . MET A 1 103 ? 154.430 176.453 -17.202 1.00 27.95 ? 100 MET A CG    1 
ATOM   800  S  SD    . MET A 1 103 ? 154.780 174.853 -16.433 1.00 27.68 ? 100 MET A SD    1 
ATOM   801  C  CE    . MET A 1 103 ? 153.826 174.979 -14.904 1.00 25.43 ? 100 MET A CE    1 
ATOM   802  N  N     . GLU A 1 104 ? 157.745 178.431 -19.726 1.00 21.31 ? 101 GLU A N     1 
ATOM   803  C  CA    . GLU A 1 104 ? 158.450 178.684 -20.986 1.00 21.05 ? 101 GLU A CA    1 
ATOM   804  C  C     . GLU A 1 104 ? 159.957 178.546 -20.819 1.00 23.33 ? 101 GLU A C     1 
ATOM   805  O  O     . GLU A 1 104 ? 160.644 178.124 -21.738 1.00 22.86 ? 101 GLU A O     1 
ATOM   806  C  CB    . GLU A 1 104 ? 158.093 180.058 -21.536 1.00 25.34 ? 101 GLU A CB    1 
ATOM   807  C  CG    . GLU A 1 104 ? 156.650 180.106 -22.023 1.00 25.20 ? 101 GLU A CG    1 
ATOM   808  C  CD    . GLU A 1 104 ? 156.304 181.404 -22.719 1.00 37.98 ? 101 GLU A CD    1 
ATOM   809  O  OE1   . GLU A 1 104 ? 157.107 182.362 -22.638 1.00 33.31 ? 101 GLU A OE1   1 
ATOM   810  O  OE2   . GLU A 1 104 ? 155.223 181.459 -23.344 1.00 39.26 ? 101 GLU A OE2   1 
ATOM   811  N  N     . ILE A 1 105 ? 160.468 178.896 -19.642 1.00 25.88 ? 102 ILE A N     1 
ATOM   812  C  CA    . ILE A 1 105 ? 161.872 178.652 -19.325 1.00 19.53 ? 102 ILE A CA    1 
ATOM   813  C  C     . ILE A 1 105 ? 162.158 177.142 -19.287 1.00 20.70 ? 102 ILE A C     1 
ATOM   814  O  O     . ILE A 1 105 ? 163.116 176.668 -19.903 1.00 22.22 ? 102 ILE A O     1 
ATOM   815  C  CB    . ILE A 1 105 ? 162.262 179.314 -17.984 1.00 21.26 ? 102 ILE A CB    1 
ATOM   816  C  CG1   . ILE A 1 105 ? 162.158 180.834 -18.110 1.00 25.95 ? 102 ILE A CG1   1 
ATOM   817  C  CG2   . ILE A 1 105 ? 163.682 178.902 -17.543 1.00 20.83 ? 102 ILE A CG2   1 
ATOM   818  C  CD1   . ILE A 1 105 ? 162.384 181.574 -16.807 1.00 24.92 ? 102 ILE A CD1   1 
ATOM   819  N  N     . MET A 1 106 ? 161.325 176.378 -18.589 1.00 18.75 ? 103 MET A N     1 
ATOM   820  C  CA    . MET A 1 106 ? 161.547 174.924 -18.506 1.00 23.85 ? 103 MET A CA    1 
ATOM   821  C  C     . MET A 1 106 ? 161.494 174.240 -19.875 1.00 24.76 ? 103 MET A C     1 
ATOM   822  O  O     . MET A 1 106 ? 162.241 173.291 -20.147 1.00 18.13 ? 103 MET A O     1 
ATOM   823  C  CB    . MET A 1 106 ? 160.525 174.279 -17.578 1.00 19.33 ? 103 MET A CB    1 
ATOM   824  C  CG    . MET A 1 106 ? 160.789 174.552 -16.107 1.00 21.97 ? 103 MET A CG    1 
ATOM   825  S  SD    . MET A 1 106 ? 159.517 173.870 -15.028 1.00 26.65 ? 103 MET A SD    1 
ATOM   826  C  CE    . MET A 1 106 ? 159.662 172.115 -15.339 1.00 27.74 ? 103 MET A CE    1 
ATOM   827  N  N     . SER A 1 107 ? 160.586 174.718 -20.717 1.00 18.33 ? 104 SER A N     1 
ATOM   828  C  CA    . SER A 1 107 ? 160.422 174.202 -22.067 1.00 25.33 ? 104 SER A CA    1 
ATOM   829  C  C     . SER A 1 107 ? 161.664 174.405 -22.941 1.00 31.48 ? 104 SER A C     1 
ATOM   830  O  O     . SER A 1 107 ? 161.793 173.748 -23.974 1.00 29.58 ? 104 SER A O     1 
ATOM   831  C  CB    . SER A 1 107 ? 159.207 174.852 -22.729 1.00 24.45 ? 104 SER A CB    1 
ATOM   832  O  OG    . SER A 1 107 ? 158.025 174.474 -22.041 1.00 43.42 ? 104 SER A OG    1 
ATOM   833  N  N     . ARG A 1 108 ? 162.577 175.293 -22.537 1.00 26.56 ? 105 ARG A N     1 
ATOM   834  C  CA    . ARG A 1 108 ? 163.846 175.418 -23.261 1.00 24.31 ? 105 ARG A CA    1 
ATOM   835  C  C     . ARG A 1 108 ? 164.732 174.185 -23.061 1.00 31.23 ? 105 ARG A C     1 
ATOM   836  O  O     . ARG A 1 108 ? 165.531 173.843 -23.929 1.00 24.38 ? 105 ARG A O     1 
ATOM   837  C  CB    . ARG A 1 108 ? 164.618 176.665 -22.827 1.00 28.52 ? 105 ARG A CB    1 
ATOM   838  C  CG    . ARG A 1 108 ? 163.901 177.977 -23.084 1.00 28.76 ? 105 ARG A CG    1 
ATOM   839  C  CD    . ARG A 1 108 ? 164.902 179.088 -23.301 1.00 30.72 ? 105 ARG A CD    1 
ATOM   840  N  NE    . ARG A 1 108 ? 165.925 179.174 -22.258 1.00 26.78 ? 105 ARG A NE    1 
ATOM   841  C  CZ    . ARG A 1 108 ? 165.870 180.024 -21.232 1.00 30.76 ? 105 ARG A CZ    1 
ATOM   842  N  NH1   . ARG A 1 108 ? 164.834 180.845 -21.102 1.00 27.09 ? 105 ARG A NH1   1 
ATOM   843  N  NH2   . ARG A 1 108 ? 166.846 180.056 -20.335 1.00 21.86 ? 105 ARG A NH2   1 
ATOM   844  N  N     . PHE A 1 109 ? 164.588 173.519 -21.918 1.00 28.15 ? 106 PHE A N     1 
ATOM   845  C  CA    . PHE A 1 109 ? 165.478 172.406 -21.579 1.00 29.38 ? 106 PHE A CA    1 
ATOM   846  C  C     . PHE A 1 109 ? 164.986 171.064 -22.104 1.00 25.32 ? 106 PHE A C     1 
ATOM   847  O  O     . PHE A 1 109 ? 165.787 170.194 -22.451 1.00 36.82 ? 106 PHE A O     1 
ATOM   848  C  CB    . PHE A 1 109 ? 165.673 172.328 -20.062 1.00 20.62 ? 106 PHE A CB    1 
ATOM   849  C  CG    . PHE A 1 109 ? 166.454 173.490 -19.493 1.00 23.39 ? 106 PHE A CG    1 
ATOM   850  C  CD1   . PHE A 1 109 ? 165.849 174.714 -19.278 1.00 22.07 ? 106 PHE A CD1   1 
ATOM   851  C  CD2   . PHE A 1 109 ? 167.796 173.361 -19.194 1.00 23.47 ? 106 PHE A CD2   1 
ATOM   852  C  CE1   . PHE A 1 109 ? 166.563 175.786 -18.762 1.00 17.19 ? 106 PHE A CE1   1 
ATOM   853  C  CE2   . PHE A 1 109 ? 168.514 174.431 -18.680 1.00 30.07 ? 106 PHE A CE2   1 
ATOM   854  C  CZ    . PHE A 1 109 ? 167.895 175.642 -18.462 1.00 20.71 ? 106 PHE A CZ    1 
ATOM   855  N  N     . ALA A 1 110 ? 163.672 170.899 -22.174 1.00 25.03 ? 107 ALA A N     1 
ATOM   856  C  CA    . ALA A 1 110 ? 163.094 169.612 -22.518 1.00 26.21 ? 107 ALA A CA    1 
ATOM   857  C  C     . ALA A 1 110 ? 161.588 169.709 -22.657 1.00 23.57 ? 107 ALA A C     1 
ATOM   858  O  O     . ALA A 1 110 ? 160.980 170.723 -22.314 1.00 26.51 ? 107 ALA A O     1 
ATOM   859  C  CB    . ALA A 1 110 ? 163.459 168.572 -21.462 1.00 24.84 ? 107 ALA A CB    1 
ATOM   860  N  N     . VAL A 1 111 ? 160.976 168.640 -23.146 1.00 29.26 ? 108 VAL A N     1 
ATOM   861  C  CA    . VAL A 1 111 ? 159.528 168.602 -23.222 1.00 32.91 ? 108 VAL A CA    1 
ATOM   862  C  C     . VAL A 1 111 ? 158.955 168.521 -21.806 1.00 29.11 ? 108 VAL A C     1 
ATOM   863  O  O     . VAL A 1 111 ? 159.454 167.763 -20.958 1.00 31.55 ? 108 VAL A O     1 
ATOM   864  C  CB    . VAL A 1 111 ? 159.041 167.420 -24.074 1.00 47.49 ? 108 VAL A CB    1 
ATOM   865  C  CG1   . VAL A 1 111 ? 159.526 167.583 -25.513 1.00 44.32 ? 108 VAL A CG1   1 
ATOM   866  C  CG2   . VAL A 1 111 ? 159.527 166.107 -23.490 1.00 52.42 ? 108 VAL A CG2   1 
ATOM   867  N  N     . ILE A 1 112 ? 157.939 169.333 -21.537 1.00 26.35 ? 109 ILE A N     1 
ATOM   868  C  CA    . ILE A 1 112 ? 157.350 169.358 -20.201 1.00 34.16 ? 109 ILE A CA    1 
ATOM   869  C  C     . ILE A 1 112 ? 155.898 168.923 -20.241 1.00 24.91 ? 109 ILE A C     1 
ATOM   870  O  O     . ILE A 1 112 ? 155.216 169.048 -21.260 1.00 20.03 ? 109 ILE A O     1 
ATOM   871  C  CB    . ILE A 1 112 ? 157.432 170.770 -19.535 1.00 31.98 ? 109 ILE A CB    1 
ATOM   872  C  CG1   . ILE A 1 112 ? 156.383 171.710 -20.134 1.00 30.58 ? 109 ILE A CG1   1 
ATOM   873  C  CG2   . ILE A 1 112 ? 158.857 171.335 -19.626 1.00 24.99 ? 109 ILE A CG2   1 
ATOM   874  C  CD1   . ILE A 1 112 ? 156.314 173.099 -19.493 1.00 25.91 ? 109 ILE A CD1   1 
ATOM   875  N  N     . GLU A 1 113 ? 155.450 168.374 -19.127 1.00 17.35 ? 110 GLU A N     1 
ATOM   876  C  CA    . GLU A 1 113 ? 154.034 168.166 -18.870 1.00 23.92 ? 110 GLU A CA    1 
ATOM   877  C  C     . GLU A 1 113 ? 153.593 169.114 -17.762 1.00 23.45 ? 110 GLU A C     1 
ATOM   878  O  O     . GLU A 1 113 ? 154.010 168.958 -16.608 1.00 19.68 ? 110 GLU A O     1 
ATOM   879  C  CB    . GLU A 1 113 ? 153.738 166.713 -18.464 1.00 26.90 ? 110 GLU A CB    1 
ATOM   880  C  CG    . GLU A 1 113 ? 152.251 166.459 -18.140 1.00 23.12 ? 110 GLU A CG    1 
ATOM   881  C  CD    . GLU A 1 113 ? 151.969 165.030 -17.667 1.00 28.98 ? 110 GLU A CD    1 
ATOM   882  O  OE1   . GLU A 1 113 ? 152.820 164.140 -17.890 1.00 24.79 ? 110 GLU A OE1   1 
ATOM   883  O  OE2   . GLU A 1 113 ? 150.899 164.798 -17.070 1.00 31.61 ? 110 GLU A OE2   1 
ATOM   884  N  N     . ARG A 1 114 ? 152.774 170.099 -18.125 1.00 21.22 ? 111 ARG A N     1 
ATOM   885  C  CA    . ARG A 1 114 ? 152.171 171.012 -17.160 1.00 25.98 ? 111 ARG A CA    1 
ATOM   886  C  C     . ARG A 1 114 ? 151.246 170.238 -16.235 1.00 23.86 ? 111 ARG A C     1 
ATOM   887  O  O     . ARG A 1 114 ? 150.188 169.764 -16.661 1.00 26.83 ? 111 ARG A O     1 
ATOM   888  C  CB    . ARG A 1 114 ? 151.384 172.121 -17.871 1.00 24.26 ? 111 ARG A CB    1 
ATOM   889  C  CG    . ARG A 1 114 ? 150.811 173.166 -16.916 1.00 21.54 ? 111 ARG A CG    1 
ATOM   890  C  CD    . ARG A 1 114 ? 149.603 173.863 -17.508 1.00 29.98 ? 111 ARG A CD    1 
ATOM   891  N  NE    . ARG A 1 114 ? 149.266 175.106 -16.816 1.00 31.05 ? 111 ARG A NE    1 
ATOM   892  C  CZ    . ARG A 1 114 ? 148.325 175.229 -15.882 1.00 32.59 ? 111 ARG A CZ    1 
ATOM   893  N  NH1   . ARG A 1 114 ? 147.604 174.183 -15.499 1.00 28.74 ? 111 ARG A NH1   1 
ATOM   894  N  NH2   . ARG A 1 114 ? 148.104 176.412 -15.329 1.00 28.52 ? 111 ARG A NH2   1 
ATOM   895  N  N     . ALA A 1 115 ? 151.631 170.100 -14.972 1.00 22.30 ? 112 ALA A N     1 
ATOM   896  C  CA    . ALA A 1 115 ? 150.864 169.253 -14.068 1.00 18.25 ? 112 ALA A CA    1 
ATOM   897  C  C     . ALA A 1 115 ? 149.900 170.064 -13.219 1.00 25.08 ? 112 ALA A C     1 
ATOM   898  O  O     . ALA A 1 115 ? 148.904 169.539 -12.721 1.00 16.93 ? 112 ALA A O     1 
ATOM   899  C  CB    . ALA A 1 115 ? 151.810 168.443 -13.174 1.00 21.12 ? 112 ALA A CB    1 
ATOM   900  N  N     . SER A 1 116 ? 150.219 171.343 -13.045 1.00 16.53 ? 113 SER A N     1 
ATOM   901  C  CA    . SER A 1 116 ? 149.376 172.269 -12.299 1.00 22.21 ? 113 SER A CA    1 
ATOM   902  C  C     . SER A 1 116 ? 149.856 173.681 -12.594 1.00 18.96 ? 113 SER A C     1 
ATOM   903  O  O     . SER A 1 116 ? 150.813 173.861 -13.347 1.00 21.48 ? 113 SER A O     1 
ATOM   904  C  CB    . SER A 1 116 ? 149.430 171.986 -10.790 1.00 22.86 ? 113 SER A CB    1 
ATOM   905  O  OG    . SER A 1 116 ? 150.525 172.666 -10.178 1.00 22.74 ? 113 SER A OG    1 
ATOM   906  N  N     . ILE A 1 117 ? 149.209 174.687 -12.012 1.00 15.64 ? 114 ILE A N     1 
ATOM   907  C  CA    . ILE A 1 117 ? 149.664 176.063 -12.225 1.00 17.05 ? 114 ILE A CA    1 
ATOM   908  C  C     . ILE A 1 117 ? 151.156 176.264 -11.843 1.00 25.14 ? 114 ILE A C     1 
ATOM   909  O  O     . ILE A 1 117 ? 151.837 177.115 -12.435 1.00 17.18 ? 114 ILE A O     1 
ATOM   910  C  CB    . ILE A 1 117 ? 148.782 177.070 -11.438 1.00 23.36 ? 114 ILE A CB    1 
ATOM   911  C  CG1   . ILE A 1 117 ? 148.890 178.482 -12.032 1.00 24.92 ? 114 ILE A CG1   1 
ATOM   912  C  CG2   . ILE A 1 117 ? 149.104 177.047 -9.941  1.00 14.95 ? 114 ILE A CG2   1 
ATOM   913  C  CD1   . ILE A 1 117 ? 147.839 179.428 -11.498 1.00 21.28 ? 114 ILE A CD1   1 
ATOM   914  N  N     . ASP A 1 118 ? 151.687 175.477 -10.898 1.00 18.85 ? 115 ASP A N     1 
ATOM   915  C  CA    . ASP A 1 118 ? 153.071 175.719 -10.472 1.00 19.71 ? 115 ASP A CA    1 
ATOM   916  C  C     . ASP A 1 118 ? 153.984 174.481 -10.497 1.00 26.53 ? 115 ASP A C     1 
ATOM   917  O  O     . ASP A 1 118 ? 155.064 174.505 -9.900  1.00 20.16 ? 115 ASP A O     1 
ATOM   918  C  CB    . ASP A 1 118 ? 153.089 176.354 -9.068  1.00 12.23 ? 115 ASP A CB    1 
ATOM   919  C  CG    . ASP A 1 118 ? 152.954 175.331 -7.948  1.00 18.91 ? 115 ASP A CG    1 
ATOM   920  O  OD1   . ASP A 1 118 ? 152.282 174.290 -8.130  1.00 18.43 ? 115 ASP A OD1   1 
ATOM   921  O  OD2   . ASP A 1 118 ? 153.538 175.570 -6.877  1.00 19.19 ? 115 ASP A OD2   1 
ATOM   922  N  N     . GLU A 1 119 ? 153.568 173.423 -11.200 1.00 24.75 ? 116 GLU A N     1 
ATOM   923  C  CA    . GLU A 1 119 ? 154.374 172.203 -11.326 1.00 21.26 ? 116 GLU A CA    1 
ATOM   924  C  C     . GLU A 1 119 ? 154.437 171.671 -12.744 1.00 22.94 ? 116 GLU A C     1 
ATOM   925  O  O     . GLU A 1 119 ? 153.440 171.699 -13.464 1.00 16.20 ? 116 GLU A O     1 
ATOM   926  C  CB    . GLU A 1 119 ? 153.830 171.062 -10.455 1.00 22.05 ? 116 GLU A CB    1 
ATOM   927  C  CG    . GLU A 1 119 ? 153.360 171.443 -9.087  1.00 30.85 ? 116 GLU A CG    1 
ATOM   928  C  CD    . GLU A 1 119 ? 152.892 170.236 -8.313  1.00 29.40 ? 116 GLU A CD    1 
ATOM   929  O  OE1   . GLU A 1 119 ? 152.506 169.247 -8.964  1.00 32.57 ? 116 GLU A OE1   1 
ATOM   930  O  OE2   . GLU A 1 119 ? 152.934 170.263 -7.066  1.00 34.15 ? 116 GLU A OE2   1 
ATOM   931  N  N     . ALA A 1 120 ? 155.595 171.134 -13.117 1.00 18.04 ? 117 ALA A N     1 
ATOM   932  C  CA    . ALA A 1 120 ? 155.734 170.459 -14.402 1.00 19.67 ? 117 ALA A CA    1 
ATOM   933  C  C     . ALA A 1 120 ? 156.700 169.284 -14.308 1.00 18.09 ? 117 ALA A C     1 
ATOM   934  O  O     . ALA A 1 120 ? 157.742 169.371 -13.655 1.00 24.00 ? 117 ALA A O     1 
ATOM   935  C  CB    . ALA A 1 120 ? 156.196 171.434 -15.471 1.00 19.60 ? 117 ALA A CB    1 
ATOM   936  N  N     . TYR A 1 121 ? 156.338 168.179 -14.949 1.00 19.78 ? 118 TYR A N     1 
ATOM   937  C  CA    . TYR A 1 121 ? 157.259 167.067 -15.133 1.00 16.90 ? 118 TYR A CA    1 
ATOM   938  C  C     . TYR A 1 121 ? 158.103 167.306 -16.374 1.00 23.12 ? 118 TYR A C     1 
ATOM   939  O  O     . TYR A 1 121 ? 157.644 167.942 -17.323 1.00 18.65 ? 118 TYR A O     1 
ATOM   940  C  CB    . TYR A 1 121 ? 156.515 165.747 -15.267 1.00 17.68 ? 118 TYR A CB    1 
ATOM   941  C  CG    . TYR A 1 121 ? 155.760 165.333 -14.019 1.00 19.28 ? 118 TYR A CG    1 
ATOM   942  C  CD1   . TYR A 1 121 ? 156.383 164.619 -13.010 1.00 22.42 ? 118 TYR A CD1   1 
ATOM   943  C  CD2   . TYR A 1 121 ? 154.415 165.635 -13.870 1.00 18.68 ? 118 TYR A CD2   1 
ATOM   944  C  CE1   . TYR A 1 121 ? 155.681 164.229 -11.881 1.00 19.35 ? 118 TYR A CE1   1 
ATOM   945  C  CE2   . TYR A 1 121 ? 153.712 165.252 -12.753 1.00 21.47 ? 118 TYR A CE2   1 
ATOM   946  C  CZ    . TYR A 1 121 ? 154.342 164.553 -11.763 1.00 24.93 ? 118 TYR A CZ    1 
ATOM   947  O  OH    . TYR A 1 121 ? 153.612 164.182 -10.655 1.00 22.15 ? 118 TYR A OH    1 
ATOM   948  N  N     . VAL A 1 122 ? 159.324 166.772 -16.340 1.00 20.38 ? 119 VAL A N     1 
ATOM   949  C  CA    . VAL A 1 122 ? 160.313 166.880 -17.405 1.00 26.84 ? 119 VAL A CA    1 
ATOM   950  C  C     . VAL A 1 122 ? 160.890 165.491 -17.680 1.00 25.13 ? 119 VAL A C     1 
ATOM   951  O  O     . VAL A 1 122 ? 161.351 164.850 -16.749 1.00 19.57 ? 119 VAL A O     1 
ATOM   952  C  CB    . VAL A 1 122 ? 161.497 167.830 -17.012 1.00 24.07 ? 119 VAL A CB    1 
ATOM   953  C  CG1   . VAL A 1 122 ? 162.081 168.480 -18.242 1.00 29.55 ? 119 VAL A CG1   1 
ATOM   954  C  CG2   . VAL A 1 122 ? 161.060 168.888 -16.028 1.00 23.86 ? 119 VAL A CG2   1 
ATOM   955  N  N     . ASP A 1 123 ? 160.872 165.019 -18.929 1.00 23.40 ? 120 ASP A N     1 
ATOM   956  C  CA    . ASP A 1 123 ? 161.603 163.799 -19.274 1.00 19.28 ? 120 ASP A CA    1 
ATOM   957  C  C     . ASP A 1 123 ? 162.988 164.226 -19.742 1.00 24.00 ? 120 ASP A C     1 
ATOM   958  O  O     . ASP A 1 123 ? 163.113 164.873 -20.777 1.00 21.21 ? 120 ASP A O     1 
ATOM   959  C  CB    . ASP A 1 123 ? 160.873 162.979 -20.361 1.00 21.34 ? 120 ASP A CB    1 
ATOM   960  C  CG    . ASP A 1 123 ? 161.488 161.591 -20.569 1.00 25.37 ? 120 ASP A CG    1 
ATOM   961  O  OD1   . ASP A 1 123 ? 162.728 161.471 -20.625 1.00 29.01 ? 120 ASP A OD1   1 
ATOM   962  O  OD2   . ASP A 1 123 ? 160.729 160.601 -20.664 1.00 35.99 ? 120 ASP A OD2   1 
ATOM   963  N  N     . LEU A 1 124 ? 164.019 163.896 -18.969 1.00 19.31 ? 121 LEU A N     1 
ATOM   964  C  CA    . LEU A 1 124 ? 165.373 164.394 -19.256 1.00 23.17 ? 121 LEU A CA    1 
ATOM   965  C  C     . LEU A 1 124 ? 166.272 163.339 -19.888 1.00 17.48 ? 121 LEU A C     1 
ATOM   966  O  O     . LEU A 1 124 ? 167.478 163.565 -20.044 1.00 22.12 ? 121 LEU A O     1 
ATOM   967  C  CB    . LEU A 1 124 ? 166.032 164.932 -17.972 1.00 15.88 ? 121 LEU A CB    1 
ATOM   968  C  CG    . LEU A 1 124 ? 165.363 166.208 -17.432 1.00 25.84 ? 121 LEU A CG    1 
ATOM   969  C  CD1   . LEU A 1 124 ? 165.853 166.585 -16.038 1.00 27.10 ? 121 LEU A CD1   1 
ATOM   970  C  CD2   . LEU A 1 124 ? 165.608 167.359 -18.377 1.00 23.72 ? 121 LEU A CD2   1 
ATOM   971  N  N     . THR A 1 125 ? 165.683 162.196 -20.243 1.00 19.73 ? 122 THR A N     1 
ATOM   972  C  CA    . THR A 1 125 ? 166.433 161.048 -20.756 1.00 23.29 ? 122 THR A CA    1 
ATOM   973  C  C     . THR A 1 125 ? 167.343 161.401 -21.939 1.00 23.54 ? 122 THR A C     1 
ATOM   974  O  O     . THR A 1 125 ? 168.526 161.074 -21.940 1.00 21.73 ? 122 THR A O     1 
ATOM   975  C  CB    . THR A 1 125 ? 165.484 159.929 -21.194 1.00 20.46 ? 122 THR A CB    1 
ATOM   976  O  OG1   . THR A 1 125 ? 164.570 159.628 -20.129 1.00 23.35 ? 122 THR A OG1   1 
ATOM   977  C  CG2   . THR A 1 125 ? 166.281 158.676 -21.564 1.00 20.61 ? 122 THR A CG2   1 
ATOM   978  N  N     . SER A 1 126 ? 166.778 162.077 -22.934 1.00 21.82 ? 123 SER A N     1 
ATOM   979  C  CA    . SER A 1 126 ? 167.526 162.482 -24.125 1.00 23.42 ? 123 SER A CA    1 
ATOM   980  C  C     . SER A 1 126 ? 168.572 163.534 -23.808 1.00 28.27 ? 123 SER A C     1 
ATOM   981  O  O     . SER A 1 126 ? 169.734 163.400 -24.190 1.00 29.01 ? 123 SER A O     1 
ATOM   982  C  CB    . SER A 1 126 ? 166.574 163.014 -25.185 1.00 25.18 ? 123 SER A CB    1 
ATOM   983  O  OG    . SER A 1 126 ? 165.770 161.957 -25.679 1.00 37.36 ? 123 SER A OG    1 
ATOM   984  N  N     . ALA A 1 127 ? 168.145 164.582 -23.110 1.00 22.91 ? 124 ALA A N     1 
ATOM   985  C  CA    . ALA A 1 127 ? 169.057 165.608 -22.624 1.00 24.16 ? 124 ALA A CA    1 
ATOM   986  C  C     . ALA A 1 127 ? 170.228 164.997 -21.863 1.00 26.19 ? 124 ALA A C     1 
ATOM   987  O  O     . ALA A 1 127 ? 171.367 165.399 -22.070 1.00 29.74 ? 124 ALA A O     1 
ATOM   988  C  CB    . ALA A 1 127 ? 168.314 166.611 -21.738 1.00 27.01 ? 124 ALA A CB    1 
ATOM   989  N  N     . VAL A 1 128 ? 169.949 164.026 -20.989 1.00 26.58 ? 125 VAL A N     1 
ATOM   990  C  CA    . VAL A 1 128 ? 171.001 163.356 -20.219 1.00 28.05 ? 125 VAL A CA    1 
ATOM   991  C  C     . VAL A 1 128 ? 171.991 162.612 -21.121 1.00 27.56 ? 125 VAL A C     1 
ATOM   992  O  O     . VAL A 1 128 ? 173.203 162.707 -20.926 1.00 23.95 ? 125 VAL A O     1 
ATOM   993  C  CB    . VAL A 1 128 ? 170.422 162.349 -19.188 1.00 25.22 ? 125 VAL A CB    1 
ATOM   994  C  CG1   . VAL A 1 128 ? 171.493 161.363 -18.747 1.00 24.81 ? 125 VAL A CG1   1 
ATOM   995  C  CG2   . VAL A 1 128 ? 169.849 163.088 -17.970 1.00 24.05 ? 125 VAL A CG2   1 
ATOM   996  N  N     . GLN A 1 129 ? 171.476 161.866 -22.096 1.00 28.91 ? 126 GLN A N     1 
ATOM   997  C  CA    . GLN A 1 129 ? 172.341 161.191 -23.059 1.00 37.13 ? 126 GLN A CA    1 
ATOM   998  C  C     . GLN A 1 129 ? 173.238 162.210 -23.759 1.00 36.29 ? 126 GLN A C     1 
ATOM   999  O  O     . GLN A 1 129 ? 174.428 161.964 -23.972 1.00 39.62 ? 126 GLN A O     1 
ATOM   1000 C  CB    . GLN A 1 129 ? 171.525 160.415 -24.101 1.00 39.18 ? 126 GLN A CB    1 
ATOM   1001 C  CG    . GLN A 1 129 ? 170.700 159.243 -23.568 1.00 38.47 ? 126 GLN A CG    1 
ATOM   1002 C  CD    . GLN A 1 129 ? 171.529 158.157 -22.879 1.00 54.93 ? 126 GLN A CD    1 
ATOM   1003 O  OE1   . GLN A 1 129 ? 172.763 158.181 -22.888 1.00 66.52 ? 126 GLN A OE1   1 
ATOM   1004 N  NE2   . GLN A 1 129 ? 170.841 157.181 -22.295 1.00 66.40 ? 126 GLN A NE2   1 
ATOM   1005 N  N     . GLU A 1 130 ? 172.665 163.360 -24.095 1.00 31.50 ? 127 GLU A N     1 
ATOM   1006 C  CA    . GLU A 1 130 ? 173.414 164.419 -24.764 1.00 39.99 ? 127 GLU A CA    1 
ATOM   1007 C  C     . GLU A 1 130 ? 174.576 164.875 -23.905 1.00 43.41 ? 127 GLU A C     1 
ATOM   1008 O  O     . GLU A 1 130 ? 175.723 164.859 -24.347 1.00 39.21 ? 127 GLU A O     1 
ATOM   1009 C  CB    . GLU A 1 130 ? 172.511 165.607 -25.092 1.00 37.56 ? 127 GLU A CB    1 
ATOM   1010 C  CG    . GLU A 1 130 ? 171.603 165.380 -26.290 1.00 51.94 ? 127 GLU A CG    1 
ATOM   1011 C  CD    . GLU A 1 130 ? 172.372 165.307 -27.595 1.00 50.46 ? 127 GLU A CD    1 
ATOM   1012 N  N     . ARG A 1 131 ? 174.266 165.275 -22.675 1.00 37.33 ? 128 ARG A N     1 
ATOM   1013 C  CA    . ARG A 1 131 ? 175.276 165.766 -21.750 1.00 38.88 ? 128 ARG A CA    1 
ATOM   1014 C  C     . ARG A 1 131 ? 176.338 164.707 -21.472 1.00 44.06 ? 128 ARG A C     1 
ATOM   1015 O  O     . ARG A 1 131 ? 177.486 165.045 -21.204 1.00 43.50 ? 128 ARG A O     1 
ATOM   1016 C  CB    . ARG A 1 131 ? 174.627 166.216 -20.440 1.00 35.95 ? 128 ARG A CB    1 
ATOM   1017 C  CG    . ARG A 1 131 ? 175.573 166.924 -19.475 1.00 46.53 ? 128 ARG A CG    1 
ATOM   1018 C  CD    . ARG A 1 131 ? 175.976 168.286 -20.011 1.00 45.86 ? 128 ARG A CD    1 
ATOM   1019 N  NE    . ARG A 1 131 ? 174.802 169.144 -20.108 1.00 54.10 ? 128 ARG A NE    1 
ATOM   1020 C  CZ    . ARG A 1 131 ? 174.414 169.983 -19.154 1.00 35.37 ? 128 ARG A CZ    1 
ATOM   1021 N  NH1   . ARG A 1 131 ? 175.133 170.103 -18.040 1.00 24.60 ? 128 ARG A NH1   1 
ATOM   1022 N  NH2   . ARG A 1 131 ? 173.323 170.718 -19.324 1.00 44.25 ? 128 ARG A NH2   1 
ATOM   1023 N  N     . LEU A 1 132 ? 175.948 163.432 -21.529 1.00 34.18 ? 129 LEU A N     1 
ATOM   1024 C  CA    . LEU A 1 132 ? 176.881 162.317 -21.352 1.00 38.56 ? 129 LEU A CA    1 
ATOM   1025 C  C     . LEU A 1 132 ? 177.783 162.119 -22.580 1.00 46.61 ? 129 LEU A C     1 
ATOM   1026 O  O     . LEU A 1 132 ? 178.870 161.556 -22.460 1.00 45.14 ? 129 LEU A O     1 
ATOM   1027 C  CB    . LEU A 1 132 ? 176.121 161.016 -21.048 1.00 43.29 ? 129 LEU A CB    1 
ATOM   1028 C  CG    . LEU A 1 132 ? 175.777 160.744 -19.577 1.00 42.93 ? 129 LEU A CG    1 
ATOM   1029 C  CD1   . LEU A 1 132 ? 174.813 159.565 -19.402 1.00 36.40 ? 129 LEU A CD1   1 
ATOM   1030 C  CD2   . LEU A 1 132 ? 177.057 160.501 -18.783 1.00 43.82 ? 129 LEU A CD2   1 
ATOM   1031 N  N     . GLN A 1 133 ? 177.334 162.571 -23.753 1.00 42.66 ? 130 GLN A N     1 
ATOM   1032 C  CA    . GLN A 1 133 ? 178.171 162.528 -24.958 1.00 44.49 ? 130 GLN A CA    1 
ATOM   1033 C  C     . GLN A 1 133 ? 179.288 163.560 -24.830 1.00 52.62 ? 130 GLN A C     1 
ATOM   1034 O  O     . GLN A 1 133 ? 180.457 163.245 -25.021 1.00 56.95 ? 130 GLN A O     1 
ATOM   1035 C  CB    . GLN A 1 133 ? 177.346 162.778 -26.223 1.00 44.02 ? 130 GLN A CB    1 
ATOM   1036 N  N     . LYS A 1 134 ? 178.925 164.792 -24.482 1.00 51.69 ? 131 LYS A N     1 
ATOM   1037 C  CA    . LYS A 1 134 ? 179.907 165.752 -23.999 1.00 50.07 ? 131 LYS A CA    1 
ATOM   1038 C  C     . LYS A 1 134 ? 180.359 165.254 -22.638 1.00 59.40 ? 131 LYS A C     1 
ATOM   1039 O  O     . LYS A 1 134 ? 179.832 164.257 -22.148 1.00 63.21 ? 131 LYS A O     1 
ATOM   1040 C  CB    . LYS A 1 134 ? 179.317 167.159 -23.902 1.00 53.99 ? 131 LYS A CB    1 
ATOM   1041 N  N     . LEU A 1 135 ? 181.312 165.940 -22.016 1.00 60.89 ? 132 LEU A N     1 
ATOM   1042 C  CA    . LEU A 1 135 ? 181.845 165.485 -20.735 1.00 62.60 ? 132 LEU A CA    1 
ATOM   1043 C  C     . LEU A 1 135 ? 182.239 164.012 -20.829 1.00 64.00 ? 132 LEU A C     1 
ATOM   1044 O  O     . LEU A 1 135 ? 181.830 163.188 -20.008 1.00 72.68 ? 132 LEU A O     1 
ATOM   1045 C  CB    . LEU A 1 135 ? 180.828 165.700 -19.607 1.00 61.68 ? 132 LEU A CB    1 
ATOM   1046 N  N     . GLN A 1 136 ? 183.020 163.696 -21.856 1.00 71.76 ? 133 GLN A N     1 
ATOM   1047 C  CA    . GLN A 1 136 ? 183.379 162.321 -22.181 1.00 64.59 ? 133 GLN A CA    1 
ATOM   1048 C  C     . GLN A 1 136 ? 184.096 161.611 -21.037 1.00 65.34 ? 133 GLN A C     1 
ATOM   1049 O  O     . GLN A 1 136 ? 185.318 161.655 -20.938 1.00 71.21 ? 133 GLN A O     1 
ATOM   1050 C  CB    . GLN A 1 136 ? 184.254 162.296 -23.437 1.00 58.77 ? 133 GLN A CB    1 
ATOM   1051 N  N     . GLY A 1 137 ? 183.321 160.962 -20.173 1.00 70.36 ? 134 GLY A N     1 
ATOM   1052 C  CA    . GLY A 1 137 ? 183.866 160.126 -19.116 1.00 62.72 ? 134 GLY A CA    1 
ATOM   1053 C  C     . GLY A 1 137 ? 184.445 160.837 -17.903 1.00 62.11 ? 134 GLY A C     1 
ATOM   1054 O  O     . GLY A 1 137 ? 184.946 160.185 -16.985 1.00 64.95 ? 134 GLY A O     1 
ATOM   1055 N  N     . GLN A 1 138 ? 184.370 162.166 -17.881 1.00 57.94 ? 135 GLN A N     1 
ATOM   1056 C  CA    . GLN A 1 138 ? 185.001 162.943 -16.811 1.00 60.34 ? 135 GLN A CA    1 
ATOM   1057 C  C     . GLN A 1 138 ? 184.126 163.124 -15.565 1.00 52.71 ? 135 GLN A C     1 
ATOM   1058 O  O     . GLN A 1 138 ? 182.912 163.314 -15.667 1.00 44.41 ? 135 GLN A O     1 
ATOM   1059 C  CB    . GLN A 1 138 ? 185.430 164.308 -17.351 1.00 66.38 ? 135 GLN A CB    1 
ATOM   1060 C  CG    . GLN A 1 138 ? 184.428 164.970 -18.274 1.00 64.24 ? 135 GLN A CG    1 
ATOM   1061 C  CD    . GLN A 1 138 ? 185.009 166.203 -18.939 1.00 69.72 ? 135 GLN A CD    1 
ATOM   1062 O  OE1   . GLN A 1 138 ? 184.685 166.521 -20.081 1.00 70.29 ? 135 GLN A OE1   1 
ATOM   1063 N  NE2   . GLN A 1 138 ? 185.884 166.900 -18.223 1.00 68.78 ? 135 GLN A NE2   1 
ATOM   1064 N  N     . PRO A 1 139 ? 184.760 163.075 -14.380 1.00 55.85 ? 136 PRO A N     1 
ATOM   1065 C  CA    . PRO A 1 139 ? 184.078 163.131 -13.081 1.00 46.79 ? 136 PRO A CA    1 
ATOM   1066 C  C     . PRO A 1 139 ? 183.089 164.283 -12.961 1.00 53.54 ? 136 PRO A C     1 
ATOM   1067 O  O     . PRO A 1 139 ? 183.252 165.337 -13.575 1.00 56.19 ? 136 PRO A O     1 
ATOM   1068 C  CB    . PRO A 1 139 ? 185.229 163.316 -12.087 1.00 51.30 ? 136 PRO A CB    1 
ATOM   1069 C  CG    . PRO A 1 139 ? 186.408 162.730 -12.765 1.00 56.26 ? 136 PRO A CG    1 
ATOM   1070 C  CD    . PRO A 1 139 ? 186.225 163.005 -14.227 1.00 54.22 ? 136 PRO A CD    1 
ATOM   1071 N  N     . ILE A 1 140 ? 182.055 164.058 -12.167 1.00 46.50 ? 137 ILE A N     1 
ATOM   1072 C  CA    . ILE A 1 140 ? 181.109 165.096 -11.826 1.00 33.09 ? 137 ILE A CA    1 
ATOM   1073 C  C     . ILE A 1 140 ? 181.459 165.599 -10.447 1.00 31.79 ? 137 ILE A C     1 
ATOM   1074 O  O     . ILE A 1 140 ? 181.447 164.832 -9.491  1.00 39.01 ? 137 ILE A O     1 
ATOM   1075 C  CB    . ILE A 1 140 ? 179.663 164.565 -11.852 1.00 34.11 ? 137 ILE A CB    1 
ATOM   1076 C  CG1   . ILE A 1 140 ? 179.344 164.024 -13.245 1.00 39.56 ? 137 ILE A CG1   1 
ATOM   1077 C  CG2   . ILE A 1 140 ? 178.675 165.657 -11.456 1.00 25.06 ? 137 ILE A CG2   1 
ATOM   1078 C  CD1   . ILE A 1 140 ? 178.289 162.950 -13.251 1.00 41.03 ? 137 ILE A CD1   1 
ATOM   1079 N  N     . SER A 1 141 ? 181.764 166.884 -10.329 1.00 30.61 ? 138 SER A N     1 
ATOM   1080 C  CA    . SER A 1 141 ? 182.157 167.429 -9.037  1.00 38.29 ? 138 SER A CA    1 
ATOM   1081 C  C     . SER A 1 141 ? 180.939 167.884 -8.247  1.00 34.25 ? 138 SER A C     1 
ATOM   1082 O  O     . SER A 1 141 ? 179.911 168.247 -8.828  1.00 32.62 ? 138 SER A O     1 
ATOM   1083 C  CB    . SER A 1 141 ? 183.129 168.592 -9.211  1.00 32.56 ? 138 SER A CB    1 
ATOM   1084 O  OG    . SER A 1 141 ? 182.469 169.728 -9.726  1.00 34.49 ? 138 SER A OG    1 
ATOM   1085 N  N     . ALA A 1 142 ? 181.066 167.887 -6.924  1.00 30.15 ? 139 ALA A N     1 
ATOM   1086 C  CA    . ALA A 1 142 ? 179.963 168.284 -6.055  1.00 33.92 ? 139 ALA A CA    1 
ATOM   1087 C  C     . ALA A 1 142 ? 179.554 169.738 -6.296  1.00 31.66 ? 139 ALA A C     1 
ATOM   1088 O  O     . ALA A 1 142 ? 178.493 170.175 -5.852  1.00 26.13 ? 139 ALA A O     1 
ATOM   1089 C  CB    . ALA A 1 142 ? 180.338 168.068 -4.588  1.00 27.55 ? 139 ALA A CB    1 
ATOM   1090 N  N     . ASP A 1 143 ? 180.411 170.482 -6.990  1.00 31.75 ? 140 ASP A N     1 
ATOM   1091 C  CA    . ASP A 1 143 ? 180.167 171.891 -7.247  1.00 35.39 ? 140 ASP A CA    1 
ATOM   1092 C  C     . ASP A 1 143 ? 179.057 172.078 -8.275  1.00 30.16 ? 140 ASP A C     1 
ATOM   1093 O  O     . ASP A 1 143 ? 178.421 173.127 -8.318  1.00 23.15 ? 140 ASP A O     1 
ATOM   1094 C  CB    . ASP A 1 143 ? 181.454 172.585 -7.710  1.00 36.02 ? 140 ASP A CB    1 
ATOM   1095 C  CG    . ASP A 1 143 ? 182.430 172.827 -6.563  1.00 45.51 ? 140 ASP A CG    1 
ATOM   1096 O  OD1   . ASP A 1 143 ? 181.992 172.807 -5.393  1.00 41.93 ? 140 ASP A OD1   1 
ATOM   1097 O  OD2   . ASP A 1 143 ? 183.635 173.037 -6.830  1.00 55.02 ? 140 ASP A OD2   1 
ATOM   1098 N  N     . LEU A 1 144 ? 178.808 171.054 -9.082  1.00 27.21 ? 141 LEU A N     1 
ATOM   1099 C  CA    . LEU A 1 144 ? 177.747 171.134 -10.076 1.00 32.33 ? 141 LEU A CA    1 
ATOM   1100 C  C     . LEU A 1 144 ? 176.392 170.825 -9.445  1.00 30.90 ? 141 LEU A C     1 
ATOM   1101 O  O     . LEU A 1 144 ? 175.350 170.966 -10.086 1.00 20.57 ? 141 LEU A O     1 
ATOM   1102 C  CB    . LEU A 1 144 ? 178.029 170.184 -11.238 1.00 28.73 ? 141 LEU A CB    1 
ATOM   1103 C  CG    . LEU A 1 144 ? 179.321 170.465 -12.019 1.00 37.62 ? 141 LEU A CG    1 
ATOM   1104 C  CD1   . LEU A 1 144 ? 179.559 169.410 -13.085 1.00 30.86 ? 141 LEU A CD1   1 
ATOM   1105 C  CD2   . LEU A 1 144 ? 179.281 171.843 -12.652 1.00 29.71 ? 141 LEU A CD2   1 
ATOM   1106 N  N     . LEU A 1 145 ? 176.414 170.426 -8.174  1.00 27.22 ? 142 LEU A N     1 
ATOM   1107 C  CA    . LEU A 1 145 ? 175.195 170.028 -7.465  1.00 21.85 ? 142 LEU A CA    1 
ATOM   1108 C  C     . LEU A 1 145 ? 175.015 170.756 -6.134  1.00 26.12 ? 142 LEU A C     1 
ATOM   1109 O  O     . LEU A 1 145 ? 174.827 170.126 -5.093  1.00 22.63 ? 142 LEU A O     1 
ATOM   1110 C  CB    . LEU A 1 145 ? 175.210 168.512 -7.257  1.00 22.90 ? 142 LEU A CB    1 
ATOM   1111 C  CG    . LEU A 1 145 ? 175.228 167.777 -8.599  1.00 25.90 ? 142 LEU A CG    1 
ATOM   1112 C  CD1   . LEU A 1 145 ? 175.922 166.418 -8.552  1.00 28.98 ? 142 LEU A CD1   1 
ATOM   1113 C  CD2   . LEU A 1 145 ? 173.814 167.624 -9.124  1.00 22.48 ? 142 LEU A CD2   1 
ATOM   1114 N  N     . PRO A 1 146 ? 175.058 172.101 -6.166  1.00 26.96 ? 143 PRO A N     1 
ATOM   1115 C  CA    . PRO A 1 146 ? 175.076 172.879 -4.921  1.00 26.96 ? 143 PRO A CA    1 
ATOM   1116 C  C     . PRO A 1 146 ? 173.797 172.838 -4.078  1.00 24.38 ? 143 PRO A C     1 
ATOM   1117 O  O     . PRO A 1 146 ? 173.855 173.316 -2.949  1.00 26.22 ? 143 PRO A O     1 
ATOM   1118 C  CB    . PRO A 1 146 ? 175.321 174.305 -5.421  1.00 28.60 ? 143 PRO A CB    1 
ATOM   1119 C  CG    . PRO A 1 146 ? 174.651 174.327 -6.783  1.00 26.29 ? 143 PRO A CG    1 
ATOM   1120 C  CD    . PRO A 1 146 ? 174.962 172.974 -7.357  1.00 23.94 ? 143 PRO A CD    1 
ATOM   1121 N  N     . SER A 1 147 ? 172.676 172.321 -4.595  1.00 27.02 ? 144 SER A N     1 
ATOM   1122 C  CA    . SER A 1 147 ? 171.450 172.237 -3.786  1.00 27.38 ? 144 SER A CA    1 
ATOM   1123 C  C     . SER A 1 147 ? 170.793 170.858 -3.839  1.00 20.61 ? 144 SER A C     1 
ATOM   1124 O  O     . SER A 1 147 ? 169.622 170.699 -3.489  1.00 20.76 ? 144 SER A O     1 
ATOM   1125 C  CB    . SER A 1 147 ? 170.436 173.305 -4.221  1.00 23.50 ? 144 SER A CB    1 
ATOM   1126 O  OG    . SER A 1 147 ? 170.067 173.140 -5.575  1.00 23.22 ? 144 SER A OG    1 
ATOM   1127 N  N     . THR A 1 148 ? 171.557 169.861 -4.266  1.00 21.08 ? 145 THR A N     1 
ATOM   1128 C  CA    . THR A 1 148 ? 171.035 168.512 -4.449  1.00 19.09 ? 145 THR A CA    1 
ATOM   1129 C  C     . THR A 1 148 ? 171.171 167.669 -3.173  1.00 21.65 ? 145 THR A C     1 
ATOM   1130 O  O     . THR A 1 148 ? 172.222 167.668 -2.548  1.00 21.35 ? 145 THR A O     1 
ATOM   1131 C  CB    . THR A 1 148 ? 171.767 167.821 -5.614  1.00 22.10 ? 145 THR A CB    1 
ATOM   1132 O  OG1   . THR A 1 148 ? 171.446 168.497 -6.837  1.00 18.08 ? 145 THR A OG1   1 
ATOM   1133 C  CG2   . THR A 1 148 ? 171.382 166.325 -5.719  1.00 19.76 ? 145 THR A CG2   1 
ATOM   1134 N  N     . TYR A 1 149 ? 170.096 166.988 -2.781  1.00 23.12 ? 146 TYR A N     1 
ATOM   1135 C  CA    . TYR A 1 149 ? 170.133 165.980 -1.708  1.00 24.04 ? 146 TYR A CA    1 
ATOM   1136 C  C     . TYR A 1 149 ? 170.107 164.587 -2.330  1.00 23.44 ? 146 TYR A C     1 
ATOM   1137 O  O     . TYR A 1 149 ? 169.377 164.357 -3.306  1.00 24.18 ? 146 TYR A O     1 
ATOM   1138 C  CB    . TYR A 1 149 ? 168.948 166.154 -0.754  1.00 22.40 ? 146 TYR A CB    1 
ATOM   1139 C  CG    . TYR A 1 149 ? 169.158 167.214 0.311   1.00 22.70 ? 146 TYR A CG    1 
ATOM   1140 C  CD1   . TYR A 1 149 ? 168.897 168.557 0.051   1.00 24.43 ? 146 TYR A CD1   1 
ATOM   1141 C  CD2   . TYR A 1 149 ? 169.608 166.864 1.576   1.00 29.46 ? 146 TYR A CD2   1 
ATOM   1142 C  CE1   . TYR A 1 149 ? 169.083 169.524 1.028   1.00 26.09 ? 146 TYR A CE1   1 
ATOM   1143 C  CE2   . TYR A 1 149 ? 169.795 167.813 2.555   1.00 32.77 ? 146 TYR A CE2   1 
ATOM   1144 C  CZ    . TYR A 1 149 ? 169.537 169.141 2.278   1.00 31.49 ? 146 TYR A CZ    1 
ATOM   1145 O  OH    . TYR A 1 149 ? 169.724 170.073 3.268   1.00 35.90 ? 146 TYR A OH    1 
ATOM   1146 N  N     . ILE A 1 150 ? 170.919 163.673 -1.816  1.00 18.75 ? 147 ILE A N     1 
ATOM   1147 C  CA    . ILE A 1 150 ? 170.824 162.274 -2.249  1.00 16.68 ? 147 ILE A CA    1 
ATOM   1148 C  C     . ILE A 1 150 ? 170.052 161.495 -1.186  1.00 22.57 ? 147 ILE A C     1 
ATOM   1149 O  O     . ILE A 1 150 ? 170.542 161.297 -0.063  1.00 22.65 ? 147 ILE A O     1 
ATOM   1150 C  CB    . ILE A 1 150 ? 172.198 161.610 -2.476  1.00 16.59 ? 147 ILE A CB    1 
ATOM   1151 C  CG1   . ILE A 1 150 ? 173.086 162.453 -3.413  1.00 17.23 ? 147 ILE A CG1   1 
ATOM   1152 C  CG2   . ILE A 1 150 ? 172.001 160.202 -3.045  1.00 17.54 ? 147 ILE A CG2   1 
ATOM   1153 C  CD1   . ILE A 1 150 ? 172.498 162.650 -4.852  1.00 13.94 ? 147 ILE A CD1   1 
ATOM   1154 N  N     . GLU A 1 151 ? 168.836 161.080 -1.520  1.00 21.43 ? 148 GLU A N     1 
ATOM   1155 C  CA    . GLU A 1 151 ? 167.996 160.414 -0.529  1.00 20.66 ? 148 GLU A CA    1 
ATOM   1156 C  C     . GLU A 1 151 ? 168.649 159.112 -0.079  1.00 23.83 ? 148 GLU A C     1 
ATOM   1157 O  O     . GLU A 1 151 ? 169.125 158.329 -0.908  1.00 19.93 ? 148 GLU A O     1 
ATOM   1158 C  CB    . GLU A 1 151 ? 166.592 160.142 -1.082  1.00 18.45 ? 148 GLU A CB    1 
ATOM   1159 C  CG    . GLU A 1 151 ? 165.691 159.338 -0.108  1.00 18.93 ? 148 GLU A CG    1 
ATOM   1160 C  CD    . GLU A 1 151 ? 165.445 160.057 1.206   1.00 20.49 ? 148 GLU A CD    1 
ATOM   1161 O  OE1   . GLU A 1 151 ? 165.499 161.304 1.231   1.00 27.44 ? 148 GLU A OE1   1 
ATOM   1162 O  OE2   . GLU A 1 151 ? 165.195 159.384 2.225   1.00 25.07 ? 148 GLU A OE2   1 
ATOM   1163 N  N     . GLY A 1 152 ? 168.687 158.916 1.236   1.00 23.18 ? 149 GLY A N     1 
ATOM   1164 C  CA    . GLY A 1 152 ? 169.219 157.712 1.844   1.00 22.67 ? 149 GLY A CA    1 
ATOM   1165 C  C     . GLY A 1 152 ? 170.642 157.891 2.338   1.00 32.44 ? 149 GLY A C     1 
ATOM   1166 O  O     . GLY A 1 152 ? 171.164 157.051 3.062   1.00 25.27 ? 149 GLY A O     1 
ATOM   1167 N  N     . LEU A 1 153 ? 171.277 158.981 1.920   1.00 25.72 ? 150 LEU A N     1 
ATOM   1168 C  CA    . LEU A 1 153 ? 172.658 159.269 2.288   1.00 24.16 ? 150 LEU A CA    1 
ATOM   1169 C  C     . LEU A 1 153 ? 172.716 160.543 3.140   1.00 24.76 ? 150 LEU A C     1 
ATOM   1170 O  O     . LEU A 1 153 ? 171.857 161.408 3.009   1.00 21.78 ? 150 LEU A O     1 
ATOM   1171 C  CB    . LEU A 1 153 ? 173.523 159.401 1.029   1.00 16.02 ? 150 LEU A CB    1 
ATOM   1172 C  CG    . LEU A 1 153 ? 173.636 158.108 0.206   1.00 23.54 ? 150 LEU A CG    1 
ATOM   1173 C  CD1   . LEU A 1 153 ? 174.572 158.296 -0.980  1.00 18.43 ? 150 LEU A CD1   1 
ATOM   1174 C  CD2   . LEU A 1 153 ? 174.077 156.919 1.072   1.00 21.38 ? 150 LEU A CD2   1 
ATOM   1175 N  N     . PRO A 1 154 ? 173.724 160.667 4.015   1.00 29.83 ? 151 PRO A N     1 
ATOM   1176 C  CA    . PRO A 1 154 ? 174.836 159.733 4.224   1.00 32.21 ? 151 PRO A CA    1 
ATOM   1177 C  C     . PRO A 1 154 ? 174.427 158.542 5.075   1.00 33.77 ? 151 PRO A C     1 
ATOM   1178 O  O     . PRO A 1 154 ? 173.436 158.629 5.802   1.00 33.68 ? 151 PRO A O     1 
ATOM   1179 C  CB    . PRO A 1 154 ? 175.877 160.590 4.948   1.00 31.04 ? 151 PRO A CB    1 
ATOM   1180 C  CG    . PRO A 1 154 ? 175.039 161.548 5.772   1.00 30.35 ? 151 PRO A CG    1 
ATOM   1181 C  CD    . PRO A 1 154 ? 173.819 161.845 4.901   1.00 29.29 ? 151 PRO A CD    1 
ATOM   1182 N  N     . GLN A 1 155 ? 175.158 157.441 4.959   1.00 28.83 ? 152 GLN A N     1 
ATOM   1183 C  CA    . GLN A 1 155 ? 174.987 156.309 5.872   1.00 46.65 ? 152 GLN A CA    1 
ATOM   1184 C  C     . GLN A 1 155 ? 176.350 155.899 6.443   1.00 49.03 ? 152 GLN A C     1 
ATOM   1185 O  O     . GLN A 1 155 ? 177.393 156.231 5.872   1.00 47.00 ? 152 GLN A O     1 
ATOM   1186 C  CB    . GLN A 1 155 ? 174.337 155.117 5.169   1.00 44.25 ? 152 GLN A CB    1 
ATOM   1187 C  CG    . GLN A 1 155 ? 175.284 154.411 4.222   1.00 47.59 ? 152 GLN A CG    1 
ATOM   1188 C  CD    . GLN A 1 155 ? 174.852 152.994 3.893   1.00 51.45 ? 152 GLN A CD    1 
ATOM   1189 O  OE1   . GLN A 1 155 ? 173.675 152.631 4.035   1.00 49.50 ? 152 GLN A OE1   1 
ATOM   1190 N  NE2   . GLN A 1 155 ? 175.807 152.180 3.449   1.00 41.48 ? 152 GLN A NE2   1 
ATOM   1191 N  N     . GLY A 1 156 ? 176.339 155.183 7.565   1.00 53.43 ? 153 GLY A N     1 
ATOM   1192 C  CA    . GLY A 1 156 ? 177.564 154.756 8.225   1.00 57.39 ? 153 GLY A CA    1 
ATOM   1193 C  C     . GLY A 1 156 ? 178.406 155.905 8.755   1.00 64.84 ? 153 GLY A C     1 
ATOM   1194 O  O     . GLY A 1 156 ? 177.865 156.900 9.250   1.00 70.59 ? 153 GLY A O     1 
ATOM   1195 N  N     . PRO A 1 157 ? 179.742 155.770 8.662   1.00 73.17 ? 154 PRO A N     1 
ATOM   1196 C  CA    . PRO A 1 157 ? 180.709 156.807 9.053   1.00 72.91 ? 154 PRO A CA    1 
ATOM   1197 C  C     . PRO A 1 157 ? 180.486 158.136 8.334   1.00 62.56 ? 154 PRO A C     1 
ATOM   1198 O  O     . PRO A 1 157 ? 181.154 159.115 8.671   1.00 62.78 ? 154 PRO A O     1 
ATOM   1199 C  CB    . PRO A 1 157 ? 182.054 156.195 8.651   1.00 49.71 ? 154 PRO A CB    1 
ATOM   1200 C  CG    . PRO A 1 157 ? 181.826 154.739 8.751   1.00 50.41 ? 154 PRO A CG    1 
ATOM   1201 C  CD    . PRO A 1 157 ? 180.419 154.519 8.275   1.00 67.07 ? 154 PRO A CD    1 
ATOM   1202 N  N     . THR A 1 163 ? 177.248 165.254 9.745   1.00 60.93 ? 160 THR A N     1 
ATOM   1203 C  CA    . THR A 1 163 ? 177.742 166.192 10.746  1.00 52.18 ? 160 THR A CA    1 
ATOM   1204 C  C     . THR A 1 163 ? 176.604 166.658 11.650  1.00 53.79 ? 160 THR A C     1 
ATOM   1205 O  O     . THR A 1 163 ? 175.598 165.965 11.813  1.00 59.96 ? 160 THR A O     1 
ATOM   1206 C  CB    . THR A 1 163 ? 178.421 167.416 10.090  1.00 46.58 ? 160 THR A CB    1 
ATOM   1207 O  OG1   . THR A 1 163 ? 177.440 168.411 9.759   1.00 48.99 ? 160 THR A OG1   1 
ATOM   1208 C  CG2   . THR A 1 163 ? 179.160 166.998 8.835   1.00 42.39 ? 160 THR A CG2   1 
ATOM   1209 N  N     . VAL A 1 164 ? 176.761 167.839 12.232  1.00 44.24 ? 161 VAL A N     1 
ATOM   1210 C  CA    . VAL A 1 164 ? 175.785 168.352 13.181  1.00 51.56 ? 161 VAL A CA    1 
ATOM   1211 C  C     . VAL A 1 164 ? 174.775 169.285 12.491  1.00 45.86 ? 161 VAL A C     1 
ATOM   1212 O  O     . VAL A 1 164 ? 173.645 169.470 12.967  1.00 49.54 ? 161 VAL A O     1 
ATOM   1213 C  CB    . VAL A 1 164 ? 176.531 169.050 14.362  1.00 53.79 ? 161 VAL A CB    1 
ATOM   1214 C  CG1   . VAL A 1 164 ? 175.760 170.229 14.933  1.00 48.43 ? 161 VAL A CG1   1 
ATOM   1215 C  CG2   . VAL A 1 164 ? 176.859 168.024 15.447  1.00 41.46 ? 161 VAL A CG2   1 
ATOM   1216 N  N     . GLN A 1 165 ? 175.167 169.831 11.342  1.00 47.23 ? 162 GLN A N     1 
ATOM   1217 C  CA    . GLN A 1 165 ? 174.336 170.797 10.626  1.00 41.68 ? 162 GLN A CA    1 
ATOM   1218 C  C     . GLN A 1 165 ? 173.725 170.239 9.335   1.00 39.60 ? 162 GLN A C     1 
ATOM   1219 O  O     . GLN A 1 165 ? 174.231 169.279 8.748   1.00 33.62 ? 162 GLN A O     1 
ATOM   1220 C  CB    . GLN A 1 165 ? 175.147 172.054 10.306  1.00 48.01 ? 162 GLN A CB    1 
ATOM   1221 N  N     . LYS A 1 166 ? 172.637 170.881 8.918   1.00 30.80 ? 163 LYS A N     1 
ATOM   1222 C  CA    A LYS A 1 166 ? 171.871 170.482 7.743   0.58 35.64 ? 163 LYS A CA    1 
ATOM   1223 C  CA    B LYS A 1 166 ? 171.862 170.511 7.734   0.42 35.62 ? 163 LYS A CA    1 
ATOM   1224 C  C     . LYS A 1 166 ? 172.711 170.425 6.464   1.00 35.76 ? 163 LYS A C     1 
ATOM   1225 O  O     . LYS A 1 166 ? 172.705 169.418 5.751   1.00 33.33 ? 163 LYS A O     1 
ATOM   1226 C  CB    A LYS A 1 166 ? 170.701 171.447 7.543   0.58 32.96 ? 163 LYS A CB    1 
ATOM   1227 C  CB    B LYS A 1 166 ? 170.730 171.529 7.532   0.42 32.98 ? 163 LYS A CB    1 
ATOM   1228 C  CG    A LYS A 1 166 ? 169.338 170.795 7.571   0.58 32.12 ? 163 LYS A CG    1 
ATOM   1229 C  CG    B LYS A 1 166 ? 169.735 171.192 6.432   0.42 37.37 ? 163 LYS A CG    1 
ATOM   1230 C  CD    A LYS A 1 166 ? 169.179 169.783 6.443   0.58 37.53 ? 163 LYS A CD    1 
ATOM   1231 C  CD    B LYS A 1 166 ? 168.686 172.293 6.262   0.42 32.55 ? 163 LYS A CD    1 
ATOM   1232 C  CE    A LYS A 1 166 ? 167.721 169.621 6.086   0.58 28.47 ? 163 LYS A CE    1 
ATOM   1233 C  CE    B LYS A 1 166 ? 168.979 173.196 5.061   0.42 34.33 ? 163 LYS A CE    1 
ATOM   1234 N  NZ    A LYS A 1 166 ? 167.493 168.648 4.977   0.58 33.59 ? 163 LYS A NZ    1 
ATOM   1235 N  NZ    B LYS A 1 166 ? 170.112 174.139 5.264   0.42 29.12 ? 163 LYS A NZ    1 
ATOM   1236 N  N     . GLU A 1 167 ? 173.428 171.503 6.171   1.00 31.90 ? 164 GLU A N     1 
ATOM   1237 C  CA    . GLU A 1 167 ? 174.240 171.560 4.971   1.00 32.22 ? 164 GLU A CA    1 
ATOM   1238 C  C     . GLU A 1 167 ? 175.401 170.572 5.051   1.00 27.48 ? 164 GLU A C     1 
ATOM   1239 O  O     . GLU A 1 167 ? 175.848 170.032 4.032   1.00 29.47 ? 164 GLU A O     1 
ATOM   1240 C  CB    . GLU A 1 167 ? 174.746 172.996 4.747   1.00 36.18 ? 164 GLU A CB    1 
ATOM   1241 C  CG    . GLU A 1 167 ? 175.677 173.188 3.548   1.00 23.27 ? 164 GLU A CG    1 
ATOM   1242 C  CD    . GLU A 1 167 ? 175.033 172.870 2.184   1.00 27.04 ? 164 GLU A CD    1 
ATOM   1243 O  OE1   . GLU A 1 167 ? 173.824 172.557 2.120   1.00 35.65 ? 164 GLU A OE1   1 
ATOM   1244 O  OE2   . GLU A 1 167 ? 175.759 172.929 1.165   1.00 32.14 ? 164 GLU A OE2   1 
ATOM   1245 N  N     . GLY A 1 168 ? 175.889 170.342 6.265   1.00 31.91 ? 165 GLY A N     1 
ATOM   1246 C  CA    . GLY A 1 168 ? 176.921 169.347 6.489   1.00 33.29 ? 165 GLY A CA    1 
ATOM   1247 C  C     . GLY A 1 168 ? 176.466 167.974 6.037   1.00 32.76 ? 165 GLY A C     1 
ATOM   1248 O  O     . GLY A 1 168 ? 177.156 167.310 5.263   1.00 32.19 ? 165 GLY A O     1 
ATOM   1249 N  N     . MET A 1 169 ? 175.292 167.560 6.509   1.00 30.64 ? 166 MET A N     1 
ATOM   1250 C  CA    . MET A 1 169 ? 174.700 166.276 6.135   1.00 30.45 ? 166 MET A CA    1 
ATOM   1251 C  C     . MET A 1 169 ? 174.474 166.186 4.620   1.00 23.61 ? 166 MET A C     1 
ATOM   1252 O  O     . MET A 1 169 ? 174.796 165.178 4.000   1.00 30.88 ? 166 MET A O     1 
ATOM   1253 C  CB    . MET A 1 169 ? 173.377 166.058 6.887   1.00 27.93 ? 166 MET A CB    1 
ATOM   1254 N  N     . ARG A 1 170 ? 173.945 167.249 4.022   1.00 34.17 ? 167 ARG A N     1 
ATOM   1255 C  CA    . ARG A 1 170 ? 173.693 167.252 2.578   1.00 26.19 ? 167 ARG A CA    1 
ATOM   1256 C  C     . ARG A 1 170 ? 174.946 166.902 1.793   1.00 23.68 ? 167 ARG A C     1 
ATOM   1257 O  O     . ARG A 1 170 ? 174.913 166.054 0.897   1.00 23.72 ? 167 ARG A O     1 
ATOM   1258 C  CB    . ARG A 1 170 ? 173.168 168.614 2.117   1.00 29.54 ? 167 ARG A CB    1 
ATOM   1259 C  CG    . ARG A 1 170 ? 172.801 168.646 0.625   1.00 28.01 ? 167 ARG A CG    1 
ATOM   1260 C  CD    . ARG A 1 170 ? 172.654 170.068 0.098   1.00 26.12 ? 167 ARG A CD    1 
ATOM   1261 N  NE    . ARG A 1 170 ? 173.949 170.716 -0.109  1.00 28.94 ? 167 ARG A NE    1 
ATOM   1262 C  CZ    . ARG A 1 170 ? 174.696 170.526 -1.189  1.00 25.96 ? 167 ARG A CZ    1 
ATOM   1263 N  NH1   . ARG A 1 170 ? 174.280 169.701 -2.136  1.00 25.89 ? 167 ARG A NH1   1 
ATOM   1264 N  NH2   . ARG A 1 170 ? 175.862 171.148 -1.328  1.00 31.23 ? 167 ARG A NH2   1 
ATOM   1265 N  N     . LYS A 1 171 ? 176.052 167.559 2.148   1.00 22.15 ? 168 LYS A N     1 
ATOM   1266 C  CA    . LYS A 1 171 ? 177.322 167.394 1.450   1.00 24.25 ? 168 LYS A CA    1 
ATOM   1267 C  C     . LYS A 1 171 ? 177.953 166.028 1.695   1.00 26.10 ? 168 LYS A C     1 
ATOM   1268 O  O     . LYS A 1 171 ? 178.482 165.426 0.766   1.00 23.38 ? 168 LYS A O     1 
ATOM   1269 C  CB    . LYS A 1 171 ? 178.310 168.495 1.857   1.00 32.27 ? 168 LYS A CB    1 
ATOM   1270 C  CG    . LYS A 1 171 ? 178.020 169.870 1.254   1.00 41.10 ? 168 LYS A CG    1 
ATOM   1271 C  CD    . LYS A 1 171 ? 178.986 170.909 1.820   1.00 41.69 ? 168 LYS A CD    1 
ATOM   1272 C  CE    . LYS A 1 171 ? 178.944 172.222 1.053   1.00 49.97 ? 168 LYS A CE    1 
ATOM   1273 N  NZ    . LYS A 1 171 ? 179.877 173.221 1.665   1.00 58.02 ? 168 LYS A NZ    1 
ATOM   1274 N  N     . GLN A 1 172 ? 177.911 165.554 2.940   1.00 24.51 ? 169 GLN A N     1 
ATOM   1275 C  CA    . GLN A 1 172 ? 178.444 164.229 3.273   1.00 31.60 ? 169 GLN A CA    1 
ATOM   1276 C  C     . GLN A 1 172 ? 177.790 163.171 2.393   1.00 31.63 ? 169 GLN A C     1 
ATOM   1277 O  O     . GLN A 1 172 ? 178.467 162.301 1.835   1.00 22.82 ? 169 GLN A O     1 
ATOM   1278 C  CB    . GLN A 1 172 ? 178.211 163.875 4.750   1.00 29.40 ? 169 GLN A CB    1 
ATOM   1279 C  CG    . GLN A 1 172 ? 179.039 164.664 5.758   1.00 47.87 ? 169 GLN A CG    1 
ATOM   1280 C  CD    . GLN A 1 172 ? 180.501 164.249 5.786   1.00 62.36 ? 169 GLN A CD    1 
ATOM   1281 O  OE1   . GLN A 1 172 ? 181.370 164.956 5.269   1.00 64.99 ? 169 GLN A OE1   1 
ATOM   1282 N  NE2   . GLN A 1 172 ? 180.780 163.099 6.395   1.00 67.73 ? 169 GLN A NE2   1 
ATOM   1283 N  N     . GLY A 1 173 ? 176.465 163.264 2.272   1.00 30.11 ? 170 GLY A N     1 
ATOM   1284 C  CA    . GLY A 1 173 ? 175.700 162.340 1.456   1.00 19.80 ? 170 GLY A CA    1 
ATOM   1285 C  C     . GLY A 1 173 ? 176.081 162.446 -0.003  1.00 19.47 ? 170 GLY A C     1 
ATOM   1286 O  O     . GLY A 1 173 ? 176.264 161.441 -0.681  1.00 24.83 ? 170 GLY A O     1 
ATOM   1287 N  N     . LEU A 1 174 ? 176.197 163.678 -0.488  1.00 26.92 ? 171 LEU A N     1 
ATOM   1288 C  CA    . LEU A 1 174 ? 176.571 163.919 -1.876  1.00 24.84 ? 171 LEU A CA    1 
ATOM   1289 C  C     . LEU A 1 174 ? 177.991 163.382 -2.165  1.00 31.54 ? 171 LEU A C     1 
ATOM   1290 O  O     . LEU A 1 174 ? 178.228 162.772 -3.208  1.00 26.26 ? 171 LEU A O     1 
ATOM   1291 C  CB    . LEU A 1 174 ? 176.473 165.417 -2.189  1.00 18.96 ? 171 LEU A CB    1 
ATOM   1292 C  CG    . LEU A 1 174 ? 176.882 165.888 -3.579  1.00 19.68 ? 171 LEU A CG    1 
ATOM   1293 C  CD1   . LEU A 1 174 ? 176.002 165.244 -4.642  1.00 20.53 ? 171 LEU A CD1   1 
ATOM   1294 C  CD2   . LEU A 1 174 ? 176.842 167.414 -3.662  1.00 19.79 ? 171 LEU A CD2   1 
ATOM   1295 N  N     . PHE A 1 175 ? 178.924 163.588 -1.234  1.00 29.44 ? 172 PHE A N     1 
ATOM   1296 C  CA    . PHE A 1 175 ? 180.281 163.050 -1.397  1.00 30.43 ? 172 PHE A CA    1 
ATOM   1297 C  C     . PHE A 1 175 ? 180.272 161.519 -1.478  1.00 27.55 ? 172 PHE A C     1 
ATOM   1298 O  O     . PHE A 1 175 ? 180.886 160.940 -2.375  1.00 32.52 ? 172 PHE A O     1 
ATOM   1299 C  CB    . PHE A 1 175 ? 181.194 163.504 -0.250  1.00 34.82 ? 172 PHE A CB    1 
ATOM   1300 C  CG    . PHE A 1 175 ? 181.525 164.973 -0.273  1.00 37.43 ? 172 PHE A CG    1 
ATOM   1301 C  CD1   . PHE A 1 175 ? 181.515 165.688 -1.466  1.00 38.60 ? 172 PHE A CD1   1 
ATOM   1302 C  CD2   . PHE A 1 175 ? 181.851 165.642 0.904   1.00 47.40 ? 172 PHE A CD2   1 
ATOM   1303 C  CE1   . PHE A 1 175 ? 181.819 167.048 -1.485  1.00 39.61 ? 172 PHE A CE1   1 
ATOM   1304 C  CE2   . PHE A 1 175 ? 182.161 167.004 0.890   1.00 50.06 ? 172 PHE A CE2   1 
ATOM   1305 C  CZ    . PHE A 1 175 ? 182.139 167.705 -0.310  1.00 39.97 ? 172 PHE A CZ    1 
ATOM   1306 N  N     . GLN A 1 176 ? 179.591 160.869 -0.537  1.00 25.10 ? 173 GLN A N     1 
ATOM   1307 C  CA    . GLN A 1 176 ? 179.450 159.414 -0.564  1.00 26.81 ? 173 GLN A CA    1 
ATOM   1308 C  C     . GLN A 1 176 ? 178.883 158.968 -1.910  1.00 28.33 ? 173 GLN A C     1 
ATOM   1309 O  O     . GLN A 1 176 ? 179.415 158.057 -2.551  1.00 29.58 ? 173 GLN A O     1 
ATOM   1310 C  CB    . GLN A 1 176 ? 178.555 158.923 0.593   1.00 25.29 ? 173 GLN A CB    1 
ATOM   1311 C  CG    . GLN A 1 176 ? 179.238 158.889 1.960   1.00 25.16 ? 173 GLN A CG    1 
ATOM   1312 C  CD    . GLN A 1 176 ? 178.319 158.395 3.073   1.00 31.25 ? 173 GLN A CD    1 
ATOM   1313 O  OE1   . GLN A 1 176 ? 177.168 158.023 2.832   1.00 32.62 ? 173 GLN A OE1   1 
ATOM   1314 N  NE2   . GLN A 1 176 ? 178.831 158.385 4.299   1.00 34.08 ? 173 GLN A NE2   1 
ATOM   1315 N  N     . TRP A 1 177 ? 177.824 159.636 -2.357  1.00 25.65 ? 174 TRP A N     1 
ATOM   1316 C  CA    . TRP A 1 177 ? 177.213 159.327 -3.657  1.00 21.51 ? 174 TRP A CA    1 
ATOM   1317 C  C     . TRP A 1 177 ? 178.195 159.435 -4.816  1.00 24.75 ? 174 TRP A C     1 
ATOM   1318 O  O     . TRP A 1 177 ? 178.339 158.497 -5.610  1.00 30.55 ? 174 TRP A O     1 
ATOM   1319 C  CB    . TRP A 1 177 ? 176.012 160.255 -3.911  1.00 19.59 ? 174 TRP A CB    1 
ATOM   1320 C  CG    . TRP A 1 177 ? 175.361 160.107 -5.278  1.00 26.21 ? 174 TRP A CG    1 
ATOM   1321 C  CD1   . TRP A 1 177 ? 175.501 160.944 -6.355  1.00 22.65 ? 174 TRP A CD1   1 
ATOM   1322 C  CD2   . TRP A 1 177 ? 174.454 159.073 -5.694  1.00 19.01 ? 174 TRP A CD2   1 
ATOM   1323 N  NE1   . TRP A 1 177 ? 174.740 160.486 -7.416  1.00 20.40 ? 174 TRP A NE1   1 
ATOM   1324 C  CE2   . TRP A 1 177 ? 174.085 159.346 -7.030  1.00 22.14 ? 174 TRP A CE2   1 
ATOM   1325 C  CE3   . TRP A 1 177 ? 173.924 157.943 -5.069  1.00 20.57 ? 174 TRP A CE3   1 
ATOM   1326 C  CZ2   . TRP A 1 177 ? 173.216 158.519 -7.750  1.00 21.62 ? 174 TRP A CZ2   1 
ATOM   1327 C  CZ3   . TRP A 1 177 ? 173.054 157.133 -5.782  1.00 24.11 ? 174 TRP A CZ3   1 
ATOM   1328 C  CH2   . TRP A 1 177 ? 172.710 157.426 -7.104  1.00 24.39 ? 174 TRP A CH2   1 
ATOM   1329 N  N     . LEU A 1 178 ? 178.861 160.579 -4.926  1.00 29.67 ? 175 LEU A N     1 
ATOM   1330 C  CA    . LEU A 1 178 ? 179.746 160.837 -6.068  1.00 31.19 ? 175 LEU A CA    1 
ATOM   1331 C  C     . LEU A 1 178 ? 180.996 159.963 -6.034  1.00 40.53 ? 175 LEU A C     1 
ATOM   1332 O  O     . LEU A 1 178 ? 181.562 159.633 -7.077  1.00 32.97 ? 175 LEU A O     1 
ATOM   1333 C  CB    . LEU A 1 178 ? 180.153 162.311 -6.104  1.00 31.84 ? 175 LEU A CB    1 
ATOM   1334 C  CG    . LEU A 1 178 ? 179.041 163.320 -6.410  1.00 30.44 ? 175 LEU A CG    1 
ATOM   1335 C  CD1   . LEU A 1 178 ? 179.559 164.742 -6.255  1.00 28.65 ? 175 LEU A CD1   1 
ATOM   1336 C  CD2   . LEU A 1 178 ? 178.489 163.108 -7.819  1.00 22.63 ? 175 LEU A CD2   1 
ATOM   1337 N  N     . ASP A 1 179 ? 181.435 159.612 -4.828  1.00 25.68 ? 176 ASP A N     1 
ATOM   1338 C  CA    . ASP A 1 179 ? 182.639 158.804 -4.664  1.00 35.57 ? 176 ASP A CA    1 
ATOM   1339 C  C     . ASP A 1 179 ? 182.380 157.391 -5.166  1.00 36.69 ? 176 ASP A C     1 
ATOM   1340 O  O     . ASP A 1 179 ? 183.288 156.721 -5.655  1.00 41.91 ? 176 ASP A O     1 
ATOM   1341 C  CB    . ASP A 1 179 ? 183.096 158.783 -3.195  1.00 31.28 ? 176 ASP A CB    1 
ATOM   1342 C  CG    . ASP A 1 179 ? 183.931 160.008 -2.827  1.00 52.45 ? 176 ASP A CG    1 
ATOM   1343 O  OD1   . ASP A 1 179 ? 184.572 160.574 -3.737  1.00 61.23 ? 176 ASP A OD1   1 
ATOM   1344 O  OD2   . ASP A 1 179 ? 183.931 160.423 -1.640  1.00 48.32 ? 176 ASP A OD2   1 
ATOM   1345 N  N     . SER A 1 180 ? 181.133 156.946 -5.055  1.00 30.76 ? 177 SER A N     1 
ATOM   1346 C  CA    . SER A 1 180 ? 180.768 155.598 -5.465  1.00 32.08 ? 177 SER A CA    1 
ATOM   1347 C  C     . SER A 1 180 ? 180.391 155.526 -6.936  1.00 31.41 ? 177 SER A C     1 
ATOM   1348 O  O     . SER A 1 180 ? 180.204 154.447 -7.476  1.00 35.15 ? 177 SER A O     1 
ATOM   1349 C  CB    . SER A 1 180 ? 179.598 155.081 -4.617  1.00 28.17 ? 177 SER A CB    1 
ATOM   1350 O  OG    . SER A 1 180 ? 179.978 154.936 -3.265  1.00 42.58 ? 177 SER A OG    1 
ATOM   1351 N  N     . LEU A 1 181 ? 180.265 156.677 -7.583  1.00 35.24 ? 178 LEU A N     1 
ATOM   1352 C  CA    . LEU A 1 181 ? 179.654 156.729 -8.910  1.00 29.02 ? 178 LEU A CA    1 
ATOM   1353 C  C     . LEU A 1 181 ? 180.624 156.286 -10.015 1.00 40.22 ? 178 LEU A C     1 
ATOM   1354 O  O     . LEU A 1 181 ? 181.708 156.851 -10.166 1.00 48.16 ? 178 LEU A O     1 
ATOM   1355 C  CB    . LEU A 1 181 ? 179.133 158.154 -9.167  1.00 35.96 ? 178 LEU A CB    1 
ATOM   1356 C  CG    . LEU A 1 181 ? 177.998 158.445 -10.153 1.00 39.98 ? 178 LEU A CG    1 
ATOM   1357 C  CD1   . LEU A 1 181 ? 176.688 157.727 -9.795  1.00 30.03 ? 178 LEU A CD1   1 
ATOM   1358 C  CD2   . LEU A 1 181 ? 177.776 159.955 -10.230 1.00 30.94 ? 178 LEU A CD2   1 
ATOM   1359 N  N     . GLN A 1 182 ? 180.222 155.264 -10.771 1.00 46.26 ? 179 GLN A N     1 
ATOM   1360 C  CA    . GLN A 1 182 ? 180.982 154.763 -11.918 1.00 48.39 ? 179 GLN A CA    1 
ATOM   1361 C  C     . GLN A 1 182 ? 180.691 155.565 -13.178 1.00 55.97 ? 179 GLN A C     1 
ATOM   1362 O  O     . GLN A 1 182 ? 179.690 155.321 -13.848 1.00 60.98 ? 179 GLN A O     1 
ATOM   1363 C  CB    . GLN A 1 182 ? 180.662 153.289 -12.177 1.00 46.54 ? 179 GLN A CB    1 
ATOM   1364 N  N     . ILE A 1 183 ? 181.586 156.494 -13.510 1.00 55.72 ? 180 ILE A N     1 
ATOM   1365 C  CA    . ILE A 1 183 ? 181.363 157.443 -14.599 1.00 58.71 ? 180 ILE A CA    1 
ATOM   1366 C  C     . ILE A 1 183 ? 181.751 156.910 -15.983 1.00 62.14 ? 180 ILE A C     1 
ATOM   1367 O  O     . ILE A 1 183 ? 181.477 157.556 -16.998 1.00 61.69 ? 180 ILE A O     1 
ATOM   1368 C  CB    . ILE A 1 183 ? 182.135 158.768 -14.347 1.00 59.55 ? 180 ILE A CB    1 
ATOM   1369 C  CG1   . ILE A 1 183 ? 183.480 158.503 -13.654 1.00 62.18 ? 180 ILE A CG1   1 
ATOM   1370 C  CG2   . ILE A 1 183 ? 181.299 159.723 -13.497 1.00 48.80 ? 180 ILE A CG2   1 
ATOM   1371 C  CD1   . ILE A 1 183 ? 184.538 157.849 -14.533 1.00 55.49 ? 180 ILE A CD1   1 
ATOM   1372 N  N     . ASP A 1 184 ? 182.391 155.745 -16.022 1.00 61.09 ? 181 ASP A N     1 
ATOM   1373 C  CA    . ASP A 1 184 ? 182.875 155.185 -17.284 1.00 62.37 ? 181 ASP A CA    1 
ATOM   1374 C  C     . ASP A 1 184 ? 181.792 154.399 -18.015 1.00 63.44 ? 181 ASP A C     1 
ATOM   1375 O  O     . ASP A 1 184 ? 181.956 154.043 -19.183 1.00 60.73 ? 181 ASP A O     1 
ATOM   1376 C  CB    . ASP A 1 184 ? 184.089 154.283 -17.048 1.00 56.42 ? 181 ASP A CB    1 
ATOM   1377 C  CG    . ASP A 1 184 ? 183.711 152.936 -16.457 1.00 66.34 ? 181 ASP A CG    1 
ATOM   1378 O  OD1   . ASP A 1 184 ? 182.719 152.866 -15.697 1.00 70.63 ? 181 ASP A OD1   1 
ATOM   1379 O  OD2   . ASP A 1 184 ? 184.406 151.942 -16.753 1.00 62.87 ? 181 ASP A OD2   1 
ATOM   1380 N  N     . ASN A 1 185 ? 180.696 154.109 -17.321 1.00 58.86 ? 182 ASN A N     1 
ATOM   1381 C  CA    . ASN A 1 185 ? 179.570 153.434 -17.955 1.00 56.79 ? 182 ASN A CA    1 
ATOM   1382 C  C     . ASN A 1 185 ? 178.417 154.397 -18.175 1.00 49.30 ? 182 ASN A C     1 
ATOM   1383 O  O     . ASN A 1 185 ? 177.736 154.805 -17.230 1.00 45.38 ? 182 ASN A O     1 
ATOM   1384 C  CB    . ASN A 1 185 ? 179.105 152.239 -17.124 1.00 49.16 ? 182 ASN A CB    1 
ATOM   1385 C  CG    . ASN A 1 185 ? 177.981 151.467 -17.792 1.00 47.71 ? 182 ASN A CG    1 
ATOM   1386 O  OD1   . ASN A 1 185 ? 177.692 151.652 -18.984 1.00 54.40 ? 182 ASN A OD1   1 
ATOM   1387 N  ND2   . ASN A 1 185 ? 177.334 150.595 -17.025 1.00 60.60 ? 182 ASN A ND2   1 
ATOM   1388 N  N     . LEU A 1 186 ? 178.202 154.742 -19.439 1.00 50.24 ? 183 LEU A N     1 
ATOM   1389 C  CA    . LEU A 1 186 ? 177.185 155.709 -19.823 1.00 48.88 ? 183 LEU A CA    1 
ATOM   1390 C  C     . LEU A 1 186 ? 175.789 155.085 -19.772 1.00 46.61 ? 183 LEU A C     1 
ATOM   1391 O  O     . LEU A 1 186 ? 174.787 155.762 -20.004 1.00 40.56 ? 183 LEU A O     1 
ATOM   1392 C  CB    . LEU A 1 186 ? 177.482 156.263 -21.220 1.00 51.25 ? 183 LEU A CB    1 
ATOM   1393 C  CG    . LEU A 1 186 ? 178.438 157.458 -21.336 1.00 60.37 ? 183 LEU A CG    1 
ATOM   1394 C  CD1   . LEU A 1 186 ? 179.795 157.197 -20.687 1.00 57.39 ? 183 LEU A CD1   1 
ATOM   1395 C  CD2   . LEU A 1 186 ? 178.611 157.852 -22.799 1.00 61.13 ? 183 LEU A CD2   1 
ATOM   1396 N  N     . THR A 1 187 ? 175.731 153.792 -19.459 1.00 44.89 ? 184 THR A N     1 
ATOM   1397 C  CA    . THR A 1 187 ? 174.456 153.104 -19.315 1.00 45.19 ? 184 THR A CA    1 
ATOM   1398 C  C     . THR A 1 187 ? 174.041 152.946 -17.849 1.00 36.33 ? 184 THR A C     1 
ATOM   1399 O  O     . THR A 1 187 ? 172.962 152.431 -17.578 1.00 41.33 ? 184 THR A O     1 
ATOM   1400 C  CB    . THR A 1 187 ? 174.485 151.703 -19.980 1.00 43.18 ? 184 THR A CB    1 
ATOM   1401 N  N     . SER A 1 188 ? 174.886 153.377 -16.912 1.00 36.69 ? 185 SER A N     1 
ATOM   1402 C  CA    . SER A 1 188 ? 174.540 153.322 -15.478 1.00 30.36 ? 185 SER A CA    1 
ATOM   1403 C  C     . SER A 1 188 ? 173.342 154.214 -15.132 1.00 25.49 ? 185 SER A C     1 
ATOM   1404 O  O     . SER A 1 188 ? 173.422 155.436 -15.250 1.00 20.95 ? 185 SER A O     1 
ATOM   1405 C  CB    . SER A 1 188 ? 175.735 153.729 -14.613 1.00 32.33 ? 185 SER A CB    1 
ATOM   1406 O  OG    . SER A 1 188 ? 175.390 153.791 -13.228 1.00 31.12 ? 185 SER A OG    1 
ATOM   1407 N  N     . PRO A 1 189 ? 172.233 153.603 -14.686 1.00 25.20 ? 186 PRO A N     1 
ATOM   1408 C  CA    . PRO A 1 189 ? 171.068 154.381 -14.254 1.00 24.27 ? 186 PRO A CA    1 
ATOM   1409 C  C     . PRO A 1 189 ? 171.419 155.456 -13.233 1.00 22.37 ? 186 PRO A C     1 
ATOM   1410 O  O     . PRO A 1 189 ? 170.839 156.535 -13.304 1.00 20.38 ? 186 PRO A O     1 
ATOM   1411 C  CB    . PRO A 1 189 ? 170.151 153.321 -13.643 1.00 23.31 ? 186 PRO A CB    1 
ATOM   1412 C  CG    . PRO A 1 189 ? 170.478 152.080 -14.432 1.00 31.47 ? 186 PRO A CG    1 
ATOM   1413 C  CD    . PRO A 1 189 ? 171.969 152.153 -14.656 1.00 20.87 ? 186 PRO A CD    1 
ATOM   1414 N  N     . ASP A 1 190 ? 172.349 155.178 -12.319 1.00 20.84 ? 187 ASP A N     1 
ATOM   1415 C  CA    . ASP A 1 190 ? 172.674 156.145 -11.275 1.00 22.01 ? 187 ASP A CA    1 
ATOM   1416 C  C     . ASP A 1 190 ? 173.429 157.337 -11.827 1.00 20.07 ? 187 ASP A C     1 
ATOM   1417 O  O     . ASP A 1 190 ? 173.227 158.464 -11.374 1.00 23.93 ? 187 ASP A O     1 
ATOM   1418 C  CB    . ASP A 1 190 ? 173.494 155.510 -10.152 1.00 18.96 ? 187 ASP A CB    1 
ATOM   1419 C  CG    . ASP A 1 190 ? 172.661 154.597 -9.256  1.00 31.19 ? 187 ASP A CG    1 
ATOM   1420 O  OD1   . ASP A 1 190 ? 171.409 154.709 -9.236  1.00 22.40 ? 187 ASP A OD1   1 
ATOM   1421 O  OD2   . ASP A 1 190 ? 173.275 153.767 -8.572  1.00 24.80 ? 187 ASP A OD2   1 
ATOM   1422 N  N     . LEU A 1 191 ? 174.325 157.071 -12.769 1.00 20.92 ? 188 LEU A N     1 
ATOM   1423 C  CA    . LEU A 1 191 ? 175.066 158.117 -13.443 1.00 25.85 ? 188 LEU A CA    1 
ATOM   1424 C  C     . LEU A 1 191 ? 174.085 159.015 -14.185 1.00 23.20 ? 188 LEU A C     1 
ATOM   1425 O  O     . LEU A 1 191 ? 174.206 160.239 -14.175 1.00 23.45 ? 188 LEU A O     1 
ATOM   1426 C  CB    . LEU A 1 191 ? 176.091 157.521 -14.414 1.00 21.45 ? 188 LEU A CB    1 
ATOM   1427 C  CG    . LEU A 1 191 ? 176.859 158.536 -15.285 1.00 25.78 ? 188 LEU A CG    1 
ATOM   1428 C  CD1   . LEU A 1 191 ? 177.527 159.609 -14.434 1.00 25.87 ? 188 LEU A CD1   1 
ATOM   1429 C  CD2   . LEU A 1 191 ? 177.898 157.858 -16.176 1.00 30.58 ? 188 LEU A CD2   1 
ATOM   1430 N  N     . GLN A 1 192 ? 173.112 158.392 -14.836 1.00 19.15 ? 189 GLN A N     1 
ATOM   1431 C  CA    . GLN A 1 192 ? 172.112 159.139 -15.597 1.00 19.27 ? 189 GLN A CA    1 
ATOM   1432 C  C     . GLN A 1 192 ? 171.259 160.043 -14.705 1.00 24.04 ? 189 GLN A C     1 
ATOM   1433 O  O     . GLN A 1 192 ? 171.014 161.199 -15.066 1.00 22.11 ? 189 GLN A O     1 
ATOM   1434 C  CB    . GLN A 1 192 ? 171.242 158.168 -16.400 1.00 22.39 ? 189 GLN A CB    1 
ATOM   1435 C  CG    . GLN A 1 192 ? 171.947 157.696 -17.668 1.00 31.59 ? 189 GLN A CG    1 
ATOM   1436 C  CD    . GLN A 1 192 ? 171.323 156.466 -18.290 1.00 42.18 ? 189 GLN A CD    1 
ATOM   1437 O  OE1   . GLN A 1 192 ? 170.519 155.771 -17.667 1.00 34.18 ? 189 GLN A OE1   1 
ATOM   1438 N  NE2   . GLN A 1 192 ? 171.705 156.183 -19.528 1.00 52.86 ? 189 GLN A NE2   1 
ATOM   1439 N  N     . LEU A 1 193 ? 170.833 159.538 -13.539 1.00 20.31 ? 190 LEU A N     1 
ATOM   1440 C  CA    . LEU A 1 193 ? 170.132 160.381 -12.557 1.00 15.79 ? 190 LEU A CA    1 
ATOM   1441 C  C     . LEU A 1 193 ? 170.993 161.562 -12.099 1.00 19.92 ? 190 LEU A C     1 
ATOM   1442 O  O     . LEU A 1 193 ? 170.491 162.680 -11.923 1.00 18.42 ? 190 LEU A O     1 
ATOM   1443 C  CB    . LEU A 1 193 ? 169.717 159.571 -11.323 1.00 19.06 ? 190 LEU A CB    1 
ATOM   1444 C  CG    . LEU A 1 193 ? 168.616 158.526 -11.491 1.00 19.63 ? 190 LEU A CG    1 
ATOM   1445 C  CD1   . LEU A 1 193 ? 168.340 157.838 -10.158 1.00 18.91 ? 190 LEU A CD1   1 
ATOM   1446 C  CD2   . LEU A 1 193 ? 167.346 159.140 -12.062 1.00 16.01 ? 190 LEU A CD2   1 
ATOM   1447 N  N     . THR A 1 194 ? 172.281 161.295 -11.882 1.00 18.03 ? 191 THR A N     1 
ATOM   1448 C  CA    . THR A 1 194 ? 173.226 162.309 -11.415 1.00 18.85 ? 191 THR A CA    1 
ATOM   1449 C  C     . THR A 1 194 ? 173.335 163.427 -12.460 1.00 23.89 ? 191 THR A C     1 
ATOM   1450 O  O     . THR A 1 194 ? 173.238 164.605 -12.128 1.00 21.46 ? 191 THR A O     1 
ATOM   1451 C  CB    . THR A 1 194 ? 174.611 161.699 -11.139 1.00 19.79 ? 191 THR A CB    1 
ATOM   1452 O  OG1   . THR A 1 194 ? 174.479 160.656 -10.166 1.00 25.28 ? 191 THR A OG1   1 
ATOM   1453 C  CG2   . THR A 1 194 ? 175.593 162.760 -10.614 1.00 17.94 ? 191 THR A CG2   1 
ATOM   1454 N  N     . VAL A 1 195 ? 173.527 163.051 -13.722 1.00 17.63 ? 192 VAL A N     1 
ATOM   1455 C  CA    . VAL A 1 195 ? 173.549 164.039 -14.802 1.00 24.84 ? 192 VAL A CA    1 
ATOM   1456 C  C     . VAL A 1 195 ? 172.199 164.754 -14.908 1.00 22.41 ? 192 VAL A C     1 
ATOM   1457 O  O     . VAL A 1 195 ? 172.151 165.960 -15.121 1.00 19.72 ? 192 VAL A O     1 
ATOM   1458 C  CB    . VAL A 1 195 ? 173.910 163.395 -16.165 1.00 25.66 ? 192 VAL A CB    1 
ATOM   1459 C  CG1   . VAL A 1 195 ? 173.802 164.433 -17.297 1.00 20.26 ? 192 VAL A CG1   1 
ATOM   1460 C  CG2   . VAL A 1 195 ? 175.316 162.789 -16.105 1.00 21.32 ? 192 VAL A CG2   1 
ATOM   1461 N  N     . GLY A 1 196 ? 171.106 164.004 -14.750 1.00 21.62 ? 193 GLY A N     1 
ATOM   1462 C  CA    . GLY A 1 196 ? 169.773 164.588 -14.672 1.00 16.56 ? 193 GLY A CA    1 
ATOM   1463 C  C     . GLY A 1 196 ? 169.697 165.729 -13.662 1.00 21.13 ? 193 GLY A C     1 
ATOM   1464 O  O     . GLY A 1 196 ? 169.194 166.824 -13.965 1.00 19.57 ? 193 GLY A O     1 
ATOM   1465 N  N     . ALA A 1 197 ? 170.228 165.479 -12.466 1.00 15.24 ? 194 ALA A N     1 
ATOM   1466 C  CA    . ALA A 1 197 ? 170.236 166.469 -11.391 1.00 21.14 ? 194 ALA A CA    1 
ATOM   1467 C  C     . ALA A 1 197 ? 171.114 167.688 -11.705 1.00 18.81 ? 194 ALA A C     1 
ATOM   1468 O  O     . ALA A 1 197 ? 170.800 168.807 -11.288 1.00 18.30 ? 194 ALA A O     1 
ATOM   1469 C  CB    . ALA A 1 197 ? 170.687 165.821 -10.081 1.00 16.28 ? 194 ALA A CB    1 
ATOM   1470 N  N     . VAL A 1 198 ? 172.218 167.471 -12.415 1.00 17.54 ? 195 VAL A N     1 
ATOM   1471 C  CA    . VAL A 1 198 ? 173.039 168.593 -12.876 1.00 17.50 ? 195 VAL A CA    1 
ATOM   1472 C  C     . VAL A 1 198 ? 172.205 169.505 -13.790 1.00 19.22 ? 195 VAL A C     1 
ATOM   1473 O  O     . VAL A 1 198 ? 172.190 170.723 -13.613 1.00 19.87 ? 195 VAL A O     1 
ATOM   1474 C  CB    . VAL A 1 198 ? 174.319 168.113 -13.612 1.00 21.17 ? 195 VAL A CB    1 
ATOM   1475 C  CG1   . VAL A 1 198 ? 174.999 169.288 -14.384 1.00 20.04 ? 195 VAL A CG1   1 
ATOM   1476 C  CG2   . VAL A 1 198 ? 175.299 167.488 -12.617 1.00 16.08 ? 195 VAL A CG2   1 
ATOM   1477 N  N     . ILE A 1 199 ? 171.491 168.917 -14.744 1.00 16.04 ? 196 ILE A N     1 
ATOM   1478 C  CA    . ILE A 1 199 ? 170.636 169.720 -15.625 1.00 18.58 ? 196 ILE A CA    1 
ATOM   1479 C  C     . ILE A 1 199 ? 169.548 170.458 -14.835 1.00 24.49 ? 196 ILE A C     1 
ATOM   1480 O  O     . ILE A 1 199 ? 169.236 171.625 -15.114 1.00 21.66 ? 196 ILE A O     1 
ATOM   1481 C  CB    . ILE A 1 199 ? 170.006 168.841 -16.732 1.00 20.15 ? 196 ILE A CB    1 
ATOM   1482 C  CG1   . ILE A 1 199 ? 171.110 168.327 -17.660 1.00 22.79 ? 196 ILE A CG1   1 
ATOM   1483 C  CG2   . ILE A 1 199 ? 168.997 169.632 -17.558 1.00 18.91 ? 196 ILE A CG2   1 
ATOM   1484 C  CD1   . ILE A 1 199 ? 170.692 167.169 -18.533 1.00 22.77 ? 196 ILE A CD1   1 
ATOM   1485 N  N     . VAL A 1 200 ? 168.999 169.809 -13.810 1.00 22.14 ? 197 VAL A N     1 
ATOM   1486 C  CA    . VAL A 1 200 ? 167.942 170.446 -13.041 1.00 19.75 ? 197 VAL A CA    1 
ATOM   1487 C  C     . VAL A 1 200 ? 168.483 171.603 -12.191 1.00 20.39 ? 197 VAL A C     1 
ATOM   1488 O  O     . VAL A 1 200 ? 167.810 172.639 -12.052 1.00 21.27 ? 197 VAL A O     1 
ATOM   1489 C  CB    . VAL A 1 200 ? 167.202 169.420 -12.165 1.00 16.95 ? 197 VAL A CB    1 
ATOM   1490 C  CG1   . VAL A 1 200 ? 166.170 170.113 -11.283 1.00 18.41 ? 197 VAL A CG1   1 
ATOM   1491 C  CG2   . VAL A 1 200 ? 166.514 168.389 -13.063 1.00 19.66 ? 197 VAL A CG2   1 
ATOM   1492 N  N     . GLU A 1 201 ? 169.685 171.457 -11.635 1.00 18.31 ? 198 GLU A N     1 
ATOM   1493 C  CA    . GLU A 1 201 ? 170.339 172.618 -11.010 1.00 25.91 ? 198 GLU A CA    1 
ATOM   1494 C  C     . GLU A 1 201 ? 170.358 173.809 -11.992 1.00 22.81 ? 198 GLU A C     1 
ATOM   1495 O  O     . GLU A 1 201 ? 170.005 174.933 -11.635 1.00 21.26 ? 198 GLU A O     1 
ATOM   1496 C  CB    . GLU A 1 201 ? 171.777 172.292 -10.554 1.00 20.90 ? 198 GLU A CB    1 
ATOM   1497 C  CG    . GLU A 1 201 ? 171.904 171.286 -9.391  1.00 23.28 ? 198 GLU A CG    1 
ATOM   1498 C  CD    . GLU A 1 201 ? 171.764 171.894 -7.998  1.00 22.23 ? 198 GLU A CD    1 
ATOM   1499 O  OE1   . GLU A 1 201 ? 171.401 173.091 -7.857  1.00 19.66 ? 198 GLU A OE1   1 
ATOM   1500 O  OE2   . GLU A 1 201 ? 172.007 171.149 -7.024  1.00 23.88 ? 198 GLU A OE2   1 
ATOM   1501 N  N     . GLU A 1 202 ? 170.751 173.544 -13.235 1.00 21.77 ? 199 GLU A N     1 
ATOM   1502 C  CA    . GLU A 1 202 ? 170.799 174.579 -14.269 1.00 22.49 ? 199 GLU A CA    1 
ATOM   1503 C  C     . GLU A 1 202 ? 169.413 175.173 -14.528 1.00 25.04 ? 199 GLU A C     1 
ATOM   1504 O  O     . GLU A 1 202 ? 169.250 176.392 -14.621 1.00 20.34 ? 199 GLU A O     1 
ATOM   1505 C  CB    . GLU A 1 202 ? 171.384 174.008 -15.572 1.00 24.54 ? 199 GLU A CB    1 
ATOM   1506 C  CG    . GLU A 1 202 ? 172.872 173.657 -15.463 1.00 27.69 ? 199 GLU A CG    1 
ATOM   1507 C  CD    . GLU A 1 202 ? 173.363 172.693 -16.541 1.00 27.71 ? 199 GLU A CD    1 
ATOM   1508 O  OE1   . GLU A 1 202 ? 172.593 172.341 -17.454 1.00 33.53 ? 199 GLU A OE1   1 
ATOM   1509 O  OE2   . GLU A 1 202 ? 174.540 172.287 -16.473 1.00 32.45 ? 199 GLU A OE2   1 
ATOM   1510 N  N     . MET A 1 203 ? 168.413 174.302 -14.643 1.00 20.16 ? 200 MET A N     1 
ATOM   1511 C  CA    . MET A 1 203 ? 167.073 174.739 -14.962 1.00 22.39 ? 200 MET A CA    1 
ATOM   1512 C  C     . MET A 1 203 ? 166.552 175.619 -13.833 1.00 22.36 ? 200 MET A C     1 
ATOM   1513 O  O     . MET A 1 203 ? 165.960 176.672 -14.074 1.00 17.51 ? 200 MET A O     1 
ATOM   1514 C  CB    . MET A 1 203 ? 166.157 173.535 -15.195 1.00 25.54 ? 200 MET A CB    1 
ATOM   1515 C  CG    . MET A 1 203 ? 164.815 173.868 -15.829 1.00 35.86 ? 200 MET A CG    1 
ATOM   1516 S  SD    . MET A 1 203 ? 163.786 172.392 -16.086 1.00 43.99 ? 200 MET A SD    1 
ATOM   1517 C  CE    . MET A 1 203 ? 165.045 171.263 -16.649 1.00 20.42 ? 200 MET A CE    1 
ATOM   1518 N  N     . ARG A 1 204 ? 166.804 175.193 -12.598 1.00 17.89 ? 201 ARG A N     1 
ATOM   1519 C  CA    . ARG A 1 204 ? 166.320 175.927 -11.441 1.00 14.98 ? 201 ARG A CA    1 
ATOM   1520 C  C     . ARG A 1 204 ? 167.053 177.258 -11.308 1.00 23.17 ? 201 ARG A C     1 
ATOM   1521 O  O     . ARG A 1 204 ? 166.465 178.249 -10.878 1.00 18.20 ? 201 ARG A O     1 
ATOM   1522 C  CB    . ARG A 1 204 ? 166.465 175.075 -10.179 1.00 17.02 ? 201 ARG A CB    1 
ATOM   1523 C  CG    . ARG A 1 204 ? 165.408 173.922 -10.128 1.00 19.68 ? 201 ARG A CG    1 
ATOM   1524 C  CD    . ARG A 1 204 ? 165.471 173.078 -8.836  1.00 19.32 ? 201 ARG A CD    1 
ATOM   1525 N  NE    . ARG A 1 204 ? 165.529 173.912 -7.638  1.00 16.96 ? 201 ARG A NE    1 
ATOM   1526 C  CZ    . ARG A 1 204 ? 166.584 173.986 -6.836  1.00 20.52 ? 201 ARG A CZ    1 
ATOM   1527 N  NH1   . ARG A 1 204 ? 167.657 173.250 -7.084  1.00 19.41 ? 201 ARG A NH1   1 
ATOM   1528 N  NH2   . ARG A 1 204 ? 166.556 174.778 -5.773  1.00 19.36 ? 201 ARG A NH2   1 
ATOM   1529 N  N     . ALA A 1 205 ? 168.330 177.283 -11.687 1.00 19.64 ? 202 ALA A N     1 
ATOM   1530 C  CA    . ALA A 1 205 ? 169.087 178.527 -11.678 1.00 19.74 ? 202 ALA A CA    1 
ATOM   1531 C  C     . ALA A 1 205 ? 168.512 179.521 -12.677 1.00 19.62 ? 202 ALA A C     1 
ATOM   1532 O  O     . ALA A 1 205 ? 168.375 180.702 -12.376 1.00 22.37 ? 202 ALA A O     1 
ATOM   1533 C  CB    . ALA A 1 205 ? 170.558 178.271 -11.987 1.00 22.00 ? 202 ALA A CB    1 
ATOM   1534 N  N     . ALA A 1 206 ? 168.194 179.036 -13.871 1.00 17.91 ? 203 ALA A N     1 
ATOM   1535 C  CA    . ALA A 1 206 ? 167.637 179.882 -14.916 1.00 19.63 ? 203 ALA A CA    1 
ATOM   1536 C  C     . ALA A 1 206 ? 166.252 180.413 -14.519 1.00 18.83 ? 203 ALA A C     1 
ATOM   1537 O  O     . ALA A 1 206 ? 165.957 181.592 -14.715 1.00 19.61 ? 203 ALA A O     1 
ATOM   1538 C  CB    . ALA A 1 206 ? 167.564 179.122 -16.222 1.00 19.79 ? 203 ALA A CB    1 
ATOM   1539 N  N     . ILE A 1 207 ? 165.405 179.557 -13.949 1.00 19.52 ? 204 ILE A N     1 
ATOM   1540 C  CA    . ILE A 1 207 ? 164.111 180.044 -13.468 1.00 16.16 ? 204 ILE A CA    1 
ATOM   1541 C  C     . ILE A 1 207 ? 164.304 181.196 -12.494 1.00 15.07 ? 204 ILE A C     1 
ATOM   1542 O  O     . ILE A 1 207 ? 163.674 182.250 -12.633 1.00 17.22 ? 204 ILE A O     1 
ATOM   1543 C  CB    . ILE A 1 207 ? 163.278 178.941 -12.779 1.00 18.25 ? 204 ILE A CB    1 
ATOM   1544 C  CG1   . ILE A 1 207 ? 162.928 177.835 -13.781 1.00 21.51 ? 204 ILE A CG1   1 
ATOM   1545 C  CG2   . ILE A 1 207 ? 161.999 179.561 -12.147 1.00 15.04 ? 204 ILE A CG2   1 
ATOM   1546 C  CD1   . ILE A 1 207 ? 162.221 176.635 -13.150 1.00 21.56 ? 204 ILE A CD1   1 
ATOM   1547 N  N     . GLU A 1 208 ? 165.187 181.019 -11.517 1.00 15.30 ? 205 GLU A N     1 
ATOM   1548 C  CA    . GLU A 1 208 ? 165.313 182.044 -10.484 1.00 16.82 ? 205 GLU A CA    1 
ATOM   1549 C  C     . GLU A 1 208 ? 165.970 183.315 -11.025 1.00 19.75 ? 205 GLU A C     1 
ATOM   1550 O  O     . GLU A 1 208 ? 165.605 184.423 -10.635 1.00 21.61 ? 205 GLU A O     1 
ATOM   1551 C  CB    . GLU A 1 208 ? 166.105 181.530 -9.267  1.00 20.05 ? 205 GLU A CB    1 
ATOM   1552 C  CG    . GLU A 1 208 ? 166.066 182.535 -8.085  1.00 19.21 ? 205 GLU A CG    1 
ATOM   1553 C  CD    . GLU A 1 208 ? 166.957 182.152 -6.920  1.00 23.82 ? 205 GLU A CD    1 
ATOM   1554 O  OE1   . GLU A 1 208 ? 167.634 181.118 -7.015  1.00 23.72 ? 205 GLU A OE1   1 
ATOM   1555 O  OE2   . GLU A 1 208 ? 166.971 182.886 -5.908  1.00 28.72 ? 205 GLU A OE2   1 
ATOM   1556 N  N     . ARG A 1 209 ? 166.930 183.156 -11.926 1.00 16.22 ? 206 ARG A N     1 
ATOM   1557 C  CA    . ARG A 1 209 ? 167.571 184.321 -12.546 1.00 21.65 ? 206 ARG A CA    1 
ATOM   1558 C  C     . ARG A 1 209 ? 166.586 185.156 -13.363 1.00 21.25 ? 206 ARG A C     1 
ATOM   1559 O  O     . ARG A 1 209 ? 166.572 186.380 -13.252 1.00 23.83 ? 206 ARG A O     1 
ATOM   1560 C  CB    . ARG A 1 209 ? 168.742 183.899 -13.446 1.00 18.26 ? 206 ARG A CB    1 
ATOM   1561 C  CG    . ARG A 1 209 ? 169.507 185.120 -14.006 1.00 32.85 ? 206 ARG A CG    1 
ATOM   1562 C  CD    . ARG A 1 209 ? 170.594 184.786 -15.042 1.00 34.94 ? 206 ARG A CD    1 
ATOM   1563 N  NE    . ARG A 1 209 ? 170.082 184.586 -16.402 1.00 38.92 ? 206 ARG A NE    1 
ATOM   1564 C  CZ    . ARG A 1 209 ? 169.734 185.566 -17.237 1.00 39.04 ? 206 ARG A CZ    1 
ATOM   1565 N  NH1   . ARG A 1 209 ? 169.823 186.830 -16.853 1.00 34.01 ? 206 ARG A NH1   1 
ATOM   1566 N  NH2   . ARG A 1 209 ? 169.286 185.280 -18.457 1.00 34.80 ? 206 ARG A NH2   1 
ATOM   1567 N  N     . GLU A 1 210 ? 165.764 184.490 -14.176 1.00 18.48 ? 207 GLU A N     1 
ATOM   1568 C  CA    . GLU A 1 210 ? 164.899 185.171 -15.133 1.00 17.74 ? 207 GLU A CA    1 
ATOM   1569 C  C     . GLU A 1 210 ? 163.523 185.550 -14.587 1.00 18.48 ? 207 GLU A C     1 
ATOM   1570 O  O     . GLU A 1 210 ? 162.809 186.359 -15.197 1.00 14.39 ? 207 GLU A O     1 
ATOM   1571 C  CB    . GLU A 1 210 ? 164.743 184.300 -16.383 1.00 21.36 ? 207 GLU A CB    1 
ATOM   1572 C  CG    . GLU A 1 210 ? 166.087 183.946 -16.998 1.00 18.71 ? 207 GLU A CG    1 
ATOM   1573 C  CD    . GLU A 1 210 ? 165.982 183.014 -18.195 1.00 21.37 ? 207 GLU A CD    1 
ATOM   1574 O  OE1   . GLU A 1 210 ? 164.957 183.039 -18.906 1.00 23.39 ? 207 GLU A OE1   1 
ATOM   1575 O  OE2   . GLU A 1 210 ? 166.940 182.255 -18.419 1.00 20.83 ? 207 GLU A OE2   1 
ATOM   1576 N  N     . THR A 1 211 ? 163.141 184.978 -13.444 1.00 14.41 ? 208 THR A N     1 
ATOM   1577 C  CA    . THR A 1 211 ? 161.851 185.311 -12.858 1.00 15.33 ? 208 THR A CA    1 
ATOM   1578 C  C     . THR A 1 211 ? 161.951 185.823 -11.427 1.00 17.73 ? 208 THR A C     1 
ATOM   1579 O  O     . THR A 1 211 ? 161.034 186.485 -10.942 1.00 17.80 ? 208 THR A O     1 
ATOM   1580 C  CB    . THR A 1 211 ? 160.895 184.101 -12.862 1.00 16.92 ? 208 THR A CB    1 
ATOM   1581 O  OG1   . THR A 1 211 ? 161.384 183.110 -11.952 1.00 18.61 ? 208 THR A OG1   1 
ATOM   1582 C  CG2   . THR A 1 211 ? 160.766 183.505 -14.267 1.00 13.28 ? 208 THR A CG2   1 
ATOM   1583 N  N     . GLY A 1 212 ? 163.030 185.472 -10.734 1.00 18.16 ? 209 GLY A N     1 
ATOM   1584 C  CA    . GLY A 1 212 ? 163.125 185.756 -9.305  1.00 20.19 ? 209 GLY A CA    1 
ATOM   1585 C  C     . GLY A 1 212 ? 162.498 184.682 -8.420  1.00 27.91 ? 209 GLY A C     1 
ATOM   1586 O  O     . GLY A 1 212 ? 162.681 184.686 -7.199  1.00 25.65 ? 209 GLY A O     1 
ATOM   1587 N  N     . PHE A 1 213 ? 161.768 183.754 -9.030  1.00 20.20 ? 210 PHE A N     1 
ATOM   1588 C  CA    . PHE A 1 213 ? 161.083 182.698 -8.275  1.00 21.11 ? 210 PHE A CA    1 
ATOM   1589 C  C     . PHE A 1 213 ? 162.006 181.538 -7.950  1.00 19.51 ? 210 PHE A C     1 
ATOM   1590 O  O     . PHE A 1 213 ? 162.766 181.100 -8.813  1.00 18.98 ? 210 PHE A O     1 
ATOM   1591 C  CB    . PHE A 1 213 ? 159.876 182.162 -9.047  1.00 18.04 ? 210 PHE A CB    1 
ATOM   1592 C  CG    . PHE A 1 213 ? 158.869 183.213 -9.415  1.00 20.37 ? 210 PHE A CG    1 
ATOM   1593 C  CD1   . PHE A 1 213 ? 158.562 184.248 -8.534  1.00 20.56 ? 210 PHE A CD1   1 
ATOM   1594 C  CD2   . PHE A 1 213 ? 158.243 183.181 -10.661 1.00 16.93 ? 210 PHE A CD2   1 
ATOM   1595 C  CE1   . PHE A 1 213 ? 157.630 185.230 -8.893  1.00 19.74 ? 210 PHE A CE1   1 
ATOM   1596 C  CE2   . PHE A 1 213 ? 157.325 184.150 -11.026 1.00 14.11 ? 210 PHE A CE2   1 
ATOM   1597 C  CZ    . PHE A 1 213 ? 157.006 185.173 -10.136 1.00 18.34 ? 210 PHE A CZ    1 
ATOM   1598 N  N     . GLN A 1 214 ? 161.920 181.048 -6.709  1.00 14.39 ? 211 GLN A N     1 
ATOM   1599 C  CA    . GLN A 1 214 ? 162.592 179.816 -6.280  1.00 19.19 ? 211 GLN A CA    1 
ATOM   1600 C  C     . GLN A 1 214 ? 161.672 178.589 -6.374  1.00 20.20 ? 211 GLN A C     1 
ATOM   1601 O  O     . GLN A 1 214 ? 160.445 178.714 -6.310  1.00 16.97 ? 211 GLN A O     1 
ATOM   1602 C  CB    . GLN A 1 214 ? 163.107 179.966 -4.838  1.00 21.26 ? 211 GLN A CB    1 
ATOM   1603 C  CG    . GLN A 1 214 ? 164.378 180.807 -4.754  1.00 19.30 ? 211 GLN A CG    1 
ATOM   1604 C  CD    . GLN A 1 214 ? 164.847 181.057 -3.341  1.00 24.96 ? 211 GLN A CD    1 
ATOM   1605 O  OE1   . GLN A 1 214 ? 164.225 180.619 -2.373  1.00 22.23 ? 211 GLN A OE1   1 
ATOM   1606 N  NE2   . GLN A 1 214 ? 165.970 181.763 -3.215  1.00 31.77 ? 211 GLN A NE2   1 
ATOM   1607 N  N     . CYS A 1 215 ? 162.268 177.408 -6.526  1.00 14.07 ? 212 CYS A N     1 
ATOM   1608 C  CA    . CYS A 1 215 ? 161.504 176.165 -6.567  1.00 16.67 ? 212 CYS A CA    1 
ATOM   1609 C  C     . CYS A 1 215 ? 162.275 174.980 -6.015  1.00 18.13 ? 212 CYS A C     1 
ATOM   1610 O  O     . CYS A 1 215 ? 163.482 175.057 -5.746  1.00 18.41 ? 212 CYS A O     1 
ATOM   1611 C  CB    . CYS A 1 215 ? 161.082 175.845 -7.999  1.00 17.69 ? 212 CYS A CB    1 
ATOM   1612 S  SG    . CYS A 1 215 ? 162.490 175.622 -9.120  1.00 21.75 ? 212 CYS A SG    1 
ATOM   1613 N  N     . SER A 1 216 ? 161.570 173.865 -5.878  1.00 18.10 ? 213 SER A N     1 
ATOM   1614 C  CA    . SER A 1 216 ? 162.210 172.598 -5.547  1.00 20.11 ? 213 SER A CA    1 
ATOM   1615 C  C     . SER A 1 216 ? 162.004 171.629 -6.690  1.00 19.13 ? 213 SER A C     1 
ATOM   1616 O  O     . SER A 1 216 ? 161.171 171.862 -7.569  1.00 18.23 ? 213 SER A O     1 
ATOM   1617 C  CB    . SER A 1 216 ? 161.642 172.023 -4.252  1.00 18.97 ? 213 SER A CB    1 
ATOM   1618 O  OG    . SER A 1 216 ? 161.726 173.008 -3.248  1.00 24.59 ? 213 SER A OG    1 
ATOM   1619 N  N     . ALA A 1 217 ? 162.755 170.536 -6.674  1.00 17.43 ? 214 ALA A N     1 
ATOM   1620 C  CA    . ALA A 1 217 ? 162.599 169.522 -7.701  1.00 15.59 ? 214 ALA A CA    1 
ATOM   1621 C  C     . ALA A 1 217 ? 162.904 168.144 -7.158  1.00 19.47 ? 214 ALA A C     1 
ATOM   1622 O  O     . ALA A 1 217 ? 163.592 168.007 -6.152  1.00 15.76 ? 214 ALA A O     1 
ATOM   1623 C  CB    . ALA A 1 217 ? 163.505 169.823 -8.898  1.00 18.70 ? 214 ALA A CB    1 
ATOM   1624 N  N     . GLY A 1 218 ? 162.372 167.131 -7.834  1.00 17.54 ? 215 GLY A N     1 
ATOM   1625 C  CA    . GLY A 1 218 ? 162.698 165.746 -7.551  1.00 16.75 ? 215 GLY A CA    1 
ATOM   1626 C  C     . GLY A 1 218 ? 163.234 165.161 -8.845  1.00 19.36 ? 215 GLY A C     1 
ATOM   1627 O  O     . GLY A 1 218 ? 162.746 165.504 -9.933  1.00 17.81 ? 215 GLY A O     1 
ATOM   1628 N  N     . ILE A 1 219 ? 164.251 164.317 -8.737  1.00 12.41 ? 216 ILE A N     1 
ATOM   1629 C  CA    . ILE A 1 219 ? 164.806 163.636 -9.891  1.00 13.51 ? 216 ILE A CA    1 
ATOM   1630 C  C     . ILE A 1 219 ? 164.834 162.128 -9.598  1.00 13.93 ? 216 ILE A C     1 
ATOM   1631 O  O     . ILE A 1 219 ? 165.420 161.706 -8.614  1.00 16.78 ? 216 ILE A O     1 
ATOM   1632 C  CB    . ILE A 1 219 ? 166.255 164.137 -10.224 1.00 18.58 ? 216 ILE A CB    1 
ATOM   1633 C  CG1   . ILE A 1 219 ? 166.300 165.663 -10.405 1.00 13.51 ? 216 ILE A CG1   1 
ATOM   1634 C  CG2   . ILE A 1 219 ? 166.789 163.453 -11.458 1.00 16.32 ? 216 ILE A CG2   1 
ATOM   1635 C  CD1   . ILE A 1 219 ? 166.643 166.443 -9.118  1.00 21.58 ? 216 ILE A CD1   1 
ATOM   1636 N  N     . SER A 1 220 ? 164.207 161.333 -10.453 1.00 15.95 ? 217 SER A N     1 
ATOM   1637 C  CA    . SER A 1 220 ? 164.190 159.885 -10.289 1.00 16.35 ? 217 SER A CA    1 
ATOM   1638 C  C     . SER A 1 220 ? 163.872 159.232 -11.635 1.00 20.00 ? 217 SER A C     1 
ATOM   1639 O  O     . SER A 1 220 ? 164.028 159.862 -12.674 1.00 15.88 ? 217 SER A O     1 
ATOM   1640 C  CB    . SER A 1 220 ? 163.174 159.476 -9.219  1.00 14.89 ? 217 SER A CB    1 
ATOM   1641 O  OG    . SER A 1 220 ? 163.266 158.091 -8.924  1.00 16.55 ? 217 SER A OG    1 
ATOM   1642 N  N     . HIS A 1 221 ? 163.403 157.985 -11.628 1.00 16.25 ? 218 HIS A N     1 
ATOM   1643 C  CA    . HIS A 1 221 ? 163.207 157.274 -12.884 1.00 18.17 ? 218 HIS A CA    1 
ATOM   1644 C  C     . HIS A 1 221 ? 161.762 157.309 -13.402 1.00 18.16 ? 218 HIS A C     1 
ATOM   1645 O  O     . HIS A 1 221 ? 161.476 156.812 -14.486 1.00 15.14 ? 218 HIS A O     1 
ATOM   1646 C  CB    . HIS A 1 221 ? 163.660 155.817 -12.730 1.00 19.53 ? 218 HIS A CB    1 
ATOM   1647 C  CG    . HIS A 1 221 ? 165.144 155.643 -12.604 1.00 19.75 ? 218 HIS A CG    1 
ATOM   1648 N  ND1   . HIS A 1 221 ? 166.022 155.963 -13.619 1.00 16.66 ? 218 HIS A ND1   1 
ATOM   1649 C  CD2   . HIS A 1 221 ? 165.901 155.136 -11.598 1.00 17.86 ? 218 HIS A CD2   1 
ATOM   1650 C  CE1   . HIS A 1 221 ? 167.257 155.685 -13.237 1.00 22.89 ? 218 HIS A CE1   1 
ATOM   1651 N  NE2   . HIS A 1 221 ? 167.213 155.182 -12.013 1.00 21.14 ? 218 HIS A NE2   1 
ATOM   1652 N  N     . ASN A 1 222 ? 160.847 157.885 -12.632 1.00 17.95 ? 219 ASN A N     1 
ATOM   1653 C  CA    . ASN A 1 222 ? 159.460 158.004 -13.082 1.00 14.70 ? 219 ASN A CA    1 
ATOM   1654 C  C     . ASN A 1 222 ? 158.803 159.163 -12.358 1.00 18.27 ? 219 ASN A C     1 
ATOM   1655 O  O     . ASN A 1 222 ? 159.404 159.761 -11.456 1.00 19.70 ? 219 ASN A O     1 
ATOM   1656 C  CB    . ASN A 1 222 ? 158.689 156.697 -12.830 1.00 12.94 ? 219 ASN A CB    1 
ATOM   1657 C  CG    . ASN A 1 222 ? 158.746 156.267 -11.370 1.00 20.60 ? 219 ASN A CG    1 
ATOM   1658 O  OD1   . ASN A 1 222 ? 158.262 156.980 -10.477 1.00 22.49 ? 219 ASN A OD1   1 
ATOM   1659 N  ND2   . ASN A 1 222 ? 159.330 155.095 -11.117 1.00 18.09 ? 219 ASN A ND2   1 
ATOM   1660 N  N     . LYS A 1 223 ? 157.567 159.466 -12.731 1.00 18.19 ? 220 LYS A N     1 
ATOM   1661 C  CA    . LYS A 1 223 ? 156.864 160.651 -12.241 1.00 16.81 ? 220 LYS A CA    1 
ATOM   1662 C  C     . LYS A 1 223 ? 156.542 160.551 -10.762 1.00 18.79 ? 220 LYS A C     1 
ATOM   1663 O  O     . LYS A 1 223 ? 156.738 161.522 -10.017 1.00 17.37 ? 220 LYS A O     1 
ATOM   1664 C  CB    . LYS A 1 223 ? 155.573 160.873 -13.054 1.00 20.25 ? 220 LYS A CB    1 
ATOM   1665 C  CG    . LYS A 1 223 ? 155.843 161.171 -14.549 1.00 20.68 ? 220 LYS A CG    1 
ATOM   1666 C  CD    . LYS A 1 223 ? 154.594 161.030 -15.445 1.00 22.76 ? 220 LYS A CD    1 
ATOM   1667 C  CE    . LYS A 1 223 ? 153.553 162.078 -15.150 1.00 23.41 ? 220 LYS A CE    1 
ATOM   1668 N  NZ    . LYS A 1 223 ? 152.394 162.051 -16.129 1.00 21.75 ? 220 LYS A NZ    1 
ATOM   1669 N  N     . VAL A 1 224 ? 156.045 159.390 -10.330 1.00 17.21 ? 221 VAL A N     1 
ATOM   1670 C  CA    . VAL A 1 224 ? 155.650 159.226 -8.934  1.00 17.03 ? 221 VAL A CA    1 
ATOM   1671 C  C     . VAL A 1 224 ? 156.840 159.390 -7.973  1.00 17.45 ? 221 VAL A C     1 
ATOM   1672 O  O     . VAL A 1 224 ? 156.719 160.063 -6.936  1.00 19.88 ? 221 VAL A O     1 
ATOM   1673 C  CB    . VAL A 1 224 ? 154.953 157.862 -8.694  1.00 23.27 ? 221 VAL A CB    1 
ATOM   1674 C  CG1   . VAL A 1 224 ? 154.893 157.540 -7.200  1.00 20.20 ? 221 VAL A CG1   1 
ATOM   1675 C  CG2   . VAL A 1 224 ? 153.536 157.862 -9.316  1.00 18.41 ? 221 VAL A CG2   1 
ATOM   1676 N  N     . LEU A 1 225 ? 157.985 158.800 -8.306  1.00 17.22 ? 222 LEU A N     1 
ATOM   1677 C  CA    . LEU A 1 225 ? 159.183 158.980 -7.469  1.00 18.31 ? 222 LEU A CA    1 
ATOM   1678 C  C     . LEU A 1 225 ? 159.720 160.412 -7.552  1.00 21.27 ? 222 LEU A C     1 
ATOM   1679 O  O     . LEU A 1 225 ? 160.232 160.940 -6.563  1.00 16.34 ? 222 LEU A O     1 
ATOM   1680 C  CB    . LEU A 1 225 ? 160.300 157.983 -7.847  1.00 15.32 ? 222 LEU A CB    1 
ATOM   1681 C  CG    . LEU A 1 225 ? 160.005 156.500 -7.555  1.00 18.38 ? 222 LEU A CG    1 
ATOM   1682 C  CD1   . LEU A 1 225 ? 161.219 155.585 -7.759  1.00 18.05 ? 222 LEU A CD1   1 
ATOM   1683 C  CD2   . LEU A 1 225 ? 159.433 156.329 -6.159  1.00 17.85 ? 222 LEU A CD2   1 
ATOM   1684 N  N     . ALA A 1 226 ? 159.623 161.037 -8.726  1.00 13.99 ? 223 ALA A N     1 
ATOM   1685 C  CA    . ALA A 1 226 ? 160.115 162.405 -8.865  1.00 15.37 ? 223 ALA A CA    1 
ATOM   1686 C  C     . ALA A 1 226 ? 159.232 163.344 -8.042  1.00 19.40 ? 223 ALA A C     1 
ATOM   1687 O  O     . ALA A 1 226 ? 159.728 164.246 -7.375  1.00 17.39 ? 223 ALA A O     1 
ATOM   1688 C  CB    . ALA A 1 226 ? 160.144 162.829 -10.325 1.00 21.69 ? 223 ALA A CB    1 
ATOM   1689 N  N     . LYS A 1 227 ? 157.920 163.113 -8.080  1.00 16.28 ? 224 LYS A N     1 
ATOM   1690 C  CA    . LYS A 1 227 ? 156.994 163.893 -7.254  1.00 14.15 ? 224 LYS A CA    1 
ATOM   1691 C  C     . LYS A 1 227 ? 157.251 163.684 -5.743  1.00 17.83 ? 224 LYS A C     1 
ATOM   1692 O  O     . LYS A 1 227 ? 157.338 164.653 -4.986  1.00 16.78 ? 224 LYS A O     1 
ATOM   1693 C  CB    . LYS A 1 227 ? 155.546 163.539 -7.625  1.00 15.71 ? 224 LYS A CB    1 
ATOM   1694 C  CG    . LYS A 1 227 ? 154.487 164.074 -6.676  1.00 20.07 ? 224 LYS A CG    1 
ATOM   1695 C  CD    . LYS A 1 227 ? 154.099 165.481 -7.019  1.00 35.16 ? 224 LYS A CD    1 
ATOM   1696 C  CE    . LYS A 1 227 ? 152.952 165.963 -6.136  1.00 35.01 ? 224 LYS A CE    1 
ATOM   1697 N  NZ    . LYS A 1 227 ? 153.087 167.436 -5.918  1.00 40.60 ? 224 LYS A NZ    1 
ATOM   1698 N  N     . LEU A 1 228 ? 157.377 162.428 -5.308  1.00 16.81 ? 225 LEU A N     1 
ATOM   1699 C  CA    . LEU A 1 228 ? 157.728 162.125 -3.914  1.00 15.67 ? 225 LEU A CA    1 
ATOM   1700 C  C     . LEU A 1 228 ? 159.061 162.774 -3.513  1.00 21.43 ? 225 LEU A C     1 
ATOM   1701 O  O     . LEU A 1 228 ? 159.154 163.437 -2.486  1.00 20.65 ? 225 LEU A O     1 
ATOM   1702 C  CB    . LEU A 1 228 ? 157.788 160.600 -3.694  1.00 18.46 ? 225 LEU A CB    1 
ATOM   1703 C  CG    . LEU A 1 228 ? 158.006 160.145 -2.244  1.00 28.14 ? 225 LEU A CG    1 
ATOM   1704 C  CD1   . LEU A 1 228 ? 156.837 160.613 -1.358  1.00 18.47 ? 225 LEU A CD1   1 
ATOM   1705 C  CD2   . LEU A 1 228 ? 158.198 158.648 -2.152  1.00 17.63 ? 225 LEU A CD2   1 
ATOM   1706 N  N     . ALA A 1 229 ? 160.082 162.594 -4.347  1.00 18.11 ? 226 ALA A N     1 
ATOM   1707 C  CA    . ALA A 1 229 ? 161.404 163.191 -4.136  1.00 19.45 ? 226 ALA A CA    1 
ATOM   1708 C  C     . ALA A 1 229 ? 161.357 164.721 -3.954  1.00 21.68 ? 226 ALA A C     1 
ATOM   1709 O  O     . ALA A 1 229 ? 162.064 165.282 -3.123  1.00 20.32 ? 226 ALA A O     1 
ATOM   1710 C  CB    . ALA A 1 229 ? 162.346 162.831 -5.337  1.00 14.37 ? 226 ALA A CB    1 
ATOM   1711 N  N     . CYS A 1 230 ? 160.531 165.391 -4.751  1.00 21.45 ? 227 CYS A N     1 
ATOM   1712 C  CA    . CYS A 1 230 ? 160.460 166.853 -4.718  1.00 21.10 ? 227 CYS A CA    1 
ATOM   1713 C  C     . CYS A 1 230 ? 160.147 167.399 -3.318  1.00 19.16 ? 227 CYS A C     1 
ATOM   1714 O  O     . CYS A 1 230 ? 160.733 168.385 -2.875  1.00 20.35 ? 227 CYS A O     1 
ATOM   1715 C  CB    . CYS A 1 230 ? 159.405 167.346 -5.710  1.00 17.74 ? 227 CYS A CB    1 
ATOM   1716 S  SG    . CYS A 1 230 ? 159.392 169.131 -5.893  1.00 20.11 ? 227 CYS A SG    1 
ATOM   1717 N  N     . GLY A 1 231 ? 159.219 166.749 -2.626  1.00 19.61 ? 228 GLY A N     1 
ATOM   1718 C  CA    . GLY A 1 231 ? 158.771 167.237 -1.335  1.00 19.67 ? 228 GLY A CA    1 
ATOM   1719 C  C     . GLY A 1 231 ? 159.642 166.827 -0.167  1.00 18.78 ? 228 GLY A C     1 
ATOM   1720 O  O     . GLY A 1 231 ? 159.342 167.165 0.963   1.00 25.17 ? 228 GLY A O     1 
ATOM   1721 N  N     . LEU A 1 232 ? 160.723 166.099 -0.426  1.00 23.48 ? 229 LEU A N     1 
ATOM   1722 C  CA    . LEU A 1 232 ? 161.570 165.605 0.665   1.00 21.90 ? 229 LEU A CA    1 
ATOM   1723 C  C     . LEU A 1 232 ? 162.439 166.711 1.281   1.00 29.68 ? 229 LEU A C     1 
ATOM   1724 O  O     . LEU A 1 232 ? 162.769 166.674 2.471   1.00 20.09 ? 229 LEU A O     1 
ATOM   1725 C  CB    . LEU A 1 232 ? 162.454 164.455 0.170   1.00 22.75 ? 229 LEU A CB    1 
ATOM   1726 C  CG    . LEU A 1 232 ? 161.698 163.159 -0.179  1.00 16.81 ? 229 LEU A CG    1 
ATOM   1727 C  CD1   . LEU A 1 232 ? 162.660 162.075 -0.607  1.00 17.80 ? 229 LEU A CD1   1 
ATOM   1728 C  CD2   . LEU A 1 232 ? 160.867 162.703 1.015   1.00 23.12 ? 229 LEU A CD2   1 
ATOM   1729 N  N     . ASN A 1 233 ? 162.810 167.691 0.467   1.00 17.80 ? 230 ASN A N     1 
ATOM   1730 C  CA    . ASN A 1 233 ? 163.690 168.764 0.925   1.00 28.58 ? 230 ASN A CA    1 
ATOM   1731 C  C     . ASN A 1 233 ? 163.236 170.097 0.326   1.00 25.03 ? 230 ASN A C     1 
ATOM   1732 O  O     . ASN A 1 233 ? 163.754 170.535 -0.688  1.00 31.32 ? 230 ASN A O     1 
ATOM   1733 C  CB    . ASN A 1 233 ? 165.158 168.478 0.548   1.00 21.53 ? 230 ASN A CB    1 
ATOM   1734 C  CG    . ASN A 1 233 ? 165.738 167.257 1.273   1.00 29.62 ? 230 ASN A CG    1 
ATOM   1735 O  OD1   . ASN A 1 233 ? 166.138 167.343 2.432   1.00 26.60 ? 230 ASN A OD1   1 
ATOM   1736 N  ND2   . ASN A 1 233 ? 165.803 166.131 0.582   1.00 16.56 ? 230 ASN A ND2   1 
ATOM   1737 N  N     . LYS A 1 234 ? 162.243 170.709 0.952   1.00 28.08 ? 231 LYS A N     1 
ATOM   1738 C  CA    . LYS A 1 234 ? 161.676 171.977 0.504   1.00 27.85 ? 231 LYS A CA    1 
ATOM   1739 C  C     . LYS A 1 234 ? 161.933 172.977 1.603   1.00 25.65 ? 231 LYS A C     1 
ATOM   1740 O  O     . LYS A 1 234 ? 162.026 172.586 2.761   1.00 29.62 ? 231 LYS A O     1 
ATOM   1741 C  CB    . LYS A 1 234 ? 160.166 171.855 0.214   1.00 27.64 ? 231 LYS A CB    1 
ATOM   1742 C  CG    . LYS A 1 234 ? 159.842 171.447 -1.215  1.00 26.97 ? 231 LYS A CG    1 
ATOM   1743 C  CD    . LYS A 1 234 ? 158.327 171.375 -1.495  0.75 24.32 ? 231 LYS A CD    1 
ATOM   1744 C  CE    . LYS A 1 234 ? 157.704 172.733 -1.810  0.59 24.55 ? 231 LYS A CE    1 
ATOM   1745 N  NZ    . LYS A 1 234 ? 157.901 173.267 -3.209  0.96 18.64 ? 231 LYS A NZ    1 
ATOM   1746 N  N     . PRO A 1 235 ? 162.089 174.268 1.260   1.00 24.65 ? 232 PRO A N     1 
ATOM   1747 C  CA    . PRO A 1 235 ? 162.089 174.898 -0.066  1.00 19.70 ? 232 PRO A CA    1 
ATOM   1748 C  C     . PRO A 1 235 ? 163.484 175.062 -0.690  1.00 19.73 ? 232 PRO A C     1 
ATOM   1749 O  O     . PRO A 1 235 ? 164.485 174.752 -0.049  1.00 21.83 ? 232 PRO A O     1 
ATOM   1750 C  CB    . PRO A 1 235 ? 161.474 176.268 0.224   1.00 24.26 ? 232 PRO A CB    1 
ATOM   1751 C  CG    . PRO A 1 235 ? 162.007 176.586 1.617   1.00 25.33 ? 232 PRO A CG    1 
ATOM   1752 C  CD    . PRO A 1 235 ? 162.151 175.274 2.340   1.00 22.34 ? 232 PRO A CD    1 
ATOM   1753 N  N     . ASN A 1 236 ? 163.523 175.520 -1.943  1.00 18.01 ? 233 ASN A N     1 
ATOM   1754 C  CA    . ASN A 1 236 ? 164.764 175.891 -2.638  1.00 20.68 ? 233 ASN A CA    1 
ATOM   1755 C  C     . ASN A 1 236 ? 165.842 174.804 -2.673  1.00 16.57 ? 233 ASN A C     1 
ATOM   1756 O  O     . ASN A 1 236 ? 167.025 175.103 -2.602  1.00 24.63 ? 233 ASN A O     1 
ATOM   1757 C  CB    . ASN A 1 236 ? 165.343 177.167 -2.002  1.00 16.73 ? 233 ASN A CB    1 
ATOM   1758 C  CG    . ASN A 1 236 ? 166.331 177.887 -2.913  1.00 20.93 ? 233 ASN A CG    1 
ATOM   1759 O  OD1   . ASN A 1 236 ? 166.178 177.908 -4.129  1.00 26.54 ? 233 ASN A OD1   1 
ATOM   1760 N  ND2   . ASN A 1 236 ? 167.357 178.467 -2.320  1.00 26.43 ? 233 ASN A ND2   1 
ATOM   1761 N  N     . ARG A 1 237 ? 165.439 173.540 -2.775  1.00 21.30 ? 234 ARG A N     1 
ATOM   1762 C  CA    . ARG A 1 237 ? 166.395 172.421 -2.820  1.00 21.02 ? 234 ARG A CA    1 
ATOM   1763 C  C     . ARG A 1 237 ? 165.898 171.352 -3.791  1.00 17.06 ? 234 ARG A C     1 
ATOM   1764 O  O     . ARG A 1 237 ? 164.737 171.337 -4.159  1.00 21.19 ? 234 ARG A O     1 
ATOM   1765 C  CB    . ARG A 1 237 ? 166.591 171.781 -1.430  1.00 20.99 ? 234 ARG A CB    1 
ATOM   1766 C  CG    . ARG A 1 237 ? 167.217 172.682 -0.358  1.00 26.39 ? 234 ARG A CG    1 
ATOM   1767 C  CD    . ARG A 1 237 ? 168.655 173.019 -0.691  1.00 24.89 ? 234 ARG A CD    1 
ATOM   1768 N  NE    . ARG A 1 237 ? 169.324 173.720 0.404   1.00 32.99 ? 234 ARG A NE    1 
ATOM   1769 C  CZ    . ARG A 1 237 ? 169.351 175.044 0.547   1.00 38.65 ? 234 ARG A CZ    1 
ATOM   1770 N  NH1   . ARG A 1 237 ? 168.748 175.832 -0.334  1.00 29.18 ? 234 ARG A NH1   1 
ATOM   1771 N  NH2   . ARG A 1 237 ? 169.976 175.583 1.583   1.00 44.88 ? 234 ARG A NH2   1 
ATOM   1772 N  N     . GLN A 1 238 ? 166.758 170.430 -4.186  1.00 16.41 ? 235 GLN A N     1 
ATOM   1773 C  CA    . GLN A 1 238 ? 166.295 169.345 -5.049  1.00 16.62 ? 235 GLN A CA    1 
ATOM   1774 C  C     . GLN A 1 238 ? 166.799 167.998 -4.544  1.00 24.33 ? 235 GLN A C     1 
ATOM   1775 O  O     . GLN A 1 238 ? 167.820 167.923 -3.867  1.00 20.56 ? 235 GLN A O     1 
ATOM   1776 C  CB    . GLN A 1 238 ? 166.734 169.572 -6.492  1.00 13.56 ? 235 GLN A CB    1 
ATOM   1777 C  CG    . GLN A 1 238 ? 168.247 169.641 -6.713  1.00 15.06 ? 235 GLN A CG    1 
ATOM   1778 C  CD    . GLN A 1 238 ? 168.608 169.923 -8.174  1.00 23.15 ? 235 GLN A CD    1 
ATOM   1779 O  OE1   . GLN A 1 238 ? 168.200 170.940 -8.744  1.00 21.49 ? 235 GLN A OE1   1 
ATOM   1780 N  NE2   . GLN A 1 238 ? 169.352 169.012 -8.789  1.00 14.10 ? 235 GLN A NE2   1 
ATOM   1781 N  N     . THR A 1 239 ? 166.076 166.937 -4.872  1.00 16.86 ? 236 THR A N     1 
ATOM   1782 C  CA    . THR A 1 239 ? 166.356 165.650 -4.284  1.00 18.25 ? 236 THR A CA    1 
ATOM   1783 C  C     . THR A 1 239 ? 166.414 164.563 -5.353  1.00 18.40 ? 236 THR A C     1 
ATOM   1784 O  O     . THR A 1 239 ? 165.535 164.468 -6.203  1.00 17.10 ? 236 THR A O     1 
ATOM   1785 C  CB    . THR A 1 239 ? 165.303 165.299 -3.232  1.00 18.21 ? 236 THR A CB    1 
ATOM   1786 O  OG1   . THR A 1 239 ? 165.273 166.333 -2.239  1.00 22.04 ? 236 THR A OG1   1 
ATOM   1787 C  CG2   . THR A 1 239 ? 165.624 163.946 -2.552  1.00 14.09 ? 236 THR A CG2   1 
ATOM   1788 N  N     . LEU A 1 240 ? 167.471 163.765 -5.304  1.00 19.68 ? 237 LEU A N     1 
ATOM   1789 C  CA    . LEU A 1 240 ? 167.645 162.637 -6.198  1.00 16.05 ? 237 LEU A CA    1 
ATOM   1790 C  C     . LEU A 1 240 ? 167.238 161.360 -5.454  1.00 21.91 ? 237 LEU A C     1 
ATOM   1791 O  O     . LEU A 1 240 ? 167.795 161.042 -4.400  1.00 15.05 ? 237 LEU A O     1 
ATOM   1792 C  CB    . LEU A 1 240 ? 169.098 162.583 -6.690  1.00 16.56 ? 237 LEU A CB    1 
ATOM   1793 C  CG    . LEU A 1 240 ? 169.532 161.596 -7.780  1.00 20.39 ? 237 LEU A CG    1 
ATOM   1794 C  CD1   . LEU A 1 240 ? 170.868 162.052 -8.376  1.00 14.79 ? 237 LEU A CD1   1 
ATOM   1795 C  CD2   . LEU A 1 240 ? 169.648 160.145 -7.257  1.00 20.07 ? 237 LEU A CD2   1 
ATOM   1796 N  N     . VAL A 1 241 ? 166.246 160.646 -5.989  1.00 18.97 ? 238 VAL A N     1 
ATOM   1797 C  CA    . VAL A 1 241 ? 165.836 159.369 -5.416  1.00 15.44 ? 238 VAL A CA    1 
ATOM   1798 C  C     . VAL A 1 241 ? 166.218 158.250 -6.374  1.00 17.76 ? 238 VAL A C     1 
ATOM   1799 O  O     . VAL A 1 241 ? 165.633 158.112 -7.446  1.00 14.85 ? 238 VAL A O     1 
ATOM   1800 C  CB    . VAL A 1 241 ? 164.314 159.353 -5.112  1.00 15.46 ? 238 VAL A CB    1 
ATOM   1801 C  CG1   . VAL A 1 241 ? 163.767 157.931 -4.992  1.00 16.29 ? 238 VAL A CG1   1 
ATOM   1802 C  CG2   . VAL A 1 241 ? 164.025 160.165 -3.855  1.00 10.90 ? 238 VAL A CG2   1 
ATOM   1803 N  N     . SER A 1 242 ? 167.230 157.466 -6.000  1.00 16.06 ? 239 SER A N     1 
ATOM   1804 C  CA    . SER A 1 242 ? 167.710 156.417 -6.891  1.00 19.96 ? 239 SER A CA    1 
ATOM   1805 C  C     . SER A 1 242 ? 166.835 155.181 -6.754  1.00 20.52 ? 239 SER A C     1 
ATOM   1806 O  O     . SER A 1 242 ? 166.062 155.037 -5.789  1.00 17.13 ? 239 SER A O     1 
ATOM   1807 C  CB    . SER A 1 242 ? 169.169 156.060 -6.593  1.00 20.62 ? 239 SER A CB    1 
ATOM   1808 O  OG    . SER A 1 242 ? 169.271 155.508 -5.292  1.00 24.56 ? 239 SER A OG    1 
ATOM   1809 N  N     . HIS A 1 243 ? 166.942 154.301 -7.735  1.00 17.03 ? 240 HIS A N     1 
ATOM   1810 C  CA    . HIS A 1 243 ? 166.227 153.033 -7.684  1.00 19.27 ? 240 HIS A CA    1 
ATOM   1811 C  C     . HIS A 1 243 ? 166.593 152.289 -6.396  1.00 19.28 ? 240 HIS A C     1 
ATOM   1812 O  O     . HIS A 1 243 ? 165.722 151.801 -5.667  1.00 14.20 ? 240 HIS A O     1 
ATOM   1813 C  CB    . HIS A 1 243 ? 166.554 152.181 -8.914  1.00 16.02 ? 240 HIS A CB    1 
ATOM   1814 C  CG    . HIS A 1 243 ? 165.886 150.848 -8.899  1.00 19.02 ? 240 HIS A CG    1 
ATOM   1815 N  ND1   . HIS A 1 243 ? 164.546 150.690 -9.176  1.00 19.92 ? 240 HIS A ND1   1 
ATOM   1816 C  CD2   . HIS A 1 243 ? 166.363 149.613 -8.614  1.00 18.52 ? 240 HIS A CD2   1 
ATOM   1817 C  CE1   . HIS A 1 243 ? 164.223 149.413 -9.056  1.00 20.62 ? 240 HIS A CE1   1 
ATOM   1818 N  NE2   . HIS A 1 243 ? 165.307 148.739 -8.719  1.00 18.38 ? 240 HIS A NE2   1 
ATOM   1819 N  N     . GLY A 1 244 ? 167.891 152.258 -6.103  1.00 19.34 ? 241 GLY A N     1 
ATOM   1820 C  CA    . GLY A 1 244 ? 168.408 151.541 -4.949  1.00 18.31 ? 241 GLY A CA    1 
ATOM   1821 C  C     . GLY A 1 244 ? 167.950 152.084 -3.611  1.00 20.08 ? 241 GLY A C     1 
ATOM   1822 O  O     . GLY A 1 244 ? 167.975 151.372 -2.612  1.00 20.42 ? 241 GLY A O     1 
ATOM   1823 N  N     . SER A 1 245 ? 167.511 153.342 -3.581  1.00 19.43 ? 242 SER A N     1 
ATOM   1824 C  CA    . SER A 1 245 ? 167.035 153.947 -2.338  1.00 17.29 ? 242 SER A CA    1 
ATOM   1825 C  C     . SER A 1 245 ? 165.616 153.515 -1.955  1.00 17.16 ? 242 SER A C     1 
ATOM   1826 O  O     . SER A 1 245 ? 165.185 153.735 -0.826  1.00 20.45 ? 242 SER A O     1 
ATOM   1827 C  CB    . SER A 1 245 ? 167.077 155.476 -2.440  1.00 20.96 ? 242 SER A CB    1 
ATOM   1828 O  OG    . SER A 1 245 ? 165.999 155.938 -3.235  1.00 13.24 ? 242 SER A OG    1 
ATOM   1829 N  N     . VAL A 1 246 ? 164.886 152.917 -2.893  1.00 17.77 ? 243 VAL A N     1 
ATOM   1830 C  CA    . VAL A 1 246 ? 163.453 152.658 -2.687  1.00 16.75 ? 243 VAL A CA    1 
ATOM   1831 C  C     . VAL A 1 246 ? 163.081 151.701 -1.518  1.00 15.94 ? 243 VAL A C     1 
ATOM   1832 O  O     . VAL A 1 246 ? 162.188 152.030 -0.744  1.00 19.17 ? 243 VAL A O     1 
ATOM   1833 C  CB    . VAL A 1 246 ? 162.816 152.145 -4.005  1.00 18.78 ? 243 VAL A CB    1 
ATOM   1834 C  CG1   . VAL A 1 246 ? 161.360 151.692 -3.774  1.00 14.33 ? 243 VAL A CG1   1 
ATOM   1835 C  CG2   . VAL A 1 246 ? 162.866 153.252 -5.046  1.00 15.27 ? 243 VAL A CG2   1 
ATOM   1836 N  N     . PRO A 1 247 ? 163.764 150.541 -1.372  1.00 19.43 ? 244 PRO A N     1 
ATOM   1837 C  CA    . PRO A 1 247 ? 163.385 149.649 -0.258  1.00 17.19 ? 244 PRO A CA    1 
ATOM   1838 C  C     . PRO A 1 247 ? 163.397 150.312 1.123   1.00 18.26 ? 244 PRO A C     1 
ATOM   1839 O  O     . PRO A 1 247 ? 162.414 150.166 1.860   1.00 17.19 ? 244 PRO A O     1 
ATOM   1840 C  CB    . PRO A 1 247 ? 164.442 148.537 -0.316  1.00 15.88 ? 244 PRO A CB    1 
ATOM   1841 C  CG    . PRO A 1 247 ? 164.801 148.462 -1.786  1.00 20.78 ? 244 PRO A CG    1 
ATOM   1842 C  CD    . PRO A 1 247 ? 164.780 149.918 -2.253  1.00 15.27 ? 244 PRO A CD    1 
ATOM   1843 N  N     . GLN A 1 248 ? 164.455 151.042 1.466   1.00 19.71 ? 245 GLN A N     1 
ATOM   1844 C  CA    . GLN A 1 248 ? 164.470 151.725 2.760   1.00 19.55 ? 245 GLN A CA    1 
ATOM   1845 C  C     . GLN A 1 248 ? 163.489 152.903 2.822   1.00 23.14 ? 245 GLN A C     1 
ATOM   1846 O  O     . GLN A 1 248 ? 162.800 153.086 3.832   1.00 18.52 ? 245 GLN A O     1 
ATOM   1847 C  CB    . GLN A 1 248 ? 165.876 152.206 3.107   1.00 16.94 ? 245 GLN A CB    1 
ATOM   1848 C  CG    . GLN A 1 248 ? 166.848 151.074 3.416   1.00 22.61 ? 245 GLN A CG    1 
ATOM   1849 C  CD    . GLN A 1 248 ? 167.658 151.332 4.686   1.00 36.12 ? 245 GLN A CD    1 
ATOM   1850 O  OE1   . GLN A 1 248 ? 167.138 151.213 5.801   1.00 47.25 ? 245 GLN A OE1   1 
ATOM   1851 N  NE2   . GLN A 1 248 ? 168.934 151.683 4.520   1.00 33.48 ? 245 GLN A NE2   1 
ATOM   1852 N  N     . LEU A 1 249 ? 163.433 153.704 1.757   1.00 21.22 ? 246 LEU A N     1 
ATOM   1853 C  CA    . LEU A 1 249 ? 162.522 154.853 1.715   1.00 17.42 ? 246 LEU A CA    1 
ATOM   1854 C  C     . LEU A 1 249 ? 161.068 154.404 1.850   1.00 17.11 ? 246 LEU A C     1 
ATOM   1855 O  O     . LEU A 1 249 ? 160.299 154.975 2.629   1.00 21.30 ? 246 LEU A O     1 
ATOM   1856 C  CB    . LEU A 1 249 ? 162.702 155.641 0.407   1.00 18.77 ? 246 LEU A CB    1 
ATOM   1857 C  CG    . LEU A 1 249 ? 161.805 156.851 0.137   1.00 22.69 ? 246 LEU A CG    1 
ATOM   1858 C  CD1   . LEU A 1 249 ? 162.009 157.925 1.204   1.00 17.13 ? 246 LEU A CD1   1 
ATOM   1859 C  CD2   . LEU A 1 249 ? 162.062 157.414 -1.301  1.00 15.49 ? 246 LEU A CD2   1 
ATOM   1860 N  N     . PHE A 1 250 ? 160.696 153.367 1.109   1.00 18.42 ? 247 PHE A N     1 
ATOM   1861 C  CA    . PHE A 1 250 ? 159.317 152.863 1.156   1.00 19.21 ? 247 PHE A CA    1 
ATOM   1862 C  C     . PHE A 1 250 ? 158.991 152.081 2.422   1.00 21.16 ? 247 PHE A C     1 
ATOM   1863 O  O     . PHE A 1 250 ? 157.810 151.862 2.730   1.00 20.17 ? 247 PHE A O     1 
ATOM   1864 C  CB    . PHE A 1 250 ? 159.018 151.977 -0.058  1.00 15.62 ? 247 PHE A CB    1 
ATOM   1865 C  CG    . PHE A 1 250 ? 158.638 152.749 -1.309  1.00 15.96 ? 247 PHE A CG    1 
ATOM   1866 C  CD1   . PHE A 1 250 ? 158.778 154.131 -1.369  1.00 22.56 ? 247 PHE A CD1   1 
ATOM   1867 C  CD2   . PHE A 1 250 ? 158.124 152.090 -2.411  1.00 13.96 ? 247 PHE A CD2   1 
ATOM   1868 C  CE1   . PHE A 1 250 ? 158.416 154.849 -2.521  1.00 16.24 ? 247 PHE A CE1   1 
ATOM   1869 C  CE2   . PHE A 1 250 ? 157.772 152.798 -3.567  1.00 22.29 ? 247 PHE A CE2   1 
ATOM   1870 C  CZ    . PHE A 1 250 ? 157.923 154.171 -3.618  1.00 18.77 ? 247 PHE A CZ    1 
ATOM   1871 N  N     . SER A 1 251 ? 160.017 151.648 3.153   1.00 18.37 ? 248 SER A N     1 
ATOM   1872 C  CA    . SER A 1 251 ? 159.790 150.740 4.274   1.00 19.48 ? 248 SER A CA    1 
ATOM   1873 C  C     . SER A 1 251 ? 159.044 151.428 5.435   1.00 19.89 ? 248 SER A C     1 
ATOM   1874 O  O     . SER A 1 251 ? 158.371 150.766 6.225   1.00 19.03 ? 248 SER A O     1 
ATOM   1875 C  CB    . SER A 1 251 ? 161.123 150.148 4.758   1.00 17.92 ? 248 SER A CB    1 
ATOM   1876 O  OG    . SER A 1 251 ? 161.800 151.044 5.621   1.00 16.95 ? 248 SER A OG    1 
ATOM   1877 N  N     . GLN A 1 252 ? 159.162 152.751 5.529   1.00 16.11 ? 249 GLN A N     1 
ATOM   1878 C  CA    . GLN A 1 252 ? 158.489 153.526 6.564   1.00 15.54 ? 249 GLN A CA    1 
ATOM   1879 C  C     . GLN A 1 252 ? 157.649 154.644 5.955   1.00 25.17 ? 249 GLN A C     1 
ATOM   1880 O  O     . GLN A 1 252 ? 157.299 155.625 6.627   1.00 18.97 ? 249 GLN A O     1 
ATOM   1881 C  CB    . GLN A 1 252 ? 159.485 154.143 7.537   1.00 22.41 ? 249 GLN A CB    1 
ATOM   1882 C  CG    . GLN A 1 252 ? 160.281 153.163 8.377   1.00 28.11 ? 249 GLN A CG    1 
ATOM   1883 C  CD    . GLN A 1 252 ? 161.095 153.880 9.439   1.00 32.31 ? 249 GLN A CD    1 
ATOM   1884 O  OE1   . GLN A 1 252 ? 162.195 154.371 9.170   1.00 30.71 ? 249 GLN A OE1   1 
ATOM   1885 N  NE2   . GLN A 1 252 ? 160.542 153.975 10.644  1.00 28.10 ? 249 GLN A NE2   1 
ATOM   1886 N  N     . MET A 1 253 ? 157.337 154.501 4.676   1.00 21.09 ? 250 MET A N     1 
ATOM   1887 C  CA    . MET A 1 253 ? 156.633 155.541 3.950   1.00 21.73 ? 250 MET A CA    1 
ATOM   1888 C  C     . MET A 1 253 ? 155.137 155.266 3.956   1.00 22.16 ? 250 MET A C     1 
ATOM   1889 O  O     . MET A 1 253 ? 154.678 154.267 3.372   1.00 21.38 ? 250 MET A O     1 
ATOM   1890 C  CB    . MET A 1 253 ? 157.161 155.640 2.513   1.00 19.91 ? 250 MET A CB    1 
ATOM   1891 C  CG    . MET A 1 253 ? 156.479 156.691 1.646   1.00 23.72 ? 250 MET A CG    1 
ATOM   1892 S  SD    . MET A 1 253 ? 156.711 158.395 2.196   1.00 23.91 ? 250 MET A SD    1 
ATOM   1893 C  CE    . MET A 1 253 ? 158.522 158.557 2.256   1.00 17.76 ? 250 MET A CE    1 
ATOM   1894 N  N     . PRO A 1 254 ? 154.362 156.151 4.609   1.00 21.79 ? 251 PRO A N     1 
ATOM   1895 C  CA    . PRO A 1 254 ? 152.923 155.886 4.673   1.00 22.53 ? 251 PRO A CA    1 
ATOM   1896 C  C     . PRO A 1 254 ? 152.320 155.885 3.270   1.00 20.84 ? 251 PRO A C     1 
ATOM   1897 O  O     . PRO A 1 254 ? 152.698 156.667 2.395   1.00 15.49 ? 251 PRO A O     1 
ATOM   1898 C  CB    . PRO A 1 254 ? 152.376 157.035 5.536   1.00 20.30 ? 251 PRO A CB    1 
ATOM   1899 C  CG    . PRO A 1 254 ? 153.553 157.549 6.301   1.00 22.15 ? 251 PRO A CG    1 
ATOM   1900 C  CD    . PRO A 1 254 ? 154.726 157.381 5.335   1.00 22.18 ? 251 PRO A CD    1 
ATOM   1901 N  N     . ILE A 1 255 ? 151.409 154.954 3.064   1.00 18.12 ? 252 ILE A N     1 
ATOM   1902 C  CA    . ILE A 1 255 ? 150.821 154.728 1.762   1.00 19.26 ? 252 ILE A CA    1 
ATOM   1903 C  C     . ILE A 1 255 ? 150.231 156.014 1.172   1.00 22.73 ? 252 ILE A C     1 
ATOM   1904 O  O     . ILE A 1 255 ? 150.460 156.313 -0.005  1.00 21.09 ? 252 ILE A O     1 
ATOM   1905 C  CB    . ILE A 1 255 ? 149.776 153.588 1.862   1.00 20.18 ? 252 ILE A CB    1 
ATOM   1906 C  CG1   . ILE A 1 255 ? 150.536 152.272 2.101   1.00 20.93 ? 252 ILE A CG1   1 
ATOM   1907 C  CG2   . ILE A 1 255 ? 148.913 153.515 0.600   1.00 17.34 ? 252 ILE A CG2   1 
ATOM   1908 C  CD1   . ILE A 1 255 ? 149.685 151.043 2.282   1.00 20.82 ? 252 ILE A CD1   1 
ATOM   1909 N  N     . ARG A 1 256 ? 149.548 156.802 2.001   1.00 19.99 ? 253 ARG A N     1 
ATOM   1910 C  CA    . ARG A 1 256 ? 148.894 158.032 1.556   1.00 19.10 ? 253 ARG A CA    1 
ATOM   1911 C  C     . ARG A 1 256 ? 149.844 159.070 0.932   1.00 21.13 ? 253 ARG A C     1 
ATOM   1912 O  O     . ARG A 1 256 ? 149.390 159.994 0.254   1.00 20.92 ? 253 ARG A O     1 
ATOM   1913 C  CB    . ARG A 1 256 ? 148.142 158.684 2.725   1.00 22.78 ? 253 ARG A CB    1 
ATOM   1914 C  CG    . ARG A 1 256 ? 149.048 159.383 3.738   1.00 19.11 ? 253 ARG A CG    1 
ATOM   1915 C  CD    . ARG A 1 256 ? 148.243 160.022 4.856   1.00 18.37 ? 253 ARG A CD    1 
ATOM   1916 N  NE    . ARG A 1 256 ? 149.110 160.462 5.945   1.00 31.17 ? 253 ARG A NE    1 
ATOM   1917 C  CZ    . ARG A 1 256 ? 149.485 159.702 6.974   1.00 31.87 ? 253 ARG A CZ    1 
ATOM   1918 N  NH1   . ARG A 1 256 ? 149.059 158.442 7.070   1.00 28.26 ? 253 ARG A NH1   1 
ATOM   1919 N  NH2   . ARG A 1 256 ? 150.300 160.203 7.903   1.00 28.86 ? 253 ARG A NH2   1 
ATOM   1920 N  N     . LYS A 1 257 ? 151.151 158.919 1.132   1.00 20.23 ? 254 LYS A N     1 
ATOM   1921 C  CA    . LYS A 1 257 ? 152.108 159.905 0.601   1.00 22.60 ? 254 LYS A CA    1 
ATOM   1922 C  C     . LYS A 1 257 ? 152.404 159.758 -0.894  1.00 24.54 ? 254 LYS A C     1 
ATOM   1923 O  O     . LYS A 1 257 ? 152.984 160.667 -1.516  1.00 20.69 ? 254 LYS A O     1 
ATOM   1924 C  CB    . LYS A 1 257 ? 153.427 159.832 1.374   1.00 20.03 ? 254 LYS A CB    1 
ATOM   1925 C  CG    . LYS A 1 257 ? 153.260 159.973 2.872   1.00 25.78 ? 254 LYS A CG    1 
ATOM   1926 C  CD    . LYS A 1 257 ? 152.631 161.306 3.245   1.00 17.71 ? 254 LYS A CD    1 
ATOM   1927 C  CE    . LYS A 1 257 ? 152.722 161.550 4.761   1.00 25.71 ? 254 LYS A CE    1 
ATOM   1928 N  NZ    . LYS A 1 257 ? 152.022 162.811 5.185   1.00 29.61 ? 254 LYS A NZ    1 
ATOM   1929 N  N     . ILE A 1 258 ? 152.023 158.623 -1.476  1.00 16.31 ? 255 ILE A N     1 
ATOM   1930 C  CA    . ILE A 1 258 ? 152.355 158.358 -2.877  1.00 14.17 ? 255 ILE A CA    1 
ATOM   1931 C  C     . ILE A 1 258 ? 151.223 158.854 -3.762  1.00 18.12 ? 255 ILE A C     1 
ATOM   1932 O  O     . ILE A 1 258 ? 150.044 158.640 -3.460  1.00 18.34 ? 255 ILE A O     1 
ATOM   1933 C  CB    . ILE A 1 258 ? 152.643 156.855 -3.116  1.00 22.23 ? 255 ILE A CB    1 
ATOM   1934 C  CG1   . ILE A 1 258 ? 154.097 156.512 -2.745  1.00 27.93 ? 255 ILE A CG1   1 
ATOM   1935 C  CG2   . ILE A 1 258 ? 152.445 156.471 -4.577  1.00 24.83 ? 255 ILE A CG2   1 
ATOM   1936 C  CD1   . ILE A 1 258 ? 154.485 156.823 -1.310  1.00 32.04 ? 255 ILE A CD1   1 
ATOM   1937 N  N     . ARG A 1 259 ? 151.574 159.541 -4.843  1.00 19.28 ? 256 ARG A N     1 
ATOM   1938 C  CA    . ARG A 1 259 ? 150.578 160.166 -5.705  1.00 16.07 ? 256 ARG A CA    1 
ATOM   1939 C  C     . ARG A 1 259 ? 149.532 159.156 -6.204  1.00 20.66 ? 256 ARG A C     1 
ATOM   1940 O  O     . ARG A 1 259 ? 149.897 158.104 -6.729  1.00 18.91 ? 256 ARG A O     1 
ATOM   1941 C  CB    . ARG A 1 259 ? 151.258 160.837 -6.909  1.00 20.54 ? 256 ARG A CB    1 
ATOM   1942 C  CG    . ARG A 1 259 ? 150.340 161.786 -7.671  1.00 26.86 ? 256 ARG A CG    1 
ATOM   1943 C  CD    . ARG A 1 259 ? 150.864 162.064 -9.082  1.00 25.55 ? 256 ARG A CD    1 
ATOM   1944 N  NE    . ARG A 1 259 ? 150.582 160.961 -10.001 1.00 34.26 ? 256 ARG A NE    1 
ATOM   1945 N  N     . SER A 1 260 ? 148.257 159.517 -6.011  1.00 22.78 ? 257 SER A N     1 
ATOM   1946 C  CA    . SER A 1 260 ? 147.030 158.771 -6.369  1.00 23.24 ? 257 SER A CA    1 
ATOM   1947 C  C     . SER A 1 260 ? 146.575 157.820 -5.248  1.00 28.50 ? 257 SER A C     1 
ATOM   1948 O  O     . SER A 1 260 ? 145.514 157.194 -5.340  1.00 22.65 ? 257 SER A O     1 
ATOM   1949 C  CB    . SER A 1 260 ? 147.190 157.992 -7.689  1.00 27.58 ? 257 SER A CB    1 
ATOM   1950 O  OG    . SER A 1 260 ? 147.877 156.773 -7.485  1.00 23.58 ? 257 SER A OG    1 
ATOM   1951 N  N     . LEU A 1 261 ? 147.353 157.738 -4.174  1.00 16.62 ? 258 LEU A N     1 
ATOM   1952 C  CA    . LEU A 1 261 ? 146.984 156.898 -3.041  1.00 18.82 ? 258 LEU A CA    1 
ATOM   1953 C  C     . LEU A 1 261 ? 146.559 157.721 -1.811  1.00 22.24 ? 258 LEU A C     1 
ATOM   1954 O  O     . LEU A 1 261 ? 146.339 157.170 -0.732  1.00 19.92 ? 258 LEU A O     1 
ATOM   1955 C  CB    . LEU A 1 261 ? 148.149 155.969 -2.675  1.00 18.95 ? 258 LEU A CB    1 
ATOM   1956 C  CG    . LEU A 1 261 ? 148.493 154.864 -3.687  1.00 16.44 ? 258 LEU A CG    1 
ATOM   1957 C  CD1   . LEU A 1 261 ? 149.570 153.935 -3.122  1.00 14.18 ? 258 LEU A CD1   1 
ATOM   1958 C  CD2   . LEU A 1 261 ? 147.260 154.051 -4.121  1.00 22.00 ? 258 LEU A CD2   1 
ATOM   1959 N  N     . GLY A 1 262 ? 146.433 159.034 -1.977  1.00 22.12 ? 259 GLY A N     1 
ATOM   1960 C  CA    . GLY A 1 262 ? 146.093 159.925 -0.875  1.00 18.58 ? 259 GLY A CA    1 
ATOM   1961 C  C     . GLY A 1 262 ? 144.610 159.999 -0.537  1.00 27.16 ? 259 GLY A C     1 
ATOM   1962 O  O     . GLY A 1 262 ? 144.212 160.686 0.409   1.00 24.65 ? 259 GLY A O     1 
ATOM   1963 N  N     . GLY A 1 263 ? 143.789 159.280 -1.297  1.00 21.05 ? 260 GLY A N     1 
ATOM   1964 C  CA    . GLY A 1 263 ? 142.350 159.330 -1.116  1.00 23.77 ? 260 GLY A CA    1 
ATOM   1965 C  C     . GLY A 1 263 ? 141.745 157.982 -0.788  1.00 23.12 ? 260 GLY A C     1 
ATOM   1966 O  O     . GLY A 1 263 ? 142.286 157.244 0.033   1.00 23.68 ? 260 GLY A O     1 
ATOM   1967 N  N     . LYS A 1 264 ? 140.633 157.649 -1.444  1.00 25.64 ? 261 LYS A N     1 
ATOM   1968 C  CA    . LYS A 1 264 ? 139.863 156.448 -1.100  1.00 28.24 ? 261 LYS A CA    1 
ATOM   1969 C  C     . LYS A 1 264 ? 140.586 155.125 -1.408  1.00 23.33 ? 261 LYS A C     1 
ATOM   1970 O  O     . LYS A 1 264 ? 140.555 154.199 -0.600  1.00 24.44 ? 261 LYS A O     1 
ATOM   1971 C  CB    . LYS A 1 264 ? 138.502 156.478 -1.815  1.00 23.12 ? 261 LYS A CB    1 
ATOM   1972 C  CG    . LYS A 1 264 ? 137.511 157.457 -1.191  1.00 29.13 ? 261 LYS A CG    1 
ATOM   1973 C  CD    . LYS A 1 264 ? 136.156 157.420 -1.900  1.00 44.41 ? 261 LYS A CD    1 
ATOM   1974 C  CE    . LYS A 1 264 ? 135.176 158.411 -1.275  1.00 50.47 ? 261 LYS A CE    1 
ATOM   1975 N  NZ    . LYS A 1 264 ? 133.773 158.184 -1.728  1.00 46.36 ? 261 LYS A NZ    1 
ATOM   1976 N  N     . LEU A 1 265 ? 141.220 155.025 -2.572  1.00 25.69 ? 262 LEU A N     1 
ATOM   1977 C  CA    . LEU A 1 265 ? 141.971 153.815 -2.926  1.00 21.27 ? 262 LEU A CA    1 
ATOM   1978 C  C     . LEU A 1 265 ? 143.084 153.501 -1.911  1.00 23.99 ? 262 LEU A C     1 
ATOM   1979 O  O     . LEU A 1 265 ? 143.241 152.355 -1.482  1.00 26.58 ? 262 LEU A O     1 
ATOM   1980 C  CB    . LEU A 1 265 ? 142.576 153.958 -4.320  1.00 22.39 ? 262 LEU A CB    1 
ATOM   1981 C  CG    . LEU A 1 265 ? 143.422 152.791 -4.823  1.00 24.68 ? 262 LEU A CG    1 
ATOM   1982 C  CD1   . LEU A 1 265 ? 142.586 151.505 -4.933  1.00 26.87 ? 262 LEU A CD1   1 
ATOM   1983 C  CD2   . LEU A 1 265 ? 144.040 153.152 -6.172  1.00 29.91 ? 262 LEU A CD2   1 
ATOM   1984 N  N     . GLY A 1 266 ? 143.868 154.509 -1.546  1.00 20.48 ? 263 GLY A N     1 
ATOM   1985 C  CA    . GLY A 1 266 ? 144.887 154.335 -0.521  1.00 20.28 ? 263 GLY A CA    1 
ATOM   1986 C  C     . GLY A 1 266 ? 144.315 153.858 0.810   1.00 27.63 ? 263 GLY A C     1 
ATOM   1987 O  O     . GLY A 1 266 ? 144.937 153.047 1.506   1.00 18.89 ? 263 GLY A O     1 
ATOM   1988 N  N     . ALA A 1 267 ? 143.122 154.349 1.153   1.00 19.68 ? 264 ALA A N     1 
ATOM   1989 C  CA    . ALA A 1 267 ? 142.441 153.931 2.380   1.00 27.58 ? 264 ALA A CA    1 
ATOM   1990 C  C     . ALA A 1 267 ? 141.994 152.469 2.301   1.00 24.93 ? 264 ALA A C     1 
ATOM   1991 O  O     . ALA A 1 267 ? 142.146 151.710 3.262   1.00 26.15 ? 264 ALA A O     1 
ATOM   1992 C  CB    . ALA A 1 267 ? 141.241 154.843 2.663   1.00 26.90 ? 264 ALA A CB    1 
ATOM   1993 N  N     . SER A 1 268 ? 141.449 152.076 1.153   1.00 25.00 ? 265 SER A N     1 
ATOM   1994 C  CA    . SER A 1 268 ? 141.101 150.672 0.896   1.00 21.58 ? 265 SER A CA    1 
ATOM   1995 C  C     . SER A 1 268 ? 142.335 149.788 0.996   1.00 24.59 ? 265 SER A C     1 
ATOM   1996 O  O     . SER A 1 268 ? 142.274 148.681 1.537   1.00 22.70 ? 265 SER A O     1 
ATOM   1997 C  CB    . SER A 1 268 ? 140.482 150.494 -0.503  1.00 21.09 ? 265 SER A CB    1 
ATOM   1998 O  OG    . SER A 1 268 ? 139.527 151.501 -0.764  1.00 39.80 ? 265 SER A OG    1 
ATOM   1999 N  N     . VAL A 1 269 ? 143.448 150.261 0.437   1.00 20.24 ? 266 VAL A N     1 
ATOM   2000 C  CA    . VAL A 1 269 ? 144.668 149.465 0.462   1.00 23.60 ? 266 VAL A CA    1 
ATOM   2001 C  C     . VAL A 1 269 ? 145.073 149.180 1.911   1.00 22.24 ? 266 VAL A C     1 
ATOM   2002 O  O     . VAL A 1 269 ? 145.341 148.036 2.274   1.00 25.02 ? 266 VAL A O     1 
ATOM   2003 C  CB    . VAL A 1 269 ? 145.835 150.151 -0.286  1.00 21.80 ? 266 VAL A CB    1 
ATOM   2004 C  CG1   . VAL A 1 269 ? 147.145 149.421 0.002   1.00 21.21 ? 266 VAL A CG1   1 
ATOM   2005 C  CG2   . VAL A 1 269 ? 145.561 150.182 -1.799  1.00 19.09 ? 266 VAL A CG2   1 
ATOM   2006 N  N     . ILE A 1 270 ? 145.075 150.221 2.736   1.00 20.48 ? 267 ILE A N     1 
ATOM   2007 C  CA    . ILE A 1 270 ? 145.439 150.098 4.144   1.00 17.57 ? 267 ILE A CA    1 
ATOM   2008 C  C     . ILE A 1 270 ? 144.487 149.174 4.894   1.00 22.21 ? 267 ILE A C     1 
ATOM   2009 O  O     . ILE A 1 270 ? 144.927 148.280 5.623   1.00 24.86 ? 267 ILE A O     1 
ATOM   2010 C  CB    . ILE A 1 270 ? 145.462 151.477 4.812   1.00 22.15 ? 267 ILE A CB    1 
ATOM   2011 C  CG1   . ILE A 1 270 ? 146.702 152.249 4.350   1.00 18.45 ? 267 ILE A CG1   1 
ATOM   2012 C  CG2   . ILE A 1 270 ? 145.416 151.348 6.334   1.00 28.20 ? 267 ILE A CG2   1 
ATOM   2013 C  CD1   . ILE A 1 270 ? 146.594 153.767 4.494   1.00 20.20 ? 267 ILE A CD1   1 
ATOM   2014 N  N     . GLU A 1 271 ? 143.187 149.383 4.684   1.00 24.95 ? 268 GLU A N     1 
ATOM   2015 C  CA    . GLU A 1 271 ? 142.133 148.667 5.407   1.00 26.49 ? 268 GLU A CA    1 
ATOM   2016 C  C     . GLU A 1 271 ? 142.023 147.182 5.018   1.00 24.92 ? 268 GLU A C     1 
ATOM   2017 O  O     . GLU A 1 271 ? 142.041 146.304 5.877   1.00 24.43 ? 268 GLU A O     1 
ATOM   2018 C  CB    . GLU A 1 271 ? 140.787 149.367 5.180   1.00 30.76 ? 268 GLU A CB    1 
ATOM   2019 N  N     . ILE A 1 272 ? 141.923 146.902 3.724   1.00 19.27 ? 269 ILE A N     1 
ATOM   2020 C  CA    A ILE A 1 272 ? 141.783 145.531 3.240   0.06 20.88 ? 269 ILE A CA    1 
ATOM   2021 C  CA    B ILE A 1 272 ? 141.769 145.528 3.254   0.94 20.57 ? 269 ILE A CA    1 
ATOM   2022 C  C     . ILE A 1 272 ? 143.031 144.691 3.515   1.00 29.43 ? 269 ILE A C     1 
ATOM   2023 O  O     . ILE A 1 272 ? 142.943 143.533 3.946   1.00 24.27 ? 269 ILE A O     1 
ATOM   2024 C  CB    A ILE A 1 272 ? 141.482 145.501 1.725   0.06 25.91 ? 269 ILE A CB    1 
ATOM   2025 C  CB    B ILE A 1 272 ? 141.400 145.506 1.735   0.94 26.16 ? 269 ILE A CB    1 
ATOM   2026 C  CG1   A ILE A 1 272 ? 140.193 146.267 1.420   0.06 22.54 ? 269 ILE A CG1   1 
ATOM   2027 C  CG1   B ILE A 1 272 ? 140.000 146.102 1.516   0.94 22.06 ? 269 ILE A CG1   1 
ATOM   2028 C  CG2   A ILE A 1 272 ? 141.374 144.068 1.225   0.06 24.48 ? 269 ILE A CG2   1 
ATOM   2029 C  CG2   B ILE A 1 272 ? 141.449 144.097 1.170   0.94 24.44 ? 269 ILE A CG2   1 
ATOM   2030 C  CD1   A ILE A 1 272 ? 138.973 145.709 2.113   0.06 22.52 ? 269 ILE A CD1   1 
ATOM   2031 C  CD1   B ILE A 1 272 ? 139.637 146.285 0.037   0.94 22.99 ? 269 ILE A CD1   1 
ATOM   2032 N  N     . LEU A 1 273 ? 144.208 145.267 3.283   1.00 22.43 ? 270 LEU A N     1 
ATOM   2033 C  CA    . LEU A 1 273 ? 145.426 144.472 3.430   1.00 24.80 ? 270 LEU A CA    1 
ATOM   2034 C  C     . LEU A 1 273 ? 145.931 144.456 4.867   1.00 30.40 ? 270 LEU A C     1 
ATOM   2035 O  O     . LEU A 1 273 ? 146.648 143.537 5.270   1.00 24.17 ? 270 LEU A O     1 
ATOM   2036 C  CB    . LEU A 1 273 ? 146.517 144.982 2.489   1.00 28.09 ? 270 LEU A CB    1 
ATOM   2037 C  CG    . LEU A 1 273 ? 146.170 144.891 1.001   1.00 24.75 ? 270 LEU A CG    1 
ATOM   2038 C  CD1   . LEU A 1 273 ? 147.383 145.260 0.154   1.00 20.93 ? 270 LEU A CD1   1 
ATOM   2039 C  CD2   . LEU A 1 273 ? 145.681 143.499 0.640   1.00 23.74 ? 270 LEU A CD2   1 
ATOM   2040 N  N     . GLY A 1 274 ? 145.544 145.469 5.637   1.00 24.12 ? 271 GLY A N     1 
ATOM   2041 C  CA    . GLY A 1 274 ? 146.017 145.602 6.995   1.00 24.96 ? 271 GLY A CA    1 
ATOM   2042 C  C     . GLY A 1 274 ? 147.468 146.030 7.067   1.00 31.91 ? 271 GLY A C     1 
ATOM   2043 O  O     . GLY A 1 274 ? 148.197 145.565 7.936   1.00 31.10 ? 271 GLY A O     1 
ATOM   2044 N  N     . ILE A 1 275 ? 147.883 146.917 6.159   1.00 22.82 ? 272 ILE A N     1 
ATOM   2045 C  CA    . ILE A 1 275 ? 149.258 147.426 6.134   1.00 19.11 ? 272 ILE A CA    1 
ATOM   2046 C  C     . ILE A 1 275 ? 149.311 148.957 6.325   1.00 22.41 ? 272 ILE A C     1 
ATOM   2047 O  O     . ILE A 1 275 ? 148.284 149.618 6.294   1.00 21.69 ? 272 ILE A O     1 
ATOM   2048 C  CB    . ILE A 1 275 ? 149.963 147.065 4.823   1.00 23.17 ? 272 ILE A CB    1 
ATOM   2049 C  CG1   . ILE A 1 275 ? 149.253 147.701 3.618   1.00 21.29 ? 272 ILE A CG1   1 
ATOM   2050 C  CG2   . ILE A 1 275 ? 150.044 145.551 4.659   1.00 22.48 ? 272 ILE A CG2   1 
ATOM   2051 C  CD1   . ILE A 1 275 ? 149.990 147.446 2.272   1.00 23.42 ? 272 ILE A CD1   1 
ATOM   2052 N  N     . GLU A 1 276 ? 150.510 149.508 6.519   1.00 22.43 ? 273 GLU A N     1 
ATOM   2053 C  CA    . GLU A 1 276 ? 150.694 150.956 6.697   1.00 22.08 ? 273 GLU A CA    1 
ATOM   2054 C  C     . GLU A 1 276 ? 151.594 151.623 5.658   1.00 23.23 ? 273 GLU A C     1 
ATOM   2055 O  O     . GLU A 1 276 ? 151.362 152.773 5.255   1.00 22.78 ? 273 GLU A O     1 
ATOM   2056 C  CB    . GLU A 1 276 ? 151.318 151.256 8.066   1.00 23.14 ? 273 GLU A CB    1 
ATOM   2057 C  CG    . GLU A 1 276 ? 150.454 151.024 9.285   1.00 30.68 ? 273 GLU A CG    1 
ATOM   2058 C  CD    . GLU A 1 276 ? 151.228 151.369 10.559  1.00 40.97 ? 273 GLU A CD    1 
ATOM   2059 O  OE1   . GLU A 1 276 ? 151.606 150.442 11.301  1.00 44.92 ? 273 GLU A OE1   1 
ATOM   2060 O  OE2   . GLU A 1 276 ? 151.486 152.566 10.800  1.00 37.95 ? 273 GLU A OE2   1 
ATOM   2061 N  N     . TYR A 1 277 ? 152.658 150.918 5.283   1.00 21.97 ? 274 TYR A N     1 
ATOM   2062 C  CA    . TYR A 1 277 ? 153.745 151.502 4.514   1.00 19.12 ? 274 TYR A CA    1 
ATOM   2063 C  C     . TYR A 1 277 ? 153.827 150.915 3.112   1.00 18.86 ? 274 TYR A C     1 
ATOM   2064 O  O     . TYR A 1 277 ? 153.481 149.745 2.906   1.00 16.85 ? 274 TYR A O     1 
ATOM   2065 C  CB    . TYR A 1 277 ? 155.071 151.290 5.249   1.00 19.29 ? 274 TYR A CB    1 
ATOM   2066 C  CG    . TYR A 1 277 ? 155.039 151.791 6.684   1.00 17.79 ? 274 TYR A CG    1 
ATOM   2067 C  CD1   . TYR A 1 277 ? 154.746 153.118 6.963   1.00 17.24 ? 274 TYR A CD1   1 
ATOM   2068 C  CD2   . TYR A 1 277 ? 155.302 150.936 7.756   1.00 24.51 ? 274 TYR A CD2   1 
ATOM   2069 C  CE1   . TYR A 1 277 ? 154.706 153.598 8.255   1.00 22.72 ? 274 TYR A CE1   1 
ATOM   2070 C  CE2   . TYR A 1 277 ? 155.277 151.410 9.071   1.00 25.47 ? 274 TYR A CE2   1 
ATOM   2071 C  CZ    . TYR A 1 277 ? 154.970 152.746 9.310   1.00 25.18 ? 274 TYR A CZ    1 
ATOM   2072 O  OH    . TYR A 1 277 ? 154.933 153.244 10.598  1.00 21.19 ? 274 TYR A OH    1 
ATOM   2073 N  N     . MET A 1 278 ? 154.316 151.718 2.162   1.00 17.51 ? 275 MET A N     1 
ATOM   2074 C  CA    . MET A 1 278 ? 154.374 151.322 0.751   1.00 16.91 ? 275 MET A CA    1 
ATOM   2075 C  C     . MET A 1 278 ? 155.129 150.001 0.538   1.00 17.25 ? 275 MET A C     1 
ATOM   2076 O  O     . MET A 1 278 ? 154.695 149.146 -0.236  1.00 17.79 ? 275 MET A O     1 
ATOM   2077 C  CB    . MET A 1 278 ? 155.023 152.436 -0.089  1.00 16.65 ? 275 MET A CB    1 
ATOM   2078 C  CG    . MET A 1 278 ? 154.042 153.435 -0.644  1.00 35.39 ? 275 MET A CG    1 
ATOM   2079 S  SD    . MET A 1 278 ? 152.800 152.716 -1.749  1.00 25.36 ? 275 MET A SD    1 
ATOM   2080 C  CE    . MET A 1 278 ? 153.827 152.119 -3.072  1.00 34.80 ? 275 MET A CE    1 
ATOM   2081 N  N     . GLY A 1 279 ? 156.230 149.821 1.260   1.00 16.96 ? 276 GLY A N     1 
ATOM   2082 C  CA    . GLY A 1 279 ? 157.068 148.637 1.115   1.00 20.61 ? 276 GLY A CA    1 
ATOM   2083 C  C     . GLY A 1 279 ? 156.335 147.333 1.397   1.00 23.64 ? 276 GLY A C     1 
ATOM   2084 O  O     . GLY A 1 279 ? 156.624 146.289 0.791   1.00 20.76 ? 276 GLY A O     1 
ATOM   2085 N  N     . GLU A 1 280 ? 155.370 147.393 2.309   1.00 19.66 ? 277 GLU A N     1 
ATOM   2086 C  CA    . GLU A 1 280 ? 154.639 146.206 2.718   1.00 16.23 ? 277 GLU A CA    1 
ATOM   2087 C  C     . GLU A 1 280 ? 153.865 145.601 1.560   1.00 18.23 ? 277 GLU A C     1 
ATOM   2088 O  O     . GLU A 1 280 ? 153.565 144.403 1.571   1.00 19.12 ? 277 GLU A O     1 
ATOM   2089 C  CB    . GLU A 1 280 ? 153.678 146.520 3.882   1.00 18.51 ? 277 GLU A CB    1 
ATOM   2090 C  CG    . GLU A 1 280 ? 154.366 146.896 5.193   1.00 16.62 ? 277 GLU A CG    1 
ATOM   2091 C  CD    . GLU A 1 280 ? 153.368 147.142 6.330   1.00 22.99 ? 277 GLU A CD    1 
ATOM   2092 O  OE1   . GLU A 1 280 ? 152.981 146.170 7.016   1.00 20.94 ? 277 GLU A OE1   1 
ATOM   2093 O  OE2   . GLU A 1 280 ? 152.965 148.304 6.530   1.00 19.87 ? 277 GLU A OE2   1 
ATOM   2094 N  N     . LEU A 1 281 ? 153.553 146.416 0.557   1.00 19.72 ? 278 LEU A N     1 
ATOM   2095 C  CA    . LEU A 1 281 ? 152.850 145.922 -0.619  1.00 21.87 ? 278 LEU A CA    1 
ATOM   2096 C  C     . LEU A 1 281 ? 153.620 144.859 -1.396  1.00 20.90 ? 278 LEU A C     1 
ATOM   2097 O  O     . LEU A 1 281 ? 153.004 144.082 -2.125  1.00 20.64 ? 278 LEU A O     1 
ATOM   2098 C  CB    . LEU A 1 281 ? 152.503 147.073 -1.558  1.00 19.31 ? 278 LEU A CB    1 
ATOM   2099 C  CG    . LEU A 1 281 ? 151.288 147.929 -1.194  1.00 25.18 ? 278 LEU A CG    1 
ATOM   2100 C  CD1   . LEU A 1 281 ? 151.283 149.238 -2.019  1.00 21.57 ? 278 LEU A CD1   1 
ATOM   2101 C  CD2   . LEU A 1 281 ? 150.007 147.138 -1.435  1.00 19.85 ? 278 LEU A CD2   1 
ATOM   2102 N  N     . THR A 1 282 ? 154.946 144.801 -1.237  1.00 24.32 ? 279 THR A N     1 
ATOM   2103 C  CA    . THR A 1 282 ? 155.757 143.837 -1.999  1.00 21.91 ? 279 THR A CA    1 
ATOM   2104 C  C     . THR A 1 282 ? 155.392 142.395 -1.670  1.00 20.40 ? 279 THR A C     1 
ATOM   2105 O  O     . THR A 1 282 ? 155.679 141.500 -2.441  1.00 20.81 ? 279 THR A O     1 
ATOM   2106 C  CB    . THR A 1 282 ? 157.288 143.982 -1.743  1.00 20.48 ? 279 THR A CB    1 
ATOM   2107 O  OG1   . THR A 1 282 ? 157.561 143.782 -0.346  1.00 20.42 ? 279 THR A OG1   1 
ATOM   2108 C  CG2   . THR A 1 282 ? 157.820 145.352 -2.200  1.00 16.73 ? 279 THR A CG2   1 
ATOM   2109 N  N     . GLN A 1 283 ? 154.752 142.164 -0.532  1.00 20.12 ? 280 GLN A N     1 
ATOM   2110 C  CA    A GLN A 1 283 ? 154.528 140.783 -0.112  0.56 25.06 ? 280 GLN A CA    1 
ATOM   2111 C  CA    B GLN A 1 283 ? 154.467 140.815 -0.062  0.44 25.07 ? 280 GLN A CA    1 
ATOM   2112 C  C     . GLN A 1 283 ? 153.223 140.205 -0.692  1.00 28.17 ? 280 GLN A C     1 
ATOM   2113 O  O     . GLN A 1 283 ? 152.834 139.085 -0.365  1.00 27.72 ? 280 GLN A O     1 
ATOM   2114 C  CB    A GLN A 1 283 ? 154.550 140.678 1.429   0.56 25.03 ? 280 GLN A CB    1 
ATOM   2115 C  CB    B GLN A 1 283 ? 154.331 140.821 1.466   0.44 24.67 ? 280 GLN A CB    1 
ATOM   2116 C  CG    A GLN A 1 283 ? 153.382 141.311 2.137   0.56 20.81 ? 280 GLN A CG    1 
ATOM   2117 C  CG    B GLN A 1 283 ? 155.664 140.963 2.137   0.44 21.49 ? 280 GLN A CG    1 
ATOM   2118 C  CD    A GLN A 1 283 ? 153.645 141.558 3.611   0.56 29.83 ? 280 GLN A CD    1 
ATOM   2119 C  CD    B GLN A 1 283 ? 156.716 140.108 1.446   0.44 25.72 ? 280 GLN A CD    1 
ATOM   2120 O  OE1   A GLN A 1 283 ? 153.478 142.682 4.099   0.56 21.01 ? 280 GLN A OE1   1 
ATOM   2121 O  OE1   B GLN A 1 283 ? 156.660 138.876 1.500   0.44 23.61 ? 280 GLN A OE1   1 
ATOM   2122 N  NE2   A GLN A 1 283 ? 154.052 140.510 4.334   0.56 23.64 ? 280 GLN A NE2   1 
ATOM   2123 N  NE2   B GLN A 1 283 ? 157.666 140.759 0.767   0.44 22.04 ? 280 GLN A NE2   1 
ATOM   2124 N  N     . PHE A 1 284 ? 152.576 140.944 -1.591  1.00 19.39 ? 281 PHE A N     1 
ATOM   2125 C  CA    . PHE A 1 284 ? 151.361 140.427 -2.217  1.00 23.62 ? 281 PHE A CA    1 
ATOM   2126 C  C     . PHE A 1 284 ? 151.620 140.116 -3.697  1.00 30.42 ? 281 PHE A C     1 
ATOM   2127 O  O     . PHE A 1 284 ? 152.418 140.808 -4.339  1.00 23.24 ? 281 PHE A O     1 
ATOM   2128 C  CB    . PHE A 1 284 ? 150.219 141.425 -2.035  1.00 19.91 ? 281 PHE A CB    1 
ATOM   2129 C  CG    . PHE A 1 284 ? 149.898 141.695 -0.602  1.00 23.91 ? 281 PHE A CG    1 
ATOM   2130 C  CD1   . PHE A 1 284 ? 150.541 142.719 0.090   1.00 21.31 ? 281 PHE A CD1   1 
ATOM   2131 C  CD2   . PHE A 1 284 ? 148.989 140.893 0.079   1.00 23.00 ? 281 PHE A CD2   1 
ATOM   2132 C  CE1   . PHE A 1 284 ? 150.253 142.959 1.417   1.00 22.01 ? 281 PHE A CE1   1 
ATOM   2133 C  CE2   . PHE A 1 284 ? 148.708 141.124 1.413   1.00 26.07 ? 281 PHE A CE2   1 
ATOM   2134 C  CZ    . PHE A 1 284 ? 149.339 142.156 2.082   1.00 24.38 ? 281 PHE A CZ    1 
ATOM   2135 N  N     . THR A 1 285 ? 151.002 139.058 -4.229  1.00 21.64 ? 282 THR A N     1 
ATOM   2136 C  CA    . THR A 1 285 ? 151.175 138.776 -5.655  1.00 18.83 ? 282 THR A CA    1 
ATOM   2137 C  C     . THR A 1 285 ? 150.391 139.813 -6.462  1.00 15.96 ? 282 THR A C     1 
ATOM   2138 O  O     . THR A 1 285 ? 149.475 140.447 -5.955  1.00 19.66 ? 282 THR A O     1 
ATOM   2139 C  CB    . THR A 1 285 ? 150.707 137.364 -6.060  1.00 20.08 ? 282 THR A CB    1 
ATOM   2140 O  OG1   . THR A 1 285 ? 149.289 137.298 -5.982  1.00 21.41 ? 282 THR A OG1   1 
ATOM   2141 C  CG2   . THR A 1 285 ? 151.315 136.288 -5.156  1.00 22.92 ? 282 THR A CG2   1 
ATOM   2142 N  N     . GLU A 1 286 ? 150.763 139.992 -7.718  1.00 18.97 ? 283 GLU A N     1 
ATOM   2143 C  CA    . GLU A 1 286 ? 150.037 140.900 -8.589  1.00 19.20 ? 283 GLU A CA    1 
ATOM   2144 C  C     . GLU A 1 286 ? 148.564 140.481 -8.711  1.00 23.67 ? 283 GLU A C     1 
ATOM   2145 O  O     . GLU A 1 286 ? 147.667 141.333 -8.767  1.00 20.04 ? 283 GLU A O     1 
ATOM   2146 C  CB    . GLU A 1 286 ? 150.708 140.945 -9.975  1.00 24.47 ? 283 GLU A CB    1 
ATOM   2147 C  CG    . GLU A 1 286 ? 150.002 141.832 -10.969 1.00 20.64 ? 283 GLU A CG    1 
ATOM   2148 C  CD    . GLU A 1 286 ? 150.763 141.984 -12.270 1.00 32.36 ? 283 GLU A CD    1 
ATOM   2149 O  OE1   . GLU A 1 286 ? 151.680 141.172 -12.515 1.00 28.64 ? 283 GLU A OE1   1 
ATOM   2150 O  OE2   . GLU A 1 286 ? 150.450 142.928 -13.039 1.00 24.45 ? 283 GLU A OE2   1 
ATOM   2151 N  N     . SER A 1 287 ? 148.315 139.169 -8.749  1.00 19.67 ? 284 SER A N     1 
ATOM   2152 C  CA    . SER A 1 287 ? 146.949 138.654 -8.814  1.00 22.52 ? 284 SER A CA    1 
ATOM   2153 C  C     . SER A 1 287 ? 146.125 138.992 -7.575  1.00 27.64 ? 284 SER A C     1 
ATOM   2154 O  O     . SER A 1 287 ? 144.931 139.296 -7.682  1.00 24.99 ? 284 SER A O     1 
ATOM   2155 C  CB    . SER A 1 287 ? 146.953 137.130 -9.013  1.00 27.79 ? 284 SER A CB    1 
ATOM   2156 O  OG    . SER A 1 287 ? 147.231 136.808 -10.362 1.00 23.85 ? 284 SER A OG    1 
ATOM   2157 N  N     . GLN A 1 288 ? 146.744 138.916 -6.398  1.00 23.00 ? 285 GLN A N     1 
ATOM   2158 C  CA    . GLN A 1 288 ? 146.040 139.288 -5.179  1.00 18.86 ? 285 GLN A CA    1 
ATOM   2159 C  C     . GLN A 1 288 ? 145.654 140.759 -5.220  1.00 23.08 ? 285 GLN A C     1 
ATOM   2160 O  O     . GLN A 1 288 ? 144.522 141.113 -4.926  1.00 23.18 ? 285 GLN A O     1 
ATOM   2161 C  CB    . GLN A 1 288 ? 146.893 139.020 -3.941  1.00 26.62 ? 285 GLN A CB    1 
ATOM   2162 C  CG    . GLN A 1 288 ? 147.123 137.576 -3.640  1.00 24.36 ? 285 GLN A CG    1 
ATOM   2163 C  CD    . GLN A 1 288 ? 148.012 137.396 -2.419  1.00 29.75 ? 285 GLN A CD    1 
ATOM   2164 O  OE1   . GLN A 1 288 ? 149.176 137.793 -2.416  1.00 21.83 ? 285 GLN A OE1   1 
ATOM   2165 N  NE2   . GLN A 1 288 ? 147.456 136.808 -1.368  1.00 33.58 ? 285 GLN A NE2   1 
ATOM   2166 N  N     . LEU A 1 289 ? 146.600 141.614 -5.600  1.00 19.75 ? 286 LEU A N     1 
ATOM   2167 C  CA    . LEU A 1 289 ? 146.329 143.049 -5.642  1.00 26.00 ? 286 LEU A CA    1 
ATOM   2168 C  C     . LEU A 1 289 ? 145.255 143.374 -6.672  1.00 22.63 ? 286 LEU A C     1 
ATOM   2169 O  O     . LEU A 1 289 ? 144.400 144.236 -6.445  1.00 21.05 ? 286 LEU A O     1 
ATOM   2170 C  CB    . LEU A 1 289 ? 147.614 143.831 -5.942  1.00 19.59 ? 286 LEU A CB    1 
ATOM   2171 C  CG    . LEU A 1 289 ? 148.716 143.632 -4.895  1.00 21.81 ? 286 LEU A CG    1 
ATOM   2172 C  CD1   . LEU A 1 289 ? 150.048 144.193 -5.381  1.00 18.69 ? 286 LEU A CD1   1 
ATOM   2173 C  CD2   . LEU A 1 289 ? 148.319 144.253 -3.527  1.00 18.93 ? 286 LEU A CD2   1 
ATOM   2174 N  N     . GLN A 1 290 ? 145.291 142.675 -7.804  1.00 22.40 ? 287 GLN A N     1 
ATOM   2175 C  CA    . GLN A 1 290 ? 144.277 142.874 -8.827  1.00 21.56 ? 287 GLN A CA    1 
ATOM   2176 C  C     . GLN A 1 290 ? 142.895 142.417 -8.336  1.00 27.59 ? 287 GLN A C     1 
ATOM   2177 O  O     . GLN A 1 290 ? 141.873 143.006 -8.699  1.00 26.65 ? 287 GLN A O     1 
ATOM   2178 C  CB    . GLN A 1 290 ? 144.652 142.132 -10.114 1.00 20.67 ? 287 GLN A CB    1 
ATOM   2179 C  CG    . GLN A 1 290 ? 145.827 142.746 -10.899 1.00 26.83 ? 287 GLN A CG    1 
ATOM   2180 C  CD    . GLN A 1 290 ? 146.192 141.916 -12.126 1.00 29.76 ? 287 GLN A CD    1 
ATOM   2181 O  OE1   . GLN A 1 290 ? 146.024 140.696 -12.131 1.00 24.80 ? 287 GLN A OE1   1 
ATOM   2182 N  NE2   . GLN A 1 290 ? 146.676 142.578 -13.178 1.00 25.46 ? 287 GLN A NE2   1 
ATOM   2183 N  N     . SER A 1 291 ? 142.861 141.369 -7.522  1.00 23.40 ? 288 SER A N     1 
ATOM   2184 C  CA    A SER A 1 291 ? 141.599 140.843 -6.999  0.54 27.47 ? 288 SER A CA    1 
ATOM   2185 C  CA    B SER A 1 291 ? 141.591 140.857 -7.020  0.46 27.46 ? 288 SER A CA    1 
ATOM   2186 C  C     . SER A 1 291 ? 140.956 141.835 -6.029  1.00 33.17 ? 288 SER A C     1 
ATOM   2187 O  O     . SER A 1 291 ? 139.734 141.948 -5.960  1.00 33.58 ? 288 SER A O     1 
ATOM   2188 C  CB    A SER A 1 291 ? 141.809 139.487 -6.305  0.54 24.89 ? 288 SER A CB    1 
ATOM   2189 C  CB    B SER A 1 291 ? 141.778 139.488 -6.365  0.46 24.87 ? 288 SER A CB    1 
ATOM   2190 O  OG    A SER A 1 291 ? 142.473 139.627 -5.054  0.54 23.85 ? 288 SER A OG    1 
ATOM   2191 O  OG    B SER A 1 291 ? 140.531 138.931 -5.999  0.46 22.13 ? 288 SER A OG    1 
ATOM   2192 N  N     . HIS A 1 292 ? 141.786 142.557 -5.281  1.00 28.57 ? 289 HIS A N     1 
ATOM   2193 C  CA    . HIS A 1 292 ? 141.275 143.523 -4.311  1.00 27.76 ? 289 HIS A CA    1 
ATOM   2194 C  C     . HIS A 1 292 ? 140.950 144.885 -4.912  1.00 33.25 ? 289 HIS A C     1 
ATOM   2195 O  O     . HIS A 1 292 ? 139.988 145.528 -4.500  1.00 40.46 ? 289 HIS A O     1 
ATOM   2196 C  CB    . HIS A 1 292 ? 142.280 143.709 -3.176  1.00 30.80 ? 289 HIS A CB    1 
ATOM   2197 C  CG    . HIS A 1 292 ? 142.372 142.533 -2.253  1.00 33.53 ? 289 HIS A CG    1 
ATOM   2198 N  ND1   . HIS A 1 292 ? 141.263 141.941 -1.687  1.00 30.18 ? 289 HIS A ND1   1 
ATOM   2199 C  CD2   . HIS A 1 292 ? 143.444 141.839 -1.797  1.00 35.46 ? 289 HIS A CD2   1 
ATOM   2200 C  CE1   . HIS A 1 292 ? 141.648 140.937 -0.918  1.00 33.57 ? 289 HIS A CE1   1 
ATOM   2201 N  NE2   . HIS A 1 292 ? 142.967 140.854 -0.965  1.00 26.15 ? 289 HIS A NE2   1 
ATOM   2202 N  N     . PHE A 1 293 ? 141.753 145.333 -5.874  1.00 24.57 ? 290 PHE A N     1 
ATOM   2203 C  CA    . PHE A 1 293 ? 141.676 146.730 -6.317  1.00 28.43 ? 290 PHE A CA    1 
ATOM   2204 C  C     . PHE A 1 293 ? 141.481 146.896 -7.830  1.00 29.55 ? 290 PHE A C     1 
ATOM   2205 O  O     . PHE A 1 293 ? 141.543 148.013 -8.335  1.00 31.05 ? 290 PHE A O     1 
ATOM   2206 C  CB    . PHE A 1 293 ? 142.936 147.496 -5.878  1.00 22.68 ? 290 PHE A CB    1 
ATOM   2207 C  CG    . PHE A 1 293 ? 143.314 147.267 -4.440  1.00 22.67 ? 290 PHE A CG    1 
ATOM   2208 C  CD1   . PHE A 1 293 ? 142.527 147.775 -3.414  1.00 19.85 ? 290 PHE A CD1   1 
ATOM   2209 C  CD2   . PHE A 1 293 ? 144.449 146.537 -4.114  1.00 20.52 ? 290 PHE A CD2   1 
ATOM   2210 C  CE1   . PHE A 1 293 ? 142.862 147.556 -2.084  1.00 19.28 ? 290 PHE A CE1   1 
ATOM   2211 C  CE2   . PHE A 1 293 ? 144.788 146.310 -2.785  1.00 19.74 ? 290 PHE A CE2   1 
ATOM   2212 C  CZ    . PHE A 1 293 ? 143.990 146.815 -1.773  1.00 22.39 ? 290 PHE A CZ    1 
ATOM   2213 N  N     . GLY A 1 294 ? 141.237 145.800 -8.547  1.00 29.06 ? 291 GLY A N     1 
ATOM   2214 C  CA    . GLY A 1 294 ? 141.007 145.886 -9.989  1.00 23.94 ? 291 GLY A CA    1 
ATOM   2215 C  C     . GLY A 1 294 ? 142.294 145.661 -10.754 1.00 29.48 ? 291 GLY A C     1 
ATOM   2216 O  O     . GLY A 1 294 ? 143.373 145.857 -10.195 1.00 26.03 ? 291 GLY A O     1 
ATOM   2217 N  N     . GLU A 1 295 ? 142.189 145.262 -12.026 1.00 26.77 ? 292 GLU A N     1 
ATOM   2218 C  CA    . GLU A 1 295 ? 143.359 144.845 -12.801 1.00 23.76 ? 292 GLU A CA    1 
ATOM   2219 C  C     . GLU A 1 295 ? 144.371 145.972 -12.986 1.00 21.36 ? 292 GLU A C     1 
ATOM   2220 O  O     . GLU A 1 295 ? 145.562 145.759 -12.807 1.00 21.37 ? 292 GLU A O     1 
ATOM   2221 C  CB    . GLU A 1 295 ? 142.931 144.306 -14.175 1.00 27.64 ? 292 GLU A CB    1 
ATOM   2222 C  CG    . GLU A 1 295 ? 142.196 142.982 -14.088 1.00 45.29 ? 292 GLU A CG    1 
ATOM   2223 C  CD    . GLU A 1 295 ? 141.816 142.413 -15.449 1.00 53.58 ? 292 GLU A CD    1 
ATOM   2224 O  OE1   . GLU A 1 295 ? 142.026 143.101 -16.481 1.00 46.16 ? 292 GLU A OE1   1 
ATOM   2225 O  OE2   . GLU A 1 295 ? 141.251 141.294 -15.472 1.00 39.00 ? 292 GLU A OE2   1 
ATOM   2226 N  N     . LYS A 1 296 ? 143.898 147.161 -13.365 1.00 21.77 ? 293 LYS A N     1 
ATOM   2227 C  CA    . LYS A 1 296 ? 144.781 148.316 -13.561 1.00 30.22 ? 293 LYS A CA    1 
ATOM   2228 C  C     . LYS A 1 296 ? 145.486 148.729 -12.261 1.00 27.28 ? 293 LYS A C     1 
ATOM   2229 O  O     . LYS A 1 296 ? 146.719 148.769 -12.205 1.00 27.24 ? 293 LYS A O     1 
ATOM   2230 C  CB    . LYS A 1 296 ? 143.996 149.508 -14.127 1.00 29.86 ? 293 LYS A CB    1 
ATOM   2231 N  N     . ASN A 1 297 ? 144.701 149.046 -11.234 1.00 25.18 ? 294 ASN A N     1 
ATOM   2232 C  CA    . ASN A 1 297 ? 145.250 149.428 -9.925  1.00 24.21 ? 294 ASN A CA    1 
ATOM   2233 C  C     . ASN A 1 297 ? 146.175 148.360 -9.341  1.00 21.30 ? 294 ASN A C     1 
ATOM   2234 O  O     . ASN A 1 297 ? 147.204 148.689 -8.751  1.00 24.02 ? 294 ASN A O     1 
ATOM   2235 C  CB    . ASN A 1 297 ? 144.132 149.721 -8.908  1.00 28.25 ? 294 ASN A CB    1 
ATOM   2236 C  CG    . ASN A 1 297 ? 143.377 151.012 -9.200  1.00 28.42 ? 294 ASN A CG    1 
ATOM   2237 O  OD1   . ASN A 1 297 ? 143.903 151.915 -9.845  1.00 29.74 ? 294 ASN A OD1   1 
ATOM   2238 N  ND2   . ASN A 1 297 ? 142.135 151.107 -8.703  1.00 22.01 ? 294 ASN A ND2   1 
ATOM   2239 N  N     . GLY A 1 298 ? 145.802 147.092 -9.488  1.00 23.61 ? 295 GLY A N     1 
ATOM   2240 C  CA    . GLY A 1 298 ? 146.599 145.987 -8.958  1.00 23.46 ? 295 GLY A CA    1 
ATOM   2241 C  C     . GLY A 1 298 ? 147.964 145.867 -9.624  1.00 24.00 ? 295 GLY A C     1 
ATOM   2242 O  O     . GLY A 1 298 ? 149.009 145.690 -8.962  1.00 22.32 ? 295 GLY A O     1 
ATOM   2243 N  N     . SER A 1 299 ? 147.961 145.962 -10.949 1.00 20.03 ? 296 SER A N     1 
ATOM   2244 C  CA    . SER A 1 299 ? 149.202 145.947 -11.692 1.00 22.05 ? 296 SER A CA    1 
ATOM   2245 C  C     . SER A 1 299 ? 150.037 147.181 -11.363 1.00 20.66 ? 296 SER A C     1 
ATOM   2246 O  O     . SER A 1 299 ? 151.265 147.102 -11.254 1.00 20.94 ? 296 SER A O     1 
ATOM   2247 C  CB    . SER A 1 299 ? 148.934 145.862 -13.199 1.00 24.64 ? 296 SER A CB    1 
ATOM   2248 O  OG    . SER A 1 299 ? 148.520 144.556 -13.551 1.00 26.14 ? 296 SER A OG    1 
ATOM   2249 N  N     . TRP A 1 300 ? 149.375 148.321 -11.197 1.00 19.47 ? 297 TRP A N     1 
ATOM   2250 C  CA    . TRP A 1 300 ? 150.092 149.553 -10.911 1.00 18.93 ? 297 TRP A CA    1 
ATOM   2251 C  C     . TRP A 1 300 ? 150.790 149.452 -9.545  1.00 18.98 ? 297 TRP A C     1 
ATOM   2252 O  O     . TRP A 1 300 ? 151.984 149.754 -9.418  1.00 16.93 ? 297 TRP A O     1 
ATOM   2253 C  CB    . TRP A 1 300 ? 149.138 150.746 -10.942 1.00 23.52 ? 297 TRP A CB    1 
ATOM   2254 C  CG    . TRP A 1 300 ? 149.823 152.035 -10.686 1.00 20.42 ? 297 TRP A CG    1 
ATOM   2255 C  CD1   . TRP A 1 300 ? 150.491 152.810 -11.601 1.00 25.79 ? 297 TRP A CD1   1 
ATOM   2256 C  CD2   . TRP A 1 300 ? 149.925 152.718 -9.431  1.00 19.85 ? 297 TRP A CD2   1 
ATOM   2257 N  NE1   . TRP A 1 300 ? 151.007 153.933 -10.983 1.00 20.12 ? 297 TRP A NE1   1 
ATOM   2258 C  CE2   . TRP A 1 300 ? 150.665 153.905 -9.657  1.00 22.38 ? 297 TRP A CE2   1 
ATOM   2259 C  CE3   . TRP A 1 300 ? 149.456 152.451 -8.141  1.00 27.69 ? 297 TRP A CE3   1 
ATOM   2260 C  CZ2   . TRP A 1 300 ? 150.949 154.811 -8.643  1.00 20.29 ? 297 TRP A CZ2   1 
ATOM   2261 C  CZ3   . TRP A 1 300 ? 149.728 153.363 -7.136  1.00 21.27 ? 297 TRP A CZ3   1 
ATOM   2262 C  CH2   . TRP A 1 300 ? 150.480 154.522 -7.393  1.00 14.66 ? 297 TRP A CH2   1 
ATOM   2263 N  N     . LEU A 1 301 ? 150.022 149.023 -8.543  1.00 16.02 ? 298 LEU A N     1 
ATOM   2264 C  CA    . LEU A 1 301 ? 150.499 148.847 -7.180  1.00 23.15 ? 298 LEU A CA    1 
ATOM   2265 C  C     . LEU A 1 301 ? 151.665 147.872 -7.123  1.00 21.14 ? 298 LEU A C     1 
ATOM   2266 O  O     . LEU A 1 301 ? 152.670 148.144 -6.467  1.00 20.72 ? 298 LEU A O     1 
ATOM   2267 C  CB    . LEU A 1 301 ? 149.357 148.363 -6.270  1.00 19.92 ? 298 LEU A CB    1 
ATOM   2268 C  CG    . LEU A 1 301 ? 148.291 149.394 -5.873  1.00 27.08 ? 298 LEU A CG    1 
ATOM   2269 C  CD1   . LEU A 1 301 ? 147.077 148.685 -5.270  1.00 16.12 ? 298 LEU A CD1   1 
ATOM   2270 C  CD2   . LEU A 1 301 ? 148.842 150.479 -4.922  1.00 19.62 ? 298 LEU A CD2   1 
ATOM   2271 N  N     . TYR A 1 302 ? 151.537 146.743 -7.819  1.00 18.81 ? 299 TYR A N     1 
ATOM   2272 C  CA    . TYR A 1 302 ? 152.572 145.703 -7.782  1.00 20.03 ? 299 TYR A CA    1 
ATOM   2273 C  C     . TYR A 1 302 ? 153.921 146.265 -8.206  1.00 19.33 ? 299 TYR A C     1 
ATOM   2274 O  O     . TYR A 1 302 ? 154.935 146.076 -7.530  1.00 19.56 ? 299 TYR A O     1 
ATOM   2275 C  CB    . TYR A 1 302 ? 152.207 144.518 -8.686  1.00 20.21 ? 299 TYR A CB    1 
ATOM   2276 C  CG    . TYR A 1 302 ? 153.217 143.392 -8.632  1.00 24.10 ? 299 TYR A CG    1 
ATOM   2277 C  CD1   . TYR A 1 302 ? 153.132 142.403 -7.649  1.00 21.24 ? 299 TYR A CD1   1 
ATOM   2278 C  CD2   . TYR A 1 302 ? 154.275 143.330 -9.541  1.00 27.97 ? 299 TYR A CD2   1 
ATOM   2279 C  CE1   . TYR A 1 302 ? 154.057 141.380 -7.582  1.00 25.08 ? 299 TYR A CE1   1 
ATOM   2280 C  CE2   . TYR A 1 302 ? 155.211 142.303 -9.484  1.00 29.57 ? 299 TYR A CE2   1 
ATOM   2281 C  CZ    . TYR A 1 302 ? 155.093 141.331 -8.504  1.00 31.49 ? 299 TYR A CZ    1 
ATOM   2282 O  OH    . TYR A 1 302 ? 156.010 140.310 -8.440  1.00 27.87 ? 299 TYR A OH    1 
ATOM   2283 N  N     . ALA A 1 303 ? 153.917 146.968 -9.329  1.00 21.11 ? 300 ALA A N     1 
ATOM   2284 C  CA    . ALA A 1 303 ? 155.118 147.616 -9.838  1.00 19.08 ? 300 ALA A CA    1 
ATOM   2285 C  C     . ALA A 1 303 ? 155.589 148.788 -8.958  1.00 19.02 ? 300 ALA A C     1 
ATOM   2286 O  O     . ALA A 1 303 ? 156.783 148.911 -8.647  1.00 21.61 ? 300 ALA A O     1 
ATOM   2287 C  CB    . ALA A 1 303 ? 154.868 148.101 -11.274 1.00 19.21 ? 300 ALA A CB    1 
ATOM   2288 N  N     . MET A 1 304 ? 154.646 149.632 -8.555  1.00 17.44 ? 301 MET A N     1 
ATOM   2289 C  CA    A MET A 1 304 ? 154.931 150.869 -7.832  0.05 20.32 ? 301 MET A CA    1 
ATOM   2290 C  CA    B MET A 1 304 ? 154.985 150.881 -7.860  0.95 20.45 ? 301 MET A CA    1 
ATOM   2291 C  C     . MET A 1 304 ? 155.679 150.646 -6.524  1.00 20.14 ? 301 MET A C     1 
ATOM   2292 O  O     . MET A 1 304 ? 156.577 151.426 -6.154  1.00 18.27 ? 301 MET A O     1 
ATOM   2293 C  CB    A MET A 1 304 ? 153.621 151.614 -7.557  0.05 18.95 ? 301 MET A CB    1 
ATOM   2294 C  CB    B MET A 1 304 ? 153.740 151.739 -7.624  0.95 18.67 ? 301 MET A CB    1 
ATOM   2295 C  CG    A MET A 1 304 ? 153.704 152.718 -6.519  0.05 20.08 ? 301 MET A CG    1 
ATOM   2296 C  CG    B MET A 1 304 ? 154.054 153.180 -7.192  0.95 19.79 ? 301 MET A CG    1 
ATOM   2297 S  SD    A MET A 1 304 ? 154.928 153.971 -6.917  0.05 20.10 ? 301 MET A SD    1 
ATOM   2298 S  SD    B MET A 1 304 ? 154.856 154.114 -8.522  0.95 21.72 ? 301 MET A SD    1 
ATOM   2299 C  CE    A MET A 1 304 ? 154.467 154.318 -8.605  0.05 21.47 ? 301 MET A CE    1 
ATOM   2300 C  CE    B MET A 1 304 ? 156.500 154.395 -7.877  0.95 20.06 ? 301 MET A CE    1 
ATOM   2301 N  N     . CYS A 1 305 ? 155.295 149.593 -5.803  1.00 16.30 ? 302 CYS A N     1 
ATOM   2302 C  CA    . CYS A 1 305 ? 155.908 149.346 -4.481  1.00 22.32 ? 302 CYS A CA    1 
ATOM   2303 C  C     . CYS A 1 305 ? 157.354 148.878 -4.625  1.00 19.30 ? 302 CYS A C     1 
ATOM   2304 O  O     . CYS A 1 305 ? 158.123 148.855 -3.650  1.00 18.40 ? 302 CYS A O     1 
ATOM   2305 C  CB    . CYS A 1 305 ? 155.092 148.333 -3.660  1.00 22.31 ? 302 CYS A CB    1 
ATOM   2306 S  SG    . CYS A 1 305 ? 155.073 146.651 -4.321  1.00 19.12 ? 302 CYS A SG    1 
ATOM   2307 N  N     . ARG A 1 306 ? 157.727 148.544 -5.858  1.00 21.16 ? 303 ARG A N     1 
ATOM   2308 C  CA    . ARG A 1 306 ? 159.100 148.194 -6.203  1.00 19.75 ? 303 ARG A CA    1 
ATOM   2309 C  C     . ARG A 1 306 ? 159.814 149.386 -6.878  1.00 19.96 ? 303 ARG A C     1 
ATOM   2310 O  O     . ARG A 1 306 ? 160.924 149.255 -7.397  1.00 19.24 ? 303 ARG A O     1 
ATOM   2311 C  CB    . ARG A 1 306 ? 159.101 146.950 -7.109  1.00 21.71 ? 303 ARG A CB    1 
ATOM   2312 C  CG    . ARG A 1 306 ? 158.545 145.697 -6.404  1.00 18.16 ? 303 ARG A CG    1 
ATOM   2313 C  CD    . ARG A 1 306 ? 158.358 144.485 -7.333  1.00 24.59 ? 303 ARG A CD    1 
ATOM   2314 N  NE    . ARG A 1 306 ? 158.115 143.285 -6.530  1.00 25.45 ? 303 ARG A NE    1 
ATOM   2315 C  CZ    . ARG A 1 306 ? 156.958 142.999 -5.942  1.00 22.00 ? 303 ARG A CZ    1 
ATOM   2316 N  NH1   . ARG A 1 306 ? 155.909 143.813 -6.090  1.00 19.40 ? 303 ARG A NH1   1 
ATOM   2317 N  NH2   . ARG A 1 306 ? 156.841 141.895 -5.210  1.00 23.52 ? 303 ARG A NH2   1 
ATOM   2318 N  N     . GLY A 1 307 ? 159.168 150.549 -6.861  1.00 20.57 ? 304 GLY A N     1 
ATOM   2319 C  CA    . GLY A 1 307 ? 159.748 151.761 -7.421  1.00 18.30 ? 304 GLY A CA    1 
ATOM   2320 C  C     . GLY A 1 307 ? 159.627 151.881 -8.940  1.00 17.15 ? 304 GLY A C     1 
ATOM   2321 O  O     . GLY A 1 307 ? 160.314 152.695 -9.561  1.00 22.67 ? 304 GLY A O     1 
ATOM   2322 N  N     . ILE A 1 308 ? 158.737 151.087 -9.522  1.00 18.19 ? 305 ILE A N     1 
ATOM   2323 C  CA    . ILE A 1 308 ? 158.564 150.979 -10.975 1.00 18.16 ? 305 ILE A CA    1 
ATOM   2324 C  C     . ILE A 1 308 ? 157.226 151.590 -11.408 1.00 22.17 ? 305 ILE A C     1 
ATOM   2325 O  O     . ILE A 1 308 ? 156.196 151.308 -10.807 1.00 18.84 ? 305 ILE A O     1 
ATOM   2326 C  CB    . ILE A 1 308 ? 158.635 149.498 -11.422 1.00 20.29 ? 305 ILE A CB    1 
ATOM   2327 C  CG1   . ILE A 1 308 ? 160.010 148.910 -11.104 1.00 22.72 ? 305 ILE A CG1   1 
ATOM   2328 C  CG2   . ILE A 1 308 ? 158.289 149.325 -12.908 1.00 22.18 ? 305 ILE A CG2   1 
ATOM   2329 C  CD1   . ILE A 1 308 ? 160.111 147.410 -11.359 1.00 30.31 ? 305 ILE A CD1   1 
ATOM   2330 N  N     . GLU A 1 309 ? 157.254 152.427 -12.448 1.00 21.82 ? 306 GLU A N     1 
ATOM   2331 C  CA    . GLU A 1 309 ? 156.062 153.125 -12.944 1.00 21.58 ? 306 GLU A CA    1 
ATOM   2332 C  C     . GLU A 1 309 ? 156.336 153.605 -14.362 1.00 25.78 ? 306 GLU A C     1 
ATOM   2333 O  O     . GLU A 1 309 ? 157.437 154.058 -14.658 1.00 23.19 ? 306 GLU A O     1 
ATOM   2334 C  CB    . GLU A 1 309 ? 155.709 154.306 -12.034 1.00 30.18 ? 306 GLU A CB    1 
ATOM   2335 C  CG    . GLU A 1 309 ? 154.242 154.656 -12.031 1.00 33.85 ? 306 GLU A CG    1 
ATOM   2336 C  CD    . GLU A 1 309 ? 153.968 156.088 -12.439 1.00 32.85 ? 306 GLU A CD    1 
ATOM   2337 O  OE1   . GLU A 1 309 ? 154.923 156.894 -12.560 1.00 27.79 ? 306 GLU A OE1   1 
ATOM   2338 O  OE2   . GLU A 1 309 ? 152.781 156.400 -12.636 1.00 38.39 ? 306 GLU A OE2   1 
ATOM   2339 N  N     . HIS A 1 310 ? 155.356 153.497 -15.248 1.00 23.50 ? 307 HIS A N     1 
ATOM   2340 C  CA    . HIS A 1 310 ? 155.622 153.774 -16.658 1.00 30.50 ? 307 HIS A CA    1 
ATOM   2341 C  C     . HIS A 1 310 ? 154.783 154.895 -17.241 1.00 25.10 ? 307 HIS A C     1 
ATOM   2342 O  O     . HIS A 1 310 ? 154.866 155.146 -18.435 1.00 23.12 ? 307 HIS A O     1 
ATOM   2343 C  CB    . HIS A 1 310 ? 155.422 152.504 -17.493 1.00 27.99 ? 307 HIS A CB    1 
ATOM   2344 C  CG    . HIS A 1 310 ? 156.372 151.405 -17.135 1.00 31.44 ? 307 HIS A CG    1 
ATOM   2345 N  ND1   . HIS A 1 310 ? 157.736 151.516 -17.310 1.00 33.79 ? 307 HIS A ND1   1 
ATOM   2346 C  CD2   . HIS A 1 310 ? 156.159 150.187 -16.584 1.00 33.76 ? 307 HIS A CD2   1 
ATOM   2347 C  CE1   . HIS A 1 310 ? 158.320 150.405 -16.894 1.00 36.69 ? 307 HIS A CE1   1 
ATOM   2348 N  NE2   . HIS A 1 310 ? 157.385 149.583 -16.452 1.00 35.37 ? 307 HIS A NE2   1 
ATOM   2349 N  N     . ASP A 1 311 ? 153.993 155.572 -16.411 1.00 19.24 ? 308 ASP A N     1 
ATOM   2350 C  CA    . ASP A 1 311 ? 153.212 156.703 -16.892 1.00 17.94 ? 308 ASP A CA    1 
ATOM   2351 C  C     . ASP A 1 311 ? 154.143 157.696 -17.599 1.00 24.22 ? 308 ASP A C     1 
ATOM   2352 O  O     . ASP A 1 311 ? 155.127 158.161 -17.019 1.00 24.24 ? 308 ASP A O     1 
ATOM   2353 C  CB    . ASP A 1 311 ? 152.453 157.380 -15.744 1.00 26.84 ? 308 ASP A CB    1 
ATOM   2354 C  CG    . ASP A 1 311 ? 151.537 158.504 -16.231 1.00 32.99 ? 308 ASP A CG    1 
ATOM   2355 O  OD1   . ASP A 1 311 ? 150.903 158.334 -17.292 1.00 34.91 ? 308 ASP A OD1   1 
ATOM   2356 O  OD2   . ASP A 1 311 ? 151.468 159.565 -15.570 1.00 39.80 ? 308 ASP A OD2   1 
ATOM   2357 N  N     . PRO A 1 312 ? 153.863 157.987 -18.880 1.00 24.00 ? 309 PRO A N     1 
ATOM   2358 C  CA    . PRO A 1 312 ? 154.754 158.871 -19.629 1.00 20.80 ? 309 PRO A CA    1 
ATOM   2359 C  C     . PRO A 1 312 ? 154.574 160.341 -19.259 1.00 18.74 ? 309 PRO A C     1 
ATOM   2360 O  O     . PRO A 1 312 ? 153.478 160.759 -18.870 1.00 21.43 ? 309 PRO A O     1 
ATOM   2361 C  CB    . PRO A 1 312 ? 154.338 158.628 -21.086 1.00 21.98 ? 309 PRO A CB    1 
ATOM   2362 C  CG    . PRO A 1 312 ? 152.872 158.308 -20.984 1.00 27.91 ? 309 PRO A CG    1 
ATOM   2363 C  CD    . PRO A 1 312 ? 152.749 157.489 -19.713 1.00 29.48 ? 309 PRO A CD    1 
ATOM   2364 N  N     . VAL A 1 313 ? 155.660 161.098 -19.364 1.00 20.02 ? 310 VAL A N     1 
ATOM   2365 C  CA    . VAL A 1 313 ? 155.608 162.558 -19.355 1.00 23.66 ? 310 VAL A CA    1 
ATOM   2366 C  C     . VAL A 1 313 ? 154.939 162.983 -20.658 1.00 23.15 ? 310 VAL A C     1 
ATOM   2367 O  O     . VAL A 1 313 ? 155.514 162.822 -21.749 1.00 20.56 ? 310 VAL A O     1 
ATOM   2368 C  CB    . VAL A 1 313 ? 157.014 163.195 -19.247 1.00 22.40 ? 310 VAL A CB    1 
ATOM   2369 C  CG1   . VAL A 1 313 ? 156.939 164.701 -19.447 1.00 23.38 ? 310 VAL A CG1   1 
ATOM   2370 C  CG2   . VAL A 1 313 ? 157.674 162.859 -17.888 1.00 17.81 ? 310 VAL A CG2   1 
ATOM   2371 N  N     . LYS A 1 314 ? 153.716 163.491 -20.550 1.00 21.29 ? 311 LYS A N     1 
ATOM   2372 C  CA    . LYS A 1 314 ? 152.941 163.861 -21.735 1.00 24.09 ? 311 LYS A CA    1 
ATOM   2373 C  C     . LYS A 1 314 ? 153.378 165.217 -22.239 1.00 24.80 ? 311 LYS A C     1 
ATOM   2374 O  O     . LYS A 1 314 ? 153.613 166.124 -21.443 1.00 25.99 ? 311 LYS A O     1 
ATOM   2375 C  CB    . LYS A 1 314 ? 151.439 163.869 -21.426 1.00 26.07 ? 311 LYS A CB    1 
ATOM   2376 C  CG    . LYS A 1 314 ? 150.886 162.486 -21.085 1.00 26.42 ? 311 LYS A CG    1 
ATOM   2377 C  CD    . LYS A 1 314 ? 149.450 162.552 -20.603 1.00 38.10 ? 311 LYS A CD    1 
ATOM   2378 C  CE    . LYS A 1 314 ? 149.003 161.188 -20.099 1.00 46.76 ? 311 LYS A CE    1 
ATOM   2379 N  NZ    . LYS A 1 314 ? 147.518 161.058 -20.108 1.00 54.69 ? 311 LYS A NZ    1 
ATOM   2380 N  N     . PRO A 1 315 ? 153.508 165.359 -23.569 1.00 26.96 ? 312 PRO A N     1 
ATOM   2381 C  CA    . PRO A 1 315 ? 153.920 166.631 -24.164 1.00 20.84 ? 312 PRO A CA    1 
ATOM   2382 C  C     . PRO A 1 315 ? 152.783 167.643 -24.188 1.00 31.69 ? 312 PRO A C     1 
ATOM   2383 O  O     . PRO A 1 315 ? 152.122 167.797 -25.218 1.00 30.41 ? 312 PRO A O     1 
ATOM   2384 C  CB    . PRO A 1 315 ? 154.322 166.236 -25.589 1.00 27.60 ? 312 PRO A CB    1 
ATOM   2385 C  CG    . PRO A 1 315 ? 153.436 165.050 -25.892 1.00 29.56 ? 312 PRO A CG    1 
ATOM   2386 C  CD    . PRO A 1 315 ? 153.376 164.291 -24.581 1.00 26.14 ? 312 PRO A CD    1 
ATOM   2387 N  N     . ARG A 1 316 ? 152.565 168.333 -23.077 1.00 29.67 ? 313 ARG A N     1 
ATOM   2388 C  CA    . ARG A 1 316 ? 151.417 169.223 -22.959 1.00 23.74 ? 313 ARG A CA    1 
ATOM   2389 C  C     . ARG A 1 316 ? 151.767 170.389 -22.046 1.00 31.52 ? 313 ARG A C     1 
ATOM   2390 O  O     . ARG A 1 316 ? 151.932 170.216 -20.839 1.00 27.34 ? 313 ARG A O     1 
ATOM   2391 C  CB    . ARG A 1 316 ? 150.207 168.463 -22.424 1.00 32.38 ? 313 ARG A CB    1 
ATOM   2392 C  CG    . ARG A 1 316 ? 148.904 169.246 -22.402 1.00 42.47 ? 313 ARG A CG    1 
ATOM   2393 C  CD    . ARG A 1 316 ? 147.860 168.570 -21.501 1.00 38.37 ? 313 ARG A CD    1 
ATOM   2394 N  NE    . ARG A 1 316 ? 148.228 168.629 -20.084 1.00 44.08 ? 313 ARG A NE    1 
ATOM   2395 C  CZ    . ARG A 1 316 ? 148.310 167.573 -19.272 1.00 50.42 ? 313 ARG A CZ    1 
ATOM   2396 N  NH1   . ARG A 1 316 ? 148.035 166.351 -19.721 1.00 43.73 ? 313 ARG A NH1   1 
ATOM   2397 N  NH2   . ARG A 1 316 ? 148.653 167.744 -17.998 1.00 39.23 ? 313 ARG A NH2   1 
ATOM   2398 N  N     . GLN A 1 317 ? 151.887 171.573 -22.636 1.00 26.17 ? 314 GLN A N     1 
ATOM   2399 C  CA    . GLN A 1 317 ? 152.325 172.764 -21.916 1.00 28.55 ? 314 GLN A CA    1 
ATOM   2400 C  C     . GLN A 1 317 ? 151.159 173.693 -21.577 1.00 30.70 ? 314 GLN A C     1 
ATOM   2401 O  O     . GLN A 1 317 ? 151.273 174.570 -20.723 1.00 38.40 ? 314 GLN A O     1 
ATOM   2402 C  CB    . GLN A 1 317 ? 153.364 173.517 -22.743 1.00 34.50 ? 314 GLN A CB    1 
ATOM   2403 C  CG    . GLN A 1 317 ? 154.053 174.623 -21.977 1.00 42.89 ? 314 GLN A CG    1 
ATOM   2404 C  CD    . GLN A 1 317 ? 155.148 175.285 -22.771 1.00 41.06 ? 314 GLN A CD    1 
ATOM   2405 O  OE1   . GLN A 1 317 ? 155.627 174.738 -23.769 1.00 49.06 ? 314 GLN A OE1   1 
ATOM   2406 N  NE2   . GLN A 1 317 ? 155.546 176.481 -22.343 1.00 38.11 ? 314 GLN A NE2   1 
ATOM   2407 N  N     . LEU A 1 318 ? 150.036 173.499 -22.252 1.00 30.24 ? 315 LEU A N     1 
ATOM   2408 C  CA    . LEU A 1 318 ? 148.852 174.313 -22.019 1.00 30.91 ? 315 LEU A CA    1 
ATOM   2409 C  C     . LEU A 1 318 ? 147.745 173.472 -21.413 1.00 27.23 ? 315 LEU A C     1 
ATOM   2410 O  O     . LEU A 1 318 ? 147.634 172.284 -21.716 1.00 32.80 ? 315 LEU A O     1 
ATOM   2411 C  CB    . LEU A 1 318 ? 148.345 174.942 -23.334 1.00 36.47 ? 315 LEU A CB    1 
ATOM   2412 C  CG    . LEU A 1 318 ? 149.313 175.576 -24.327 1.00 32.16 ? 315 LEU A CG    1 
ATOM   2413 C  CD1   . LEU A 1 318 ? 148.568 175.930 -25.625 1.00 32.82 ? 315 LEU A CD1   1 
ATOM   2414 C  CD2   . LEU A 1 318 ? 150.013 176.798 -23.744 1.00 35.13 ? 315 LEU A CD2   1 
ATOM   2415 N  N     . PRO A 1 319 ? 146.895 174.094 -20.581 1.00 31.09 ? 316 PRO A N     1 
ATOM   2416 C  CA    . PRO A 1 319 ? 145.708 173.393 -20.067 1.00 25.28 ? 316 PRO A CA    1 
ATOM   2417 C  C     . PRO A 1 319 ? 144.804 172.922 -21.194 1.00 32.09 ? 316 PRO A C     1 
ATOM   2418 O  O     . PRO A 1 319 ? 144.796 173.551 -22.257 1.00 34.65 ? 316 PRO A O     1 
ATOM   2419 C  CB    . PRO A 1 319 ? 145.000 174.461 -19.215 1.00 33.47 ? 316 PRO A CB    1 
ATOM   2420 C  CG    . PRO A 1 319 ? 146.074 175.484 -18.897 1.00 33.66 ? 316 PRO A CG    1 
ATOM   2421 C  CD    . PRO A 1 319 ? 146.980 175.487 -20.098 1.00 24.16 ? 316 PRO A CD    1 
ATOM   2422 N  N     . LYS A 1 320 ? 144.057 171.843 -20.966 1.00 28.86 ? 317 LYS A N     1 
ATOM   2423 C  CA    . LYS A 1 320 ? 143.097 171.325 -21.944 1.00 32.50 ? 317 LYS A CA    1 
ATOM   2424 C  C     . LYS A 1 320 ? 141.705 171.923 -21.776 1.00 31.16 ? 317 LYS A C     1 
ATOM   2425 O  O     . LYS A 1 320 ? 140.829 171.722 -22.623 1.00 28.38 ? 317 LYS A O     1 
ATOM   2426 C  CB    . LYS A 1 320 ? 142.987 169.797 -21.835 1.00 37.46 ? 317 LYS A CB    1 
ATOM   2427 C  CG    . LYS A 1 320 ? 144.125 169.020 -22.470 1.00 38.77 ? 317 LYS A CG    1 
ATOM   2428 C  CD    . LYS A 1 320 ? 144.311 167.652 -21.789 1.00 44.33 ? 317 LYS A CD    1 
ATOM   2429 C  CE    . LYS A 1 320 ? 143.415 166.580 -22.396 1.00 42.78 ? 317 LYS A CE    1 
ATOM   2430 N  N     . THR A 1 321 ? 141.494 172.622 -20.664 1.00 29.01 ? 318 THR A N     1 
ATOM   2431 C  CA    . THR A 1 321 ? 140.208 173.245 -20.364 1.00 24.87 ? 318 THR A CA    1 
ATOM   2432 C  C     . THR A 1 321 ? 140.438 174.639 -19.792 1.00 25.63 ? 318 THR A C     1 
ATOM   2433 O  O     . THR A 1 321 ? 141.524 174.940 -19.292 1.00 27.72 ? 318 THR A O     1 
ATOM   2434 C  CB    . THR A 1 321 ? 139.375 172.422 -19.363 1.00 29.14 ? 318 THR A CB    1 
ATOM   2435 O  OG1   . THR A 1 321 ? 140.145 172.187 -18.178 1.00 29.07 ? 318 THR A OG1   1 
ATOM   2436 C  CG2   . THR A 1 321 ? 138.959 171.096 -19.957 1.00 24.05 ? 318 THR A CG2   1 
ATOM   2437 N  N     . ILE A 1 322 ? 139.421 175.488 -19.887 1.00 19.03 ? 319 ILE A N     1 
ATOM   2438 C  CA    . ILE A 1 322 ? 139.477 176.853 -19.369 1.00 25.75 ? 319 ILE A CA    1 
ATOM   2439 C  C     . ILE A 1 322 ? 138.155 177.112 -18.649 1.00 27.96 ? 319 ILE A C     1 
ATOM   2440 O  O     . ILE A 1 322 ? 137.095 177.166 -19.275 1.00 26.73 ? 319 ILE A O     1 
ATOM   2441 C  CB    . ILE A 1 322 ? 139.715 177.892 -20.492 1.00 34.05 ? 319 ILE A CB    1 
ATOM   2442 C  CG1   . ILE A 1 322 ? 141.123 177.718 -21.081 1.00 31.21 ? 319 ILE A CG1   1 
ATOM   2443 C  CG2   . ILE A 1 322 ? 139.489 179.341 -19.991 1.00 22.66 ? 319 ILE A CG2   1 
ATOM   2444 C  CD1   . ILE A 1 322 ? 141.480 178.744 -22.147 1.00 28.47 ? 319 ILE A CD1   1 
ATOM   2445 N  N     . GLY A 1 323 ? 138.224 177.219 -17.325 1.00 24.53 ? 320 GLY A N     1 
ATOM   2446 C  CA    . GLY A 1 323 ? 137.027 177.315 -16.513 1.00 30.30 ? 320 GLY A CA    1 
ATOM   2447 C  C     . GLY A 1 323 ? 137.008 178.488 -15.551 1.00 25.20 ? 320 GLY A C     1 
ATOM   2448 O  O     . GLY A 1 323 ? 138.052 179.034 -15.196 1.00 26.24 ? 320 GLY A O     1 
ATOM   2449 N  N     . CYS A 1 324 ? 135.796 178.856 -15.145 1.00 23.19 ? 321 CYS A N     1 
ATOM   2450 C  CA    . CYS A 1 324 ? 135.530 179.943 -14.210 1.00 25.34 ? 321 CYS A CA    1 
ATOM   2451 C  C     . CYS A 1 324 ? 134.503 179.420 -13.236 0.61 25.94 ? 321 CYS A C     1 
ATOM   2452 O  O     . CYS A 1 324 ? 133.490 178.868 -13.643 1.00 23.79 ? 321 CYS A O     1 
ATOM   2453 C  CB    . CYS A 1 324 ? 134.990 181.203 -14.916 1.00 26.61 ? 321 CYS A CB    1 
ATOM   2454 S  SG    . CYS A 1 324 ? 136.099 181.946 -16.098 0.48 17.89 ? 321 CYS A SG    1 
ATOM   2455 N  N     . SER A 1 325 ? 134.759 179.607 -11.951 1.00 27.57 ? 322 SER A N     1 
ATOM   2456 C  CA    . SER A 1 325 ? 133.982 178.962 -10.918 1.00 29.78 ? 322 SER A CA    1 
ATOM   2457 C  C     . SER A 1 325 ? 133.793 179.915 -9.740  1.00 28.48 ? 322 SER A C     1 
ATOM   2458 O  O     . SER A 1 325 ? 134.681 180.698 -9.434  1.00 27.71 ? 322 SER A O     1 
ATOM   2459 C  CB    . SER A 1 325 ? 134.694 177.680 -10.469 1.00 31.66 ? 322 SER A CB    1 
ATOM   2460 O  OG    . SER A 1 325 ? 133.984 177.014 -9.450  1.00 36.12 ? 322 SER A OG    1 
ATOM   2461 N  N     . LYS A 1 326 ? 132.643 179.847 -9.083  1.00 29.93 ? 323 LYS A N     1 
ATOM   2462 C  CA    . LYS A 1 326 ? 132.459 180.593 -7.844  1.00 32.94 ? 323 LYS A CA    1 
ATOM   2463 C  C     . LYS A 1 326 ? 131.556 179.844 -6.886  1.00 32.25 ? 323 LYS A C     1 
ATOM   2464 O  O     . LYS A 1 326 ? 130.483 179.367 -7.279  1.00 28.31 ? 323 LYS A O     1 
ATOM   2465 C  CB    . LYS A 1 326 ? 131.874 181.990 -8.098  1.00 28.10 ? 323 LYS A CB    1 
ATOM   2466 C  CG    . LYS A 1 326 ? 131.802 182.818 -6.811  1.00 25.58 ? 323 LYS A CG    1 
ATOM   2467 C  CD    . LYS A 1 326 ? 131.318 184.237 -7.046  1.00 26.62 ? 323 LYS A CD    1 
ATOM   2468 C  CE    . LYS A 1 326 ? 131.085 184.969 -5.719  1.00 23.34 ? 323 LYS A CE    1 
ATOM   2469 N  NZ    . LYS A 1 326 ? 132.338 185.077 -4.940  1.00 27.42 ? 323 LYS A NZ    1 
ATOM   2470 N  N     . ASN A 1 327 ? 131.993 179.746 -5.631  1.00 27.61 ? 324 ASN A N     1 
ATOM   2471 C  CA    . ASN A 1 327 ? 131.166 179.144 -4.597  1.00 30.98 ? 324 ASN A CA    1 
ATOM   2472 C  C     . ASN A 1 327 ? 130.266 180.162 -3.900  1.00 31.37 ? 324 ASN A C     1 
ATOM   2473 O  O     . ASN A 1 327 ? 130.614 181.334 -3.750  1.00 28.37 ? 324 ASN A O     1 
ATOM   2474 C  CB    . ASN A 1 327 ? 132.034 178.416 -3.580  1.00 33.54 ? 324 ASN A CB    1 
ATOM   2475 C  CG    . ASN A 1 327 ? 132.820 177.268 -4.206  1.00 44.07 ? 324 ASN A CG    1 
ATOM   2476 O  OD1   . ASN A 1 327 ? 133.827 176.817 -3.664  1.00 43.98 ? 324 ASN A OD1   1 
ATOM   2477 N  ND2   . ASN A 1 327 ? 132.364 176.800 -5.357  1.00 34.96 ? 324 ASN A ND2   1 
ATOM   2478 N  N     . PHE A 1 328 ? 129.083 179.703 -3.509  1.00 31.72 ? 325 PHE A N     1 
ATOM   2479 C  CA    . PHE A 1 328 ? 128.097 180.547 -2.841  1.00 32.89 ? 325 PHE A CA    1 
ATOM   2480 C  C     . PHE A 1 328 ? 127.623 179.852 -1.574  1.00 36.77 ? 325 PHE A C     1 
ATOM   2481 O  O     . PHE A 1 328 ? 126.494 179.383 -1.504  1.00 34.33 ? 325 PHE A O     1 
ATOM   2482 C  CB    . PHE A 1 328 ? 126.920 180.850 -3.769  1.00 29.83 ? 325 PHE A CB    1 
ATOM   2483 C  CG    . PHE A 1 328 ? 127.324 181.533 -5.039  1.00 33.10 ? 325 PHE A CG    1 
ATOM   2484 C  CD1   . PHE A 1 328 ? 127.508 182.906 -5.074  1.00 30.43 ? 325 PHE A CD1   1 
ATOM   2485 C  CD2   . PHE A 1 328 ? 127.536 180.808 -6.195  1.00 26.73 ? 325 PHE A CD2   1 
ATOM   2486 C  CE1   . PHE A 1 328 ? 127.894 183.547 -6.238  1.00 31.31 ? 325 PHE A CE1   1 
ATOM   2487 C  CE2   . PHE A 1 328 ? 127.925 181.448 -7.360  1.00 23.27 ? 325 PHE A CE2   1 
ATOM   2488 C  CZ    . PHE A 1 328 ? 128.103 182.814 -7.381  1.00 28.95 ? 325 PHE A CZ    1 
ATOM   2489 N  N     . PRO A 1 329 ? 128.503 179.783 -0.569  1.00 30.60 ? 326 PRO A N     1 
ATOM   2490 C  CA    . PRO A 1 329 ? 128.272 178.981 0.630   1.00 46.63 ? 326 PRO A CA    1 
ATOM   2491 C  C     . PRO A 1 329 ? 127.341 179.631 1.643   1.00 44.59 ? 326 PRO A C     1 
ATOM   2492 O  O     . PRO A 1 329 ? 127.276 180.859 1.741   1.00 42.24 ? 326 PRO A O     1 
ATOM   2493 C  CB    . PRO A 1 329 ? 129.669 178.846 1.213   1.00 49.43 ? 326 PRO A CB    1 
ATOM   2494 C  CG    . PRO A 1 329 ? 130.338 180.132 0.838   1.00 40.93 ? 326 PRO A CG    1 
ATOM   2495 C  CD    . PRO A 1 329 ? 129.792 180.499 -0.511  1.00 41.55 ? 326 PRO A CD    1 
ATOM   2496 N  N     . GLY A 1 330 ? 126.637 178.791 2.396   1.00 57.50 ? 327 GLY A N     1 
ATOM   2497 C  CA    . GLY A 1 330 ? 125.802 179.243 3.494   1.00 56.43 ? 327 GLY A CA    1 
ATOM   2498 C  C     . GLY A 1 330 ? 124.657 180.126 3.051   1.00 48.61 ? 327 GLY A C     1 
ATOM   2499 O  O     . GLY A 1 330 ? 123.947 179.803 2.093   1.00 40.82 ? 327 GLY A O     1 
ATOM   2500 N  N     . LYS A 1 331 ? 124.499 181.249 3.750   1.00 42.92 ? 328 LYS A N     1 
ATOM   2501 C  CA    . LYS A 1 331 ? 123.431 182.207 3.490   1.00 43.59 ? 328 LYS A CA    1 
ATOM   2502 C  C     . LYS A 1 331 ? 123.578 182.932 2.146   1.00 32.83 ? 328 LYS A C     1 
ATOM   2503 O  O     . LYS A 1 331 ? 122.627 183.546 1.671   1.00 43.87 ? 328 LYS A O     1 
ATOM   2504 C  CB    . LYS A 1 331 ? 123.368 183.234 4.631   1.00 51.14 ? 328 LYS A CB    1 
ATOM   2505 N  N     . THR A 1 332 ? 124.760 182.854 1.536   1.00 43.69 ? 329 THR A N     1 
ATOM   2506 C  CA    . THR A 1 332 ? 125.018 183.545 0.273   1.00 43.99 ? 329 THR A CA    1 
ATOM   2507 C  C     . THR A 1 332 ? 124.504 182.773 -0.938  1.00 43.88 ? 329 THR A C     1 
ATOM   2508 O  O     . THR A 1 332 ? 124.551 183.280 -2.052  1.00 44.77 ? 329 THR A O     1 
ATOM   2509 C  CB    . THR A 1 332 ? 126.526 183.816 0.057   1.00 39.00 ? 329 THR A CB    1 
ATOM   2510 O  OG1   . THR A 1 332 ? 127.208 182.582 -0.210  1.00 43.31 ? 329 THR A OG1   1 
ATOM   2511 C  CG2   . THR A 1 332 ? 127.144 184.501 1.276   1.00 44.18 ? 329 THR A CG2   1 
ATOM   2512 N  N     . ALA A 1 333 ? 124.015 181.555 -0.710  1.00 43.92 ? 330 ALA A N     1 
ATOM   2513 C  CA    . ALA A 1 333 ? 123.571 180.668 -1.787  1.00 41.78 ? 330 ALA A CA    1 
ATOM   2514 C  C     . ALA A 1 333 ? 122.492 181.323 -2.631  1.00 33.14 ? 330 ALA A C     1 
ATOM   2515 O  O     . ALA A 1 333 ? 121.586 181.952 -2.099  1.00 44.63 ? 330 ALA A O     1 
ATOM   2516 C  CB    . ALA A 1 333 ? 123.072 179.344 -1.213  1.00 39.25 ? 330 ALA A CB    1 
ATOM   2517 N  N     . LEU A 1 334 ? 122.605 181.191 -3.951  1.00 38.12 ? 331 LEU A N     1 
ATOM   2518 C  CA    . LEU A 1 334 ? 121.702 181.875 -4.881  1.00 41.24 ? 331 LEU A CA    1 
ATOM   2519 C  C     . LEU A 1 334 ? 120.271 181.353 -4.769  1.00 41.05 ? 331 LEU A C     1 
ATOM   2520 O  O     . LEU A 1 334 ? 120.026 180.155 -4.930  1.00 44.58 ? 331 LEU A O     1 
ATOM   2521 C  CB    . LEU A 1 334 ? 122.206 181.731 -6.321  1.00 33.43 ? 331 LEU A CB    1 
ATOM   2522 C  CG    . LEU A 1 334 ? 123.638 182.224 -6.543  1.00 35.21 ? 331 LEU A CG    1 
ATOM   2523 C  CD1   . LEU A 1 334 ? 123.994 182.218 -8.037  1.00 30.97 ? 331 LEU A CD1   1 
ATOM   2524 C  CD2   . LEU A 1 334 ? 123.832 183.613 -5.930  1.00 32.23 ? 331 LEU A CD2   1 
ATOM   2525 N  N     . ALA A 1 335 ? 119.333 182.264 -4.513  1.00 40.57 ? 332 ALA A N     1 
ATOM   2526 C  CA    . ALA A 1 335 ? 117.973 181.893 -4.120  1.00 41.92 ? 332 ALA A CA    1 
ATOM   2527 C  C     . ALA A 1 335 ? 116.911 182.362 -5.114  1.00 44.48 ? 332 ALA A C     1 
ATOM   2528 O  O     . ALA A 1 335 ? 115.761 181.919 -5.061  1.00 45.16 ? 332 ALA A O     1 
ATOM   2529 C  CB    . ALA A 1 335 ? 117.672 182.448 -2.731  1.00 48.86 ? 332 ALA A CB    1 
ATOM   2530 N  N     . THR A 1 336 ? 117.301 183.254 -6.020  1.00 44.66 ? 333 THR A N     1 
ATOM   2531 C  CA    . THR A 1 336 ? 116.395 183.769 -7.043  1.00 42.37 ? 333 THR A CA    1 
ATOM   2532 C  C     . THR A 1 336 ? 116.947 183.543 -8.449  1.00 43.12 ? 333 THR A C     1 
ATOM   2533 O  O     . THR A 1 336 ? 118.161 183.427 -8.641  1.00 38.03 ? 333 THR A O     1 
ATOM   2534 C  CB    . THR A 1 336 ? 116.130 185.274 -6.861  1.00 34.39 ? 333 THR A CB    1 
ATOM   2535 O  OG1   . THR A 1 336 ? 117.320 186.015 -7.159  1.00 35.40 ? 333 THR A OG1   1 
ATOM   2536 C  CG2   . THR A 1 336 ? 115.711 185.569 -5.440  1.00 39.93 ? 333 THR A CG2   1 
ATOM   2537 N  N     . ARG A 1 337 ? 116.043 183.485 -9.423  1.00 46.09 ? 334 ARG A N     1 
ATOM   2538 C  CA    . ARG A 1 337 ? 116.410 183.385 -10.832 1.00 36.58 ? 334 ARG A CA    1 
ATOM   2539 C  C     . ARG A 1 337 ? 117.311 184.540 -11.259 1.00 41.99 ? 334 ARG A C     1 
ATOM   2540 O  O     . ARG A 1 337 ? 118.292 184.337 -11.982 1.00 38.46 ? 334 ARG A O     1 
ATOM   2541 C  CB    . ARG A 1 337 ? 115.155 183.353 -11.710 1.00 36.29 ? 334 ARG A CB    1 
ATOM   2542 N  N     . GLU A 1 338 ? 116.991 185.748 -10.806 1.00 34.04 ? 335 GLU A N     1 
ATOM   2543 C  CA    . GLU A 1 338 ? 117.799 186.921 -11.160 1.00 43.39 ? 335 GLU A CA    1 
ATOM   2544 C  C     . GLU A 1 338 ? 119.261 186.797 -10.730 1.00 37.17 ? 335 GLU A C     1 
ATOM   2545 O  O     . GLU A 1 338 ? 120.162 187.200 -11.464 1.00 37.99 ? 335 GLU A O     1 
ATOM   2546 C  CB    . GLU A 1 338 ? 117.208 188.191 -10.549 1.00 43.24 ? 335 GLU A CB    1 
ATOM   2547 C  CG    . GLU A 1 338 ? 116.062 188.795 -11.339 1.00 54.27 ? 335 GLU A CG    1 
ATOM   2548 C  CD    . GLU A 1 338 ? 116.516 189.445 -12.630 1.00 63.22 ? 335 GLU A CD    1 
ATOM   2549 O  OE1   . GLU A 1 338 ? 117.738 189.462 -12.898 1.00 63.09 ? 335 GLU A OE1   1 
ATOM   2550 O  OE2   . GLU A 1 338 ? 115.646 189.947 -13.375 1.00 69.48 ? 335 GLU A OE2   1 
ATOM   2551 N  N     . GLN A 1 339 ? 119.489 186.260 -9.535  1.00 37.88 ? 336 GLN A N     1 
ATOM   2552 C  CA    . GLN A 1 339 ? 120.846 186.053 -9.042  1.00 35.07 ? 336 GLN A CA    1 
ATOM   2553 C  C     . GLN A 1 339 ? 121.599 185.048 -9.904  1.00 30.96 ? 336 GLN A C     1 
ATOM   2554 O  O     . GLN A 1 339 ? 122.750 185.279 -10.273 1.00 37.80 ? 336 GLN A O     1 
ATOM   2555 C  CB    . GLN A 1 339 ? 120.845 185.554 -7.594  1.00 39.95 ? 336 GLN A CB    1 
ATOM   2556 C  CG    . GLN A 1 339 ? 120.704 186.601 -6.508  1.00 42.20 ? 336 GLN A CG    1 
ATOM   2557 C  CD    . GLN A 1 339 ? 120.777 185.970 -5.124  1.00 40.01 ? 336 GLN A CD    1 
ATOM   2558 O  OE1   . GLN A 1 339 ? 120.094 184.980 -4.846  1.00 36.79 ? 336 GLN A OE1   1 
ATOM   2559 N  NE2   . GLN A 1 339 ? 121.626 186.524 -4.259  1.00 31.83 ? 336 GLN A NE2   1 
ATOM   2560 N  N     . VAL A 1 340 ? 120.958 183.917 -10.185 1.00 32.70 ? 337 VAL A N     1 
ATOM   2561 C  CA    . VAL A 1 340 ? 121.588 182.869 -10.977 1.00 38.94 ? 337 VAL A CA    1 
ATOM   2562 C  C     . VAL A 1 340 ? 122.032 183.416 -12.332 1.00 29.05 ? 337 VAL A C     1 
ATOM   2563 O  O     . VAL A 1 340 ? 123.167 183.212 -12.752 1.00 29.76 ? 337 VAL A O     1 
ATOM   2564 C  CB    . VAL A 1 340 ? 120.649 181.675 -11.183 1.00 38.13 ? 337 VAL A CB    1 
ATOM   2565 C  CG1   . VAL A 1 340 ? 121.276 180.652 -12.145 1.00 26.99 ? 337 VAL A CG1   1 
ATOM   2566 C  CG2   . VAL A 1 340 ? 120.326 181.036 -9.853  1.00 35.53 ? 337 VAL A CG2   1 
ATOM   2567 N  N     . GLN A 1 341 ? 121.144 184.143 -12.989 1.00 28.09 ? 338 GLN A N     1 
ATOM   2568 C  CA    . GLN A 1 341 ? 121.460 184.739 -14.273 1.00 36.16 ? 338 GLN A CA    1 
ATOM   2569 C  C     . GLN A 1 341 ? 122.579 185.773 -14.177 1.00 32.72 ? 338 GLN A C     1 
ATOM   2570 O  O     . GLN A 1 341 ? 123.448 185.820 -15.047 1.00 30.71 ? 338 GLN A O     1 
ATOM   2571 C  CB    . GLN A 1 341 ? 120.203 185.362 -14.884 1.00 36.75 ? 338 GLN A CB    1 
ATOM   2572 C  CG    . GLN A 1 341 ? 119.166 184.295 -15.239 1.00 39.24 ? 338 GLN A CG    1 
ATOM   2573 C  CD    . GLN A 1 341 ? 117.857 184.866 -15.744 1.00 45.89 ? 338 GLN A CD    1 
ATOM   2574 O  OE1   . GLN A 1 341 ? 117.598 186.062 -15.619 1.00 56.82 ? 338 GLN A OE1   1 
ATOM   2575 N  NE2   . GLN A 1 341 ? 117.022 184.007 -16.321 1.00 48.06 ? 338 GLN A NE2   1 
ATOM   2576 N  N     . TRP A 1 342 ? 122.573 186.588 -13.124 1.00 32.37 ? 339 TRP A N     1 
ATOM   2577 C  CA    A TRP A 1 342 ? 123.600 187.614 -12.939 0.18 30.73 ? 339 TRP A CA    1 
ATOM   2578 C  CA    B TRP A 1 342 ? 123.594 187.619 -12.992 0.82 30.80 ? 339 TRP A CA    1 
ATOM   2579 C  C     . TRP A 1 342 ? 124.978 186.994 -12.732 1.00 25.40 ? 339 TRP A C     1 
ATOM   2580 O  O     . TRP A 1 342 ? 125.979 187.441 -13.300 1.00 23.80 ? 339 TRP A O     1 
ATOM   2581 C  CB    A TRP A 1 342 ? 123.253 188.519 -11.751 0.18 30.05 ? 339 TRP A CB    1 
ATOM   2582 C  CB    B TRP A 1 342 ? 123.225 188.618 -11.887 0.82 29.94 ? 339 TRP A CB    1 
ATOM   2583 C  CG    A TRP A 1 342 ? 124.427 189.305 -11.221 0.18 29.43 ? 339 TRP A CG    1 
ATOM   2584 C  CG    B TRP A 1 342 ? 124.121 189.833 -11.874 0.82 31.78 ? 339 TRP A CG    1 
ATOM   2585 C  CD1   A TRP A 1 342 ? 125.227 188.972 -10.164 0.18 28.46 ? 339 TRP A CD1   1 
ATOM   2586 C  CD1   B TRP A 1 342 ? 124.004 190.961 -12.651 0.82 26.16 ? 339 TRP A CD1   1 
ATOM   2587 C  CD2   A TRP A 1 342 ? 124.930 190.550 -11.727 0.18 28.64 ? 339 TRP A CD2   1 
ATOM   2588 C  CD2   B TRP A 1 342 ? 125.281 190.030 -11.055 0.82 29.16 ? 339 TRP A CD2   1 
ATOM   2589 N  NE1   A TRP A 1 342 ? 126.193 189.933 -9.980  0.18 27.70 ? 339 TRP A NE1   1 
ATOM   2590 N  NE1   B TRP A 1 342 ? 125.016 191.845 -12.350 0.82 28.59 ? 339 TRP A NE1   1 
ATOM   2591 C  CE2   A TRP A 1 342 ? 126.034 190.911 -10.926 0.18 27.84 ? 339 TRP A CE2   1 
ATOM   2592 C  CE2   B TRP A 1 342 ? 125.813 191.297 -11.379 0.82 26.55 ? 339 TRP A CE2   1 
ATOM   2593 C  CE3   A TRP A 1 342 ? 124.555 191.394 -12.778 0.18 28.01 ? 339 TRP A CE3   1 
ATOM   2594 C  CE3   B TRP A 1 342 ? 125.917 189.259 -10.073 0.82 28.58 ? 339 TRP A CE3   1 
ATOM   2595 C  CZ2   A TRP A 1 342 ? 126.765 192.078 -11.144 0.18 27.00 ? 339 TRP A CZ2   1 
ATOM   2596 C  CZ2   B TRP A 1 342 ? 126.958 191.804 -10.762 0.82 25.67 ? 339 TRP A CZ2   1 
ATOM   2597 C  CZ3   A TRP A 1 342 ? 125.283 192.554 -12.991 0.18 27.89 ? 339 TRP A CZ3   1 
ATOM   2598 C  CZ3   B TRP A 1 342 ? 127.045 189.768 -9.460  0.82 22.51 ? 339 TRP A CZ3   1 
ATOM   2599 C  CH2   A TRP A 1 342 ? 126.374 192.883 -12.178 0.18 26.69 ? 339 TRP A CH2   1 
ATOM   2600 C  CH2   B TRP A 1 342 ? 127.554 191.026 -9.807  0.82 26.62 ? 339 TRP A CH2   1 
ATOM   2601 N  N     . TRP A 1 343 ? 125.045 185.955 -11.909 1.00 27.96 ? 340 TRP A N     1 
ATOM   2602 C  CA    . TRP A 1 343 ? 126.348 185.338 -11.662 1.00 28.68 ? 340 TRP A CA    1 
ATOM   2603 C  C     . TRP A 1 343 ? 126.820 184.518 -12.870 1.00 27.39 ? 340 TRP A C     1 
ATOM   2604 O  O     . TRP A 1 343 ? 128.012 184.539 -13.188 1.00 26.92 ? 340 TRP A O     1 
ATOM   2605 C  CB    . TRP A 1 343 ? 126.326 184.502 -10.379 1.00 26.60 ? 340 TRP A CB    1 
ATOM   2606 C  CG    . TRP A 1 343 ? 126.381 185.410 -9.150  1.00 35.10 ? 340 TRP A CG    1 
ATOM   2607 C  CD1   . TRP A 1 343 ? 125.344 185.730 -8.323  1.00 34.44 ? 340 TRP A CD1   1 
ATOM   2608 C  CD2   . TRP A 1 343 ? 127.520 186.147 -8.667  1.00 23.29 ? 340 TRP A CD2   1 
ATOM   2609 N  NE1   . TRP A 1 343 ? 125.768 186.605 -7.349  1.00 32.03 ? 340 TRP A NE1   1 
ATOM   2610 C  CE2   . TRP A 1 343 ? 127.098 186.878 -7.540  1.00 29.35 ? 340 TRP A CE2   1 
ATOM   2611 C  CE3   . TRP A 1 343 ? 128.854 186.251 -9.076  1.00 23.27 ? 340 TRP A CE3   1 
ATOM   2612 C  CZ2   . TRP A 1 343 ? 127.964 187.696 -6.806  1.00 28.93 ? 340 TRP A CZ2   1 
ATOM   2613 C  CZ3   . TRP A 1 343 ? 129.714 187.062 -8.351  1.00 28.52 ? 340 TRP A CZ3   1 
ATOM   2614 C  CH2   . TRP A 1 343 ? 129.263 187.779 -7.229  1.00 31.34 ? 340 TRP A CH2   1 
ATOM   2615 N  N     . LEU A 1 344 ? 125.905 183.840 -13.569 1.00 24.99 ? 341 LEU A N     1 
ATOM   2616 C  CA    . LEU A 1 344 ? 126.273 183.197 -14.844 1.00 27.71 ? 341 LEU A CA    1 
ATOM   2617 C  C     . LEU A 1 344 ? 126.908 184.227 -15.785 1.00 25.00 ? 341 LEU A C     1 
ATOM   2618 O  O     . LEU A 1 344 ? 127.939 183.960 -16.423 1.00 24.46 ? 341 LEU A O     1 
ATOM   2619 C  CB    . LEU A 1 344 ? 125.056 182.537 -15.524 1.00 29.72 ? 341 LEU A CB    1 
ATOM   2620 C  CG    . LEU A 1 344 ? 124.529 181.238 -14.906 1.00 29.43 ? 341 LEU A CG    1 
ATOM   2621 C  CD1   . LEU A 1 344 ? 123.186 180.813 -15.546 1.00 26.11 ? 341 LEU A CD1   1 
ATOM   2622 C  CD2   . LEU A 1 344 ? 125.567 180.121 -14.998 1.00 25.65 ? 341 LEU A CD2   1 
ATOM   2623 N  N     . LEU A 1 345 ? 126.313 185.416 -15.856 1.00 25.85 ? 342 LEU A N     1 
ATOM   2624 C  CA    . LEU A 1 345 ? 126.874 186.455 -16.711 1.00 22.90 ? 342 LEU A CA    1 
ATOM   2625 C  C     . LEU A 1 345 ? 128.288 186.878 -16.268 1.00 30.70 ? 342 LEU A C     1 
ATOM   2626 O  O     . LEU A 1 345 ? 129.190 187.024 -17.106 1.00 25.78 ? 342 LEU A O     1 
ATOM   2627 C  CB    . LEU A 1 345 ? 125.956 187.671 -16.757 1.00 30.78 ? 342 LEU A CB    1 
ATOM   2628 C  CG    . LEU A 1 345 ? 126.494 188.794 -17.651 1.00 29.04 ? 342 LEU A CG    1 
ATOM   2629 C  CD1   . LEU A 1 345 ? 126.732 188.273 -19.045 1.00 25.82 ? 342 LEU A CD1   1 
ATOM   2630 C  CD2   . LEU A 1 345 ? 125.555 189.990 -17.684 1.00 36.63 ? 342 LEU A CD2   1 
ATOM   2631 N  N     . GLN A 1 346 ? 128.489 187.059 -14.962 1.00 23.83 ? 343 GLN A N     1 
ATOM   2632 C  CA    . GLN A 1 346 ? 129.796 187.465 -14.453 1.00 24.43 ? 343 GLN A CA    1 
ATOM   2633 C  C     . GLN A 1 346 ? 130.862 186.432 -14.839 1.00 25.41 ? 343 GLN A C     1 
ATOM   2634 O  O     . GLN A 1 346 ? 131.941 186.800 -15.306 1.00 18.62 ? 343 GLN A O     1 
ATOM   2635 C  CB    . GLN A 1 346 ? 129.769 187.657 -12.922 1.00 24.57 ? 343 GLN A CB    1 
ATOM   2636 C  CG    . GLN A 1 346 ? 128.751 188.716 -12.421 1.00 23.68 ? 343 GLN A CG    1 
ATOM   2637 C  CD    . GLN A 1 346 ? 128.727 189.957 -13.284 1.00 24.13 ? 343 GLN A CD    1 
ATOM   2638 O  OE1   . GLN A 1 346 ? 129.714 190.698 -13.369 1.00 25.85 ? 343 GLN A OE1   1 
ATOM   2639 N  NE2   . GLN A 1 346 ? 127.603 190.184 -13.950 1.00 23.61 ? 343 GLN A NE2   1 
ATOM   2640 N  N     . LEU A 1 347 ? 130.537 185.150 -14.653 1.00 21.56 ? 344 LEU A N     1 
ATOM   2641 C  CA    . LEU A 1 347 ? 131.435 184.041 -14.991 1.00 27.92 ? 344 LEU A CA    1 
ATOM   2642 C  C     . LEU A 1 347 ? 131.715 183.933 -16.488 1.00 27.05 ? 344 LEU A C     1 
ATOM   2643 O  O     . LEU A 1 347 ? 132.850 183.624 -16.899 1.00 24.09 ? 344 LEU A O     1 
ATOM   2644 C  CB    . LEU A 1 347 ? 130.856 182.702 -14.498 1.00 22.90 ? 344 LEU A CB    1 
ATOM   2645 C  CG    . LEU A 1 347 ? 130.818 182.505 -12.982 1.00 27.17 ? 344 LEU A CG    1 
ATOM   2646 C  CD1   . LEU A 1 347 ? 130.163 181.169 -12.599 1.00 25.52 ? 344 LEU A CD1   1 
ATOM   2647 C  CD2   . LEU A 1 347 ? 132.194 182.601 -12.419 1.00 31.61 ? 344 LEU A CD2   1 
ATOM   2648 N  N     . ALA A 1 348 ? 130.676 184.153 -17.292 1.00 23.21 ? 345 ALA A N     1 
ATOM   2649 C  CA    . ALA A 1 348 ? 130.794 184.053 -18.740 1.00 23.42 ? 345 ALA A CA    1 
ATOM   2650 C  C     . ALA A 1 348 ? 131.665 185.178 -19.273 1.00 26.49 ? 345 ALA A C     1 
ATOM   2651 O  O     . ALA A 1 348 ? 132.417 184.985 -20.223 1.00 22.36 ? 345 ALA A O     1 
ATOM   2652 C  CB    . ALA A 1 348 ? 129.407 184.075 -19.409 1.00 20.79 ? 345 ALA A CB    1 
ATOM   2653 N  N     . GLN A 1 349 ? 131.568 186.352 -18.649 1.00 27.83 ? 346 GLN A N     1 
ATOM   2654 C  CA    . GLN A 1 349 ? 132.395 187.497 -19.031 1.00 19.01 ? 346 GLN A CA    1 
ATOM   2655 C  C     . GLN A 1 349 ? 133.886 187.292 -18.728 1.00 24.77 ? 346 GLN A C     1 
ATOM   2656 O  O     . GLN A 1 349 ? 134.760 187.717 -19.495 1.00 16.07 ? 346 GLN A O     1 
ATOM   2657 C  CB    . GLN A 1 349 ? 131.880 188.766 -18.331 1.00 25.10 ? 346 GLN A CB    1 
ATOM   2658 C  CG    . GLN A 1 349 ? 130.546 189.264 -18.911 1.00 26.97 ? 346 GLN A CG    1 
ATOM   2659 C  CD    . GLN A 1 349 ? 130.038 190.528 -18.250 1.00 29.81 ? 346 GLN A CD    1 
ATOM   2660 O  OE1   . GLN A 1 349 ? 130.456 190.882 -17.151 1.00 33.31 ? 346 GLN A OE1   1 
ATOM   2661 N  NE2   . GLN A 1 349 ? 129.115 191.208 -18.917 1.00 29.50 ? 346 GLN A NE2   1 
ATOM   2662 N  N     . GLU A 1 350 ? 134.197 186.661 -17.604 1.00 20.40 ? 347 GLU A N     1 
ATOM   2663 C  CA    . GLU A 1 350 ? 135.602 186.381 -17.347 1.00 21.28 ? 347 GLU A CA    1 
ATOM   2664 C  C     . GLU A 1 350 ? 136.051 185.323 -18.348 1.00 23.93 ? 347 GLU A C     1 
ATOM   2665 O  O     . GLU A 1 350 ? 137.141 185.408 -18.907 1.00 22.00 ? 347 GLU A O     1 
ATOM   2666 C  CB    . GLU A 1 350 ? 135.856 185.898 -15.919 1.00 19.03 ? 347 GLU A CB    1 
ATOM   2667 C  CG    . GLU A 1 350 ? 137.337 185.716 -15.654 1.00 24.82 ? 347 GLU A CG    1 
ATOM   2668 C  CD    . GLU A 1 350 ? 137.659 184.965 -14.369 1.00 36.68 ? 347 GLU A CD    1 
ATOM   2669 O  OE1   . GLU A 1 350 ? 136.852 184.995 -13.415 1.00 30.71 ? 347 GLU A OE1   1 
ATOM   2670 O  OE2   . GLU A 1 350 ? 138.735 184.343 -14.323 1.00 29.04 ? 347 GLU A OE2   1 
ATOM   2671 N  N     . LEU A 1 351 ? 135.178 184.345 -18.571 1.00 17.54 ? 348 LEU A N     1 
ATOM   2672 C  CA    . LEU A 1 351 ? 135.465 183.212 -19.443 1.00 25.57 ? 348 LEU A CA    1 
ATOM   2673 C  C     . LEU A 1 351 ? 135.715 183.675 -20.878 1.00 25.34 ? 348 LEU A C     1 
ATOM   2674 O  O     . LEU A 1 351 ? 136.655 183.221 -21.533 1.00 21.65 ? 348 LEU A O     1 
ATOM   2675 C  CB    . LEU A 1 351 ? 134.319 182.192 -19.401 1.00 21.38 ? 348 LEU A CB    1 
ATOM   2676 C  CG    . LEU A 1 351 ? 134.559 180.906 -20.213 1.00 27.99 ? 348 LEU A CG    1 
ATOM   2677 C  CD1   . LEU A 1 351 ? 135.818 180.178 -19.732 1.00 26.64 ? 348 LEU A CD1   1 
ATOM   2678 C  CD2   . LEU A 1 351 ? 133.342 179.974 -20.191 1.00 24.76 ? 348 LEU A CD2   1 
ATOM   2679 N  N     . GLU A 1 352 ? 134.872 184.584 -21.354 1.00 26.01 ? 349 GLU A N     1 
ATOM   2680 C  CA    . GLU A 1 352 ? 135.040 185.148 -22.688 1.00 28.39 ? 349 GLU A CA    1 
ATOM   2681 C  C     . GLU A 1 352 ? 136.385 185.861 -22.813 1.00 24.58 ? 349 GLU A C     1 
ATOM   2682 O  O     . GLU A 1 352 ? 137.084 185.743 -23.831 1.00 23.33 ? 349 GLU A O     1 
ATOM   2683 C  CB    . GLU A 1 352 ? 133.901 186.120 -23.013 1.00 22.65 ? 349 GLU A CB    1 
ATOM   2684 C  CG    . GLU A 1 352 ? 134.107 186.833 -24.343 1.00 34.70 ? 349 GLU A CG    1 
ATOM   2685 C  CD    . GLU A 1 352 ? 133.401 188.167 -24.411 1.00 41.78 ? 349 GLU A CD    1 
ATOM   2686 O  OE1   . GLU A 1 352 ? 132.195 188.239 -24.061 1.00 40.96 ? 349 GLU A OE1   1 
ATOM   2687 O  OE2   . GLU A 1 352 ? 134.062 189.144 -24.820 1.00 49.01 ? 349 GLU A OE2   1 
ATOM   2688 N  N     . GLU A 1 353 ? 136.746 186.597 -21.765 1.00 23.87 ? 350 GLU A N     1 
ATOM   2689 C  CA    . GLU A 1 353 ? 138.020 187.321 -21.726 1.00 26.34 ? 350 GLU A CA    1 
ATOM   2690 C  C     . GLU A 1 353 ? 139.201 186.366 -21.859 1.00 25.42 ? 350 GLU A C     1 
ATOM   2691 O  O     . GLU A 1 353 ? 140.166 186.632 -22.581 1.00 27.80 ? 350 GLU A O     1 
ATOM   2692 C  CB    . GLU A 1 353 ? 138.136 188.109 -20.418 1.00 35.57 ? 350 GLU A CB    1 
ATOM   2693 C  CG    . GLU A 1 353 ? 138.791 189.469 -20.530 1.00 44.86 ? 350 GLU A CG    1 
ATOM   2694 C  CD    . GLU A 1 353 ? 138.583 190.320 -19.277 1.00 53.65 ? 350 GLU A CD    1 
ATOM   2695 O  OE1   . GLU A 1 353 ? 139.577 190.586 -18.568 1.00 61.17 ? 350 GLU A OE1   1 
ATOM   2696 O  OE2   . GLU A 1 353 ? 137.427 190.721 -19.002 1.00 46.73 ? 350 GLU A OE2   1 
ATOM   2697 N  N     . ARG A 1 354 ? 139.128 185.251 -21.148 1.00 21.58 ? 351 ARG A N     1 
ATOM   2698 C  CA    . ARG A 1 354 ? 140.227 184.297 -21.135 1.00 30.14 ? 351 ARG A CA    1 
ATOM   2699 C  C     . ARG A 1 354 ? 140.264 183.469 -22.421 1.00 22.04 ? 351 ARG A C     1 
ATOM   2700 O  O     . ARG A 1 354 ? 141.340 183.140 -22.907 1.00 24.00 ? 351 ARG A O     1 
ATOM   2701 C  CB    . ARG A 1 354 ? 140.130 183.407 -19.889 1.00 25.34 ? 351 ARG A CB    1 
ATOM   2702 C  CG    . ARG A 1 354 ? 140.525 184.188 -18.623 1.00 24.76 ? 351 ARG A CG    1 
ATOM   2703 C  CD    . ARG A 1 354 ? 140.152 183.460 -17.362 1.00 25.44 ? 351 ARG A CD    1 
ATOM   2704 N  NE    . ARG A 1 354 ? 140.669 182.099 -17.344 1.00 23.03 ? 351 ARG A NE    1 
ATOM   2705 C  CZ    . ARG A 1 354 ? 140.343 181.199 -16.417 1.00 35.04 ? 351 ARG A CZ    1 
ATOM   2706 N  NH1   . ARG A 1 354 ? 140.846 179.971 -16.475 1.00 24.80 ? 351 ARG A NH1   1 
ATOM   2707 N  NH2   . ARG A 1 354 ? 139.514 181.536 -15.427 1.00 32.21 ? 351 ARG A NH2   1 
ATOM   2708 N  N     . LEU A 1 355 ? 139.095 183.177 -22.987 1.00 20.86 ? 352 LEU A N     1 
ATOM   2709 C  CA    . LEU A 1 355 ? 139.024 182.435 -24.254 1.00 21.35 ? 352 LEU A CA    1 
ATOM   2710 C  C     . LEU A 1 355 ? 139.587 183.215 -25.449 1.00 25.90 ? 352 LEU A C     1 
ATOM   2711 O  O     . LEU A 1 355 ? 140.290 182.652 -26.285 1.00 26.31 ? 352 LEU A O     1 
ATOM   2712 C  CB    . LEU A 1 355 ? 137.578 182.021 -24.544 1.00 22.72 ? 352 LEU A CB    1 
ATOM   2713 C  CG    . LEU A 1 355 ? 137.091 180.846 -23.704 1.00 19.15 ? 352 LEU A CG    1 
ATOM   2714 C  CD1   . LEU A 1 355 ? 135.603 180.650 -23.853 1.00 19.60 ? 352 LEU A CD1   1 
ATOM   2715 C  CD2   . LEU A 1 355 ? 137.849 179.607 -24.123 1.00 23.56 ? 352 LEU A CD2   1 
ATOM   2716 N  N     . THR A 1 356 ? 139.257 184.500 -25.537 1.00 26.02 ? 353 THR A N     1 
ATOM   2717 C  CA    . THR A 1 356 ? 139.761 185.354 -26.610 1.00 20.08 ? 353 THR A CA    1 
ATOM   2718 C  C     . THR A 1 356 ? 141.282 185.443 -26.557 1.00 22.45 ? 353 THR A C     1 
ATOM   2719 O  O     . THR A 1 356 ? 141.960 185.359 -27.573 1.00 24.46 ? 353 THR A O     1 
ATOM   2720 C  CB    . THR A 1 356 ? 139.141 186.770 -26.518 1.00 21.17 ? 353 THR A CB    1 
ATOM   2721 O  OG1   . THR A 1 356 ? 137.714 186.654 -26.497 1.00 21.30 ? 353 THR A OG1   1 
ATOM   2722 C  CG2   . THR A 1 356 ? 139.553 187.635 -27.702 1.00 28.29 ? 353 THR A CG2   1 
ATOM   2723 N  N     . LYS A 1 357 ? 141.820 185.621 -25.356 1.00 26.09 ? 354 LYS A N     1 
ATOM   2724 C  CA    . LYS A 1 357 ? 143.261 185.622 -25.173 1.00 29.40 ? 354 LYS A CA    1 
ATOM   2725 C  C     . LYS A 1 357 ? 143.865 184.283 -25.608 1.00 26.25 ? 354 LYS A C     1 
ATOM   2726 O  O     . LYS A 1 357 ? 144.853 184.254 -26.348 1.00 25.93 ? 354 LYS A O     1 
ATOM   2727 C  CB    . LYS A 1 357 ? 143.607 185.918 -23.721 1.00 35.88 ? 354 LYS A CB    1 
ATOM   2728 C  CG    . LYS A 1 357 ? 145.077 185.778 -23.401 1.00 39.39 ? 354 LYS A CG    1 
ATOM   2729 C  CD    . LYS A 1 357 ? 145.807 187.095 -23.544 1.00 42.92 ? 354 LYS A CD    1 
ATOM   2730 C  CE    . LYS A 1 357 ? 147.264 186.952 -23.112 1.00 48.78 ? 354 LYS A CE    1 
ATOM   2731 N  NZ    . LYS A 1 357 ? 147.377 186.145 -21.862 1.00 39.37 ? 354 LYS A NZ    1 
ATOM   2732 N  N     . ASP A 1 358 ? 143.245 183.185 -25.170 1.00 24.14 ? 355 ASP A N     1 
ATOM   2733 C  CA    . ASP A 1 358 ? 143.736 181.839 -25.470 1.00 25.82 ? 355 ASP A CA    1 
ATOM   2734 C  C     . ASP A 1 358 ? 143.793 181.595 -26.974 1.00 28.09 ? 355 ASP A C     1 
ATOM   2735 O  O     . ASP A 1 358 ? 144.797 181.094 -27.483 1.00 29.47 ? 355 ASP A O     1 
ATOM   2736 C  CB    . ASP A 1 358 ? 142.857 180.773 -24.807 1.00 23.42 ? 355 ASP A CB    1 
ATOM   2737 C  CG    . ASP A 1 358 ? 143.302 179.346 -25.144 1.00 26.57 ? 355 ASP A CG    1 
ATOM   2738 O  OD1   . ASP A 1 358 ? 144.333 178.888 -24.608 1.00 31.90 ? 355 ASP A OD1   1 
ATOM   2739 O  OD2   . ASP A 1 358 ? 142.613 178.675 -25.939 1.00 24.89 ? 355 ASP A OD2   1 
ATOM   2740 N  N     . ARG A 1 359 ? 142.722 181.959 -27.677 1.00 24.15 ? 356 ARG A N     1 
ATOM   2741 C  CA    . ARG A 1 359 ? 142.664 181.810 -29.135 1.00 23.13 ? 356 ARG A CA    1 
ATOM   2742 C  C     . ARG A 1 359 ? 143.749 182.615 -29.863 1.00 22.01 ? 356 ARG A C     1 
ATOM   2743 O  O     . ARG A 1 359 ? 144.354 182.134 -30.822 1.00 28.63 ? 356 ARG A O     1 
ATOM   2744 C  CB    . ARG A 1 359 ? 141.288 182.216 -29.668 1.00 27.86 ? 356 ARG A CB    1 
ATOM   2745 C  CG    . ARG A 1 359 ? 141.116 181.884 -31.159 1.00 31.73 ? 356 ARG A CG    1 
ATOM   2746 C  CD    . ARG A 1 359 ? 140.487 183.025 -31.933 1.00 39.54 ? 356 ARG A CD    1 
ATOM   2747 N  NE    . ARG A 1 359 ? 139.050 183.096 -31.717 1.00 41.52 ? 356 ARG A NE    1 
ATOM   2748 C  CZ    . ARG A 1 359 ? 138.418 184.160 -31.229 1.00 41.87 ? 356 ARG A CZ    1 
ATOM   2749 N  NH1   . ARG A 1 359 ? 139.099 185.254 -30.906 1.00 42.03 ? 356 ARG A NH1   1 
ATOM   2750 N  NH2   . ARG A 1 359 ? 137.101 184.127 -31.067 1.00 43.91 ? 356 ARG A NH2   1 
ATOM   2751 N  N     . ASN A 1 360 ? 144.007 183.832 -29.403 1.00 27.09 ? 357 ASN A N     1 
ATOM   2752 C  CA    . ASN A 1 360 ? 145.032 184.657 -30.026 1.00 26.57 ? 357 ASN A CA    1 
ATOM   2753 C  C     . ASN A 1 360 ? 146.438 184.129 -29.789 1.00 28.26 ? 357 ASN A C     1 
ATOM   2754 O  O     . ASN A 1 360 ? 147.298 184.180 -30.692 1.00 24.69 ? 357 ASN A O     1 
ATOM   2755 C  CB    . ASN A 1 360 ? 144.919 186.097 -29.533 1.00 26.03 ? 357 ASN A CB    1 
ATOM   2756 C  CG    . ASN A 1 360 ? 143.754 186.823 -30.159 1.00 27.47 ? 357 ASN A CG    1 
ATOM   2757 O  OD1   . ASN A 1 360 ? 143.525 186.710 -31.355 1.00 33.06 ? 357 ASN A OD1   1 
ATOM   2758 N  ND2   . ASN A 1 360 ? 143.009 187.562 -29.358 1.00 28.04 ? 357 ASN A ND2   1 
ATOM   2759 N  N     . ASP A 1 361 ? 146.659 183.607 -28.584 1.00 26.28 ? 358 ASP A N     1 
ATOM   2760 C  CA    . ASP A 1 361 ? 147.977 183.134 -28.165 1.00 28.07 ? 358 ASP A CA    1 
ATOM   2761 C  C     . ASP A 1 361 ? 148.306 181.774 -28.742 1.00 21.25 ? 358 ASP A C     1 
ATOM   2762 O  O     . ASP A 1 361 ? 149.421 181.543 -29.186 1.00 28.78 ? 358 ASP A O     1 
ATOM   2763 C  CB    . ASP A 1 361 ? 148.079 183.029 -26.637 1.00 29.49 ? 358 ASP A CB    1 
ATOM   2764 C  CG    . ASP A 1 361 ? 148.040 184.374 -25.938 1.00 40.56 ? 358 ASP A CG    1 
ATOM   2765 O  OD1   . ASP A 1 361 ? 148.287 185.424 -26.579 1.00 32.66 ? 358 ASP A OD1   1 
ATOM   2766 O  OD2   . ASP A 1 361 ? 147.758 184.366 -24.722 1.00 40.64 ? 358 ASP A OD2   1 
ATOM   2767 N  N     . ASN A 1 362 ? 147.338 180.866 -28.710 1.00 25.77 ? 359 ASN A N     1 
ATOM   2768 C  CA    . ASN A 1 362 ? 147.638 179.445 -28.859 1.00 29.13 ? 359 ASN A CA    1 
ATOM   2769 C  C     . ASN A 1 362 ? 146.958 178.832 -30.062 1.00 27.29 ? 359 ASN A C     1 
ATOM   2770 O  O     . ASN A 1 362 ? 147.013 177.619 -30.261 1.00 27.93 ? 359 ASN A O     1 
ATOM   2771 C  CB    . ASN A 1 362 ? 147.251 178.685 -27.572 1.00 23.04 ? 359 ASN A CB    1 
ATOM   2772 C  CG    . ASN A 1 362 ? 147.956 179.248 -26.336 1.00 27.10 ? 359 ASN A CG    1 
ATOM   2773 O  OD1   . ASN A 1 362 ? 149.142 179.552 -26.380 1.00 27.32 ? 359 ASN A OD1   1 
ATOM   2774 N  ND2   . ASN A 1 362 ? 147.218 179.415 -25.247 1.00 27.16 ? 359 ASN A ND2   1 
ATOM   2775 N  N     . ASP A 1 363 ? 146.304 179.671 -30.857 1.00 28.69 ? 360 ASP A N     1 
ATOM   2776 C  CA    . ASP A 1 363 ? 145.758 179.234 -32.136 1.00 27.46 ? 360 ASP A CA    1 
ATOM   2777 C  C     . ASP A 1 363 ? 144.836 178.045 -31.989 1.00 32.89 ? 360 ASP A C     1 
ATOM   2778 O  O     . ASP A 1 363 ? 145.051 177.015 -32.624 1.00 29.17 ? 360 ASP A O     1 
ATOM   2779 C  CB    . ASP A 1 363 ? 146.896 178.887 -33.108 1.00 30.97 ? 360 ASP A CB    1 
ATOM   2780 C  CG    . ASP A 1 363 ? 147.734 180.090 -33.461 1.00 33.60 ? 360 ASP A CG    1 
ATOM   2781 O  OD1   . ASP A 1 363 ? 147.156 181.089 -33.949 1.00 29.94 ? 360 ASP A OD1   1 
ATOM   2782 O  OD2   . ASP A 1 363 ? 148.961 180.047 -33.230 1.00 31.80 ? 360 ASP A OD2   1 
ATOM   2783 N  N     . ARG A 1 364 ? 143.830 178.176 -31.126 1.00 32.53 ? 361 ARG A N     1 
ATOM   2784 C  CA    . ARG A 1 364 ? 142.840 177.117 -30.935 1.00 26.59 ? 361 ARG A CA    1 
ATOM   2785 C  C     . ARG A 1 364 ? 141.526 177.730 -30.484 1.00 30.37 ? 361 ARG A C     1 
ATOM   2786 O  O     . ARG A 1 364 ? 141.490 178.882 -30.062 1.00 26.82 ? 361 ARG A O     1 
ATOM   2787 C  CB    . ARG A 1 364 ? 143.321 176.079 -29.921 1.00 29.97 ? 361 ARG A CB    1 
ATOM   2788 C  CG    . ARG A 1 364 ? 143.607 176.647 -28.550 1.00 30.25 ? 361 ARG A CG    1 
ATOM   2789 C  CD    . ARG A 1 364 ? 143.985 175.573 -27.527 1.00 31.47 ? 361 ARG A CD    1 
ATOM   2790 N  NE    . ARG A 1 364 ? 144.219 176.158 -26.200 1.00 24.92 ? 361 ARG A NE    1 
ATOM   2791 C  CZ    . ARG A 1 364 ? 144.458 175.451 -25.096 1.00 30.35 ? 361 ARG A CZ    1 
ATOM   2792 N  NH1   . ARG A 1 364 ? 144.511 174.129 -25.151 1.00 29.85 ? 361 ARG A NH1   1 
ATOM   2793 N  NH2   . ARG A 1 364 ? 144.654 176.068 -23.934 1.00 32.30 ? 361 ARG A NH2   1 
ATOM   2794 N  N     . VAL A 1 365 ? 140.450 176.957 -30.601 1.00 32.29 ? 362 VAL A N     1 
ATOM   2795 C  CA    . VAL A 1 365 ? 139.133 177.393 -30.172 1.00 29.97 ? 362 VAL A CA    1 
ATOM   2796 C  C     . VAL A 1 365 ? 138.374 176.259 -29.487 1.00 31.46 ? 362 VAL A C     1 
ATOM   2797 O  O     . VAL A 1 365 ? 138.376 175.114 -29.961 1.00 27.64 ? 362 VAL A O     1 
ATOM   2798 C  CB    . VAL A 1 365 ? 138.299 177.933 -31.359 1.00 35.66 ? 362 VAL A CB    1 
ATOM   2799 C  CG1   . VAL A 1 365 ? 138.106 176.867 -32.436 1.00 35.74 ? 362 VAL A CG1   1 
ATOM   2800 C  CG2   . VAL A 1 365 ? 136.960 178.471 -30.867 1.00 41.25 ? 362 VAL A CG2   1 
ATOM   2801 N  N     . ALA A 1 366 ? 137.740 176.587 -28.362 1.00 26.45 ? 363 ALA A N     1 
ATOM   2802 C  CA    . ALA A 1 366 ? 136.885 175.644 -27.638 1.00 24.92 ? 363 ALA A CA    1 
ATOM   2803 C  C     . ALA A 1 366 ? 135.550 175.432 -28.353 1.00 27.80 ? 363 ALA A C     1 
ATOM   2804 O  O     . ALA A 1 366 ? 135.013 176.354 -28.969 1.00 31.69 ? 363 ALA A O     1 
ATOM   2805 C  CB    . ALA A 1 366 ? 136.655 176.136 -26.226 1.00 23.58 ? 363 ALA A CB    1 
ATOM   2806 N  N     . THR A 1 367 ? 135.001 174.223 -28.256 1.00 24.83 ? 364 THR A N     1 
ATOM   2807 C  CA    . THR A 1 367 ? 133.774 173.914 -28.979 1.00 29.58 ? 364 THR A CA    1 
ATOM   2808 C  C     . THR A 1 367 ? 132.644 173.431 -28.081 1.00 22.58 ? 364 THR A C     1 
ATOM   2809 O  O     . THR A 1 367 ? 131.508 173.331 -28.516 1.00 26.93 ? 364 THR A O     1 
ATOM   2810 C  CB    . THR A 1 367 ? 134.026 172.843 -30.073 1.00 24.13 ? 364 THR A CB    1 
ATOM   2811 O  OG1   . THR A 1 367 ? 134.631 171.685 -29.477 1.00 26.67 ? 364 THR A OG1   1 
ATOM   2812 C  CG2   . THR A 1 367 ? 134.951 173.397 -31.136 1.00 19.04 ? 364 THR A CG2   1 
ATOM   2813 N  N     . GLN A 1 368 ? 132.957 173.115 -26.832 1.00 28.08 ? 365 GLN A N     1 
ATOM   2814 C  CA    . GLN A 1 368 ? 131.931 172.688 -25.890 1.00 25.60 ? 365 GLN A CA    1 
ATOM   2815 C  C     . GLN A 1 368 ? 131.948 173.547 -24.630 1.00 29.00 ? 365 GLN A C     1 
ATOM   2816 O  O     . GLN A 1 368 ? 133.011 173.934 -24.130 1.00 24.22 ? 365 GLN A O     1 
ATOM   2817 C  CB    . GLN A 1 368 ? 132.117 171.214 -25.515 1.00 29.96 ? 365 GLN A CB    1 
ATOM   2818 C  CG    . GLN A 1 368 ? 130.971 170.625 -24.684 1.00 32.61 ? 365 GLN A CG    1 
ATOM   2819 C  CD    . GLN A 1 368 ? 131.172 169.149 -24.392 1.00 40.35 ? 365 GLN A CD    1 
ATOM   2820 O  OE1   . GLN A 1 368 ? 132.047 168.770 -23.608 1.00 45.68 ? 365 GLN A OE1   1 
ATOM   2821 N  NE2   . GLN A 1 368 ? 130.374 168.303 -25.036 1.00 47.33 ? 365 GLN A NE2   1 
ATOM   2822 N  N     . LEU A 1 369 ? 130.759 173.860 -24.136 1.00 22.66 ? 366 LEU A N     1 
ATOM   2823 C  CA    . LEU A 1 369 ? 130.613 174.567 -22.875 1.00 29.78 ? 366 LEU A CA    1 
ATOM   2824 C  C     . LEU A 1 369 ? 130.026 173.596 -21.860 1.00 30.00 ? 366 LEU A C     1 
ATOM   2825 O  O     . LEU A 1 369 ? 128.932 173.068 -22.054 1.00 30.55 ? 366 LEU A O     1 
ATOM   2826 C  CB    . LEU A 1 369 ? 129.714 175.796 -23.020 1.00 28.94 ? 366 LEU A CB    1 
ATOM   2827 C  CG    . LEU A 1 369 ? 129.587 176.670 -21.767 1.00 39.59 ? 366 LEU A CG    1 
ATOM   2828 C  CD1   . LEU A 1 369 ? 130.925 177.347 -21.453 1.00 25.58 ? 366 LEU A CD1   1 
ATOM   2829 C  CD2   . LEU A 1 369 ? 128.466 177.705 -21.925 1.00 29.24 ? 366 LEU A CD2   1 
ATOM   2830 N  N     . VAL A 1 370 ? 130.780 173.338 -20.802 1.00 26.44 ? 367 VAL A N     1 
ATOM   2831 C  CA    . VAL A 1 370 ? 130.311 172.510 -19.714 1.00 20.95 ? 367 VAL A CA    1 
ATOM   2832 C  C     . VAL A 1 370 ? 129.789 173.387 -18.578 1.00 32.36 ? 367 VAL A C     1 
ATOM   2833 O  O     . VAL A 1 370 ? 130.462 174.324 -18.118 1.00 29.32 ? 367 VAL A O     1 
ATOM   2834 C  CB    . VAL A 1 370 ? 131.426 171.589 -19.206 1.00 29.31 ? 367 VAL A CB    1 
ATOM   2835 C  CG1   . VAL A 1 370 ? 131.004 170.888 -17.905 1.00 27.63 ? 367 VAL A CG1   1 
ATOM   2836 C  CG2   . VAL A 1 370 ? 131.796 170.580 -20.288 1.00 25.93 ? 367 VAL A CG2   1 
ATOM   2837 N  N     . VAL A 1 371 ? 128.573 173.088 -18.148 1.00 27.54 ? 368 VAL A N     1 
ATOM   2838 C  CA    . VAL A 1 371 ? 127.921 173.830 -17.088 1.00 31.11 ? 368 VAL A CA    1 
ATOM   2839 C  C     . VAL A 1 371 ? 127.684 172.909 -15.914 1.00 33.95 ? 368 VAL A C     1 
ATOM   2840 O  O     . VAL A 1 371 ? 127.108 171.837 -16.071 1.00 30.57 ? 368 VAL A O     1 
ATOM   2841 C  CB    . VAL A 1 371 ? 126.591 174.427 -17.559 1.00 39.21 ? 368 VAL A CB    1 
ATOM   2842 C  CG1   . VAL A 1 371 ? 126.051 175.414 -16.526 1.00 39.60 ? 368 VAL A CG1   1 
ATOM   2843 C  CG2   . VAL A 1 371 ? 126.788 175.102 -18.904 1.00 35.44 ? 368 VAL A CG2   1 
ATOM   2844 N  N     . SER A 1 372 ? 128.149 173.335 -14.744 1.00 30.24 ? 369 SER A N     1 
ATOM   2845 C  CA    . SER A 1 372 ? 128.116 172.528 -13.537 1.00 25.25 ? 369 SER A CA    1 
ATOM   2846 C  C     . SER A 1 372 ? 127.649 173.373 -12.356 1.00 37.36 ? 369 SER A C     1 
ATOM   2847 O  O     . SER A 1 372 ? 128.155 174.478 -12.147 1.00 30.70 ? 369 SER A O     1 
ATOM   2848 C  CB    . SER A 1 372 ? 129.502 171.939 -13.251 1.00 33.15 ? 369 SER A CB    1 
ATOM   2849 O  OG    . SER A 1 372 ? 129.498 171.090 -12.114 1.00 34.82 ? 369 SER A OG    1 
ATOM   2850 N  N     . ILE A 1 373 ? 126.691 172.845 -11.595 1.00 28.80 ? 370 ILE A N     1 
ATOM   2851 C  CA    . ILE A 1 373 ? 126.167 173.509 -10.401 1.00 36.60 ? 370 ILE A CA    1 
ATOM   2852 C  C     . ILE A 1 373 ? 126.208 172.600 -9.166  1.00 42.25 ? 370 ILE A C     1 
ATOM   2853 O  O     . ILE A 1 373 ? 126.298 171.374 -9.285  1.00 38.39 ? 370 ILE A O     1 
ATOM   2854 C  CB    . ILE A 1 373 ? 124.708 173.978 -10.595 1.00 37.03 ? 370 ILE A CB    1 
ATOM   2855 C  CG1   . ILE A 1 373 ? 123.758 172.776 -10.648 1.00 35.83 ? 370 ILE A CG1   1 
ATOM   2856 C  CG2   . ILE A 1 373 ? 124.568 174.875 -11.831 1.00 32.22 ? 370 ILE A CG2   1 
ATOM   2857 C  CD1   . ILE A 1 373 ? 122.322 173.160 -10.926 1.00 35.22 ? 370 ILE A CD1   1 
ATOM   2858 N  N     . ARG A 1 374 ? 126.147 173.214 -7.985  1.00 43.13 ? 371 ARG A N     1 
ATOM   2859 C  CA    . ARG A 1 374 ? 125.989 172.485 -6.725  1.00 41.60 ? 371 ARG A CA    1 
ATOM   2860 C  C     . ARG A 1 374 ? 124.739 172.989 -5.994  1.00 49.08 ? 371 ARG A C     1 
ATOM   2861 O  O     . ARG A 1 374 ? 124.469 174.194 -5.955  1.00 39.36 ? 371 ARG A O     1 
ATOM   2862 C  CB    . ARG A 1 374 ? 127.236 172.636 -5.841  1.00 43.01 ? 371 ARG A CB    1 
ATOM   2863 C  CG    . ARG A 1 374 ? 127.315 171.705 -4.632  1.00 37.54 ? 371 ARG A CG    1 
ATOM   2864 C  CD    . ARG A 1 374 ? 128.555 172.020 -3.791  1.00 48.69 ? 371 ARG A CD    1 
ATOM   2865 N  NE    . ARG A 1 374 ? 128.625 171.215 -2.574  1.00 55.99 ? 371 ARG A NE    1 
ATOM   2866 N  N     . VAL A 1 375 ? 123.967 172.060 -5.436  1.00 49.93 ? 372 VAL A N     1 
ATOM   2867 C  CA    . VAL A 1 375 ? 122.748 172.413 -4.707  1.00 46.82 ? 372 VAL A CA    1 
ATOM   2868 C  C     . VAL A 1 375 ? 123.015 172.404 -3.201  1.00 44.50 ? 372 VAL A C     1 
ATOM   2869 O  O     . VAL A 1 375 ? 123.884 171.679 -2.715  1.00 44.59 ? 372 VAL A O     1 
ATOM   2870 C  CB    . VAL A 1 375 ? 121.586 171.456 -5.040  1.00 44.38 ? 372 VAL A CB    1 
ATOM   2871 C  CG2   . VAL A 1 375 ? 121.382 171.388 -6.552  1.00 39.05 ? 372 VAL A CG2   1 
ATOM   2872 N  N     . GLN A 1 376 ? 122.286 173.234 -2.468  1.00 47.45 ? 373 GLN A N     1 
ATOM   2873 C  CA    . GLN A 1 376 ? 122.476 173.331 -1.023  1.00 52.55 ? 373 GLN A CA    1 
ATOM   2874 C  C     . GLN A 1 376 ? 122.205 171.980 -0.349  1.00 42.71 ? 373 GLN A C     1 
ATOM   2875 O  O     . GLN A 1 376 ? 121.125 171.407 -0.496  1.00 47.04 ? 373 GLN A O     1 
ATOM   2876 C  CB    . GLN A 1 376 ? 121.567 174.418 -0.451  1.00 52.00 ? 373 GLN A CB    1 
ATOM   2877 C  CG    . GLN A 1 376 ? 121.807 174.764 1.010   1.00 48.14 ? 373 GLN A CG    1 
ATOM   2878 C  CD    . GLN A 1 376 ? 120.853 175.850 1.483   1.00 54.98 ? 373 GLN A CD    1 
ATOM   2879 O  OE1   . GLN A 1 376 ? 119.737 175.560 1.917   1.00 57.89 ? 373 GLN A OE1   1 
ATOM   2880 N  NE2   . GLN A 1 376 ? 121.277 177.109 1.373   1.00 41.98 ? 373 GLN A NE2   1 
ATOM   2881 N  N     . GLY A 1 377 ? 123.200 171.466 0.367   1.00 46.33 ? 374 GLY A N     1 
ATOM   2882 C  CA    . GLY A 1 377 ? 123.094 170.158 0.993   1.00 63.05 ? 374 GLY A CA    1 
ATOM   2883 C  C     . GLY A 1 377 ? 123.973 169.087 0.361   1.00 68.31 ? 374 GLY A C     1 
ATOM   2884 O  O     . GLY A 1 377 ? 123.869 167.910 0.714   1.00 64.31 ? 374 GLY A O     1 
ATOM   2885 N  N     . ASP A 1 378 ? 124.826 169.506 -0.576  1.00 68.12 ? 375 ASP A N     1 
ATOM   2886 C  CA    . ASP A 1 378 ? 125.806 168.638 -1.242  1.00 65.02 ? 375 ASP A CA    1 
ATOM   2887 C  C     . ASP A 1 378 ? 125.154 167.505 -2.040  1.00 69.56 ? 375 ASP A C     1 
ATOM   2888 O  O     . ASP A 1 378 ? 125.434 166.326 -1.811  1.00 70.57 ? 375 ASP A O     1 
ATOM   2889 C  CB    . ASP A 1 378 ? 126.792 168.064 -0.219  1.00 58.35 ? 375 ASP A CB    1 
ATOM   2890 C  CG    . ASP A 1 378 ? 127.966 167.358 -0.867  1.00 68.17 ? 375 ASP A CG    1 
ATOM   2891 O  OD2   . ASP A 1 378 ? 128.166 166.162 -0.566  1.00 69.11 ? 375 ASP A OD2   1 
ATOM   2892 N  N     . LYS A 1 379 ? 124.298 167.877 -2.990  1.00 69.17 ? 376 LYS A N     1 
ATOM   2893 C  CA    . LYS A 1 379 ? 123.635 166.910 -3.863  1.00 65.84 ? 376 LYS A CA    1 
ATOM   2894 C  C     . LYS A 1 379 ? 124.630 166.242 -4.809  1.00 65.03 ? 376 LYS A C     1 
ATOM   2895 O  O     . LYS A 1 379 ? 125.565 166.888 -5.281  1.00 72.00 ? 376 LYS A O     1 
ATOM   2896 C  CB    . LYS A 1 379 ? 122.517 167.586 -4.666  1.00 54.15 ? 376 LYS A CB    1 
ATOM   2897 N  N     . ARG A 1 380 ? 124.418 164.948 -5.063  1.00 71.05 ? 377 ARG A N     1 
ATOM   2898 C  CA    . ARG A 1 380 ? 125.232 164.134 -5.975  1.00 48.13 ? 377 ARG A CA    1 
ATOM   2899 C  C     . ARG A 1 380 ? 126.729 164.430 -5.898  1.00 57.63 ? 377 ARG A C     1 
ATOM   2900 O  O     . ARG A 1 380 ? 127.426 163.956 -4.998  1.00 64.10 ? 377 ARG A O     1 
ATOM   2901 C  CB    . ARG A 1 380 ? 124.742 164.315 -7.414  1.00 47.14 ? 377 ARG A CB    1 
ATOM   2902 C  C     . LEU A 1 381 ? 129.682 168.892 -5.903  1.00 58.88 ? 378 LEU A C     1 
ATOM   2903 O  O     . LEU A 1 381 ? 130.373 168.475 -4.965  1.00 60.20 ? 378 LEU A O     1 
ATOM   2904 N  N     . SER A 1 382 ? 130.036 168.764 -7.179  1.00 41.87 ? 379 SER A N     1 
ATOM   2905 C  CA    . SER A 1 382 ? 129.083 168.950 -8.275  1.00 49.00 ? 379 SER A CA    1 
ATOM   2906 C  C     . SER A 1 382 ? 127.814 168.138 -8.100  1.00 41.99 ? 379 SER A C     1 
ATOM   2907 O  O     . SER A 1 382 ? 127.871 166.929 -7.879  1.00 45.51 ? 379 SER A O     1 
ATOM   2908 C  CB    . SER A 1 382 ? 129.718 168.581 -9.618  1.00 46.93 ? 379 SER A CB    1 
ATOM   2909 O  OG    . SER A 1 382 ? 128.741 168.567 -10.653 1.00 41.09 ? 379 SER A OG    1 
ATOM   2910 N  N     . SER A 1 383 ? 126.670 168.807 -8.225  1.00 44.68 ? 380 SER A N     1 
ATOM   2911 C  CA    . SER A 1 383 ? 125.372 168.144 -8.166  1.00 43.37 ? 380 SER A CA    1 
ATOM   2912 C  C     . SER A 1 383 ? 124.930 167.706 -9.546  1.00 42.15 ? 380 SER A C     1 
ATOM   2913 O  O     . SER A 1 383 ? 124.184 166.744 -9.694  1.00 50.06 ? 380 SER A O     1 
ATOM   2914 C  CB    . SER A 1 383 ? 124.301 169.069 -7.572  1.00 45.84 ? 380 SER A CB    1 
ATOM   2915 O  OG    . SER A 1 383 ? 124.560 169.395 -6.220  1.00 45.06 ? 380 SER A OG    1 
ATOM   2916 N  N     . LEU A 1 384 ? 125.391 168.432 -10.556 1.00 42.18 ? 381 LEU A N     1 
ATOM   2917 C  CA    . LEU A 1 384 ? 124.806 168.350 -11.882 1.00 41.84 ? 381 LEU A CA    1 
ATOM   2918 C  C     . LEU A 1 384 ? 125.725 168.979 -12.925 1.00 43.51 ? 381 LEU A C     1 
ATOM   2919 O  O     . LEU A 1 384 ? 126.323 170.028 -12.676 1.00 41.61 ? 381 LEU A O     1 
ATOM   2920 C  CB    . LEU A 1 384 ? 123.443 169.045 -11.894 1.00 37.62 ? 381 LEU A CB    1 
ATOM   2921 C  CG    . LEU A 1 384 ? 122.716 169.009 -13.237 1.00 30.26 ? 381 LEU A CG    1 
ATOM   2922 C  CD1   . LEU A 1 384 ? 121.851 167.757 -13.302 1.00 44.77 ? 381 LEU A CD1   1 
ATOM   2923 C  CD2   . LEU A 1 384 ? 121.894 170.259 -13.454 1.00 39.44 ? 381 LEU A CD2   1 
ATOM   2924 N  N     . ARG A 1 385 ? 125.808 168.344 -14.092 1.00 38.57 ? 382 ARG A N     1 
ATOM   2925 C  CA    . ARG A 1 385 ? 126.748 168.733 -15.139 1.00 38.05 ? 382 ARG A CA    1 
ATOM   2926 C  C     . ARG A 1 385 ? 126.070 168.569 -16.494 1.00 34.74 ? 382 ARG A C     1 
ATOM   2927 O  O     . ARG A 1 385 ? 125.682 167.461 -16.858 1.00 40.65 ? 382 ARG A O     1 
ATOM   2928 C  CB    . ARG A 1 385 ? 128.017 167.869 -15.058 1.00 31.56 ? 382 ARG A CB    1 
ATOM   2929 C  CG    . ARG A 1 385 ? 129.332 168.596 -15.268 1.00 39.22 ? 382 ARG A CG    1 
ATOM   2930 C  CD    . ARG A 1 385 ? 130.524 167.729 -14.829 1.00 38.04 ? 382 ARG A CD    1 
ATOM   2931 N  NE    . ARG A 1 385 ? 130.259 166.976 -13.595 1.00 45.10 ? 382 ARG A NE    1 
ATOM   2932 C  CZ    . ARG A 1 385 ? 131.145 166.190 -12.979 1.00 43.06 ? 382 ARG A CZ    1 
ATOM   2933 N  NH1   . ARG A 1 385 ? 132.372 166.033 -13.475 1.00 32.86 ? 382 ARG A NH1   1 
ATOM   2934 N  NH2   . ARG A 1 385 ? 130.805 165.551 -11.866 1.00 37.07 ? 382 ARG A NH2   1 
ATOM   2935 N  N     . ARG A 1 386 ? 125.898 169.662 -17.233 1.00 28.63 ? 383 ARG A N     1 
ATOM   2936 C  CA    . ARG A 1 386 ? 125.303 169.591 -18.571 1.00 31.62 ? 383 ARG A CA    1 
ATOM   2937 C  C     . ARG A 1 386 ? 126.154 170.381 -19.542 1.00 36.28 ? 383 ARG A C     1 
ATOM   2938 O  O     . ARG A 1 386 ? 126.921 171.241 -19.125 1.00 33.44 ? 383 ARG A O     1 
ATOM   2939 C  CB    . ARG A 1 386 ? 123.870 170.120 -18.567 1.00 33.34 ? 383 ARG A CB    1 
ATOM   2940 C  CG    . ARG A 1 386 ? 122.931 169.346 -17.661 1.00 31.74 ? 383 ARG A CG    1 
ATOM   2941 C  CD    . ARG A 1 386 ? 122.593 167.990 -18.269 1.00 33.09 ? 383 ARG A CD    1 
ATOM   2942 N  NE    . ARG A 1 386 ? 121.495 167.322 -17.572 1.00 29.36 ? 383 ARG A NE    1 
ATOM   2943 C  CZ    . ARG A 1 386 ? 121.660 166.388 -16.638 1.00 41.21 ? 383 ARG A CZ    1 
ATOM   2944 N  NH1   . ARG A 1 386 ? 122.884 166.010 -16.283 1.00 39.41 ? 383 ARG A NH1   1 
ATOM   2945 N  NH2   . ARG A 1 386 ? 120.601 165.826 -16.061 1.00 37.42 ? 383 ARG A NH2   1 
ATOM   2946 N  N     . CYS A 1 387 ? 126.015 170.084 -20.830 1.00 36.34 ? 384 CYS A N     1 
ATOM   2947 C  CA    . CYS A 1 387 ? 126.831 170.702 -21.867 1.00 26.97 ? 384 CYS A CA    1 
ATOM   2948 C  C     . CYS A 1 387 ? 125.987 171.292 -22.985 1.00 32.33 ? 384 CYS A C     1 
ATOM   2949 O  O     . CYS A 1 387 ? 124.847 170.898 -23.197 1.00 40.50 ? 384 CYS A O     1 
ATOM   2950 C  CB    . CYS A 1 387 ? 127.809 169.685 -22.476 1.00 34.34 ? 384 CYS A CB    1 
ATOM   2951 S  SG    . CYS A 1 387 ? 128.727 168.691 -21.290 1.00 56.11 ? 384 CYS A SG    1 
ATOM   2952 N  N     . CYS A 1 388 ? 126.575 172.230 -23.710 1.00 30.43 ? 385 CYS A N     1 
ATOM   2953 C  CA    . CYS A 1 388 ? 125.991 172.737 -24.939 1.00 36.03 ? 385 CYS A CA    1 
ATOM   2954 C  C     . CYS A 1 388 ? 127.112 173.126 -25.881 1.00 36.74 ? 385 CYS A C     1 
ATOM   2955 O  O     . CYS A 1 388 ? 128.287 173.113 -25.497 1.00 32.27 ? 385 CYS A O     1 
ATOM   2956 C  CB    . CYS A 1 388 ? 125.075 173.926 -24.654 1.00 44.46 ? 385 CYS A CB    1 
ATOM   2957 S  SG    . CYS A 1 388 ? 125.897 175.341 -23.913 1.00 38.08 ? 385 CYS A SG    1 
ATOM   2958 N  N     . ALA A 1 389 ? 126.764 173.454 -27.120 1.00 34.22 ? 386 ALA A N     1 
ATOM   2959 C  CA    . ALA A 1 389 ? 127.770 173.910 -28.058 1.00 28.95 ? 386 ALA A CA    1 
ATOM   2960 C  C     . ALA A 1 389 ? 128.293 175.281 -27.664 1.00 29.59 ? 386 ALA A C     1 
ATOM   2961 O  O     . ALA A 1 389 ? 127.523 176.170 -27.286 1.00 31.09 ? 386 ALA A O     1 
ATOM   2962 C  CB    . ALA A 1 389 ? 127.214 173.945 -29.467 1.00 33.77 ? 386 ALA A CB    1 
ATOM   2963 N  N     . LEU A 1 390 ? 129.608 175.445 -27.756 1.00 24.17 ? 387 LEU A N     1 
ATOM   2964 C  CA    . LEU A 1 390 ? 130.235 176.757 -27.660 1.00 34.23 ? 387 LEU A CA    1 
ATOM   2965 C  C     . LEU A 1 390 ? 130.602 177.192 -29.077 1.00 33.50 ? 387 LEU A C     1 
ATOM   2966 O  O     . LEU A 1 390 ? 131.613 176.756 -29.625 1.00 34.90 ? 387 LEU A O     1 
ATOM   2967 C  CB    . LEU A 1 390 ? 131.478 176.715 -26.759 1.00 25.14 ? 387 LEU A CB    1 
ATOM   2968 C  CG    . LEU A 1 390 ? 131.938 177.950 -25.973 1.00 33.96 ? 387 LEU A CG    1 
ATOM   2969 C  CD1   . LEU A 1 390 ? 133.215 177.629 -25.198 1.00 23.84 ? 387 LEU A CD1   1 
ATOM   2970 C  CD2   . LEU A 1 390 ? 132.173 179.169 -26.858 1.00 26.58 ? 387 LEU A CD2   1 
ATOM   2971 N  N     . THR A 1 391 ? 129.779 178.044 -29.671 1.00 28.32 ? 388 THR A N     1 
ATOM   2972 C  CA    . THR A 1 391 ? 129.973 178.421 -31.069 1.00 28.47 ? 388 THR A CA    1 
ATOM   2973 C  C     . THR A 1 391 ? 130.490 179.838 -31.205 1.00 32.94 ? 388 THR A C     1 
ATOM   2974 O  O     . THR A 1 391 ? 131.044 180.202 -32.240 1.00 34.10 ? 388 THR A O     1 
ATOM   2975 C  CB    . THR A 1 391 ? 128.665 178.278 -31.880 1.00 41.37 ? 388 THR A CB    1 
ATOM   2976 O  OG1   . THR A 1 391 ? 127.582 178.913 -31.179 1.00 38.33 ? 388 THR A OG1   1 
ATOM   2977 C  CG2   . THR A 1 391 ? 128.335 176.807 -32.095 1.00 28.36 ? 388 THR A CG2   1 
ATOM   2978 N  N     . ARG A 1 392 ? 130.303 180.642 -30.162 1.00 30.88 ? 389 ARG A N     1 
ATOM   2979 C  CA    . ARG A 1 392 ? 130.748 182.030 -30.181 1.00 30.24 ? 389 ARG A CA    1 
ATOM   2980 C  C     . ARG A 1 392 ? 131.349 182.451 -28.848 1.00 29.81 ? 389 ARG A C     1 
ATOM   2981 O  O     . ARG A 1 392 ? 130.746 182.243 -27.790 1.00 32.05 ? 389 ARG A O     1 
ATOM   2982 C  CB    . ARG A 1 392 ? 129.589 182.964 -30.532 1.00 35.62 ? 389 ARG A CB    1 
ATOM   2983 C  CG    . ARG A 1 392 ? 129.164 182.885 -31.983 1.00 46.74 ? 389 ARG A CG    1 
ATOM   2984 C  CD    . ARG A 1 392 ? 128.085 183.894 -32.305 1.00 50.57 ? 389 ARG A CD    1 
ATOM   2985 N  NE    . ARG A 1 392 ? 127.770 183.876 -33.729 1.00 53.88 ? 389 ARG A NE    1 
ATOM   2986 C  CZ    . ARG A 1 392 ? 127.056 184.810 -34.344 1.00 50.57 ? 389 ARG A CZ    1 
ATOM   2987 N  NH1   . ARG A 1 392 ? 126.584 185.844 -33.660 1.00 65.97 ? 389 ARG A NH1   1 
ATOM   2988 N  NH2   . ARG A 1 392 ? 126.821 184.716 -35.644 1.00 50.14 ? 389 ARG A NH2   1 
ATOM   2989 N  N     . TYR A 1 393 ? 132.539 183.040 -28.905 1.00 27.74 ? 390 TYR A N     1 
ATOM   2990 C  CA    . TYR A 1 393 ? 133.146 183.656 -27.733 1.00 25.73 ? 390 TYR A CA    1 
ATOM   2991 C  C     . TYR A 1 393 ? 132.374 184.932 -27.419 1.00 37.76 ? 390 TYR A C     1 
ATOM   2992 O  O     . TYR A 1 393 ? 132.833 186.052 -27.701 1.00 29.05 ? 390 TYR A O     1 
ATOM   2993 C  CB    . TYR A 1 393 ? 134.626 183.963 -27.964 1.00 33.79 ? 390 TYR A CB    1 
ATOM   2994 C  CG    . TYR A 1 393 ? 135.538 182.752 -27.943 1.00 25.14 ? 390 TYR A CG    1 
ATOM   2995 C  CD1   . TYR A 1 393 ? 135.020 181.462 -27.851 1.00 23.96 ? 390 TYR A CD1   1 
ATOM   2996 C  CD2   . TYR A 1 393 ? 136.917 182.904 -27.993 1.00 28.02 ? 390 TYR A CD2   1 
ATOM   2997 C  CE1   . TYR A 1 393 ? 135.854 180.361 -27.810 1.00 28.05 ? 390 TYR A CE1   1 
ATOM   2998 C  CE2   . TYR A 1 393 ? 137.760 181.807 -27.970 1.00 26.92 ? 390 TYR A CE2   1 
ATOM   2999 C  CZ    . TYR A 1 393 ? 137.226 180.539 -27.874 1.00 25.24 ? 390 TYR A CZ    1 
ATOM   3000 O  OH    . TYR A 1 393 ? 138.056 179.444 -27.842 1.00 23.81 ? 390 TYR A OH    1 
ATOM   3001 N  N     . ASP A 1 394 ? 131.183 184.748 -26.858 1.00 30.36 ? 391 ASP A N     1 
ATOM   3002 C  CA    . ASP A 1 394 ? 130.323 185.856 -26.491 1.00 28.76 ? 391 ASP A CA    1 
ATOM   3003 C  C     . ASP A 1 394 ? 129.673 185.574 -25.151 1.00 25.04 ? 391 ASP A C     1 
ATOM   3004 O  O     . ASP A 1 394 ? 128.999 184.561 -24.993 1.00 27.68 ? 391 ASP A O     1 
ATOM   3005 C  CB    . ASP A 1 394 ? 129.257 186.095 -27.550 1.00 34.71 ? 391 ASP A CB    1 
ATOM   3006 C  CG    . ASP A 1 394 ? 128.324 187.225 -27.169 1.00 38.35 ? 391 ASP A CG    1 
ATOM   3007 O  OD1   . ASP A 1 394 ? 128.742 188.395 -27.267 1.00 40.53 ? 391 ASP A OD1   1 
ATOM   3008 O  OD2   . ASP A 1 394 ? 127.194 186.945 -26.737 1.00 38.86 ? 391 ASP A OD2   1 
ATOM   3009 N  N     . ALA A 1 395 ? 129.890 186.472 -24.191 1.00 27.74 ? 392 ALA A N     1 
ATOM   3010 C  CA    . ALA A 1 395 ? 129.496 186.234 -22.811 1.00 28.31 ? 392 ALA A CA    1 
ATOM   3011 C  C     . ALA A 1 395 ? 127.984 186.136 -22.621 1.00 23.72 ? 392 ALA A C     1 
ATOM   3012 O  O     . ALA A 1 395 ? 127.512 185.323 -21.833 1.00 23.65 ? 392 ALA A O     1 
ATOM   3013 C  CB    . ALA A 1 395 ? 130.074 187.329 -21.900 1.00 24.93 ? 392 ALA A CB    1 
ATOM   3014 N  N     . HIS A 1 396 ? 127.217 186.964 -23.324 1.00 26.64 ? 393 HIS A N     1 
ATOM   3015 C  CA    . HIS A 1 396 ? 125.771 186.958 -23.124 1.00 29.60 ? 393 HIS A CA    1 
ATOM   3016 C  C     . HIS A 1 396 ? 125.178 185.669 -23.671 1.00 28.55 ? 393 HIS A C     1 
ATOM   3017 O  O     . HIS A 1 396 ? 124.262 185.110 -23.078 1.00 29.54 ? 393 HIS A O     1 
ATOM   3018 C  CB    . HIS A 1 396 ? 125.121 188.191 -23.761 1.00 32.96 ? 393 HIS A CB    1 
ATOM   3019 C  CG    . HIS A 1 396 ? 125.439 189.465 -23.040 1.00 38.94 ? 393 HIS A CG    1 
ATOM   3020 N  ND1   . HIS A 1 396 ? 124.751 189.876 -21.916 1.00 51.29 ? 393 HIS A ND1   1 
ATOM   3021 C  CD2   . HIS A 1 396 ? 126.392 190.403 -23.258 1.00 48.59 ? 393 HIS A CD2   1 
ATOM   3022 C  CE1   . HIS A 1 396 ? 125.259 191.016 -21.482 1.00 50.33 ? 393 HIS A CE1   1 
ATOM   3023 N  NE2   . HIS A 1 396 ? 126.258 191.358 -22.279 1.00 45.95 ? 393 HIS A NE2   1 
ATOM   3024 N  N     . LYS A 1 397 ? 125.730 185.172 -24.773 1.00 29.71 ? 394 LYS A N     1 
ATOM   3025 C  CA    . LYS A 1 397 ? 125.240 183.916 -25.335 1.00 30.51 ? 394 LYS A CA    1 
ATOM   3026 C  C     . LYS A 1 397 ? 125.607 182.736 -24.445 1.00 28.25 ? 394 LYS A C     1 
ATOM   3027 O  O     . LYS A 1 397 ? 124.790 181.842 -24.235 1.00 28.80 ? 394 LYS A O     1 
ATOM   3028 C  CB    . LYS A 1 397 ? 125.783 183.685 -26.755 1.00 28.22 ? 394 LYS A CB    1 
ATOM   3029 C  CG    . LYS A 1 397 ? 125.386 182.314 -27.327 1.00 25.61 ? 394 LYS A CG    1 
ATOM   3030 C  CD    . LYS A 1 397 ? 125.688 182.188 -28.818 1.00 24.54 ? 394 LYS A CD    1 
ATOM   3031 C  CE    . LYS A 1 397 ? 125.506 180.739 -29.292 1.00 36.44 ? 394 LYS A CE    1 
ATOM   3032 N  NZ    . LYS A 1 397 ? 124.323 180.068 -28.657 1.00 31.15 ? 394 LYS A NZ    1 
ATOM   3033 N  N     . MET A 1 398 ? 126.834 182.732 -23.929 1.00 23.99 ? 395 MET A N     1 
ATOM   3034 C  CA    . MET A 1 398 ? 127.284 181.617 -23.099 1.00 28.69 ? 395 MET A CA    1 
ATOM   3035 C  C     . MET A 1 398 ? 126.495 181.552 -21.800 1.00 30.05 ? 395 MET A C     1 
ATOM   3036 O  O     . MET A 1 398 ? 126.098 180.467 -21.364 1.00 26.98 ? 395 MET A O     1 
ATOM   3037 C  CB    . MET A 1 398 ? 128.784 181.717 -22.809 1.00 27.00 ? 395 MET A CB    1 
ATOM   3038 C  CG    . MET A 1 398 ? 129.655 181.204 -23.962 1.00 22.78 ? 395 MET A CG    1 
ATOM   3039 S  SD    . MET A 1 398 ? 131.423 181.178 -23.600 1.00 35.44 ? 395 MET A SD    1 
ATOM   3040 C  CE    . MET A 1 398 ? 131.701 182.895 -23.125 1.00 30.15 ? 395 MET A CE    1 
ATOM   3041 N  N     . SER A 1 399 ? 126.247 182.709 -21.189 1.00 28.94 ? 396 SER A N     1 
ATOM   3042 C  CA    . SER A 1 399 ? 125.535 182.719 -19.917 1.00 26.96 ? 396 SER A CA    1 
ATOM   3043 C  C     . SER A 1 399 ? 124.071 182.376 -20.164 1.00 30.20 ? 396 SER A C     1 
ATOM   3044 O  O     . SER A 1 399 ? 123.440 181.701 -19.350 1.00 30.28 ? 396 SER A O     1 
ATOM   3045 C  CB    . SER A 1 399 ? 125.682 184.067 -19.198 1.00 31.49 ? 396 SER A CB    1 
ATOM   3046 O  OG    . SER A 1 399 ? 125.144 185.138 -19.951 1.00 32.86 ? 396 SER A OG    1 
ATOM   3047 N  N     . HIS A 1 400 ? 123.544 182.794 -21.312 1.00 31.64 ? 397 HIS A N     1 
ATOM   3048 C  CA    . HIS A 1 400 ? 122.169 182.437 -21.651 1.00 35.72 ? 397 HIS A CA    1 
ATOM   3049 C  C     . HIS A 1 400 ? 122.012 180.926 -21.895 1.00 37.42 ? 397 HIS A C     1 
ATOM   3050 O  O     . HIS A 1 400 ? 121.078 180.288 -21.376 1.00 34.09 ? 397 HIS A O     1 
ATOM   3051 C  CB    . HIS A 1 400 ? 121.698 183.214 -22.879 1.00 38.97 ? 397 HIS A CB    1 
ATOM   3052 C  CG    . HIS A 1 400 ? 120.298 182.878 -23.286 1.00 48.02 ? 397 HIS A CG    1 
ATOM   3053 N  ND1   . HIS A 1 400 ? 120.000 181.823 -24.122 1.00 51.45 ? 397 HIS A ND1   1 
ATOM   3054 C  CD2   . HIS A 1 400 ? 119.112 183.433 -22.942 1.00 36.23 ? 397 HIS A CD2   1 
ATOM   3055 C  CE1   . HIS A 1 400 ? 118.691 181.752 -24.288 1.00 48.08 ? 397 HIS A CE1   1 
ATOM   3056 N  NE2   . HIS A 1 400 ? 118.129 182.720 -23.587 1.00 43.79 ? 397 HIS A NE2   1 
ATOM   3057 N  N     . ASP A 1 401 ? 122.924 180.364 -22.689 1.00 31.36 ? 398 ASP A N     1 
ATOM   3058 C  CA    . ASP A 1 401 ? 122.930 178.925 -22.971 1.00 29.63 ? 398 ASP A CA    1 
ATOM   3059 C  C     . ASP A 1 401 ? 123.088 178.081 -21.706 1.00 30.74 ? 398 ASP A C     1 
ATOM   3060 O  O     . ASP A 1 401 ? 122.417 177.055 -21.552 1.00 36.34 ? 398 ASP A O     1 
ATOM   3061 C  CB    . ASP A 1 401 ? 124.046 178.574 -23.957 1.00 27.51 ? 398 ASP A CB    1 
ATOM   3062 C  CG    . ASP A 1 401 ? 123.798 179.141 -25.348 1.00 32.59 ? 398 ASP A CG    1 
ATOM   3063 O  OD1   . ASP A 1 401 ? 122.649 179.549 -25.629 1.00 32.16 ? 398 ASP A OD1   1 
ATOM   3064 O  OD2   . ASP A 1 401 ? 124.752 179.175 -26.160 1.00 31.79 ? 398 ASP A OD2   1 
ATOM   3065 N  N     . ALA A 1 402 ? 123.982 178.509 -20.814 1.00 27.55 ? 399 ALA A N     1 
ATOM   3066 C  CA    . ALA A 1 402 ? 124.213 177.808 -19.551 1.00 27.51 ? 399 ALA A CA    1 
ATOM   3067 C  C     . ALA A 1 402 ? 122.953 177.799 -18.721 1.00 21.81 ? 399 ALA A C     1 
ATOM   3068 O  O     . ALA A 1 402 ? 122.614 176.796 -18.099 1.00 32.48 ? 399 ALA A O     1 
ATOM   3069 C  CB    . ALA A 1 402 ? 125.344 178.447 -18.775 1.00 28.30 ? 399 ALA A CB    1 
ATOM   3070 N  N     . PHE A 1 403 ? 122.247 178.920 -18.713 1.00 26.86 ? 400 PHE A N     1 
ATOM   3071 C  CA    . PHE A 1 403 ? 121.000 178.976 -17.971 1.00 28.64 ? 400 PHE A CA    1 
ATOM   3072 C  C     . PHE A 1 403 ? 119.991 178.030 -18.596 1.00 32.91 ? 400 PHE A C     1 
ATOM   3073 O  O     . PHE A 1 403 ? 119.325 177.275 -17.892 1.00 33.04 ? 400 PHE A O     1 
ATOM   3074 C  CB    . PHE A 1 403 ? 120.436 180.389 -17.937 1.00 33.13 ? 400 PHE A CB    1 
ATOM   3075 C  CG    . PHE A 1 403 ? 119.210 180.520 -17.082 1.00 41.38 ? 400 PHE A CG    1 
ATOM   3076 C  CD1   . PHE A 1 403 ? 119.323 180.603 -15.706 1.00 38.42 ? 400 PHE A CD1   1 
ATOM   3077 C  CD2   . PHE A 1 403 ? 117.946 180.545 -17.652 1.00 43.27 ? 400 PHE A CD2   1 
ATOM   3078 C  CE1   . PHE A 1 403 ? 118.198 180.717 -14.910 1.00 48.60 ? 400 PHE A CE1   1 
ATOM   3079 C  CE2   . PHE A 1 403 ? 116.819 180.658 -16.863 1.00 47.90 ? 400 PHE A CE2   1 
ATOM   3080 C  CZ    . PHE A 1 403 ? 116.949 180.744 -15.487 1.00 45.44 ? 400 PHE A CZ    1 
ATOM   3081 N  N     . THR A 1 404 ? 119.890 178.070 -19.922 1.00 30.95 ? 401 THR A N     1 
ATOM   3082 C  CA    . THR A 1 404 ? 118.952 177.212 -20.627 1.00 33.27 ? 401 THR A CA    1 
ATOM   3083 C  C     . THR A 1 404 ? 119.128 175.743 -20.236 1.00 29.58 ? 401 THR A C     1 
ATOM   3084 O  O     . THR A 1 404 ? 118.147 175.069 -19.933 1.00 37.70 ? 401 THR A O     1 
ATOM   3085 C  CB    . THR A 1 404 ? 119.089 177.366 -22.154 1.00 31.79 ? 401 THR A CB    1 
ATOM   3086 O  OG1   . THR A 1 404 ? 118.569 178.640 -22.544 1.00 38.73 ? 401 THR A OG1   1 
ATOM   3087 C  CG2   . THR A 1 404 ? 118.310 176.281 -22.876 1.00 37.74 ? 401 THR A CG2   1 
ATOM   3088 N  N     . VAL A 1 405 ? 120.367 175.255 -20.181 1.00 37.22 ? 402 VAL A N     1 
ATOM   3089 C  CA    . VAL A 1 405 ? 120.575 173.836 -19.868 1.00 35.19 ? 402 VAL A CA    1 
ATOM   3090 C  C     . VAL A 1 405 ? 120.449 173.466 -18.380 1.00 38.13 ? 402 VAL A C     1 
ATOM   3091 O  O     . VAL A 1 405 ? 120.417 172.280 -18.052 1.00 37.54 ? 402 VAL A O     1 
ATOM   3092 C  CB    . VAL A 1 405 ? 121.962 173.320 -20.365 1.00 39.43 ? 402 VAL A CB    1 
ATOM   3093 C  CG1   . VAL A 1 405 ? 122.163 173.630 -21.844 1.00 38.54 ? 402 VAL A CG1   1 
ATOM   3094 C  CG2   . VAL A 1 405 ? 123.093 173.879 -19.531 1.00 33.91 ? 402 VAL A CG2   1 
ATOM   3095 N  N     . ILE A 1 406 ? 120.388 174.442 -17.475 1.00 35.55 ? 403 ILE A N     1 
ATOM   3096 C  CA    . ILE A 1 406 ? 120.241 174.094 -16.060 1.00 36.80 ? 403 ILE A CA    1 
ATOM   3097 C  C     . ILE A 1 406 ? 118.880 174.457 -15.456 1.00 43.70 ? 403 ILE A C     1 
ATOM   3098 O  O     . ILE A 1 406 ? 118.529 173.973 -14.373 1.00 40.33 ? 403 ILE A O     1 
ATOM   3099 C  CB    . ILE A 1 406 ? 121.320 174.767 -15.178 1.00 41.30 ? 403 ILE A CB    1 
ATOM   3100 C  CG1   . ILE A 1 406 ? 121.127 176.283 -15.161 1.00 33.63 ? 403 ILE A CG1   1 
ATOM   3101 C  CG2   . ILE A 1 406 ? 122.714 174.362 -15.618 1.00 42.71 ? 403 ILE A CG2   1 
ATOM   3102 C  CD1   . ILE A 1 406 ? 121.853 176.957 -14.042 1.00 35.13 ? 403 ILE A CD1   1 
ATOM   3103 N  N     . LYS A 1 407 ? 118.123 175.308 -16.145 1.00 36.09 ? 404 LYS A N     1 
ATOM   3104 C  CA    . LYS A 1 407 ? 116.908 175.879 -15.570 1.00 40.80 ? 404 LYS A CA    1 
ATOM   3105 C  C     . LYS A 1 407 ? 115.884 174.817 -15.146 1.00 46.58 ? 404 LYS A C     1 
ATOM   3106 O  O     . LYS A 1 407 ? 115.091 175.034 -14.226 1.00 49.81 ? 404 LYS A O     1 
ATOM   3107 C  CB    . LYS A 1 407 ? 116.272 176.861 -16.558 1.00 42.30 ? 404 LYS A CB    1 
ATOM   3108 C  CG    . LYS A 1 407 ? 115.844 176.250 -17.877 1.00 43.22 ? 404 LYS A CG    1 
ATOM   3109 C  CD    . LYS A 1 407 ? 115.267 177.308 -18.799 1.00 42.31 ? 404 LYS A CD    1 
ATOM   3110 C  CE    . LYS A 1 407 ? 114.819 176.702 -20.115 1.00 34.89 ? 404 LYS A CE    1 
ATOM   3111 N  NZ    . LYS A 1 407 ? 114.274 177.717 -21.053 1.00 52.31 ? 404 LYS A NZ    1 
ATOM   3112 N  N     . ASN A 1 408 ? 115.916 173.666 -15.810 1.00 47.39 ? 405 ASN A N     1 
ATOM   3113 C  CA    . ASN A 1 408 ? 115.001 172.571 -15.498 1.00 56.44 ? 405 ASN A CA    1 
ATOM   3114 C  C     . ASN A 1 408 ? 115.230 172.020 -14.089 1.00 49.61 ? 405 ASN A C     1 
ATOM   3115 O  O     . ASN A 1 408 ? 114.342 171.408 -13.502 1.00 51.13 ? 405 ASN A O     1 
ATOM   3116 C  CB    . ASN A 1 408 ? 115.138 171.448 -16.537 1.00 42.61 ? 405 ASN A CB    1 
ATOM   3117 N  N     . CYS A 1 409 ? 116.420 172.254 -13.544 1.00 52.45 ? 406 CYS A N     1 
ATOM   3118 C  CA    . CYS A 1 409 ? 116.785 171.711 -12.241 1.00 47.65 ? 406 CYS A CA    1 
ATOM   3119 C  C     . CYS A 1 409 ? 116.128 172.492 -11.106 1.00 53.84 ? 406 CYS A C     1 
ATOM   3120 O  O     . CYS A 1 409 ? 116.189 172.088 -9.946  1.00 56.27 ? 406 CYS A O     1 
ATOM   3121 C  CB    . CYS A 1 409 ? 118.309 171.706 -12.067 1.00 55.03 ? 406 CYS A CB    1 
ATOM   3122 N  N     . ASN A 1 410 ? 115.497 173.608 -11.451 1.00 51.09 ? 407 ASN A N     1 
ATOM   3123 C  CA    . ASN A 1 410 ? 114.805 174.443 -10.477 1.00 52.00 ? 407 ASN A CA    1 
ATOM   3124 C  C     . ASN A 1 410 ? 113.441 173.865 -10.073 1.00 56.01 ? 407 ASN A C     1 
ATOM   3125 O  O     . ASN A 1 410 ? 112.517 173.796 -10.890 1.00 48.31 ? 407 ASN A O     1 
ATOM   3126 C  CB    . ASN A 1 410 ? 114.629 175.855 -11.042 1.00 50.01 ? 407 ASN A CB    1 
ATOM   3127 C  CG    . ASN A 1 410 ? 114.066 176.833 -10.025 1.00 49.74 ? 407 ASN A CG    1 
ATOM   3128 O  OD1   . ASN A 1 410 ? 113.952 176.527 -8.836  1.00 48.00 ? 407 ASN A OD1   1 
ATOM   3129 N  ND2   . ASN A 1 410 ? 113.717 178.026 -10.493 1.00 51.68 ? 407 ASN A ND2   1 
ATOM   3130 N  N     . THR A 1 411 ? 113.322 173.465 -8.808  1.00 55.60 ? 408 THR A N     1 
ATOM   3131 C  CA    . THR A 1 411 ? 112.069 172.927 -8.281  1.00 59.57 ? 408 THR A CA    1 
ATOM   3132 C  C     . THR A 1 411 ? 111.236 174.006 -7.588  1.00 55.22 ? 408 THR A C     1 
ATOM   3133 O  O     . THR A 1 411 ? 110.667 173.767 -6.525  1.00 59.64 ? 408 THR A O     1 
ATOM   3134 C  CB    . THR A 1 411 ? 112.318 171.768 -7.277  1.00 59.68 ? 408 THR A CB    1 
ATOM   3135 O  OG1   . THR A 1 411 ? 112.454 172.288 -5.948  1.00 48.51 ? 408 THR A OG1   1 
ATOM   3136 C  CG2   . THR A 1 411 ? 113.568 170.977 -7.653  1.00 54.44 ? 408 THR A CG2   1 
ATOM   3137 N  N     . SER A 1 412 ? 111.165 175.189 -8.190  1.00 52.46 ? 409 SER A N     1 
ATOM   3138 C  CA    . SER A 1 412 ? 110.346 176.270 -7.650  1.00 61.54 ? 409 SER A CA    1 
ATOM   3139 C  C     . SER A 1 412 ? 109.284 176.698 -8.658  1.00 59.98 ? 409 SER A C     1 
ATOM   3140 O  O     . SER A 1 412 ? 108.301 175.990 -8.873  1.00 62.16 ? 409 SER A O     1 
ATOM   3141 C  CB    . SER A 1 412 ? 111.213 177.470 -7.258  1.00 55.80 ? 409 SER A CB    1 
ATOM   3142 N  N     . THR A 1 416 ? 110.244 183.509 -10.333 1.00 58.11 ? 413 THR A N     1 
ATOM   3143 C  CA    . THR A 1 416 ? 111.224 184.425 -9.751  1.00 58.67 ? 413 THR A CA    1 
ATOM   3144 C  C     . THR A 1 416 ? 112.149 183.729 -8.744  1.00 55.61 ? 413 THR A C     1 
ATOM   3145 O  O     . THR A 1 416 ? 113.298 184.137 -8.561  1.00 53.07 ? 413 THR A O     1 
ATOM   3146 C  CB    . THR A 1 416 ? 110.533 185.616 -9.054  1.00 49.98 ? 413 THR A CB    1 
ATOM   3147 N  N     . GLU A 1 417 ? 111.654 182.675 -8.101  1.00 47.98 ? 414 GLU A N     1 
ATOM   3148 C  CA    . GLU A 1 417 ? 112.426 181.987 -7.070  1.00 51.00 ? 414 GLU A CA    1 
ATOM   3149 C  C     . GLU A 1 417 ? 113.203 180.789 -7.599  1.00 56.28 ? 414 GLU A C     1 
ATOM   3150 O  O     . GLU A 1 417 ? 112.781 180.120 -8.547  1.00 52.89 ? 414 GLU A O     1 
ATOM   3151 C  CB    . GLU A 1 417 ? 111.509 181.523 -5.936  1.00 56.51 ? 414 GLU A CB    1 
ATOM   3152 C  CG    . GLU A 1 417 ? 110.715 182.640 -5.314  1.00 50.43 ? 414 GLU A CG    1 
ATOM   3153 C  CD    . GLU A 1 417 ? 111.531 183.899 -5.182  1.00 48.17 ? 414 GLU A CD    1 
ATOM   3154 O  OE1   . GLU A 1 417 ? 112.479 183.911 -4.364  1.00 52.17 ? 414 GLU A OE1   1 
ATOM   3155 O  OE2   . GLU A 1 417 ? 111.237 184.863 -5.922  1.00 49.78 ? 414 GLU A OE2   1 
ATOM   3156 N  N     . TRP A 1 418 ? 114.335 180.510 -6.963  1.00 54.51 ? 415 TRP A N     1 
ATOM   3157 C  CA    . TRP A 1 418 ? 115.117 179.334 -7.310  1.00 47.77 ? 415 TRP A CA    1 
ATOM   3158 C  C     . TRP A 1 418 ? 115.363 178.451 -6.094  1.00 52.22 ? 415 TRP A C     1 
ATOM   3159 O  O     . TRP A 1 418 ? 115.963 178.872 -5.103  1.00 50.44 ? 415 TRP A O     1 
ATOM   3160 C  CB    . TRP A 1 418 ? 116.456 179.730 -7.944  1.00 50.88 ? 415 TRP A CB    1 
ATOM   3161 C  CG    . TRP A 1 418 ? 117.175 178.560 -8.549  1.00 44.35 ? 415 TRP A CG    1 
ATOM   3162 C  CD1   . TRP A 1 418 ? 117.702 177.491 -7.889  1.00 48.56 ? 415 TRP A CD1   1 
ATOM   3163 C  CD2   . TRP A 1 418 ? 117.418 178.330 -9.942  1.00 39.91 ? 415 TRP A CD2   1 
ATOM   3164 N  NE1   . TRP A 1 418 ? 118.267 176.611 -8.783  1.00 48.77 ? 415 TRP A NE1   1 
ATOM   3165 C  CE2   . TRP A 1 418 ? 118.108 177.106 -10.050 1.00 47.58 ? 415 TRP A CE2   1 
ATOM   3166 C  CE3   . TRP A 1 418 ? 117.128 179.046 -11.107 1.00 47.71 ? 415 TRP A CE3   1 
ATOM   3167 C  CZ2   . TRP A 1 418 ? 118.508 176.576 -11.282 1.00 39.47 ? 415 TRP A CZ2   1 
ATOM   3168 C  CZ3   . TRP A 1 418 ? 117.531 178.520 -12.331 1.00 50.68 ? 415 TRP A CZ3   1 
ATOM   3169 C  CH2   . TRP A 1 418 ? 118.214 177.300 -12.405 1.00 48.89 ? 415 TRP A CH2   1 
ATOM   3170 N  N     . SER A 1 419 ? 114.907 177.210 -6.187  1.00 55.36 ? 416 SER A N     1 
ATOM   3171 C  CA    . SER A 1 419 ? 115.158 176.231 -5.144  1.00 55.97 ? 416 SER A CA    1 
ATOM   3172 C  C     . SER A 1 419 ? 115.477 174.884 -5.780  1.00 60.07 ? 416 SER A C     1 
ATOM   3173 O  O     . SER A 1 419 ? 114.952 174.560 -6.847  1.00 59.84 ? 416 SER A O     1 
ATOM   3174 C  CB    . SER A 1 419 ? 113.959 176.123 -4.207  1.00 54.22 ? 416 SER A CB    1 
ATOM   3175 O  OG    . SER A 1 419 ? 112.768 175.949 -4.949  1.00 65.42 ? 416 SER A OG    1 
ATOM   3176 N  N     . PRO A 1 420 ? 116.368 174.106 -5.148  1.00 53.49 ? 417 PRO A N     1 
ATOM   3177 C  CA    . PRO A 1 420 ? 117.110 174.472 -3.935  1.00 57.49 ? 417 PRO A CA    1 
ATOM   3178 C  C     . PRO A 1 420 ? 118.217 175.476 -4.241  1.00 53.87 ? 417 PRO A C     1 
ATOM   3179 O  O     . PRO A 1 420 ? 118.701 175.502 -5.372  1.00 57.05 ? 417 PRO A O     1 
ATOM   3180 C  CB    . PRO A 1 420 ? 117.691 173.137 -3.471  1.00 66.24 ? 417 PRO A CB    1 
ATOM   3181 C  CG    . PRO A 1 420 ? 117.897 172.377 -4.744  1.00 60.79 ? 417 PRO A CG    1 
ATOM   3182 C  CD    . PRO A 1 420 ? 116.751 172.774 -5.646  1.00 52.37 ? 417 PRO A CD    1 
ATOM   3183 N  N     . PRO A 1 421 ? 118.599 176.302 -3.254  1.00 62.38 ? 418 PRO A N     1 
ATOM   3184 C  CA    . PRO A 1 421 ? 119.653 177.305 -3.448  1.00 53.61 ? 418 PRO A CA    1 
ATOM   3185 C  C     . PRO A 1 421 ? 120.945 176.705 -4.002  1.00 48.51 ? 418 PRO A C     1 
ATOM   3186 O  O     . PRO A 1 421 ? 121.351 175.618 -3.578  1.00 45.39 ? 418 PRO A O     1 
ATOM   3187 C  CB    . PRO A 1 421 ? 119.871 177.859 -2.037  1.00 49.49 ? 418 PRO A CB    1 
ATOM   3188 C  CG    . PRO A 1 421 ? 118.564 177.642 -1.348  1.00 55.47 ? 418 PRO A CG    1 
ATOM   3189 C  CD    . PRO A 1 421 ? 118.038 176.346 -1.891  1.00 53.93 ? 418 PRO A CD    1 
ATOM   3190 N  N     . LEU A 1 422 ? 121.565 177.404 -4.952  1.00 40.41 ? 419 LEU A N     1 
ATOM   3191 C  CA    . LEU A 1 422 ? 122.819 176.956 -5.559  1.00 41.69 ? 419 LEU A CA    1 
ATOM   3192 C  C     . LEU A 1 422 ? 123.978 177.442 -4.715  1.00 36.77 ? 419 LEU A C     1 
ATOM   3193 O  O     . LEU A 1 422 ? 124.056 178.631 -4.398  1.00 39.08 ? 419 LEU A O     1 
ATOM   3194 C  CB    . LEU A 1 422 ? 122.978 177.480 -6.999  1.00 31.71 ? 419 LEU A CB    1 
ATOM   3195 C  CG    . LEU A 1 422 ? 121.882 177.195 -8.020  1.00 39.19 ? 419 LEU A CG    1 
ATOM   3196 C  CD1   . LEU A 1 422 ? 120.813 178.235 -7.837  1.00 50.73 ? 419 LEU A CD1   1 
ATOM   3197 C  CD2   . LEU A 1 422 ? 122.405 177.225 -9.450  1.00 35.53 ? 419 LEU A CD2   1 
ATOM   3198 N  N     . THR A 1 423 ? 124.875 176.532 -4.351  1.00 34.32 ? 420 THR A N     1 
ATOM   3199 C  CA    . THR A 1 423 ? 126.058 176.913 -3.594  1.00 39.39 ? 420 THR A CA    1 
ATOM   3200 C  C     . THR A 1 423 ? 127.301 176.934 -4.475  1.00 36.55 ? 420 THR A C     1 
ATOM   3201 O  O     . THR A 1 423 ? 128.396 177.247 -4.000  1.00 33.80 ? 420 THR A O     1 
ATOM   3202 C  CB    . THR A 1 423 ? 126.312 175.967 -2.397  1.00 39.99 ? 420 THR A CB    1 
ATOM   3203 O  OG1   . THR A 1 423 ? 126.461 174.621 -2.870  1.00 41.29 ? 420 THR A OG1   1 
ATOM   3204 C  CG2   . THR A 1 423 ? 125.160 176.038 -1.395  1.00 42.82 ? 420 THR A CG2   1 
ATOM   3205 N  N     . MET A 1 424 ? 127.146 176.589 -5.750  1.00 33.85 ? 421 MET A N     1 
ATOM   3206 C  CA    . MET A 1 424 ? 128.235 176.818 -6.696  1.00 31.42 ? 421 MET A CA    1 
ATOM   3207 C  C     . MET A 1 424 ? 127.759 176.875 -8.143  1.00 27.21 ? 421 MET A C     1 
ATOM   3208 O  O     . MET A 1 424 ? 126.754 176.258 -8.525  1.00 35.28 ? 421 MET A O     1 
ATOM   3209 C  CB    . MET A 1 424 ? 129.322 175.746 -6.555  1.00 38.55 ? 421 MET A CB    1 
ATOM   3210 C  CG    . MET A 1 424 ? 129.262 174.660 -7.589  1.00 48.44 ? 421 MET A CG    1 
ATOM   3211 S  SD    . MET A 1 424 ? 130.569 174.809 -8.802  1.00 54.42 ? 421 MET A SD    1 
ATOM   3212 C  CE    . MET A 1 424 ? 131.968 174.174 -7.867  1.00 35.27 ? 421 MET A CE    1 
ATOM   3213 N  N     . LEU A 1 425 ? 128.489 177.658 -8.930  1.00 23.86 ? 422 LEU A N     1 
ATOM   3214 C  CA    . LEU A 1 425 ? 128.336 177.728 -10.373 1.00 18.17 ? 422 LEU A CA    1 
ATOM   3215 C  C     . LEU A 1 425 ? 129.704 177.564 -11.020 1.00 31.54 ? 422 LEU A C     1 
ATOM   3216 O  O     . LEU A 1 425 ? 130.714 178.079 -10.518 1.00 31.67 ? 422 LEU A O     1 
ATOM   3217 C  CB    . LEU A 1 425 ? 127.731 179.052 -10.813 1.00 16.80 ? 422 LEU A CB    1 
ATOM   3218 C  CG    . LEU A 1 425 ? 126.307 179.424 -10.423 1.00 27.08 ? 422 LEU A CG    1 
ATOM   3219 C  CD1   . LEU A 1 425 ? 126.102 180.895 -10.720 1.00 28.15 ? 422 LEU A CD1   1 
ATOM   3220 C  CD2   . LEU A 1 425 ? 125.302 178.591 -11.193 1.00 28.60 ? 422 LEU A CD2   1 
ATOM   3221 N  N     . PHE A 1 426 ? 129.730 176.877 -12.154 1.00 27.80 ? 423 PHE A N     1 
ATOM   3222 C  CA    . PHE A 1 426 ? 130.977 176.542 -12.817 1.00 27.87 ? 423 PHE A CA    1 
ATOM   3223 C  C     . PHE A 1 426 ? 130.754 176.521 -14.317 1.00 25.80 ? 423 PHE A C     1 
ATOM   3224 O  O     . PHE A 1 426 ? 129.908 175.772 -14.803 1.00 35.67 ? 423 PHE A O     1 
ATOM   3225 C  CB    . PHE A 1 426 ? 131.480 175.180 -12.326 1.00 27.90 ? 423 PHE A CB    1 
ATOM   3226 C  CG    . PHE A 1 426 ? 132.814 174.769 -12.898 1.00 38.36 ? 423 PHE A CG    1 
ATOM   3227 C  CD1   . PHE A 1 426 ? 133.767 175.716 -13.254 1.00 39.57 ? 423 PHE A CD1   1 
ATOM   3228 C  CD2   . PHE A 1 426 ? 133.108 173.426 -13.090 1.00 48.32 ? 423 PHE A CD2   1 
ATOM   3229 C  CE1   . PHE A 1 426 ? 134.998 175.329 -13.775 1.00 39.93 ? 423 PHE A CE1   1 
ATOM   3230 C  CE2   . PHE A 1 426 ? 134.330 173.030 -13.610 1.00 44.94 ? 423 PHE A CE2   1 
ATOM   3231 C  CZ    . PHE A 1 426 ? 135.277 173.981 -13.955 1.00 42.05 ? 423 PHE A CZ    1 
ATOM   3232 N  N     . LEU A 1 427 ? 131.483 177.352 -15.054 1.00 26.85 ? 424 LEU A N     1 
ATOM   3233 C  CA    . LEU A 1 427 ? 131.436 177.303 -16.518 1.00 26.73 ? 424 LEU A CA    1 
ATOM   3234 C  C     . LEU A 1 427 ? 132.786 176.839 -17.033 1.00 25.51 ? 424 LEU A C     1 
ATOM   3235 O  O     . LEU A 1 427 ? 133.801 177.379 -16.626 1.00 27.51 ? 424 LEU A O     1 
ATOM   3236 C  CB    . LEU A 1 427 ? 131.101 178.670 -17.118 1.00 24.51 ? 424 LEU A CB    1 
ATOM   3237 C  CG    . LEU A 1 427 ? 129.734 179.308 -16.888 1.00 27.54 ? 424 LEU A CG    1 
ATOM   3238 C  CD1   . LEU A 1 427 ? 129.634 180.598 -17.695 1.00 25.24 ? 424 LEU A CD1   1 
ATOM   3239 C  CD2   . LEU A 1 427 ? 128.577 178.356 -17.217 1.00 23.84 ? 424 LEU A CD2   1 
ATOM   3240 N  N     . CYS A 1 428 ? 132.815 175.859 -17.931 1.00 27.69 ? 425 CYS A N     1 
ATOM   3241 C  CA    . CYS A 1 428 ? 134.103 175.348 -18.420 1.00 23.44 ? 425 CYS A CA    1 
ATOM   3242 C  C     . CYS A 1 428 ? 134.118 175.151 -19.941 1.00 27.66 ? 425 CYS A C     1 
ATOM   3243 O  O     . CYS A 1 428 ? 133.332 174.367 -20.481 1.00 25.31 ? 425 CYS A O     1 
ATOM   3244 C  CB    . CYS A 1 428 ? 134.454 174.027 -17.720 1.00 25.92 ? 425 CYS A CB    1 
ATOM   3245 S  SG    . CYS A 1 428 ? 136.134 173.405 -18.050 1.00 31.67 ? 425 CYS A SG    1 
ATOM   3246 N  N     . ALA A 1 429 ? 135.012 175.866 -20.622 1.00 25.65 ? 426 ALA A N     1 
ATOM   3247 C  CA    . ALA A 1 429 ? 135.189 175.704 -22.059 1.00 21.08 ? 426 ALA A CA    1 
ATOM   3248 C  C     . ALA A 1 429 ? 136.139 174.534 -22.330 1.00 25.77 ? 426 ALA A C     1 
ATOM   3249 O  O     . ALA A 1 429 ? 137.198 174.409 -21.698 1.00 24.19 ? 426 ALA A O     1 
ATOM   3250 C  CB    . ALA A 1 429 ? 135.723 176.976 -22.682 1.00 19.05 ? 426 ALA A CB    1 
ATOM   3251 N  N     . THR A 1 430 ? 135.763 173.679 -23.269 1.00 26.33 ? 427 THR A N     1 
ATOM   3252 C  CA    . THR A 1 430 ? 136.536 172.475 -23.529 1.00 28.01 ? 427 THR A CA    1 
ATOM   3253 C  C     . THR A 1 430 ? 136.389 171.988 -24.971 1.00 28.58 ? 427 THR A C     1 
ATOM   3254 O  O     . THR A 1 430 ? 135.796 172.676 -25.808 1.00 25.04 ? 427 THR A O     1 
ATOM   3255 C  CB    . THR A 1 430 ? 136.129 171.355 -22.565 1.00 31.99 ? 427 THR A CB    1 
ATOM   3256 O  OG1   . THR A 1 430 ? 137.058 170.271 -22.682 1.00 45.33 ? 427 THR A OG1   1 
ATOM   3257 C  CG2   . THR A 1 430 ? 134.702 170.876 -22.864 1.00 26.45 ? 427 THR A CG2   1 
ATOM   3258 N  N     . LYS A 1 431 ? 136.949 170.807 -25.244 1.00 29.58 ? 428 LYS A N     1 
ATOM   3259 C  CA    . LYS A 1 431 ? 136.996 170.226 -26.588 1.00 25.94 ? 428 LYS A CA    1 
ATOM   3260 C  C     . LYS A 1 431 ? 137.520 171.241 -27.614 1.00 24.46 ? 428 LYS A C     1 
ATOM   3261 O  O     . LYS A 1 431 ? 136.777 171.737 -28.464 1.00 27.92 ? 428 LYS A O     1 
ATOM   3262 C  CB    . LYS A 1 431 ? 135.620 169.700 -26.995 1.00 22.34 ? 428 LYS A CB    1 
ATOM   3263 C  CG    . LYS A 1 431 ? 135.104 168.582 -26.103 1.00 34.95 ? 428 LYS A CG    1 
ATOM   3264 C  CD    . LYS A 1 431 ? 133.962 167.812 -26.768 1.00 39.58 ? 428 LYS A CD    1 
ATOM   3265 C  CE    . LYS A 1 431 ? 133.313 166.811 -25.811 1.00 40.38 ? 428 LYS A CE    1 
ATOM   3266 N  NZ    . LYS A 1 431 ? 134.244 165.748 -25.332 1.00 42.32 ? 428 LYS A NZ    1 
ATOM   3267 N  N     . PHE A 1 432 ? 138.800 171.557 -27.497 1.00 23.19 ? 429 PHE A N     1 
ATOM   3268 C  CA    . PHE A 1 432 ? 139.452 172.545 -28.338 1.00 26.71 ? 429 PHE A CA    1 
ATOM   3269 C  C     . PHE A 1 432 ? 139.802 171.966 -29.702 1.00 33.41 ? 429 PHE A C     1 
ATOM   3270 O  O     . PHE A 1 432 ? 140.120 170.784 -29.816 1.00 35.01 ? 429 PHE A O     1 
ATOM   3271 C  CB    . PHE A 1 432 ? 140.731 173.066 -27.661 1.00 25.53 ? 429 PHE A CB    1 
ATOM   3272 C  CG    . PHE A 1 432 ? 140.476 174.050 -26.552 1.00 26.53 ? 429 PHE A CG    1 
ATOM   3273 C  CD1   . PHE A 1 432 ? 140.224 173.616 -25.258 1.00 35.56 ? 429 PHE A CD1   1 
ATOM   3274 C  CD2   . PHE A 1 432 ? 140.480 175.411 -26.807 1.00 26.30 ? 429 PHE A CD2   1 
ATOM   3275 C  CE1   . PHE A 1 432 ? 139.988 174.529 -24.233 1.00 35.56 ? 429 PHE A CE1   1 
ATOM   3276 C  CE2   . PHE A 1 432 ? 140.240 176.328 -25.797 1.00 26.53 ? 429 PHE A CE2   1 
ATOM   3277 C  CZ    . PHE A 1 432 ? 139.997 175.887 -24.507 1.00 28.68 ? 429 PHE A CZ    1 
ATOM   3278 N  N     . SER A 1 433 ? 139.754 172.811 -30.725 1.00 28.32 ? 430 SER A N     1 
ATOM   3279 C  CA    . SER A 1 433 ? 140.231 172.456 -32.061 1.00 35.41 ? 430 SER A CA    1 
ATOM   3280 C  C     . SER A 1 433 ? 141.169 173.537 -32.569 1.00 31.31 ? 430 SER A C     1 
ATOM   3281 O  O     . SER A 1 433 ? 140.986 174.717 -32.258 1.00 27.54 ? 430 SER A O     1 
ATOM   3282 C  CB    . SER A 1 433 ? 139.065 172.287 -33.046 1.00 35.30 ? 430 SER A CB    1 
ATOM   3283 O  OG    . SER A 1 433 ? 138.019 171.518 -32.483 1.00 44.55 ? 430 SER A OG    1 
ATOM   3284 N  N     . ALA A 1 434 ? 142.177 173.149 -33.346 1.00 27.72 ? 431 ALA A N     1 
ATOM   3285 C  CA    . ALA A 1 434 ? 142.949 174.154 -34.074 1.00 33.61 ? 431 ALA A CA    1 
ATOM   3286 C  C     . ALA A 1 434 ? 142.041 174.692 -35.190 1.00 36.33 ? 431 ALA A C     1 
ATOM   3287 O  O     . ALA A 1 434 ? 141.277 173.930 -35.795 1.00 51.08 ? 431 ALA A O     1 
ATOM   3288 N  N     . SER A 1 435 ? 142.113 175.987 -35.478 1.00 45.95 ? 432 SER A N     1 
ATOM   3289 C  CA    . SER A 1 435 ? 142.991 176.920 -34.797 1.00 28.12 ? 432 SER A CA    1 
ATOM   3290 C  C     . SER A 1 435 ? 142.143 177.990 -34.115 1.00 44.12 ? 432 SER A C     1 
ATOM   3291 O  O     . SER A 1 435 ? 141.214 178.522 -34.721 1.00 45.10 ? 432 SER A O     1 
ATOM   3292 C  CB    . SER A 1 435 ? 143.960 177.594 -35.775 1.00 38.68 ? 432 SER A CB    1 
ATOM   3293 O  OG    . SER A 1 435 ? 143.429 178.836 -36.196 1.00 28.99 ? 432 SER A OG    1 
ATOM   3294 C  "C4'" A DA  B 2 2   ? 134.697 176.836 6.313   0.87 46.87 ? 2   DA  T "C4'" 1 
ATOM   3295 O  "O4'" A DA  B 2 2   ? 133.949 175.900 7.129   0.87 56.56 ? 2   DA  T "O4'" 1 
ATOM   3296 C  "C3'" A DA  B 2 2   ? 134.903 176.134 4.978   0.87 46.57 ? 2   DA  T "C3'" 1 
ATOM   3297 O  "O3'" A DA  B 2 2   ? 136.079 175.339 5.021   0.87 49.50 ? 2   DA  T "O3'" 1 
ATOM   3298 C  "C2'" A DA  B 2 2   ? 133.649 175.272 4.868   0.87 47.87 ? 2   DA  T "C2'" 1 
ATOM   3299 C  "C1'" A DA  B 2 2   ? 133.437 174.852 6.320   0.87 54.96 ? 2   DA  T "C1'" 1 
ATOM   3300 P  P     A DT  B 2 3   ? 137.272 175.609 3.981   0.50 44.43 ? 3   DT  T P     1 
ATOM   3301 P  P     B DT  B 2 3   ? 129.848 175.509 4.605   0.50 54.72 ? 3   DT  T P     1 
ATOM   3302 O  OP1   A DT  B 2 3   ? 136.633 175.738 2.652   0.50 50.99 ? 3   DT  T OP1   1 
ATOM   3303 O  OP1   B DT  B 2 3   ? 130.641 174.504 5.349   0.50 42.18 ? 3   DT  T OP1   1 
ATOM   3304 O  OP2   A DT  B 2 3   ? 138.313 174.579 4.188   0.50 45.85 ? 3   DT  T OP2   1 
ATOM   3305 O  OP2   B DT  B 2 3   ? 128.980 176.451 5.349   0.50 49.27 ? 3   DT  T OP2   1 
ATOM   3306 O  "O5'" A DT  B 2 3   ? 137.854 177.033 4.443   0.50 46.53 ? 3   DT  T "O5'" 1 
ATOM   3307 O  "O5'" B DT  B 2 3   ? 130.822 176.368 3.662   0.50 44.50 ? 3   DT  T "O5'" 1 
ATOM   3308 C  "C5'" A DT  B 2 3   ? 139.166 177.434 4.075   0.50 39.78 ? 3   DT  T "C5'" 1 
ATOM   3309 C  "C5'" B DT  B 2 3   ? 132.177 175.968 3.469   0.50 45.57 ? 3   DT  T "C5'" 1 
ATOM   3310 C  "C4'" A DT  B 2 3   ? 139.124 178.583 3.086   0.50 43.12 ? 3   DT  T "C4'" 1 
ATOM   3311 C  "C4'" B DT  B 2 3   ? 132.934 177.001 2.651   0.50 48.95 ? 3   DT  T "C4'" 1 
ATOM   3312 O  "O4'" A DT  B 2 3   ? 140.408 178.711 2.424   0.50 40.38 ? 3   DT  T "O4'" 1 
ATOM   3313 O  "O4'" B DT  B 2 3   ? 132.181 178.237 2.636   0.50 49.86 ? 3   DT  T "O4'" 1 
ATOM   3314 C  "C3'" A DT  B 2 3   ? 138.086 178.406 1.997   0.50 39.90 ? 3   DT  T "C3'" 1 
ATOM   3315 C  "C3'" B DT  B 2 3   ? 134.280 177.400 3.219   0.50 47.43 ? 3   DT  T "C3'" 1 
ATOM   3316 O  "O3'" A DT  B 2 3   ? 137.206 179.559 1.905   0.50 44.60 ? 3   DT  T "O3'" 1 
ATOM   3317 O  "O3'" B DT  B 2 3   ? 135.123 177.982 2.191   0.50 51.27 ? 3   DT  T "O3'" 1 
ATOM   3318 C  "C2'" A DT  B 2 3   ? 138.863 178.081 0.714   0.50 40.39 ? 3   DT  T "C2'" 1 
ATOM   3319 C  "C2'" B DT  B 2 3   ? 133.852 178.459 4.231   0.50 48.82 ? 3   DT  T "C2'" 1 
ATOM   3320 C  "C1'" A DT  B 2 3   ? 140.335 178.260 1.084   0.50 38.20 ? 3   DT  T "C1'" 1 
ATOM   3321 C  "C1'" B DT  B 2 3   ? 132.888 179.228 3.352   0.50 46.95 ? 3   DT  T "C1'" 1 
ATOM   3322 N  N1    A DT  B 2 3   ? 141.158 177.013 0.956   0.50 34.29 ? 3   DT  T N1    1 
ATOM   3323 N  N1    B DT  B 2 3   ? 131.889 180.116 4.031   0.50 44.81 ? 3   DT  T N1    1 
ATOM   3324 C  C2    A DT  B 2 3   ? 142.396 177.090 0.374   0.50 32.89 ? 3   DT  T C2    1 
ATOM   3325 C  C2    B DT  B 2 3   ? 131.023 179.603 4.974   0.50 43.87 ? 3   DT  T C2    1 
ATOM   3326 O  O2    A DT  B 2 3   ? 142.859 178.127 -0.062  0.50 39.35 ? 3   DT  T O2    1 
ATOM   3327 O  O2    B DT  B 2 3   ? 131.053 178.450 5.361   0.50 49.92 ? 3   DT  T O2    1 
ATOM   3328 N  N3    A DT  B 2 3   ? 143.081 175.908 0.320   0.50 27.68 ? 3   DT  T N3    1 
ATOM   3329 N  N3    B DT  B 2 3   ? 130.122 180.511 5.471   0.50 41.06 ? 3   DT  T N3    1 
ATOM   3330 C  C4    A DT  B 2 3   ? 142.652 174.677 0.777   0.50 33.09 ? 3   DT  T C4    1 
ATOM   3331 C  C4    B DT  B 2 3   ? 129.992 181.840 5.115   0.50 39.11 ? 3   DT  T C4    1 
ATOM   3332 O  O4    A DT  B 2 3   ? 143.338 173.669 0.682   0.50 32.08 ? 3   DT  T O4    1 
ATOM   3333 O  O4    B DT  B 2 3   ? 129.151 182.572 5.616   0.50 48.34 ? 3   DT  T O4    1 
ATOM   3334 C  C5    A DT  B 2 3   ? 141.339 174.664 1.376   0.50 31.88 ? 3   DT  T C5    1 
ATOM   3335 C  C5    B DT  B 2 3   ? 130.912 182.303 4.107   0.50 40.73 ? 3   DT  T C5    1 
ATOM   3336 C  C7    A DT  B 2 3   ? 140.763 173.385 1.911   0.50 39.05 ? 3   DT  T C7    1 
ATOM   3337 C  C7    B DT  B 2 3   ? 130.866 183.725 3.634   0.50 38.07 ? 3   DT  T C7    1 
ATOM   3338 C  C6    A DT  B 2 3   ? 140.665 175.818 1.435   0.50 36.67 ? 3   DT  T C6    1 
ATOM   3339 C  C6    B DT  B 2 3   ? 131.794 181.428 3.614   0.50 42.06 ? 3   DT  T C6    1 
ATOM   3340 P  P     A DG  B 2 4   ? 137.659 181.010 1.359   0.32 47.79 ? 4   DG  T P     1 
ATOM   3341 P  P     B DG  B 2 4   ? 134.709 178.056 0.627   0.68 57.31 ? 4   DG  T P     1 
ATOM   3342 O  OP1   A DG  B 2 4   ? 138.785 180.996 0.398   0.32 44.65 ? 4   DG  T OP1   1 
ATOM   3343 O  OP1   B DG  B 2 4   ? 133.570 178.966 0.382   0.68 51.08 ? 4   DG  T OP1   1 
ATOM   3344 O  OP2   A DG  B 2 4   ? 137.806 181.910 2.496   0.32 45.63 ? 4   DG  T OP2   1 
ATOM   3345 O  OP2   B DG  B 2 4   ? 134.709 176.699 0.048   0.68 52.32 ? 4   DG  T OP2   1 
ATOM   3346 O  "O5'" A DG  B 2 4   ? 136.318 181.532 0.684   0.32 42.25 ? 4   DG  T "O5'" 1 
ATOM   3347 O  "O5'" B DG  B 2 4   ? 135.948 178.825 -0.009  0.68 53.02 ? 4   DG  T "O5'" 1 
ATOM   3348 C  "C5'" A DG  B 2 4   ? 135.650 180.716 -0.246  0.32 45.28 ? 4   DG  T "C5'" 1 
ATOM   3349 C  "C5'" B DG  B 2 4   ? 135.905 180.238 -0.183  0.68 44.26 ? 4   DG  T "C5'" 1 
ATOM   3350 C  "C4'" A DG  B 2 4   ? 136.441 180.666 -1.530  0.32 46.12 ? 4   DG  T "C4'" 1 
ATOM   3351 C  "C4'" B DG  B 2 4   ? 136.555 180.624 -1.500  0.68 46.26 ? 4   DG  T "C4'" 1 
ATOM   3352 O  "O4'" A DG  B 2 4   ? 137.464 179.637 -1.449  0.32 46.07 ? 4   DG  T "O4'" 1 
ATOM   3353 O  "O4'" B DG  B 2 4   ? 137.736 179.805 -1.691  0.68 47.86 ? 4   DG  T "O4'" 1 
ATOM   3354 C  "C3'" A DG  B 2 4   ? 135.647 180.341 -2.783  0.32 44.03 ? 4   DG  T "C3'" 1 
ATOM   3355 C  "C3'" B DG  B 2 4   ? 135.713 180.352 -2.744  0.68 44.05 ? 4   DG  T "C3'" 1 
ATOM   3356 O  "O3'" A DG  B 2 4   ? 136.218 181.058 -3.839  0.32 44.12 ? 4   DG  T "O3'" 1 
ATOM   3357 O  "O3'" B DG  B 2 4   ? 136.237 181.098 -3.834  0.68 44.22 ? 4   DG  T "O3'" 1 
ATOM   3358 C  "C2'" A DG  B 2 4   ? 135.910 178.848 -2.940  0.32 44.72 ? 4   DG  T "C2'" 1 
ATOM   3359 C  "C2'" B DG  B 2 4   ? 135.981 178.874 -2.948  0.68 44.84 ? 4   DG  T "C2'" 1 
ATOM   3360 C  "C1'" A DG  B 2 4   ? 137.375 178.843 -2.602  0.32 45.09 ? 4   DG  T "C1'" 1 
ATOM   3361 C  "C1'" B DG  B 2 4   ? 137.482 178.878 -2.738  0.68 45.34 ? 4   DG  T "C1'" 1 
ATOM   3362 N  N9    A DG  B 2 4   ? 137.955 177.533 -2.337  0.32 42.87 ? 4   DG  T N9    1 
ATOM   3363 N  N9    B DG  B 2 4   ? 138.062 177.590 -2.386  0.68 43.12 ? 4   DG  T N9    1 
ATOM   3364 C  C8    A DG  B 2 4   ? 137.361 176.431 -1.765  0.32 39.67 ? 4   DG  T C8    1 
ATOM   3365 C  C8    B DG  B 2 4   ? 137.484 176.523 -1.731  0.68 39.60 ? 4   DG  T C8    1 
ATOM   3366 N  N7    A DG  B 2 4   ? 138.170 175.407 -1.662  0.32 37.48 ? 4   DG  T N7    1 
ATOM   3367 N  N7    B DG  B 2 4   ? 138.306 175.512 -1.578  0.68 37.34 ? 4   DG  T N7    1 
ATOM   3368 C  C5    A DG  B 2 4   ? 139.365 175.869 -2.202  0.32 35.63 ? 4   DG  T C5    1 
ATOM   3369 C  C5    B DG  B 2 4   ? 139.484 175.953 -2.169  0.68 35.57 ? 4   DG  T C5    1 
ATOM   3370 C  C6    A DG  B 2 4   ? 140.612 175.220 -2.372  0.32 34.23 ? 4   DG  T C6    1 
ATOM   3371 C  C6    B DG  B 2 4   ? 140.739 175.316 -2.325  0.68 34.45 ? 4   DG  T C6    1 
ATOM   3372 O  O6    A DG  B 2 4   ? 140.924 174.058 -2.067  0.32 28.67 ? 4   DG  T O6    1 
ATOM   3373 O  O6    B DG  B 2 4   ? 141.082 174.176 -1.956  0.68 28.15 ? 4   DG  T O6    1 
ATOM   3374 N  N1    A DG  B 2 4   ? 141.552 176.069 -2.964  0.32 30.03 ? 4   DG  T N1    1 
ATOM   3375 N  N1    B DG  B 2 4   ? 141.649 176.152 -2.991  0.68 29.69 ? 4   DG  T N1    1 
ATOM   3376 C  C2    A DG  B 2 4   ? 141.305 177.370 -3.336  0.32 33.73 ? 4   DG  T C2    1 
ATOM   3377 C  C2    B DG  B 2 4   ? 141.358 177.427 -3.432  0.68 33.74 ? 4   DG  T C2    1 
ATOM   3378 N  N2    A DG  B 2 4   ? 142.311 178.040 -3.890  0.32 34.85 ? 4   DG  T N2    1 
ATOM   3379 N  N2    B DG  B 2 4   ? 142.319 178.095 -4.050  0.68 34.99 ? 4   DG  T N2    1 
ATOM   3380 N  N3    A DG  B 2 4   ? 140.151 177.975 -3.183  0.32 36.02 ? 4   DG  T N3    1 
ATOM   3381 N  N3    B DG  B 2 4   ? 140.203 178.007 -3.289  0.68 35.97 ? 4   DG  T N3    1 
ATOM   3382 C  C4    A DG  B 2 4   ? 139.235 177.172 -2.615  0.32 38.84 ? 4   DG  T C4    1 
ATOM   3383 C  C4    B DG  B 2 4   ? 139.327 177.226 -2.659  0.68 38.94 ? 4   DG  T C4    1 
ATOM   3384 P  P     . DA  B 2 5   ? 135.534 181.045 -5.283  1.00 42.12 ? 5   DA  T P     1 
ATOM   3385 O  OP1   . DA  B 2 5   ? 135.366 182.458 -5.692  1.00 33.97 ? 5   DA  T OP1   1 
ATOM   3386 O  OP2   . DA  B 2 5   ? 134.385 180.108 -5.230  1.00 32.74 ? 5   DA  T OP2   1 
ATOM   3387 O  "O5'" . DA  B 2 5   ? 136.688 180.490 -6.248  1.00 39.54 ? 5   DA  T "O5'" 1 
ATOM   3388 C  "C5'" . DA  B 2 5   ? 137.805 181.332 -6.559  1.00 34.95 ? 5   DA  T "C5'" 1 
ATOM   3389 C  "C4'" . DA  B 2 5   ? 138.797 180.617 -7.451  1.00 34.67 ? 5   DA  T "C4'" 1 
ATOM   3390 O  "O4'" . DA  B 2 5   ? 139.332 179.463 -6.742  1.00 32.50 ? 5   DA  T "O4'" 1 
ATOM   3391 C  "C3'" . DA  B 2 5   ? 138.205 180.083 -8.767  1.00 26.30 ? 5   DA  T "C3'" 1 
ATOM   3392 O  "O3'" . DA  B 2 5   ? 139.057 180.401 -9.844  1.00 28.90 ? 5   DA  T "O3'" 1 
ATOM   3393 C  "C2'" . DA  B 2 5   ? 138.133 178.577 -8.539  1.00 33.90 ? 5   DA  T "C2'" 1 
ATOM   3394 C  "C1'" . DA  B 2 5   ? 139.320 178.363 -7.610  1.00 35.75 ? 5   DA  T "C1'" 1 
ATOM   3395 N  N9    . DA  B 2 5   ? 139.225 177.131 -6.843  1.00 31.08 ? 5   DA  T N9    1 
ATOM   3396 C  C8    . DA  B 2 5   ? 138.122 176.621 -6.216  1.00 28.88 ? 5   DA  T C8    1 
ATOM   3397 N  N7    . DA  B 2 5   ? 138.337 175.461 -5.631  1.00 27.88 ? 5   DA  T N7    1 
ATOM   3398 C  C5    . DA  B 2 5   ? 139.670 175.194 -5.911  1.00 33.65 ? 5   DA  T C5    1 
ATOM   3399 C  C6    . DA  B 2 5   ? 140.515 174.121 -5.579  1.00 29.07 ? 5   DA  T C6    1 
ATOM   3400 N  N6    . DA  B 2 5   ? 140.123 173.064 -4.863  1.00 22.89 ? 5   DA  T N6    1 
ATOM   3401 N  N1    . DA  B 2 5   ? 141.784 174.174 -6.016  1.00 31.36 ? 5   DA  T N1    1 
ATOM   3402 C  C2    . DA  B 2 5   ? 142.185 175.231 -6.725  1.00 27.23 ? 5   DA  T C2    1 
ATOM   3403 N  N3    . DA  B 2 5   ? 141.487 176.293 -7.109  1.00 31.99 ? 5   DA  T N3    1 
ATOM   3404 C  C4    . DA  B 2 5   ? 140.224 176.210 -6.664  1.00 32.62 ? 5   DA  T C4    1 
ATOM   3405 P  P     . DT  B 2 6   ? 138.512 180.328 -11.351 1.00 34.41 ? 6   DT  T P     1 
ATOM   3406 O  OP1   . DT  B 2 6   ? 139.630 180.736 -12.242 1.00 38.22 ? 6   DT  T OP1   1 
ATOM   3407 O  OP2   . DT  B 2 6   ? 137.240 181.091 -11.423 1.00 30.20 ? 6   DT  T OP2   1 
ATOM   3408 O  "O5'" . DT  B 2 6   ? 138.147 178.781 -11.522 1.00 32.95 ? 6   DT  T "O5'" 1 
ATOM   3409 C  "C5'" . DT  B 2 6   ? 138.849 177.980 -12.431 1.00 34.78 ? 6   DT  T "C5'" 1 
ATOM   3410 C  "C4'" . DT  B 2 6   ? 140.076 177.345 -11.805 1.00 31.41 ? 6   DT  T "C4'" 1 
ATOM   3411 O  "O4'" . DT  B 2 6   ? 139.726 176.666 -10.579 1.00 33.78 ? 6   DT  T "O4'" 1 
ATOM   3412 C  "C3'" . DT  B 2 6   ? 140.675 176.264 -12.678 1.00 34.49 ? 6   DT  T "C3'" 1 
ATOM   3413 O  "O3'" . DT  B 2 6   ? 141.646 176.820 -13.502 1.00 35.68 ? 6   DT  T "O3'" 1 
ATOM   3414 C  "C2'" . DT  B 2 6   ? 141.281 175.255 -11.702 1.00 31.54 ? 6   DT  T "C2'" 1 
ATOM   3415 C  "C1'" . DT  B 2 6   ? 140.671 175.635 -10.354 1.00 29.20 ? 6   DT  T "C1'" 1 
ATOM   3416 N  N1    . DT  B 2 6   ? 140.012 174.496 -9.650  1.00 28.06 ? 6   DT  T N1    1 
ATOM   3417 C  C2    . DT  B 2 6   ? 140.777 173.417 -9.266  1.00 30.96 ? 6   DT  T C2    1 
ATOM   3418 O  O2    . DT  B 2 6   ? 141.976 173.320 -9.503  1.00 24.67 ? 6   DT  T O2    1 
ATOM   3419 N  N3    . DT  B 2 6   ? 140.092 172.442 -8.590  1.00 27.83 ? 6   DT  T N3    1 
ATOM   3420 C  C4    . DT  B 2 6   ? 138.748 172.435 -8.259  1.00 28.14 ? 6   DT  T C4    1 
ATOM   3421 O  O4    . DT  B 2 6   ? 138.230 171.507 -7.646  1.00 28.47 ? 6   DT  T O4    1 
ATOM   3422 C  C5    . DT  B 2 6   ? 138.001 173.596 -8.679  1.00 26.19 ? 6   DT  T C5    1 
ATOM   3423 C  C7    . DT  B 2 6   ? 136.541 173.697 -8.363  1.00 30.42 ? 6   DT  T C7    1 
ATOM   3424 C  C6    . DT  B 2 6   ? 138.658 174.564 -9.350  1.00 26.19 ? 6   DT  T C6    1 
ATOM   3425 P  P     . DG  B 2 7   ? 141.684 176.399 -15.045 1.00 31.59 ? 7   DG  T P     1 
ATOM   3426 O  OP1   . DG  B 2 7   ? 142.830 177.128 -15.618 1.00 31.53 ? 7   DG  T OP1   1 
ATOM   3427 O  OP2   . DG  B 2 7   ? 140.320 176.497 -15.620 1.00 34.78 ? 7   DG  T OP2   1 
ATOM   3428 O  "O5'" . DG  B 2 7   ? 141.999 174.824 -15.009 1.00 38.32 ? 7   DG  T "O5'" 1 
ATOM   3429 C  "C5'" . DG  B 2 7   ? 143.318 174.373 -15.059 1.00 32.30 ? 7   DG  T "C5'" 1 
ATOM   3430 C  "C4'" . DG  B 2 7   ? 143.399 172.888 -14.759 1.00 31.81 ? 7   DG  T "C4'" 1 
ATOM   3431 O  "O4'" . DG  B 2 7   ? 142.640 172.570 -13.589 1.00 32.55 ? 7   DG  T "O4'" 1 
ATOM   3432 C  "C3'" . DG  B 2 7   ? 142.851 171.946 -15.838 1.00 32.32 ? 7   DG  T "C3'" 1 
ATOM   3433 O  "O3'" . DG  B 2 7   ? 143.922 171.481 -16.639 1.00 32.36 ? 7   DG  T "O3'" 1 
ATOM   3434 C  "C2'" . DG  B 2 7   ? 142.217 170.795 -15.026 1.00 28.33 ? 7   DG  T "C2'" 1 
ATOM   3435 C  "C1'" . DG  B 2 7   ? 142.517 171.184 -13.578 1.00 26.60 ? 7   DG  T "C1'" 1 
ATOM   3436 N  N9    . DG  B 2 7   ? 141.464 170.797 -12.653 1.00 33.50 ? 7   DG  T N9    1 
ATOM   3437 C  C8    . DG  B 2 7   ? 140.267 171.431 -12.447 1.00 29.06 ? 7   DG  T C8    1 
ATOM   3438 N  N7    . DG  B 2 7   ? 139.507 170.827 -11.580 1.00 25.51 ? 7   DG  T N7    1 
ATOM   3439 C  C5    . DG  B 2 7   ? 140.250 169.718 -11.191 1.00 28.48 ? 7   DG  T C5    1 
ATOM   3440 C  C6    . DG  B 2 7   ? 139.942 168.697 -10.264 1.00 23.85 ? 7   DG  T C6    1 
ATOM   3441 O  O6    . DG  B 2 7   ? 138.916 168.571 -9.585  1.00 25.39 ? 7   DG  T O6    1 
ATOM   3442 N  N1    . DG  B 2 7   ? 140.970 167.746 -10.173 1.00 24.00 ? 7   DG  T N1    1 
ATOM   3443 C  C2    . DG  B 2 7   ? 142.156 167.802 -10.880 1.00 27.15 ? 7   DG  T C2    1 
ATOM   3444 N  N2    . DG  B 2 7   ? 143.035 166.808 -10.662 1.00 24.92 ? 7   DG  T N2    1 
ATOM   3445 N  N3    . DG  B 2 7   ? 142.450 168.759 -11.753 1.00 26.92 ? 7   DG  T N3    1 
ATOM   3446 C  C4    . DG  B 2 7   ? 141.454 169.682 -11.848 1.00 26.95 ? 7   DG  T C4    1 
ATOM   3447 P  P     . DA  B 2 8   ? 143.678 170.418 -17.824 1.00 34.31 ? 8   DA  T P     1 
ATOM   3448 O  OP1   . DA  B 2 8   ? 144.778 170.651 -18.763 1.00 31.04 ? 8   DA  T OP1   1 
ATOM   3449 O  OP2   . DA  B 2 8   ? 142.285 170.425 -18.340 1.00 33.84 ? 8   DA  T OP2   1 
ATOM   3450 O  "O5'" . DA  B 2 8   ? 143.898 169.010 -17.113 1.00 34.64 ? 8   DA  T "O5'" 1 
ATOM   3451 C  "C5'" . DA  B 2 8   ? 145.144 168.690 -16.508 1.00 33.60 ? 8   DA  T "C5'" 1 
ATOM   3452 C  "C4'" . DA  B 2 8   ? 145.167 167.221 -16.130 1.00 29.48 ? 8   DA  T "C4'" 1 
ATOM   3453 O  "O4'" . DA  B 2 8   ? 144.271 167.020 -15.010 1.00 29.72 ? 8   DA  T "O4'" 1 
ATOM   3454 C  "C3'" . DA  B 2 8   ? 144.694 166.285 -17.245 1.00 28.62 ? 8   DA  T "C3'" 1 
ATOM   3455 O  "O3'" . DA  B 2 8   ? 145.543 165.148 -17.364 1.00 33.12 ? 8   DA  T "O3'" 1 
ATOM   3456 C  "C2'" . DA  B 2 8   ? 143.276 165.906 -16.832 1.00 28.73 ? 8   DA  T "C2'" 1 
ATOM   3457 C  "C1'" . DA  B 2 8   ? 143.335 166.015 -15.309 1.00 31.91 ? 8   DA  T "C1'" 1 
ATOM   3458 N  N9    . DA  B 2 8   ? 142.047 166.379 -14.725 1.00 29.56 ? 8   DA  T N9    1 
ATOM   3459 C  C8    . DA  B 2 8   ? 141.232 167.405 -15.113 1.00 29.81 ? 8   DA  T C8    1 
ATOM   3460 N  N7    . DA  B 2 8   ? 140.124 167.488 -14.426 1.00 22.53 ? 8   DA  T N7    1 
ATOM   3461 C  C5    . DA  B 2 8   ? 140.207 166.429 -13.542 1.00 23.40 ? 8   DA  T C5    1 
ATOM   3462 C  C6    . DA  B 2 8   ? 139.339 165.965 -12.538 1.00 19.29 ? 8   DA  T C6    1 
ATOM   3463 N  N6    . DA  B 2 8   ? 138.161 166.543 -12.259 1.00 25.01 ? 8   DA  T N6    1 
ATOM   3464 N  N1    . DA  B 2 8   ? 139.730 164.886 -11.821 1.00 24.49 ? 8   DA  T N1    1 
ATOM   3465 C  C2    . DA  B 2 8   ? 140.909 164.316 -12.097 1.00 21.20 ? 8   DA  T C2    1 
ATOM   3466 N  N3    . DA  B 2 8   ? 141.810 164.663 -13.012 1.00 26.93 ? 8   DA  T N3    1 
ATOM   3467 C  C4    . DA  B 2 8   ? 141.389 165.738 -13.712 1.00 28.27 ? 8   DA  T C4    1 
ATOM   3468 P  P     . DC  B 2 9   ? 145.357 164.118 -18.596 1.00 36.47 ? 9   DC  T P     1 
ATOM   3469 O  OP1   . DC  B 2 9   ? 146.675 163.501 -18.816 1.00 37.99 ? 9   DC  T OP1   1 
ATOM   3470 O  OP2   . DC  B 2 9   ? 144.635 164.716 -19.748 1.00 34.81 ? 9   DC  T OP2   1 
ATOM   3471 O  "O5'" . DC  B 2 9   ? 144.408 162.995 -17.995 1.00 31.84 ? 9   DC  T "O5'" 1 
ATOM   3472 C  "C5'" . DC  B 2 9   ? 144.915 162.164 -16.992 1.00 34.40 ? 9   DC  T "C5'" 1 
ATOM   3473 C  "C4'" . DC  B 2 9   ? 143.799 161.398 -16.352 1.00 34.23 ? 9   DC  T "C4'" 1 
ATOM   3474 O  "O4'" . DC  B 2 9   ? 142.792 162.318 -15.911 1.00 35.20 ? 9   DC  T "O4'" 1 
ATOM   3475 C  "C3'" . DC  B 2 9   ? 143.081 160.418 -17.290 1.00 41.61 ? 9   DC  T "C3'" 1 
ATOM   3476 O  "O3'" . DC  B 2 9   ? 143.303 159.113 -16.822 1.00 43.59 ? 9   DC  T "O3'" 1 
ATOM   3477 C  "C2'" . DC  B 2 9   ? 141.598 160.815 -17.185 1.00 30.48 ? 9   DC  T "C2'" 1 
ATOM   3478 C  "C1'" . DC  B 2 9   ? 141.586 161.628 -15.904 1.00 29.93 ? 9   DC  T "C1'" 1 
ATOM   3479 N  N1    . DC  B 2 9   ? 140.475 162.594 -15.814 1.00 26.35 ? 9   DC  T N1    1 
ATOM   3480 C  C2    . DC  B 2 9   ? 139.568 162.455 -14.782 1.00 27.66 ? 9   DC  T C2    1 
ATOM   3481 O  O2    . DC  B 2 9   ? 139.737 161.538 -13.974 1.00 26.80 ? 9   DC  T O2    1 
ATOM   3482 N  N3    . DC  B 2 9   ? 138.534 163.328 -14.687 1.00 28.59 ? 9   DC  T N3    1 
ATOM   3483 C  C4    . DC  B 2 9   ? 138.394 164.301 -15.592 1.00 28.05 ? 9   DC  T C4    1 
ATOM   3484 N  N4    . DC  B 2 9   ? 137.350 165.136 -15.461 1.00 25.59 ? 9   DC  T N4    1 
ATOM   3485 C  C5    . DC  B 2 9   ? 139.314 164.457 -16.671 1.00 33.21 ? 9   DC  T C5    1 
ATOM   3486 C  C6    . DC  B 2 9   ? 140.337 163.588 -16.740 1.00 33.56 ? 9   DC  T C6    1 
ATOM   3487 P  P     . DG  B 2 10  ? 142.763 157.841 -17.631 1.00 36.85 ? 10  DG  T P     1 
ATOM   3488 O  OP1   . DG  B 2 10  ? 143.926 156.946 -17.796 1.00 46.51 ? 10  DG  T OP1   1 
ATOM   3489 O  OP2   . DG  B 2 10  ? 141.987 158.230 -18.830 1.00 31.98 ? 10  DG  T OP2   1 
ATOM   3490 O  "O5'" . DG  B 2 10  ? 141.748 157.188 -16.605 1.00 37.41 ? 10  DG  T "O5'" 1 
ATOM   3491 C  "C5'" . DG  B 2 10  ? 142.067 157.131 -15.224 1.00 32.66 ? 10  DG  T "C5'" 1 
ATOM   3492 C  "C4'" . DG  B 2 10  ? 140.931 156.492 -14.462 1.00 34.34 ? 10  DG  T "C4'" 1 
ATOM   3493 O  "O4'" . DG  B 2 10  ? 139.909 157.484 -14.223 1.00 34.64 ? 10  DG  T "O4'" 1 
ATOM   3494 C  "C3'" . DG  B 2 10  ? 140.247 155.340 -15.200 1.00 35.33 ? 10  DG  T "C3'" 1 
ATOM   3495 O  "O3'" . DG  B 2 10  ? 139.870 154.328 -14.274 1.00 44.58 ? 10  DG  T "O3'" 1 
ATOM   3496 C  "C2'" . DG  B 2 10  ? 139.036 156.013 -15.849 1.00 35.49 ? 10  DG  T "C2'" 1 
ATOM   3497 C  "C1'" . DG  B 2 10  ? 138.697 157.109 -14.844 1.00 36.50 ? 10  DG  T "C1'" 1 
ATOM   3498 N  N9    . DG  B 2 10  ? 138.095 158.306 -15.450 1.00 29.44 ? 10  DG  T N9    1 
ATOM   3499 C  C8    . DG  B 2 10  ? 138.641 159.091 -16.436 1.00 28.67 ? 10  DG  T C8    1 
ATOM   3500 N  N7    . DG  B 2 10  ? 137.885 160.097 -16.782 1.00 29.89 ? 10  DG  T N7    1 
ATOM   3501 C  C5    . DG  B 2 10  ? 136.762 159.980 -15.968 1.00 30.25 ? 10  DG  T C5    1 
ATOM   3502 C  C6    . DG  B 2 10  ? 135.595 160.779 -15.903 1.00 23.60 ? 10  DG  T C6    1 
ATOM   3503 O  O6    . DG  B 2 10  ? 135.320 161.800 -16.554 1.00 27.59 ? 10  DG  T O6    1 
ATOM   3504 N  N1    . DG  B 2 10  ? 134.692 160.297 -14.958 1.00 31.17 ? 10  DG  T N1    1 
ATOM   3505 C  C2    . DG  B 2 10  ? 134.895 159.192 -14.162 1.00 28.00 ? 10  DG  T C2    1 
ATOM   3506 N  N2    . DG  B 2 10  ? 133.907 158.895 -13.303 1.00 27.50 ? 10  DG  T N2    1 
ATOM   3507 N  N3    . DG  B 2 10  ? 135.982 158.427 -14.216 1.00 28.07 ? 10  DG  T N3    1 
ATOM   3508 C  C4    . DG  B 2 10  ? 136.873 158.880 -15.141 1.00 22.98 ? 10  DG  T C4    1 
ATOM   3509 P  P     . DC  B 2 11  ? 139.222 152.945 -14.779 1.00 43.25 ? 11  DC  T P     1 
ATOM   3510 O  OP1   . DC  B 2 11  ? 139.612 151.892 -13.822 1.00 44.96 ? 11  DC  T OP1   1 
ATOM   3511 O  OP2   . DC  B 2 11  ? 139.496 152.759 -16.217 1.00 34.88 ? 11  DC  T OP2   1 
ATOM   3512 O  "O5'" . DC  B 2 11  ? 137.661 153.202 -14.630 1.00 39.92 ? 11  DC  T "O5'" 1 
ATOM   3513 C  "C5'" . DC  B 2 11  ? 137.110 153.399 -13.365 1.00 30.64 ? 11  DC  T "C5'" 1 
ATOM   3514 C  "C4'" . DC  B 2 11  ? 135.603 153.506 -13.473 1.00 31.21 ? 11  DC  T "C4'" 1 
ATOM   3515 O  "O4'" . DC  B 2 11  ? 135.252 154.755 -14.092 1.00 33.59 ? 11  DC  T "O4'" 1 
ATOM   3516 C  "C3'" . DC  B 2 11  ? 134.933 152.414 -14.303 1.00 33.36 ? 11  DC  T "C3'" 1 
ATOM   3517 O  "O3'" . DC  B 2 11  ? 133.899 151.848 -13.535 1.00 35.66 ? 11  DC  T "O3'" 1 
ATOM   3518 C  "C2'" . DC  B 2 11  ? 134.395 153.152 -15.547 1.00 26.98 ? 11  DC  T "C2'" 1 
ATOM   3519 C  "C1'" . DC  B 2 11  ? 134.215 154.567 -15.016 1.00 30.32 ? 11  DC  T "C1'" 1 
ATOM   3520 N  N1    . DC  B 2 11  ? 134.355 155.654 -16.038 1.00 28.31 ? 11  DC  T N1    1 
ATOM   3521 C  C2    . DC  B 2 11  ? 133.299 156.553 -16.250 1.00 29.25 ? 11  DC  T C2    1 
ATOM   3522 O  O2    . DC  B 2 11  ? 132.237 156.409 -15.621 1.00 24.74 ? 11  DC  T O2    1 
ATOM   3523 N  N3    . DC  B 2 11  ? 133.462 157.548 -17.158 1.00 31.05 ? 11  DC  T N3    1 
ATOM   3524 C  C4    . DC  B 2 11  ? 134.614 157.669 -17.828 1.00 30.71 ? 11  DC  T C4    1 
ATOM   3525 N  N4    . DC  B 2 11  ? 134.720 158.671 -18.714 1.00 28.93 ? 11  DC  T N4    1 
ATOM   3526 C  C5    . DC  B 2 11  ? 135.704 156.772 -17.616 1.00 30.72 ? 11  DC  T C5    1 
ATOM   3527 C  C6    . DC  B 2 11  ? 135.534 155.793 -16.717 1.00 30.82 ? 11  DC  T C6    1 
ATOM   3528 P  P     . DT  B 2 12  ? 133.257 150.433 -13.929 1.00 30.94 ? 12  DT  T P     1 
ATOM   3529 O  OP1   . DT  B 2 12  ? 132.874 149.796 -12.658 1.00 35.74 ? 12  DT  T OP1   1 
ATOM   3530 O  OP2   . DT  B 2 12  ? 134.132 149.715 -14.884 1.00 29.07 ? 12  DT  T OP2   1 
ATOM   3531 O  "O5'" . DT  B 2 12  ? 131.932 150.856 -14.707 1.00 35.26 ? 12  DT  T "O5'" 1 
ATOM   3532 C  "C5'" . DT  B 2 12  ? 130.956 151.658 -14.055 1.00 31.94 ? 12  DT  T "C5'" 1 
ATOM   3533 C  "C4'" . DT  B 2 12  ? 129.951 152.167 -15.061 1.00 26.85 ? 12  DT  T "C4'" 1 
ATOM   3534 O  "O4'" . DT  B 2 12  ? 130.501 153.331 -15.740 1.00 38.47 ? 12  DT  T "O4'" 1 
ATOM   3535 C  "C3'" . DT  B 2 12  ? 129.610 151.151 -16.167 1.00 31.08 ? 12  DT  T "C3'" 1 
ATOM   3536 O  "O3'" . DT  B 2 12  ? 128.204 150.928 -16.238 1.00 24.46 ? 12  DT  T "O3'" 1 
ATOM   3537 C  "C2'" . DT  B 2 12  ? 130.145 151.806 -17.449 1.00 34.40 ? 12  DT  T "C2'" 1 
ATOM   3538 C  "C1'" . DT  B 2 12  ? 130.093 153.274 -17.090 1.00 35.07 ? 12  DT  T "C1'" 1 
ATOM   3539 N  N1    . DT  B 2 12  ? 130.975 154.128 -17.941 1.00 34.45 ? 12  DT  T N1    1 
ATOM   3540 C  C2    . DT  B 2 12  ? 130.505 155.345 -18.382 1.00 28.05 ? 12  DT  T C2    1 
ATOM   3541 O  O2    . DT  B 2 12  ? 129.419 155.793 -18.078 1.00 38.28 ? 12  DT  T O2    1 
ATOM   3542 N  N3    . DT  B 2 12  ? 131.369 156.041 -19.174 1.00 34.87 ? 12  DT  T N3    1 
ATOM   3543 C  C4    . DT  B 2 12  ? 132.623 155.650 -19.589 1.00 29.88 ? 12  DT  T C4    1 
ATOM   3544 O  O4    . DT  B 2 12  ? 133.312 156.353 -20.312 1.00 31.49 ? 12  DT  T O4    1 
ATOM   3545 C  C5    . DT  B 2 12  ? 133.062 154.360 -19.109 1.00 28.20 ? 12  DT  T C5    1 
ATOM   3546 C  C7    . DT  B 2 12  ? 134.418 153.834 -19.494 1.00 29.05 ? 12  DT  T C7    1 
ATOM   3547 C  C6    . DT  B 2 12  ? 132.224 153.663 -18.318 1.00 30.42 ? 12  DT  T C6    1 
ATOM   3548 O  "O5'" . DA  C 3 1   ? 127.839 163.721 -24.221 1.00 50.09 ? 1   DA  P "O5'" 1 
ATOM   3549 C  "C5'" . DA  C 3 1   ? 126.584 163.147 -24.574 1.00 43.40 ? 1   DA  P "C5'" 1 
ATOM   3550 C  "C4'" . DA  C 3 1   ? 125.823 162.694 -23.339 1.00 40.36 ? 1   DA  P "C4'" 1 
ATOM   3551 O  "O4'" . DA  C 3 1   ? 126.333 161.418 -22.887 1.00 36.15 ? 1   DA  P "O4'" 1 
ATOM   3552 C  "C3'" . DA  C 3 1   ? 125.907 163.632 -22.138 1.00 35.90 ? 1   DA  P "C3'" 1 
ATOM   3553 O  "O3'" . DA  C 3 1   ? 124.687 163.601 -21.425 1.00 38.83 ? 1   DA  P "O3'" 1 
ATOM   3554 C  "C2'" . DA  C 3 1   ? 127.062 163.065 -21.304 1.00 33.05 ? 1   DA  P "C2'" 1 
ATOM   3555 C  "C1'" . DA  C 3 1   ? 127.141 161.589 -21.734 1.00 43.82 ? 1   DA  P "C1'" 1 
ATOM   3556 N  N9    . DA  C 3 1   ? 128.506 161.126 -22.037 1.00 30.04 ? 1   DA  P N9    1 
ATOM   3557 C  C8    . DA  C 3 1   ? 129.350 161.594 -23.010 1.00 30.48 ? 1   DA  P C8    1 
ATOM   3558 N  N7    . DA  C 3 1   ? 130.515 160.986 -23.040 1.00 32.70 ? 1   DA  P N7    1 
ATOM   3559 C  C5    . DA  C 3 1   ? 130.427 160.056 -22.016 1.00 30.76 ? 1   DA  P C5    1 
ATOM   3560 C  C6    . DA  C 3 1   ? 131.327 159.084 -21.529 1.00 34.58 ? 1   DA  P C6    1 
ATOM   3561 N  N6    . DA  C 3 1   ? 132.553 158.885 -22.035 1.00 35.09 ? 1   DA  P N6    1 
ATOM   3562 N  N1    . DA  C 3 1   ? 130.915 158.315 -20.500 1.00 32.63 ? 1   DA  P N1    1 
ATOM   3563 C  C2    . DA  C 3 1   ? 129.686 158.507 -19.997 1.00 34.01 ? 1   DA  P C2    1 
ATOM   3564 N  N3    . DA  C 3 1   ? 128.756 159.373 -20.373 1.00 30.48 ? 1   DA  P N3    1 
ATOM   3565 C  C4    . DA  C 3 1   ? 129.195 160.132 -21.390 1.00 29.04 ? 1   DA  P C4    1 
ATOM   3566 P  P     . DG  C 3 2   ? 124.283 164.820 -20.454 1.00 35.99 ? 2   DG  P P     1 
ATOM   3567 O  OP1   . DG  C 3 2   ? 122.799 164.830 -20.384 1.00 32.31 ? 2   DG  P OP1   1 
ATOM   3568 O  OP2   . DG  C 3 2   ? 125.038 166.014 -20.903 1.00 37.30 ? 2   DG  P OP2   1 
ATOM   3569 O  "O5'" . DG  C 3 2   ? 124.832 164.353 -19.014 1.00 29.39 ? 2   DG  P "O5'" 1 
ATOM   3570 C  "C5'" . DG  C 3 2   ? 124.113 163.369 -18.296 1.00 28.83 ? 2   DG  P "C5'" 1 
ATOM   3571 C  "C4'" . DG  C 3 2   ? 124.959 162.787 -17.193 1.00 34.11 ? 2   DG  P "C4'" 1 
ATOM   3572 O  "O4'" . DG  C 3 2   ? 126.155 162.205 -17.748 1.00 32.62 ? 2   DG  P "O4'" 1 
ATOM   3573 C  "C3'" . DG  C 3 2   ? 125.418 163.796 -16.132 1.00 28.93 ? 2   DG  P "C3'" 1 
ATOM   3574 O  "O3'" . DG  C 3 2   ? 124.858 163.417 -14.900 1.00 34.38 ? 2   DG  P "O3'" 1 
ATOM   3575 C  "C2'" . DG  C 3 2   ? 126.952 163.681 -16.139 1.00 26.70 ? 2   DG  P "C2'" 1 
ATOM   3576 C  "C1'" . DG  C 3 2   ? 127.177 162.324 -16.806 1.00 27.35 ? 2   DG  P "C1'" 1 
ATOM   3577 N  N9    . DG  C 3 2   ? 128.478 162.194 -17.481 1.00 30.58 ? 2   DG  P N9    1 
ATOM   3578 C  C8    . DG  C 3 2   ? 129.043 163.067 -18.383 1.00 22.70 ? 2   DG  P C8    1 
ATOM   3579 N  N7    . DG  C 3 2   ? 130.228 162.692 -18.798 1.00 29.07 ? 2   DG  P N7    1 
ATOM   3580 C  C5    . DG  C 3 2   ? 130.464 161.488 -18.129 1.00 28.54 ? 2   DG  P C5    1 
ATOM   3581 C  C6    . DG  C 3 2   ? 131.584 160.611 -18.169 1.00 30.94 ? 2   DG  P C6    1 
ATOM   3582 O  O6    . DG  C 3 2   ? 132.624 160.715 -18.840 1.00 29.02 ? 2   DG  P O6    1 
ATOM   3583 N  N1    . DG  C 3 2   ? 131.408 159.509 -17.324 1.00 27.28 ? 2   DG  P N1    1 
ATOM   3584 C  C2    . DG  C 3 2   ? 130.295 159.288 -16.549 1.00 25.30 ? 2   DG  P C2    1 
ATOM   3585 N  N2    . DG  C 3 2   ? 130.294 158.167 -15.809 1.00 30.31 ? 2   DG  P N2    1 
ATOM   3586 N  N3    . DG  C 3 2   ? 129.250 160.097 -16.504 1.00 26.54 ? 2   DG  P N3    1 
ATOM   3587 C  C4    . DG  C 3 2   ? 129.399 161.172 -17.313 1.00 31.64 ? 2   DG  P C4    1 
ATOM   3588 P  P     . DC  C 3 3   ? 125.104 164.249 -13.549 1.00 38.83 ? 3   DC  P P     1 
ATOM   3589 O  OP1   . DC  C 3 3   ? 123.793 164.294 -12.868 1.00 48.45 ? 3   DC  P OP1   1 
ATOM   3590 O  OP2   . DC  C 3 3   ? 125.881 165.493 -13.798 1.00 37.09 ? 3   DC  P OP2   1 
ATOM   3591 O  "O5'" . DC  C 3 3   ? 126.078 163.288 -12.711 1.00 46.98 ? 3   DC  P "O5'" 1 
ATOM   3592 C  "C5'" . DC  C 3 3   ? 125.733 161.924 -12.507 1.00 46.48 ? 3   DC  P "C5'" 1 
ATOM   3593 C  "C4'" . DC  C 3 3   ? 126.934 161.131 -12.017 1.00 43.43 ? 3   DC  P "C4'" 1 
ATOM   3594 O  "O4'" . DC  C 3 3   ? 127.934 161.074 -13.068 1.00 44.60 ? 3   DC  P "O4'" 1 
ATOM   3595 C  "C3'" . DC  C 3 3   ? 127.635 161.723 -10.784 1.00 45.00 ? 3   DC  P "C3'" 1 
ATOM   3596 O  "O3'" . DC  C 3 3   ? 127.733 160.758 -9.754  1.00 32.68 ? 3   DC  P "O3'" 1 
ATOM   3597 C  "C2'" . DC  C 3 3   ? 129.020 162.131 -11.295 1.00 36.27 ? 3   DC  P "C2'" 1 
ATOM   3598 C  "C1'" . DC  C 3 3   ? 129.206 161.209 -12.490 1.00 40.71 ? 3   DC  P "C1'" 1 
ATOM   3599 N  N1    . DC  C 3 3   ? 130.119 161.775 -13.487 1.00 35.65 ? 3   DC  P N1    1 
ATOM   3600 C  C2    . DC  C 3 3   ? 131.281 161.080 -13.818 1.00 29.48 ? 3   DC  P C2    1 
ATOM   3601 O  O2    . DC  C 3 3   ? 131.503 159.986 -13.282 1.00 38.54 ? 3   DC  P O2    1 
ATOM   3602 N  N3    . DC  C 3 3   ? 132.131 161.620 -14.713 1.00 28.54 ? 3   DC  P N3    1 
ATOM   3603 C  C4    . DC  C 3 3   ? 131.861 162.801 -15.265 1.00 28.58 ? 3   DC  P C4    1 
ATOM   3604 N  N4    . DC  C 3 3   ? 132.736 163.286 -16.148 1.00 32.67 ? 3   DC  P N4    1 
ATOM   3605 C  C5    . DC  C 3 3   ? 130.679 163.535 -14.936 1.00 32.09 ? 3   DC  P C5    1 
ATOM   3606 C  C6    . DC  C 3 3   ? 129.844 162.990 -14.045 1.00 29.08 ? 3   DC  P C6    1 
ATOM   3607 P  P     . DG  C 3 4   ? 128.383 161.176 -8.345  1.00 40.17 ? 4   DG  P P     1 
ATOM   3608 O  OP1   . DG  C 3 4   ? 127.652 160.444 -7.286  1.00 51.58 ? 4   DG  P OP1   1 
ATOM   3609 O  OP2   . DG  C 3 4   ? 128.509 162.659 -8.298  1.00 38.50 ? 4   DG  P OP2   1 
ATOM   3610 O  "O5'" . DG  C 3 4   ? 129.864 160.593 -8.417  1.00 35.77 ? 4   DG  P "O5'" 1 
ATOM   3611 C  "C5'" . DG  C 3 4   ? 130.068 159.220 -8.723  1.00 43.10 ? 4   DG  P "C5'" 1 
ATOM   3612 C  "C4'" . DG  C 3 4   ? 131.544 158.890 -8.675  1.00 47.59 ? 4   DG  P "C4'" 1 
ATOM   3613 O  "O4'" . DG  C 3 4   ? 132.195 159.445 -9.843  1.00 40.22 ? 4   DG  P "O4'" 1 
ATOM   3614 C  "C3'" . DG  C 3 4   ? 132.270 159.459 -7.457  1.00 43.48 ? 4   DG  P "C3'" 1 
ATOM   3615 O  "O3'" . DG  C 3 4   ? 133.027 158.439 -6.811  1.00 50.49 ? 4   DG  P "O3'" 1 
ATOM   3616 C  "C2'" . DG  C 3 4   ? 133.157 160.575 -8.025  1.00 29.56 ? 4   DG  P "C2'" 1 
ATOM   3617 C  "C1'" . DG  C 3 4   ? 133.360 160.149 -9.467  1.00 36.31 ? 4   DG  P "C1'" 1 
ATOM   3618 N  N9    . DG  C 3 4   ? 133.534 161.281 -10.386 1.00 28.67 ? 4   DG  P N9    1 
ATOM   3619 C  C8    . DG  C 3 4   ? 132.647 162.303 -10.617 1.00 31.54 ? 4   DG  P C8    1 
ATOM   3620 N  N7    . DG  C 3 4   ? 133.071 163.172 -11.493 1.00 35.16 ? 4   DG  P N7    1 
ATOM   3621 C  C5    . DG  C 3 4   ? 134.321 162.695 -11.867 1.00 27.97 ? 4   DG  P C5    1 
ATOM   3622 C  C6    . DG  C 3 4   ? 135.268 163.223 -12.775 1.00 30.22 ? 4   DG  P C6    1 
ATOM   3623 O  O6    . DG  C 3 4   ? 135.187 164.252 -13.462 1.00 27.64 ? 4   DG  P O6    1 
ATOM   3624 N  N1    . DG  C 3 4   ? 136.408 162.427 -12.850 1.00 26.78 ? 4   DG  P N1    1 
ATOM   3625 C  C2    . DG  C 3 4   ? 136.610 161.277 -12.135 1.00 25.85 ? 4   DG  P C2    1 
ATOM   3626 N  N2    . DG  C 3 4   ? 137.780 160.637 -12.339 1.00 21.26 ? 4   DG  P N2    1 
ATOM   3627 N  N3    . DG  C 3 4   ? 135.742 160.788 -11.271 1.00 25.78 ? 4   DG  P N3    1 
ATOM   3628 C  C4    . DG  C 3 4   ? 134.621 161.537 -11.194 1.00 28.32 ? 4   DG  P C4    1 
ATOM   3629 P  P     . DT  C 3 5   ? 133.877 158.792 -5.492  1.00 45.27 ? 5   DT  P P     1 
ATOM   3630 O  OP1   . DT  C 3 5   ? 133.837 157.619 -4.605  1.00 44.47 ? 5   DT  P OP1   1 
ATOM   3631 O  OP2   . DT  C 3 5   ? 133.456 160.121 -4.991  1.00 41.47 ? 5   DT  P OP2   1 
ATOM   3632 O  "O5'" . DT  C 3 5   ? 135.351 159.005 -6.064  1.00 40.51 ? 5   DT  P "O5'" 1 
ATOM   3633 C  "C5'" . DT  C 3 5   ? 135.941 158.021 -6.883  1.00 39.61 ? 5   DT  P "C5'" 1 
ATOM   3634 C  "C4'" . DT  C 3 5   ? 137.374 158.396 -7.190  1.00 33.95 ? 5   DT  P "C4'" 1 
ATOM   3635 O  "O4'" . DT  C 3 5   ? 137.410 159.427 -8.210  1.00 30.45 ? 5   DT  P "O4'" 1 
ATOM   3636 C  "C3'" . DT  C 3 5   ? 138.161 158.941 -5.996  1.00 25.31 ? 5   DT  P "C3'" 1 
ATOM   3637 O  "O3'" . DT  C 3 5   ? 139.408 158.283 -5.957  1.00 23.06 ? 5   DT  P "O3'" 1 
ATOM   3638 C  "C2'" . DT  C 3 5   ? 138.304 160.438 -6.300  1.00 29.11 ? 5   DT  P "C2'" 1 
ATOM   3639 C  "C1'" . DT  C 3 5   ? 138.304 160.448 -7.824  1.00 32.65 ? 5   DT  P "C1'" 1 
ATOM   3640 N  N1    . DT  C 3 5   ? 137.813 161.723 -8.439  1.00 24.36 ? 5   DT  P N1    1 
ATOM   3641 C  C2    . DT  C 3 5   ? 138.588 162.364 -9.386  1.00 28.54 ? 5   DT  P C2    1 
ATOM   3642 O  O2    . DT  C 3 5   ? 139.684 161.969 -9.725  1.00 27.82 ? 5   DT  P O2    1 
ATOM   3643 N  N3    . DT  C 3 5   ? 138.033 163.497 -9.916  1.00 22.57 ? 5   DT  P N3    1 
ATOM   3644 C  C4    . DT  C 3 5   ? 136.799 164.047 -9.591  1.00 26.56 ? 5   DT  P C4    1 
ATOM   3645 O  O4    . DT  C 3 5   ? 136.378 165.072 -10.121 1.00 25.44 ? 5   DT  P O4    1 
ATOM   3646 C  C5    . DT  C 3 5   ? 136.035 163.315 -8.599  1.00 30.60 ? 5   DT  P C5    1 
ATOM   3647 C  C7    . DT  C 3 5   ? 134.686 163.803 -8.165  1.00 22.08 ? 5   DT  P C7    1 
ATOM   3648 C  C6    . DT  C 3 5   ? 136.575 162.199 -8.086  1.00 25.12 ? 5   DT  P C6    1 
ATOM   3649 P  P     . DC  C 3 6   ? 140.387 158.436 -4.695  1.00 25.69 ? 6   DC  P P     1 
ATOM   3650 O  OP1   . DC  C 3 6   ? 141.100 157.142 -4.568  1.00 24.25 ? 6   DC  P OP1   1 
ATOM   3651 O  OP2   . DC  C 3 6   ? 139.645 159.014 -3.560  1.00 23.10 ? 6   DC  P OP2   1 
ATOM   3652 O  "O5'" . DC  C 3 6   ? 141.421 159.545 -5.172  1.00 21.11 ? 6   DC  P "O5'" 1 
ATOM   3653 C  "C5'" . DC  C 3 6   ? 142.274 159.292 -6.271  1.00 21.07 ? 6   DC  P "C5'" 1 
ATOM   3654 C  "C4'" . DC  C 3 6   ? 143.000 160.554 -6.630  1.00 27.35 ? 6   DC  P "C4'" 1 
ATOM   3655 O  "O4'" . DC  C 3 6   ? 142.083 161.458 -7.290  1.00 31.03 ? 6   DC  P "O4'" 1 
ATOM   3656 C  "C3'" . DC  C 3 6   ? 143.531 161.307 -5.404  1.00 30.24 ? 6   DC  P "C3'" 1 
ATOM   3657 O  "O3'" . DC  C 3 6   ? 144.941 161.210 -5.356  1.00 23.87 ? 6   DC  P "O3'" 1 
ATOM   3658 C  "C2'" . DC  C 3 6   ? 143.047 162.762 -5.586  1.00 27.03 ? 6   DC  P "C2'" 1 
ATOM   3659 C  "C1'" . DC  C 3 6   ? 142.495 162.771 -7.016  1.00 30.70 ? 6   DC  P "C1'" 1 
ATOM   3660 N  N1    . DC  C 3 6   ? 141.348 163.699 -7.175  1.00 29.83 ? 6   DC  P N1    1 
ATOM   3661 C  C2    . DC  C 3 6   ? 141.411 164.699 -8.160  1.00 29.91 ? 6   DC  P C2    1 
ATOM   3662 O  O2    . DC  C 3 6   ? 142.401 164.744 -8.918  1.00 24.38 ? 6   DC  P O2    1 
ATOM   3663 N  N3    . DC  C 3 6   ? 140.382 165.575 -8.272  1.00 20.64 ? 6   DC  P N3    1 
ATOM   3664 C  C4    . DC  C 3 6   ? 139.339 165.495 -7.455  1.00 20.70 ? 6   DC  P C4    1 
ATOM   3665 N  N4    . DC  C 3 6   ? 138.357 166.389 -7.625  1.00 21.05 ? 6   DC  P N4    1 
ATOM   3666 C  C5    . DC  C 3 6   ? 139.254 164.497 -6.426  1.00 26.34 ? 6   DC  P C5    1 
ATOM   3667 C  C6    . DC  C 3 6   ? 140.277 163.627 -6.320  1.00 27.00 ? 6   DC  P C6    1 
ATOM   3668 P  P     . DA  C 3 7   ? 145.773 161.932 -4.188  1.00 23.02 ? 7   DA  P P     1 
ATOM   3669 O  OP1   . DA  C 3 7   ? 147.032 161.184 -4.060  1.00 22.69 ? 7   DA  P OP1   1 
ATOM   3670 O  OP2   . DA  C 3 7   ? 144.891 162.105 -3.001  1.00 26.78 ? 7   DA  P OP2   1 
ATOM   3671 O  "O5'" . DA  C 3 7   ? 146.008 163.419 -4.715  1.00 26.60 ? 7   DA  P "O5'" 1 
ATOM   3672 C  "C5'" . DA  C 3 7   ? 146.962 163.676 -5.695  1.00 25.94 ? 7   DA  P "C5'" 1 
ATOM   3673 C  "C4'" . DA  C 3 7   ? 146.732 165.045 -6.325  1.00 26.85 ? 7   DA  P "C4'" 1 
ATOM   3674 O  "O4'" . DA  C 3 7   ? 145.339 165.221 -6.678  1.00 32.94 ? 7   DA  P "O4'" 1 
ATOM   3675 C  "C3'" . DA  C 3 7   ? 147.006 166.251 -5.449  1.00 31.69 ? 7   DA  P "C3'" 1 
ATOM   3676 O  "O3'" . DA  C 3 7   ? 148.418 166.502 -5.371  1.00 25.84 ? 7   DA  P "O3'" 1 
ATOM   3677 C  "C2'" . DA  C 3 7   ? 146.279 167.355 -6.232  1.00 28.33 ? 7   DA  P "C2'" 1 
ATOM   3678 C  "C1'" . DA  C 3 7   ? 145.162 166.590 -6.970  1.00 30.66 ? 7   DA  P "C1'" 1 
ATOM   3679 N  N9    . DA  C 3 7   ? 143.824 167.023 -6.573  1.00 28.80 ? 7   DA  P N9    1 
ATOM   3680 C  C8    . DA  C 3 7   ? 142.993 166.446 -5.646  1.00 25.24 ? 7   DA  P C8    1 
ATOM   3681 N  N7    . DA  C 3 7   ? 141.854 167.096 -5.484  1.00 22.72 ? 7   DA  P N7    1 
ATOM   3682 C  C5    . DA  C 3 7   ? 141.956 168.162 -6.361  1.00 24.82 ? 7   DA  P C5    1 
ATOM   3683 C  C6    . DA  C 3 7   ? 141.084 169.217 -6.669  1.00 25.32 ? 7   DA  P C6    1 
ATOM   3684 N  N6    . DA  C 3 7   ? 139.883 169.362 -6.103  1.00 24.22 ? 7   DA  P N6    1 
ATOM   3685 N  N1    . DA  C 3 7   ? 141.494 170.123 -7.588  1.00 27.32 ? 7   DA  P N1    1 
ATOM   3686 C  C2    . DA  C 3 7   ? 142.703 169.978 -8.146  1.00 24.81 ? 7   DA  P C2    1 
ATOM   3687 N  N3    . DA  C 3 7   ? 143.610 169.025 -7.936  1.00 25.88 ? 7   DA  P N3    1 
ATOM   3688 C  C4    . DA  C 3 7   ? 143.170 168.142 -7.023  1.00 23.14 ? 7   DA  P C4    1 
ATOM   3689 P  P     . DT  C 3 8   ? 148.992 167.744 -4.532  1.00 37.08 ? 8   DT  P P     1 
ATOM   3690 O  OP1   . DT  C 3 8   ? 150.461 167.562 -4.454  1.00 27.84 ? 8   DT  P OP1   1 
ATOM   3691 O  OP2   . DT  C 3 8   ? 148.200 167.890 -3.284  1.00 36.69 ? 8   DT  P OP2   1 
ATOM   3692 O  "O5'" . DT  C 3 8   ? 148.707 169.028 -5.475  1.00 39.12 ? 8   DT  P "O5'" 1 
ATOM   3693 C  "C5'" . DT  C 3 8   ? 149.263 169.106 -6.830  1.00 19.66 ? 8   DT  P "C5'" 1 
ATOM   3694 C  "C4'" . DT  C 3 8   ? 149.034 170.494 -7.420  1.00 21.79 ? 8   DT  P "C4'" 1 
ATOM   3695 O  "O4'" . DT  C 3 8   ? 147.619 170.772 -7.502  1.00 22.95 ? 8   DT  P "O4'" 1 
ATOM   3696 C  "C3'" . DT  C 3 8   ? 149.637 171.652 -6.632  1.00 20.66 ? 8   DT  P "C3'" 1 
ATOM   3697 O  "O3'" . DT  C 3 8   ? 150.076 172.648 -7.539  1.00 24.23 ? 8   DT  P "O3'" 1 
ATOM   3698 C  "C2'" . DT  C 3 8   ? 148.458 172.140 -5.784  1.00 27.61 ? 8   DT  P "C2'" 1 
ATOM   3699 C  "C1'" . DT  C 3 8   ? 147.305 171.941 -6.766  1.00 29.96 ? 8   DT  P "C1'" 1 
ATOM   3700 N  N1    . DT  C 3 8   ? 145.935 171.747 -6.115  1.00 23.61 ? 8   DT  P N1    1 
ATOM   3701 C  C2    . DT  C 3 8   ? 144.901 172.601 -6.459  1.00 25.53 ? 8   DT  P C2    1 
ATOM   3702 O  O2    . DT  C 3 8   ? 145.028 173.524 -7.252  1.00 32.58 ? 8   DT  P O2    1 
ATOM   3703 N  N3    . DT  C 3 8   ? 143.711 172.341 -5.841  1.00 23.54 ? 8   DT  P N3    1 
ATOM   3704 C  C4    . DT  C 3 8   ? 143.447 171.342 -4.927  1.00 24.92 ? 8   DT  P C4    1 
ATOM   3705 O  O4    . DT  C 3 8   ? 142.346 171.209 -4.415  1.00 27.40 ? 8   DT  P O4    1 
ATOM   3706 C  C5    . DT  C 3 8   ? 144.569 170.483 -4.598  1.00 24.03 ? 8   DT  P C5    1 
ATOM   3707 C  C7    . DT  C 3 8   ? 144.398 169.371 -3.607  1.00 25.76 ? 8   DT  P C7    1 
ATOM   3708 C  C6    . DT  C 3 8   ? 145.749 170.723 -5.199  1.00 20.66 ? 8   DT  P C6    1 
HETATM 3709 N  N1    . DCP D 4 .   ? 146.520 176.354 -4.405  1.00 24.70 ? 501 DCP A N1    1 
HETATM 3710 C  C2    . DCP D 4 .   ? 145.144 176.580 -4.348  1.00 25.53 ? 501 DCP A C2    1 
HETATM 3711 N  N3    . DCP D 4 .   ? 144.314 175.696 -3.754  1.00 22.35 ? 501 DCP A N3    1 
HETATM 3712 C  C4    . DCP D 4 .   ? 144.825 174.567 -3.195  1.00 26.83 ? 501 DCP A C4    1 
HETATM 3713 C  C5    . DCP D 4 .   ? 146.198 174.328 -3.238  1.00 24.58 ? 501 DCP A C5    1 
HETATM 3714 C  C6    . DCP D 4 .   ? 147.036 175.248 -3.852  1.00 21.86 ? 501 DCP A C6    1 
HETATM 3715 O  O2    . DCP D 4 .   ? 144.749 177.626 -4.893  1.00 23.24 ? 501 DCP A O2    1 
HETATM 3716 N  N4    . DCP D 4 .   ? 144.017 173.671 -2.574  1.00 23.00 ? 501 DCP A N4    1 
HETATM 3717 C  "C1'" . DCP D 4 .   ? 147.333 177.376 -5.089  1.00 21.67 ? 501 DCP A "C1'" 1 
HETATM 3718 C  "C2'" . DCP D 4 .   ? 148.093 178.235 -4.081  1.00 18.59 ? 501 DCP A "C2'" 1 
HETATM 3719 C  "C3'" . DCP D 4 .   ? 149.527 177.728 -4.185  1.00 14.67 ? 501 DCP A "C3'" 1 
HETATM 3720 C  "C4'" . DCP D 4 .   ? 149.633 177.147 -5.583  1.00 18.32 ? 501 DCP A "C4'" 1 
HETATM 3721 O  "O4'" . DCP D 4 .   ? 148.301 176.724 -5.914  1.00 22.02 ? 501 DCP A "O4'" 1 
HETATM 3722 O  "O3'" . DCP D 4 .   ? 150.499 178.749 -3.957  1.00 15.96 ? 501 DCP A "O3'" 1 
HETATM 3723 C  "C5'" . DCP D 4 .   ? 150.562 175.940 -5.592  1.00 18.48 ? 501 DCP A "C5'" 1 
HETATM 3724 O  "O5'" . DCP D 4 .   ? 150.043 174.991 -4.650  1.00 20.63 ? 501 DCP A "O5'" 1 
HETATM 3725 P  PA    . DCP D 4 .   ? 151.030 174.034 -3.822  1.00 19.58 ? 501 DCP A PA    1 
HETATM 3726 O  O1A   . DCP D 4 .   ? 152.257 173.751 -4.642  1.00 22.20 ? 501 DCP A O1A   1 
HETATM 3727 O  O2A   . DCP D 4 .   ? 150.226 172.886 -3.266  1.00 18.93 ? 501 DCP A O2A   1 
HETATM 3728 O  O3A   . DCP D 4 .   ? 151.455 174.991 -2.584  1.00 18.81 ? 501 DCP A O3A   1 
HETATM 3729 P  PB    . DCP D 4 .   ? 152.605 176.145 -2.619  1.00 18.22 ? 501 DCP A PB    1 
HETATM 3730 O  O1B   . DCP D 4 .   ? 153.310 176.192 -3.940  1.00 15.38 ? 501 DCP A O1B   1 
HETATM 3731 O  O2B   . DCP D 4 .   ? 151.953 177.400 -2.096  1.00 17.74 ? 501 DCP A O2B   1 
HETATM 3732 O  O3B   . DCP D 4 .   ? 153.577 175.666 -1.419  1.00 18.74 ? 501 DCP A O3B   1 
HETATM 3733 P  PG    . DCP D 4 .   ? 154.716 174.530 -1.493  1.00 18.98 ? 501 DCP A PG    1 
HETATM 3734 O  O1G   . DCP D 4 .   ? 154.526 173.833 -2.803  1.00 18.76 ? 501 DCP A O1G   1 
HETATM 3735 O  O2G   . DCP D 4 .   ? 155.988 175.344 -1.324  1.00 18.75 ? 501 DCP A O2G   1 
HETATM 3736 O  O3G   . DCP D 4 .   ? 154.324 173.655 -0.309  1.00 20.54 ? 501 DCP A O3G   1 
HETATM 3737 CA CA    . CA  E 5 .   ? 154.347 174.433 -4.946  1.00 18.03 ? 502 CA  A CA    1 
HETATM 3738 CA CA    . CA  F 5 .   ? 152.331 172.392 -6.735  0.54 21.42 ? 503 CA  A CA    1 
HETATM 3739 C  C1    . GOL G 6 .   ? 159.978 146.681 3.440   1.00 22.02 ? 504 GOL A C1    1 
HETATM 3740 O  O1    . GOL G 6 .   ? 158.567 146.854 3.429   1.00 19.42 ? 504 GOL A O1    1 
HETATM 3741 C  C2    . GOL G 6 .   ? 160.623 147.229 2.148   1.00 21.80 ? 504 GOL A C2    1 
HETATM 3742 O  O2    . GOL G 6 .   ? 160.270 148.578 1.902   1.00 20.53 ? 504 GOL A O2    1 
HETATM 3743 C  C3    . GOL G 6 .   ? 160.284 146.386 0.922   1.00 17.51 ? 504 GOL A C3    1 
HETATM 3744 O  O3    . GOL G 6 .   ? 161.126 146.743 -0.158  1.00 24.86 ? 504 GOL A O3    1 
HETATM 3745 C  C1    . GOL H 6 .   ? 153.757 188.478 -15.813 1.00 38.28 ? 505 GOL A C1    1 
HETATM 3746 O  O1    . GOL H 6 .   ? 153.692 187.094 -15.552 1.00 27.87 ? 505 GOL A O1    1 
HETATM 3747 C  C2    . GOL H 6 .   ? 154.374 188.674 -17.190 1.00 38.00 ? 505 GOL A C2    1 
HETATM 3748 O  O2    . GOL H 6 .   ? 153.546 188.082 -18.160 1.00 33.16 ? 505 GOL A O2    1 
HETATM 3749 C  C3    . GOL H 6 .   ? 154.516 190.163 -17.476 1.00 28.33 ? 505 GOL A C3    1 
HETATM 3750 O  O3    . GOL H 6 .   ? 155.633 190.317 -18.321 1.00 40.59 ? 505 GOL A O3    1 
HETATM 3751 O  O     . HOH I 7 .   ? 165.229 139.621 -20.993 1.00 38.99 ? 601 HOH A O     1 
HETATM 3752 O  O     . HOH I 7 .   ? 149.362 145.212 9.907   1.00 25.82 ? 602 HOH A O     1 
HETATM 3753 O  O     . HOH I 7 .   ? 140.744 188.629 -23.675 1.00 30.17 ? 603 HOH A O     1 
HETATM 3754 O  O     . HOH I 7 .   ? 139.787 190.915 -1.644  0.83 38.92 ? 604 HOH A O     1 
HETATM 3755 O  O     . HOH I 7 .   ? 147.873 137.962 -12.407 1.00 33.45 ? 605 HOH A O     1 
HETATM 3756 O  O     . HOH I 7 .   ? 163.198 184.633 -19.460 1.00 24.30 ? 606 HOH A O     1 
HETATM 3757 O  O     . HOH I 7 .   ? 144.424 138.922 -11.640 1.00 35.00 ? 607 HOH A O     1 
HETATM 3758 O  O     . HOH I 7 .   ? 127.099 178.598 -25.829 1.00 31.14 ? 608 HOH A O     1 
HETATM 3759 O  O     . HOH I 7 .   ? 170.597 188.142 -14.945 1.00 27.99 ? 609 HOH A O     1 
HETATM 3760 O  O     . HOH I 7 .   ? 171.824 163.867 2.932   1.00 29.39 ? 610 HOH A O     1 
HETATM 3761 O  O     . HOH I 7 .   ? 147.505 191.269 -4.100  1.00 36.02 ? 611 HOH A O     1 
HETATM 3762 O  O     . HOH I 7 .   ? 157.455 148.214 5.250   1.00 20.77 ? 612 HOH A O     1 
HETATM 3763 O  O     . HOH I 7 .   ? 169.230 182.205 -17.335 1.00 29.39 ? 613 HOH A O     1 
HETATM 3764 O  O     . HOH I 7 .   ? 168.351 188.148 -12.761 1.00 23.91 ? 614 HOH A O     1 
HETATM 3765 O  O     . HOH I 7 .   ? 118.481 167.031 -16.834 1.00 52.50 ? 615 HOH A O     1 
HETATM 3766 O  O     . HOH I 7 .   ? 158.506 176.830 14.308  1.00 37.51 ? 616 HOH A O     1 
HETATM 3767 O  O     . HOH I 7 .   ? 155.300 189.243 -9.350  1.00 22.36 ? 617 HOH A O     1 
HETATM 3768 O  O     . HOH I 7 .   ? 148.660 174.780 12.557  1.00 40.65 ? 618 HOH A O     1 
HETATM 3769 O  O     . HOH I 7 .   ? 153.146 143.584 6.523   1.00 18.33 ? 619 HOH A O     1 
HETATM 3770 O  O     . HOH I 7 .   ? 145.208 187.816 -10.566 1.00 20.33 ? 620 HOH A O     1 
HETATM 3771 O  O     . HOH I 7 .   ? 167.116 151.270 -0.128  1.00 23.79 ? 621 HOH A O     1 
HETATM 3772 O  O     . HOH I 7 .   ? 156.881 156.126 9.176   1.00 33.90 ? 622 HOH A O     1 
HETATM 3773 O  O     . HOH I 7 .   ? 162.311 186.765 -17.756 1.00 18.54 ? 623 HOH A O     1 
HETATM 3774 O  O     . HOH I 7 .   ? 166.450 165.307 4.093   1.00 27.29 ? 624 HOH A O     1 
HETATM 3775 O  O     . HOH I 7 .   ? 144.384 191.892 3.638   1.00 29.64 ? 625 HOH A O     1 
HETATM 3776 O  O     . HOH I 7 .   ? 155.855 173.216 4.198   1.00 30.29 ? 626 HOH A O     1 
HETATM 3777 O  O     . HOH I 7 .   ? 160.319 148.431 -2.191  1.00 21.79 ? 627 HOH A O     1 
HETATM 3778 O  O     . HOH I 7 .   ? 165.083 184.764 -5.602  1.00 31.95 ? 628 HOH A O     1 
HETATM 3779 O  O     . HOH I 7 .   ? 169.249 162.681 1.834   1.00 34.37 ? 629 HOH A O     1 
HETATM 3780 O  O     . HOH I 7 .   ? 157.878 153.843 11.024  1.00 37.10 ? 630 HOH A O     1 
HETATM 3781 O  O     . HOH I 7 .   ? 144.916 139.150 -0.166  1.00 41.79 ? 631 HOH A O     1 
HETATM 3782 O  O     . HOH I 7 .   ? 145.826 162.099 2.075   1.00 30.69 ? 632 HOH A O     1 
HETATM 3783 O  O     . HOH I 7 .   ? 158.187 190.728 -17.482 1.00 26.34 ? 633 HOH A O     1 
HETATM 3784 O  O     . HOH I 7 .   ? 178.882 175.267 -6.695  1.00 41.26 ? 634 HOH A O     1 
HETATM 3785 O  O     . HOH I 7 .   ? 139.572 181.314 18.246  1.00 26.99 ? 635 HOH A O     1 
HETATM 3786 O  O     . HOH I 7 .   ? 151.217 136.550 -1.072  1.00 38.56 ? 636 HOH A O     1 
HETATM 3787 O  O     . HOH I 7 .   ? 162.871 145.256 -1.683  1.00 19.54 ? 637 HOH A O     1 
HETATM 3788 O  O     . HOH I 7 .   ? 166.821 155.158 0.879   1.00 21.96 ? 638 HOH A O     1 
HETATM 3789 O  O     . HOH I 7 .   ? 147.893 134.947 -6.351  1.00 28.31 ? 639 HOH A O     1 
HETATM 3790 O  O     . HOH I 7 .   ? 139.998 188.703 -2.947  1.00 33.46 ? 640 HOH A O     1 
HETATM 3791 O  O     . HOH I 7 .   ? 158.144 159.679 -20.283 1.00 20.34 ? 641 HOH A O     1 
HETATM 3792 O  O     . HOH I 7 .   ? 152.080 187.947 -13.342 1.00 23.62 ? 642 HOH A O     1 
HETATM 3793 O  O     . HOH I 7 .   ? 118.522 164.426 -14.866 0.69 38.36 ? 643 HOH A O     1 
HETATM 3794 O  O     . HOH I 7 .   ? 158.666 176.842 7.996   1.00 27.69 ? 644 HOH A O     1 
HETATM 3795 O  O     . HOH I 7 .   ? 162.981 154.602 6.508   1.00 30.95 ? 645 HOH A O     1 
HETATM 3796 O  O     . HOH I 7 .   ? 142.916 138.470 -9.432  1.00 27.09 ? 646 HOH A O     1 
HETATM 3797 O  O     . HOH I 7 .   ? 168.838 158.360 -3.695  1.00 16.20 ? 647 HOH A O     1 
HETATM 3798 O  O     . HOH I 7 .   ? 170.966 154.292 3.573   1.00 37.08 ? 648 HOH A O     1 
HETATM 3799 O  O     . HOH I 7 .   ? 170.322 152.585 -7.737  1.00 24.75 ? 649 HOH A O     1 
HETATM 3800 O  O     . HOH I 7 .   ? 141.889 149.139 -11.514 1.00 26.10 ? 650 HOH A O     1 
HETATM 3801 O  O     . HOH I 7 .   ? 147.133 187.984 -26.228 1.00 34.23 ? 651 HOH A O     1 
HETATM 3802 O  O     . HOH I 7 .   ? 157.691 144.256 2.451   1.00 31.78 ? 652 HOH A O     1 
HETATM 3803 O  O     . HOH I 7 .   ? 149.452 162.891 3.982   1.00 35.23 ? 653 HOH A O     1 
HETATM 3804 O  O     . HOH I 7 .   ? 161.732 159.001 -22.789 1.00 35.36 ? 654 HOH A O     1 
HETATM 3805 O  O     . HOH I 7 .   ? 150.034 137.053 -9.566  1.00 25.77 ? 655 HOH A O     1 
HETATM 3806 O  O     . HOH I 7 .   ? 150.897 178.007 -28.029 1.00 34.89 ? 656 HOH A O     1 
HETATM 3807 O  O     . HOH I 7 .   ? 158.692 199.117 -1.103  1.00 42.83 ? 657 HOH A O     1 
HETATM 3808 O  O     . HOH I 7 .   ? 164.809 136.981 -14.856 1.00 46.21 ? 658 HOH A O     1 
HETATM 3809 O  O     . HOH I 7 .   ? 171.268 178.070 -15.781 1.00 29.38 ? 659 HOH A O     1 
HETATM 3810 O  O     . HOH I 7 .   ? 114.360 186.573 -9.766  1.00 33.83 ? 660 HOH A O     1 
HETATM 3811 O  O     . HOH I 7 .   ? 136.839 181.118 12.973  1.00 47.44 ? 661 HOH A O     1 
HETATM 3812 O  O     . HOH I 7 .   ? 138.604 168.380 -29.043 1.00 32.32 ? 662 HOH A O     1 
HETATM 3813 O  O     . HOH I 7 .   ? 142.845 189.634 9.284   1.00 35.67 ? 663 HOH A O     1 
HETATM 3814 O  O     . HOH I 7 .   ? 135.091 192.702 -8.117  1.00 35.18 ? 664 HOH A O     1 
HETATM 3815 O  O     . HOH I 7 .   ? 153.187 179.281 -23.488 1.00 35.17 ? 665 HOH A O     1 
HETATM 3816 O  O     . HOH I 7 .   ? 151.646 189.949 -19.516 1.00 35.58 ? 666 HOH A O     1 
HETATM 3817 O  O     . HOH I 7 .   ? 153.638 189.310 -11.896 1.00 24.05 ? 667 HOH A O     1 
HETATM 3818 O  O     . HOH I 7 .   ? 121.350 185.403 -1.499  1.00 49.49 ? 668 HOH A O     1 
HETATM 3819 O  O     . HOH I 7 .   ? 175.866 159.012 8.542   1.00 48.42 ? 669 HOH A O     1 
HETATM 3820 O  O     . HOH I 7 .   ? 176.877 155.904 -5.923  1.00 43.11 ? 670 HOH A O     1 
HETATM 3821 O  O     . HOH I 7 .   ? 137.738 185.496 16.095  1.00 38.31 ? 671 HOH A O     1 
HETATM 3822 O  O     . HOH I 7 .   ? 165.306 148.827 -5.594  1.00 22.38 ? 672 HOH A O     1 
HETATM 3823 O  O     . HOH I 7 .   ? 142.330 170.189 -33.917 1.00 27.90 ? 673 HOH A O     1 
HETATM 3824 O  O     . HOH I 7 .   ? 146.401 191.283 -6.893  1.00 38.08 ? 674 HOH A O     1 
HETATM 3825 O  O     . HOH I 7 .   ? 123.849 188.343 -5.213  1.00 40.30 ? 675 HOH A O     1 
HETATM 3826 O  O     . HOH I 7 .   ? 168.314 160.836 3.551   1.00 37.38 ? 676 HOH A O     1 
HETATM 3827 O  O     . HOH I 7 .   ? 149.614 189.124 -20.799 1.00 44.32 ? 677 HOH A O     1 
HETATM 3828 O  O     . HOH I 7 .   ? 140.506 168.445 -31.751 1.00 33.30 ? 678 HOH A O     1 
HETATM 3829 O  O     . HOH I 7 .   ? 140.928 147.840 -13.691 1.00 35.87 ? 679 HOH A O     1 
HETATM 3830 O  O     . HOH I 7 .   ? 140.362 170.062 -25.318 1.00 33.83 ? 680 HOH A O     1 
HETATM 3831 O  O     . HOH I 7 .   ? 176.284 154.243 -7.888  1.00 34.33 ? 681 HOH A O     1 
HETATM 3832 O  O     . HOH I 7 .   ? 150.678 193.565 -1.756  1.00 30.47 ? 682 HOH A O     1 
HETATM 3833 O  O     . HOH I 7 .   ? 164.427 152.472 6.794   1.00 35.76 ? 683 HOH A O     1 
HETATM 3834 O  O     . HOH I 7 .   ? 160.776 188.125 9.156   1.00 43.91 ? 684 HOH A O     1 
HETATM 3835 O  O     . HOH I 7 .   ? 149.240 137.128 1.266   1.00 42.48 ? 685 HOH A O     1 
HETATM 3836 O  O     . HOH I 7 .   ? 153.024 137.996 -8.832  1.00 34.87 ? 686 HOH A O     1 
HETATM 3837 O  O     . HOH I 7 .   ? 146.277 157.205 5.964   1.00 30.70 ? 687 HOH A O     1 
HETATM 3838 O  O     . HOH I 7 .   ? 164.528 191.990 -1.391  1.00 37.55 ? 688 HOH A O     1 
HETATM 3839 O  O     . HOH I 7 .   ? 155.499 138.697 -4.069  1.00 38.22 ? 689 HOH A O     1 
HETATM 3840 O  O     . HOH I 7 .   ? 154.202 174.341 12.243  1.00 35.54 ? 690 HOH A O     1 
HETATM 3841 O  O     . HOH I 7 .   ? 152.978 163.683 -0.142  1.00 38.65 ? 691 HOH A O     1 
HETATM 3842 O  O     . HOH I 7 .   ? 139.529 169.734 -34.949 1.00 49.13 ? 692 HOH A O     1 
HETATM 3843 O  O     . HOH I 7 .   ? 146.611 187.555 -32.505 1.00 37.26 ? 693 HOH A O     1 
HETATM 3844 O  O     . HOH I 7 .   ? 140.448 172.292 -38.666 1.00 39.26 ? 694 HOH A O     1 
HETATM 3845 O  O     . HOH I 7 .   ? 172.193 174.626 -19.974 1.00 37.95 ? 695 HOH A O     1 
HETATM 3846 O  O     . HOH I 7 .   ? 161.854 187.815 -6.058  1.00 35.89 ? 696 HOH A O     1 
HETATM 3847 O  O     . HOH I 7 .   ? 125.391 186.372 -3.378  1.00 40.57 ? 697 HOH A O     1 
HETATM 3848 O  O     . HOH I 7 .   ? 133.354 194.214 -9.496  1.00 39.21 ? 698 HOH A O     1 
HETATM 3849 O  O     . HOH I 7 .   ? 161.203 187.720 -3.614  1.00 33.70 ? 699 HOH A O     1 
HETATM 3850 O  O     . HOH I 7 .   ? 152.830 172.107 3.455   1.00 37.33 ? 700 HOH A O     1 
HETATM 3851 O  O     . HOH I 7 .   ? 132.108 174.884 -32.767 1.00 39.30 ? 701 HOH A O     1 
HETATM 3852 O  O     . HOH I 7 .   ? 144.173 149.280 9.132   1.00 45.80 ? 702 HOH A O     1 
HETATM 3853 O  O     A HOH I 7 .   ? 146.329 191.137 -11.397 0.45 21.17 ? 703 HOH A O     1 
HETATM 3854 O  O     B HOH I 7 .   ? 145.280 189.929 -12.161 0.55 25.60 ? 703 HOH A O     1 
HETATM 3855 O  O     . HOH I 7 .   ? 157.683 157.487 -21.779 1.00 24.89 ? 704 HOH A O     1 
HETATM 3856 O  O     . HOH I 7 .   ? 140.993 179.812 -39.317 1.00 47.37 ? 705 HOH A O     1 
HETATM 3857 O  O     . HOH I 7 .   ? 146.477 151.277 9.627   1.00 36.06 ? 706 HOH A O     1 
HETATM 3858 O  O     . HOH I 7 .   ? 153.233 177.883 -25.558 1.00 48.28 ? 707 HOH A O     1 
HETATM 3859 O  O     . HOH I 7 .   ? 143.806 187.656 17.425  1.00 34.17 ? 708 HOH A O     1 
HETATM 3860 O  O     . HOH I 7 .   ? 152.449 173.428 10.599  1.00 32.02 ? 709 HOH A O     1 
HETATM 3861 O  O     . HOH I 7 .   ? 158.470 187.333 -19.412 1.00 33.30 ? 710 HOH A O     1 
HETATM 3862 O  O     . HOH I 7 .   ? 170.393 164.952 4.880   1.00 39.86 ? 711 HOH A O     1 
HETATM 3863 O  O     . HOH I 7 .   ? 147.969 153.883 8.618   1.00 35.94 ? 712 HOH A O     1 
HETATM 3864 O  O     . HOH I 7 .   ? 151.339 173.759 5.486   1.00 36.41 ? 713 HOH A O     1 
HETATM 3865 O  O     . HOH I 7 .   ? 156.137 157.842 -14.551 1.00 16.95 ? 714 HOH A O     1 
HETATM 3866 O  O     . HOH I 7 .   ? 163.623 168.359 -2.766  1.00 16.07 ? 715 HOH A O     1 
HETATM 3867 O  O     . HOH I 7 .   ? 162.011 179.389 -1.677  1.00 22.22 ? 716 HOH A O     1 
HETATM 3868 O  O     . HOH I 7 .   ? 153.578 143.214 -4.722  1.00 19.47 ? 717 HOH A O     1 
HETATM 3869 O  O     . HOH I 7 .   ? 165.199 165.180 -22.467 1.00 19.79 ? 718 HOH A O     1 
HETATM 3870 O  O     . HOH I 7 .   ? 143.585 157.357 -3.286  1.00 17.44 ? 719 HOH A O     1 
HETATM 3871 O  O     . HOH I 7 .   ? 148.282 149.484 -14.689 1.00 28.01 ? 720 HOH A O     1 
HETATM 3872 O  O     . HOH I 7 .   ? 157.387 164.207 -0.649  1.00 24.96 ? 721 HOH A O     1 
HETATM 3873 O  O     A HOH I 7 .   ? 170.534 172.256 2.544   0.40 23.26 ? 722 HOH A O     1 
HETATM 3874 O  O     B HOH I 7 .   ? 172.026 173.333 3.242   0.60 28.44 ? 722 HOH A O     1 
HETATM 3875 O  O     . HOH I 7 .   ? 127.176 166.312 -18.914 1.00 41.07 ? 723 HOH A O     1 
HETATM 3876 O  O     . HOH I 7 .   ? 158.761 183.067 -0.205  1.00 17.49 ? 724 HOH A O     1 
HETATM 3877 O  O     . HOH I 7 .   ? 148.617 156.285 4.752   1.00 28.77 ? 725 HOH A O     1 
HETATM 3878 O  O     . HOH I 7 .   ? 172.705 164.413 0.485   1.00 20.05 ? 726 HOH A O     1 
HETATM 3879 O  O     . HOH I 7 .   ? 140.756 179.439 -27.556 1.00 27.38 ? 727 HOH A O     1 
HETATM 3880 O  O     . HOH I 7 .   ? 160.073 154.240 -16.135 1.00 27.50 ? 728 HOH A O     1 
HETATM 3881 O  O     . HOH I 7 .   ? 143.244 184.205 -16.298 1.00 25.77 ? 729 HOH A O     1 
HETATM 3882 O  O     . HOH I 7 .   ? 128.675 180.321 -27.867 1.00 34.69 ? 730 HOH A O     1 
HETATM 3883 O  O     . HOH I 7 .   ? 154.445 160.305 -5.331  1.00 17.25 ? 731 HOH A O     1 
HETATM 3884 O  O     . HOH I 7 .   ? 160.181 153.365 -13.312 1.00 18.29 ? 732 HOH A O     1 
HETATM 3885 O  O     . HOH I 7 .   ? 151.078 177.467 -17.291 1.00 26.71 ? 733 HOH A O     1 
HETATM 3886 O  O     . HOH I 7 .   ? 165.399 149.457 -16.661 1.00 31.57 ? 734 HOH A O     1 
HETATM 3887 O  O     . HOH I 7 .   ? 159.450 182.716 10.822  1.00 26.68 ? 735 HOH A O     1 
HETATM 3888 O  O     . HOH I 7 .   ? 149.821 154.660 6.718   1.00 28.55 ? 736 HOH A O     1 
HETATM 3889 O  O     . HOH I 7 .   ? 154.011 162.318 -3.408  1.00 22.44 ? 737 HOH A O     1 
HETATM 3890 O  O     . HOH I 7 .   ? 168.718 154.294 -10.072 1.00 19.64 ? 738 HOH A O     1 
HETATM 3891 O  O     . HOH I 7 .   ? 162.980 152.719 -10.330 1.00 19.56 ? 739 HOH A O     1 
HETATM 3892 O  O     . HOH I 7 .   ? 160.740 186.307 -0.429  1.00 30.20 ? 740 HOH A O     1 
HETATM 3893 O  O     . HOH I 7 .   ? 146.820 174.512 -10.152 1.00 24.98 ? 741 HOH A O     1 
HETATM 3894 O  O     . HOH I 7 .   ? 159.589 183.501 -19.016 1.00 22.32 ? 742 HOH A O     1 
HETATM 3895 O  O     . HOH I 7 .   ? 158.828 181.675 2.037   1.00 19.98 ? 743 HOH A O     1 
HETATM 3896 O  O     . HOH I 7 .   ? 146.087 188.630 -7.683  1.00 25.21 ? 744 HOH A O     1 
HETATM 3897 O  O     . HOH I 7 .   ? 151.171 177.103 -19.853 1.00 24.58 ? 745 HOH A O     1 
HETATM 3898 O  O     . HOH I 7 .   ? 152.218 173.211 0.973   1.00 27.16 ? 746 HOH A O     1 
HETATM 3899 O  O     . HOH I 7 .   ? 159.723 186.212 -17.357 1.00 22.90 ? 747 HOH A O     1 
HETATM 3900 O  O     . HOH I 7 .   ? 165.407 156.626 2.915   1.00 27.31 ? 748 HOH A O     1 
HETATM 3901 O  O     . HOH I 7 .   ? 170.784 175.320 -9.108  1.00 23.85 ? 749 HOH A O     1 
HETATM 3902 O  O     . HOH I 7 .   ? 161.642 184.379 0.882   0.63 35.75 ? 750 HOH A O     1 
HETATM 3903 O  O     . HOH I 7 .   ? 177.761 170.840 -3.204  1.00 24.75 ? 751 HOH A O     1 
HETATM 3904 O  O     . HOH I 7 .   ? 143.765 178.747 -7.222  1.00 28.53 ? 752 HOH A O     1 
HETATM 3905 O  O     . HOH I 7 .   ? 145.515 176.512 -1.110  0.74 18.14 ? 753 HOH A O     1 
HETATM 3906 O  O     . HOH I 7 .   ? 147.312 171.263 -16.584 1.00 38.70 ? 754 HOH A O     1 
HETATM 3907 O  O     . HOH I 7 .   ? 149.754 171.793 -24.940 1.00 35.10 ? 755 HOH A O     1 
HETATM 3908 O  O     . HOH I 7 .   ? 153.343 185.601 -18.675 1.00 24.74 ? 756 HOH A O     1 
HETATM 3909 O  O     . HOH I 7 .   ? 150.537 175.476 1.513   1.00 30.21 ? 757 HOH A O     1 
HETATM 3910 O  O     . HOH I 7 .   ? 153.606 151.172 -11.344 1.00 23.64 ? 758 HOH A O     1 
HETATM 3911 O  O     . HOH I 7 .   ? 143.917 156.514 -7.751  1.00 29.76 ? 759 HOH A O     1 
HETATM 3912 O  O     . HOH I 7 .   ? 146.305 171.539 -24.075 1.00 32.55 ? 760 HOH A O     1 
HETATM 3913 O  O     . HOH I 7 .   ? 159.154 147.650 -16.125 1.00 37.52 ? 761 HOH A O     1 
HETATM 3914 O  O     . HOH I 7 .   ? 155.150 164.357 -2.180  1.00 31.35 ? 762 HOH A O     1 
HETATM 3915 O  O     . HOH I 7 .   ? 159.953 185.033 2.232   1.00 33.02 ? 763 HOH A O     1 
HETATM 3916 O  O     . HOH I 7 .   ? 149.124 171.805 6.266   1.00 37.09 ? 764 HOH A O     1 
HETATM 3917 O  O     . HOH I 7 .   ? 149.457 175.000 4.041   1.00 27.22 ? 765 HOH A O     1 
HETATM 3918 O  O     . HOH I 7 .   ? 140.730 193.405 -6.075  1.00 39.87 ? 766 HOH A O     1 
HETATM 3919 O  O     . HOH I 7 .   ? 180.502 153.341 -21.310 1.00 49.19 ? 767 HOH A O     1 
HETATM 3920 O  O     . HOH I 7 .   ? 165.096 177.594 -6.716  1.00 26.90 ? 768 HOH A O     1 
HETATM 3921 O  O     . HOH I 7 .   ? 150.707 163.181 -14.133 1.00 36.19 ? 769 HOH A O     1 
HETATM 3922 O  O     . HOH I 7 .   ? 151.727 166.166 -9.814  1.00 36.02 ? 770 HOH A O     1 
HETATM 3923 O  O     . HOH I 7 .   ? 143.526 182.886 -21.270 1.00 26.77 ? 771 HOH A O     1 
HETATM 3924 O  O     . HOH I 7 .   ? 168.943 176.303 -4.847  1.00 29.05 ? 772 HOH A O     1 
HETATM 3925 O  O     . HOH I 7 .   ? 140.424 183.368 -12.523 1.00 27.48 ? 773 HOH A O     1 
HETATM 3926 O  O     . HOH I 7 .   ? 136.607 187.845 -12.992 1.00 35.55 ? 774 HOH A O     1 
HETATM 3927 O  O     . HOH I 7 .   ? 140.577 178.896 10.593  1.00 27.48 ? 775 HOH A O     1 
HETATM 3928 O  O     . HOH I 7 .   ? 142.747 187.986 15.072  1.00 30.99 ? 776 HOH A O     1 
HETATM 3929 O  O     . HOH I 7 .   ? 154.075 187.332 14.542  1.00 34.73 ? 777 HOH A O     1 
HETATM 3930 O  O     . HOH I 7 .   ? 148.988 178.691 -20.629 1.00 26.79 ? 778 HOH A O     1 
HETATM 3931 O  O     . HOH I 7 .   ? 148.981 180.378 -22.440 1.00 39.19 ? 779 HOH A O     1 
HETATM 3932 O  O     . HOH I 7 .   ? 145.340 179.679 -21.942 1.00 36.38 ? 780 HOH A O     1 
HETATM 3933 O  O     . HOH I 7 .   ? 165.408 167.381 -23.954 1.00 30.79 ? 781 HOH A O     1 
HETATM 3934 O  O     . HOH I 7 .   ? 163.936 162.449 -23.180 1.00 25.63 ? 782 HOH A O     1 
HETATM 3935 O  O     . HOH I 7 .   ? 175.043 172.439 -12.087 1.00 28.52 ? 783 HOH A O     1 
HETATM 3936 O  O     . HOH I 7 .   ? 165.636 169.613 3.890   1.00 33.80 ? 784 HOH A O     1 
HETATM 3937 O  O     . HOH I 7 .   ? 162.945 170.252 4.168   1.00 36.12 ? 785 HOH A O     1 
HETATM 3938 O  O     . HOH I 7 .   ? 168.030 155.830 -16.265 1.00 26.45 ? 786 HOH A O     1 
HETATM 3939 O  O     . HOH I 7 .   ? 151.487 146.506 9.006   1.00 29.39 ? 787 HOH A O     1 
HETATM 3940 O  O     . HOH I 7 .   ? 144.567 157.543 1.344   1.00 22.53 ? 788 HOH A O     1 
HETATM 3941 O  O     . HOH I 7 .   ? 138.361 152.601 -3.087  1.00 35.77 ? 789 HOH A O     1 
HETATM 3942 O  O     . HOH I 7 .   ? 138.247 153.704 1.484   1.00 37.00 ? 790 HOH A O     1 
HETATM 3943 O  O     . HOH I 7 .   ? 144.293 142.136 7.121   1.00 47.47 ? 791 HOH A O     1 
HETATM 3944 O  O     . HOH I 7 .   ? 146.559 141.055 4.460   1.00 35.11 ? 792 HOH A O     1 
HETATM 3945 O  O     . HOH I 7 .   ? 148.590 142.405 7.119   1.00 43.51 ? 793 HOH A O     1 
HETATM 3946 O  O     . HOH I 7 .   ? 119.152 183.884 -19.550 1.00 44.96 ? 794 HOH A O     1 
HETATM 3947 O  O     . HOH I 7 .   ? 150.826 163.386 -3.900  1.00 31.76 ? 795 HOH A O     1 
HETATM 3948 O  O     . HOH I 7 .   ? 153.973 171.245 -2.589  1.00 30.15 ? 796 HOH A O     1 
HETATM 3949 O  O     . HOH I 7 .   ? 151.257 177.825 0.475   1.00 19.29 ? 797 HOH A O     1 
HETATM 3950 O  O     . HOH I 7 .   ? 162.658 181.142 -22.020 1.00 34.77 ? 798 HOH A O     1 
HETATM 3951 O  O     . HOH I 7 .   ? 145.989 173.710 -13.013 1.00 36.06 ? 799 HOH A O     1 
HETATM 3952 O  O     . HOH I 7 .   ? 145.079 177.795 -9.322  1.00 36.84 ? 800 HOH A O     1 
HETATM 3953 O  O     . HOH I 7 .   ? 145.739 171.587 -1.080  1.00 31.08 ? 801 HOH A O     1 
HETATM 3954 O  O     . HOH I 7 .   ? 161.196 180.216 1.137   1.00 36.90 ? 802 HOH A O     1 
HETATM 3955 O  O     . HOH I 7 .   ? 176.340 174.499 -1.864  1.00 37.23 ? 803 HOH A O     1 
HETATM 3956 O  O     . HOH I 7 .   ? 183.561 166.722 -5.861  1.00 43.20 ? 804 HOH A O     1 
HETATM 3957 O  O     . HOH I 7 .   ? 180.857 156.223 -1.250  1.00 25.93 ? 805 HOH A O     1 
HETATM 3958 O  O     . HOH I 7 .   ? 146.738 154.879 -9.690  1.00 35.99 ? 806 HOH A O     1 
HETATM 3959 O  O     A HOH I 7 .   ? 173.016 152.141 -11.327 0.57 18.62 ? 807 HOH A O     1 
HETATM 3960 O  O     B HOH I 7 .   ? 175.031 151.795 -11.533 0.43 27.35 ? 807 HOH A O     1 
HETATM 3961 O  O     . HOH I 7 .   ? 158.678 153.319 -18.764 1.00 42.53 ? 808 HOH A O     1 
HETATM 3962 O  O     . HOH I 7 .   ? 145.996 171.178 -13.662 1.00 39.96 ? 809 HOH A O     1 
HETATM 3963 O  O     . HOH I 7 .   ? 146.384 174.806 -32.559 1.00 39.96 ? 810 HOH A O     1 
HETATM 3964 O  O     . HOH I 7 .   ? 152.081 192.029 -4.143  1.00 23.74 ? 811 HOH A O     1 
HETATM 3965 O  O     . HOH I 7 .   ? 147.391 152.835 -14.060 1.00 45.73 ? 812 HOH A O     1 
HETATM 3966 O  O     . HOH I 7 .   ? 168.441 149.485 -17.054 1.00 47.58 ? 813 HOH A O     1 
HETATM 3967 O  O     . HOH I 7 .   ? 167.025 163.755 1.299   1.00 27.08 ? 814 HOH A O     1 
HETATM 3968 O  O     . HOH I 7 .   ? 152.652 145.111 -12.853 1.00 31.63 ? 815 HOH A O     1 
HETATM 3969 O  O     . HOH I 7 .   ? 149.875 165.649 -14.095 1.00 43.79 ? 816 HOH A O     1 
HETATM 3970 O  O     . HOH I 7 .   ? 162.618 166.629 -24.392 1.00 35.28 ? 817 HOH A O     1 
HETATM 3971 O  O     . HOH I 7 .   ? 128.146 166.089 -11.966 1.00 41.48 ? 818 HOH A O     1 
HETATM 3972 O  O     . HOH I 7 .   ? 172.877 176.439 -9.457  1.00 33.72 ? 819 HOH A O     1 
HETATM 3973 O  O     . HOH I 7 .   ? 152.738 170.351 -0.087  1.00 47.75 ? 820 HOH A O     1 
HETATM 3974 O  O     A HOH I 7 .   ? 152.875 150.794 -13.801 0.48 19.19 ? 821 HOH A O     1 
HETATM 3975 O  O     B HOH I 7 .   ? 152.970 152.351 -15.177 0.52 19.09 ? 821 HOH A O     1 
HETATM 3976 O  O     . HOH I 7 .   ? 121.528 183.581 -17.913 1.00 34.12 ? 822 HOH A O     1 
HETATM 3977 O  O     . HOH I 7 .   ? 153.073 147.654 -15.159 1.00 52.72 ? 823 HOH A O     1 
HETATM 3978 O  O     . HOH I 7 .   ? 140.327 193.805 -10.924 1.00 43.12 ? 824 HOH A O     1 
HETATM 3979 O  O     . HOH I 7 .   ? 144.637 184.220 -18.641 1.00 44.51 ? 825 HOH A O     1 
HETATM 3980 O  O     . HOH I 7 .   ? 115.084 169.223 -10.519 1.00 47.03 ? 826 HOH A O     1 
HETATM 3981 O  O     . HOH I 7 .   ? 156.538 188.424 13.436  1.00 46.43 ? 827 HOH A O     1 
HETATM 3982 O  O     . HOH I 7 .   ? 181.509 167.426 10.952  1.00 50.47 ? 828 HOH A O     1 
HETATM 3983 O  O     . HOH I 7 .   ? 162.933 160.695 4.272   1.00 44.88 ? 829 HOH A O     1 
HETATM 3984 O  O     . HOH I 7 .   ? 165.385 180.608 0.235   1.00 36.85 ? 830 HOH A O     1 
HETATM 3985 O  O     . HOH I 7 .   ? 157.276 155.340 -20.247 1.00 31.83 ? 831 HOH A O     1 
HETATM 3986 O  O     . HOH I 7 .   ? 166.923 178.597 0.731   1.00 39.70 ? 832 HOH A O     1 
HETATM 3987 O  O     . HOH I 7 .   ? 124.293 193.037 -19.369 1.00 46.52 ? 833 HOH A O     1 
HETATM 3988 O  O     . HOH I 7 .   ? 149.831 155.707 -17.794 1.00 39.96 ? 834 HOH A O     1 
HETATM 3989 O  O     . HOH I 7 .   ? 168.344 177.361 -22.571 1.00 35.58 ? 835 HOH A O     1 
HETATM 3990 O  O     A HOH I 7 .   ? 140.011 153.398 -8.068  0.49 20.48 ? 836 HOH A O     1 
HETATM 3991 O  O     B HOH I 7 .   ? 139.561 153.321 -9.894  0.51 23.97 ? 836 HOH A O     1 
HETATM 3992 O  O     . HOH I 7 .   ? 123.144 187.495 -20.879 1.00 50.79 ? 837 HOH A O     1 
HETATM 3993 O  O     . HOH I 7 .   ? 187.729 160.975 -4.115  1.00 58.72 ? 838 HOH A O     1 
HETATM 3994 O  O     . HOH I 7 .   ? 150.737 149.009 -14.492 1.00 40.25 ? 839 HOH A O     1 
HETATM 3995 O  O     . HOH I 7 .   ? 135.507 188.937 10.599  1.00 46.52 ? 840 HOH A O     1 
HETATM 3996 O  O     . HOH I 7 .   ? 146.243 152.762 -11.354 1.00 42.09 ? 841 HOH A O     1 
HETATM 3997 O  O     . HOH I 7 .   ? 145.466 173.583 9.550   1.00 39.49 ? 842 HOH A O     1 
HETATM 3998 O  O     . HOH I 7 .   ? 115.142 167.569 -8.270  1.00 47.57 ? 843 HOH A O     1 
HETATM 3999 O  O     . HOH I 7 .   ? 148.360 162.500 1.604   1.00 35.68 ? 844 HOH A O     1 
HETATM 4000 O  O     . HOH I 7 .   ? 159.851 142.706 -17.194 1.00 45.77 ? 845 HOH A O     1 
HETATM 4001 O  O     . HOH I 7 .   ? 167.814 146.556 -15.723 1.00 49.15 ? 846 HOH A O     1 
HETATM 4002 O  O     . HOH I 7 .   ? 183.138 163.498 -8.254  1.00 46.60 ? 847 HOH A O     1 
HETATM 4003 O  O     . HOH I 7 .   ? 147.753 167.191 -13.982 1.00 49.99 ? 848 HOH A O     1 
HETATM 4004 O  O     . HOH I 7 .   ? 146.588 173.092 4.789   0.79 34.41 ? 849 HOH A O     1 
HETATM 4005 O  O     . HOH I 7 .   ? 142.373 163.283 0.477   1.00 43.21 ? 850 HOH A O     1 
HETATM 4006 O  O     . HOH I 7 .   ? 153.510 178.038 -21.334 0.93 37.53 ? 851 HOH A O     1 
HETATM 4007 O  O     . HOH I 7 .   ? 164.356 178.714 -8.968  0.56 19.28 ? 852 HOH A O     1 
HETATM 4008 O  O     . HOH I 7 .   ? 160.465 181.744 -1.572  1.00 34.48 ? 853 HOH A O     1 
HETATM 4009 O  O     . HOH I 7 .   ? 164.538 156.413 5.063   0.82 34.99 ? 854 HOH A O     1 
HETATM 4010 O  O     . HOH I 7 .   ? 160.211 183.235 -21.313 1.00 34.74 ? 855 HOH A O     1 
HETATM 4011 O  O     . HOH I 7 .   ? 160.837 155.470 4.894   1.00 31.82 ? 856 HOH A O     1 
HETATM 4012 O  O     . HOH I 7 .   ? 143.331 181.834 -18.853 0.95 24.15 ? 857 HOH A O     1 
HETATM 4013 O  O     . HOH I 7 .   ? 152.463 170.961 -4.743  0.89 36.39 ? 858 HOH A O     1 
HETATM 4014 O  O     . HOH I 7 .   ? 147.467 179.658 -18.560 0.93 28.93 ? 859 HOH A O     1 
HETATM 4015 O  O     . HOH I 7 .   ? 148.774 178.949 -16.784 1.00 35.06 ? 860 HOH A O     1 
HETATM 4016 O  O     . HOH I 7 .   ? 144.777 179.378 -19.067 1.00 31.76 ? 861 HOH A O     1 
HETATM 4017 O  O     . HOH I 7 .   ? 152.350 159.043 -12.780 0.76 23.65 ? 862 HOH A O     1 
HETATM 4018 O  O     . HOH J 7 .   ? 134.043 155.503 -23.633 1.00 45.15 ? 101 HOH T O     1 
HETATM 4019 O  O     . HOH J 7 .   ? 138.056 161.613 -19.091 1.00 34.44 ? 102 HOH T O     1 
HETATM 4020 O  O     . HOH J 7 .   ? 143.066 177.087 -18.043 1.00 34.34 ? 103 HOH T O     1 
HETATM 4021 O  O     . HOH J 7 .   ? 144.338 163.204 -12.847 1.00 30.09 ? 104 HOH T O     1 
HETATM 4022 O  O     . HOH J 7 .   ? 141.796 160.238 -12.562 1.00 45.34 ? 105 HOH T O     1 
HETATM 4023 O  O     . HOH J 7 .   ? 145.158 169.091 -12.448 1.00 35.80 ? 106 HOH T O     1 
HETATM 4024 O  O     . HOH J 7 .   ? 137.490 167.867 -17.529 1.00 45.79 ? 107 HOH T O     1 
HETATM 4025 O  O     . HOH J 7 .   ? 145.193 172.822 -11.002 1.00 30.21 ? 108 HOH T O     1 
HETATM 4026 O  O     . HOH J 7 .   ? 140.535 168.340 -18.352 1.00 35.57 ? 109 HOH T O     1 
HETATM 4027 O  O     . HOH J 7 .   ? 134.941 177.935 -6.950  1.00 33.28 ? 110 HOH T O     1 
HETATM 4028 O  O     . HOH J 7 .   ? 135.873 163.178 -18.605 1.00 37.00 ? 111 HOH T O     1 
HETATM 4029 O  O     . HOH J 7 .   ? 141.462 164.755 -19.662 1.00 38.58 ? 112 HOH T O     1 
HETATM 4030 O  O     . HOH J 7 .   ? 138.534 169.278 -15.157 1.00 38.33 ? 113 HOH T O     1 
HETATM 4031 O  O     . HOH J 7 .   ? 136.576 169.747 -10.221 1.00 42.47 ? 114 HOH T O     1 
HETATM 4032 O  O     . HOH J 7 .   ? 136.116 174.774 -4.237  1.00 32.34 ? 115 HOH T O     1 
HETATM 4033 O  O     . HOH J 7 .   ? 146.250 173.937 0.670   1.00 38.65 ? 116 HOH T O     1 
HETATM 4034 O  O     . HOH K 7 .   ? 141.307 156.105 -6.822  1.00 31.07 ? 101 HOH P O     1 
HETATM 4035 O  O     . HOH K 7 .   ? 136.203 158.128 -11.116 1.00 39.08 ? 102 HOH P O     1 
HETATM 4036 O  O     . HOH K 7 .   ? 130.245 157.636 -12.055 1.00 37.47 ? 103 HOH P O     1 
HETATM 4037 O  O     . HOH K 7 .   ? 140.591 157.683 -9.182  1.00 40.21 ? 104 HOH P O     1 
HETATM 4038 O  O     . HOH K 7 .   ? 143.709 158.420 -9.366  1.00 38.53 ? 105 HOH P O     1 
HETATM 4039 O  O     . HOH K 7 .   ? 146.152 169.403 -9.677  1.00 29.31 ? 106 HOH P O     1 
HETATM 4040 O  O     . HOH K 7 .   ? 138.952 158.271 -10.983 1.00 45.74 ? 107 HOH P O     1 
HETATM 4041 O  O     . HOH K 7 .   ? 134.600 166.654 -11.000 0.58 29.73 ? 108 HOH P O     1 
HETATM 4042 O  O     . HOH K 7 .   ? 141.355 159.986 -10.206 1.00 40.63 ? 109 HOH P O     1 
HETATM 4043 O  O     . HOH K 7 .   ? 146.318 175.281 -7.926  1.00 31.09 ? 110 HOH P O     1 
HETATM 4044 O  O     . HOH K 7 .   ? 146.632 166.789 -1.585  1.00 35.96 ? 111 HOH P O     1 
HETATM 4045 O  O     . HOH K 7 .   ? 144.826 163.777 -10.144 1.00 38.91 ? 112 HOH P O     1 
HETATM 4046 O  O     . HOH K 7 .   ? 149.231 161.788 -2.327  1.00 21.87 ? 113 HOH P O     1 
HETATM 4047 O  O     . HOH K 7 .   ? 141.156 169.816 -3.016  1.00 38.44 ? 114 HOH P O     1 
HETATM 4048 O  O     . HOH K 7 .   ? 128.300 160.047 -5.058  0.82 48.31 ? 115 HOH P O     1 
HETATM 4049 O  O     . HOH K 7 .   ? 130.097 166.940 -18.806 1.00 47.99 ? 116 HOH P O     1 
HETATM 4050 O  O     . HOH K 7 .   ? 135.826 158.219 -22.679 1.00 52.94 ? 117 HOH P O     1 
HETATM 4051 O  O     . HOH K 7 .   ? 139.893 166.427 -3.011  1.00 42.02 ? 118 HOH P O     1 
HETATM 4052 O  O     . HOH K 7 .   ? 148.618 164.354 -1.055  1.00 42.29 ? 119 HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  ALA 41  38  38  ALA ALA A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ALA 64  61  61  ALA ALA A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 ?   ?   ?   A . n 
A 1 414 ILE 414 411 ?   ?   ?   A . n 
A 1 415 GLN 415 412 ?   ?   ?   A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   ?   ?   ?   T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DG  4   4   4   DG  DG  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 DCP 1   501 1   DCP DCP A . 
E 5 CA  1   502 1   CA  CA  A . 
F 5 CA  1   503 2   CA  CA  A . 
G 6 GOL 1   504 1   GOL GOL A . 
H 6 GOL 1   505 2   GOL GOL A . 
I 7 HOH 1   601 203 HOH HOH A . 
I 7 HOH 2   602 7   HOH HOH A . 
I 7 HOH 3   603 164 HOH HOH A . 
I 7 HOH 4   604 206 HOH HOH A . 
I 7 HOH 5   605 93  HOH HOH A . 
I 7 HOH 6   606 106 HOH HOH A . 
I 7 HOH 7   607 255 HOH HOH A . 
I 7 HOH 8   608 160 HOH HOH A . 
I 7 HOH 9   609 213 HOH HOH A . 
I 7 HOH 10  610 193 HOH HOH A . 
I 7 HOH 11  611 292 HOH HOH A . 
I 7 HOH 12  612 31  HOH HOH A . 
I 7 HOH 13  613 12  HOH HOH A . 
I 7 HOH 14  614 91  HOH HOH A . 
I 7 HOH 15  615 197 HOH HOH A . 
I 7 HOH 16  616 158 HOH HOH A . 
I 7 HOH 17  617 25  HOH HOH A . 
I 7 HOH 18  618 220 HOH HOH A . 
I 7 HOH 19  619 145 HOH HOH A . 
I 7 HOH 20  620 29  HOH HOH A . 
I 7 HOH 21  621 11  HOH HOH A . 
I 7 HOH 22  622 143 HOH HOH A . 
I 7 HOH 23  623 76  HOH HOH A . 
I 7 HOH 24  624 138 HOH HOH A . 
I 7 HOH 25  625 103 HOH HOH A . 
I 7 HOH 26  626 173 HOH HOH A . 
I 7 HOH 27  627 46  HOH HOH A . 
I 7 HOH 28  628 53  HOH HOH A . 
I 7 HOH 29  629 226 HOH HOH A . 
I 7 HOH 30  630 208 HOH HOH A . 
I 7 HOH 31  631 214 HOH HOH A . 
I 7 HOH 32  632 148 HOH HOH A . 
I 7 HOH 33  633 168 HOH HOH A . 
I 7 HOH 34  634 285 HOH HOH A . 
I 7 HOH 35  635 74  HOH HOH A . 
I 7 HOH 36  636 241 HOH HOH A . 
I 7 HOH 37  637 23  HOH HOH A . 
I 7 HOH 38  638 30  HOH HOH A . 
I 7 HOH 39  639 154 HOH HOH A . 
I 7 HOH 40  640 124 HOH HOH A . 
I 7 HOH 41  641 22  HOH HOH A . 
I 7 HOH 42  642 73  HOH HOH A . 
I 7 HOH 43  643 3   HOH HOH A . 
I 7 HOH 44  644 222 HOH HOH A . 
I 7 HOH 45  645 244 HOH HOH A . 
I 7 HOH 46  646 128 HOH HOH A . 
I 7 HOH 47  647 19  HOH HOH A . 
I 7 HOH 48  648 234 HOH HOH A . 
I 7 HOH 49  649 16  HOH HOH A . 
I 7 HOH 50  650 18  HOH HOH A . 
I 7 HOH 51  651 78  HOH HOH A . 
I 7 HOH 52  652 247 HOH HOH A . 
I 7 HOH 53  653 282 HOH HOH A . 
I 7 HOH 54  654 67  HOH HOH A . 
I 7 HOH 55  655 153 HOH HOH A . 
I 7 HOH 56  656 314 HOH HOH A . 
I 7 HOH 57  657 246 HOH HOH A . 
I 7 HOH 58  658 207 HOH HOH A . 
I 7 HOH 59  659 205 HOH HOH A . 
I 7 HOH 60  660 212 HOH HOH A . 
I 7 HOH 61  661 68  HOH HOH A . 
I 7 HOH 62  662 162 HOH HOH A . 
I 7 HOH 63  663 94  HOH HOH A . 
I 7 HOH 64  664 123 HOH HOH A . 
I 7 HOH 65  665 131 HOH HOH A . 
I 7 HOH 66  666 284 HOH HOH A . 
I 7 HOH 67  667 166 HOH HOH A . 
I 7 HOH 68  668 10  HOH HOH A . 
I 7 HOH 69  669 294 HOH HOH A . 
I 7 HOH 70  670 210 HOH HOH A . 
I 7 HOH 71  671 59  HOH HOH A . 
I 7 HOH 72  672 113 HOH HOH A . 
I 7 HOH 73  673 174 HOH HOH A . 
I 7 HOH 74  674 27  HOH HOH A . 
I 7 HOH 75  675 296 HOH HOH A . 
I 7 HOH 76  676 136 HOH HOH A . 
I 7 HOH 77  677 165 HOH HOH A . 
I 7 HOH 78  678 268 HOH HOH A . 
I 7 HOH 79  679 39  HOH HOH A . 
I 7 HOH 80  680 118 HOH HOH A . 
I 7 HOH 81  681 50  HOH HOH A . 
I 7 HOH 82  682 194 HOH HOH A . 
I 7 HOH 83  683 248 HOH HOH A . 
I 7 HOH 84  684 229 HOH HOH A . 
I 7 HOH 85  685 273 HOH HOH A . 
I 7 HOH 86  686 237 HOH HOH A . 
I 7 HOH 87  687 114 HOH HOH A . 
I 7 HOH 88  688 262 HOH HOH A . 
I 7 HOH 89  689 259 HOH HOH A . 
I 7 HOH 90  690 177 HOH HOH A . 
I 7 HOH 91  691 175 HOH HOH A . 
I 7 HOH 92  692 157 HOH HOH A . 
I 7 HOH 93  693 287 HOH HOH A . 
I 7 HOH 94  694 172 HOH HOH A . 
I 7 HOH 95  695 311 HOH HOH A . 
I 7 HOH 96  696 183 HOH HOH A . 
I 7 HOH 97  697 99  HOH HOH A . 
I 7 HOH 98  698 240 HOH HOH A . 
I 7 HOH 99  699 258 HOH HOH A . 
I 7 HOH 100 700 235 HOH HOH A . 
I 7 HOH 101 701 141 HOH HOH A . 
I 7 HOH 102 702 272 HOH HOH A . 
I 7 HOH 103 703 223 HOH HOH A . 
I 7 HOH 104 704 304 HOH HOH A . 
I 7 HOH 105 705 288 HOH HOH A . 
I 7 HOH 106 706 221 HOH HOH A . 
I 7 HOH 107 707 254 HOH HOH A . 
I 7 HOH 108 708 266 HOH HOH A . 
I 7 HOH 109 709 265 HOH HOH A . 
I 7 HOH 110 710 209 HOH HOH A . 
I 7 HOH 111 711 137 HOH HOH A . 
I 7 HOH 112 712 276 HOH HOH A . 
I 7 HOH 113 713 199 HOH HOH A . 
I 7 HOH 114 714 4   HOH HOH A . 
I 7 HOH 115 715 5   HOH HOH A . 
I 7 HOH 116 716 6   HOH HOH A . 
I 7 HOH 117 717 8   HOH HOH A . 
I 7 HOH 118 718 9   HOH HOH A . 
I 7 HOH 119 719 13  HOH HOH A . 
I 7 HOH 120 720 14  HOH HOH A . 
I 7 HOH 121 721 15  HOH HOH A . 
I 7 HOH 122 722 17  HOH HOH A . 
I 7 HOH 123 723 20  HOH HOH A . 
I 7 HOH 124 724 24  HOH HOH A . 
I 7 HOH 125 725 32  HOH HOH A . 
I 7 HOH 126 726 36  HOH HOH A . 
I 7 HOH 127 727 38  HOH HOH A . 
I 7 HOH 128 728 40  HOH HOH A . 
I 7 HOH 129 729 41  HOH HOH A . 
I 7 HOH 130 730 42  HOH HOH A . 
I 7 HOH 131 731 44  HOH HOH A . 
I 7 HOH 132 732 45  HOH HOH A . 
I 7 HOH 133 733 47  HOH HOH A . 
I 7 HOH 134 734 48  HOH HOH A . 
I 7 HOH 135 735 49  HOH HOH A . 
I 7 HOH 136 736 51  HOH HOH A . 
I 7 HOH 137 737 52  HOH HOH A . 
I 7 HOH 138 738 56  HOH HOH A . 
I 7 HOH 139 739 57  HOH HOH A . 
I 7 HOH 140 740 61  HOH HOH A . 
I 7 HOH 141 741 62  HOH HOH A . 
I 7 HOH 142 742 63  HOH HOH A . 
I 7 HOH 143 743 64  HOH HOH A . 
I 7 HOH 144 744 65  HOH HOH A . 
I 7 HOH 145 745 66  HOH HOH A . 
I 7 HOH 146 746 70  HOH HOH A . 
I 7 HOH 147 747 71  HOH HOH A . 
I 7 HOH 148 748 75  HOH HOH A . 
I 7 HOH 149 749 77  HOH HOH A . 
I 7 HOH 150 750 79  HOH HOH A . 
I 7 HOH 151 751 81  HOH HOH A . 
I 7 HOH 152 752 82  HOH HOH A . 
I 7 HOH 153 753 86  HOH HOH A . 
I 7 HOH 154 754 87  HOH HOH A . 
I 7 HOH 155 755 89  HOH HOH A . 
I 7 HOH 156 756 90  HOH HOH A . 
I 7 HOH 157 757 92  HOH HOH A . 
I 7 HOH 158 758 95  HOH HOH A . 
I 7 HOH 159 759 98  HOH HOH A . 
I 7 HOH 160 760 100 HOH HOH A . 
I 7 HOH 161 761 101 HOH HOH A . 
I 7 HOH 162 762 102 HOH HOH A . 
I 7 HOH 163 763 104 HOH HOH A . 
I 7 HOH 164 764 105 HOH HOH A . 
I 7 HOH 165 765 107 HOH HOH A . 
I 7 HOH 166 766 108 HOH HOH A . 
I 7 HOH 167 767 111 HOH HOH A . 
I 7 HOH 168 768 112 HOH HOH A . 
I 7 HOH 169 769 115 HOH HOH A . 
I 7 HOH 170 770 116 HOH HOH A . 
I 7 HOH 171 771 119 HOH HOH A . 
I 7 HOH 172 772 120 HOH HOH A . 
I 7 HOH 173 773 121 HOH HOH A . 
I 7 HOH 174 774 122 HOH HOH A . 
I 7 HOH 175 775 125 HOH HOH A . 
I 7 HOH 176 776 126 HOH HOH A . 
I 7 HOH 177 777 127 HOH HOH A . 
I 7 HOH 178 778 129 HOH HOH A . 
I 7 HOH 179 779 130 HOH HOH A . 
I 7 HOH 180 780 132 HOH HOH A . 
I 7 HOH 181 781 133 HOH HOH A . 
I 7 HOH 182 782 134 HOH HOH A . 
I 7 HOH 183 783 135 HOH HOH A . 
I 7 HOH 184 784 139 HOH HOH A . 
I 7 HOH 185 785 140 HOH HOH A . 
I 7 HOH 186 786 142 HOH HOH A . 
I 7 HOH 187 787 144 HOH HOH A . 
I 7 HOH 188 788 146 HOH HOH A . 
I 7 HOH 189 789 147 HOH HOH A . 
I 7 HOH 190 790 149 HOH HOH A . 
I 7 HOH 191 791 150 HOH HOH A . 
I 7 HOH 192 792 151 HOH HOH A . 
I 7 HOH 193 793 152 HOH HOH A . 
I 7 HOH 194 794 161 HOH HOH A . 
I 7 HOH 195 795 170 HOH HOH A . 
I 7 HOH 196 796 171 HOH HOH A . 
I 7 HOH 197 797 176 HOH HOH A . 
I 7 HOH 198 798 178 HOH HOH A . 
I 7 HOH 199 799 179 HOH HOH A . 
I 7 HOH 200 800 180 HOH HOH A . 
I 7 HOH 201 801 181 HOH HOH A . 
I 7 HOH 202 802 182 HOH HOH A . 
I 7 HOH 203 803 184 HOH HOH A . 
I 7 HOH 204 804 185 HOH HOH A . 
I 7 HOH 205 805 187 HOH HOH A . 
I 7 HOH 206 806 195 HOH HOH A . 
I 7 HOH 207 807 196 HOH HOH A . 
I 7 HOH 208 808 200 HOH HOH A . 
I 7 HOH 209 809 201 HOH HOH A . 
I 7 HOH 210 810 202 HOH HOH A . 
I 7 HOH 211 811 204 HOH HOH A . 
I 7 HOH 212 812 211 HOH HOH A . 
I 7 HOH 213 813 215 HOH HOH A . 
I 7 HOH 214 814 217 HOH HOH A . 
I 7 HOH 215 815 218 HOH HOH A . 
I 7 HOH 216 816 219 HOH HOH A . 
I 7 HOH 217 817 224 HOH HOH A . 
I 7 HOH 218 818 225 HOH HOH A . 
I 7 HOH 219 819 228 HOH HOH A . 
I 7 HOH 220 820 230 HOH HOH A . 
I 7 HOH 221 821 232 HOH HOH A . 
I 7 HOH 222 822 233 HOH HOH A . 
I 7 HOH 223 823 236 HOH HOH A . 
I 7 HOH 224 824 238 HOH HOH A . 
I 7 HOH 225 825 239 HOH HOH A . 
I 7 HOH 226 826 243 HOH HOH A . 
I 7 HOH 227 827 245 HOH HOH A . 
I 7 HOH 228 828 250 HOH HOH A . 
I 7 HOH 229 829 251 HOH HOH A . 
I 7 HOH 230 830 253 HOH HOH A . 
I 7 HOH 231 831 256 HOH HOH A . 
I 7 HOH 232 832 263 HOH HOH A . 
I 7 HOH 233 833 267 HOH HOH A . 
I 7 HOH 234 834 269 HOH HOH A . 
I 7 HOH 235 835 270 HOH HOH A . 
I 7 HOH 236 836 271 HOH HOH A . 
I 7 HOH 237 837 274 HOH HOH A . 
I 7 HOH 238 838 275 HOH HOH A . 
I 7 HOH 239 839 277 HOH HOH A . 
I 7 HOH 240 840 278 HOH HOH A . 
I 7 HOH 241 841 280 HOH HOH A . 
I 7 HOH 242 842 281 HOH HOH A . 
I 7 HOH 243 843 283 HOH HOH A . 
I 7 HOH 244 844 286 HOH HOH A . 
I 7 HOH 245 845 290 HOH HOH A . 
I 7 HOH 246 846 291 HOH HOH A . 
I 7 HOH 247 847 293 HOH HOH A . 
I 7 HOH 248 848 298 HOH HOH A . 
I 7 HOH 249 849 300 HOH HOH A . 
I 7 HOH 250 850 303 HOH HOH A . 
I 7 HOH 251 851 305 HOH HOH A . 
I 7 HOH 252 852 307 HOH HOH A . 
I 7 HOH 253 853 308 HOH HOH A . 
I 7 HOH 254 854 309 HOH HOH A . 
I 7 HOH 255 855 310 HOH HOH A . 
I 7 HOH 256 856 313 HOH HOH A . 
I 7 HOH 257 857 315 HOH HOH A . 
I 7 HOH 258 858 316 HOH HOH A . 
I 7 HOH 259 859 317 HOH HOH A . 
I 7 HOH 260 860 318 HOH HOH A . 
I 7 HOH 261 861 319 HOH HOH A . 
I 7 HOH 262 862 321 HOH HOH A . 
J 7 HOH 1   101 227 HOH HOH T . 
J 7 HOH 2   102 2   HOH HOH T . 
J 7 HOH 3   103 21  HOH HOH T . 
J 7 HOH 4   104 43  HOH HOH T . 
J 7 HOH 5   105 54  HOH HOH T . 
J 7 HOH 6   106 58  HOH HOH T . 
J 7 HOH 7   107 84  HOH HOH T . 
J 7 HOH 8   108 97  HOH HOH T . 
J 7 HOH 9   109 117 HOH HOH T . 
J 7 HOH 10  110 155 HOH HOH T . 
J 7 HOH 11  111 188 HOH HOH T . 
J 7 HOH 12  112 189 HOH HOH T . 
J 7 HOH 13  113 190 HOH HOH T . 
J 7 HOH 14  114 191 HOH HOH T . 
J 7 HOH 15  115 192 HOH HOH T . 
J 7 HOH 16  116 249 HOH HOH T . 
K 7 HOH 1   101 1   HOH HOH P . 
K 7 HOH 2   102 28  HOH HOH P . 
K 7 HOH 3   103 33  HOH HOH P . 
K 7 HOH 4   104 34  HOH HOH P . 
K 7 HOH 5   105 35  HOH HOH P . 
K 7 HOH 6   106 37  HOH HOH P . 
K 7 HOH 7   107 55  HOH HOH P . 
K 7 HOH 8   108 60  HOH HOH P . 
K 7 HOH 9   109 69  HOH HOH P . 
K 7 HOH 10  110 83  HOH HOH P . 
K 7 HOH 11  111 85  HOH HOH P . 
K 7 HOH 12  112 88  HOH HOH P . 
K 7 HOH 13  113 169 HOH HOH P . 
K 7 HOH 14  114 216 HOH HOH P . 
K 7 HOH 15  115 252 HOH HOH P . 
K 7 HOH 16  116 261 HOH HOH P . 
K 7 HOH 17  117 264 HOH HOH P . 
K 7 HOH 18  118 299 HOH HOH P . 
K 7 HOH 19  119 302 HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4950  ? 
1 MORE         -55   ? 
1 'SSA (A^2)'  21370 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 52.0  ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 75.0  ? 
3  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 107.5 ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 120.1 ? 
5  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 84.3  ? 
6  O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 84.2  ? 
7  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A   ? D DCP .   ? A DCP 501 ? 1_555 123.7 ? 
8  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A   ? D DCP .   ? A DCP 501 ? 1_555 87.6  ? 
9  O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A   ? D DCP .   ? A DCP 501 ? 1_555 161.3 ? 
10 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1A   ? D DCP .   ? A DCP 501 ? 1_555 86.4  ? 
11 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B   ? D DCP .   ? A DCP 501 ? 1_555 150.2 ? 
12 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B   ? D DCP .   ? A DCP 501 ? 1_555 157.8 ? 
13 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B   ? D DCP .   ? A DCP 501 ? 1_555 87.1  ? 
14 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B   ? D DCP .   ? A DCP 501 ? 1_555 80.5  ? 
15 O1A   ? D DCP .   ? A DCP 501 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1B   ? D DCP .   ? A DCP 501 ? 1_555 75.4  ? 
16 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D DCP .   ? A DCP 501 ? 1_555 80.9  ? 
17 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D DCP .   ? A DCP 501 ? 1_555 112.5 ? 
18 O     ? A MET 17  ? A MET 14  ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D DCP .   ? A DCP 501 ? 1_555 101.5 ? 
19 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D DCP .   ? A DCP 501 ? 1_555 159.0 ? 
20 O1A   ? D DCP .   ? A DCP 501 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D DCP .   ? A DCP 501 ? 1_555 82.0  ? 
21 O1B   ? D DCP .   ? A DCP 501 ? 1_555 CA ? E CA . ? A CA 502 ? 1_555 O1G   ? D DCP .   ? A DCP 501 ? 1_555 79.6  ? 
22 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 92.0  ? 
23 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 78.9  ? 
24 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 133.2 ? 
25 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 163.5 ? 
26 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 72.4  ? 
27 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 "O3'" ? C DT  8   ? P DT  8   ? 1_555 107.7 ? 
28 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O1A   ? D DCP .   ? A DCP 501 ? 1_555 84.5  ? 
29 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O1A   ? D DCP .   ? A DCP 501 ? 1_555 93.3  ? 
30 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O1A   ? D DCP .   ? A DCP 501 ? 1_555 130.5 ? 
31 "O3'" ? C DT  8   ? P DT  8   ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O1A   ? D DCP .   ? A DCP 501 ? 1_555 101.2 ? 
32 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 858 ? 1_555 84.0  ? 
33 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 858 ? 1_555 161.9 ? 
34 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 858 ? 1_555 63.3  ? 
35 "O3'" ? C DT  8   ? P DT  8   ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 858 ? 1_555 112.5 ? 
36 O1A   ? D DCP .   ? A DCP 501 ? 1_555 CA ? F CA . ? A CA 503 ? 1_555 O     ? I HOH .   ? A HOH 858 ? 1_555 68.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-05-13 
2 'Structure model' 1 1 2015-05-20 
3 'Structure model' 1 2 2015-07-08 
4 'Structure model' 1 3 2017-09-20 
5 'Structure model' 1 4 2019-12-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Database references'        
5 4 'Structure model' 'Derived calculations'       
6 4 'Structure model' 'Source and taxonomy'        
7 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation                  
2 4 'Structure model' entity_src_gen            
3 4 'Structure model' pdbx_audit_support        
4 4 'Structure model' pdbx_entity_src_syn       
5 4 'Structure model' pdbx_struct_assembly      
6 4 'Structure model' pdbx_struct_assembly_gen  
7 4 'Structure model' pdbx_struct_assembly_prop 
8 4 'Structure model' pdbx_struct_oper_list     
9 5 'Structure model' pdbx_audit_support        
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_citation.journal_id_CSD'                  
2  4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'      
3  4 'Structure model' '_pdbx_audit_support.funding_organization'  
4  4 'Structure model' '_pdbx_entity_src_syn.pdbx_alt_source_flag' 
5  4 'Structure model' '_pdbx_struct_assembly.oligomeric_details'  
6  4 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'    
7  4 'Structure model' '_pdbx_struct_assembly_prop.type'           
8  4 'Structure model' '_pdbx_struct_assembly_prop.value'          
9  4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
10 5 'Structure model' '_pdbx_audit_support.funding_organization'  
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(phenix.refine: dev_1839)' 1 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? ARP      ? ? ? .                           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                           3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                           4 
? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot     ? ? ? .                           5 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                           6 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "O4'" T DT 12 ? ? "C1'" T DT 12 ? ? N1 T DT 12 ? ? 110.56 108.30 2.26 0.30 N 
2 1 "O4'" P DA 7  ? ? "C1'" P DA 7  ? ? N9 P DA 7  ? ? 110.25 108.30 1.95 0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 22.14   66.90   
2 1 TYR A 39  ? ? 66.96   172.50  
3 1 LYS A 40  ? ? -139.00 -32.29  
4 1 GLN A 133 ? ? -58.70  90.09   
5 1 SER A 217 ? ? -159.09 -159.36 
6 1 SER A 257 ? ? 88.78   -3.52   
7 1 THR A 408 ? ? -95.17  42.34   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLY -2  ? N     ? A GLY 1   N     
2   1 Y 1 A MET 1   ? CG    ? A MET 4   CG    
3   1 Y 1 A MET 1   ? SD    ? A MET 4   SD    
4   1 Y 1 A MET 1   ? CE    ? A MET 4   CE    
5   1 Y 1 A GLU 127 ? OE1   ? A GLU 130 OE1   
6   1 Y 1 A GLU 127 ? OE2   ? A GLU 130 OE2   
7   1 Y 1 A GLN 130 ? CG    ? A GLN 133 CG    
8   1 Y 1 A GLN 130 ? CD    ? A GLN 133 CD    
9   1 Y 1 A GLN 130 ? OE1   ? A GLN 133 OE1   
10  1 Y 1 A GLN 130 ? NE2   ? A GLN 133 NE2   
11  1 Y 1 A LYS 131 ? CG    ? A LYS 134 CG    
12  1 Y 1 A LYS 131 ? CD    ? A LYS 134 CD    
13  1 Y 1 A LYS 131 ? CE    ? A LYS 134 CE    
14  1 Y 1 A LYS 131 ? NZ    ? A LYS 134 NZ    
15  1 Y 1 A LEU 132 ? CG    ? A LEU 135 CG    
16  1 Y 1 A LEU 132 ? CD1   ? A LEU 135 CD1   
17  1 Y 1 A LEU 132 ? CD2   ? A LEU 135 CD2   
18  1 Y 1 A GLN 133 ? CG    ? A GLN 136 CG    
19  1 Y 1 A GLN 133 ? CD    ? A GLN 136 CD    
20  1 Y 1 A GLN 133 ? OE1   ? A GLN 136 OE1   
21  1 Y 1 A GLN 133 ? NE2   ? A GLN 136 NE2   
22  1 Y 1 A GLN 162 ? CG    ? A GLN 165 CG    
23  1 Y 1 A GLN 162 ? CD    ? A GLN 165 CD    
24  1 Y 1 A GLN 162 ? OE1   ? A GLN 165 OE1   
25  1 Y 1 A GLN 162 ? NE2   ? A GLN 165 NE2   
26  1 Y 1 A MET 166 ? CG    ? A MET 169 CG    
27  1 Y 1 A MET 166 ? SD    ? A MET 169 SD    
28  1 Y 1 A MET 166 ? CE    ? A MET 169 CE    
29  1 Y 1 A GLN 179 ? CG    ? A GLN 182 CG    
30  1 Y 1 A GLN 179 ? CD    ? A GLN 182 CD    
31  1 Y 1 A GLN 179 ? OE1   ? A GLN 182 OE1   
32  1 Y 1 A GLN 179 ? NE2   ? A GLN 182 NE2   
33  1 Y 1 A THR 184 ? OG1   ? A THR 187 OG1   
34  1 Y 1 A THR 184 ? CG2   ? A THR 187 CG2   
35  1 Y 1 A ARG 256 ? CZ    ? A ARG 259 CZ    
36  1 Y 1 A ARG 256 ? NH1   ? A ARG 259 NH1   
37  1 Y 1 A ARG 256 ? NH2   ? A ARG 259 NH2   
38  1 Y 1 A GLU 268 ? CG    ? A GLU 271 CG    
39  1 Y 1 A GLU 268 ? CD    ? A GLU 271 CD    
40  1 Y 1 A GLU 268 ? OE1   ? A GLU 271 OE1   
41  1 Y 1 A GLU 268 ? OE2   ? A GLU 271 OE2   
42  1 Y 1 A LYS 293 ? CG    ? A LYS 296 CG    
43  1 Y 1 A LYS 293 ? CD    ? A LYS 296 CD    
44  1 Y 1 A LYS 293 ? CE    ? A LYS 296 CE    
45  1 Y 1 A LYS 293 ? NZ    ? A LYS 296 NZ    
46  1 Y 1 A LYS 317 ? NZ    ? A LYS 320 NZ    
47  1 Y 1 A LYS 328 ? CG    ? A LYS 331 CG    
48  1 Y 1 A LYS 328 ? CD    ? A LYS 331 CD    
49  1 Y 1 A LYS 328 ? CE    ? A LYS 331 CE    
50  1 Y 1 A LYS 328 ? NZ    ? A LYS 331 NZ    
51  1 Y 1 A ARG 334 ? CG    ? A ARG 337 CG    
52  1 Y 1 A ARG 334 ? CD    ? A ARG 337 CD    
53  1 Y 1 A ARG 334 ? NE    ? A ARG 337 NE    
54  1 Y 1 A ARG 334 ? CZ    ? A ARG 337 CZ    
55  1 Y 1 A ARG 334 ? NH1   ? A ARG 337 NH1   
56  1 Y 1 A ARG 334 ? NH2   ? A ARG 337 NH2   
57  1 Y 1 A ARG 371 ? CZ    ? A ARG 374 CZ    
58  1 Y 1 A ARG 371 ? NH1   ? A ARG 374 NH1   
59  1 Y 1 A ARG 371 ? NH2   ? A ARG 374 NH2   
60  1 Y 1 A VAL 372 ? CG1   ? A VAL 375 CG1   
61  1 Y 1 A ASP 375 ? OD1   ? A ASP 378 OD1   
62  1 Y 1 A LYS 376 ? CG    ? A LYS 379 CG    
63  1 Y 1 A LYS 376 ? CD    ? A LYS 379 CD    
64  1 Y 1 A LYS 376 ? CE    ? A LYS 379 CE    
65  1 Y 1 A LYS 376 ? NZ    ? A LYS 379 NZ    
66  1 Y 1 A ARG 377 ? CG    ? A ARG 380 CG    
67  1 Y 1 A ARG 377 ? CD    ? A ARG 380 CD    
68  1 Y 1 A ARG 377 ? NE    ? A ARG 380 NE    
69  1 Y 1 A ARG 377 ? CZ    ? A ARG 380 CZ    
70  1 Y 1 A ARG 377 ? NH1   ? A ARG 380 NH1   
71  1 Y 1 A ARG 377 ? NH2   ? A ARG 380 NH2   
72  1 Y 1 A LEU 378 ? N     ? A LEU 381 N     
73  1 Y 1 A LEU 378 ? CA    ? A LEU 381 CA    
74  1 Y 1 A LEU 378 ? CB    ? A LEU 381 CB    
75  1 Y 1 A LEU 378 ? CG    ? A LEU 381 CG    
76  1 Y 1 A LEU 378 ? CD1   ? A LEU 381 CD1   
77  1 Y 1 A LEU 378 ? CD2   ? A LEU 381 CD2   
78  1 Y 1 A ASN 405 ? CG    ? A ASN 408 CG    
79  1 Y 1 A ASN 405 ? OD1   ? A ASN 408 OD1   
80  1 Y 1 A ASN 405 ? ND2   ? A ASN 408 ND2   
81  1 Y 1 A CYS 406 ? SG    ? A CYS 409 SG    
82  1 Y 1 A SER 409 ? OG    ? A SER 412 OG    
83  1 Y 1 A THR 413 ? OG1   ? A THR 416 OG1   
84  1 Y 1 A THR 413 ? CG2   ? A THR 416 CG2   
85  1 Y 1 A ALA 431 ? CB    ? A ALA 434 CB    
86  1 Y 1 T DA  2   ? P     ? B DA  2   P     
87  1 Y 1 T DA  2   ? OP1   ? B DA  2   OP1   
88  1 Y 1 T DA  2   ? OP2   ? B DA  2   OP2   
89  1 Y 1 T DA  2   ? "O5'" ? B DA  2   "O5'" 
90  1 Y 1 T DA  2   ? "C5'" ? B DA  2   "C5'" 
91  1 Y 1 T DA  2   ? N9    ? B DA  2   N9    
92  1 Y 1 T DA  2   ? C8    ? B DA  2   C8    
93  1 Y 1 T DA  2   ? N7    ? B DA  2   N7    
94  1 Y 1 T DA  2   ? C5    ? B DA  2   C5    
95  1 Y 1 T DA  2   ? C6    ? B DA  2   C6    
96  1 Y 1 T DA  2   ? N6    ? B DA  2   N6    
97  1 Y 1 T DA  2   ? N1    ? B DA  2   N1    
98  1 Y 1 T DA  2   ? C2    ? B DA  2   C2    
99  1 Y 1 T DA  2   ? N3    ? B DA  2   N3    
100 1 Y 1 T DA  2   ? C4    ? B DA  2   C4    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
6 1 Y 1 A GLY 410 ? A GLY 413 
7 1 Y 1 A ILE 411 ? A ILE 414 
8 1 Y 1 A GLN 412 ? A GLN 415 
9 1 Y 1 T DC  1   ? B DC  1   
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4YQW 'double helix'        
4YQW 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DA 5  1_555 C DT 8 1_555 0.208  -0.260 -0.389 -6.483 -7.635  4.468 1 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 -0.290 -0.051 0.238  -2.008 -14.800 0.434 2 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 -0.405 -0.108 -0.277 -6.929 -2.982  0.987 3 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 -0.015 -0.033 -0.118 4.681  -1.297  2.626 4 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.321  -0.062 -0.504 12.651 -3.844  3.710 5 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.230 -0.113 -0.345 -4.543 -6.205  3.492 6 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 0.116  -0.133 0.268  -6.794 -0.731  2.239 7 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.736 -0.206 -0.181 15.714 4.510   9.974 8 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 1.029  -1.265 3.228 -3.623 0.916  24.826 -3.170 -3.391 3.002 2.115  8.366  
25.101 1 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.288 -1.316 3.448 4.732  9.381  28.844 -4.314 1.466  2.811 18.092 -9.126 
30.660 2 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.408 -0.523 3.186 -0.381 -0.136 33.925 -0.875 0.640  3.192 -0.232 0.652  
33.927 3 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.564  -0.692 3.245 3.630  1.387  30.652 -1.568 -0.356 3.255 2.611  -6.832 
30.891 4 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.406 -0.711 3.923 -2.589 4.580  35.581 -1.929 0.218  3.824 7.445  4.208  
35.955 5 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.243 -0.535 3.481 -4.730 1.122  35.187 -1.053 -0.340 3.466 1.845  7.778  
35.510 6 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.607  -0.284 2.892 -0.427 -0.149 23.086 -0.663 -1.649 2.882 -0.373 1.067  
23.090 7 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of Environmental Health Sciences (NIH/NIEHS)' 'United States' 'R01 ES010375' 1 
'National Institutes of Health/National Cancer Institute (NIH/NCI)'                             'United States' 'P01 CA160032' 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-DEOXYCYTIDINE-5'-TRIPHOSPHATE" DCP 
5 'CALCIUM ION'                      CA  
6 GLYCEROL                           GOL 
7 water                              HOH 
#