data_4YVF
# 
_entry.id   4YVF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YVF         
WWPDB D_1000206931 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YVF 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Akiko, K.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Bioorg.Med.Chem. 
_citation.journal_id_ASTM           BMECEP 
_citation.journal_id_CSD            1200 
_citation.journal_id_ISSN           1464-3391 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            23 
_citation.language                  ? 
_citation.page_first                4952 
_citation.page_last                 4969 
_citation.title                     
'Discovery and structural analyses of S-adenosyl-L-homocysteine hydrolase inhibitors based on non-adenosine analogs.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.bmc.2015.05.018 
_citation.pdbx_database_id_PubMed   26037610 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Nakao, A.'   1 ? 
primary 'Suzuki, H.'  2 ? 
primary 'Ueno, H.'    3 ? 
primary 'Iwasaki, H.' 4 ? 
primary 'Setsuta, T.' 5 ? 
primary 'Kashima, A.' 6 ? 
primary 'Sunada, S.'  7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4YVF 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     91.528 
_cell.length_a_esd                 ? 
_cell.length_b                     134.150 
_cell.length_b_esd                 ? 
_cell.length_c                     185.164 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4YVF 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Adenosylhomocysteinase 47772.957 2   3.3.1.1 ? ? ? 
2 non-polymer syn '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' 665.441   2   ?       ? ? ? 
3 non-polymer syn 
;2-{[5-chloro-2-(4-chlorophenoxy)phenyl](2-{[2-(methylamino)ethyl]amino}-2-oxoethyl)amino}-N-(1,3-dihydro-2H-isoindol-2-yl)-N-methylacetamide
;
556.483   2   ?       ? ? ? 
4 water       nat water 18.015    244 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'AdoHcyase,S-adenosyl-L-homocysteine hydrolase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCN
IFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTG
VHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVN
IKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
KLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCN
IFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTG
VHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVN
IKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
KLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ASP n 
1 4   LYS n 
1 5   LEU n 
1 6   PRO n 
1 7   TYR n 
1 8   LYS n 
1 9   VAL n 
1 10  ALA n 
1 11  ASP n 
1 12  ILE n 
1 13  GLY n 
1 14  LEU n 
1 15  ALA n 
1 16  ALA n 
1 17  TRP n 
1 18  GLY n 
1 19  ARG n 
1 20  LYS n 
1 21  ALA n 
1 22  LEU n 
1 23  ASP n 
1 24  ILE n 
1 25  ALA n 
1 26  GLU n 
1 27  ASN n 
1 28  GLU n 
1 29  MET n 
1 30  PRO n 
1 31  GLY n 
1 32  LEU n 
1 33  MET n 
1 34  ARG n 
1 35  MET n 
1 36  ARG n 
1 37  GLU n 
1 38  ARG n 
1 39  TYR n 
1 40  SER n 
1 41  ALA n 
1 42  SER n 
1 43  LYS n 
1 44  PRO n 
1 45  LEU n 
1 46  LYS n 
1 47  GLY n 
1 48  ALA n 
1 49  ARG n 
1 50  ILE n 
1 51  ALA n 
1 52  GLY n 
1 53  CYS n 
1 54  LEU n 
1 55  HIS n 
1 56  MET n 
1 57  THR n 
1 58  VAL n 
1 59  GLU n 
1 60  THR n 
1 61  ALA n 
1 62  VAL n 
1 63  LEU n 
1 64  ILE n 
1 65  GLU n 
1 66  THR n 
1 67  LEU n 
1 68  VAL n 
1 69  THR n 
1 70  LEU n 
1 71  GLY n 
1 72  ALA n 
1 73  GLU n 
1 74  VAL n 
1 75  GLN n 
1 76  TRP n 
1 77  SER n 
1 78  SER n 
1 79  CYS n 
1 80  ASN n 
1 81  ILE n 
1 82  PHE n 
1 83  SER n 
1 84  THR n 
1 85  GLN n 
1 86  ASP n 
1 87  HIS n 
1 88  ALA n 
1 89  ALA n 
1 90  ALA n 
1 91  ALA n 
1 92  ILE n 
1 93  ALA n 
1 94  LYS n 
1 95  ALA n 
1 96  GLY n 
1 97  ILE n 
1 98  PRO n 
1 99  VAL n 
1 100 TYR n 
1 101 ALA n 
1 102 TRP n 
1 103 LYS n 
1 104 GLY n 
1 105 GLU n 
1 106 THR n 
1 107 ASP n 
1 108 GLU n 
1 109 GLU n 
1 110 TYR n 
1 111 LEU n 
1 112 TRP n 
1 113 CYS n 
1 114 ILE n 
1 115 GLU n 
1 116 GLN n 
1 117 THR n 
1 118 LEU n 
1 119 TYR n 
1 120 PHE n 
1 121 LYS n 
1 122 ASP n 
1 123 GLY n 
1 124 PRO n 
1 125 LEU n 
1 126 ASN n 
1 127 MET n 
1 128 ILE n 
1 129 LEU n 
1 130 ASP n 
1 131 ASP n 
1 132 GLY n 
1 133 GLY n 
1 134 ASP n 
1 135 LEU n 
1 136 THR n 
1 137 ASN n 
1 138 LEU n 
1 139 ILE n 
1 140 HIS n 
1 141 THR n 
1 142 LYS n 
1 143 TYR n 
1 144 PRO n 
1 145 GLN n 
1 146 LEU n 
1 147 LEU n 
1 148 PRO n 
1 149 GLY n 
1 150 ILE n 
1 151 ARG n 
1 152 GLY n 
1 153 ILE n 
1 154 SER n 
1 155 GLU n 
1 156 GLU n 
1 157 THR n 
1 158 THR n 
1 159 THR n 
1 160 GLY n 
1 161 VAL n 
1 162 HIS n 
1 163 ASN n 
1 164 LEU n 
1 165 TYR n 
1 166 LYS n 
1 167 MET n 
1 168 MET n 
1 169 ALA n 
1 170 ASN n 
1 171 GLY n 
1 172 ILE n 
1 173 LEU n 
1 174 LYS n 
1 175 VAL n 
1 176 PRO n 
1 177 ALA n 
1 178 ILE n 
1 179 ASN n 
1 180 VAL n 
1 181 ASN n 
1 182 ASP n 
1 183 SER n 
1 184 VAL n 
1 185 THR n 
1 186 LYS n 
1 187 SER n 
1 188 LYS n 
1 189 PHE n 
1 190 ASP n 
1 191 ASN n 
1 192 LEU n 
1 193 TYR n 
1 194 GLY n 
1 195 CYS n 
1 196 ARG n 
1 197 GLU n 
1 198 SER n 
1 199 LEU n 
1 200 ILE n 
1 201 ASP n 
1 202 GLY n 
1 203 ILE n 
1 204 LYS n 
1 205 ARG n 
1 206 ALA n 
1 207 THR n 
1 208 ASP n 
1 209 VAL n 
1 210 MET n 
1 211 ILE n 
1 212 ALA n 
1 213 GLY n 
1 214 LYS n 
1 215 VAL n 
1 216 ALA n 
1 217 VAL n 
1 218 VAL n 
1 219 ALA n 
1 220 GLY n 
1 221 TYR n 
1 222 GLY n 
1 223 ASP n 
1 224 VAL n 
1 225 GLY n 
1 226 LYS n 
1 227 GLY n 
1 228 CYS n 
1 229 ALA n 
1 230 GLN n 
1 231 ALA n 
1 232 LEU n 
1 233 ARG n 
1 234 GLY n 
1 235 PHE n 
1 236 GLY n 
1 237 ALA n 
1 238 ARG n 
1 239 VAL n 
1 240 ILE n 
1 241 ILE n 
1 242 THR n 
1 243 GLU n 
1 244 ILE n 
1 245 ASP n 
1 246 PRO n 
1 247 ILE n 
1 248 ASN n 
1 249 ALA n 
1 250 LEU n 
1 251 GLN n 
1 252 ALA n 
1 253 ALA n 
1 254 MET n 
1 255 GLU n 
1 256 GLY n 
1 257 TYR n 
1 258 GLU n 
1 259 VAL n 
1 260 THR n 
1 261 THR n 
1 262 MET n 
1 263 ASP n 
1 264 GLU n 
1 265 ALA n 
1 266 CYS n 
1 267 GLN n 
1 268 GLU n 
1 269 GLY n 
1 270 ASN n 
1 271 ILE n 
1 272 PHE n 
1 273 VAL n 
1 274 THR n 
1 275 THR n 
1 276 THR n 
1 277 GLY n 
1 278 CYS n 
1 279 ILE n 
1 280 ASP n 
1 281 ILE n 
1 282 ILE n 
1 283 LEU n 
1 284 GLY n 
1 285 ARG n 
1 286 HIS n 
1 287 PHE n 
1 288 GLU n 
1 289 GLN n 
1 290 MET n 
1 291 LYS n 
1 292 ASP n 
1 293 ASP n 
1 294 ALA n 
1 295 ILE n 
1 296 VAL n 
1 297 CYS n 
1 298 ASN n 
1 299 ILE n 
1 300 GLY n 
1 301 HIS n 
1 302 PHE n 
1 303 ASP n 
1 304 VAL n 
1 305 GLU n 
1 306 ILE n 
1 307 ASP n 
1 308 VAL n 
1 309 LYS n 
1 310 TRP n 
1 311 LEU n 
1 312 ASN n 
1 313 GLU n 
1 314 ASN n 
1 315 ALA n 
1 316 VAL n 
1 317 GLU n 
1 318 LYS n 
1 319 VAL n 
1 320 ASN n 
1 321 ILE n 
1 322 LYS n 
1 323 PRO n 
1 324 GLN n 
1 325 VAL n 
1 326 ASP n 
1 327 ARG n 
1 328 TYR n 
1 329 ARG n 
1 330 LEU n 
1 331 LYS n 
1 332 ASN n 
1 333 GLY n 
1 334 ARG n 
1 335 ARG n 
1 336 ILE n 
1 337 ILE n 
1 338 LEU n 
1 339 LEU n 
1 340 ALA n 
1 341 GLU n 
1 342 GLY n 
1 343 ARG n 
1 344 LEU n 
1 345 VAL n 
1 346 ASN n 
1 347 LEU n 
1 348 GLY n 
1 349 CYS n 
1 350 ALA n 
1 351 MET n 
1 352 GLY n 
1 353 HIS n 
1 354 PRO n 
1 355 SER n 
1 356 PHE n 
1 357 VAL n 
1 358 MET n 
1 359 SER n 
1 360 ASN n 
1 361 SER n 
1 362 PHE n 
1 363 THR n 
1 364 ASN n 
1 365 GLN n 
1 366 VAL n 
1 367 MET n 
1 368 ALA n 
1 369 GLN n 
1 370 ILE n 
1 371 GLU n 
1 372 LEU n 
1 373 TRP n 
1 374 THR n 
1 375 HIS n 
1 376 PRO n 
1 377 ASP n 
1 378 LYS n 
1 379 TYR n 
1 380 PRO n 
1 381 VAL n 
1 382 GLY n 
1 383 VAL n 
1 384 HIS n 
1 385 PHE n 
1 386 LEU n 
1 387 PRO n 
1 388 LYS n 
1 389 LYS n 
1 390 LEU n 
1 391 ASP n 
1 392 GLU n 
1 393 ALA n 
1 394 VAL n 
1 395 ALA n 
1 396 GLU n 
1 397 ALA n 
1 398 HIS n 
1 399 LEU n 
1 400 GLY n 
1 401 LYS n 
1 402 LEU n 
1 403 ASN n 
1 404 VAL n 
1 405 LYS n 
1 406 LEU n 
1 407 THR n 
1 408 LYS n 
1 409 LEU n 
1 410 THR n 
1 411 GLU n 
1 412 LYS n 
1 413 GLN n 
1 414 ALA n 
1 415 GLN n 
1 416 TYR n 
1 417 LEU n 
1 418 GLY n 
1 419 MET n 
1 420 SER n 
1 421 CYS n 
1 422 ASP n 
1 423 GLY n 
1 424 PRO n 
1 425 PHE n 
1 426 LYS n 
1 427 PRO n 
1 428 ASP n 
1 429 HIS n 
1 430 TYR n 
1 431 ARG n 
1 432 TYR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   432 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AHCY, SAHH' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    SAHH_HUMAN 
_struct_ref.pdbx_db_accession          P23526 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMRERYSASKPLKGARIAGCLHMTVETAVLIETLVTLGAEVQWSSCN
IFSTQDHAAAAIAKAGIPVYAWKGETDEEYLWCIEQTLYFKDGPLNMILDDGGDLTNLIHTKYPQLLPGIRGISEETTTG
VHNLYKMMANGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYGDVGKGCAQALRGFGARVI
ITEIDPINALQAAMEGYEVTTMDEACQEGNIFVTTTGCIDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVN
IKPQVDRYRLKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHLG
KLNVKLTKLTEKQAQYLGMSCDGPFKPDHYRY
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YVF A 1 ? 432 ? P23526 1 ? 432 ? 1 432 
2 1 4YVF B 1 ? 432 ? P23526 1 ? 432 ? 1 432 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?    'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE ?    'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE ?    'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?    'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE ?    'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE ?    'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?    'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE ?    'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE ?    'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER ?    'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?    'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE ?    'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE ?    'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE ?    'C5 H11 N O2 S'     149.211 
NAI non-polymer         . '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' NADH 'C21 H29 N7 O14 P2' 665.441 
PHE 'L-peptide linking' y PHENYLALANINE ?    'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE ?    'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE ?    'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE ?    'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?    'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE ?    'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE ?    'C5 H11 N O2'       117.146 
XFA non-polymer         . 
;2-{[5-chloro-2-(4-chlorophenoxy)phenyl](2-{[2-(methylamino)ethyl]amino}-2-oxoethyl)amino}-N-(1,3-dihydro-2H-isoindol-2-yl)-N-methylacetamide
;
?    'C28 H31 Cl2 N5 O3' 556.483 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YVF 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.00 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.94 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'HEPES, PEG 4000, 2-propanol, ethyl acetate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           93 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS V' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2003-02-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.82565 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL24XU' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.82565 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL24XU 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
# 
_reflns.B_iso_Wilson_estimate            22.1 
_reflns.entry_id                         4YVF 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.7 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       31605 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.6 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.18 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            25.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               23.9 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4YVF 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.70 
_refine.ls_d_res_low                             47.81 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     31525 
_refine.ls_number_reflns_R_free                  1565 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.5 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_R_free                       0.239 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_bsol                 26.9233 
_refine.solvent_model_param_ksol                 0.415278 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               3383107.73 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        4YVF 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_sigma_a_free            0.27 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             0.19 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6644 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         164 
_refine_hist.number_atoms_solvent             244 
_refine_hist.number_atoms_total               7052 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        47.81 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006 ?    ? ? c_bond_d                ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_bond_d_na             ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_bond_d_prot           ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_angle_d               ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_angle_d_na            ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_angle_d_prot          ? ? 
'X-RAY DIFFRACTION' ? 1.2   ?    ? ? c_angle_deg             ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_angle_deg_na          ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_angle_deg_prot        ? ? 
'X-RAY DIFFRACTION' ? 22.0  ?    ? ? c_dihedral_angle_d      ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_dihedral_angle_d_na   ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_dihedral_angle_d_prot ? ? 
'X-RAY DIFFRACTION' ? 0.73  ?    ? ? c_improper_angle_d      ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_improper_angle_d_na   ? ? 
'X-RAY DIFFRACTION' ? ?     ?    ? ? c_improper_angle_d_prot ? ? 
'X-RAY DIFFRACTION' ? 1.00  1.50 ? ? c_mcbond_it             ? ? 
'X-RAY DIFFRACTION' ? 1.60  2.00 ? ? c_mcangle_it            ? ? 
'X-RAY DIFFRACTION' ? 1.85  2.00 ? ? c_scbond_it             ? ? 
'X-RAY DIFFRACTION' ? 2.66  2.50 ? ? c_scangle_it            ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.70 
_refine_ls_shell.d_res_low                        2.87 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             280 
_refine_ls_shell.number_reflns_R_work             4826 
_refine_ls_shell.percent_reflns_obs               98.5 
_refine_ls_shell.percent_reflns_R_free            5.5 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.282 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.R_factor_R_work                  0.229 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 ACCELRYS_CNX:libraries/toppar/protein_rep.para ACCELRYS_CNX:libraries/toppar/protein.top 
'X-RAY DIFFRACTION' 2 ../../../param/nad.par                         ../../../param/nad.top                    
'X-RAY DIFFRACTION' 3 ../../../param/fa.par                          ../../../param/fa.top                     
'X-RAY DIFFRACTION' 4 ACCELRYS_CNX:libraries/toppar/water_rep.param  ACCELRYS_CNX:libraries/toppar/water.top   
'X-RAY DIFFRACTION' 5 ../../../param/cis_peptide.param               ?                                         
# 
_struct.entry_id                     4YVF 
_struct.title                        'Structure of S-adenosyl-L-homocysteine hydrolase' 
_struct.pdbx_descriptor              'S-adenosyl-L-homocysteine hydrolase' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YVF 
_struct_keywords.text            'SAHH, HYDROLASE' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 11  ? GLY A 13  ? ASP A 11  GLY A 13  5 ? 3  
HELX_P HELX_P2  AA2 LEU A 14  ? MET A 29  ? LEU A 14  MET A 29  1 ? 16 
HELX_P HELX_P3  AA3 MET A 29  ? SER A 40  ? MET A 29  SER A 40  1 ? 12 
HELX_P HELX_P4  AA4 THR A 57  ? LEU A 70  ? THR A 57  LEU A 70  1 ? 14 
HELX_P HELX_P5  AA5 GLN A 85  ? ALA A 95  ? GLN A 85  ALA A 95  1 ? 11 
HELX_P HELX_P6  AA6 THR A 106 ? THR A 117 ? THR A 106 THR A 117 1 ? 12 
HELX_P HELX_P7  AA7 GLY A 133 ? TYR A 143 ? GLY A 133 TYR A 143 1 ? 11 
HELX_P HELX_P8  AA8 PRO A 144 ? ILE A 150 ? PRO A 144 ILE A 150 5 ? 7  
HELX_P HELX_P9  AA9 THR A 157 ? ASN A 170 ? THR A 157 ASN A 170 1 ? 14 
HELX_P HELX_P10 AB1 SER A 183 ? ASP A 208 ? SER A 183 ASP A 208 1 ? 26 
HELX_P HELX_P11 AB2 GLY A 222 ? PHE A 235 ? GLY A 222 PHE A 235 1 ? 14 
HELX_P HELX_P12 AB3 ASP A 245 ? MET A 254 ? ASP A 245 MET A 254 1 ? 10 
HELX_P HELX_P13 AB4 THR A 261 ? CYS A 266 ? THR A 261 CYS A 266 1 ? 6  
HELX_P HELX_P14 AB5 LEU A 283 ? GLU A 288 ? LEU A 283 GLU A 288 1 ? 6  
HELX_P HELX_P15 AB6 ASP A 307 ? ALA A 315 ? ASP A 307 ALA A 315 1 ? 9  
HELX_P HELX_P16 AB7 GLU A 341 ? ARG A 343 ? GLU A 341 ARG A 343 5 ? 3  
HELX_P HELX_P17 AB8 LEU A 344 ? CYS A 349 ? LEU A 344 CYS A 349 1 ? 6  
HELX_P HELX_P18 AB9 PRO A 354 ? HIS A 375 ? PRO A 354 HIS A 375 1 ? 22 
HELX_P HELX_P19 AC1 PRO A 376 ? TYR A 379 ? PRO A 376 TYR A 379 5 ? 4  
HELX_P HELX_P20 AC2 PRO A 387 ? GLY A 400 ? PRO A 387 GLY A 400 1 ? 14 
HELX_P HELX_P21 AC3 THR A 410 ? GLY A 418 ? THR A 410 GLY A 418 1 ? 9  
HELX_P HELX_P22 AC4 ASP B 11  ? GLY B 13  ? ASP B 11  GLY B 13  5 ? 3  
HELX_P HELX_P23 AC5 LEU B 14  ? ASN B 27  ? LEU B 14  ASN B 27  1 ? 14 
HELX_P HELX_P24 AC6 MET B 29  ? SER B 40  ? MET B 29  SER B 40  1 ? 12 
HELX_P HELX_P25 AC7 THR B 57  ? LEU B 70  ? THR B 57  LEU B 70  1 ? 14 
HELX_P HELX_P26 AC8 GLN B 85  ? ALA B 95  ? GLN B 85  ALA B 95  1 ? 11 
HELX_P HELX_P27 AC9 THR B 106 ? LEU B 118 ? THR B 106 LEU B 118 1 ? 13 
HELX_P HELX_P28 AD1 GLY B 133 ? TYR B 143 ? GLY B 133 TYR B 143 1 ? 11 
HELX_P HELX_P29 AD2 PRO B 144 ? ILE B 150 ? PRO B 144 ILE B 150 5 ? 7  
HELX_P HELX_P30 AD3 THR B 157 ? ASN B 170 ? THR B 157 ASN B 170 1 ? 14 
HELX_P HELX_P31 AD4 SER B 183 ? ASP B 208 ? SER B 183 ASP B 208 1 ? 26 
HELX_P HELX_P32 AD5 GLY B 222 ? PHE B 235 ? GLY B 222 PHE B 235 1 ? 14 
HELX_P HELX_P33 AD6 ASP B 245 ? GLU B 255 ? ASP B 245 GLU B 255 1 ? 11 
HELX_P HELX_P34 AD7 THR B 261 ? CYS B 266 ? THR B 261 CYS B 266 1 ? 6  
HELX_P HELX_P35 AD8 LEU B 283 ? GLU B 288 ? LEU B 283 GLU B 288 1 ? 6  
HELX_P HELX_P36 AD9 ASP B 307 ? ALA B 315 ? ASP B 307 ALA B 315 1 ? 9  
HELX_P HELX_P37 AE1 GLU B 341 ? ARG B 343 ? GLU B 341 ARG B 343 5 ? 3  
HELX_P HELX_P38 AE2 LEU B 344 ? CYS B 349 ? LEU B 344 CYS B 349 1 ? 6  
HELX_P HELX_P39 AE3 PRO B 354 ? HIS B 375 ? PRO B 354 HIS B 375 1 ? 22 
HELX_P HELX_P40 AE4 PRO B 376 ? TYR B 379 ? PRO B 376 TYR B 379 5 ? 4  
HELX_P HELX_P41 AE5 PRO B 387 ? GLY B 400 ? PRO B 387 GLY B 400 1 ? 14 
HELX_P HELX_P42 AE6 THR B 410 ? GLY B 418 ? THR B 410 GLY B 418 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 423 A . ? GLY 423 A PRO 424 A ? PRO 424 A 1 0.29 
2 GLY 423 B . ? GLY 423 B PRO 424 B ? PRO 424 B 1 0.70 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 8 ? 
AA2 ? 2 ? 
AA3 ? 8 ? 
AA4 ? 7 ? 
AA5 ? 2 ? 
AA6 ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA1 6 7 ? parallel      
AA1 7 8 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA3 6 7 ? anti-parallel 
AA3 7 8 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? parallel      
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA4 5 6 ? parallel      
AA4 6 7 ? parallel      
AA5 1 2 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA6 5 6 ? parallel      
AA6 6 7 ? anti-parallel 
AA6 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LYS A 8   ? VAL A 9   ? LYS A 8   VAL A 9   
AA1 2 VAL A 99  ? ALA A 101 ? VAL A 99  ALA A 101 
AA1 3 GLU A 73  ? SER A 77  ? GLU A 73  SER A 77  
AA1 4 ARG A 49  ? CYS A 53  ? ARG A 49  CYS A 53  
AA1 5 MET A 127 ? ASP A 130 ? MET A 127 ASP A 130 
AA1 6 ILE A 153 ? GLU A 155 ? ILE A 153 GLU A 155 
AA1 7 PRO A 176 ? ASN A 179 ? PRO A 176 ASN A 179 
AA1 8 GLY A 382 ? PHE A 385 ? GLY A 382 PHE A 385 
AA2 1 TYR A 119 ? PHE A 120 ? TYR A 119 PHE A 120 
AA2 2 GLY A 123 ? PRO A 124 ? GLY A 123 PRO A 124 
AA3 1 GLU A 258 ? VAL A 259 ? GLU A 258 VAL A 259 
AA3 2 ARG A 238 ? THR A 242 ? ARG A 238 THR A 242 
AA3 3 VAL A 215 ? ALA A 219 ? VAL A 215 ALA A 219 
AA3 4 ILE A 271 ? THR A 274 ? ILE A 271 THR A 274 
AA3 5 ALA A 294 ? ASN A 298 ? ALA A 294 ASN A 298 
AA3 6 ARG A 335 ? LEU A 339 ? ARG A 335 LEU A 339 
AA3 7 VAL A 325 ? ARG A 329 ? VAL A 325 ARG A 329 
AA3 8 GLU A 317 ? LYS A 322 ? GLU A 317 LYS A 322 
AA4 1 VAL B 99  ? TYR B 100 ? VAL B 99  TYR B 100 
AA4 2 GLU B 73  ? SER B 77  ? GLU B 73  SER B 77  
AA4 3 ARG B 49  ? CYS B 53  ? ARG B 49  CYS B 53  
AA4 4 MET B 127 ? ASP B 130 ? MET B 127 ASP B 130 
AA4 5 GLY B 152 ? GLU B 155 ? GLY B 152 GLU B 155 
AA4 6 ALA B 177 ? ASN B 179 ? ALA B 177 ASN B 179 
AA4 7 VAL B 383 ? PHE B 385 ? VAL B 383 PHE B 385 
AA5 1 TYR B 119 ? PHE B 120 ? TYR B 119 PHE B 120 
AA5 2 GLY B 123 ? PRO B 124 ? GLY B 123 PRO B 124 
AA6 1 GLU B 258 ? VAL B 259 ? GLU B 258 VAL B 259 
AA6 2 ARG B 238 ? THR B 242 ? ARG B 238 THR B 242 
AA6 3 VAL B 215 ? ALA B 219 ? VAL B 215 ALA B 219 
AA6 4 ILE B 271 ? THR B 274 ? ILE B 271 THR B 274 
AA6 5 ALA B 294 ? ASN B 298 ? ALA B 294 ASN B 298 
AA6 6 ARG B 335 ? LEU B 339 ? ARG B 335 LEU B 339 
AA6 7 VAL B 325 ? ARG B 329 ? VAL B 325 ARG B 329 
AA6 8 GLU B 317 ? LYS B 322 ? GLU B 317 LYS B 322 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 8   ? N LYS A 8   O VAL A 99  ? O VAL A 99  
AA1 2 3 O TYR A 100 ? O TYR A 100 N TRP A 76  ? N TRP A 76  
AA1 3 4 O GLU A 73  ? O GLU A 73  N ILE A 50  ? N ILE A 50  
AA1 4 5 N ALA A 51  ? N ALA A 51  O MET A 127 ? O MET A 127 
AA1 5 6 N ASP A 130 ? N ASP A 130 O SER A 154 ? O SER A 154 
AA1 6 7 N ILE A 153 ? N ILE A 153 O ILE A 178 ? O ILE A 178 
AA1 7 8 N ASN A 179 ? N ASN A 179 O HIS A 384 ? O HIS A 384 
AA2 1 2 N PHE A 120 ? N PHE A 120 O GLY A 123 ? O GLY A 123 
AA3 1 2 O GLU A 258 ? O GLU A 258 N ILE A 241 ? N ILE A 241 
AA3 2 3 O ILE A 240 ? O ILE A 240 N VAL A 218 ? N VAL A 218 
AA3 3 4 N VAL A 217 ? N VAL A 217 O ILE A 271 ? O ILE A 271 
AA3 4 5 N PHE A 272 ? N PHE A 272 O ILE A 295 ? O ILE A 295 
AA3 5 6 N VAL A 296 ? N VAL A 296 O ILE A 337 ? O ILE A 337 
AA3 6 7 O ILE A 336 ? O ILE A 336 N TYR A 328 ? N TYR A 328 
AA3 7 8 O ARG A 327 ? O ARG A 327 N VAL A 319 ? N VAL A 319 
AA4 1 2 O TYR B 100 ? O TYR B 100 N TRP B 76  ? N TRP B 76  
AA4 2 3 O GLU B 73  ? O GLU B 73  N ILE B 50  ? N ILE B 50  
AA4 3 4 N ALA B 51  ? N ALA B 51  O MET B 127 ? O MET B 127 
AA4 4 5 N ASP B 130 ? N ASP B 130 O SER B 154 ? O SER B 154 
AA4 5 6 N ILE B 153 ? N ILE B 153 O ILE B 178 ? O ILE B 178 
AA4 6 7 N ASN B 179 ? N ASN B 179 O HIS B 384 ? O HIS B 384 
AA5 1 2 N PHE B 120 ? N PHE B 120 O GLY B 123 ? O GLY B 123 
AA6 1 2 O GLU B 258 ? O GLU B 258 N ILE B 241 ? N ILE B 241 
AA6 2 3 O ILE B 240 ? O ILE B 240 N ALA B 216 ? N ALA B 216 
AA6 3 4 N VAL B 217 ? N VAL B 217 O ILE B 271 ? O ILE B 271 
AA6 4 5 N PHE B 272 ? N PHE B 272 O ILE B 295 ? O ILE B 295 
AA6 5 6 N ALA B 294 ? N ALA B 294 O ILE B 337 ? O ILE B 337 
AA6 6 7 O ILE B 336 ? O ILE B 336 N TYR B 328 ? N TYR B 328 
AA6 7 8 O ARG B 327 ? O ARG B 327 N VAL B 319 ? N VAL B 319 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NAI 501 ? 31 'binding site for residue NAI A 501' 
AC2 Software A XFA 502 ? 15 'binding site for residue XFA A 502' 
AC3 Software B NAI 501 ? 33 'binding site for residue NAI B 501' 
AC4 Software B XFA 502 ? 14 'binding site for residue XFA B 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 31 ASP A 190 ? ASP A 190 . ? 1_555 ? 
2  AC1 31 ASN A 191 ? ASN A 191 . ? 1_555 ? 
3  AC1 31 CYS A 195 ? CYS A 195 . ? 1_555 ? 
4  AC1 31 GLY A 222 ? GLY A 222 . ? 1_555 ? 
5  AC1 31 ASP A 223 ? ASP A 223 . ? 1_555 ? 
6  AC1 31 VAL A 224 ? VAL A 224 . ? 1_555 ? 
7  AC1 31 THR A 242 ? THR A 242 . ? 1_555 ? 
8  AC1 31 GLU A 243 ? GLU A 243 . ? 1_555 ? 
9  AC1 31 ILE A 244 ? ILE A 244 . ? 1_555 ? 
10 AC1 31 ASP A 245 ? ASP A 245 . ? 1_555 ? 
11 AC1 31 ASN A 248 ? ASN A 248 . ? 1_555 ? 
12 AC1 31 THR A 275 ? THR A 275 . ? 1_555 ? 
13 AC1 31 THR A 276 ? THR A 276 . ? 1_555 ? 
14 AC1 31 GLY A 277 ? GLY A 277 . ? 1_555 ? 
15 AC1 31 CYS A 278 ? CYS A 278 . ? 1_555 ? 
16 AC1 31 ILE A 281 ? ILE A 281 . ? 1_555 ? 
17 AC1 31 ILE A 299 ? ILE A 299 . ? 1_555 ? 
18 AC1 31 GLY A 300 ? GLY A 300 . ? 1_555 ? 
19 AC1 31 HIS A 301 ? HIS A 301 . ? 1_555 ? 
20 AC1 31 LEU A 344 ? LEU A 344 . ? 1_555 ? 
21 AC1 31 ASN A 346 ? ASN A 346 . ? 1_555 ? 
22 AC1 31 HIS A 353 ? HIS A 353 . ? 1_555 ? 
23 AC1 31 XFA D .   ? XFA A 502 . ? 1_555 ? 
24 AC1 31 HOH G .   ? HOH A 646 . ? 1_555 ? 
25 AC1 31 HOH G .   ? HOH A 655 . ? 1_555 ? 
26 AC1 31 HOH G .   ? HOH A 668 . ? 1_555 ? 
27 AC1 31 HOH G .   ? HOH A 678 . ? 1_555 ? 
28 AC1 31 HOH G .   ? HOH A 681 . ? 1_555 ? 
29 AC1 31 HOH G .   ? HOH A 684 . ? 1_555 ? 
30 AC1 31 LYS B 426 ? LYS B 426 . ? 1_555 ? 
31 AC1 31 TYR B 430 ? TYR B 430 . ? 1_555 ? 
32 AC2 15 HIS A 55  ? HIS A 55  . ? 1_555 ? 
33 AC2 15 THR A 57  ? THR A 57  . ? 1_555 ? 
34 AC2 15 GLU A 59  ? GLU A 59  . ? 1_555 ? 
35 AC2 15 SER A 83  ? SER A 83  . ? 1_555 ? 
36 AC2 15 GLN A 85  ? GLN A 85  . ? 1_555 ? 
37 AC2 15 ASP A 190 ? ASP A 190 . ? 1_555 ? 
38 AC2 15 LEU A 344 ? LEU A 344 . ? 1_555 ? 
39 AC2 15 ASN A 346 ? ASN A 346 . ? 1_555 ? 
40 AC2 15 LEU A 347 ? LEU A 347 . ? 1_555 ? 
41 AC2 15 MET A 351 ? MET A 351 . ? 1_555 ? 
42 AC2 15 GLY A 352 ? GLY A 352 . ? 1_555 ? 
43 AC2 15 HIS A 353 ? HIS A 353 . ? 1_555 ? 
44 AC2 15 MET A 358 ? MET A 358 . ? 1_555 ? 
45 AC2 15 NAI C .   ? NAI A 501 . ? 1_555 ? 
46 AC2 15 HOH G .   ? HOH A 620 . ? 1_555 ? 
47 AC3 33 LEU A 409 ? LEU A 409 . ? 1_555 ? 
48 AC3 33 GLN A 413 ? GLN A 413 . ? 1_555 ? 
49 AC3 33 LYS A 426 ? LYS A 426 . ? 1_555 ? 
50 AC3 33 TYR A 430 ? TYR A 430 . ? 1_555 ? 
51 AC3 33 ASP B 190 ? ASP B 190 . ? 1_555 ? 
52 AC3 33 ASN B 191 ? ASN B 191 . ? 1_555 ? 
53 AC3 33 CYS B 195 ? CYS B 195 . ? 1_555 ? 
54 AC3 33 GLY B 222 ? GLY B 222 . ? 1_555 ? 
55 AC3 33 ASP B 223 ? ASP B 223 . ? 1_555 ? 
56 AC3 33 VAL B 224 ? VAL B 224 . ? 1_555 ? 
57 AC3 33 THR B 242 ? THR B 242 . ? 1_555 ? 
58 AC3 33 GLU B 243 ? GLU B 243 . ? 1_555 ? 
59 AC3 33 ILE B 244 ? ILE B 244 . ? 1_555 ? 
60 AC3 33 ASP B 245 ? ASP B 245 . ? 1_555 ? 
61 AC3 33 ASN B 248 ? ASN B 248 . ? 1_555 ? 
62 AC3 33 THR B 275 ? THR B 275 . ? 1_555 ? 
63 AC3 33 THR B 276 ? THR B 276 . ? 1_555 ? 
64 AC3 33 GLY B 277 ? GLY B 277 . ? 1_555 ? 
65 AC3 33 CYS B 278 ? CYS B 278 . ? 1_555 ? 
66 AC3 33 ILE B 281 ? ILE B 281 . ? 1_555 ? 
67 AC3 33 ILE B 299 ? ILE B 299 . ? 1_555 ? 
68 AC3 33 GLY B 300 ? GLY B 300 . ? 1_555 ? 
69 AC3 33 HIS B 301 ? HIS B 301 . ? 1_555 ? 
70 AC3 33 ASN B 346 ? ASN B 346 . ? 1_555 ? 
71 AC3 33 HIS B 353 ? HIS B 353 . ? 1_555 ? 
72 AC3 33 XFA F .   ? XFA B 502 . ? 1_555 ? 
73 AC3 33 HOH H .   ? HOH B 619 . ? 1_555 ? 
74 AC3 33 HOH H .   ? HOH B 626 . ? 1_555 ? 
75 AC3 33 HOH H .   ? HOH B 653 . ? 1_555 ? 
76 AC3 33 HOH H .   ? HOH B 659 . ? 1_555 ? 
77 AC3 33 HOH H .   ? HOH B 671 . ? 1_555 ? 
78 AC3 33 HOH H .   ? HOH B 673 . ? 1_555 ? 
79 AC3 33 HOH H .   ? HOH B 678 . ? 1_555 ? 
80 AC4 14 HIS B 55  ? HIS B 55  . ? 1_555 ? 
81 AC4 14 THR B 57  ? THR B 57  . ? 1_555 ? 
82 AC4 14 GLU B 59  ? GLU B 59  . ? 1_555 ? 
83 AC4 14 SER B 83  ? SER B 83  . ? 1_555 ? 
84 AC4 14 GLN B 85  ? GLN B 85  . ? 1_555 ? 
85 AC4 14 ASP B 190 ? ASP B 190 . ? 1_555 ? 
86 AC4 14 LEU B 344 ? LEU B 344 . ? 1_555 ? 
87 AC4 14 ASN B 346 ? ASN B 346 . ? 1_555 ? 
88 AC4 14 LEU B 347 ? LEU B 347 . ? 1_555 ? 
89 AC4 14 MET B 351 ? MET B 351 . ? 1_555 ? 
90 AC4 14 GLY B 352 ? GLY B 352 . ? 1_555 ? 
91 AC4 14 HIS B 353 ? HIS B 353 . ? 1_555 ? 
92 AC4 14 NAI E .   ? NAI B 501 . ? 1_555 ? 
93 AC4 14 HOH H .   ? HOH B 614 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4YVF 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4YVF 
_atom_sites.fract_transf_matrix[1][1]   0.010926 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007454 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005401 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 4   ? 14.428 179.367 35.477  1.00 28.65 ? 4   LYS A N   1 
ATOM   2    C  CA  . LYS A 1 4   ? 14.931 178.164 34.750  1.00 29.52 ? 4   LYS A CA  1 
ATOM   3    C  C   . LYS A 1 4   ? 14.361 178.085 33.338  1.00 29.16 ? 4   LYS A C   1 
ATOM   4    O  O   . LYS A 1 4   ? 13.200 178.411 33.114  1.00 30.06 ? 4   LYS A O   1 
ATOM   5    C  CB  . LYS A 1 4   ? 14.562 176.886 35.512  1.00 29.41 ? 4   LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 4   ? 15.140 175.629 34.870  1.00 31.00 ? 4   LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 4   ? 14.690 174.346 35.559  1.00 31.18 ? 4   LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 4   ? 15.243 173.130 34.816  1.00 32.13 ? 4   LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 4   ? 14.817 171.828 35.407  1.00 32.65 ? 4   LYS A NZ  1 
ATOM   10   N  N   . LEU A 1 5   ? 15.174 177.647 32.383  1.00 29.23 ? 5   LEU A N   1 
ATOM   11   C  CA  . LEU A 1 5   ? 14.722 177.538 30.998  1.00 30.00 ? 5   LEU A CA  1 
ATOM   12   C  C   . LEU A 1 5   ? 13.821 176.327 30.803  1.00 30.11 ? 5   LEU A C   1 
ATOM   13   O  O   . LEU A 1 5   ? 14.074 175.262 31.366  1.00 30.36 ? 5   LEU A O   1 
ATOM   14   C  CB  . LEU A 1 5   ? 15.918 177.421 30.053  1.00 30.40 ? 5   LEU A CB  1 
ATOM   15   C  CG  . LEU A 1 5   ? 16.828 178.643 29.968  1.00 31.09 ? 5   LEU A CG  1 
ATOM   16   C  CD1 . LEU A 1 5   ? 18.016 178.341 29.065  1.00 30.42 ? 5   LEU A CD1 1 
ATOM   17   C  CD2 . LEU A 1 5   ? 16.028 179.822 29.431  1.00 30.41 ? 5   LEU A CD2 1 
ATOM   18   N  N   . PRO A 1 6   ? 12.754 176.477 30.002  1.00 29.25 ? 6   PRO A N   1 
ATOM   19   C  CA  . PRO A 1 6   ? 11.821 175.377 29.739  1.00 29.69 ? 6   PRO A CA  1 
ATOM   20   C  C   . PRO A 1 6   ? 12.476 174.367 28.802  1.00 31.09 ? 6   PRO A C   1 
ATOM   21   O  O   . PRO A 1 6   ? 12.044 173.221 28.692  1.00 32.91 ? 6   PRO A O   1 
ATOM   22   C  CB  . PRO A 1 6   ? 10.634 176.084 29.095  1.00 29.02 ? 6   PRO A CB  1 
ATOM   23   C  CG  . PRO A 1 6   ? 11.298 177.181 28.319  1.00 29.02 ? 6   PRO A CG  1 
ATOM   24   C  CD  . PRO A 1 6   ? 12.340 177.701 29.293  1.00 28.15 ? 6   PRO A CD  1 
ATOM   25   N  N   . TYR A 1 7   ? 13.525 174.820 28.127  1.00 31.33 ? 7   TYR A N   1 
ATOM   26   C  CA  . TYR A 1 7   ? 14.285 174.002 27.193  1.00 31.97 ? 7   TYR A CA  1 
ATOM   27   C  C   . TYR A 1 7   ? 15.424 174.874 26.690  1.00 32.01 ? 7   TYR A C   1 
ATOM   28   O  O   . TYR A 1 7   ? 15.615 175.985 27.180  1.00 32.91 ? 7   TYR A O   1 
ATOM   29   C  CB  . TYR A 1 7   ? 13.399 173.547 26.029  1.00 32.54 ? 7   TYR A CB  1 
ATOM   30   C  CG  . TYR A 1 7   ? 12.802 174.684 25.234  1.00 34.85 ? 7   TYR A CG  1 
ATOM   31   C  CD1 . TYR A 1 7   ? 13.525 175.308 24.219  1.00 34.80 ? 7   TYR A CD1 1 
ATOM   32   C  CD2 . TYR A 1 7   ? 11.521 175.155 25.514  1.00 33.73 ? 7   TYR A CD2 1 
ATOM   33   C  CE1 . TYR A 1 7   ? 12.989 176.369 23.509  1.00 33.73 ? 7   TYR A CE1 1 
ATOM   34   C  CE2 . TYR A 1 7   ? 10.982 176.212 24.812  1.00 33.93 ? 7   TYR A CE2 1 
ATOM   35   C  CZ  . TYR A 1 7   ? 11.720 176.817 23.811  1.00 34.46 ? 7   TYR A CZ  1 
ATOM   36   O  OH  . TYR A 1 7   ? 11.189 177.883 23.118  1.00 36.78 ? 7   TYR A OH  1 
ATOM   37   N  N   . LYS A 1 8   ? 16.178 174.375 25.718  1.00 31.23 ? 8   LYS A N   1 
ATOM   38   C  CA  . LYS A 1 8   ? 17.305 175.118 25.169  1.00 30.37 ? 8   LYS A CA  1 
ATOM   39   C  C   . LYS A 1 8   ? 17.870 174.350 23.982  1.00 30.01 ? 8   LYS A C   1 
ATOM   40   O  O   . LYS A 1 8   ? 18.622 173.394 24.146  1.00 29.65 ? 8   LYS A O   1 
ATOM   41   C  CB  . LYS A 1 8   ? 18.371 175.305 26.250  1.00 30.61 ? 8   LYS A CB  1 
ATOM   42   C  CG  . LYS A 1 8   ? 19.732 175.774 25.762  1.00 30.59 ? 8   LYS A CG  1 
ATOM   43   C  CD  . LYS A 1 8   ? 19.843 177.266 25.571  1.00 29.83 ? 8   LYS A CD  1 
ATOM   44   C  CE  . LYS A 1 8   ? 21.329 177.658 25.505  1.00 31.17 ? 8   LYS A CE  1 
ATOM   45   N  NZ  . LYS A 1 8   ? 21.588 179.071 25.102  1.00 29.60 ? 8   LYS A NZ  1 
ATOM   46   N  N   . VAL A 1 9   ? 17.484 174.780 22.785  1.00 30.17 ? 9   VAL A N   1 
ATOM   47   C  CA  . VAL A 1 9   ? 17.916 174.150 21.546  1.00 28.55 ? 9   VAL A CA  1 
ATOM   48   C  C   . VAL A 1 9   ? 18.485 175.195 20.585  1.00 29.13 ? 9   VAL A C   1 
ATOM   49   O  O   . VAL A 1 9   ? 18.250 176.394 20.745  1.00 28.68 ? 9   VAL A O   1 
ATOM   50   C  CB  . VAL A 1 9   ? 16.731 173.430 20.866  1.00 27.98 ? 9   VAL A CB  1 
ATOM   51   C  CG1 . VAL A 1 9   ? 16.205 172.316 21.772  1.00 26.73 ? 9   VAL A CG1 1 
ATOM   52   C  CG2 . VAL A 1 9   ? 15.618 174.433 20.565  1.00 27.06 ? 9   VAL A CG2 1 
ATOM   53   N  N   . ALA A 1 10  ? 19.230 174.729 19.588  1.00 28.63 ? 10  ALA A N   1 
ATOM   54   C  CA  . ALA A 1 10  ? 19.848 175.598 18.592  1.00 27.78 ? 10  ALA A CA  1 
ATOM   55   C  C   . ALA A 1 10  ? 18.858 176.571 17.966  1.00 28.73 ? 10  ALA A C   1 
ATOM   56   O  O   . ALA A 1 10  ? 19.025 177.788 18.062  1.00 29.30 ? 10  ALA A O   1 
ATOM   57   C  CB  . ALA A 1 10  ? 20.500 174.755 17.495  1.00 23.38 ? 10  ALA A CB  1 
ATOM   58   N  N   . ASP A 1 11  ? 17.831 176.020 17.325  1.00 29.12 ? 11  ASP A N   1 
ATOM   59   C  CA  . ASP A 1 11  ? 16.810 176.806 16.646  1.00 27.26 ? 11  ASP A CA  1 
ATOM   60   C  C   . ASP A 1 11  ? 15.492 176.047 16.686  1.00 28.54 ? 11  ASP A C   1 
ATOM   61   O  O   . ASP A 1 11  ? 15.283 175.099 15.923  1.00 30.47 ? 11  ASP A O   1 
ATOM   62   C  CB  . ASP A 1 11  ? 17.242 177.049 15.198  1.00 26.13 ? 11  ASP A CB  1 
ATOM   63   C  CG  . ASP A 1 11  ? 16.195 177.786 14.392  1.00 26.83 ? 11  ASP A CG  1 
ATOM   64   O  OD1 . ASP A 1 11  ? 15.172 178.198 14.984  1.00 25.64 ? 11  ASP A OD1 1 
ATOM   65   O  OD2 . ASP A 1 11  ? 16.400 177.953 13.168  1.00 24.61 ? 11  ASP A OD2 1 
ATOM   66   N  N   . ILE A 1 12  ? 14.597 176.467 17.571  1.00 28.39 ? 12  ILE A N   1 
ATOM   67   C  CA  . ILE A 1 12  ? 13.312 175.800 17.723  1.00 26.94 ? 12  ILE A CA  1 
ATOM   68   C  C   . ILE A 1 12  ? 12.408 175.945 16.504  1.00 26.89 ? 12  ILE A C   1 
ATOM   69   O  O   . ILE A 1 12  ? 11.300 175.408 16.477  1.00 26.26 ? 12  ILE A O   1 
ATOM   70   C  CB  . ILE A 1 12  ? 12.573 176.310 18.980  1.00 28.06 ? 12  ILE A CB  1 
ATOM   71   C  CG1 . ILE A 1 12  ? 11.359 175.424 19.267  1.00 26.67 ? 12  ILE A CG1 1 
ATOM   72   C  CG2 . ILE A 1 12  ? 12.151 177.754 18.787  1.00 26.62 ? 12  ILE A CG2 1 
ATOM   73   C  CD1 . ILE A 1 12  ? 10.843 175.552 20.675  1.00 26.45 ? 12  ILE A CD1 1 
ATOM   74   N  N   . GLY A 1 13  ? 12.883 176.665 15.493  1.00 26.71 ? 13  GLY A N   1 
ATOM   75   C  CA  . GLY A 1 13  ? 12.096 176.837 14.286  1.00 25.10 ? 13  GLY A CA  1 
ATOM   76   C  C   . GLY A 1 13  ? 12.338 175.679 13.342  1.00 25.54 ? 13  GLY A C   1 
ATOM   77   O  O   . GLY A 1 13  ? 11.780 175.621 12.251  1.00 25.09 ? 13  GLY A O   1 
ATOM   78   N  N   . LEU A 1 14  ? 13.184 174.748 13.765  1.00 26.48 ? 14  LEU A N   1 
ATOM   79   C  CA  . LEU A 1 14  ? 13.501 173.579 12.954  1.00 26.65 ? 14  LEU A CA  1 
ATOM   80   C  C   . LEU A 1 14  ? 12.539 172.465 13.320  1.00 25.83 ? 14  LEU A C   1 
ATOM   81   O  O   . LEU A 1 14  ? 12.638 171.353 12.808  1.00 24.78 ? 14  LEU A O   1 
ATOM   82   C  CB  . LEU A 1 14  ? 14.940 173.125 13.219  1.00 26.89 ? 14  LEU A CB  1 
ATOM   83   C  CG  . LEU A 1 14  ? 16.052 174.111 12.835  1.00 26.58 ? 14  LEU A CG  1 
ATOM   84   C  CD1 . LEU A 1 14  ? 17.393 173.581 13.310  1.00 25.66 ? 14  LEU A CD1 1 
ATOM   85   C  CD2 . LEU A 1 14  ? 16.063 174.311 11.327  1.00 25.72 ? 14  LEU A CD2 1 
ATOM   86   N  N   . ALA A 1 15  ? 11.600 172.786 14.204  1.00 25.35 ? 15  ALA A N   1 
ATOM   87   C  CA  . ALA A 1 15  ? 10.617 171.823 14.678  1.00 26.67 ? 15  ALA A CA  1 
ATOM   88   C  C   . ALA A 1 15  ? 9.811  171.118 13.586  1.00 27.29 ? 15  ALA A C   1 
ATOM   89   O  O   . ALA A 1 15  ? 9.605  169.904 13.665  1.00 28.92 ? 15  ALA A O   1 
ATOM   90   C  CB  . ALA A 1 15  ? 9.673  172.498 15.667  1.00 25.04 ? 15  ALA A CB  1 
ATOM   91   N  N   . ALA A 1 16  ? 9.346  171.864 12.582  1.00 26.56 ? 16  ALA A N   1 
ATOM   92   C  CA  . ALA A 1 16  ? 8.561  171.270 11.497  1.00 26.24 ? 16  ALA A CA  1 
ATOM   93   C  C   . ALA A 1 16  ? 9.407  170.241 10.759  1.00 27.49 ? 16  ALA A C   1 
ATOM   94   O  O   . ALA A 1 16  ? 8.981  169.104 10.540  1.00 27.45 ? 16  ALA A O   1 
ATOM   95   C  CB  . ALA A 1 16  ? 8.083  172.345 10.531  1.00 24.52 ? 16  ALA A CB  1 
ATOM   96   N  N   . TRP A 1 17  ? 10.609 170.652 10.372  1.00 28.40 ? 17  TRP A N   1 
ATOM   97   C  CA  . TRP A 1 17  ? 11.527 169.761 9.678   1.00 28.76 ? 17  TRP A CA  1 
ATOM   98   C  C   . TRP A 1 17  ? 11.748 168.521 10.547  1.00 27.60 ? 17  TRP A C   1 
ATOM   99   O  O   . TRP A 1 17  ? 11.728 167.390 10.057  1.00 27.74 ? 17  TRP A O   1 
ATOM   100  C  CB  . TRP A 1 17  ? 12.857 170.476 9.422   1.00 28.81 ? 17  TRP A CB  1 
ATOM   101  C  CG  . TRP A 1 17  ? 13.912 169.598 8.823   1.00 33.76 ? 17  TRP A CG  1 
ATOM   102  C  CD1 . TRP A 1 17  ? 13.727 168.408 8.168   1.00 35.10 ? 17  TRP A CD1 1 
ATOM   103  C  CD2 . TRP A 1 17  ? 15.317 169.868 8.766   1.00 35.40 ? 17  TRP A CD2 1 
ATOM   104  N  NE1 . TRP A 1 17  ? 14.929 167.928 7.706   1.00 35.07 ? 17  TRP A NE1 1 
ATOM   105  C  CE2 . TRP A 1 17  ? 15.921 168.804 8.058   1.00 35.96 ? 17  TRP A CE2 1 
ATOM   106  C  CE3 . TRP A 1 17  ? 16.124 170.909 9.240   1.00 34.99 ? 17  TRP A CE3 1 
ATOM   107  C  CZ2 . TRP A 1 17  ? 17.293 168.751 7.814   1.00 37.14 ? 17  TRP A CZ2 1 
ATOM   108  C  CZ3 . TRP A 1 17  ? 17.488 170.855 8.995   1.00 36.41 ? 17  TRP A CZ3 1 
ATOM   109  C  CH2 . TRP A 1 17  ? 18.057 169.784 8.289   1.00 36.94 ? 17  TRP A CH2 1 
ATOM   110  N  N   . GLY A 1 18  ? 11.948 168.748 11.840  1.00 25.69 ? 18  GLY A N   1 
ATOM   111  C  CA  . GLY A 1 18  ? 12.163 167.649 12.754  1.00 24.84 ? 18  GLY A CA  1 
ATOM   112  C  C   . GLY A 1 18  ? 10.954 166.739 12.814  1.00 25.27 ? 18  GLY A C   1 
ATOM   113  O  O   . GLY A 1 18  ? 11.090 165.510 12.817  1.00 24.67 ? 18  GLY A O   1 
ATOM   114  N  N   . ARG A 1 19  ? 9.767  167.339 12.852  1.00 24.43 ? 19  ARG A N   1 
ATOM   115  C  CA  . ARG A 1 19  ? 8.534  166.568 12.927  1.00 24.02 ? 19  ARG A CA  1 
ATOM   116  C  C   . ARG A 1 19  ? 8.375  165.642 11.722  1.00 24.88 ? 19  ARG A C   1 
ATOM   117  O  O   . ARG A 1 19  ? 7.919  164.504 11.857  1.00 24.76 ? 19  ARG A O   1 
ATOM   118  C  CB  . ARG A 1 19  ? 7.338  167.509 13.045  1.00 21.48 ? 19  ARG A CB  1 
ATOM   119  C  CG  . ARG A 1 19  ? 6.010  166.799 13.200  1.00 20.76 ? 19  ARG A CG  1 
ATOM   120  C  CD  . ARG A 1 19  ? 6.096  165.629 14.167  1.00 22.08 ? 19  ARG A CD  1 
ATOM   121  N  NE  . ARG A 1 19  ? 6.493  166.019 15.518  1.00 23.53 ? 19  ARG A NE  1 
ATOM   122  C  CZ  . ARG A 1 19  ? 6.488  165.198 16.570  1.00 22.20 ? 19  ARG A CZ  1 
ATOM   123  N  NH1 . ARG A 1 19  ? 6.107  163.937 16.434  1.00 19.04 ? 19  ARG A NH1 1 
ATOM   124  N  NH2 . ARG A 1 19  ? 6.863  165.638 17.764  1.00 20.55 ? 19  ARG A NH2 1 
ATOM   125  N  N   . LYS A 1 20  ? 8.766  166.125 10.549  1.00 25.71 ? 20  LYS A N   1 
ATOM   126  C  CA  . LYS A 1 20  ? 8.674  165.323 9.342   1.00 26.47 ? 20  LYS A CA  1 
ATOM   127  C  C   . LYS A 1 20  ? 9.615  164.133 9.458   1.00 26.46 ? 20  LYS A C   1 
ATOM   128  O  O   . LYS A 1 20  ? 9.251  163.005 9.135   1.00 28.00 ? 20  LYS A O   1 
ATOM   129  C  CB  . LYS A 1 20  ? 9.050  166.155 8.119   1.00 29.18 ? 20  LYS A CB  1 
ATOM   130  C  CG  . LYS A 1 20  ? 9.087  165.343 6.840   1.00 33.13 ? 20  LYS A CG  1 
ATOM   131  C  CD  . LYS A 1 20  ? 9.371  166.213 5.621   1.00 36.78 ? 20  LYS A CD  1 
ATOM   132  C  CE  . LYS A 1 20  ? 10.786 166.773 5.632   1.00 37.10 ? 20  LYS A CE  1 
ATOM   133  N  NZ  . LYS A 1 20  ? 11.096 167.421 4.325   1.00 36.96 ? 20  LYS A NZ  1 
ATOM   134  N  N   . ALA A 1 21  ? 10.829 164.390 9.928   1.00 24.97 ? 21  ALA A N   1 
ATOM   135  C  CA  . ALA A 1 21  ? 11.820 163.337 10.088  1.00 23.57 ? 21  ALA A CA  1 
ATOM   136  C  C   . ALA A 1 21  ? 11.321 162.264 11.053  1.00 24.00 ? 21  ALA A C   1 
ATOM   137  O  O   . ALA A 1 21  ? 11.505 161.071 10.815  1.00 23.84 ? 21  ALA A O   1 
ATOM   138  C  CB  . ALA A 1 21  ? 13.130 163.928 10.589  1.00 20.68 ? 21  ALA A CB  1 
ATOM   139  N  N   . LEU A 1 22  ? 10.690 162.693 12.142  1.00 24.93 ? 22  LEU A N   1 
ATOM   140  C  CA  . LEU A 1 22  ? 10.167 161.757 13.133  1.00 25.10 ? 22  LEU A CA  1 
ATOM   141  C  C   . LEU A 1 22  ? 9.044  160.908 12.555  1.00 24.75 ? 22  LEU A C   1 
ATOM   142  O  O   . LEU A 1 22  ? 8.948  159.722 12.845  1.00 25.10 ? 22  LEU A O   1 
ATOM   143  C  CB  . LEU A 1 22  ? 9.637  162.501 14.365  1.00 25.99 ? 22  LEU A CB  1 
ATOM   144  C  CG  . LEU A 1 22  ? 10.618 163.312 15.213  1.00 26.13 ? 22  LEU A CG  1 
ATOM   145  C  CD1 . LEU A 1 22  ? 9.970  163.675 16.541  1.00 26.81 ? 22  LEU A CD1 1 
ATOM   146  C  CD2 . LEU A 1 22  ? 11.856 162.505 15.466  1.00 26.85 ? 22  LEU A CD2 1 
ATOM   147  N  N   . ASP A 1 23  ? 8.190  161.515 11.741  1.00 24.08 ? 23  ASP A N   1 
ATOM   148  C  CA  . ASP A 1 23  ? 7.086  160.778 11.154  1.00 24.14 ? 23  ASP A CA  1 
ATOM   149  C  C   . ASP A 1 23  ? 7.594  159.720 10.178  1.00 25.08 ? 23  ASP A C   1 
ATOM   150  O  O   . ASP A 1 23  ? 6.946  158.690 9.963   1.00 27.28 ? 23  ASP A O   1 
ATOM   151  C  CB  . ASP A 1 23  ? 6.120  161.735 10.455  1.00 21.93 ? 23  ASP A CB  1 
ATOM   152  C  CG  . ASP A 1 23  ? 4.979  161.010 9.779   1.00 22.06 ? 23  ASP A CG  1 
ATOM   153  O  OD1 . ASP A 1 23  ? 5.155  160.600 8.615   1.00 22.64 ? 23  ASP A OD1 1 
ATOM   154  O  OD2 . ASP A 1 23  ? 3.913  160.835 10.412  1.00 20.68 ? 23  ASP A OD2 1 
ATOM   155  N  N   . ILE A 1 24  ? 8.755  159.976 9.587   1.00 23.55 ? 24  ILE A N   1 
ATOM   156  C  CA  . ILE A 1 24  ? 9.345  159.028 8.661   1.00 22.05 ? 24  ILE A CA  1 
ATOM   157  C  C   . ILE A 1 24  ? 10.067 157.954 9.462   1.00 21.08 ? 24  ILE A C   1 
ATOM   158  O  O   . ILE A 1 24  ? 10.059 156.779 9.102   1.00 19.96 ? 24  ILE A O   1 
ATOM   159  C  CB  . ILE A 1 24  ? 10.361 159.715 7.723   1.00 22.25 ? 24  ILE A CB  1 
ATOM   160  C  CG1 . ILE A 1 24  ? 9.618  160.614 6.729   1.00 23.49 ? 24  ILE A CG1 1 
ATOM   161  C  CG2 . ILE A 1 24  ? 11.203 158.667 7.007   1.00 16.65 ? 24  ILE A CG2 1 
ATOM   162  C  CD1 . ILE A 1 24  ? 10.514 161.275 5.697   1.00 23.12 ? 24  ILE A CD1 1 
ATOM   163  N  N   . ALA A 1 25  ? 10.681 158.367 10.562  1.00 20.44 ? 25  ALA A N   1 
ATOM   164  C  CA  . ALA A 1 25  ? 11.421 157.446 11.406  1.00 21.69 ? 25  ALA A CA  1 
ATOM   165  C  C   . ALA A 1 25  ? 10.490 156.485 12.136  1.00 23.26 ? 25  ALA A C   1 
ATOM   166  O  O   . ALA A 1 25  ? 10.813 155.309 12.315  1.00 24.77 ? 25  ALA A O   1 
ATOM   167  C  CB  . ALA A 1 25  ? 12.264 158.224 12.408  1.00 20.20 ? 25  ALA A CB  1 
ATOM   168  N  N   . GLU A 1 26  ? 9.332  156.985 12.552  1.00 24.15 ? 26  GLU A N   1 
ATOM   169  C  CA  . GLU A 1 26  ? 8.367  156.165 13.268  1.00 24.12 ? 26  GLU A CA  1 
ATOM   170  C  C   . GLU A 1 26  ? 8.052  154.861 12.545  1.00 24.83 ? 26  GLU A C   1 
ATOM   171  O  O   . GLU A 1 26  ? 7.900  153.817 13.182  1.00 24.82 ? 26  GLU A O   1 
ATOM   172  C  CB  . GLU A 1 26  ? 7.092  156.971 13.537  1.00 24.23 ? 26  GLU A CB  1 
ATOM   173  C  CG  . GLU A 1 26  ? 7.172  157.774 14.832  1.00 25.58 ? 26  GLU A CG  1 
ATOM   174  C  CD  . GLU A 1 26  ? 6.132  158.873 14.930  1.00 27.19 ? 26  GLU A CD  1 
ATOM   175  O  OE1 . GLU A 1 26  ? 4.929  158.595 14.727  1.00 26.16 ? 26  GLU A OE1 1 
ATOM   176  O  OE2 . GLU A 1 26  ? 6.526  160.022 15.222  1.00 28.35 ? 26  GLU A OE2 1 
ATOM   177  N  N   . ASN A 1 27  ? 7.969  154.904 11.218  1.00 24.90 ? 27  ASN A N   1 
ATOM   178  C  CA  . ASN A 1 27  ? 7.693  153.684 10.471  1.00 25.41 ? 27  ASN A CA  1 
ATOM   179  C  C   . ASN A 1 27  ? 8.834  152.678 10.571  1.00 25.87 ? 27  ASN A C   1 
ATOM   180  O  O   . ASN A 1 27  ? 8.606  151.475 10.493  1.00 27.93 ? 27  ASN A O   1 
ATOM   181  C  CB  . ASN A 1 27  ? 7.405  153.992 9.005   1.00 24.45 ? 27  ASN A CB  1 
ATOM   182  C  CG  . ASN A 1 27  ? 5.946  154.291 8.760   1.00 24.71 ? 27  ASN A CG  1 
ATOM   183  O  OD1 . ASN A 1 27  ? 5.087  153.922 9.562   1.00 24.27 ? 27  ASN A OD1 1 
ATOM   184  N  ND2 . ASN A 1 27  ? 5.651  154.943 7.642   1.00 25.99 ? 27  ASN A ND2 1 
ATOM   185  N  N   . GLU A 1 28  ? 10.059 153.163 10.751  1.00 25.52 ? 28  GLU A N   1 
ATOM   186  C  CA  . GLU A 1 28  ? 11.209 152.273 10.875  1.00 25.31 ? 28  GLU A CA  1 
ATOM   187  C  C   . GLU A 1 28  ? 11.496 151.893 12.333  1.00 26.03 ? 28  GLU A C   1 
ATOM   188  O  O   . GLU A 1 28  ? 12.438 151.147 12.616  1.00 26.16 ? 28  GLU A O   1 
ATOM   189  C  CB  . GLU A 1 28  ? 12.456 152.911 10.254  1.00 24.71 ? 28  GLU A CB  1 
ATOM   190  C  CG  . GLU A 1 28  ? 12.466 152.924 8.733   1.00 24.85 ? 28  GLU A CG  1 
ATOM   191  C  CD  . GLU A 1 28  ? 12.308 151.535 8.128   1.00 25.95 ? 28  GLU A CD  1 
ATOM   192  O  OE1 . GLU A 1 28  ? 13.099 150.634 8.474   1.00 25.25 ? 28  GLU A OE1 1 
ATOM   193  O  OE2 . GLU A 1 28  ? 11.393 151.342 7.297   1.00 27.39 ? 28  GLU A OE2 1 
ATOM   194  N  N   . MET A 1 29  ? 10.684 152.399 13.258  1.00 25.53 ? 29  MET A N   1 
ATOM   195  C  CA  . MET A 1 29  ? 10.872 152.080 14.672  1.00 24.78 ? 29  MET A CA  1 
ATOM   196  C  C   . MET A 1 29  ? 9.589  151.501 15.269  1.00 24.81 ? 29  MET A C   1 
ATOM   197  O  O   . MET A 1 29  ? 8.997  152.073 16.187  1.00 24.18 ? 29  MET A O   1 
ATOM   198  C  CB  . MET A 1 29  ? 11.303 153.333 15.435  1.00 24.50 ? 29  MET A CB  1 
ATOM   199  C  CG  . MET A 1 29  ? 12.598 153.938 14.908  1.00 24.23 ? 29  MET A CG  1 
ATOM   200  S  SD  . MET A 1 29  ? 13.151 155.360 15.842  1.00 23.13 ? 29  MET A SD  1 
ATOM   201  C  CE  . MET A 1 29  ? 14.104 154.587 17.119  1.00 21.46 ? 29  MET A CE  1 
ATOM   202  N  N   . PRO A 1 30  ? 9.163  150.333 14.759  1.00 24.41 ? 30  PRO A N   1 
ATOM   203  C  CA  . PRO A 1 30  ? 7.962  149.603 15.169  1.00 23.70 ? 30  PRO A CA  1 
ATOM   204  C  C   . PRO A 1 30  ? 7.938  149.194 16.633  1.00 23.34 ? 30  PRO A C   1 
ATOM   205  O  O   . PRO A 1 30  ? 6.876  149.152 17.249  1.00 23.75 ? 30  PRO A O   1 
ATOM   206  C  CB  . PRO A 1 30  ? 7.965  148.396 14.233  1.00 25.05 ? 30  PRO A CB  1 
ATOM   207  C  CG  . PRO A 1 30  ? 9.419  148.123 14.069  1.00 24.79 ? 30  PRO A CG  1 
ATOM   208  C  CD  . PRO A 1 30  ? 9.971  149.515 13.835  1.00 24.38 ? 30  PRO A CD  1 
ATOM   209  N  N   . GLY A 1 31  ? 9.109  148.882 17.179  1.00 22.73 ? 31  GLY A N   1 
ATOM   210  C  CA  . GLY A 1 31  ? 9.194  148.468 18.567  1.00 21.62 ? 31  GLY A CA  1 
ATOM   211  C  C   . GLY A 1 31  ? 8.731  149.546 19.525  1.00 22.35 ? 31  GLY A C   1 
ATOM   212  O  O   . GLY A 1 31  ? 8.070  149.260 20.529  1.00 21.21 ? 31  GLY A O   1 
ATOM   213  N  N   . LEU A 1 32  ? 9.089  150.792 19.222  1.00 22.74 ? 32  LEU A N   1 
ATOM   214  C  CA  . LEU A 1 32  ? 8.698  151.918 20.058  1.00 21.59 ? 32  LEU A CA  1 
ATOM   215  C  C   . LEU A 1 32  ? 7.214  152.201 19.860  1.00 22.47 ? 32  LEU A C   1 
ATOM   216  O  O   . LEU A 1 32  ? 6.485  152.444 20.821  1.00 22.32 ? 32  LEU A O   1 
ATOM   217  C  CB  . LEU A 1 32  ? 9.523  153.157 19.702  1.00 20.79 ? 32  LEU A CB  1 
ATOM   218  C  CG  . LEU A 1 32  ? 10.986 153.139 20.149  1.00 20.48 ? 32  LEU A CG  1 
ATOM   219  C  CD1 . LEU A 1 32  ? 11.651 154.468 19.840  1.00 19.43 ? 32  LEU A CD1 1 
ATOM   220  C  CD2 . LEU A 1 32  ? 11.045 152.871 21.638  1.00 21.33 ? 32  LEU A CD2 1 
ATOM   221  N  N   . MET A 1 33  ? 6.775  152.154 18.606  1.00 22.28 ? 33  MET A N   1 
ATOM   222  C  CA  . MET A 1 33  ? 5.382  152.403 18.267  1.00 22.44 ? 33  MET A CA  1 
ATOM   223  C  C   . MET A 1 33  ? 4.469  151.332 18.848  1.00 23.77 ? 33  MET A C   1 
ATOM   224  O  O   . MET A 1 33  ? 3.330  151.606 19.227  1.00 22.34 ? 33  MET A O   1 
ATOM   225  C  CB  . MET A 1 33  ? 5.226  152.460 16.751  1.00 22.09 ? 33  MET A CB  1 
ATOM   226  C  CG  . MET A 1 33  ? 6.083  153.531 16.113  1.00 24.21 ? 33  MET A CG  1 
ATOM   227  S  SD  . MET A 1 33  ? 5.864  155.142 16.926  1.00 28.67 ? 33  MET A SD  1 
ATOM   228  C  CE  . MET A 1 33  ? 4.472  155.783 15.984  1.00 26.50 ? 33  MET A CE  1 
ATOM   229  N  N   . ARG A 1 34  ? 4.978  150.108 18.918  1.00 26.02 ? 34  ARG A N   1 
ATOM   230  C  CA  . ARG A 1 34  ? 4.213  148.998 19.461  1.00 27.52 ? 34  ARG A CA  1 
ATOM   231  C  C   . ARG A 1 34  ? 4.004  149.249 20.957  1.00 27.10 ? 34  ARG A C   1 
ATOM   232  O  O   . ARG A 1 34  ? 2.952  148.932 21.520  1.00 26.80 ? 34  ARG A O   1 
ATOM   233  C  CB  . ARG A 1 34  ? 4.968  147.687 19.223  1.00 30.01 ? 34  ARG A CB  1 
ATOM   234  C  CG  . ARG A 1 34  ? 4.151  146.427 19.507  1.00 36.53 ? 34  ARG A CG  1 
ATOM   235  C  CD  . ARG A 1 34  ? 2.920  146.296 18.592  1.00 40.68 ? 34  ARG A CD  1 
ATOM   236  N  NE  . ARG A 1 34  ? 3.245  146.113 17.169  1.00 44.14 ? 34  ARG A NE  1 
ATOM   237  C  CZ  . ARG A 1 34  ? 3.464  147.099 16.295  1.00 46.11 ? 34  ARG A CZ  1 
ATOM   238  N  NH1 . ARG A 1 34  ? 3.402  148.367 16.678  1.00 46.15 ? 34  ARG A NH1 1 
ATOM   239  N  NH2 . ARG A 1 34  ? 3.733  146.818 15.023  1.00 46.06 ? 34  ARG A NH2 1 
ATOM   240  N  N   . MET A 1 35  ? 5.008  149.838 21.595  1.00 26.08 ? 35  MET A N   1 
ATOM   241  C  CA  . MET A 1 35  ? 4.921  150.150 23.011  1.00 26.34 ? 35  MET A CA  1 
ATOM   242  C  C   . MET A 1 35  ? 3.822  151.178 23.248  1.00 26.57 ? 35  MET A C   1 
ATOM   243  O  O   . MET A 1 35  ? 3.045  151.064 24.198  1.00 27.10 ? 35  MET A O   1 
ATOM   244  C  CB  . MET A 1 35  ? 6.254  150.703 23.521  1.00 27.37 ? 35  MET A CB  1 
ATOM   245  C  CG  . MET A 1 35  ? 7.399  149.707 23.456  1.00 28.22 ? 35  MET A CG  1 
ATOM   246  S  SD  . MET A 1 35  ? 7.027  148.187 24.363  1.00 31.59 ? 35  MET A SD  1 
ATOM   247  C  CE  . MET A 1 35  ? 7.781  148.575 25.949  1.00 31.19 ? 35  MET A CE  1 
ATOM   248  N  N   . ARG A 1 36  ? 3.762  152.187 22.383  1.00 26.52 ? 36  ARG A N   1 
ATOM   249  C  CA  . ARG A 1 36  ? 2.751  153.228 22.521  1.00 26.38 ? 36  ARG A CA  1 
ATOM   250  C  C   . ARG A 1 36  ? 1.370  152.617 22.355  1.00 26.76 ? 36  ARG A C   1 
ATOM   251  O  O   . ARG A 1 36  ? 0.453  152.890 23.139  1.00 26.51 ? 36  ARG A O   1 
ATOM   252  C  CB  . ARG A 1 36  ? 2.949  154.323 21.470  1.00 25.40 ? 36  ARG A CB  1 
ATOM   253  C  CG  . ARG A 1 36  ? 4.271  155.044 21.546  1.00 23.28 ? 36  ARG A CG  1 
ATOM   254  C  CD  . ARG A 1 36  ? 4.321  156.152 20.521  1.00 23.64 ? 36  ARG A CD  1 
ATOM   255  N  NE  . ARG A 1 36  ? 5.651  156.743 20.434  1.00 27.38 ? 36  ARG A NE  1 
ATOM   256  C  CZ  . ARG A 1 36  ? 5.978  157.748 19.628  1.00 26.38 ? 36  ARG A CZ  1 
ATOM   257  N  NH1 . ARG A 1 36  ? 5.064  158.283 18.833  1.00 26.10 ? 36  ARG A NH1 1 
ATOM   258  N  NH2 . ARG A 1 36  ? 7.224  158.214 19.614  1.00 24.20 ? 36  ARG A NH2 1 
ATOM   259  N  N   . GLU A 1 37  ? 1.223  151.786 21.331  1.00 27.07 ? 37  GLU A N   1 
ATOM   260  C  CA  . GLU A 1 37  ? -0.054 151.144 21.074  1.00 28.95 ? 37  GLU A CA  1 
ATOM   261  C  C   . GLU A 1 37  ? -0.477 150.284 22.258  1.00 29.20 ? 37  GLU A C   1 
ATOM   262  O  O   . GLU A 1 37  ? -1.661 150.189 22.565  1.00 29.05 ? 37  GLU A O   1 
ATOM   263  C  CB  . GLU A 1 37  ? 0.033  150.296 19.808  1.00 29.43 ? 37  GLU A CB  1 
ATOM   264  C  CG  . GLU A 1 37  ? 0.609  151.071 18.639  1.00 34.99 ? 37  GLU A CG  1 
ATOM   265  C  CD  . GLU A 1 37  ? 0.646  150.280 17.348  1.00 37.71 ? 37  GLU A CD  1 
ATOM   266  O  OE1 . GLU A 1 37  ? 1.048  149.095 17.379  1.00 38.77 ? 37  GLU A OE1 1 
ATOM   267  O  OE2 . GLU A 1 37  ? 0.287  150.856 16.298  1.00 39.57 ? 37  GLU A OE2 1 
ATOM   268  N  N   . ARG A 1 38  ? 0.487  149.680 22.943  1.00 29.92 ? 38  ARG A N   1 
ATOM   269  C  CA  . ARG A 1 38  ? 0.158  148.824 24.076  1.00 31.58 ? 38  ARG A CA  1 
ATOM   270  C  C   . ARG A 1 38  ? 0.091  149.520 25.430  1.00 31.38 ? 38  ARG A C   1 
ATOM   271  O  O   . ARG A 1 38  ? -0.502 148.984 26.366  1.00 31.99 ? 38  ARG A O   1 
ATOM   272  C  CB  . ARG A 1 38  ? 1.154  147.658 24.167  1.00 33.17 ? 38  ARG A CB  1 
ATOM   273  C  CG  . ARG A 1 38  ? 1.100  146.695 22.992  1.00 35.44 ? 38  ARG A CG  1 
ATOM   274  C  CD  . ARG A 1 38  ? 2.234  145.684 23.062  1.00 38.97 ? 38  ARG A CD  1 
ATOM   275  N  NE  . ARG A 1 38  ? 2.312  144.855 21.859  1.00 43.52 ? 38  ARG A NE  1 
ATOM   276  C  CZ  . ARG A 1 38  ? 3.314  144.021 21.587  1.00 45.16 ? 38  ARG A CZ  1 
ATOM   277  N  NH1 . ARG A 1 38  ? 3.299  143.307 20.467  1.00 44.58 ? 38  ARG A NH1 1 
ATOM   278  N  NH2 . ARG A 1 38  ? 4.334  143.906 22.432  1.00 43.81 ? 38  ARG A NH2 1 
ATOM   279  N  N   . TYR A 1 39  ? 0.674  150.707 25.553  1.00 30.86 ? 39  TYR A N   1 
ATOM   280  C  CA  . TYR A 1 39  ? 0.656  151.361 26.851  1.00 31.07 ? 39  TYR A CA  1 
ATOM   281  C  C   . TYR A 1 39  ? 0.185  152.800 26.942  1.00 30.19 ? 39  TYR A C   1 
ATOM   282  O  O   . TYR A 1 39  ? 0.267  153.401 28.010  1.00 29.69 ? 39  TYR A O   1 
ATOM   283  C  CB  . TYR A 1 39  ? 2.036  151.248 27.484  1.00 34.68 ? 39  TYR A CB  1 
ATOM   284  C  CG  . TYR A 1 39  ? 2.482  149.823 27.638  1.00 37.30 ? 39  TYR A CG  1 
ATOM   285  C  CD1 . TYR A 1 39  ? 1.786  148.948 28.466  1.00 38.94 ? 39  TYR A CD1 1 
ATOM   286  C  CD2 . TYR A 1 39  ? 3.575  149.336 26.926  1.00 39.40 ? 39  TYR A CD2 1 
ATOM   287  C  CE1 . TYR A 1 39  ? 2.161  147.619 28.582  1.00 41.96 ? 39  TYR A CE1 1 
ATOM   288  C  CE2 . TYR A 1 39  ? 3.964  148.005 27.032  1.00 42.61 ? 39  TYR A CE2 1 
ATOM   289  C  CZ  . TYR A 1 39  ? 3.250  147.149 27.861  1.00 43.87 ? 39  TYR A CZ  1 
ATOM   290  O  OH  . TYR A 1 39  ? 3.604  145.820 27.950  1.00 44.51 ? 39  TYR A OH  1 
ATOM   291  N  N   . SER A 1 40  ? -0.319 153.362 25.852  1.00 29.58 ? 40  SER A N   1 
ATOM   292  C  CA  . SER A 1 40  ? -0.778 154.738 25.919  1.00 29.63 ? 40  SER A CA  1 
ATOM   293  C  C   . SER A 1 40  ? -1.980 154.843 26.861  1.00 29.24 ? 40  SER A C   1 
ATOM   294  O  O   . SER A 1 40  ? -2.309 155.929 27.336  1.00 29.84 ? 40  SER A O   1 
ATOM   295  C  CB  . SER A 1 40  ? -1.146 155.258 24.527  1.00 30.43 ? 40  SER A CB  1 
ATOM   296  O  OG  . SER A 1 40  ? -2.373 154.718 24.074  1.00 34.46 ? 40  SER A OG  1 
ATOM   297  N  N   . ALA A 1 41  ? -2.624 153.714 27.148  1.00 27.81 ? 41  ALA A N   1 
ATOM   298  C  CA  . ALA A 1 41  ? -3.787 153.721 28.033  1.00 27.23 ? 41  ALA A CA  1 
ATOM   299  C  C   . ALA A 1 41  ? -3.447 153.367 29.478  1.00 27.04 ? 41  ALA A C   1 
ATOM   300  O  O   . ALA A 1 41  ? -3.769 154.123 30.395  1.00 28.02 ? 41  ALA A O   1 
ATOM   301  C  CB  . ALA A 1 41  ? -4.858 152.765 27.509  1.00 26.02 ? 41  ALA A CB  1 
ATOM   302  N  N   . SER A 1 42  ? -2.804 152.218 29.680  1.00 25.59 ? 42  SER A N   1 
ATOM   303  C  CA  . SER A 1 42  ? -2.448 151.777 31.026  1.00 23.62 ? 42  SER A CA  1 
ATOM   304  C  C   . SER A 1 42  ? -1.387 152.685 31.643  1.00 23.44 ? 42  SER A C   1 
ATOM   305  O  O   . SER A 1 42  ? -1.233 152.726 32.863  1.00 21.78 ? 42  SER A O   1 
ATOM   306  C  CB  . SER A 1 42  ? -1.946 150.327 31.002  1.00 22.44 ? 42  SER A CB  1 
ATOM   307  O  OG  . SER A 1 42  ? -0.684 150.217 30.360  1.00 24.02 ? 42  SER A OG  1 
ATOM   308  N  N   . LYS A 1 43  ? -0.665 153.407 30.788  1.00 23.42 ? 43  LYS A N   1 
ATOM   309  C  CA  . LYS A 1 43  ? 0.386  154.328 31.216  1.00 25.30 ? 43  LYS A CA  1 
ATOM   310  C  C   . LYS A 1 43  ? 1.172  153.803 32.405  1.00 26.59 ? 43  LYS A C   1 
ATOM   311  O  O   . LYS A 1 43  ? 1.032  154.288 33.527  1.00 26.47 ? 43  LYS A O   1 
ATOM   312  C  CB  . LYS A 1 43  ? -0.214 155.699 31.539  1.00 24.26 ? 43  LYS A CB  1 
ATOM   313  C  CG  . LYS A 1 43  ? -0.882 156.337 30.324  1.00 25.06 ? 43  LYS A CG  1 
ATOM   314  C  CD  . LYS A 1 43  ? -1.126 157.816 30.509  1.00 24.23 ? 43  LYS A CD  1 
ATOM   315  C  CE  . LYS A 1 43  ? -1.705 158.425 29.247  1.00 23.56 ? 43  LYS A CE  1 
ATOM   316  N  NZ  . LYS A 1 43  ? -0.819 158.212 28.076  1.00 23.08 ? 43  LYS A NZ  1 
ATOM   317  N  N   . PRO A 1 44  ? 2.017  152.792 32.160  1.00 27.50 ? 44  PRO A N   1 
ATOM   318  C  CA  . PRO A 1 44  ? 2.868  152.130 33.154  1.00 27.80 ? 44  PRO A CA  1 
ATOM   319  C  C   . PRO A 1 44  ? 3.987  153.007 33.729  1.00 29.31 ? 44  PRO A C   1 
ATOM   320  O  O   . PRO A 1 44  ? 4.601  152.654 34.745  1.00 29.07 ? 44  PRO A O   1 
ATOM   321  C  CB  . PRO A 1 44  ? 3.404  150.921 32.390  1.00 26.95 ? 44  PRO A CB  1 
ATOM   322  C  CG  . PRO A 1 44  ? 3.490  151.432 30.980  1.00 26.39 ? 44  PRO A CG  1 
ATOM   323  C  CD  . PRO A 1 44  ? 2.186  152.179 30.828  1.00 27.54 ? 44  PRO A CD  1 
ATOM   324  N  N   . LEU A 1 45  ? 4.251  154.143 33.081  1.00 28.37 ? 45  LEU A N   1 
ATOM   325  C  CA  . LEU A 1 45  ? 5.297  155.053 33.544  1.00 26.70 ? 45  LEU A CA  1 
ATOM   326  C  C   . LEU A 1 45  ? 4.735  156.259 34.278  1.00 27.19 ? 45  LEU A C   1 
ATOM   327  O  O   . LEU A 1 45  ? 5.464  157.192 34.613  1.00 27.73 ? 45  LEU A O   1 
ATOM   328  C  CB  . LEU A 1 45  ? 6.160  155.511 32.371  1.00 25.02 ? 45  LEU A CB  1 
ATOM   329  C  CG  . LEU A 1 45  ? 7.063  154.404 31.828  1.00 23.43 ? 45  LEU A CG  1 
ATOM   330  C  CD1 . LEU A 1 45  ? 7.886  154.907 30.658  1.00 21.69 ? 45  LEU A CD1 1 
ATOM   331  C  CD2 . LEU A 1 45  ? 7.967  153.925 32.950  1.00 22.78 ? 45  LEU A CD2 1 
ATOM   332  N  N   . LYS A 1 46  ? 3.432  156.230 34.530  1.00 27.68 ? 46  LYS A N   1 
ATOM   333  C  CA  . LYS A 1 46  ? 2.774  157.313 35.241  1.00 29.06 ? 46  LYS A CA  1 
ATOM   334  C  C   . LYS A 1 46  ? 3.495  157.554 36.565  1.00 28.98 ? 46  LYS A C   1 
ATOM   335  O  O   . LYS A 1 46  ? 3.760  156.615 37.317  1.00 28.74 ? 46  LYS A O   1 
ATOM   336  C  CB  . LYS A 1 46  ? 1.310  156.949 35.493  1.00 30.58 ? 46  LYS A CB  1 
ATOM   337  C  CG  . LYS A 1 46  ? 0.571  157.911 36.399  1.00 33.95 ? 46  LYS A CG  1 
ATOM   338  C  CD  . LYS A 1 46  ? -0.886 157.497 36.574  1.00 37.06 ? 46  LYS A CD  1 
ATOM   339  C  CE  . LYS A 1 46  ? -1.598 158.419 37.563  1.00 38.81 ? 46  LYS A CE  1 
ATOM   340  N  NZ  . LYS A 1 46  ? -3.055 158.123 37.685  1.00 39.93 ? 46  LYS A NZ  1 
ATOM   341  N  N   . GLY A 1 47  ? 3.817  158.814 36.841  1.00 28.57 ? 47  GLY A N   1 
ATOM   342  C  CA  . GLY A 1 47  ? 4.506  159.148 38.075  1.00 27.73 ? 47  GLY A CA  1 
ATOM   343  C  C   . GLY A 1 47  ? 6.013  159.170 37.902  1.00 28.22 ? 47  GLY A C   1 
ATOM   344  O  O   . GLY A 1 47  ? 6.745  159.641 38.772  1.00 27.66 ? 47  GLY A O   1 
ATOM   345  N  N   . ALA A 1 48  ? 6.482  158.653 36.772  1.00 28.03 ? 48  ALA A N   1 
ATOM   346  C  CA  . ALA A 1 48  ? 7.909  158.616 36.493  1.00 27.48 ? 48  ALA A CA  1 
ATOM   347  C  C   . ALA A 1 48  ? 8.422  159.964 35.993  1.00 27.23 ? 48  ALA A C   1 
ATOM   348  O  O   . ALA A 1 48  ? 7.770  160.634 35.191  1.00 27.07 ? 48  ALA A O   1 
ATOM   349  C  CB  . ALA A 1 48  ? 8.208  157.537 35.461  1.00 27.14 ? 48  ALA A CB  1 
ATOM   350  N  N   . ARG A 1 49  ? 9.588  160.359 36.491  1.00 26.12 ? 49  ARG A N   1 
ATOM   351  C  CA  . ARG A 1 49  ? 10.231 161.602 36.081  1.00 26.39 ? 49  ARG A CA  1 
ATOM   352  C  C   . ARG A 1 49  ? 11.575 161.158 35.539  1.00 26.49 ? 49  ARG A C   1 
ATOM   353  O  O   . ARG A 1 49  ? 12.576 161.128 36.266  1.00 24.35 ? 49  ARG A O   1 
ATOM   354  C  CB  . ARG A 1 49  ? 10.453 162.519 37.270  1.00 28.37 ? 49  ARG A CB  1 
ATOM   355  C  CG  . ARG A 1 49  ? 9.199  163.033 37.922  1.00 28.49 ? 49  ARG A CG  1 
ATOM   356  C  CD  . ARG A 1 49  ? 9.562  163.434 39.326  1.00 33.46 ? 49  ARG A CD  1 
ATOM   357  N  NE  . ARG A 1 49  ? 8.499  164.158 40.000  1.00 36.18 ? 49  ARG A NE  1 
ATOM   358  C  CZ  . ARG A 1 49  ? 8.564  164.531 41.269  1.00 36.60 ? 49  ARG A CZ  1 
ATOM   359  N  NH1 . ARG A 1 49  ? 9.643  164.238 41.986  1.00 35.57 ? 49  ARG A NH1 1 
ATOM   360  N  NH2 . ARG A 1 49  ? 7.558  165.206 41.811  1.00 38.46 ? 49  ARG A NH2 1 
ATOM   361  N  N   . ILE A 1 50  ? 11.578 160.806 34.257  1.00 25.65 ? 50  ILE A N   1 
ATOM   362  C  CA  . ILE A 1 50  ? 12.766 160.304 33.591  1.00 24.25 ? 50  ILE A CA  1 
ATOM   363  C  C   . ILE A 1 50  ? 13.711 161.364 33.039  1.00 24.07 ? 50  ILE A C   1 
ATOM   364  O  O   . ILE A 1 50  ? 13.361 162.121 32.129  1.00 23.73 ? 50  ILE A O   1 
ATOM   365  C  CB  . ILE A 1 50  ? 12.373 159.353 32.432  1.00 24.21 ? 50  ILE A CB  1 
ATOM   366  C  CG1 . ILE A 1 50  ? 11.403 158.284 32.941  1.00 24.79 ? 50  ILE A CG1 1 
ATOM   367  C  CG2 . ILE A 1 50  ? 13.612 158.675 31.856  1.00 24.47 ? 50  ILE A CG2 1 
ATOM   368  C  CD1 . ILE A 1 50  ? 10.973 157.283 31.873  1.00 21.64 ? 50  ILE A CD1 1 
ATOM   369  N  N   . ALA A 1 51  ? 14.912 161.420 33.603  1.00 22.89 ? 51  ALA A N   1 
ATOM   370  C  CA  . ALA A 1 51  ? 15.921 162.344 33.118  1.00 23.04 ? 51  ALA A CA  1 
ATOM   371  C  C   . ALA A 1 51  ? 16.751 161.465 32.193  1.00 23.15 ? 51  ALA A C   1 
ATOM   372  O  O   . ALA A 1 51  ? 17.298 160.449 32.626  1.00 22.83 ? 51  ALA A O   1 
ATOM   373  C  CB  . ALA A 1 51  ? 16.774 162.870 34.270  1.00 23.49 ? 51  ALA A CB  1 
ATOM   374  N  N   . GLY A 1 52  ? 16.815 161.834 30.918  1.00 23.09 ? 52  GLY A N   1 
ATOM   375  C  CA  . GLY A 1 52  ? 17.568 161.042 29.968  1.00 23.10 ? 52  GLY A CA  1 
ATOM   376  C  C   . GLY A 1 52  ? 18.759 161.777 29.390  1.00 24.07 ? 52  GLY A C   1 
ATOM   377  O  O   . GLY A 1 52  ? 18.683 162.979 29.129  1.00 26.04 ? 52  GLY A O   1 
ATOM   378  N  N   . CYS A 1 53  ? 19.862 161.055 29.202  1.00 23.02 ? 53  CYS A N   1 
ATOM   379  C  CA  . CYS A 1 53  ? 21.087 161.618 28.642  1.00 22.24 ? 53  CYS A CA  1 
ATOM   380  C  C   . CYS A 1 53  ? 21.480 160.727 27.469  1.00 23.08 ? 53  CYS A C   1 
ATOM   381  O  O   . CYS A 1 53  ? 22.228 159.759 27.625  1.00 22.41 ? 53  CYS A O   1 
ATOM   382  C  CB  . CYS A 1 53  ? 22.196 161.627 29.698  1.00 22.42 ? 53  CYS A CB  1 
ATOM   383  S  SG  . CYS A 1 53  ? 23.729 162.400 29.152  1.00 21.82 ? 53  CYS A SG  1 
ATOM   384  N  N   . LEU A 1 54  ? 20.975 161.069 26.288  1.00 24.03 ? 54  LEU A N   1 
ATOM   385  C  CA  . LEU A 1 54  ? 21.219 160.271 25.094  1.00 24.23 ? 54  LEU A CA  1 
ATOM   386  C  C   . LEU A 1 54  ? 21.218 161.137 23.838  1.00 24.19 ? 54  LEU A C   1 
ATOM   387  O  O   . LEU A 1 54  ? 20.360 162.007 23.687  1.00 24.03 ? 54  LEU A O   1 
ATOM   388  C  CB  . LEU A 1 54  ? 20.107 159.222 24.980  1.00 22.83 ? 54  LEU A CB  1 
ATOM   389  C  CG  . LEU A 1 54  ? 20.330 157.842 24.361  1.00 24.08 ? 54  LEU A CG  1 
ATOM   390  C  CD1 . LEU A 1 54  ? 18.987 157.122 24.360  1.00 23.46 ? 54  LEU A CD1 1 
ATOM   391  C  CD2 . LEU A 1 54  ? 20.892 157.933 22.957  1.00 20.47 ? 54  LEU A CD2 1 
ATOM   392  N  N   . HIS A 1 55  ? 22.175 160.878 22.946  1.00 24.18 ? 55  HIS A N   1 
ATOM   393  C  CA  . HIS A 1 55  ? 22.302 161.593 21.675  1.00 24.76 ? 55  HIS A CA  1 
ATOM   394  C  C   . HIS A 1 55  ? 20.937 162.092 21.222  1.00 24.83 ? 55  HIS A C   1 
ATOM   395  O  O   . HIS A 1 55  ? 20.082 161.296 20.853  1.00 25.72 ? 55  HIS A O   1 
ATOM   396  C  CB  . HIS A 1 55  ? 22.857 160.654 20.597  1.00 24.79 ? 55  HIS A CB  1 
ATOM   397  C  CG  . HIS A 1 55  ? 24.113 159.943 20.996  1.00 26.31 ? 55  HIS A CG  1 
ATOM   398  N  ND1 . HIS A 1 55  ? 25.318 160.592 21.163  1.00 26.57 ? 55  HIS A ND1 1 
ATOM   399  C  CD2 . HIS A 1 55  ? 24.347 158.640 21.280  1.00 26.84 ? 55  HIS A CD2 1 
ATOM   400  C  CE1 . HIS A 1 55  ? 26.239 159.719 21.532  1.00 27.75 ? 55  HIS A CE1 1 
ATOM   401  N  NE2 . HIS A 1 55  ? 25.675 158.527 21.610  1.00 27.35 ? 55  HIS A NE2 1 
ATOM   402  N  N   . MET A 1 56  ? 20.726 163.402 21.246  1.00 24.91 ? 56  MET A N   1 
ATOM   403  C  CA  . MET A 1 56  ? 19.438 163.953 20.835  1.00 24.72 ? 56  MET A CA  1 
ATOM   404  C  C   . MET A 1 56  ? 19.287 163.907 19.317  1.00 25.14 ? 56  MET A C   1 
ATOM   405  O  O   . MET A 1 56  ? 19.535 164.899 18.620  1.00 25.84 ? 56  MET A O   1 
ATOM   406  C  CB  . MET A 1 56  ? 19.294 165.391 21.339  1.00 22.47 ? 56  MET A CB  1 
ATOM   407  C  CG  . MET A 1 56  ? 17.951 166.027 21.034  1.00 21.48 ? 56  MET A CG  1 
ATOM   408  S  SD  . MET A 1 56  ? 16.542 165.214 21.824  1.00 22.63 ? 56  MET A SD  1 
ATOM   409  C  CE  . MET A 1 56  ? 15.743 164.465 20.413  1.00 21.03 ? 56  MET A CE  1 
ATOM   410  N  N   . THR A 1 57  ? 18.877 162.742 18.816  1.00 23.76 ? 57  THR A N   1 
ATOM   411  C  CA  . THR A 1 57  ? 18.684 162.519 17.384  1.00 22.66 ? 57  THR A CA  1 
ATOM   412  C  C   . THR A 1 57  ? 17.212 162.260 17.088  1.00 23.06 ? 57  THR A C   1 
ATOM   413  O  O   . THR A 1 57  ? 16.387 162.198 18.003  1.00 23.64 ? 57  THR A O   1 
ATOM   414  C  CB  . THR A 1 57  ? 19.458 161.294 16.911  1.00 21.33 ? 57  THR A CB  1 
ATOM   415  O  OG1 . THR A 1 57  ? 18.969 160.144 17.611  1.00 20.66 ? 57  THR A OG1 1 
ATOM   416  C  CG2 . THR A 1 57  ? 20.942 161.454 17.182  1.00 21.53 ? 57  THR A CG2 1 
ATOM   417  N  N   . VAL A 1 58  ? 16.890 162.095 15.808  1.00 22.15 ? 58  VAL A N   1 
ATOM   418  C  CA  . VAL A 1 58  ? 15.514 161.832 15.407  1.00 21.67 ? 58  VAL A CA  1 
ATOM   419  C  C   . VAL A 1 58  ? 15.018 160.557 16.075  1.00 21.74 ? 58  VAL A C   1 
ATOM   420  O  O   . VAL A 1 58  ? 13.940 160.530 16.669  1.00 20.60 ? 58  VAL A O   1 
ATOM   421  C  CB  . VAL A 1 58  ? 15.392 161.679 13.879  1.00 21.20 ? 58  VAL A CB  1 
ATOM   422  C  CG1 . VAL A 1 58  ? 13.984 161.245 13.511  1.00 18.38 ? 58  VAL A CG1 1 
ATOM   423  C  CG2 . VAL A 1 58  ? 15.737 163.000 13.202  1.00 19.63 ? 58  VAL A CG2 1 
ATOM   424  N  N   . GLU A 1 59  ? 15.819 159.501 15.977  1.00 22.56 ? 59  GLU A N   1 
ATOM   425  C  CA  . GLU A 1 59  ? 15.470 158.221 16.577  1.00 21.84 ? 59  GLU A CA  1 
ATOM   426  C  C   . GLU A 1 59  ? 15.219 158.404 18.066  1.00 21.38 ? 59  GLU A C   1 
ATOM   427  O  O   . GLU A 1 59  ? 14.257 157.875 18.617  1.00 20.31 ? 59  GLU A O   1 
ATOM   428  C  CB  . GLU A 1 59  ? 16.606 157.212 16.380  1.00 22.50 ? 59  GLU A CB  1 
ATOM   429  C  CG  . GLU A 1 59  ? 16.785 156.697 14.959  1.00 24.24 ? 59  GLU A CG  1 
ATOM   430  C  CD  . GLU A 1 59  ? 17.296 157.752 14.004  1.00 25.49 ? 59  GLU A CD  1 
ATOM   431  O  OE1 . GLU A 1 59  ? 17.975 158.691 14.471  1.00 26.27 ? 59  GLU A OE1 1 
ATOM   432  O  OE2 . GLU A 1 59  ? 17.035 157.633 12.787  1.00 25.63 ? 59  GLU A OE2 1 
ATOM   433  N  N   . THR A 1 60  ? 16.101 159.157 18.715  1.00 21.83 ? 60  THR A N   1 
ATOM   434  C  CA  . THR A 1 60  ? 15.981 159.410 20.142  1.00 21.11 ? 60  THR A CA  1 
ATOM   435  C  C   . THR A 1 60  ? 14.698 160.155 20.467  1.00 20.58 ? 60  THR A C   1 
ATOM   436  O  O   . THR A 1 60  ? 14.074 159.914 21.494  1.00 22.14 ? 60  THR A O   1 
ATOM   437  C  CB  . THR A 1 60  ? 17.189 160.206 20.659  1.00 21.70 ? 60  THR A CB  1 
ATOM   438  O  OG1 . THR A 1 60  ? 18.355 159.367 20.636  1.00 21.49 ? 60  THR A OG1 1 
ATOM   439  C  CG2 . THR A 1 60  ? 16.937 160.698 22.084  1.00 22.03 ? 60  THR A CG2 1 
ATOM   440  N  N   . ALA A 1 61  ? 14.306 161.061 19.582  1.00 20.15 ? 61  ALA A N   1 
ATOM   441  C  CA  . ALA A 1 61  ? 13.086 161.825 19.775  1.00 18.53 ? 61  ALA A CA  1 
ATOM   442  C  C   . ALA A 1 61  ? 11.892 160.872 19.852  1.00 17.45 ? 61  ALA A C   1 
ATOM   443  O  O   . ALA A 1 61  ? 10.983 161.062 20.665  1.00 17.98 ? 61  ALA A O   1 
ATOM   444  C  CB  . ALA A 1 61  ? 12.908 162.802 18.628  1.00 16.82 ? 61  ALA A CB  1 
ATOM   445  N  N   . VAL A 1 62  ? 11.901 159.846 19.007  1.00 15.60 ? 62  VAL A N   1 
ATOM   446  C  CA  . VAL A 1 62  ? 10.819 158.876 18.991  1.00 14.73 ? 62  VAL A CA  1 
ATOM   447  C  C   . VAL A 1 62  ? 10.810 158.144 20.320  1.00 15.89 ? 62  VAL A C   1 
ATOM   448  O  O   . VAL A 1 62  ? 9.753  157.799 20.838  1.00 18.85 ? 62  VAL A O   1 
ATOM   449  C  CB  . VAL A 1 62  ? 10.975 157.868 17.831  1.00 13.98 ? 62  VAL A CB  1 
ATOM   450  C  CG1 . VAL A 1 62  ? 9.779  156.940 17.778  1.00 14.61 ? 62  VAL A CG1 1 
ATOM   451  C  CG2 . VAL A 1 62  ? 11.102 158.609 16.513  1.00 13.55 ? 62  VAL A CG2 1 
ATOM   452  N  N   . LEU A 1 63  ? 11.992 157.916 20.878  1.00 17.23 ? 63  LEU A N   1 
ATOM   453  C  CA  . LEU A 1 63  ? 12.097 157.252 22.173  1.00 18.55 ? 63  LEU A CA  1 
ATOM   454  C  C   . LEU A 1 63  ? 11.508 158.152 23.257  1.00 20.04 ? 63  LEU A C   1 
ATOM   455  O  O   . LEU A 1 63  ? 10.788 157.687 24.146  1.00 21.46 ? 63  LEU A O   1 
ATOM   456  C  CB  . LEU A 1 63  ? 13.563 156.961 22.517  1.00 17.80 ? 63  LEU A CB  1 
ATOM   457  C  CG  . LEU A 1 63  ? 13.869 156.637 23.991  1.00 16.78 ? 63  LEU A CG  1 
ATOM   458  C  CD1 . LEU A 1 63  ? 13.176 155.347 24.424  1.00 14.07 ? 63  LEU A CD1 1 
ATOM   459  C  CD2 . LEU A 1 63  ? 15.362 156.519 24.172  1.00 14.33 ? 63  LEU A CD2 1 
ATOM   460  N  N   . ILE A 1 64  ? 11.827 159.442 23.187  1.00 20.53 ? 64  ILE A N   1 
ATOM   461  C  CA  . ILE A 1 64  ? 11.330 160.392 24.172  1.00 21.30 ? 64  ILE A CA  1 
ATOM   462  C  C   . ILE A 1 64  ? 9.811  160.459 24.172  1.00 21.43 ? 64  ILE A C   1 
ATOM   463  O  O   . ILE A 1 64  ? 9.176  160.365 25.225  1.00 20.96 ? 64  ILE A O   1 
ATOM   464  C  CB  . ILE A 1 64  ? 11.881 161.812 23.926  1.00 21.65 ? 64  ILE A CB  1 
ATOM   465  C  CG1 . ILE A 1 64  ? 13.394 161.832 24.152  1.00 19.88 ? 64  ILE A CG1 1 
ATOM   466  C  CG2 . ILE A 1 64  ? 11.191 162.799 24.859  1.00 20.48 ? 64  ILE A CG2 1 
ATOM   467  C  CD1 . ILE A 1 64  ? 14.027 163.165 23.882  1.00 19.17 ? 64  ILE A CD1 1 
ATOM   468  N  N   . GLU A 1 65  ? 9.225  160.609 22.991  1.00 20.77 ? 65  GLU A N   1 
ATOM   469  C  CA  . GLU A 1 65  ? 7.779  160.692 22.916  1.00 21.91 ? 65  GLU A CA  1 
ATOM   470  C  C   . GLU A 1 65  ? 7.089  159.382 23.259  1.00 22.37 ? 65  GLU A C   1 
ATOM   471  O  O   . GLU A 1 65  ? 5.901  159.364 23.577  1.00 23.92 ? 65  GLU A O   1 
ATOM   472  C  CB  . GLU A 1 65  ? 7.355  161.184 21.540  1.00 22.44 ? 65  GLU A CB  1 
ATOM   473  C  CG  . GLU A 1 65  ? 7.865  162.588 21.254  1.00 22.57 ? 65  GLU A CG  1 
ATOM   474  C  CD  . GLU A 1 65  ? 7.133  163.256 20.114  1.00 21.83 ? 65  GLU A CD  1 
ATOM   475  O  OE1 . GLU A 1 65  ? 7.054  162.660 19.019  1.00 22.26 ? 65  GLU A OE1 1 
ATOM   476  O  OE2 . GLU A 1 65  ? 6.642  164.382 20.315  1.00 21.82 ? 65  GLU A OE2 1 
ATOM   477  N  N   . THR A 1 66  ? 7.833  158.285 23.208  1.00 21.64 ? 66  THR A N   1 
ATOM   478  C  CA  . THR A 1 66  ? 7.271  156.988 23.549  1.00 21.22 ? 66  THR A CA  1 
ATOM   479  C  C   . THR A 1 66  ? 7.107  156.944 25.068  1.00 21.57 ? 66  THR A C   1 
ATOM   480  O  O   . THR A 1 66  ? 6.084  156.499 25.585  1.00 20.56 ? 66  THR A O   1 
ATOM   481  C  CB  . THR A 1 66  ? 8.197  155.836 23.073  1.00 22.06 ? 66  THR A CB  1 
ATOM   482  O  OG1 . THR A 1 66  ? 8.193  155.788 21.640  1.00 19.82 ? 66  THR A OG1 1 
ATOM   483  C  CG2 . THR A 1 66  ? 7.727  154.488 23.626  1.00 20.86 ? 66  THR A CG2 1 
ATOM   484  N  N   . LEU A 1 67  ? 8.119  157.436 25.776  1.00 22.66 ? 67  LEU A N   1 
ATOM   485  C  CA  . LEU A 1 67  ? 8.100  157.479 27.237  1.00 23.42 ? 67  LEU A CA  1 
ATOM   486  C  C   . LEU A 1 67  ? 6.952  158.336 27.767  1.00 23.54 ? 67  LEU A C   1 
ATOM   487  O  O   . LEU A 1 67  ? 6.263  157.956 28.714  1.00 24.50 ? 67  LEU A O   1 
ATOM   488  C  CB  . LEU A 1 67  ? 9.419  158.048 27.758  1.00 23.57 ? 67  LEU A CB  1 
ATOM   489  C  CG  . LEU A 1 67  ? 10.689 157.307 27.344  1.00 24.19 ? 67  LEU A CG  1 
ATOM   490  C  CD1 . LEU A 1 67  ? 11.892 158.051 27.891  1.00 24.42 ? 67  LEU A CD1 1 
ATOM   491  C  CD2 . LEU A 1 67  ? 10.647 155.874 27.860  1.00 22.51 ? 67  LEU A CD2 1 
ATOM   492  N  N   . VAL A 1 68  ? 6.763  159.506 27.168  1.00 23.68 ? 68  VAL A N   1 
ATOM   493  C  CA  . VAL A 1 68  ? 5.696  160.393 27.593  1.00 23.38 ? 68  VAL A CA  1 
ATOM   494  C  C   . VAL A 1 68  ? 4.351  159.717 27.361  1.00 24.91 ? 68  VAL A C   1 
ATOM   495  O  O   . VAL A 1 68  ? 3.462  159.778 28.207  1.00 27.04 ? 68  VAL A O   1 
ATOM   496  C  CB  . VAL A 1 68  ? 5.741  161.730 26.826  1.00 22.89 ? 68  VAL A CB  1 
ATOM   497  C  CG1 . VAL A 1 68  ? 4.462  162.524 27.082  1.00 19.55 ? 68  VAL A CG1 1 
ATOM   498  C  CG2 . VAL A 1 68  ? 6.955  162.529 27.265  1.00 21.09 ? 68  VAL A CG2 1 
ATOM   499  N  N   . THR A 1 69  ? 4.199  159.069 26.213  1.00 25.38 ? 69  THR A N   1 
ATOM   500  C  CA  . THR A 1 69  ? 2.955  158.374 25.915  1.00 25.57 ? 69  THR A CA  1 
ATOM   501  C  C   . THR A 1 69  ? 2.692  157.317 26.980  1.00 24.93 ? 69  THR A C   1 
ATOM   502  O  O   . THR A 1 69  ? 1.546  157.013 27.284  1.00 26.42 ? 69  THR A O   1 
ATOM   503  C  CB  . THR A 1 69  ? 3.010  157.669 24.552  1.00 25.52 ? 69  THR A CB  1 
ATOM   504  O  OG1 . THR A 1 69  ? 3.296  158.625 23.528  1.00 24.34 ? 69  THR A OG1 1 
ATOM   505  C  CG2 . THR A 1 69  ? 1.685  156.998 24.255  1.00 24.86 ? 69  THR A CG2 1 
ATOM   506  N  N   . LEU A 1 70  ? 3.757  156.754 27.542  1.00 24.80 ? 70  LEU A N   1 
ATOM   507  C  CA  . LEU A 1 70  ? 3.611  155.736 28.572  1.00 25.57 ? 70  LEU A CA  1 
ATOM   508  C  C   . LEU A 1 70  ? 3.307  156.339 29.945  1.00 26.40 ? 70  LEU A C   1 
ATOM   509  O  O   . LEU A 1 70  ? 3.310  155.630 30.954  1.00 27.87 ? 70  LEU A O   1 
ATOM   510  C  CB  . LEU A 1 70  ? 4.865  154.855 28.646  1.00 25.00 ? 70  LEU A CB  1 
ATOM   511  C  CG  . LEU A 1 70  ? 5.272  154.155 27.344  1.00 26.31 ? 70  LEU A CG  1 
ATOM   512  C  CD1 . LEU A 1 70  ? 6.262  153.049 27.650  1.00 25.72 ? 70  LEU A CD1 1 
ATOM   513  C  CD2 . LEU A 1 70  ? 4.050  153.577 26.649  1.00 26.72 ? 70  LEU A CD2 1 
ATOM   514  N  N   . GLY A 1 71  ? 3.054  157.646 29.974  1.00 26.57 ? 71  GLY A N   1 
ATOM   515  C  CA  . GLY A 1 71  ? 2.707  158.320 31.217  1.00 25.13 ? 71  GLY A CA  1 
ATOM   516  C  C   . GLY A 1 71  ? 3.810  159.002 32.002  1.00 24.58 ? 71  GLY A C   1 
ATOM   517  O  O   . GLY A 1 71  ? 3.559  159.574 33.068  1.00 24.69 ? 71  GLY A O   1 
ATOM   518  N  N   . ALA A 1 72  ? 5.029  158.970 31.486  1.00 24.35 ? 72  ALA A N   1 
ATOM   519  C  CA  . ALA A 1 72  ? 6.142  159.580 32.204  1.00 24.57 ? 72  ALA A CA  1 
ATOM   520  C  C   . ALA A 1 72  ? 6.429  161.052 31.892  1.00 24.46 ? 72  ALA A C   1 
ATOM   521  O  O   . ALA A 1 72  ? 6.111  161.563 30.815  1.00 23.59 ? 72  ALA A O   1 
ATOM   522  C  CB  . ALA A 1 72  ? 7.409  158.758 31.976  1.00 23.60 ? 72  ALA A CB  1 
ATOM   523  N  N   . GLU A 1 73  ? 7.024  161.719 32.875  1.00 25.58 ? 73  GLU A N   1 
ATOM   524  C  CA  . GLU A 1 73  ? 7.448  163.107 32.766  1.00 26.39 ? 73  GLU A CA  1 
ATOM   525  C  C   . GLU A 1 73  ? 8.892  162.931 32.282  1.00 25.20 ? 73  GLU A C   1 
ATOM   526  O  O   . GLU A 1 73  ? 9.654  162.161 32.874  1.00 25.83 ? 73  GLU A O   1 
ATOM   527  C  CB  . GLU A 1 73  ? 7.428  163.775 34.146  1.00 29.83 ? 73  GLU A CB  1 
ATOM   528  C  CG  . GLU A 1 73  ? 6.480  164.963 34.270  1.00 35.59 ? 73  GLU A CG  1 
ATOM   529  C  CD  . GLU A 1 73  ? 6.567  165.646 35.635  1.00 40.30 ? 73  GLU A CD  1 
ATOM   530  O  OE1 . GLU A 1 73  ? 6.175  165.014 36.645  1.00 42.37 ? 73  GLU A OE1 1 
ATOM   531  O  OE2 . GLU A 1 73  ? 7.028  166.813 35.697  1.00 41.99 ? 73  GLU A OE2 1 
ATOM   532  N  N   . VAL A 1 74  ? 9.272  163.630 31.219  1.00 24.19 ? 74  VAL A N   1 
ATOM   533  C  CA  . VAL A 1 74  ? 10.613 163.477 30.657  1.00 23.40 ? 74  VAL A CA  1 
ATOM   534  C  C   . VAL A 1 74  ? 11.381 164.773 30.391  1.00 24.92 ? 74  VAL A C   1 
ATOM   535  O  O   . VAL A 1 74  ? 10.842 165.716 29.803  1.00 26.35 ? 74  VAL A O   1 
ATOM   536  C  CB  . VAL A 1 74  ? 10.542 162.697 29.309  1.00 23.31 ? 74  VAL A CB  1 
ATOM   537  C  CG1 . VAL A 1 74  ? 11.913 162.642 28.655  1.00 22.42 ? 74  VAL A CG1 1 
ATOM   538  C  CG2 . VAL A 1 74  ? 9.995  161.293 29.539  1.00 22.95 ? 74  VAL A CG2 1 
ATOM   539  N  N   . GLN A 1 75  ? 12.640 164.807 30.827  1.00 24.67 ? 75  GLN A N   1 
ATOM   540  C  CA  . GLN A 1 75  ? 13.528 165.948 30.600  1.00 23.82 ? 75  GLN A CA  1 
ATOM   541  C  C   . GLN A 1 75  ? 14.772 165.336 29.972  1.00 24.36 ? 75  GLN A C   1 
ATOM   542  O  O   . GLN A 1 75  ? 15.255 164.301 30.434  1.00 22.96 ? 75  GLN A O   1 
ATOM   543  C  CB  . GLN A 1 75  ? 13.839 166.670 31.906  1.00 23.76 ? 75  GLN A CB  1 
ATOM   544  C  CG  . GLN A 1 75  ? 12.655 167.487 32.384  1.00 24.27 ? 75  GLN A CG  1 
ATOM   545  C  CD  . GLN A 1 75  ? 12.949 168.332 33.600  1.00 24.89 ? 75  GLN A CD  1 
ATOM   546  O  OE1 . GLN A 1 75  ? 12.188 169.242 33.923  1.00 28.66 ? 75  GLN A OE1 1 
ATOM   547  N  NE2 . GLN A 1 75  ? 14.045 168.035 34.287  1.00 24.77 ? 75  GLN A NE2 1 
ATOM   548  N  N   . TRP A 1 76  ? 15.293 165.980 28.930  1.00 24.06 ? 76  TRP A N   1 
ATOM   549  C  CA  . TRP A 1 76  ? 16.402 165.417 28.177  1.00 23.98 ? 76  TRP A CA  1 
ATOM   550  C  C   . TRP A 1 76  ? 17.629 166.266 27.858  1.00 25.51 ? 76  TRP A C   1 
ATOM   551  O  O   . TRP A 1 76  ? 17.573 167.495 27.807  1.00 27.28 ? 76  TRP A O   1 
ATOM   552  C  CB  . TRP A 1 76  ? 15.831 164.900 26.859  1.00 22.71 ? 76  TRP A CB  1 
ATOM   553  C  CG  . TRP A 1 76  ? 16.456 163.659 26.355  1.00 23.81 ? 76  TRP A CG  1 
ATOM   554  C  CD1 . TRP A 1 76  ? 17.523 163.553 25.512  1.00 22.75 ? 76  TRP A CD1 1 
ATOM   555  C  CD2 . TRP A 1 76  ? 16.046 162.323 26.659  1.00 24.22 ? 76  TRP A CD2 1 
ATOM   556  N  NE1 . TRP A 1 76  ? 17.800 162.230 25.270  1.00 22.90 ? 76  TRP A NE1 1 
ATOM   557  C  CE2 . TRP A 1 76  ? 16.906 161.456 25.965  1.00 23.40 ? 76  TRP A CE2 1 
ATOM   558  C  CE3 . TRP A 1 76  ? 15.031 161.779 27.452  1.00 23.86 ? 76  TRP A CE3 1 
ATOM   559  C  CZ2 . TRP A 1 76  ? 16.781 160.073 26.039  1.00 24.69 ? 76  TRP A CZ2 1 
ATOM   560  C  CZ3 . TRP A 1 76  ? 14.908 160.411 27.520  1.00 25.70 ? 76  TRP A CZ3 1 
ATOM   561  C  CH2 . TRP A 1 76  ? 15.778 159.570 26.818  1.00 24.36 ? 76  TRP A CH2 1 
ATOM   562  N  N   . SER A 1 77  ? 18.736 165.566 27.617  1.00 25.07 ? 77  SER A N   1 
ATOM   563  C  CA  . SER A 1 77  ? 20.006 166.172 27.229  1.00 24.84 ? 77  SER A CA  1 
ATOM   564  C  C   . SER A 1 77  ? 20.762 165.127 26.392  1.00 24.16 ? 77  SER A C   1 
ATOM   565  O  O   . SER A 1 77  ? 20.563 163.921 26.550  1.00 23.04 ? 77  SER A O   1 
ATOM   566  C  CB  . SER A 1 77  ? 20.835 166.574 28.458  1.00 24.55 ? 77  SER A CB  1 
ATOM   567  O  OG  . SER A 1 77  ? 21.337 165.446 29.158  1.00 24.55 ? 77  SER A OG  1 
ATOM   568  N  N   . SER A 1 78  ? 21.606 165.585 25.481  1.00 23.65 ? 78  SER A N   1 
ATOM   569  C  CA  . SER A 1 78  ? 22.363 164.659 24.659  1.00 24.80 ? 78  SER A CA  1 
ATOM   570  C  C   . SER A 1 78  ? 23.449 164.064 25.552  1.00 25.15 ? 78  SER A C   1 
ATOM   571  O  O   . SER A 1 78  ? 23.628 164.507 26.683  1.00 28.54 ? 78  SER A O   1 
ATOM   572  C  CB  . SER A 1 78  ? 22.988 165.404 23.474  1.00 24.57 ? 78  SER A CB  1 
ATOM   573  O  OG  . SER A 1 78  ? 23.438 164.505 22.475  1.00 23.71 ? 78  SER A OG  1 
ATOM   574  N  N   . CYS A 1 79  ? 24.158 163.053 25.066  1.00 24.52 ? 79  CYS A N   1 
ATOM   575  C  CA  . CYS A 1 79  ? 25.231 162.448 25.850  1.00 24.13 ? 79  CYS A CA  1 
ATOM   576  C  C   . CYS A 1 79  ? 26.539 162.687 25.095  1.00 24.45 ? 79  CYS A C   1 
ATOM   577  O  O   . CYS A 1 79  ? 27.592 162.144 25.434  1.00 23.46 ? 79  CYS A O   1 
ATOM   578  C  CB  . CYS A 1 79  ? 24.986 160.949 26.044  1.00 22.07 ? 79  CYS A CB  1 
ATOM   579  S  SG  . CYS A 1 79  ? 25.028 159.981 24.530  1.00 23.88 ? 79  CYS A SG  1 
ATOM   580  N  N   . ASN A 1 80  ? 26.442 163.519 24.062  1.00 25.27 ? 80  ASN A N   1 
ATOM   581  C  CA  . ASN A 1 80  ? 27.575 163.888 23.226  1.00 25.59 ? 80  ASN A CA  1 
ATOM   582  C  C   . ASN A 1 80  ? 27.337 165.309 22.709  1.00 26.00 ? 80  ASN A C   1 
ATOM   583  O  O   . ASN A 1 80  ? 26.225 165.644 22.301  1.00 26.23 ? 80  ASN A O   1 
ATOM   584  C  CB  . ASN A 1 80  ? 27.705 162.910 22.059  1.00 26.21 ? 80  ASN A CB  1 
ATOM   585  C  CG  . ASN A 1 80  ? 28.914 163.192 21.205  1.00 26.11 ? 80  ASN A CG  1 
ATOM   586  O  OD1 . ASN A 1 80  ? 28.921 164.126 20.401  1.00 26.29 ? 80  ASN A OD1 1 
ATOM   587  N  ND2 . ASN A 1 80  ? 29.956 162.398 21.387  1.00 24.39 ? 80  ASN A ND2 1 
ATOM   588  N  N   . ILE A 1 81  ? 28.383 166.134 22.727  1.00 26.04 ? 81  ILE A N   1 
ATOM   589  C  CA  . ILE A 1 81  ? 28.288 167.529 22.293  1.00 26.21 ? 81  ILE A CA  1 
ATOM   590  C  C   . ILE A 1 81  ? 28.070 167.772 20.794  1.00 26.70 ? 81  ILE A C   1 
ATOM   591  O  O   . ILE A 1 81  ? 27.882 168.914 20.379  1.00 26.31 ? 81  ILE A O   1 
ATOM   592  C  CB  . ILE A 1 81  ? 29.543 168.334 22.738  1.00 25.74 ? 81  ILE A CB  1 
ATOM   593  C  CG1 . ILE A 1 81  ? 30.810 167.715 22.132  1.00 26.40 ? 81  ILE A CG1 1 
ATOM   594  C  CG2 . ILE A 1 81  ? 29.636 168.357 24.254  1.00 24.20 ? 81  ILE A CG2 1 
ATOM   595  C  CD1 . ILE A 1 81  ? 32.096 168.428 22.510  1.00 21.23 ? 81  ILE A CD1 1 
ATOM   596  N  N   . PHE A 1 82  ? 28.085 166.714 19.989  1.00 26.95 ? 82  PHE A N   1 
ATOM   597  C  CA  . PHE A 1 82  ? 27.894 166.856 18.542  1.00 27.23 ? 82  PHE A CA  1 
ATOM   598  C  C   . PHE A 1 82  ? 26.812 165.936 17.981  1.00 27.49 ? 82  PHE A C   1 
ATOM   599  O  O   . PHE A 1 82  ? 26.429 166.063 16.817  1.00 29.02 ? 82  PHE A O   1 
ATOM   600  C  CB  . PHE A 1 82  ? 29.187 166.528 17.791  1.00 27.21 ? 82  PHE A CB  1 
ATOM   601  C  CG  . PHE A 1 82  ? 30.329 167.437 18.101  1.00 27.93 ? 82  PHE A CG  1 
ATOM   602  C  CD1 . PHE A 1 82  ? 30.265 168.784 17.787  1.00 29.08 ? 82  PHE A CD1 1 
ATOM   603  C  CD2 . PHE A 1 82  ? 31.495 166.934 18.659  1.00 28.47 ? 82  PHE A CD2 1 
ATOM   604  C  CE1 . PHE A 1 82  ? 31.349 169.617 18.019  1.00 29.69 ? 82  PHE A CE1 1 
ATOM   605  C  CE2 . PHE A 1 82  ? 32.584 167.758 18.894  1.00 29.13 ? 82  PHE A CE2 1 
ATOM   606  C  CZ  . PHE A 1 82  ? 32.512 169.103 18.573  1.00 28.87 ? 82  PHE A CZ  1 
ATOM   607  N  N   . SER A 1 83  ? 26.338 164.998 18.792  1.00 26.20 ? 83  SER A N   1 
ATOM   608  C  CA  . SER A 1 83  ? 25.340 164.039 18.333  1.00 25.01 ? 83  SER A CA  1 
ATOM   609  C  C   . SER A 1 83  ? 23.951 164.606 18.073  1.00 24.56 ? 83  SER A C   1 
ATOM   610  O  O   . SER A 1 83  ? 23.179 164.039 17.306  1.00 24.96 ? 83  SER A O   1 
ATOM   611  C  CB  . SER A 1 83  ? 25.240 162.892 19.334  1.00 25.82 ? 83  SER A CB  1 
ATOM   612  O  OG  . SER A 1 83  ? 24.963 163.382 20.632  1.00 26.14 ? 83  SER A OG  1 
ATOM   613  N  N   . THR A 1 84  ? 23.632 165.727 18.705  1.00 25.07 ? 84  THR A N   1 
ATOM   614  C  CA  . THR A 1 84  ? 22.318 166.340 18.541  1.00 24.55 ? 84  THR A CA  1 
ATOM   615  C  C   . THR A 1 84  ? 21.982 166.783 17.119  1.00 24.11 ? 84  THR A C   1 
ATOM   616  O  O   . THR A 1 84  ? 22.784 167.437 16.455  1.00 23.17 ? 84  THR A O   1 
ATOM   617  C  CB  . THR A 1 84  ? 22.159 167.578 19.460  1.00 24.29 ? 84  THR A CB  1 
ATOM   618  O  OG1 . THR A 1 84  ? 22.169 167.172 20.834  1.00 23.62 ? 84  THR A OG1 1 
ATOM   619  C  CG2 . THR A 1 84  ? 20.859 168.304 19.153  1.00 22.64 ? 84  THR A CG2 1 
ATOM   620  N  N   . GLN A 1 85  ? 20.791 166.405 16.660  1.00 24.76 ? 85  GLN A N   1 
ATOM   621  C  CA  . GLN A 1 85  ? 20.290 166.803 15.345  1.00 24.59 ? 85  GLN A CA  1 
ATOM   622  C  C   . GLN A 1 85  ? 19.282 167.886 15.706  1.00 24.74 ? 85  GLN A C   1 
ATOM   623  O  O   . GLN A 1 85  ? 18.152 167.587 16.082  1.00 26.11 ? 85  GLN A O   1 
ATOM   624  C  CB  . GLN A 1 85  ? 19.584 165.636 14.638  1.00 22.92 ? 85  GLN A CB  1 
ATOM   625  C  CG  . GLN A 1 85  ? 20.526 164.579 14.063  1.00 20.30 ? 85  GLN A CG  1 
ATOM   626  C  CD  . GLN A 1 85  ? 19.785 163.411 13.422  1.00 20.02 ? 85  GLN A CD  1 
ATOM   627  O  OE1 . GLN A 1 85  ? 19.082 162.654 14.099  1.00 20.58 ? 85  GLN A OE1 1 
ATOM   628  N  NE2 . GLN A 1 85  ? 19.940 163.260 12.112  1.00 17.19 ? 85  GLN A NE2 1 
ATOM   629  N  N   . ASP A 1 86  ? 19.706 169.141 15.603  1.00 23.81 ? 86  ASP A N   1 
ATOM   630  C  CA  . ASP A 1 86  ? 18.876 170.282 15.973  1.00 23.44 ? 86  ASP A CA  1 
ATOM   631  C  C   . ASP A 1 86  ? 17.391 170.273 15.585  1.00 24.05 ? 86  ASP A C   1 
ATOM   632  O  O   . ASP A 1 86  ? 16.546 170.689 16.379  1.00 22.92 ? 86  ASP A O   1 
ATOM   633  C  CB  . ASP A 1 86  ? 19.548 171.574 15.496  1.00 22.12 ? 86  ASP A CB  1 
ATOM   634  C  CG  . ASP A 1 86  ? 20.922 171.788 16.136  1.00 22.07 ? 86  ASP A CG  1 
ATOM   635  O  OD1 . ASP A 1 86  ? 21.111 171.417 17.316  1.00 20.42 ? 86  ASP A OD1 1 
ATOM   636  O  OD2 . ASP A 1 86  ? 21.816 172.344 15.467  1.00 22.96 ? 86  ASP A OD2 1 
ATOM   637  N  N   . HIS A 1 87  ? 17.050 169.808 14.388  1.00 25.50 ? 87  HIS A N   1 
ATOM   638  C  CA  . HIS A 1 87  ? 15.637 169.784 14.014  1.00 27.03 ? 87  HIS A CA  1 
ATOM   639  C  C   . HIS A 1 87  ? 14.878 168.747 14.851  1.00 27.22 ? 87  HIS A C   1 
ATOM   640  O  O   . HIS A 1 87  ? 13.656 168.828 15.005  1.00 26.94 ? 87  HIS A O   1 
ATOM   641  C  CB  . HIS A 1 87  ? 15.468 169.494 12.519  1.00 27.58 ? 87  HIS A CB  1 
ATOM   642  C  CG  . HIS A 1 87  ? 15.975 168.152 12.095  1.00 29.87 ? 87  HIS A CG  1 
ATOM   643  N  ND1 . HIS A 1 87  ? 17.274 167.745 12.310  1.00 31.58 ? 87  HIS A ND1 1 
ATOM   644  C  CD2 . HIS A 1 87  ? 15.366 167.140 11.433  1.00 30.49 ? 87  HIS A CD2 1 
ATOM   645  C  CE1 . HIS A 1 87  ? 17.444 166.539 11.797  1.00 31.41 ? 87  HIS A CE1 1 
ATOM   646  N  NE2 . HIS A 1 87  ? 16.302 166.150 11.258  1.00 30.09 ? 87  HIS A NE2 1 
ATOM   647  N  N   . ALA A 1 88  ? 15.608 167.774 15.393  1.00 25.81 ? 88  ALA A N   1 
ATOM   648  C  CA  . ALA A 1 88  ? 14.999 166.748 16.229  1.00 24.94 ? 88  ALA A CA  1 
ATOM   649  C  C   . ALA A 1 88  ? 14.812 167.329 17.624  1.00 24.50 ? 88  ALA A C   1 
ATOM   650  O  O   . ALA A 1 88  ? 13.771 167.142 18.256  1.00 25.48 ? 88  ALA A O   1 
ATOM   651  C  CB  . ALA A 1 88  ? 15.883 165.515 16.283  1.00 25.86 ? 88  ALA A CB  1 
ATOM   652  N  N   . ALA A 1 89  ? 15.826 168.043 18.097  1.00 23.27 ? 89  ALA A N   1 
ATOM   653  C  CA  . ALA A 1 89  ? 15.767 168.678 19.407  1.00 23.28 ? 89  ALA A CA  1 
ATOM   654  C  C   . ALA A 1 89  ? 14.643 169.716 19.415  1.00 23.66 ? 89  ALA A C   1 
ATOM   655  O  O   . ALA A 1 89  ? 13.887 169.813 20.378  1.00 24.36 ? 89  ALA A O   1 
ATOM   656  C  CB  . ALA A 1 89  ? 17.101 169.341 19.728  1.00 21.60 ? 89  ALA A CB  1 
ATOM   657  N  N   . ALA A 1 90  ? 14.536 170.490 18.338  1.00 24.59 ? 90  ALA A N   1 
ATOM   658  C  CA  . ALA A 1 90  ? 13.491 171.503 18.228  1.00 25.28 ? 90  ALA A CA  1 
ATOM   659  C  C   . ALA A 1 90  ? 12.112 170.856 18.389  1.00 25.00 ? 90  ALA A C   1 
ATOM   660  O  O   . ALA A 1 90  ? 11.327 171.257 19.246  1.00 25.36 ? 90  ALA A O   1 
ATOM   661  C  CB  . ALA A 1 90  ? 13.584 172.211 16.879  1.00 25.01 ? 90  ALA A CB  1 
ATOM   662  N  N   . ALA A 1 91  ? 11.836 169.848 17.566  1.00 24.27 ? 91  ALA A N   1 
ATOM   663  C  CA  . ALA A 1 91  ? 10.562 169.134 17.600  1.00 22.86 ? 91  ALA A CA  1 
ATOM   664  C  C   . ALA A 1 91  ? 10.168 168.756 19.020  1.00 23.78 ? 91  ALA A C   1 
ATOM   665  O  O   . ALA A 1 91  ? 9.026  168.977 19.438  1.00 23.72 ? 91  ALA A O   1 
ATOM   666  C  CB  . ALA A 1 91  ? 10.643 167.890 16.739  1.00 22.92 ? 91  ALA A CB  1 
ATOM   667  N  N   . ILE A 1 92  ? 11.109 168.176 19.759  1.00 23.28 ? 92  ILE A N   1 
ATOM   668  C  CA  . ILE A 1 92  ? 10.858 167.782 21.142  1.00 21.49 ? 92  ILE A CA  1 
ATOM   669  C  C   . ILE A 1 92  ? 10.582 169.014 22.008  1.00 22.62 ? 92  ILE A C   1 
ATOM   670  O  O   . ILE A 1 92  ? 9.665  169.013 22.836  1.00 23.30 ? 92  ILE A O   1 
ATOM   671  C  CB  . ILE A 1 92  ? 12.063 167.005 21.730  1.00 19.53 ? 92  ILE A CB  1 
ATOM   672  C  CG1 . ILE A 1 92  ? 12.207 165.660 21.015  1.00 20.76 ? 92  ILE A CG1 1 
ATOM   673  C  CG2 . ILE A 1 92  ? 11.881 166.784 23.227  1.00 15.15 ? 92  ILE A CG2 1 
ATOM   674  C  CD1 . ILE A 1 92  ? 11.071 164.687 21.277  1.00 18.60 ? 92  ILE A CD1 1 
ATOM   675  N  N   . ALA A 1 93  ? 11.374 170.064 21.819  1.00 22.63 ? 93  ALA A N   1 
ATOM   676  C  CA  . ALA A 1 93  ? 11.192 171.280 22.597  1.00 24.02 ? 93  ALA A CA  1 
ATOM   677  C  C   . ALA A 1 93  ? 9.803  171.827 22.312  1.00 25.76 ? 93  ALA A C   1 
ATOM   678  O  O   . ALA A 1 93  ? 9.037  172.128 23.230  1.00 26.88 ? 93  ALA A O   1 
ATOM   679  C  CB  . ALA A 1 93  ? 12.249 172.307 22.222  1.00 23.52 ? 93  ALA A CB  1 
ATOM   680  N  N   . LYS A 1 94  ? 9.482  171.939 21.027  1.00 26.32 ? 94  LYS A N   1 
ATOM   681  C  CA  . LYS A 1 94  ? 8.192  172.447 20.593  1.00 25.93 ? 94  LYS A CA  1 
ATOM   682  C  C   . LYS A 1 94  ? 7.025  171.648 21.153  1.00 25.98 ? 94  LYS A C   1 
ATOM   683  O  O   . LYS A 1 94  ? 5.938  172.185 21.340  1.00 26.07 ? 94  LYS A O   1 
ATOM   684  C  CB  . LYS A 1 94  ? 8.112  172.446 19.069  1.00 26.33 ? 94  LYS A CB  1 
ATOM   685  C  CG  . LYS A 1 94  ? 6.760  172.898 18.538  1.00 29.32 ? 94  LYS A CG  1 
ATOM   686  C  CD  . LYS A 1 94  ? 6.719  172.865 17.020  1.00 31.79 ? 94  LYS A CD  1 
ATOM   687  C  CE  . LYS A 1 94  ? 5.374  173.337 16.473  1.00 32.05 ? 94  LYS A CE  1 
ATOM   688  N  NZ  . LYS A 1 94  ? 5.436  173.542 14.993  1.00 31.16 ? 94  LYS A NZ  1 
ATOM   689  N  N   . ALA A 1 95  ? 7.250  170.363 21.415  1.00 27.02 ? 95  ALA A N   1 
ATOM   690  C  CA  . ALA A 1 95  ? 6.201  169.495 21.946  1.00 26.21 ? 95  ALA A CA  1 
ATOM   691  C  C   . ALA A 1 95  ? 5.925  169.750 23.423  1.00 26.24 ? 95  ALA A C   1 
ATOM   692  O  O   . ALA A 1 95  ? 4.952  169.233 23.968  1.00 27.50 ? 95  ALA A O   1 
ATOM   693  C  CB  . ALA A 1 95  ? 6.574  168.038 21.737  1.00 24.27 ? 95  ALA A CB  1 
ATOM   694  N  N   . GLY A 1 96  ? 6.780  170.540 24.069  1.00 25.11 ? 96  GLY A N   1 
ATOM   695  C  CA  . GLY A 1 96  ? 6.590  170.836 25.478  1.00 24.57 ? 96  GLY A CA  1 
ATOM   696  C  C   . GLY A 1 96  ? 7.406  169.956 26.409  1.00 24.60 ? 96  GLY A C   1 
ATOM   697  O  O   . GLY A 1 96  ? 7.126  169.869 27.611  1.00 23.64 ? 96  GLY A O   1 
ATOM   698  N  N   . ILE A 1 97  ? 8.417  169.300 25.848  1.00 24.38 ? 97  ILE A N   1 
ATOM   699  C  CA  . ILE A 1 97  ? 9.292  168.430 26.616  1.00 23.16 ? 97  ILE A CA  1 
ATOM   700  C  C   . ILE A 1 97  ? 10.633 169.127 26.804  1.00 23.05 ? 97  ILE A C   1 
ATOM   701  O  O   . ILE A 1 97  ? 11.324 169.456 25.835  1.00 22.57 ? 97  ILE A O   1 
ATOM   702  C  CB  . ILE A 1 97  ? 9.520  167.095 25.882  1.00 25.22 ? 97  ILE A CB  1 
ATOM   703  C  CG1 . ILE A 1 97  ? 8.170  166.425 25.596  1.00 25.66 ? 97  ILE A CG1 1 
ATOM   704  C  CG2 . ILE A 1 97  ? 10.409 166.184 26.718  1.00 22.76 ? 97  ILE A CG2 1 
ATOM   705  C  CD1 . ILE A 1 97  ? 8.284  165.110 24.876  1.00 24.11 ? 97  ILE A CD1 1 
ATOM   706  N  N   . PRO A 1 98  ? 11.012 169.380 28.062  1.00 22.60 ? 98  PRO A N   1 
ATOM   707  C  CA  . PRO A 1 98  ? 12.282 170.044 28.373  1.00 23.38 ? 98  PRO A CA  1 
ATOM   708  C  C   . PRO A 1 98  ? 13.503 169.323 27.787  1.00 23.39 ? 98  PRO A C   1 
ATOM   709  O  O   . PRO A 1 98  ? 13.932 168.285 28.292  1.00 24.03 ? 98  PRO A O   1 
ATOM   710  C  CB  . PRO A 1 98  ? 12.297 170.054 29.900  1.00 21.37 ? 98  PRO A CB  1 
ATOM   711  C  CG  . PRO A 1 98  ? 10.856 170.131 30.247  1.00 20.57 ? 98  PRO A CG  1 
ATOM   712  C  CD  . PRO A 1 98  ? 10.230 169.150 29.287  1.00 21.49 ? 98  PRO A CD  1 
ATOM   713  N  N   . VAL A 1 99  ? 14.047 169.867 26.710  1.00 22.48 ? 99  VAL A N   1 
ATOM   714  C  CA  . VAL A 1 99  ? 15.224 169.278 26.097  1.00 22.96 ? 99  VAL A CA  1 
ATOM   715  C  C   . VAL A 1 99  ? 16.296 170.346 26.005  1.00 22.99 ? 99  VAL A C   1 
ATOM   716  O  O   . VAL A 1 99  ? 16.043 171.446 25.525  1.00 23.68 ? 99  VAL A O   1 
ATOM   717  C  CB  . VAL A 1 99  ? 14.928 168.740 24.686  1.00 23.62 ? 99  VAL A CB  1 
ATOM   718  C  CG1 . VAL A 1 99  ? 14.361 169.844 23.804  1.00 23.23 ? 99  VAL A CG1 1 
ATOM   719  C  CG2 . VAL A 1 99  ? 16.199 168.178 24.083  1.00 23.54 ? 99  VAL A CG2 1 
ATOM   720  N  N   . TYR A 1 100 ? 17.490 170.028 26.489  1.00 23.58 ? 100 TYR A N   1 
ATOM   721  C  CA  . TYR A 1 100 ? 18.592 170.975 26.450  1.00 24.11 ? 100 TYR A CA  1 
ATOM   722  C  C   . TYR A 1 100 ? 19.740 170.358 25.667  1.00 24.41 ? 100 TYR A C   1 
ATOM   723  O  O   . TYR A 1 100 ? 20.582 169.643 26.224  1.00 25.12 ? 100 TYR A O   1 
ATOM   724  C  CB  . TYR A 1 100 ? 19.041 171.326 27.872  1.00 26.48 ? 100 TYR A CB  1 
ATOM   725  C  CG  . TYR A 1 100 ? 17.898 171.722 28.781  1.00 28.39 ? 100 TYR A CG  1 
ATOM   726  C  CD1 . TYR A 1 100 ? 17.117 170.758 29.402  1.00 28.78 ? 100 TYR A CD1 1 
ATOM   727  C  CD2 . TYR A 1 100 ? 17.578 173.059 28.991  1.00 29.44 ? 100 TYR A CD2 1 
ATOM   728  C  CE1 . TYR A 1 100 ? 16.047 171.112 30.209  1.00 30.69 ? 100 TYR A CE1 1 
ATOM   729  C  CE2 . TYR A 1 100 ? 16.508 173.424 29.797  1.00 29.37 ? 100 TYR A CE2 1 
ATOM   730  C  CZ  . TYR A 1 100 ? 15.747 172.445 30.402  1.00 29.46 ? 100 TYR A CZ  1 
ATOM   731  O  OH  . TYR A 1 100 ? 14.679 172.788 31.199  1.00 27.89 ? 100 TYR A OH  1 
ATOM   732  N  N   . ALA A 1 101 ? 19.766 170.627 24.366  1.00 23.79 ? 101 ALA A N   1 
ATOM   733  C  CA  . ALA A 1 101 ? 20.805 170.079 23.514  1.00 23.73 ? 101 ALA A CA  1 
ATOM   734  C  C   . ALA A 1 101 ? 20.854 170.755 22.159  1.00 23.48 ? 101 ALA A C   1 
ATOM   735  O  O   . ALA A 1 101 ? 19.856 171.277 21.666  1.00 21.56 ? 101 ALA A O   1 
ATOM   736  C  CB  . ALA A 1 101 ? 20.591 168.572 23.333  1.00 24.62 ? 101 ALA A CB  1 
ATOM   737  N  N   . TRP A 1 102 ? 22.037 170.732 21.560  1.00 23.93 ? 102 TRP A N   1 
ATOM   738  C  CA  . TRP A 1 102 ? 22.248 171.318 20.248  1.00 23.83 ? 102 TRP A CA  1 
ATOM   739  C  C   . TRP A 1 102 ? 23.625 170.889 19.770  1.00 24.07 ? 102 TRP A C   1 
ATOM   740  O  O   . TRP A 1 102 ? 24.530 170.663 20.577  1.00 23.49 ? 102 TRP A O   1 
ATOM   741  C  CB  . TRP A 1 102 ? 22.159 172.849 20.326  1.00 23.07 ? 102 TRP A CB  1 
ATOM   742  C  CG  . TRP A 1 102 ? 23.221 173.484 21.174  1.00 21.72 ? 102 TRP A CG  1 
ATOM   743  C  CD1 . TRP A 1 102 ? 24.493 173.825 20.791  1.00 22.51 ? 102 TRP A CD1 1 
ATOM   744  C  CD2 . TRP A 1 102 ? 23.117 173.823 22.561  1.00 19.09 ? 102 TRP A CD2 1 
ATOM   745  N  NE1 . TRP A 1 102 ? 25.182 174.352 21.859  1.00 20.40 ? 102 TRP A NE1 1 
ATOM   746  C  CE2 . TRP A 1 102 ? 24.358 174.361 22.955  1.00 19.31 ? 102 TRP A CE2 1 
ATOM   747  C  CE3 . TRP A 1 102 ? 22.096 173.722 23.507  1.00 19.03 ? 102 TRP A CE3 1 
ATOM   748  C  CZ2 . TRP A 1 102 ? 24.599 174.795 24.252  1.00 19.91 ? 102 TRP A CZ2 1 
ATOM   749  C  CZ3 . TRP A 1 102 ? 22.338 174.152 24.791  1.00 18.48 ? 102 TRP A CZ3 1 
ATOM   750  C  CH2 . TRP A 1 102 ? 23.577 174.682 25.154  1.00 19.85 ? 102 TRP A CH2 1 
ATOM   751  N  N   . LYS A 1 103 ? 23.776 170.755 18.460  1.00 24.04 ? 103 LYS A N   1 
ATOM   752  C  CA  . LYS A 1 103 ? 25.057 170.368 17.903  1.00 25.64 ? 103 LYS A CA  1 
ATOM   753  C  C   . LYS A 1 103 ? 26.099 171.447 18.210  1.00 26.69 ? 103 LYS A C   1 
ATOM   754  O  O   . LYS A 1 103 ? 25.827 172.642 18.076  1.00 26.82 ? 103 LYS A O   1 
ATOM   755  C  CB  . LYS A 1 103 ? 24.937 170.179 16.388  1.00 25.84 ? 103 LYS A CB  1 
ATOM   756  C  CG  . LYS A 1 103 ? 26.214 169.673 15.738  1.00 26.95 ? 103 LYS A CG  1 
ATOM   757  C  CD  . LYS A 1 103 ? 25.973 169.206 14.315  1.00 27.69 ? 103 LYS A CD  1 
ATOM   758  C  CE  . LYS A 1 103 ? 27.229 168.556 13.749  1.00 31.04 ? 103 LYS A CE  1 
ATOM   759  N  NZ  . LYS A 1 103 ? 27.063 168.092 12.333  1.00 33.06 ? 103 LYS A NZ  1 
ATOM   760  N  N   . GLY A 1 104 ? 27.281 171.020 18.645  1.00 28.04 ? 104 GLY A N   1 
ATOM   761  C  CA  . GLY A 1 104 ? 28.351 171.956 18.936  1.00 27.25 ? 104 GLY A CA  1 
ATOM   762  C  C   . GLY A 1 104 ? 28.365 172.571 20.320  1.00 28.56 ? 104 GLY A C   1 
ATOM   763  O  O   . GLY A 1 104 ? 28.586 173.779 20.462  1.00 29.88 ? 104 GLY A O   1 
ATOM   764  N  N   . GLU A 1 105 ? 28.132 171.759 21.346  1.00 27.72 ? 105 GLU A N   1 
ATOM   765  C  CA  . GLU A 1 105 ? 28.154 172.271 22.712  1.00 28.20 ? 105 GLU A CA  1 
ATOM   766  C  C   . GLU A 1 105 ? 29.593 172.274 23.217  1.00 28.47 ? 105 GLU A C   1 
ATOM   767  O  O   . GLU A 1 105 ? 30.455 171.584 22.674  1.00 29.88 ? 105 GLU A O   1 
ATOM   768  C  CB  . GLU A 1 105 ? 27.321 171.393 23.646  1.00 25.96 ? 105 GLU A CB  1 
ATOM   769  C  CG  . GLU A 1 105 ? 25.958 171.020 23.121  1.00 26.52 ? 105 GLU A CG  1 
ATOM   770  C  CD  . GLU A 1 105 ? 25.245 170.049 24.040  1.00 27.05 ? 105 GLU A CD  1 
ATOM   771  O  OE1 . GLU A 1 105 ? 25.941 169.393 24.853  1.00 22.48 ? 105 GLU A OE1 1 
ATOM   772  O  OE2 . GLU A 1 105 ? 23.998 169.938 23.942  1.00 27.41 ? 105 GLU A OE2 1 
ATOM   773  N  N   . THR A 1 106 ? 29.850 173.064 24.251  1.00 28.49 ? 106 THR A N   1 
ATOM   774  C  CA  . THR A 1 106 ? 31.171 173.112 24.853  1.00 27.37 ? 106 THR A CA  1 
ATOM   775  C  C   . THR A 1 106 ? 31.051 172.191 26.061  1.00 27.96 ? 106 THR A C   1 
ATOM   776  O  O   . THR A 1 106 ? 29.936 171.844 26.468  1.00 26.70 ? 106 THR A O   1 
ATOM   777  C  CB  . THR A 1 106 ? 31.540 174.531 25.349  1.00 26.66 ? 106 THR A CB  1 
ATOM   778  O  OG1 . THR A 1 106 ? 30.668 174.906 26.426  1.00 25.74 ? 106 THR A OG1 1 
ATOM   779  C  CG2 . THR A 1 106 ? 31.433 175.539 24.220  1.00 22.38 ? 106 THR A CG2 1 
ATOM   780  N  N   . ASP A 1 107 ? 32.186 171.797 26.630  1.00 27.85 ? 107 ASP A N   1 
ATOM   781  C  CA  . ASP A 1 107 ? 32.174 170.916 27.790  1.00 28.58 ? 107 ASP A CA  1 
ATOM   782  C  C   . ASP A 1 107 ? 31.313 171.485 28.904  1.00 28.75 ? 107 ASP A C   1 
ATOM   783  O  O   . ASP A 1 107 ? 30.576 170.751 29.553  1.00 28.73 ? 107 ASP A O   1 
ATOM   784  C  CB  . ASP A 1 107 ? 33.592 170.700 28.300  1.00 30.31 ? 107 ASP A CB  1 
ATOM   785  C  CG  . ASP A 1 107 ? 34.462 169.981 27.297  1.00 33.10 ? 107 ASP A CG  1 
ATOM   786  O  OD1 . ASP A 1 107 ? 35.697 170.111 27.400  1.00 34.52 ? 107 ASP A OD1 1 
ATOM   787  O  OD2 . ASP A 1 107 ? 33.913 169.279 26.414  1.00 34.26 ? 107 ASP A OD2 1 
ATOM   788  N  N   . GLU A 1 108 ? 31.399 172.793 29.125  1.00 29.55 ? 108 GLU A N   1 
ATOM   789  C  CA  . GLU A 1 108 ? 30.605 173.419 30.172  1.00 30.50 ? 108 GLU A CA  1 
ATOM   790  C  C   . GLU A 1 108 ? 29.121 173.354 29.870  1.00 28.83 ? 108 GLU A C   1 
ATOM   791  O  O   . GLU A 1 108 ? 28.323 173.026 30.747  1.00 27.74 ? 108 GLU A O   1 
ATOM   792  C  CB  . GLU A 1 108 ? 30.994 174.882 30.360  1.00 34.54 ? 108 GLU A CB  1 
ATOM   793  C  CG  . GLU A 1 108 ? 32.221 175.115 31.205  1.00 39.75 ? 108 GLU A CG  1 
ATOM   794  C  CD  . GLU A 1 108 ? 32.358 176.578 31.579  1.00 44.41 ? 108 GLU A CD  1 
ATOM   795  O  OE1 . GLU A 1 108 ? 32.416 177.422 30.653  1.00 45.44 ? 108 GLU A OE1 1 
ATOM   796  O  OE2 . GLU A 1 108 ? 32.399 176.885 32.794  1.00 46.33 ? 108 GLU A OE2 1 
ATOM   797  N  N   . GLU A 1 109 ? 28.748 173.688 28.638  1.00 27.90 ? 109 GLU A N   1 
ATOM   798  C  CA  . GLU A 1 109 ? 27.342 173.658 28.244  1.00 28.75 ? 109 GLU A CA  1 
ATOM   799  C  C   . GLU A 1 109 ? 26.829 172.235 28.353  1.00 27.89 ? 109 GLU A C   1 
ATOM   800  O  O   . GLU A 1 109 ? 25.738 171.991 28.873  1.00 27.25 ? 109 GLU A O   1 
ATOM   801  C  CB  . GLU A 1 109 ? 27.179 174.145 26.809  1.00 29.27 ? 109 GLU A CB  1 
ATOM   802  C  CG  . GLU A 1 109 ? 27.765 175.512 26.574  1.00 31.02 ? 109 GLU A CG  1 
ATOM   803  C  CD  . GLU A 1 109 ? 27.704 175.916 25.125  1.00 33.10 ? 109 GLU A CD  1 
ATOM   804  O  OE1 . GLU A 1 109 ? 28.189 175.145 24.272  1.00 32.56 ? 109 GLU A OE1 1 
ATOM   805  O  OE2 . GLU A 1 109 ? 27.174 177.009 24.841  1.00 36.09 ? 109 GLU A OE2 1 
ATOM   806  N  N   . TYR A 1 110 ? 27.634 171.300 27.855  1.00 26.89 ? 110 TYR A N   1 
ATOM   807  C  CA  . TYR A 1 110 ? 27.289 169.891 27.891  1.00 27.26 ? 110 TYR A CA  1 
ATOM   808  C  C   . TYR A 1 110 ? 26.921 169.501 29.321  1.00 28.64 ? 110 TYR A C   1 
ATOM   809  O  O   . TYR A 1 110 ? 25.864 168.916 29.577  1.00 29.59 ? 110 TYR A O   1 
ATOM   810  C  CB  . TYR A 1 110 ? 28.470 169.054 27.408  1.00 26.03 ? 110 TYR A CB  1 
ATOM   811  C  CG  . TYR A 1 110 ? 28.212 167.577 27.502  1.00 25.63 ? 110 TYR A CG  1 
ATOM   812  C  CD1 . TYR A 1 110 ? 27.322 166.953 26.638  1.00 25.34 ? 110 TYR A CD1 1 
ATOM   813  C  CD2 . TYR A 1 110 ? 28.791 166.820 28.513  1.00 26.31 ? 110 TYR A CD2 1 
ATOM   814  C  CE1 . TYR A 1 110 ? 27.005 165.613 26.782  1.00 25.79 ? 110 TYR A CE1 1 
ATOM   815  C  CE2 . TYR A 1 110 ? 28.483 165.478 28.669  1.00 27.53 ? 110 TYR A CE2 1 
ATOM   816  C  CZ  . TYR A 1 110 ? 27.586 164.881 27.802  1.00 27.82 ? 110 TYR A CZ  1 
ATOM   817  O  OH  . TYR A 1 110 ? 27.259 163.556 27.981  1.00 29.24 ? 110 TYR A OH  1 
ATOM   818  N  N   . LEU A 1 111 ? 27.801 169.837 30.254  1.00 28.90 ? 111 LEU A N   1 
ATOM   819  C  CA  . LEU A 1 111 ? 27.575 169.535 31.658  1.00 29.65 ? 111 LEU A CA  1 
ATOM   820  C  C   . LEU A 1 111 ? 26.304 170.239 32.153  1.00 29.42 ? 111 LEU A C   1 
ATOM   821  O  O   . LEU A 1 111 ? 25.483 169.647 32.859  1.00 30.07 ? 111 LEU A O   1 
ATOM   822  C  CB  . LEU A 1 111 ? 28.786 169.992 32.473  1.00 31.21 ? 111 LEU A CB  1 
ATOM   823  C  CG  . LEU A 1 111 ? 28.870 169.457 33.901  1.00 35.23 ? 111 LEU A CG  1 
ATOM   824  C  CD1 . LEU A 1 111 ? 28.993 167.937 33.852  1.00 34.89 ? 111 LEU A CD1 1 
ATOM   825  C  CD2 . LEU A 1 111 ? 30.068 170.083 34.627  1.00 35.35 ? 111 LEU A CD2 1 
ATOM   826  N  N   . TRP A 1 112 ? 26.152 171.501 31.760  1.00 28.73 ? 112 TRP A N   1 
ATOM   827  C  CA  . TRP A 1 112 ? 25.006 172.330 32.131  1.00 27.75 ? 112 TRP A CA  1 
ATOM   828  C  C   . TRP A 1 112 ? 23.694 171.728 31.639  1.00 27.79 ? 112 TRP A C   1 
ATOM   829  O  O   . TRP A 1 112 ? 22.694 171.729 32.356  1.00 26.95 ? 112 TRP A O   1 
ATOM   830  C  CB  . TRP A 1 112 ? 25.167 173.732 31.533  1.00 27.14 ? 112 TRP A CB  1 
ATOM   831  C  CG  . TRP A 1 112 ? 24.003 174.654 31.792  1.00 28.74 ? 112 TRP A CG  1 
ATOM   832  C  CD1 . TRP A 1 112 ? 23.786 175.412 32.909  1.00 29.02 ? 112 TRP A CD1 1 
ATOM   833  C  CD2 . TRP A 1 112 ? 22.889 174.907 30.915  1.00 28.67 ? 112 TRP A CD2 1 
ATOM   834  N  NE1 . TRP A 1 112 ? 22.610 176.121 32.781  1.00 29.10 ? 112 TRP A NE1 1 
ATOM   835  C  CE2 . TRP A 1 112 ? 22.042 175.829 31.568  1.00 28.59 ? 112 TRP A CE2 1 
ATOM   836  C  CE3 . TRP A 1 112 ? 22.529 174.442 29.646  1.00 26.91 ? 112 TRP A CE3 1 
ATOM   837  C  CZ2 . TRP A 1 112 ? 20.859 176.295 30.995  1.00 29.16 ? 112 TRP A CZ2 1 
ATOM   838  C  CZ3 . TRP A 1 112 ? 21.354 174.906 29.078  1.00 30.26 ? 112 TRP A CZ3 1 
ATOM   839  C  CH2 . TRP A 1 112 ? 20.532 175.825 29.753  1.00 30.19 ? 112 TRP A CH2 1 
ATOM   840  N  N   . CYS A 1 113 ? 23.698 171.226 30.406  1.00 27.88 ? 113 CYS A N   1 
ATOM   841  C  CA  . CYS A 1 113 ? 22.499 170.627 29.826  1.00 27.53 ? 113 CYS A CA  1 
ATOM   842  C  C   . CYS A 1 113 ? 21.989 169.458 30.663  1.00 26.96 ? 113 CYS A C   1 
ATOM   843  O  O   . CYS A 1 113 ? 20.790 169.330 30.896  1.00 26.40 ? 113 CYS A O   1 
ATOM   844  C  CB  . CYS A 1 113 ? 22.774 170.160 28.392  1.00 26.36 ? 113 CYS A CB  1 
ATOM   845  S  SG  . CYS A 1 113 ? 22.892 171.493 27.161  1.00 24.80 ? 113 CYS A SG  1 
ATOM   846  N  N   . ILE A 1 114 ? 22.902 168.611 31.123  1.00 27.01 ? 114 ILE A N   1 
ATOM   847  C  CA  . ILE A 1 114 ? 22.511 167.466 31.931  1.00 28.24 ? 114 ILE A CA  1 
ATOM   848  C  C   . ILE A 1 114 ? 21.923 167.917 33.266  1.00 29.19 ? 114 ILE A C   1 
ATOM   849  O  O   . ILE A 1 114 ? 21.015 167.274 33.807  1.00 29.30 ? 114 ILE A O   1 
ATOM   850  C  CB  . ILE A 1 114 ? 23.715 166.539 32.216  1.00 29.11 ? 114 ILE A CB  1 
ATOM   851  C  CG1 . ILE A 1 114 ? 24.325 166.050 30.899  1.00 28.10 ? 114 ILE A CG1 1 
ATOM   852  C  CG2 . ILE A 1 114 ? 23.267 165.345 33.065  1.00 27.71 ? 114 ILE A CG2 1 
ATOM   853  C  CD1 . ILE A 1 114 ? 25.546 165.170 31.090  1.00 27.16 ? 114 ILE A CD1 1 
ATOM   854  N  N   . GLU A 1 115 ? 22.437 169.024 33.796  1.00 28.71 ? 115 GLU A N   1 
ATOM   855  C  CA  . GLU A 1 115 ? 21.955 169.526 35.077  1.00 28.91 ? 115 GLU A CA  1 
ATOM   856  C  C   . GLU A 1 115 ? 20.556 170.102 34.978  1.00 28.13 ? 115 GLU A C   1 
ATOM   857  O  O   . GLU A 1 115 ? 19.790 170.049 35.937  1.00 28.43 ? 115 GLU A O   1 
ATOM   858  C  CB  . GLU A 1 115 ? 22.920 170.572 35.643  1.00 29.52 ? 115 GLU A CB  1 
ATOM   859  C  CG  . GLU A 1 115 ? 24.313 170.013 35.917  1.00 32.42 ? 115 GLU A CG  1 
ATOM   860  C  CD  . GLU A 1 115 ? 25.213 170.987 36.648  1.00 34.75 ? 115 GLU A CD  1 
ATOM   861  O  OE1 . GLU A 1 115 ? 25.405 172.120 36.151  1.00 36.93 ? 115 GLU A OE1 1 
ATOM   862  O  OE2 . GLU A 1 115 ? 25.738 170.615 37.719  1.00 37.50 ? 115 GLU A OE2 1 
ATOM   863  N  N   . GLN A 1 116 ? 20.216 170.638 33.812  1.00 27.99 ? 116 GLN A N   1 
ATOM   864  C  CA  . GLN A 1 116 ? 18.893 171.217 33.607  1.00 27.67 ? 116 GLN A CA  1 
ATOM   865  C  C   . GLN A 1 116 ? 17.781 170.169 33.676  1.00 26.83 ? 116 GLN A C   1 
ATOM   866  O  O   . GLN A 1 116 ? 16.638 170.488 33.996  1.00 27.32 ? 116 GLN A O   1 
ATOM   867  C  CB  . GLN A 1 116 ? 18.838 171.933 32.256  1.00 26.56 ? 116 GLN A CB  1 
ATOM   868  C  CG  . GLN A 1 116 ? 19.881 173.020 32.123  1.00 27.62 ? 116 GLN A CG  1 
ATOM   869  C  CD  . GLN A 1 116 ? 19.994 173.863 33.383  1.00 27.49 ? 116 GLN A CD  1 
ATOM   870  O  OE1 . GLN A 1 116 ? 19.023 174.480 33.820  1.00 28.31 ? 116 GLN A OE1 1 
ATOM   871  N  NE2 . GLN A 1 116 ? 21.184 173.887 33.974  1.00 25.97 ? 116 GLN A NE2 1 
ATOM   872  N  N   . THR A 1 117 ? 18.127 168.918 33.395  1.00 25.50 ? 117 THR A N   1 
ATOM   873  C  CA  . THR A 1 117 ? 17.160 167.827 33.393  1.00 24.22 ? 117 THR A CA  1 
ATOM   874  C  C   . THR A 1 117 ? 16.913 167.185 34.762  1.00 24.32 ? 117 THR A C   1 
ATOM   875  O  O   . THR A 1 117 ? 15.990 166.385 34.916  1.00 24.46 ? 117 THR A O   1 
ATOM   876  C  CB  . THR A 1 117 ? 17.606 166.714 32.415  1.00 23.56 ? 117 THR A CB  1 
ATOM   877  O  OG1 . THR A 1 117 ? 18.758 166.042 32.944  1.00 23.97 ? 117 THR A OG1 1 
ATOM   878  C  CG2 . THR A 1 117 ? 17.975 167.306 31.058  1.00 22.94 ? 117 THR A CG2 1 
ATOM   879  N  N   . LEU A 1 118 ? 17.726 167.536 35.754  1.00 24.35 ? 118 LEU A N   1 
ATOM   880  C  CA  . LEU A 1 118 ? 17.598 166.949 37.090  1.00 25.42 ? 118 LEU A CA  1 
ATOM   881  C  C   . LEU A 1 118 ? 16.314 167.255 37.873  1.00 25.30 ? 118 LEU A C   1 
ATOM   882  O  O   . LEU A 1 118 ? 15.753 166.357 38.502  1.00 26.04 ? 118 LEU A O   1 
ATOM   883  C  CB  . LEU A 1 118 ? 18.823 167.318 37.936  1.00 25.82 ? 118 LEU A CB  1 
ATOM   884  C  CG  . LEU A 1 118 ? 20.169 166.917 37.328  1.00 26.11 ? 118 LEU A CG  1 
ATOM   885  C  CD1 . LEU A 1 118 ? 21.292 167.223 38.301  1.00 26.64 ? 118 LEU A CD1 1 
ATOM   886  C  CD2 . LEU A 1 118 ? 20.149 165.434 36.993  1.00 27.78 ? 118 LEU A CD2 1 
ATOM   887  N  N   . TYR A 1 119 ? 15.851 168.503 37.854  1.00 25.57 ? 119 TYR A N   1 
ATOM   888  C  CA  . TYR A 1 119 ? 14.624 168.853 38.576  1.00 26.54 ? 119 TYR A CA  1 
ATOM   889  C  C   . TYR A 1 119 ? 13.442 169.095 37.645  1.00 26.03 ? 119 TYR A C   1 
ATOM   890  O  O   . TYR A 1 119 ? 13.559 169.814 36.652  1.00 24.41 ? 119 TYR A O   1 
ATOM   891  C  CB  . TYR A 1 119 ? 14.823 170.100 39.447  1.00 27.64 ? 119 TYR A CB  1 
ATOM   892  C  CG  . TYR A 1 119 ? 15.831 169.939 40.556  1.00 28.96 ? 119 TYR A CG  1 
ATOM   893  C  CD1 . TYR A 1 119 ? 17.183 170.183 40.329  1.00 29.37 ? 119 TYR A CD1 1 
ATOM   894  C  CD2 . TYR A 1 119 ? 15.432 169.545 41.834  1.00 29.85 ? 119 TYR A CD2 1 
ATOM   895  C  CE1 . TYR A 1 119 ? 18.124 170.043 41.346  1.00 31.01 ? 119 TYR A CE1 1 
ATOM   896  C  CE2 . TYR A 1 119 ? 16.364 169.401 42.865  1.00 31.49 ? 119 TYR A CE2 1 
ATOM   897  C  CZ  . TYR A 1 119 ? 17.712 169.653 42.614  1.00 32.91 ? 119 TYR A CZ  1 
ATOM   898  O  OH  . TYR A 1 119 ? 18.649 169.532 43.626  1.00 32.86 ? 119 TYR A OH  1 
ATOM   899  N  N   . PHE A 1 120 ? 12.306 168.490 37.980  1.00 26.51 ? 120 PHE A N   1 
ATOM   900  C  CA  . PHE A 1 120 ? 11.082 168.628 37.191  1.00 27.63 ? 120 PHE A CA  1 
ATOM   901  C  C   . PHE A 1 120 ? 10.107 169.567 37.884  1.00 29.02 ? 120 PHE A C   1 
ATOM   902  O  O   . PHE A 1 120 ? 10.302 169.958 39.039  1.00 29.17 ? 120 PHE A O   1 
ATOM   903  C  CB  . PHE A 1 120 ? 10.393 167.274 37.005  1.00 26.92 ? 120 PHE A CB  1 
ATOM   904  C  CG  . PHE A 1 120 ? 11.187 166.285 36.207  1.00 27.61 ? 120 PHE A CG  1 
ATOM   905  C  CD1 . PHE A 1 120 ? 12.452 165.887 36.624  1.00 29.06 ? 120 PHE A CD1 1 
ATOM   906  C  CD2 . PHE A 1 120 ? 10.658 165.727 35.050  1.00 26.78 ? 120 PHE A CD2 1 
ATOM   907  C  CE1 . PHE A 1 120 ? 13.179 164.945 35.902  1.00 29.62 ? 120 PHE A CE1 1 
ATOM   908  C  CE2 . PHE A 1 120 ? 11.376 164.787 34.324  1.00 28.09 ? 120 PHE A CE2 1 
ATOM   909  C  CZ  . PHE A 1 120 ? 12.639 164.395 34.750  1.00 27.73 ? 120 PHE A CZ  1 
ATOM   910  N  N   . LYS A 1 121 ? 9.036  169.901 37.178  1.00 30.03 ? 121 LYS A N   1 
ATOM   911  C  CA  . LYS A 1 121 ? 8.020  170.798 37.700  1.00 31.29 ? 121 LYS A CA  1 
ATOM   912  C  C   . LYS A 1 121 ? 7.644  170.545 39.164  1.00 32.11 ? 121 LYS A C   1 
ATOM   913  O  O   . LYS A 1 121 ? 7.437  171.487 39.922  1.00 33.15 ? 121 LYS A O   1 
ATOM   914  C  CB  . LYS A 1 121 ? 6.763  170.710 36.832  1.00 31.93 ? 121 LYS A CB  1 
ATOM   915  C  CG  . LYS A 1 121 ? 5.639  171.635 37.272  1.00 34.04 ? 121 LYS A CG  1 
ATOM   916  C  CD  . LYS A 1 121 ? 4.375  171.388 36.462  1.00 34.48 ? 121 LYS A CD  1 
ATOM   917  C  CE  . LYS A 1 121 ? 3.784  170.017 36.744  1.00 34.90 ? 121 LYS A CE  1 
ATOM   918  N  NZ  . LYS A 1 121 ? 2.367  170.131 37.211  1.00 35.98 ? 121 LYS A NZ  1 
ATOM   919  N  N   . ASP A 1 122 ? 7.569  169.282 39.569  1.00 32.08 ? 122 ASP A N   1 
ATOM   920  C  CA  . ASP A 1 122 ? 7.166  168.970 40.936  1.00 31.54 ? 122 ASP A CA  1 
ATOM   921  C  C   . ASP A 1 122 ? 8.203  168.221 41.766  1.00 30.82 ? 122 ASP A C   1 
ATOM   922  O  O   . ASP A 1 122 ? 7.884  167.654 42.815  1.00 30.19 ? 122 ASP A O   1 
ATOM   923  C  CB  . ASP A 1 122 ? 5.865  168.172 40.898  1.00 33.90 ? 122 ASP A CB  1 
ATOM   924  C  CG  . ASP A 1 122 ? 4.857  168.761 39.930  1.00 37.64 ? 122 ASP A CG  1 
ATOM   925  O  OD1 . ASP A 1 122 ? 4.405  169.903 40.163  1.00 39.49 ? 122 ASP A OD1 1 
ATOM   926  O  OD2 . ASP A 1 122 ? 4.523  168.087 38.929  1.00 39.65 ? 122 ASP A OD2 1 
ATOM   927  N  N   . GLY A 1 123 ? 9.445  168.214 41.305  1.00 29.48 ? 123 GLY A N   1 
ATOM   928  C  CA  . GLY A 1 123 ? 10.472 167.522 42.056  1.00 28.06 ? 123 GLY A CA  1 
ATOM   929  C  C   . GLY A 1 123 ? 11.602 167.032 41.184  1.00 27.16 ? 123 GLY A C   1 
ATOM   930  O  O   . GLY A 1 123 ? 11.579 167.208 39.968  1.00 26.89 ? 123 GLY A O   1 
ATOM   931  N  N   . PRO A 1 124 ? 12.615 166.410 41.792  1.00 25.61 ? 124 PRO A N   1 
ATOM   932  C  CA  . PRO A 1 124 ? 13.786 165.874 41.098  1.00 25.72 ? 124 PRO A CA  1 
ATOM   933  C  C   . PRO A 1 124 ? 13.443 164.591 40.341  1.00 25.95 ? 124 PRO A C   1 
ATOM   934  O  O   . PRO A 1 124 ? 12.388 163.985 40.567  1.00 24.89 ? 124 PRO A O   1 
ATOM   935  C  CB  . PRO A 1 124 ? 14.762 165.620 42.239  1.00 26.58 ? 124 PRO A CB  1 
ATOM   936  C  CG  . PRO A 1 124 ? 13.840 165.161 43.341  1.00 25.97 ? 124 PRO A CG  1 
ATOM   937  C  CD  . PRO A 1 124 ? 12.688 166.145 43.240  1.00 25.73 ? 124 PRO A CD  1 
ATOM   938  N  N   . LEU A 1 125 ? 14.325 164.182 39.435  1.00 25.27 ? 125 LEU A N   1 
ATOM   939  C  CA  . LEU A 1 125 ? 14.093 162.958 38.690  1.00 25.45 ? 125 LEU A CA  1 
ATOM   940  C  C   . LEU A 1 125 ? 13.915 161.794 39.662  1.00 25.62 ? 125 LEU A C   1 
ATOM   941  O  O   . LEU A 1 125 ? 14.282 161.888 40.835  1.00 25.55 ? 125 LEU A O   1 
ATOM   942  C  CB  . LEU A 1 125 ? 15.270 162.656 37.756  1.00 25.01 ? 125 LEU A CB  1 
ATOM   943  C  CG  . LEU A 1 125 ? 16.730 162.777 38.229  1.00 26.55 ? 125 LEU A CG  1 
ATOM   944  C  CD1 . LEU A 1 125 ? 16.855 162.580 39.733  1.00 26.17 ? 125 LEU A CD1 1 
ATOM   945  C  CD2 . LEU A 1 125 ? 17.580 161.764 37.463  1.00 22.98 ? 125 LEU A CD2 1 
ATOM   946  N  N   . ASN A 1 126 ? 13.331 160.706 39.175  1.00 25.66 ? 126 ASN A N   1 
ATOM   947  C  CA  . ASN A 1 126 ? 13.152 159.518 39.997  1.00 26.04 ? 126 ASN A CA  1 
ATOM   948  C  C   . ASN A 1 126 ? 13.515 158.293 39.158  1.00 24.00 ? 126 ASN A C   1 
ATOM   949  O  O   . ASN A 1 126 ? 13.327 157.155 39.578  1.00 24.33 ? 126 ASN A O   1 
ATOM   950  C  CB  . ASN A 1 126 ? 11.715 159.410 40.510  1.00 26.34 ? 126 ASN A CB  1 
ATOM   951  C  CG  . ASN A 1 126 ? 10.701 159.376 39.393  1.00 29.64 ? 126 ASN A CG  1 
ATOM   952  O  OD1 . ASN A 1 126 ? 10.971 158.853 38.303  1.00 30.30 ? 126 ASN A OD1 1 
ATOM   953  N  ND2 . ASN A 1 126 ? 9.517  159.920 39.657  1.00 27.78 ? 126 ASN A ND2 1 
ATOM   954  N  N   . MET A 1 127 ? 14.046 158.551 37.970  1.00 22.36 ? 127 MET A N   1 
ATOM   955  C  CA  . MET A 1 127 ? 14.463 157.501 37.048  1.00 22.33 ? 127 MET A CA  1 
ATOM   956  C  C   . MET A 1 127 ? 15.596 158.005 36.169  1.00 22.84 ? 127 MET A C   1 
ATOM   957  O  O   . MET A 1 127 ? 15.590 159.160 35.741  1.00 24.12 ? 127 MET A O   1 
ATOM   958  C  CB  . MET A 1 127 ? 13.302 157.072 36.150  1.00 22.19 ? 127 MET A CB  1 
ATOM   959  C  CG  . MET A 1 127 ? 12.286 156.155 36.814  1.00 23.00 ? 127 MET A CG  1 
ATOM   960  S  SD  . MET A 1 127 ? 13.021 154.602 37.371  1.00 25.47 ? 127 MET A SD  1 
ATOM   961  C  CE  . MET A 1 127 ? 13.176 153.714 35.804  1.00 22.98 ? 127 MET A CE  1 
ATOM   962  N  N   . ILE A 1 128 ? 16.568 157.138 35.901  1.00 23.26 ? 128 ILE A N   1 
ATOM   963  C  CA  . ILE A 1 128 ? 17.691 157.504 35.049  1.00 23.22 ? 128 ILE A CA  1 
ATOM   964  C  C   . ILE A 1 128 ? 17.799 156.623 33.807  1.00 24.09 ? 128 ILE A C   1 
ATOM   965  O  O   . ILE A 1 128 ? 17.926 155.405 33.909  1.00 24.87 ? 128 ILE A O   1 
ATOM   966  C  CB  . ILE A 1 128 ? 19.028 157.422 35.803  1.00 22.96 ? 128 ILE A CB  1 
ATOM   967  C  CG1 . ILE A 1 128 ? 19.122 158.557 36.824  1.00 21.60 ? 128 ILE A CG1 1 
ATOM   968  C  CG2 . ILE A 1 128 ? 20.185 157.493 34.812  1.00 20.97 ? 128 ILE A CG2 1 
ATOM   969  C  CD1 . ILE A 1 128 ? 20.356 158.489 37.696  1.00 20.18 ? 128 ILE A CD1 1 
ATOM   970  N  N   . LEU A 1 129 ? 17.721 157.253 32.636  1.00 23.68 ? 129 LEU A N   1 
ATOM   971  C  CA  . LEU A 1 129 ? 17.848 156.559 31.362  1.00 22.88 ? 129 LEU A CA  1 
ATOM   972  C  C   . LEU A 1 129 ? 19.145 157.127 30.814  1.00 24.15 ? 129 LEU A C   1 
ATOM   973  O  O   . LEU A 1 129 ? 19.177 158.240 30.286  1.00 23.29 ? 129 LEU A O   1 
ATOM   974  C  CB  . LEU A 1 129 ? 16.674 156.891 30.440  1.00 24.30 ? 129 LEU A CB  1 
ATOM   975  C  CG  . LEU A 1 129 ? 16.563 156.147 29.100  1.00 24.78 ? 129 LEU A CG  1 
ATOM   976  C  CD1 . LEU A 1 129 ? 15.142 156.278 28.585  1.00 26.61 ? 129 LEU A CD1 1 
ATOM   977  C  CD2 . LEU A 1 129 ? 17.553 156.690 28.082  1.00 21.43 ? 129 LEU A CD2 1 
ATOM   978  N  N   . ASP A 1 130 ? 20.218 156.353 30.961  1.00 25.14 ? 130 ASP A N   1 
ATOM   979  C  CA  . ASP A 1 130 ? 21.544 156.784 30.551  1.00 23.44 ? 130 ASP A CA  1 
ATOM   980  C  C   . ASP A 1 130 ? 22.134 156.041 29.365  1.00 24.85 ? 130 ASP A C   1 
ATOM   981  O  O   . ASP A 1 130 ? 21.725 154.933 29.027  1.00 25.96 ? 130 ASP A O   1 
ATOM   982  C  CB  . ASP A 1 130 ? 22.499 156.648 31.737  1.00 22.50 ? 130 ASP A CB  1 
ATOM   983  C  CG  . ASP A 1 130 ? 23.500 157.783 31.823  1.00 20.25 ? 130 ASP A CG  1 
ATOM   984  O  OD1 . ASP A 1 130 ? 23.611 158.567 30.855  1.00 17.64 ? 130 ASP A OD1 1 
ATOM   985  O  OD2 . ASP A 1 130 ? 24.178 157.877 32.869  1.00 19.25 ? 130 ASP A OD2 1 
ATOM   986  N  N   . ASP A 1 131 ? 23.113 156.689 28.746  1.00 25.57 ? 131 ASP A N   1 
ATOM   987  C  CA  . ASP A 1 131 ? 23.848 156.152 27.614  1.00 25.24 ? 131 ASP A CA  1 
ATOM   988  C  C   . ASP A 1 131 ? 25.251 156.741 27.748  1.00 25.19 ? 131 ASP A C   1 
ATOM   989  O  O   . ASP A 1 131 ? 25.515 157.859 27.310  1.00 25.88 ? 131 ASP A O   1 
ATOM   990  C  CB  . ASP A 1 131 ? 23.215 156.590 26.292  1.00 24.22 ? 131 ASP A CB  1 
ATOM   991  C  CG  . ASP A 1 131 ? 24.022 156.141 25.084  1.00 25.82 ? 131 ASP A CG  1 
ATOM   992  O  OD1 . ASP A 1 131 ? 25.165 156.616 24.914  1.00 24.94 ? 131 ASP A OD1 1 
ATOM   993  O  OD2 . ASP A 1 131 ? 23.517 155.305 24.305  1.00 28.06 ? 131 ASP A OD2 1 
ATOM   994  N  N   . GLY A 1 132 ? 26.142 155.996 28.387  1.00 24.79 ? 132 GLY A N   1 
ATOM   995  C  CA  . GLY A 1 132 ? 27.493 156.485 28.572  1.00 24.40 ? 132 GLY A CA  1 
ATOM   996  C  C   . GLY A 1 132 ? 27.829 156.661 30.038  1.00 24.99 ? 132 GLY A C   1 
ATOM   997  O  O   . GLY A 1 132 ? 29.000 156.731 30.402  1.00 27.05 ? 132 GLY A O   1 
ATOM   998  N  N   . GLY A 1 133 ? 26.806 156.740 30.882  1.00 25.08 ? 133 GLY A N   1 
ATOM   999  C  CA  . GLY A 1 133 ? 27.036 156.896 32.305  1.00 25.76 ? 133 GLY A CA  1 
ATOM   1000 C  C   . GLY A 1 133 ? 27.203 158.309 32.849  1.00 26.63 ? 133 GLY A C   1 
ATOM   1001 O  O   . GLY A 1 133 ? 27.224 158.492 34.070  1.00 26.08 ? 133 GLY A O   1 
ATOM   1002 N  N   . ASP A 1 134 ? 27.311 159.309 31.975  1.00 26.93 ? 134 ASP A N   1 
ATOM   1003 C  CA  . ASP A 1 134 ? 27.485 160.688 32.438  1.00 27.69 ? 134 ASP A CA  1 
ATOM   1004 C  C   . ASP A 1 134 ? 26.412 161.127 33.425  1.00 27.68 ? 134 ASP A C   1 
ATOM   1005 O  O   . ASP A 1 134 ? 26.721 161.626 34.511  1.00 29.30 ? 134 ASP A O   1 
ATOM   1006 C  CB  . ASP A 1 134 ? 27.510 161.669 31.261  1.00 27.30 ? 134 ASP A CB  1 
ATOM   1007 C  CG  . ASP A 1 134 ? 28.780 161.565 30.446  1.00 27.82 ? 134 ASP A CG  1 
ATOM   1008 O  OD1 . ASP A 1 134 ? 29.758 160.971 30.947  1.00 26.90 ? 134 ASP A OD1 1 
ATOM   1009 O  OD2 . ASP A 1 134 ? 28.805 162.088 29.311  1.00 28.06 ? 134 ASP A OD2 1 
ATOM   1010 N  N   . LEU A 1 135 ? 25.152 160.949 33.045  1.00 27.04 ? 135 LEU A N   1 
ATOM   1011 C  CA  . LEU A 1 135 ? 24.049 161.336 33.905  1.00 27.04 ? 135 LEU A CA  1 
ATOM   1012 C  C   . LEU A 1 135 ? 24.162 160.604 35.233  1.00 27.90 ? 135 LEU A C   1 
ATOM   1013 O  O   . LEU A 1 135 ? 23.932 161.183 36.298  1.00 28.98 ? 135 LEU A O   1 
ATOM   1014 C  CB  . LEU A 1 135 ? 22.711 161.008 33.233  1.00 27.37 ? 135 LEU A CB  1 
ATOM   1015 C  CG  . LEU A 1 135 ? 21.433 161.224 34.056  1.00 27.27 ? 135 LEU A CG  1 
ATOM   1016 C  CD1 . LEU A 1 135 ? 21.407 162.638 34.634  1.00 26.00 ? 135 LEU A CD1 1 
ATOM   1017 C  CD2 . LEU A 1 135 ? 20.214 160.983 33.171  1.00 27.07 ? 135 LEU A CD2 1 
ATOM   1018 N  N   . THR A 1 136 ? 24.539 159.332 35.167  1.00 27.27 ? 136 THR A N   1 
ATOM   1019 C  CA  . THR A 1 136 ? 24.677 158.527 36.368  1.00 27.58 ? 136 THR A CA  1 
ATOM   1020 C  C   . THR A 1 136 ? 25.834 159.007 37.258  1.00 28.67 ? 136 THR A C   1 
ATOM   1021 O  O   . THR A 1 136 ? 25.711 159.018 38.486  1.00 28.35 ? 136 THR A O   1 
ATOM   1022 C  CB  . THR A 1 136 ? 24.869 157.038 36.002  1.00 26.97 ? 136 THR A CB  1 
ATOM   1023 O  OG1 . THR A 1 136 ? 23.834 156.644 35.094  1.00 24.31 ? 136 THR A OG1 1 
ATOM   1024 C  CG2 . THR A 1 136 ? 24.795 156.156 37.253  1.00 24.83 ? 136 THR A CG2 1 
ATOM   1025 N  N   . ASN A 1 137 ? 26.950 159.407 36.645  1.00 29.16 ? 137 ASN A N   1 
ATOM   1026 C  CA  . ASN A 1 137 ? 28.099 159.890 37.413  1.00 30.22 ? 137 ASN A CA  1 
ATOM   1027 C  C   . ASN A 1 137 ? 27.845 161.278 37.991  1.00 30.37 ? 137 ASN A C   1 
ATOM   1028 O  O   . ASN A 1 137 ? 28.243 161.562 39.122  1.00 30.35 ? 137 ASN A O   1 
ATOM   1029 C  CB  . ASN A 1 137 ? 29.374 159.917 36.558  1.00 30.55 ? 137 ASN A CB  1 
ATOM   1030 C  CG  . ASN A 1 137 ? 29.951 158.529 36.322  1.00 32.01 ? 137 ASN A CG  1 
ATOM   1031 O  OD1 . ASN A 1 137 ? 30.010 157.700 37.235  1.00 31.96 ? 137 ASN A OD1 1 
ATOM   1032 N  ND2 . ASN A 1 137 ? 30.391 158.274 35.096  1.00 31.37 ? 137 ASN A ND2 1 
ATOM   1033 N  N   . LEU A 1 138 ? 27.192 162.139 37.213  1.00 29.26 ? 138 LEU A N   1 
ATOM   1034 C  CA  . LEU A 1 138 ? 26.877 163.488 37.668  1.00 29.17 ? 138 LEU A CA  1 
ATOM   1035 C  C   . LEU A 1 138 ? 26.065 163.444 38.957  1.00 29.37 ? 138 LEU A C   1 
ATOM   1036 O  O   . LEU A 1 138 ? 26.334 164.186 39.902  1.00 29.85 ? 138 LEU A O   1 
ATOM   1037 C  CB  . LEU A 1 138 ? 26.067 164.232 36.611  1.00 31.43 ? 138 LEU A CB  1 
ATOM   1038 C  CG  . LEU A 1 138 ? 25.586 165.608 37.082  1.00 31.84 ? 138 LEU A CG  1 
ATOM   1039 C  CD1 . LEU A 1 138 ? 26.787 166.527 37.236  1.00 31.75 ? 138 LEU A CD1 1 
ATOM   1040 C  CD2 . LEU A 1 138 ? 24.591 166.189 36.091  1.00 32.38 ? 138 LEU A CD2 1 
ATOM   1041 N  N   . ILE A 1 139 ? 25.062 162.574 38.987  1.00 28.92 ? 139 ILE A N   1 
ATOM   1042 C  CA  . ILE A 1 139 ? 24.211 162.440 40.164  1.00 28.78 ? 139 ILE A CA  1 
ATOM   1043 C  C   . ILE A 1 139 ? 24.977 161.869 41.349  1.00 28.15 ? 139 ILE A C   1 
ATOM   1044 O  O   . ILE A 1 139 ? 24.919 162.412 42.453  1.00 27.82 ? 139 ILE A O   1 
ATOM   1045 C  CB  . ILE A 1 139 ? 23.003 161.509 39.899  1.00 28.94 ? 139 ILE A CB  1 
ATOM   1046 C  CG1 . ILE A 1 139 ? 22.149 162.057 38.757  1.00 27.82 ? 139 ILE A CG1 1 
ATOM   1047 C  CG2 . ILE A 1 139 ? 22.163 161.384 41.159  1.00 28.46 ? 139 ILE A CG2 1 
ATOM   1048 C  CD1 . ILE A 1 139 ? 21.546 163.394 39.054  1.00 29.58 ? 139 ILE A CD1 1 
ATOM   1049 N  N   . HIS A 1 140 ? 25.688 160.768 41.119  1.00 27.19 ? 140 HIS A N   1 
ATOM   1050 C  CA  . HIS A 1 140 ? 26.440 160.120 42.190  1.00 28.01 ? 140 HIS A CA  1 
ATOM   1051 C  C   . HIS A 1 140 ? 27.585 160.970 42.719  1.00 28.48 ? 140 HIS A C   1 
ATOM   1052 O  O   . HIS A 1 140 ? 27.897 160.931 43.909  1.00 28.95 ? 140 HIS A O   1 
ATOM   1053 C  CB  . HIS A 1 140 ? 26.990 158.761 41.734  1.00 26.26 ? 140 HIS A CB  1 
ATOM   1054 C  CG  . HIS A 1 140 ? 25.998 157.643 41.821  1.00 26.10 ? 140 HIS A CG  1 
ATOM   1055 N  ND1 . HIS A 1 140 ? 25.205 157.263 40.759  1.00 26.27 ? 140 HIS A ND1 1 
ATOM   1056 C  CD2 . HIS A 1 140 ? 25.668 156.821 42.847  1.00 26.34 ? 140 HIS A CD2 1 
ATOM   1057 C  CE1 . HIS A 1 140 ? 24.432 156.256 41.125  1.00 25.64 ? 140 HIS A CE1 1 
ATOM   1058 N  NE2 . HIS A 1 140 ? 24.693 155.967 42.388  1.00 25.02 ? 140 HIS A NE2 1 
ATOM   1059 N  N   . THR A 1 141 ? 28.202 161.744 41.835  1.00 28.43 ? 141 THR A N   1 
ATOM   1060 C  CA  . THR A 1 141 ? 29.320 162.587 42.223  1.00 28.23 ? 141 THR A CA  1 
ATOM   1061 C  C   . THR A 1 141 ? 28.922 163.974 42.712  1.00 28.90 ? 141 THR A C   1 
ATOM   1062 O  O   . THR A 1 141 ? 29.405 164.439 43.750  1.00 28.46 ? 141 THR A O   1 
ATOM   1063 C  CB  . THR A 1 141 ? 30.302 162.772 41.055  1.00 27.86 ? 141 THR A CB  1 
ATOM   1064 O  OG1 . THR A 1 141 ? 30.760 161.491 40.614  1.00 29.84 ? 141 THR A OG1 1 
ATOM   1065 C  CG2 . THR A 1 141 ? 31.500 163.600 41.496  1.00 27.98 ? 141 THR A CG2 1 
ATOM   1066 N  N   . LYS A 1 142 ? 28.038 164.636 41.977  1.00 28.20 ? 142 LYS A N   1 
ATOM   1067 C  CA  . LYS A 1 142 ? 27.651 165.989 42.348  1.00 29.32 ? 142 LYS A CA  1 
ATOM   1068 C  C   . LYS A 1 142 ? 26.278 166.155 43.002  1.00 29.35 ? 142 LYS A C   1 
ATOM   1069 O  O   . LYS A 1 142 ? 26.040 167.141 43.687  1.00 28.77 ? 142 LYS A O   1 
ATOM   1070 C  CB  . LYS A 1 142 ? 27.760 166.884 41.111  1.00 29.38 ? 142 LYS A CB  1 
ATOM   1071 C  CG  . LYS A 1 142 ? 27.672 168.370 41.379  1.00 30.98 ? 142 LYS A CG  1 
ATOM   1072 C  CD  . LYS A 1 142 ? 27.787 169.144 40.068  1.00 31.48 ? 142 LYS A CD  1 
ATOM   1073 C  CE  . LYS A 1 142 ? 27.790 170.648 40.291  1.00 30.65 ? 142 LYS A CE  1 
ATOM   1074 N  NZ  . LYS A 1 142 ? 27.902 171.388 38.999  1.00 29.30 ? 142 LYS A NZ  1 
ATOM   1075 N  N   . TYR A 1 143 ? 25.380 165.197 42.808  1.00 29.76 ? 143 TYR A N   1 
ATOM   1076 C  CA  . TYR A 1 143 ? 24.047 165.308 43.392  1.00 29.80 ? 143 TYR A CA  1 
ATOM   1077 C  C   . TYR A 1 143 ? 23.593 164.067 44.146  1.00 30.04 ? 143 TYR A C   1 
ATOM   1078 O  O   . TYR A 1 143 ? 22.464 163.607 43.977  1.00 31.36 ? 143 TYR A O   1 
ATOM   1079 C  CB  . TYR A 1 143 ? 23.030 165.636 42.300  1.00 29.81 ? 143 TYR A CB  1 
ATOM   1080 C  CG  . TYR A 1 143 ? 23.288 166.957 41.620  1.00 31.30 ? 143 TYR A CG  1 
ATOM   1081 C  CD1 . TYR A 1 143 ? 22.843 168.151 42.179  1.00 31.65 ? 143 TYR A CD1 1 
ATOM   1082 C  CD2 . TYR A 1 143 ? 24.000 167.016 40.428  1.00 32.48 ? 143 TYR A CD2 1 
ATOM   1083 C  CE1 . TYR A 1 143 ? 23.099 169.369 41.567  1.00 31.14 ? 143 TYR A CE1 1 
ATOM   1084 C  CE2 . TYR A 1 143 ? 24.263 168.224 39.810  1.00 33.35 ? 143 TYR A CE2 1 
ATOM   1085 C  CZ  . TYR A 1 143 ? 23.810 169.397 40.382  1.00 32.59 ? 143 TYR A CZ  1 
ATOM   1086 O  OH  . TYR A 1 143 ? 24.074 170.595 39.762  1.00 31.96 ? 143 TYR A OH  1 
ATOM   1087 N  N   . PRO A 1 144 ? 24.464 163.513 44.996  1.00 29.23 ? 144 PRO A N   1 
ATOM   1088 C  CA  . PRO A 1 144 ? 24.088 162.318 45.754  1.00 29.04 ? 144 PRO A CA  1 
ATOM   1089 C  C   . PRO A 1 144 ? 22.808 162.514 46.573  1.00 29.03 ? 144 PRO A C   1 
ATOM   1090 O  O   . PRO A 1 144 ? 22.112 161.549 46.897  1.00 29.06 ? 144 PRO A O   1 
ATOM   1091 C  CB  . PRO A 1 144 ? 25.320 162.061 46.626  1.00 28.42 ? 144 PRO A CB  1 
ATOM   1092 C  CG  . PRO A 1 144 ? 25.899 163.429 46.819  1.00 28.86 ? 144 PRO A CG  1 
ATOM   1093 C  CD  . PRO A 1 144 ? 25.776 164.023 45.430  1.00 30.28 ? 144 PRO A CD  1 
ATOM   1094 N  N   . GLN A 1 145 ? 22.488 163.762 46.897  1.00 28.54 ? 145 GLN A N   1 
ATOM   1095 C  CA  . GLN A 1 145 ? 21.289 164.043 47.675  1.00 28.61 ? 145 GLN A CA  1 
ATOM   1096 C  C   . GLN A 1 145 ? 20.047 163.533 46.953  1.00 29.53 ? 145 GLN A C   1 
ATOM   1097 O  O   . GLN A 1 145 ? 18.995 163.334 47.563  1.00 31.02 ? 145 GLN A O   1 
ATOM   1098 C  CB  . GLN A 1 145 ? 21.143 165.549 47.926  1.00 27.51 ? 145 GLN A CB  1 
ATOM   1099 C  CG  . GLN A 1 145 ? 22.346 166.189 48.590  1.00 26.10 ? 145 GLN A CG  1 
ATOM   1100 C  CD  . GLN A 1 145 ? 23.334 166.736 47.586  1.00 25.96 ? 145 GLN A CD  1 
ATOM   1101 O  OE1 . GLN A 1 145 ? 23.357 166.314 46.430  1.00 27.91 ? 145 GLN A OE1 1 
ATOM   1102 N  NE2 . GLN A 1 145 ? 24.166 167.673 48.022  1.00 24.90 ? 145 GLN A NE2 1 
ATOM   1103 N  N   . LEU A 1 146 ? 20.174 163.307 45.653  1.00 28.72 ? 146 LEU A N   1 
ATOM   1104 C  CA  . LEU A 1 146 ? 19.042 162.852 44.867  1.00 28.34 ? 146 LEU A CA  1 
ATOM   1105 C  C   . LEU A 1 146 ? 18.951 161.342 44.679  1.00 28.92 ? 146 LEU A C   1 
ATOM   1106 O  O   . LEU A 1 146 ? 17.909 160.830 44.272  1.00 29.59 ? 146 LEU A O   1 
ATOM   1107 C  CB  . LEU A 1 146 ? 19.068 163.543 43.503  1.00 29.86 ? 146 LEU A CB  1 
ATOM   1108 C  CG  . LEU A 1 146 ? 19.107 165.071 43.591  1.00 30.28 ? 146 LEU A CG  1 
ATOM   1109 C  CD1 . LEU A 1 146 ? 19.032 165.669 42.203  1.00 29.57 ? 146 LEU A CD1 1 
ATOM   1110 C  CD2 . LEU A 1 146 ? 17.946 165.561 44.448  1.00 29.03 ? 146 LEU A CD2 1 
ATOM   1111 N  N   . LEU A 1 147 ? 20.029 160.626 44.977  1.00 29.24 ? 147 LEU A N   1 
ATOM   1112 C  CA  . LEU A 1 147 ? 20.026 159.173 44.816  1.00 29.58 ? 147 LEU A CA  1 
ATOM   1113 C  C   . LEU A 1 147 ? 18.852 158.462 45.504  1.00 30.10 ? 147 LEU A C   1 
ATOM   1114 O  O   . LEU A 1 147 ? 18.107 157.715 44.862  1.00 31.80 ? 147 LEU A O   1 
ATOM   1115 C  CB  . LEU A 1 147 ? 21.348 158.577 45.311  1.00 28.23 ? 147 LEU A CB  1 
ATOM   1116 C  CG  . LEU A 1 147 ? 22.612 158.985 44.551  1.00 29.05 ? 147 LEU A CG  1 
ATOM   1117 C  CD1 . LEU A 1 147 ? 23.817 158.265 45.135  1.00 27.65 ? 147 LEU A CD1 1 
ATOM   1118 C  CD2 . LEU A 1 147 ? 22.458 158.642 43.078  1.00 29.58 ? 147 LEU A CD2 1 
ATOM   1119 N  N   . PRO A 1 148 ? 18.667 158.678 46.815  1.00 29.45 ? 148 PRO A N   1 
ATOM   1120 C  CA  . PRO A 1 148 ? 17.550 157.998 47.479  1.00 29.06 ? 148 PRO A CA  1 
ATOM   1121 C  C   . PRO A 1 148 ? 16.172 158.200 46.842  1.00 28.91 ? 148 PRO A C   1 
ATOM   1122 O  O   . PRO A 1 148 ? 15.276 157.367 47.015  1.00 28.29 ? 148 PRO A O   1 
ATOM   1123 C  CB  . PRO A 1 148 ? 17.636 158.506 48.926  1.00 27.40 ? 148 PRO A CB  1 
ATOM   1124 C  CG  . PRO A 1 148 ? 18.438 159.777 48.824  1.00 28.44 ? 148 PRO A CG  1 
ATOM   1125 C  CD  . PRO A 1 148 ? 19.465 159.446 47.786  1.00 28.80 ? 148 PRO A CD  1 
ATOM   1126 N  N   . GLY A 1 149 ? 16.002 159.287 46.094  1.00 27.81 ? 149 GLY A N   1 
ATOM   1127 C  CA  . GLY A 1 149 ? 14.721 159.527 45.451  1.00 25.76 ? 149 GLY A CA  1 
ATOM   1128 C  C   . GLY A 1 149 ? 14.640 158.925 44.056  1.00 26.76 ? 149 GLY A C   1 
ATOM   1129 O  O   . GLY A 1 149 ? 13.593 158.975 43.405  1.00 27.10 ? 149 GLY A O   1 
ATOM   1130 N  N   . ILE A 1 150 ? 15.748 158.358 43.589  1.00 26.64 ? 150 ILE A N   1 
ATOM   1131 C  CA  . ILE A 1 150 ? 15.800 157.748 42.267  1.00 27.66 ? 150 ILE A CA  1 
ATOM   1132 C  C   . ILE A 1 150 ? 15.557 156.242 42.378  1.00 28.42 ? 150 ILE A C   1 
ATOM   1133 O  O   . ILE A 1 150 ? 16.282 155.524 43.069  1.00 27.98 ? 150 ILE A O   1 
ATOM   1134 C  CB  . ILE A 1 150 ? 17.164 158.018 41.594  1.00 29.44 ? 150 ILE A CB  1 
ATOM   1135 C  CG1 . ILE A 1 150 ? 17.374 159.529 41.456  1.00 28.40 ? 150 ILE A CG1 1 
ATOM   1136 C  CG2 . ILE A 1 150 ? 17.218 157.350 40.220  1.00 28.76 ? 150 ILE A CG2 1 
ATOM   1137 C  CD1 . ILE A 1 150 ? 18.760 159.914 41.014  1.00 28.24 ? 150 ILE A CD1 1 
ATOM   1138 N  N   . ARG A 1 151 ? 14.526 155.775 41.683  1.00 28.70 ? 151 ARG A N   1 
ATOM   1139 C  CA  . ARG A 1 151 ? 14.134 154.374 41.720  1.00 28.57 ? 151 ARG A CA  1 
ATOM   1140 C  C   . ARG A 1 151 ? 14.891 153.412 40.799  1.00 29.52 ? 151 ARG A C   1 
ATOM   1141 O  O   . ARG A 1 151 ? 14.888 152.199 41.034  1.00 29.80 ? 151 ARG A O   1 
ATOM   1142 C  CB  . ARG A 1 151 ? 12.635 154.274 41.445  1.00 27.22 ? 151 ARG A CB  1 
ATOM   1143 C  CG  . ARG A 1 151 ? 12.130 152.870 41.220  1.00 26.88 ? 151 ARG A CG  1 
ATOM   1144 C  CD  . ARG A 1 151 ? 10.622 152.869 41.191  1.00 26.35 ? 151 ARG A CD  1 
ATOM   1145 N  NE  . ARG A 1 151 ? 10.084 153.180 42.506  1.00 26.83 ? 151 ARG A NE  1 
ATOM   1146 C  CZ  . ARG A 1 151 ? 8.839  153.582 42.730  1.00 29.10 ? 151 ARG A CZ  1 
ATOM   1147 N  NH1 . ARG A 1 151 ? 7.989  153.730 41.718  1.00 29.29 ? 151 ARG A NH1 1 
ATOM   1148 N  NH2 . ARG A 1 151 ? 8.442  153.824 43.972  1.00 28.57 ? 151 ARG A NH2 1 
ATOM   1149 N  N   . GLY A 1 152 ? 15.541 153.931 39.760  1.00 28.46 ? 152 GLY A N   1 
ATOM   1150 C  CA  . GLY A 1 152 ? 16.262 153.042 38.871  1.00 26.95 ? 152 GLY A CA  1 
ATOM   1151 C  C   . GLY A 1 152 ? 17.085 153.701 37.784  1.00 26.87 ? 152 GLY A C   1 
ATOM   1152 O  O   . GLY A 1 152 ? 16.924 154.884 37.484  1.00 27.24 ? 152 GLY A O   1 
ATOM   1153 N  N   . ILE A 1 153 ? 17.967 152.908 37.183  1.00 25.49 ? 153 ILE A N   1 
ATOM   1154 C  CA  . ILE A 1 153 ? 18.850 153.368 36.123  1.00 23.80 ? 153 ILE A CA  1 
ATOM   1155 C  C   . ILE A 1 153 ? 18.906 152.341 35.006  1.00 24.62 ? 153 ILE A C   1 
ATOM   1156 O  O   . ILE A 1 153 ? 19.065 151.151 35.261  1.00 26.32 ? 153 ILE A O   1 
ATOM   1157 C  CB  . ILE A 1 153 ? 20.301 153.535 36.623  1.00 22.72 ? 153 ILE A CB  1 
ATOM   1158 C  CG1 . ILE A 1 153 ? 20.399 154.675 37.625  1.00 20.21 ? 153 ILE A CG1 1 
ATOM   1159 C  CG2 . ILE A 1 153 ? 21.238 153.756 35.440  1.00 22.76 ? 153 ILE A CG2 1 
ATOM   1160 C  CD1 . ILE A 1 153 ? 21.752 154.743 38.293  1.00 20.22 ? 153 ILE A CD1 1 
ATOM   1161 N  N   . SER A 1 154 ? 18.772 152.797 33.769  1.00 23.94 ? 154 SER A N   1 
ATOM   1162 C  CA  . SER A 1 154 ? 18.877 151.894 32.640  1.00 24.27 ? 154 SER A CA  1 
ATOM   1163 C  C   . SER A 1 154 ? 20.080 152.421 31.856  1.00 24.60 ? 154 SER A C   1 
ATOM   1164 O  O   . SER A 1 154 ? 20.203 153.631 31.634  1.00 23.82 ? 154 SER A O   1 
ATOM   1165 C  CB  . SER A 1 154 ? 17.600 151.914 31.789  1.00 23.75 ? 154 SER A CB  1 
ATOM   1166 O  OG  . SER A 1 154 ? 17.467 153.121 31.066  1.00 24.30 ? 154 SER A OG  1 
ATOM   1167 N  N   . GLU A 1 155 ? 20.979 151.515 31.478  1.00 22.86 ? 155 GLU A N   1 
ATOM   1168 C  CA  . GLU A 1 155 ? 22.187 151.871 30.740  1.00 23.48 ? 155 GLU A CA  1 
ATOM   1169 C  C   . GLU A 1 155 ? 22.325 150.957 29.523  1.00 23.75 ? 155 GLU A C   1 
ATOM   1170 O  O   . GLU A 1 155 ? 22.125 149.749 29.630  1.00 25.02 ? 155 GLU A O   1 
ATOM   1171 C  CB  . GLU A 1 155 ? 23.408 151.722 31.659  1.00 23.53 ? 155 GLU A CB  1 
ATOM   1172 C  CG  . GLU A 1 155 ? 24.763 151.991 31.000  1.00 23.79 ? 155 GLU A CG  1 
ATOM   1173 C  CD  . GLU A 1 155 ? 24.891 153.402 30.465  1.00 23.89 ? 155 GLU A CD  1 
ATOM   1174 O  OE1 . GLU A 1 155 ? 24.715 154.357 31.252  1.00 25.36 ? 155 GLU A OE1 1 
ATOM   1175 O  OE2 . GLU A 1 155 ? 25.168 153.556 29.258  1.00 23.15 ? 155 GLU A OE2 1 
ATOM   1176 N  N   . GLU A 1 156 ? 22.674 151.520 28.370  1.00 23.71 ? 156 GLU A N   1 
ATOM   1177 C  CA  . GLU A 1 156 ? 22.803 150.707 27.161  1.00 24.52 ? 156 GLU A CA  1 
ATOM   1178 C  C   . GLU A 1 156 ? 24.177 150.678 26.504  1.00 24.83 ? 156 GLU A C   1 
ATOM   1179 O  O   . GLU A 1 156 ? 24.295 150.233 25.360  1.00 25.29 ? 156 GLU A O   1 
ATOM   1180 C  CB  . GLU A 1 156 ? 21.795 151.163 26.113  1.00 23.39 ? 156 GLU A CB  1 
ATOM   1181 C  CG  . GLU A 1 156 ? 21.976 152.610 25.722  1.00 24.89 ? 156 GLU A CG  1 
ATOM   1182 C  CD  . GLU A 1 156 ? 20.940 153.068 24.725  1.00 25.47 ? 156 GLU A CD  1 
ATOM   1183 O  OE1 . GLU A 1 156 ? 19.804 152.551 24.765  1.00 24.18 ? 156 GLU A OE1 1 
ATOM   1184 O  OE2 . GLU A 1 156 ? 21.260 153.956 23.911  1.00 28.46 ? 156 GLU A OE2 1 
ATOM   1185 N  N   . THR A 1 157 ? 25.211 151.143 27.197  1.00 23.93 ? 157 THR A N   1 
ATOM   1186 C  CA  . THR A 1 157 ? 26.539 151.141 26.598  1.00 23.92 ? 157 THR A CA  1 
ATOM   1187 C  C   . THR A 1 157 ? 27.537 150.325 27.394  1.00 24.66 ? 157 THR A C   1 
ATOM   1188 O  O   . THR A 1 157 ? 27.341 150.047 28.579  1.00 25.65 ? 157 THR A O   1 
ATOM   1189 C  CB  . THR A 1 157 ? 27.116 152.576 26.439  1.00 22.25 ? 157 THR A CB  1 
ATOM   1190 O  OG1 . THR A 1 157 ? 27.332 153.153 27.730  1.00 22.86 ? 157 THR A OG1 1 
ATOM   1191 C  CG2 . THR A 1 157 ? 26.168 153.454 25.642  1.00 20.53 ? 157 THR A CG2 1 
ATOM   1192 N  N   . THR A 1 158 ? 28.615 149.941 26.722  1.00 25.14 ? 158 THR A N   1 
ATOM   1193 C  CA  . THR A 1 158 ? 29.672 149.171 27.348  1.00 25.63 ? 158 THR A CA  1 
ATOM   1194 C  C   . THR A 1 158 ? 30.300 150.046 28.431  1.00 25.73 ? 158 THR A C   1 
ATOM   1195 O  O   . THR A 1 158 ? 30.411 149.639 29.587  1.00 26.27 ? 158 THR A O   1 
ATOM   1196 C  CB  . THR A 1 158 ? 30.738 148.761 26.303  1.00 26.10 ? 158 THR A CB  1 
ATOM   1197 O  OG1 . THR A 1 158 ? 30.126 147.949 25.289  1.00 24.96 ? 158 THR A OG1 1 
ATOM   1198 C  CG2 . THR A 1 158 ? 31.867 147.989 26.963  1.00 24.92 ? 158 THR A CG2 1 
ATOM   1199 N  N   . THR A 1 159 ? 30.698 151.256 28.052  1.00 25.71 ? 159 THR A N   1 
ATOM   1200 C  CA  . THR A 1 159 ? 31.299 152.194 28.998  1.00 26.41 ? 159 THR A CA  1 
ATOM   1201 C  C   . THR A 1 159 ? 30.421 152.344 30.236  1.00 25.66 ? 159 THR A C   1 
ATOM   1202 O  O   . THR A 1 159 ? 30.876 152.137 31.361  1.00 25.97 ? 159 THR A O   1 
ATOM   1203 C  CB  . THR A 1 159 ? 31.495 153.588 28.353  1.00 27.22 ? 159 THR A CB  1 
ATOM   1204 O  OG1 . THR A 1 159 ? 32.539 153.511 27.377  1.00 29.51 ? 159 THR A OG1 1 
ATOM   1205 C  CG2 . THR A 1 159 ? 31.866 154.628 29.399  1.00 26.37 ? 159 THR A CG2 1 
ATOM   1206 N  N   . GLY A 1 160 ? 29.159 152.705 30.020  1.00 25.61 ? 160 GLY A N   1 
ATOM   1207 C  CA  . GLY A 1 160 ? 28.240 152.870 31.132  1.00 25.66 ? 160 GLY A CA  1 
ATOM   1208 C  C   . GLY A 1 160 ? 28.189 151.665 32.059  1.00 25.48 ? 160 GLY A C   1 
ATOM   1209 O  O   . GLY A 1 160 ? 28.301 151.812 33.277  1.00 22.88 ? 160 GLY A O   1 
ATOM   1210 N  N   . VAL A 1 161 ? 28.024 150.475 31.483  1.00 25.38 ? 161 VAL A N   1 
ATOM   1211 C  CA  . VAL A 1 161 ? 27.949 149.247 32.268  1.00 26.23 ? 161 VAL A CA  1 
ATOM   1212 C  C   . VAL A 1 161 ? 29.259 148.963 32.995  1.00 27.66 ? 161 VAL A C   1 
ATOM   1213 O  O   . VAL A 1 161 ? 29.255 148.562 34.159  1.00 28.62 ? 161 VAL A O   1 
ATOM   1214 C  CB  . VAL A 1 161 ? 27.562 148.043 31.376  1.00 25.44 ? 161 VAL A CB  1 
ATOM   1215 C  CG1 . VAL A 1 161 ? 27.626 146.752 32.172  1.00 23.36 ? 161 VAL A CG1 1 
ATOM   1216 C  CG2 . VAL A 1 161 ? 26.158 148.248 30.832  1.00 24.00 ? 161 VAL A CG2 1 
ATOM   1217 N  N   . HIS A 1 162 ? 30.379 149.171 32.310  1.00 29.21 ? 162 HIS A N   1 
ATOM   1218 C  CA  . HIS A 1 162 ? 31.682 148.958 32.927  1.00 31.24 ? 162 HIS A CA  1 
ATOM   1219 C  C   . HIS A 1 162 ? 31.794 149.893 34.121  1.00 31.57 ? 162 HIS A C   1 
ATOM   1220 O  O   . HIS A 1 162 ? 32.286 149.511 35.184  1.00 32.74 ? 162 HIS A O   1 
ATOM   1221 C  CB  . HIS A 1 162 ? 32.804 149.264 31.934  1.00 32.41 ? 162 HIS A CB  1 
ATOM   1222 C  CG  . HIS A 1 162 ? 33.199 148.095 31.089  1.00 35.26 ? 162 HIS A CG  1 
ATOM   1223 N  ND1 . HIS A 1 162 ? 34.028 148.214 29.995  1.00 36.97 ? 162 HIS A ND1 1 
ATOM   1224 C  CD2 . HIS A 1 162 ? 32.900 146.779 31.194  1.00 35.87 ? 162 HIS A CD2 1 
ATOM   1225 C  CE1 . HIS A 1 162 ? 34.224 147.021 29.460  1.00 36.00 ? 162 HIS A CE1 1 
ATOM   1226 N  NE2 . HIS A 1 162 ? 33.550 146.133 30.169  1.00 35.62 ? 162 HIS A NE2 1 
ATOM   1227 N  N   . ASN A 1 163 ? 31.317 151.118 33.934  1.00 30.93 ? 163 ASN A N   1 
ATOM   1228 C  CA  . ASN A 1 163 ? 31.351 152.126 34.979  1.00 31.26 ? 163 ASN A CA  1 
ATOM   1229 C  C   . ASN A 1 163 ? 30.466 151.737 36.172  1.00 29.80 ? 163 ASN A C   1 
ATOM   1230 O  O   . ASN A 1 163 ? 30.880 151.862 37.326  1.00 30.10 ? 163 ASN A O   1 
ATOM   1231 C  CB  . ASN A 1 163 ? 30.914 153.475 34.397  1.00 33.69 ? 163 ASN A CB  1 
ATOM   1232 C  CG  . ASN A 1 163 ? 31.048 154.607 35.391  1.00 35.73 ? 163 ASN A CG  1 
ATOM   1233 O  OD1 . ASN A 1 163 ? 32.122 154.831 35.949  1.00 37.85 ? 163 ASN A OD1 1 
ATOM   1234 N  ND2 . ASN A 1 163 ? 29.957 155.332 35.619  1.00 36.88 ? 163 ASN A ND2 1 
ATOM   1235 N  N   . LEU A 1 164 ? 29.258 151.257 35.895  1.00 27.75 ? 164 LEU A N   1 
ATOM   1236 C  CA  . LEU A 1 164 ? 28.338 150.852 36.953  1.00 28.04 ? 164 LEU A CA  1 
ATOM   1237 C  C   . LEU A 1 164 ? 28.921 149.720 37.787  1.00 30.03 ? 164 LEU A C   1 
ATOM   1238 O  O   . LEU A 1 164 ? 28.633 149.604 38.982  1.00 30.16 ? 164 LEU A O   1 
ATOM   1239 C  CB  . LEU A 1 164 ? 27.003 150.403 36.357  1.00 27.04 ? 164 LEU A CB  1 
ATOM   1240 C  CG  . LEU A 1 164 ? 26.057 151.483 35.820  1.00 26.56 ? 164 LEU A CG  1 
ATOM   1241 C  CD1 . LEU A 1 164 ? 24.967 150.820 35.020  1.00 25.51 ? 164 LEU A CD1 1 
ATOM   1242 C  CD2 . LEU A 1 164 ? 25.467 152.299 36.964  1.00 23.24 ? 164 LEU A CD2 1 
ATOM   1243 N  N   . TYR A 1 165 ? 29.730 148.881 37.145  1.00 30.80 ? 165 TYR A N   1 
ATOM   1244 C  CA  . TYR A 1 165 ? 30.365 147.756 37.819  1.00 30.31 ? 165 TYR A CA  1 
ATOM   1245 C  C   . TYR A 1 165 ? 31.442 148.252 38.773  1.00 30.86 ? 165 TYR A C   1 
ATOM   1246 O  O   . TYR A 1 165 ? 31.588 147.725 39.877  1.00 30.05 ? 165 TYR A O   1 
ATOM   1247 C  CB  . TYR A 1 165 ? 30.963 146.787 36.794  1.00 30.79 ? 165 TYR A CB  1 
ATOM   1248 C  CG  . TYR A 1 165 ? 29.953 145.817 36.207  1.00 32.02 ? 165 TYR A CG  1 
ATOM   1249 C  CD1 . TYR A 1 165 ? 30.019 145.437 34.869  1.00 33.31 ? 165 TYR A CD1 1 
ATOM   1250 C  CD2 . TYR A 1 165 ? 28.941 145.275 36.992  1.00 32.70 ? 165 TYR A CD2 1 
ATOM   1251 C  CE1 . TYR A 1 165 ? 29.102 144.547 34.329  1.00 33.53 ? 165 TYR A CE1 1 
ATOM   1252 C  CE2 . TYR A 1 165 ? 28.019 144.383 36.464  1.00 33.06 ? 165 TYR A CE2 1 
ATOM   1253 C  CZ  . TYR A 1 165 ? 28.104 144.024 35.131  1.00 34.88 ? 165 TYR A CZ  1 
ATOM   1254 O  OH  . TYR A 1 165 ? 27.188 143.141 34.597  1.00 35.77 ? 165 TYR A OH  1 
ATOM   1255 N  N   . LYS A 1 166 ? 32.196 149.265 38.354  1.00 31.09 ? 166 LYS A N   1 
ATOM   1256 C  CA  . LYS A 1 166 ? 33.231 149.819 39.219  1.00 33.03 ? 166 LYS A CA  1 
ATOM   1257 C  C   . LYS A 1 166 ? 32.529 150.470 40.415  1.00 33.32 ? 166 LYS A C   1 
ATOM   1258 O  O   . LYS A 1 166 ? 32.905 150.265 41.572  1.00 33.66 ? 166 LYS A O   1 
ATOM   1259 C  CB  . LYS A 1 166 ? 34.060 150.859 38.466  1.00 34.43 ? 166 LYS A CB  1 
ATOM   1260 C  CG  . LYS A 1 166 ? 34.737 150.328 37.218  1.00 36.86 ? 166 LYS A CG  1 
ATOM   1261 C  CD  . LYS A 1 166 ? 35.464 151.448 36.487  1.00 40.60 ? 166 LYS A CD  1 
ATOM   1262 C  CE  . LYS A 1 166 ? 35.966 150.998 35.113  1.00 42.27 ? 166 LYS A CE  1 
ATOM   1263 N  NZ  . LYS A 1 166 ? 36.705 152.084 34.390  1.00 40.97 ? 166 LYS A NZ  1 
ATOM   1264 N  N   . MET A 1 167 ? 31.493 151.247 40.129  1.00 33.19 ? 167 MET A N   1 
ATOM   1265 C  CA  . MET A 1 167 ? 30.737 151.895 41.188  1.00 34.58 ? 167 MET A CA  1 
ATOM   1266 C  C   . MET A 1 167 ? 30.212 150.875 42.197  1.00 35.83 ? 167 MET A C   1 
ATOM   1267 O  O   . MET A 1 167 ? 30.315 151.074 43.409  1.00 36.04 ? 167 MET A O   1 
ATOM   1268 C  CB  . MET A 1 167 ? 29.571 152.675 40.590  1.00 33.14 ? 167 MET A CB  1 
ATOM   1269 C  CG  . MET A 1 167 ? 30.008 153.895 39.810  1.00 33.34 ? 167 MET A CG  1 
ATOM   1270 S  SD  . MET A 1 167 ? 28.624 154.738 39.065  1.00 34.09 ? 167 MET A SD  1 
ATOM   1271 C  CE  . MET A 1 167 ? 27.693 155.142 40.525  1.00 32.18 ? 167 MET A CE  1 
ATOM   1272 N  N   . MET A 1 168 ? 29.650 149.781 41.694  1.00 37.10 ? 168 MET A N   1 
ATOM   1273 C  CA  . MET A 1 168 ? 29.113 148.746 42.567  1.00 38.71 ? 168 MET A CA  1 
ATOM   1274 C  C   . MET A 1 168 ? 30.252 148.055 43.324  1.00 39.24 ? 168 MET A C   1 
ATOM   1275 O  O   . MET A 1 168 ? 30.097 147.663 44.484  1.00 39.14 ? 168 MET A O   1 
ATOM   1276 C  CB  . MET A 1 168 ? 28.318 147.723 41.748  1.00 38.26 ? 168 MET A CB  1 
ATOM   1277 C  CG  . MET A 1 168 ? 27.471 146.779 42.589  1.00 39.56 ? 168 MET A CG  1 
ATOM   1278 S  SD  . MET A 1 168 ? 26.397 147.670 43.755  1.00 45.02 ? 168 MET A SD  1 
ATOM   1279 C  CE  . MET A 1 168 ? 25.891 146.330 44.883  1.00 40.31 ? 168 MET A CE  1 
ATOM   1280 N  N   . ALA A 1 169 ? 31.400 147.923 42.667  1.00 39.13 ? 169 ALA A N   1 
ATOM   1281 C  CA  . ALA A 1 169 ? 32.557 147.282 43.284  1.00 38.97 ? 169 ALA A CA  1 
ATOM   1282 C  C   . ALA A 1 169 ? 33.127 148.166 44.383  1.00 39.42 ? 169 ALA A C   1 
ATOM   1283 O  O   . ALA A 1 169 ? 33.745 147.675 45.329  1.00 40.69 ? 169 ALA A O   1 
ATOM   1284 C  CB  . ALA A 1 169 ? 33.632 146.999 42.233  1.00 36.59 ? 169 ALA A CB  1 
ATOM   1285 N  N   . ASN A 1 170 ? 32.915 149.472 44.255  1.00 38.59 ? 170 ASN A N   1 
ATOM   1286 C  CA  . ASN A 1 170 ? 33.418 150.422 45.236  1.00 37.46 ? 170 ASN A CA  1 
ATOM   1287 C  C   . ASN A 1 170 ? 32.344 150.899 46.220  1.00 37.26 ? 170 ASN A C   1 
ATOM   1288 O  O   . ASN A 1 170 ? 32.575 151.824 46.998  1.00 37.83 ? 170 ASN A O   1 
ATOM   1289 C  CB  . ASN A 1 170 ? 34.038 151.622 44.521  1.00 36.95 ? 170 ASN A CB  1 
ATOM   1290 C  CG  . ASN A 1 170 ? 35.251 151.240 43.684  1.00 37.94 ? 170 ASN A CG  1 
ATOM   1291 O  OD1 . ASN A 1 170 ? 36.259 150.756 44.208  1.00 37.90 ? 170 ASN A OD1 1 
ATOM   1292 N  ND2 . ASN A 1 170 ? 35.161 151.463 42.375  1.00 38.21 ? 170 ASN A ND2 1 
ATOM   1293 N  N   . GLY A 1 171 ? 31.174 150.269 46.191  1.00 35.97 ? 171 GLY A N   1 
ATOM   1294 C  CA  . GLY A 1 171 ? 30.109 150.664 47.098  1.00 35.57 ? 171 GLY A CA  1 
ATOM   1295 C  C   . GLY A 1 171 ? 29.569 152.061 46.830  1.00 35.33 ? 171 GLY A C   1 
ATOM   1296 O  O   . GLY A 1 171 ? 28.911 152.663 47.687  1.00 35.06 ? 171 GLY A O   1 
ATOM   1297 N  N   . ILE A 1 172 ? 29.839 152.572 45.632  1.00 34.23 ? 172 ILE A N   1 
ATOM   1298 C  CA  . ILE A 1 172 ? 29.388 153.901 45.233  1.00 33.23 ? 172 ILE A CA  1 
ATOM   1299 C  C   . ILE A 1 172 ? 27.961 153.906 44.690  1.00 31.75 ? 172 ILE A C   1 
ATOM   1300 O  O   . ILE A 1 172 ? 27.191 154.827 44.960  1.00 32.21 ? 172 ILE A O   1 
ATOM   1301 C  CB  . ILE A 1 172 ? 30.317 154.485 44.157  1.00 33.63 ? 172 ILE A CB  1 
ATOM   1302 C  CG1 . ILE A 1 172 ? 31.701 154.736 44.755  1.00 33.11 ? 172 ILE A CG1 1 
ATOM   1303 C  CG2 . ILE A 1 172 ? 29.716 155.760 43.589  1.00 32.30 ? 172 ILE A CG2 1 
ATOM   1304 C  CD1 . ILE A 1 172 ? 32.744 155.120 43.725  1.00 34.51 ? 172 ILE A CD1 1 
ATOM   1305 N  N   . LEU A 1 173 ? 27.615 152.878 43.920  1.00 29.71 ? 173 LEU A N   1 
ATOM   1306 C  CA  . LEU A 1 173 ? 26.283 152.775 43.337  1.00 28.38 ? 173 LEU A CA  1 
ATOM   1307 C  C   . LEU A 1 173 ? 25.219 152.713 44.431  1.00 27.78 ? 173 LEU A C   1 
ATOM   1308 O  O   . LEU A 1 173 ? 25.330 151.927 45.371  1.00 26.15 ? 173 LEU A O   1 
ATOM   1309 C  CB  . LEU A 1 173 ? 26.198 151.530 42.453  1.00 27.74 ? 173 LEU A CB  1 
ATOM   1310 C  CG  . LEU A 1 173 ? 24.911 151.362 41.649  1.00 27.40 ? 173 LEU A CG  1 
ATOM   1311 C  CD1 . LEU A 1 173 ? 24.748 152.543 40.697  1.00 25.19 ? 173 LEU A CD1 1 
ATOM   1312 C  CD2 . LEU A 1 173 ? 24.966 150.052 40.877  1.00 27.36 ? 173 LEU A CD2 1 
ATOM   1313 N  N   . LYS A 1 174 ? 24.187 153.542 44.298  1.00 28.00 ? 174 LYS A N   1 
ATOM   1314 C  CA  . LYS A 1 174 ? 23.114 153.601 45.289  1.00 29.72 ? 174 LYS A CA  1 
ATOM   1315 C  C   . LYS A 1 174 ? 21.744 153.337 44.682  1.00 30.06 ? 174 LYS A C   1 
ATOM   1316 O  O   . LYS A 1 174 ? 20.735 153.293 45.384  1.00 30.95 ? 174 LYS A O   1 
ATOM   1317 C  CB  . LYS A 1 174 ? 23.112 154.974 45.965  1.00 30.08 ? 174 LYS A CB  1 
ATOM   1318 C  CG  . LYS A 1 174 ? 24.396 155.293 46.714  1.00 32.71 ? 174 LYS A CG  1 
ATOM   1319 C  CD  . LYS A 1 174 ? 24.565 154.357 47.904  1.00 35.50 ? 174 LYS A CD  1 
ATOM   1320 C  CE  . LYS A 1 174 ? 25.840 154.649 48.676  1.00 37.35 ? 174 LYS A CE  1 
ATOM   1321 N  NZ  . LYS A 1 174 ? 25.901 153.849 49.940  1.00 39.88 ? 174 LYS A NZ  1 
ATOM   1322 N  N   . VAL A 1 175 ? 21.711 153.162 43.371  1.00 30.89 ? 175 VAL A N   1 
ATOM   1323 C  CA  . VAL A 1 175 ? 20.461 152.919 42.669  1.00 30.38 ? 175 VAL A CA  1 
ATOM   1324 C  C   . VAL A 1 175 ? 20.535 151.633 41.859  1.00 30.14 ? 175 VAL A C   1 
ATOM   1325 O  O   . VAL A 1 175 ? 21.579 151.304 41.299  1.00 30.15 ? 175 VAL A O   1 
ATOM   1326 C  CB  . VAL A 1 175 ? 20.152 154.088 41.708  1.00 30.06 ? 175 VAL A CB  1 
ATOM   1327 C  CG1 . VAL A 1 175 ? 18.922 153.771 40.876  1.00 30.25 ? 175 VAL A CG1 1 
ATOM   1328 C  CG2 . VAL A 1 175 ? 19.953 155.371 42.502  1.00 29.96 ? 175 VAL A CG2 1 
ATOM   1329 N  N   . PRO A 1 176 ? 19.432 150.875 41.804  1.00 30.16 ? 176 PRO A N   1 
ATOM   1330 C  CA  . PRO A 1 176 ? 19.486 149.638 41.017  1.00 29.69 ? 176 PRO A CA  1 
ATOM   1331 C  C   . PRO A 1 176 ? 19.626 150.020 39.537  1.00 29.35 ? 176 PRO A C   1 
ATOM   1332 O  O   . PRO A 1 176 ? 18.981 150.960 39.062  1.00 28.65 ? 176 PRO A O   1 
ATOM   1333 C  CB  . PRO A 1 176 ? 18.138 148.972 41.312  1.00 29.00 ? 176 PRO A CB  1 
ATOM   1334 C  CG  . PRO A 1 176 ? 17.773 149.499 42.661  1.00 30.32 ? 176 PRO A CG  1 
ATOM   1335 C  CD  . PRO A 1 176 ? 18.182 150.957 42.576  1.00 30.49 ? 176 PRO A CD  1 
ATOM   1336 N  N   . ALA A 1 177 ? 20.477 149.304 38.814  1.00 27.92 ? 177 ALA A N   1 
ATOM   1337 C  CA  . ALA A 1 177 ? 20.669 149.595 37.403  1.00 25.88 ? 177 ALA A CA  1 
ATOM   1338 C  C   . ALA A 1 177 ? 20.438 148.354 36.549  1.00 25.27 ? 177 ALA A C   1 
ATOM   1339 O  O   . ALA A 1 177 ? 20.896 147.254 36.876  1.00 24.47 ? 177 ALA A O   1 
ATOM   1340 C  CB  . ALA A 1 177 ? 22.074 150.140 37.165  1.00 24.80 ? 177 ALA A CB  1 
ATOM   1341 N  N   . ILE A 1 178 ? 19.695 148.537 35.465  1.00 23.62 ? 178 ILE A N   1 
ATOM   1342 C  CA  . ILE A 1 178 ? 19.434 147.453 34.539  1.00 22.69 ? 178 ILE A CA  1 
ATOM   1343 C  C   . ILE A 1 178 ? 20.307 147.714 33.324  1.00 23.09 ? 178 ILE A C   1 
ATOM   1344 O  O   . ILE A 1 178 ? 20.268 148.797 32.733  1.00 23.22 ? 178 ILE A O   1 
ATOM   1345 C  CB  . ILE A 1 178 ? 17.950 147.397 34.104  1.00 23.14 ? 178 ILE A CB  1 
ATOM   1346 C  CG1 . ILE A 1 178 ? 17.105 146.783 35.225  1.00 23.71 ? 178 ILE A CG1 1 
ATOM   1347 C  CG2 . ILE A 1 178 ? 17.812 146.601 32.816  1.00 18.40 ? 178 ILE A CG2 1 
ATOM   1348 C  CD1 . ILE A 1 178 ? 15.678 146.469 34.820  1.00 24.21 ? 178 ILE A CD1 1 
ATOM   1349 N  N   . ASN A 1 179 ? 21.119 146.724 32.976  1.00 23.10 ? 179 ASN A N   1 
ATOM   1350 C  CA  . ASN A 1 179 ? 22.012 146.821 31.833  1.00 21.95 ? 179 ASN A CA  1 
ATOM   1351 C  C   . ASN A 1 179 ? 21.335 146.208 30.611  1.00 22.37 ? 179 ASN A C   1 
ATOM   1352 O  O   . ASN A 1 179 ? 21.019 145.015 30.596  1.00 23.30 ? 179 ASN A O   1 
ATOM   1353 C  CB  . ASN A 1 179 ? 23.337 146.110 32.162  1.00 19.34 ? 179 ASN A CB  1 
ATOM   1354 C  CG  . ASN A 1 179 ? 24.016 145.500 30.938  1.00 19.38 ? 179 ASN A CG  1 
ATOM   1355 O  OD1 . ASN A 1 179 ? 24.073 146.105 29.864  1.00 16.65 ? 179 ASN A OD1 1 
ATOM   1356 N  ND2 . ASN A 1 179 ? 24.555 144.295 31.109  1.00 17.80 ? 179 ASN A ND2 1 
ATOM   1357 N  N   . VAL A 1 180 ? 21.073 147.036 29.605  1.00 21.86 ? 180 VAL A N   1 
ATOM   1358 C  CA  . VAL A 1 180 ? 20.456 146.541 28.380  1.00 22.82 ? 180 VAL A CA  1 
ATOM   1359 C  C   . VAL A 1 180 ? 21.514 146.465 27.288  1.00 22.86 ? 180 VAL A C   1 
ATOM   1360 O  O   . VAL A 1 180 ? 21.227 146.114 26.148  1.00 25.40 ? 180 VAL A O   1 
ATOM   1361 C  CB  . VAL A 1 180 ? 19.292 147.446 27.891  1.00 21.85 ? 180 VAL A CB  1 
ATOM   1362 C  CG1 . VAL A 1 180 ? 18.175 147.459 28.928  1.00 21.95 ? 180 VAL A CG1 1 
ATOM   1363 C  CG2 . VAL A 1 180 ? 19.797 148.852 27.609  1.00 18.83 ? 180 VAL A CG2 1 
ATOM   1364 N  N   . ASN A 1 181 ? 22.747 146.797 27.636  1.00 22.10 ? 181 ASN A N   1 
ATOM   1365 C  CA  . ASN A 1 181 ? 23.818 146.736 26.658  1.00 23.39 ? 181 ASN A CA  1 
ATOM   1366 C  C   . ASN A 1 181 ? 23.981 145.286 26.185  1.00 22.50 ? 181 ASN A C   1 
ATOM   1367 O  O   . ASN A 1 181 ? 24.130 145.020 24.994  1.00 21.35 ? 181 ASN A O   1 
ATOM   1368 C  CB  . ASN A 1 181 ? 25.125 147.245 27.280  1.00 23.31 ? 181 ASN A CB  1 
ATOM   1369 C  CG  . ASN A 1 181 ? 26.258 147.329 26.272  1.00 24.48 ? 181 ASN A CG  1 
ATOM   1370 O  OD1 . ASN A 1 181 ? 26.082 147.842 25.163  1.00 24.83 ? 181 ASN A OD1 1 
ATOM   1371 N  ND2 . ASN A 1 181 ? 27.431 146.837 26.656  1.00 23.95 ? 181 ASN A ND2 1 
ATOM   1372 N  N   . ASP A 1 182 ? 23.913 144.358 27.135  1.00 22.45 ? 182 ASP A N   1 
ATOM   1373 C  CA  . ASP A 1 182 ? 24.078 142.938 26.864  1.00 22.55 ? 182 ASP A CA  1 
ATOM   1374 C  C   . ASP A 1 182 ? 22.822 142.143 26.501  1.00 22.35 ? 182 ASP A C   1 
ATOM   1375 O  O   . ASP A 1 182 ? 22.845 140.914 26.522  1.00 22.46 ? 182 ASP A O   1 
ATOM   1376 C  CB  . ASP A 1 182 ? 24.778 142.272 28.054  1.00 21.38 ? 182 ASP A CB  1 
ATOM   1377 C  CG  . ASP A 1 182 ? 26.175 142.824 28.288  1.00 22.59 ? 182 ASP A CG  1 
ATOM   1378 O  OD1 . ASP A 1 182 ? 26.981 142.796 27.325  1.00 22.61 ? 182 ASP A OD1 1 
ATOM   1379 O  OD2 . ASP A 1 182 ? 26.463 143.283 29.421  1.00 17.39 ? 182 ASP A OD2 1 
ATOM   1380 N  N   . SER A 1 183 ? 21.725 142.819 26.180  1.00 21.71 ? 183 SER A N   1 
ATOM   1381 C  CA  . SER A 1 183 ? 20.526 142.088 25.787  1.00 21.15 ? 183 SER A CA  1 
ATOM   1382 C  C   . SER A 1 183 ? 20.807 141.692 24.342  1.00 20.88 ? 183 SER A C   1 
ATOM   1383 O  O   . SER A 1 183 ? 21.560 142.374 23.644  1.00 20.95 ? 183 SER A O   1 
ATOM   1384 C  CB  . SER A 1 183 ? 19.270 142.973 25.869  1.00 21.79 ? 183 SER A CB  1 
ATOM   1385 O  OG  . SER A 1 183 ? 19.137 143.816 24.737  1.00 21.65 ? 183 SER A OG  1 
ATOM   1386 N  N   . VAL A 1 184 ? 20.216 140.594 23.888  1.00 19.59 ? 184 VAL A N   1 
ATOM   1387 C  CA  . VAL A 1 184 ? 20.457 140.142 22.528  1.00 18.87 ? 184 VAL A CA  1 
ATOM   1388 C  C   . VAL A 1 184 ? 19.943 141.127 21.480  1.00 19.24 ? 184 VAL A C   1 
ATOM   1389 O  O   . VAL A 1 184 ? 20.655 141.456 20.529  1.00 19.67 ? 184 VAL A O   1 
ATOM   1390 C  CB  . VAL A 1 184 ? 19.813 138.761 22.280  1.00 18.38 ? 184 VAL A CB  1 
ATOM   1391 C  CG1 . VAL A 1 184 ? 20.256 138.217 20.936  1.00 17.28 ? 184 VAL A CG1 1 
ATOM   1392 C  CG2 . VAL A 1 184 ? 20.190 137.807 23.390  1.00 16.77 ? 184 VAL A CG2 1 
ATOM   1393 N  N   . THR A 1 185 ? 18.715 141.602 21.650  1.00 19.98 ? 185 THR A N   1 
ATOM   1394 C  CA  . THR A 1 185 ? 18.142 142.538 20.689  1.00 21.87 ? 185 THR A CA  1 
ATOM   1395 C  C   . THR A 1 185 ? 18.957 143.817 20.576  1.00 22.79 ? 185 THR A C   1 
ATOM   1396 O  O   . THR A 1 185 ? 19.082 144.394 19.494  1.00 23.24 ? 185 THR A O   1 
ATOM   1397 C  CB  . THR A 1 185 ? 16.689 142.912 21.047  1.00 21.17 ? 185 THR A CB  1 
ATOM   1398 O  OG1 . THR A 1 185 ? 16.610 143.289 22.428  1.00 20.83 ? 185 THR A OG1 1 
ATOM   1399 C  CG2 . THR A 1 185 ? 15.771 141.749 20.772  1.00 21.10 ? 185 THR A CG2 1 
ATOM   1400 N  N   . LYS A 1 186 ? 19.519 144.258 21.692  1.00 23.00 ? 186 LYS A N   1 
ATOM   1401 C  CA  . LYS A 1 186 ? 20.311 145.471 21.676  1.00 22.99 ? 186 LYS A CA  1 
ATOM   1402 C  C   . LYS A 1 186 ? 21.657 145.213 21.006  1.00 22.96 ? 186 LYS A C   1 
ATOM   1403 O  O   . LYS A 1 186 ? 21.990 145.855 20.009  1.00 23.78 ? 186 LYS A O   1 
ATOM   1404 C  CB  . LYS A 1 186 ? 20.504 145.986 23.108  1.00 22.62 ? 186 LYS A CB  1 
ATOM   1405 C  CG  . LYS A 1 186 ? 21.048 147.408 23.217  1.00 21.36 ? 186 LYS A CG  1 
ATOM   1406 C  CD  . LYS A 1 186 ? 22.548 147.469 23.015  1.00 21.44 ? 186 LYS A CD  1 
ATOM   1407 C  CE  . LYS A 1 186 ? 23.046 148.909 23.010  1.00 23.44 ? 186 LYS A CE  1 
ATOM   1408 N  NZ  . LYS A 1 186 ? 24.542 149.002 23.009  1.00 21.75 ? 186 LYS A NZ  1 
ATOM   1409 N  N   . SER A 1 187 ? 22.418 144.260 21.542  1.00 23.25 ? 187 SER A N   1 
ATOM   1410 C  CA  . SER A 1 187 ? 23.744 143.942 21.006  1.00 24.03 ? 187 SER A CA  1 
ATOM   1411 C  C   . SER A 1 187 ? 23.772 143.538 19.535  1.00 23.46 ? 187 SER A C   1 
ATOM   1412 O  O   . SER A 1 187 ? 24.599 144.024 18.769  1.00 23.09 ? 187 SER A O   1 
ATOM   1413 C  CB  . SER A 1 187 ? 24.412 142.848 21.848  1.00 23.97 ? 187 SER A CB  1 
ATOM   1414 O  OG  . SER A 1 187 ? 23.588 141.706 21.955  1.00 24.41 ? 187 SER A OG  1 
ATOM   1415 N  N   . LYS A 1 188 ? 22.870 142.656 19.131  1.00 23.18 ? 188 LYS A N   1 
ATOM   1416 C  CA  . LYS A 1 188 ? 22.853 142.221 17.744  1.00 24.06 ? 188 LYS A CA  1 
ATOM   1417 C  C   . LYS A 1 188 ? 22.673 143.368 16.757  1.00 22.69 ? 188 LYS A C   1 
ATOM   1418 O  O   . LYS A 1 188 ? 23.378 143.454 15.750  1.00 22.61 ? 188 LYS A O   1 
ATOM   1419 C  CB  . LYS A 1 188 ? 21.754 141.184 17.541  1.00 26.33 ? 188 LYS A CB  1 
ATOM   1420 C  CG  . LYS A 1 188 ? 22.072 139.850 18.169  1.00 29.38 ? 188 LYS A CG  1 
ATOM   1421 C  CD  . LYS A 1 188 ? 23.305 139.260 17.523  1.00 32.06 ? 188 LYS A CD  1 
ATOM   1422 C  CE  . LYS A 1 188 ? 23.528 137.826 17.963  1.00 35.33 ? 188 LYS A CE  1 
ATOM   1423 N  NZ  . LYS A 1 188 ? 24.663 137.203 17.220  1.00 38.19 ? 188 LYS A NZ  1 
ATOM   1424 N  N   . PHE A 1 189 ? 21.734 144.257 17.045  1.00 21.39 ? 189 PHE A N   1 
ATOM   1425 C  CA  . PHE A 1 189 ? 21.481 145.374 16.152  1.00 20.04 ? 189 PHE A CA  1 
ATOM   1426 C  C   . PHE A 1 189 ? 22.528 146.462 16.263  1.00 18.70 ? 189 PHE A C   1 
ATOM   1427 O  O   . PHE A 1 189 ? 23.032 146.953 15.255  1.00 16.54 ? 189 PHE A O   1 
ATOM   1428 C  CB  . PHE A 1 189 ? 20.080 145.926 16.409  1.00 19.28 ? 189 PHE A CB  1 
ATOM   1429 C  CG  . PHE A 1 189 ? 19.004 145.112 15.763  1.00 21.08 ? 189 PHE A CG  1 
ATOM   1430 C  CD1 . PHE A 1 189 ? 18.634 145.353 14.448  1.00 20.74 ? 189 PHE A CD1 1 
ATOM   1431 C  CD2 . PHE A 1 189 ? 18.423 144.048 16.434  1.00 20.47 ? 189 PHE A CD2 1 
ATOM   1432 C  CE1 . PHE A 1 189 ? 17.711 144.548 13.811  1.00 19.80 ? 189 PHE A CE1 1 
ATOM   1433 C  CE2 . PHE A 1 189 ? 17.501 143.239 15.802  1.00 21.65 ? 189 PHE A CE2 1 
ATOM   1434 C  CZ  . PHE A 1 189 ? 17.145 143.490 14.483  1.00 21.45 ? 189 PHE A CZ  1 
ATOM   1435 N  N   . ASP A 1 190 ? 22.870 146.818 17.493  1.00 18.82 ? 190 ASP A N   1 
ATOM   1436 C  CA  . ASP A 1 190 ? 23.862 147.854 17.723  1.00 19.53 ? 190 ASP A CA  1 
ATOM   1437 C  C   . ASP A 1 190 ? 25.257 147.478 17.215  1.00 18.66 ? 190 ASP A C   1 
ATOM   1438 O  O   . ASP A 1 190 ? 26.002 148.342 16.768  1.00 18.51 ? 190 ASP A O   1 
ATOM   1439 C  CB  . ASP A 1 190 ? 23.922 148.192 19.213  1.00 19.88 ? 190 ASP A CB  1 
ATOM   1440 C  CG  . ASP A 1 190 ? 24.647 149.490 19.478  1.00 21.20 ? 190 ASP A CG  1 
ATOM   1441 O  OD1 . ASP A 1 190 ? 24.342 150.481 18.777  1.00 23.63 ? 190 ASP A OD1 1 
ATOM   1442 O  OD2 . ASP A 1 190 ? 25.511 149.523 20.382  1.00 20.55 ? 190 ASP A OD2 1 
ATOM   1443 N  N   . ASN A 1 191 ? 25.608 146.195 17.268  1.00 19.29 ? 191 ASN A N   1 
ATOM   1444 C  CA  . ASN A 1 191 ? 26.929 145.763 16.816  1.00 18.62 ? 191 ASN A CA  1 
ATOM   1445 C  C   . ASN A 1 191 ? 26.976 145.141 15.421  1.00 18.89 ? 191 ASN A C   1 
ATOM   1446 O  O   . ASN A 1 191 ? 27.615 145.677 14.518  1.00 19.28 ? 191 ASN A O   1 
ATOM   1447 C  CB  . ASN A 1 191 ? 27.539 144.774 17.811  1.00 18.36 ? 191 ASN A CB  1 
ATOM   1448 C  CG  . ASN A 1 191 ? 27.483 145.266 19.248  1.00 18.98 ? 191 ASN A CG  1 
ATOM   1449 O  OD1 . ASN A 1 191 ? 28.013 146.322 19.581  1.00 20.74 ? 191 ASN A OD1 1 
ATOM   1450 N  ND2 . ASN A 1 191 ? 26.842 144.489 20.110  1.00 21.13 ? 191 ASN A ND2 1 
ATOM   1451 N  N   . LEU A 1 192 ? 26.295 144.016 15.238  1.00 19.30 ? 192 LEU A N   1 
ATOM   1452 C  CA  . LEU A 1 192 ? 26.325 143.321 13.956  1.00 18.91 ? 192 LEU A CA  1 
ATOM   1453 C  C   . LEU A 1 192 ? 25.507 143.960 12.836  1.00 18.86 ? 192 LEU A C   1 
ATOM   1454 O  O   . LEU A 1 192 ? 26.070 144.475 11.869  1.00 19.07 ? 192 LEU A O   1 
ATOM   1455 C  CB  . LEU A 1 192 ? 25.897 141.864 14.152  1.00 18.96 ? 192 LEU A CB  1 
ATOM   1456 C  CG  . LEU A 1 192 ? 26.423 140.823 13.154  1.00 19.84 ? 192 LEU A CG  1 
ATOM   1457 C  CD1 . LEU A 1 192 ? 26.168 139.447 13.718  1.00 16.87 ? 192 LEU A CD1 1 
ATOM   1458 C  CD2 . LEU A 1 192 ? 25.764 140.982 11.791  1.00 19.66 ? 192 LEU A CD2 1 
ATOM   1459 N  N   . TYR A 1 193 ? 24.185 143.919 12.958  1.00 18.20 ? 193 TYR A N   1 
ATOM   1460 C  CA  . TYR A 1 193 ? 23.306 144.480 11.935  1.00 17.97 ? 193 TYR A CA  1 
ATOM   1461 C  C   . TYR A 1 193 ? 23.554 145.953 11.636  1.00 18.64 ? 193 TYR A C   1 
ATOM   1462 O  O   . TYR A 1 193 ? 23.642 146.352 10.469  1.00 19.79 ? 193 TYR A O   1 
ATOM   1463 C  CB  . TYR A 1 193 ? 21.846 144.293 12.340  1.00 18.48 ? 193 TYR A CB  1 
ATOM   1464 C  CG  . TYR A 1 193 ? 21.490 142.864 12.636  1.00 17.02 ? 193 TYR A CG  1 
ATOM   1465 C  CD1 . TYR A 1 193 ? 21.811 141.848 11.736  1.00 17.11 ? 193 TYR A CD1 1 
ATOM   1466 C  CD2 . TYR A 1 193 ? 20.840 142.523 13.815  1.00 15.48 ? 193 TYR A CD2 1 
ATOM   1467 C  CE1 . TYR A 1 193 ? 21.494 140.524 12.007  1.00 17.12 ? 193 TYR A CE1 1 
ATOM   1468 C  CE2 . TYR A 1 193 ? 20.517 141.205 14.093  1.00 17.01 ? 193 TYR A CE2 1 
ATOM   1469 C  CZ  . TYR A 1 193 ? 20.847 140.211 13.187  1.00 16.05 ? 193 TYR A CZ  1 
ATOM   1470 O  OH  . TYR A 1 193 ? 20.533 138.909 13.468  1.00 15.46 ? 193 TYR A OH  1 
ATOM   1471 N  N   . GLY A 1 194 ? 23.649 146.759 12.690  1.00 18.50 ? 194 GLY A N   1 
ATOM   1472 C  CA  . GLY A 1 194 ? 23.887 148.177 12.516  1.00 17.56 ? 194 GLY A CA  1 
ATOM   1473 C  C   . GLY A 1 194 ? 25.094 148.456 11.645  1.00 19.07 ? 194 GLY A C   1 
ATOM   1474 O  O   . GLY A 1 194 ? 25.006 149.195 10.664  1.00 22.01 ? 194 GLY A O   1 
ATOM   1475 N  N   . CYS A 1 195 ? 26.230 147.858 11.989  1.00 18.81 ? 195 CYS A N   1 
ATOM   1476 C  CA  . CYS A 1 195 ? 27.449 148.074 11.228  1.00 18.18 ? 195 CYS A CA  1 
ATOM   1477 C  C   . CYS A 1 195 ? 27.449 147.389 9.876   1.00 19.47 ? 195 CYS A C   1 
ATOM   1478 O  O   . CYS A 1 195 ? 28.149 147.816 8.965   1.00 22.12 ? 195 CYS A O   1 
ATOM   1479 C  CB  . CYS A 1 195 ? 28.651 147.618 12.040  1.00 18.54 ? 195 CYS A CB  1 
ATOM   1480 S  SG  . CYS A 1 195 ? 28.835 148.524 13.589  1.00 17.35 ? 195 CYS A SG  1 
ATOM   1481 N  N   . ARG A 1 196 ? 26.668 146.327 9.733   1.00 19.53 ? 196 ARG A N   1 
ATOM   1482 C  CA  . ARG A 1 196 ? 26.599 145.627 8.459   1.00 18.82 ? 196 ARG A CA  1 
ATOM   1483 C  C   . ARG A 1 196 ? 25.904 146.524 7.436   1.00 19.75 ? 196 ARG A C   1 
ATOM   1484 O  O   . ARG A 1 196 ? 26.188 146.473 6.235   1.00 17.80 ? 196 ARG A O   1 
ATOM   1485 C  CB  . ARG A 1 196 ? 25.809 144.329 8.616   1.00 18.81 ? 196 ARG A CB  1 
ATOM   1486 C  CG  . ARG A 1 196 ? 25.818 143.456 7.377   1.00 19.72 ? 196 ARG A CG  1 
ATOM   1487 C  CD  . ARG A 1 196 ? 25.213 142.107 7.667   1.00 19.86 ? 196 ARG A CD  1 
ATOM   1488 N  NE  . ARG A 1 196 ? 23.762 142.168 7.781   1.00 22.26 ? 196 ARG A NE  1 
ATOM   1489 C  CZ  . ARG A 1 196 ? 23.000 141.153 8.181   1.00 23.62 ? 196 ARG A CZ  1 
ATOM   1490 N  NH1 . ARG A 1 196 ? 23.556 139.995 8.522   1.00 21.36 ? 196 ARG A NH1 1 
ATOM   1491 N  NH2 . ARG A 1 196 ? 21.679 141.284 8.206   1.00 21.55 ? 196 ARG A NH2 1 
ATOM   1492 N  N   . GLU A 1 197 ? 24.997 147.354 7.942   1.00 20.24 ? 197 GLU A N   1 
ATOM   1493 C  CA  . GLU A 1 197 ? 24.210 148.266 7.126   1.00 21.16 ? 197 GLU A CA  1 
ATOM   1494 C  C   . GLU A 1 197 ? 24.953 149.528 6.727   1.00 22.77 ? 197 GLU A C   1 
ATOM   1495 O  O   . GLU A 1 197 ? 24.729 150.075 5.642   1.00 23.32 ? 197 GLU A O   1 
ATOM   1496 C  CB  . GLU A 1 197 ? 22.963 148.687 7.897   1.00 22.26 ? 197 GLU A CB  1 
ATOM   1497 C  CG  . GLU A 1 197 ? 22.019 147.570 8.268   1.00 20.93 ? 197 GLU A CG  1 
ATOM   1498 C  CD  . GLU A 1 197 ? 21.006 147.277 7.176   1.00 21.49 ? 197 GLU A CD  1 
ATOM   1499 O  OE1 . GLU A 1 197 ? 20.603 148.222 6.465   1.00 18.89 ? 197 GLU A OE1 1 
ATOM   1500 O  OE2 . GLU A 1 197 ? 20.601 146.104 7.046   1.00 21.16 ? 197 GLU A OE2 1 
ATOM   1501 N  N   . SER A 1 198 ? 25.848 149.984 7.597   1.00 22.32 ? 198 SER A N   1 
ATOM   1502 C  CA  . SER A 1 198 ? 26.547 151.232 7.342   1.00 22.06 ? 198 SER A CA  1 
ATOM   1503 C  C   . SER A 1 198 ? 27.962 151.220 6.806   1.00 20.91 ? 198 SER A C   1 
ATOM   1504 O  O   . SER A 1 198 ? 28.358 152.181 6.149   1.00 22.52 ? 198 SER A O   1 
ATOM   1505 C  CB  . SER A 1 198 ? 26.517 152.088 8.606   1.00 23.04 ? 198 SER A CB  1 
ATOM   1506 O  OG  . SER A 1 198 ? 25.190 152.228 9.077   1.00 25.94 ? 198 SER A OG  1 
ATOM   1507 N  N   . LEU A 1 199 ? 28.734 150.169 7.077   1.00 18.51 ? 199 LEU A N   1 
ATOM   1508 C  CA  . LEU A 1 199 ? 30.120 150.141 6.610   1.00 16.25 ? 199 LEU A CA  1 
ATOM   1509 C  C   . LEU A 1 199 ? 30.278 150.542 5.142   1.00 17.09 ? 199 LEU A C   1 
ATOM   1510 O  O   . LEU A 1 199 ? 30.896 151.568 4.847   1.00 16.41 ? 199 LEU A O   1 
ATOM   1511 C  CB  . LEU A 1 199 ? 30.746 148.761 6.826   1.00 15.39 ? 199 LEU A CB  1 
ATOM   1512 C  CG  . LEU A 1 199 ? 32.202 148.592 6.350   1.00 14.49 ? 199 LEU A CG  1 
ATOM   1513 C  CD1 . LEU A 1 199 ? 33.146 149.474 7.161   1.00 11.28 ? 199 LEU A CD1 1 
ATOM   1514 C  CD2 . LEU A 1 199 ? 32.606 147.146 6.485   1.00 13.46 ? 199 LEU A CD2 1 
ATOM   1515 N  N   . ILE A 1 200 ? 29.720 149.741 4.231   1.00 16.83 ? 200 ILE A N   1 
ATOM   1516 C  CA  . ILE A 1 200 ? 29.830 150.018 2.801   1.00 16.65 ? 200 ILE A CA  1 
ATOM   1517 C  C   . ILE A 1 200 ? 29.242 151.386 2.492   1.00 17.46 ? 200 ILE A C   1 
ATOM   1518 O  O   . ILE A 1 200 ? 29.646 152.046 1.541   1.00 16.89 ? 200 ILE A O   1 
ATOM   1519 C  CB  . ILE A 1 200 ? 29.079 148.967 1.933   1.00 15.64 ? 200 ILE A CB  1 
ATOM   1520 C  CG1 . ILE A 1 200 ? 29.460 147.541 2.349   1.00 16.35 ? 200 ILE A CG1 1 
ATOM   1521 C  CG2 . ILE A 1 200 ? 29.423 149.172 0.463   1.00 11.49 ? 200 ILE A CG2 1 
ATOM   1522 C  CD1 . ILE A 1 200 ? 30.902 147.197 2.148   1.00 15.17 ? 200 ILE A CD1 1 
ATOM   1523 N  N   . ASP A 1 201 ? 28.287 151.808 3.308   1.00 18.81 ? 201 ASP A N   1 
ATOM   1524 C  CA  . ASP A 1 201 ? 27.636 153.096 3.114   1.00 21.32 ? 201 ASP A CA  1 
ATOM   1525 C  C   . ASP A 1 201 ? 28.632 154.225 3.369   1.00 21.47 ? 201 ASP A C   1 
ATOM   1526 O  O   . ASP A 1 201 ? 28.720 155.185 2.597   1.00 20.64 ? 201 ASP A O   1 
ATOM   1527 C  CB  . ASP A 1 201 ? 26.447 153.213 4.061   1.00 25.74 ? 201 ASP A CB  1 
ATOM   1528 C  CG  . ASP A 1 201 ? 25.440 154.224 3.598   1.00 30.25 ? 201 ASP A CG  1 
ATOM   1529 O  OD1 . ASP A 1 201 ? 24.996 154.123 2.439   1.00 32.08 ? 201 ASP A OD1 1 
ATOM   1530 O  OD2 . ASP A 1 201 ? 25.086 155.119 4.392   1.00 37.86 ? 201 ASP A OD2 1 
ATOM   1531 N  N   . GLY A 1 202 ? 29.390 154.093 4.453   1.00 20.98 ? 202 GLY A N   1 
ATOM   1532 C  CA  . GLY A 1 202 ? 30.383 155.093 4.786   1.00 20.06 ? 202 GLY A CA  1 
ATOM   1533 C  C   . GLY A 1 202 ? 31.504 155.108 3.768   1.00 21.24 ? 202 GLY A C   1 
ATOM   1534 O  O   . GLY A 1 202 ? 31.950 156.173 3.342   1.00 23.26 ? 202 GLY A O   1 
ATOM   1535 N  N   . ILE A 1 203 ? 31.955 153.926 3.360   1.00 21.34 ? 203 ILE A N   1 
ATOM   1536 C  CA  . ILE A 1 203 ? 33.039 153.816 2.390   1.00 20.39 ? 203 ILE A CA  1 
ATOM   1537 C  C   . ILE A 1 203 ? 32.672 154.346 1.003   1.00 20.32 ? 203 ILE A C   1 
ATOM   1538 O  O   . ILE A 1 203 ? 33.503 154.942 0.325   1.00 20.24 ? 203 ILE A O   1 
ATOM   1539 C  CB  . ILE A 1 203 ? 33.512 152.351 2.268   1.00 21.08 ? 203 ILE A CB  1 
ATOM   1540 C  CG1 . ILE A 1 203 ? 34.128 151.903 3.597   1.00 20.70 ? 203 ILE A CG1 1 
ATOM   1541 C  CG2 . ILE A 1 203 ? 34.528 152.209 1.136   1.00 21.13 ? 203 ILE A CG2 1 
ATOM   1542 C  CD1 . ILE A 1 203 ? 34.692 150.493 3.580   1.00 19.80 ? 203 ILE A CD1 1 
ATOM   1543 N  N   . LYS A 1 204 ? 31.429 154.129 0.585   1.00 20.75 ? 204 LYS A N   1 
ATOM   1544 C  CA  . LYS A 1 204 ? 30.963 154.588 -0.722  1.00 20.27 ? 204 LYS A CA  1 
ATOM   1545 C  C   . LYS A 1 204 ? 30.820 156.107 -0.791  1.00 20.79 ? 204 LYS A C   1 
ATOM   1546 O  O   . LYS A 1 204 ? 31.270 156.737 -1.743  1.00 18.86 ? 204 LYS A O   1 
ATOM   1547 C  CB  . LYS A 1 204 ? 29.608 153.960 -1.053  1.00 19.84 ? 204 LYS A CB  1 
ATOM   1548 C  CG  . LYS A 1 204 ? 29.642 152.494 -1.427  1.00 19.52 ? 204 LYS A CG  1 
ATOM   1549 C  CD  . LYS A 1 204 ? 30.314 152.280 -2.761  1.00 19.15 ? 204 LYS A CD  1 
ATOM   1550 C  CE  . LYS A 1 204 ? 29.908 150.942 -3.359  1.00 17.52 ? 204 LYS A CE  1 
ATOM   1551 N  NZ  . LYS A 1 204 ? 30.400 150.822 -4.755  1.00 19.21 ? 204 LYS A NZ  1 
ATOM   1552 N  N   . ARG A 1 205 ? 30.171 156.685 0.215   1.00 21.78 ? 205 ARG A N   1 
ATOM   1553 C  CA  . ARG A 1 205 ? 29.956 158.126 0.256   1.00 21.63 ? 205 ARG A CA  1 
ATOM   1554 C  C   . ARG A 1 205 ? 31.277 158.868 0.315   1.00 21.30 ? 205 ARG A C   1 
ATOM   1555 O  O   . ARG A 1 205 ? 31.384 160.014 -0.119  1.00 21.43 ? 205 ARG A O   1 
ATOM   1556 C  CB  . ARG A 1 205 ? 29.103 158.501 1.468   1.00 21.46 ? 205 ARG A CB  1 
ATOM   1557 C  CG  . ARG A 1 205 ? 27.740 157.847 1.468   1.00 23.66 ? 205 ARG A CG  1 
ATOM   1558 C  CD  . ARG A 1 205 ? 26.850 158.396 2.567   1.00 23.78 ? 205 ARG A CD  1 
ATOM   1559 N  NE  . ARG A 1 205 ? 25.611 157.632 2.687   1.00 24.14 ? 205 ARG A NE  1 
ATOM   1560 C  CZ  . ARG A 1 205 ? 24.575 158.001 3.428   1.00 22.53 ? 205 ARG A CZ  1 
ATOM   1561 N  NH1 . ARG A 1 205 ? 24.623 159.133 4.112   1.00 26.22 ? 205 ARG A NH1 1 
ATOM   1562 N  NH2 . ARG A 1 205 ? 23.505 157.227 3.501   1.00 21.13 ? 205 ARG A NH2 1 
ATOM   1563 N  N   . ALA A 1 206 ? 32.288 158.197 0.845   1.00 20.26 ? 206 ALA A N   1 
ATOM   1564 C  CA  . ALA A 1 206 ? 33.600 158.790 0.976   1.00 20.25 ? 206 ALA A CA  1 
ATOM   1565 C  C   . ALA A 1 206 ? 34.471 158.613 -0.262  1.00 21.34 ? 206 ALA A C   1 
ATOM   1566 O  O   . ALA A 1 206 ? 35.277 159.487 -0.593  1.00 22.66 ? 206 ALA A O   1 
ATOM   1567 C  CB  . ALA A 1 206 ? 34.301 158.190 2.182   1.00 20.79 ? 206 ALA A CB  1 
ATOM   1568 N  N   . THR A 1 207 ? 34.305 157.493 -0.957  1.00 20.49 ? 207 THR A N   1 
ATOM   1569 C  CA  . THR A 1 207 ? 35.149 157.216 -2.112  1.00 20.45 ? 207 THR A CA  1 
ATOM   1570 C  C   . THR A 1 207 ? 34.434 156.716 -3.353  1.00 19.97 ? 207 THR A C   1 
ATOM   1571 O  O   . THR A 1 207 ? 34.991 156.777 -4.456  1.00 20.39 ? 207 THR A O   1 
ATOM   1572 C  CB  . THR A 1 207 ? 36.226 156.167 -1.750  1.00 21.97 ? 207 THR A CB  1 
ATOM   1573 O  OG1 . THR A 1 207 ? 35.612 154.877 -1.620  1.00 24.71 ? 207 THR A OG1 1 
ATOM   1574 C  CG2 . THR A 1 207 ? 36.891 156.522 -0.427  1.00 20.76 ? 207 THR A CG2 1 
ATOM   1575 N  N   . ASP A 1 208 ? 33.219 156.204 -3.177  1.00 18.19 ? 208 ASP A N   1 
ATOM   1576 C  CA  . ASP A 1 208 ? 32.445 155.680 -4.295  1.00 15.09 ? 208 ASP A CA  1 
ATOM   1577 C  C   . ASP A 1 208 ? 33.241 154.592 -5.004  1.00 13.52 ? 208 ASP A C   1 
ATOM   1578 O  O   . ASP A 1 208 ? 33.000 154.285 -6.167  1.00 13.72 ? 208 ASP A O   1 
ATOM   1579 C  CB  . ASP A 1 208 ? 32.112 156.802 -5.279  1.00 13.85 ? 208 ASP A CB  1 
ATOM   1580 C  CG  . ASP A 1 208 ? 31.177 157.826 -4.688  1.00 17.68 ? 208 ASP A CG  1 
ATOM   1581 O  OD1 . ASP A 1 208 ? 30.067 157.437 -4.271  1.00 22.17 ? 208 ASP A OD1 1 
ATOM   1582 O  OD2 . ASP A 1 208 ? 31.543 159.019 -4.631  1.00 20.62 ? 208 ASP A OD2 1 
ATOM   1583 N  N   . VAL A 1 209 ? 34.190 154.005 -4.292  1.00 12.17 ? 209 VAL A N   1 
ATOM   1584 C  CA  . VAL A 1 209 ? 35.025 152.968 -4.871  1.00 14.59 ? 209 VAL A CA  1 
ATOM   1585 C  C   . VAL A 1 209 ? 34.248 151.672 -5.100  1.00 16.76 ? 209 VAL A C   1 
ATOM   1586 O  O   . VAL A 1 209 ? 33.254 151.395 -4.424  1.00 17.32 ? 209 VAL A O   1 
ATOM   1587 C  CB  . VAL A 1 209 ? 36.248 152.664 -3.955  1.00 13.97 ? 209 VAL A CB  1 
ATOM   1588 C  CG1 . VAL A 1 209 ? 35.807 151.841 -2.751  1.00 13.75 ? 209 VAL A CG1 1 
ATOM   1589 C  CG2 . VAL A 1 209 ? 37.329 151.953 -4.738  1.00 9.01  ? 209 VAL A CG2 1 
ATOM   1590 N  N   . MET A 1 210 ? 34.696 150.886 -6.070  1.00 17.82 ? 210 MET A N   1 
ATOM   1591 C  CA  . MET A 1 210 ? 34.059 149.613 -6.336  1.00 19.50 ? 210 MET A CA  1 
ATOM   1592 C  C   . MET A 1 210 ? 34.556 148.621 -5.292  1.00 19.40 ? 210 MET A C   1 
ATOM   1593 O  O   . MET A 1 210 ? 35.763 148.475 -5.092  1.00 18.31 ? 210 MET A O   1 
ATOM   1594 C  CB  . MET A 1 210 ? 34.410 149.116 -7.731  1.00 22.07 ? 210 MET A CB  1 
ATOM   1595 C  CG  . MET A 1 210 ? 33.853 147.744 -8.010  1.00 25.36 ? 210 MET A CG  1 
ATOM   1596 S  SD  . MET A 1 210 ? 33.478 147.524 -9.736  1.00 29.28 ? 210 MET A SD  1 
ATOM   1597 C  CE  . MET A 1 210 ? 31.822 146.944 -9.666  1.00 28.74 ? 210 MET A CE  1 
ATOM   1598 N  N   . ILE A 1 211 ? 33.619 147.956 -4.624  1.00 19.23 ? 211 ILE A N   1 
ATOM   1599 C  CA  . ILE A 1 211 ? 33.941 146.988 -3.582  1.00 19.39 ? 211 ILE A CA  1 
ATOM   1600 C  C   . ILE A 1 211 ? 34.341 145.638 -4.175  1.00 20.07 ? 211 ILE A C   1 
ATOM   1601 O  O   . ILE A 1 211 ? 35.382 145.073 -3.835  1.00 20.68 ? 211 ILE A O   1 
ATOM   1602 C  CB  . ILE A 1 211 ? 32.731 146.761 -2.645  1.00 19.26 ? 211 ILE A CB  1 
ATOM   1603 C  CG1 . ILE A 1 211 ? 32.306 148.081 -2.000  1.00 17.46 ? 211 ILE A CG1 1 
ATOM   1604 C  CG2 . ILE A 1 211 ? 33.086 145.728 -1.583  1.00 19.18 ? 211 ILE A CG2 1 
ATOM   1605 C  CD1 . ILE A 1 211 ? 33.301 148.628 -1.008  1.00 17.34 ? 211 ILE A CD1 1 
ATOM   1606 N  N   . ALA A 1 212 ? 33.506 145.121 -5.065  1.00 19.83 ? 212 ALA A N   1 
ATOM   1607 C  CA  . ALA A 1 212 ? 33.779 143.834 -5.682  1.00 20.81 ? 212 ALA A CA  1 
ATOM   1608 C  C   . ALA A 1 212 ? 35.201 143.786 -6.215  1.00 20.70 ? 212 ALA A C   1 
ATOM   1609 O  O   . ALA A 1 212 ? 35.714 144.777 -6.727  1.00 22.77 ? 212 ALA A O   1 
ATOM   1610 C  CB  . ALA A 1 212 ? 32.788 143.573 -6.813  1.00 21.09 ? 212 ALA A CB  1 
ATOM   1611 N  N   . GLY A 1 213 ? 35.840 142.632 -6.076  1.00 19.78 ? 213 GLY A N   1 
ATOM   1612 C  CA  . GLY A 1 213 ? 37.188 142.474 -6.581  1.00 20.55 ? 213 GLY A CA  1 
ATOM   1613 C  C   . GLY A 1 213 ? 38.274 142.992 -5.670  1.00 20.34 ? 213 GLY A C   1 
ATOM   1614 O  O   . GLY A 1 213 ? 39.453 142.783 -5.924  1.00 21.80 ? 213 GLY A O   1 
ATOM   1615 N  N   . LYS A 1 214 ? 37.895 143.673 -4.605  1.00 20.84 ? 214 LYS A N   1 
ATOM   1616 C  CA  . LYS A 1 214 ? 38.900 144.188 -3.699  1.00 20.25 ? 214 LYS A CA  1 
ATOM   1617 C  C   . LYS A 1 214 ? 39.098 143.287 -2.499  1.00 19.91 ? 214 LYS A C   1 
ATOM   1618 O  O   . LYS A 1 214 ? 38.208 142.511 -2.132  1.00 21.57 ? 214 LYS A O   1 
ATOM   1619 C  CB  . LYS A 1 214 ? 38.530 145.599 -3.241  1.00 19.37 ? 214 LYS A CB  1 
ATOM   1620 C  CG  . LYS A 1 214 ? 38.834 146.616 -4.296  1.00 22.19 ? 214 LYS A CG  1 
ATOM   1621 C  CD  . LYS A 1 214 ? 38.499 148.024 -3.882  1.00 23.65 ? 214 LYS A CD  1 
ATOM   1622 C  CE  . LYS A 1 214 ? 38.796 148.952 -5.041  1.00 22.43 ? 214 LYS A CE  1 
ATOM   1623 N  NZ  . LYS A 1 214 ? 38.233 148.373 -6.301  1.00 24.19 ? 214 LYS A NZ  1 
ATOM   1624 N  N   . VAL A 1 215 ? 40.284 143.379 -1.913  1.00 16.16 ? 215 VAL A N   1 
ATOM   1625 C  CA  . VAL A 1 215 ? 40.606 142.611 -0.732  1.00 15.02 ? 215 VAL A CA  1 
ATOM   1626 C  C   . VAL A 1 215 ? 40.342 143.548 0.443   1.00 16.49 ? 215 VAL A C   1 
ATOM   1627 O  O   . VAL A 1 215 ? 40.950 144.620 0.558   1.00 16.77 ? 215 VAL A O   1 
ATOM   1628 C  CB  . VAL A 1 215 ? 42.091 142.166 -0.715  1.00 14.64 ? 215 VAL A CB  1 
ATOM   1629 C  CG1 . VAL A 1 215 ? 42.416 141.498 0.617   1.00 12.59 ? 215 VAL A CG1 1 
ATOM   1630 C  CG2 . VAL A 1 215 ? 42.364 141.210 -1.862  1.00 10.54 ? 215 VAL A CG2 1 
ATOM   1631 N  N   . ALA A 1 216 ? 39.410 143.156 1.300   1.00 14.89 ? 216 ALA A N   1 
ATOM   1632 C  CA  . ALA A 1 216 ? 39.076 143.962 2.452   1.00 14.27 ? 216 ALA A CA  1 
ATOM   1633 C  C   . ALA A 1 216 ? 39.559 143.233 3.679   1.00 15.98 ? 216 ALA A C   1 
ATOM   1634 O  O   . ALA A 1 216 ? 39.120 142.121 3.960   1.00 19.83 ? 216 ALA A O   1 
ATOM   1635 C  CB  . ALA A 1 216 ? 37.579 144.171 2.523   1.00 13.45 ? 216 ALA A CB  1 
ATOM   1636 N  N   . VAL A 1 217 ? 40.483 143.844 4.405   1.00 15.84 ? 217 VAL A N   1 
ATOM   1637 C  CA  . VAL A 1 217 ? 40.989 143.222 5.611   1.00 14.80 ? 217 VAL A CA  1 
ATOM   1638 C  C   . VAL A 1 217 ? 40.181 143.780 6.767   1.00 15.18 ? 217 VAL A C   1 
ATOM   1639 O  O   . VAL A 1 217 ? 40.097 144.989 6.955   1.00 15.44 ? 217 VAL A O   1 
ATOM   1640 C  CB  . VAL A 1 217 ? 42.478 143.523 5.821   1.00 14.45 ? 217 VAL A CB  1 
ATOM   1641 C  CG1 . VAL A 1 217 ? 42.977 142.800 7.054   1.00 14.91 ? 217 VAL A CG1 1 
ATOM   1642 C  CG2 . VAL A 1 217 ? 43.268 143.087 4.600   1.00 14.29 ? 217 VAL A CG2 1 
ATOM   1643 N  N   . VAL A 1 218 ? 39.561 142.887 7.523   1.00 15.49 ? 218 VAL A N   1 
ATOM   1644 C  CA  . VAL A 1 218 ? 38.745 143.286 8.650   1.00 15.72 ? 218 VAL A CA  1 
ATOM   1645 C  C   . VAL A 1 218 ? 39.368 142.787 9.943   1.00 17.27 ? 218 VAL A C   1 
ATOM   1646 O  O   . VAL A 1 218 ? 39.309 141.595 10.261  1.00 19.93 ? 218 VAL A O   1 
ATOM   1647 C  CB  . VAL A 1 218 ? 37.319 142.723 8.508   1.00 15.30 ? 218 VAL A CB  1 
ATOM   1648 C  CG1 . VAL A 1 218 ? 36.498 143.045 9.744   1.00 16.10 ? 218 VAL A CG1 1 
ATOM   1649 C  CG2 . VAL A 1 218 ? 36.665 143.306 7.277   1.00 14.45 ? 218 VAL A CG2 1 
ATOM   1650 N  N   . ALA A 1 219 ? 39.983 143.705 10.679  1.00 17.18 ? 219 ALA A N   1 
ATOM   1651 C  CA  . ALA A 1 219 ? 40.615 143.368 11.943  1.00 16.55 ? 219 ALA A CA  1 
ATOM   1652 C  C   . ALA A 1 219 ? 39.532 143.118 12.983  1.00 17.28 ? 219 ALA A C   1 
ATOM   1653 O  O   . ALA A 1 219 ? 38.759 144.014 13.322  1.00 17.25 ? 219 ALA A O   1 
ATOM   1654 C  CB  . ALA A 1 219 ? 41.528 144.500 12.390  1.00 16.31 ? 219 ALA A CB  1 
ATOM   1655 N  N   . GLY A 1 220 ? 39.477 141.890 13.487  1.00 17.92 ? 220 GLY A N   1 
ATOM   1656 C  CA  . GLY A 1 220 ? 38.474 141.548 14.477  1.00 17.32 ? 220 GLY A CA  1 
ATOM   1657 C  C   . GLY A 1 220 ? 37.281 140.834 13.860  1.00 17.94 ? 220 GLY A C   1 
ATOM   1658 O  O   . GLY A 1 220 ? 36.848 141.145 12.742  1.00 17.23 ? 220 GLY A O   1 
ATOM   1659 N  N   . TYR A 1 221 ? 36.748 139.862 14.590  1.00 17.58 ? 221 TYR A N   1 
ATOM   1660 C  CA  . TYR A 1 221 ? 35.609 139.109 14.103  1.00 17.66 ? 221 TYR A CA  1 
ATOM   1661 C  C   . TYR A 1 221 ? 34.572 138.930 15.205  1.00 18.49 ? 221 TYR A C   1 
ATOM   1662 O  O   . TYR A 1 221 ? 34.062 137.833 15.433  1.00 19.34 ? 221 TYR A O   1 
ATOM   1663 C  CB  . TYR A 1 221 ? 36.060 137.747 13.567  1.00 16.76 ? 221 TYR A CB  1 
ATOM   1664 C  CG  . TYR A 1 221 ? 35.026 137.073 12.695  1.00 18.19 ? 221 TYR A CG  1 
ATOM   1665 C  CD1 . TYR A 1 221 ? 34.728 137.569 11.430  1.00 16.12 ? 221 TYR A CD1 1 
ATOM   1666 C  CD2 . TYR A 1 221 ? 34.341 135.938 13.139  1.00 18.54 ? 221 TYR A CD2 1 
ATOM   1667 C  CE1 . TYR A 1 221 ? 33.781 136.957 10.628  1.00 16.49 ? 221 TYR A CE1 1 
ATOM   1668 C  CE2 . TYR A 1 221 ? 33.394 135.320 12.347  1.00 17.37 ? 221 TYR A CE2 1 
ATOM   1669 C  CZ  . TYR A 1 221 ? 33.117 135.833 11.090  1.00 18.93 ? 221 TYR A CZ  1 
ATOM   1670 O  OH  . TYR A 1 221 ? 32.176 135.215 10.293  1.00 18.06 ? 221 TYR A OH  1 
ATOM   1671 N  N   . GLY A 1 222 ? 34.296 140.019 15.915  1.00 18.98 ? 222 GLY A N   1 
ATOM   1672 C  CA  . GLY A 1 222 ? 33.278 139.994 16.946  1.00 18.35 ? 222 GLY A CA  1 
ATOM   1673 C  C   . GLY A 1 222 ? 31.977 140.292 16.218  1.00 18.33 ? 222 GLY A C   1 
ATOM   1674 O  O   . GLY A 1 222 ? 31.840 139.955 15.039  1.00 18.15 ? 222 GLY A O   1 
ATOM   1675 N  N   . ASP A 1 223 ? 31.019 140.929 16.876  1.00 17.44 ? 223 ASP A N   1 
ATOM   1676 C  CA  . ASP A 1 223 ? 29.778 141.223 16.182  1.00 17.49 ? 223 ASP A CA  1 
ATOM   1677 C  C   . ASP A 1 223 ? 29.972 142.287 15.117  1.00 15.20 ? 223 ASP A C   1 
ATOM   1678 O  O   . ASP A 1 223 ? 29.433 142.175 14.017  1.00 14.13 ? 223 ASP A O   1 
ATOM   1679 C  CB  . ASP A 1 223 ? 28.694 141.657 17.164  1.00 22.24 ? 223 ASP A CB  1 
ATOM   1680 C  CG  . ASP A 1 223 ? 28.191 140.506 18.015  1.00 26.70 ? 223 ASP A CG  1 
ATOM   1681 O  OD1 . ASP A 1 223 ? 28.115 139.369 17.499  1.00 25.53 ? 223 ASP A OD1 1 
ATOM   1682 O  OD2 . ASP A 1 223 ? 27.860 140.743 19.196  1.00 31.74 ? 223 ASP A OD2 1 
ATOM   1683 N  N   . VAL A 1 224 ? 30.749 143.316 15.442  1.00 14.63 ? 224 VAL A N   1 
ATOM   1684 C  CA  . VAL A 1 224 ? 31.008 144.394 14.492  1.00 12.99 ? 224 VAL A CA  1 
ATOM   1685 C  C   . VAL A 1 224 ? 31.772 143.808 13.316  1.00 13.83 ? 224 VAL A C   1 
ATOM   1686 O  O   . VAL A 1 224 ? 31.374 143.987 12.159  1.00 14.12 ? 224 VAL A O   1 
ATOM   1687 C  CB  . VAL A 1 224 ? 31.838 145.540 15.132  1.00 12.72 ? 224 VAL A CB  1 
ATOM   1688 C  CG1 . VAL A 1 224 ? 32.153 146.612 14.088  1.00 11.61 ? 224 VAL A CG1 1 
ATOM   1689 C  CG2 . VAL A 1 224 ? 31.062 146.163 16.287  1.00 8.96  ? 224 VAL A CG2 1 
ATOM   1690 N  N   . GLY A 1 225 ? 32.857 143.094 13.626  1.00 12.03 ? 225 GLY A N   1 
ATOM   1691 C  CA  . GLY A 1 225 ? 33.660 142.469 12.593  1.00 11.74 ? 225 GLY A CA  1 
ATOM   1692 C  C   . GLY A 1 225 ? 32.857 141.509 11.734  1.00 12.74 ? 225 GLY A C   1 
ATOM   1693 O  O   . GLY A 1 225 ? 33.005 141.481 10.510  1.00 12.11 ? 225 GLY A O   1 
ATOM   1694 N  N   . LYS A 1 226 ? 32.001 140.716 12.372  1.00 14.03 ? 226 LYS A N   1 
ATOM   1695 C  CA  . LYS A 1 226 ? 31.171 139.764 11.640  1.00 15.23 ? 226 LYS A CA  1 
ATOM   1696 C  C   . LYS A 1 226 ? 30.297 140.471 10.622  1.00 14.42 ? 226 LYS A C   1 
ATOM   1697 O  O   . LYS A 1 226 ? 30.256 140.083 9.455   1.00 15.20 ? 226 LYS A O   1 
ATOM   1698 C  CB  . LYS A 1 226 ? 30.290 138.959 12.599  1.00 15.06 ? 226 LYS A CB  1 
ATOM   1699 C  CG  . LYS A 1 226 ? 31.025 137.843 13.339  1.00 15.32 ? 226 LYS A CG  1 
ATOM   1700 C  CD  . LYS A 1 226 ? 30.068 137.045 14.212  1.00 14.90 ? 226 LYS A CD  1 
ATOM   1701 C  CE  . LYS A 1 226 ? 30.767 135.889 14.910  1.00 14.44 ? 226 LYS A CE  1 
ATOM   1702 N  NZ  . LYS A 1 226 ? 31.730 136.340 15.942  1.00 11.75 ? 226 LYS A NZ  1 
ATOM   1703 N  N   . GLY A 1 227 ? 29.605 141.514 11.067  1.00 15.10 ? 227 GLY A N   1 
ATOM   1704 C  CA  . GLY A 1 227 ? 28.734 142.255 10.175  1.00 15.23 ? 227 GLY A CA  1 
ATOM   1705 C  C   . GLY A 1 227 ? 29.474 142.937 9.041   1.00 15.68 ? 227 GLY A C   1 
ATOM   1706 O  O   . GLY A 1 227 ? 28.982 142.975 7.910   1.00 17.09 ? 227 GLY A O   1 
ATOM   1707 N  N   . CYS A 1 228 ? 30.656 143.475 9.334   1.00 15.81 ? 228 CYS A N   1 
ATOM   1708 C  CA  . CYS A 1 228 ? 31.448 144.161 8.315   1.00 17.58 ? 228 CYS A CA  1 
ATOM   1709 C  C   . CYS A 1 228 ? 31.873 143.172 7.254   1.00 18.57 ? 228 CYS A C   1 
ATOM   1710 O  O   . CYS A 1 228 ? 31.742 143.434 6.057   1.00 19.06 ? 228 CYS A O   1 
ATOM   1711 C  CB  . CYS A 1 228 ? 32.688 144.826 8.931   1.00 16.24 ? 228 CYS A CB  1 
ATOM   1712 S  SG  . CYS A 1 228 ? 32.324 146.301 9.933   1.00 17.68 ? 228 CYS A SG  1 
ATOM   1713 N  N   . ALA A 1 229 ? 32.378 142.031 7.714   1.00 19.46 ? 229 ALA A N   1 
ATOM   1714 C  CA  . ALA A 1 229 ? 32.826 140.963 6.837   1.00 18.81 ? 229 ALA A CA  1 
ATOM   1715 C  C   . ALA A 1 229 ? 31.668 140.498 5.951   1.00 18.84 ? 229 ALA A C   1 
ATOM   1716 O  O   . ALA A 1 229 ? 31.823 140.329 4.737   1.00 17.70 ? 229 ALA A O   1 
ATOM   1717 C  CB  . ALA A 1 229 ? 33.345 139.808 7.676   1.00 18.95 ? 229 ALA A CB  1 
ATOM   1718 N  N   . GLN A 1 230 ? 30.503 140.302 6.559   1.00 18.36 ? 230 GLN A N   1 
ATOM   1719 C  CA  . GLN A 1 230 ? 29.336 139.850 5.811   1.00 20.31 ? 230 GLN A CA  1 
ATOM   1720 C  C   . GLN A 1 230 ? 28.926 140.872 4.751   1.00 19.92 ? 230 GLN A C   1 
ATOM   1721 O  O   . GLN A 1 230 ? 28.660 140.518 3.599   1.00 19.18 ? 230 GLN A O   1 
ATOM   1722 C  CB  . GLN A 1 230 ? 28.178 139.584 6.763   1.00 20.05 ? 230 GLN A CB  1 
ATOM   1723 C  CG  . GLN A 1 230 ? 26.943 139.012 6.096   1.00 19.42 ? 230 GLN A CG  1 
ATOM   1724 C  CD  . GLN A 1 230 ? 25.943 138.527 7.124   1.00 21.16 ? 230 GLN A CD  1 
ATOM   1725 O  OE1 . GLN A 1 230 ? 26.024 138.897 8.301   1.00 22.87 ? 230 GLN A OE1 1 
ATOM   1726 N  NE2 . GLN A 1 230 ? 24.992 137.704 6.693   1.00 18.76 ? 230 GLN A NE2 1 
ATOM   1727 N  N   . ALA A 1 231 ? 28.875 142.140 5.145   1.00 19.08 ? 231 ALA A N   1 
ATOM   1728 C  CA  . ALA A 1 231 ? 28.525 143.196 4.208   1.00 17.86 ? 231 ALA A CA  1 
ATOM   1729 C  C   . ALA A 1 231 ? 29.491 143.163 3.015   1.00 18.05 ? 231 ALA A C   1 
ATOM   1730 O  O   . ALA A 1 231 ? 29.066 143.016 1.868   1.00 18.91 ? 231 ALA A O   1 
ATOM   1731 C  CB  . ALA A 1 231 ? 28.590 144.547 4.903   1.00 14.25 ? 231 ALA A CB  1 
ATOM   1732 N  N   . LEU A 1 232 ? 30.788 143.286 3.299   1.00 17.42 ? 232 LEU A N   1 
ATOM   1733 C  CA  . LEU A 1 232 ? 31.825 143.285 2.270   1.00 16.94 ? 232 LEU A CA  1 
ATOM   1734 C  C   . LEU A 1 232 ? 31.763 142.069 1.357   1.00 18.22 ? 232 LEU A C   1 
ATOM   1735 O  O   . LEU A 1 232 ? 31.889 142.192 0.139   1.00 18.07 ? 232 LEU A O   1 
ATOM   1736 C  CB  . LEU A 1 232 ? 33.204 143.356 2.922   1.00 15.71 ? 232 LEU A CB  1 
ATOM   1737 C  CG  . LEU A 1 232 ? 33.536 144.681 3.609   1.00 16.78 ? 232 LEU A CG  1 
ATOM   1738 C  CD1 . LEU A 1 232 ? 34.685 144.484 4.587   1.00 15.98 ? 232 LEU A CD1 1 
ATOM   1739 C  CD2 . LEU A 1 232 ? 33.871 145.728 2.563   1.00 13.17 ? 232 LEU A CD2 1 
ATOM   1740 N  N   . ARG A 1 233 ? 31.591 140.892 1.948   1.00 19.21 ? 233 ARG A N   1 
ATOM   1741 C  CA  . ARG A 1 233 ? 31.511 139.669 1.169   1.00 20.04 ? 233 ARG A CA  1 
ATOM   1742 C  C   . ARG A 1 233 ? 30.322 139.731 0.230   1.00 19.72 ? 233 ARG A C   1 
ATOM   1743 O  O   . ARG A 1 233 ? 30.367 139.209 -0.882  1.00 20.76 ? 233 ARG A O   1 
ATOM   1744 C  CB  . ARG A 1 233 ? 31.355 138.458 2.082   1.00 23.01 ? 233 ARG A CB  1 
ATOM   1745 C  CG  . ARG A 1 233 ? 30.731 137.272 1.369   1.00 27.28 ? 233 ARG A CG  1 
ATOM   1746 C  CD  . ARG A 1 233 ? 30.585 136.082 2.279   1.00 30.93 ? 233 ARG A CD  1 
ATOM   1747 N  NE  . ARG A 1 233 ? 31.878 135.474 2.559   1.00 36.55 ? 233 ARG A NE  1 
ATOM   1748 C  CZ  . ARG A 1 233 ? 32.049 134.428 3.358   1.00 38.96 ? 233 ARG A CZ  1 
ATOM   1749 N  NH1 . ARG A 1 233 ? 30.998 133.877 3.958   1.00 39.49 ? 233 ARG A NH1 1 
ATOM   1750 N  NH2 . ARG A 1 233 ? 33.269 133.935 3.554   1.00 38.80 ? 233 ARG A NH2 1 
ATOM   1751 N  N   . GLY A 1 234 ? 29.257 140.374 0.691   1.00 19.63 ? 234 GLY A N   1 
ATOM   1752 C  CA  . GLY A 1 234 ? 28.057 140.490 -0.111  1.00 18.85 ? 234 GLY A CA  1 
ATOM   1753 C  C   . GLY A 1 234 ? 28.248 141.332 -1.351  1.00 18.30 ? 234 GLY A C   1 
ATOM   1754 O  O   . GLY A 1 234 ? 27.439 141.274 -2.272  1.00 18.37 ? 234 GLY A O   1 
ATOM   1755 N  N   . PHE A 1 235 ? 29.319 142.113 -1.385  1.00 19.08 ? 235 PHE A N   1 
ATOM   1756 C  CA  . PHE A 1 235 ? 29.584 142.975 -2.531  1.00 20.17 ? 235 PHE A CA  1 
ATOM   1757 C  C   . PHE A 1 235 ? 30.613 142.423 -3.492  1.00 17.21 ? 235 PHE A C   1 
ATOM   1758 O  O   . PHE A 1 235 ? 30.922 143.044 -4.513  1.00 15.66 ? 235 PHE A O   1 
ATOM   1759 C  CB  . PHE A 1 235 ? 30.014 144.362 -2.062  1.00 23.35 ? 235 PHE A CB  1 
ATOM   1760 C  CG  . PHE A 1 235 ? 28.873 145.293 -1.858  1.00 27.20 ? 235 PHE A CG  1 
ATOM   1761 C  CD1 . PHE A 1 235 ? 28.101 145.699 -2.936  1.00 29.26 ? 235 PHE A CD1 1 
ATOM   1762 C  CD2 . PHE A 1 235 ? 28.548 145.746 -0.594  1.00 29.46 ? 235 PHE A CD2 1 
ATOM   1763 C  CE1 . PHE A 1 235 ? 27.025 146.540 -2.758  1.00 29.22 ? 235 PHE A CE1 1 
ATOM   1764 C  CE2 . PHE A 1 235 ? 27.468 146.590 -0.411  1.00 31.85 ? 235 PHE A CE2 1 
ATOM   1765 C  CZ  . PHE A 1 235 ? 26.706 146.986 -1.496  1.00 30.05 ? 235 PHE A CZ  1 
ATOM   1766 N  N   . GLY A 1 236 ? 31.141 141.253 -3.162  1.00 14.74 ? 236 GLY A N   1 
ATOM   1767 C  CA  . GLY A 1 236 ? 32.117 140.636 -4.034  1.00 13.98 ? 236 GLY A CA  1 
ATOM   1768 C  C   . GLY A 1 236 ? 33.544 140.885 -3.618  1.00 12.40 ? 236 GLY A C   1 
ATOM   1769 O  O   . GLY A 1 236 ? 34.450 140.683 -4.407  1.00 13.82 ? 236 GLY A O   1 
ATOM   1770 N  N   . ALA A 1 237 ? 33.748 141.324 -2.383  1.00 12.71 ? 237 ALA A N   1 
ATOM   1771 C  CA  . ALA A 1 237 ? 35.094 141.567 -1.885  1.00 13.81 ? 237 ALA A CA  1 
ATOM   1772 C  C   . ALA A 1 237 ? 35.644 140.291 -1.252  1.00 14.67 ? 237 ALA A C   1 
ATOM   1773 O  O   . ALA A 1 237 ? 34.893 139.515 -0.656  1.00 13.46 ? 237 ALA A O   1 
ATOM   1774 C  CB  . ALA A 1 237 ? 35.078 142.681 -0.850  1.00 12.94 ? 237 ALA A CB  1 
ATOM   1775 N  N   . ARG A 1 238 ? 36.949 140.071 -1.401  1.00 15.39 ? 238 ARG A N   1 
ATOM   1776 C  CA  . ARG A 1 238 ? 37.606 138.917 -0.802  1.00 15.01 ? 238 ARG A CA  1 
ATOM   1777 C  C   . ARG A 1 238 ? 37.999 139.394 0.588   1.00 16.47 ? 238 ARG A C   1 
ATOM   1778 O  O   . ARG A 1 238 ? 38.987 140.101 0.757   1.00 18.08 ? 238 ARG A O   1 
ATOM   1779 C  CB  . ARG A 1 238 ? 38.851 138.523 -1.604  1.00 15.08 ? 238 ARG A CB  1 
ATOM   1780 C  CG  . ARG A 1 238 ? 39.536 137.241 -1.117  1.00 16.21 ? 238 ARG A CG  1 
ATOM   1781 C  CD  . ARG A 1 238 ? 40.214 136.494 -2.264  1.00 13.61 ? 238 ARG A CD  1 
ATOM   1782 N  NE  . ARG A 1 238 ? 41.380 137.193 -2.796  1.00 10.40 ? 238 ARG A NE  1 
ATOM   1783 C  CZ  . ARG A 1 238 ? 42.554 137.242 -2.183  1.00 11.57 ? 238 ARG A CZ  1 
ATOM   1784 N  NH1 . ARG A 1 238 ? 42.721 136.636 -1.018  1.00 13.92 ? 238 ARG A NH1 1 
ATOM   1785 N  NH2 . ARG A 1 238 ? 43.564 137.888 -2.735  1.00 13.55 ? 238 ARG A NH2 1 
ATOM   1786 N  N   . VAL A 1 239 ? 37.207 139.015 1.582   1.00 17.19 ? 239 VAL A N   1 
ATOM   1787 C  CA  . VAL A 1 239 ? 37.450 139.438 2.949   1.00 16.75 ? 239 VAL A CA  1 
ATOM   1788 C  C   . VAL A 1 239 ? 38.497 138.621 3.692   1.00 17.25 ? 239 VAL A C   1 
ATOM   1789 O  O   . VAL A 1 239 ? 38.452 137.397 3.706   1.00 17.86 ? 239 VAL A O   1 
ATOM   1790 C  CB  . VAL A 1 239 ? 36.131 139.411 3.768   1.00 17.71 ? 239 VAL A CB  1 
ATOM   1791 C  CG1 . VAL A 1 239 ? 36.412 139.720 5.230   1.00 14.38 ? 239 VAL A CG1 1 
ATOM   1792 C  CG2 . VAL A 1 239 ? 35.140 140.412 3.187   1.00 16.83 ? 239 VAL A CG2 1 
ATOM   1793 N  N   . ILE A 1 240 ? 39.450 139.317 4.300   1.00 17.58 ? 240 ILE A N   1 
ATOM   1794 C  CA  . ILE A 1 240 ? 40.487 138.672 5.089   1.00 17.15 ? 240 ILE A CA  1 
ATOM   1795 C  C   . ILE A 1 240 ? 40.288 139.137 6.525   1.00 18.09 ? 240 ILE A C   1 
ATOM   1796 O  O   . ILE A 1 240 ? 40.143 140.331 6.798   1.00 18.50 ? 240 ILE A O   1 
ATOM   1797 C  CB  . ILE A 1 240 ? 41.906 139.048 4.611   1.00 17.17 ? 240 ILE A CB  1 
ATOM   1798 C  CG1 . ILE A 1 240 ? 42.148 138.479 3.213   1.00 17.45 ? 240 ILE A CG1 1 
ATOM   1799 C  CG2 . ILE A 1 240 ? 42.946 138.504 5.577   1.00 16.74 ? 240 ILE A CG2 1 
ATOM   1800 C  CD1 . ILE A 1 240 ? 43.577 138.588 2.755   1.00 17.01 ? 240 ILE A CD1 1 
ATOM   1801 N  N   . ILE A 1 241 ? 40.274 138.178 7.441   1.00 17.98 ? 241 ILE A N   1 
ATOM   1802 C  CA  . ILE A 1 241 ? 40.058 138.461 8.851   1.00 16.48 ? 241 ILE A CA  1 
ATOM   1803 C  C   . ILE A 1 241 ? 41.322 138.331 9.705   1.00 17.24 ? 241 ILE A C   1 
ATOM   1804 O  O   . ILE A 1 241 ? 42.193 137.515 9.413   1.00 18.57 ? 241 ILE A O   1 
ATOM   1805 C  CB  . ILE A 1 241 ? 38.986 137.496 9.423   1.00 14.19 ? 241 ILE A CB  1 
ATOM   1806 C  CG1 . ILE A 1 241 ? 37.680 137.633 8.634   1.00 13.85 ? 241 ILE A CG1 1 
ATOM   1807 C  CG2 . ILE A 1 241 ? 38.751 137.784 10.884  1.00 14.65 ? 241 ILE A CG2 1 
ATOM   1808 C  CD1 . ILE A 1 241 ? 37.067 139.020 8.684   1.00 13.97 ? 241 ILE A CD1 1 
ATOM   1809 N  N   . THR A 1 242 ? 41.432 139.163 10.738  1.00 15.10 ? 242 THR A N   1 
ATOM   1810 C  CA  . THR A 1 242 ? 42.552 139.066 11.665  1.00 14.57 ? 242 THR A CA  1 
ATOM   1811 C  C   . THR A 1 242 ? 41.856 138.903 13.009  1.00 15.52 ? 242 THR A C   1 
ATOM   1812 O  O   . THR A 1 242 ? 40.781 139.451 13.221  1.00 15.66 ? 242 THR A O   1 
ATOM   1813 C  CB  . THR A 1 242 ? 43.462 140.338 11.696  1.00 13.84 ? 242 THR A CB  1 
ATOM   1814 O  OG1 . THR A 1 242 ? 42.894 141.322 12.564  1.00 14.99 ? 242 THR A OG1 1 
ATOM   1815 C  CG2 . THR A 1 242 ? 43.623 140.925 10.309  1.00 14.35 ? 242 THR A CG2 1 
ATOM   1816 N  N   . GLU A 1 243 ? 42.447 138.135 13.912  1.00 16.85 ? 243 GLU A N   1 
ATOM   1817 C  CA  . GLU A 1 243 ? 41.831 137.915 15.212  1.00 17.22 ? 243 GLU A CA  1 
ATOM   1818 C  C   . GLU A 1 243 ? 42.843 137.410 16.234  1.00 19.31 ? 243 GLU A C   1 
ATOM   1819 O  O   . GLU A 1 243 ? 43.862 136.814 15.883  1.00 17.97 ? 243 GLU A O   1 
ATOM   1820 C  CB  . GLU A 1 243 ? 40.680 136.907 15.083  1.00 16.92 ? 243 GLU A CB  1 
ATOM   1821 C  CG  . GLU A 1 243 ? 39.284 137.504 15.221  1.00 15.64 ? 243 GLU A CG  1 
ATOM   1822 C  CD  . GLU A 1 243 ? 38.968 137.890 16.651  1.00 17.41 ? 243 GLU A CD  1 
ATOM   1823 O  OE1 . GLU A 1 243 ? 39.887 137.811 17.499  1.00 17.82 ? 243 GLU A OE1 1 
ATOM   1824 O  OE2 . GLU A 1 243 ? 37.812 138.275 16.930  1.00 12.96 ? 243 GLU A OE2 1 
ATOM   1825 N  N   . ILE A 1 244 ? 42.549 137.671 17.502  1.00 19.92 ? 244 ILE A N   1 
ATOM   1826 C  CA  . ILE A 1 244 ? 43.399 137.244 18.605  1.00 21.97 ? 244 ILE A CA  1 
ATOM   1827 C  C   . ILE A 1 244 ? 42.687 136.132 19.374  1.00 23.35 ? 244 ILE A C   1 
ATOM   1828 O  O   . ILE A 1 244 ? 43.308 135.381 20.132  1.00 23.44 ? 244 ILE A O   1 
ATOM   1829 C  CB  . ILE A 1 244 ? 43.649 138.383 19.596  1.00 21.08 ? 244 ILE A CB  1 
ATOM   1830 C  CG1 . ILE A 1 244 ? 42.307 138.938 20.074  1.00 19.35 ? 244 ILE A CG1 1 
ATOM   1831 C  CG2 . ILE A 1 244 ? 44.501 139.445 18.956  1.00 23.00 ? 244 ILE A CG2 1 
ATOM   1832 C  CD1 . ILE A 1 244 ? 42.293 139.318 21.510  1.00 18.46 ? 244 ILE A CD1 1 
ATOM   1833 N  N   . ASP A 1 245 ? 41.373 136.058 19.193  1.00 22.68 ? 245 ASP A N   1 
ATOM   1834 C  CA  . ASP A 1 245 ? 40.575 135.045 19.859  1.00 22.73 ? 245 ASP A CA  1 
ATOM   1835 C  C   . ASP A 1 245 ? 40.472 133.836 18.926  1.00 22.71 ? 245 ASP A C   1 
ATOM   1836 O  O   . ASP A 1 245 ? 39.976 133.946 17.799  1.00 22.47 ? 245 ASP A O   1 
ATOM   1837 C  CB  . ASP A 1 245 ? 39.184 135.597 20.176  1.00 22.22 ? 245 ASP A CB  1 
ATOM   1838 C  CG  . ASP A 1 245 ? 38.397 134.687 21.095  1.00 22.75 ? 245 ASP A CG  1 
ATOM   1839 O  OD1 . ASP A 1 245 ? 38.410 133.460 20.860  1.00 22.63 ? 245 ASP A OD1 1 
ATOM   1840 O  OD2 . ASP A 1 245 ? 37.760 135.196 22.042  1.00 21.46 ? 245 ASP A OD2 1 
ATOM   1841 N  N   . PRO A 1 246 ? 40.946 132.668 19.388  1.00 21.17 ? 246 PRO A N   1 
ATOM   1842 C  CA  . PRO A 1 246 ? 40.923 131.422 18.614  1.00 20.49 ? 246 PRO A CA  1 
ATOM   1843 C  C   . PRO A 1 246 ? 39.510 130.981 18.256  1.00 20.24 ? 246 PRO A C   1 
ATOM   1844 O  O   . PRO A 1 246 ? 39.284 130.385 17.204  1.00 19.10 ? 246 PRO A O   1 
ATOM   1845 C  CB  . PRO A 1 246 ? 41.618 130.433 19.537  1.00 20.87 ? 246 PRO A CB  1 
ATOM   1846 C  CG  . PRO A 1 246 ? 41.226 130.923 20.896  1.00 20.71 ? 246 PRO A CG  1 
ATOM   1847 C  CD  . PRO A 1 246 ? 41.398 132.420 20.768  1.00 19.84 ? 246 PRO A CD  1 
ATOM   1848 N  N   . ILE A 1 247 ? 38.563 131.286 19.137  1.00 18.95 ? 247 ILE A N   1 
ATOM   1849 C  CA  . ILE A 1 247 ? 37.176 130.918 18.910  1.00 18.14 ? 247 ILE A CA  1 
ATOM   1850 C  C   . ILE A 1 247 ? 36.581 131.752 17.782  1.00 17.71 ? 247 ILE A C   1 
ATOM   1851 O  O   . ILE A 1 247 ? 35.972 131.215 16.861  1.00 18.77 ? 247 ILE A O   1 
ATOM   1852 C  CB  . ILE A 1 247 ? 36.337 131.111 20.184  1.00 16.82 ? 247 ILE A CB  1 
ATOM   1853 C  CG1 . ILE A 1 247 ? 36.824 130.144 21.270  1.00 16.46 ? 247 ILE A CG1 1 
ATOM   1854 C  CG2 . ILE A 1 247 ? 34.862 130.894 19.876  1.00 16.11 ? 247 ILE A CG2 1 
ATOM   1855 C  CD1 . ILE A 1 247 ? 36.078 130.264 22.608  1.00 14.05 ? 247 ILE A CD1 1 
ATOM   1856 N  N   . ASN A 1 248 ? 36.767 133.064 17.856  1.00 16.71 ? 248 ASN A N   1 
ATOM   1857 C  CA  . ASN A 1 248 ? 36.250 133.962 16.837  1.00 16.52 ? 248 ASN A CA  1 
ATOM   1858 C  C   . ASN A 1 248 ? 36.905 133.678 15.489  1.00 16.42 ? 248 ASN A C   1 
ATOM   1859 O  O   . ASN A 1 248 ? 36.247 133.702 14.447  1.00 16.07 ? 248 ASN A O   1 
ATOM   1860 C  CB  . ASN A 1 248 ? 36.503 135.406 17.259  1.00 17.96 ? 248 ASN A CB  1 
ATOM   1861 C  CG  . ASN A 1 248 ? 35.633 135.828 18.425  1.00 19.44 ? 248 ASN A CG  1 
ATOM   1862 O  OD1 . ASN A 1 248 ? 34.585 136.443 18.240  1.00 22.82 ? 248 ASN A OD1 1 
ATOM   1863 N  ND2 . ASN A 1 248 ? 36.054 135.484 19.632  1.00 19.01 ? 248 ASN A ND2 1 
ATOM   1864 N  N   . ALA A 1 249 ? 38.205 133.405 15.526  1.00 15.74 ? 249 ALA A N   1 
ATOM   1865 C  CA  . ALA A 1 249 ? 38.979 133.098 14.330  1.00 14.52 ? 249 ALA A CA  1 
ATOM   1866 C  C   . ALA A 1 249 ? 38.437 131.841 13.652  1.00 14.70 ? 249 ALA A C   1 
ATOM   1867 O  O   . ALA A 1 249 ? 38.294 131.795 12.425  1.00 13.26 ? 249 ALA A O   1 
ATOM   1868 C  CB  . ALA A 1 249 ? 40.444 132.894 14.706  1.00 13.52 ? 249 ALA A CB  1 
ATOM   1869 N  N   . LEU A 1 250 ? 38.135 130.826 14.460  1.00 14.24 ? 250 LEU A N   1 
ATOM   1870 C  CA  . LEU A 1 250 ? 37.620 129.563 13.950  1.00 15.61 ? 250 LEU A CA  1 
ATOM   1871 C  C   . LEU A 1 250 ? 36.279 129.774 13.242  1.00 16.66 ? 250 LEU A C   1 
ATOM   1872 O  O   . LEU A 1 250 ? 36.014 129.164 12.191  1.00 17.40 ? 250 LEU A O   1 
ATOM   1873 C  CB  . LEU A 1 250 ? 37.484 128.554 15.099  1.00 14.29 ? 250 LEU A CB  1 
ATOM   1874 C  CG  . LEU A 1 250 ? 37.059 127.110 14.806  1.00 13.26 ? 250 LEU A CG  1 
ATOM   1875 C  CD1 . LEU A 1 250 ? 37.828 126.540 13.635  1.00 12.10 ? 250 LEU A CD1 1 
ATOM   1876 C  CD2 . LEU A 1 250 ? 37.302 126.272 16.049  1.00 15.15 ? 250 LEU A CD2 1 
ATOM   1877 N  N   . GLN A 1 251 ? 35.447 130.641 13.816  1.00 14.03 ? 251 GLN A N   1 
ATOM   1878 C  CA  . GLN A 1 251 ? 34.145 130.957 13.242  1.00 14.47 ? 251 GLN A CA  1 
ATOM   1879 C  C   . GLN A 1 251 ? 34.331 131.539 11.848  1.00 15.40 ? 251 GLN A C   1 
ATOM   1880 O  O   . GLN A 1 251 ? 33.609 131.192 10.909  1.00 15.28 ? 251 GLN A O   1 
ATOM   1881 C  CB  . GLN A 1 251 ? 33.426 131.985 14.109  1.00 16.44 ? 251 GLN A CB  1 
ATOM   1882 C  CG  . GLN A 1 251 ? 32.945 131.473 15.446  1.00 17.29 ? 251 GLN A CG  1 
ATOM   1883 C  CD  . GLN A 1 251 ? 32.266 132.556 16.258  1.00 20.31 ? 251 GLN A CD  1 
ATOM   1884 O  OE1 . GLN A 1 251 ? 32.902 133.533 16.672  1.00 20.43 ? 251 GLN A OE1 1 
ATOM   1885 N  NE2 . GLN A 1 251 ? 30.961 132.396 16.484  1.00 18.74 ? 251 GLN A NE2 1 
ATOM   1886 N  N   . ALA A 1 252 ? 35.303 132.440 11.732  1.00 15.16 ? 252 ALA A N   1 
ATOM   1887 C  CA  . ALA A 1 252 ? 35.614 133.090 10.472  1.00 14.87 ? 252 ALA A CA  1 
ATOM   1888 C  C   . ALA A 1 252 ? 36.088 132.051 9.461   1.00 15.76 ? 252 ALA A C   1 
ATOM   1889 O  O   . ALA A 1 252 ? 35.698 132.082 8.290   1.00 16.50 ? 252 ALA A O   1 
ATOM   1890 C  CB  . ALA A 1 252 ? 36.690 134.143 10.689  1.00 13.69 ? 252 ALA A CB  1 
ATOM   1891 N  N   . ALA A 1 253 ? 36.929 131.130 9.921   1.00 15.43 ? 253 ALA A N   1 
ATOM   1892 C  CA  . ALA A 1 253 ? 37.459 130.089 9.052   1.00 15.60 ? 253 ALA A CA  1 
ATOM   1893 C  C   . ALA A 1 253 ? 36.337 129.169 8.556   1.00 16.96 ? 253 ALA A C   1 
ATOM   1894 O  O   . ALA A 1 253 ? 36.399 128.649 7.438   1.00 15.74 ? 253 ALA A O   1 
ATOM   1895 C  CB  . ALA A 1 253 ? 38.519 129.285 9.796   1.00 15.44 ? 253 ALA A CB  1 
ATOM   1896 N  N   . MET A 1 254 ? 35.316 128.975 9.387   1.00 16.55 ? 254 MET A N   1 
ATOM   1897 C  CA  . MET A 1 254 ? 34.193 128.127 9.018   1.00 18.56 ? 254 MET A CA  1 
ATOM   1898 C  C   . MET A 1 254 ? 33.278 128.814 8.008   1.00 19.65 ? 254 MET A C   1 
ATOM   1899 O  O   . MET A 1 254 ? 32.401 128.181 7.423   1.00 20.51 ? 254 MET A O   1 
ATOM   1900 C  CB  . MET A 1 254 ? 33.391 127.723 10.259  1.00 19.28 ? 254 MET A CB  1 
ATOM   1901 C  CG  . MET A 1 254 ? 34.171 126.856 11.239  1.00 22.31 ? 254 MET A CG  1 
ATOM   1902 S  SD  . MET A 1 254 ? 35.052 125.484 10.432  1.00 23.64 ? 254 MET A SD  1 
ATOM   1903 C  CE  . MET A 1 254 ? 33.718 124.313 10.266  1.00 27.10 ? 254 MET A CE  1 
ATOM   1904 N  N   . GLU A 1 255 ? 33.470 130.113 7.808   1.00 19.41 ? 255 GLU A N   1 
ATOM   1905 C  CA  . GLU A 1 255 ? 32.657 130.824 6.836   1.00 19.40 ? 255 GLU A CA  1 
ATOM   1906 C  C   . GLU A 1 255 ? 33.446 130.987 5.546   1.00 18.93 ? 255 GLU A C   1 
ATOM   1907 O  O   . GLU A 1 255 ? 32.955 131.549 4.568   1.00 19.98 ? 255 GLU A O   1 
ATOM   1908 C  CB  . GLU A 1 255 ? 32.221 132.182 7.378   1.00 20.33 ? 255 GLU A CB  1 
ATOM   1909 C  CG  . GLU A 1 255 ? 31.290 132.086 8.578   1.00 19.07 ? 255 GLU A CG  1 
ATOM   1910 C  CD  . GLU A 1 255 ? 30.181 131.074 8.363   1.00 20.30 ? 255 GLU A CD  1 
ATOM   1911 O  OE1 . GLU A 1 255 ? 29.579 131.070 7.265   1.00 22.11 ? 255 GLU A OE1 1 
ATOM   1912 O  OE2 . GLU A 1 255 ? 29.907 130.284 9.291   1.00 16.94 ? 255 GLU A OE2 1 
ATOM   1913 N  N   . GLY A 1 256 ? 34.674 130.479 5.553   1.00 17.63 ? 256 GLY A N   1 
ATOM   1914 C  CA  . GLY A 1 256 ? 35.505 130.549 4.370   1.00 15.97 ? 256 GLY A CA  1 
ATOM   1915 C  C   . GLY A 1 256 ? 36.354 131.794 4.288   1.00 16.56 ? 256 GLY A C   1 
ATOM   1916 O  O   . GLY A 1 256 ? 36.895 132.095 3.230   1.00 17.16 ? 256 GLY A O   1 
ATOM   1917 N  N   . TYR A 1 257 ? 36.472 132.523 5.391   1.00 16.45 ? 257 TYR A N   1 
ATOM   1918 C  CA  . TYR A 1 257 ? 37.280 133.737 5.403   1.00 18.41 ? 257 TYR A CA  1 
ATOM   1919 C  C   . TYR A 1 257 ? 38.708 133.380 5.762   1.00 19.63 ? 257 TYR A C   1 
ATOM   1920 O  O   . TYR A 1 257 ? 38.939 132.618 6.700   1.00 17.64 ? 257 TYR A O   1 
ATOM   1921 C  CB  . TYR A 1 257 ? 36.796 134.738 6.462   1.00 19.06 ? 257 TYR A CB  1 
ATOM   1922 C  CG  . TYR A 1 257 ? 35.424 135.342 6.258   1.00 19.64 ? 257 TYR A CG  1 
ATOM   1923 C  CD1 . TYR A 1 257 ? 35.177 136.247 5.230   1.00 19.59 ? 257 TYR A CD1 1 
ATOM   1924 C  CD2 . TYR A 1 257 ? 34.386 135.040 7.130   1.00 18.59 ? 257 TYR A CD2 1 
ATOM   1925 C  CE1 . TYR A 1 257 ? 33.935 136.832 5.082   1.00 21.20 ? 257 TYR A CE1 1 
ATOM   1926 C  CE2 . TYR A 1 257 ? 33.150 135.616 6.990   1.00 20.88 ? 257 TYR A CE2 1 
ATOM   1927 C  CZ  . TYR A 1 257 ? 32.923 136.510 5.968   1.00 21.74 ? 257 TYR A CZ  1 
ATOM   1928 O  OH  . TYR A 1 257 ? 31.666 137.055 5.828   1.00 23.03 ? 257 TYR A OH  1 
ATOM   1929 N  N   . GLU A 1 258 ? 39.666 133.933 5.026   1.00 20.64 ? 258 GLU A N   1 
ATOM   1930 C  CA  . GLU A 1 258 ? 41.060 133.688 5.353   1.00 20.27 ? 258 GLU A CA  1 
ATOM   1931 C  C   . GLU A 1 258 ? 41.333 134.477 6.633   1.00 19.26 ? 258 GLU A C   1 
ATOM   1932 O  O   . GLU A 1 258 ? 40.917 135.627 6.759   1.00 20.23 ? 258 GLU A O   1 
ATOM   1933 C  CB  . GLU A 1 258 ? 41.984 134.182 4.242   1.00 20.75 ? 258 GLU A CB  1 
ATOM   1934 C  CG  . GLU A 1 258 ? 43.448 134.180 4.643   1.00 19.84 ? 258 GLU A CG  1 
ATOM   1935 C  CD  . GLU A 1 258 ? 44.379 134.395 3.467   1.00 21.69 ? 258 GLU A CD  1 
ATOM   1936 O  OE1 . GLU A 1 258 ? 43.923 134.949 2.440   1.00 20.98 ? 258 GLU A OE1 1 
ATOM   1937 O  OE2 . GLU A 1 258 ? 45.570 134.020 3.577   1.00 20.95 ? 258 GLU A OE2 1 
ATOM   1938 N  N   . VAL A 1 259 ? 42.008 133.851 7.588   1.00 16.62 ? 259 VAL A N   1 
ATOM   1939 C  CA  . VAL A 1 259 ? 42.321 134.516 8.839   1.00 14.87 ? 259 VAL A CA  1 
ATOM   1940 C  C   . VAL A 1 259 ? 43.829 134.567 9.030   1.00 15.00 ? 259 VAL A C   1 
ATOM   1941 O  O   . VAL A 1 259 ? 44.473 133.555 9.281   1.00 15.12 ? 259 VAL A O   1 
ATOM   1942 C  CB  . VAL A 1 259 ? 41.690 133.789 10.043  1.00 15.51 ? 259 VAL A CB  1 
ATOM   1943 C  CG1 . VAL A 1 259 ? 41.953 134.576 11.318  1.00 14.93 ? 259 VAL A CG1 1 
ATOM   1944 C  CG2 . VAL A 1 259 ? 40.200 133.613 9.827   1.00 15.03 ? 259 VAL A CG2 1 
ATOM   1945 N  N   . THR A 1 260 ? 44.394 135.757 8.897   1.00 15.49 ? 260 THR A N   1 
ATOM   1946 C  CA  . THR A 1 260 ? 45.826 135.927 9.060   1.00 14.88 ? 260 THR A CA  1 
ATOM   1947 C  C   . THR A 1 260 ? 46.087 137.168 9.907   1.00 15.28 ? 260 THR A C   1 
ATOM   1948 O  O   . THR A 1 260 ? 45.163 137.777 10.442  1.00 14.74 ? 260 THR A O   1 
ATOM   1949 C  CB  . THR A 1 260 ? 46.536 136.046 7.680   1.00 13.95 ? 260 THR A CB  1 
ATOM   1950 O  OG1 . THR A 1 260 ? 47.956 135.954 7.857   1.00 15.46 ? 260 THR A OG1 1 
ATOM   1951 C  CG2 . THR A 1 260 ? 46.194 137.355 7.008   1.00 11.63 ? 260 THR A CG2 1 
ATOM   1952 N  N   . THR A 1 261 ? 47.353 137.531 10.036  1.00 16.23 ? 261 THR A N   1 
ATOM   1953 C  CA  . THR A 1 261 ? 47.730 138.690 10.831  1.00 15.11 ? 261 THR A CA  1 
ATOM   1954 C  C   . THR A 1 261 ? 47.747 139.950 9.989   1.00 14.74 ? 261 THR A C   1 
ATOM   1955 O  O   . THR A 1 261 ? 47.876 139.892 8.763   1.00 11.85 ? 261 THR A O   1 
ATOM   1956 C  CB  . THR A 1 261 ? 49.128 138.505 11.418  1.00 14.97 ? 261 THR A CB  1 
ATOM   1957 O  OG1 . THR A 1 261 ? 50.063 138.379 10.341  1.00 13.28 ? 261 THR A OG1 1 
ATOM   1958 C  CG2 . THR A 1 261 ? 49.184 137.243 12.284  1.00 14.78 ? 261 THR A CG2 1 
ATOM   1959 N  N   . MET A 1 262 ? 47.621 141.088 10.665  1.00 14.71 ? 262 MET A N   1 
ATOM   1960 C  CA  . MET A 1 262 ? 47.650 142.376 10.001  1.00 14.36 ? 262 MET A CA  1 
ATOM   1961 C  C   . MET A 1 262 ? 49.005 142.540 9.328   1.00 14.77 ? 262 MET A C   1 
ATOM   1962 O  O   . MET A 1 262 ? 49.092 143.044 8.204   1.00 14.30 ? 262 MET A O   1 
ATOM   1963 C  CB  . MET A 1 262 ? 47.439 143.502 11.016  1.00 15.48 ? 262 MET A CB  1 
ATOM   1964 C  CG  . MET A 1 262 ? 47.389 144.902 10.394  1.00 15.07 ? 262 MET A CG  1 
ATOM   1965 S  SD  . MET A 1 262 ? 46.130 145.065 9.096   1.00 16.61 ? 262 MET A SD  1 
ATOM   1966 C  CE  . MET A 1 262 ? 44.639 145.059 10.086  1.00 11.02 ? 262 MET A CE  1 
ATOM   1967 N  N   . ASP A 1 263 ? 50.054 142.108 10.030  1.00 16.37 ? 263 ASP A N   1 
ATOM   1968 C  CA  . ASP A 1 263 ? 51.431 142.182 9.533   1.00 18.23 ? 263 ASP A CA  1 
ATOM   1969 C  C   . ASP A 1 263 ? 51.573 141.536 8.177   1.00 18.40 ? 263 ASP A C   1 
ATOM   1970 O  O   . ASP A 1 263 ? 52.463 141.871 7.405   1.00 18.92 ? 263 ASP A O   1 
ATOM   1971 C  CB  . ASP A 1 263 ? 52.403 141.497 10.495  1.00 19.09 ? 263 ASP A CB  1 
ATOM   1972 C  CG  . ASP A 1 263 ? 52.669 142.316 11.738  1.00 21.63 ? 263 ASP A CG  1 
ATOM   1973 O  OD1 . ASP A 1 263 ? 52.301 143.507 11.754  1.00 24.37 ? 263 ASP A OD1 1 
ATOM   1974 O  OD2 . ASP A 1 263 ? 53.258 141.779 12.696  1.00 23.21 ? 263 ASP A OD2 1 
ATOM   1975 N  N   . GLU A 1 264 ? 50.693 140.597 7.887   1.00 21.40 ? 264 GLU A N   1 
ATOM   1976 C  CA  . GLU A 1 264 ? 50.743 139.916 6.610   1.00 24.50 ? 264 GLU A CA  1 
ATOM   1977 C  C   . GLU A 1 264 ? 49.727 140.521 5.643   1.00 23.24 ? 264 GLU A C   1 
ATOM   1978 O  O   . GLU A 1 264 ? 50.067 140.827 4.507   1.00 24.36 ? 264 GLU A O   1 
ATOM   1979 C  CB  . GLU A 1 264 ? 50.483 138.419 6.817   1.00 26.56 ? 264 GLU A CB  1 
ATOM   1980 C  CG  . GLU A 1 264 ? 50.792 137.564 5.610   1.00 35.43 ? 264 GLU A CG  1 
ATOM   1981 C  CD  . GLU A 1 264 ? 50.852 136.079 5.941   1.00 41.30 ? 264 GLU A CD  1 
ATOM   1982 O  OE1 . GLU A 1 264 ? 51.800 135.665 6.651   1.00 42.36 ? 264 GLU A OE1 1 
ATOM   1983 O  OE2 . GLU A 1 264 ? 49.949 135.331 5.491   1.00 42.68 ? 264 GLU A OE2 1 
ATOM   1984 N  N   . ALA A 1 265 ? 48.494 140.720 6.105   1.00 22.33 ? 265 ALA A N   1 
ATOM   1985 C  CA  . ALA A 1 265 ? 47.429 141.272 5.267   1.00 21.91 ? 265 ALA A CA  1 
ATOM   1986 C  C   . ALA A 1 265 ? 47.658 142.698 4.779   1.00 22.31 ? 265 ALA A C   1 
ATOM   1987 O  O   . ALA A 1 265 ? 47.189 143.067 3.700   1.00 22.28 ? 265 ALA A O   1 
ATOM   1988 C  CB  . ALA A 1 265 ? 46.098 141.195 5.999   1.00 20.64 ? 265 ALA A CB  1 
ATOM   1989 N  N   . CYS A 1 266 ? 48.368 143.502 5.564   1.00 22.79 ? 266 CYS A N   1 
ATOM   1990 C  CA  . CYS A 1 266 ? 48.616 144.888 5.177   1.00 23.38 ? 266 CYS A CA  1 
ATOM   1991 C  C   . CYS A 1 266 ? 49.246 144.977 3.793   1.00 23.36 ? 266 CYS A C   1 
ATOM   1992 O  O   . CYS A 1 266 ? 49.147 146.002 3.120   1.00 22.69 ? 266 CYS A O   1 
ATOM   1993 C  CB  . CYS A 1 266 ? 49.515 145.583 6.204   1.00 23.82 ? 266 CYS A CB  1 
ATOM   1994 S  SG  . CYS A 1 266 ? 51.187 144.914 6.352   1.00 24.47 ? 266 CYS A SG  1 
ATOM   1995 N  N   . GLN A 1 267 ? 49.882 143.891 3.368   1.00 23.48 ? 267 GLN A N   1 
ATOM   1996 C  CA  . GLN A 1 267 ? 50.525 143.848 2.062   1.00 24.59 ? 267 GLN A CA  1 
ATOM   1997 C  C   . GLN A 1 267 ? 49.540 143.500 0.960   1.00 25.30 ? 267 GLN A C   1 
ATOM   1998 O  O   . GLN A 1 267 ? 49.828 143.693 -0.221  1.00 26.12 ? 267 GLN A O   1 
ATOM   1999 C  CB  . GLN A 1 267 ? 51.636 142.809 2.060   1.00 23.91 ? 267 GLN A CB  1 
ATOM   2000 C  CG  . GLN A 1 267 ? 52.722 143.064 3.076   1.00 26.42 ? 267 GLN A CG  1 
ATOM   2001 C  CD  . GLN A 1 267 ? 53.574 141.838 3.302   1.00 27.24 ? 267 GLN A CD  1 
ATOM   2002 O  OE1 . GLN A 1 267 ? 54.108 141.257 2.355   1.00 25.48 ? 267 GLN A OE1 1 
ATOM   2003 N  NE2 . GLN A 1 267 ? 53.704 141.431 4.562   1.00 28.52 ? 267 GLN A NE2 1 
ATOM   2004 N  N   . GLU A 1 268 ? 48.370 143.004 1.340   1.00 24.93 ? 268 GLU A N   1 
ATOM   2005 C  CA  . GLU A 1 268 ? 47.402 142.608 0.338   1.00 24.22 ? 268 GLU A CA  1 
ATOM   2006 C  C   . GLU A 1 268 ? 46.064 143.332 0.312   1.00 22.46 ? 268 GLU A C   1 
ATOM   2007 O  O   . GLU A 1 268 ? 45.403 143.372 -0.723  1.00 23.69 ? 268 GLU A O   1 
ATOM   2008 C  CB  . GLU A 1 268 ? 47.174 141.110 0.458   1.00 26.97 ? 268 GLU A CB  1 
ATOM   2009 C  CG  . GLU A 1 268 ? 46.285 140.540 -0.610  1.00 30.14 ? 268 GLU A CG  1 
ATOM   2010 C  CD  . GLU A 1 268 ? 46.407 139.044 -0.686  1.00 31.62 ? 268 GLU A CD  1 
ATOM   2011 O  OE1 . GLU A 1 268 ? 46.657 138.434 0.384   1.00 30.72 ? 268 GLU A OE1 1 
ATOM   2012 O  OE2 . GLU A 1 268 ? 46.247 138.490 -1.802  1.00 30.00 ? 268 GLU A OE2 1 
ATOM   2013 N  N   . GLY A 1 269 ? 45.661 143.915 1.432   1.00 20.33 ? 269 GLY A N   1 
ATOM   2014 C  CA  . GLY A 1 269 ? 44.380 144.597 1.461   1.00 18.47 ? 269 GLY A CA  1 
ATOM   2015 C  C   . GLY A 1 269 ? 44.271 145.897 0.682   1.00 17.71 ? 269 GLY A C   1 
ATOM   2016 O  O   . GLY A 1 269 ? 45.222 146.677 0.618   1.00 16.69 ? 269 GLY A O   1 
ATOM   2017 N  N   . ASN A 1 270 ? 43.102 146.121 0.082   1.00 16.73 ? 270 ASN A N   1 
ATOM   2018 C  CA  . ASN A 1 270 ? 42.824 147.343 -0.673  1.00 15.43 ? 270 ASN A CA  1 
ATOM   2019 C  C   . ASN A 1 270 ? 42.018 148.226 0.255   1.00 16.03 ? 270 ASN A C   1 
ATOM   2020 O  O   . ASN A 1 270 ? 42.053 149.453 0.177   1.00 17.46 ? 270 ASN A O   1 
ATOM   2021 C  CB  . ASN A 1 270 ? 41.967 147.057 -1.905  1.00 14.09 ? 270 ASN A CB  1 
ATOM   2022 C  CG  . ASN A 1 270 ? 42.591 146.049 -2.827  1.00 15.51 ? 270 ASN A CG  1 
ATOM   2023 O  OD1 . ASN A 1 270 ? 42.184 144.887 -2.861  1.00 19.90 ? 270 ASN A OD1 1 
ATOM   2024 N  ND2 . ASN A 1 270 ? 43.596 146.477 -3.576  1.00 14.07 ? 270 ASN A ND2 1 
ATOM   2025 N  N   . ILE A 1 271 ? 41.281 147.562 1.133   1.00 15.95 ? 271 ILE A N   1 
ATOM   2026 C  CA  . ILE A 1 271 ? 40.422 148.214 2.097   1.00 14.38 ? 271 ILE A CA  1 
ATOM   2027 C  C   . ILE A 1 271 ? 40.700 147.615 3.472   1.00 15.10 ? 271 ILE A C   1 
ATOM   2028 O  O   . ILE A 1 271 ? 40.805 146.402 3.624   1.00 15.21 ? 271 ILE A O   1 
ATOM   2029 C  CB  . ILE A 1 271 ? 38.932 148.009 1.707   1.00 12.52 ? 271 ILE A CB  1 
ATOM   2030 C  CG1 . ILE A 1 271 ? 38.647 148.732 0.385   1.00 12.77 ? 271 ILE A CG1 1 
ATOM   2031 C  CG2 . ILE A 1 271 ? 38.019 148.505 2.814   1.00 13.31 ? 271 ILE A CG2 1 
ATOM   2032 C  CD1 . ILE A 1 271 ? 37.233 148.564 -0.139  1.00 9.91  ? 271 ILE A CD1 1 
ATOM   2033 N  N   . PHE A 1 272 ? 40.843 148.477 4.470   1.00 15.52 ? 272 PHE A N   1 
ATOM   2034 C  CA  . PHE A 1 272 ? 41.106 148.024 5.826   1.00 14.98 ? 272 PHE A CA  1 
ATOM   2035 C  C   . PHE A 1 272 ? 40.029 148.548 6.768   1.00 16.21 ? 272 PHE A C   1 
ATOM   2036 O  O   . PHE A 1 272 ? 39.722 149.748 6.783   1.00 16.54 ? 272 PHE A O   1 
ATOM   2037 C  CB  . PHE A 1 272 ? 42.483 148.501 6.303   1.00 14.56 ? 272 PHE A CB  1 
ATOM   2038 C  CG  . PHE A 1 272 ? 43.629 147.910 5.537   1.00 15.05 ? 272 PHE A CG  1 
ATOM   2039 C  CD1 . PHE A 1 272 ? 43.979 148.408 4.290   1.00 14.93 ? 272 PHE A CD1 1 
ATOM   2040 C  CD2 . PHE A 1 272 ? 44.347 146.845 6.059   1.00 15.62 ? 272 PHE A CD2 1 
ATOM   2041 C  CE1 . PHE A 1 272 ? 45.022 147.859 3.578   1.00 15.40 ? 272 PHE A CE1 1 
ATOM   2042 C  CE2 . PHE A 1 272 ? 45.395 146.284 5.354   1.00 16.48 ? 272 PHE A CE2 1 
ATOM   2043 C  CZ  . PHE A 1 272 ? 45.734 146.794 4.107   1.00 18.53 ? 272 PHE A CZ  1 
ATOM   2044 N  N   . VAL A 1 273 ? 39.453 147.639 7.545   1.00 13.77 ? 273 VAL A N   1 
ATOM   2045 C  CA  . VAL A 1 273 ? 38.413 148.002 8.486   1.00 14.19 ? 273 VAL A CA  1 
ATOM   2046 C  C   . VAL A 1 273 ? 38.765 147.420 9.843   1.00 15.92 ? 273 VAL A C   1 
ATOM   2047 O  O   . VAL A 1 273 ? 39.010 146.223 9.963   1.00 17.17 ? 273 VAL A O   1 
ATOM   2048 C  CB  . VAL A 1 273 ? 37.047 147.443 8.056   1.00 13.71 ? 273 VAL A CB  1 
ATOM   2049 C  CG1 . VAL A 1 273 ? 35.971 147.982 8.971   1.00 12.66 ? 273 VAL A CG1 1 
ATOM   2050 C  CG2 . VAL A 1 273 ? 36.769 147.788 6.603   1.00 8.85  ? 273 VAL A CG2 1 
ATOM   2051 N  N   . THR A 1 274 ? 38.790 148.273 10.862  1.00 16.29 ? 274 THR A N   1 
ATOM   2052 C  CA  . THR A 1 274 ? 39.121 147.837 12.211  1.00 15.47 ? 274 THR A CA  1 
ATOM   2053 C  C   . THR A 1 274 ? 37.855 147.802 13.048  1.00 14.87 ? 274 THR A C   1 
ATOM   2054 O  O   . THR A 1 274 ? 37.062 148.736 13.022  1.00 14.24 ? 274 THR A O   1 
ATOM   2055 C  CB  . THR A 1 274 ? 40.161 148.786 12.866  1.00 17.31 ? 274 THR A CB  1 
ATOM   2056 O  OG1 . THR A 1 274 ? 39.624 150.113 12.938  1.00 19.96 ? 274 THR A OG1 1 
ATOM   2057 C  CG2 . THR A 1 274 ? 41.457 148.805 12.051  1.00 13.90 ? 274 THR A CG2 1 
ATOM   2058 N  N   . THR A 1 275 ? 37.679 146.717 13.794  1.00 15.12 ? 275 THR A N   1 
ATOM   2059 C  CA  . THR A 1 275 ? 36.495 146.509 14.624  1.00 14.79 ? 275 THR A CA  1 
ATOM   2060 C  C   . THR A 1 275 ? 36.888 145.779 15.907  1.00 16.30 ? 275 THR A C   1 
ATOM   2061 O  O   . THR A 1 275 ? 36.053 145.110 16.534  1.00 16.06 ? 275 THR A O   1 
ATOM   2062 C  CB  . THR A 1 275 ? 35.489 145.597 13.909  1.00 14.39 ? 275 THR A CB  1 
ATOM   2063 O  OG1 . THR A 1 275 ? 35.911 144.238 14.069  1.00 14.84 ? 275 THR A OG1 1 
ATOM   2064 C  CG2 . THR A 1 275 ? 35.436 145.904 12.417  1.00 13.42 ? 275 THR A CG2 1 
ATOM   2065 N  N   . THR A 1 276 ? 38.154 145.907 16.292  1.00 15.76 ? 276 THR A N   1 
ATOM   2066 C  CA  . THR A 1 276 ? 38.672 145.207 17.462  1.00 15.38 ? 276 THR A CA  1 
ATOM   2067 C  C   . THR A 1 276 ? 38.334 145.814 18.812  1.00 17.04 ? 276 THR A C   1 
ATOM   2068 O  O   . THR A 1 276 ? 38.179 145.086 19.799  1.00 17.61 ? 276 THR A O   1 
ATOM   2069 C  CB  . THR A 1 276 ? 40.203 145.081 17.401  1.00 15.34 ? 276 THR A CB  1 
ATOM   2070 O  OG1 . THR A 1 276 ? 40.793 146.359 17.672  1.00 18.17 ? 276 THR A OG1 1 
ATOM   2071 C  CG2 . THR A 1 276 ? 40.652 144.598 16.027  1.00 14.49 ? 276 THR A CG2 1 
ATOM   2072 N  N   . GLY A 1 277 ? 38.221 147.138 18.860  1.00 17.31 ? 277 GLY A N   1 
ATOM   2073 C  CA  . GLY A 1 277 ? 37.945 147.802 20.121  1.00 15.96 ? 277 GLY A CA  1 
ATOM   2074 C  C   . GLY A 1 277 ? 39.252 147.850 20.892  1.00 15.74 ? 277 GLY A C   1 
ATOM   2075 O  O   . GLY A 1 277 ? 39.284 148.109 22.090  1.00 16.88 ? 277 GLY A O   1 
ATOM   2076 N  N   . CYS A 1 278 ? 40.342 147.614 20.172  1.00 15.49 ? 278 CYS A N   1 
ATOM   2077 C  CA  . CYS A 1 278 ? 41.680 147.589 20.741  1.00 18.61 ? 278 CYS A CA  1 
ATOM   2078 C  C   . CYS A 1 278 ? 42.588 148.629 20.073  1.00 20.19 ? 278 CYS A C   1 
ATOM   2079 O  O   . CYS A 1 278 ? 42.319 149.084 18.962  1.00 21.36 ? 278 CYS A O   1 
ATOM   2080 C  CB  . CYS A 1 278 ? 42.255 146.180 20.551  1.00 19.99 ? 278 CYS A CB  1 
ATOM   2081 S  SG  . CYS A 1 278 ? 43.910 145.877 21.184  1.00 21.34 ? 278 CYS A SG  1 
ATOM   2082 N  N   . ILE A 1 279 ? 43.665 149.003 20.751  1.00 21.77 ? 279 ILE A N   1 
ATOM   2083 C  CA  . ILE A 1 279 ? 44.608 149.980 20.212  1.00 24.22 ? 279 ILE A CA  1 
ATOM   2084 C  C   . ILE A 1 279 ? 45.686 149.329 19.351  1.00 25.04 ? 279 ILE A C   1 
ATOM   2085 O  O   . ILE A 1 279 ? 45.932 148.126 19.434  1.00 25.80 ? 279 ILE A O   1 
ATOM   2086 C  CB  . ILE A 1 279 ? 45.357 150.722 21.332  1.00 25.12 ? 279 ILE A CB  1 
ATOM   2087 C  CG1 . ILE A 1 279 ? 46.194 149.709 22.131  1.00 26.18 ? 279 ILE A CG1 1 
ATOM   2088 C  CG2 . ILE A 1 279 ? 44.379 151.459 22.220  1.00 24.25 ? 279 ILE A CG2 1 
ATOM   2089 C  CD1 . ILE A 1 279 ? 47.047 150.322 23.226  1.00 26.23 ? 279 ILE A CD1 1 
ATOM   2090 N  N   . ASP A 1 280 ? 46.333 150.153 18.535  1.00 25.74 ? 280 ASP A N   1 
ATOM   2091 C  CA  . ASP A 1 280 ? 47.431 149.724 17.677  1.00 25.67 ? 280 ASP A CA  1 
ATOM   2092 C  C   . ASP A 1 280 ? 47.138 148.570 16.736  1.00 24.25 ? 280 ASP A C   1 
ATOM   2093 O  O   . ASP A 1 280 ? 47.852 147.573 16.738  1.00 26.24 ? 280 ASP A O   1 
ATOM   2094 C  CB  . ASP A 1 280 ? 48.655 149.384 18.543  1.00 25.28 ? 280 ASP A CB  1 
ATOM   2095 C  CG  . ASP A 1 280 ? 49.007 150.508 19.519  1.00 27.20 ? 280 ASP A CG  1 
ATOM   2096 O  OD1 . ASP A 1 280 ? 48.806 151.693 19.161  1.00 28.39 ? 280 ASP A OD1 1 
ATOM   2097 O  OD2 . ASP A 1 280 ? 49.490 150.216 20.633  1.00 26.79 ? 280 ASP A OD2 1 
ATOM   2098 N  N   . ILE A 1 281 ? 46.101 148.713 15.918  1.00 22.25 ? 281 ILE A N   1 
ATOM   2099 C  CA  . ILE A 1 281 ? 45.739 147.671 14.967  1.00 19.56 ? 281 ILE A CA  1 
ATOM   2100 C  C   . ILE A 1 281 ? 46.490 147.908 13.670  1.00 19.92 ? 281 ILE A C   1 
ATOM   2101 O  O   . ILE A 1 281 ? 47.177 147.030 13.164  1.00 19.46 ? 281 ILE A O   1 
ATOM   2102 C  CB  . ILE A 1 281 ? 44.234 147.678 14.689  1.00 17.73 ? 281 ILE A CB  1 
ATOM   2103 C  CG1 . ILE A 1 281 ? 43.477 147.494 16.002  1.00 16.03 ? 281 ILE A CG1 1 
ATOM   2104 C  CG2 . ILE A 1 281 ? 43.882 146.570 13.714  1.00 16.39 ? 281 ILE A CG2 1 
ATOM   2105 C  CD1 . ILE A 1 281 ? 43.944 146.298 16.790  1.00 12.90 ? 281 ILE A CD1 1 
ATOM   2106 N  N   . ILE A 1 282 ? 46.348 149.106 13.124  1.00 21.04 ? 282 ILE A N   1 
ATOM   2107 C  CA  . ILE A 1 282 ? 47.055 149.451 11.906  1.00 20.22 ? 282 ILE A CA  1 
ATOM   2108 C  C   . ILE A 1 282 ? 48.117 150.470 12.293  1.00 19.97 ? 282 ILE A C   1 
ATOM   2109 O  O   . ILE A 1 282 ? 47.807 151.513 12.851  1.00 19.10 ? 282 ILE A O   1 
ATOM   2110 C  CB  . ILE A 1 282 ? 46.098 150.012 10.852  1.00 18.73 ? 282 ILE A CB  1 
ATOM   2111 C  CG1 . ILE A 1 282 ? 45.110 148.911 10.452  1.00 17.77 ? 282 ILE A CG1 1 
ATOM   2112 C  CG2 . ILE A 1 282 ? 46.888 150.511 9.643   1.00 19.69 ? 282 ILE A CG2 1 
ATOM   2113 C  CD1 . ILE A 1 282 ? 44.261 149.228 9.241   1.00 18.76 ? 282 ILE A CD1 1 
ATOM   2114 N  N   . LEU A 1 283 ? 49.373 150.142 12.014  1.00 20.43 ? 283 LEU A N   1 
ATOM   2115 C  CA  . LEU A 1 283 ? 50.484 151.005 12.374  1.00 21.29 ? 283 LEU A CA  1 
ATOM   2116 C  C   . LEU A 1 283 ? 51.338 151.423 11.189  1.00 22.88 ? 283 LEU A C   1 
ATOM   2117 O  O   . LEU A 1 283 ? 51.075 151.038 10.047  1.00 24.30 ? 283 LEU A O   1 
ATOM   2118 C  CB  . LEU A 1 283 ? 51.358 150.289 13.399  1.00 22.39 ? 283 LEU A CB  1 
ATOM   2119 C  CG  . LEU A 1 283 ? 50.566 149.682 14.563  1.00 23.05 ? 283 LEU A CG  1 
ATOM   2120 C  CD1 . LEU A 1 283 ? 51.506 148.924 15.483  1.00 21.42 ? 283 LEU A CD1 1 
ATOM   2121 C  CD2 . LEU A 1 283 ? 49.829 150.787 15.315  1.00 22.30 ? 283 LEU A CD2 1 
ATOM   2122 N  N   . GLY A 1 284 ? 52.367 152.219 11.475  1.00 23.88 ? 284 GLY A N   1 
ATOM   2123 C  CA  . GLY A 1 284 ? 53.262 152.695 10.434  1.00 22.57 ? 284 GLY A CA  1 
ATOM   2124 C  C   . GLY A 1 284 ? 53.859 151.570 9.612   1.00 22.75 ? 284 GLY A C   1 
ATOM   2125 O  O   . GLY A 1 284 ? 53.930 151.664 8.385   1.00 23.41 ? 284 GLY A O   1 
ATOM   2126 N  N   . ARG A 1 285 ? 54.288 150.498 10.271  1.00 21.86 ? 285 ARG A N   1 
ATOM   2127 C  CA  . ARG A 1 285 ? 54.865 149.377 9.539   1.00 22.11 ? 285 ARG A CA  1 
ATOM   2128 C  C   . ARG A 1 285 ? 53.825 148.720 8.624   1.00 21.17 ? 285 ARG A C   1 
ATOM   2129 O  O   . ARG A 1 285 ? 54.180 148.108 7.619   1.00 23.62 ? 285 ARG A O   1 
ATOM   2130 C  CB  . ARG A 1 285 ? 55.478 148.351 10.504  1.00 20.42 ? 285 ARG A CB  1 
ATOM   2131 C  CG  . ARG A 1 285 ? 54.496 147.682 11.432  1.00 22.68 ? 285 ARG A CG  1 
ATOM   2132 C  CD  . ARG A 1 285 ? 55.204 146.677 12.317  1.00 23.70 ? 285 ARG A CD  1 
ATOM   2133 N  NE  . ARG A 1 285 ? 54.284 145.656 12.803  1.00 25.47 ? 285 ARG A NE  1 
ATOM   2134 C  CZ  . ARG A 1 285 ? 53.805 145.600 14.040  1.00 26.62 ? 285 ARG A CZ  1 
ATOM   2135 N  NH1 . ARG A 1 285 ? 54.164 146.511 14.935  1.00 26.46 ? 285 ARG A NH1 1 
ATOM   2136 N  NH2 . ARG A 1 285 ? 52.955 144.636 14.376  1.00 27.22 ? 285 ARG A NH2 1 
ATOM   2137 N  N   . HIS A 1 286 ? 52.544 148.851 8.959   1.00 20.14 ? 286 HIS A N   1 
ATOM   2138 C  CA  . HIS A 1 286 ? 51.485 148.288 8.114   1.00 19.74 ? 286 HIS A CA  1 
ATOM   2139 C  C   . HIS A 1 286 ? 51.243 149.242 6.947   1.00 19.78 ? 286 HIS A C   1 
ATOM   2140 O  O   . HIS A 1 286 ? 51.153 148.824 5.791   1.00 19.20 ? 286 HIS A O   1 
ATOM   2141 C  CB  . HIS A 1 286 ? 50.186 148.117 8.904   1.00 18.13 ? 286 HIS A CB  1 
ATOM   2142 C  CG  . HIS A 1 286 ? 50.312 147.179 10.059  1.00 18.43 ? 286 HIS A CG  1 
ATOM   2143 N  ND1 . HIS A 1 286 ? 49.728 147.425 11.284  1.00 18.21 ? 286 HIS A ND1 1 
ATOM   2144 C  CD2 . HIS A 1 286 ? 50.975 146.006 10.186  1.00 17.15 ? 286 HIS A CD2 1 
ATOM   2145 C  CE1 . HIS A 1 286 ? 50.032 146.445 12.116  1.00 18.28 ? 286 HIS A CE1 1 
ATOM   2146 N  NE2 . HIS A 1 286 ? 50.787 145.572 11.474  1.00 18.22 ? 286 HIS A NE2 1 
ATOM   2147 N  N   . PHE A 1 287 ? 51.144 150.531 7.260   1.00 19.12 ? 287 PHE A N   1 
ATOM   2148 C  CA  . PHE A 1 287 ? 50.926 151.544 6.236   1.00 19.24 ? 287 PHE A CA  1 
ATOM   2149 C  C   . PHE A 1 287 ? 52.003 151.482 5.159   1.00 20.57 ? 287 PHE A C   1 
ATOM   2150 O  O   . PHE A 1 287 ? 51.699 151.506 3.962   1.00 19.94 ? 287 PHE A O   1 
ATOM   2151 C  CB  . PHE A 1 287 ? 50.928 152.936 6.862   1.00 17.60 ? 287 PHE A CB  1 
ATOM   2152 C  CG  . PHE A 1 287 ? 49.662 153.281 7.588   1.00 17.44 ? 287 PHE A CG  1 
ATOM   2153 C  CD1 . PHE A 1 287 ? 48.442 153.273 6.924   1.00 16.82 ? 287 PHE A CD1 1 
ATOM   2154 C  CD2 . PHE A 1 287 ? 49.693 153.659 8.919   1.00 17.24 ? 287 PHE A CD2 1 
ATOM   2155 C  CE1 . PHE A 1 287 ? 47.284 153.640 7.567   1.00 15.36 ? 287 PHE A CE1 1 
ATOM   2156 C  CE2 . PHE A 1 287 ? 48.534 154.027 9.573   1.00 17.15 ? 287 PHE A CE2 1 
ATOM   2157 C  CZ  . PHE A 1 287 ? 47.327 154.020 8.895   1.00 16.56 ? 287 PHE A CZ  1 
ATOM   2158 N  N   . GLU A 1 288 ? 53.258 151.393 5.594   1.00 21.62 ? 288 GLU A N   1 
ATOM   2159 C  CA  . GLU A 1 288 ? 54.389 151.352 4.675   1.00 24.01 ? 288 GLU A CA  1 
ATOM   2160 C  C   . GLU A 1 288 ? 54.352 150.163 3.732   1.00 23.57 ? 288 GLU A C   1 
ATOM   2161 O  O   . GLU A 1 288 ? 55.054 150.141 2.727   1.00 23.91 ? 288 GLU A O   1 
ATOM   2162 C  CB  . GLU A 1 288 ? 55.697 151.349 5.460   1.00 25.82 ? 288 GLU A CB  1 
ATOM   2163 C  CG  . GLU A 1 288 ? 55.808 152.525 6.410   1.00 31.96 ? 288 GLU A CG  1 
ATOM   2164 C  CD  . GLU A 1 288 ? 57.157 152.614 7.088   1.00 34.34 ? 288 GLU A CD  1 
ATOM   2165 O  OE1 . GLU A 1 288 ? 57.633 151.576 7.598   1.00 35.93 ? 288 GLU A OE1 1 
ATOM   2166 O  OE2 . GLU A 1 288 ? 57.733 153.726 7.118   1.00 35.22 ? 288 GLU A OE2 1 
ATOM   2167 N  N   . GLN A 1 289 ? 53.518 149.183 4.049   1.00 23.52 ? 289 GLN A N   1 
ATOM   2168 C  CA  . GLN A 1 289 ? 53.396 147.989 3.224   1.00 23.36 ? 289 GLN A CA  1 
ATOM   2169 C  C   . GLN A 1 289 ? 52.159 147.996 2.333   1.00 21.05 ? 289 GLN A C   1 
ATOM   2170 O  O   . GLN A 1 289 ? 52.040 147.177 1.424   1.00 20.38 ? 289 GLN A O   1 
ATOM   2171 C  CB  . GLN A 1 289 ? 53.350 146.750 4.120   1.00 25.33 ? 289 GLN A CB  1 
ATOM   2172 C  CG  . GLN A 1 289 ? 54.642 146.481 4.847   1.00 29.50 ? 289 GLN A CG  1 
ATOM   2173 C  CD  . GLN A 1 289 ? 55.762 146.157 3.881   1.00 33.78 ? 289 GLN A CD  1 
ATOM   2174 O  OE1 . GLN A 1 289 ? 55.709 145.147 3.170   1.00 35.76 ? 289 GLN A OE1 1 
ATOM   2175 N  NE2 . GLN A 1 289 ? 56.779 147.017 3.838   1.00 33.58 ? 289 GLN A NE2 1 
ATOM   2176 N  N   . MET A 1 290 ? 51.240 148.920 2.590   1.00 19.73 ? 290 MET A N   1 
ATOM   2177 C  CA  . MET A 1 290 ? 50.002 148.968 1.825   1.00 19.77 ? 290 MET A CA  1 
ATOM   2178 C  C   . MET A 1 290 ? 50.113 149.360 0.360   1.00 19.83 ? 290 MET A C   1 
ATOM   2179 O  O   . MET A 1 290 ? 51.029 150.081 -0.050  1.00 20.45 ? 290 MET A O   1 
ATOM   2180 C  CB  . MET A 1 290 ? 48.996 149.884 2.515   1.00 18.89 ? 290 MET A CB  1 
ATOM   2181 C  CG  . MET A 1 290 ? 48.630 149.431 3.905   1.00 18.13 ? 290 MET A CG  1 
ATOM   2182 S  SD  . MET A 1 290 ? 47.383 150.476 4.647   1.00 19.46 ? 290 MET A SD  1 
ATOM   2183 C  CE  . MET A 1 290 ? 47.002 149.540 6.116   1.00 14.04 ? 290 MET A CE  1 
ATOM   2184 N  N   . LYS A 1 291 ? 49.169 148.851 -0.424  1.00 19.96 ? 291 LYS A N   1 
ATOM   2185 C  CA  . LYS A 1 291 ? 49.101 149.149 -1.843  1.00 20.87 ? 291 LYS A CA  1 
ATOM   2186 C  C   . LYS A 1 291 ? 48.667 150.605 -1.990  1.00 20.53 ? 291 LYS A C   1 
ATOM   2187 O  O   . LYS A 1 291 ? 48.065 151.189 -1.082  1.00 18.58 ? 291 LYS A O   1 
ATOM   2188 C  CB  . LYS A 1 291 ? 48.094 148.224 -2.529  1.00 21.46 ? 291 LYS A CB  1 
ATOM   2189 C  CG  . LYS A 1 291 ? 48.530 146.779 -2.537  1.00 24.63 ? 291 LYS A CG  1 
ATOM   2190 C  CD  . LYS A 1 291 ? 47.432 145.861 -3.034  1.00 27.05 ? 291 LYS A CD  1 
ATOM   2191 C  CE  . LYS A 1 291 ? 47.853 144.406 -2.907  1.00 27.44 ? 291 LYS A CE  1 
ATOM   2192 N  NZ  . LYS A 1 291 ? 46.741 143.481 -3.256  1.00 30.61 ? 291 LYS A NZ  1 
ATOM   2193 N  N   . ASP A 1 292 ? 48.973 151.187 -3.140  1.00 19.82 ? 292 ASP A N   1 
ATOM   2194 C  CA  . ASP A 1 292 ? 48.634 152.574 -3.388  1.00 19.80 ? 292 ASP A CA  1 
ATOM   2195 C  C   . ASP A 1 292 ? 47.136 152.833 -3.314  1.00 19.40 ? 292 ASP A C   1 
ATOM   2196 O  O   . ASP A 1 292 ? 46.341 152.155 -3.959  1.00 22.34 ? 292 ASP A O   1 
ATOM   2197 C  CB  . ASP A 1 292 ? 49.171 152.999 -4.749  1.00 19.08 ? 292 ASP A CB  1 
ATOM   2198 C  CG  . ASP A 1 292 ? 49.115 154.482 -4.942  1.00 19.67 ? 292 ASP A CG  1 
ATOM   2199 O  OD1 . ASP A 1 292 ? 49.355 155.206 -3.949  1.00 19.14 ? 292 ASP A OD1 1 
ATOM   2200 O  OD2 . ASP A 1 292 ? 48.842 154.919 -6.081  1.00 19.36 ? 292 ASP A OD2 1 
ATOM   2201 N  N   . ASP A 1 293 ? 46.767 153.831 -2.524  1.00 17.91 ? 293 ASP A N   1 
ATOM   2202 C  CA  . ASP A 1 293 ? 45.374 154.210 -2.331  1.00 17.14 ? 293 ASP A CA  1 
ATOM   2203 C  C   . ASP A 1 293 ? 44.550 153.236 -1.522  1.00 15.25 ? 293 ASP A C   1 
ATOM   2204 O  O   . ASP A 1 293 ? 43.327 153.211 -1.634  1.00 13.53 ? 293 ASP A O   1 
ATOM   2205 C  CB  . ASP A 1 293 ? 44.670 154.465 -3.662  1.00 17.32 ? 293 ASP A CB  1 
ATOM   2206 C  CG  . ASP A 1 293 ? 44.763 155.904 -4.087  1.00 18.68 ? 293 ASP A CG  1 
ATOM   2207 O  OD1 . ASP A 1 293 ? 44.932 156.772 -3.200  1.00 18.65 ? 293 ASP A OD1 1 
ATOM   2208 O  OD2 . ASP A 1 293 ? 44.656 156.167 -5.299  1.00 19.32 ? 293 ASP A OD2 1 
ATOM   2209 N  N   . ALA A 1 294 ? 45.220 152.438 -0.705  1.00 14.67 ? 294 ALA A N   1 
ATOM   2210 C  CA  . ALA A 1 294 ? 44.520 151.501 0.148   1.00 15.67 ? 294 ALA A CA  1 
ATOM   2211 C  C   . ALA A 1 294 ? 43.598 152.345 1.022   1.00 16.64 ? 294 ALA A C   1 
ATOM   2212 O  O   . ALA A 1 294 ? 44.019 153.357 1.581   1.00 18.08 ? 294 ALA A O   1 
ATOM   2213 C  CB  . ALA A 1 294 ? 45.518 150.734 1.018   1.00 14.43 ? 294 ALA A CB  1 
ATOM   2214 N  N   . ILE A 1 295 ? 42.335 151.948 1.114   1.00 16.71 ? 295 ILE A N   1 
ATOM   2215 C  CA  . ILE A 1 295 ? 41.375 152.668 1.938   1.00 16.46 ? 295 ILE A CA  1 
ATOM   2216 C  C   . ILE A 1 295 ? 41.465 152.111 3.359   1.00 18.31 ? 295 ILE A C   1 
ATOM   2217 O  O   . ILE A 1 295 ? 41.386 150.898 3.575   1.00 19.06 ? 295 ILE A O   1 
ATOM   2218 C  CB  . ILE A 1 295 ? 39.945 152.501 1.389   1.00 16.80 ? 295 ILE A CB  1 
ATOM   2219 C  CG1 . ILE A 1 295 ? 39.836 153.209 0.033   1.00 16.07 ? 295 ILE A CG1 1 
ATOM   2220 C  CG2 . ILE A 1 295 ? 38.930 153.048 2.383   1.00 13.72 ? 295 ILE A CG2 1 
ATOM   2221 C  CD1 . ILE A 1 295 ? 38.497 153.023 -0.650  1.00 17.53 ? 295 ILE A CD1 1 
ATOM   2222 N  N   . VAL A 1 296 ? 41.644 153.002 4.324   1.00 17.28 ? 296 VAL A N   1 
ATOM   2223 C  CA  . VAL A 1 296 ? 41.780 152.599 5.712   1.00 16.60 ? 296 VAL A CA  1 
ATOM   2224 C  C   . VAL A 1 296 ? 40.715 153.270 6.564   1.00 18.29 ? 296 VAL A C   1 
ATOM   2225 O  O   . VAL A 1 296 ? 40.543 154.484 6.503   1.00 20.56 ? 296 VAL A O   1 
ATOM   2226 C  CB  . VAL A 1 296 ? 43.181 152.971 6.227   1.00 14.69 ? 296 VAL A CB  1 
ATOM   2227 C  CG1 . VAL A 1 296 ? 43.319 152.616 7.691   1.00 15.81 ? 296 VAL A CG1 1 
ATOM   2228 C  CG2 . VAL A 1 296 ? 44.230 152.248 5.399   1.00 11.89 ? 296 VAL A CG2 1 
ATOM   2229 N  N   . CYS A 1 297 ? 39.987 152.483 7.350   1.00 18.17 ? 297 CYS A N   1 
ATOM   2230 C  CA  . CYS A 1 297 ? 38.938 153.047 8.188   1.00 18.88 ? 297 CYS A CA  1 
ATOM   2231 C  C   . CYS A 1 297 ? 38.702 152.249 9.459   1.00 19.61 ? 297 CYS A C   1 
ATOM   2232 O  O   . CYS A 1 297 ? 39.041 151.071 9.559   1.00 19.71 ? 297 CYS A O   1 
ATOM   2233 C  CB  . CYS A 1 297 ? 37.620 153.158 7.412   1.00 18.01 ? 297 CYS A CB  1 
ATOM   2234 S  SG  . CYS A 1 297 ? 36.852 151.565 6.993   1.00 21.10 ? 297 CYS A SG  1 
ATOM   2235 N  N   . ASN A 1 298 ? 38.101 152.916 10.432  1.00 20.03 ? 298 ASN A N   1 
ATOM   2236 C  CA  . ASN A 1 298 ? 37.821 152.310 11.714  1.00 19.83 ? 298 ASN A CA  1 
ATOM   2237 C  C   . ASN A 1 298 ? 36.331 152.388 12.021  1.00 20.63 ? 298 ASN A C   1 
ATOM   2238 O  O   . ASN A 1 298 ? 35.684 153.411 11.789  1.00 21.42 ? 298 ASN A O   1 
ATOM   2239 C  CB  . ASN A 1 298 ? 38.634 153.022 12.798  1.00 17.64 ? 298 ASN A CB  1 
ATOM   2240 C  CG  . ASN A 1 298 ? 38.210 152.630 14.196  1.00 19.48 ? 298 ASN A CG  1 
ATOM   2241 O  OD1 . ASN A 1 298 ? 38.036 151.444 14.498  1.00 19.43 ? 298 ASN A OD1 1 
ATOM   2242 N  ND2 . ASN A 1 298 ? 38.051 153.626 15.067  1.00 16.50 ? 298 ASN A ND2 1 
ATOM   2243 N  N   . ILE A 1 299 ? 35.789 151.290 12.533  1.00 19.31 ? 299 ILE A N   1 
ATOM   2244 C  CA  . ILE A 1 299 ? 34.384 151.235 12.873  1.00 19.19 ? 299 ILE A CA  1 
ATOM   2245 C  C   . ILE A 1 299 ? 34.257 150.575 14.239  1.00 20.82 ? 299 ILE A C   1 
ATOM   2246 O  O   . ILE A 1 299 ? 33.182 150.141 14.647  1.00 21.29 ? 299 ILE A O   1 
ATOM   2247 C  CB  . ILE A 1 299 ? 33.592 150.453 11.793  1.00 16.90 ? 299 ILE A CB  1 
ATOM   2248 C  CG1 . ILE A 1 299 ? 32.092 150.687 11.964  1.00 12.05 ? 299 ILE A CG1 1 
ATOM   2249 C  CG2 . ILE A 1 299 ? 33.936 148.982 11.864  1.00 16.61 ? 299 ILE A CG2 1 
ATOM   2250 C  CD1 . ILE A 1 299 ? 31.273 150.185 10.813  1.00 9.67  ? 299 ILE A CD1 1 
ATOM   2251 N  N   . GLY A 1 300 ? 35.376 150.531 14.956  1.00 23.80 ? 300 GLY A N   1 
ATOM   2252 C  CA  . GLY A 1 300 ? 35.393 149.932 16.279  1.00 26.20 ? 300 GLY A CA  1 
ATOM   2253 C  C   . GLY A 1 300 ? 35.382 150.937 17.420  1.00 28.18 ? 300 GLY A C   1 
ATOM   2254 O  O   . GLY A 1 300 ? 34.341 151.515 17.741  1.00 27.34 ? 300 GLY A O   1 
ATOM   2255 N  N   . HIS A 1 301 ? 36.542 151.152 18.035  1.00 30.45 ? 301 HIS A N   1 
ATOM   2256 C  CA  . HIS A 1 301 ? 36.646 152.076 19.162  1.00 32.82 ? 301 HIS A CA  1 
ATOM   2257 C  C   . HIS A 1 301 ? 37.064 153.482 18.742  1.00 32.74 ? 301 HIS A C   1 
ATOM   2258 O  O   . HIS A 1 301 ? 37.976 153.648 17.935  1.00 32.39 ? 301 HIS A O   1 
ATOM   2259 C  CB  . HIS A 1 301 ? 37.624 151.529 20.207  1.00 33.82 ? 301 HIS A CB  1 
ATOM   2260 C  CG  . HIS A 1 301 ? 37.547 152.240 21.521  1.00 38.58 ? 301 HIS A CG  1 
ATOM   2261 N  ND1 . HIS A 1 301 ? 36.355 152.439 22.189  1.00 40.55 ? 301 HIS A ND1 1 
ATOM   2262 C  CD2 . HIS A 1 301 ? 38.506 152.814 22.285  1.00 38.96 ? 301 HIS A CD2 1 
ATOM   2263 C  CE1 . HIS A 1 301 ? 36.584 153.107 23.305  1.00 39.85 ? 301 HIS A CE1 1 
ATOM   2264 N  NE2 . HIS A 1 301 ? 37.881 153.347 23.387  1.00 40.10 ? 301 HIS A NE2 1 
ATOM   2265 N  N   . PHE A 1 302 ? 36.389 154.478 19.318  1.00 33.94 ? 302 PHE A N   1 
ATOM   2266 C  CA  . PHE A 1 302 ? 36.608 155.898 19.032  1.00 35.42 ? 302 PHE A CA  1 
ATOM   2267 C  C   . PHE A 1 302 ? 37.628 156.177 17.940  1.00 33.77 ? 302 PHE A C   1 
ATOM   2268 O  O   . PHE A 1 302 ? 37.257 156.264 16.773  1.00 34.97 ? 302 PHE A O   1 
ATOM   2269 C  CB  . PHE A 1 302 ? 36.996 156.669 20.302  1.00 39.42 ? 302 PHE A CB  1 
ATOM   2270 C  CG  . PHE A 1 302 ? 37.089 158.171 20.093  1.00 44.16 ? 302 PHE A CG  1 
ATOM   2271 C  CD1 . PHE A 1 302 ? 37.855 158.966 20.945  1.00 45.61 ? 302 PHE A CD1 1 
ATOM   2272 C  CD2 . PHE A 1 302 ? 36.453 158.779 19.010  1.00 44.12 ? 302 PHE A CD2 1 
ATOM   2273 C  CE1 . PHE A 1 302 ? 37.989 160.335 20.714  1.00 46.59 ? 302 PHE A CE1 1 
ATOM   2274 C  CE2 . PHE A 1 302 ? 36.583 160.147 18.772  1.00 44.80 ? 302 PHE A CE2 1 
ATOM   2275 C  CZ  . PHE A 1 302 ? 37.352 160.925 19.621  1.00 46.61 ? 302 PHE A CZ  1 
ATOM   2276 N  N   . ASP A 1 303 ? 38.899 156.338 18.311  1.00 32.38 ? 303 ASP A N   1 
ATOM   2277 C  CA  . ASP A 1 303 ? 39.952 156.598 17.322  1.00 31.94 ? 303 ASP A CA  1 
ATOM   2278 C  C   . ASP A 1 303 ? 41.308 155.998 17.705  1.00 31.43 ? 303 ASP A C   1 
ATOM   2279 O  O   . ASP A 1 303 ? 42.352 156.468 17.241  1.00 31.29 ? 303 ASP A O   1 
ATOM   2280 C  CB  . ASP A 1 303 ? 40.131 158.103 17.105  1.00 33.90 ? 303 ASP A CB  1 
ATOM   2281 C  CG  . ASP A 1 303 ? 40.460 158.850 18.394  1.00 36.74 ? 303 ASP A CG  1 
ATOM   2282 O  OD1 . ASP A 1 303 ? 41.023 158.234 19.328  1.00 36.17 ? 303 ASP A OD1 1 
ATOM   2283 O  OD2 . ASP A 1 303 ? 40.164 160.064 18.470  1.00 39.66 ? 303 ASP A OD2 1 
ATOM   2284 N  N   . VAL A 1 304 ? 41.296 154.953 18.530  1.00 30.28 ? 304 VAL A N   1 
ATOM   2285 C  CA  . VAL A 1 304 ? 42.538 154.328 18.984  1.00 29.25 ? 304 VAL A CA  1 
ATOM   2286 C  C   . VAL A 1 304 ? 43.041 153.116 18.201  1.00 27.36 ? 304 VAL A C   1 
ATOM   2287 O  O   . VAL A 1 304 ? 44.121 152.615 18.487  1.00 28.30 ? 304 VAL A O   1 
ATOM   2288 C  CB  . VAL A 1 304 ? 42.413 153.881 20.449  1.00 30.69 ? 304 VAL A CB  1 
ATOM   2289 C  CG1 . VAL A 1 304 ? 41.918 155.035 21.300  1.00 31.59 ? 304 VAL A CG1 1 
ATOM   2290 C  CG2 . VAL A 1 304 ? 41.465 152.687 20.548  1.00 31.06 ? 304 VAL A CG2 1 
ATOM   2291 N  N   . GLU A 1 305 ? 42.277 152.648 17.221  1.00 25.36 ? 305 GLU A N   1 
ATOM   2292 C  CA  . GLU A 1 305 ? 42.668 151.465 16.462  1.00 23.53 ? 305 GLU A CA  1 
ATOM   2293 C  C   . GLU A 1 305 ? 43.676 151.698 15.348  1.00 23.62 ? 305 GLU A C   1 
ATOM   2294 O  O   . GLU A 1 305 ? 44.517 150.843 15.072  1.00 24.65 ? 305 GLU A O   1 
ATOM   2295 C  CB  . GLU A 1 305 ? 41.415 150.775 15.918  1.00 22.93 ? 305 GLU A CB  1 
ATOM   2296 C  CG  . GLU A 1 305 ? 40.485 150.324 17.042  1.00 23.30 ? 305 GLU A CG  1 
ATOM   2297 C  CD  . GLU A 1 305 ? 39.601 149.154 16.663  1.00 24.37 ? 305 GLU A CD  1 
ATOM   2298 O  OE1 . GLU A 1 305 ? 40.068 148.267 15.910  1.00 24.01 ? 305 GLU A OE1 1 
ATOM   2299 O  OE2 . GLU A 1 305 ? 38.448 149.113 17.141  1.00 23.24 ? 305 GLU A OE2 1 
ATOM   2300 N  N   . ILE A 1 306 ? 43.591 152.854 14.708  1.00 23.26 ? 306 ILE A N   1 
ATOM   2301 C  CA  . ILE A 1 306 ? 44.506 153.204 13.633  1.00 21.66 ? 306 ILE A CA  1 
ATOM   2302 C  C   . ILE A 1 306 ? 45.488 154.230 14.181  1.00 22.25 ? 306 ILE A C   1 
ATOM   2303 O  O   . ILE A 1 306 ? 45.103 155.116 14.940  1.00 23.18 ? 306 ILE A O   1 
ATOM   2304 C  CB  . ILE A 1 306 ? 43.743 153.816 12.448  1.00 21.04 ? 306 ILE A CB  1 
ATOM   2305 C  CG1 . ILE A 1 306 ? 42.662 152.834 11.983  1.00 19.72 ? 306 ILE A CG1 1 
ATOM   2306 C  CG2 . ILE A 1 306 ? 44.709 154.154 11.318  1.00 19.02 ? 306 ILE A CG2 1 
ATOM   2307 C  CD1 . ILE A 1 306 ? 41.738 153.376 10.910  1.00 19.65 ? 306 ILE A CD1 1 
ATOM   2308 N  N   . ASP A 1 307 ? 46.757 154.105 13.819  1.00 22.17 ? 307 ASP A N   1 
ATOM   2309 C  CA  . ASP A 1 307 ? 47.750 155.054 14.290  1.00 22.82 ? 307 ASP A CA  1 
ATOM   2310 C  C   . ASP A 1 307 ? 47.747 156.235 13.322  1.00 23.32 ? 307 ASP A C   1 
ATOM   2311 O  O   . ASP A 1 307 ? 48.654 156.387 12.499  1.00 22.82 ? 307 ASP A O   1 
ATOM   2312 C  CB  . ASP A 1 307 ? 49.128 154.407 14.323  1.00 24.11 ? 307 ASP A CB  1 
ATOM   2313 C  CG  . ASP A 1 307 ? 50.116 155.200 15.146  1.00 28.26 ? 307 ASP A CG  1 
ATOM   2314 O  OD1 . ASP A 1 307 ? 49.764 156.333 15.549  1.00 28.25 ? 307 ASP A OD1 1 
ATOM   2315 O  OD2 . ASP A 1 307 ? 51.240 154.692 15.388  1.00 30.20 ? 307 ASP A OD2 1 
ATOM   2316 N  N   . VAL A 1 308 ? 46.709 157.060 13.422  1.00 23.06 ? 308 VAL A N   1 
ATOM   2317 C  CA  . VAL A 1 308 ? 46.558 158.218 12.555  1.00 25.93 ? 308 VAL A CA  1 
ATOM   2318 C  C   . VAL A 1 308 ? 47.689 159.215 12.780  1.00 27.05 ? 308 VAL A C   1 
ATOM   2319 O  O   . VAL A 1 308 ? 48.149 159.879 11.847  1.00 28.35 ? 308 VAL A O   1 
ATOM   2320 C  CB  . VAL A 1 308 ? 45.196 158.923 12.802  1.00 25.54 ? 308 VAL A CB  1 
ATOM   2321 C  CG1 . VAL A 1 308 ? 45.065 160.144 11.899  1.00 25.51 ? 308 VAL A CG1 1 
ATOM   2322 C  CG2 . VAL A 1 308 ? 44.059 157.952 12.542  1.00 24.40 ? 308 VAL A CG2 1 
ATOM   2323 N  N   . LYS A 1 309 ? 48.139 159.311 14.023  1.00 27.35 ? 309 LYS A N   1 
ATOM   2324 C  CA  . LYS A 1 309 ? 49.215 160.224 14.363  1.00 28.14 ? 309 LYS A CA  1 
ATOM   2325 C  C   . LYS A 1 309 ? 50.456 159.901 13.539  1.00 29.17 ? 309 LYS A C   1 
ATOM   2326 O  O   . LYS A 1 309 ? 51.163 160.809 13.087  1.00 30.99 ? 309 LYS A O   1 
ATOM   2327 C  CB  . LYS A 1 309 ? 49.521 160.120 15.848  1.00 28.68 ? 309 LYS A CB  1 
ATOM   2328 C  CG  . LYS A 1 309 ? 50.554 161.092 16.347  1.00 31.31 ? 309 LYS A CG  1 
ATOM   2329 C  CD  . LYS A 1 309 ? 50.481 161.143 17.858  1.00 33.72 ? 309 LYS A CD  1 
ATOM   2330 C  CE  . LYS A 1 309 ? 51.596 161.966 18.461  1.00 35.11 ? 309 LYS A CE  1 
ATOM   2331 N  NZ  . LYS A 1 309 ? 51.460 161.962 19.946  1.00 37.63 ? 309 LYS A NZ  1 
ATOM   2332 N  N   . TRP A 1 310 ? 50.724 158.613 13.337  1.00 27.52 ? 310 TRP A N   1 
ATOM   2333 C  CA  . TRP A 1 310 ? 51.879 158.222 12.540  1.00 26.79 ? 310 TRP A CA  1 
ATOM   2334 C  C   . TRP A 1 310 ? 51.731 158.806 11.133  1.00 26.05 ? 310 TRP A C   1 
ATOM   2335 O  O   . TRP A 1 310 ? 52.673 159.407 10.610  1.00 25.54 ? 310 TRP A O   1 
ATOM   2336 C  CB  . TRP A 1 310 ? 51.999 156.697 12.449  1.00 25.90 ? 310 TRP A CB  1 
ATOM   2337 C  CG  . TRP A 1 310 ? 53.216 156.249 11.689  1.00 24.71 ? 310 TRP A CG  1 
ATOM   2338 C  CD1 . TRP A 1 310 ? 54.426 155.891 12.213  1.00 24.82 ? 310 TRP A CD1 1 
ATOM   2339 C  CD2 . TRP A 1 310 ? 53.355 156.156 10.264  1.00 24.40 ? 310 TRP A CD2 1 
ATOM   2340 N  NE1 . TRP A 1 310 ? 55.310 155.581 11.202  1.00 23.29 ? 310 TRP A NE1 1 
ATOM   2341 C  CE2 . TRP A 1 310 ? 54.678 155.739 9.998   1.00 24.28 ? 310 TRP A CE2 1 
ATOM   2342 C  CE3 . TRP A 1 310 ? 52.492 156.386 9.189   1.00 24.54 ? 310 TRP A CE3 1 
ATOM   2343 C  CZ2 . TRP A 1 310 ? 55.156 155.550 8.701   1.00 26.03 ? 310 TRP A CZ2 1 
ATOM   2344 C  CZ3 . TRP A 1 310 ? 52.969 156.197 7.900   1.00 27.02 ? 310 TRP A CZ3 1 
ATOM   2345 C  CH2 . TRP A 1 310 ? 54.289 155.783 7.667   1.00 26.70 ? 310 TRP A CH2 1 
ATOM   2346 N  N   . LEU A 1 311 ? 50.553 158.624 10.529  1.00 24.58 ? 311 LEU A N   1 
ATOM   2347 C  CA  . LEU A 1 311 ? 50.277 159.146 9.184   1.00 24.37 ? 311 LEU A CA  1 
ATOM   2348 C  C   . LEU A 1 311 ? 50.567 160.639 9.113   1.00 24.89 ? 311 LEU A C   1 
ATOM   2349 O  O   . LEU A 1 311 ? 51.221 161.110 8.175   1.00 25.12 ? 311 LEU A O   1 
ATOM   2350 C  CB  . LEU A 1 311 ? 48.813 158.919 8.789   1.00 22.84 ? 311 LEU A CB  1 
ATOM   2351 C  CG  . LEU A 1 311 ? 48.357 157.540 8.307   1.00 23.13 ? 311 LEU A CG  1 
ATOM   2352 C  CD1 . LEU A 1 311 ? 46.843 157.548 8.129   1.00 21.76 ? 311 LEU A CD1 1 
ATOM   2353 C  CD2 . LEU A 1 311 ? 49.050 157.186 7.000   1.00 20.10 ? 311 LEU A CD2 1 
ATOM   2354 N  N   . ASN A 1 312 ? 50.074 161.382 10.104  1.00 24.27 ? 312 ASN A N   1 
ATOM   2355 C  CA  . ASN A 1 312 ? 50.287 162.823 10.144  1.00 24.18 ? 312 ASN A CA  1 
ATOM   2356 C  C   . ASN A 1 312 ? 51.764 163.178 10.260  1.00 25.64 ? 312 ASN A C   1 
ATOM   2357 O  O   . ASN A 1 312 ? 52.245 164.090 9.585   1.00 27.04 ? 312 ASN A O   1 
ATOM   2358 C  CB  . ASN A 1 312 ? 49.541 163.461 11.317  1.00 21.21 ? 312 ASN A CB  1 
ATOM   2359 C  CG  . ASN A 1 312 ? 48.040 163.479 11.121  1.00 20.27 ? 312 ASN A CG  1 
ATOM   2360 O  OD1 . ASN A 1 312 ? 47.538 163.783 10.035  1.00 19.15 ? 312 ASN A OD1 1 
ATOM   2361 N  ND2 . ASN A 1 312 ? 47.312 163.175 12.184  1.00 20.04 ? 312 ASN A ND2 1 
ATOM   2362 N  N   . GLU A 1 313 ? 52.484 162.452 11.110  1.00 26.07 ? 313 GLU A N   1 
ATOM   2363 C  CA  . GLU A 1 313 ? 53.900 162.721 11.319  1.00 26.32 ? 313 GLU A CA  1 
ATOM   2364 C  C   . GLU A 1 313 ? 54.845 162.135 10.272  1.00 27.08 ? 313 GLU A C   1 
ATOM   2365 O  O   . GLU A 1 313 ? 56.008 162.518 10.228  1.00 27.81 ? 313 GLU A O   1 
ATOM   2366 C  CB  . GLU A 1 313 ? 54.337 162.211 12.690  1.00 27.17 ? 313 GLU A CB  1 
ATOM   2367 C  CG  . GLU A 1 313 ? 53.492 162.681 13.859  1.00 31.78 ? 313 GLU A CG  1 
ATOM   2368 C  CD  . GLU A 1 313 ? 53.954 162.077 15.178  1.00 36.01 ? 313 GLU A CD  1 
ATOM   2369 O  OE1 . GLU A 1 313 ? 54.758 161.113 15.141  1.00 37.55 ? 313 GLU A OE1 1 
ATOM   2370 O  OE2 . GLU A 1 313 ? 53.506 162.555 16.247  1.00 36.98 ? 313 GLU A OE2 1 
ATOM   2371 N  N   . ASN A 1 314 ? 54.374 161.225 9.424   1.00 26.96 ? 314 ASN A N   1 
ATOM   2372 C  CA  . ASN A 1 314 ? 55.278 160.617 8.448   1.00 26.20 ? 314 ASN A CA  1 
ATOM   2373 C  C   . ASN A 1 314 ? 54.962 160.831 6.976   1.00 26.68 ? 314 ASN A C   1 
ATOM   2374 O  O   . ASN A 1 314 ? 55.831 160.662 6.118   1.00 26.37 ? 314 ASN A O   1 
ATOM   2375 C  CB  . ASN A 1 314 ? 55.381 159.124 8.730   1.00 26.18 ? 314 ASN A CB  1 
ATOM   2376 C  CG  . ASN A 1 314 ? 56.013 158.836 10.077  1.00 26.98 ? 314 ASN A CG  1 
ATOM   2377 O  OD1 . ASN A 1 314 ? 57.237 158.757 10.200  1.00 24.61 ? 314 ASN A OD1 1 
ATOM   2378 N  ND2 . ASN A 1 314 ? 55.178 158.699 11.103  1.00 26.42 ? 314 ASN A ND2 1 
ATOM   2379 N  N   . ALA A 1 315 ? 53.724 161.206 6.681   1.00 26.11 ? 315 ALA A N   1 
ATOM   2380 C  CA  . ALA A 1 315 ? 53.322 161.426 5.306   1.00 25.43 ? 315 ALA A CA  1 
ATOM   2381 C  C   . ALA A 1 315 ? 53.983 162.686 4.750   1.00 26.41 ? 315 ALA A C   1 
ATOM   2382 O  O   . ALA A 1 315 ? 54.235 163.642 5.481   1.00 25.12 ? 315 ALA A O   1 
ATOM   2383 C  CB  . ALA A 1 315 ? 51.801 161.544 5.227   1.00 24.24 ? 315 ALA A CB  1 
ATOM   2384 N  N   . VAL A 1 316 ? 54.274 162.676 3.455   1.00 27.07 ? 316 VAL A N   1 
ATOM   2385 C  CA  . VAL A 1 316 ? 54.876 163.833 2.814   1.00 28.29 ? 316 VAL A CA  1 
ATOM   2386 C  C   . VAL A 1 316 ? 53.769 164.673 2.178   1.00 28.32 ? 316 VAL A C   1 
ATOM   2387 O  O   . VAL A 1 316 ? 54.015 165.768 1.677   1.00 28.67 ? 316 VAL A O   1 
ATOM   2388 C  CB  . VAL A 1 316 ? 55.886 163.413 1.726   1.00 30.45 ? 316 VAL A CB  1 
ATOM   2389 C  CG1 . VAL A 1 316 ? 57.082 162.738 2.370   1.00 30.06 ? 316 VAL A CG1 1 
ATOM   2390 C  CG2 . VAL A 1 316 ? 55.217 162.476 0.719   1.00 30.21 ? 316 VAL A CG2 1 
ATOM   2391 N  N   . GLU A 1 317 ? 52.549 164.144 2.196   1.00 28.13 ? 317 GLU A N   1 
ATOM   2392 C  CA  . GLU A 1 317 ? 51.386 164.840 1.646   1.00 27.83 ? 317 GLU A CA  1 
ATOM   2393 C  C   . GLU A 1 317 ? 50.139 164.505 2.432   1.00 26.34 ? 317 GLU A C   1 
ATOM   2394 O  O   . GLU A 1 317 ? 50.019 163.423 2.992   1.00 26.81 ? 317 GLU A O   1 
ATOM   2395 C  CB  . GLU A 1 317 ? 51.098 164.436 0.202   1.00 27.74 ? 317 GLU A CB  1 
ATOM   2396 C  CG  . GLU A 1 317 ? 51.949 165.055 -0.869  1.00 31.14 ? 317 GLU A CG  1 
ATOM   2397 C  CD  . GLU A 1 317 ? 51.350 164.807 -2.240  1.00 33.44 ? 317 GLU A CD  1 
ATOM   2398 O  OE1 . GLU A 1 317 ? 50.380 164.021 -2.324  1.00 34.30 ? 317 GLU A OE1 1 
ATOM   2399 O  OE2 . GLU A 1 317 ? 51.842 165.390 -3.231  1.00 35.79 ? 317 GLU A OE2 1 
ATOM   2400 N  N   . LYS A 1 318 ? 49.209 165.446 2.462   1.00 25.82 ? 318 LYS A N   1 
ATOM   2401 C  CA  . LYS A 1 318 ? 47.931 165.231 3.119   1.00 24.37 ? 318 LYS A CA  1 
ATOM   2402 C  C   . LYS A 1 318 ? 46.898 166.041 2.359   1.00 23.22 ? 318 LYS A C   1 
ATOM   2403 O  O   . LYS A 1 318 ? 46.769 167.255 2.551   1.00 22.37 ? 318 LYS A O   1 
ATOM   2404 C  CB  . LYS A 1 318 ? 47.948 165.668 4.580   1.00 22.28 ? 318 LYS A CB  1 
ATOM   2405 C  CG  . LYS A 1 318 ? 46.609 165.389 5.246   1.00 21.88 ? 318 LYS A CG  1 
ATOM   2406 C  CD  . LYS A 1 318 ? 46.633 165.673 6.725   1.00 22.80 ? 318 LYS A CD  1 
ATOM   2407 C  CE  . LYS A 1 318 ? 45.251 165.552 7.326   1.00 20.18 ? 318 LYS A CE  1 
ATOM   2408 N  NZ  . LYS A 1 318 ? 45.299 165.909 8.765   1.00 22.38 ? 318 LYS A NZ  1 
ATOM   2409 N  N   . VAL A 1 319 ? 46.173 165.369 1.476   1.00 21.16 ? 319 VAL A N   1 
ATOM   2410 C  CA  . VAL A 1 319 ? 45.171 166.058 0.691   1.00 19.87 ? 319 VAL A CA  1 
ATOM   2411 C  C   . VAL A 1 319 ? 43.755 165.675 1.066   1.00 20.00 ? 319 VAL A C   1 
ATOM   2412 O  O   . VAL A 1 319 ? 43.382 164.510 1.027   1.00 21.30 ? 319 VAL A O   1 
ATOM   2413 C  CB  . VAL A 1 319 ? 45.374 165.809 -0.807  1.00 17.31 ? 319 VAL A CB  1 
ATOM   2414 C  CG1 . VAL A 1 319 ? 44.333 166.576 -1.601  1.00 15.15 ? 319 VAL A CG1 1 
ATOM   2415 C  CG2 . VAL A 1 319 ? 46.776 166.238 -1.209  1.00 14.15 ? 319 VAL A CG2 1 
ATOM   2416 N  N   . ASN A 1 320 ? 42.968 166.673 1.438   1.00 19.51 ? 320 ASN A N   1 
ATOM   2417 C  CA  . ASN A 1 320 ? 41.588 166.432 1.792   1.00 20.09 ? 320 ASN A CA  1 
ATOM   2418 C  C   . ASN A 1 320 ? 40.745 166.303 0.524   1.00 20.50 ? 320 ASN A C   1 
ATOM   2419 O  O   . ASN A 1 320 ? 40.650 167.232 -0.274  1.00 21.06 ? 320 ASN A O   1 
ATOM   2420 C  CB  . ASN A 1 320 ? 41.059 167.565 2.663   1.00 19.53 ? 320 ASN A CB  1 
ATOM   2421 C  CG  . ASN A 1 320 ? 39.569 167.483 2.863   1.00 20.69 ? 320 ASN A CG  1 
ATOM   2422 O  OD1 . ASN A 1 320 ? 38.794 167.968 2.039   1.00 22.56 ? 320 ASN A OD1 1 
ATOM   2423 N  ND2 . ASN A 1 320 ? 39.153 166.847 3.950   1.00 19.56 ? 320 ASN A ND2 1 
ATOM   2424 N  N   . ILE A 1 321 ? 40.142 165.133 0.349   1.00 21.39 ? 321 ILE A N   1 
ATOM   2425 C  CA  . ILE A 1 321 ? 39.313 164.842 -0.811  1.00 21.49 ? 321 ILE A CA  1 
ATOM   2426 C  C   . ILE A 1 321 ? 37.919 165.417 -0.633  1.00 20.60 ? 321 ILE A C   1 
ATOM   2427 O  O   . ILE A 1 321 ? 37.316 165.914 -1.581  1.00 21.01 ? 321 ILE A O   1 
ATOM   2428 C  CB  . ILE A 1 321 ? 39.213 163.325 -1.016  1.00 22.40 ? 321 ILE A CB  1 
ATOM   2429 C  CG1 . ILE A 1 321 ? 40.613 162.760 -1.242  1.00 24.56 ? 321 ILE A CG1 1 
ATOM   2430 C  CG2 . ILE A 1 321 ? 38.299 163.000 -2.181  1.00 19.18 ? 321 ILE A CG2 1 
ATOM   2431 C  CD1 . ILE A 1 321 ? 40.637 161.244 -1.315  1.00 31.56 ? 321 ILE A CD1 1 
ATOM   2432 N  N   . LYS A 1 322 ? 37.420 165.334 0.594   1.00 19.76 ? 322 LYS A N   1 
ATOM   2433 C  CA  . LYS A 1 322 ? 36.099 165.834 0.958   1.00 19.17 ? 322 LYS A CA  1 
ATOM   2434 C  C   . LYS A 1 322 ? 36.007 165.624 2.468   1.00 18.92 ? 322 LYS A C   1 
ATOM   2435 O  O   . LYS A 1 322 ? 36.818 164.912 3.043   1.00 18.59 ? 322 LYS A O   1 
ATOM   2436 C  CB  . LYS A 1 322 ? 34.994 165.034 0.248   1.00 18.15 ? 322 LYS A CB  1 
ATOM   2437 C  CG  . LYS A 1 322 ? 34.718 163.664 0.872   1.00 19.08 ? 322 LYS A CG  1 
ATOM   2438 C  CD  . LYS A 1 322 ? 33.641 162.891 0.125   1.00 17.88 ? 322 LYS A CD  1 
ATOM   2439 C  CE  . LYS A 1 322 ? 34.057 162.615 -1.311  1.00 19.03 ? 322 LYS A CE  1 
ATOM   2440 N  NZ  . LYS A 1 322 ? 33.104 161.727 -2.021  1.00 17.52 ? 322 LYS A NZ  1 
ATOM   2441 N  N   . PRO A 1 323 ? 35.025 166.244 3.128   1.00 20.52 ? 323 PRO A N   1 
ATOM   2442 C  CA  . PRO A 1 323 ? 34.905 166.067 4.579   1.00 20.78 ? 323 PRO A CA  1 
ATOM   2443 C  C   . PRO A 1 323 ? 35.031 164.617 5.029   1.00 21.25 ? 323 PRO A C   1 
ATOM   2444 O  O   . PRO A 1 323 ? 34.428 163.724 4.438   1.00 22.42 ? 323 PRO A O   1 
ATOM   2445 C  CB  . PRO A 1 323 ? 33.526 166.652 4.879   1.00 19.75 ? 323 PRO A CB  1 
ATOM   2446 C  CG  . PRO A 1 323 ? 33.456 167.795 3.910   1.00 19.46 ? 323 PRO A CG  1 
ATOM   2447 C  CD  . PRO A 1 323 ? 34.002 167.179 2.622   1.00 19.95 ? 323 PRO A CD  1 
ATOM   2448 N  N   . GLN A 1 324 ? 35.827 164.395 6.072   1.00 21.64 ? 324 GLN A N   1 
ATOM   2449 C  CA  . GLN A 1 324 ? 36.042 163.061 6.631   1.00 21.22 ? 324 GLN A CA  1 
ATOM   2450 C  C   . GLN A 1 324 ? 36.717 162.065 5.683   1.00 21.32 ? 324 GLN A C   1 
ATOM   2451 O  O   . GLN A 1 324 ? 36.600 160.851 5.849   1.00 22.24 ? 324 GLN A O   1 
ATOM   2452 C  CB  . GLN A 1 324 ? 34.713 162.487 7.121   1.00 20.84 ? 324 GLN A CB  1 
ATOM   2453 C  CG  . GLN A 1 324 ? 34.110 163.273 8.258   1.00 22.46 ? 324 GLN A CG  1 
ATOM   2454 C  CD  . GLN A 1 324 ? 35.146 163.664 9.290   1.00 24.78 ? 324 GLN A CD  1 
ATOM   2455 O  OE1 . GLN A 1 324 ? 35.880 162.820 9.802   1.00 27.27 ? 324 GLN A OE1 1 
ATOM   2456 N  NE2 . GLN A 1 324 ? 35.216 164.952 9.599   1.00 24.90 ? 324 GLN A NE2 1 
ATOM   2457 N  N   . VAL A 1 325 ? 37.426 162.583 4.692   1.00 20.71 ? 325 VAL A N   1 
ATOM   2458 C  CA  . VAL A 1 325 ? 38.123 161.741 3.733   1.00 21.12 ? 325 VAL A CA  1 
ATOM   2459 C  C   . VAL A 1 325 ? 39.426 162.444 3.394   1.00 21.57 ? 325 VAL A C   1 
ATOM   2460 O  O   . VAL A 1 325 ? 39.420 163.498 2.756   1.00 22.25 ? 325 VAL A O   1 
ATOM   2461 C  CB  . VAL A 1 325 ? 37.303 161.554 2.431   1.00 22.34 ? 325 VAL A CB  1 
ATOM   2462 C  CG1 . VAL A 1 325 ? 38.045 160.630 1.472   1.00 20.27 ? 325 VAL A CG1 1 
ATOM   2463 C  CG2 . VAL A 1 325 ? 35.932 160.994 2.755   1.00 21.82 ? 325 VAL A CG2 1 
ATOM   2464 N  N   . ASP A 1 326 ? 40.539 161.866 3.832   1.00 21.06 ? 326 ASP A N   1 
ATOM   2465 C  CA  . ASP A 1 326 ? 41.845 162.457 3.574   1.00 20.53 ? 326 ASP A CA  1 
ATOM   2466 C  C   . ASP A 1 326 ? 42.784 161.490 2.891   1.00 20.46 ? 326 ASP A C   1 
ATOM   2467 O  O   . ASP A 1 326 ? 42.804 160.302 3.207   1.00 20.71 ? 326 ASP A O   1 
ATOM   2468 C  CB  . ASP A 1 326 ? 42.457 162.940 4.882   1.00 19.94 ? 326 ASP A CB  1 
ATOM   2469 C  CG  . ASP A 1 326 ? 41.653 164.045 5.506   1.00 20.07 ? 326 ASP A CG  1 
ATOM   2470 O  OD1 . ASP A 1 326 ? 41.612 165.146 4.920   1.00 20.38 ? 326 ASP A OD1 1 
ATOM   2471 O  OD2 . ASP A 1 326 ? 41.045 163.810 6.569   1.00 22.45 ? 326 ASP A OD2 1 
ATOM   2472 N  N   . ARG A 1 327 ? 43.577 162.014 1.964   1.00 20.74 ? 327 ARG A N   1 
ATOM   2473 C  CA  . ARG A 1 327 ? 44.516 161.201 1.206   1.00 21.64 ? 327 ARG A CA  1 
ATOM   2474 C  C   . ARG A 1 327 ? 45.976 161.542 1.510   1.00 22.93 ? 327 ARG A C   1 
ATOM   2475 O  O   . ARG A 1 327 ? 46.504 162.553 1.037   1.00 25.94 ? 327 ARG A O   1 
ATOM   2476 C  CB  . ARG A 1 327 ? 44.237 161.377 -0.285  1.00 19.57 ? 327 ARG A CB  1 
ATOM   2477 C  CG  . ARG A 1 327 ? 44.799 160.279 -1.156  1.00 20.27 ? 327 ARG A CG  1 
ATOM   2478 C  CD  . ARG A 1 327 ? 44.608 160.635 -2.604  1.00 20.23 ? 327 ARG A CD  1 
ATOM   2479 N  NE  . ARG A 1 327 ? 44.932 159.546 -3.512  1.00 19.71 ? 327 ARG A NE  1 
ATOM   2480 C  CZ  . ARG A 1 327 ? 45.230 159.736 -4.789  1.00 21.67 ? 327 ARG A CZ  1 
ATOM   2481 N  NH1 . ARG A 1 327 ? 45.248 160.970 -5.274  1.00 23.83 ? 327 ARG A NH1 1 
ATOM   2482 N  NH2 . ARG A 1 327 ? 45.479 158.708 -5.587  1.00 21.52 ? 327 ARG A NH2 1 
ATOM   2483 N  N   . TYR A 1 328 ? 46.628 160.691 2.296   1.00 22.64 ? 328 TYR A N   1 
ATOM   2484 C  CA  . TYR A 1 328 ? 48.025 160.902 2.655   1.00 21.64 ? 328 TYR A CA  1 
ATOM   2485 C  C   . TYR A 1 328 ? 48.955 160.256 1.653   1.00 22.93 ? 328 TYR A C   1 
ATOM   2486 O  O   . TYR A 1 328 ? 48.669 159.174 1.143   1.00 24.82 ? 328 TYR A O   1 
ATOM   2487 C  CB  . TYR A 1 328 ? 48.354 160.285 4.014   1.00 20.36 ? 328 TYR A CB  1 
ATOM   2488 C  CG  . TYR A 1 328 ? 47.646 160.882 5.199   1.00 20.25 ? 328 TYR A CG  1 
ATOM   2489 C  CD1 . TYR A 1 328 ? 46.311 160.601 5.451   1.00 18.87 ? 328 TYR A CD1 1 
ATOM   2490 C  CD2 . TYR A 1 328 ? 48.326 161.694 6.096   1.00 20.18 ? 328 TYR A CD2 1 
ATOM   2491 C  CE1 . TYR A 1 328 ? 45.680 161.103 6.564   1.00 16.66 ? 328 TYR A CE1 1 
ATOM   2492 C  CE2 . TYR A 1 328 ? 47.699 162.203 7.211   1.00 18.11 ? 328 TYR A CE2 1 
ATOM   2493 C  CZ  . TYR A 1 328 ? 46.378 161.900 7.441   1.00 17.14 ? 328 TYR A CZ  1 
ATOM   2494 O  OH  . TYR A 1 328 ? 45.753 162.380 8.566   1.00 18.30 ? 328 TYR A OH  1 
ATOM   2495 N  N   . ARG A 1 329 ? 50.071 160.922 1.374   1.00 23.47 ? 329 ARG A N   1 
ATOM   2496 C  CA  . ARG A 1 329 ? 51.074 160.365 0.481   1.00 23.28 ? 329 ARG A CA  1 
ATOM   2497 C  C   . ARG A 1 329 ? 52.234 160.023 1.410   1.00 23.85 ? 329 ARG A C   1 
ATOM   2498 O  O   . ARG A 1 329 ? 52.571 160.816 2.299   1.00 23.36 ? 329 ARG A O   1 
ATOM   2499 C  CB  . ARG A 1 329 ? 51.519 161.385 -0.562  1.00 23.93 ? 329 ARG A CB  1 
ATOM   2500 C  CG  . ARG A 1 329 ? 52.475 160.805 -1.583  1.00 24.66 ? 329 ARG A CG  1 
ATOM   2501 C  CD  . ARG A 1 329 ? 53.108 161.889 -2.397  1.00 25.87 ? 329 ARG A CD  1 
ATOM   2502 N  NE  . ARG A 1 329 ? 54.113 161.355 -3.305  1.00 28.31 ? 329 ARG A NE  1 
ATOM   2503 C  CZ  . ARG A 1 329 ? 53.843 160.859 -4.505  1.00 29.00 ? 329 ARG A CZ  1 
ATOM   2504 N  NH1 . ARG A 1 329 ? 52.593 160.830 -4.949  1.00 29.34 ? 329 ARG A NH1 1 
ATOM   2505 N  NH2 . ARG A 1 329 ? 54.826 160.393 -5.261  1.00 29.46 ? 329 ARG A NH2 1 
ATOM   2506 N  N   . LEU A 1 330 ? 52.829 158.845 1.222   1.00 23.91 ? 330 LEU A N   1 
ATOM   2507 C  CA  . LEU A 1 330 ? 53.932 158.399 2.075   1.00 23.87 ? 330 LEU A CA  1 
ATOM   2508 C  C   . LEU A 1 330 ? 55.285 158.603 1.418   1.00 24.48 ? 330 LEU A C   1 
ATOM   2509 O  O   . LEU A 1 330 ? 55.374 158.779 0.203   1.00 24.77 ? 330 LEU A O   1 
ATOM   2510 C  CB  . LEU A 1 330 ? 53.755 156.923 2.428   1.00 24.76 ? 330 LEU A CB  1 
ATOM   2511 C  CG  . LEU A 1 330 ? 52.408 156.588 3.075   1.00 27.45 ? 330 LEU A CG  1 
ATOM   2512 C  CD1 . LEU A 1 330 ? 52.357 155.110 3.461   1.00 27.18 ? 330 LEU A CD1 1 
ATOM   2513 C  CD2 . LEU A 1 330 ? 52.206 157.479 4.302   1.00 26.85 ? 330 LEU A CD2 1 
ATOM   2514 N  N   . LYS A 1 331 ? 56.344 158.578 2.222   1.00 24.80 ? 331 LYS A N   1 
ATOM   2515 C  CA  . LYS A 1 331 ? 57.685 158.764 1.678   1.00 24.11 ? 331 LYS A CA  1 
ATOM   2516 C  C   . LYS A 1 331 ? 57.982 157.788 0.553   1.00 23.93 ? 331 LYS A C   1 
ATOM   2517 O  O   . LYS A 1 331 ? 58.820 158.075 -0.297  1.00 24.26 ? 331 LYS A O   1 
ATOM   2518 C  CB  . LYS A 1 331 ? 58.750 158.613 2.758   1.00 23.59 ? 331 LYS A CB  1 
ATOM   2519 C  CG  . LYS A 1 331 ? 58.692 159.660 3.832   1.00 23.89 ? 331 LYS A CG  1 
ATOM   2520 C  CD  . LYS A 1 331 ? 60.031 159.760 4.515   1.00 26.76 ? 331 LYS A CD  1 
ATOM   2521 C  CE  . LYS A 1 331 ? 59.988 160.723 5.683   1.00 28.09 ? 331 LYS A CE  1 
ATOM   2522 N  NZ  . LYS A 1 331 ? 59.131 160.190 6.767   1.00 31.37 ? 331 LYS A NZ  1 
ATOM   2523 N  N   . ASN A 1 332 ? 57.307 156.639 0.542   1.00 22.91 ? 332 ASN A N   1 
ATOM   2524 C  CA  . ASN A 1 332 ? 57.535 155.664 -0.519  1.00 22.33 ? 332 ASN A CA  1 
ATOM   2525 C  C   . ASN A 1 332 ? 56.731 155.987 -1.772  1.00 22.89 ? 332 ASN A C   1 
ATOM   2526 O  O   . ASN A 1 332 ? 56.768 155.236 -2.747  1.00 23.66 ? 332 ASN A O   1 
ATOM   2527 C  CB  . ASN A 1 332 ? 57.201 154.241 -0.059  1.00 21.96 ? 332 ASN A CB  1 
ATOM   2528 C  CG  . ASN A 1 332 ? 55.752 154.076 0.365   1.00 23.31 ? 332 ASN A CG  1 
ATOM   2529 O  OD1 . ASN A 1 332 ? 54.834 154.586 -0.276  1.00 23.42 ? 332 ASN A OD1 1 
ATOM   2530 N  ND2 . ASN A 1 332 ? 55.541 153.335 1.444   1.00 26.42 ? 332 ASN A ND2 1 
ATOM   2531 N  N   . GLY A 1 333 ? 55.991 157.092 -1.743  1.00 22.88 ? 333 GLY A N   1 
ATOM   2532 C  CA  . GLY A 1 333 ? 55.209 157.475 -2.906  1.00 24.33 ? 333 GLY A CA  1 
ATOM   2533 C  C   . GLY A 1 333 ? 53.786 156.946 -2.967  1.00 26.68 ? 333 GLY A C   1 
ATOM   2534 O  O   . GLY A 1 333 ? 52.980 157.427 -3.769  1.00 27.66 ? 333 GLY A O   1 
ATOM   2535 N  N   . ARG A 1 334 ? 53.466 155.952 -2.143  1.00 26.97 ? 334 ARG A N   1 
ATOM   2536 C  CA  . ARG A 1 334 ? 52.117 155.397 -2.129  1.00 26.72 ? 334 ARG A CA  1 
ATOM   2537 C  C   . ARG A 1 334 ? 51.192 156.248 -1.266  1.00 25.20 ? 334 ARG A C   1 
ATOM   2538 O  O   . ARG A 1 334 ? 51.614 156.829 -0.265  1.00 24.08 ? 334 ARG A O   1 
ATOM   2539 C  CB  . ARG A 1 334 ? 52.138 153.961 -1.617  1.00 28.52 ? 334 ARG A CB  1 
ATOM   2540 C  CG  . ARG A 1 334 ? 52.825 153.013 -2.568  1.00 32.56 ? 334 ARG A CG  1 
ATOM   2541 C  CD  . ARG A 1 334 ? 52.850 151.602 -2.017  1.00 37.08 ? 334 ARG A CD  1 
ATOM   2542 N  NE  . ARG A 1 334 ? 53.263 150.649 -3.040  1.00 40.39 ? 334 ARG A NE  1 
ATOM   2543 C  CZ  . ARG A 1 334 ? 53.240 149.330 -2.888  1.00 42.52 ? 334 ARG A CZ  1 
ATOM   2544 N  NH1 . ARG A 1 334 ? 52.825 148.801 -1.743  1.00 43.20 ? 334 ARG A NH1 1 
ATOM   2545 N  NH2 . ARG A 1 334 ? 53.614 148.540 -3.888  1.00 42.06 ? 334 ARG A NH2 1 
ATOM   2546 N  N   . ARG A 1 335 ? 49.928 156.327 -1.666  1.00 23.20 ? 335 ARG A N   1 
ATOM   2547 C  CA  . ARG A 1 335 ? 48.957 157.125 -0.935  1.00 21.05 ? 335 ARG A CA  1 
ATOM   2548 C  C   . ARG A 1 335 ? 48.020 156.258 -0.110  1.00 20.63 ? 335 ARG A C   1 
ATOM   2549 O  O   . ARG A 1 335 ? 47.685 155.138 -0.486  1.00 21.51 ? 335 ARG A O   1 
ATOM   2550 C  CB  . ARG A 1 335 ? 48.137 157.994 -1.900  1.00 19.08 ? 335 ARG A CB  1 
ATOM   2551 C  CG  . ARG A 1 335 ? 48.881 159.191 -2.505  1.00 17.23 ? 335 ARG A CG  1 
ATOM   2552 C  CD  . ARG A 1 335 ? 50.036 158.779 -3.415  1.00 14.54 ? 335 ARG A CD  1 
ATOM   2553 N  NE  . ARG A 1 335 ? 49.604 157.963 -4.549  1.00 14.91 ? 335 ARG A NE  1 
ATOM   2554 C  CZ  . ARG A 1 335 ? 48.943 158.419 -5.612  1.00 15.33 ? 335 ARG A CZ  1 
ATOM   2555 N  NH1 . ARG A 1 335 ? 48.624 159.704 -5.703  1.00 17.67 ? 335 ARG A NH1 1 
ATOM   2556 N  NH2 . ARG A 1 335 ? 48.603 157.592 -6.590  1.00 9.92  ? 335 ARG A NH2 1 
ATOM   2557 N  N   . ILE A 1 336 ? 47.610 156.785 1.033   1.00 19.12 ? 336 ILE A N   1 
ATOM   2558 C  CA  . ILE A 1 336 ? 46.692 156.083 1.905   1.00 18.50 ? 336 ILE A CA  1 
ATOM   2559 C  C   . ILE A 1 336 ? 45.437 156.954 2.024   1.00 19.37 ? 336 ILE A C   1 
ATOM   2560 O  O   . ILE A 1 336 ? 45.524 158.158 2.272   1.00 19.51 ? 336 ILE A O   1 
ATOM   2561 C  CB  . ILE A 1 336 ? 47.311 155.867 3.315   1.00 18.15 ? 336 ILE A CB  1 
ATOM   2562 C  CG1 . ILE A 1 336 ? 48.557 154.977 3.221   1.00 18.55 ? 336 ILE A CG1 1 
ATOM   2563 C  CG2 . ILE A 1 336 ? 46.287 155.238 4.246   1.00 17.92 ? 336 ILE A CG2 1 
ATOM   2564 C  CD1 . ILE A 1 336 ? 48.287 153.541 2.802   1.00 16.03 ? 336 ILE A CD1 1 
ATOM   2565 N  N   . ILE A 1 337 ? 44.271 156.358 1.818   1.00 19.71 ? 337 ILE A N   1 
ATOM   2566 C  CA  . ILE A 1 337 ? 43.028 157.111 1.943   1.00 19.94 ? 337 ILE A CA  1 
ATOM   2567 C  C   . ILE A 1 337 ? 42.398 156.800 3.295   1.00 19.27 ? 337 ILE A C   1 
ATOM   2568 O  O   . ILE A 1 337 ? 41.841 155.730 3.497   1.00 20.62 ? 337 ILE A O   1 
ATOM   2569 C  CB  . ILE A 1 337 ? 42.039 156.765 0.808   1.00 19.60 ? 337 ILE A CB  1 
ATOM   2570 C  CG1 . ILE A 1 337 ? 42.612 157.241 -0.535  1.00 18.65 ? 337 ILE A CG1 1 
ATOM   2571 C  CG2 . ILE A 1 337 ? 40.685 157.400 1.088   1.00 16.27 ? 337 ILE A CG2 1 
ATOM   2572 C  CD1 . ILE A 1 337 ? 41.734 156.957 -1.730  1.00 14.06 ? 337 ILE A CD1 1 
ATOM   2573 N  N   . LEU A 1 338 ? 42.512 157.742 4.225   1.00 19.76 ? 338 LEU A N   1 
ATOM   2574 C  CA  . LEU A 1 338 ? 41.968 157.580 5.569   1.00 19.28 ? 338 LEU A CA  1 
ATOM   2575 C  C   . LEU A 1 338 ? 40.574 158.189 5.677   1.00 18.91 ? 338 LEU A C   1 
ATOM   2576 O  O   . LEU A 1 338 ? 40.341 159.312 5.218   1.00 18.47 ? 338 LEU A O   1 
ATOM   2577 C  CB  . LEU A 1 338 ? 42.885 158.250 6.589   1.00 19.46 ? 338 LEU A CB  1 
ATOM   2578 C  CG  . LEU A 1 338 ? 42.488 158.055 8.051   1.00 22.10 ? 338 LEU A CG  1 
ATOM   2579 C  CD1 . LEU A 1 338 ? 42.665 156.586 8.423   1.00 21.11 ? 338 LEU A CD1 1 
ATOM   2580 C  CD2 . LEU A 1 338 ? 43.340 158.945 8.947   1.00 21.64 ? 338 LEU A CD2 1 
ATOM   2581 N  N   . LEU A 1 339 ? 39.656 157.452 6.296   1.00 17.58 ? 339 LEU A N   1 
ATOM   2582 C  CA  . LEU A 1 339 ? 38.288 157.925 6.461   1.00 17.83 ? 339 LEU A CA  1 
ATOM   2583 C  C   . LEU A 1 339 ? 37.998 158.416 7.876   1.00 18.67 ? 339 LEU A C   1 
ATOM   2584 O  O   . LEU A 1 339 ? 38.593 157.941 8.845   1.00 18.37 ? 339 LEU A O   1 
ATOM   2585 C  CB  . LEU A 1 339 ? 37.298 156.815 6.113   1.00 17.44 ? 339 LEU A CB  1 
ATOM   2586 C  CG  . LEU A 1 339 ? 37.493 156.053 4.800   1.00 18.25 ? 339 LEU A CG  1 
ATOM   2587 C  CD1 . LEU A 1 339 ? 36.231 155.238 4.506   1.00 15.80 ? 339 LEU A CD1 1 
ATOM   2588 C  CD2 . LEU A 1 339 ? 37.772 157.023 3.664   1.00 16.64 ? 339 LEU A CD2 1 
ATOM   2589 N  N   . ALA A 1 340 ? 37.074 159.371 7.981   1.00 19.94 ? 340 ALA A N   1 
ATOM   2590 C  CA  . ALA A 1 340 ? 36.646 159.931 9.267   1.00 20.43 ? 340 ALA A CA  1 
ATOM   2591 C  C   . ALA A 1 340 ? 37.788 160.177 10.243  1.00 21.74 ? 340 ALA A C   1 
ATOM   2592 O  O   . ALA A 1 340 ? 37.608 160.086 11.459  1.00 20.36 ? 340 ALA A O   1 
ATOM   2593 C  CB  . ALA A 1 340 ? 35.605 159.016 9.912   1.00 18.85 ? 340 ALA A CB  1 
ATOM   2594 N  N   . GLU A 1 341 ? 38.962 160.474 9.697   1.00 23.24 ? 341 GLU A N   1 
ATOM   2595 C  CA  . GLU A 1 341 ? 40.143 160.762 10.497  1.00 25.15 ? 341 GLU A CA  1 
ATOM   2596 C  C   . GLU A 1 341 ? 40.468 159.695 11.523  1.00 26.18 ? 341 GLU A C   1 
ATOM   2597 O  O   . GLU A 1 341 ? 40.935 160.013 12.619  1.00 26.75 ? 341 GLU A O   1 
ATOM   2598 C  CB  . GLU A 1 341 ? 39.976 162.100 11.216  1.00 25.21 ? 341 GLU A CB  1 
ATOM   2599 C  CG  . GLU A 1 341 ? 39.696 163.260 10.281  1.00 28.68 ? 341 GLU A CG  1 
ATOM   2600 C  CD  . GLU A 1 341 ? 39.912 164.598 10.946  1.00 29.15 ? 341 GLU A CD  1 
ATOM   2601 O  OE1 . GLU A 1 341 ? 39.249 164.867 11.965  1.00 28.98 ? 341 GLU A OE1 1 
ATOM   2602 O  OE2 . GLU A 1 341 ? 40.749 165.377 10.448  1.00 32.03 ? 341 GLU A OE2 1 
ATOM   2603 N  N   . GLY A 1 342 ? 40.232 158.436 11.171  1.00 26.00 ? 342 GLY A N   1 
ATOM   2604 C  CA  . GLY A 1 342 ? 40.514 157.359 12.100  1.00 25.73 ? 342 GLY A CA  1 
ATOM   2605 C  C   . GLY A 1 342 ? 39.366 157.085 13.053  1.00 25.78 ? 342 GLY A C   1 
ATOM   2606 O  O   . GLY A 1 342 ? 39.407 156.126 13.820  1.00 26.40 ? 342 GLY A O   1 
ATOM   2607 N  N   . ARG A 1 343 ? 38.336 157.921 13.020  1.00 25.85 ? 343 ARG A N   1 
ATOM   2608 C  CA  . ARG A 1 343 ? 37.199 157.711 13.906  1.00 26.19 ? 343 ARG A CA  1 
ATOM   2609 C  C   . ARG A 1 343 ? 36.203 156.771 13.250  1.00 24.43 ? 343 ARG A C   1 
ATOM   2610 O  O   . ARG A 1 343 ? 36.508 156.149 12.238  1.00 25.82 ? 343 ARG A O   1 
ATOM   2611 C  CB  . ARG A 1 343 ? 36.532 159.043 14.246  1.00 28.65 ? 343 ARG A CB  1 
ATOM   2612 C  CG  . ARG A 1 343 ? 37.466 160.013 14.938  1.00 33.38 ? 343 ARG A CG  1 
ATOM   2613 C  CD  . ARG A 1 343 ? 36.738 161.223 15.490  1.00 39.51 ? 343 ARG A CD  1 
ATOM   2614 N  NE  . ARG A 1 343 ? 37.669 162.158 16.121  1.00 47.53 ? 343 ARG A NE  1 
ATOM   2615 C  CZ  . ARG A 1 343 ? 37.309 163.215 16.848  1.00 51.70 ? 343 ARG A CZ  1 
ATOM   2616 N  NH1 . ARG A 1 343 ? 38.241 164.002 17.372  1.00 52.54 ? 343 ARG A NH1 1 
ATOM   2617 N  NH2 . ARG A 1 343 ? 36.024 163.486 17.061  1.00 52.14 ? 343 ARG A NH2 1 
ATOM   2618 N  N   . LEU A 1 344 ? 35.012 156.664 13.824  1.00 22.55 ? 344 LEU A N   1 
ATOM   2619 C  CA  . LEU A 1 344 ? 33.999 155.774 13.280  1.00 19.90 ? 344 LEU A CA  1 
ATOM   2620 C  C   . LEU A 1 344 ? 33.550 156.221 11.899  1.00 19.57 ? 344 LEU A C   1 
ATOM   2621 O  O   . LEU A 1 344 ? 32.953 157.287 11.738  1.00 18.35 ? 344 LEU A O   1 
ATOM   2622 C  CB  . LEU A 1 344 ? 32.798 155.705 14.219  1.00 18.60 ? 344 LEU A CB  1 
ATOM   2623 C  CG  . LEU A 1 344 ? 33.107 155.315 15.663  1.00 19.59 ? 344 LEU A CG  1 
ATOM   2624 C  CD1 . LEU A 1 344 ? 31.797 155.107 16.400  1.00 20.52 ? 344 LEU A CD1 1 
ATOM   2625 C  CD2 . LEU A 1 344 ? 33.959 154.051 15.714  1.00 17.65 ? 344 LEU A CD2 1 
ATOM   2626 N  N   . VAL A 1 345 ? 33.841 155.383 10.909  1.00 19.07 ? 345 VAL A N   1 
ATOM   2627 C  CA  . VAL A 1 345 ? 33.497 155.650 9.522   1.00 18.29 ? 345 VAL A CA  1 
ATOM   2628 C  C   . VAL A 1 345 ? 31.997 155.747 9.282   1.00 18.97 ? 345 VAL A C   1 
ATOM   2629 O  O   . VAL A 1 345 ? 31.557 156.495 8.411   1.00 19.75 ? 345 VAL A O   1 
ATOM   2630 C  CB  . VAL A 1 345 ? 34.061 154.548 8.590   1.00 18.52 ? 345 VAL A CB  1 
ATOM   2631 C  CG1 . VAL A 1 345 ? 33.489 153.188 8.985   1.00 16.89 ? 345 VAL A CG1 1 
ATOM   2632 C  CG2 . VAL A 1 345 ? 33.730 154.867 7.132   1.00 15.12 ? 345 VAL A CG2 1 
ATOM   2633 N  N   . ASN A 1 346 ? 31.210 154.993 10.044  1.00 18.78 ? 346 ASN A N   1 
ATOM   2634 C  CA  . ASN A 1 346 ? 29.764 155.013 9.844   1.00 19.73 ? 346 ASN A CA  1 
ATOM   2635 C  C   . ASN A 1 346 ? 29.118 156.253 10.456  1.00 19.98 ? 346 ASN A C   1 
ATOM   2636 O  O   . ASN A 1 346 ? 27.934 156.525 10.249  1.00 18.81 ? 346 ASN A O   1 
ATOM   2637 C  CB  . ASN A 1 346 ? 29.130 153.722 10.383  1.00 18.34 ? 346 ASN A CB  1 
ATOM   2638 C  CG  . ASN A 1 346 ? 29.307 153.562 11.870  1.00 18.94 ? 346 ASN A CG  1 
ATOM   2639 O  OD1 . ASN A 1 346 ? 30.317 153.974 12.430  1.00 19.90 ? 346 ASN A OD1 1 
ATOM   2640 N  ND2 . ASN A 1 346 ? 28.331 152.938 12.517  1.00 19.14 ? 346 ASN A ND2 1 
ATOM   2641 N  N   . LEU A 1 347 ? 29.912 157.008 11.205  1.00 20.40 ? 347 LEU A N   1 
ATOM   2642 C  CA  . LEU A 1 347 ? 29.432 158.240 11.807  1.00 20.93 ? 347 LEU A CA  1 
ATOM   2643 C  C   . LEU A 1 347 ? 29.929 159.415 10.974  1.00 21.20 ? 347 LEU A C   1 
ATOM   2644 O  O   . LEU A 1 347 ? 29.156 160.304 10.619  1.00 21.78 ? 347 LEU A O   1 
ATOM   2645 C  CB  . LEU A 1 347 ? 29.941 158.381 13.244  1.00 20.47 ? 347 LEU A CB  1 
ATOM   2646 C  CG  . LEU A 1 347 ? 29.158 157.647 14.340  1.00 22.63 ? 347 LEU A CG  1 
ATOM   2647 C  CD1 . LEU A 1 347 ? 29.746 157.996 15.694  1.00 20.98 ? 347 LEU A CD1 1 
ATOM   2648 C  CD2 . LEU A 1 347 ? 27.683 158.045 14.292  1.00 21.17 ? 347 LEU A CD2 1 
ATOM   2649 N  N   . GLY A 1 348 ? 31.218 159.393 10.644  1.00 20.96 ? 348 GLY A N   1 
ATOM   2650 C  CA  . GLY A 1 348 ? 31.817 160.470 9.879   1.00 20.11 ? 348 GLY A CA  1 
ATOM   2651 C  C   . GLY A 1 348 ? 31.553 160.479 8.386   1.00 21.06 ? 348 GLY A C   1 
ATOM   2652 O  O   . GLY A 1 348 ? 31.573 161.544 7.764   1.00 21.23 ? 348 GLY A O   1 
ATOM   2653 N  N   . CYS A 1 349 ? 31.304 159.308 7.805   1.00 19.26 ? 349 CYS A N   1 
ATOM   2654 C  CA  . CYS A 1 349 ? 31.065 159.213 6.371   1.00 17.53 ? 349 CYS A CA  1 
ATOM   2655 C  C   . CYS A 1 349 ? 29.685 158.678 6.034   1.00 17.81 ? 349 CYS A C   1 
ATOM   2656 O  O   . CYS A 1 349 ? 29.391 158.369 4.881   1.00 19.11 ? 349 CYS A O   1 
ATOM   2657 C  CB  . CYS A 1 349 ? 32.139 158.335 5.732   1.00 15.86 ? 349 CYS A CB  1 
ATOM   2658 S  SG  . CYS A 1 349 ? 33.824 158.919 6.058   1.00 17.33 ? 349 CYS A SG  1 
ATOM   2659 N  N   . ALA A 1 350 ? 28.837 158.566 7.050   1.00 18.62 ? 350 ALA A N   1 
ATOM   2660 C  CA  . ALA A 1 350 ? 27.479 158.088 6.858   1.00 17.98 ? 350 ALA A CA  1 
ATOM   2661 C  C   . ALA A 1 350 ? 26.567 158.689 7.929   1.00 18.68 ? 350 ALA A C   1 
ATOM   2662 O  O   . ALA A 1 350 ? 26.976 159.566 8.690   1.00 18.71 ? 350 ALA A O   1 
ATOM   2663 C  CB  . ALA A 1 350 ? 27.445 156.568 6.915   1.00 17.01 ? 350 ALA A CB  1 
ATOM   2664 N  N   . MET A 1 351 ? 25.332 158.211 7.992   1.00 19.17 ? 351 MET A N   1 
ATOM   2665 C  CA  . MET A 1 351 ? 24.378 158.722 8.956   1.00 19.80 ? 351 MET A CA  1 
ATOM   2666 C  C   . MET A 1 351 ? 24.227 157.877 10.211  1.00 19.88 ? 351 MET A C   1 
ATOM   2667 O  O   . MET A 1 351 ? 23.217 157.973 10.906  1.00 20.43 ? 351 MET A O   1 
ATOM   2668 C  CB  . MET A 1 351 ? 23.024 158.890 8.278   1.00 22.52 ? 351 MET A CB  1 
ATOM   2669 C  CG  . MET A 1 351 ? 23.038 159.942 7.181   1.00 25.74 ? 351 MET A CG  1 
ATOM   2670 S  SD  . MET A 1 351 ? 23.483 161.574 7.832   1.00 27.63 ? 351 MET A SD  1 
ATOM   2671 C  CE  . MET A 1 351 ? 23.473 162.539 6.280   1.00 30.87 ? 351 MET A CE  1 
ATOM   2672 N  N   . GLY A 1 352 ? 25.234 157.063 10.507  1.00 20.31 ? 352 GLY A N   1 
ATOM   2673 C  CA  . GLY A 1 352 ? 25.177 156.216 11.686  1.00 20.26 ? 352 GLY A CA  1 
ATOM   2674 C  C   . GLY A 1 352 ? 24.248 155.033 11.482  1.00 19.79 ? 352 GLY A C   1 
ATOM   2675 O  O   . GLY A 1 352 ? 23.979 154.642 10.348  1.00 20.59 ? 352 GLY A O   1 
ATOM   2676 N  N   . HIS A 1 353 ? 23.748 154.472 12.578  1.00 18.18 ? 353 HIS A N   1 
ATOM   2677 C  CA  . HIS A 1 353 ? 22.844 153.335 12.510  1.00 18.90 ? 353 HIS A CA  1 
ATOM   2678 C  C   . HIS A 1 353 ? 21.483 153.654 11.918  1.00 20.24 ? 353 HIS A C   1 
ATOM   2679 O  O   . HIS A 1 353 ? 20.953 154.749 12.096  1.00 21.74 ? 353 HIS A O   1 
ATOM   2680 C  CB  . HIS A 1 353 ? 22.608 152.754 13.897  1.00 18.98 ? 353 HIS A CB  1 
ATOM   2681 C  CG  . HIS A 1 353 ? 23.738 151.925 14.412  1.00 20.65 ? 353 HIS A CG  1 
ATOM   2682 N  ND1 . HIS A 1 353 ? 24.605 151.247 13.580  1.00 19.83 ? 353 HIS A ND1 1 
ATOM   2683 C  CD2 . HIS A 1 353 ? 24.099 151.605 15.677  1.00 19.35 ? 353 HIS A CD2 1 
ATOM   2684 C  CE1 . HIS A 1 353 ? 25.449 150.544 14.311  1.00 20.78 ? 353 HIS A CE1 1 
ATOM   2685 N  NE2 . HIS A 1 353 ? 25.163 150.743 15.587  1.00 22.19 ? 353 HIS A NE2 1 
ATOM   2686 N  N   . PRO A 1 354 ? 20.892 152.689 11.201  1.00 21.59 ? 354 PRO A N   1 
ATOM   2687 C  CA  . PRO A 1 354 ? 19.568 152.889 10.598  1.00 20.10 ? 354 PRO A CA  1 
ATOM   2688 C  C   . PRO A 1 354 ? 18.578 153.062 11.744  1.00 19.67 ? 354 PRO A C   1 
ATOM   2689 O  O   . PRO A 1 354 ? 18.853 152.655 12.875  1.00 18.96 ? 354 PRO A O   1 
ATOM   2690 C  CB  . PRO A 1 354 ? 19.333 151.587 9.837   1.00 19.65 ? 354 PRO A CB  1 
ATOM   2691 C  CG  . PRO A 1 354 ? 20.721 151.175 9.449   1.00 22.82 ? 354 PRO A CG  1 
ATOM   2692 C  CD  . PRO A 1 354 ? 21.517 151.447 10.709  1.00 22.04 ? 354 PRO A CD  1 
ATOM   2693 N  N   . SER A 1 355 ? 17.426 153.653 11.465  1.00 19.02 ? 355 SER A N   1 
ATOM   2694 C  CA  . SER A 1 355 ? 16.440 153.858 12.512  1.00 19.02 ? 355 SER A CA  1 
ATOM   2695 C  C   . SER A 1 355 ? 15.986 152.556 13.165  1.00 20.37 ? 355 SER A C   1 
ATOM   2696 O  O   . SER A 1 355 ? 15.874 152.481 14.389  1.00 21.39 ? 355 SER A O   1 
ATOM   2697 C  CB  . SER A 1 355 ? 15.240 154.607 11.952  1.00 17.48 ? 355 SER A CB  1 
ATOM   2698 O  OG  . SER A 1 355 ? 15.640 155.891 11.519  1.00 18.42 ? 355 SER A OG  1 
ATOM   2699 N  N   . PHE A 1 356 ? 15.732 151.534 12.348  1.00 20.22 ? 356 PHE A N   1 
ATOM   2700 C  CA  . PHE A 1 356 ? 15.286 150.235 12.844  1.00 20.20 ? 356 PHE A CA  1 
ATOM   2701 C  C   . PHE A 1 356 ? 16.244 149.673 13.900  1.00 20.30 ? 356 PHE A C   1 
ATOM   2702 O  O   . PHE A 1 356 ? 15.810 149.061 14.885  1.00 18.57 ? 356 PHE A O   1 
ATOM   2703 C  CB  . PHE A 1 356 ? 15.141 149.265 11.669  1.00 21.54 ? 356 PHE A CB  1 
ATOM   2704 C  CG  . PHE A 1 356 ? 14.403 147.998 12.005  1.00 21.94 ? 356 PHE A CG  1 
ATOM   2705 C  CD1 . PHE A 1 356 ? 15.070 146.903 12.524  1.00 21.37 ? 356 PHE A CD1 1 
ATOM   2706 C  CD2 . PHE A 1 356 ? 13.039 147.896 11.770  1.00 22.60 ? 356 PHE A CD2 1 
ATOM   2707 C  CE1 . PHE A 1 356 ? 14.392 145.729 12.799  1.00 20.84 ? 356 PHE A CE1 1 
ATOM   2708 C  CE2 . PHE A 1 356 ? 12.357 146.723 12.045  1.00 21.88 ? 356 PHE A CE2 1 
ATOM   2709 C  CZ  . PHE A 1 356 ? 13.035 145.642 12.558  1.00 21.78 ? 356 PHE A CZ  1 
ATOM   2710 N  N   . VAL A 1 357 ? 17.544 149.887 13.699  1.00 19.04 ? 357 VAL A N   1 
ATOM   2711 C  CA  . VAL A 1 357 ? 18.543 149.426 14.662  1.00 18.47 ? 357 VAL A CA  1 
ATOM   2712 C  C   . VAL A 1 357 ? 18.353 150.175 15.978  1.00 18.73 ? 357 VAL A C   1 
ATOM   2713 O  O   . VAL A 1 357 ? 18.292 149.574 17.050  1.00 20.59 ? 357 VAL A O   1 
ATOM   2714 C  CB  . VAL A 1 357 ? 19.990 149.687 14.164  1.00 18.96 ? 357 VAL A CB  1 
ATOM   2715 C  CG1 . VAL A 1 357 ? 20.962 149.667 15.343  1.00 15.12 ? 357 VAL A CG1 1 
ATOM   2716 C  CG2 . VAL A 1 357 ? 20.391 148.637 13.140  1.00 15.08 ? 357 VAL A CG2 1 
ATOM   2717 N  N   . MET A 1 358 ? 18.258 151.495 15.891  1.00 18.33 ? 358 MET A N   1 
ATOM   2718 C  CA  . MET A 1 358 ? 18.079 152.317 17.077  1.00 17.27 ? 358 MET A CA  1 
ATOM   2719 C  C   . MET A 1 358 ? 16.792 151.935 17.790  1.00 17.15 ? 358 MET A C   1 
ATOM   2720 O  O   . MET A 1 358 ? 16.697 152.035 19.014  1.00 17.51 ? 358 MET A O   1 
ATOM   2721 C  CB  . MET A 1 358 ? 18.038 153.799 16.695  1.00 17.82 ? 358 MET A CB  1 
ATOM   2722 C  CG  . MET A 1 358 ? 19.314 154.316 16.060  1.00 17.51 ? 358 MET A CG  1 
ATOM   2723 S  SD  . MET A 1 358 ? 20.769 153.836 17.007  1.00 22.53 ? 358 MET A SD  1 
ATOM   2724 C  CE  . MET A 1 358 ? 20.452 154.675 18.578  1.00 17.53 ? 358 MET A CE  1 
ATOM   2725 N  N   . SER A 1 359 ? 15.803 151.492 17.019  1.00 16.27 ? 359 SER A N   1 
ATOM   2726 C  CA  . SER A 1 359 ? 14.524 151.096 17.583  1.00 15.86 ? 359 SER A CA  1 
ATOM   2727 C  C   . SER A 1 359 ? 14.715 149.938 18.552  1.00 16.41 ? 359 SER A C   1 
ATOM   2728 O  O   . SER A 1 359 ? 14.079 149.882 19.601  1.00 17.05 ? 359 SER A O   1 
ATOM   2729 C  CB  . SER A 1 359 ? 13.558 150.691 16.472  1.00 16.21 ? 359 SER A CB  1 
ATOM   2730 O  OG  . SER A 1 359 ? 12.302 150.307 17.001  1.00 15.11 ? 359 SER A OG  1 
ATOM   2731 N  N   . ASN A 1 360 ? 15.601 149.018 18.200  1.00 16.79 ? 360 ASN A N   1 
ATOM   2732 C  CA  . ASN A 1 360 ? 15.868 147.872 19.052  1.00 17.92 ? 360 ASN A CA  1 
ATOM   2733 C  C   . ASN A 1 360 ? 16.570 148.260 20.344  1.00 18.92 ? 360 ASN A C   1 
ATOM   2734 O  O   . ASN A 1 360 ? 16.242 147.746 21.417  1.00 19.52 ? 360 ASN A O   1 
ATOM   2735 C  CB  . ASN A 1 360 ? 16.684 146.833 18.281  1.00 17.15 ? 360 ASN A CB  1 
ATOM   2736 C  CG  . ASN A 1 360 ? 15.801 145.895 17.477  1.00 16.96 ? 360 ASN A CG  1 
ATOM   2737 O  OD1 . ASN A 1 360 ? 15.234 144.947 18.023  1.00 15.90 ? 360 ASN A OD1 1 
ATOM   2738 N  ND2 . ASN A 1 360 ? 15.656 146.170 16.185  1.00 14.98 ? 360 ASN A ND2 1 
ATOM   2739 N  N   . SER A 1 361 ? 17.528 149.174 20.250  1.00 19.76 ? 361 SER A N   1 
ATOM   2740 C  CA  . SER A 1 361 ? 18.247 149.616 21.436  1.00 20.11 ? 361 SER A CA  1 
ATOM   2741 C  C   . SER A 1 361 ? 17.312 150.362 22.379  1.00 19.05 ? 361 SER A C   1 
ATOM   2742 O  O   . SER A 1 361 ? 17.264 150.070 23.573  1.00 18.86 ? 361 SER A O   1 
ATOM   2743 C  CB  . SER A 1 361 ? 19.408 150.539 21.057  1.00 20.71 ? 361 SER A CB  1 
ATOM   2744 O  OG  . SER A 1 361 ? 20.375 149.858 20.286  1.00 23.86 ? 361 SER A OG  1 
ATOM   2745 N  N   . PHE A 1 362 ? 16.570 151.323 21.835  1.00 18.40 ? 362 PHE A N   1 
ATOM   2746 C  CA  . PHE A 1 362 ? 15.657 152.132 22.640  1.00 19.00 ? 362 PHE A CA  1 
ATOM   2747 C  C   . PHE A 1 362 ? 14.461 151.366 23.195  1.00 19.00 ? 362 PHE A C   1 
ATOM   2748 O  O   . PHE A 1 362 ? 14.018 151.626 24.317  1.00 18.16 ? 362 PHE A O   1 
ATOM   2749 C  CB  . PHE A 1 362 ? 15.176 153.346 21.840  1.00 19.21 ? 362 PHE A CB  1 
ATOM   2750 C  CG  . PHE A 1 362 ? 16.291 154.262 21.413  1.00 20.57 ? 362 PHE A CG  1 
ATOM   2751 C  CD1 . PHE A 1 362 ? 17.523 154.221 22.053  1.00 20.25 ? 362 PHE A CD1 1 
ATOM   2752 C  CD2 . PHE A 1 362 ? 16.106 155.175 20.386  1.00 20.17 ? 362 PHE A CD2 1 
ATOM   2753 C  CE1 . PHE A 1 362 ? 18.548 155.070 21.678  1.00 20.07 ? 362 PHE A CE1 1 
ATOM   2754 C  CE2 . PHE A 1 362 ? 17.130 156.030 20.005  1.00 20.46 ? 362 PHE A CE2 1 
ATOM   2755 C  CZ  . PHE A 1 362 ? 18.349 155.979 20.650  1.00 20.93 ? 362 PHE A CZ  1 
ATOM   2756 N  N   . THR A 1 363 ? 13.932 150.424 22.421  1.00 18.62 ? 363 THR A N   1 
ATOM   2757 C  CA  . THR A 1 363 ? 12.808 149.647 22.909  1.00 18.62 ? 363 THR A CA  1 
ATOM   2758 C  C   . THR A 1 363 ? 13.305 148.874 24.137  1.00 20.07 ? 363 THR A C   1 
ATOM   2759 O  O   . THR A 1 363 ? 12.524 148.462 25.000  1.00 19.91 ? 363 THR A O   1 
ATOM   2760 C  CB  . THR A 1 363 ? 12.281 148.704 21.822  1.00 17.13 ? 363 THR A CB  1 
ATOM   2761 O  OG1 . THR A 1 363 ? 11.844 149.484 20.700  1.00 16.34 ? 363 THR A OG1 1 
ATOM   2762 C  CG2 . THR A 1 363 ? 11.106 147.887 22.342  1.00 16.27 ? 363 THR A CG2 1 
ATOM   2763 N  N   . ASN A 1 364 ? 14.622 148.712 24.216  1.00 20.44 ? 364 ASN A N   1 
ATOM   2764 C  CA  . ASN A 1 364 ? 15.246 148.041 25.349  1.00 20.53 ? 364 ASN A CA  1 
ATOM   2765 C  C   . ASN A 1 364 ? 15.245 148.989 26.540  1.00 20.04 ? 364 ASN A C   1 
ATOM   2766 O  O   . ASN A 1 364 ? 14.968 148.575 27.659  1.00 19.67 ? 364 ASN A O   1 
ATOM   2767 C  CB  . ASN A 1 364 ? 16.679 147.639 25.005  1.00 21.11 ? 364 ASN A CB  1 
ATOM   2768 C  CG  . ASN A 1 364 ? 16.794 146.188 24.613  1.00 21.54 ? 364 ASN A CG  1 
ATOM   2769 O  OD1 . ASN A 1 364 ? 16.855 145.310 25.472  1.00 23.05 ? 364 ASN A OD1 1 
ATOM   2770 N  ND2 . ASN A 1 364 ? 16.806 145.921 23.311  1.00 18.27 ? 364 ASN A ND2 1 
ATOM   2771 N  N   . GLN A 1 365 ? 15.569 150.258 26.289  1.00 20.28 ? 365 GLN A N   1 
ATOM   2772 C  CA  . GLN A 1 365 ? 15.575 151.287 27.334  1.00 20.38 ? 365 GLN A CA  1 
ATOM   2773 C  C   . GLN A 1 365 ? 14.165 151.387 27.914  1.00 20.43 ? 365 GLN A C   1 
ATOM   2774 O  O   . GLN A 1 365 ? 13.982 151.393 29.125  1.00 20.07 ? 365 GLN A O   1 
ATOM   2775 C  CB  . GLN A 1 365 ? 15.995 152.644 26.750  1.00 19.62 ? 365 GLN A CB  1 
ATOM   2776 C  CG  . GLN A 1 365 ? 17.459 152.724 26.349  1.00 19.51 ? 365 GLN A CG  1 
ATOM   2777 C  CD  . GLN A 1 365 ? 18.389 152.950 27.538  1.00 21.70 ? 365 GLN A CD  1 
ATOM   2778 O  OE1 . GLN A 1 365 ? 18.187 152.394 28.620  1.00 23.82 ? 365 GLN A OE1 1 
ATOM   2779 N  NE2 . GLN A 1 365 ? 19.416 153.766 27.337  1.00 19.31 ? 365 GLN A NE2 1 
ATOM   2780 N  N   . VAL A 1 366 ? 13.167 151.453 27.041  1.00 21.71 ? 366 VAL A N   1 
ATOM   2781 C  CA  . VAL A 1 366 ? 11.782 151.530 27.489  1.00 22.20 ? 366 VAL A CA  1 
ATOM   2782 C  C   . VAL A 1 366 ? 11.474 150.360 28.418  1.00 23.65 ? 366 VAL A C   1 
ATOM   2783 O  O   . VAL A 1 366 ? 10.969 150.559 29.519  1.00 25.23 ? 366 VAL A O   1 
ATOM   2784 C  CB  . VAL A 1 366 ? 10.788 151.480 26.301  1.00 21.26 ? 366 VAL A CB  1 
ATOM   2785 C  CG1 . VAL A 1 366 ? 9.365  151.469 26.824  1.00 17.92 ? 366 VAL A CG1 1 
ATOM   2786 C  CG2 . VAL A 1 366 ? 11.003 152.671 25.378  1.00 18.53 ? 366 VAL A CG2 1 
ATOM   2787 N  N   . MET A 1 367 ? 11.786 149.144 27.969  1.00 23.98 ? 367 MET A N   1 
ATOM   2788 C  CA  . MET A 1 367 ? 11.543 147.931 28.755  1.00 22.88 ? 367 MET A CA  1 
ATOM   2789 C  C   . MET A 1 367 ? 12.188 148.026 30.127  1.00 22.69 ? 367 MET A C   1 
ATOM   2790 O  O   . MET A 1 367 ? 11.569 147.693 31.136  1.00 23.55 ? 367 MET A O   1 
ATOM   2791 C  CB  . MET A 1 367 ? 12.108 146.697 28.041  1.00 25.19 ? 367 MET A CB  1 
ATOM   2792 C  CG  . MET A 1 367 ? 11.446 146.337 26.720  1.00 24.54 ? 367 MET A CG  1 
ATOM   2793 S  SD  . MET A 1 367 ? 9.729  145.840 26.899  1.00 26.66 ? 367 MET A SD  1 
ATOM   2794 C  CE  . MET A 1 367 ? 9.261  145.608 25.169  1.00 23.12 ? 367 MET A CE  1 
ATOM   2795 N  N   . ALA A 1 368 ? 13.443 148.466 30.153  1.00 22.23 ? 368 ALA A N   1 
ATOM   2796 C  CA  . ALA A 1 368 ? 14.197 148.614 31.393  1.00 20.54 ? 368 ALA A CA  1 
ATOM   2797 C  C   . ALA A 1 368 ? 13.513 149.613 32.318  1.00 21.71 ? 368 ALA A C   1 
ATOM   2798 O  O   . ALA A 1 368 ? 13.372 149.367 33.522  1.00 21.02 ? 368 ALA A O   1 
ATOM   2799 C  CB  . ALA A 1 368 ? 15.603 149.080 31.083  1.00 20.05 ? 368 ALA A CB  1 
ATOM   2800 N  N   . GLN A 1 369 ? 13.099 150.742 31.744  1.00 21.55 ? 369 GLN A N   1 
ATOM   2801 C  CA  . GLN A 1 369 ? 12.422 151.801 32.483  1.00 20.89 ? 369 GLN A CA  1 
ATOM   2802 C  C   . GLN A 1 369 ? 11.126 151.322 33.131  1.00 21.90 ? 369 GLN A C   1 
ATOM   2803 O  O   . GLN A 1 369 ? 10.849 151.628 34.296  1.00 23.83 ? 369 GLN A O   1 
ATOM   2804 C  CB  . GLN A 1 369 ? 12.127 152.978 31.553  1.00 19.03 ? 369 GLN A CB  1 
ATOM   2805 C  CG  . GLN A 1 369 ? 13.355 153.778 31.164  1.00 18.38 ? 369 GLN A CG  1 
ATOM   2806 C  CD  . GLN A 1 369 ? 13.989 154.474 32.354  1.00 21.56 ? 369 GLN A CD  1 
ATOM   2807 O  OE1 . GLN A 1 369 ? 13.313 155.180 33.105  1.00 21.07 ? 369 GLN A OE1 1 
ATOM   2808 N  NE2 . GLN A 1 369 ? 15.293 154.284 32.531  1.00 21.00 ? 369 GLN A NE2 1 
ATOM   2809 N  N   . ILE A 1 370 ? 10.331 150.573 32.375  1.00 21.07 ? 370 ILE A N   1 
ATOM   2810 C  CA  . ILE A 1 370 ? 9.067  150.057 32.883  1.00 20.76 ? 370 ILE A CA  1 
ATOM   2811 C  C   . ILE A 1 370 ? 9.334  149.037 33.987  1.00 23.09 ? 370 ILE A C   1 
ATOM   2812 O  O   . ILE A 1 370 ? 8.687  149.056 35.033  1.00 25.78 ? 370 ILE A O   1 
ATOM   2813 C  CB  . ILE A 1 370 ? 8.239  149.402 31.733  1.00 18.85 ? 370 ILE A CB  1 
ATOM   2814 C  CG1 . ILE A 1 370 ? 7.772  150.492 30.761  1.00 15.23 ? 370 ILE A CG1 1 
ATOM   2815 C  CG2 . ILE A 1 370 ? 7.053  148.627 32.291  1.00 13.69 ? 370 ILE A CG2 1 
ATOM   2816 C  CD1 . ILE A 1 370 ? 7.020  149.983 29.567  1.00 11.15 ? 370 ILE A CD1 1 
ATOM   2817 N  N   . GLU A 1 371 ? 10.310 148.166 33.753  1.00 22.93 ? 371 GLU A N   1 
ATOM   2818 C  CA  . GLU A 1 371 ? 10.677 147.120 34.698  1.00 23.20 ? 371 GLU A CA  1 
ATOM   2819 C  C   . GLU A 1 371 ? 11.122 147.662 36.058  1.00 23.84 ? 371 GLU A C   1 
ATOM   2820 O  O   . GLU A 1 371 ? 10.682 147.170 37.097  1.00 24.90 ? 371 GLU A O   1 
ATOM   2821 C  CB  . GLU A 1 371 ? 11.781 146.248 34.079  1.00 24.00 ? 371 GLU A CB  1 
ATOM   2822 C  CG  . GLU A 1 371 ? 12.291 145.101 34.944  1.00 24.18 ? 371 GLU A CG  1 
ATOM   2823 C  CD  . GLU A 1 371 ? 11.207 144.102 35.326  1.00 27.56 ? 371 GLU A CD  1 
ATOM   2824 O  OE1 . GLU A 1 371 ? 10.117 144.124 34.703  1.00 28.06 ? 371 GLU A OE1 1 
ATOM   2825 O  OE2 . GLU A 1 371 ? 11.453 143.285 36.246  1.00 26.46 ? 371 GLU A OE2 1 
ATOM   2826 N  N   . LEU A 1 372 ? 11.996 148.664 36.055  1.00 23.40 ? 372 LEU A N   1 
ATOM   2827 C  CA  . LEU A 1 372 ? 12.478 149.246 37.302  1.00 22.92 ? 372 LEU A CA  1 
ATOM   2828 C  C   . LEU A 1 372 ? 11.405 150.090 37.979  1.00 24.80 ? 372 LEU A C   1 
ATOM   2829 O  O   . LEU A 1 372 ? 11.157 149.954 39.179  1.00 24.89 ? 372 LEU A O   1 
ATOM   2830 C  CB  . LEU A 1 372 ? 13.718 150.100 37.048  1.00 22.65 ? 372 LEU A CB  1 
ATOM   2831 C  CG  . LEU A 1 372 ? 15.016 149.333 36.776  1.00 23.25 ? 372 LEU A CG  1 
ATOM   2832 C  CD1 . LEU A 1 372 ? 16.115 150.300 36.380  1.00 22.28 ? 372 LEU A CD1 1 
ATOM   2833 C  CD2 . LEU A 1 372 ? 15.417 148.549 38.017  1.00 23.18 ? 372 LEU A CD2 1 
ATOM   2834 N  N   . TRP A 1 373 ? 10.757 150.956 37.208  1.00 24.98 ? 373 TRP A N   1 
ATOM   2835 C  CA  . TRP A 1 373 ? 9.722  151.808 37.765  1.00 24.64 ? 373 TRP A CA  1 
ATOM   2836 C  C   . TRP A 1 373 ? 8.564  151.035 38.402  1.00 25.18 ? 373 TRP A C   1 
ATOM   2837 O  O   . TRP A 1 373 ? 8.080  151.419 39.470  1.00 25.63 ? 373 TRP A O   1 
ATOM   2838 C  CB  . TRP A 1 373 ? 9.177  152.759 36.693  1.00 23.59 ? 373 TRP A CB  1 
ATOM   2839 C  CG  . TRP A 1 373 ? 8.188  153.739 37.249  1.00 24.08 ? 373 TRP A CG  1 
ATOM   2840 C  CD1 . TRP A 1 373 ? 6.845  153.788 36.996  1.00 24.96 ? 373 TRP A CD1 1 
ATOM   2841 C  CD2 . TRP A 1 373 ? 8.447  154.751 38.234  1.00 24.32 ? 373 TRP A CD2 1 
ATOM   2842 N  NE1 . TRP A 1 373 ? 6.251  154.764 37.770  1.00 25.44 ? 373 TRP A NE1 1 
ATOM   2843 C  CE2 . TRP A 1 373 ? 7.212  155.368 38.538  1.00 25.20 ? 373 TRP A CE2 1 
ATOM   2844 C  CE3 . TRP A 1 373 ? 9.599  155.191 38.892  1.00 23.16 ? 373 TRP A CE3 1 
ATOM   2845 C  CZ2 . TRP A 1 373 ? 7.100  156.399 39.471  1.00 24.68 ? 373 TRP A CZ2 1 
ATOM   2846 C  CZ3 . TRP A 1 373 ? 9.484  156.217 39.821  1.00 24.44 ? 373 TRP A CZ3 1 
ATOM   2847 C  CH2 . TRP A 1 373 ? 8.244  156.807 40.101  1.00 24.55 ? 373 TRP A CH2 1 
ATOM   2848 N  N   . THR A 1 374 ? 8.124  149.949 37.767  1.00 25.23 ? 374 THR A N   1 
ATOM   2849 C  CA  . THR A 1 374 ? 6.999  149.182 38.304  1.00 26.71 ? 374 THR A CA  1 
ATOM   2850 C  C   . THR A 1 374 ? 7.345  147.978 39.176  1.00 27.37 ? 374 THR A C   1 
ATOM   2851 O  O   . THR A 1 374 ? 6.472  147.417 39.836  1.00 27.22 ? 374 THR A O   1 
ATOM   2852 C  CB  . THR A 1 374 ? 6.043  148.712 37.180  1.00 26.48 ? 374 THR A CB  1 
ATOM   2853 O  OG1 . THR A 1 374 ? 6.723  147.811 36.298  1.00 24.05 ? 374 THR A OG1 1 
ATOM   2854 C  CG2 . THR A 1 374 ? 5.532  149.904 36.397  1.00 25.03 ? 374 THR A CG2 1 
ATOM   2855 N  N   . HIS A 1 375 ? 8.611  147.582 39.189  1.00 29.04 ? 375 HIS A N   1 
ATOM   2856 C  CA  . HIS A 1 375 ? 9.029  146.450 40.009  1.00 30.75 ? 375 HIS A CA  1 
ATOM   2857 C  C   . HIS A 1 375 ? 10.269 146.762 40.831  1.00 32.94 ? 375 HIS A C   1 
ATOM   2858 O  O   . HIS A 1 375 ? 11.254 146.024 40.793  1.00 33.38 ? 375 HIS A O   1 
ATOM   2859 C  CB  . HIS A 1 375 ? 9.288  145.218 39.134  1.00 28.95 ? 375 HIS A CB  1 
ATOM   2860 C  CG  . HIS A 1 375 ? 8.054  144.674 38.492  1.00 28.84 ? 375 HIS A CG  1 
ATOM   2861 N  ND1 . HIS A 1 375 ? 7.710  144.950 37.188  1.00 29.42 ? 375 HIS A ND1 1 
ATOM   2862 C  CD2 . HIS A 1 375 ? 7.045  143.925 38.997  1.00 30.00 ? 375 HIS A CD2 1 
ATOM   2863 C  CE1 . HIS A 1 375 ? 6.541  144.397 36.916  1.00 30.09 ? 375 HIS A CE1 1 
ATOM   2864 N  NE2 . HIS A 1 375 ? 6.115  143.770 37.998  1.00 29.31 ? 375 HIS A NE2 1 
ATOM   2865 N  N   . PRO A 1 376 ? 10.235 147.860 41.598  1.00 34.97 ? 376 PRO A N   1 
ATOM   2866 C  CA  . PRO A 1 376 ? 11.400 148.215 42.414  1.00 36.85 ? 376 PRO A CA  1 
ATOM   2867 C  C   . PRO A 1 376 ? 11.777 147.055 43.341  1.00 39.13 ? 376 PRO A C   1 
ATOM   2868 O  O   . PRO A 1 376 ? 12.945 146.654 43.429  1.00 39.07 ? 376 PRO A O   1 
ATOM   2869 C  CB  . PRO A 1 376 ? 10.920 149.456 43.174  1.00 36.26 ? 376 PRO A CB  1 
ATOM   2870 C  CG  . PRO A 1 376 ? 9.435  149.208 43.321  1.00 35.82 ? 376 PRO A CG  1 
ATOM   2871 C  CD  . PRO A 1 376 ? 9.065  148.689 41.947  1.00 35.28 ? 376 PRO A CD  1 
ATOM   2872 N  N   . ASP A 1 377 ? 10.759 146.515 44.007  1.00 40.51 ? 377 ASP A N   1 
ATOM   2873 C  CA  . ASP A 1 377 ? 10.908 145.402 44.939  1.00 41.26 ? 377 ASP A CA  1 
ATOM   2874 C  C   . ASP A 1 377 ? 11.752 144.249 44.390  1.00 40.48 ? 377 ASP A C   1 
ATOM   2875 O  O   . ASP A 1 377 ? 12.311 143.467 45.157  1.00 41.38 ? 377 ASP A O   1 
ATOM   2876 C  CB  . ASP A 1 377 ? 9.517  144.884 45.333  1.00 43.09 ? 377 ASP A CB  1 
ATOM   2877 C  CG  . ASP A 1 377 ? 8.676  144.473 44.121  1.00 46.53 ? 377 ASP A CG  1 
ATOM   2878 O  OD1 . ASP A 1 377 ? 8.892  143.367 43.577  1.00 48.08 ? 377 ASP A OD1 1 
ATOM   2879 O  OD2 . ASP A 1 377 ? 7.802  145.264 43.701  1.00 49.51 ? 377 ASP A OD2 1 
ATOM   2880 N  N   . LYS A 1 378 ? 11.850 144.148 43.069  1.00 38.73 ? 378 LYS A N   1 
ATOM   2881 C  CA  . LYS A 1 378 ? 12.609 143.067 42.440  1.00 37.59 ? 378 LYS A CA  1 
ATOM   2882 C  C   . LYS A 1 378 ? 14.085 143.367 42.212  1.00 36.82 ? 378 LYS A C   1 
ATOM   2883 O  O   . LYS A 1 378 ? 14.858 142.458 41.893  1.00 37.28 ? 378 LYS A O   1 
ATOM   2884 C  CB  . LYS A 1 378 ? 11.978 142.691 41.088  1.00 36.99 ? 378 LYS A CB  1 
ATOM   2885 C  CG  . LYS A 1 378 ? 10.624 142.000 41.194  1.00 38.24 ? 378 LYS A CG  1 
ATOM   2886 C  CD  . LYS A 1 378 ? 9.927  141.920 39.841  1.00 39.35 ? 378 LYS A CD  1 
ATOM   2887 C  CE  . LYS A 1 378 ? 10.788 141.224 38.798  1.00 38.63 ? 378 LYS A CE  1 
ATOM   2888 N  NZ  . LYS A 1 378 ? 10.132 141.238 37.459  1.00 37.41 ? 378 LYS A NZ  1 
ATOM   2889 N  N   . TYR A 1 379 ? 14.490 144.624 42.380  1.00 34.28 ? 379 TYR A N   1 
ATOM   2890 C  CA  . TYR A 1 379 ? 15.877 144.976 42.116  1.00 31.45 ? 379 TYR A CA  1 
ATOM   2891 C  C   . TYR A 1 379 ? 16.663 145.625 43.226  1.00 31.42 ? 379 TYR A C   1 
ATOM   2892 O  O   . TYR A 1 379 ? 16.430 146.781 43.580  1.00 33.05 ? 379 TYR A O   1 
ATOM   2893 C  CB  . TYR A 1 379 ? 15.932 145.859 40.879  1.00 29.82 ? 379 TYR A CB  1 
ATOM   2894 C  CG  . TYR A 1 379 ? 15.442 145.137 39.658  1.00 29.33 ? 379 TYR A CG  1 
ATOM   2895 C  CD1 . TYR A 1 379 ? 16.267 144.248 38.981  1.00 29.40 ? 379 TYR A CD1 1 
ATOM   2896 C  CD2 . TYR A 1 379 ? 14.136 145.290 39.216  1.00 27.37 ? 379 TYR A CD2 1 
ATOM   2897 C  CE1 . TYR A 1 379 ? 15.802 143.529 37.899  1.00 28.66 ? 379 TYR A CE1 1 
ATOM   2898 C  CE2 . TYR A 1 379 ? 13.662 144.575 38.138  1.00 27.19 ? 379 TYR A CE2 1 
ATOM   2899 C  CZ  . TYR A 1 379 ? 14.497 143.694 37.485  1.00 26.89 ? 379 TYR A CZ  1 
ATOM   2900 O  OH  . TYR A 1 379 ? 14.019 142.955 36.432  1.00 25.38 ? 379 TYR A OH  1 
ATOM   2901 N  N   . PRO A 1 380 ? 17.617 144.879 43.795  1.00 30.91 ? 380 PRO A N   1 
ATOM   2902 C  CA  . PRO A 1 380 ? 18.464 145.383 44.876  1.00 29.90 ? 380 PRO A CA  1 
ATOM   2903 C  C   . PRO A 1 380 ? 19.478 146.299 44.208  1.00 29.77 ? 380 PRO A C   1 
ATOM   2904 O  O   . PRO A 1 380 ? 19.719 146.175 43.004  1.00 28.63 ? 380 PRO A O   1 
ATOM   2905 C  CB  . PRO A 1 380 ? 19.134 144.115 45.421  1.00 29.35 ? 380 PRO A CB  1 
ATOM   2906 C  CG  . PRO A 1 380 ? 18.229 142.997 44.973  1.00 29.32 ? 380 PRO A CG  1 
ATOM   2907 C  CD  . PRO A 1 380 ? 17.835 143.438 43.593  1.00 30.14 ? 380 PRO A CD  1 
ATOM   2908 N  N   . VAL A 1 381 ? 20.058 147.225 44.961  1.00 30.15 ? 381 VAL A N   1 
ATOM   2909 C  CA  . VAL A 1 381 ? 21.062 148.098 44.375  1.00 29.74 ? 381 VAL A CA  1 
ATOM   2910 C  C   . VAL A 1 381 ? 22.079 147.157 43.731  1.00 30.74 ? 381 VAL A C   1 
ATOM   2911 O  O   . VAL A 1 381 ? 22.467 146.147 44.326  1.00 30.57 ? 381 VAL A O   1 
ATOM   2912 C  CB  . VAL A 1 381 ? 21.755 148.967 45.448  1.00 28.87 ? 381 VAL A CB  1 
ATOM   2913 C  CG1 . VAL A 1 381 ? 22.920 149.731 44.838  1.00 28.16 ? 381 VAL A CG1 1 
ATOM   2914 C  CG2 . VAL A 1 381 ? 20.755 149.936 46.045  1.00 28.43 ? 381 VAL A CG2 1 
ATOM   2915 N  N   . GLY A 1 382 ? 22.489 147.477 42.510  1.00 31.22 ? 382 GLY A N   1 
ATOM   2916 C  CA  . GLY A 1 382 ? 23.444 146.642 41.804  1.00 31.96 ? 382 GLY A CA  1 
ATOM   2917 C  C   . GLY A 1 382 ? 23.119 146.622 40.322  1.00 32.66 ? 382 GLY A C   1 
ATOM   2918 O  O   . GLY A 1 382 ? 22.081 147.139 39.907  1.00 33.35 ? 382 GLY A O   1 
ATOM   2919 N  N   . VAL A 1 383 ? 23.993 146.026 39.518  1.00 32.50 ? 383 VAL A N   1 
ATOM   2920 C  CA  . VAL A 1 383 ? 23.769 145.975 38.078  1.00 32.47 ? 383 VAL A CA  1 
ATOM   2921 C  C   . VAL A 1 383 ? 23.072 144.675 37.709  1.00 32.48 ? 383 VAL A C   1 
ATOM   2922 O  O   . VAL A 1 383 ? 23.550 143.593 38.041  1.00 33.70 ? 383 VAL A O   1 
ATOM   2923 C  CB  . VAL A 1 383 ? 25.104 146.091 37.307  1.00 32.77 ? 383 VAL A CB  1 
ATOM   2924 C  CG1 . VAL A 1 383 ? 24.838 146.327 35.824  1.00 31.28 ? 383 VAL A CG1 1 
ATOM   2925 C  CG2 . VAL A 1 383 ? 25.940 147.227 37.893  1.00 32.43 ? 383 VAL A CG2 1 
ATOM   2926 N  N   . HIS A 1 384 ? 21.938 144.786 37.024  1.00 31.57 ? 384 HIS A N   1 
ATOM   2927 C  CA  . HIS A 1 384 ? 21.159 143.615 36.630  1.00 30.54 ? 384 HIS A CA  1 
ATOM   2928 C  C   . HIS A 1 384 ? 20.992 143.530 35.114  1.00 29.64 ? 384 HIS A C   1 
ATOM   2929 O  O   . HIS A 1 384 ? 20.895 144.554 34.434  1.00 29.42 ? 384 HIS A O   1 
ATOM   2930 C  CB  . HIS A 1 384 ? 19.771 143.684 37.270  1.00 30.38 ? 384 HIS A CB  1 
ATOM   2931 C  CG  . HIS A 1 384 ? 19.795 143.991 38.735  1.00 32.19 ? 384 HIS A CG  1 
ATOM   2932 N  ND1 . HIS A 1 384 ? 20.119 143.052 39.690  1.00 33.06 ? 384 HIS A ND1 1 
ATOM   2933 C  CD2 . HIS A 1 384 ? 19.544 145.140 39.408  1.00 32.65 ? 384 HIS A CD2 1 
ATOM   2934 C  CE1 . HIS A 1 384 ? 20.064 143.607 40.888  1.00 33.27 ? 384 HIS A CE1 1 
ATOM   2935 N  NE2 . HIS A 1 384 ? 19.718 144.873 40.745  1.00 33.23 ? 384 HIS A NE2 1 
ATOM   2936 N  N   . PHE A 1 385 ? 20.958 142.310 34.586  1.00 27.88 ? 385 PHE A N   1 
ATOM   2937 C  CA  . PHE A 1 385 ? 20.763 142.117 33.151  1.00 25.70 ? 385 PHE A CA  1 
ATOM   2938 C  C   . PHE A 1 385 ? 19.275 142.265 32.867  1.00 25.65 ? 385 PHE A C   1 
ATOM   2939 O  O   . PHE A 1 385 ? 18.446 142.004 33.735  1.00 26.88 ? 385 PHE A O   1 
ATOM   2940 C  CB  . PHE A 1 385 ? 21.206 140.721 32.726  1.00 22.82 ? 385 PHE A CB  1 
ATOM   2941 C  CG  . PHE A 1 385 ? 22.684 140.569 32.579  1.00 21.34 ? 385 PHE A CG  1 
ATOM   2942 C  CD1 . PHE A 1 385 ? 23.351 141.172 31.529  1.00 21.52 ? 385 PHE A CD1 1 
ATOM   2943 C  CD2 . PHE A 1 385 ? 23.406 139.801 33.471  1.00 20.65 ? 385 PHE A CD2 1 
ATOM   2944 C  CE1 . PHE A 1 385 ? 24.718 141.007 31.365  1.00 21.32 ? 385 PHE A CE1 1 
ATOM   2945 C  CE2 . PHE A 1 385 ? 24.771 139.632 33.317  1.00 20.77 ? 385 PHE A CE2 1 
ATOM   2946 C  CZ  . PHE A 1 385 ? 25.428 140.236 32.259  1.00 20.70 ? 385 PHE A CZ  1 
ATOM   2947 N  N   . LEU A 1 386 ? 18.926 142.697 31.664  1.00 24.68 ? 386 LEU A N   1 
ATOM   2948 C  CA  . LEU A 1 386 ? 17.518 142.820 31.328  1.00 25.04 ? 386 LEU A CA  1 
ATOM   2949 C  C   . LEU A 1 386 ? 16.904 141.417 31.248  1.00 25.54 ? 386 LEU A C   1 
ATOM   2950 O  O   . LEU A 1 386 ? 17.395 140.562 30.505  1.00 27.38 ? 386 LEU A O   1 
ATOM   2951 C  CB  . LEU A 1 386 ? 17.353 143.516 29.978  1.00 24.73 ? 386 LEU A CB  1 
ATOM   2952 C  CG  . LEU A 1 386 ? 15.903 143.614 29.507  1.00 24.01 ? 386 LEU A CG  1 
ATOM   2953 C  CD1 . LEU A 1 386 ? 15.119 144.480 30.485  1.00 24.77 ? 386 LEU A CD1 1 
ATOM   2954 C  CD2 . LEU A 1 386 ? 15.843 144.193 28.110  1.00 22.94 ? 386 LEU A CD2 1 
ATOM   2955 N  N   . PRO A 1 387 ? 15.833 141.153 32.015  1.00 24.80 ? 387 PRO A N   1 
ATOM   2956 C  CA  . PRO A 1 387 ? 15.203 139.828 31.970  1.00 24.02 ? 387 PRO A CA  1 
ATOM   2957 C  C   . PRO A 1 387 ? 14.978 139.391 30.519  1.00 24.39 ? 387 PRO A C   1 
ATOM   2958 O  O   . PRO A 1 387 ? 14.517 140.179 29.684  1.00 25.48 ? 387 PRO A O   1 
ATOM   2959 C  CB  . PRO A 1 387 ? 13.891 140.047 32.712  1.00 23.95 ? 387 PRO A CB  1 
ATOM   2960 C  CG  . PRO A 1 387 ? 14.256 141.064 33.734  1.00 24.21 ? 387 PRO A CG  1 
ATOM   2961 C  CD  . PRO A 1 387 ? 15.122 142.042 32.951  1.00 26.11 ? 387 PRO A CD  1 
ATOM   2962 N  N   . LYS A 1 388 ? 15.305 138.138 30.222  1.00 23.18 ? 388 LYS A N   1 
ATOM   2963 C  CA  . LYS A 1 388 ? 15.154 137.608 28.875  1.00 21.77 ? 388 LYS A CA  1 
ATOM   2964 C  C   . LYS A 1 388 ? 13.747 137.792 28.304  1.00 22.60 ? 388 LYS A C   1 
ATOM   2965 O  O   . LYS A 1 388 ? 13.587 138.119 27.124  1.00 21.69 ? 388 LYS A O   1 
ATOM   2966 C  CB  . LYS A 1 388 ? 15.541 136.128 28.851  1.00 19.65 ? 388 LYS A CB  1 
ATOM   2967 C  CG  . LYS A 1 388 ? 15.443 135.496 27.480  1.00 18.78 ? 388 LYS A CG  1 
ATOM   2968 C  CD  . LYS A 1 388 ? 16.082 134.120 27.459  1.00 19.04 ? 388 LYS A CD  1 
ATOM   2969 C  CE  . LYS A 1 388 ? 17.600 134.214 27.549  1.00 18.05 ? 388 LYS A CE  1 
ATOM   2970 N  NZ  . LYS A 1 388 ? 18.165 134.952 26.388  1.00 17.10 ? 388 LYS A NZ  1 
ATOM   2971 N  N   . LYS A 1 389 ? 12.724 137.588 29.131  1.00 23.19 ? 389 LYS A N   1 
ATOM   2972 C  CA  . LYS A 1 389 ? 11.355 137.745 28.658  1.00 24.17 ? 389 LYS A CA  1 
ATOM   2973 C  C   . LYS A 1 389 ? 11.166 139.151 28.087  1.00 23.82 ? 389 LYS A C   1 
ATOM   2974 O  O   . LYS A 1 389 ? 10.390 139.355 27.146  1.00 22.72 ? 389 LYS A O   1 
ATOM   2975 C  CB  . LYS A 1 389 ? 10.361 137.490 29.795  1.00 25.46 ? 389 LYS A CB  1 
ATOM   2976 C  CG  . LYS A 1 389 ? 8.919  137.414 29.326  1.00 29.58 ? 389 LYS A CG  1 
ATOM   2977 C  CD  . LYS A 1 389 ? 8.079  136.558 30.258  1.00 34.02 ? 389 LYS A CD  1 
ATOM   2978 C  CE  . LYS A 1 389 ? 6.656  136.383 29.734  1.00 35.81 ? 389 LYS A CE  1 
ATOM   2979 N  NZ  . LYS A 1 389 ? 5.923  135.316 30.492  1.00 38.79 ? 389 LYS A NZ  1 
ATOM   2980 N  N   . LEU A 1 390 ? 11.887 140.115 28.658  1.00 23.28 ? 390 LEU A N   1 
ATOM   2981 C  CA  . LEU A 1 390 ? 11.819 141.496 28.197  1.00 22.86 ? 390 LEU A CA  1 
ATOM   2982 C  C   . LEU A 1 390 ? 12.613 141.669 26.908  1.00 22.13 ? 390 LEU A C   1 
ATOM   2983 O  O   . LEU A 1 390 ? 12.230 142.430 26.015  1.00 21.74 ? 390 LEU A O   1 
ATOM   2984 C  CB  . LEU A 1 390 ? 12.345 142.438 29.280  1.00 23.70 ? 390 LEU A CB  1 
ATOM   2985 C  CG  . LEU A 1 390 ? 11.399 142.504 30.481  1.00 23.81 ? 390 LEU A CG  1 
ATOM   2986 C  CD1 . LEU A 1 390 ? 11.788 143.645 31.399  1.00 23.12 ? 390 LEU A CD1 1 
ATOM   2987 C  CD2 . LEU A 1 390 ? 9.982  142.696 29.969  1.00 22.08 ? 390 LEU A CD2 1 
ATOM   2988 N  N   . ASP A 1 391 ? 13.728 140.956 26.814  1.00 21.19 ? 391 ASP A N   1 
ATOM   2989 C  CA  . ASP A 1 391 ? 14.547 141.013 25.618  1.00 19.95 ? 391 ASP A CA  1 
ATOM   2990 C  C   . ASP A 1 391 ? 13.719 140.402 24.477  1.00 19.74 ? 391 ASP A C   1 
ATOM   2991 O  O   . ASP A 1 391 ? 13.736 140.900 23.348  1.00 19.20 ? 391 ASP A O   1 
ATOM   2992 C  CB  . ASP A 1 391 ? 15.844 140.231 25.849  1.00 18.21 ? 391 ASP A CB  1 
ATOM   2993 C  CG  . ASP A 1 391 ? 16.846 140.417 24.733  1.00 19.24 ? 391 ASP A CG  1 
ATOM   2994 O  OD1 . ASP A 1 391 ? 16.665 141.335 23.910  1.00 19.71 ? 391 ASP A OD1 1 
ATOM   2995 O  OD2 . ASP A 1 391 ? 17.827 139.651 24.685  1.00 20.35 ? 391 ASP A OD2 1 
ATOM   2996 N  N   . GLU A 1 392 ? 12.979 139.336 24.784  1.00 19.72 ? 392 GLU A N   1 
ATOM   2997 C  CA  . GLU A 1 392 ? 12.137 138.680 23.781  1.00 20.69 ? 392 GLU A CA  1 
ATOM   2998 C  C   . GLU A 1 392 ? 11.012 139.617 23.379  1.00 19.43 ? 392 GLU A C   1 
ATOM   2999 O  O   . GLU A 1 392 ? 10.632 139.663 22.213  1.00 20.65 ? 392 GLU A O   1 
ATOM   3000 C  CB  . GLU A 1 392 ? 11.534 137.376 24.322  1.00 21.19 ? 392 GLU A CB  1 
ATOM   3001 C  CG  . GLU A 1 392 ? 12.565 136.388 24.852  1.00 24.33 ? 392 GLU A CG  1 
ATOM   3002 C  CD  . GLU A 1 392 ? 11.955 135.080 25.337  1.00 25.92 ? 392 GLU A CD  1 
ATOM   3003 O  OE1 . GLU A 1 392 ? 10.880 135.106 25.976  1.00 27.46 ? 392 GLU A OE1 1 
ATOM   3004 O  OE2 . GLU A 1 392 ? 12.567 134.022 25.093  1.00 27.02 ? 392 GLU A OE2 1 
ATOM   3005 N  N   . ALA A 1 393 ? 10.485 140.361 24.352  1.00 18.12 ? 393 ALA A N   1 
ATOM   3006 C  CA  . ALA A 1 393 ? 9.400  141.307 24.102  1.00 16.77 ? 393 ALA A CA  1 
ATOM   3007 C  C   . ALA A 1 393 ? 9.842  142.362 23.095  1.00 16.52 ? 393 ALA A C   1 
ATOM   3008 O  O   . ALA A 1 393 ? 9.044  142.825 22.279  1.00 18.06 ? 393 ALA A O   1 
ATOM   3009 C  CB  . ALA A 1 393 ? 8.966  141.970 25.402  1.00 13.33 ? 393 ALA A CB  1 
ATOM   3010 N  N   . VAL A 1 394 ? 11.115 142.736 23.155  1.00 15.68 ? 394 VAL A N   1 
ATOM   3011 C  CA  . VAL A 1 394 ? 11.665 143.718 22.232  1.00 15.64 ? 394 VAL A CA  1 
ATOM   3012 C  C   . VAL A 1 394 ? 11.626 143.174 20.806  1.00 16.53 ? 394 VAL A C   1 
ATOM   3013 O  O   . VAL A 1 394 ? 11.138 143.837 19.889  1.00 17.95 ? 394 VAL A O   1 
ATOM   3014 C  CB  . VAL A 1 394 ? 13.130 144.059 22.573  1.00 14.90 ? 394 VAL A CB  1 
ATOM   3015 C  CG1 . VAL A 1 394 ? 13.703 144.988 21.515  1.00 13.36 ? 394 VAL A CG1 1 
ATOM   3016 C  CG2 . VAL A 1 394 ? 13.211 144.687 23.948  1.00 12.00 ? 394 VAL A CG2 1 
ATOM   3017 N  N   . ALA A 1 395 ? 12.146 141.965 20.620  1.00 16.79 ? 395 ALA A N   1 
ATOM   3018 C  CA  . ALA A 1 395 ? 12.164 141.355 19.299  1.00 17.85 ? 395 ALA A CA  1 
ATOM   3019 C  C   . ALA A 1 395 ? 10.740 141.169 18.777  1.00 19.99 ? 395 ALA A C   1 
ATOM   3020 O  O   . ALA A 1 395 ? 10.449 141.441 17.600  1.00 20.27 ? 395 ALA A O   1 
ATOM   3021 C  CB  . ALA A 1 395 ? 12.880 140.019 19.353  1.00 15.86 ? 395 ALA A CB  1 
ATOM   3022 N  N   . GLU A 1 396 ? 9.852  140.711 19.656  1.00 20.44 ? 396 GLU A N   1 
ATOM   3023 C  CA  . GLU A 1 396 ? 8.468  140.484 19.272  1.00 21.80 ? 396 GLU A CA  1 
ATOM   3024 C  C   . GLU A 1 396 ? 7.842  141.786 18.800  1.00 20.82 ? 396 GLU A C   1 
ATOM   3025 O  O   . GLU A 1 396 ? 7.074  141.800 17.839  1.00 21.65 ? 396 GLU A O   1 
ATOM   3026 C  CB  . GLU A 1 396 ? 7.675  139.890 20.446  1.00 25.68 ? 396 GLU A CB  1 
ATOM   3027 C  CG  . GLU A 1 396 ? 6.196  139.633 20.148  1.00 30.36 ? 396 GLU A CG  1 
ATOM   3028 C  CD  . GLU A 1 396 ? 5.335  140.887 20.298  1.00 35.10 ? 396 GLU A CD  1 
ATOM   3029 O  OE1 . GLU A 1 396 ? 4.242  140.939 19.691  1.00 36.09 ? 396 GLU A OE1 1 
ATOM   3030 O  OE2 . GLU A 1 396 ? 5.744  141.817 21.037  1.00 36.97 ? 396 GLU A OE2 1 
ATOM   3031 N  N   . ALA A 1 397 ? 8.197  142.884 19.459  1.00 19.83 ? 397 ALA A N   1 
ATOM   3032 C  CA  . ALA A 1 397 ? 7.667  144.195 19.097  1.00 18.18 ? 397 ALA A CA  1 
ATOM   3033 C  C   . ALA A 1 397 ? 8.074  144.619 17.693  1.00 17.12 ? 397 ALA A C   1 
ATOM   3034 O  O   . ALA A 1 397 ? 7.432  145.478 17.096  1.00 17.56 ? 397 ALA A O   1 
ATOM   3035 C  CB  . ALA A 1 397 ? 8.118  145.236 20.106  1.00 17.80 ? 397 ALA A CB  1 
ATOM   3036 N  N   . HIS A 1 398 ? 9.134  144.021 17.157  1.00 17.36 ? 398 HIS A N   1 
ATOM   3037 C  CA  . HIS A 1 398 ? 9.577  144.372 15.811  1.00 17.56 ? 398 HIS A CA  1 
ATOM   3038 C  C   . HIS A 1 398 ? 9.108  143.392 14.732  1.00 17.02 ? 398 HIS A C   1 
ATOM   3039 O  O   . HIS A 1 398 ? 9.274  143.654 13.541  1.00 16.59 ? 398 HIS A O   1 
ATOM   3040 C  CB  . HIS A 1 398 ? 11.103 144.473 15.757  1.00 17.87 ? 398 HIS A CB  1 
ATOM   3041 C  CG  . HIS A 1 398 ? 11.664 145.597 16.566  1.00 18.38 ? 398 HIS A CG  1 
ATOM   3042 N  ND1 . HIS A 1 398 ? 11.683 145.587 17.944  1.00 19.54 ? 398 HIS A ND1 1 
ATOM   3043 C  CD2 . HIS A 1 398 ? 12.218 146.773 16.191  1.00 18.19 ? 398 HIS A CD2 1 
ATOM   3044 C  CE1 . HIS A 1 398 ? 12.226 146.708 18.383  1.00 18.76 ? 398 HIS A CE1 1 
ATOM   3045 N  NE2 . HIS A 1 398 ? 12.559 147.445 17.339  1.00 18.64 ? 398 HIS A NE2 1 
ATOM   3046 N  N   . LEU A 1 399 ? 8.513  142.275 15.137  1.00 17.32 ? 399 LEU A N   1 
ATOM   3047 C  CA  . LEU A 1 399 ? 8.071  141.282 14.161  1.00 18.98 ? 399 LEU A CA  1 
ATOM   3048 C  C   . LEU A 1 399 ? 6.947  141.751 13.247  1.00 19.46 ? 399 LEU A C   1 
ATOM   3049 O  O   . LEU A 1 399 ? 6.925  141.405 12.067  1.00 18.43 ? 399 LEU A O   1 
ATOM   3050 C  CB  . LEU A 1 399 ? 7.663  139.987 14.867  1.00 18.21 ? 399 LEU A CB  1 
ATOM   3051 C  CG  . LEU A 1 399 ? 8.815  139.352 15.655  1.00 19.66 ? 399 LEU A CG  1 
ATOM   3052 C  CD1 . LEU A 1 399 ? 8.395  137.977 16.149  1.00 17.94 ? 399 LEU A CD1 1 
ATOM   3053 C  CD2 . LEU A 1 399 ? 10.058 139.255 14.766  1.00 15.51 ? 399 LEU A CD2 1 
ATOM   3054 N  N   . GLY A 1 400 ? 6.024  142.543 13.789  1.00 20.59 ? 400 GLY A N   1 
ATOM   3055 C  CA  . GLY A 1 400 ? 4.914  143.035 12.994  1.00 21.24 ? 400 GLY A CA  1 
ATOM   3056 C  C   . GLY A 1 400 ? 5.383  143.744 11.743  1.00 24.41 ? 400 GLY A C   1 
ATOM   3057 O  O   . GLY A 1 400 ? 5.026  143.363 10.624  1.00 23.24 ? 400 GLY A O   1 
ATOM   3058 N  N   . LYS A 1 401 ? 6.188  144.784 11.930  1.00 26.19 ? 401 LYS A N   1 
ATOM   3059 C  CA  . LYS A 1 401 ? 6.712  145.550 10.808  1.00 29.05 ? 401 LYS A CA  1 
ATOM   3060 C  C   . LYS A 1 401 ? 7.309  144.612 9.760   1.00 29.54 ? 401 LYS A C   1 
ATOM   3061 O  O   . LYS A 1 401 ? 7.201  144.855 8.560   1.00 30.85 ? 401 LYS A O   1 
ATOM   3062 C  CB  . LYS A 1 401 ? 7.786  146.528 11.300  1.00 31.48 ? 401 LYS A CB  1 
ATOM   3063 C  CG  . LYS A 1 401 ? 8.501  147.295 10.192  1.00 35.04 ? 401 LYS A CG  1 
ATOM   3064 C  CD  . LYS A 1 401 ? 7.560  148.257 9.467   1.00 38.29 ? 401 LYS A CD  1 
ATOM   3065 C  CE  . LYS A 1 401 ? 8.315  149.082 8.422   1.00 39.59 ? 401 LYS A CE  1 
ATOM   3066 N  NZ  . LYS A 1 401 ? 7.423  150.100 7.780   1.00 44.78 ? 401 LYS A NZ  1 
ATOM   3067 N  N   . LEU A 1 402 ? 7.937  143.535 10.222  1.00 28.87 ? 402 LEU A N   1 
ATOM   3068 C  CA  . LEU A 1 402 ? 8.559  142.569 9.328   1.00 27.40 ? 402 LEU A CA  1 
ATOM   3069 C  C   . LEU A 1 402 ? 7.537  141.602 8.755   1.00 28.28 ? 402 LEU A C   1 
ATOM   3070 O  O   . LEU A 1 402 ? 7.868  140.750 7.928   1.00 28.31 ? 402 LEU A O   1 
ATOM   3071 C  CB  . LEU A 1 402 ? 9.644  141.796 10.075  1.00 25.47 ? 402 LEU A CB  1 
ATOM   3072 C  CG  . LEU A 1 402 ? 10.812 142.669 10.532  1.00 23.53 ? 402 LEU A CG  1 
ATOM   3073 C  CD1 . LEU A 1 402 ? 11.764 141.865 11.396  1.00 24.18 ? 402 LEU A CD1 1 
ATOM   3074 C  CD2 . LEU A 1 402 ? 11.523 143.219 9.317   1.00 22.37 ? 402 LEU A CD2 1 
ATOM   3075 N  N   . ASN A 1 403 ? 6.291  141.744 9.194   1.00 29.30 ? 403 ASN A N   1 
ATOM   3076 C  CA  . ASN A 1 403 ? 5.211  140.883 8.728   1.00 30.60 ? 403 ASN A CA  1 
ATOM   3077 C  C   . ASN A 1 403 ? 5.632  139.421 8.915   1.00 28.68 ? 403 ASN A C   1 
ATOM   3078 O  O   . ASN A 1 403 ? 5.477  138.585 8.025   1.00 29.39 ? 403 ASN A O   1 
ATOM   3079 C  CB  . ASN A 1 403 ? 4.919  141.181 7.253   1.00 34.26 ? 403 ASN A CB  1 
ATOM   3080 C  CG  . ASN A 1 403 ? 3.570  140.648 6.799   1.00 38.54 ? 403 ASN A CG  1 
ATOM   3081 O  OD1 . ASN A 1 403 ? 3.166  140.855 5.648   1.00 41.29 ? 403 ASN A OD1 1 
ATOM   3082 N  ND2 . ASN A 1 403 ? 2.866  139.958 7.696   1.00 37.86 ? 403 ASN A ND2 1 
ATOM   3083 N  N   . VAL A 1 404 ? 6.188  139.138 10.087  1.00 25.43 ? 404 VAL A N   1 
ATOM   3084 C  CA  . VAL A 1 404 ? 6.643  137.804 10.439  1.00 22.83 ? 404 VAL A CA  1 
ATOM   3085 C  C   . VAL A 1 404 ? 5.602  137.143 11.321  1.00 23.50 ? 404 VAL A C   1 
ATOM   3086 O  O   . VAL A 1 404 ? 5.227  137.692 12.353  1.00 23.21 ? 404 VAL A O   1 
ATOM   3087 C  CB  . VAL A 1 404 ? 7.957  137.855 11.232  1.00 20.71 ? 404 VAL A CB  1 
ATOM   3088 C  CG1 . VAL A 1 404 ? 8.149  136.565 11.996  1.00 16.93 ? 404 VAL A CG1 1 
ATOM   3089 C  CG2 . VAL A 1 404 ? 9.116  138.100 10.299  1.00 21.58 ? 404 VAL A CG2 1 
ATOM   3090 N  N   . LYS A 1 405 ? 5.132  135.966 10.923  1.00 23.49 ? 405 LYS A N   1 
ATOM   3091 C  CA  . LYS A 1 405 ? 4.144  135.269 11.728  1.00 22.98 ? 405 LYS A CA  1 
ATOM   3092 C  C   . LYS A 1 405 ? 4.827  134.324 12.704  1.00 21.43 ? 405 LYS A C   1 
ATOM   3093 O  O   . LYS A 1 405 ? 5.318  133.265 12.324  1.00 22.12 ? 405 LYS A O   1 
ATOM   3094 C  CB  . LYS A 1 405 ? 3.169  134.502 10.841  1.00 25.71 ? 405 LYS A CB  1 
ATOM   3095 C  CG  . LYS A 1 405 ? 2.276  135.388 9.987   1.00 29.77 ? 405 LYS A CG  1 
ATOM   3096 C  CD  . LYS A 1 405 ? 1.178  134.547 9.351   1.00 35.33 ? 405 LYS A CD  1 
ATOM   3097 C  CE  . LYS A 1 405 ? 0.247  135.365 8.465   1.00 36.76 ? 405 LYS A CE  1 
ATOM   3098 N  NZ  . LYS A 1 405 ? -0.864 134.517 7.937   1.00 35.46 ? 405 LYS A NZ  1 
ATOM   3099 N  N   . LEU A 1 406 ? 4.860  134.726 13.968  1.00 19.17 ? 406 LEU A N   1 
ATOM   3100 C  CA  . LEU A 1 406 ? 5.478  133.922 15.006  1.00 18.43 ? 406 LEU A CA  1 
ATOM   3101 C  C   . LEU A 1 406 ? 4.542  132.789 15.403  1.00 20.57 ? 406 LEU A C   1 
ATOM   3102 O  O   . LEU A 1 406 ? 3.343  132.991 15.592  1.00 22.30 ? 406 LEU A O   1 
ATOM   3103 C  CB  . LEU A 1 406 ? 5.784  134.788 16.232  1.00 14.11 ? 406 LEU A CB  1 
ATOM   3104 C  CG  . LEU A 1 406 ? 6.634  134.157 17.341  1.00 14.16 ? 406 LEU A CG  1 
ATOM   3105 C  CD1 . LEU A 1 406 ? 8.087  134.003 16.866  1.00 9.18  ? 406 LEU A CD1 1 
ATOM   3106 C  CD2 . LEU A 1 406 ? 6.568  135.021 18.597  1.00 10.20 ? 406 LEU A CD2 1 
ATOM   3107 N  N   . THR A 1 407 ? 5.090  131.589 15.516  1.00 21.84 ? 407 THR A N   1 
ATOM   3108 C  CA  . THR A 1 407 ? 4.299  130.436 15.917  1.00 21.86 ? 407 THR A CA  1 
ATOM   3109 C  C   . THR A 1 407 ? 4.096  130.507 17.434  1.00 22.29 ? 407 THR A C   1 
ATOM   3110 O  O   . THR A 1 407 ? 4.896  131.125 18.143  1.00 21.13 ? 407 THR A O   1 
ATOM   3111 C  CB  . THR A 1 407 ? 5.035  129.131 15.567  1.00 20.88 ? 407 THR A CB  1 
ATOM   3112 O  OG1 . THR A 1 407 ? 5.217  129.065 14.152  1.00 20.46 ? 407 THR A OG1 1 
ATOM   3113 C  CG2 . THR A 1 407 ? 4.253  127.922 16.038  1.00 20.46 ? 407 THR A CG2 1 
ATOM   3114 N  N   . LYS A 1 408 ? 3.024  129.885 17.922  1.00 22.99 ? 408 LYS A N   1 
ATOM   3115 C  CA  . LYS A 1 408 ? 2.725  129.866 19.352  1.00 22.48 ? 408 LYS A CA  1 
ATOM   3116 C  C   . LYS A 1 408 ? 2.667  128.433 19.869  1.00 23.40 ? 408 LYS A C   1 
ATOM   3117 O  O   . LYS A 1 408 ? 1.890  127.613 19.380  1.00 22.42 ? 408 LYS A O   1 
ATOM   3118 C  CB  . LYS A 1 408 ? 1.389  130.542 19.628  1.00 21.74 ? 408 LYS A CB  1 
ATOM   3119 C  CG  . LYS A 1 408 ? 1.142  130.836 21.094  1.00 23.12 ? 408 LYS A CG  1 
ATOM   3120 C  CD  . LYS A 1 408 ? 1.979  132.021 21.570  1.00 24.93 ? 408 LYS A CD  1 
ATOM   3121 C  CE  . LYS A 1 408 ? 1.778  132.281 23.064  1.00 25.45 ? 408 LYS A CE  1 
ATOM   3122 N  NZ  . LYS A 1 408 ? 2.573  133.447 23.548  1.00 26.27 ? 408 LYS A NZ  1 
ATOM   3123 N  N   . LEU A 1 409 ? 3.497  128.133 20.860  1.00 24.74 ? 409 LEU A N   1 
ATOM   3124 C  CA  . LEU A 1 409 ? 3.530  126.798 21.439  1.00 24.78 ? 409 LEU A CA  1 
ATOM   3125 C  C   . LEU A 1 409 ? 2.175  126.423 22.023  1.00 25.06 ? 409 LEU A C   1 
ATOM   3126 O  O   . LEU A 1 409 ? 1.541  127.229 22.707  1.00 25.68 ? 409 LEU A O   1 
ATOM   3127 C  CB  . LEU A 1 409 ? 4.583  126.720 22.554  1.00 24.45 ? 409 LEU A CB  1 
ATOM   3128 C  CG  . LEU A 1 409 ? 6.066  126.899 22.212  1.00 24.48 ? 409 LEU A CG  1 
ATOM   3129 C  CD1 . LEU A 1 409 ? 6.859  126.943 23.498  1.00 23.70 ? 409 LEU A CD1 1 
ATOM   3130 C  CD2 . LEU A 1 409 ? 6.558  125.759 21.324  1.00 23.63 ? 409 LEU A CD2 1 
ATOM   3131 N  N   . THR A 1 410 ? 1.738  125.198 21.743  1.00 25.10 ? 410 THR A N   1 
ATOM   3132 C  CA  . THR A 1 410 ? 0.483  124.685 22.274  1.00 23.44 ? 410 THR A CA  1 
ATOM   3133 C  C   . THR A 1 410 ? 0.788  124.331 23.721  1.00 25.61 ? 410 THR A C   1 
ATOM   3134 O  O   . THR A 1 410 ? 1.956  124.164 24.083  1.00 25.86 ? 410 THR A O   1 
ATOM   3135 C  CB  . THR A 1 410 ? 0.060  123.400 21.564  1.00 21.89 ? 410 THR A CB  1 
ATOM   3136 O  OG1 . THR A 1 410 ? 1.015  122.372 21.852  1.00 21.63 ? 410 THR A OG1 1 
ATOM   3137 C  CG2 . THR A 1 410 ? -0.004 123.611 20.071  1.00 18.85 ? 410 THR A CG2 1 
ATOM   3138 N  N   . GLU A 1 411 ? -0.243 124.205 24.550  1.00 28.38 ? 411 GLU A N   1 
ATOM   3139 C  CA  . GLU A 1 411 ? -0.023 123.867 25.954  1.00 30.83 ? 411 GLU A CA  1 
ATOM   3140 C  C   . GLU A 1 411 ? 0.747  122.553 26.052  1.00 29.53 ? 411 GLU A C   1 
ATOM   3141 O  O   . GLU A 1 411 ? 1.624  122.394 26.894  1.00 29.87 ? 411 GLU A O   1 
ATOM   3142 C  CB  . GLU A 1 411 ? -1.362 123.755 26.692  1.00 34.21 ? 411 GLU A CB  1 
ATOM   3143 C  CG  . GLU A 1 411 ? -2.295 124.943 26.447  1.00 42.28 ? 411 GLU A CG  1 
ATOM   3144 C  CD  . GLU A 1 411 ? -3.559 124.908 27.305  1.00 47.60 ? 411 GLU A CD  1 
ATOM   3145 O  OE1 . GLU A 1 411 ? -4.160 123.815 27.442  1.00 50.19 ? 411 GLU A OE1 1 
ATOM   3146 O  OE2 . GLU A 1 411 ? -3.958 125.979 27.828  1.00 48.50 ? 411 GLU A OE2 1 
ATOM   3147 N  N   . LYS A 1 412 ? 0.429  121.613 25.173  1.00 28.91 ? 412 LYS A N   1 
ATOM   3148 C  CA  . LYS A 1 412 ? 1.105  120.323 25.181  1.00 28.71 ? 412 LYS A CA  1 
ATOM   3149 C  C   . LYS A 1 412 ? 2.599  120.477 24.860  1.00 27.30 ? 412 LYS A C   1 
ATOM   3150 O  O   . LYS A 1 412 ? 3.445  119.793 25.445  1.00 27.28 ? 412 LYS A O   1 
ATOM   3151 C  CB  . LYS A 1 412 ? 0.435  119.384 24.172  1.00 30.41 ? 412 LYS A CB  1 
ATOM   3152 C  CG  . LYS A 1 412 ? 1.048  117.997 24.097  1.00 33.81 ? 412 LYS A CG  1 
ATOM   3153 C  CD  . LYS A 1 412 ? 0.528  117.230 22.878  1.00 36.45 ? 412 LYS A CD  1 
ATOM   3154 C  CE  . LYS A 1 412 ? 1.227  115.874 22.738  1.00 37.83 ? 412 LYS A CE  1 
ATOM   3155 N  NZ  . LYS A 1 412 ? 0.823  115.134 21.502  1.00 37.06 ? 412 LYS A NZ  1 
ATOM   3156 N  N   . GLN A 1 413 ? 2.922  121.378 23.935  1.00 25.64 ? 413 GLN A N   1 
ATOM   3157 C  CA  . GLN A 1 413 ? 4.312  121.607 23.552  1.00 24.95 ? 413 GLN A CA  1 
ATOM   3158 C  C   . GLN A 1 413 ? 5.093  122.307 24.659  1.00 24.81 ? 413 GLN A C   1 
ATOM   3159 O  O   . GLN A 1 413 ? 6.259  121.994 24.902  1.00 24.40 ? 413 GLN A O   1 
ATOM   3160 C  CB  . GLN A 1 413 ? 4.383  122.442 22.269  1.00 24.85 ? 413 GLN A CB  1 
ATOM   3161 C  CG  . GLN A 1 413 ? 3.821  121.734 21.047  1.00 25.37 ? 413 GLN A CG  1 
ATOM   3162 C  CD  . GLN A 1 413 ? 3.814  122.609 19.804  1.00 24.96 ? 413 GLN A CD  1 
ATOM   3163 O  OE1 . GLN A 1 413 ? 3.312  123.736 19.827  1.00 22.48 ? 413 GLN A OE1 1 
ATOM   3164 N  NE2 . GLN A 1 413 ? 4.361  122.088 18.707  1.00 22.46 ? 413 GLN A NE2 1 
ATOM   3165 N  N   . ALA A 1 414 ? 4.444  123.256 25.326  1.00 24.33 ? 414 ALA A N   1 
ATOM   3166 C  CA  . ALA A 1 414 ? 5.082  123.998 26.404  1.00 23.68 ? 414 ALA A CA  1 
ATOM   3167 C  C   . ALA A 1 414 ? 5.414  123.053 27.556  1.00 24.11 ? 414 ALA A C   1 
ATOM   3168 O  O   . ALA A 1 414 ? 6.508  123.100 28.117  1.00 23.67 ? 414 ALA A O   1 
ATOM   3169 C  CB  . ALA A 1 414 ? 4.164  125.117 26.882  1.00 22.40 ? 414 ALA A CB  1 
ATOM   3170 N  N   . GLN A 1 415 ? 4.467  122.191 27.905  1.00 25.16 ? 415 GLN A N   1 
ATOM   3171 C  CA  . GLN A 1 415 ? 4.689  121.242 28.983  1.00 27.40 ? 415 GLN A CA  1 
ATOM   3172 C  C   . GLN A 1 415 ? 5.838  120.327 28.596  1.00 26.80 ? 415 GLN A C   1 
ATOM   3173 O  O   . GLN A 1 415 ? 6.728  120.060 29.399  1.00 26.22 ? 415 GLN A O   1 
ATOM   3174 C  CB  . GLN A 1 415 ? 3.430  120.423 29.231  1.00 30.72 ? 415 GLN A CB  1 
ATOM   3175 C  CG  . GLN A 1 415 ? 2.239  121.261 29.626  1.00 36.04 ? 415 GLN A CG  1 
ATOM   3176 C  CD  . GLN A 1 415 ? 1.015  120.418 29.906  1.00 39.98 ? 415 GLN A CD  1 
ATOM   3177 O  OE1 . GLN A 1 415 ? -0.046 120.941 30.253  1.00 40.78 ? 415 GLN A OE1 1 
ATOM   3178 N  NE2 . GLN A 1 415 ? 1.155  119.100 29.758  1.00 41.43 ? 415 GLN A NE2 1 
ATOM   3179 N  N   . TYR A 1 416 ? 5.814  119.854 27.354  1.00 26.00 ? 416 TYR A N   1 
ATOM   3180 C  CA  . TYR A 1 416 ? 6.867  118.983 26.860  1.00 25.27 ? 416 TYR A CA  1 
ATOM   3181 C  C   . TYR A 1 416 ? 8.222  119.680 26.979  1.00 25.55 ? 416 TYR A C   1 
ATOM   3182 O  O   . TYR A 1 416 ? 9.196  119.100 27.466  1.00 24.59 ? 416 TYR A O   1 
ATOM   3183 C  CB  . TYR A 1 416 ? 6.619  118.627 25.398  1.00 24.74 ? 416 TYR A CB  1 
ATOM   3184 C  CG  . TYR A 1 416 ? 7.659  117.695 24.831  1.00 24.55 ? 416 TYR A CG  1 
ATOM   3185 C  CD1 . TYR A 1 416 ? 7.581  116.320 25.047  1.00 24.23 ? 416 TYR A CD1 1 
ATOM   3186 C  CD2 . TYR A 1 416 ? 8.745  118.188 24.113  1.00 24.27 ? 416 TYR A CD2 1 
ATOM   3187 C  CE1 . TYR A 1 416 ? 8.559  115.459 24.564  1.00 22.81 ? 416 TYR A CE1 1 
ATOM   3188 C  CE2 . TYR A 1 416 ? 9.734  117.334 23.627  1.00 23.10 ? 416 TYR A CE2 1 
ATOM   3189 C  CZ  . TYR A 1 416 ? 9.633  115.972 23.860  1.00 23.45 ? 416 TYR A CZ  1 
ATOM   3190 O  OH  . TYR A 1 416 ? 10.616 115.123 23.408  1.00 23.94 ? 416 TYR A OH  1 
ATOM   3191 N  N   . LEU A 1 417 ? 8.276  120.933 26.534  1.00 25.08 ? 417 LEU A N   1 
ATOM   3192 C  CA  . LEU A 1 417 ? 9.511  121.705 26.577  1.00 24.25 ? 417 LEU A CA  1 
ATOM   3193 C  C   . LEU A 1 417 ? 9.836  122.221 27.971  1.00 25.30 ? 417 LEU A C   1 
ATOM   3194 O  O   . LEU A 1 417 ? 10.940 122.704 28.224  1.00 25.54 ? 417 LEU A O   1 
ATOM   3195 C  CB  . LEU A 1 417 ? 9.426  122.873 25.597  1.00 22.07 ? 417 LEU A CB  1 
ATOM   3196 C  CG  . LEU A 1 417 ? 9.397  122.456 24.125  1.00 22.13 ? 417 LEU A CG  1 
ATOM   3197 C  CD1 . LEU A 1 417 ? 9.233  123.682 23.256  1.00 19.95 ? 417 LEU A CD1 1 
ATOM   3198 C  CD2 . LEU A 1 417 ? 10.683 121.702 23.773  1.00 17.04 ? 417 LEU A CD2 1 
ATOM   3199 N  N   . GLY A 1 418 ? 8.872  122.115 28.877  1.00 26.48 ? 418 GLY A N   1 
ATOM   3200 C  CA  . GLY A 1 418 ? 9.091  122.582 30.229  1.00 26.50 ? 418 GLY A CA  1 
ATOM   3201 C  C   . GLY A 1 418 ? 9.200  124.091 30.296  1.00 27.58 ? 418 GLY A C   1 
ATOM   3202 O  O   . GLY A 1 418 ? 9.908  124.628 31.143  1.00 28.01 ? 418 GLY A O   1 
ATOM   3203 N  N   . MET A 1 419 ? 8.506  124.781 29.397  1.00 28.38 ? 419 MET A N   1 
ATOM   3204 C  CA  . MET A 1 419 ? 8.531  126.236 29.394  1.00 28.69 ? 419 MET A CA  1 
ATOM   3205 C  C   . MET A 1 419 ? 7.136  126.842 29.252  1.00 29.20 ? 419 MET A C   1 
ATOM   3206 O  O   . MET A 1 419 ? 6.152  126.130 29.044  1.00 29.21 ? 419 MET A O   1 
ATOM   3207 C  CB  . MET A 1 419 ? 9.461  126.757 28.289  1.00 29.07 ? 419 MET A CB  1 
ATOM   3208 C  CG  . MET A 1 419 ? 9.148  126.280 26.891  1.00 28.93 ? 419 MET A CG  1 
ATOM   3209 S  SD  . MET A 1 419 ? 10.286 126.986 25.663  1.00 28.62 ? 419 MET A SD  1 
ATOM   3210 C  CE  . MET A 1 419 ? 11.611 125.761 25.650  1.00 29.91 ? 419 MET A CE  1 
ATOM   3211 N  N   . SER A 1 420 ? 7.061  128.163 29.389  1.00 29.97 ? 420 SER A N   1 
ATOM   3212 C  CA  . SER A 1 420 ? 5.801  128.892 29.289  1.00 29.31 ? 420 SER A CA  1 
ATOM   3213 C  C   . SER A 1 420 ? 5.428  129.227 27.847  1.00 29.88 ? 420 SER A C   1 
ATOM   3214 O  O   . SER A 1 420 ? 6.296  129.406 26.998  1.00 29.44 ? 420 SER A O   1 
ATOM   3215 C  CB  . SER A 1 420 ? 5.900  130.190 30.093  1.00 28.29 ? 420 SER A CB  1 
ATOM   3216 O  OG  . SER A 1 420 ? 4.755  130.999 29.897  1.00 28.73 ? 420 SER A OG  1 
ATOM   3217 N  N   . CYS A 1 421 ? 4.129  129.309 27.578  1.00 30.59 ? 421 CYS A N   1 
ATOM   3218 C  CA  . CYS A 1 421 ? 3.640  129.654 26.247  1.00 30.23 ? 421 CYS A CA  1 
ATOM   3219 C  C   . CYS A 1 421 ? 4.145  131.038 25.889  1.00 28.84 ? 421 CYS A C   1 
ATOM   3220 O  O   . CYS A 1 421 ? 4.263  131.390 24.714  1.00 28.49 ? 421 CYS A O   1 
ATOM   3221 C  CB  . CYS A 1 421 ? 2.111  129.684 26.220  1.00 30.75 ? 421 CYS A CB  1 
ATOM   3222 S  SG  . CYS A 1 421 ? 1.314  128.074 26.085  1.00 41.49 ? 421 CYS A SG  1 
ATOM   3223 N  N   . ASP A 1 422 ? 4.436  131.826 26.915  1.00 27.11 ? 422 ASP A N   1 
ATOM   3224 C  CA  . ASP A 1 422 ? 4.895  133.183 26.705  1.00 25.77 ? 422 ASP A CA  1 
ATOM   3225 C  C   . ASP A 1 422 ? 6.378  133.396 26.993  1.00 24.29 ? 422 ASP A C   1 
ATOM   3226 O  O   . ASP A 1 422 ? 6.855  134.526 27.006  1.00 23.80 ? 422 ASP A O   1 
ATOM   3227 C  CB  . ASP A 1 422 ? 4.043  134.139 27.548  1.00 28.70 ? 422 ASP A CB  1 
ATOM   3228 C  CG  . ASP A 1 422 ? 2.550  134.009 27.250  1.00 28.94 ? 422 ASP A CG  1 
ATOM   3229 O  OD1 . ASP A 1 422 ? 2.185  133.915 26.062  1.00 30.36 ? 422 ASP A OD1 1 
ATOM   3230 O  OD2 . ASP A 1 422 ? 1.738  134.011 28.199  1.00 29.21 ? 422 ASP A OD2 1 
ATOM   3231 N  N   . GLY A 1 423 ? 7.108  132.312 27.217  1.00 23.13 ? 423 GLY A N   1 
ATOM   3232 C  CA  . GLY A 1 423 ? 8.532  132.434 27.478  1.00 22.28 ? 423 GLY A CA  1 
ATOM   3233 C  C   . GLY A 1 423 ? 8.880  132.769 28.912  1.00 21.58 ? 423 GLY A C   1 
ATOM   3234 O  O   . GLY A 1 423 ? 7.993  132.861 29.754  1.00 24.10 ? 423 GLY A O   1 
ATOM   3235 N  N   . PRO A 1 424 ? 10.171 132.970 29.222  1.00 21.56 ? 424 PRO A N   1 
ATOM   3236 C  CA  . PRO A 1 424 ? 11.283 132.895 28.266  1.00 20.40 ? 424 PRO A CA  1 
ATOM   3237 C  C   . PRO A 1 424 ? 11.421 131.528 27.606  1.00 19.72 ? 424 PRO A C   1 
ATOM   3238 O  O   . PRO A 1 424 ? 11.073 130.503 28.191  1.00 21.07 ? 424 PRO A O   1 
ATOM   3239 C  CB  . PRO A 1 424 ? 12.498 133.270 29.116  1.00 19.23 ? 424 PRO A CB  1 
ATOM   3240 C  CG  . PRO A 1 424 ? 12.107 132.805 30.478  1.00 20.05 ? 424 PRO A CG  1 
ATOM   3241 C  CD  . PRO A 1 424 ? 10.671 133.251 30.578  1.00 19.67 ? 424 PRO A CD  1 
ATOM   3242 N  N   . PHE A 1 425 ? 11.939 131.525 26.384  1.00 19.11 ? 425 PHE A N   1 
ATOM   3243 C  CA  . PHE A 1 425 ? 12.101 130.302 25.610  1.00 18.62 ? 425 PHE A CA  1 
ATOM   3244 C  C   . PHE A 1 425 ? 13.516 129.735 25.632  1.00 17.95 ? 425 PHE A C   1 
ATOM   3245 O  O   . PHE A 1 425 ? 13.765 128.635 25.133  1.00 17.50 ? 425 PHE A O   1 
ATOM   3246 C  CB  . PHE A 1 425 ? 11.689 130.576 24.166  1.00 18.12 ? 425 PHE A CB  1 
ATOM   3247 C  CG  . PHE A 1 425 ? 10.309 131.159 24.032  1.00 19.99 ? 425 PHE A CG  1 
ATOM   3248 C  CD1 . PHE A 1 425 ? 9.186  130.387 24.290  1.00 18.16 ? 425 PHE A CD1 1 
ATOM   3249 C  CD2 . PHE A 1 425 ? 10.132 132.482 23.642  1.00 20.43 ? 425 PHE A CD2 1 
ATOM   3250 C  CE1 . PHE A 1 425 ? 7.918  130.916 24.160  1.00 17.27 ? 425 PHE A CE1 1 
ATOM   3251 C  CE2 . PHE A 1 425 ? 8.859  133.018 23.510  1.00 19.77 ? 425 PHE A CE2 1 
ATOM   3252 C  CZ  . PHE A 1 425 ? 7.753  132.232 23.769  1.00 18.41 ? 425 PHE A CZ  1 
ATOM   3253 N  N   . LYS A 1 426 ? 14.440 130.475 26.227  1.00 18.41 ? 426 LYS A N   1 
ATOM   3254 C  CA  . LYS A 1 426 ? 15.832 130.046 26.266  1.00 18.97 ? 426 LYS A CA  1 
ATOM   3255 C  C   . LYS A 1 426 ? 16.459 130.234 27.640  1.00 19.32 ? 426 LYS A C   1 
ATOM   3256 O  O   . LYS A 1 426 ? 16.095 131.150 28.374  1.00 20.87 ? 426 LYS A O   1 
ATOM   3257 C  CB  . LYS A 1 426 ? 16.629 130.850 25.233  1.00 18.43 ? 426 LYS A CB  1 
ATOM   3258 C  CG  . LYS A 1 426 ? 16.069 130.772 23.821  1.00 17.59 ? 426 LYS A CG  1 
ATOM   3259 C  CD  . LYS A 1 426 ? 16.567 129.539 23.109  1.00 18.95 ? 426 LYS A CD  1 
ATOM   3260 C  CE  . LYS A 1 426 ? 15.616 129.127 22.014  1.00 22.30 ? 426 LYS A CE  1 
ATOM   3261 N  NZ  . LYS A 1 426 ? 15.203 130.260 21.160  1.00 24.33 ? 426 LYS A NZ  1 
ATOM   3262 N  N   . PRO A 1 427 ? 17.399 129.354 28.013  1.00 20.10 ? 427 PRO A N   1 
ATOM   3263 C  CA  . PRO A 1 427 ? 18.071 129.463 29.313  1.00 20.06 ? 427 PRO A CA  1 
ATOM   3264 C  C   . PRO A 1 427 ? 19.015 130.670 29.247  1.00 20.26 ? 427 PRO A C   1 
ATOM   3265 O  O   . PRO A 1 427 ? 19.325 131.162 28.164  1.00 18.59 ? 427 PRO A O   1 
ATOM   3266 C  CB  . PRO A 1 427 ? 18.825 128.138 29.424  1.00 20.48 ? 427 PRO A CB  1 
ATOM   3267 C  CG  . PRO A 1 427 ? 19.179 127.841 27.987  1.00 20.70 ? 427 PRO A CG  1 
ATOM   3268 C  CD  . PRO A 1 427 ? 17.876 128.173 27.270  1.00 19.95 ? 427 PRO A CD  1 
ATOM   3269 N  N   . ASP A 1 428 ? 19.482 131.141 30.392  1.00 21.81 ? 428 ASP A N   1 
ATOM   3270 C  CA  . ASP A 1 428 ? 20.355 132.304 30.399  1.00 23.76 ? 428 ASP A CA  1 
ATOM   3271 C  C   . ASP A 1 428 ? 21.630 132.194 29.569  1.00 23.82 ? 428 ASP A C   1 
ATOM   3272 O  O   . ASP A 1 428 ? 22.009 133.152 28.896  1.00 23.98 ? 428 ASP A O   1 
ATOM   3273 C  CB  . ASP A 1 428 ? 20.698 132.692 31.841  1.00 25.78 ? 428 ASP A CB  1 
ATOM   3274 C  CG  . ASP A 1 428 ? 19.497 133.260 32.590  1.00 30.22 ? 428 ASP A CG  1 
ATOM   3275 O  OD1 . ASP A 1 428 ? 18.858 134.205 32.067  1.00 28.12 ? 428 ASP A OD1 1 
ATOM   3276 O  OD2 . ASP A 1 428 ? 19.194 132.763 33.698  1.00 31.66 ? 428 ASP A OD2 1 
ATOM   3277 N  N   . HIS A 1 429 ? 22.283 131.035 29.595  1.00 23.99 ? 429 HIS A N   1 
ATOM   3278 C  CA  . HIS A 1 429 ? 23.531 130.853 28.852  1.00 24.15 ? 429 HIS A CA  1 
ATOM   3279 C  C   . HIS A 1 429 ? 23.389 130.711 27.335  1.00 23.90 ? 429 HIS A C   1 
ATOM   3280 O  O   . HIS A 1 429 ? 24.391 130.686 26.622  1.00 25.02 ? 429 HIS A O   1 
ATOM   3281 C  CB  . HIS A 1 429 ? 24.290 129.642 29.384  1.00 24.75 ? 429 HIS A CB  1 
ATOM   3282 C  CG  . HIS A 1 429 ? 23.554 128.351 29.216  1.00 27.54 ? 429 HIS A CG  1 
ATOM   3283 N  ND1 . HIS A 1 429 ? 22.475 128.001 29.999  1.00 28.91 ? 429 HIS A ND1 1 
ATOM   3284 C  CD2 . HIS A 1 429 ? 23.727 127.335 28.338  1.00 28.90 ? 429 HIS A CD2 1 
ATOM   3285 C  CE1 . HIS A 1 429 ? 22.016 126.824 29.610  1.00 31.11 ? 429 HIS A CE1 1 
ATOM   3286 N  NE2 . HIS A 1 429 ? 22.758 126.398 28.604  1.00 29.93 ? 429 HIS A NE2 1 
ATOM   3287 N  N   . TYR A 1 430 ? 22.157 130.615 26.842  1.00 22.77 ? 430 TYR A N   1 
ATOM   3288 C  CA  . TYR A 1 430 ? 21.922 130.470 25.408  1.00 20.92 ? 430 TYR A CA  1 
ATOM   3289 C  C   . TYR A 1 430 ? 22.572 131.633 24.651  1.00 21.11 ? 430 TYR A C   1 
ATOM   3290 O  O   . TYR A 1 430 ? 22.378 132.797 25.004  1.00 21.10 ? 430 TYR A O   1 
ATOM   3291 C  CB  . TYR A 1 430 ? 20.416 130.429 25.123  1.00 20.48 ? 430 TYR A CB  1 
ATOM   3292 C  CG  . TYR A 1 430 ? 20.076 130.009 23.712  1.00 18.42 ? 430 TYR A CG  1 
ATOM   3293 C  CD1 . TYR A 1 430 ? 20.222 128.687 23.308  1.00 16.23 ? 430 TYR A CD1 1 
ATOM   3294 C  CD2 . TYR A 1 430 ? 19.634 130.938 22.778  1.00 17.32 ? 430 TYR A CD2 1 
ATOM   3295 C  CE1 . TYR A 1 430 ? 19.941 128.302 22.013  1.00 16.74 ? 430 TYR A CE1 1 
ATOM   3296 C  CE2 . TYR A 1 430 ? 19.351 130.566 21.483  1.00 18.02 ? 430 TYR A CE2 1 
ATOM   3297 C  CZ  . TYR A 1 430 ? 19.508 129.245 21.102  1.00 18.36 ? 430 TYR A CZ  1 
ATOM   3298 O  OH  . TYR A 1 430 ? 19.255 128.876 19.802  1.00 16.70 ? 430 TYR A OH  1 
ATOM   3299 N  N   . ARG A 1 431 ? 23.320 131.307 23.598  1.00 19.62 ? 431 ARG A N   1 
ATOM   3300 C  CA  . ARG A 1 431 ? 24.037 132.305 22.817  1.00 18.03 ? 431 ARG A CA  1 
ATOM   3301 C  C   . ARG A 1 431 ? 23.402 132.823 21.532  1.00 18.68 ? 431 ARG A C   1 
ATOM   3302 O  O   . ARG A 1 431 ? 23.853 133.843 21.006  1.00 20.28 ? 431 ARG A O   1 
ATOM   3303 C  CB  . ARG A 1 431 ? 25.433 131.783 22.474  1.00 18.43 ? 431 ARG A CB  1 
ATOM   3304 C  CG  . ARG A 1 431 ? 26.272 131.388 23.665  1.00 18.82 ? 431 ARG A CG  1 
ATOM   3305 C  CD  . ARG A 1 431 ? 27.716 131.152 23.253  1.00 21.47 ? 431 ARG A CD  1 
ATOM   3306 N  NE  . ARG A 1 431 ? 28.533 130.751 24.393  1.00 26.89 ? 431 ARG A NE  1 
ATOM   3307 C  CZ  . ARG A 1 431 ? 28.491 129.547 24.959  1.00 27.96 ? 431 ARG A CZ  1 
ATOM   3308 N  NH1 . ARG A 1 431 ? 27.675 128.615 24.481  1.00 27.48 ? 431 ARG A NH1 1 
ATOM   3309 N  NH2 . ARG A 1 431 ? 29.249 129.287 26.020  1.00 27.12 ? 431 ARG A NH2 1 
ATOM   3310 N  N   . TYR A 1 432 ? 22.386 132.135 21.011  1.00 17.56 ? 432 TYR A N   1 
ATOM   3311 C  CA  . TYR A 1 432 ? 21.728 132.565 19.767  1.00 16.40 ? 432 TYR A CA  1 
ATOM   3312 C  C   . TYR A 1 432 ? 22.696 132.557 18.582  1.00 15.70 ? 432 TYR A C   1 
ATOM   3313 O  O   . TYR A 1 432 ? 23.742 131.886 18.694  1.00 14.70 ? 432 TYR A O   1 
ATOM   3314 C  CB  . TYR A 1 432 ? 21.131 133.977 19.906  1.00 16.29 ? 432 TYR A CB  1 
ATOM   3315 C  CG  . TYR A 1 432 ? 20.101 134.109 20.997  1.00 15.83 ? 432 TYR A CG  1 
ATOM   3316 C  CD1 . TYR A 1 432 ? 20.478 134.370 22.307  1.00 17.16 ? 432 TYR A CD1 1 
ATOM   3317 C  CD2 . TYR A 1 432 ? 18.755 133.926 20.727  1.00 16.54 ? 432 TYR A CD2 1 
ATOM   3318 C  CE1 . TYR A 1 432 ? 19.539 134.444 23.317  1.00 18.69 ? 432 TYR A CE1 1 
ATOM   3319 C  CE2 . TYR A 1 432 ? 17.805 133.997 21.729  1.00 17.38 ? 432 TYR A CE2 1 
ATOM   3320 C  CZ  . TYR A 1 432 ? 18.201 134.258 23.021  1.00 18.73 ? 432 TYR A CZ  1 
ATOM   3321 O  OH  . TYR A 1 432 ? 17.259 134.358 24.017  1.00 19.74 ? 432 TYR A OH  1 
ATOM   3322 O  OXT . TYR A 1 432 ? 22.390 133.212 17.555  1.00 14.99 ? 432 TYR A OXT 1 
ATOM   3323 N  N   . LYS B 1 4   ? 37.240 87.208  32.462  1.00 33.54 ? 4   LYS B N   1 
ATOM   3324 C  CA  . LYS B 1 4   ? 36.637 88.407  31.819  1.00 33.19 ? 4   LYS B CA  1 
ATOM   3325 C  C   . LYS B 1 4   ? 37.217 88.608  30.424  1.00 33.54 ? 4   LYS B C   1 
ATOM   3326 O  O   . LYS B 1 4   ? 38.435 88.587  30.242  1.00 34.63 ? 4   LYS B O   1 
ATOM   3327 C  CB  . LYS B 1 4   ? 36.908 89.651  32.667  1.00 32.95 ? 4   LYS B CB  1 
ATOM   3328 C  CG  . LYS B 1 4   ? 36.412 90.938  32.028  1.00 34.60 ? 4   LYS B CG  1 
ATOM   3329 C  CD  . LYS B 1 4   ? 36.787 92.148  32.863  1.00 35.46 ? 4   LYS B CD  1 
ATOM   3330 C  CE  . LYS B 1 4   ? 36.202 93.415  32.275  1.00 35.31 ? 4   LYS B CE  1 
ATOM   3331 N  NZ  . LYS B 1 4   ? 36.633 94.610  33.050  1.00 37.02 ? 4   LYS B NZ  1 
ATOM   3332 N  N   . LEU B 1 5   ? 36.349 88.800  29.436  1.00 33.08 ? 5   LEU B N   1 
ATOM   3333 C  CA  . LEU B 1 5   ? 36.808 88.997  28.064  1.00 32.55 ? 5   LEU B CA  1 
ATOM   3334 C  C   . LEU B 1 5   ? 37.642 90.274  27.971  1.00 31.93 ? 5   LEU B C   1 
ATOM   3335 O  O   . LEU B 1 5   ? 37.300 91.298  28.567  1.00 30.98 ? 5   LEU B O   1 
ATOM   3336 C  CB  . LEU B 1 5   ? 35.608 89.071  27.111  1.00 32.02 ? 5   LEU B CB  1 
ATOM   3337 C  CG  . LEU B 1 5   ? 34.750 87.802  27.005  1.00 31.93 ? 5   LEU B CG  1 
ATOM   3338 C  CD1 . LEU B 1 5   ? 33.520 88.060  26.142  1.00 31.57 ? 5   LEU B CD1 1 
ATOM   3339 C  CD2 . LEU B 1 5   ? 35.592 86.681  26.404  1.00 33.79 ? 5   LEU B CD2 1 
ATOM   3340 N  N   . PRO B 1 6   ? 38.767 90.221  27.240  1.00 31.78 ? 6   PRO B N   1 
ATOM   3341 C  CA  . PRO B 1 6   ? 39.629 91.402  27.094  1.00 31.23 ? 6   PRO B CA  1 
ATOM   3342 C  C   . PRO B 1 6   ? 38.928 92.480  26.270  1.00 30.49 ? 6   PRO B C   1 
ATOM   3343 O  O   . PRO B 1 6   ? 39.369 93.633  26.220  1.00 31.87 ? 6   PRO B O   1 
ATOM   3344 C  CB  . PRO B 1 6   ? 40.874 90.836  26.409  1.00 29.61 ? 6   PRO B CB  1 
ATOM   3345 C  CG  . PRO B 1 6   ? 40.317 89.726  25.576  1.00 30.32 ? 6   PRO B CG  1 
ATOM   3346 C  CD  . PRO B 1 6   ? 39.316 89.067  26.504  1.00 30.03 ? 6   PRO B CD  1 
ATOM   3347 N  N   . TYR B 1 7   ? 37.826 92.084  25.640  1.00 28.60 ? 7   TYR B N   1 
ATOM   3348 C  CA  . TYR B 1 7   ? 37.018 92.971  24.820  1.00 28.33 ? 7   TYR B CA  1 
ATOM   3349 C  C   . TYR B 1 7   ? 35.969 92.110  24.134  1.00 27.48 ? 7   TYR B C   1 
ATOM   3350 O  O   . TYR B 1 7   ? 35.956 90.896  24.302  1.00 28.17 ? 7   TYR B O   1 
ATOM   3351 C  CB  . TYR B 1 7   ? 37.887 93.671  23.769  1.00 28.74 ? 7   TYR B CB  1 
ATOM   3352 C  CG  . TYR B 1 7   ? 38.529 92.721  22.784  1.00 30.31 ? 7   TYR B CG  1 
ATOM   3353 C  CD1 . TYR B 1 7   ? 37.787 92.151  21.749  1.00 29.68 ? 7   TYR B CD1 1 
ATOM   3354 C  CD2 . TYR B 1 7   ? 39.869 92.355  22.911  1.00 30.52 ? 7   TYR B CD2 1 
ATOM   3355 C  CE1 . TYR B 1 7   ? 38.356 91.243  20.873  1.00 28.83 ? 7   TYR B CE1 1 
ATOM   3356 C  CE2 . TYR B 1 7   ? 40.449 91.446  22.037  1.00 29.71 ? 7   TYR B CE2 1 
ATOM   3357 C  CZ  . TYR B 1 7   ? 39.687 90.892  21.023  1.00 30.94 ? 7   TYR B CZ  1 
ATOM   3358 O  OH  . TYR B 1 7   ? 40.253 89.973  20.165  1.00 32.87 ? 7   TYR B OH  1 
ATOM   3359 N  N   . LYS B 1 8   ? 35.085 92.736  23.370  1.00 27.06 ? 8   LYS B N   1 
ATOM   3360 C  CA  . LYS B 1 8   ? 34.061 92.001  22.640  1.00 27.34 ? 8   LYS B CA  1 
ATOM   3361 C  C   . LYS B 1 8   ? 33.586 92.886  21.504  1.00 27.24 ? 8   LYS B C   1 
ATOM   3362 O  O   . LYS B 1 8   ? 32.934 93.903  21.725  1.00 28.03 ? 8   LYS B O   1 
ATOM   3363 C  CB  . LYS B 1 8   ? 32.878 91.636  23.546  1.00 27.51 ? 8   LYS B CB  1 
ATOM   3364 C  CG  . LYS B 1 8   ? 32.044 90.465  23.029  1.00 26.08 ? 8   LYS B CG  1 
ATOM   3365 C  CD  . LYS B 1 8   ? 30.792 90.256  23.881  1.00 28.80 ? 8   LYS B CD  1 
ATOM   3366 C  CE  . LYS B 1 8   ? 30.119 88.902  23.624  1.00 27.91 ? 8   LYS B CE  1 
ATOM   3367 N  NZ  . LYS B 1 8   ? 29.725 88.687  22.202  1.00 27.07 ? 8   LYS B NZ  1 
ATOM   3368 N  N   . VAL B 1 9   ? 33.938 92.503  20.286  1.00 27.11 ? 9   VAL B N   1 
ATOM   3369 C  CA  . VAL B 1 9   ? 33.547 93.260  19.109  1.00 27.75 ? 9   VAL B CA  1 
ATOM   3370 C  C   . VAL B 1 9   ? 33.007 92.284  18.061  1.00 28.34 ? 9   VAL B C   1 
ATOM   3371 O  O   . VAL B 1 9   ? 33.283 91.084  18.123  1.00 29.00 ? 9   VAL B O   1 
ATOM   3372 C  CB  . VAL B 1 9   ? 34.757 94.047  18.520  1.00 26.94 ? 9   VAL B CB  1 
ATOM   3373 C  CG1 . VAL B 1 9   ? 35.427 94.872  19.617  1.00 26.39 ? 9   VAL B CG1 1 
ATOM   3374 C  CG2 . VAL B 1 9   ? 35.754 93.094  17.886  1.00 24.54 ? 9   VAL B CG2 1 
ATOM   3375 N  N   . ALA B 1 10  ? 32.230 92.795  17.111  1.00 27.34 ? 10  ALA B N   1 
ATOM   3376 C  CA  . ALA B 1 10  ? 31.670 91.953  16.066  1.00 27.16 ? 10  ALA B CA  1 
ATOM   3377 C  C   . ALA B 1 10  ? 32.730 91.014  15.484  1.00 27.67 ? 10  ALA B C   1 
ATOM   3378 O  O   . ALA B 1 10  ? 32.749 89.821  15.780  1.00 28.06 ? 10  ALA B O   1 
ATOM   3379 C  CB  . ALA B 1 10  ? 31.078 92.820  14.964  1.00 26.49 ? 10  ALA B CB  1 
ATOM   3380 N  N   . ASP B 1 11  ? 33.620 91.560  14.667  1.00 27.85 ? 11  ASP B N   1 
ATOM   3381 C  CA  . ASP B 1 11  ? 34.658 90.763  14.035  1.00 27.55 ? 11  ASP B CA  1 
ATOM   3382 C  C   . ASP B 1 11  ? 35.999 91.481  14.103  1.00 28.55 ? 11  ASP B C   1 
ATOM   3383 O  O   . ASP B 1 11  ? 36.249 92.418  13.347  1.00 30.00 ? 11  ASP B O   1 
ATOM   3384 C  CB  . ASP B 1 11  ? 34.252 90.481  12.581  1.00 27.37 ? 11  ASP B CB  1 
ATOM   3385 C  CG  . ASP B 1 11  ? 35.383 89.923  11.752  1.00 27.27 ? 11  ASP B CG  1 
ATOM   3386 O  OD1 . ASP B 1 11  ? 36.311 89.321  12.330  1.00 27.63 ? 11  ASP B OD1 1 
ATOM   3387 O  OD2 . ASP B 1 11  ? 35.334 90.076  10.513  1.00 27.38 ? 11  ASP B OD2 1 
ATOM   3388 N  N   . ILE B 1 12  ? 36.854 91.029  15.018  1.00 29.49 ? 12  ILE B N   1 
ATOM   3389 C  CA  . ILE B 1 12  ? 38.181 91.612  15.225  1.00 28.30 ? 12  ILE B CA  1 
ATOM   3390 C  C   . ILE B 1 12  ? 38.998 91.702  13.936  1.00 27.60 ? 12  ILE B C   1 
ATOM   3391 O  O   . ILE B 1 12  ? 39.990 92.424  13.872  1.00 27.47 ? 12  ILE B O   1 
ATOM   3392 C  CB  . ILE B 1 12  ? 38.991 90.789  16.264  1.00 30.02 ? 12  ILE B CB  1 
ATOM   3393 C  CG1 . ILE B 1 12  ? 40.260 91.545  16.663  1.00 30.24 ? 12  ILE B CG1 1 
ATOM   3394 C  CG2 . ILE B 1 12  ? 39.371 89.435  15.680  1.00 29.82 ? 12  ILE B CG2 1 
ATOM   3395 C  CD1 . ILE B 1 12  ? 39.991 92.788  17.478  1.00 31.18 ? 12  ILE B CD1 1 
ATOM   3396 N  N   . GLY B 1 13  ? 38.578 90.965  12.915  1.00 26.94 ? 13  GLY B N   1 
ATOM   3397 C  CA  . GLY B 1 13  ? 39.290 90.976  11.651  1.00 27.60 ? 13  GLY B CA  1 
ATOM   3398 C  C   . GLY B 1 13  ? 39.040 92.212  10.805  1.00 28.24 ? 13  GLY B C   1 
ATOM   3399 O  O   . GLY B 1 13  ? 39.523 92.314  9.671   1.00 27.82 ? 13  GLY B O   1 
ATOM   3400 N  N   . LEU B 1 14  ? 38.278 93.154  11.349  1.00 27.93 ? 14  LEU B N   1 
ATOM   3401 C  CA  . LEU B 1 14  ? 37.979 94.388  10.637  1.00 27.31 ? 14  LEU B CA  1 
ATOM   3402 C  C   . LEU B 1 14  ? 38.930 95.488  11.108  1.00 26.84 ? 14  LEU B C   1 
ATOM   3403 O  O   . LEU B 1 14  ? 38.811 96.642  10.693  1.00 27.46 ? 14  LEU B O   1 
ATOM   3404 C  CB  . LEU B 1 14  ? 36.527 94.804  10.887  1.00 26.36 ? 14  LEU B CB  1 
ATOM   3405 C  CG  . LEU B 1 14  ? 35.447 93.814  10.439  1.00 26.66 ? 14  LEU B CG  1 
ATOM   3406 C  CD1 . LEU B 1 14  ? 34.077 94.345  10.836  1.00 25.78 ? 14  LEU B CD1 1 
ATOM   3407 C  CD2 . LEU B 1 14  ? 35.523 93.596  8.928   1.00 25.54 ? 14  LEU B CD2 1 
ATOM   3408 N  N   . ALA B 1 15  ? 39.881 95.113  11.963  1.00 25.30 ? 15  ALA B N   1 
ATOM   3409 C  CA  . ALA B 1 15  ? 40.856 96.056  12.512  1.00 24.62 ? 15  ALA B CA  1 
ATOM   3410 C  C   . ALA B 1 15  ? 41.663 96.841  11.476  1.00 24.35 ? 15  ALA B C   1 
ATOM   3411 O  O   . ALA B 1 15  ? 41.813 98.051  11.605  1.00 26.40 ? 15  ALA B O   1 
ATOM   3412 C  CB  . ALA B 1 15  ? 41.800 95.330  13.461  1.00 21.68 ? 15  ALA B CB  1 
ATOM   3413 N  N   . ALA B 1 16  ? 42.194 96.166  10.461  1.00 23.91 ? 16  ALA B N   1 
ATOM   3414 C  CA  . ALA B 1 16  ? 42.977 96.850  9.434   1.00 23.74 ? 16  ALA B CA  1 
ATOM   3415 C  C   . ALA B 1 16  ? 42.128 97.940  8.786   1.00 25.21 ? 16  ALA B C   1 
ATOM   3416 O  O   . ALA B 1 16  ? 42.576 99.075  8.609   1.00 25.43 ? 16  ALA B O   1 
ATOM   3417 C  CB  . ALA B 1 16  ? 43.448 95.860  8.383   1.00 21.34 ? 16  ALA B CB  1 
ATOM   3418 N  N   . TRP B 1 17  ? 40.895 97.582  8.437   1.00 26.06 ? 17  TRP B N   1 
ATOM   3419 C  CA  . TRP B 1 17  ? 39.961 98.513  7.820   1.00 25.48 ? 17  TRP B CA  1 
ATOM   3420 C  C   . TRP B 1 17  ? 39.745 99.689  8.775   1.00 26.18 ? 17  TRP B C   1 
ATOM   3421 O  O   . TRP B 1 17  ? 39.868 100.859 8.382   1.00 25.40 ? 17  TRP B O   1 
ATOM   3422 C  CB  . TRP B 1 17  ? 38.644 97.787  7.528   1.00 27.04 ? 17  TRP B CB  1 
ATOM   3423 C  CG  . TRP B 1 17  ? 37.593 98.627  6.864   1.00 29.71 ? 17  TRP B CG  1 
ATOM   3424 C  CD1 . TRP B 1 17  ? 37.780 99.789  6.179   1.00 30.58 ? 17  TRP B CD1 1 
ATOM   3425 C  CD2 . TRP B 1 17  ? 36.189 98.342  6.795   1.00 30.33 ? 17  TRP B CD2 1 
ATOM   3426 N  NE1 . TRP B 1 17  ? 36.580 100.248 5.686   1.00 30.92 ? 17  TRP B NE1 1 
ATOM   3427 C  CE2 . TRP B 1 17  ? 35.589 99.378  6.048   1.00 30.68 ? 17  TRP B CE2 1 
ATOM   3428 C  CE3 . TRP B 1 17  ? 35.383 97.312  7.291   1.00 31.52 ? 17  TRP B CE3 1 
ATOM   3429 C  CZ2 . TRP B 1 17  ? 34.221 99.415  5.784   1.00 31.68 ? 17  TRP B CZ2 1 
ATOM   3430 C  CZ3 . TRP B 1 17  ? 34.017 97.350  7.028   1.00 31.58 ? 17  TRP B CZ3 1 
ATOM   3431 C  CH2 . TRP B 1 17  ? 33.453 98.395  6.281   1.00 32.07 ? 17  TRP B CH2 1 
ATOM   3432 N  N   . GLY B 1 18  ? 39.435 99.367  10.033  1.00 25.48 ? 18  GLY B N   1 
ATOM   3433 C  CA  . GLY B 1 18  ? 39.223 100.391 11.039  1.00 24.37 ? 18  GLY B CA  1 
ATOM   3434 C  C   . GLY B 1 18  ? 40.449 101.277 11.186  1.00 24.68 ? 18  GLY B C   1 
ATOM   3435 O  O   . GLY B 1 18  ? 40.344 102.508 11.251  1.00 24.87 ? 18  GLY B O   1 
ATOM   3436 N  N   . ARG B 1 19  ? 41.622 100.653 11.235  1.00 23.55 ? 19  ARG B N   1 
ATOM   3437 C  CA  . ARG B 1 19  ? 42.868 101.394 11.365  1.00 22.30 ? 19  ARG B CA  1 
ATOM   3438 C  C   . ARG B 1 19  ? 43.026 102.356 10.182  1.00 22.53 ? 19  ARG B C   1 
ATOM   3439 O  O   . ARG B 1 19  ? 43.479 103.488 10.342  1.00 23.04 ? 19  ARG B O   1 
ATOM   3440 C  CB  . ARG B 1 19  ? 44.048 100.419 11.434  1.00 18.74 ? 19  ARG B CB  1 
ATOM   3441 C  CG  . ARG B 1 19  ? 45.407 101.077 11.575  1.00 16.88 ? 19  ARG B CG  1 
ATOM   3442 C  CD  . ARG B 1 19  ? 45.440 102.124 12.684  1.00 19.19 ? 19  ARG B CD  1 
ATOM   3443 N  NE  . ARG B 1 19  ? 45.040 101.595 13.989  1.00 18.49 ? 19  ARG B NE  1 
ATOM   3444 C  CZ  . ARG B 1 19  ? 44.964 102.321 15.105  1.00 17.37 ? 19  ARG B CZ  1 
ATOM   3445 N  NH1 . ARG B 1 19  ? 45.261 103.613 15.090  1.00 18.94 ? 19  ARG B NH1 1 
ATOM   3446 N  NH2 . ARG B 1 19  ? 44.588 101.754 16.240  1.00 14.09 ? 19  ARG B NH2 1 
ATOM   3447 N  N   . LYS B 1 20  ? 42.639 101.906 8.995   1.00 22.64 ? 20  LYS B N   1 
ATOM   3448 C  CA  . LYS B 1 20  ? 42.736 102.750 7.818   1.00 22.69 ? 20  LYS B CA  1 
ATOM   3449 C  C   . LYS B 1 20  ? 41.828 103.969 7.960   1.00 23.92 ? 20  LYS B C   1 
ATOM   3450 O  O   . LYS B 1 20  ? 42.223 105.086 7.637   1.00 23.46 ? 20  LYS B O   1 
ATOM   3451 C  CB  . LYS B 1 20  ? 42.349 101.968 6.564   1.00 21.21 ? 20  LYS B CB  1 
ATOM   3452 C  CG  . LYS B 1 20  ? 42.127 102.862 5.358   1.00 20.14 ? 20  LYS B CG  1 
ATOM   3453 C  CD  . LYS B 1 20  ? 41.925 102.065 4.088   1.00 19.09 ? 20  LYS B CD  1 
ATOM   3454 C  CE  . LYS B 1 20  ? 40.745 101.124 4.199   1.00 18.35 ? 20  LYS B CE  1 
ATOM   3455 N  NZ  . LYS B 1 20  ? 40.599 100.369 2.926   1.00 20.92 ? 20  LYS B NZ  1 
ATOM   3456 N  N   . ALA B 1 21  ? 40.611 103.743 8.449   1.00 24.44 ? 21  ALA B N   1 
ATOM   3457 C  CA  . ALA B 1 21  ? 39.643 104.819 8.632   1.00 24.31 ? 21  ALA B CA  1 
ATOM   3458 C  C   . ALA B 1 21  ? 40.114 105.818 9.688   1.00 24.91 ? 21  ALA B C   1 
ATOM   3459 O  O   . ALA B 1 21  ? 39.909 107.025 9.543   1.00 26.13 ? 21  ALA B O   1 
ATOM   3460 C  CB  . ALA B 1 21  ? 38.280 104.245 9.019   1.00 22.00 ? 21  ALA B CB  1 
ATOM   3461 N  N   . LEU B 1 22  ? 40.737 105.321 10.751  1.00 23.60 ? 22  LEU B N   1 
ATOM   3462 C  CA  . LEU B 1 22  ? 41.227 106.200 11.799  1.00 24.16 ? 22  LEU B CA  1 
ATOM   3463 C  C   . LEU B 1 22  ? 42.348 107.087 11.267  1.00 24.94 ? 22  LEU B C   1 
ATOM   3464 O  O   . LEU B 1 22  ? 42.387 108.286 11.544  1.00 23.88 ? 22  LEU B O   1 
ATOM   3465 C  CB  . LEU B 1 22  ? 41.760 105.395 12.985  1.00 27.00 ? 22  LEU B CB  1 
ATOM   3466 C  CG  . LEU B 1 22  ? 40.889 104.304 13.609  1.00 29.61 ? 22  LEU B CG  1 
ATOM   3467 C  CD1 . LEU B 1 22  ? 41.408 104.028 15.016  1.00 29.71 ? 22  LEU B CD1 1 
ATOM   3468 C  CD2 . LEU B 1 22  ? 39.437 104.722 13.652  1.00 28.45 ? 22  LEU B CD2 1 
ATOM   3469 N  N   . ASP B 1 23  ? 43.263 106.492 10.505  1.00 25.87 ? 23  ASP B N   1 
ATOM   3470 C  CA  . ASP B 1 23  ? 44.384 107.237 9.947   1.00 25.08 ? 23  ASP B CA  1 
ATOM   3471 C  C   . ASP B 1 23  ? 43.863 108.419 9.148   1.00 24.06 ? 23  ASP B C   1 
ATOM   3472 O  O   . ASP B 1 23  ? 44.381 109.530 9.238   1.00 26.17 ? 23  ASP B O   1 
ATOM   3473 C  CB  . ASP B 1 23  ? 45.231 106.350 9.036   1.00 25.31 ? 23  ASP B CB  1 
ATOM   3474 C  CG  . ASP B 1 23  ? 46.536 107.020 8.628   1.00 29.07 ? 23  ASP B CG  1 
ATOM   3475 O  OD1 . ASP B 1 23  ? 47.460 107.074 9.471   1.00 29.24 ? 23  ASP B OD1 1 
ATOM   3476 O  OD2 . ASP B 1 23  ? 46.634 107.510 7.478   1.00 28.92 ? 23  ASP B OD2 1 
ATOM   3477 N  N   . ILE B 1 24  ? 42.831 108.172 8.359   1.00 21.49 ? 24  ILE B N   1 
ATOM   3478 C  CA  . ILE B 1 24  ? 42.245 109.218 7.549   1.00 19.62 ? 24  ILE B CA  1 
ATOM   3479 C  C   . ILE B 1 24  ? 41.561 110.229 8.463   1.00 20.41 ? 24  ILE B C   1 
ATOM   3480 O  O   . ILE B 1 24  ? 41.691 111.440 8.280   1.00 21.31 ? 24  ILE B O   1 
ATOM   3481 C  CB  . ILE B 1 24  ? 41.227 108.621 6.557   1.00 16.74 ? 24  ILE B CB  1 
ATOM   3482 C  CG1 . ILE B 1 24  ? 41.958 107.699 5.576   1.00 15.60 ? 24  ILE B CG1 1 
ATOM   3483 C  CG2 . ILE B 1 24  ? 40.486 109.724 5.834   1.00 12.37 ? 24  ILE B CG2 1 
ATOM   3484 C  CD1 . ILE B 1 24  ? 41.050 106.964 4.613   1.00 15.69 ? 24  ILE B CD1 1 
ATOM   3485 N  N   . ALA B 1 25  ? 40.854 109.724 9.466   1.00 19.98 ? 25  ALA B N   1 
ATOM   3486 C  CA  . ALA B 1 25  ? 40.142 110.581 10.397  1.00 19.72 ? 25  ALA B CA  1 
ATOM   3487 C  C   . ALA B 1 25  ? 41.075 111.515 11.159  1.00 21.02 ? 25  ALA B C   1 
ATOM   3488 O  O   . ALA B 1 25  ? 40.755 112.688 11.355  1.00 21.74 ? 25  ALA B O   1 
ATOM   3489 C  CB  . ALA B 1 25  ? 39.338 109.732 11.370  1.00 18.17 ? 25  ALA B CB  1 
ATOM   3490 N  N   . GLU B 1 26  ? 42.229 111.003 11.580  1.00 22.10 ? 26  GLU B N   1 
ATOM   3491 C  CA  . GLU B 1 26  ? 43.185 111.815 12.333  1.00 21.32 ? 26  GLU B CA  1 
ATOM   3492 C  C   . GLU B 1 26  ? 43.483 113.148 11.660  1.00 21.30 ? 26  GLU B C   1 
ATOM   3493 O  O   . GLU B 1 26  ? 43.527 114.179 12.322  1.00 22.91 ? 26  GLU B O   1 
ATOM   3494 C  CB  . GLU B 1 26  ? 44.497 111.059 12.548  1.00 22.60 ? 26  GLU B CB  1 
ATOM   3495 C  CG  . GLU B 1 26  ? 44.344 109.707 13.222  1.00 23.92 ? 26  GLU B CG  1 
ATOM   3496 C  CD  . GLU B 1 26  ? 45.664 109.132 13.690  1.00 23.26 ? 26  GLU B CD  1 
ATOM   3497 O  OE1 . GLU B 1 26  ? 46.675 109.268 12.962  1.00 21.65 ? 26  GLU B OE1 1 
ATOM   3498 O  OE2 . GLU B 1 26  ? 45.684 108.533 14.785  1.00 25.13 ? 26  GLU B OE2 1 
ATOM   3499 N  N   . ASN B 1 27  ? 43.693 113.139 10.349  1.00 20.74 ? 27  ASN B N   1 
ATOM   3500 C  CA  . ASN B 1 27  ? 43.973 114.385 9.652   1.00 20.78 ? 27  ASN B CA  1 
ATOM   3501 C  C   . ASN B 1 27  ? 42.810 115.368 9.711   1.00 22.05 ? 27  ASN B C   1 
ATOM   3502 O  O   . ASN B 1 27  ? 42.990 116.562 9.473   1.00 22.61 ? 27  ASN B O   1 
ATOM   3503 C  CB  . ASN B 1 27  ? 44.344 114.126 8.197   1.00 20.02 ? 27  ASN B CB  1 
ATOM   3504 C  CG  . ASN B 1 27  ? 45.835 113.999 8.004   1.00 20.80 ? 27  ASN B CG  1 
ATOM   3505 O  OD1 . ASN B 1 27  ? 46.615 114.563 8.772   1.00 19.50 ? 27  ASN B OD1 1 
ATOM   3506 N  ND2 . ASN B 1 27  ? 46.243 113.276 6.969   1.00 21.06 ? 27  ASN B ND2 1 
ATOM   3507 N  N   . GLU B 1 28  ? 41.620 114.868 10.028  1.00 22.29 ? 28  GLU B N   1 
ATOM   3508 C  CA  . GLU B 1 28  ? 40.442 115.720 10.123  1.00 21.29 ? 28  GLU B CA  1 
ATOM   3509 C  C   . GLU B 1 28  ? 40.098 116.033 11.572  1.00 20.35 ? 28  GLU B C   1 
ATOM   3510 O  O   . GLU B 1 28  ? 39.109 116.705 11.851  1.00 18.99 ? 28  GLU B O   1 
ATOM   3511 C  CB  . GLU B 1 28  ? 39.250 115.062 9.430   1.00 21.69 ? 28  GLU B CB  1 
ATOM   3512 C  CG  . GLU B 1 28  ? 39.326 115.125 7.913   1.00 25.02 ? 28  GLU B CG  1 
ATOM   3513 C  CD  . GLU B 1 28  ? 39.331 116.555 7.387   1.00 26.19 ? 28  GLU B CD  1 
ATOM   3514 O  OE1 . GLU B 1 28  ? 38.327 117.270 7.596   1.00 26.51 ? 28  GLU B OE1 1 
ATOM   3515 O  OE2 . GLU B 1 28  ? 40.338 116.964 6.769   1.00 27.09 ? 28  GLU B OE2 1 
ATOM   3516 N  N   . MET B 1 29  ? 40.925 115.549 12.493  1.00 19.66 ? 29  MET B N   1 
ATOM   3517 C  CA  . MET B 1 29  ? 40.697 115.800 13.913  1.00 21.06 ? 29  MET B CA  1 
ATOM   3518 C  C   . MET B 1 29  ? 41.969 116.350 14.554  1.00 21.15 ? 29  MET B C   1 
ATOM   3519 O  O   . MET B 1 29  ? 42.544 115.740 15.454  1.00 22.25 ? 29  MET B O   1 
ATOM   3520 C  CB  . MET B 1 29  ? 40.248 114.507 14.612  1.00 21.39 ? 29  MET B CB  1 
ATOM   3521 C  CG  . MET B 1 29  ? 38.971 113.908 14.008  1.00 20.94 ? 29  MET B CG  1 
ATOM   3522 S  SD  . MET B 1 29  ? 38.368 112.423 14.827  1.00 21.70 ? 29  MET B SD  1 
ATOM   3523 C  CE  . MET B 1 29  ? 37.497 113.157 16.192  1.00 17.87 ? 29  MET B CE  1 
ATOM   3524 N  N   . PRO B 1 30  ? 42.414 117.530 14.096  1.00 21.13 ? 30  PRO B N   1 
ATOM   3525 C  CA  . PRO B 1 30  ? 43.616 118.205 14.587  1.00 19.65 ? 30  PRO B CA  1 
ATOM   3526 C  C   . PRO B 1 30  ? 43.571 118.510 16.080  1.00 20.09 ? 30  PRO B C   1 
ATOM   3527 O  O   . PRO B 1 30  ? 44.592 118.447 16.769  1.00 19.95 ? 30  PRO B O   1 
ATOM   3528 C  CB  . PRO B 1 30  ? 43.665 119.467 13.733  1.00 20.84 ? 30  PRO B CB  1 
ATOM   3529 C  CG  . PRO B 1 30  ? 42.227 119.766 13.497  1.00 20.52 ? 30  PRO B CG  1 
ATOM   3530 C  CD  . PRO B 1 30  ? 41.680 118.402 13.160  1.00 21.78 ? 30  PRO B CD  1 
ATOM   3531 N  N   . GLY B 1 31  ? 42.386 118.848 16.575  1.00 19.41 ? 31  GLY B N   1 
ATOM   3532 C  CA  . GLY B 1 31  ? 42.245 119.149 17.983  1.00 18.94 ? 31  GLY B CA  1 
ATOM   3533 C  C   . GLY B 1 31  ? 42.796 118.019 18.827  1.00 20.51 ? 31  GLY B C   1 
ATOM   3534 O  O   . GLY B 1 31  ? 43.579 118.247 19.751  1.00 20.02 ? 31  GLY B O   1 
ATOM   3535 N  N   . LEU B 1 32  ? 42.395 116.793 18.506  1.00 20.74 ? 32  LEU B N   1 
ATOM   3536 C  CA  . LEU B 1 32  ? 42.854 115.627 19.251  1.00 21.36 ? 32  LEU B CA  1 
ATOM   3537 C  C   . LEU B 1 32  ? 44.336 115.342 18.989  1.00 22.86 ? 32  LEU B C   1 
ATOM   3538 O  O   . LEU B 1 32  ? 45.083 114.994 19.903  1.00 21.73 ? 32  LEU B O   1 
ATOM   3539 C  CB  . LEU B 1 32  ? 42.005 114.401 18.885  1.00 19.75 ? 32  LEU B CB  1 
ATOM   3540 C  CG  . LEU B 1 32  ? 40.529 114.389 19.308  1.00 18.45 ? 32  LEU B CG  1 
ATOM   3541 C  CD1 . LEU B 1 32  ? 39.873 113.121 18.797  1.00 18.24 ? 32  LEU B CD1 1 
ATOM   3542 C  CD2 . LEU B 1 32  ? 40.403 114.469 20.823  1.00 15.27 ? 32  LEU B CD2 1 
ATOM   3543 N  N   . MET B 1 33  ? 44.758 115.491 17.737  1.00 24.86 ? 33  MET B N   1 
ATOM   3544 C  CA  . MET B 1 33  ? 46.148 115.247 17.380  1.00 26.61 ? 33  MET B CA  1 
ATOM   3545 C  C   . MET B 1 33  ? 47.066 116.281 18.023  1.00 28.54 ? 33  MET B C   1 
ATOM   3546 O  O   . MET B 1 33  ? 48.227 115.997 18.332  1.00 29.09 ? 33  MET B O   1 
ATOM   3547 C  CB  . MET B 1 33  ? 46.308 115.266 15.864  1.00 26.39 ? 33  MET B CB  1 
ATOM   3548 C  CG  . MET B 1 33  ? 45.485 114.197 15.169  1.00 27.59 ? 33  MET B CG  1 
ATOM   3549 S  SD  . MET B 1 33  ? 45.759 112.577 15.924  1.00 29.72 ? 33  MET B SD  1 
ATOM   3550 C  CE  . MET B 1 33  ? 47.377 112.177 15.254  1.00 27.55 ? 33  MET B CE  1 
ATOM   3551 N  N   . ARG B 1 34  ? 46.535 117.482 18.228  1.00 29.73 ? 34  ARG B N   1 
ATOM   3552 C  CA  . ARG B 1 34  ? 47.288 118.563 18.851  1.00 30.30 ? 34  ARG B CA  1 
ATOM   3553 C  C   . ARG B 1 34  ? 47.551 118.185 20.306  1.00 28.71 ? 34  ARG B C   1 
ATOM   3554 O  O   . ARG B 1 34  ? 48.626 118.446 20.843  1.00 28.36 ? 34  ARG B O   1 
ATOM   3555 C  CB  . ARG B 1 34  ? 46.485 119.865 18.776  1.00 33.36 ? 34  ARG B CB  1 
ATOM   3556 C  CG  . ARG B 1 34  ? 47.115 121.026 19.518  1.00 39.39 ? 34  ARG B CG  1 
ATOM   3557 C  CD  . ARG B 1 34  ? 48.439 121.453 18.901  1.00 43.78 ? 34  ARG B CD  1 
ATOM   3558 N  NE  . ARG B 1 34  ? 49.044 122.553 19.656  1.00 48.39 ? 34  ARG B NE  1 
ATOM   3559 C  CZ  . ARG B 1 34  ? 50.154 123.192 19.296  1.00 50.26 ? 34  ARG B CZ  1 
ATOM   3560 N  NH1 . ARG B 1 34  ? 50.627 124.180 20.048  1.00 48.39 ? 34  ARG B NH1 1 
ATOM   3561 N  NH2 . ARG B 1 34  ? 50.790 122.848 18.181  1.00 50.98 ? 34  ARG B NH2 1 
ATOM   3562 N  N   . MET B 1 35  ? 46.557 117.563 20.932  1.00 27.68 ? 35  MET B N   1 
ATOM   3563 C  CA  . MET B 1 35  ? 46.667 117.123 22.315  1.00 28.09 ? 35  MET B CA  1 
ATOM   3564 C  C   . MET B 1 35  ? 47.752 116.059 22.441  1.00 28.18 ? 35  MET B C   1 
ATOM   3565 O  O   . MET B 1 35  ? 48.517 116.056 23.405  1.00 28.13 ? 35  MET B O   1 
ATOM   3566 C  CB  . MET B 1 35  ? 45.333 116.543 22.800  1.00 30.30 ? 35  MET B CB  1 
ATOM   3567 C  CG  . MET B 1 35  ? 44.179 117.529 22.810  1.00 31.70 ? 35  MET B CG  1 
ATOM   3568 S  SD  . MET B 1 35  ? 44.574 118.996 23.781  1.00 37.40 ? 35  MET B SD  1 
ATOM   3569 C  CE  . MET B 1 35  ? 44.036 118.481 25.416  1.00 35.62 ? 35  MET B CE  1 
ATOM   3570 N  N   . ARG B 1 36  ? 47.807 115.152 21.469  1.00 27.90 ? 36  ARG B N   1 
ATOM   3571 C  CA  . ARG B 1 36  ? 48.800 114.087 21.476  1.00 28.37 ? 36  ARG B CA  1 
ATOM   3572 C  C   . ARG B 1 36  ? 50.205 114.663 21.329  1.00 28.61 ? 36  ARG B C   1 
ATOM   3573 O  O   . ARG B 1 36  ? 51.121 114.293 22.066  1.00 28.08 ? 36  ARG B O   1 
ATOM   3574 C  CB  . ARG B 1 36  ? 48.547 113.095 20.334  1.00 28.32 ? 36  ARG B CB  1 
ATOM   3575 C  CG  . ARG B 1 36  ? 47.226 112.347 20.393  1.00 27.31 ? 36  ARG B CG  1 
ATOM   3576 C  CD  . ARG B 1 36  ? 47.187 111.292 19.298  1.00 25.30 ? 36  ARG B CD  1 
ATOM   3577 N  NE  . ARG B 1 36  ? 45.884 110.650 19.167  1.00 26.83 ? 36  ARG B NE  1 
ATOM   3578 C  CZ  . ARG B 1 36  ? 45.636 109.620 18.361  1.00 27.18 ? 36  ARG B CZ  1 
ATOM   3579 N  NH1 . ARG B 1 36  ? 46.606 109.113 17.617  1.00 27.38 ? 36  ARG B NH1 1 
ATOM   3580 N  NH2 . ARG B 1 36  ? 44.415 109.100 18.287  1.00 25.98 ? 36  ARG B NH2 1 
ATOM   3581 N  N   . GLU B 1 37  ? 50.375 115.566 20.370  1.00 28.68 ? 37  GLU B N   1 
ATOM   3582 C  CA  . GLU B 1 37  ? 51.678 116.178 20.134  1.00 30.52 ? 37  GLU B CA  1 
ATOM   3583 C  C   . GLU B 1 37  ? 52.128 116.976 21.353  1.00 30.98 ? 37  GLU B C   1 
ATOM   3584 O  O   . GLU B 1 37  ? 53.297 116.944 21.730  1.00 30.42 ? 37  GLU B O   1 
ATOM   3585 C  CB  . GLU B 1 37  ? 51.614 117.106 18.920  1.00 32.03 ? 37  GLU B CB  1 
ATOM   3586 C  CG  . GLU B 1 37  ? 51.020 116.461 17.679  1.00 35.08 ? 37  GLU B CG  1 
ATOM   3587 C  CD  . GLU B 1 37  ? 50.754 117.462 16.565  1.00 36.49 ? 37  GLU B CD  1 
ATOM   3588 O  OE1 . GLU B 1 37  ? 50.583 118.663 16.869  1.00 36.48 ? 37  GLU B OE1 1 
ATOM   3589 O  OE2 . GLU B 1 37  ? 50.698 117.038 15.388  1.00 36.45 ? 37  GLU B OE2 1 
ATOM   3590 N  N   . ARG B 1 38  ? 51.184 117.677 21.970  1.00 31.21 ? 38  ARG B N   1 
ATOM   3591 C  CA  . ARG B 1 38  ? 51.462 118.510 23.132  1.00 32.61 ? 38  ARG B CA  1 
ATOM   3592 C  C   . ARG B 1 38  ? 51.511 117.796 24.486  1.00 32.59 ? 38  ARG B C   1 
ATOM   3593 O  O   . ARG B 1 38  ? 52.027 118.346 25.462  1.00 31.76 ? 38  ARG B O   1 
ATOM   3594 C  CB  . ARG B 1 38  ? 50.413 119.623 23.216  1.00 35.14 ? 38  ARG B CB  1 
ATOM   3595 C  CG  . ARG B 1 38  ? 50.541 120.496 24.458  1.00 41.08 ? 38  ARG B CG  1 
ATOM   3596 C  CD  . ARG B 1 38  ? 49.374 121.460 24.595  1.00 46.20 ? 38  ARG B CD  1 
ATOM   3597 N  NE  . ARG B 1 38  ? 49.505 122.340 25.756  1.00 50.39 ? 38  ARG B NE  1 
ATOM   3598 C  CZ  . ARG B 1 38  ? 48.533 123.138 26.196  1.00 52.85 ? 38  ARG B CZ  1 
ATOM   3599 N  NH1 . ARG B 1 38  ? 48.728 123.914 27.261  1.00 52.76 ? 38  ARG B NH1 1 
ATOM   3600 N  NH2 . ARG B 1 38  ? 47.358 123.153 25.574  1.00 51.82 ? 38  ARG B NH2 1 
ATOM   3601 N  N   . TYR B 1 39  ? 50.993 116.575 24.557  1.00 32.30 ? 39  TYR B N   1 
ATOM   3602 C  CA  . TYR B 1 39  ? 50.963 115.880 25.837  1.00 31.99 ? 39  TYR B CA  1 
ATOM   3603 C  C   . TYR B 1 39  ? 51.502 114.466 25.917  1.00 31.47 ? 39  TYR B C   1 
ATOM   3604 O  O   . TYR B 1 39  ? 51.636 113.926 27.012  1.00 31.88 ? 39  TYR B O   1 
ATOM   3605 C  CB  . TYR B 1 39  ? 49.534 115.882 26.373  1.00 33.34 ? 39  TYR B CB  1 
ATOM   3606 C  CG  . TYR B 1 39  ? 49.089 117.215 26.908  1.00 35.20 ? 39  TYR B CG  1 
ATOM   3607 C  CD1 . TYR B 1 39  ? 49.793 117.835 27.931  1.00 35.92 ? 39  TYR B CD1 1 
ATOM   3608 C  CD2 . TYR B 1 39  ? 47.956 117.844 26.412  1.00 37.08 ? 39  TYR B CD2 1 
ATOM   3609 C  CE1 . TYR B 1 39  ? 49.387 119.038 28.447  1.00 37.05 ? 39  TYR B CE1 1 
ATOM   3610 C  CE2 . TYR B 1 39  ? 47.536 119.059 26.925  1.00 38.88 ? 39  TYR B CE2 1 
ATOM   3611 C  CZ  . TYR B 1 39  ? 48.259 119.651 27.946  1.00 38.98 ? 39  TYR B CZ  1 
ATOM   3612 O  OH  . TYR B 1 39  ? 47.856 120.860 28.476  1.00 38.41 ? 39  TYR B OH  1 
ATOM   3613 N  N   . SER B 1 40  ? 51.810 113.853 24.784  1.00 31.47 ? 40  SER B N   1 
ATOM   3614 C  CA  . SER B 1 40  ? 52.307 112.486 24.822  1.00 32.80 ? 40  SER B CA  1 
ATOM   3615 C  C   . SER B 1 40  ? 53.513 112.349 25.741  1.00 33.40 ? 40  SER B C   1 
ATOM   3616 O  O   . SER B 1 40  ? 53.627 111.379 26.490  1.00 34.67 ? 40  SER B O   1 
ATOM   3617 C  CB  . SER B 1 40  ? 52.668 112.010 23.416  1.00 31.45 ? 40  SER B CB  1 
ATOM   3618 O  OG  . SER B 1 40  ? 53.510 112.948 22.776  1.00 36.12 ? 40  SER B OG  1 
ATOM   3619 N  N   . ALA B 1 41  ? 54.400 113.334 25.701  1.00 33.91 ? 41  ALA B N   1 
ATOM   3620 C  CA  . ALA B 1 41  ? 55.609 113.294 26.516  1.00 33.23 ? 41  ALA B CA  1 
ATOM   3621 C  C   . ALA B 1 41  ? 55.392 113.505 28.011  1.00 32.85 ? 41  ALA B C   1 
ATOM   3622 O  O   . ALA B 1 41  ? 56.082 112.891 28.821  1.00 33.66 ? 41  ALA B O   1 
ATOM   3623 C  CB  . ALA B 1 41  ? 56.623 114.315 25.993  1.00 31.99 ? 41  ALA B CB  1 
ATOM   3624 N  N   . SER B 1 42  ? 54.443 114.359 28.383  1.00 31.08 ? 42  SER B N   1 
ATOM   3625 C  CA  . SER B 1 42  ? 54.205 114.641 29.798  1.00 30.04 ? 42  SER B CA  1 
ATOM   3626 C  C   . SER B 1 42  ? 53.180 113.742 30.488  1.00 29.49 ? 42  SER B C   1 
ATOM   3627 O  O   . SER B 1 42  ? 53.058 113.761 31.711  1.00 29.34 ? 42  SER B O   1 
ATOM   3628 C  CB  . SER B 1 42  ? 53.790 116.100 29.971  1.00 30.78 ? 42  SER B CB  1 
ATOM   3629 O  OG  . SER B 1 42  ? 52.527 116.340 29.376  1.00 34.80 ? 42  SER B OG  1 
ATOM   3630 N  N   . LYS B 1 43  ? 52.440 112.965 29.705  1.00 29.33 ? 43  LYS B N   1 
ATOM   3631 C  CA  . LYS B 1 43  ? 51.433 112.057 30.249  1.00 27.84 ? 43  LYS B CA  1 
ATOM   3632 C  C   . LYS B 1 43  ? 50.583 112.693 31.353  1.00 28.24 ? 43  LYS B C   1 
ATOM   3633 O  O   . LYS B 1 43  ? 50.642 112.272 32.512  1.00 29.91 ? 43  LYS B O   1 
ATOM   3634 C  CB  . LYS B 1 43  ? 52.108 110.800 30.805  1.00 25.64 ? 43  LYS B CB  1 
ATOM   3635 C  CG  . LYS B 1 43  ? 53.022 110.084 29.825  1.00 23.65 ? 43  LYS B CG  1 
ATOM   3636 C  CD  . LYS B 1 43  ? 52.271 109.595 28.603  1.00 22.80 ? 43  LYS B CD  1 
ATOM   3637 C  CE  . LYS B 1 43  ? 53.186 108.774 27.709  1.00 23.50 ? 43  LYS B CE  1 
ATOM   3638 N  NZ  . LYS B 1 43  ? 52.517 108.346 26.455  1.00 22.98 ? 43  LYS B NZ  1 
ATOM   3639 N  N   . PRO B 1 44  ? 49.785 113.719 31.012  1.00 27.24 ? 44  PRO B N   1 
ATOM   3640 C  CA  . PRO B 1 44  ? 48.938 114.377 32.015  1.00 26.07 ? 44  PRO B CA  1 
ATOM   3641 C  C   . PRO B 1 44  ? 47.839 113.484 32.599  1.00 26.04 ? 44  PRO B C   1 
ATOM   3642 O  O   . PRO B 1 44  ? 47.340 113.748 33.696  1.00 26.37 ? 44  PRO B O   1 
ATOM   3643 C  CB  . PRO B 1 44  ? 48.371 115.579 31.259  1.00 24.25 ? 44  PRO B CB  1 
ATOM   3644 C  CG  . PRO B 1 44  ? 48.367 115.111 29.827  1.00 24.30 ? 44  PRO B CG  1 
ATOM   3645 C  CD  . PRO B 1 44  ? 49.702 114.416 29.717  1.00 24.76 ? 44  PRO B CD  1 
ATOM   3646 N  N   . LEU B 1 45  ? 47.457 112.434 31.875  1.00 25.56 ? 45  LEU B N   1 
ATOM   3647 C  CA  . LEU B 1 45  ? 46.417 111.527 32.367  1.00 26.11 ? 45  LEU B CA  1 
ATOM   3648 C  C   . LEU B 1 45  ? 46.990 110.249 32.975  1.00 27.33 ? 45  LEU B C   1 
ATOM   3649 O  O   . LEU B 1 45  ? 46.295 109.240 33.093  1.00 26.58 ? 45  LEU B O   1 
ATOM   3650 C  CB  . LEU B 1 45  ? 45.443 111.166 31.246  1.00 25.26 ? 45  LEU B CB  1 
ATOM   3651 C  CG  . LEU B 1 45  ? 44.585 112.326 30.732  1.00 26.28 ? 45  LEU B CG  1 
ATOM   3652 C  CD1 . LEU B 1 45  ? 43.686 111.838 29.613  1.00 26.81 ? 45  LEU B CD1 1 
ATOM   3653 C  CD2 . LEU B 1 45  ? 43.760 112.904 31.867  1.00 25.51 ? 45  LEU B CD2 1 
ATOM   3654 N  N   . LYS B 1 46  ? 48.262 110.300 33.355  1.00 27.93 ? 46  LYS B N   1 
ATOM   3655 C  CA  . LYS B 1 46  ? 48.930 109.160 33.954  1.00 28.41 ? 46  LYS B CA  1 
ATOM   3656 C  C   . LYS B 1 46  ? 48.234 108.769 35.256  1.00 29.06 ? 46  LYS B C   1 
ATOM   3657 O  O   . LYS B 1 46  ? 47.900 109.624 36.084  1.00 28.09 ? 46  LYS B O   1 
ATOM   3658 C  CB  . LYS B 1 46  ? 50.398 109.506 34.216  1.00 31.12 ? 46  LYS B CB  1 
ATOM   3659 C  CG  . LYS B 1 46  ? 51.176 108.482 35.047  1.00 31.81 ? 46  LYS B CG  1 
ATOM   3660 C  CD  . LYS B 1 46  ? 52.579 109.002 35.339  1.00 30.70 ? 46  LYS B CD  1 
ATOM   3661 C  CE  . LYS B 1 46  ? 53.334 108.085 36.288  1.00 32.03 ? 46  LYS B CE  1 
ATOM   3662 N  NZ  . LYS B 1 46  ? 54.663 108.648 36.691  1.00 31.73 ? 46  LYS B NZ  1 
ATOM   3663 N  N   . GLY B 1 47  ? 48.012 107.469 35.424  1.00 29.13 ? 47  GLY B N   1 
ATOM   3664 C  CA  . GLY B 1 47  ? 47.356 106.968 36.618  1.00 29.22 ? 47  GLY B CA  1 
ATOM   3665 C  C   . GLY B 1 47  ? 45.849 106.903 36.465  1.00 29.01 ? 47  GLY B C   1 
ATOM   3666 O  O   . GLY B 1 47  ? 45.161 106.208 37.219  1.00 29.62 ? 47  GLY B O   1 
ATOM   3667 N  N   . ALA B 1 48  ? 45.330 107.627 35.481  1.00 27.40 ? 48  ALA B N   1 
ATOM   3668 C  CA  . ALA B 1 48  ? 43.896 107.648 35.247  1.00 26.93 ? 48  ALA B CA  1 
ATOM   3669 C  C   . ALA B 1 48  ? 43.394 106.347 34.629  1.00 26.82 ? 48  ALA B C   1 
ATOM   3670 O  O   . ALA B 1 48  ? 44.041 105.760 33.759  1.00 26.67 ? 48  ALA B O   1 
ATOM   3671 C  CB  . ALA B 1 48  ? 43.526 108.835 34.354  1.00 26.06 ? 48  ALA B CB  1 
ATOM   3672 N  N   . ARG B 1 49  ? 42.244 105.899 35.118  1.00 26.73 ? 49  ARG B N   1 
ATOM   3673 C  CA  . ARG B 1 49  ? 41.584 104.693 34.635  1.00 27.20 ? 49  ARG B CA  1 
ATOM   3674 C  C   . ARG B 1 49  ? 40.239 105.199 34.133  1.00 26.62 ? 49  ARG B C   1 
ATOM   3675 O  O   . ARG B 1 49  ? 39.258 105.259 34.882  1.00 25.91 ? 49  ARG B O   1 
ATOM   3676 C  CB  . ARG B 1 49  ? 41.383 103.693 35.777  1.00 29.10 ? 49  ARG B CB  1 
ATOM   3677 C  CG  . ARG B 1 49  ? 42.613 102.883 36.148  1.00 31.06 ? 49  ARG B CG  1 
ATOM   3678 C  CD  . ARG B 1 49  ? 42.345 102.069 37.408  1.00 35.99 ? 49  ARG B CD  1 
ATOM   3679 N  NE  . ARG B 1 49  ? 43.386 101.078 37.669  1.00 40.57 ? 49  ARG B NE  1 
ATOM   3680 C  CZ  . ARG B 1 49  ? 44.676 101.360 37.826  1.00 42.66 ? 49  ARG B CZ  1 
ATOM   3681 N  NH1 . ARG B 1 49  ? 45.104 102.614 37.749  1.00 44.72 ? 49  ARG B NH1 1 
ATOM   3682 N  NH2 . ARG B 1 49  ? 45.542 100.383 38.063  1.00 44.10 ? 49  ARG B NH2 1 
ATOM   3683 N  N   . ILE B 1 50  ? 40.206 105.568 32.858  1.00 25.75 ? 50  ILE B N   1 
ATOM   3684 C  CA  . ILE B 1 50  ? 39.008 106.127 32.252  1.00 26.09 ? 50  ILE B CA  1 
ATOM   3685 C  C   . ILE B 1 50  ? 38.045 105.144 31.605  1.00 26.84 ? 50  ILE B C   1 
ATOM   3686 O  O   . ILE B 1 50  ? 38.429 104.336 30.750  1.00 26.47 ? 50  ILE B O   1 
ATOM   3687 C  CB  . ILE B 1 50  ? 39.374 107.180 31.182  1.00 26.41 ? 50  ILE B CB  1 
ATOM   3688 C  CG1 . ILE B 1 50  ? 40.242 108.280 31.797  1.00 26.82 ? 50  ILE B CG1 1 
ATOM   3689 C  CG2 . ILE B 1 50  ? 38.106 107.768 30.578  1.00 23.48 ? 50  ILE B CG2 1 
ATOM   3690 C  CD1 . ILE B 1 50  ? 40.711 109.316 30.782  1.00 26.10 ? 50  ILE B CD1 1 
ATOM   3691 N  N   . ALA B 1 51  ? 36.786 105.230 32.023  1.00 25.96 ? 51  ALA B N   1 
ATOM   3692 C  CA  . ALA B 1 51  ? 35.740 104.396 31.463  1.00 25.95 ? 51  ALA B CA  1 
ATOM   3693 C  C   . ALA B 1 51  ? 34.892 105.345 30.632  1.00 26.11 ? 51  ALA B C   1 
ATOM   3694 O  O   . ALA B 1 51  ? 34.365 106.341 31.144  1.00 25.82 ? 51  ALA B O   1 
ATOM   3695 C  CB  . ALA B 1 51  ? 34.903 103.762 32.563  1.00 25.96 ? 51  ALA B CB  1 
ATOM   3696 N  N   . GLY B 1 52  ? 34.780 105.044 29.344  1.00 25.46 ? 52  GLY B N   1 
ATOM   3697 C  CA  . GLY B 1 52  ? 33.997 105.884 28.460  1.00 24.91 ? 52  GLY B CA  1 
ATOM   3698 C  C   . GLY B 1 52  ? 32.823 105.175 27.807  1.00 25.13 ? 52  GLY B C   1 
ATOM   3699 O  O   . GLY B 1 52  ? 32.921 104.017 27.387  1.00 25.21 ? 52  GLY B O   1 
ATOM   3700 N  N   . CYS B 1 53  ? 31.702 105.883 27.735  1.00 23.67 ? 53  CYS B N   1 
ATOM   3701 C  CA  . CYS B 1 53  ? 30.488 105.364 27.122  1.00 22.42 ? 53  CYS B CA  1 
ATOM   3702 C  C   . CYS B 1 53  ? 30.122 106.367 26.035  1.00 21.84 ? 53  CYS B C   1 
ATOM   3703 O  O   . CYS B 1 53  ? 29.433 107.355 26.294  1.00 21.51 ? 53  CYS B O   1 
ATOM   3704 C  CB  . CYS B 1 53  ? 29.370 105.272 28.157  1.00 21.49 ? 53  CYS B CB  1 
ATOM   3705 S  SG  . CYS B 1 53  ? 27.909 104.443 27.543  1.00 22.03 ? 53  CYS B SG  1 
ATOM   3706 N  N   . LEU B 1 54  ? 30.596 106.105 24.822  1.00 22.11 ? 54  LEU B N   1 
ATOM   3707 C  CA  . LEU B 1 54  ? 30.370 106.997 23.693  1.00 21.44 ? 54  LEU B CA  1 
ATOM   3708 C  C   . LEU B 1 54  ? 30.367 106.204 22.391  1.00 21.68 ? 54  LEU B C   1 
ATOM   3709 O  O   . LEU B 1 54  ? 31.228 105.351 22.185  1.00 21.27 ? 54  LEU B O   1 
ATOM   3710 C  CB  . LEU B 1 54  ? 31.497 108.039 23.656  1.00 20.63 ? 54  LEU B CB  1 
ATOM   3711 C  CG  . LEU B 1 54  ? 31.273 109.429 23.046  1.00 21.23 ? 54  LEU B CG  1 
ATOM   3712 C  CD1 . LEU B 1 54  ? 32.464 110.313 23.396  1.00 20.07 ? 54  LEU B CD1 1 
ATOM   3713 C  CD2 . LEU B 1 54  ? 31.085 109.342 21.547  1.00 20.18 ? 54  LEU B CD2 1 
ATOM   3714 N  N   . HIS B 1 55  ? 29.401 106.490 21.522  1.00 22.22 ? 55  HIS B N   1 
ATOM   3715 C  CA  . HIS B 1 55  ? 29.290 105.823 20.226  1.00 23.66 ? 55  HIS B CA  1 
ATOM   3716 C  C   . HIS B 1 55  ? 30.666 105.337 19.782  1.00 24.76 ? 55  HIS B C   1 
ATOM   3717 O  O   . HIS B 1 55  ? 31.563 106.145 19.547  1.00 25.90 ? 55  HIS B O   1 
ATOM   3718 C  CB  . HIS B 1 55  ? 28.740 106.803 19.192  1.00 24.14 ? 55  HIS B CB  1 
ATOM   3719 C  CG  . HIS B 1 55  ? 27.518 107.534 19.651  1.00 25.86 ? 55  HIS B CG  1 
ATOM   3720 N  ND1 . HIS B 1 55  ? 26.290 106.923 19.783  1.00 26.78 ? 55  HIS B ND1 1 
ATOM   3721 C  CD2 . HIS B 1 55  ? 27.346 108.813 20.064  1.00 27.36 ? 55  HIS B CD2 1 
ATOM   3722 C  CE1 . HIS B 1 55  ? 25.415 107.790 20.258  1.00 27.06 ? 55  HIS B CE1 1 
ATOM   3723 N  NE2 . HIS B 1 55  ? 26.030 108.946 20.436  1.00 27.99 ? 55  HIS B NE2 1 
ATOM   3724 N  N   . MET B 1 56  ? 30.844 104.023 19.675  1.00 24.67 ? 56  MET B N   1 
ATOM   3725 C  CA  . MET B 1 56  ? 32.140 103.488 19.273  1.00 23.92 ? 56  MET B CA  1 
ATOM   3726 C  C   . MET B 1 56  ? 32.365 103.654 17.785  1.00 22.90 ? 56  MET B C   1 
ATOM   3727 O  O   . MET B 1 56  ? 32.357 102.687 17.026  1.00 23.26 ? 56  MET B O   1 
ATOM   3728 C  CB  . MET B 1 56  ? 32.266 102.017 19.662  1.00 24.49 ? 56  MET B CB  1 
ATOM   3729 C  CG  . MET B 1 56  ? 33.619 101.417 19.328  1.00 24.78 ? 56  MET B CG  1 
ATOM   3730 S  SD  . MET B 1 56  ? 35.001 102.492 19.776  1.00 26.06 ? 56  MET B SD  1 
ATOM   3731 C  CE  . MET B 1 56  ? 35.024 102.250 21.478  1.00 26.55 ? 56  MET B CE  1 
ATOM   3732 N  N   . THR B 1 57  ? 32.577 104.901 17.382  1.00 22.69 ? 57  THR B N   1 
ATOM   3733 C  CA  . THR B 1 57  ? 32.793 105.241 15.983  1.00 23.08 ? 57  THR B CA  1 
ATOM   3734 C  C   . THR B 1 57  ? 34.264 105.455 15.680  1.00 21.72 ? 57  THR B C   1 
ATOM   3735 O  O   . THR B 1 57  ? 35.113 105.411 16.567  1.00 22.35 ? 57  THR B O   1 
ATOM   3736 C  CB  . THR B 1 57  ? 32.071 106.542 15.614  1.00 23.38 ? 57  THR B CB  1 
ATOM   3737 O  OG1 . THR B 1 57  ? 32.628 107.615 16.386  1.00 23.75 ? 57  THR B OG1 1 
ATOM   3738 C  CG2 . THR B 1 57  ? 30.574 106.431 15.899  1.00 24.18 ? 57  THR B CG2 1 
ATOM   3739 N  N   . VAL B 1 58  ? 34.546 105.699 14.408  1.00 21.86 ? 58  VAL B N   1 
ATOM   3740 C  CA  . VAL B 1 58  ? 35.899 105.957 13.948  1.00 22.58 ? 58  VAL B CA  1 
ATOM   3741 C  C   . VAL B 1 58  ? 36.416 107.190 14.677  1.00 23.35 ? 58  VAL B C   1 
ATOM   3742 O  O   . VAL B 1 58  ? 37.551 107.213 15.153  1.00 23.86 ? 58  VAL B O   1 
ATOM   3743 C  CB  . VAL B 1 58  ? 35.918 106.236 12.431  1.00 22.11 ? 58  VAL B CB  1 
ATOM   3744 C  CG1 . VAL B 1 58  ? 37.312 106.635 11.993  1.00 21.69 ? 58  VAL B CG1 1 
ATOM   3745 C  CG2 . VAL B 1 58  ? 35.430 105.005 11.672  1.00 22.34 ? 58  VAL B CG2 1 
ATOM   3746 N  N   . GLU B 1 59  ? 35.566 108.212 14.762  1.00 23.50 ? 59  GLU B N   1 
ATOM   3747 C  CA  . GLU B 1 59  ? 35.914 109.459 15.427  1.00 23.23 ? 59  GLU B CA  1 
ATOM   3748 C  C   . GLU B 1 59  ? 36.198 109.217 16.903  1.00 23.20 ? 59  GLU B C   1 
ATOM   3749 O  O   . GLU B 1 59  ? 37.161 109.748 17.456  1.00 23.35 ? 59  GLU B O   1 
ATOM   3750 C  CB  . GLU B 1 59  ? 34.779 110.474 15.279  1.00 24.19 ? 59  GLU B CB  1 
ATOM   3751 C  CG  . GLU B 1 59  ? 34.633 111.071 13.891  1.00 23.44 ? 59  GLU B CG  1 
ATOM   3752 C  CD  . GLU B 1 59  ? 34.359 110.033 12.827  1.00 24.26 ? 59  GLU B CD  1 
ATOM   3753 O  OE1 . GLU B 1 59  ? 33.568 109.103 13.082  1.00 22.23 ? 59  GLU B OE1 1 
ATOM   3754 O  OE2 . GLU B 1 59  ? 34.927 110.156 11.724  1.00 26.82 ? 59  GLU B OE2 1 
ATOM   3755 N  N   . THR B 1 60  ? 35.350 108.417 17.541  1.00 23.28 ? 60  THR B N   1 
ATOM   3756 C  CA  . THR B 1 60  ? 35.523 108.096 18.955  1.00 22.78 ? 60  THR B CA  1 
ATOM   3757 C  C   . THR B 1 60  ? 36.838 107.346 19.149  1.00 21.98 ? 60  THR B C   1 
ATOM   3758 O  O   . THR B 1 60  ? 37.562 107.574 20.117  1.00 20.97 ? 60  THR B O   1 
ATOM   3759 C  CB  . THR B 1 60  ? 34.363 107.234 19.461  1.00 22.58 ? 60  THR B CB  1 
ATOM   3760 O  OG1 . THR B 1 60  ? 33.152 107.991 19.386  1.00 23.13 ? 60  THR B OG1 1 
ATOM   3761 C  CG2 . THR B 1 60  ? 34.600 106.802 20.892  1.00 22.80 ? 60  THR B CG2 1 
ATOM   3762 N  N   . ALA B 1 61  ? 37.143 106.451 18.217  1.00 21.17 ? 61  ALA B N   1 
ATOM   3763 C  CA  . ALA B 1 61  ? 38.382 105.686 18.275  1.00 21.90 ? 61  ALA B CA  1 
ATOM   3764 C  C   . ALA B 1 61  ? 39.586 106.627 18.412  1.00 21.99 ? 61  ALA B C   1 
ATOM   3765 O  O   . ALA B 1 61  ? 40.494 106.374 19.208  1.00 21.80 ? 61  ALA B O   1 
ATOM   3766 C  CB  . ALA B 1 61  ? 38.526 104.831 17.017  1.00 19.88 ? 61  ALA B CB  1 
ATOM   3767 N  N   . VAL B 1 62  ? 39.584 107.710 17.634  1.00 21.35 ? 62  VAL B N   1 
ATOM   3768 C  CA  . VAL B 1 62  ? 40.672 108.682 17.666  1.00 20.90 ? 62  VAL B CA  1 
ATOM   3769 C  C   . VAL B 1 62  ? 40.734 109.346 19.039  1.00 21.87 ? 62  VAL B C   1 
ATOM   3770 O  O   . VAL B 1 62  ? 41.811 109.620 19.566  1.00 22.14 ? 62  VAL B O   1 
ATOM   3771 C  CB  . VAL B 1 62  ? 40.481 109.757 16.579  1.00 19.94 ? 62  VAL B CB  1 
ATOM   3772 C  CG1 . VAL B 1 62  ? 41.618 110.754 16.620  1.00 18.32 ? 62  VAL B CG1 1 
ATOM   3773 C  CG2 . VAL B 1 62  ? 40.421 109.101 15.217  1.00 20.85 ? 62  VAL B CG2 1 
ATOM   3774 N  N   . LEU B 1 63  ? 39.571 109.603 19.619  1.00 22.81 ? 63  LEU B N   1 
ATOM   3775 C  CA  . LEU B 1 63  ? 39.512 110.208 20.939  1.00 23.25 ? 63  LEU B CA  1 
ATOM   3776 C  C   . LEU B 1 63  ? 40.122 109.232 21.934  1.00 23.04 ? 63  LEU B C   1 
ATOM   3777 O  O   . LEU B 1 63  ? 40.938 109.617 22.768  1.00 23.83 ? 63  LEU B O   1 
ATOM   3778 C  CB  . LEU B 1 63  ? 38.057 110.503 21.321  1.00 23.99 ? 63  LEU B CB  1 
ATOM   3779 C  CG  . LEU B 1 63  ? 37.729 110.753 22.799  1.00 24.77 ? 63  LEU B CG  1 
ATOM   3780 C  CD1 . LEU B 1 63  ? 38.448 111.994 23.312  1.00 24.48 ? 63  LEU B CD1 1 
ATOM   3781 C  CD2 . LEU B 1 63  ? 36.224 110.909 22.954  1.00 24.71 ? 63  LEU B CD2 1 
ATOM   3782 N  N   . ILE B 1 64  ? 39.725 107.964 21.831  1.00 22.61 ? 64  ILE B N   1 
ATOM   3783 C  CA  . ILE B 1 64  ? 40.216 106.913 22.722  1.00 21.55 ? 64  ILE B CA  1 
ATOM   3784 C  C   . ILE B 1 64  ? 41.737 106.845 22.746  1.00 21.15 ? 64  ILE B C   1 
ATOM   3785 O  O   . ILE B 1 64  ? 42.349 106.928 23.812  1.00 19.87 ? 64  ILE B O   1 
ATOM   3786 C  CB  . ILE B 1 64  ? 39.660 105.523 22.308  1.00 21.88 ? 64  ILE B CB  1 
ATOM   3787 C  CG1 . ILE B 1 64  ? 38.179 105.428 22.680  1.00 20.03 ? 64  ILE B CG1 1 
ATOM   3788 C  CG2 . ILE B 1 64  ? 40.454 104.407 22.985  1.00 21.54 ? 64  ILE B CG2 1 
ATOM   3789 C  CD1 . ILE B 1 64  ? 37.517 104.176 22.208  1.00 16.44 ? 64  ILE B CD1 1 
ATOM   3790 N  N   . GLU B 1 65  ? 42.338 106.699 21.567  1.00 20.83 ? 65  GLU B N   1 
ATOM   3791 C  CA  . GLU B 1 65  ? 43.786 106.613 21.450  1.00 20.65 ? 65  GLU B CA  1 
ATOM   3792 C  C   . GLU B 1 65  ? 44.474 107.890 21.921  1.00 21.27 ? 65  GLU B C   1 
ATOM   3793 O  O   . GLU B 1 65  ? 45.621 107.858 22.367  1.00 23.05 ? 65  GLU B O   1 
ATOM   3794 C  CB  . GLU B 1 65  ? 44.180 106.299 20.007  1.00 19.89 ? 65  GLU B CB  1 
ATOM   3795 C  CG  . GLU B 1 65  ? 43.555 105.021 19.489  1.00 21.15 ? 65  GLU B CG  1 
ATOM   3796 C  CD  . GLU B 1 65  ? 44.396 104.319 18.443  1.00 21.57 ? 65  GLU B CD  1 
ATOM   3797 O  OE1 . GLU B 1 65  ? 44.719 104.936 17.405  1.00 21.08 ? 65  GLU B OE1 1 
ATOM   3798 O  OE2 . GLU B 1 65  ? 44.733 103.136 18.664  1.00 22.98 ? 65  GLU B OE2 1 
ATOM   3799 N  N   . THR B 1 66  ? 43.776 109.016 21.829  1.00 20.43 ? 66  THR B N   1 
ATOM   3800 C  CA  . THR B 1 66  ? 44.346 110.275 22.281  1.00 19.14 ? 66  THR B CA  1 
ATOM   3801 C  C   . THR B 1 66  ? 44.477 110.196 23.801  1.00 19.59 ? 66  THR B C   1 
ATOM   3802 O  O   . THR B 1 66  ? 45.496 110.584 24.375  1.00 20.20 ? 66  THR B O   1 
ATOM   3803 C  CB  . THR B 1 66  ? 43.446 111.464 21.872  1.00 17.73 ? 66  THR B CB  1 
ATOM   3804 O  OG1 . THR B 1 66  ? 43.498 111.623 20.450  1.00 14.36 ? 66  THR B OG1 1 
ATOM   3805 C  CG2 . THR B 1 66  ? 43.908 112.758 22.536  1.00 16.50 ? 66  THR B CG2 1 
ATOM   3806 N  N   . LEU B 1 67  ? 43.441 109.668 24.441  1.00 20.73 ? 67  LEU B N   1 
ATOM   3807 C  CA  . LEU B 1 67  ? 43.415 109.504 25.890  1.00 22.92 ? 67  LEU B CA  1 
ATOM   3808 C  C   . LEU B 1 67  ? 44.553 108.594 26.362  1.00 24.07 ? 67  LEU B C   1 
ATOM   3809 O  O   . LEU B 1 67  ? 45.165 108.834 27.411  1.00 23.82 ? 67  LEU B O   1 
ATOM   3810 C  CB  . LEU B 1 67  ? 42.067 108.917 26.314  1.00 21.52 ? 67  LEU B CB  1 
ATOM   3811 C  CG  . LEU B 1 67  ? 40.867 109.838 26.070  1.00 21.99 ? 67  LEU B CG  1 
ATOM   3812 C  CD1 . LEU B 1 67  ? 39.560 109.073 26.263  1.00 22.13 ? 67  LEU B CD1 1 
ATOM   3813 C  CD2 . LEU B 1 67  ? 40.951 111.023 27.021  1.00 18.63 ? 67  LEU B CD2 1 
ATOM   3814 N  N   . VAL B 1 68  ? 44.829 107.553 25.580  1.00 24.53 ? 68  VAL B N   1 
ATOM   3815 C  CA  . VAL B 1 68  ? 45.891 106.606 25.900  1.00 25.69 ? 68  VAL B CA  1 
ATOM   3816 C  C   . VAL B 1 68  ? 47.265 107.252 25.707  1.00 25.51 ? 68  VAL B C   1 
ATOM   3817 O  O   . VAL B 1 68  ? 48.198 107.004 26.475  1.00 26.57 ? 68  VAL B O   1 
ATOM   3818 C  CB  . VAL B 1 68  ? 45.782 105.334 25.019  1.00 26.10 ? 68  VAL B CB  1 
ATOM   3819 C  CG1 . VAL B 1 68  ? 46.954 104.398 25.296  1.00 25.72 ? 68  VAL B CG1 1 
ATOM   3820 C  CG2 . VAL B 1 68  ? 44.470 104.620 25.310  1.00 25.22 ? 68  VAL B CG2 1 
ATOM   3821 N  N   . THR B 1 69  ? 47.380 108.083 24.678  1.00 23.75 ? 69  THR B N   1 
ATOM   3822 C  CA  . THR B 1 69  ? 48.623 108.782 24.396  1.00 22.02 ? 69  THR B CA  1 
ATOM   3823 C  C   . THR B 1 69  ? 48.954 109.715 25.554  1.00 23.03 ? 69  THR B C   1 
ATOM   3824 O  O   . THR B 1 69  ? 50.127 109.936 25.870  1.00 23.85 ? 69  THR B O   1 
ATOM   3825 C  CB  . THR B 1 69  ? 48.502 109.642 23.128  1.00 22.39 ? 69  THR B CB  1 
ATOM   3826 O  OG1 . THR B 1 69  ? 48.195 108.805 22.011  1.00 20.11 ? 69  THR B OG1 1 
ATOM   3827 C  CG2 . THR B 1 69  ? 49.801 110.396 22.865  1.00 21.98 ? 69  THR B CG2 1 
ATOM   3828 N  N   . LEU B 1 70  ? 47.917 110.267 26.182  1.00 21.74 ? 70  LEU B N   1 
ATOM   3829 C  CA  . LEU B 1 70  ? 48.118 111.186 27.296  1.00 21.87 ? 70  LEU B CA  1 
ATOM   3830 C  C   . LEU B 1 70  ? 48.408 110.471 28.609  1.00 21.68 ? 70  LEU B C   1 
ATOM   3831 O  O   . LEU B 1 70  ? 48.484 111.104 29.670  1.00 20.46 ? 70  LEU B O   1 
ATOM   3832 C  CB  . LEU B 1 70  ? 46.907 112.115 27.454  1.00 22.67 ? 70  LEU B CB  1 
ATOM   3833 C  CG  . LEU B 1 70  ? 46.517 112.903 26.195  1.00 23.56 ? 70  LEU B CG  1 
ATOM   3834 C  CD1 . LEU B 1 70  ? 45.769 114.164 26.603  1.00 21.39 ? 70  LEU B CD1 1 
ATOM   3835 C  CD2 . LEU B 1 70  ? 47.766 113.264 25.394  1.00 21.94 ? 70  LEU B CD2 1 
ATOM   3836 N  N   . GLY B 1 71  ? 48.557 109.150 28.531  1.00 21.55 ? 71  GLY B N   1 
ATOM   3837 C  CA  . GLY B 1 71  ? 48.882 108.363 29.708  1.00 23.08 ? 71  GLY B CA  1 
ATOM   3838 C  C   . GLY B 1 71  ? 47.764 107.649 30.443  1.00 23.22 ? 71  GLY B C   1 
ATOM   3839 O  O   . GLY B 1 71  ? 48.021 106.933 31.403  1.00 23.49 ? 71  GLY B O   1 
ATOM   3840 N  N   . ALA B 1 72  ? 46.527 107.817 29.999  1.00 24.05 ? 72  ALA B N   1 
ATOM   3841 C  CA  . ALA B 1 72  ? 45.409 107.179 30.679  1.00 24.11 ? 72  ALA B CA  1 
ATOM   3842 C  C   . ALA B 1 72  ? 45.119 105.763 30.210  1.00 24.53 ? 72  ALA B C   1 
ATOM   3843 O  O   . ALA B 1 72  ? 45.416 105.394 29.072  1.00 24.93 ? 72  ALA B O   1 
ATOM   3844 C  CB  . ALA B 1 72  ? 44.151 108.031 30.517  1.00 25.03 ? 72  ALA B CB  1 
ATOM   3845 N  N   . GLU B 1 73  ? 44.551 104.972 31.115  1.00 24.97 ? 73  GLU B N   1 
ATOM   3846 C  CA  . GLU B 1 73  ? 44.136 103.609 30.813  1.00 24.30 ? 73  GLU B CA  1 
ATOM   3847 C  C   . GLU B 1 73  ? 42.703 103.815 30.353  1.00 24.00 ? 73  GLU B C   1 
ATOM   3848 O  O   . GLU B 1 73  ? 41.999 104.678 30.885  1.00 22.69 ? 73  GLU B O   1 
ATOM   3849 C  CB  . GLU B 1 73  ? 44.132 102.739 32.065  1.00 26.81 ? 73  GLU B CB  1 
ATOM   3850 C  CG  . GLU B 1 73  ? 45.462 102.117 32.418  1.00 28.64 ? 73  GLU B CG  1 
ATOM   3851 C  CD  . GLU B 1 73  ? 45.335 101.170 33.586  1.00 30.16 ? 73  GLU B CD  1 
ATOM   3852 O  OE1 . GLU B 1 73  ? 45.342 101.638 34.746  1.00 31.27 ? 73  GLU B OE1 1 
ATOM   3853 O  OE2 . GLU B 1 73  ? 45.204 99.954  33.338  1.00 32.79 ? 73  GLU B OE2 1 
ATOM   3854 N  N   . VAL B 1 74  ? 42.256 103.032 29.381  1.00 23.84 ? 74  VAL B N   1 
ATOM   3855 C  CA  . VAL B 1 74  ? 40.908 103.223 28.876  1.00 24.04 ? 74  VAL B CA  1 
ATOM   3856 C  C   . VAL B 1 74  ? 40.129 101.946 28.605  1.00 25.42 ? 74  VAL B C   1 
ATOM   3857 O  O   . VAL B 1 74  ? 40.667 100.963 28.090  1.00 27.05 ? 74  VAL B O   1 
ATOM   3858 C  CB  . VAL B 1 74  ? 40.933 104.067 27.561  1.00 22.96 ? 74  VAL B CB  1 
ATOM   3859 C  CG1 . VAL B 1 74  ? 39.527 104.230 27.006  1.00 21.83 ? 74  VAL B CG1 1 
ATOM   3860 C  CG2 . VAL B 1 74  ? 41.545 105.428 27.822  1.00 23.53 ? 74  VAL B CG2 1 
ATOM   3861 N  N   . GLN B 1 75  ? 38.852 101.975 28.969  1.00 25.59 ? 75  GLN B N   1 
ATOM   3862 C  CA  . GLN B 1 75  ? 37.945 100.866 28.717  1.00 25.89 ? 75  GLN B CA  1 
ATOM   3863 C  C   . GLN B 1 75  ? 36.693 101.531 28.162  1.00 24.30 ? 75  GLN B C   1 
ATOM   3864 O  O   . GLN B 1 75  ? 36.210 102.524 28.705  1.00 23.38 ? 75  GLN B O   1 
ATOM   3865 C  CB  . GLN B 1 75  ? 37.682 100.074 29.995  1.00 27.77 ? 75  GLN B CB  1 
ATOM   3866 C  CG  . GLN B 1 75  ? 38.895 99.230  30.373  1.00 29.21 ? 75  GLN B CG  1 
ATOM   3867 C  CD  . GLN B 1 75  ? 38.625 98.273  31.509  1.00 31.16 ? 75  GLN B CD  1 
ATOM   3868 O  OE1 . GLN B 1 75  ? 39.371 97.313  31.709  1.00 32.49 ? 75  GLN B OE1 1 
ATOM   3869 N  NE2 . GLN B 1 75  ? 37.564 98.529  32.268  1.00 30.81 ? 75  GLN B NE2 1 
ATOM   3870 N  N   . TRP B 1 76  ? 36.173 100.985 27.073  1.00 22.58 ? 76  TRP B N   1 
ATOM   3871 C  CA  . TRP B 1 76  ? 35.049 101.615 26.415  1.00 22.50 ? 76  TRP B CA  1 
ATOM   3872 C  C   . TRP B 1 76  ? 33.837 100.756 26.073  1.00 21.91 ? 76  TRP B C   1 
ATOM   3873 O  O   . TRP B 1 76  ? 33.903 99.534  26.016  1.00 20.88 ? 76  TRP B O   1 
ATOM   3874 C  CB  . TRP B 1 76  ? 35.583 102.272 25.140  1.00 22.62 ? 76  TRP B CB  1 
ATOM   3875 C  CG  . TRP B 1 76  ? 34.947 103.568 24.768  1.00 23.11 ? 76  TRP B CG  1 
ATOM   3876 C  CD1 . TRP B 1 76  ? 33.820 103.748 24.023  1.00 23.27 ? 76  TRP B CD1 1 
ATOM   3877 C  CD2 . TRP B 1 76  ? 35.438 104.877 25.079  1.00 23.77 ? 76  TRP B CD2 1 
ATOM   3878 N  NE1 . TRP B 1 76  ? 33.583 105.088 23.841  1.00 25.54 ? 76  TRP B NE1 1 
ATOM   3879 C  CE2 . TRP B 1 76  ? 34.562 105.803 24.482  1.00 25.39 ? 76  TRP B CE2 1 
ATOM   3880 C  CE3 . TRP B 1 76  ? 36.535 105.355 25.804  1.00 23.42 ? 76  TRP B CE3 1 
ATOM   3881 C  CZ2 . TRP B 1 76  ? 34.750 107.182 24.583  1.00 24.71 ? 76  TRP B CZ2 1 
ATOM   3882 C  CZ3 . TRP B 1 76  ? 36.721 106.722 25.904  1.00 23.52 ? 76  TRP B CZ3 1 
ATOM   3883 C  CH2 . TRP B 1 76  ? 35.833 107.620 25.296  1.00 24.21 ? 76  TRP B CH2 1 
ATOM   3884 N  N   . SER B 1 77  ? 32.728 101.450 25.844  1.00 22.31 ? 77  SER B N   1 
ATOM   3885 C  CA  . SER B 1 77  ? 31.453 100.864 25.462  1.00 22.41 ? 77  SER B CA  1 
ATOM   3886 C  C   . SER B 1 77  ? 30.718 101.974 24.708  1.00 23.45 ? 77  SER B C   1 
ATOM   3887 O  O   . SER B 1 77  ? 30.954 103.160 24.943  1.00 24.33 ? 77  SER B O   1 
ATOM   3888 C  CB  . SER B 1 77  ? 30.647 100.434 26.697  1.00 20.88 ? 77  SER B CB  1 
ATOM   3889 O  OG  . SER B 1 77  ? 30.252 101.542 27.485  1.00 17.95 ? 77  SER B OG  1 
ATOM   3890 N  N   . SER B 1 78  ? 29.845 101.592 23.788  1.00 24.75 ? 78  SER B N   1 
ATOM   3891 C  CA  . SER B 1 78  ? 29.094 102.569 23.013  1.00 25.81 ? 78  SER B CA  1 
ATOM   3892 C  C   . SER B 1 78  ? 27.939 103.073 23.867  1.00 26.52 ? 78  SER B C   1 
ATOM   3893 O  O   . SER B 1 78  ? 27.526 102.387 24.800  1.00 28.61 ? 78  SER B O   1 
ATOM   3894 C  CB  . SER B 1 78  ? 28.560 101.906 21.744  1.00 24.42 ? 78  SER B CB  1 
ATOM   3895 O  OG  . SER B 1 78  ? 27.979 102.853 20.872  1.00 26.44 ? 78  SER B OG  1 
ATOM   3896 N  N   . CYS B 1 79  ? 27.420 104.264 23.569  1.00 26.75 ? 79  CYS B N   1 
ATOM   3897 C  CA  . CYS B 1 79  ? 26.294 104.794 24.342  1.00 26.51 ? 79  CYS B CA  1 
ATOM   3898 C  C   . CYS B 1 79  ? 24.975 104.597 23.590  1.00 26.47 ? 79  CYS B C   1 
ATOM   3899 O  O   . CYS B 1 79  ? 23.935 105.139 23.968  1.00 26.33 ? 79  CYS B O   1 
ATOM   3900 C  CB  . CYS B 1 79  ? 26.503 106.276 24.683  1.00 25.89 ? 79  CYS B CB  1 
ATOM   3901 S  SG  . CYS B 1 79  ? 26.498 107.408 23.281  1.00 27.90 ? 79  CYS B SG  1 
ATOM   3902 N  N   . ASN B 1 80  ? 25.035 103.805 22.524  1.00 25.74 ? 80  ASN B N   1 
ATOM   3903 C  CA  . ASN B 1 80  ? 23.866 103.487 21.718  1.00 25.91 ? 80  ASN B CA  1 
ATOM   3904 C  C   . ASN B 1 80  ? 24.079 102.112 21.069  1.00 26.71 ? 80  ASN B C   1 
ATOM   3905 O  O   . ASN B 1 80  ? 25.148 101.842 20.521  1.00 26.33 ? 80  ASN B O   1 
ATOM   3906 C  CB  . ASN B 1 80  ? 23.651 104.567 20.657  1.00 26.08 ? 80  ASN B CB  1 
ATOM   3907 C  CG  . ASN B 1 80  ? 22.422 104.317 19.817  1.00 26.57 ? 80  ASN B CG  1 
ATOM   3908 O  OD1 . ASN B 1 80  ? 22.498 103.685 18.766  1.00 27.47 ? 80  ASN B OD1 1 
ATOM   3909 N  ND2 . ASN B 1 80  ? 21.273 104.795 20.286  1.00 25.98 ? 80  ASN B ND2 1 
ATOM   3910 N  N   . ILE B 1 81  ? 23.067 101.246 21.134  1.00 26.47 ? 81  ILE B N   1 
ATOM   3911 C  CA  . ILE B 1 81  ? 23.180 99.900  20.574  1.00 27.20 ? 81  ILE B CA  1 
ATOM   3912 C  C   . ILE B 1 81  ? 23.422 99.811  19.071  1.00 26.76 ? 81  ILE B C   1 
ATOM   3913 O  O   . ILE B 1 81  ? 23.792 98.751  18.578  1.00 27.33 ? 81  ILE B O   1 
ATOM   3914 C  CB  . ILE B 1 81  ? 21.935 99.025  20.895  1.00 28.64 ? 81  ILE B CB  1 
ATOM   3915 C  CG1 . ILE B 1 81  ? 20.664 99.694  20.371  1.00 30.69 ? 81  ILE B CG1 1 
ATOM   3916 C  CG2 . ILE B 1 81  ? 21.833 98.775  22.397  1.00 28.99 ? 81  ILE B CG2 1 
ATOM   3917 C  CD1 . ILE B 1 81  ? 19.405 98.866  20.606  1.00 29.38 ? 81  ILE B CD1 1 
ATOM   3918 N  N   . PHE B 1 82  ? 23.233 100.906 18.342  1.00 26.81 ? 82  PHE B N   1 
ATOM   3919 C  CA  . PHE B 1 82  ? 23.438 100.883 16.891  1.00 27.45 ? 82  PHE B CA  1 
ATOM   3920 C  C   . PHE B 1 82  ? 24.584 101.753 16.375  1.00 26.80 ? 82  PHE B C   1 
ATOM   3921 O  O   . PHE B 1 82  ? 25.046 101.565 15.246  1.00 25.98 ? 82  PHE B O   1 
ATOM   3922 C  CB  . PHE B 1 82  ? 22.151 101.306 16.168  1.00 28.64 ? 82  PHE B CB  1 
ATOM   3923 C  CG  . PHE B 1 82  ? 21.046 100.294 16.249  1.00 31.68 ? 82  PHE B CG  1 
ATOM   3924 C  CD1 . PHE B 1 82  ? 21.202 99.033  15.687  1.00 31.46 ? 82  PHE B CD1 1 
ATOM   3925 C  CD2 . PHE B 1 82  ? 19.849 100.599 16.892  1.00 31.42 ? 82  PHE B CD2 1 
ATOM   3926 C  CE1 . PHE B 1 82  ? 20.182 98.098  15.766  1.00 31.88 ? 82  PHE B CE1 1 
ATOM   3927 C  CE2 . PHE B 1 82  ? 18.831 99.668  16.972  1.00 29.72 ? 82  PHE B CE2 1 
ATOM   3928 C  CZ  . PHE B 1 82  ? 18.997 98.417  16.409  1.00 29.39 ? 82  PHE B CZ  1 
ATOM   3929 N  N   . SER B 1 83  ? 25.034 102.697 17.199  1.00 25.99 ? 83  SER B N   1 
ATOM   3930 C  CA  . SER B 1 83  ? 26.094 103.631 16.819  1.00 25.31 ? 83  SER B CA  1 
ATOM   3931 C  C   . SER B 1 83  ? 27.516 103.087 16.623  1.00 25.91 ? 83  SER B C   1 
ATOM   3932 O  O   . SER B 1 83  ? 28.389 103.803 16.124  1.00 26.58 ? 83  SER B O   1 
ATOM   3933 C  CB  . SER B 1 83  ? 26.133 104.781 17.822  1.00 22.19 ? 83  SER B CB  1 
ATOM   3934 O  OG  . SER B 1 83  ? 26.234 104.294 19.144  1.00 21.67 ? 83  SER B OG  1 
ATOM   3935 N  N   . THR B 1 84  ? 27.760 101.836 16.996  1.00 25.31 ? 84  THR B N   1 
ATOM   3936 C  CA  . THR B 1 84  ? 29.100 101.285 16.838  1.00 25.57 ? 84  THR B CA  1 
ATOM   3937 C  C   . THR B 1 84  ? 29.463 100.957 15.393  1.00 25.54 ? 84  THR B C   1 
ATOM   3938 O  O   . THR B 1 84  ? 28.663 100.394 14.646  1.00 24.60 ? 84  THR B O   1 
ATOM   3939 C  CB  . THR B 1 84  ? 29.303 99.999  17.683  1.00 25.03 ? 84  THR B CB  1 
ATOM   3940 O  OG1 . THR B 1 84  ? 29.244 100.315 19.079  1.00 25.54 ? 84  THR B OG1 1 
ATOM   3941 C  CG2 . THR B 1 84  ? 30.654 99.381  17.384  1.00 25.22 ? 84  THR B CG2 1 
ATOM   3942 N  N   . GLN B 1 85  ? 30.671 101.351 15.002  1.00 26.16 ? 85  GLN B N   1 
ATOM   3943 C  CA  . GLN B 1 85  ? 31.195 101.055 13.676  1.00 26.63 ? 85  GLN B CA  1 
ATOM   3944 C  C   . GLN B 1 85  ? 32.172 99.941  13.998  1.00 27.28 ? 85  GLN B C   1 
ATOM   3945 O  O   . GLN B 1 85  ? 33.236 100.177 14.569  1.00 29.26 ? 85  GLN B O   1 
ATOM   3946 C  CB  . GLN B 1 85  ? 31.911 102.269 13.087  1.00 26.24 ? 85  GLN B CB  1 
ATOM   3947 C  CG  . GLN B 1 85  ? 30.969 103.270 12.433  1.00 25.26 ? 85  GLN B CG  1 
ATOM   3948 C  CD  . GLN B 1 85  ? 31.708 104.432 11.804  1.00 26.05 ? 85  GLN B CD  1 
ATOM   3949 O  OE1 . GLN B 1 85  ? 32.281 105.266 12.505  1.00 26.44 ? 85  GLN B OE1 1 
ATOM   3950 N  NE2 . GLN B 1 85  ? 31.708 104.488 10.474  1.00 23.72 ? 85  GLN B NE2 1 
ATOM   3951 N  N   . ASP B 1 86  ? 31.789 98.718  13.660  1.00 26.66 ? 86  ASP B N   1 
ATOM   3952 C  CA  . ASP B 1 86  ? 32.602 97.560  13.981  1.00 25.15 ? 86  ASP B CA  1 
ATOM   3953 C  C   . ASP B 1 86  ? 34.080 97.637  13.632  1.00 25.44 ? 86  ASP B C   1 
ATOM   3954 O  O   . ASP B 1 86  ? 34.917 97.252  14.447  1.00 24.91 ? 86  ASP B O   1 
ATOM   3955 C  CB  . ASP B 1 86  ? 31.968 96.305  13.378  1.00 24.59 ? 86  ASP B CB  1 
ATOM   3956 C  CG  . ASP B 1 86  ? 30.574 96.037  13.937  1.00 26.09 ? 86  ASP B CG  1 
ATOM   3957 O  OD1 . ASP B 1 86  ? 30.373 96.253  15.156  1.00 22.48 ? 86  ASP B OD1 1 
ATOM   3958 O  OD2 . ASP B 1 86  ? 29.683 95.605  13.166  1.00 27.06 ? 86  ASP B OD2 1 
ATOM   3959 N  N   . HIS B 1 87  ? 34.420 98.140  12.449  1.00 25.81 ? 87  HIS B N   1 
ATOM   3960 C  CA  . HIS B 1 87  ? 35.826 98.214  12.091  1.00 26.28 ? 87  HIS B CA  1 
ATOM   3961 C  C   . HIS B 1 87  ? 36.573 99.135  13.042  1.00 27.26 ? 87  HIS B C   1 
ATOM   3962 O  O   . HIS B 1 87  ? 37.737 98.888  13.373  1.00 29.15 ? 87  HIS B O   1 
ATOM   3963 C  CB  . HIS B 1 87  ? 36.010 98.656  10.628  1.00 27.45 ? 87  HIS B CB  1 
ATOM   3964 C  CG  . HIS B 1 87  ? 35.415 99.992  10.297  1.00 29.10 ? 87  HIS B CG  1 
ATOM   3965 N  ND1 . HIS B 1 87  ? 34.134 100.354 10.662  1.00 29.63 ? 87  HIS B ND1 1 
ATOM   3966 C  CD2 . HIS B 1 87  ? 35.900 101.021 9.560   1.00 27.86 ? 87  HIS B CD2 1 
ATOM   3967 C  CE1 . HIS B 1 87  ? 33.856 101.544 10.159  1.00 28.38 ? 87  HIS B CE1 1 
ATOM   3968 N  NE2 . HIS B 1 87  ? 34.910 101.970 9.486   1.00 25.86 ? 87  HIS B NE2 1 
ATOM   3969 N  N   . ALA B 1 88  ? 35.904 100.186 13.503  1.00 25.82 ? 88  ALA B N   1 
ATOM   3970 C  CA  . ALA B 1 88  ? 36.536 101.120 14.424  1.00 24.71 ? 88  ALA B CA  1 
ATOM   3971 C  C   . ALA B 1 88  ? 36.801 100.409 15.748  1.00 24.79 ? 88  ALA B C   1 
ATOM   3972 O  O   . ALA B 1 88  ? 37.905 100.473 16.289  1.00 23.84 ? 88  ALA B O   1 
ATOM   3973 C  CB  . ALA B 1 88  ? 35.643 102.333 14.639  1.00 24.34 ? 88  ALA B CB  1 
ATOM   3974 N  N   . ALA B 1 89  ? 35.782 99.726  16.261  1.00 23.89 ? 89  ALA B N   1 
ATOM   3975 C  CA  . ALA B 1 89  ? 35.900 98.986  17.513  1.00 23.74 ? 89  ALA B CA  1 
ATOM   3976 C  C   . ALA B 1 89  ? 36.962 97.890  17.389  1.00 23.88 ? 89  ALA B C   1 
ATOM   3977 O  O   . ALA B 1 89  ? 37.686 97.602  18.346  1.00 22.16 ? 89  ALA B O   1 
ATOM   3978 C  CB  . ALA B 1 89  ? 34.555 98.369  17.881  1.00 23.90 ? 89  ALA B CB  1 
ATOM   3979 N  N   . ALA B 1 90  ? 37.050 97.285  16.207  1.00 23.67 ? 90  ALA B N   1 
ATOM   3980 C  CA  . ALA B 1 90  ? 38.025 96.227  15.960  1.00 25.05 ? 90  ALA B CA  1 
ATOM   3981 C  C   . ALA B 1 90  ? 39.445 96.766  16.105  1.00 25.79 ? 90  ALA B C   1 
ATOM   3982 O  O   . ALA B 1 90  ? 40.299 96.126  16.720  1.00 26.71 ? 90  ALA B O   1 
ATOM   3983 C  CB  . ALA B 1 90  ? 37.827 95.638  14.561  1.00 23.72 ? 90  ALA B CB  1 
ATOM   3984 N  N   . ALA B 1 91  ? 39.693 97.944  15.536  1.00 25.26 ? 91  ALA B N   1 
ATOM   3985 C  CA  . ALA B 1 91  ? 41.011 98.562  15.612  1.00 24.40 ? 91  ALA B CA  1 
ATOM   3986 C  C   . ALA B 1 91  ? 41.392 98.850  17.060  1.00 24.15 ? 91  ALA B C   1 
ATOM   3987 O  O   . ALA B 1 91  ? 42.527 98.607  17.476  1.00 25.34 ? 91  ALA B O   1 
ATOM   3988 C  CB  . ALA B 1 91  ? 41.035 99.852  14.795  1.00 25.07 ? 91  ALA B CB  1 
ATOM   3989 N  N   . ILE B 1 92  ? 40.438 99.371  17.823  1.00 23.35 ? 92  ILE B N   1 
ATOM   3990 C  CA  . ILE B 1 92  ? 40.661 99.694  19.227  1.00 22.14 ? 92  ILE B CA  1 
ATOM   3991 C  C   . ILE B 1 92  ? 40.965 98.432  20.034  1.00 22.18 ? 92  ILE B C   1 
ATOM   3992 O  O   . ILE B 1 92  ? 41.863 98.424  20.878  1.00 21.78 ? 92  ILE B O   1 
ATOM   3993 C  CB  . ILE B 1 92  ? 39.418 100.407 19.823  1.00 22.22 ? 92  ILE B CB  1 
ATOM   3994 C  CG1 . ILE B 1 92  ? 39.216 101.752 19.126  1.00 21.21 ? 92  ILE B CG1 1 
ATOM   3995 C  CG2 . ILE B 1 92  ? 39.589 100.622 21.323  1.00 22.05 ? 92  ILE B CG2 1 
ATOM   3996 C  CD1 . ILE B 1 92  ? 40.384 102.695 19.287  1.00 21.61 ? 92  ILE B CD1 1 
ATOM   3997 N  N   . ALA B 1 93  ? 40.213 97.368  19.772  1.00 22.09 ? 93  ALA B N   1 
ATOM   3998 C  CA  . ALA B 1 93  ? 40.410 96.103  20.469  1.00 22.35 ? 93  ALA B CA  1 
ATOM   3999 C  C   . ALA B 1 93  ? 41.789 95.544  20.139  1.00 23.11 ? 93  ALA B C   1 
ATOM   4000 O  O   . ALA B 1 93  ? 42.513 95.077  21.023  1.00 23.81 ? 93  ALA B O   1 
ATOM   4001 C  CB  . ALA B 1 93  ? 39.327 95.100  20.066  1.00 19.88 ? 93  ALA B CB  1 
ATOM   4002 N  N   . LYS B 1 94  ? 42.161 95.602  18.866  1.00 23.70 ? 94  LYS B N   1 
ATOM   4003 C  CA  . LYS B 1 94  ? 43.455 95.084  18.464  1.00 25.67 ? 94  LYS B CA  1 
ATOM   4004 C  C   . LYS B 1 94  ? 44.604 95.908  19.040  1.00 25.12 ? 94  LYS B C   1 
ATOM   4005 O  O   . LYS B 1 94  ? 45.713 95.406  19.207  1.00 24.96 ? 94  LYS B O   1 
ATOM   4006 C  CB  . LYS B 1 94  ? 43.573 95.036  16.942  1.00 28.21 ? 94  LYS B CB  1 
ATOM   4007 C  CG  . LYS B 1 94  ? 44.931 94.508  16.497  1.00 34.06 ? 94  LYS B CG  1 
ATOM   4008 C  CD  . LYS B 1 94  ? 45.144 94.582  14.997  1.00 36.75 ? 94  LYS B CD  1 
ATOM   4009 C  CE  . LYS B 1 94  ? 46.597 94.243  14.654  1.00 40.17 ? 94  LYS B CE  1 
ATOM   4010 N  NZ  . LYS B 1 94  ? 46.868 94.376  13.194  1.00 43.20 ? 94  LYS B NZ  1 
ATOM   4011 N  N   . ALA B 1 95  ? 44.342 97.174  19.345  1.00 24.79 ? 95  ALA B N   1 
ATOM   4012 C  CA  . ALA B 1 95  ? 45.377 98.034  19.900  1.00 23.81 ? 95  ALA B CA  1 
ATOM   4013 C  C   . ALA B 1 95  ? 45.618 97.678  21.362  1.00 23.61 ? 95  ALA B C   1 
ATOM   4014 O  O   . ALA B 1 95  ? 46.513 98.225  22.005  1.00 23.19 ? 95  ALA B O   1 
ATOM   4015 C  CB  . ALA B 1 95  ? 44.971 99.493  19.772  1.00 23.75 ? 95  ALA B CB  1 
ATOM   4016 N  N   . GLY B 1 96  ? 44.814 96.757  21.883  1.00 22.61 ? 96  GLY B N   1 
ATOM   4017 C  CA  . GLY B 1 96  ? 44.972 96.347  23.266  1.00 23.07 ? 96  GLY B CA  1 
ATOM   4018 C  C   . GLY B 1 96  ? 44.155 97.160  24.251  1.00 23.83 ? 96  GLY B C   1 
ATOM   4019 O  O   . GLY B 1 96  ? 44.495 97.258  25.427  1.00 23.16 ? 96  GLY B O   1 
ATOM   4020 N  N   . ILE B 1 97  ? 43.067 97.751  23.776  1.00 25.42 ? 97  ILE B N   1 
ATOM   4021 C  CA  . ILE B 1 97  ? 42.210 98.544  24.645  1.00 24.71 ? 97  ILE B CA  1 
ATOM   4022 C  C   . ILE B 1 97  ? 40.895 97.805  24.850  1.00 23.97 ? 97  ILE B C   1 
ATOM   4023 O  O   . ILE B 1 97  ? 40.255 97.371  23.890  1.00 24.81 ? 97  ILE B O   1 
ATOM   4024 C  CB  . ILE B 1 97  ? 41.933 99.932  24.028  1.00 25.46 ? 97  ILE B CB  1 
ATOM   4025 C  CG1 . ILE B 1 97  ? 43.265 100.631 23.734  1.00 25.85 ? 97  ILE B CG1 1 
ATOM   4026 C  CG2 . ILE B 1 97  ? 41.092 100.771 24.980  1.00 24.60 ? 97  ILE B CG2 1 
ATOM   4027 C  CD1 . ILE B 1 97  ? 43.137 101.958 23.044  1.00 25.00 ? 97  ILE B CD1 1 
ATOM   4028 N  N   . PRO B 1 98  ? 40.489 97.624  26.113  1.00 23.41 ? 98  PRO B N   1 
ATOM   4029 C  CA  . PRO B 1 98  ? 39.231 96.924  26.378  1.00 23.52 ? 98  PRO B CA  1 
ATOM   4030 C  C   . PRO B 1 98  ? 38.028 97.727  25.885  1.00 23.60 ? 98  PRO B C   1 
ATOM   4031 O  O   . PRO B 1 98  ? 37.649 98.746  26.478  1.00 22.91 ? 98  PRO B O   1 
ATOM   4032 C  CB  . PRO B 1 98  ? 39.229 96.763  27.901  1.00 22.86 ? 98  PRO B CB  1 
ATOM   4033 C  CG  . PRO B 1 98  ? 40.683 96.758  28.250  1.00 22.69 ? 98  PRO B CG  1 
ATOM   4034 C  CD  . PRO B 1 98  ? 41.242 97.838  27.359  1.00 22.90 ? 98  PRO B CD  1 
ATOM   4035 N  N   . VAL B 1 99  ? 37.442 97.267  24.788  1.00 22.89 ? 99  VAL B N   1 
ATOM   4036 C  CA  . VAL B 1 99  ? 36.271 97.910  24.228  1.00 21.38 ? 99  VAL B CA  1 
ATOM   4037 C  C   . VAL B 1 99  ? 35.172 96.874  24.052  1.00 21.32 ? 99  VAL B C   1 
ATOM   4038 O  O   . VAL B 1 99  ? 35.395 95.797  23.502  1.00 20.40 ? 99  VAL B O   1 
ATOM   4039 C  CB  . VAL B 1 99  ? 36.577 98.564  22.869  1.00 21.36 ? 99  VAL B CB  1 
ATOM   4040 C  CG1 . VAL B 1 99  ? 37.334 97.593  21.974  1.00 20.62 ? 99  VAL B CG1 1 
ATOM   4041 C  CG2 . VAL B 1 99  ? 35.274 98.999  22.211  1.00 19.55 ? 99  VAL B CG2 1 
ATOM   4042 N  N   . TYR B 1 100 ? 33.984 97.204  24.541  1.00 22.31 ? 100 TYR B N   1 
ATOM   4043 C  CA  . TYR B 1 100 ? 32.837 96.313  24.441  1.00 21.95 ? 100 TYR B CA  1 
ATOM   4044 C  C   . TYR B 1 100 ? 31.725 97.033  23.696  1.00 22.37 ? 100 TYR B C   1 
ATOM   4045 O  O   . TYR B 1 100 ? 30.943 97.787  24.282  1.00 22.10 ? 100 TYR B O   1 
ATOM   4046 C  CB  . TYR B 1 100 ? 32.375 95.900  25.839  1.00 21.89 ? 100 TYR B CB  1 
ATOM   4047 C  CG  . TYR B 1 100 ? 33.506 95.338  26.654  1.00 24.09 ? 100 TYR B CG  1 
ATOM   4048 C  CD1 . TYR B 1 100 ? 34.370 96.177  27.342  1.00 23.81 ? 100 TYR B CD1 1 
ATOM   4049 C  CD2 . TYR B 1 100 ? 33.764 93.968  26.671  1.00 25.72 ? 100 TYR B CD2 1 
ATOM   4050 C  CE1 . TYR B 1 100 ? 35.465 95.673  28.021  1.00 26.32 ? 100 TYR B CE1 1 
ATOM   4051 C  CE2 . TYR B 1 100 ? 34.860 93.452  27.349  1.00 26.03 ? 100 TYR B CE2 1 
ATOM   4052 C  CZ  . TYR B 1 100 ? 35.706 94.312  28.022  1.00 26.86 ? 100 TYR B CZ  1 
ATOM   4053 O  OH  . TYR B 1 100 ? 36.796 93.819  28.703  1.00 27.76 ? 100 TYR B OH  1 
ATOM   4054 N  N   . ALA B 1 101 ? 31.669 96.798  22.391  1.00 22.05 ? 101 ALA B N   1 
ATOM   4055 C  CA  . ALA B 1 101 ? 30.668 97.433  21.560  1.00 23.53 ? 101 ALA B CA  1 
ATOM   4056 C  C   . ALA B 1 101 ? 30.604 96.803  20.174  1.00 24.38 ? 101 ALA B C   1 
ATOM   4057 O  O   . ALA B 1 101 ? 31.615 96.359  19.632  1.00 24.52 ? 101 ALA B O   1 
ATOM   4058 C  CB  . ALA B 1 101 ? 30.978 98.923  21.433  1.00 22.92 ? 101 ALA B CB  1 
ATOM   4059 N  N   . TRP B 1 102 ? 29.400 96.762  19.616  1.00 23.80 ? 102 TRP B N   1 
ATOM   4060 C  CA  . TRP B 1 102 ? 29.182 96.241  18.279  1.00 23.87 ? 102 TRP B CA  1 
ATOM   4061 C  C   . TRP B 1 102 ? 27.813 96.725  17.845  1.00 23.23 ? 102 TRP B C   1 
ATOM   4062 O  O   . TRP B 1 102 ? 26.951 97.004  18.678  1.00 22.74 ? 102 TRP B O   1 
ATOM   4063 C  CB  . TRP B 1 102 ? 29.261 94.701  18.244  1.00 25.63 ? 102 TRP B CB  1 
ATOM   4064 C  CG  . TRP B 1 102 ? 28.235 93.991  19.074  1.00 26.50 ? 102 TRP B CG  1 
ATOM   4065 C  CD1 . TRP B 1 102 ? 26.956 93.671  18.712  1.00 25.95 ? 102 TRP B CD1 1 
ATOM   4066 C  CD2 . TRP B 1 102 ? 28.388 93.560  20.430  1.00 26.78 ? 102 TRP B CD2 1 
ATOM   4067 N  NE1 . TRP B 1 102 ? 26.304 93.070  19.764  1.00 25.04 ? 102 TRP B NE1 1 
ATOM   4068 C  CE2 . TRP B 1 102 ? 27.161 92.990  20.830  1.00 26.61 ? 102 TRP B CE2 1 
ATOM   4069 C  CE3 . TRP B 1 102 ? 29.445 93.603  21.347  1.00 27.60 ? 102 TRP B CE3 1 
ATOM   4070 C  CZ2 . TRP B 1 102 ? 26.959 92.468  22.109  1.00 27.52 ? 102 TRP B CZ2 1 
ATOM   4071 C  CZ3 . TRP B 1 102 ? 29.244 93.084  22.618  1.00 29.32 ? 102 TRP B CZ3 1 
ATOM   4072 C  CH2 . TRP B 1 102 ? 28.009 92.524  22.986  1.00 28.28 ? 102 TRP B CH2 1 
ATOM   4073 N  N   . LYS B 1 103 ? 27.632 96.855  16.538  1.00 22.75 ? 103 LYS B N   1 
ATOM   4074 C  CA  . LYS B 1 103 ? 26.365 97.304  15.993  1.00 22.33 ? 103 LYS B CA  1 
ATOM   4075 C  C   . LYS B 1 103 ? 25.308 96.219  16.198  1.00 22.60 ? 103 LYS B C   1 
ATOM   4076 O  O   . LYS B 1 103 ? 25.572 95.036  15.989  1.00 21.61 ? 103 LYS B O   1 
ATOM   4077 C  CB  . LYS B 1 103 ? 26.528 97.608  14.504  1.00 20.62 ? 103 LYS B CB  1 
ATOM   4078 C  CG  . LYS B 1 103 ? 25.343 98.306  13.880  1.00 20.84 ? 103 LYS B CG  1 
ATOM   4079 C  CD  . LYS B 1 103 ? 25.616 98.655  12.432  1.00 22.28 ? 103 LYS B CD  1 
ATOM   4080 C  CE  . LYS B 1 103 ? 24.480 99.468  11.836  1.00 22.87 ? 103 LYS B CE  1 
ATOM   4081 N  NZ  . LYS B 1 103 ? 24.677 99.657  10.368  1.00 28.76 ? 103 LYS B NZ  1 
ATOM   4082 N  N   . GLY B 1 104 ? 24.120 96.627  16.624  1.00 22.61 ? 104 GLY B N   1 
ATOM   4083 C  CA  . GLY B 1 104 ? 23.047 95.678  16.829  1.00 23.88 ? 104 GLY B CA  1 
ATOM   4084 C  C   . GLY B 1 104 ? 22.998 94.999  18.183  1.00 25.37 ? 104 GLY B C   1 
ATOM   4085 O  O   . GLY B 1 104 ? 22.586 93.839  18.281  1.00 27.09 ? 104 GLY B O   1 
ATOM   4086 N  N   . GLU B 1 105 ? 23.407 95.702  19.232  1.00 24.48 ? 105 GLU B N   1 
ATOM   4087 C  CA  . GLU B 1 105 ? 23.372 95.126  20.570  1.00 25.25 ? 105 GLU B CA  1 
ATOM   4088 C  C   . GLU B 1 105 ? 21.928 95.013  21.050  1.00 25.29 ? 105 GLU B C   1 
ATOM   4089 O  O   . GLU B 1 105 ? 21.015 95.545  20.422  1.00 26.37 ? 105 GLU B O   1 
ATOM   4090 C  CB  . GLU B 1 105 ? 24.142 96.009  21.553  1.00 23.90 ? 105 GLU B CB  1 
ATOM   4091 C  CG  . GLU B 1 105 ? 25.606 96.196  21.222  1.00 24.31 ? 105 GLU B CG  1 
ATOM   4092 C  CD  . GLU B 1 105 ? 26.260 97.203  22.140  1.00 25.08 ? 105 GLU B CD  1 
ATOM   4093 O  OE1 . GLU B 1 105 ? 25.530 97.790  22.966  1.00 24.74 ? 105 GLU B OE1 1 
ATOM   4094 O  OE2 . GLU B 1 105 ? 27.490 97.411  22.038  1.00 25.54 ? 105 GLU B OE2 1 
ATOM   4095 N  N   . THR B 1 106 ? 21.717 94.306  22.154  1.00 25.73 ? 106 THR B N   1 
ATOM   4096 C  CA  . THR B 1 106 ? 20.378 94.203  22.720  1.00 26.74 ? 106 THR B CA  1 
ATOM   4097 C  C   . THR B 1 106 ? 20.460 95.080  23.960  1.00 27.71 ? 106 THR B C   1 
ATOM   4098 O  O   . THR B 1 106 ? 21.540 95.543  24.326  1.00 26.85 ? 106 THR B O   1 
ATOM   4099 C  CB  . THR B 1 106 ? 20.017 92.770  23.176  1.00 25.34 ? 106 THR B CB  1 
ATOM   4100 O  OG1 . THR B 1 106 ? 20.730 92.465  24.380  1.00 25.86 ? 106 THR B OG1 1 
ATOM   4101 C  CG2 . THR B 1 106 ? 20.364 91.753  22.102  1.00 22.44 ? 106 THR B CG2 1 
ATOM   4102 N  N   . ASP B 1 107 ? 19.331 95.305  24.613  1.00 29.77 ? 107 ASP B N   1 
ATOM   4103 C  CA  . ASP B 1 107 ? 19.327 96.126  25.811  1.00 31.70 ? 107 ASP B CA  1 
ATOM   4104 C  C   . ASP B 1 107 ? 20.167 95.489  26.917  1.00 32.36 ? 107 ASP B C   1 
ATOM   4105 O  O   . ASP B 1 107 ? 20.864 96.183  27.657  1.00 31.56 ? 107 ASP B O   1 
ATOM   4106 C  CB  . ASP B 1 107 ? 17.887 96.344  26.276  1.00 33.15 ? 107 ASP B CB  1 
ATOM   4107 C  CG  . ASP B 1 107 ? 17.067 97.141  25.269  1.00 36.46 ? 107 ASP B CG  1 
ATOM   4108 O  OD1 . ASP B 1 107 ? 16.918 96.683  24.114  1.00 40.92 ? 107 ASP B OD1 1 
ATOM   4109 O  OD2 . ASP B 1 107 ? 16.572 98.229  25.625  1.00 37.41 ? 107 ASP B OD2 1 
ATOM   4110 N  N   . GLU B 1 108 ? 20.116 94.165  27.017  1.00 33.70 ? 108 GLU B N   1 
ATOM   4111 C  CA  . GLU B 1 108 ? 20.879 93.461  28.044  1.00 34.40 ? 108 GLU B CA  1 
ATOM   4112 C  C   . GLU B 1 108 ? 22.363 93.543  27.730  1.00 32.42 ? 108 GLU B C   1 
ATOM   4113 O  O   . GLU B 1 108 ? 23.189 93.709  28.623  1.00 31.90 ? 108 GLU B O   1 
ATOM   4114 C  CB  . GLU B 1 108 ? 20.464 91.986  28.124  1.00 37.81 ? 108 GLU B CB  1 
ATOM   4115 C  CG  . GLU B 1 108 ? 18.961 91.739  28.239  1.00 44.15 ? 108 GLU B CG  1 
ATOM   4116 C  CD  . GLU B 1 108 ? 18.639 90.297  28.630  1.00 49.04 ? 108 GLU B CD  1 
ATOM   4117 O  OE1 . GLU B 1 108 ? 19.276 89.368  28.075  1.00 51.32 ? 108 GLU B OE1 1 
ATOM   4118 O  OE2 . GLU B 1 108 ? 17.745 90.094  29.486  1.00 49.42 ? 108 GLU B OE2 1 
ATOM   4119 N  N   . GLU B 1 109 ? 22.701 93.412  26.453  1.00 30.62 ? 109 GLU B N   1 
ATOM   4120 C  CA  . GLU B 1 109 ? 24.094 93.475  26.032  1.00 30.55 ? 109 GLU B CA  1 
ATOM   4121 C  C   . GLU B 1 109 ? 24.653 94.881  26.232  1.00 30.55 ? 109 GLU B C   1 
ATOM   4122 O  O   . GLU B 1 109 ? 25.787 95.055  26.680  1.00 31.29 ? 109 GLU B O   1 
ATOM   4123 C  CB  . GLU B 1 109 ? 24.213 93.087  24.563  1.00 30.65 ? 109 GLU B CB  1 
ATOM   4124 C  CG  . GLU B 1 109 ? 23.488 91.817  24.222  1.00 30.82 ? 109 GLU B CG  1 
ATOM   4125 C  CD  . GLU B 1 109 ? 23.770 91.342  22.820  1.00 32.95 ? 109 GLU B CD  1 
ATOM   4126 O  OE1 . GLU B 1 109 ? 23.536 92.103  21.849  1.00 31.15 ? 109 GLU B OE1 1 
ATOM   4127 O  OE2 . GLU B 1 109 ? 24.227 90.187  22.694  1.00 36.15 ? 109 GLU B OE2 1 
ATOM   4128 N  N   . TYR B 1 110 ? 23.851 95.882  25.887  1.00 30.37 ? 110 TYR B N   1 
ATOM   4129 C  CA  . TYR B 1 110 ? 24.256 97.270  26.038  1.00 30.75 ? 110 TYR B CA  1 
ATOM   4130 C  C   . TYR B 1 110 ? 24.697 97.493  27.477  1.00 31.65 ? 110 TYR B C   1 
ATOM   4131 O  O   . TYR B 1 110 ? 25.805 97.951  27.748  1.00 32.61 ? 110 TYR B O   1 
ATOM   4132 C  CB  . TYR B 1 110 ? 23.084 98.195  25.725  1.00 29.71 ? 110 TYR B CB  1 
ATOM   4133 C  CG  . TYR B 1 110 ? 23.409 99.651  25.916  1.00 28.59 ? 110 TYR B CG  1 
ATOM   4134 C  CD1 . TYR B 1 110 ? 24.146 100.348 24.961  1.00 28.67 ? 110 TYR B CD1 1 
ATOM   4135 C  CD2 . TYR B 1 110 ? 23.020 100.324 27.071  1.00 26.55 ? 110 TYR B CD2 1 
ATOM   4136 C  CE1 . TYR B 1 110 ? 24.493 101.679 25.150  1.00 26.08 ? 110 TYR B CE1 1 
ATOM   4137 C  CE2 . TYR B 1 110 ? 23.359 101.650 27.269  1.00 27.42 ? 110 TYR B CE2 1 
ATOM   4138 C  CZ  . TYR B 1 110 ? 24.099 102.320 26.304  1.00 27.08 ? 110 TYR B CZ  1 
ATOM   4139 O  OH  . TYR B 1 110 ? 24.456 103.627 26.505  1.00 27.44 ? 110 TYR B OH  1 
ATOM   4140 N  N   . LEU B 1 111 ? 23.806 97.161  28.397  1.00 32.21 ? 111 LEU B N   1 
ATOM   4141 C  CA  . LEU B 1 111 ? 24.070 97.313  29.816  1.00 33.01 ? 111 LEU B CA  1 
ATOM   4142 C  C   . LEU B 1 111 ? 25.305 96.493  30.197  1.00 32.22 ? 111 LEU B C   1 
ATOM   4143 O  O   . LEU B 1 111 ? 26.161 96.946  30.962  1.00 32.47 ? 111 LEU B O   1 
ATOM   4144 C  CB  . LEU B 1 111 ? 22.849 96.835  30.605  1.00 35.06 ? 111 LEU B CB  1 
ATOM   4145 C  CG  . LEU B 1 111 ? 22.780 97.105  32.108  1.00 39.57 ? 111 LEU B CG  1 
ATOM   4146 C  CD1 . LEU B 1 111 ? 22.708 98.616  32.362  1.00 39.73 ? 111 LEU B CD1 1 
ATOM   4147 C  CD2 . LEU B 1 111 ? 21.549 96.399  32.685  1.00 40.34 ? 111 LEU B CD2 1 
ATOM   4148 N  N   . TRP B 1 112 ? 25.392 95.288  29.644  1.00 30.21 ? 112 TRP B N   1 
ATOM   4149 C  CA  . TRP B 1 112 ? 26.504 94.396  29.921  1.00 28.65 ? 112 TRP B CA  1 
ATOM   4150 C  C   . TRP B 1 112 ? 27.830 94.999  29.477  1.00 28.82 ? 112 TRP B C   1 
ATOM   4151 O  O   . TRP B 1 112 ? 28.853 94.819  30.142  1.00 28.75 ? 112 TRP B O   1 
ATOM   4152 C  CB  . TRP B 1 112 ? 26.302 93.059  29.207  1.00 29.00 ? 112 TRP B CB  1 
ATOM   4153 C  CG  . TRP B 1 112 ? 27.465 92.120  29.377  1.00 28.46 ? 112 TRP B CG  1 
ATOM   4154 C  CD1 . TRP B 1 112 ? 27.692 91.271  30.425  1.00 26.76 ? 112 TRP B CD1 1 
ATOM   4155 C  CD2 . TRP B 1 112 ? 28.580 91.966  28.490  1.00 27.34 ? 112 TRP B CD2 1 
ATOM   4156 N  NE1 . TRP B 1 112 ? 28.877 90.601  30.243  1.00 25.57 ? 112 TRP B NE1 1 
ATOM   4157 C  CE2 . TRP B 1 112 ? 29.442 91.008  29.064  1.00 26.96 ? 112 TRP B CE2 1 
ATOM   4158 C  CE3 . TRP B 1 112 ? 28.933 92.547  27.268  1.00 27.02 ? 112 TRP B CE3 1 
ATOM   4159 C  CZ2 . TRP B 1 112 ? 30.635 90.616  28.457  1.00 27.43 ? 112 TRP B CZ2 1 
ATOM   4160 C  CZ3 . TRP B 1 112 ? 30.118 92.158  26.666  1.00 28.55 ? 112 TRP B CZ3 1 
ATOM   4161 C  CH2 . TRP B 1 112 ? 30.956 91.200  27.262  1.00 28.95 ? 112 TRP B CH2 1 
ATOM   4162 N  N   . CYS B 1 113 ? 27.813 95.704  28.347  1.00 27.33 ? 113 CYS B N   1 
ATOM   4163 C  CA  . CYS B 1 113 ? 29.025 96.329  27.821  1.00 26.17 ? 113 CYS B CA  1 
ATOM   4164 C  C   . CYS B 1 113 ? 29.562 97.449  28.724  1.00 25.40 ? 113 CYS B C   1 
ATOM   4165 O  O   . CYS B 1 113 ? 30.766 97.559  28.948  1.00 25.45 ? 113 CYS B O   1 
ATOM   4166 C  CB  . CYS B 1 113 ? 28.769 96.871  26.412  1.00 25.21 ? 113 CYS B CB  1 
ATOM   4167 S  SG  . CYS B 1 113 ? 28.561 95.598  25.137  1.00 26.07 ? 113 CYS B SG  1 
ATOM   4168 N  N   . ILE B 1 114 ? 28.672 98.279  29.244  1.00 24.27 ? 114 ILE B N   1 
ATOM   4169 C  CA  . ILE B 1 114 ? 29.104 99.358  30.109  1.00 25.20 ? 114 ILE B CA  1 
ATOM   4170 C  C   . ILE B 1 114 ? 29.707 98.760  31.376  1.00 26.59 ? 114 ILE B C   1 
ATOM   4171 O  O   . ILE B 1 114 ? 30.702 99.262  31.907  1.00 27.22 ? 114 ILE B O   1 
ATOM   4172 C  CB  . ILE B 1 114 ? 27.920 100.279 30.490  1.00 24.83 ? 114 ILE B CB  1 
ATOM   4173 C  CG1 . ILE B 1 114 ? 27.201 100.751 29.223  1.00 24.30 ? 114 ILE B CG1 1 
ATOM   4174 C  CG2 . ILE B 1 114 ? 28.426 101.486 31.262  1.00 23.76 ? 114 ILE B CG2 1 
ATOM   4175 C  CD1 . ILE B 1 114 ? 26.014 101.655 29.480  1.00 23.11 ? 114 ILE B CD1 1 
ATOM   4176 N  N   . GLU B 1 115 ? 29.111 97.673  31.853  1.00 27.17 ? 115 GLU B N   1 
ATOM   4177 C  CA  . GLU B 1 115 ? 29.600 97.026  33.062  1.00 27.88 ? 115 GLU B CA  1 
ATOM   4178 C  C   . GLU B 1 115 ? 31.018 96.479  32.907  1.00 27.31 ? 115 GLU B C   1 
ATOM   4179 O  O   . GLU B 1 115 ? 31.806 96.504  33.856  1.00 27.10 ? 115 GLU B O   1 
ATOM   4180 C  CB  . GLU B 1 115 ? 28.635 95.915  33.484  1.00 28.94 ? 115 GLU B CB  1 
ATOM   4181 C  CG  . GLU B 1 115 ? 27.258 96.455  33.858  1.00 30.32 ? 115 GLU B CG  1 
ATOM   4182 C  CD  . GLU B 1 115 ? 26.299 95.392  34.361  1.00 30.04 ? 115 GLU B CD  1 
ATOM   4183 O  OE1 . GLU B 1 115 ? 26.002 94.429  33.617  1.00 29.24 ? 115 GLU B OE1 1 
ATOM   4184 O  OE2 . GLU B 1 115 ? 25.835 95.531  35.511  1.00 32.46 ? 115 GLU B OE2 1 
ATOM   4185 N  N   . GLN B 1 116 ? 31.347 96.008  31.708  1.00 27.14 ? 116 GLN B N   1 
ATOM   4186 C  CA  . GLN B 1 116 ? 32.672 95.458  31.434  1.00 27.13 ? 116 GLN B CA  1 
ATOM   4187 C  C   . GLN B 1 116 ? 33.757 96.527  31.424  1.00 27.30 ? 116 GLN B C   1 
ATOM   4188 O  O   . GLN B 1 116 ? 34.944 96.216  31.345  1.00 28.48 ? 116 GLN B O   1 
ATOM   4189 C  CB  . GLN B 1 116 ? 32.678 94.727  30.089  1.00 27.69 ? 116 GLN B CB  1 
ATOM   4190 C  CG  . GLN B 1 116 ? 31.618 93.630  29.970  1.00 28.91 ? 116 GLN B CG  1 
ATOM   4191 C  CD  . GLN B 1 116 ? 31.555 92.739  31.207  1.00 28.34 ? 116 GLN B CD  1 
ATOM   4192 O  OE1 . GLN B 1 116 ? 32.534 92.081  31.566  1.00 27.83 ? 116 GLN B OE1 1 
ATOM   4193 N  NE2 . GLN B 1 116 ? 30.400 92.722  31.866  1.00 26.58 ? 116 GLN B NE2 1 
ATOM   4194 N  N   . THR B 1 117 ? 33.355 97.790  31.513  1.00 27.02 ? 117 THR B N   1 
ATOM   4195 C  CA  . THR B 1 117 ? 34.321 98.882  31.497  1.00 25.92 ? 117 THR B CA  1 
ATOM   4196 C  C   . THR B 1 117 ? 34.596 99.455  32.887  1.00 25.30 ? 117 THR B C   1 
ATOM   4197 O  O   . THR B 1 117 ? 35.578 100.165 33.083  1.00 27.04 ? 117 THR B O   1 
ATOM   4198 C  CB  . THR B 1 117 ? 33.842 100.038 30.582  1.00 25.40 ? 117 THR B CB  1 
ATOM   4199 O  OG1 . THR B 1 117 ? 32.713 100.687 31.181  1.00 25.15 ? 117 THR B OG1 1 
ATOM   4200 C  CG2 . THR B 1 117 ? 33.441 99.512  29.209  1.00 22.71 ? 117 THR B CG2 1 
ATOM   4201 N  N   . LEU B 1 118 ? 33.743 99.136  33.851  1.00 24.79 ? 118 LEU B N   1 
ATOM   4202 C  CA  . LEU B 1 118 ? 33.899 99.656  35.208  1.00 25.58 ? 118 LEU B CA  1 
ATOM   4203 C  C   . LEU B 1 118 ? 35.144 99.160  35.940  1.00 25.97 ? 118 LEU B C   1 
ATOM   4204 O  O   . LEU B 1 118 ? 35.710 99.879  36.765  1.00 27.06 ? 118 LEU B O   1 
ATOM   4205 C  CB  . LEU B 1 118 ? 32.666 99.316  36.052  1.00 24.67 ? 118 LEU B CB  1 
ATOM   4206 C  CG  . LEU B 1 118 ? 31.295 99.552  35.415  1.00 25.17 ? 118 LEU B CG  1 
ATOM   4207 C  CD1 . LEU B 1 118 ? 30.216 99.444  36.489  1.00 23.18 ? 118 LEU B CD1 1 
ATOM   4208 C  CD2 . LEU B 1 118 ? 31.266 100.924 34.748  1.00 24.87 ? 118 LEU B CD2 1 
ATOM   4209 N  N   . TYR B 1 119 ? 35.565 97.935  35.648  1.00 25.77 ? 119 TYR B N   1 
ATOM   4210 C  CA  . TYR B 1 119 ? 36.730 97.367  36.310  1.00 25.90 ? 119 TYR B CA  1 
ATOM   4211 C  C   . TYR B 1 119 ? 37.892 97.142  35.366  1.00 26.55 ? 119 TYR B C   1 
ATOM   4212 O  O   . TYR B 1 119 ? 37.747 96.524  34.317  1.00 26.27 ? 119 TYR B O   1 
ATOM   4213 C  CB  . TYR B 1 119 ? 36.344 96.057  36.999  1.00 24.28 ? 119 TYR B CB  1 
ATOM   4214 C  CG  . TYR B 1 119 ? 35.303 96.264  38.070  1.00 22.26 ? 119 TYR B CG  1 
ATOM   4215 C  CD1 . TYR B 1 119 ? 35.654 96.764  39.320  1.00 22.23 ? 119 TYR B CD1 1 
ATOM   4216 C  CD2 . TYR B 1 119 ? 33.960 96.017  37.810  1.00 21.35 ? 119 TYR B CD2 1 
ATOM   4217 C  CE1 . TYR B 1 119 ? 34.697 97.015  40.282  1.00 22.91 ? 119 TYR B CE1 1 
ATOM   4218 C  CE2 . TYR B 1 119 ? 32.995 96.263  38.757  1.00 22.36 ? 119 TYR B CE2 1 
ATOM   4219 C  CZ  . TYR B 1 119 ? 33.365 96.762  39.992  1.00 26.25 ? 119 TYR B CZ  1 
ATOM   4220 O  OH  . TYR B 1 119 ? 32.395 97.010  40.939  1.00 30.35 ? 119 TYR B OH  1 
ATOM   4221 N  N   . PHE B 1 120 ? 39.050 97.662  35.753  1.00 28.46 ? 120 PHE B N   1 
ATOM   4222 C  CA  . PHE B 1 120 ? 40.253 97.532  34.950  1.00 29.59 ? 120 PHE B CA  1 
ATOM   4223 C  C   . PHE B 1 120 ? 41.097 96.391  35.494  1.00 31.59 ? 120 PHE B C   1 
ATOM   4224 O  O   . PHE B 1 120 ? 40.780 95.807  36.534  1.00 33.11 ? 120 PHE B O   1 
ATOM   4225 C  CB  . PHE B 1 120 ? 41.060 98.839  34.978  1.00 28.63 ? 120 PHE B CB  1 
ATOM   4226 C  CG  . PHE B 1 120 ? 40.407 99.971  34.234  1.00 28.43 ? 120 PHE B CG  1 
ATOM   4227 C  CD1 . PHE B 1 120 ? 39.168 100.462 34.630  1.00 29.21 ? 120 PHE B CD1 1 
ATOM   4228 C  CD2 . PHE B 1 120 ? 41.021 100.533 33.127  1.00 26.50 ? 120 PHE B CD2 1 
ATOM   4229 C  CE1 . PHE B 1 120 ? 38.553 101.492 33.931  1.00 27.71 ? 120 PHE B CE1 1 
ATOM   4230 C  CE2 . PHE B 1 120 ? 40.414 101.559 32.428  1.00 26.40 ? 120 PHE B CE2 1 
ATOM   4231 C  CZ  . PHE B 1 120 ? 39.176 102.040 32.831  1.00 25.58 ? 120 PHE B CZ  1 
ATOM   4232 N  N   . LYS B 1 121 ? 42.170 96.078  34.783  1.00 31.68 ? 121 LYS B N   1 
ATOM   4233 C  CA  . LYS B 1 121 ? 43.067 95.010  35.188  1.00 32.25 ? 121 LYS B CA  1 
ATOM   4234 C  C   . LYS B 1 121 ? 43.553 95.169  36.632  1.00 33.24 ? 121 LYS B C   1 
ATOM   4235 O  O   . LYS B 1 121 ? 43.582 94.199  37.394  1.00 33.58 ? 121 LYS B O   1 
ATOM   4236 C  CB  . LYS B 1 121 ? 44.269 94.970  34.241  1.00 32.41 ? 121 LYS B CB  1 
ATOM   4237 C  CG  . LYS B 1 121 ? 45.259 93.853  34.510  1.00 33.95 ? 121 LYS B CG  1 
ATOM   4238 C  CD  . LYS B 1 121 ? 46.325 93.815  33.417  1.00 36.19 ? 121 LYS B CD  1 
ATOM   4239 C  CE  . LYS B 1 121 ? 47.175 95.092  33.410  1.00 37.80 ? 121 LYS B CE  1 
ATOM   4240 N  NZ  . LYS B 1 121 ? 47.979 95.263  34.668  1.00 36.14 ? 121 LYS B NZ  1 
ATOM   4241 N  N   . ASP B 1 122 ? 43.912 96.391  37.014  1.00 32.94 ? 122 ASP B N   1 
ATOM   4242 C  CA  . ASP B 1 122 ? 44.442 96.623  38.351  1.00 34.45 ? 122 ASP B CA  1 
ATOM   4243 C  C   . ASP B 1 122 ? 43.535 97.416  39.285  1.00 34.44 ? 122 ASP B C   1 
ATOM   4244 O  O   . ASP B 1 122 ? 43.993 97.964  40.288  1.00 35.25 ? 122 ASP B O   1 
ATOM   4245 C  CB  . ASP B 1 122 ? 45.802 97.320  38.241  1.00 36.52 ? 122 ASP B CB  1 
ATOM   4246 C  CG  . ASP B 1 122 ? 46.729 96.634  37.249  1.00 39.52 ? 122 ASP B CG  1 
ATOM   4247 O  OD1 . ASP B 1 122 ? 47.141 95.477  37.513  1.00 40.66 ? 122 ASP B OD1 1 
ATOM   4248 O  OD2 . ASP B 1 122 ? 47.037 97.252  36.203  1.00 39.69 ? 122 ASP B OD2 1 
ATOM   4249 N  N   . GLY B 1 123 ? 42.251 97.481  38.965  1.00 33.52 ? 123 GLY B N   1 
ATOM   4250 C  CA  . GLY B 1 123 ? 41.347 98.218  39.824  1.00 31.73 ? 123 GLY B CA  1 
ATOM   4251 C  C   . GLY B 1 123 ? 40.225 98.884  39.061  1.00 31.37 ? 123 GLY B C   1 
ATOM   4252 O  O   . GLY B 1 123 ? 40.245 98.942  37.826  1.00 29.44 ? 123 GLY B O   1 
ATOM   4253 N  N   . PRO B 1 124 ? 39.224 99.399  39.787  1.00 29.60 ? 124 PRO B N   1 
ATOM   4254 C  CA  . PRO B 1 124 ? 38.044 100.083 39.254  1.00 29.73 ? 124 PRO B CA  1 
ATOM   4255 C  C   . PRO B 1 124 ? 38.398 101.439 38.642  1.00 30.62 ? 124 PRO B C   1 
ATOM   4256 O  O   . PRO B 1 124 ? 39.474 101.992 38.910  1.00 30.55 ? 124 PRO B O   1 
ATOM   4257 C  CB  . PRO B 1 124 ? 37.143 100.203 40.479  1.00 28.43 ? 124 PRO B CB  1 
ATOM   4258 C  CG  . PRO B 1 124 ? 38.131 100.430 41.568  1.00 28.78 ? 124 PRO B CG  1 
ATOM   4259 C  CD  . PRO B 1 124 ? 39.210 99.407  41.259  1.00 28.55 ? 124 PRO B CD  1 
ATOM   4260 N  N   . LEU B 1 125 ? 37.491 101.965 37.820  1.00 29.51 ? 125 LEU B N   1 
ATOM   4261 C  CA  . LEU B 1 125 ? 37.699 103.247 37.154  1.00 28.48 ? 125 LEU B CA  1 
ATOM   4262 C  C   . LEU B 1 125 ? 37.839 104.372 38.170  1.00 28.43 ? 125 LEU B C   1 
ATOM   4263 O  O   . LEU B 1 125 ? 37.469 104.217 39.333  1.00 27.63 ? 125 LEU B O   1 
ATOM   4264 C  CB  . LEU B 1 125 ? 36.519 103.560 36.224  1.00 27.47 ? 125 LEU B CB  1 
ATOM   4265 C  CG  . LEU B 1 125 ? 35.236 104.091 36.886  1.00 27.38 ? 125 LEU B CG  1 
ATOM   4266 C  CD1 . LEU B 1 125 ? 34.213 104.436 35.815  1.00 22.06 ? 125 LEU B CD1 1 
ATOM   4267 C  CD2 . LEU B 1 125 ? 34.673 103.062 37.867  1.00 26.92 ? 125 LEU B CD2 1 
ATOM   4268 N  N   . ASN B 1 126 ? 38.383 105.502 37.727  1.00 28.74 ? 126 ASN B N   1 
ATOM   4269 C  CA  . ASN B 1 126 ? 38.536 106.669 38.592  1.00 28.47 ? 126 ASN B CA  1 
ATOM   4270 C  C   . ASN B 1 126 ? 38.125 107.925 37.827  1.00 28.33 ? 126 ASN B C   1 
ATOM   4271 O  O   . ASN B 1 126 ? 38.179 109.037 38.356  1.00 28.66 ? 126 ASN B O   1 
ATOM   4272 C  CB  . ASN B 1 126 ? 39.980 106.803 39.099  1.00 27.04 ? 126 ASN B CB  1 
ATOM   4273 C  CG  . ASN B 1 126 ? 41.010 106.745 37.981  1.00 27.62 ? 126 ASN B CG  1 
ATOM   4274 O  OD1 . ASN B 1 126 ? 40.847 107.370 36.928  1.00 27.50 ? 126 ASN B OD1 1 
ATOM   4275 N  ND2 . ASN B 1 126 ? 42.085 106.005 38.212  1.00 24.72 ? 126 ASN B ND2 1 
ATOM   4276 N  N   . MET B 1 127 ? 37.708 107.732 36.579  1.00 27.74 ? 127 MET B N   1 
ATOM   4277 C  CA  . MET B 1 127 ? 37.275 108.833 35.718  1.00 27.48 ? 127 MET B CA  1 
ATOM   4278 C  C   . MET B 1 127 ? 36.170 108.394 34.768  1.00 27.62 ? 127 MET B C   1 
ATOM   4279 O  O   . MET B 1 127 ? 36.225 107.301 34.199  1.00 29.22 ? 127 MET B O   1 
ATOM   4280 C  CB  . MET B 1 127 ? 38.449 109.372 34.894  1.00 25.87 ? 127 MET B CB  1 
ATOM   4281 C  CG  . MET B 1 127 ? 39.403 110.270 35.665  1.00 25.04 ? 127 MET B CG  1 
ATOM   4282 S  SD  . MET B 1 127 ? 38.589 111.746 36.302  1.00 25.62 ? 127 MET B SD  1 
ATOM   4283 C  CE  . MET B 1 127 ? 38.569 112.818 34.876  1.00 24.36 ? 127 MET B CE  1 
ATOM   4284 N  N   . ILE B 1 128 ? 35.172 109.253 34.592  1.00 27.65 ? 128 ILE B N   1 
ATOM   4285 C  CA  . ILE B 1 128 ? 34.060 108.953 33.699  1.00 26.32 ? 128 ILE B CA  1 
ATOM   4286 C  C   . ILE B 1 128 ? 33.957 109.943 32.540  1.00 25.62 ? 128 ILE B C   1 
ATOM   4287 O  O   . ILE B 1 128 ? 33.913 111.155 32.740  1.00 24.87 ? 128 ILE B O   1 
ATOM   4288 C  CB  . ILE B 1 128 ? 32.705 108.988 34.432  1.00 26.51 ? 128 ILE B CB  1 
ATOM   4289 C  CG1 . ILE B 1 128 ? 32.694 108.017 35.605  1.00 25.33 ? 128 ILE B CG1 1 
ATOM   4290 C  CG2 . ILE B 1 128 ? 31.595 108.623 33.464  1.00 27.22 ? 128 ILE B CG2 1 
ATOM   4291 C  CD1 . ILE B 1 128 ? 31.395 108.072 36.397  1.00 23.97 ? 128 ILE B CD1 1 
ATOM   4292 N  N   . LEU B 1 129 ? 33.927 109.409 31.327  1.00 24.97 ? 129 LEU B N   1 
ATOM   4293 C  CA  . LEU B 1 129 ? 33.780 110.219 30.127  1.00 24.72 ? 129 LEU B CA  1 
ATOM   4294 C  C   . LEU B 1 129 ? 32.454 109.675 29.594  1.00 24.96 ? 129 LEU B C   1 
ATOM   4295 O  O   . LEU B 1 129 ? 32.374 108.528 29.152  1.00 26.00 ? 129 LEU B O   1 
ATOM   4296 C  CB  . LEU B 1 129 ? 34.944 109.957 29.162  1.00 23.69 ? 129 LEU B CB  1 
ATOM   4297 C  CG  . LEU B 1 129 ? 35.084 110.823 27.903  1.00 23.81 ? 129 LEU B CG  1 
ATOM   4298 C  CD1 . LEU B 1 129 ? 36.541 110.815 27.443  1.00 22.85 ? 129 LEU B CD1 1 
ATOM   4299 C  CD2 . LEU B 1 129 ? 34.151 110.315 26.804  1.00 20.71 ? 129 LEU B CD2 1 
ATOM   4300 N  N   . ASP B 1 130 ? 31.411 110.495 29.664  1.00 23.59 ? 130 ASP B N   1 
ATOM   4301 C  CA  . ASP B 1 130 ? 30.083 110.063 29.266  1.00 21.78 ? 130 ASP B CA  1 
ATOM   4302 C  C   . ASP B 1 130 ? 29.446 110.876 28.148  1.00 22.51 ? 130 ASP B C   1 
ATOM   4303 O  O   . ASP B 1 130 ? 29.801 112.027 27.902  1.00 22.41 ? 130 ASP B O   1 
ATOM   4304 C  CB  . ASP B 1 130 ? 29.164 110.120 30.489  1.00 21.75 ? 130 ASP B CB  1 
ATOM   4305 C  CG  . ASP B 1 130 ? 28.133 109.009 30.512  1.00 21.97 ? 130 ASP B CG  1 
ATOM   4306 O  OD1 . ASP B 1 130 ? 27.841 108.416 29.451  1.00 22.32 ? 130 ASP B OD1 1 
ATOM   4307 O  OD2 . ASP B 1 130 ? 27.604 108.738 31.610  1.00 22.65 ? 130 ASP B OD2 1 
ATOM   4308 N  N   . ASP B 1 131 ? 28.489 110.246 27.479  1.00 22.85 ? 131 ASP B N   1 
ATOM   4309 C  CA  . ASP B 1 131 ? 27.728 110.876 26.415  1.00 24.00 ? 131 ASP B CA  1 
ATOM   4310 C  C   . ASP B 1 131 ? 26.293 110.359 26.543  1.00 24.39 ? 131 ASP B C   1 
ATOM   4311 O  O   . ASP B 1 131 ? 25.926 109.353 25.926  1.00 26.09 ? 131 ASP B O   1 
ATOM   4312 C  CB  . ASP B 1 131 ? 28.297 110.517 25.041  1.00 23.51 ? 131 ASP B CB  1 
ATOM   4313 C  CG  . ASP B 1 131 ? 27.548 111.201 23.909  1.00 23.63 ? 131 ASP B CG  1 
ATOM   4314 O  OD1 . ASP B 1 131 ? 26.366 110.863 23.670  1.00 20.84 ? 131 ASP B OD1 1 
ATOM   4315 O  OD2 . ASP B 1 131 ? 28.143 112.090 23.265  1.00 24.59 ? 131 ASP B OD2 1 
ATOM   4316 N  N   . GLY B 1 132 ? 25.498 111.040 27.366  1.00 22.57 ? 132 GLY B N   1 
ATOM   4317 C  CA  . GLY B 1 132 ? 24.120 110.640 27.572  1.00 20.81 ? 132 GLY B CA  1 
ATOM   4318 C  C   . GLY B 1 132 ? 23.806 110.418 29.037  1.00 21.34 ? 132 GLY B C   1 
ATOM   4319 O  O   . GLY B 1 132 ? 22.644 110.407 29.434  1.00 21.80 ? 132 GLY B O   1 
ATOM   4320 N  N   . GLY B 1 133 ? 24.841 110.231 29.847  1.00 21.08 ? 133 GLY B N   1 
ATOM   4321 C  CA  . GLY B 1 133 ? 24.623 110.017 31.264  1.00 22.18 ? 133 GLY B CA  1 
ATOM   4322 C  C   . GLY B 1 133 ? 24.335 108.582 31.675  1.00 23.31 ? 133 GLY B C   1 
ATOM   4323 O  O   . GLY B 1 133 ? 24.081 108.318 32.852  1.00 23.42 ? 133 GLY B O   1 
ATOM   4324 N  N   . ASP B 1 134 ? 24.370 107.652 30.722  1.00 24.26 ? 134 ASP B N   1 
ATOM   4325 C  CA  . ASP B 1 134 ? 24.118 106.243 31.026  1.00 24.51 ? 134 ASP B CA  1 
ATOM   4326 C  C   . ASP B 1 134 ? 25.132 105.697 32.015  1.00 26.15 ? 134 ASP B C   1 
ATOM   4327 O  O   . ASP B 1 134 ? 24.770 105.183 33.074  1.00 28.73 ? 134 ASP B O   1 
ATOM   4328 C  CB  . ASP B 1 134 ? 24.164 105.392 29.757  1.00 22.62 ? 134 ASP B CB  1 
ATOM   4329 C  CG  . ASP B 1 134 ? 22.822 105.290 29.086  1.00 21.16 ? 134 ASP B CG  1 
ATOM   4330 O  OD1 . ASP B 1 134 ? 21.851 105.836 29.650  1.00 20.70 ? 134 ASP B OD1 1 
ATOM   4331 O  OD2 . ASP B 1 134 ? 22.734 104.664 28.007  1.00 19.58 ? 134 ASP B OD2 1 
ATOM   4332 N  N   . LEU B 1 135 ? 26.403 105.805 31.648  1.00 26.03 ? 135 LEU B N   1 
ATOM   4333 C  CA  . LEU B 1 135 ? 27.501 105.331 32.472  1.00 25.69 ? 135 LEU B CA  1 
ATOM   4334 C  C   . LEU B 1 135 ? 27.453 106.005 33.835  1.00 26.55 ? 135 LEU B C   1 
ATOM   4335 O  O   . LEU B 1 135 ? 27.686 105.378 34.872  1.00 27.38 ? 135 LEU B O   1 
ATOM   4336 C  CB  . LEU B 1 135 ? 28.825 105.645 31.777  1.00 26.65 ? 135 LEU B CB  1 
ATOM   4337 C  CG  . LEU B 1 135 ? 30.123 105.369 32.532  1.00 27.87 ? 135 LEU B CG  1 
ATOM   4338 C  CD1 . LEU B 1 135 ? 30.161 103.916 32.998  1.00 27.68 ? 135 LEU B CD1 1 
ATOM   4339 C  CD2 . LEU B 1 135 ? 31.302 105.683 31.621  1.00 27.13 ? 135 LEU B CD2 1 
ATOM   4340 N  N   . THR B 1 136 ? 27.137 107.292 33.830  1.00 26.47 ? 136 THR B N   1 
ATOM   4341 C  CA  . THR B 1 136 ? 27.061 108.046 35.068  1.00 25.85 ? 136 THR B CA  1 
ATOM   4342 C  C   . THR B 1 136 ? 25.947 107.487 35.952  1.00 26.63 ? 136 THR B C   1 
ATOM   4343 O  O   . THR B 1 136 ? 26.137 107.308 37.157  1.00 27.01 ? 136 THR B O   1 
ATOM   4344 C  CB  . THR B 1 136 ? 26.799 109.543 34.783  1.00 24.08 ? 136 THR B CB  1 
ATOM   4345 O  OG1 . THR B 1 136 ? 27.821 110.045 33.914  1.00 21.36 ? 136 THR B OG1 1 
ATOM   4346 C  CG2 . THR B 1 136 ? 26.795 110.342 36.075  1.00 21.03 ? 136 THR B CG2 1 
ATOM   4347 N  N   . ASN B 1 137 ? 24.792 107.205 35.348  1.00 26.66 ? 137 ASN B N   1 
ATOM   4348 C  CA  . ASN B 1 137 ? 23.658 106.670 36.093  1.00 28.08 ? 137 ASN B CA  1 
ATOM   4349 C  C   . ASN B 1 137 ? 23.905 105.249 36.573  1.00 27.67 ? 137 ASN B C   1 
ATOM   4350 O  O   . ASN B 1 137 ? 23.651 104.928 37.737  1.00 27.73 ? 137 ASN B O   1 
ATOM   4351 C  CB  . ASN B 1 137 ? 22.384 106.700 35.245  1.00 30.28 ? 137 ASN B CB  1 
ATOM   4352 C  CG  . ASN B 1 137 ? 21.850 108.105 35.048  1.00 32.11 ? 137 ASN B CG  1 
ATOM   4353 O  OD1 . ASN B 1 137 ? 21.790 108.895 35.991  1.00 32.80 ? 137 ASN B OD1 1 
ATOM   4354 N  ND2 . ASN B 1 137 ? 21.447 108.421 33.823  1.00 32.52 ? 137 ASN B ND2 1 
ATOM   4355 N  N   . LEU B 1 138 ? 24.398 104.403 35.671  1.00 26.25 ? 138 LEU B N   1 
ATOM   4356 C  CA  . LEU B 1 138 ? 24.683 103.016 36.001  1.00 25.17 ? 138 LEU B CA  1 
ATOM   4357 C  C   . LEU B 1 138 ? 25.482 102.932 37.296  1.00 25.58 ? 138 LEU B C   1 
ATOM   4358 O  O   . LEU B 1 138 ? 25.107 102.203 38.214  1.00 26.35 ? 138 LEU B O   1 
ATOM   4359 C  CB  . LEU B 1 138 ? 25.468 102.346 34.870  1.00 25.22 ? 138 LEU B CB  1 
ATOM   4360 C  CG  . LEU B 1 138 ? 25.767 100.850 35.070  1.00 26.32 ? 138 LEU B CG  1 
ATOM   4361 C  CD1 . LEU B 1 138 ? 24.461 100.067 35.021  1.00 24.86 ? 138 LEU B CD1 1 
ATOM   4362 C  CD2 . LEU B 1 138 ? 26.735 100.346 34.000  1.00 24.15 ? 138 LEU B CD2 1 
ATOM   4363 N  N   . ILE B 1 139 ? 26.575 103.688 37.371  1.00 24.25 ? 139 ILE B N   1 
ATOM   4364 C  CA  . ILE B 1 139 ? 27.425 103.685 38.554  1.00 23.02 ? 139 ILE B CA  1 
ATOM   4365 C  C   . ILE B 1 139 ? 26.738 104.233 39.792  1.00 23.37 ? 139 ILE B C   1 
ATOM   4366 O  O   . ILE B 1 139 ? 26.752 103.594 40.840  1.00 22.52 ? 139 ILE B O   1 
ATOM   4367 C  CB  . ILE B 1 139 ? 28.716 104.494 38.324  1.00 22.06 ? 139 ILE B CB  1 
ATOM   4368 C  CG1 . ILE B 1 139 ? 29.527 103.867 37.192  1.00 20.46 ? 139 ILE B CG1 1 
ATOM   4369 C  CG2 . ILE B 1 139 ? 29.551 104.522 39.597  1.00 20.40 ? 139 ILE B CG2 1 
ATOM   4370 C  CD1 . ILE B 1 139 ? 30.800 104.605 36.902  1.00 20.21 ? 139 ILE B CD1 1 
ATOM   4371 N  N   . HIS B 1 140 ? 26.140 105.415 39.682  1.00 25.11 ? 140 HIS B N   1 
ATOM   4372 C  CA  . HIS B 1 140 ? 25.463 106.008 40.834  1.00 26.38 ? 140 HIS B CA  1 
ATOM   4373 C  C   . HIS B 1 140 ? 24.350 105.115 41.373  1.00 26.82 ? 140 HIS B C   1 
ATOM   4374 O  O   . HIS B 1 140 ? 24.188 104.989 42.585  1.00 27.72 ? 140 HIS B O   1 
ATOM   4375 C  CB  . HIS B 1 140 ? 24.870 107.378 40.487  1.00 25.04 ? 140 HIS B CB  1 
ATOM   4376 C  CG  . HIS B 1 140 ? 25.853 108.506 40.563  1.00 26.43 ? 140 HIS B CG  1 
ATOM   4377 N  ND1 . HIS B 1 140 ? 26.707 108.825 39.529  1.00 26.99 ? 140 HIS B ND1 1 
ATOM   4378 C  CD2 . HIS B 1 140 ? 26.117 109.392 41.554  1.00 26.56 ? 140 HIS B CD2 1 
ATOM   4379 C  CE1 . HIS B 1 140 ? 27.453 109.858 39.880  1.00 26.85 ? 140 HIS B CE1 1 
ATOM   4380 N  NE2 . HIS B 1 140 ? 27.115 110.221 41.104  1.00 26.55 ? 140 HIS B NE2 1 
ATOM   4381 N  N   . THR B 1 141 ? 23.594 104.487 40.478  1.00 26.79 ? 141 THR B N   1 
ATOM   4382 C  CA  . THR B 1 141 ? 22.492 103.637 40.903  1.00 28.87 ? 141 THR B CA  1 
ATOM   4383 C  C   . THR B 1 141 ? 22.851 102.182 41.197  1.00 29.37 ? 141 THR B C   1 
ATOM   4384 O  O   . THR B 1 141 ? 22.397 101.625 42.195  1.00 30.05 ? 141 THR B O   1 
ATOM   4385 C  CB  . THR B 1 141 ? 21.325 103.654 39.873  1.00 29.24 ? 141 THR B CB  1 
ATOM   4386 O  OG1 . THR B 1 141 ? 21.821 103.310 38.577  1.00 30.81 ? 141 THR B OG1 1 
ATOM   4387 C  CG2 . THR B 1 141 ? 20.670 105.032 39.817  1.00 28.72 ? 141 THR B CG2 1 
ATOM   4388 N  N   . LYS B 1 142 ? 23.669 101.566 40.351  1.00 29.64 ? 142 LYS B N   1 
ATOM   4389 C  CA  . LYS B 1 142 ? 24.027 100.168 40.563  1.00 29.07 ? 142 LYS B CA  1 
ATOM   4390 C  C   . LYS B 1 142 ? 25.408 99.929  41.169  1.00 28.32 ? 142 LYS B C   1 
ATOM   4391 O  O   . LYS B 1 142 ? 25.678 98.844  41.676  1.00 29.10 ? 142 LYS B O   1 
ATOM   4392 C  CB  . LYS B 1 142 ? 23.901 99.389  39.251  1.00 29.79 ? 142 LYS B CB  1 
ATOM   4393 C  CG  . LYS B 1 142 ? 24.007 97.877  39.425  1.00 33.82 ? 142 LYS B CG  1 
ATOM   4394 C  CD  . LYS B 1 142 ? 23.801 97.124  38.111  1.00 35.16 ? 142 LYS B CD  1 
ATOM   4395 C  CE  . LYS B 1 142 ? 23.823 95.614  38.340  1.00 35.43 ? 142 LYS B CE  1 
ATOM   4396 N  NZ  . LYS B 1 142 ? 23.575 94.847  37.086  1.00 34.14 ? 142 LYS B NZ  1 
ATOM   4397 N  N   . TYR B 1 143 ? 26.282 100.928 41.123  1.00 27.83 ? 143 TYR B N   1 
ATOM   4398 C  CA  . TYR B 1 143 ? 27.622 100.771 41.682  1.00 26.70 ? 143 TYR B CA  1 
ATOM   4399 C  C   . TYR B 1 143 ? 28.020 101.950 42.556  1.00 27.47 ? 143 TYR B C   1 
ATOM   4400 O  O   . TYR B 1 143 ? 29.108 102.505 42.408  1.00 29.70 ? 143 TYR B O   1 
ATOM   4401 C  CB  . TYR B 1 143 ? 28.658 100.604 40.568  1.00 25.04 ? 143 TYR B CB  1 
ATOM   4402 C  CG  . TYR B 1 143 ? 28.401 99.429  39.653  1.00 26.44 ? 143 TYR B CG  1 
ATOM   4403 C  CD1 . TYR B 1 143 ? 27.338 99.442  38.756  1.00 25.82 ? 143 TYR B CD1 1 
ATOM   4404 C  CD2 . TYR B 1 143 ? 29.208 98.292  39.703  1.00 27.10 ? 143 TYR B CD2 1 
ATOM   4405 C  CE1 . TYR B 1 143 ? 27.077 98.358  37.935  1.00 27.46 ? 143 TYR B CE1 1 
ATOM   4406 C  CE2 . TYR B 1 143 ? 28.960 97.197  38.883  1.00 28.00 ? 143 TYR B CE2 1 
ATOM   4407 C  CZ  . TYR B 1 143 ? 27.890 97.235  38.000  1.00 28.90 ? 143 TYR B CZ  1 
ATOM   4408 O  OH  . TYR B 1 143 ? 27.635 96.158  37.177  1.00 27.26 ? 143 TYR B OH  1 
ATOM   4409 N  N   . PRO B 1 144 ? 27.146 102.353 43.487  1.00 27.14 ? 144 PRO B N   1 
ATOM   4410 C  CA  . PRO B 1 144 ? 27.529 103.488 44.329  1.00 26.72 ? 144 PRO B CA  1 
ATOM   4411 C  C   . PRO B 1 144 ? 28.867 103.286 45.041  1.00 27.16 ? 144 PRO B C   1 
ATOM   4412 O  O   . PRO B 1 144 ? 29.577 104.250 45.317  1.00 27.59 ? 144 PRO B O   1 
ATOM   4413 C  CB  . PRO B 1 144 ? 26.347 103.617 45.293  1.00 26.01 ? 144 PRO B CB  1 
ATOM   4414 C  CG  . PRO B 1 144 ? 25.777 102.224 45.340  1.00 25.28 ? 144 PRO B CG  1 
ATOM   4415 C  CD  . PRO B 1 144 ? 25.847 101.798 43.901  1.00 26.00 ? 144 PRO B CD  1 
ATOM   4416 N  N   . GLN B 1 145 ? 29.210 102.032 45.323  1.00 28.05 ? 145 GLN B N   1 
ATOM   4417 C  CA  . GLN B 1 145 ? 30.461 101.701 46.010  1.00 28.40 ? 145 GLN B CA  1 
ATOM   4418 C  C   . GLN B 1 145 ? 31.701 102.183 45.255  1.00 29.37 ? 145 GLN B C   1 
ATOM   4419 O  O   . GLN B 1 145 ? 32.760 102.384 45.855  1.00 30.73 ? 145 GLN B O   1 
ATOM   4420 C  CB  . GLN B 1 145 ? 30.573 100.187 46.225  1.00 26.93 ? 145 GLN B CB  1 
ATOM   4421 C  CG  . GLN B 1 145 ? 30.601 99.382  44.932  1.00 26.03 ? 145 GLN B CG  1 
ATOM   4422 C  CD  . GLN B 1 145 ? 29.217 98.977  44.448  1.00 26.27 ? 145 GLN B CD  1 
ATOM   4423 O  OE1 . GLN B 1 145 ? 28.213 99.618  44.770  1.00 25.47 ? 145 GLN B OE1 1 
ATOM   4424 N  NE2 . GLN B 1 145 ? 29.161 97.911  43.657  1.00 25.64 ? 145 GLN B NE2 1 
ATOM   4425 N  N   . LEU B 1 146 ? 31.572 102.359 43.943  1.00 28.73 ? 146 LEU B N   1 
ATOM   4426 C  CA  . LEU B 1 146 ? 32.692 102.812 43.123  1.00 28.65 ? 146 LEU B CA  1 
ATOM   4427 C  C   . LEU B 1 146 ? 32.812 104.341 43.044  1.00 28.35 ? 146 LEU B C   1 
ATOM   4428 O  O   . LEU B 1 146 ? 33.841 104.871 42.616  1.00 28.13 ? 146 LEU B O   1 
ATOM   4429 C  CB  . LEU B 1 146 ? 32.569 102.231 41.708  1.00 28.99 ? 146 LEU B CB  1 
ATOM   4430 C  CG  . LEU B 1 146 ? 32.606 100.701 41.609  1.00 29.65 ? 146 LEU B CG  1 
ATOM   4431 C  CD1 . LEU B 1 146 ? 32.458 100.264 40.155  1.00 27.90 ? 146 LEU B CD1 1 
ATOM   4432 C  CD2 . LEU B 1 146 ? 33.911 100.186 42.194  1.00 27.57 ? 146 LEU B CD2 1 
ATOM   4433 N  N   . LEU B 1 147 ? 31.764 105.041 43.469  1.00 27.32 ? 147 LEU B N   1 
ATOM   4434 C  CA  . LEU B 1 147 ? 31.742 106.500 43.428  1.00 26.07 ? 147 LEU B CA  1 
ATOM   4435 C  C   . LEU B 1 147 ? 32.900 107.219 44.130  1.00 26.46 ? 147 LEU B C   1 
ATOM   4436 O  O   . LEU B 1 147 ? 33.520 108.111 43.552  1.00 26.55 ? 147 LEU B O   1 
ATOM   4437 C  CB  . LEU B 1 147 ? 30.401 107.017 43.973  1.00 23.62 ? 147 LEU B CB  1 
ATOM   4438 C  CG  . LEU B 1 147 ? 29.146 106.664 43.158  1.00 23.11 ? 147 LEU B CG  1 
ATOM   4439 C  CD1 . LEU B 1 147 ? 27.888 107.110 43.903  1.00 20.30 ? 147 LEU B CD1 1 
ATOM   4440 C  CD2 . LEU B 1 147 ? 29.221 107.321 41.778  1.00 20.58 ? 147 LEU B CD2 1 
ATOM   4441 N  N   . PRO B 1 148 ? 33.218 106.842 45.379  1.00 27.78 ? 148 PRO B N   1 
ATOM   4442 C  CA  . PRO B 1 148 ? 34.326 107.556 46.028  1.00 26.75 ? 148 PRO B CA  1 
ATOM   4443 C  C   . PRO B 1 148 ? 35.696 107.527 45.345  1.00 26.48 ? 148 PRO B C   1 
ATOM   4444 O  O   . PRO B 1 148 ? 36.509 108.427 45.551  1.00 27.76 ? 148 PRO B O   1 
ATOM   4445 C  CB  . PRO B 1 148 ? 34.341 106.973 47.452  1.00 26.30 ? 148 PRO B CB  1 
ATOM   4446 C  CG  . PRO B 1 148 ? 33.624 105.659 47.327  1.00 26.36 ? 148 PRO B CG  1 
ATOM   4447 C  CD  . PRO B 1 148 ? 32.541 105.933 46.325  1.00 26.93 ? 148 PRO B CD  1 
ATOM   4448 N  N   . GLY B 1 149 ? 35.954 106.520 44.520  1.00 26.46 ? 149 GLY B N   1 
ATOM   4449 C  CA  . GLY B 1 149 ? 37.243 106.444 43.852  1.00 25.31 ? 149 GLY B CA  1 
ATOM   4450 C  C   . GLY B 1 149 ? 37.245 107.048 42.461  1.00 27.02 ? 149 GLY B C   1 
ATOM   4451 O  O   . GLY B 1 149 ? 38.189 106.859 41.686  1.00 26.84 ? 149 GLY B O   1 
ATOM   4452 N  N   . ILE B 1 150 ? 36.177 107.766 42.133  1.00 28.10 ? 150 ILE B N   1 
ATOM   4453 C  CA  . ILE B 1 150 ? 36.058 108.416 40.830  1.00 29.06 ? 150 ILE B CA  1 
ATOM   4454 C  C   . ILE B 1 150 ? 36.299 109.911 41.042  1.00 29.41 ? 150 ILE B C   1 
ATOM   4455 O  O   . ILE B 1 150 ? 35.535 110.583 41.741  1.00 29.51 ? 150 ILE B O   1 
ATOM   4456 C  CB  . ILE B 1 150 ? 34.654 108.190 40.211  1.00 28.82 ? 150 ILE B CB  1 
ATOM   4457 C  CG1 . ILE B 1 150 ? 34.433 106.697 39.944  1.00 28.38 ? 150 ILE B CG1 1 
ATOM   4458 C  CG2 . ILE B 1 150 ? 34.520 108.976 38.919  1.00 28.65 ? 150 ILE B CG2 1 
ATOM   4459 C  CD1 . ILE B 1 150 ? 33.051 106.357 39.403  1.00 25.91 ? 150 ILE B CD1 1 
ATOM   4460 N  N   . ARG B 1 151 ? 37.370 110.419 40.441  1.00 28.96 ? 151 ARG B N   1 
ATOM   4461 C  CA  . ARG B 1 151 ? 37.737 111.818 40.585  1.00 29.35 ? 151 ARG B CA  1 
ATOM   4462 C  C   . ARG B 1 151 ? 36.808 112.797 39.877  1.00 30.00 ? 151 ARG B C   1 
ATOM   4463 O  O   . ARG B 1 151 ? 36.412 113.808 40.464  1.00 30.57 ? 151 ARG B O   1 
ATOM   4464 C  CB  . ARG B 1 151 ? 39.175 112.032 40.105  1.00 29.85 ? 151 ARG B CB  1 
ATOM   4465 C  CG  . ARG B 1 151 ? 39.669 113.475 40.232  1.00 29.70 ? 151 ARG B CG  1 
ATOM   4466 C  CD  . ARG B 1 151 ? 41.174 113.519 40.124  1.00 28.63 ? 151 ARG B CD  1 
ATOM   4467 N  NE  . ARG B 1 151 ? 41.802 112.848 41.258  1.00 28.82 ? 151 ARG B NE  1 
ATOM   4468 C  CZ  . ARG B 1 151 ? 43.078 112.476 41.294  1.00 30.04 ? 151 ARG B CZ  1 
ATOM   4469 N  NH1 . ARG B 1 151 ? 43.866 112.704 40.250  1.00 29.60 ? 151 ARG B NH1 1 
ATOM   4470 N  NH2 . ARG B 1 151 ? 43.570 111.884 42.378  1.00 29.43 ? 151 ARG B NH2 1 
ATOM   4471 N  N   . GLY B 1 152 ? 36.461 112.502 38.625  1.00 28.71 ? 152 GLY B N   1 
ATOM   4472 C  CA  . GLY B 1 152 ? 35.586 113.391 37.887  1.00 26.84 ? 152 GLY B CA  1 
ATOM   4473 C  C   . GLY B 1 152 ? 34.785 112.784 36.748  1.00 26.78 ? 152 GLY B C   1 
ATOM   4474 O  O   . GLY B 1 152 ? 35.028 111.649 36.315  1.00 25.11 ? 152 GLY B O   1 
ATOM   4475 N  N   . ILE B 1 153 ? 33.825 113.570 36.266  1.00 26.30 ? 153 ILE B N   1 
ATOM   4476 C  CA  . ILE B 1 153 ? 32.936 113.190 35.170  1.00 26.89 ? 153 ILE B CA  1 
ATOM   4477 C  C   . ILE B 1 153 ? 32.890 114.321 34.153  1.00 25.64 ? 153 ILE B C   1 
ATOM   4478 O  O   . ILE B 1 153 ? 32.893 115.497 34.523  1.00 26.40 ? 153 ILE B O   1 
ATOM   4479 C  CB  . ILE B 1 153 ? 31.469 113.011 35.641  1.00 28.38 ? 153 ILE B CB  1 
ATOM   4480 C  CG1 . ILE B 1 153 ? 31.358 111.917 36.694  1.00 29.52 ? 153 ILE B CG1 1 
ATOM   4481 C  CG2 . ILE B 1 153 ? 30.574 112.705 34.452  1.00 27.88 ? 153 ILE B CG2 1 
ATOM   4482 C  CD1 . ILE B 1 153 ? 29.958 111.839 37.303  1.00 30.02 ? 153 ILE B CD1 1 
ATOM   4483 N  N   . SER B 1 154 ? 32.844 113.970 32.874  1.00 24.65 ? 154 SER B N   1 
ATOM   4484 C  CA  . SER B 1 154 ? 32.729 114.972 31.823  1.00 24.62 ? 154 SER B CA  1 
ATOM   4485 C  C   . SER B 1 154 ? 31.550 114.515 30.957  1.00 24.51 ? 154 SER B C   1 
ATOM   4486 O  O   . SER B 1 154 ? 31.456 113.343 30.578  1.00 23.70 ? 154 SER B O   1 
ATOM   4487 C  CB  . SER B 1 154 ? 34.029 115.092 31.009  1.00 23.17 ? 154 SER B CB  1 
ATOM   4488 O  OG  . SER B 1 154 ? 34.325 113.911 30.290  1.00 26.66 ? 154 SER B OG  1 
ATOM   4489 N  N   . GLU B 1 155 ? 30.637 115.440 30.680  1.00 24.46 ? 155 GLU B N   1 
ATOM   4490 C  CA  . GLU B 1 155 ? 29.438 115.147 29.898  1.00 24.48 ? 155 GLU B CA  1 
ATOM   4491 C  C   . GLU B 1 155 ? 29.280 116.121 28.717  1.00 24.63 ? 155 GLU B C   1 
ATOM   4492 O  O   . GLU B 1 155 ? 29.408 117.338 28.872  1.00 23.35 ? 155 GLU B O   1 
ATOM   4493 C  CB  . GLU B 1 155 ? 28.217 115.213 30.829  1.00 22.99 ? 155 GLU B CB  1 
ATOM   4494 C  CG  . GLU B 1 155 ? 26.872 115.051 30.157  1.00 21.67 ? 155 GLU B CG  1 
ATOM   4495 C  CD  . GLU B 1 155 ? 26.705 113.696 29.512  1.00 22.06 ? 155 GLU B CD  1 
ATOM   4496 O  OE1 . GLU B 1 155 ? 26.967 112.684 30.191  1.00 23.50 ? 155 GLU B OE1 1 
ATOM   4497 O  OE2 . GLU B 1 155 ? 26.308 113.641 28.331  1.00 22.09 ? 155 GLU B OE2 1 
ATOM   4498 N  N   . GLU B 1 156 ? 28.984 115.583 27.539  1.00 24.95 ? 156 GLU B N   1 
ATOM   4499 C  CA  . GLU B 1 156 ? 28.838 116.424 26.359  1.00 26.03 ? 156 GLU B CA  1 
ATOM   4500 C  C   . GLU B 1 156 ? 27.448 116.499 25.748  1.00 26.29 ? 156 GLU B C   1 
ATOM   4501 O  O   . GLU B 1 156 ? 27.282 117.096 24.684  1.00 27.97 ? 156 GLU B O   1 
ATOM   4502 C  CB  . GLU B 1 156 ? 29.809 115.971 25.276  1.00 26.92 ? 156 GLU B CB  1 
ATOM   4503 C  CG  . GLU B 1 156 ? 29.548 114.567 24.768  1.00 27.02 ? 156 GLU B CG  1 
ATOM   4504 C  CD  . GLU B 1 156 ? 30.593 114.145 23.782  1.00 27.49 ? 156 GLU B CD  1 
ATOM   4505 O  OE1 . GLU B 1 156 ? 31.513 114.952 23.550  1.00 29.12 ? 156 GLU B OE1 1 
ATOM   4506 O  OE2 . GLU B 1 156 ? 30.508 113.023 23.243  1.00 29.78 ? 156 GLU B OE2 1 
ATOM   4507 N  N   . THR B 1 157 ? 26.450 115.904 26.388  1.00 24.81 ? 157 THR B N   1 
ATOM   4508 C  CA  . THR B 1 157 ? 25.111 115.968 25.820  1.00 24.10 ? 157 THR B CA  1 
ATOM   4509 C  C   . THR B 1 157 ? 24.148 116.737 26.713  1.00 23.84 ? 157 THR B C   1 
ATOM   4510 O  O   . THR B 1 157 ? 24.347 116.842 27.926  1.00 23.26 ? 157 THR B O   1 
ATOM   4511 C  CB  . THR B 1 157 ? 24.539 114.555 25.546  1.00 23.37 ? 157 THR B CB  1 
ATOM   4512 O  OG1 . THR B 1 157 ? 24.206 113.914 26.783  1.00 23.57 ? 157 THR B OG1 1 
ATOM   4513 C  CG2 . THR B 1 157 ? 25.562 113.715 24.806  1.00 22.12 ? 157 THR B CG2 1 
ATOM   4514 N  N   . THR B 1 158 ? 23.103 117.279 26.098  1.00 23.32 ? 158 THR B N   1 
ATOM   4515 C  CA  . THR B 1 158 ? 22.097 118.043 26.818  1.00 24.77 ? 158 THR B CA  1 
ATOM   4516 C  C   . THR B 1 158 ? 21.382 117.153 27.840  1.00 26.11 ? 158 THR B C   1 
ATOM   4517 O  O   . THR B 1 158 ? 21.172 117.546 28.994  1.00 25.36 ? 158 THR B O   1 
ATOM   4518 C  CB  . THR B 1 158 ? 21.064 118.642 25.835  1.00 25.30 ? 158 THR B CB  1 
ATOM   4519 O  OG1 . THR B 1 158 ? 21.724 119.545 24.934  1.00 25.26 ? 158 THR B OG1 1 
ATOM   4520 C  CG2 . THR B 1 158 ? 19.974 119.389 26.593  1.00 26.47 ? 158 THR B CG2 1 
ATOM   4521 N  N   . THR B 1 159 ? 21.013 115.950 27.408  1.00 26.91 ? 159 THR B N   1 
ATOM   4522 C  CA  . THR B 1 159 ? 20.340 115.001 28.283  1.00 28.17 ? 159 THR B CA  1 
ATOM   4523 C  C   . THR B 1 159 ? 21.237 114.681 29.472  1.00 28.17 ? 159 THR B C   1 
ATOM   4524 O  O   . THR B 1 159 ? 20.801 114.706 30.623  1.00 27.73 ? 159 THR B O   1 
ATOM   4525 C  CB  . THR B 1 159 ? 20.031 113.692 27.546  1.00 29.59 ? 159 THR B CB  1 
ATOM   4526 O  OG1 . THR B 1 159 ? 19.291 113.984 26.356  1.00 30.43 ? 159 THR B OG1 1 
ATOM   4527 C  CG2 . THR B 1 159 ? 19.208 112.761 28.437  1.00 28.53 ? 159 THR B CG2 1 
ATOM   4528 N  N   . GLY B 1 160 ? 22.497 114.378 29.184  1.00 28.22 ? 160 GLY B N   1 
ATOM   4529 C  CA  . GLY B 1 160 ? 23.424 114.069 30.252  1.00 28.75 ? 160 GLY B CA  1 
ATOM   4530 C  C   . GLY B 1 160 ? 23.518 115.217 31.236  1.00 28.54 ? 160 GLY B C   1 
ATOM   4531 O  O   . GLY B 1 160 ? 23.415 115.017 32.449  1.00 29.97 ? 160 GLY B O   1 
ATOM   4532 N  N   . VAL B 1 161 ? 23.703 116.427 30.715  1.00 26.67 ? 161 VAL B N   1 
ATOM   4533 C  CA  . VAL B 1 161 ? 23.820 117.603 31.568  1.00 26.44 ? 161 VAL B CA  1 
ATOM   4534 C  C   . VAL B 1 161 ? 22.553 117.835 32.388  1.00 25.44 ? 161 VAL B C   1 
ATOM   4535 O  O   . VAL B 1 161 ? 22.621 118.013 33.599  1.00 25.17 ? 161 VAL B O   1 
ATOM   4536 C  CB  . VAL B 1 161 ? 24.153 118.871 30.733  1.00 26.16 ? 161 VAL B CB  1 
ATOM   4537 C  CG1 . VAL B 1 161 ? 24.309 120.071 31.640  1.00 23.26 ? 161 VAL B CG1 1 
ATOM   4538 C  CG2 . VAL B 1 161 ? 25.439 118.653 29.958  1.00 25.83 ? 161 VAL B CG2 1 
ATOM   4539 N  N   . HIS B 1 162 ? 21.394 117.835 31.743  1.00 26.65 ? 162 HIS B N   1 
ATOM   4540 C  CA  . HIS B 1 162 ? 20.159 118.034 32.493  1.00 28.98 ? 162 HIS B CA  1 
ATOM   4541 C  C   . HIS B 1 162 ? 20.085 117.011 33.615  1.00 29.03 ? 162 HIS B C   1 
ATOM   4542 O  O   . HIS B 1 162 ? 19.752 117.342 34.755  1.00 28.64 ? 162 HIS B O   1 
ATOM   4543 C  CB  . HIS B 1 162 ? 18.944 117.897 31.579  1.00 29.91 ? 162 HIS B CB  1 
ATOM   4544 C  CG  . HIS B 1 162 ? 18.650 119.135 30.794  1.00 34.04 ? 162 HIS B CG  1 
ATOM   4545 N  ND1 . HIS B 1 162 ? 17.756 119.161 29.743  1.00 34.59 ? 162 HIS B ND1 1 
ATOM   4546 C  CD2 . HIS B 1 162 ? 19.135 120.395 30.908  1.00 34.20 ? 162 HIS B CD2 1 
ATOM   4547 C  CE1 . HIS B 1 162 ? 17.706 120.384 29.243  1.00 35.84 ? 162 HIS B CE1 1 
ATOM   4548 N  NE2 . HIS B 1 162 ? 18.533 121.151 29.932  1.00 35.62 ? 162 HIS B NE2 1 
ATOM   4549 N  N   . ASN B 1 163 ? 20.416 115.769 33.277  1.00 28.56 ? 163 ASN B N   1 
ATOM   4550 C  CA  . ASN B 1 163 ? 20.403 114.681 34.236  1.00 28.09 ? 163 ASN B CA  1 
ATOM   4551 C  C   . ASN B 1 163 ? 21.282 115.037 35.435  1.00 28.08 ? 163 ASN B C   1 
ATOM   4552 O  O   . ASN B 1 163 ? 20.831 114.981 36.580  1.00 29.24 ? 163 ASN B O   1 
ATOM   4553 C  CB  . ASN B 1 163 ? 20.910 113.405 33.568  1.00 29.51 ? 163 ASN B CB  1 
ATOM   4554 C  CG  . ASN B 1 163 ? 20.800 112.192 34.468  1.00 30.53 ? 163 ASN B CG  1 
ATOM   4555 O  OD1 . ASN B 1 163 ? 19.702 111.818 34.893  1.00 30.39 ? 163 ASN B OD1 1 
ATOM   4556 N  ND2 . ASN B 1 163 ? 21.937 111.568 34.763  1.00 29.32 ? 163 ASN B ND2 1 
ATOM   4557 N  N   . LEU B 1 164 ? 22.533 115.407 35.170  1.00 25.69 ? 164 LEU B N   1 
ATOM   4558 C  CA  . LEU B 1 164 ? 23.450 115.778 36.238  1.00 25.53 ? 164 LEU B CA  1 
ATOM   4559 C  C   . LEU B 1 164 ? 22.831 116.850 37.132  1.00 27.59 ? 164 LEU B C   1 
ATOM   4560 O  O   . LEU B 1 164 ? 23.033 116.852 38.355  1.00 27.46 ? 164 LEU B O   1 
ATOM   4561 C  CB  . LEU B 1 164 ? 24.774 116.282 35.654  1.00 23.53 ? 164 LEU B CB  1 
ATOM   4562 C  CG  . LEU B 1 164 ? 25.723 115.228 35.064  1.00 23.77 ? 164 LEU B CG  1 
ATOM   4563 C  CD1 . LEU B 1 164 ? 26.770 115.903 34.196  1.00 22.95 ? 164 LEU B CD1 1 
ATOM   4564 C  CD2 . LEU B 1 164 ? 26.382 114.430 36.181  1.00 19.95 ? 164 LEU B CD2 1 
ATOM   4565 N  N   . TYR B 1 165 ? 22.072 117.759 36.520  1.00 28.58 ? 165 TYR B N   1 
ATOM   4566 C  CA  . TYR B 1 165 ? 21.427 118.829 37.271  1.00 28.92 ? 165 TYR B CA  1 
ATOM   4567 C  C   . TYR B 1 165 ? 20.362 118.292 38.211  1.00 29.36 ? 165 TYR B C   1 
ATOM   4568 O  O   . TYR B 1 165 ? 20.290 118.713 39.362  1.00 30.41 ? 165 TYR B O   1 
ATOM   4569 C  CB  . TYR B 1 165 ? 20.818 119.869 36.327  1.00 28.23 ? 165 TYR B CB  1 
ATOM   4570 C  CG  . TYR B 1 165 ? 21.843 120.831 35.768  1.00 29.39 ? 165 TYR B CG  1 
ATOM   4571 C  CD1 . TYR B 1 165 ? 22.688 121.547 36.612  1.00 29.78 ? 165 TYR B CD1 1 
ATOM   4572 C  CD2 . TYR B 1 165 ? 21.976 121.016 34.399  1.00 30.69 ? 165 TYR B CD2 1 
ATOM   4573 C  CE1 . TYR B 1 165 ? 23.641 122.417 36.105  1.00 30.41 ? 165 TYR B CE1 1 
ATOM   4574 C  CE2 . TYR B 1 165 ? 22.921 121.883 33.882  1.00 29.85 ? 165 TYR B CE2 1 
ATOM   4575 C  CZ  . TYR B 1 165 ? 23.752 122.579 34.735  1.00 30.68 ? 165 TYR B CZ  1 
ATOM   4576 O  OH  . TYR B 1 165 ? 24.703 123.424 34.205  1.00 29.28 ? 165 TYR B OH  1 
ATOM   4577 N  N   . LYS B 1 166 ? 19.536 117.368 37.730  1.00 29.66 ? 166 LYS B N   1 
ATOM   4578 C  CA  . LYS B 1 166 ? 18.509 116.791 38.584  1.00 31.91 ? 166 LYS B CA  1 
ATOM   4579 C  C   . LYS B 1 166 ? 19.226 116.065 39.717  1.00 32.46 ? 166 LYS B C   1 
ATOM   4580 O  O   . LYS B 1 166 ? 18.901 116.236 40.892  1.00 33.09 ? 166 LYS B O   1 
ATOM   4581 C  CB  . LYS B 1 166 ? 17.645 115.792 37.814  1.00 33.60 ? 166 LYS B CB  1 
ATOM   4582 C  CG  . LYS B 1 166 ? 16.793 116.384 36.709  1.00 35.24 ? 166 LYS B CG  1 
ATOM   4583 C  CD  . LYS B 1 166 ? 15.827 115.332 36.170  1.00 38.05 ? 166 LYS B CD  1 
ATOM   4584 C  CE  . LYS B 1 166 ? 14.990 115.855 35.004  1.00 39.03 ? 166 LYS B CE  1 
ATOM   4585 N  NZ  . LYS B 1 166 ? 13.995 114.834 34.549  1.00 40.04 ? 166 LYS B NZ  1 
ATOM   4586 N  N   . MET B 1 167 ? 20.213 115.258 39.352  1.00 32.58 ? 167 MET B N   1 
ATOM   4587 C  CA  . MET B 1 167 ? 20.977 114.518 40.340  1.00 33.34 ? 167 MET B CA  1 
ATOM   4588 C  C   . MET B 1 167 ? 21.503 115.449 41.414  1.00 34.30 ? 167 MET B C   1 
ATOM   4589 O  O   . MET B 1 167 ? 21.187 115.288 42.593  1.00 35.20 ? 167 MET B O   1 
ATOM   4590 C  CB  . MET B 1 167 ? 22.148 113.799 39.680  1.00 32.58 ? 167 MET B CB  1 
ATOM   4591 C  CG  . MET B 1 167 ? 21.735 112.653 38.796  1.00 31.59 ? 167 MET B CG  1 
ATOM   4592 S  SD  . MET B 1 167 ? 23.174 111.879 38.081  1.00 33.89 ? 167 MET B SD  1 
ATOM   4593 C  CE  . MET B 1 167 ? 24.017 111.306 39.561  1.00 31.60 ? 167 MET B CE  1 
ATOM   4594 N  N   . MET B 1 168 ? 22.307 116.425 41.004  1.00 35.53 ? 168 MET B N   1 
ATOM   4595 C  CA  . MET B 1 168 ? 22.878 117.378 41.950  1.00 35.83 ? 168 MET B CA  1 
ATOM   4596 C  C   . MET B 1 168 ? 21.761 118.006 42.782  1.00 35.51 ? 168 MET B C   1 
ATOM   4597 O  O   . MET B 1 168 ? 21.874 118.124 44.004  1.00 35.99 ? 168 MET B O   1 
ATOM   4598 C  CB  . MET B 1 168 ? 23.657 118.466 41.203  1.00 36.24 ? 168 MET B CB  1 
ATOM   4599 C  CG  . MET B 1 168 ? 24.342 119.494 42.095  1.00 36.30 ? 168 MET B CG  1 
ATOM   4600 S  SD  . MET B 1 168 ? 25.724 118.820 43.037  1.00 41.96 ? 168 MET B SD  1 
ATOM   4601 C  CE  . MET B 1 168 ? 24.900 118.365 44.590  1.00 43.09 ? 168 MET B CE  1 
ATOM   4602 N  N   . ALA B 1 169 ? 20.674 118.389 42.122  1.00 34.21 ? 169 ALA B N   1 
ATOM   4603 C  CA  . ALA B 1 169 ? 19.559 119.004 42.826  1.00 34.15 ? 169 ALA B CA  1 
ATOM   4604 C  C   . ALA B 1 169 ? 19.036 118.095 43.934  1.00 35.75 ? 169 ALA B C   1 
ATOM   4605 O  O   . ALA B 1 169 ? 18.727 118.559 45.032  1.00 36.68 ? 169 ALA B O   1 
ATOM   4606 C  CB  . ALA B 1 169 ? 18.437 119.333 41.848  1.00 30.57 ? 169 ALA B CB  1 
ATOM   4607 N  N   . ASN B 1 170 ? 18.948 116.799 43.647  1.00 35.60 ? 170 ASN B N   1 
ATOM   4608 C  CA  . ASN B 1 170 ? 18.437 115.840 44.615  1.00 35.19 ? 170 ASN B CA  1 
ATOM   4609 C  C   . ASN B 1 170 ? 19.492 115.188 45.501  1.00 35.43 ? 170 ASN B C   1 
ATOM   4610 O  O   . ASN B 1 170 ? 19.198 114.217 46.201  1.00 35.96 ? 170 ASN B O   1 
ATOM   4611 C  CB  . ASN B 1 170 ? 17.636 114.753 43.899  1.00 37.56 ? 170 ASN B CB  1 
ATOM   4612 C  CG  . ASN B 1 170 ? 16.432 115.309 43.161  1.00 39.22 ? 170 ASN B CG  1 
ATOM   4613 O  OD1 . ASN B 1 170 ? 15.667 116.106 43.706  1.00 40.92 ? 170 ASN B OD1 1 
ATOM   4614 N  ND2 . ASN B 1 170 ? 16.251 114.882 41.918  1.00 39.74 ? 170 ASN B ND2 1 
ATOM   4615 N  N   . GLY B 1 171 ? 20.713 115.715 45.469  1.00 33.64 ? 171 GLY B N   1 
ATOM   4616 C  CA  . GLY B 1 171 ? 21.778 115.174 46.298  1.00 31.44 ? 171 GLY B CA  1 
ATOM   4617 C  C   . GLY B 1 171 ? 22.326 113.821 45.879  1.00 31.86 ? 171 GLY B C   1 
ATOM   4618 O  O   . GLY B 1 171 ? 23.072 113.194 46.633  1.00 31.93 ? 171 GLY B O   1 
ATOM   4619 N  N   . ILE B 1 172 ? 21.974 113.364 44.681  1.00 30.93 ? 172 ILE B N   1 
ATOM   4620 C  CA  . ILE B 1 172 ? 22.458 112.077 44.200  1.00 30.34 ? 172 ILE B CA  1 
ATOM   4621 C  C   . ILE B 1 172 ? 23.857 112.152 43.585  1.00 30.11 ? 172 ILE B C   1 
ATOM   4622 O  O   . ILE B 1 172 ? 24.651 111.218 43.718  1.00 31.10 ? 172 ILE B O   1 
ATOM   4623 C  CB  . ILE B 1 172 ? 21.496 111.476 43.161  1.00 31.03 ? 172 ILE B CB  1 
ATOM   4624 C  CG1 . ILE B 1 172 ? 20.113 111.287 43.785  1.00 30.85 ? 172 ILE B CG1 1 
ATOM   4625 C  CG2 . ILE B 1 172 ? 22.037 110.136 42.662  1.00 29.71 ? 172 ILE B CG2 1 
ATOM   4626 C  CD1 . ILE B 1 172 ? 19.093 110.696 42.828  1.00 32.70 ? 172 ILE B CD1 1 
ATOM   4627 N  N   . LEU B 1 173 ? 24.164 113.255 42.911  1.00 29.77 ? 173 LEU B N   1 
ATOM   4628 C  CA  . LEU B 1 173 ? 25.482 113.404 42.300  1.00 28.83 ? 173 LEU B CA  1 
ATOM   4629 C  C   . LEU B 1 173 ? 26.544 113.332 43.389  1.00 28.33 ? 173 LEU B C   1 
ATOM   4630 O  O   . LEU B 1 173 ? 26.500 114.090 44.354  1.00 28.53 ? 173 LEU B O   1 
ATOM   4631 C  CB  . LEU B 1 173 ? 25.586 114.739 41.560  1.00 28.18 ? 173 LEU B CB  1 
ATOM   4632 C  CG  . LEU B 1 173 ? 26.884 114.905 40.767  1.00 27.03 ? 173 LEU B CG  1 
ATOM   4633 C  CD1 . LEU B 1 173 ? 27.054 113.727 39.819  1.00 24.49 ? 173 LEU B CD1 1 
ATOM   4634 C  CD2 . LEU B 1 173 ? 26.858 116.215 40.007  1.00 26.09 ? 173 LEU B CD2 1 
ATOM   4635 N  N   . LYS B 1 174 ? 27.497 112.420 43.225  1.00 28.57 ? 174 LYS B N   1 
ATOM   4636 C  CA  . LYS B 1 174 ? 28.561 112.227 44.212  1.00 28.13 ? 174 LYS B CA  1 
ATOM   4637 C  C   . LYS B 1 174 ? 29.943 112.491 43.633  1.00 27.77 ? 174 LYS B C   1 
ATOM   4638 O  O   . LYS B 1 174 ? 30.950 112.371 44.331  1.00 26.73 ? 174 LYS B O   1 
ATOM   4639 C  CB  . LYS B 1 174 ? 28.518 110.790 44.742  1.00 29.27 ? 174 LYS B CB  1 
ATOM   4640 C  CG  . LYS B 1 174 ? 27.180 110.388 45.316  1.00 30.03 ? 174 LYS B CG  1 
ATOM   4641 C  CD  . LYS B 1 174 ? 26.828 111.294 46.478  1.00 30.69 ? 174 LYS B CD  1 
ATOM   4642 C  CE  . LYS B 1 174 ? 25.480 110.948 47.063  1.00 30.13 ? 174 LYS B CE  1 
ATOM   4643 N  NZ  . LYS B 1 174 ? 25.224 111.820 48.232  1.00 33.25 ? 174 LYS B NZ  1 
ATOM   4644 N  N   . VAL B 1 175 ? 29.993 112.839 42.353  1.00 27.28 ? 175 VAL B N   1 
ATOM   4645 C  CA  . VAL B 1 175 ? 31.262 113.099 41.696  1.00 26.88 ? 175 VAL B CA  1 
ATOM   4646 C  C   . VAL B 1 175 ? 31.232 114.413 40.937  1.00 26.71 ? 175 VAL B C   1 
ATOM   4647 O  O   . VAL B 1 175 ? 30.239 114.744 40.300  1.00 26.96 ? 175 VAL B O   1 
ATOM   4648 C  CB  . VAL B 1 175 ? 31.613 111.948 40.719  1.00 27.59 ? 175 VAL B CB  1 
ATOM   4649 C  CG1 . VAL B 1 175 ? 32.774 112.350 39.818  1.00 28.22 ? 175 VAL B CG1 1 
ATOM   4650 C  CG2 . VAL B 1 175 ? 31.979 110.693 41.513  1.00 27.01 ? 175 VAL B CG2 1 
ATOM   4651 N  N   . PRO B 1 176 ? 32.325 115.190 41.010  1.00 27.19 ? 176 PRO B N   1 
ATOM   4652 C  CA  . PRO B 1 176 ? 32.407 116.473 40.313  1.00 26.86 ? 176 PRO B CA  1 
ATOM   4653 C  C   . PRO B 1 176 ? 32.245 116.214 38.827  1.00 27.73 ? 176 PRO B C   1 
ATOM   4654 O  O   . PRO B 1 176 ? 32.825 115.267 38.294  1.00 28.84 ? 176 PRO B O   1 
ATOM   4655 C  CB  . PRO B 1 176 ? 33.812 116.957 40.653  1.00 26.74 ? 176 PRO B CB  1 
ATOM   4656 C  CG  . PRO B 1 176 ? 34.043 116.383 42.005  1.00 26.94 ? 176 PRO B CG  1 
ATOM   4657 C  CD  . PRO B 1 176 ? 33.527 114.972 41.831  1.00 27.95 ? 176 PRO B CD  1 
ATOM   4658 N  N   . ALA B 1 177 ? 31.462 117.042 38.151  1.00 26.91 ? 177 ALA B N   1 
ATOM   4659 C  CA  . ALA B 1 177 ? 31.263 116.843 36.723  1.00 26.13 ? 177 ALA B CA  1 
ATOM   4660 C  C   . ALA B 1 177 ? 31.463 118.129 35.933  1.00 26.64 ? 177 ALA B C   1 
ATOM   4661 O  O   . ALA B 1 177 ? 31.139 119.220 36.409  1.00 27.01 ? 177 ALA B O   1 
ATOM   4662 C  CB  . ALA B 1 177 ? 29.865 116.280 36.463  1.00 22.36 ? 177 ALA B CB  1 
ATOM   4663 N  N   . ILE B 1 178 ? 32.017 117.992 34.731  1.00 25.81 ? 178 ILE B N   1 
ATOM   4664 C  CA  . ILE B 1 178 ? 32.226 119.136 33.857  1.00 24.47 ? 178 ILE B CA  1 
ATOM   4665 C  C   . ILE B 1 178 ? 31.363 119.004 32.609  1.00 24.60 ? 178 ILE B C   1 
ATOM   4666 O  O   . ILE B 1 178 ? 31.440 118.007 31.882  1.00 23.30 ? 178 ILE B O   1 
ATOM   4667 C  CB  . ILE B 1 178 ? 33.691 119.275 33.416  1.00 22.86 ? 178 ILE B CB  1 
ATOM   4668 C  CG1 . ILE B 1 178 ? 34.529 119.829 34.572  1.00 23.22 ? 178 ILE B CG1 1 
ATOM   4669 C  CG2 . ILE B 1 178 ? 33.766 120.176 32.190  1.00 18.80 ? 178 ILE B CG2 1 
ATOM   4670 C  CD1 . ILE B 1 178 ? 35.993 120.060 34.237  1.00 22.96 ? 178 ILE B CD1 1 
ATOM   4671 N  N   . ASN B 1 179 ? 30.531 120.016 32.384  1.00 23.78 ? 179 ASN B N   1 
ATOM   4672 C  CA  . ASN B 1 179 ? 29.640 120.060 31.230  1.00 22.54 ? 179 ASN B CA  1 
ATOM   4673 C  C   . ASN B 1 179 ? 30.314 120.782 30.061  1.00 22.13 ? 179 ASN B C   1 
ATOM   4674 O  O   . ASN B 1 179 ? 30.634 121.970 30.147  1.00 21.86 ? 179 ASN B O   1 
ATOM   4675 C  CB  . ASN B 1 179 ? 28.322 120.748 31.626  1.00 19.52 ? 179 ASN B CB  1 
ATOM   4676 C  CG  . ASN B 1 179 ? 27.695 121.543 30.489  1.00 20.33 ? 179 ASN B CG  1 
ATOM   4677 O  OD1 . ASN B 1 179 ? 27.652 121.105 29.337  1.00 19.73 ? 179 ASN B OD1 1 
ATOM   4678 N  ND2 . ASN B 1 179 ? 27.186 122.720 30.820  1.00 20.72 ? 179 ASN B ND2 1 
ATOM   4679 N  N   . VAL B 1 180 ? 30.558 120.049 28.979  1.00 21.45 ? 180 VAL B N   1 
ATOM   4680 C  CA  . VAL B 1 180 ? 31.179 120.635 27.796  1.00 22.66 ? 180 VAL B CA  1 
ATOM   4681 C  C   . VAL B 1 180 ? 30.120 120.796 26.710  1.00 22.77 ? 180 VAL B C   1 
ATOM   4682 O  O   . VAL B 1 180 ? 30.387 121.322 25.632  1.00 22.97 ? 180 VAL B O   1 
ATOM   4683 C  CB  . VAL B 1 180 ? 32.343 119.758 27.248  1.00 22.48 ? 180 VAL B CB  1 
ATOM   4684 C  CG1 . VAL B 1 180 ? 33.401 119.570 28.328  1.00 21.73 ? 180 VAL B CG1 1 
ATOM   4685 C  CG2 . VAL B 1 180 ? 31.815 118.414 26.753  1.00 20.44 ? 180 VAL B CG2 1 
ATOM   4686 N  N   . ASN B 1 181 ? 28.907 120.345 27.005  1.00 22.66 ? 181 ASN B N   1 
ATOM   4687 C  CA  . ASN B 1 181 ? 27.825 120.459 26.045  1.00 22.64 ? 181 ASN B CA  1 
ATOM   4688 C  C   . ASN B 1 181 ? 27.564 121.926 25.714  1.00 22.88 ? 181 ASN B C   1 
ATOM   4689 O  O   . ASN B 1 181 ? 27.191 122.257 24.590  1.00 22.77 ? 181 ASN B O   1 
ATOM   4690 C  CB  . ASN B 1 181 ? 26.545 119.831 26.603  1.00 20.48 ? 181 ASN B CB  1 
ATOM   4691 C  CG  . ASN B 1 181 ? 25.365 119.966 25.649  1.00 20.95 ? 181 ASN B CG  1 
ATOM   4692 O  OD1 . ASN B 1 181 ? 25.425 119.512 24.504  1.00 19.65 ? 181 ASN B OD1 1 
ATOM   4693 N  ND2 . ASN B 1 181 ? 24.287 120.594 26.117  1.00 17.56 ? 181 ASN B ND2 1 
ATOM   4694 N  N   . ASP B 1 182 ? 27.780 122.801 26.694  1.00 22.92 ? 182 ASP B N   1 
ATOM   4695 C  CA  . ASP B 1 182 ? 27.529 124.225 26.510  1.00 22.99 ? 182 ASP B CA  1 
ATOM   4696 C  C   . ASP B 1 182 ? 28.745 125.078 26.177  1.00 23.64 ? 182 ASP B C   1 
ATOM   4697 O  O   . ASP B 1 182 ? 28.697 126.301 26.283  1.00 23.60 ? 182 ASP B O   1 
ATOM   4698 C  CB  . ASP B 1 182 ? 26.833 124.790 27.751  1.00 20.87 ? 182 ASP B CB  1 
ATOM   4699 C  CG  . ASP B 1 182 ? 25.505 124.123 28.015  1.00 20.70 ? 182 ASP B CG  1 
ATOM   4700 O  OD1 . ASP B 1 182 ? 24.657 124.129 27.096  1.00 18.31 ? 182 ASP B OD1 1 
ATOM   4701 O  OD2 . ASP B 1 182 ? 25.310 123.592 29.133  1.00 18.97 ? 182 ASP B OD2 1 
ATOM   4702 N  N   . SER B 1 183 ? 29.840 124.442 25.789  1.00 23.18 ? 183 SER B N   1 
ATOM   4703 C  CA  . SER B 1 183 ? 31.013 125.209 25.433  1.00 22.20 ? 183 SER B CA  1 
ATOM   4704 C  C   . SER B 1 183 ? 30.780 125.637 23.987  1.00 21.62 ? 183 SER B C   1 
ATOM   4705 O  O   . SER B 1 183 ? 30.111 124.940 23.225  1.00 21.10 ? 183 SER B O   1 
ATOM   4706 C  CB  . SER B 1 183 ? 32.284 124.360 25.557  1.00 23.01 ? 183 SER B CB  1 
ATOM   4707 O  OG  . SER B 1 183 ? 32.535 123.621 24.381  1.00 26.50 ? 183 SER B OG  1 
ATOM   4708 N  N   . VAL B 1 184 ? 31.325 126.786 23.617  1.00 20.45 ? 184 VAL B N   1 
ATOM   4709 C  CA  . VAL B 1 184 ? 31.157 127.317 22.276  1.00 18.98 ? 184 VAL B CA  1 
ATOM   4710 C  C   . VAL B 1 184 ? 31.652 126.388 21.172  1.00 19.89 ? 184 VAL B C   1 
ATOM   4711 O  O   . VAL B 1 184 ? 30.931 126.125 20.201  1.00 20.79 ? 184 VAL B O   1 
ATOM   4712 C  CB  . VAL B 1 184 ? 31.876 128.675 22.136  1.00 18.98 ? 184 VAL B CB  1 
ATOM   4713 C  CG1 . VAL B 1 184 ? 31.608 129.269 20.762  1.00 15.19 ? 184 VAL B CG1 1 
ATOM   4714 C  CG2 . VAL B 1 184 ? 31.423 129.612 23.245  1.00 16.90 ? 184 VAL B CG2 1 
ATOM   4715 N  N   . THR B 1 185 ? 32.878 125.897 21.311  1.00 19.29 ? 185 THR B N   1 
ATOM   4716 C  CA  . THR B 1 185 ? 33.440 125.017 20.292  1.00 18.88 ? 185 THR B CA  1 
ATOM   4717 C  C   . THR B 1 185 ? 32.618 123.754 20.110  1.00 18.34 ? 185 THR B C   1 
ATOM   4718 O  O   . THR B 1 185 ? 32.416 123.292 18.990  1.00 18.89 ? 185 THR B O   1 
ATOM   4719 C  CB  . THR B 1 185 ? 34.891 124.615 20.622  1.00 18.81 ? 185 THR B CB  1 
ATOM   4720 O  OG1 . THR B 1 185 ? 34.957 124.141 21.971  1.00 20.96 ? 185 THR B OG1 1 
ATOM   4721 C  CG2 . THR B 1 185 ? 35.828 125.793 20.438  1.00 16.60 ? 185 THR B CG2 1 
ATOM   4722 N  N   . LYS B 1 186 ? 32.138 123.197 21.211  1.00 18.42 ? 186 LYS B N   1 
ATOM   4723 C  CA  . LYS B 1 186 ? 31.342 121.987 21.135  1.00 19.14 ? 186 LYS B CA  1 
ATOM   4724 C  C   . LYS B 1 186 ? 29.966 122.275 20.543  1.00 19.33 ? 186 LYS B C   1 
ATOM   4725 O  O   . LYS B 1 186 ? 29.579 121.671 19.544  1.00 19.90 ? 186 LYS B O   1 
ATOM   4726 C  CB  . LYS B 1 186 ? 31.202 121.365 22.527  1.00 20.03 ? 186 LYS B CB  1 
ATOM   4727 C  CG  . LYS B 1 186 ? 30.624 119.952 22.542  1.00 18.67 ? 186 LYS B CG  1 
ATOM   4728 C  CD  . LYS B 1 186 ? 29.126 119.951 22.326  1.00 17.34 ? 186 LYS B CD  1 
ATOM   4729 C  CE  . LYS B 1 186 ? 28.563 118.545 22.403  1.00 17.56 ? 186 LYS B CE  1 
ATOM   4730 N  NZ  . LYS B 1 186 ? 27.075 118.525 22.385  1.00 16.30 ? 186 LYS B NZ  1 
ATOM   4731 N  N   . SER B 1 187 ? 29.236 123.207 21.148  1.00 19.31 ? 187 SER B N   1 
ATOM   4732 C  CA  . SER B 1 187 ? 27.895 123.543 20.677  1.00 19.72 ? 187 SER B CA  1 
ATOM   4733 C  C   . SER B 1 187 ? 27.808 124.022 19.225  1.00 20.62 ? 187 SER B C   1 
ATOM   4734 O  O   . SER B 1 187 ? 26.965 123.543 18.465  1.00 21.71 ? 187 SER B O   1 
ATOM   4735 C  CB  . SER B 1 187 ? 27.251 124.581 21.601  1.00 18.62 ? 187 SER B CB  1 
ATOM   4736 O  OG  . SER B 1 187 ? 28.007 125.771 21.647  1.00 21.26 ? 187 SER B OG  1 
ATOM   4737 N  N   . LYS B 1 188 ? 28.662 124.960 18.828  1.00 20.06 ? 188 LYS B N   1 
ATOM   4738 C  CA  . LYS B 1 188 ? 28.609 125.446 17.458  1.00 20.24 ? 188 LYS B CA  1 
ATOM   4739 C  C   . LYS B 1 188 ? 28.831 124.325 16.448  1.00 19.43 ? 188 LYS B C   1 
ATOM   4740 O  O   . LYS B 1 188 ? 28.075 124.173 15.492  1.00 20.38 ? 188 LYS B O   1 
ATOM   4741 C  CB  . LYS B 1 188 ? 29.629 126.567 17.253  1.00 21.92 ? 188 LYS B CB  1 
ATOM   4742 C  CG  . LYS B 1 188 ? 29.217 127.864 17.918  1.00 25.18 ? 188 LYS B CG  1 
ATOM   4743 C  CD  . LYS B 1 188 ? 27.899 128.363 17.332  1.00 29.21 ? 188 LYS B CD  1 
ATOM   4744 C  CE  . LYS B 1 188 ? 27.224 129.412 18.215  1.00 31.64 ? 188 LYS B CE  1 
ATOM   4745 N  NZ  . LYS B 1 188 ? 26.699 128.833 19.501  1.00 34.52 ? 188 LYS B NZ  1 
ATOM   4746 N  N   . PHE B 1 189 ? 29.863 123.527 16.666  1.00 18.94 ? 189 PHE B N   1 
ATOM   4747 C  CA  . PHE B 1 189 ? 30.153 122.434 15.760  1.00 18.83 ? 189 PHE B CA  1 
ATOM   4748 C  C   . PHE B 1 189 ? 29.149 121.298 15.838  1.00 19.42 ? 189 PHE B C   1 
ATOM   4749 O  O   . PHE B 1 189 ? 28.740 120.759 14.810  1.00 19.08 ? 189 PHE B O   1 
ATOM   4750 C  CB  . PHE B 1 189 ? 31.569 121.919 16.017  1.00 18.70 ? 189 PHE B CB  1 
ATOM   4751 C  CG  . PHE B 1 189 ? 32.625 122.739 15.342  1.00 18.41 ? 189 PHE B CG  1 
ATOM   4752 C  CD1 . PHE B 1 189 ? 33.014 122.453 14.046  1.00 16.46 ? 189 PHE B CD1 1 
ATOM   4753 C  CD2 . PHE B 1 189 ? 33.164 123.849 15.969  1.00 17.00 ? 189 PHE B CD2 1 
ATOM   4754 C  CE1 . PHE B 1 189 ? 33.916 123.258 13.388  1.00 16.71 ? 189 PHE B CE1 1 
ATOM   4755 C  CE2 . PHE B 1 189 ? 34.065 124.657 15.312  1.00 17.40 ? 189 PHE B CE2 1 
ATOM   4756 C  CZ  . PHE B 1 189 ? 34.440 124.361 14.019  1.00 16.80 ? 189 PHE B CZ  1 
ATOM   4757 N  N   . ASP B 1 190 ? 28.732 120.952 17.052  1.00 19.22 ? 190 ASP B N   1 
ATOM   4758 C  CA  . ASP B 1 190 ? 27.789 119.864 17.234  1.00 20.19 ? 190 ASP B CA  1 
ATOM   4759 C  C   . ASP B 1 190 ? 26.380 120.200 16.768  1.00 21.08 ? 190 ASP B C   1 
ATOM   4760 O  O   . ASP B 1 190 ? 25.643 119.315 16.327  1.00 21.20 ? 190 ASP B O   1 
ATOM   4761 C  CB  . ASP B 1 190 ? 27.757 119.417 18.699  1.00 20.90 ? 190 ASP B CB  1 
ATOM   4762 C  CG  . ASP B 1 190 ? 26.953 118.138 18.896  1.00 22.23 ? 190 ASP B CG  1 
ATOM   4763 O  OD1 . ASP B 1 190 ? 27.112 117.213 18.066  1.00 20.58 ? 190 ASP B OD1 1 
ATOM   4764 O  OD2 . ASP B 1 190 ? 26.173 118.053 19.875  1.00 21.28 ? 190 ASP B OD2 1 
ATOM   4765 N  N   . ASN B 1 191 ? 26.000 121.472 16.858  1.00 21.16 ? 191 ASN B N   1 
ATOM   4766 C  CA  . ASN B 1 191 ? 24.662 121.877 16.437  1.00 20.23 ? 191 ASN B CA  1 
ATOM   4767 C  C   . ASN B 1 191 ? 24.611 122.551 15.072  1.00 19.44 ? 191 ASN B C   1 
ATOM   4768 O  O   . ASN B 1 191 ? 23.964 122.056 14.155  1.00 18.86 ? 191 ASN B O   1 
ATOM   4769 C  CB  . ASN B 1 191 ? 24.033 122.830 17.453  1.00 19.46 ? 191 ASN B CB  1 
ATOM   4770 C  CG  . ASN B 1 191 ? 23.987 122.256 18.847  1.00 20.88 ? 191 ASN B CG  1 
ATOM   4771 O  OD1 . ASN B 1 191 ? 23.399 121.205 19.086  1.00 22.95 ? 191 ASN B OD1 1 
ATOM   4772 N  ND2 . ASN B 1 191 ? 24.605 122.956 19.786  1.00 23.23 ? 191 ASN B ND2 1 
ATOM   4773 N  N   . LEU B 1 192 ? 25.302 123.677 14.942  1.00 19.63 ? 192 LEU B N   1 
ATOM   4774 C  CA  . LEU B 1 192 ? 25.271 124.452 13.706  1.00 18.84 ? 192 LEU B CA  1 
ATOM   4775 C  C   . LEU B 1 192 ? 26.102 123.919 12.555  1.00 18.24 ? 192 LEU B C   1 
ATOM   4776 O  O   . LEU B 1 192 ? 25.547 123.522 11.534  1.00 18.47 ? 192 LEU B O   1 
ATOM   4777 C  CB  . LEU B 1 192 ? 25.661 125.903 14.007  1.00 19.24 ? 192 LEU B CB  1 
ATOM   4778 C  CG  . LEU B 1 192 ? 25.141 126.997 13.067  1.00 20.40 ? 192 LEU B CG  1 
ATOM   4779 C  CD1 . LEU B 1 192 ? 25.238 128.329 13.787  1.00 19.26 ? 192 LEU B CD1 1 
ATOM   4780 C  CD2 . LEU B 1 192 ? 25.918 127.013 11.747  1.00 19.23 ? 192 LEU B CD2 1 
ATOM   4781 N  N   . TYR B 1 193 ? 27.422 123.910 12.711  1.00 18.12 ? 193 TYR B N   1 
ATOM   4782 C  CA  . TYR B 1 193 ? 28.309 123.433 11.651  1.00 18.84 ? 193 TYR B CA  1 
ATOM   4783 C  C   . TYR B 1 193 ? 28.082 121.988 11.265  1.00 18.90 ? 193 TYR B C   1 
ATOM   4784 O  O   . TYR B 1 193 ? 28.061 121.653 10.084  1.00 18.50 ? 193 TYR B O   1 
ATOM   4785 C  CB  . TYR B 1 193 ? 29.772 123.607 12.052  1.00 19.73 ? 193 TYR B CB  1 
ATOM   4786 C  CG  . TYR B 1 193 ? 30.134 125.031 12.339  1.00 19.57 ? 193 TYR B CG  1 
ATOM   4787 C  CD1 . TYR B 1 193 ? 29.706 126.049 11.502  1.00 20.17 ? 193 TYR B CD1 1 
ATOM   4788 C  CD2 . TYR B 1 193 ? 30.880 125.364 13.455  1.00 20.19 ? 193 TYR B CD2 1 
ATOM   4789 C  CE1 . TYR B 1 193 ? 30.006 127.362 11.771  1.00 21.09 ? 193 TYR B CE1 1 
ATOM   4790 C  CE2 . TYR B 1 193 ? 31.189 126.676 13.733  1.00 20.73 ? 193 TYR B CE2 1 
ATOM   4791 C  CZ  . TYR B 1 193 ? 30.747 127.669 12.887  1.00 20.43 ? 193 TYR B CZ  1 
ATOM   4792 O  OH  . TYR B 1 193 ? 31.043 128.977 13.161  1.00 20.67 ? 193 TYR B OH  1 
ATOM   4793 N  N   . GLY B 1 194 ? 27.923 121.132 12.269  1.00 19.49 ? 194 GLY B N   1 
ATOM   4794 C  CA  . GLY B 1 194 ? 27.707 119.722 12.004  1.00 20.35 ? 194 GLY B CA  1 
ATOM   4795 C  C   . GLY B 1 194 ? 26.545 119.463 11.066  1.00 21.08 ? 194 GLY B C   1 
ATOM   4796 O  O   . GLY B 1 194 ? 26.702 118.808 10.034  1.00 22.21 ? 194 GLY B O   1 
ATOM   4797 N  N   . CYS B 1 195 ? 25.374 119.983 11.419  1.00 20.80 ? 195 CYS B N   1 
ATOM   4798 C  CA  . CYS B 1 195 ? 24.177 119.789 10.610  1.00 20.12 ? 195 CYS B CA  1 
ATOM   4799 C  C   . CYS B 1 195 ? 24.236 120.529 9.281   1.00 20.10 ? 195 CYS B C   1 
ATOM   4800 O  O   . CYS B 1 195 ? 23.603 120.113 8.312   1.00 19.94 ? 195 CYS B O   1 
ATOM   4801 C  CB  . CYS B 1 195 ? 22.939 120.230 11.391  1.00 18.54 ? 195 CYS B CB  1 
ATOM   4802 S  SG  . CYS B 1 195 ? 22.708 119.342 12.943  1.00 20.89 ? 195 CYS B SG  1 
ATOM   4803 N  N   . ARG B 1 196 ? 24.993 121.623 9.233   1.00 18.87 ? 196 ARG B N   1 
ATOM   4804 C  CA  . ARG B 1 196 ? 25.108 122.388 8.004   1.00 17.91 ? 196 ARG B CA  1 
ATOM   4805 C  C   . ARG B 1 196 ? 25.828 121.584 6.925   1.00 18.63 ? 196 ARG B C   1 
ATOM   4806 O  O   . ARG B 1 196 ? 25.612 121.792 5.728   1.00 17.38 ? 196 ARG B O   1 
ATOM   4807 C  CB  . ARG B 1 196 ? 25.872 123.682 8.254   1.00 17.55 ? 196 ARG B CB  1 
ATOM   4808 C  CG  . ARG B 1 196 ? 25.813 124.636 7.078   1.00 16.91 ? 196 ARG B CG  1 
ATOM   4809 C  CD  . ARG B 1 196 ? 26.427 125.958 7.419   1.00 15.25 ? 196 ARG B CD  1 
ATOM   4810 N  NE  . ARG B 1 196 ? 27.877 125.883 7.501   1.00 15.31 ? 196 ARG B NE  1 
ATOM   4811 C  CZ  . ARG B 1 196 ? 28.646 126.898 7.886   1.00 17.66 ? 196 ARG B CZ  1 
ATOM   4812 N  NH1 . ARG B 1 196 ? 28.091 128.058 8.231   1.00 15.47 ? 196 ARG B NH1 1 
ATOM   4813 N  NH2 . ARG B 1 196 ? 29.966 126.764 7.898   1.00 14.98 ? 196 ARG B NH2 1 
ATOM   4814 N  N   . GLU B 1 197 ? 26.678 120.661 7.363   1.00 18.38 ? 197 GLU B N   1 
ATOM   4815 C  CA  . GLU B 1 197 ? 27.452 119.821 6.460   1.00 18.65 ? 197 GLU B CA  1 
ATOM   4816 C  C   . GLU B 1 197 ? 26.706 118.569 6.010   1.00 19.06 ? 197 GLU B C   1 
ATOM   4817 O  O   . GLU B 1 197 ? 26.897 118.094 4.889   1.00 19.27 ? 197 GLU B O   1 
ATOM   4818 C  CB  . GLU B 1 197 ? 28.743 119.372 7.144   1.00 18.88 ? 197 GLU B CB  1 
ATOM   4819 C  CG  . GLU B 1 197 ? 29.687 120.472 7.555   1.00 20.15 ? 197 GLU B CG  1 
ATOM   4820 C  CD  . GLU B 1 197 ? 30.696 120.818 6.473   1.00 22.34 ? 197 GLU B CD  1 
ATOM   4821 O  OE1 . GLU B 1 197 ? 31.229 119.888 5.830   1.00 20.93 ? 197 GLU B OE1 1 
ATOM   4822 O  OE2 . GLU B 1 197 ? 30.970 122.019 6.278   1.00 23.94 ? 197 GLU B OE2 1 
ATOM   4823 N  N   . SER B 1 198 ? 25.840 118.048 6.870   1.00 18.70 ? 198 SER B N   1 
ATOM   4824 C  CA  . SER B 1 198 ? 25.152 116.807 6.557   1.00 19.79 ? 198 SER B CA  1 
ATOM   4825 C  C   . SER B 1 198 ? 23.697 116.804 6.106   1.00 18.84 ? 198 SER B C   1 
ATOM   4826 O  O   . SER B 1 198 ? 23.279 115.870 5.429   1.00 18.95 ? 198 SER B O   1 
ATOM   4827 C  CB  . SER B 1 198 ? 25.316 115.862 7.741   1.00 23.46 ? 198 SER B CB  1 
ATOM   4828 O  OG  . SER B 1 198 ? 26.696 115.688 8.027   1.00 27.30 ? 198 SER B OG  1 
ATOM   4829 N  N   . LEU B 1 199 ? 22.924 117.825 6.461   1.00 19.45 ? 199 LEU B N   1 
ATOM   4830 C  CA  . LEU B 1 199 ? 21.514 117.869 6.073   1.00 19.03 ? 199 LEU B CA  1 
ATOM   4831 C  C   . LEU B 1 199 ? 21.286 117.499 4.616   1.00 20.15 ? 199 LEU B C   1 
ATOM   4832 O  O   . LEU B 1 199 ? 20.638 116.498 4.309   1.00 22.52 ? 199 LEU B O   1 
ATOM   4833 C  CB  . LEU B 1 199 ? 20.920 119.255 6.326   1.00 17.86 ? 199 LEU B CB  1 
ATOM   4834 C  CG  . LEU B 1 199 ? 19.482 119.441 5.817   1.00 18.44 ? 199 LEU B CG  1 
ATOM   4835 C  CD1 . LEU B 1 199 ? 18.560 118.443 6.491   1.00 17.71 ? 199 LEU B CD1 1 
ATOM   4836 C  CD2 . LEU B 1 199 ? 19.007 120.859 6.089   1.00 17.11 ? 199 LEU B CD2 1 
ATOM   4837 N  N   . ILE B 1 200 ? 21.826 118.312 3.719   1.00 20.88 ? 200 ILE B N   1 
ATOM   4838 C  CA  . ILE B 1 200 ? 21.667 118.095 2.287   1.00 21.34 ? 200 ILE B CA  1 
ATOM   4839 C  C   . ILE B 1 200 ? 22.314 116.806 1.812   1.00 21.76 ? 200 ILE B C   1 
ATOM   4840 O  O   . ILE B 1 200 ? 21.885 116.203 0.833   1.00 22.50 ? 200 ILE B O   1 
ATOM   4841 C  CB  . ILE B 1 200 ? 22.238 119.289 1.511   1.00 21.18 ? 200 ILE B CB  1 
ATOM   4842 C  CG1 . ILE B 1 200 ? 21.391 120.532 1.823   1.00 18.92 ? 200 ILE B CG1 1 
ATOM   4843 C  CG2 . ILE B 1 200 ? 22.284 118.978 0.027   1.00 18.69 ? 200 ILE B CG2 1 
ATOM   4844 C  CD1 . ILE B 1 200 ? 21.956 121.812 1.288   1.00 20.67 ? 200 ILE B CD1 1 
ATOM   4845 N  N   . ASP B 1 201 ? 23.343 116.376 2.524   1.00 22.66 ? 201 ASP B N   1 
ATOM   4846 C  CA  . ASP B 1 201 ? 24.034 115.148 2.183   1.00 23.76 ? 201 ASP B CA  1 
ATOM   4847 C  C   . ASP B 1 201 ? 23.038 113.994 2.386   1.00 23.78 ? 201 ASP B C   1 
ATOM   4848 O  O   . ASP B 1 201 ? 22.915 113.093 1.547   1.00 22.45 ? 201 ASP B O   1 
ATOM   4849 C  CB  . ASP B 1 201 ? 25.254 115.010 3.095   1.00 26.00 ? 201 ASP B CB  1 
ATOM   4850 C  CG  . ASP B 1 201 ? 26.164 113.878 2.694   1.00 29.97 ? 201 ASP B CG  1 
ATOM   4851 O  OD1 . ASP B 1 201 ? 26.309 113.623 1.480   1.00 31.43 ? 201 ASP B OD1 1 
ATOM   4852 O  OD2 . ASP B 1 201 ? 26.752 113.252 3.602   1.00 34.75 ? 201 ASP B OD2 1 
ATOM   4853 N  N   . GLY B 1 202 ? 22.312 114.046 3.499   1.00 22.44 ? 202 GLY B N   1 
ATOM   4854 C  CA  . GLY B 1 202 ? 21.331 113.021 3.786   1.00 22.32 ? 202 GLY B CA  1 
ATOM   4855 C  C   . GLY B 1 202 ? 20.189 113.046 2.785   1.00 22.94 ? 202 GLY B C   1 
ATOM   4856 O  O   . GLY B 1 202 ? 19.800 112.008 2.239   1.00 22.82 ? 202 GLY B O   1 
ATOM   4857 N  N   . ILE B 1 203 ? 19.655 114.236 2.526   1.00 21.26 ? 203 ILE B N   1 
ATOM   4858 C  CA  . ILE B 1 203 ? 18.549 114.370 1.594   1.00 18.02 ? 203 ILE B CA  1 
ATOM   4859 C  C   . ILE B 1 203 ? 18.944 113.875 0.213   1.00 19.18 ? 203 ILE B C   1 
ATOM   4860 O  O   . ILE B 1 203 ? 18.153 113.226 -0.473  1.00 19.73 ? 203 ILE B O   1 
ATOM   4861 C  CB  . ILE B 1 203 ? 18.076 115.829 1.506   1.00 16.47 ? 203 ILE B CB  1 
ATOM   4862 C  CG1 . ILE B 1 203 ? 17.589 116.294 2.881   1.00 14.35 ? 203 ILE B CG1 1 
ATOM   4863 C  CG2 . ILE B 1 203 ? 16.968 115.956 0.468   1.00 14.67 ? 203 ILE B CG2 1 
ATOM   4864 C  CD1 . ILE B 1 203 ? 17.038 117.709 2.912   1.00 12.48 ? 203 ILE B CD1 1 
ATOM   4865 N  N   . LYS B 1 204 ? 20.174 114.177 -0.193  1.00 19.63 ? 204 LYS B N   1 
ATOM   4866 C  CA  . LYS B 1 204 ? 20.673 113.749 -1.495  1.00 19.82 ? 204 LYS B CA  1 
ATOM   4867 C  C   . LYS B 1 204 ? 20.789 112.223 -1.597  1.00 19.44 ? 204 LYS B C   1 
ATOM   4868 O  O   . LYS B 1 204 ? 20.270 111.613 -2.531  1.00 18.51 ? 204 LYS B O   1 
ATOM   4869 C  CB  . LYS B 1 204 ? 22.040 114.375 -1.767  1.00 20.80 ? 204 LYS B CB  1 
ATOM   4870 C  CG  . LYS B 1 204 ? 22.005 115.849 -2.120  1.00 20.25 ? 204 LYS B CG  1 
ATOM   4871 C  CD  . LYS B 1 204 ? 21.378 116.061 -3.477  1.00 21.52 ? 204 LYS B CD  1 
ATOM   4872 C  CE  . LYS B 1 204 ? 21.694 117.440 -4.020  1.00 19.27 ? 204 LYS B CE  1 
ATOM   4873 N  NZ  . LYS B 1 204 ? 21.331 117.503 -5.459  1.00 21.11 ? 204 LYS B NZ  1 
ATOM   4874 N  N   . ARG B 1 205 ? 21.474 111.606 -0.641  1.00 18.67 ? 205 ARG B N   1 
ATOM   4875 C  CA  . ARG B 1 205 ? 21.631 110.158 -0.670  1.00 19.28 ? 205 ARG B CA  1 
ATOM   4876 C  C   . ARG B 1 205 ? 20.272 109.472 -0.684  1.00 18.72 ? 205 ARG B C   1 
ATOM   4877 O  O   . ARG B 1 205 ? 20.080 108.455 -1.353  1.00 19.54 ? 205 ARG B O   1 
ATOM   4878 C  CB  . ARG B 1 205 ? 22.463 109.688 0.531   1.00 18.74 ? 205 ARG B CB  1 
ATOM   4879 C  CG  . ARG B 1 205 ? 23.848 110.289 0.528   1.00 20.03 ? 205 ARG B CG  1 
ATOM   4880 C  CD  . ARG B 1 205 ? 24.748 109.765 1.619   1.00 21.34 ? 205 ARG B CD  1 
ATOM   4881 N  NE  . ARG B 1 205 ? 25.976 110.556 1.686   1.00 23.71 ? 205 ARG B NE  1 
ATOM   4882 C  CZ  . ARG B 1 205 ? 27.066 110.197 2.353   1.00 23.05 ? 205 ARG B CZ  1 
ATOM   4883 N  NH1 . ARG B 1 205 ? 27.084 109.050 3.012   1.00 23.69 ? 205 ARG B NH1 1 
ATOM   4884 N  NH2 . ARG B 1 205 ? 28.133 110.987 2.362   1.00 21.59 ? 205 ARG B NH2 1 
ATOM   4885 N  N   . ALA B 1 206 ? 19.323 110.050 0.038   1.00 17.62 ? 206 ALA B N   1 
ATOM   4886 C  CA  . ALA B 1 206 ? 17.987 109.492 0.108   1.00 17.19 ? 206 ALA B CA  1 
ATOM   4887 C  C   . ALA B 1 206 ? 17.182 109.691 -1.172  1.00 18.28 ? 206 ALA B C   1 
ATOM   4888 O  O   . ALA B 1 206 ? 16.468 108.788 -1.608  1.00 18.29 ? 206 ALA B O   1 
ATOM   4889 C  CB  . ALA B 1 206 ? 17.241 110.101 1.283   1.00 16.67 ? 206 ALA B CB  1 
ATOM   4890 N  N   . THR B 1 207 ? 17.308 110.861 -1.789  1.00 18.90 ? 207 THR B N   1 
ATOM   4891 C  CA  . THR B 1 207 ? 16.521 111.143 -2.979  1.00 19.44 ? 207 THR B CA  1 
ATOM   4892 C  C   . THR B 1 207 ? 17.282 111.605 -4.213  1.00 20.44 ? 207 THR B C   1 
ATOM   4893 O  O   . THR B 1 207 ? 16.795 111.453 -5.334  1.00 21.52 ? 207 THR B O   1 
ATOM   4894 C  CB  . THR B 1 207 ? 15.450 112.210 -2.666  1.00 20.07 ? 207 THR B CB  1 
ATOM   4895 O  OG1 . THR B 1 207 ? 16.095 113.452 -2.375  1.00 22.07 ? 207 THR B OG1 1 
ATOM   4896 C  CG2 . THR B 1 207 ? 14.619 111.800 -1.455  1.00 20.14 ? 207 THR B CG2 1 
ATOM   4897 N  N   . ASP B 1 208 ? 18.463 112.178 -4.018  1.00 20.10 ? 208 ASP B N   1 
ATOM   4898 C  CA  . ASP B 1 208 ? 19.239 112.681 -5.142  1.00 18.34 ? 208 ASP B CA  1 
ATOM   4899 C  C   . ASP B 1 208 ? 18.453 113.782 -5.822  1.00 17.08 ? 208 ASP B C   1 
ATOM   4900 O  O   . ASP B 1 208 ? 18.681 114.080 -6.989  1.00 16.86 ? 208 ASP B O   1 
ATOM   4901 C  CB  . ASP B 1 208 ? 19.511 111.586 -6.172  1.00 19.33 ? 208 ASP B CB  1 
ATOM   4902 C  CG  . ASP B 1 208 ? 20.488 110.557 -5.682  1.00 20.19 ? 208 ASP B CG  1 
ATOM   4903 O  OD1 . ASP B 1 208 ? 21.545 110.951 -5.153  1.00 21.32 ? 208 ASP B OD1 1 
ATOM   4904 O  OD2 . ASP B 1 208 ? 20.203 109.352 -5.839  1.00 22.86 ? 208 ASP B OD2 1 
ATOM   4905 N  N   . VAL B 1 209 ? 17.530 114.390 -5.090  1.00 17.49 ? 209 VAL B N   1 
ATOM   4906 C  CA  . VAL B 1 209 ? 16.702 115.448 -5.656  1.00 18.97 ? 209 VAL B CA  1 
ATOM   4907 C  C   . VAL B 1 209 ? 17.438 116.771 -5.851  1.00 19.36 ? 209 VAL B C   1 
ATOM   4908 O  O   . VAL B 1 209 ? 18.442 117.049 -5.194  1.00 19.60 ? 209 VAL B O   1 
ATOM   4909 C  CB  . VAL B 1 209 ? 15.462 115.720 -4.773  1.00 18.68 ? 209 VAL B CB  1 
ATOM   4910 C  CG1 . VAL B 1 209 ? 15.871 116.500 -3.531  1.00 16.58 ? 209 VAL B CG1 1 
ATOM   4911 C  CG2 . VAL B 1 209 ? 14.409 116.474 -5.571  1.00 15.80 ? 209 VAL B CG2 1 
ATOM   4912 N  N   . MET B 1 210 ? 16.931 117.583 -6.769  1.00 20.54 ? 210 MET B N   1 
ATOM   4913 C  CA  . MET B 1 210 ? 17.511 118.889 -7.025  1.00 22.32 ? 210 MET B CA  1 
ATOM   4914 C  C   . MET B 1 210 ? 17.043 119.841 -5.927  1.00 21.25 ? 210 MET B C   1 
ATOM   4915 O  O   . MET B 1 210 ? 15.846 120.016 -5.723  1.00 21.50 ? 210 MET B O   1 
ATOM   4916 C  CB  . MET B 1 210 ? 17.064 119.425 -8.383  1.00 24.42 ? 210 MET B CB  1 
ATOM   4917 C  CG  . MET B 1 210 ? 17.480 120.862 -8.595  1.00 29.41 ? 210 MET B CG  1 
ATOM   4918 S  SD  . MET B 1 210 ? 18.165 121.153 -10.215 1.00 31.96 ? 210 MET B SD  1 
ATOM   4919 C  CE  . MET B 1 210 ? 19.583 120.154 -10.118 1.00 32.25 ? 210 MET B CE  1 
ATOM   4920 N  N   . ILE B 1 211 ? 17.990 120.447 -5.222  1.00 20.63 ? 211 ILE B N   1 
ATOM   4921 C  CA  . ILE B 1 211 ? 17.669 121.362 -4.139  1.00 21.15 ? 211 ILE B CA  1 
ATOM   4922 C  C   . ILE B 1 211 ? 17.288 122.741 -4.665  1.00 21.27 ? 211 ILE B C   1 
ATOM   4923 O  O   . ILE B 1 211 ? 16.265 123.307 -4.277  1.00 21.97 ? 211 ILE B O   1 
ATOM   4924 C  CB  . ILE B 1 211 ? 18.865 121.505 -3.171  1.00 22.16 ? 211 ILE B CB  1 
ATOM   4925 C  CG1 . ILE B 1 211 ? 19.266 120.128 -2.632  1.00 21.85 ? 211 ILE B CG1 1 
ATOM   4926 C  CG2 . ILE B 1 211 ? 18.509 122.452 -2.038  1.00 21.98 ? 211 ILE B CG2 1 
ATOM   4927 C  CD1 . ILE B 1 211 ? 18.139 119.377 -1.950  1.00 17.48 ? 211 ILE B CD1 1 
ATOM   4928 N  N   . ALA B 1 212 ? 18.117 123.279 -5.549  1.00 21.53 ? 212 ALA B N   1 
ATOM   4929 C  CA  . ALA B 1 212 ? 17.865 124.590 -6.131  1.00 21.41 ? 212 ALA B CA  1 
ATOM   4930 C  C   . ALA B 1 212 ? 16.445 124.667 -6.680  1.00 20.91 ? 212 ALA B C   1 
ATOM   4931 O  O   . ALA B 1 212 ? 15.948 123.713 -7.278  1.00 21.84 ? 212 ALA B O   1 
ATOM   4932 C  CB  . ALA B 1 212 ? 18.868 124.863 -7.245  1.00 20.78 ? 212 ALA B CB  1 
ATOM   4933 N  N   . GLY B 1 213 ? 15.789 125.801 -6.461  1.00 19.63 ? 213 GLY B N   1 
ATOM   4934 C  CA  . GLY B 1 213 ? 14.441 125.974 -6.966  1.00 19.10 ? 213 GLY B CA  1 
ATOM   4935 C  C   . GLY B 1 213 ? 13.347 125.461 -6.055  1.00 18.93 ? 213 GLY B C   1 
ATOM   4936 O  O   . GLY B 1 213 ? 12.169 125.748 -6.272  1.00 18.54 ? 213 GLY B O   1 
ATOM   4937 N  N   . LYS B 1 214 ? 13.722 124.697 -5.036  1.00 18.66 ? 214 LYS B N   1 
ATOM   4938 C  CA  . LYS B 1 214 ? 12.731 124.172 -4.107  1.00 16.75 ? 214 LYS B CA  1 
ATOM   4939 C  C   . LYS B 1 214 ? 12.533 125.093 -2.923  1.00 16.90 ? 214 LYS B C   1 
ATOM   4940 O  O   . LYS B 1 214 ? 13.408 125.897 -2.588  1.00 15.52 ? 214 LYS B O   1 
ATOM   4941 C  CB  . LYS B 1 214 ? 13.133 122.786 -3.609  1.00 16.12 ? 214 LYS B CB  1 
ATOM   4942 C  CG  . LYS B 1 214 ? 13.050 121.748 -4.693  1.00 19.86 ? 214 LYS B CG  1 
ATOM   4943 C  CD  . LYS B 1 214 ? 13.020 120.343 -4.150  1.00 19.98 ? 214 LYS B CD  1 
ATOM   4944 C  CE  . LYS B 1 214 ? 12.563 119.396 -5.241  1.00 18.36 ? 214 LYS B CE  1 
ATOM   4945 N  NZ  . LYS B 1 214 ? 13.347 119.620 -6.478  1.00 15.51 ? 214 LYS B NZ  1 
ATOM   4946 N  N   . VAL B 1 215 ? 11.357 124.987 -2.315  1.00 16.30 ? 215 VAL B N   1 
ATOM   4947 C  CA  . VAL B 1 215 ? 11.022 125.773 -1.142  1.00 15.99 ? 215 VAL B CA  1 
ATOM   4948 C  C   . VAL B 1 215 ? 11.282 124.841 0.027   1.00 16.90 ? 215 VAL B C   1 
ATOM   4949 O  O   . VAL B 1 215 ? 10.677 123.766 0.125   1.00 18.79 ? 215 VAL B O   1 
ATOM   4950 C  CB  . VAL B 1 215 ? 9.535  126.200 -1.140  1.00 15.28 ? 215 VAL B CB  1 
ATOM   4951 C  CG1 . VAL B 1 215 ? 9.160  126.766 0.220   1.00 12.09 ? 215 VAL B CG1 1 
ATOM   4952 C  CG2 . VAL B 1 215 ? 9.292  127.237 -2.217  1.00 11.85 ? 215 VAL B CG2 1 
ATOM   4953 N  N   . ALA B 1 216 ? 12.202 125.231 0.899   1.00 15.66 ? 216 ALA B N   1 
ATOM   4954 C  CA  . ALA B 1 216 ? 12.530 124.399 2.041   1.00 15.00 ? 216 ALA B CA  1 
ATOM   4955 C  C   . ALA B 1 216 ? 11.990 125.054 3.289   1.00 16.68 ? 216 ALA B C   1 
ATOM   4956 O  O   . ALA B 1 216 ? 12.300 126.206 3.586   1.00 19.24 ? 216 ALA B O   1 
ATOM   4957 C  CB  . ALA B 1 216 ? 14.036 124.214 2.150   1.00 10.67 ? 216 ALA B CB  1 
ATOM   4958 N  N   . VAL B 1 217 ? 11.158 124.323 4.015   1.00 16.76 ? 217 VAL B N   1 
ATOM   4959 C  CA  . VAL B 1 217 ? 10.599 124.855 5.238   1.00 16.10 ? 217 VAL B CA  1 
ATOM   4960 C  C   . VAL B 1 217 ? 11.406 124.269 6.379   1.00 17.10 ? 217 VAL B C   1 
ATOM   4961 O  O   . VAL B 1 217 ? 11.453 123.052 6.549   1.00 17.44 ? 217 VAL B O   1 
ATOM   4962 C  CB  . VAL B 1 217 ? 9.115  124.463 5.397   1.00 15.07 ? 217 VAL B CB  1 
ATOM   4963 C  CG1 . VAL B 1 217 ? 8.542  125.083 6.666   1.00 11.15 ? 217 VAL B CG1 1 
ATOM   4964 C  CG2 . VAL B 1 217 ? 8.330  124.924 4.178   1.00 15.44 ? 217 VAL B CG2 1 
ATOM   4965 N  N   . VAL B 1 218 ? 12.070 125.136 7.137   1.00 16.74 ? 218 VAL B N   1 
ATOM   4966 C  CA  . VAL B 1 218 ? 12.867 124.688 8.269   1.00 15.75 ? 218 VAL B CA  1 
ATOM   4967 C  C   . VAL B 1 218 ? 12.187 125.154 9.543   1.00 16.88 ? 218 VAL B C   1 
ATOM   4968 O  O   . VAL B 1 218 ? 12.086 126.356 9.798   1.00 18.90 ? 218 VAL B O   1 
ATOM   4969 C  CB  . VAL B 1 218 ? 14.300 125.261 8.221   1.00 14.78 ? 218 VAL B CB  1 
ATOM   4970 C  CG1 . VAL B 1 218 ? 15.110 124.729 9.389   1.00 11.15 ? 218 VAL B CG1 1 
ATOM   4971 C  CG2 . VAL B 1 218 ? 14.967 124.890 6.903   1.00 14.74 ? 218 VAL B CG2 1 
ATOM   4972 N  N   . ALA B 1 219 ? 11.701 124.199 10.329  1.00 16.81 ? 219 ALA B N   1 
ATOM   4973 C  CA  . ALA B 1 219 ? 11.026 124.512 11.580  1.00 17.18 ? 219 ALA B CA  1 
ATOM   4974 C  C   . ALA B 1 219 ? 12.071 124.699 12.662  1.00 18.09 ? 219 ALA B C   1 
ATOM   4975 O  O   . ALA B 1 219 ? 12.775 123.765 13.038  1.00 20.12 ? 219 ALA B O   1 
ATOM   4976 C  CB  . ALA B 1 219 ? 10.064 123.399 11.960  1.00 14.58 ? 219 ALA B CB  1 
ATOM   4977 N  N   . GLY B 1 220 ? 12.171 125.923 13.158  1.00 19.40 ? 220 GLY B N   1 
ATOM   4978 C  CA  . GLY B 1 220 ? 13.143 126.216 14.183  1.00 18.03 ? 220 GLY B CA  1 
ATOM   4979 C  C   . GLY B 1 220 ? 14.330 126.951 13.596  1.00 17.29 ? 220 GLY B C   1 
ATOM   4980 O  O   . GLY B 1 220 ? 14.791 126.648 12.495  1.00 15.49 ? 220 GLY B O   1 
ATOM   4981 N  N   . TYR B 1 221 ? 14.821 127.935 14.334  1.00 17.55 ? 221 TYR B N   1 
ATOM   4982 C  CA  . TYR B 1 221 ? 15.962 128.700 13.879  1.00 18.75 ? 221 TYR B CA  1 
ATOM   4983 C  C   . TYR B 1 221 ? 16.984 128.813 14.999  1.00 18.57 ? 221 TYR B C   1 
ATOM   4984 O  O   . TYR B 1 221 ? 17.481 129.903 15.300  1.00 19.07 ? 221 TYR B O   1 
ATOM   4985 C  CB  . TYR B 1 221 ? 15.536 130.095 13.407  1.00 19.66 ? 221 TYR B CB  1 
ATOM   4986 C  CG  . TYR B 1 221 ? 16.584 130.774 12.549  1.00 21.01 ? 221 TYR B CG  1 
ATOM   4987 C  CD1 . TYR B 1 221 ? 16.899 130.280 11.288  1.00 21.00 ? 221 TYR B CD1 1 
ATOM   4988 C  CD2 . TYR B 1 221 ? 17.259 131.906 12.999  1.00 20.45 ? 221 TYR B CD2 1 
ATOM   4989 C  CE1 . TYR B 1 221 ? 17.854 130.899 10.497  1.00 21.09 ? 221 TYR B CE1 1 
ATOM   4990 C  CE2 . TYR B 1 221 ? 18.215 132.530 12.218  1.00 19.62 ? 221 TYR B CE2 1 
ATOM   4991 C  CZ  . TYR B 1 221 ? 18.507 132.025 10.969  1.00 21.34 ? 221 TYR B CZ  1 
ATOM   4992 O  OH  . TYR B 1 221 ? 19.442 132.653 10.181  1.00 21.22 ? 221 TYR B OH  1 
ATOM   4993 N  N   . GLY B 1 222 ? 17.258 127.678 15.637  1.00 17.67 ? 222 GLY B N   1 
ATOM   4994 C  CA  . GLY B 1 222 ? 18.262 127.629 16.681  1.00 16.89 ? 222 GLY B CA  1 
ATOM   4995 C  C   . GLY B 1 222 ? 19.549 127.363 15.919  1.00 18.32 ? 222 GLY B C   1 
ATOM   4996 O  O   . GLY B 1 222 ? 19.667 127.761 14.758  1.00 17.06 ? 222 GLY B O   1 
ATOM   4997 N  N   . ASP B 1 223 ? 20.516 126.687 16.522  1.00 19.15 ? 223 ASP B N   1 
ATOM   4998 C  CA  . ASP B 1 223 ? 21.738 126.431 15.778  1.00 19.99 ? 223 ASP B CA  1 
ATOM   4999 C  C   . ASP B 1 223 ? 21.507 125.436 14.645  1.00 18.51 ? 223 ASP B C   1 
ATOM   5000 O  O   . ASP B 1 223 ? 22.007 125.626 13.541  1.00 18.43 ? 223 ASP B O   1 
ATOM   5001 C  CB  . ASP B 1 223 ? 22.852 125.945 16.705  1.00 23.98 ? 223 ASP B CB  1 
ATOM   5002 C  CG  . ASP B 1 223 ? 23.419 127.065 17.563  1.00 27.75 ? 223 ASP B CG  1 
ATOM   5003 O  OD1 . ASP B 1 223 ? 23.371 128.231 17.114  1.00 28.09 ? 223 ASP B OD1 1 
ATOM   5004 O  OD2 . ASP B 1 223 ? 23.921 126.782 18.672  1.00 30.55 ? 223 ASP B OD2 1 
ATOM   5005 N  N   . VAL B 1 224 ? 20.741 124.382 14.907  1.00 17.66 ? 224 VAL B N   1 
ATOM   5006 C  CA  . VAL B 1 224 ? 20.465 123.394 13.871  1.00 16.63 ? 224 VAL B CA  1 
ATOM   5007 C  C   . VAL B 1 224 ? 19.714 124.072 12.720  1.00 17.10 ? 224 VAL B C   1 
ATOM   5008 O  O   . VAL B 1 224 ? 20.090 123.931 11.547  1.00 14.90 ? 224 VAL B O   1 
ATOM   5009 C  CB  . VAL B 1 224 ? 19.629 122.211 14.428  1.00 16.35 ? 224 VAL B CB  1 
ATOM   5010 C  CG1 . VAL B 1 224 ? 19.323 121.209 13.323  1.00 15.03 ? 224 VAL B CG1 1 
ATOM   5011 C  CG2 . VAL B 1 224 ? 20.401 121.515 15.539  1.00 16.16 ? 224 VAL B CG2 1 
ATOM   5012 N  N   . GLY B 1 225 ? 18.667 124.823 13.065  1.00 15.92 ? 225 GLY B N   1 
ATOM   5013 C  CA  . GLY B 1 225 ? 17.891 125.524 12.058  1.00 14.01 ? 225 GLY B CA  1 
ATOM   5014 C  C   . GLY B 1 225 ? 18.754 126.489 11.268  1.00 14.15 ? 225 GLY B C   1 
ATOM   5015 O  O   . GLY B 1 225 ? 18.674 126.547 10.036  1.00 13.28 ? 225 GLY B O   1 
ATOM   5016 N  N   . LYS B 1 226 ? 19.587 127.253 11.972  1.00 14.43 ? 226 LYS B N   1 
ATOM   5017 C  CA  . LYS B 1 226 ? 20.470 128.211 11.308  1.00 13.51 ? 226 LYS B CA  1 
ATOM   5018 C  C   . LYS B 1 226 ? 21.355 127.494 10.303  1.00 13.43 ? 226 LYS B C   1 
ATOM   5019 O  O   . LYS B 1 226 ? 21.440 127.905 9.141   1.00 13.57 ? 226 LYS B O   1 
ATOM   5020 C  CB  . LYS B 1 226 ? 21.336 128.958 12.330  1.00 11.63 ? 226 LYS B CB  1 
ATOM   5021 C  CG  . LYS B 1 226 ? 20.592 130.044 13.119  1.00 10.43 ? 226 LYS B CG  1 
ATOM   5022 C  CD  . LYS B 1 226 ? 21.497 130.643 14.186  1.00 12.03 ? 226 LYS B CD  1 
ATOM   5023 C  CE  . LYS B 1 226 ? 20.869 131.826 14.914  1.00 12.52 ? 226 LYS B CE  1 
ATOM   5024 N  NZ  . LYS B 1 226 ? 19.679 131.443 15.724  1.00 13.55 ? 226 LYS B NZ  1 
ATOM   5025 N  N   . GLY B 1 227 ? 21.996 126.416 10.754  1.00 13.48 ? 227 GLY B N   1 
ATOM   5026 C  CA  . GLY B 1 227 ? 22.868 125.641 9.889   1.00 13.24 ? 227 GLY B CA  1 
ATOM   5027 C  C   . GLY B 1 227 ? 22.143 125.040 8.697   1.00 15.32 ? 227 GLY B C   1 
ATOM   5028 O  O   . GLY B 1 227 ? 22.667 125.030 7.581   1.00 16.87 ? 227 GLY B O   1 
ATOM   5029 N  N   . CYS B 1 228 ? 20.933 124.541 8.924   1.00 15.88 ? 228 CYS B N   1 
ATOM   5030 C  CA  . CYS B 1 228 ? 20.153 123.939 7.850   1.00 17.13 ? 228 CYS B CA  1 
ATOM   5031 C  C   . CYS B 1 228 ? 19.698 124.980 6.844   1.00 17.75 ? 228 CYS B C   1 
ATOM   5032 O  O   . CYS B 1 228 ? 19.820 124.773 5.636   1.00 19.28 ? 228 CYS B O   1 
ATOM   5033 C  CB  . CYS B 1 228 ? 18.933 123.200 8.415   1.00 17.25 ? 228 CYS B CB  1 
ATOM   5034 S  SG  . CYS B 1 228 ? 19.334 121.702 9.355   1.00 19.78 ? 228 CYS B SG  1 
ATOM   5035 N  N   . ALA B 1 229 ? 19.168 126.094 7.341   1.00 18.73 ? 229 ALA B N   1 
ATOM   5036 C  CA  . ALA B 1 229 ? 18.704 127.175 6.472   1.00 19.00 ? 229 ALA B CA  1 
ATOM   5037 C  C   . ALA B 1 229 ? 19.859 127.688 5.603   1.00 18.99 ? 229 ALA B C   1 
ATOM   5038 O  O   . ALA B 1 229 ? 19.687 127.983 4.419   1.00 19.14 ? 229 ALA B O   1 
ATOM   5039 C  CB  . ALA B 1 229 ? 18.148 128.303 7.312   1.00 19.10 ? 229 ALA B CB  1 
ATOM   5040 N  N   . GLN B 1 230 ? 21.041 127.779 6.201   1.00 17.85 ? 230 GLN B N   1 
ATOM   5041 C  CA  . GLN B 1 230 ? 22.220 128.248 5.497   1.00 18.64 ? 230 GLN B CA  1 
ATOM   5042 C  C   . GLN B 1 230 ? 22.589 127.266 4.387   1.00 18.63 ? 230 GLN B C   1 
ATOM   5043 O  O   . GLN B 1 230 ? 22.751 127.647 3.230   1.00 18.90 ? 230 GLN B O   1 
ATOM   5044 C  CB  . GLN B 1 230 ? 23.370 128.392 6.484   1.00 18.00 ? 230 GLN B CB  1 
ATOM   5045 C  CG  . GLN B 1 230 ? 24.533 129.219 5.985   1.00 17.68 ? 230 GLN B CG  1 
ATOM   5046 C  CD  . GLN B 1 230 ? 25.544 129.461 7.088   1.00 20.96 ? 230 GLN B CD  1 
ATOM   5047 O  OE1 . GLN B 1 230 ? 25.351 129.010 8.225   1.00 21.50 ? 230 GLN B OE1 1 
ATOM   5048 N  NE2 . GLN B 1 230 ? 26.625 130.174 6.768   1.00 19.37 ? 230 GLN B NE2 1 
ATOM   5049 N  N   . ALA B 1 231 ? 22.727 125.998 4.749   1.00 18.57 ? 231 ALA B N   1 
ATOM   5050 C  CA  . ALA B 1 231 ? 23.056 124.969 3.775   1.00 18.77 ? 231 ALA B CA  1 
ATOM   5051 C  C   . ALA B 1 231 ? 22.084 125.031 2.594   1.00 18.51 ? 231 ALA B C   1 
ATOM   5052 O  O   . ALA B 1 231 ? 22.494 125.126 1.438   1.00 19.55 ? 231 ALA B O   1 
ATOM   5053 C  CB  . ALA B 1 231 ? 22.985 123.600 4.435   1.00 18.20 ? 231 ALA B CB  1 
ATOM   5054 N  N   . LEU B 1 232 ? 20.792 124.978 2.902   1.00 17.91 ? 232 LEU B N   1 
ATOM   5055 C  CA  . LEU B 1 232 ? 19.744 125.012 1.892   1.00 17.38 ? 232 LEU B CA  1 
ATOM   5056 C  C   . LEU B 1 232 ? 19.816 126.242 0.990   1.00 17.70 ? 232 LEU B C   1 
ATOM   5057 O  O   . LEU B 1 232 ? 19.724 126.137 -0.240  1.00 16.60 ? 232 LEU B O   1 
ATOM   5058 C  CB  . LEU B 1 232 ? 18.380 124.943 2.580   1.00 17.12 ? 232 LEU B CB  1 
ATOM   5059 C  CG  . LEU B 1 232 ? 18.062 123.573 3.187   1.00 16.81 ? 232 LEU B CG  1 
ATOM   5060 C  CD1 . LEU B 1 232 ? 16.845 123.659 4.068   1.00 16.64 ? 232 LEU B CD1 1 
ATOM   5061 C  CD2 . LEU B 1 232 ? 17.839 122.570 2.070   1.00 15.89 ? 232 LEU B CD2 1 
ATOM   5062 N  N   . ARG B 1 233 ? 19.974 127.407 1.606   1.00 17.83 ? 233 ARG B N   1 
ATOM   5063 C  CA  . ARG B 1 233 ? 20.064 128.648 0.858   1.00 18.46 ? 233 ARG B CA  1 
ATOM   5064 C  C   . ARG B 1 233 ? 21.282 128.634 -0.057  1.00 18.35 ? 233 ARG B C   1 
ATOM   5065 O  O   . ARG B 1 233 ? 21.251 129.180 -1.163  1.00 17.63 ? 233 ARG B O   1 
ATOM   5066 C  CB  . ARG B 1 233 ? 20.168 129.835 1.807   1.00 20.36 ? 233 ARG B CB  1 
ATOM   5067 C  CG  . ARG B 1 233 ? 20.673 131.077 1.119   1.00 22.78 ? 233 ARG B CG  1 
ATOM   5068 C  CD  . ARG B 1 233 ? 20.901 132.194 2.093   1.00 25.92 ? 233 ARG B CD  1 
ATOM   5069 N  NE  . ARG B 1 233 ? 19.650 132.815 2.504   1.00 29.17 ? 233 ARG B NE  1 
ATOM   5070 C  CZ  . ARG B 1 233 ? 19.584 133.844 3.339   1.00 28.38 ? 233 ARG B CZ  1 
ATOM   5071 N  NH1 . ARG B 1 233 ? 20.702 134.349 3.842   1.00 27.36 ? 233 ARG B NH1 1 
ATOM   5072 N  NH2 . ARG B 1 233 ? 18.408 134.364 3.668   1.00 28.57 ? 233 ARG B NH2 1 
ATOM   5073 N  N   . GLY B 1 234 ? 22.355 128.008 0.410   1.00 17.63 ? 234 GLY B N   1 
ATOM   5074 C  CA  . GLY B 1 234 ? 23.564 127.939 -0.385  1.00 18.73 ? 234 GLY B CA  1 
ATOM   5075 C  C   . GLY B 1 234 ? 23.357 127.158 -1.664  1.00 21.00 ? 234 GLY B C   1 
ATOM   5076 O  O   . GLY B 1 234 ? 24.058 127.379 -2.653  1.00 20.60 ? 234 GLY B O   1 
ATOM   5077 N  N   . PHE B 1 235 ? 22.388 126.247 -1.645  1.00 22.50 ? 235 PHE B N   1 
ATOM   5078 C  CA  . PHE B 1 235 ? 22.094 125.423 -2.803  1.00 23.24 ? 235 PHE B CA  1 
ATOM   5079 C  C   . PHE B 1 235 ? 21.077 125.997 -3.764  1.00 22.61 ? 235 PHE B C   1 
ATOM   5080 O  O   . PHE B 1 235 ? 20.781 125.382 -4.791  1.00 23.08 ? 235 PHE B O   1 
ATOM   5081 C  CB  . PHE B 1 235 ? 21.629 124.039 -2.370  1.00 27.78 ? 235 PHE B CB  1 
ATOM   5082 C  CG  . PHE B 1 235 ? 22.707 123.014 -2.413  1.00 31.09 ? 235 PHE B CG  1 
ATOM   5083 C  CD1 . PHE B 1 235 ? 23.596 122.881 -1.364  1.00 32.88 ? 235 PHE B CD1 1 
ATOM   5084 C  CD2 . PHE B 1 235 ? 22.861 122.209 -3.526  1.00 33.16 ? 235 PHE B CD2 1 
ATOM   5085 C  CE1 . PHE B 1 235 ? 24.623 121.966 -1.423  1.00 34.32 ? 235 PHE B CE1 1 
ATOM   5086 C  CE2 . PHE B 1 235 ? 23.889 121.290 -3.591  1.00 35.52 ? 235 PHE B CE2 1 
ATOM   5087 C  CZ  . PHE B 1 235 ? 24.771 121.170 -2.537  1.00 35.06 ? 235 PHE B CZ  1 
ATOM   5088 N  N   . GLY B 1 236 ? 20.532 127.162 -3.436  1.00 20.75 ? 236 GLY B N   1 
ATOM   5089 C  CA  . GLY B 1 236 ? 19.566 127.778 -4.329  1.00 19.27 ? 236 GLY B CA  1 
ATOM   5090 C  C   . GLY B 1 236 ? 18.122 127.480 -3.995  1.00 17.99 ? 236 GLY B C   1 
ATOM   5091 O  O   . GLY B 1 236 ? 17.248 127.592 -4.840  1.00 17.89 ? 236 GLY B O   1 
ATOM   5092 N  N   . ALA B 1 237 ? 17.867 127.090 -2.757  1.00 18.39 ? 237 ALA B N   1 
ATOM   5093 C  CA  . ALA B 1 237 ? 16.509 126.811 -2.337  1.00 18.86 ? 237 ALA B CA  1 
ATOM   5094 C  C   . ALA B 1 237 ? 16.004 128.013 -1.540  1.00 19.14 ? 237 ALA B C   1 
ATOM   5095 O  O   . ALA B 1 237 ? 16.765 128.631 -0.793  1.00 19.87 ? 237 ALA B O   1 
ATOM   5096 C  CB  . ALA B 1 237 ? 16.475 125.550 -1.476  1.00 18.07 ? 237 ALA B CB  1 
ATOM   5097 N  N   . ARG B 1 238 ? 14.733 128.359 -1.730  1.00 19.34 ? 238 ARG B N   1 
ATOM   5098 C  CA  . ARG B 1 238 ? 14.113 129.463 -1.004  1.00 18.57 ? 238 ARG B CA  1 
ATOM   5099 C  C   . ARG B 1 238 ? 13.732 128.872 0.348   1.00 19.00 ? 238 ARG B C   1 
ATOM   5100 O  O   . ARG B 1 238 ? 12.899 127.969 0.429   1.00 20.05 ? 238 ARG B O   1 
ATOM   5101 C  CB  . ARG B 1 238 ? 12.870 129.966 -1.746  1.00 17.08 ? 238 ARG B CB  1 
ATOM   5102 C  CG  . ARG B 1 238 ? 12.141 131.111 -1.054  1.00 16.85 ? 238 ARG B CG  1 
ATOM   5103 C  CD  . ARG B 1 238 ? 11.419 131.985 -2.064  1.00 15.24 ? 238 ARG B CD  1 
ATOM   5104 N  NE  . ARG B 1 238 ? 10.303 131.312 -2.716  1.00 14.90 ? 238 ARG B NE  1 
ATOM   5105 C  CZ  . ARG B 1 238 ? 9.108  131.136 -2.160  1.00 15.75 ? 238 ARG B CZ  1 
ATOM   5106 N  NH1 . ARG B 1 238 ? 8.869  131.582 -0.935  1.00 16.07 ? 238 ARG B NH1 1 
ATOM   5107 N  NH2 . ARG B 1 238 ? 8.147  130.519 -2.833  1.00 14.29 ? 238 ARG B NH2 1 
ATOM   5108 N  N   . VAL B 1 239 ? 14.360 129.378 1.403   1.00 17.69 ? 239 VAL B N   1 
ATOM   5109 C  CA  . VAL B 1 239 ? 14.131 128.871 2.745   1.00 16.20 ? 239 VAL B CA  1 
ATOM   5110 C  C   . VAL B 1 239 ? 13.084 129.632 3.546   1.00 17.06 ? 239 VAL B C   1 
ATOM   5111 O  O   . VAL B 1 239 ? 13.132 130.853 3.656   1.00 18.67 ? 239 VAL B O   1 
ATOM   5112 C  CB  . VAL B 1 239 ? 15.454 128.862 3.542   1.00 15.54 ? 239 VAL B CB  1 
ATOM   5113 C  CG1 . VAL B 1 239 ? 15.201 128.443 4.973   1.00 15.33 ? 239 VAL B CG1 1 
ATOM   5114 C  CG2 . VAL B 1 239 ? 16.453 127.932 2.873   1.00 15.47 ? 239 VAL B CG2 1 
ATOM   5115 N  N   . ILE B 1 240 ? 12.135 128.896 4.107   1.00 17.55 ? 240 ILE B N   1 
ATOM   5116 C  CA  . ILE B 1 240 ? 11.093 129.499 4.927   1.00 17.55 ? 240 ILE B CA  1 
ATOM   5117 C  C   . ILE B 1 240 ? 11.290 128.989 6.351   1.00 18.26 ? 240 ILE B C   1 
ATOM   5118 O  O   . ILE B 1 240 ? 11.442 127.788 6.575   1.00 20.28 ? 240 ILE B O   1 
ATOM   5119 C  CB  . ILE B 1 240 ? 9.680  129.128 4.418   1.00 16.80 ? 240 ILE B CB  1 
ATOM   5120 C  CG1 . ILE B 1 240 ? 9.513  129.596 2.968   1.00 14.07 ? 240 ILE B CG1 1 
ATOM   5121 C  CG2 . ILE B 1 240 ? 8.621  129.767 5.306   1.00 15.16 ? 240 ILE B CG2 1 
ATOM   5122 C  CD1 . ILE B 1 240 ? 8.131  129.387 2.423   1.00 10.25 ? 240 ILE B CD1 1 
ATOM   5123 N  N   . ILE B 1 241 ? 11.301 129.912 7.307   1.00 16.80 ? 241 ILE B N   1 
ATOM   5124 C  CA  . ILE B 1 241 ? 11.513 129.568 8.709   1.00 15.60 ? 241 ILE B CA  1 
ATOM   5125 C  C   . ILE B 1 241 ? 10.251 129.647 9.582   1.00 16.36 ? 241 ILE B C   1 
ATOM   5126 O  O   . ILE B 1 241 ? 9.407  130.520 9.389   1.00 17.27 ? 241 ILE B O   1 
ATOM   5127 C  CB  . ILE B 1 241 ? 12.598 130.503 9.344   1.00 14.39 ? 241 ILE B CB  1 
ATOM   5128 C  CG1 . ILE B 1 241 ? 13.949 130.333 8.628   1.00 13.67 ? 241 ILE B CG1 1 
ATOM   5129 C  CG2 . ILE B 1 241 ? 12.736 130.217 10.827  1.00 12.72 ? 241 ILE B CG2 1 
ATOM   5130 C  CD1 . ILE B 1 241 ? 14.534 128.938 8.683   1.00 11.70 ? 241 ILE B CD1 1 
ATOM   5131 N  N   . THR B 1 242 ? 10.117 128.715 10.524  1.00 15.38 ? 242 THR B N   1 
ATOM   5132 C  CA  . THR B 1 242 ? 8.997  128.741 11.467  1.00 13.86 ? 242 THR B CA  1 
ATOM   5133 C  C   . THR B 1 242 ? 9.697  128.807 12.818  1.00 14.32 ? 242 THR B C   1 
ATOM   5134 O  O   . THR B 1 242 ? 10.733 128.165 13.022  1.00 12.57 ? 242 THR B O   1 
ATOM   5135 C  CB  . THR B 1 242 ? 8.092  127.471 11.416  1.00 14.46 ? 242 THR B CB  1 
ATOM   5136 O  OG1 . THR B 1 242 ? 8.655  126.437 12.229  1.00 15.02 ? 242 THR B OG1 1 
ATOM   5137 C  CG2 . THR B 1 242 ? 7.945  126.970 9.995   1.00 15.32 ? 242 THR B CG2 1 
ATOM   5138 N  N   . GLU B 1 243 ? 9.146  129.592 13.734  1.00 13.27 ? 243 GLU B N   1 
ATOM   5139 C  CA  . GLU B 1 243 ? 9.760  129.759 15.042  1.00 11.79 ? 243 GLU B CA  1 
ATOM   5140 C  C   . GLU B 1 243 ? 8.753  130.179 16.110  1.00 13.59 ? 243 GLU B C   1 
ATOM   5141 O  O   . GLU B 1 243 ? 7.710  130.767 15.809  1.00 12.21 ? 243 GLU B O   1 
ATOM   5142 C  CB  . GLU B 1 243 ? 10.865 130.817 14.945  1.00 10.61 ? 243 GLU B CB  1 
ATOM   5143 C  CG  . GLU B 1 243 ? 12.287 130.281 15.041  1.00 13.68 ? 243 GLU B CG  1 
ATOM   5144 C  CD  . GLU B 1 243 ? 12.630 129.793 16.439  1.00 15.30 ? 243 GLU B CD  1 
ATOM   5145 O  OE1 . GLU B 1 243 ? 11.783 129.957 17.346  1.00 15.66 ? 243 GLU B OE1 1 
ATOM   5146 O  OE2 . GLU B 1 243 ? 13.739 129.252 16.635  1.00 13.51 ? 243 GLU B OE2 1 
ATOM   5147 N  N   . ILE B 1 244 ? 9.070  129.862 17.362  1.00 14.67 ? 244 ILE B N   1 
ATOM   5148 C  CA  . ILE B 1 244 ? 8.219  130.247 18.478  1.00 15.27 ? 244 ILE B CA  1 
ATOM   5149 C  C   . ILE B 1 244 ? 8.930  131.318 19.300  1.00 16.36 ? 244 ILE B C   1 
ATOM   5150 O  O   . ILE B 1 244 ? 8.299  132.005 20.106  1.00 16.49 ? 244 ILE B O   1 
ATOM   5151 C  CB  . ILE B 1 244 ? 7.861  129.039 19.405  1.00 14.93 ? 244 ILE B CB  1 
ATOM   5152 C  CG1 . ILE B 1 244 ? 9.118  128.300 19.857  1.00 14.32 ? 244 ILE B CG1 1 
ATOM   5153 C  CG2 . ILE B 1 244 ? 6.898  128.122 18.704  1.00 16.23 ? 244 ILE B CG2 1 
ATOM   5154 C  CD1 . ILE B 1 244 ? 9.762  128.873 21.095  1.00 13.83 ? 244 ILE B CD1 1 
ATOM   5155 N  N   . ASP B 1 245 ? 10.241 131.452 19.090  1.00 16.39 ? 245 ASP B N   1 
ATOM   5156 C  CA  . ASP B 1 245 ? 11.044 132.444 19.802  1.00 17.14 ? 245 ASP B CA  1 
ATOM   5157 C  C   . ASP B 1 245 ? 11.224 133.675 18.922  1.00 18.71 ? 245 ASP B C   1 
ATOM   5158 O  O   . ASP B 1 245 ? 11.832 133.602 17.850  1.00 18.38 ? 245 ASP B O   1 
ATOM   5159 C  CB  . ASP B 1 245 ? 12.419 131.875 20.157  1.00 18.44 ? 245 ASP B CB  1 
ATOM   5160 C  CG  . ASP B 1 245 ? 13.198 132.777 21.100  1.00 18.61 ? 245 ASP B CG  1 
ATOM   5161 O  OD1 . ASP B 1 245 ? 13.175 134.003 20.905  1.00 21.98 ? 245 ASP B OD1 1 
ATOM   5162 O  OD2 . ASP B 1 245 ? 13.841 132.265 22.036  1.00 20.69 ? 245 ASP B OD2 1 
ATOM   5163 N  N   . PRO B 1 246 ? 10.707 134.831 19.376  1.00 19.73 ? 246 PRO B N   1 
ATOM   5164 C  CA  . PRO B 1 246 ? 10.786 136.106 18.653  1.00 18.72 ? 246 PRO B CA  1 
ATOM   5165 C  C   . PRO B 1 246 ? 12.202 136.565 18.321  1.00 18.08 ? 246 PRO B C   1 
ATOM   5166 O  O   . PRO B 1 246 ? 12.422 137.223 17.305  1.00 17.67 ? 246 PRO B O   1 
ATOM   5167 C  CB  . PRO B 1 246 ? 10.060 137.074 19.581  1.00 18.14 ? 246 PRO B CB  1 
ATOM   5168 C  CG  . PRO B 1 246 ? 10.341 136.502 20.936  1.00 19.62 ? 246 PRO B CG  1 
ATOM   5169 C  CD  . PRO B 1 246 ? 10.130 135.028 20.718  1.00 19.08 ? 246 PRO B CD  1 
ATOM   5170 N  N   . ILE B 1 247 ? 13.160 136.214 19.169  1.00 16.92 ? 247 ILE B N   1 
ATOM   5171 C  CA  . ILE B 1 247 ? 14.541 136.604 18.929  1.00 17.83 ? 247 ILE B CA  1 
ATOM   5172 C  C   . ILE B 1 247 ? 15.102 135.823 17.746  1.00 19.01 ? 247 ILE B C   1 
ATOM   5173 O  O   . ILE B 1 247 ? 15.703 136.401 16.836  1.00 21.02 ? 247 ILE B O   1 
ATOM   5174 C  CB  . ILE B 1 247 ? 15.416 136.365 20.173  1.00 17.00 ? 247 ILE B CB  1 
ATOM   5175 C  CG1 . ILE B 1 247 ? 14.839 137.147 21.361  1.00 18.01 ? 247 ILE B CG1 1 
ATOM   5176 C  CG2 . ILE B 1 247 ? 16.838 136.814 19.905  1.00 15.01 ? 247 ILE B CG2 1 
ATOM   5177 C  CD1 . ILE B 1 247 ? 15.602 136.973 22.656  1.00 15.45 ? 247 ILE B CD1 1 
ATOM   5178 N  N   . ASN B 1 248 ? 14.898 134.512 17.749  1.00 18.36 ? 248 ASN B N   1 
ATOM   5179 C  CA  . ASN B 1 248 ? 15.385 133.687 16.655  1.00 18.15 ? 248 ASN B CA  1 
ATOM   5180 C  C   . ASN B 1 248 ? 14.660 134.070 15.372  1.00 18.16 ? 248 ASN B C   1 
ATOM   5181 O  O   . ASN B 1 248 ? 15.274 134.180 14.311  1.00 19.76 ? 248 ASN B O   1 
ATOM   5182 C  CB  . ASN B 1 248 ? 15.169 132.203 16.964  1.00 20.16 ? 248 ASN B CB  1 
ATOM   5183 C  CG  . ASN B 1 248 ? 15.917 131.755 18.209  1.00 19.46 ? 248 ASN B CG  1 
ATOM   5184 O  OD1 . ASN B 1 248 ? 15.512 132.058 19.330  1.00 18.30 ? 248 ASN B OD1 1 
ATOM   5185 N  ND2 . ASN B 1 248 ? 17.026 131.045 18.014  1.00 18.12 ? 248 ASN B ND2 1 
ATOM   5186 N  N   . ALA B 1 249 ? 13.353 134.281 15.472  1.00 17.57 ? 249 ALA B N   1 
ATOM   5187 C  CA  . ALA B 1 249 ? 12.558 134.675 14.317  1.00 16.68 ? 249 ALA B CA  1 
ATOM   5188 C  C   . ALA B 1 249 ? 13.089 135.996 13.741  1.00 16.80 ? 249 ALA B C   1 
ATOM   5189 O  O   . ALA B 1 249 ? 13.195 136.155 12.525  1.00 17.57 ? 249 ALA B O   1 
ATOM   5190 C  CB  . ALA B 1 249 ? 11.104 134.822 14.720  1.00 15.22 ? 249 ALA B CB  1 
ATOM   5191 N  N   . LEU B 1 250 ? 13.433 136.937 14.614  1.00 15.90 ? 250 LEU B N   1 
ATOM   5192 C  CA  . LEU B 1 250 ? 13.953 138.223 14.164  1.00 16.96 ? 250 LEU B CA  1 
ATOM   5193 C  C   . LEU B 1 250 ? 15.298 138.054 13.450  1.00 16.86 ? 250 LEU B C   1 
ATOM   5194 O  O   . LEU B 1 250 ? 15.587 138.744 12.464  1.00 15.14 ? 250 LEU B O   1 
ATOM   5195 C  CB  . LEU B 1 250 ? 14.111 139.182 15.353  1.00 17.98 ? 250 LEU B CB  1 
ATOM   5196 C  CG  . LEU B 1 250 ? 14.492 140.625 14.997  1.00 19.67 ? 250 LEU B CG  1 
ATOM   5197 C  CD1 . LEU B 1 250 ? 13.516 141.165 13.975  1.00 20.84 ? 250 LEU B CD1 1 
ATOM   5198 C  CD2 . LEU B 1 250 ? 14.479 141.500 16.234  1.00 21.53 ? 250 LEU B CD2 1 
ATOM   5199 N  N   . GLN B 1 251 ? 16.117 137.132 13.949  1.00 16.58 ? 251 GLN B N   1 
ATOM   5200 C  CA  . GLN B 1 251 ? 17.422 136.875 13.352  1.00 16.71 ? 251 GLN B CA  1 
ATOM   5201 C  C   . GLN B 1 251 ? 17.262 136.335 11.942  1.00 18.02 ? 251 GLN B C   1 
ATOM   5202 O  O   . GLN B 1 251 ? 18.006 136.714 11.032  1.00 18.98 ? 251 GLN B O   1 
ATOM   5203 C  CB  . GLN B 1 251 ? 18.186 135.860 14.181  1.00 18.06 ? 251 GLN B CB  1 
ATOM   5204 C  CG  . GLN B 1 251 ? 18.527 136.307 15.581  1.00 16.52 ? 251 GLN B CG  1 
ATOM   5205 C  CD  . GLN B 1 251 ? 19.273 135.228 16.327  1.00 18.68 ? 251 GLN B CD  1 
ATOM   5206 O  OE1 . GLN B 1 251 ? 18.699 134.198 16.684  1.00 22.56 ? 251 GLN B OE1 1 
ATOM   5207 N  NE2 . GLN B 1 251 ? 20.565 135.441 16.546  1.00 18.08 ? 251 GLN B NE2 1 
ATOM   5208 N  N   . ALA B 1 252 ? 16.291 135.440 11.770  1.00 17.15 ? 252 ALA B N   1 
ATOM   5209 C  CA  . ALA B 1 252 ? 16.018 134.845 10.470  1.00 16.56 ? 252 ALA B CA  1 
ATOM   5210 C  C   . ALA B 1 252 ? 15.531 135.930 9.514   1.00 16.31 ? 252 ALA B C   1 
ATOM   5211 O  O   . ALA B 1 252 ? 15.917 135.958 8.341   1.00 16.35 ? 252 ALA B O   1 
ATOM   5212 C  CB  . ALA B 1 252 ? 14.967 133.751 10.610  1.00 17.91 ? 252 ALA B CB  1 
ATOM   5213 N  N   . ALA B 1 253 ? 14.681 136.821 10.022  1.00 14.11 ? 253 ALA B N   1 
ATOM   5214 C  CA  . ALA B 1 253 ? 14.160 137.919 9.218   1.00 15.07 ? 253 ALA B CA  1 
ATOM   5215 C  C   . ALA B 1 253 ? 15.298 138.843 8.777   1.00 15.59 ? 253 ALA B C   1 
ATOM   5216 O  O   . ALA B 1 253 ? 15.268 139.386 7.676   1.00 15.91 ? 253 ALA B O   1 
ATOM   5217 C  CB  . ALA B 1 253 ? 13.121 138.703 10.013  1.00 13.73 ? 253 ALA B CB  1 
ATOM   5218 N  N   . MET B 1 254 ? 16.302 139.011 9.634   1.00 16.37 ? 254 MET B N   1 
ATOM   5219 C  CA  . MET B 1 254 ? 17.440 139.866 9.307   1.00 18.41 ? 254 MET B CA  1 
ATOM   5220 C  C   . MET B 1 254 ? 18.322 139.266 8.227   1.00 18.54 ? 254 MET B C   1 
ATOM   5221 O  O   . MET B 1 254 ? 19.092 139.978 7.592   1.00 19.22 ? 254 MET B O   1 
ATOM   5222 C  CB  . MET B 1 254 ? 18.297 140.146 10.547  1.00 19.10 ? 254 MET B CB  1 
ATOM   5223 C  CG  . MET B 1 254 ? 17.627 141.019 11.583  1.00 19.79 ? 254 MET B CG  1 
ATOM   5224 S  SD  . MET B 1 254 ? 16.779 142.423 10.842  1.00 20.32 ? 254 MET B SD  1 
ATOM   5225 C  CE  . MET B 1 254 ? 18.152 143.526 10.547  1.00 22.89 ? 254 MET B CE  1 
ATOM   5226 N  N   . GLU B 1 255 ? 18.230 137.955 8.030   1.00 20.55 ? 255 GLU B N   1 
ATOM   5227 C  CA  . GLU B 1 255 ? 19.027 137.300 6.995   1.00 20.36 ? 255 GLU B CA  1 
ATOM   5228 C  C   . GLU B 1 255 ? 18.208 137.156 5.729   1.00 19.91 ? 255 GLU B C   1 
ATOM   5229 O  O   . GLU B 1 255 ? 18.645 136.534 4.769   1.00 20.82 ? 255 GLU B O   1 
ATOM   5230 C  CB  . GLU B 1 255 ? 19.508 135.926 7.452   1.00 20.83 ? 255 GLU B CB  1 
ATOM   5231 C  CG  . GLU B 1 255 ? 20.497 135.981 8.601   1.00 21.90 ? 255 GLU B CG  1 
ATOM   5232 C  CD  . GLU B 1 255 ? 21.597 136.996 8.360   1.00 23.19 ? 255 GLU B CD  1 
ATOM   5233 O  OE1 . GLU B 1 255 ? 22.185 136.987 7.257   1.00 24.96 ? 255 GLU B OE1 1 
ATOM   5234 O  OE2 . GLU B 1 255 ? 21.875 137.799 9.273   1.00 22.09 ? 255 GLU B OE2 1 
ATOM   5235 N  N   . GLY B 1 256 ? 17.012 137.734 5.734   1.00 18.91 ? 256 GLY B N   1 
ATOM   5236 C  CA  . GLY B 1 256 ? 16.168 137.671 4.561   1.00 17.68 ? 256 GLY B CA  1 
ATOM   5237 C  C   . GLY B 1 256 ? 15.347 136.408 4.405   1.00 17.46 ? 256 GLY B C   1 
ATOM   5238 O  O   . GLY B 1 256 ? 14.948 136.073 3.294   1.00 19.21 ? 256 GLY B O   1 
ATOM   5239 N  N   . TYR B 1 257 ? 15.099 135.696 5.499   1.00 16.65 ? 257 TYR B N   1 
ATOM   5240 C  CA  . TYR B 1 257 ? 14.281 134.489 5.436   1.00 16.44 ? 257 TYR B CA  1 
ATOM   5241 C  C   . TYR B 1 257 ? 12.849 134.845 5.797   1.00 17.02 ? 257 TYR B C   1 
ATOM   5242 O  O   . TYR B 1 257 ? 12.599 135.522 6.795   1.00 16.91 ? 257 TYR B O   1 
ATOM   5243 C  CB  . TYR B 1 257 ? 14.747 133.425 6.437   1.00 15.51 ? 257 TYR B CB  1 
ATOM   5244 C  CG  . TYR B 1 257 ? 16.086 132.796 6.161   1.00 13.70 ? 257 TYR B CG  1 
ATOM   5245 C  CD1 . TYR B 1 257 ? 16.288 131.988 5.050   1.00 13.41 ? 257 TYR B CD1 1 
ATOM   5246 C  CD2 . TYR B 1 257 ? 17.143 132.992 7.031   1.00 12.53 ? 257 TYR B CD2 1 
ATOM   5247 C  CE1 . TYR B 1 257 ? 17.516 131.394 4.821   1.00 14.61 ? 257 TYR B CE1 1 
ATOM   5248 C  CE2 . TYR B 1 257 ? 18.359 132.405 6.813   1.00 14.02 ? 257 TYR B CE2 1 
ATOM   5249 C  CZ  . TYR B 1 257 ? 18.548 131.610 5.712   1.00 13.66 ? 257 TYR B CZ  1 
ATOM   5250 O  OH  . TYR B 1 257 ? 19.786 131.051 5.506   1.00 15.70 ? 257 TYR B OH  1 
ATOM   5251 N  N   . GLU B 1 258 ? 11.906 134.399 4.983   1.00 17.29 ? 258 GLU B N   1 
ATOM   5252 C  CA  . GLU B 1 258 ? 10.514 134.646 5.294   1.00 17.49 ? 258 GLU B CA  1 
ATOM   5253 C  C   . GLU B 1 258 ? 10.208 133.760 6.495   1.00 17.99 ? 258 GLU B C   1 
ATOM   5254 O  O   . GLU B 1 258 ? 10.514 132.572 6.491   1.00 19.24 ? 258 GLU B O   1 
ATOM   5255 C  CB  . GLU B 1 258 ? 9.628  134.252 4.117   1.00 17.18 ? 258 GLU B CB  1 
ATOM   5256 C  CG  . GLU B 1 258 ? 8.202  133.946 4.506   1.00 17.03 ? 258 GLU B CG  1 
ATOM   5257 C  CD  . GLU B 1 258 ? 7.314  133.690 3.310   1.00 18.00 ? 258 GLU B CD  1 
ATOM   5258 O  OE1 . GLU B 1 258 ? 7.806  133.137 2.294   1.00 16.70 ? 258 GLU B OE1 1 
ATOM   5259 O  OE2 . GLU B 1 258 ? 6.118  134.035 3.395   1.00 18.45 ? 258 GLU B OE2 1 
ATOM   5260 N  N   . VAL B 1 259 ? 9.629  134.340 7.534   1.00 18.73 ? 259 VAL B N   1 
ATOM   5261 C  CA  . VAL B 1 259 ? 9.295  133.568 8.719   1.00 18.95 ? 259 VAL B CA  1 
ATOM   5262 C  C   . VAL B 1 259 ? 7.781  133.506 8.893   1.00 19.85 ? 259 VAL B C   1 
ATOM   5263 O  O   . VAL B 1 259 ? 7.131  134.516 9.150   1.00 19.92 ? 259 VAL B O   1 
ATOM   5264 C  CB  . VAL B 1 259 ? 9.918  134.188 9.991   1.00 18.57 ? 259 VAL B CB  1 
ATOM   5265 C  CG1 . VAL B 1 259 ? 9.606  133.319 11.192  1.00 16.54 ? 259 VAL B CG1 1 
ATOM   5266 C  CG2 . VAL B 1 259 ? 11.418 134.340 9.819   1.00 18.84 ? 259 VAL B CG2 1 
ATOM   5267 N  N   . THR B 1 260 ? 7.218  132.315 8.743   1.00 20.09 ? 260 THR B N   1 
ATOM   5268 C  CA  . THR B 1 260 ? 5.783  132.144 8.896   1.00 18.55 ? 260 THR B CA  1 
ATOM   5269 C  C   . THR B 1 260 ? 5.503  130.862 9.668   1.00 17.76 ? 260 THR B C   1 
ATOM   5270 O  O   . THR B 1 260 ? 6.428  130.198 10.136  1.00 16.81 ? 260 THR B O   1 
ATOM   5271 C  CB  . THR B 1 260 ? 5.078  132.103 7.523   1.00 18.02 ? 260 THR B CB  1 
ATOM   5272 O  OG1 . THR B 1 260 ? 3.658  132.165 7.712   1.00 18.52 ? 260 THR B OG1 1 
ATOM   5273 C  CG2 . THR B 1 260 ? 5.440  130.839 6.775   1.00 17.14 ? 260 THR B CG2 1 
ATOM   5274 N  N   . THR B 1 261 ? 4.229  130.519 9.813   1.00 17.78 ? 261 THR B N   1 
ATOM   5275 C  CA  . THR B 1 261 ? 3.855  129.321 10.557  1.00 16.80 ? 261 THR B CA  1 
ATOM   5276 C  C   . THR B 1 261 ? 3.782  128.110 9.659   1.00 16.03 ? 261 THR B C   1 
ATOM   5277 O  O   . THR B 1 261 ? 3.555  128.231 8.459   1.00 15.25 ? 261 THR B O   1 
ATOM   5278 C  CB  . THR B 1 261 ? 2.486  129.487 11.254  1.00 17.04 ? 261 THR B CB  1 
ATOM   5279 O  OG1 . THR B 1 261 ? 1.468  129.686 10.264  1.00 18.45 ? 261 THR B OG1 1 
ATOM   5280 C  CG2 . THR B 1 261 ? 2.513  130.684 12.203  1.00 14.90 ? 261 THR B CG2 1 
ATOM   5281 N  N   . MET B 1 262 ? 3.985  126.941 10.257  1.00 16.08 ? 262 MET B N   1 
ATOM   5282 C  CA  . MET B 1 262 ? 3.930  125.689 9.529   1.00 15.27 ? 262 MET B CA  1 
ATOM   5283 C  C   . MET B 1 262 ? 2.544  125.534 8.928   1.00 16.06 ? 262 MET B C   1 
ATOM   5284 O  O   . MET B 1 262 ? 2.407  125.077 7.790   1.00 15.56 ? 262 MET B O   1 
ATOM   5285 C  CB  . MET B 1 262 ? 4.218  124.512 10.465  1.00 16.89 ? 262 MET B CB  1 
ATOM   5286 C  CG  . MET B 1 262 ? 4.195  123.133 9.784   1.00 16.08 ? 262 MET B CG  1 
ATOM   5287 S  SD  . MET B 1 262 ? 5.467  122.899 8.507   1.00 16.84 ? 262 MET B SD  1 
ATOM   5288 C  CE  . MET B 1 262 ? 6.943  122.749 9.535   1.00 11.59 ? 262 MET B CE  1 
ATOM   5289 N  N   . ASP B 1 263 ? 1.518  125.920 9.691   1.00 16.94 ? 263 ASP B N   1 
ATOM   5290 C  CA  . ASP B 1 263 ? 0.141  125.815 9.213   1.00 17.99 ? 263 ASP B CA  1 
ATOM   5291 C  C   . ASP B 1 263 ? 0.016  126.459 7.840   1.00 18.99 ? 263 ASP B C   1 
ATOM   5292 O  O   . ASP B 1 263 ? -0.802 126.052 7.017   1.00 18.13 ? 263 ASP B O   1 
ATOM   5293 C  CB  . ASP B 1 263 ? -0.835 126.483 10.186  1.00 17.94 ? 263 ASP B CB  1 
ATOM   5294 C  CG  . ASP B 1 263 ? -1.086 125.651 11.440  1.00 20.98 ? 263 ASP B CG  1 
ATOM   5295 O  OD1 . ASP B 1 263 ? -0.943 124.412 11.384  1.00 22.75 ? 263 ASP B OD1 1 
ATOM   5296 O  OD2 . ASP B 1 263 ? -1.447 126.231 12.486  1.00 22.17 ? 263 ASP B OD2 1 
ATOM   5297 N  N   . GLU B 1 264 ? 0.855  127.455 7.593   1.00 20.80 ? 264 GLU B N   1 
ATOM   5298 C  CA  . GLU B 1 264 ? 0.853  128.169 6.330   1.00 23.60 ? 264 GLU B CA  1 
ATOM   5299 C  C   . GLU B 1 264 ? 1.868  127.603 5.327   1.00 24.50 ? 264 GLU B C   1 
ATOM   5300 O  O   . GLU B 1 264 ? 1.516  127.287 4.186   1.00 25.77 ? 264 GLU B O   1 
ATOM   5301 C  CB  . GLU B 1 264 ? 1.150  129.633 6.600   1.00 25.71 ? 264 GLU B CB  1 
ATOM   5302 C  CG  . GLU B 1 264 ? 0.748  130.562 5.497   1.00 31.77 ? 264 GLU B CG  1 
ATOM   5303 C  CD  . GLU B 1 264 ? 0.174  131.850 6.047   1.00 35.99 ? 264 GLU B CD  1 
ATOM   5304 O  OE1 . GLU B 1 264 ? -0.918 131.782 6.659   1.00 35.89 ? 264 GLU B OE1 1 
ATOM   5305 O  OE2 . GLU B 1 264 ? 0.815  132.916 5.878   1.00 36.75 ? 264 GLU B OE2 1 
ATOM   5306 N  N   . ALA B 1 265 ? 3.119  127.464 5.759   1.00 23.88 ? 265 ALA B N   1 
ATOM   5307 C  CA  . ALA B 1 265 ? 4.186  126.956 4.896   1.00 22.81 ? 265 ALA B CA  1 
ATOM   5308 C  C   . ALA B 1 265 ? 4.004  125.522 4.407   1.00 23.13 ? 265 ALA B C   1 
ATOM   5309 O  O   . ALA B 1 265 ? 4.598  125.130 3.392   1.00 23.41 ? 265 ALA B O   1 
ATOM   5310 C  CB  . ALA B 1 265 ? 5.522  127.085 5.603   1.00 22.01 ? 265 ALA B CB  1 
ATOM   5311 N  N   . CYS B 1 266 ? 3.193  124.739 5.115   1.00 22.36 ? 266 CYS B N   1 
ATOM   5312 C  CA  . CYS B 1 266 ? 2.974  123.347 4.726   1.00 22.27 ? 266 CYS B CA  1 
ATOM   5313 C  C   . CYS B 1 266 ? 2.374  123.223 3.327   1.00 22.83 ? 266 CYS B C   1 
ATOM   5314 O  O   . CYS B 1 266 ? 2.534  122.201 2.657   1.00 22.93 ? 266 CYS B O   1 
ATOM   5315 C  CB  . CYS B 1 266 ? 2.073  122.641 5.744   1.00 21.64 ? 266 CYS B CB  1 
ATOM   5316 S  SG  . CYS B 1 266 ? 0.343  123.181 5.801   1.00 21.11 ? 266 CYS B SG  1 
ATOM   5317 N  N   . GLN B 1 267 ? 1.695  124.276 2.887   1.00 23.57 ? 267 GLN B N   1 
ATOM   5318 C  CA  . GLN B 1 267 ? 1.067  124.292 1.572   1.00 24.74 ? 267 GLN B CA  1 
ATOM   5319 C  C   . GLN B 1 267 ? 2.057  124.699 0.499   1.00 23.96 ? 267 GLN B C   1 
ATOM   5320 O  O   . GLN B 1 267 ? 1.784  124.557 -0.693  1.00 24.13 ? 267 GLN B O   1 
ATOM   5321 C  CB  . GLN B 1 267 ? -0.083 125.290 1.556   1.00 26.05 ? 267 GLN B CB  1 
ATOM   5322 C  CG  . GLN B 1 267 ? -1.128 125.053 2.615   1.00 30.55 ? 267 GLN B CG  1 
ATOM   5323 C  CD  . GLN B 1 267 ? -2.004 126.272 2.820   1.00 33.34 ? 267 GLN B CD  1 
ATOM   5324 O  OE1 . GLN B 1 267 ? -2.497 126.867 1.854   1.00 32.42 ? 267 GLN B OE1 1 
ATOM   5325 N  NE2 . GLN B 1 267 ? -2.205 126.652 4.082   1.00 32.36 ? 267 GLN B NE2 1 
ATOM   5326 N  N   . GLU B 1 268 ? 3.213  125.197 0.917   1.00 22.76 ? 268 GLU B N   1 
ATOM   5327 C  CA  . GLU B 1 268 ? 4.196  125.658 -0.046  1.00 22.65 ? 268 GLU B CA  1 
ATOM   5328 C  C   . GLU B 1 268 ? 5.531  124.911 -0.115  1.00 20.24 ? 268 GLU B C   1 
ATOM   5329 O  O   . GLU B 1 268 ? 6.161  124.867 -1.168  1.00 19.67 ? 268 GLU B O   1 
ATOM   5330 C  CB  . GLU B 1 268 ? 4.437  127.146 0.197   1.00 24.36 ? 268 GLU B CB  1 
ATOM   5331 C  CG  . GLU B 1 268 ? 5.394  127.787 -0.767  1.00 28.39 ? 268 GLU B CG  1 
ATOM   5332 C  CD  . GLU B 1 268 ? 5.129  129.267 -0.928  1.00 30.49 ? 268 GLU B CD  1 
ATOM   5333 O  OE1 . GLU B 1 268 ? 4.925  129.944 0.104   1.00 29.02 ? 268 GLU B OE1 1 
ATOM   5334 O  OE2 . GLU B 1 268 ? 5.131  129.745 -2.086  1.00 31.20 ? 268 GLU B OE2 1 
ATOM   5335 N  N   . GLY B 1 269 ? 5.958  124.313 0.990   1.00 18.23 ? 269 GLY B N   1 
ATOM   5336 C  CA  . GLY B 1 269 ? 7.233  123.617 0.989   1.00 17.19 ? 269 GLY B CA  1 
ATOM   5337 C  C   . GLY B 1 269 ? 7.371  122.371 0.130   1.00 17.58 ? 269 GLY B C   1 
ATOM   5338 O  O   . GLY B 1 269 ? 6.441  121.574 0.015   1.00 18.62 ? 269 GLY B O   1 
ATOM   5339 N  N   . ASN B 1 270 ? 8.541  122.212 -0.487  1.00 17.78 ? 270 ASN B N   1 
ATOM   5340 C  CA  . ASN B 1 270 ? 8.841  121.038 -1.307  1.00 15.58 ? 270 ASN B CA  1 
ATOM   5341 C  C   . ASN B 1 270 ? 9.623  120.108 -0.402  1.00 16.62 ? 270 ASN B C   1 
ATOM   5342 O  O   . ASN B 1 270 ? 9.622  118.896 -0.576  1.00 18.54 ? 270 ASN B O   1 
ATOM   5343 C  CB  . ASN B 1 270 ? 9.739  121.392 -2.492  1.00 15.61 ? 270 ASN B CB  1 
ATOM   5344 C  CG  . ASN B 1 270 ? 9.053  122.263 -3.508  1.00 15.69 ? 270 ASN B CG  1 
ATOM   5345 O  OD1 . ASN B 1 270 ? 9.405  123.428 -3.681  1.00 18.07 ? 270 ASN B OD1 1 
ATOM   5346 N  ND2 . ASN B 1 270 ? 8.066  121.704 -4.193  1.00 17.48 ? 270 ASN B ND2 1 
ATOM   5347 N  N   . ILE B 1 271 ? 10.312 120.709 0.559   1.00 16.84 ? 271 ILE B N   1 
ATOM   5348 C  CA  . ILE B 1 271 ? 11.131 119.985 1.510   1.00 15.95 ? 271 ILE B CA  1 
ATOM   5349 C  C   . ILE B 1 271 ? 10.817 120.537 2.886   1.00 16.52 ? 271 ILE B C   1 
ATOM   5350 O  O   . ILE B 1 271 ? 10.643 121.745 3.049   1.00 18.47 ? 271 ILE B O   1 
ATOM   5351 C  CB  . ILE B 1 271 ? 12.642 120.207 1.231   1.00 15.82 ? 271 ILE B CB  1 
ATOM   5352 C  CG1 . ILE B 1 271 ? 13.010 119.643 -0.141  1.00 17.55 ? 271 ILE B CG1 1 
ATOM   5353 C  CG2 . ILE B 1 271 ? 13.479 119.559 2.323   1.00 13.90 ? 271 ILE B CG2 1 
ATOM   5354 C  CD1 . ILE B 1 271 ? 14.469 119.831 -0.519  1.00 15.67 ? 271 ILE B CD1 1 
ATOM   5355 N  N   . PHE B 1 272 ? 10.738 119.650 3.870   1.00 15.25 ? 272 PHE B N   1 
ATOM   5356 C  CA  . PHE B 1 272 ? 10.464 120.058 5.236   1.00 15.15 ? 272 PHE B CA  1 
ATOM   5357 C  C   . PHE B 1 272 ? 11.527 119.497 6.171   1.00 15.55 ? 272 PHE B C   1 
ATOM   5358 O  O   . PHE B 1 272 ? 11.851 118.315 6.130   1.00 17.67 ? 272 PHE B O   1 
ATOM   5359 C  CB  . PHE B 1 272 ? 9.074  119.585 5.673   1.00 15.16 ? 272 PHE B CB  1 
ATOM   5360 C  CG  . PHE B 1 272 ? 7.946  120.263 4.946   1.00 13.85 ? 272 PHE B CG  1 
ATOM   5361 C  CD1 . PHE B 1 272 ? 7.638  119.920 3.637   1.00 12.80 ? 272 PHE B CD1 1 
ATOM   5362 C  CD2 . PHE B 1 272 ? 7.203  121.251 5.568   1.00 14.19 ? 272 PHE B CD2 1 
ATOM   5363 C  CE1 . PHE B 1 272 ? 6.609  120.547 2.960   1.00 13.20 ? 272 PHE B CE1 1 
ATOM   5364 C  CE2 . PHE B 1 272 ? 6.165  121.890 4.896   1.00 15.57 ? 272 PHE B CE2 1 
ATOM   5365 C  CZ  . PHE B 1 272 ? 5.868  121.537 3.591   1.00 14.78 ? 272 PHE B CZ  1 
ATOM   5366 N  N   . VAL B 1 273 ? 12.070 120.357 7.016   1.00 14.66 ? 273 VAL B N   1 
ATOM   5367 C  CA  . VAL B 1 273 ? 13.102 119.950 7.952   1.00 13.71 ? 273 VAL B CA  1 
ATOM   5368 C  C   . VAL B 1 273 ? 12.774 120.491 9.339   1.00 15.06 ? 273 VAL B C   1 
ATOM   5369 O  O   . VAL B 1 273 ? 12.624 121.698 9.524   1.00 15.53 ? 273 VAL B O   1 
ATOM   5370 C  CB  . VAL B 1 273 ? 14.476 120.488 7.508   1.00 13.39 ? 273 VAL B CB  1 
ATOM   5371 C  CG1 . VAL B 1 273 ? 15.545 120.058 8.482   1.00 12.04 ? 273 VAL B CG1 1 
ATOM   5372 C  CG2 . VAL B 1 273 ? 14.789 119.998 6.112   1.00 10.73 ? 273 VAL B CG2 1 
ATOM   5373 N  N   . THR B 1 274 ? 12.652 119.591 10.310  1.00 15.46 ? 274 THR B N   1 
ATOM   5374 C  CA  . THR B 1 274 ? 12.346 119.982 11.680  1.00 15.51 ? 274 THR B CA  1 
ATOM   5375 C  C   . THR B 1 274 ? 13.624 119.957 12.507  1.00 15.96 ? 274 THR B C   1 
ATOM   5376 O  O   . THR B 1 274 ? 14.365 118.981 12.473  1.00 17.23 ? 274 THR B O   1 
ATOM   5377 C  CB  . THR B 1 274 ? 11.297 119.036 12.299  1.00 16.75 ? 274 THR B CB  1 
ATOM   5378 O  OG1 . THR B 1 274 ? 11.784 117.689 12.273  1.00 17.71 ? 274 THR B OG1 1 
ATOM   5379 C  CG2 . THR B 1 274 ? 9.994  119.109 11.514  1.00 16.14 ? 274 THR B CG2 1 
ATOM   5380 N  N   . THR B 1 275 ? 13.878 121.037 13.243  1.00 15.98 ? 275 THR B N   1 
ATOM   5381 C  CA  . THR B 1 275 ? 15.087 121.167 14.066  1.00 14.70 ? 275 THR B CA  1 
ATOM   5382 C  C   . THR B 1 275 ? 14.750 121.785 15.416  1.00 16.19 ? 275 THR B C   1 
ATOM   5383 O  O   . THR B 1 275 ? 15.637 122.251 16.133  1.00 16.81 ? 275 THR B O   1 
ATOM   5384 C  CB  . THR B 1 275 ? 16.098 122.122 13.409  1.00 13.46 ? 275 THR B CB  1 
ATOM   5385 O  OG1 . THR B 1 275 ? 15.663 123.473 13.610  1.00 10.81 ? 275 THR B OG1 1 
ATOM   5386 C  CG2 . THR B 1 275 ? 16.192 121.869 11.921  1.00 12.38 ? 275 THR B CG2 1 
ATOM   5387 N  N   . THR B 1 276 ? 13.468 121.783 15.754  1.00 17.59 ? 276 THR B N   1 
ATOM   5388 C  CA  . THR B 1 276 ? 12.978 122.405 16.980  1.00 17.77 ? 276 THR B CA  1 
ATOM   5389 C  C   . THR B 1 276 ? 13.288 121.734 18.306  1.00 19.70 ? 276 THR B C   1 
ATOM   5390 O  O   . THR B 1 276 ? 13.440 122.414 19.322  1.00 21.58 ? 276 THR B O   1 
ATOM   5391 C  CB  . THR B 1 276 ? 11.446 122.592 16.919  1.00 18.27 ? 276 THR B CB  1 
ATOM   5392 O  OG1 . THR B 1 276 ? 10.797 121.357 17.253  1.00 16.90 ? 276 THR B OG1 1 
ATOM   5393 C  CG2 . THR B 1 276 ? 11.012 123.015 15.516  1.00 16.89 ? 276 THR B CG2 1 
ATOM   5394 N  N   . GLY B 1 277 ? 13.371 120.408 18.313  1.00 21.09 ? 277 GLY B N   1 
ATOM   5395 C  CA  . GLY B 1 277 ? 13.609 119.708 19.563  1.00 21.03 ? 277 GLY B CA  1 
ATOM   5396 C  C   . GLY B 1 277 ? 12.296 119.674 20.339  1.00 21.34 ? 277 GLY B C   1 
ATOM   5397 O  O   . GLY B 1 277 ? 12.259 119.380 21.531  1.00 22.57 ? 277 GLY B O   1 
ATOM   5398 N  N   . CYS B 1 278 ? 11.208 119.969 19.637  1.00 21.66 ? 278 CYS B N   1 
ATOM   5399 C  CA  . CYS B 1 278 ? 9.867  120.006 20.214  1.00 21.98 ? 278 CYS B CA  1 
ATOM   5400 C  C   . CYS B 1 278 ? 8.964  118.988 19.515  1.00 22.07 ? 278 CYS B C   1 
ATOM   5401 O  O   . CYS B 1 278 ? 9.281  118.519 18.423  1.00 23.17 ? 278 CYS B O   1 
ATOM   5402 C  CB  . CYS B 1 278 ? 9.296  121.419 20.041  1.00 22.90 ? 278 CYS B CB  1 
ATOM   5403 S  SG  . CYS B 1 278 ? 7.639  121.691 20.671  1.00 23.51 ? 278 CYS B SG  1 
ATOM   5404 N  N   . ILE B 1 279 ? 7.843  118.646 20.138  1.00 22.31 ? 279 ILE B N   1 
ATOM   5405 C  CA  . ILE B 1 279 ? 6.916  117.687 19.546  1.00 24.07 ? 279 ILE B CA  1 
ATOM   5406 C  C   . ILE B 1 279 ? 5.852  118.343 18.666  1.00 24.47 ? 279 ILE B C   1 
ATOM   5407 O  O   . ILE B 1 279 ? 5.662  119.560 18.687  1.00 25.70 ? 279 ILE B O   1 
ATOM   5408 C  CB  . ILE B 1 279 ? 6.164  116.887 20.622  1.00 25.41 ? 279 ILE B CB  1 
ATOM   5409 C  CG1 . ILE B 1 279 ? 5.348  117.842 21.495  1.00 26.21 ? 279 ILE B CG1 1 
ATOM   5410 C  CG2 . ILE B 1 279 ? 7.137  116.087 21.461  1.00 27.31 ? 279 ILE B CG2 1 
ATOM   5411 C  CD1 . ILE B 1 279 ? 4.534  117.138 22.572  1.00 27.57 ? 279 ILE B CD1 1 
ATOM   5412 N  N   . ASP B 1 280 ? 5.155  117.512 17.900  1.00 23.57 ? 280 ASP B N   1 
ATOM   5413 C  CA  . ASP B 1 280 ? 4.076  117.963 17.035  1.00 23.50 ? 280 ASP B CA  1 
ATOM   5414 C  C   . ASP B 1 280 ? 4.420  119.152 16.140  1.00 23.87 ? 280 ASP B C   1 
ATOM   5415 O  O   . ASP B 1 280 ? 3.748  120.184 16.192  1.00 25.05 ? 280 ASP B O   1 
ATOM   5416 C  CB  . ASP B 1 280 ? 2.847  118.312 17.886  1.00 22.72 ? 280 ASP B CB  1 
ATOM   5417 C  CG  . ASP B 1 280 ? 2.509  117.226 18.898  1.00 23.29 ? 280 ASP B CG  1 
ATOM   5418 O  OD1 . ASP B 1 280 ? 2.779  116.044 18.605  1.00 22.70 ? 280 ASP B OD1 1 
ATOM   5419 O  OD2 . ASP B 1 280 ? 1.965  117.552 19.979  1.00 23.07 ? 280 ASP B OD2 1 
ATOM   5420 N  N   . ILE B 1 281 ? 5.450  119.009 15.313  1.00 22.03 ? 281 ILE B N   1 
ATOM   5421 C  CA  . ILE B 1 281 ? 5.836  120.093 14.420  1.00 19.76 ? 281 ILE B CA  1 
ATOM   5422 C  C   . ILE B 1 281 ? 5.122  119.903 13.095  1.00 21.19 ? 281 ILE B C   1 
ATOM   5423 O  O   . ILE B 1 281 ? 4.498  120.824 12.568  1.00 22.14 ? 281 ILE B O   1 
ATOM   5424 C  CB  . ILE B 1 281 ? 7.352  120.109 14.187  1.00 18.64 ? 281 ILE B CB  1 
ATOM   5425 C  CG1 . ILE B 1 281 ? 8.069  120.281 15.523  1.00 16.91 ? 281 ILE B CG1 1 
ATOM   5426 C  CG2 . ILE B 1 281 ? 7.721  121.221 13.226  1.00 16.45 ? 281 ILE B CG2 1 
ATOM   5427 C  CD1 . ILE B 1 281 ? 7.588  121.473 16.315  1.00 14.97 ? 281 ILE B CD1 1 
ATOM   5428 N  N   . ILE B 1 282 ? 5.213  118.698 12.552  1.00 21.82 ? 282 ILE B N   1 
ATOM   5429 C  CA  . ILE B 1 282 ? 4.543  118.398 11.304  1.00 22.12 ? 282 ILE B CA  1 
ATOM   5430 C  C   . ILE B 1 282 ? 3.472  117.354 11.595  1.00 22.40 ? 282 ILE B C   1 
ATOM   5431 O  O   . ILE B 1 282 ? 3.764  116.191 11.859  1.00 23.80 ? 282 ILE B O   1 
ATOM   5432 C  CB  . ILE B 1 282 ? 5.547  117.905 10.247  1.00 22.17 ? 282 ILE B CB  1 
ATOM   5433 C  CG1 . ILE B 1 282 ? 6.521  119.048 9.913   1.00 20.54 ? 282 ILE B CG1 1 
ATOM   5434 C  CG2 . ILE B 1 282 ? 4.802  117.443 8.994   1.00 21.17 ? 282 ILE B CG2 1 
ATOM   5435 C  CD1 . ILE B 1 282 ? 7.574  118.711 8.882   1.00 18.72 ? 282 ILE B CD1 1 
ATOM   5436 N  N   . LEU B 1 283 ? 2.223  117.801 11.564  1.00 22.42 ? 283 LEU B N   1 
ATOM   5437 C  CA  . LEU B 1 283 ? 1.083  116.951 11.856  1.00 22.13 ? 283 LEU B CA  1 
ATOM   5438 C  C   . LEU B 1 283 ? 0.336  116.532 10.601  1.00 22.84 ? 283 LEU B C   1 
ATOM   5439 O  O   . LEU B 1 283 ? 0.654  116.983 9.500   1.00 25.75 ? 283 LEU B O   1 
ATOM   5440 C  CB  . LEU B 1 283 ? 0.142  117.699 12.795  1.00 22.55 ? 283 LEU B CB  1 
ATOM   5441 C  CG  . LEU B 1 283 ? 0.847  118.304 14.010  1.00 22.08 ? 283 LEU B CG  1 
ATOM   5442 C  CD1 . LEU B 1 283 ? -0.142 119.128 14.802  1.00 24.48 ? 283 LEU B CD1 1 
ATOM   5443 C  CD2 . LEU B 1 283 ? 1.436  117.206 14.871  1.00 20.80 ? 283 LEU B CD2 1 
ATOM   5444 N  N   . GLY B 1 284 ? -0.663 115.671 10.771  1.00 21.61 ? 284 GLY B N   1 
ATOM   5445 C  CA  . GLY B 1 284 ? -1.431 115.197 9.636   1.00 21.38 ? 284 GLY B CA  1 
ATOM   5446 C  C   . GLY B 1 284 ? -2.099 116.303 8.843   1.00 22.74 ? 284 GLY B C   1 
ATOM   5447 O  O   . GLY B 1 284 ? -2.188 116.235 7.613   1.00 23.09 ? 284 GLY B O   1 
ATOM   5448 N  N   . ARG B 1 285 ? -2.574 117.332 9.537   1.00 22.27 ? 285 ARG B N   1 
ATOM   5449 C  CA  . ARG B 1 285 ? -3.233 118.427 8.850   1.00 20.80 ? 285 ARG B CA  1 
ATOM   5450 C  C   . ARG B 1 285 ? -2.247 119.171 7.950   1.00 20.01 ? 285 ARG B C   1 
ATOM   5451 O  O   . ARG B 1 285 ? -2.643 119.872 7.022   1.00 21.23 ? 285 ARG B O   1 
ATOM   5452 C  CB  . ARG B 1 285 ? -3.886 119.381 9.854   1.00 19.89 ? 285 ARG B CB  1 
ATOM   5453 C  CG  . ARG B 1 285 ? -2.940 120.136 10.765  1.00 21.69 ? 285 ARG B CG  1 
ATOM   5454 C  CD  . ARG B 1 285 ? -3.645 121.381 11.291  1.00 21.92 ? 285 ARG B CD  1 
ATOM   5455 N  NE  . ARG B 1 285 ? -2.752 122.301 11.986  1.00 23.07 ? 285 ARG B NE  1 
ATOM   5456 C  CZ  . ARG B 1 285 ? -2.492 122.254 13.288  1.00 23.95 ? 285 ARG B CZ  1 
ATOM   5457 N  NH1 . ARG B 1 285 ? -3.064 121.327 14.045  1.00 21.73 ? 285 ARG B NH1 1 
ATOM   5458 N  NH2 . ARG B 1 285 ? -1.655 123.131 13.830  1.00 23.23 ? 285 ARG B NH2 1 
ATOM   5459 N  N   . HIS B 1 286 ? -0.958 119.016 8.221   1.00 18.71 ? 286 HIS B N   1 
ATOM   5460 C  CA  . HIS B 1 286 ? 0.057  119.658 7.398   1.00 18.70 ? 286 HIS B CA  1 
ATOM   5461 C  C   . HIS B 1 286 ? 0.289  118.763 6.189   1.00 19.96 ? 286 HIS B C   1 
ATOM   5462 O  O   . HIS B 1 286 ? 0.329  119.232 5.048   1.00 20.57 ? 286 HIS B O   1 
ATOM   5463 C  CB  . HIS B 1 286 ? 1.347  119.825 8.196   1.00 17.35 ? 286 HIS B CB  1 
ATOM   5464 C  CG  . HIS B 1 286 ? 1.218  120.780 9.339   1.00 15.98 ? 286 HIS B CG  1 
ATOM   5465 N  ND1 . HIS B 1 286 ? 1.833  120.577 10.555  1.00 14.65 ? 286 HIS B ND1 1 
ATOM   5466 C  CD2 . HIS B 1 286 ? 0.533  121.944 9.452   1.00 13.52 ? 286 HIS B CD2 1 
ATOM   5467 C  CE1 . HIS B 1 286 ? 1.530  121.573 11.369  1.00 15.11 ? 286 HIS B CE1 1 
ATOM   5468 N  NE2 . HIS B 1 286 ? 0.743  122.415 10.724  1.00 13.93 ? 286 HIS B NE2 1 
ATOM   5469 N  N   . PHE B 1 287 ? 0.423  117.467 6.453   1.00 19.41 ? 287 PHE B N   1 
ATOM   5470 C  CA  . PHE B 1 287 ? 0.628  116.478 5.404   1.00 19.47 ? 287 PHE B CA  1 
ATOM   5471 C  C   . PHE B 1 287 ? -0.432 116.562 4.305   1.00 20.47 ? 287 PHE B C   1 
ATOM   5472 O  O   . PHE B 1 287 ? -0.114 116.505 3.110   1.00 19.72 ? 287 PHE B O   1 
ATOM   5473 C  CB  . PHE B 1 287 ? 0.591  115.071 6.002   1.00 17.30 ? 287 PHE B CB  1 
ATOM   5474 C  CG  . PHE B 1 287 ? 1.785  114.729 6.834   1.00 16.76 ? 287 PHE B CG  1 
ATOM   5475 C  CD1 . PHE B 1 287 ? 3.042  114.652 6.264   1.00 15.79 ? 287 PHE B CD1 1 
ATOM   5476 C  CD2 . PHE B 1 287 ? 1.645  114.440 8.180   1.00 17.16 ? 287 PHE B CD2 1 
ATOM   5477 C  CE1 . PHE B 1 287 ? 4.132  114.287 7.018   1.00 17.31 ? 287 PHE B CE1 1 
ATOM   5478 C  CE2 . PHE B 1 287 ? 2.733  114.075 8.941   1.00 17.06 ? 287 PHE B CE2 1 
ATOM   5479 C  CZ  . PHE B 1 287 ? 3.977  113.996 8.362   1.00 17.76 ? 287 PHE B CZ  1 
ATOM   5480 N  N   . GLU B 1 288 ? -1.691 116.682 4.720   1.00 20.79 ? 288 GLU B N   1 
ATOM   5481 C  CA  . GLU B 1 288 ? -2.802 116.737 3.778   1.00 21.91 ? 288 GLU B CA  1 
ATOM   5482 C  C   . GLU B 1 288 ? -2.744 117.958 2.891   1.00 21.68 ? 288 GLU B C   1 
ATOM   5483 O  O   . GLU B 1 288 ? -3.453 118.039 1.895   1.00 20.83 ? 288 GLU B O   1 
ATOM   5484 C  CB  . GLU B 1 288 ? -4.125 116.737 4.529   1.00 23.58 ? 288 GLU B CB  1 
ATOM   5485 C  CG  . GLU B 1 288 ? -4.243 115.632 5.550   1.00 27.18 ? 288 GLU B CG  1 
ATOM   5486 C  CD  . GLU B 1 288 ? -5.512 115.743 6.375   1.00 29.08 ? 288 GLU B CD  1 
ATOM   5487 O  OE1 . GLU B 1 288 ? -5.838 116.867 6.831   1.00 28.44 ? 288 GLU B OE1 1 
ATOM   5488 O  OE2 . GLU B 1 288 ? -6.171 114.703 6.574   1.00 28.78 ? 288 GLU B OE2 1 
ATOM   5489 N  N   . GLN B 1 289 ? -1.889 118.905 3.259   1.00 22.35 ? 289 GLN B N   1 
ATOM   5490 C  CA  . GLN B 1 289 ? -1.741 120.146 2.515   1.00 21.63 ? 289 GLN B CA  1 
ATOM   5491 C  C   . GLN B 1 289 ? -0.509 120.188 1.620   1.00 19.66 ? 289 GLN B C   1 
ATOM   5492 O  O   . GLN B 1 289 ? -0.443 120.981 0.682   1.00 21.02 ? 289 GLN B O   1 
ATOM   5493 C  CB  . GLN B 1 289 ? -1.679 121.322 3.494   1.00 23.72 ? 289 GLN B CB  1 
ATOM   5494 C  CG  . GLN B 1 289 ? -2.894 121.445 4.389   1.00 28.08 ? 289 GLN B CG  1 
ATOM   5495 C  CD  . GLN B 1 289 ? -4.177 121.607 3.597   1.00 32.41 ? 289 GLN B CD  1 
ATOM   5496 O  OE1 . GLN B 1 289 ? -4.341 122.577 2.847   1.00 34.82 ? 289 GLN B OE1 1 
ATOM   5497 N  NE2 . GLN B 1 289 ? -5.097 120.658 3.755   1.00 33.53 ? 289 GLN B NE2 1 
ATOM   5498 N  N   . MET B 1 290 ? 0.467  119.340 1.910   1.00 18.07 ? 290 MET B N   1 
ATOM   5499 C  CA  . MET B 1 290 ? 1.710  119.327 1.150   1.00 17.55 ? 290 MET B CA  1 
ATOM   5500 C  C   . MET B 1 290 ? 1.596  118.986 -0.320  1.00 16.96 ? 290 MET B C   1 
ATOM   5501 O  O   . MET B 1 290 ? 0.671  118.300 -0.746  1.00 16.99 ? 290 MET B O   1 
ATOM   5502 C  CB  . MET B 1 290 ? 2.708  118.379 1.805   1.00 16.14 ? 290 MET B CB  1 
ATOM   5503 C  CG  . MET B 1 290 ? 3.076  118.798 3.193   1.00 14.83 ? 290 MET B CG  1 
ATOM   5504 S  SD  . MET B 1 290 ? 4.209  117.666 3.937   1.00 18.64 ? 290 MET B SD  1 
ATOM   5505 C  CE  . MET B 1 290 ? 4.523  118.484 5.488   1.00 12.95 ? 290 MET B CE  1 
ATOM   5506 N  N   . LYS B 1 291 ? 2.555  119.487 -1.089  1.00 17.61 ? 291 LYS B N   1 
ATOM   5507 C  CA  . LYS B 1 291 ? 2.603  119.225 -2.515  1.00 18.70 ? 291 LYS B CA  1 
ATOM   5508 C  C   . LYS B 1 291 ? 2.993  117.771 -2.684  1.00 18.79 ? 291 LYS B C   1 
ATOM   5509 O  O   . LYS B 1 291 ? 3.568  117.155 -1.786  1.00 19.24 ? 291 LYS B O   1 
ATOM   5510 C  CB  . LYS B 1 291 ? 3.640  120.121 -3.195  1.00 18.64 ? 291 LYS B CB  1 
ATOM   5511 C  CG  . LYS B 1 291 ? 3.315  121.588 -3.092  1.00 21.13 ? 291 LYS B CG  1 
ATOM   5512 C  CD  . LYS B 1 291 ? 4.408  122.453 -3.676  1.00 24.56 ? 291 LYS B CD  1 
ATOM   5513 C  CE  . LYS B 1 291 ? 3.950  123.907 -3.719  1.00 28.20 ? 291 LYS B CE  1 
ATOM   5514 N  NZ  . LYS B 1 291 ? 5.063  124.838 -4.055  1.00 30.98 ? 291 LYS B NZ  1 
ATOM   5515 N  N   . ASP B 1 292 ? 2.665  117.222 -3.840  1.00 17.97 ? 292 ASP B N   1 
ATOM   5516 C  CA  . ASP B 1 292 ? 2.981  115.845 -4.131  1.00 17.33 ? 292 ASP B CA  1 
ATOM   5517 C  C   . ASP B 1 292 ? 4.485  115.600 -4.009  1.00 17.23 ? 292 ASP B C   1 
ATOM   5518 O  O   . ASP B 1 292 ? 5.304  116.406 -4.451  1.00 19.01 ? 292 ASP B O   1 
ATOM   5519 C  CB  . ASP B 1 292 ? 2.483  115.517 -5.531  1.00 17.16 ? 292 ASP B CB  1 
ATOM   5520 C  CG  . ASP B 1 292 ? 2.565  114.057 -5.845  1.00 19.23 ? 292 ASP B CG  1 
ATOM   5521 O  OD1 . ASP B 1 292 ? 2.442  113.234 -4.905  1.00 18.40 ? 292 ASP B OD1 1 
ATOM   5522 O  OD2 . ASP B 1 292 ? 2.739  113.738 -7.041  1.00 20.94 ? 292 ASP B OD2 1 
ATOM   5523 N  N   . ASP B 1 293 ? 4.834  114.478 -3.393  1.00 16.40 ? 293 ASP B N   1 
ATOM   5524 C  CA  . ASP B 1 293 ? 6.220  114.084 -3.184  1.00 16.11 ? 293 ASP B CA  1 
ATOM   5525 C  C   . ASP B 1 293 ? 7.064  115.011 -2.330  1.00 14.87 ? 293 ASP B C   1 
ATOM   5526 O  O   . ASP B 1 293 ? 8.287  115.070 -2.486  1.00 13.57 ? 293 ASP B O   1 
ATOM   5527 C  CB  . ASP B 1 293 ? 6.931  113.836 -4.515  1.00 17.16 ? 293 ASP B CB  1 
ATOM   5528 C  CG  . ASP B 1 293 ? 6.973  112.368 -4.869  1.00 20.38 ? 293 ASP B CG  1 
ATOM   5529 O  OD1 . ASP B 1 293 ? 6.708  111.545 -3.964  1.00 22.02 ? 293 ASP B OD1 1 
ATOM   5530 O  OD2 . ASP B 1 293 ? 7.276  112.033 -6.034  1.00 20.69 ? 293 ASP B OD2 1 
ATOM   5531 N  N   . ALA B 1 294 ? 6.416  115.723 -1.418  1.00 13.57 ? 294 ALA B N   1 
ATOM   5532 C  CA  . ALA B 1 294 ? 7.138  116.609 -0.529  1.00 12.99 ? 294 ALA B CA  1 
ATOM   5533 C  C   . ALA B 1 294 ? 8.073  115.730 0.287   1.00 15.16 ? 294 ALA B C   1 
ATOM   5534 O  O   . ALA B 1 294 ? 7.698  114.626 0.704   1.00 17.64 ? 294 ALA B O   1 
ATOM   5535 C  CB  . ALA B 1 294 ? 6.178  117.336 0.384   1.00 10.65 ? 294 ALA B CB  1 
ATOM   5536 N  N   . ILE B 1 295 ? 9.297  116.205 0.490   1.00 14.14 ? 295 ILE B N   1 
ATOM   5537 C  CA  . ILE B 1 295 ? 10.278 115.475 1.267   1.00 12.11 ? 295 ILE B CA  1 
ATOM   5538 C  C   . ILE B 1 295 ? 10.181 116.020 2.689   1.00 13.81 ? 295 ILE B C   1 
ATOM   5539 O  O   . ILE B 1 295 ? 10.251 117.231 2.915   1.00 15.37 ? 295 ILE B O   1 
ATOM   5540 C  CB  . ILE B 1 295 ? 11.699 115.677 0.686   1.00 12.56 ? 295 ILE B CB  1 
ATOM   5541 C  CG1 . ILE B 1 295 ? 11.757 115.087 -0.725  1.00 11.36 ? 295 ILE B CG1 1 
ATOM   5542 C  CG2 . ILE B 1 295 ? 12.746 115.022 1.582   1.00 10.08 ? 295 ILE B CG2 1 
ATOM   5543 C  CD1 . ILE B 1 295 ? 13.063 115.322 -1.450  1.00 12.75 ? 295 ILE B CD1 1 
ATOM   5544 N  N   . VAL B 1 296 ? 9.992  115.115 3.640   1.00 12.73 ? 296 VAL B N   1 
ATOM   5545 C  CA  . VAL B 1 296 ? 9.852  115.480 5.040   1.00 10.98 ? 296 VAL B CA  1 
ATOM   5546 C  C   . VAL B 1 296 ? 10.926 114.794 5.875   1.00 12.71 ? 296 VAL B C   1 
ATOM   5547 O  O   . VAL B 1 296 ? 11.098 113.577 5.813   1.00 13.50 ? 296 VAL B O   1 
ATOM   5548 C  CB  . VAL B 1 296 ? 8.468  115.073 5.556   1.00 8.03  ? 296 VAL B CB  1 
ATOM   5549 C  CG1 . VAL B 1 296 ? 8.301  115.485 6.999   1.00 8.51  ? 296 VAL B CG1 1 
ATOM   5550 C  CG2 . VAL B 1 296 ? 7.402  115.707 4.695   1.00 8.11  ? 296 VAL B CG2 1 
ATOM   5551 N  N   . CYS B 1 297 ? 11.657 115.572 6.659   1.00 12.72 ? 297 CYS B N   1 
ATOM   5552 C  CA  . CYS B 1 297 ? 12.701 114.981 7.467   1.00 15.36 ? 297 CYS B CA  1 
ATOM   5553 C  C   . CYS B 1 297 ? 12.949 115.740 8.756   1.00 15.83 ? 297 CYS B C   1 
ATOM   5554 O  O   . CYS B 1 297 ? 12.635 116.919 8.879   1.00 16.24 ? 297 CYS B O   1 
ATOM   5555 C  CB  . CYS B 1 297 ? 14.001 114.879 6.667   1.00 15.27 ? 297 CYS B CB  1 
ATOM   5556 S  SG  . CYS B 1 297 ? 14.807 116.445 6.363   1.00 18.05 ? 297 CYS B SG  1 
ATOM   5557 N  N   . ASN B 1 298 ? 13.533 115.037 9.713   1.00 16.57 ? 298 ASN B N   1 
ATOM   5558 C  CA  . ASN B 1 298 ? 13.817 115.582 11.021  1.00 16.74 ? 298 ASN B CA  1 
ATOM   5559 C  C   . ASN B 1 298 ? 15.311 115.501 11.289  1.00 17.51 ? 298 ASN B C   1 
ATOM   5560 O  O   . ASN B 1 298 ? 15.938 114.472 11.062  1.00 19.88 ? 298 ASN B O   1 
ATOM   5561 C  CB  . ASN B 1 298 ? 13.030 114.776 12.061  1.00 16.84 ? 298 ASN B CB  1 
ATOM   5562 C  CG  . ASN B 1 298 ? 13.304 115.212 13.479  1.00 17.52 ? 298 ASN B CG  1 
ATOM   5563 O  OD1 . ASN B 1 298 ? 13.339 116.407 13.779  1.00 18.84 ? 298 ASN B OD1 1 
ATOM   5564 N  ND2 . ASN B 1 298 ? 13.478 114.241 14.371  1.00 16.21 ? 298 ASN B ND2 1 
ATOM   5565 N  N   . ILE B 1 299 ? 15.888 116.601 11.746  1.00 16.57 ? 299 ILE B N   1 
ATOM   5566 C  CA  . ILE B 1 299 ? 17.302 116.621 12.050  1.00 16.29 ? 299 ILE B CA  1 
ATOM   5567 C  C   . ILE B 1 299 ? 17.412 117.197 13.456  1.00 16.98 ? 299 ILE B C   1 
ATOM   5568 O  O   . ILE B 1 299 ? 18.483 117.603 13.906  1.00 16.98 ? 299 ILE B O   1 
ATOM   5569 C  CB  . ILE B 1 299 ? 18.082 117.484 11.021  1.00 14.30 ? 299 ILE B CB  1 
ATOM   5570 C  CG1 . ILE B 1 299 ? 19.589 117.253 11.173  1.00 11.69 ? 299 ILE B CG1 1 
ATOM   5571 C  CG2 . ILE B 1 299 ? 17.730 118.942 11.199  1.00 14.16 ? 299 ILE B CG2 1 
ATOM   5572 C  CD1 . ILE B 1 299 ? 20.430 117.811 10.035  1.00 8.95  ? 299 ILE B CD1 1 
ATOM   5573 N  N   . GLY B 1 300 ? 16.277 117.195 14.150  1.00 17.84 ? 300 GLY B N   1 
ATOM   5574 C  CA  . GLY B 1 300 ? 16.220 117.710 15.504  1.00 20.72 ? 300 GLY B CA  1 
ATOM   5575 C  C   . GLY B 1 300 ? 16.193 116.660 16.603  1.00 22.91 ? 300 GLY B C   1 
ATOM   5576 O  O   . GLY B 1 300 ? 17.183 115.967 16.831  1.00 23.24 ? 300 GLY B O   1 
ATOM   5577 N  N   . HIS B 1 301 ? 15.059 116.537 17.285  1.00 26.13 ? 301 HIS B N   1 
ATOM   5578 C  CA  . HIS B 1 301 ? 14.924 115.587 18.388  1.00 30.13 ? 301 HIS B CA  1 
ATOM   5579 C  C   . HIS B 1 301 ? 14.425 114.209 17.968  1.00 31.72 ? 301 HIS B C   1 
ATOM   5580 O  O   . HIS B 1 301 ? 13.311 114.066 17.457  1.00 31.23 ? 301 HIS B O   1 
ATOM   5581 C  CB  . HIS B 1 301 ? 13.997 116.158 19.461  1.00 31.99 ? 301 HIS B CB  1 
ATOM   5582 C  CG  . HIS B 1 301 ? 13.989 115.364 20.727  1.00 37.52 ? 301 HIS B CG  1 
ATOM   5583 N  ND1 . HIS B 1 301 ? 15.134 115.107 21.451  1.00 39.93 ? 301 HIS B ND1 1 
ATOM   5584 C  CD2 . HIS B 1 301 ? 12.979 114.753 21.391  1.00 39.41 ? 301 HIS B CD2 1 
ATOM   5585 C  CE1 . HIS B 1 301 ? 14.830 114.370 22.505  1.00 41.09 ? 301 HIS B CE1 1 
ATOM   5586 N  NE2 . HIS B 1 301 ? 13.529 114.141 22.492  1.00 40.73 ? 301 HIS B NE2 1 
ATOM   5587 N  N   . PHE B 1 302 ? 15.267 113.206 18.221  1.00 33.42 ? 302 PHE B N   1 
ATOM   5588 C  CA  . PHE B 1 302 ? 15.016 111.806 17.886  1.00 34.92 ? 302 PHE B CA  1 
ATOM   5589 C  C   . PHE B 1 302 ? 13.857 111.549 16.928  1.00 34.38 ? 302 PHE B C   1 
ATOM   5590 O  O   . PHE B 1 302 ? 14.083 111.351 15.737  1.00 34.89 ? 302 PHE B O   1 
ATOM   5591 C  CB  . PHE B 1 302 ? 14.847 110.956 19.157  1.00 37.74 ? 302 PHE B CB  1 
ATOM   5592 C  CG  . PHE B 1 302 ? 14.759 109.466 18.880  1.00 42.42 ? 302 PHE B CG  1 
ATOM   5593 C  CD1 . PHE B 1 302 ? 15.563 108.881 17.905  1.00 43.25 ? 302 PHE B CD1 1 
ATOM   5594 C  CD2 . PHE B 1 302 ? 13.855 108.659 19.564  1.00 43.65 ? 302 PHE B CD2 1 
ATOM   5595 C  CE1 . PHE B 1 302 ? 15.464 107.519 17.611  1.00 43.65 ? 302 PHE B CE1 1 
ATOM   5596 C  CE2 . PHE B 1 302 ? 13.751 107.297 19.275  1.00 44.60 ? 302 PHE B CE2 1 
ATOM   5597 C  CZ  . PHE B 1 302 ? 14.558 106.730 18.294  1.00 44.34 ? 302 PHE B CZ  1 
ATOM   5598 N  N   . ASP B 1 303 ? 12.622 111.539 17.419  1.00 34.06 ? 303 ASP B N   1 
ATOM   5599 C  CA  . ASP B 1 303 ? 11.497 111.294 16.512  1.00 34.92 ? 303 ASP B CA  1 
ATOM   5600 C  C   . ASP B 1 303 ? 10.155 111.850 16.992  1.00 33.96 ? 303 ASP B C   1 
ATOM   5601 O  O   . ASP B 1 303 ? 9.097  111.343 16.601  1.00 36.21 ? 303 ASP B O   1 
ATOM   5602 C  CB  . ASP B 1 303 ? 11.355 109.790 16.259  1.00 35.94 ? 303 ASP B CB  1 
ATOM   5603 C  CG  . ASP B 1 303 ? 10.790 109.053 17.455  1.00 37.50 ? 303 ASP B CG  1 
ATOM   5604 O  OD1 . ASP B 1 303 ? 11.202 109.352 18.600  1.00 37.74 ? 303 ASP B OD1 1 
ATOM   5605 O  OD2 . ASP B 1 303 ? 9.934  108.170 17.248  1.00 39.06 ? 303 ASP B OD2 1 
ATOM   5606 N  N   . VAL B 1 304 ? 10.193 112.895 17.816  1.00 30.56 ? 304 VAL B N   1 
ATOM   5607 C  CA  . VAL B 1 304 ? 8.964  113.482 18.343  1.00 27.94 ? 304 VAL B CA  1 
ATOM   5608 C  C   . VAL B 1 304 ? 8.455  114.673 17.539  1.00 25.80 ? 304 VAL B C   1 
ATOM   5609 O  O   . VAL B 1 304 ? 7.336  115.136 17.750  1.00 24.67 ? 304 VAL B O   1 
ATOM   5610 C  CB  . VAL B 1 304 ? 9.160  113.956 19.798  1.00 29.58 ? 304 VAL B CB  1 
ATOM   5611 C  CG1 . VAL B 1 304 ? 9.714  112.822 20.650  1.00 30.16 ? 304 VAL B CG1 1 
ATOM   5612 C  CG2 . VAL B 1 304 ? 10.094 115.159 19.827  1.00 29.33 ? 304 VAL B CG2 1 
ATOM   5613 N  N   . GLU B 1 305 ? 9.278  115.154 16.613  1.00 23.94 ? 305 GLU B N   1 
ATOM   5614 C  CA  . GLU B 1 305 ? 8.949  116.322 15.802  1.00 22.42 ? 305 GLU B CA  1 
ATOM   5615 C  C   . GLU B 1 305 ? 7.948  116.098 14.677  1.00 21.52 ? 305 GLU B C   1 
ATOM   5616 O  O   . GLU B 1 305 ? 7.063  116.928 14.449  1.00 20.64 ? 305 GLU B O   1 
ATOM   5617 C  CB  . GLU B 1 305 ? 10.244 116.927 15.257  1.00 22.33 ? 305 GLU B CB  1 
ATOM   5618 C  CG  . GLU B 1 305 ? 11.213 117.268 16.382  1.00 23.27 ? 305 GLU B CG  1 
ATOM   5619 C  CD  . GLU B 1 305 ? 12.084 118.461 16.076  1.00 24.77 ? 305 GLU B CD  1 
ATOM   5620 O  OE1 . GLU B 1 305 ? 11.580 119.420 15.449  1.00 27.42 ? 305 GLU B OE1 1 
ATOM   5621 O  OE2 . GLU B 1 305 ? 13.265 118.450 16.478  1.00 23.22 ? 305 GLU B OE2 1 
ATOM   5622 N  N   . ILE B 1 306 ? 8.085  114.982 13.973  1.00 20.31 ? 306 ILE B N   1 
ATOM   5623 C  CA  . ILE B 1 306 ? 7.172  114.658 12.890  1.00 19.18 ? 306 ILE B CA  1 
ATOM   5624 C  C   . ILE B 1 306 ? 6.207  113.578 13.349  1.00 19.10 ? 306 ILE B C   1 
ATOM   5625 O  O   . ILE B 1 306 ? 6.617  112.581 13.941  1.00 19.76 ? 306 ILE B O   1 
ATOM   5626 C  CB  . ILE B 1 306 ? 7.926  114.142 11.670  1.00 18.96 ? 306 ILE B CB  1 
ATOM   5627 C  CG1 . ILE B 1 306 ? 8.961  115.184 11.234  1.00 16.93 ? 306 ILE B CG1 1 
ATOM   5628 C  CG2 . ILE B 1 306 ? 6.929  113.810 10.557  1.00 18.93 ? 306 ILE B CG2 1 
ATOM   5629 C  CD1 . ILE B 1 306 ? 9.912  114.702 10.174  1.00 16.78 ? 306 ILE B CD1 1 
ATOM   5630 N  N   . ASP B 1 307 ? 4.923  113.781 13.086  1.00 18.92 ? 307 ASP B N   1 
ATOM   5631 C  CA  . ASP B 1 307 ? 3.917  112.804 13.476  1.00 18.71 ? 307 ASP B CA  1 
ATOM   5632 C  C   . ASP B 1 307 ? 3.921  111.649 12.472  1.00 19.77 ? 307 ASP B C   1 
ATOM   5633 O  O   . ASP B 1 307 ? 3.047  111.549 11.598  1.00 17.56 ? 307 ASP B O   1 
ATOM   5634 C  CB  . ASP B 1 307 ? 2.543  113.464 13.523  1.00 18.54 ? 307 ASP B CB  1 
ATOM   5635 C  CG  . ASP B 1 307 ? 1.509  112.594 14.184  1.00 19.80 ? 307 ASP B CG  1 
ATOM   5636 O  OD1 . ASP B 1 307 ? 1.874  111.514 14.697  1.00 18.95 ? 307 ASP B OD1 1 
ATOM   5637 O  OD2 . ASP B 1 307 ? 0.327  112.996 14.196  1.00 22.60 ? 307 ASP B OD2 1 
ATOM   5638 N  N   . VAL B 1 308 ? 4.927  110.788 12.602  1.00 19.50 ? 308 VAL B N   1 
ATOM   5639 C  CA  . VAL B 1 308 ? 5.081  109.642 11.721  1.00 21.53 ? 308 VAL B CA  1 
ATOM   5640 C  C   . VAL B 1 308 ? 4.000  108.610 11.993  1.00 23.00 ? 308 VAL B C   1 
ATOM   5641 O  O   . VAL B 1 308 ? 3.616  107.848 11.109  1.00 24.88 ? 308 VAL B O   1 
ATOM   5642 C  CB  . VAL B 1 308 ? 6.461  108.974 11.905  1.00 21.05 ? 308 VAL B CB  1 
ATOM   5643 C  CG1 . VAL B 1 308 ? 6.600  107.803 10.937  1.00 20.80 ? 308 VAL B CG1 1 
ATOM   5644 C  CG2 . VAL B 1 308 ? 7.571  109.996 11.681  1.00 20.59 ? 308 VAL B CG2 1 
ATOM   5645 N  N   . LYS B 1 309 ? 3.510  108.584 13.224  1.00 23.15 ? 309 LYS B N   1 
ATOM   5646 C  CA  . LYS B 1 309 ? 2.474  107.639 13.575  1.00 24.43 ? 309 LYS B CA  1 
ATOM   5647 C  C   . LYS B 1 309 ? 1.217  107.949 12.767  1.00 24.40 ? 309 LYS B C   1 
ATOM   5648 O  O   . LYS B 1 309 ? 0.514  107.041 12.317  1.00 25.76 ? 309 LYS B O   1 
ATOM   5649 C  CB  . LYS B 1 309 ? 2.191  107.713 15.074  1.00 27.49 ? 309 LYS B CB  1 
ATOM   5650 C  CG  . LYS B 1 309 ? 1.100  106.781 15.545  1.00 30.26 ? 309 LYS B CG  1 
ATOM   5651 C  CD  . LYS B 1 309 ? 0.990  106.800 17.059  1.00 33.67 ? 309 LYS B CD  1 
ATOM   5652 C  CE  . LYS B 1 309 ? -0.255 106.045 17.524  1.00 35.90 ? 309 LYS B CE  1 
ATOM   5653 N  NZ  . LYS B 1 309 ? -0.355 106.011 19.011  1.00 37.21 ? 309 LYS B NZ  1 
ATOM   5654 N  N   . TRP B 1 310 ? 0.941  109.233 12.570  1.00 21.68 ? 310 TRP B N   1 
ATOM   5655 C  CA  . TRP B 1 310 ? -0.230 109.636 11.799  1.00 20.08 ? 310 TRP B CA  1 
ATOM   5656 C  C   . TRP B 1 310 ? -0.122 109.098 10.370  1.00 20.06 ? 310 TRP B C   1 
ATOM   5657 O  O   . TRP B 1 310 ? -1.113 108.634 9.795   1.00 19.27 ? 310 TRP B O   1 
ATOM   5658 C  CB  . TRP B 1 310 ? -0.349 111.163 11.750  1.00 17.76 ? 310 TRP B CB  1 
ATOM   5659 C  CG  . TRP B 1 310 ? -1.577 111.627 11.045  1.00 15.21 ? 310 TRP B CG  1 
ATOM   5660 C  CD1 . TRP B 1 310 ? -2.794 111.879 11.600  1.00 14.50 ? 310 TRP B CD1 1 
ATOM   5661 C  CD2 . TRP B 1 310 ? -1.732 111.821 9.632   1.00 16.30 ? 310 TRP B CD2 1 
ATOM   5662 N  NE1 . TRP B 1 310 ? -3.703 112.215 10.622  1.00 12.77 ? 310 TRP B NE1 1 
ATOM   5663 C  CE2 . TRP B 1 310 ? -3.077 112.187 9.405   1.00 14.19 ? 310 TRP B CE2 1 
ATOM   5664 C  CE3 . TRP B 1 310 ? -0.865 111.719 8.535   1.00 16.28 ? 310 TRP B CE3 1 
ATOM   5665 C  CZ2 . TRP B 1 310 ? -3.577 112.450 8.129   1.00 13.78 ? 310 TRP B CZ2 1 
ATOM   5666 C  CZ3 . TRP B 1 310 ? -1.367 111.982 7.263   1.00 15.54 ? 310 TRP B CZ3 1 
ATOM   5667 C  CH2 . TRP B 1 310 ? -2.709 112.343 7.074   1.00 13.61 ? 310 TRP B CH2 1 
ATOM   5668 N  N   . LEU B 1 311 ? 1.078  109.181 9.796   1.00 19.22 ? 311 LEU B N   1 
ATOM   5669 C  CA  . LEU B 1 311 ? 1.301  108.703 8.439   1.00 20.30 ? 311 LEU B CA  1 
ATOM   5670 C  C   . LEU B 1 311 ? 1.009  107.223 8.368   1.00 22.41 ? 311 LEU B C   1 
ATOM   5671 O  O   . LEU B 1 311 ? 0.252  106.774 7.502   1.00 23.12 ? 311 LEU B O   1 
ATOM   5672 C  CB  . LEU B 1 311 ? 2.740  108.958 7.995   1.00 19.39 ? 311 LEU B CB  1 
ATOM   5673 C  CG  . LEU B 1 311 ? 3.065  110.403 7.605   1.00 21.50 ? 311 LEU B CG  1 
ATOM   5674 C  CD1 . LEU B 1 311 ? 4.573  110.559 7.368   1.00 19.21 ? 311 LEU B CD1 1 
ATOM   5675 C  CD2 . LEU B 1 311 ? 2.264  110.780 6.359   1.00 18.94 ? 311 LEU B CD2 1 
ATOM   5676 N  N   . ASN B 1 312 ? 1.599  106.466 9.288   1.00 22.27 ? 312 ASN B N   1 
ATOM   5677 C  CA  . ASN B 1 312 ? 1.395  105.027 9.315   1.00 21.86 ? 312 ASN B CA  1 
ATOM   5678 C  C   . ASN B 1 312 ? -0.076 104.648 9.451   1.00 22.92 ? 312 ASN B C   1 
ATOM   5679 O  O   . ASN B 1 312 ? -0.507 103.625 8.921   1.00 23.50 ? 312 ASN B O   1 
ATOM   5680 C  CB  . ASN B 1 312 ? 2.183  104.387 10.462  1.00 19.32 ? 312 ASN B CB  1 
ATOM   5681 C  CG  . ASN B 1 312 ? 3.682  104.510 10.284  1.00 18.33 ? 312 ASN B CG  1 
ATOM   5682 O  OD1 . ASN B 1 312 ? 4.178  104.642 9.163   1.00 18.90 ? 312 ASN B OD1 1 
ATOM   5683 N  ND2 . ASN B 1 312 ? 4.417  104.449 11.393  1.00 15.27 ? 312 ASN B ND2 1 
ATOM   5684 N  N   . GLU B 1 313 ? -0.848 105.470 10.154  1.00 24.21 ? 313 GLU B N   1 
ATOM   5685 C  CA  . GLU B 1 313 ? -2.258 105.169 10.360  1.00 24.80 ? 313 GLU B CA  1 
ATOM   5686 C  C   . GLU B 1 313 ? -3.205 105.847 9.388   1.00 25.22 ? 313 GLU B C   1 
ATOM   5687 O  O   . GLU B 1 313 ? -4.402 105.585 9.429   1.00 27.52 ? 313 GLU B O   1 
ATOM   5688 C  CB  . GLU B 1 313 ? -2.686 105.555 11.772  1.00 25.01 ? 313 GLU B CB  1 
ATOM   5689 C  CG  . GLU B 1 313 ? -1.703 105.176 12.849  1.00 30.65 ? 313 GLU B CG  1 
ATOM   5690 C  CD  . GLU B 1 313 ? -2.222 105.490 14.239  1.00 33.14 ? 313 GLU B CD  1 
ATOM   5691 O  OE1 . GLU B 1 313 ? -2.874 106.544 14.409  1.00 34.72 ? 313 GLU B OE1 1 
ATOM   5692 O  OE2 . GLU B 1 313 ? -1.967 104.691 15.163  1.00 35.37 ? 313 GLU B OE2 1 
ATOM   5693 N  N   . ASN B 1 314 ? -2.699 106.706 8.510   1.00 24.60 ? 314 ASN B N   1 
ATOM   5694 C  CA  . ASN B 1 314 ? -3.598 107.404 7.598   1.00 23.49 ? 314 ASN B CA  1 
ATOM   5695 C  C   . ASN B 1 314 ? -3.293 107.316 6.124   1.00 22.91 ? 314 ASN B C   1 
ATOM   5696 O  O   . ASN B 1 314 ? -4.154 107.595 5.293   1.00 22.77 ? 314 ASN B O   1 
ATOM   5697 C  CB  . ASN B 1 314 ? -3.688 108.865 8.013   1.00 25.35 ? 314 ASN B CB  1 
ATOM   5698 C  CG  . ASN B 1 314 ? -4.496 109.045 9.277   1.00 25.84 ? 314 ASN B CG  1 
ATOM   5699 O  OD1 . ASN B 1 314 ? -5.723 109.099 9.235   1.00 26.07 ? 314 ASN B OD1 1 
ATOM   5700 N  ND2 . ASN B 1 314 ? -3.815 109.110 10.411  1.00 24.54 ? 314 ASN B ND2 1 
ATOM   5701 N  N   . ALA B 1 315 ? -2.071 106.928 5.795   1.00 22.33 ? 315 ALA B N   1 
ATOM   5702 C  CA  . ALA B 1 315 ? -1.684 106.811 4.404   1.00 21.44 ? 315 ALA B CA  1 
ATOM   5703 C  C   . ALA B 1 315 ? -2.382 105.613 3.797   1.00 21.84 ? 315 ALA B C   1 
ATOM   5704 O  O   . ALA B 1 315 ? -2.774 104.687 4.510   1.00 22.33 ? 315 ALA B O   1 
ATOM   5705 C  CB  . ALA B 1 315 ? -0.182 106.641 4.299   1.00 20.86 ? 315 ALA B CB  1 
ATOM   5706 N  N   . VAL B 1 316 ? -2.552 105.646 2.480   1.00 21.48 ? 316 VAL B N   1 
ATOM   5707 C  CA  . VAL B 1 316 ? -3.158 104.540 1.758   1.00 21.15 ? 316 VAL B CA  1 
ATOM   5708 C  C   . VAL B 1 316 ? -2.008 103.589 1.418   1.00 22.86 ? 316 VAL B C   1 
ATOM   5709 O  O   . VAL B 1 316 ? -2.205 102.380 1.286   1.00 23.17 ? 316 VAL B O   1 
ATOM   5710 C  CB  . VAL B 1 316 ? -3.833 105.024 0.452   1.00 21.16 ? 316 VAL B CB  1 
ATOM   5711 C  CG1 . VAL B 1 316 ? -4.121 103.843 -0.453  1.00 19.78 ? 316 VAL B CG1 1 
ATOM   5712 C  CG2 . VAL B 1 316 ? -5.126 105.769 0.777   1.00 18.62 ? 316 VAL B CG2 1 
ATOM   5713 N  N   . GLU B 1 317 ? -0.805 104.151 1.273   1.00 23.84 ? 317 GLU B N   1 
ATOM   5714 C  CA  . GLU B 1 317 ? 0.389  103.364 0.960   1.00 23.57 ? 317 GLU B CA  1 
ATOM   5715 C  C   . GLU B 1 317 ? 1.602  103.817 1.747   1.00 23.24 ? 317 GLU B C   1 
ATOM   5716 O  O   . GLU B 1 317 ? 1.723  104.982 2.117   1.00 22.04 ? 317 GLU B O   1 
ATOM   5717 C  CB  . GLU B 1 317 ? 0.800  103.477 -0.503  1.00 24.09 ? 317 GLU B CB  1 
ATOM   5718 C  CG  . GLU B 1 317 ? -0.197 103.106 -1.534  1.00 27.74 ? 317 GLU B CG  1 
ATOM   5719 C  CD  . GLU B 1 317 ? 0.442  103.137 -2.900  1.00 30.89 ? 317 GLU B CD  1 
ATOM   5720 O  OE1 . GLU B 1 317 ? 1.335  103.990 -3.103  1.00 28.57 ? 317 GLU B OE1 1 
ATOM   5721 O  OE2 . GLU B 1 317 ? 0.056  102.320 -3.767  1.00 35.12 ? 317 GLU B OE2 1 
ATOM   5722 N  N   . LYS B 1 318 ? 2.515  102.875 1.949   1.00 23.06 ? 318 LYS B N   1 
ATOM   5723 C  CA  . LYS B 1 318 ? 3.768  103.109 2.642   1.00 22.67 ? 318 LYS B CA  1 
ATOM   5724 C  C   . LYS B 1 318 ? 4.753  102.237 1.878   1.00 23.84 ? 318 LYS B C   1 
ATOM   5725 O  O   . LYS B 1 318 ? 4.944  101.059 2.198   1.00 24.77 ? 318 LYS B O   1 
ATOM   5726 C  CB  . LYS B 1 318 ? 3.664  102.662 4.099   1.00 21.66 ? 318 LYS B CB  1 
ATOM   5727 C  CG  . LYS B 1 318 ? 4.760  103.176 5.021   1.00 21.62 ? 318 LYS B CG  1 
ATOM   5728 C  CD  . LYS B 1 318 ? 6.018  102.351 4.935   1.00 25.34 ? 318 LYS B CD  1 
ATOM   5729 C  CE  . LYS B 1 318 ? 6.864  102.501 6.204   1.00 28.17 ? 318 LYS B CE  1 
ATOM   5730 N  NZ  . LYS B 1 318 ? 6.163  102.024 7.449   1.00 24.04 ? 318 LYS B NZ  1 
ATOM   5731 N  N   . VAL B 1 319 ? 5.341  102.808 0.833   1.00 23.28 ? 319 VAL B N   1 
ATOM   5732 C  CA  . VAL B 1 319 ? 6.301  102.075 0.022   1.00 23.00 ? 319 VAL B CA  1 
ATOM   5733 C  C   . VAL B 1 319 ? 7.729  102.450 0.366   1.00 22.20 ? 319 VAL B C   1 
ATOM   5734 O  O   . VAL B 1 319 ? 8.073  103.620 0.409   1.00 23.06 ? 319 VAL B O   1 
ATOM   5735 C  CB  . VAL B 1 319 ? 6.094  102.338 -1.484  1.00 22.78 ? 319 VAL B CB  1 
ATOM   5736 C  CG1 . VAL B 1 319 ? 7.159  101.617 -2.278  1.00 21.24 ? 319 VAL B CG1 1 
ATOM   5737 C  CG2 . VAL B 1 319 ? 4.718  101.868 -1.914  1.00 23.13 ? 319 VAL B CG2 1 
ATOM   5738 N  N   . ASN B 1 320 ? 8.555  101.446 0.626   1.00 22.85 ? 320 ASN B N   1 
ATOM   5739 C  CA  . ASN B 1 320 ? 9.962  101.677 0.929   1.00 22.61 ? 320 ASN B CA  1 
ATOM   5740 C  C   . ASN B 1 320 ? 10.687 101.906 -0.399  1.00 22.29 ? 320 ASN B C   1 
ATOM   5741 O  O   . ASN B 1 320 ? 10.579 101.102 -1.324  1.00 22.83 ? 320 ASN B O   1 
ATOM   5742 C  CB  . ASN B 1 320 ? 10.548 100.468 1.661   1.00 21.95 ? 320 ASN B CB  1 
ATOM   5743 C  CG  . ASN B 1 320 ? 12.058 100.513 1.750   1.00 23.70 ? 320 ASN B CG  1 
ATOM   5744 O  OD1 . ASN B 1 320 ? 12.758 100.267 0.770   1.00 26.22 ? 320 ASN B OD1 1 
ATOM   5745 N  ND2 . ASN B 1 320 ? 12.570 100.833 2.928   1.00 25.11 ? 320 ASN B ND2 1 
ATOM   5746 N  N   . ILE B 1 321 ? 11.401 103.019 -0.500  1.00 22.34 ? 321 ILE B N   1 
ATOM   5747 C  CA  . ILE B 1 321 ? 12.129 103.347 -1.717  1.00 23.03 ? 321 ILE B CA  1 
ATOM   5748 C  C   . ILE B 1 321 ? 13.533 102.771 -1.635  1.00 21.39 ? 321 ILE B C   1 
ATOM   5749 O  O   . ILE B 1 321 ? 14.097 102.320 -2.627  1.00 20.13 ? 321 ILE B O   1 
ATOM   5750 C  CB  . ILE B 1 321 ? 12.215 104.870 -1.898  1.00 24.31 ? 321 ILE B CB  1 
ATOM   5751 C  CG1 . ILE B 1 321 ? 10.801 105.451 -1.958  1.00 26.02 ? 321 ILE B CG1 1 
ATOM   5752 C  CG2 . ILE B 1 321 ? 12.999 105.207 -3.153  1.00 20.77 ? 321 ILE B CG2 1 
ATOM   5753 C  CD1 . ILE B 1 321 ? 10.771 106.971 -2.089  1.00 29.21 ? 321 ILE B CD1 1 
ATOM   5754 N  N   . LYS B 1 322 ? 14.079 102.801 -0.429  1.00 21.10 ? 322 LYS B N   1 
ATOM   5755 C  CA  . LYS B 1 322 ? 15.406 102.284 -0.136  1.00 22.65 ? 322 LYS B CA  1 
ATOM   5756 C  C   . LYS B 1 322 ? 15.498 102.449 1.369   1.00 22.28 ? 322 LYS B C   1 
ATOM   5757 O  O   . LYS B 1 322 ? 14.654 103.106 1.967   1.00 24.42 ? 322 LYS B O   1 
ATOM   5758 C  CB  . LYS B 1 322 ? 16.494 103.117 -0.826  1.00 22.38 ? 322 LYS B CB  1 
ATOM   5759 C  CG  . LYS B 1 322 ? 16.873 104.387 -0.079  1.00 23.13 ? 322 LYS B CG  1 
ATOM   5760 C  CD  . LYS B 1 322 ? 17.906 105.198 -0.849  1.00 20.87 ? 322 LYS B CD  1 
ATOM   5761 C  CE  . LYS B 1 322 ? 17.416 105.526 -2.244  1.00 20.77 ? 322 LYS B CE  1 
ATOM   5762 N  NZ  . LYS B 1 322 ? 18.352 106.423 -2.974  1.00 21.21 ? 322 LYS B NZ  1 
ATOM   5763 N  N   . PRO B 1 323 ? 16.509 101.850 2.005   1.00 22.92 ? 323 PRO B N   1 
ATOM   5764 C  CA  . PRO B 1 323 ? 16.637 101.981 3.463   1.00 22.60 ? 323 PRO B CA  1 
ATOM   5765 C  C   . PRO B 1 323 ? 16.527 103.431 3.927   1.00 23.20 ? 323 PRO B C   1 
ATOM   5766 O  O   . PRO B 1 323 ? 17.163 104.322 3.364   1.00 24.47 ? 323 PRO B O   1 
ATOM   5767 C  CB  . PRO B 1 323 ? 18.022 101.396 3.746   1.00 20.36 ? 323 PRO B CB  1 
ATOM   5768 C  CG  . PRO B 1 323 ? 18.160 100.350 2.690   1.00 20.62 ? 323 PRO B CG  1 
ATOM   5769 C  CD  . PRO B 1 323 ? 17.584 101.010 1.447   1.00 20.78 ? 323 PRO B CD  1 
ATOM   5770 N  N   . GLN B 1 324 ? 15.708 103.658 4.948   1.00 24.32 ? 324 GLN B N   1 
ATOM   5771 C  CA  . GLN B 1 324 ? 15.512 104.989 5.521   1.00 23.82 ? 324 GLN B CA  1 
ATOM   5772 C  C   . GLN B 1 324 ? 14.839 105.997 4.597   1.00 23.50 ? 324 GLN B C   1 
ATOM   5773 O  O   . GLN B 1 324 ? 14.944 107.201 4.809   1.00 25.11 ? 324 GLN B O   1 
ATOM   5774 C  CB  . GLN B 1 324 ? 16.848 105.556 6.002   1.00 22.82 ? 324 GLN B CB  1 
ATOM   5775 C  CG  . GLN B 1 324 ? 17.523 104.700 7.049   1.00 23.22 ? 324 GLN B CG  1 
ATOM   5776 C  CD  . GLN B 1 324 ? 16.574 104.304 8.165   1.00 26.67 ? 324 GLN B CD  1 
ATOM   5777 O  OE1 . GLN B 1 324 ? 16.041 105.156 8.880   1.00 27.06 ? 324 GLN B OE1 1 
ATOM   5778 N  NE2 . GLN B 1 324 ? 16.354 102.999 8.319   1.00 26.46 ? 324 GLN B NE2 1 
ATOM   5779 N  N   . VAL B 1 325 ? 14.153 105.506 3.575   1.00 21.83 ? 325 VAL B N   1 
ATOM   5780 C  CA  . VAL B 1 325 ? 13.450 106.377 2.646   1.00 22.50 ? 325 VAL B CA  1 
ATOM   5781 C  C   . VAL B 1 325 ? 12.109 105.725 2.343   1.00 23.63 ? 325 VAL B C   1 
ATOM   5782 O  O   . VAL B 1 325 ? 12.053 104.684 1.683   1.00 24.20 ? 325 VAL B O   1 
ATOM   5783 C  CB  . VAL B 1 325 ? 14.224 106.553 1.317   1.00 23.01 ? 325 VAL B CB  1 
ATOM   5784 C  CG1 . VAL B 1 325 ? 13.472 107.517 0.405   1.00 20.99 ? 325 VAL B CG1 1 
ATOM   5785 C  CG2 . VAL B 1 325 ? 15.627 107.055 1.588   1.00 20.88 ? 325 VAL B CG2 1 
ATOM   5786 N  N   . ASP B 1 326 ? 11.031 106.330 2.834   1.00 23.64 ? 326 ASP B N   1 
ATOM   5787 C  CA  . ASP B 1 326 ? 9.697  105.782 2.616   1.00 24.01 ? 326 ASP B CA  1 
ATOM   5788 C  C   . ASP B 1 326 ? 8.743  106.752 1.948   1.00 23.53 ? 326 ASP B C   1 
ATOM   5789 O  O   . ASP B 1 326 ? 8.590  107.898 2.378   1.00 24.11 ? 326 ASP B O   1 
ATOM   5790 C  CB  . ASP B 1 326 ? 9.100  105.317 3.939   1.00 24.18 ? 326 ASP B CB  1 
ATOM   5791 C  CG  . ASP B 1 326 ? 9.919  104.240 4.579   1.00 26.18 ? 326 ASP B CG  1 
ATOM   5792 O  OD1 . ASP B 1 326 ? 10.100 103.180 3.941   1.00 27.55 ? 326 ASP B OD1 1 
ATOM   5793 O  OD2 . ASP B 1 326 ? 10.390 104.457 5.712   1.00 28.88 ? 326 ASP B OD2 1 
ATOM   5794 N  N   . ARG B 1 327 ? 8.094  106.274 0.894   1.00 21.97 ? 327 ARG B N   1 
ATOM   5795 C  CA  . ARG B 1 327 ? 7.157  107.086 0.152   1.00 21.16 ? 327 ARG B CA  1 
ATOM   5796 C  C   . ARG B 1 327 ? 5.734  106.715 0.530   1.00 21.73 ? 327 ARG B C   1 
ATOM   5797 O  O   . ARG B 1 327 ? 5.256  105.629 0.196   1.00 23.78 ? 327 ARG B O   1 
ATOM   5798 C  CB  . ARG B 1 327 ? 7.360  106.875 -1.340  1.00 19.58 ? 327 ARG B CB  1 
ATOM   5799 C  CG  . ARG B 1 327 ? 6.887  108.040 -2.188  1.00 20.96 ? 327 ARG B CG  1 
ATOM   5800 C  CD  . ARG B 1 327 ? 6.767  107.622 -3.629  1.00 20.13 ? 327 ARG B CD  1 
ATOM   5801 N  NE  . ARG B 1 327 ? 6.588  108.750 -4.527  1.00 18.44 ? 327 ARG B NE  1 
ATOM   5802 C  CZ  . ARG B 1 327 ? 6.247  108.618 -5.801  1.00 18.41 ? 327 ARG B CZ  1 
ATOM   5803 N  NH1 . ARG B 1 327 ? 6.045  107.407 -6.299  1.00 16.17 ? 327 ARG B NH1 1 
ATOM   5804 N  NH2 . ARG B 1 327 ? 6.135  109.686 -6.579  1.00 17.72 ? 327 ARG B NH2 1 
ATOM   5805 N  N   . TYR B 1 328 ? 5.059  107.613 1.236   1.00 21.32 ? 328 TYR B N   1 
ATOM   5806 C  CA  . TYR B 1 328 ? 3.682  107.363 1.638   1.00 21.04 ? 328 TYR B CA  1 
ATOM   5807 C  C   . TYR B 1 328 ? 2.731  107.976 0.629   1.00 21.53 ? 328 TYR B C   1 
ATOM   5808 O  O   . TYR B 1 328 ? 3.009  109.041 0.084   1.00 22.14 ? 328 TYR B O   1 
ATOM   5809 C  CB  . TYR B 1 328 ? 3.367  107.997 2.992   1.00 20.77 ? 328 TYR B CB  1 
ATOM   5810 C  CG  . TYR B 1 328 ? 4.048  107.389 4.190   1.00 22.28 ? 328 TYR B CG  1 
ATOM   5811 C  CD1 . TYR B 1 328 ? 5.393  107.632 4.452   1.00 21.13 ? 328 TYR B CD1 1 
ATOM   5812 C  CD2 . TYR B 1 328 ? 3.326  106.616 5.097   1.00 21.88 ? 328 TYR B CD2 1 
ATOM   5813 C  CE1 . TYR B 1 328 ? 5.997  107.132 5.584   1.00 20.01 ? 328 TYR B CE1 1 
ATOM   5814 C  CE2 . TYR B 1 328 ? 3.921  106.110 6.233   1.00 22.17 ? 328 TYR B CE2 1 
ATOM   5815 C  CZ  . TYR B 1 328 ? 5.258  106.371 6.472   1.00 23.14 ? 328 TYR B CZ  1 
ATOM   5816 O  OH  . TYR B 1 328 ? 5.857  105.857 7.602   1.00 24.96 ? 328 TYR B OH  1 
ATOM   5817 N  N   . ARG B 1 329 ? 1.616  107.298 0.378   1.00 21.70 ? 329 ARG B N   1 
ATOM   5818 C  CA  . ARG B 1 329 ? 0.594  107.820 -0.516  1.00 20.81 ? 329 ARG B CA  1 
ATOM   5819 C  C   . ARG B 1 329 ? -0.609 108.104 0.391   1.00 21.13 ? 329 ARG B C   1 
ATOM   5820 O  O   . ARG B 1 329 ? -0.981 107.264 1.216   1.00 20.05 ? 329 ARG B O   1 
ATOM   5821 C  CB  . ARG B 1 329 ? 0.222  106.801 -1.587  1.00 21.24 ? 329 ARG B CB  1 
ATOM   5822 C  CG  . ARG B 1 329 ? -0.656 107.408 -2.669  1.00 22.25 ? 329 ARG B CG  1 
ATOM   5823 C  CD  . ARG B 1 329 ? -1.218 106.375 -3.608  1.00 20.84 ? 329 ARG B CD  1 
ATOM   5824 N  NE  . ARG B 1 329 ? -2.097 107.011 -4.581  1.00 24.28 ? 329 ARG B NE  1 
ATOM   5825 C  CZ  . ARG B 1 329 ? -1.663 107.661 -5.655  1.00 25.16 ? 329 ARG B CZ  1 
ATOM   5826 N  NH1 . ARG B 1 329 ? -0.360 107.745 -5.885  1.00 25.66 ? 329 ARG B NH1 1 
ATOM   5827 N  NH2 . ARG B 1 329 ? -2.525 108.237 -6.487  1.00 23.56 ? 329 ARG B NH2 1 
ATOM   5828 N  N   . LEU B 1 330 ? -1.210 109.283 0.249   1.00 20.38 ? 330 LEU B N   1 
ATOM   5829 C  CA  . LEU B 1 330 ? -2.339 109.665 1.100   1.00 19.89 ? 330 LEU B CA  1 
ATOM   5830 C  C   . LEU B 1 330 ? -3.699 109.509 0.434   1.00 20.28 ? 330 LEU B C   1 
ATOM   5831 O  O   . LEU B 1 330 ? -3.788 109.236 -0.762  1.00 20.10 ? 330 LEU B O   1 
ATOM   5832 C  CB  . LEU B 1 330 ? -2.168 111.112 1.576   1.00 19.13 ? 330 LEU B CB  1 
ATOM   5833 C  CG  . LEU B 1 330 ? -0.798 111.466 2.165   1.00 19.83 ? 330 LEU B CG  1 
ATOM   5834 C  CD1 . LEU B 1 330 ? -0.836 112.889 2.708   1.00 20.02 ? 330 LEU B CD1 1 
ATOM   5835 C  CD2 . LEU B 1 330 ? -0.430 110.483 3.273   1.00 19.14 ? 330 LEU B CD2 1 
ATOM   5836 N  N   . LYS B 1 331 ? -4.760 109.688 1.219   1.00 20.89 ? 331 LYS B N   1 
ATOM   5837 C  CA  . LYS B 1 331 ? -6.117 109.562 0.699   1.00 21.07 ? 331 LYS B CA  1 
ATOM   5838 C  C   . LYS B 1 331 ? -6.360 110.553 -0.418  1.00 20.81 ? 331 LYS B C   1 
ATOM   5839 O  O   . LYS B 1 331 ? -7.104 110.257 -1.359  1.00 20.92 ? 331 LYS B O   1 
ATOM   5840 C  CB  . LYS B 1 331 ? -7.144 109.778 1.804   1.00 20.72 ? 331 LYS B CB  1 
ATOM   5841 C  CG  . LYS B 1 331 ? -7.251 108.622 2.780   1.00 24.01 ? 331 LYS B CG  1 
ATOM   5842 C  CD  . LYS B 1 331 ? -8.071 109.012 4.007   1.00 26.46 ? 331 LYS B CD  1 
ATOM   5843 C  CE  . LYS B 1 331 ? -8.387 107.812 4.891   1.00 27.13 ? 331 LYS B CE  1 
ATOM   5844 N  NZ  . LYS B 1 331 ? -7.161 107.145 5.399   1.00 30.26 ? 331 LYS B NZ  1 
ATOM   5845 N  N   . ASN B 1 332 ? -5.729 111.724 -0.323  1.00 19.25 ? 332 ASN B N   1 
ATOM   5846 C  CA  . ASN B 1 332 ? -5.890 112.746 -1.354  1.00 18.07 ? 332 ASN B CA  1 
ATOM   5847 C  C   . ASN B 1 332 ? -5.091 112.413 -2.608  1.00 17.72 ? 332 ASN B C   1 
ATOM   5848 O  O   . ASN B 1 332 ? -5.055 113.208 -3.542  1.00 17.30 ? 332 ASN B O   1 
ATOM   5849 C  CB  . ASN B 1 332 ? -5.476 114.129 -0.848  1.00 18.13 ? 332 ASN B CB  1 
ATOM   5850 C  CG  . ASN B 1 332 ? -3.994 114.229 -0.545  1.00 20.97 ? 332 ASN B CG  1 
ATOM   5851 O  OD1 . ASN B 1 332 ? -3.191 113.382 -0.951  1.00 21.10 ? 332 ASN B OD1 1 
ATOM   5852 N  ND2 . ASN B 1 332 ? -3.621 115.284 0.166   1.00 22.06 ? 332 ASN B ND2 1 
ATOM   5853 N  N   . GLY B 1 333 ? -4.445 111.248 -2.617  1.00 16.73 ? 333 GLY B N   1 
ATOM   5854 C  CA  . GLY B 1 333 ? -3.682 110.824 -3.780  1.00 16.60 ? 333 GLY B CA  1 
ATOM   5855 C  C   . GLY B 1 333 ? -2.247 111.310 -3.887  1.00 17.94 ? 333 GLY B C   1 
ATOM   5856 O  O   . GLY B 1 333 ? -1.509 110.869 -4.767  1.00 17.56 ? 333 GLY B O   1 
ATOM   5857 N  N   . ARG B 1 334 ? -1.846 112.216 -3.002  1.00 19.84 ? 334 ARG B N   1 
ATOM   5858 C  CA  . ARG B 1 334 ? -0.492 112.758 -3.018  1.00 20.63 ? 334 ARG B CA  1 
ATOM   5859 C  C   . ARG B 1 334 ? 0.441  111.891 -2.181  1.00 19.84 ? 334 ARG B C   1 
ATOM   5860 O  O   . ARG B 1 334 ? -0.004 111.166 -1.297  1.00 20.05 ? 334 ARG B O   1 
ATOM   5861 C  CB  . ARG B 1 334 ? -0.500 114.187 -2.478  1.00 24.48 ? 334 ARG B CB  1 
ATOM   5862 C  CG  . ARG B 1 334 ? -1.260 115.181 -3.347  1.00 28.74 ? 334 ARG B CG  1 
ATOM   5863 C  CD  . ARG B 1 334 ? -1.338 116.546 -2.670  1.00 33.97 ? 334 ARG B CD  1 
ATOM   5864 N  NE  . ARG B 1 334 ? -1.684 117.616 -3.604  1.00 38.74 ? 334 ARG B NE  1 
ATOM   5865 C  CZ  . ARG B 1 334 ? -1.682 118.911 -3.293  1.00 41.99 ? 334 ARG B CZ  1 
ATOM   5866 N  NH1 . ARG B 1 334 ? -2.010 119.820 -4.205  1.00 41.97 ? 334 ARG B NH1 1 
ATOM   5867 N  NH2 . ARG B 1 334 ? -1.352 119.301 -2.070  1.00 43.64 ? 334 ARG B NH2 1 
ATOM   5868 N  N   . ARG B 1 335 ? 1.738  111.964 -2.453  1.00 18.98 ? 335 ARG B N   1 
ATOM   5869 C  CA  . ARG B 1 335 ? 2.686  111.158 -1.701  1.00 18.66 ? 335 ARG B CA  1 
ATOM   5870 C  C   . ARG B 1 335 ? 3.662  111.983 -0.880  1.00 18.25 ? 335 ARG B C   1 
ATOM   5871 O  O   . ARG B 1 335 ? 4.071  113.068 -1.277  1.00 17.83 ? 335 ARG B O   1 
ATOM   5872 C  CB  . ARG B 1 335 ? 3.464  110.222 -2.637  1.00 18.36 ? 335 ARG B CB  1 
ATOM   5873 C  CG  . ARG B 1 335 ? 2.577  109.343 -3.495  1.00 21.36 ? 335 ARG B CG  1 
ATOM   5874 C  CD  . ARG B 1 335 ? 2.112  110.074 -4.747  1.00 22.10 ? 335 ARG B CD  1 
ATOM   5875 N  NE  . ARG B 1 335 ? 2.608  109.394 -5.939  1.00 25.71 ? 335 ARG B NE  1 
ATOM   5876 C  CZ  . ARG B 1 335 ? 2.890  109.992 -7.090  1.00 27.88 ? 335 ARG B CZ  1 
ATOM   5877 N  NH1 . ARG B 1 335 ? 2.733  111.298 -7.232  1.00 26.23 ? 335 ARG B NH1 1 
ATOM   5878 N  NH2 . ARG B 1 335 ? 3.343  109.275 -8.105  1.00 31.97 ? 335 ARG B NH2 1 
ATOM   5879 N  N   . ILE B 1 336 ? 4.021  111.453 0.280   1.00 18.05 ? 336 ILE B N   1 
ATOM   5880 C  CA  . ILE B 1 336 ? 4.960  112.109 1.171   1.00 19.13 ? 336 ILE B CA  1 
ATOM   5881 C  C   . ILE B 1 336 ? 6.223  111.253 1.260   1.00 20.21 ? 336 ILE B C   1 
ATOM   5882 O  O   . ILE B 1 336 ? 6.157  110.057 1.553   1.00 21.52 ? 336 ILE B O   1 
ATOM   5883 C  CB  . ILE B 1 336 ? 4.364  112.268 2.593   1.00 19.83 ? 336 ILE B CB  1 
ATOM   5884 C  CG1 . ILE B 1 336 ? 3.168  113.227 2.560   1.00 20.73 ? 336 ILE B CG1 1 
ATOM   5885 C  CG2 . ILE B 1 336 ? 5.437  112.768 3.557   1.00 20.89 ? 336 ILE B CG2 1 
ATOM   5886 C  CD1 . ILE B 1 336 ? 3.508  114.642 2.111   1.00 17.78 ? 336 ILE B CD1 1 
ATOM   5887 N  N   . ILE B 1 337 ? 7.374  111.854 0.982   1.00 19.61 ? 337 ILE B N   1 
ATOM   5888 C  CA  . ILE B 1 337 ? 8.626  111.116 1.071   1.00 17.54 ? 337 ILE B CA  1 
ATOM   5889 C  C   . ILE B 1 337 ? 9.227  111.378 2.444   1.00 17.98 ? 337 ILE B C   1 
ATOM   5890 O  O   . ILE B 1 337 ? 9.772  112.450 2.695   1.00 18.16 ? 337 ILE B O   1 
ATOM   5891 C  CB  . ILE B 1 337 ? 9.613  111.557 -0.022  1.00 16.87 ? 337 ILE B CB  1 
ATOM   5892 C  CG1 . ILE B 1 337 ? 9.075  111.140 -1.395  1.00 16.05 ? 337 ILE B CG1 1 
ATOM   5893 C  CG2 . ILE B 1 337 ? 10.978 110.950 0.236   1.00 16.23 ? 337 ILE B CG2 1 
ATOM   5894 C  CD1 . ILE B 1 337 ? 10.053 111.336 -2.527  1.00 13.28 ? 337 ILE B CD1 1 
ATOM   5895 N  N   . LEU B 1 338 ? 9.098  110.402 3.340   1.00 17.48 ? 338 LEU B N   1 
ATOM   5896 C  CA  . LEU B 1 338 ? 9.616  110.525 4.699   1.00 17.58 ? 338 LEU B CA  1 
ATOM   5897 C  C   . LEU B 1 338 ? 11.016 109.931 4.770   1.00 17.89 ? 338 LEU B C   1 
ATOM   5898 O  O   . LEU B 1 338 ? 11.248 108.834 4.271   1.00 19.19 ? 338 LEU B O   1 
ATOM   5899 C  CB  . LEU B 1 338 ? 8.709  109.785 5.680   1.00 16.87 ? 338 LEU B CB  1 
ATOM   5900 C  CG  . LEU B 1 338 ? 9.101  109.944 7.151   1.00 17.91 ? 338 LEU B CG  1 
ATOM   5901 C  CD1 . LEU B 1 338 ? 8.817  111.375 7.580   1.00 16.59 ? 338 LEU B CD1 1 
ATOM   5902 C  CD2 . LEU B 1 338 ? 8.333  108.963 8.019   1.00 15.94 ? 338 LEU B CD2 1 
ATOM   5903 N  N   . LEU B 1 339 ? 11.946 110.649 5.389   1.00 17.15 ? 339 LEU B N   1 
ATOM   5904 C  CA  . LEU B 1 339 ? 13.317 110.158 5.489   1.00 17.38 ? 339 LEU B CA  1 
ATOM   5905 C  C   . LEU B 1 339 ? 13.626 109.684 6.896   1.00 18.33 ? 339 LEU B C   1 
ATOM   5906 O  O   . LEU B 1 339 ? 13.068 110.201 7.870   1.00 18.41 ? 339 LEU B O   1 
ATOM   5907 C  CB  . LEU B 1 339 ? 14.323 111.249 5.105   1.00 15.70 ? 339 LEU B CB  1 
ATOM   5908 C  CG  . LEU B 1 339 ? 14.080 111.983 3.783   1.00 16.52 ? 339 LEU B CG  1 
ATOM   5909 C  CD1 . LEU B 1 339 ? 15.279 112.891 3.454   1.00 12.37 ? 339 LEU B CD1 1 
ATOM   5910 C  CD2 . LEU B 1 339 ? 13.846 110.958 2.682   1.00 16.01 ? 339 LEU B CD2 1 
ATOM   5911 N  N   . ALA B 1 340 ? 14.519 108.696 6.982   1.00 17.94 ? 340 ALA B N   1 
ATOM   5912 C  CA  . ALA B 1 340 ? 14.960 108.122 8.247   1.00 16.91 ? 340 ALA B CA  1 
ATOM   5913 C  C   . ALA B 1 340 ? 13.815 107.847 9.223   1.00 18.11 ? 340 ALA B C   1 
ATOM   5914 O  O   . ALA B 1 340 ? 13.983 107.948 10.443  1.00 17.32 ? 340 ALA B O   1 
ATOM   5915 C  CB  . ALA B 1 340 ? 16.009 109.036 8.892   1.00 14.28 ? 340 ALA B CB  1 
ATOM   5916 N  N   . GLU B 1 341 ? 12.656 107.489 8.671   1.00 20.31 ? 341 GLU B N   1 
ATOM   5917 C  CA  . GLU B 1 341 ? 11.465 107.173 9.460   1.00 22.91 ? 341 GLU B CA  1 
ATOM   5918 C  C   . GLU B 1 341 ? 11.098 108.244 10.478  1.00 23.48 ? 341 GLU B C   1 
ATOM   5919 O  O   . GLU B 1 341 ? 10.536 107.933 11.529  1.00 24.25 ? 341 GLU B O   1 
ATOM   5920 C  CB  . GLU B 1 341 ? 11.649 105.845 10.207  1.00 25.60 ? 341 GLU B CB  1 
ATOM   5921 C  CG  . GLU B 1 341 ? 11.986 104.655 9.323   1.00 29.98 ? 341 GLU B CG  1 
ATOM   5922 C  CD  . GLU B 1 341 ? 11.687 103.331 9.999   1.00 31.37 ? 341 GLU B CD  1 
ATOM   5923 O  OE1 . GLU B 1 341 ? 12.280 103.048 11.059  1.00 29.02 ? 341 GLU B OE1 1 
ATOM   5924 O  OE2 . GLU B 1 341 ? 10.848 102.574 9.464   1.00 36.15 ? 341 GLU B OE2 1 
ATOM   5925 N  N   . GLY B 1 342 ? 11.416 109.498 10.178  1.00 23.39 ? 342 GLY B N   1 
ATOM   5926 C  CA  . GLY B 1 342 ? 11.097 110.568 11.106  1.00 23.45 ? 342 GLY B CA  1 
ATOM   5927 C  C   . GLY B 1 342 ? 12.183 110.779 12.145  1.00 23.34 ? 342 GLY B C   1 
ATOM   5928 O  O   . GLY B 1 342 ? 12.037 111.594 13.057  1.00 22.80 ? 342 GLY B O   1 
ATOM   5929 N  N   . ARG B 1 343 ? 13.273 110.033 12.022  1.00 23.54 ? 343 ARG B N   1 
ATOM   5930 C  CA  . ARG B 1 343 ? 14.378 110.179 12.956  1.00 24.57 ? 343 ARG B CA  1 
ATOM   5931 C  C   . ARG B 1 343 ? 15.401 111.122 12.335  1.00 23.68 ? 343 ARG B C   1 
ATOM   5932 O  O   . ARG B 1 343 ? 15.092 111.800 11.350  1.00 23.32 ? 343 ARG B O   1 
ATOM   5933 C  CB  . ARG B 1 343 ? 14.997 108.818 13.270  1.00 26.06 ? 343 ARG B CB  1 
ATOM   5934 C  CG  . ARG B 1 343 ? 14.057 107.898 14.046  1.00 30.06 ? 343 ARG B CG  1 
ATOM   5935 C  CD  . ARG B 1 343 ? 14.675 106.527 14.290  1.00 34.09 ? 343 ARG B CD  1 
ATOM   5936 N  NE  . ARG B 1 343 ? 15.100 105.900 13.038  1.00 40.13 ? 343 ARG B NE  1 
ATOM   5937 C  CZ  . ARG B 1 343 ? 14.628 104.745 12.572  1.00 41.78 ? 343 ARG B CZ  1 
ATOM   5938 N  NH1 . ARG B 1 343 ? 15.081 104.263 11.419  1.00 41.32 ? 343 ARG B NH1 1 
ATOM   5939 N  NH2 . ARG B 1 343 ? 13.708 104.074 13.259  1.00 40.48 ? 343 ARG B NH2 1 
ATOM   5940 N  N   . LEU B 1 344 ? 16.607 111.169 12.896  1.00 21.96 ? 344 LEU B N   1 
ATOM   5941 C  CA  . LEU B 1 344 ? 17.638 112.068 12.384  1.00 21.40 ? 344 LEU B CA  1 
ATOM   5942 C  C   . LEU B 1 344 ? 18.054 111.694 10.975  1.00 22.47 ? 344 LEU B C   1 
ATOM   5943 O  O   . LEU B 1 344 ? 18.562 110.599 10.730  1.00 23.75 ? 344 LEU B O   1 
ATOM   5944 C  CB  . LEU B 1 344 ? 18.854 112.070 13.306  1.00 19.83 ? 344 LEU B CB  1 
ATOM   5945 C  CG  . LEU B 1 344 ? 18.522 112.336 14.775  1.00 20.61 ? 344 LEU B CG  1 
ATOM   5946 C  CD1 . LEU B 1 344 ? 19.808 112.524 15.537  1.00 20.79 ? 344 LEU B CD1 1 
ATOM   5947 C  CD2 . LEU B 1 344 ? 17.629 113.568 14.916  1.00 19.05 ? 344 LEU B CD2 1 
ATOM   5948 N  N   . VAL B 1 345 ? 17.838 112.621 10.047  1.00 22.63 ? 345 VAL B N   1 
ATOM   5949 C  CA  . VAL B 1 345 ? 18.162 112.387 8.648   1.00 22.22 ? 345 VAL B CA  1 
ATOM   5950 C  C   . VAL B 1 345 ? 19.660 112.247 8.407   1.00 21.18 ? 345 VAL B C   1 
ATOM   5951 O  O   . VAL B 1 345 ? 20.081 111.447 7.570   1.00 21.14 ? 345 VAL B O   1 
ATOM   5952 C  CB  . VAL B 1 345 ? 17.592 113.524 7.748   1.00 21.14 ? 345 VAL B CB  1 
ATOM   5953 C  CG1 . VAL B 1 345 ? 18.213 114.861 8.134   1.00 21.17 ? 345 VAL B CG1 1 
ATOM   5954 C  CG2 . VAL B 1 345 ? 17.844 113.212 6.284   1.00 18.40 ? 345 VAL B CG2 1 
ATOM   5955 N  N   . ASN B 1 346 ? 20.465 113.006 9.145   1.00 19.85 ? 346 ASN B N   1 
ATOM   5956 C  CA  . ASN B 1 346 ? 21.906 112.947 8.951   1.00 20.38 ? 346 ASN B CA  1 
ATOM   5957 C  C   . ASN B 1 346 ? 22.532 111.673 9.507   1.00 20.83 ? 346 ASN B C   1 
ATOM   5958 O  O   . ASN B 1 346 ? 23.706 111.397 9.267   1.00 22.50 ? 346 ASN B O   1 
ATOM   5959 C  CB  . ASN B 1 346 ? 22.582 114.200 9.527   1.00 19.49 ? 346 ASN B CB  1 
ATOM   5960 C  CG  . ASN B 1 346 ? 22.297 114.403 10.999  1.00 20.23 ? 346 ASN B CG  1 
ATOM   5961 O  OD1 . ASN B 1 346 ? 21.193 114.155 11.470  1.00 22.57 ? 346 ASN B OD1 1 
ATOM   5962 N  ND2 . ASN B 1 346 ? 23.292 114.885 11.729  1.00 20.05 ? 346 ASN B ND2 1 
ATOM   5963 N  N   . LEU B 1 347 ? 21.744 110.891 10.237  1.00 20.30 ? 347 LEU B N   1 
ATOM   5964 C  CA  . LEU B 1 347 ? 22.227 109.627 10.783  1.00 19.15 ? 347 LEU B CA  1 
ATOM   5965 C  C   . LEU B 1 347 ? 21.741 108.450 9.931   1.00 19.40 ? 347 LEU B C   1 
ATOM   5966 O  O   . LEU B 1 347 ? 22.514 107.552 9.600   1.00 20.25 ? 347 LEU B O   1 
ATOM   5967 C  CB  . LEU B 1 347 ? 21.747 109.433 12.220  1.00 17.88 ? 347 LEU B CB  1 
ATOM   5968 C  CG  . LEU B 1 347 ? 22.428 110.230 13.340  1.00 18.50 ? 347 LEU B CG  1 
ATOM   5969 C  CD1 . LEU B 1 347 ? 21.795 109.822 14.661  1.00 13.20 ? 347 LEU B CD1 1 
ATOM   5970 C  CD2 . LEU B 1 347 ? 23.936 109.972 13.366  1.00 12.40 ? 347 LEU B CD2 1 
ATOM   5971 N  N   . GLY B 1 348 ? 20.461 108.468 9.571   1.00 17.73 ? 348 GLY B N   1 
ATOM   5972 C  CA  . GLY B 1 348 ? 19.899 107.392 8.782   1.00 15.88 ? 348 GLY B CA  1 
ATOM   5973 C  C   . GLY B 1 348 ? 20.134 107.483 7.289   1.00 17.37 ? 348 GLY B C   1 
ATOM   5974 O  O   . GLY B 1 348 ? 20.099 106.464 6.588   1.00 17.97 ? 348 GLY B O   1 
ATOM   5975 N  N   . CYS B 1 349 ? 20.387 108.688 6.788   1.00 17.12 ? 349 CYS B N   1 
ATOM   5976 C  CA  . CYS B 1 349 ? 20.598 108.870 5.352   1.00 15.53 ? 349 CYS B CA  1 
ATOM   5977 C  C   . CYS B 1 349 ? 21.965 109.419 5.004   1.00 12.49 ? 349 CYS B C   1 
ATOM   5978 O  O   . CYS B 1 349 ? 22.257 109.676 3.841   1.00 9.94  ? 349 CYS B O   1 
ATOM   5979 C  CB  . CYS B 1 349 ? 19.519 109.791 4.780   1.00 15.97 ? 349 CYS B CB  1 
ATOM   5980 S  SG  . CYS B 1 349 ? 17.839 109.218 5.082   1.00 19.91 ? 349 CYS B SG  1 
ATOM   5981 N  N   . ALA B 1 350 ? 22.799 109.598 6.020   1.00 14.58 ? 350 ALA B N   1 
ATOM   5982 C  CA  . ALA B 1 350 ? 24.150 110.114 5.818   1.00 16.45 ? 350 ALA B CA  1 
ATOM   5983 C  C   . ALA B 1 350 ? 25.111 109.416 6.771   1.00 16.71 ? 350 ALA B C   1 
ATOM   5984 O  O   . ALA B 1 350 ? 24.772 108.402 7.370   1.00 18.35 ? 350 ALA B O   1 
ATOM   5985 C  CB  . ALA B 1 350 ? 24.180 111.620 6.046   1.00 15.51 ? 350 ALA B CB  1 
ATOM   5986 N  N   . MET B 1 351 ? 26.308 109.963 6.919   1.00 17.24 ? 351 MET B N   1 
ATOM   5987 C  CA  . MET B 1 351 ? 27.298 109.357 7.794   1.00 18.17 ? 351 MET B CA  1 
ATOM   5988 C  C   . MET B 1 351 ? 27.508 110.136 9.080   1.00 18.43 ? 351 MET B C   1 
ATOM   5989 O  O   . MET B 1 351 ? 28.580 110.076 9.686   1.00 18.53 ? 351 MET B O   1 
ATOM   5990 C  CB  . MET B 1 351 ? 28.619 109.212 7.047   1.00 18.37 ? 351 MET B CB  1 
ATOM   5991 C  CG  . MET B 1 351 ? 28.537 108.220 5.897   1.00 22.47 ? 351 MET B CG  1 
ATOM   5992 S  SD  . MET B 1 351 ? 28.018 106.567 6.460   1.00 23.02 ? 351 MET B SD  1 
ATOM   5993 C  CE  . MET B 1 351 ? 29.583 105.943 7.102   1.00 21.30 ? 351 MET B CE  1 
ATOM   5994 N  N   . GLY B 1 352 ? 26.473 110.856 9.500   1.00 17.66 ? 352 GLY B N   1 
ATOM   5995 C  CA  . GLY B 1 352 ? 26.567 111.639 10.712  1.00 18.71 ? 352 GLY B CA  1 
ATOM   5996 C  C   . GLY B 1 352 ? 27.468 112.851 10.550  1.00 21.68 ? 352 GLY B C   1 
ATOM   5997 O  O   . GLY B 1 352 ? 27.732 113.306 9.430   1.00 21.79 ? 352 GLY B O   1 
ATOM   5998 N  N   . HIS B 1 353 ? 27.943 113.373 11.677  1.00 20.88 ? 353 HIS B N   1 
ATOM   5999 C  CA  . HIS B 1 353 ? 28.812 114.535 11.691  1.00 20.29 ? 353 HIS B CA  1 
ATOM   6000 C  C   . HIS B 1 353 ? 30.176 114.252 11.103  1.00 21.37 ? 353 HIS B C   1 
ATOM   6001 O  O   . HIS B 1 353 ? 30.724 113.164 11.274  1.00 23.88 ? 353 HIS B O   1 
ATOM   6002 C  CB  . HIS B 1 353 ? 29.005 115.038 13.117  1.00 21.13 ? 353 HIS B CB  1 
ATOM   6003 C  CG  . HIS B 1 353 ? 27.852 115.828 13.645  1.00 22.73 ? 353 HIS B CG  1 
ATOM   6004 N  ND1 . HIS B 1 353 ? 26.958 116.480 12.822  1.00 23.49 ? 353 HIS B ND1 1 
ATOM   6005 C  CD2 . HIS B 1 353 ? 27.485 116.127 14.913  1.00 22.56 ? 353 HIS B CD2 1 
ATOM   6006 C  CE1 . HIS B 1 353 ? 26.091 117.148 13.561  1.00 23.32 ? 353 HIS B CE1 1 
ATOM   6007 N  NE2 . HIS B 1 353 ? 26.389 116.951 14.833  1.00 24.56 ? 353 HIS B NE2 1 
ATOM   6008 N  N   . PRO B 1 354 ? 30.742 115.233 10.392  1.00 21.33 ? 354 PRO B N   1 
ATOM   6009 C  CA  . PRO B 1 354 ? 32.064 115.109 9.772   1.00 20.64 ? 354 PRO B CA  1 
ATOM   6010 C  C   . PRO B 1 354 ? 33.086 114.918 10.886  1.00 20.54 ? 354 PRO B C   1 
ATOM   6011 O  O   . PRO B 1 354 ? 32.860 115.344 12.017  1.00 20.88 ? 354 PRO B O   1 
ATOM   6012 C  CB  . PRO B 1 354 ? 32.232 116.450 9.062   1.00 22.02 ? 354 PRO B CB  1 
ATOM   6013 C  CG  . PRO B 1 354 ? 30.826 116.811 8.692   1.00 22.51 ? 354 PRO B CG  1 
ATOM   6014 C  CD  . PRO B 1 354 ? 30.064 116.462 9.948   1.00 22.32 ? 354 PRO B CD  1 
ATOM   6015 N  N   . SER B 1 355 ? 34.206 114.283 10.577  1.00 19.91 ? 355 SER B N   1 
ATOM   6016 C  CA  . SER B 1 355 ? 35.226 114.056 11.590  1.00 20.24 ? 355 SER B CA  1 
ATOM   6017 C  C   . SER B 1 355 ? 35.677 115.348 12.269  1.00 20.00 ? 355 SER B C   1 
ATOM   6018 O  O   . SER B 1 355 ? 35.908 115.363 13.476  1.00 21.29 ? 355 SER B O   1 
ATOM   6019 C  CB  . SER B 1 355 ? 36.442 113.347 10.979  1.00 20.18 ? 355 SER B CB  1 
ATOM   6020 O  OG  . SER B 1 355 ? 36.125 112.026 10.581  1.00 18.05 ? 355 SER B OG  1 
ATOM   6021 N  N   . PHE B 1 356 ? 35.798 116.427 11.502  1.00 19.90 ? 356 PHE B N   1 
ATOM   6022 C  CA  . PHE B 1 356 ? 36.247 117.707 12.055  1.00 20.81 ? 356 PHE B CA  1 
ATOM   6023 C  C   . PHE B 1 356 ? 35.319 118.199 13.159  1.00 21.86 ? 356 PHE B C   1 
ATOM   6024 O  O   . PHE B 1 356 ? 35.777 118.722 14.181  1.00 22.43 ? 356 PHE B O   1 
ATOM   6025 C  CB  . PHE B 1 356 ? 36.334 118.769 10.958  1.00 20.70 ? 356 PHE B CB  1 
ATOM   6026 C  CG  . PHE B 1 356 ? 37.082 120.008 11.371  1.00 22.21 ? 356 PHE B CG  1 
ATOM   6027 C  CD1 . PHE B 1 356 ? 38.468 120.020 11.404  1.00 22.75 ? 356 PHE B CD1 1 
ATOM   6028 C  CD2 . PHE B 1 356 ? 36.401 121.164 11.726  1.00 21.91 ? 356 PHE B CD2 1 
ATOM   6029 C  CE1 . PHE B 1 356 ? 39.161 121.168 11.782  1.00 21.27 ? 356 PHE B CE1 1 
ATOM   6030 C  CE2 . PHE B 1 356 ? 37.092 122.305 12.103  1.00 20.38 ? 356 PHE B CE2 1 
ATOM   6031 C  CZ  . PHE B 1 356 ? 38.473 122.303 12.129  1.00 18.93 ? 356 PHE B CZ  1 
ATOM   6032 N  N   . VAL B 1 357 ? 34.015 118.038 12.939  1.00 20.68 ? 357 VAL B N   1 
ATOM   6033 C  CA  . VAL B 1 357 ? 33.009 118.439 13.915  1.00 20.11 ? 357 VAL B CA  1 
ATOM   6034 C  C   . VAL B 1 357 ? 33.183 117.658 15.210  1.00 19.48 ? 357 VAL B C   1 
ATOM   6035 O  O   . VAL B 1 357 ? 33.246 118.235 16.295  1.00 20.73 ? 357 VAL B O   1 
ATOM   6036 C  CB  . VAL B 1 357 ? 31.578 118.181 13.385  1.00 21.30 ? 357 VAL B CB  1 
ATOM   6037 C  CG1 . VAL B 1 357 ? 30.582 118.141 14.544  1.00 17.57 ? 357 VAL B CG1 1 
ATOM   6038 C  CG2 . VAL B 1 357 ? 31.190 119.268 12.389  1.00 20.58 ? 357 VAL B CG2 1 
ATOM   6039 N  N   . MET B 1 358 ? 33.263 116.339 15.084  1.00 19.27 ? 358 MET B N   1 
ATOM   6040 C  CA  . MET B 1 358 ? 33.422 115.462 16.235  1.00 19.17 ? 358 MET B CA  1 
ATOM   6041 C  C   . MET B 1 358 ? 34.697 115.791 16.994  1.00 18.75 ? 358 MET B C   1 
ATOM   6042 O  O   . MET B 1 358 ? 34.751 115.666 18.218  1.00 19.15 ? 358 MET B O   1 
ATOM   6043 C  CB  . MET B 1 358 ? 33.444 113.997 15.783  1.00 20.61 ? 358 MET B CB  1 
ATOM   6044 C  CG  . MET B 1 358 ? 32.193 113.550 15.020  1.00 21.00 ? 358 MET B CG  1 
ATOM   6045 S  SD  . MET B 1 358 ? 30.652 113.898 15.914  1.00 23.71 ? 358 MET B SD  1 
ATOM   6046 C  CE  . MET B 1 358 ? 31.095 113.392 17.578  1.00 21.33 ? 358 MET B CE  1 
ATOM   6047 N  N   . SER B 1 359 ? 35.721 116.218 16.262  1.00 18.33 ? 359 SER B N   1 
ATOM   6048 C  CA  . SER B 1 359 ? 36.992 116.571 16.876  1.00 18.33 ? 359 SER B CA  1 
ATOM   6049 C  C   . SER B 1 359 ? 36.806 117.659 17.928  1.00 17.50 ? 359 SER B C   1 
ATOM   6050 O  O   . SER B 1 359 ? 37.418 117.624 18.993  1.00 18.36 ? 359 SER B O   1 
ATOM   6051 C  CB  . SER B 1 359 ? 37.977 117.048 15.812  1.00 18.44 ? 359 SER B CB  1 
ATOM   6052 O  OG  . SER B 1 359 ? 39.203 117.434 16.409  1.00 20.12 ? 359 SER B OG  1 
ATOM   6053 N  N   . ASN B 1 360 ? 35.953 118.626 17.626  1.00 16.94 ? 360 ASN B N   1 
ATOM   6054 C  CA  . ASN B 1 360 ? 35.694 119.710 18.554  1.00 16.95 ? 360 ASN B CA  1 
ATOM   6055 C  C   . ASN B 1 360 ? 34.991 119.216 19.809  1.00 17.81 ? 360 ASN B C   1 
ATOM   6056 O  O   . ASN B 1 360 ? 35.310 119.646 20.918  1.00 17.79 ? 360 ASN B O   1 
ATOM   6057 C  CB  . ASN B 1 360 ? 34.881 120.799 17.853  1.00 15.49 ? 360 ASN B CB  1 
ATOM   6058 C  CG  . ASN B 1 360 ? 35.761 121.742 17.055  1.00 13.62 ? 360 ASN B CG  1 
ATOM   6059 O  OD1 . ASN B 1 360 ? 36.308 122.696 17.600  1.00 13.42 ? 360 ASN B OD1 1 
ATOM   6060 N  ND2 . ASN B 1 360 ? 35.930 121.459 15.769  1.00 11.01 ? 360 ASN B ND2 1 
ATOM   6061 N  N   . SER B 1 361 ? 34.041 118.302 19.634  1.00 18.78 ? 361 SER B N   1 
ATOM   6062 C  CA  . SER B 1 361 ? 33.319 117.742 20.766  1.00 19.82 ? 361 SER B CA  1 
ATOM   6063 C  C   . SER B 1 361 ? 34.270 116.930 21.633  1.00 20.00 ? 361 SER B C   1 
ATOM   6064 O  O   . SER B 1 361 ? 34.348 117.135 22.848  1.00 19.21 ? 361 SER B O   1 
ATOM   6065 C  CB  . SER B 1 361 ? 32.191 116.823 20.290  1.00 21.18 ? 361 SER B CB  1 
ATOM   6066 O  OG  . SER B 1 361 ? 31.149 117.549 19.674  1.00 25.54 ? 361 SER B OG  1 
ATOM   6067 N  N   . PHE B 1 362 ? 34.992 116.010 20.995  1.00 19.80 ? 362 PHE B N   1 
ATOM   6068 C  CA  . PHE B 1 362 ? 35.923 115.135 21.698  1.00 20.49 ? 362 PHE B CA  1 
ATOM   6069 C  C   . PHE B 1 362 ? 37.141 115.836 22.281  1.00 21.72 ? 362 PHE B C   1 
ATOM   6070 O  O   . PHE B 1 362 ? 37.643 115.433 23.335  1.00 21.17 ? 362 PHE B O   1 
ATOM   6071 C  CB  . PHE B 1 362 ? 36.352 113.981 20.790  1.00 19.32 ? 362 PHE B CB  1 
ATOM   6072 C  CG  . PHE B 1 362 ? 35.208 113.115 20.346  1.00 18.19 ? 362 PHE B CG  1 
ATOM   6073 C  CD1 . PHE B 1 362 ? 34.029 113.089 21.067  1.00 17.29 ? 362 PHE B CD1 1 
ATOM   6074 C  CD2 . PHE B 1 362 ? 35.312 112.321 19.221  1.00 18.69 ? 362 PHE B CD2 1 
ATOM   6075 C  CE1 . PHE B 1 362 ? 32.973 112.288 20.675  1.00 18.80 ? 362 PHE B CE1 1 
ATOM   6076 C  CE2 . PHE B 1 362 ? 34.255 111.516 18.826  1.00 19.21 ? 362 PHE B CE2 1 
ATOM   6077 C  CZ  . PHE B 1 362 ? 33.085 111.501 19.554  1.00 16.41 ? 362 PHE B CZ  1 
ATOM   6078 N  N   . THR B 1 363 ? 37.623 116.883 21.616  1.00 21.98 ? 363 THR B N   1 
ATOM   6079 C  CA  . THR B 1 363 ? 38.764 117.599 22.166  1.00 22.00 ? 363 THR B CA  1 
ATOM   6080 C  C   . THR B 1 363 ? 38.276 118.282 23.443  1.00 22.63 ? 363 THR B C   1 
ATOM   6081 O  O   . THR B 1 363 ? 39.037 118.468 24.394  1.00 23.51 ? 363 THR B O   1 
ATOM   6082 C  CB  . THR B 1 363 ? 39.326 118.613 21.172  1.00 20.13 ? 363 THR B CB  1 
ATOM   6083 O  OG1 . THR B 1 363 ? 39.828 117.914 20.030  1.00 19.70 ? 363 THR B OG1 1 
ATOM   6084 C  CG2 . THR B 1 363 ? 40.464 119.393 21.792  1.00 21.37 ? 363 THR B CG2 1 
ATOM   6085 N  N   . ASN B 1 364 ? 36.993 118.628 23.468  1.00 22.64 ? 364 ASN B N   1 
ATOM   6086 C  CA  . ASN B 1 364 ? 36.396 119.236 24.654  1.00 24.10 ? 364 ASN B CA  1 
ATOM   6087 C  C   . ASN B 1 364 ? 36.424 118.203 25.781  1.00 24.62 ? 364 ASN B C   1 
ATOM   6088 O  O   . ASN B 1 364 ? 36.699 118.536 26.933  1.00 24.88 ? 364 ASN B O   1 
ATOM   6089 C  CB  . ASN B 1 364 ? 34.948 119.655 24.374  1.00 24.06 ? 364 ASN B CB  1 
ATOM   6090 C  CG  . ASN B 1 364 ? 34.822 121.133 24.034  1.00 24.59 ? 364 ASN B CG  1 
ATOM   6091 O  OD1 . ASN B 1 364 ? 34.961 121.989 24.908  1.00 24.99 ? 364 ASN B OD1 1 
ATOM   6092 N  ND2 . ASN B 1 364 ? 34.568 121.439 22.760  1.00 20.19 ? 364 ASN B ND2 1 
ATOM   6093 N  N   . GLN B 1 365 ? 36.137 116.948 25.435  1.00 24.35 ? 365 GLN B N   1 
ATOM   6094 C  CA  . GLN B 1 365 ? 36.136 115.853 26.403  1.00 23.23 ? 365 GLN B CA  1 
ATOM   6095 C  C   . GLN B 1 365 ? 37.530 115.694 27.008  1.00 23.75 ? 365 GLN B C   1 
ATOM   6096 O  O   . GLN B 1 365 ? 37.678 115.610 28.227  1.00 23.66 ? 365 GLN B O   1 
ATOM   6097 C  CB  . GLN B 1 365 ? 35.710 114.549 25.725  1.00 22.50 ? 365 GLN B CB  1 
ATOM   6098 C  CG  . GLN B 1 365 ? 34.251 114.515 25.334  1.00 21.07 ? 365 GLN B CG  1 
ATOM   6099 C  CD  . GLN B 1 365 ? 33.342 114.246 26.516  1.00 22.73 ? 365 GLN B CD  1 
ATOM   6100 O  OE1 . GLN B 1 365 ? 33.659 114.600 27.657  1.00 22.55 ? 365 GLN B OE1 1 
ATOM   6101 N  NE2 . GLN B 1 365 ? 32.197 113.626 26.250  1.00 21.50 ? 365 GLN B NE2 1 
ATOM   6102 N  N   . VAL B 1 366 ? 38.550 115.657 26.152  1.00 22.78 ? 366 VAL B N   1 
ATOM   6103 C  CA  . VAL B 1 366 ? 39.924 115.529 26.623  1.00 21.59 ? 366 VAL B CA  1 
ATOM   6104 C  C   . VAL B 1 366 ? 40.212 116.657 27.604  1.00 23.11 ? 366 VAL B C   1 
ATOM   6105 O  O   . VAL B 1 366 ? 40.714 116.418 28.700  1.00 25.36 ? 366 VAL B O   1 
ATOM   6106 C  CB  . VAL B 1 366 ? 40.943 115.622 25.470  1.00 20.20 ? 366 VAL B CB  1 
ATOM   6107 C  CG1 . VAL B 1 366 ? 42.338 115.592 26.027  1.00 16.55 ? 366 VAL B CG1 1 
ATOM   6108 C  CG2 . VAL B 1 366 ? 40.742 114.482 24.490  1.00 18.25 ? 366 VAL B CG2 1 
ATOM   6109 N  N   . MET B 1 367 ? 39.892 117.887 27.213  1.00 23.20 ? 367 MET B N   1 
ATOM   6110 C  CA  . MET B 1 367 ? 40.114 119.034 28.087  1.00 24.48 ? 367 MET B CA  1 
ATOM   6111 C  C   . MET B 1 367 ? 39.500 118.797 29.464  1.00 23.51 ? 367 MET B C   1 
ATOM   6112 O  O   . MET B 1 367 ? 40.168 118.971 30.484  1.00 23.54 ? 367 MET B O   1 
ATOM   6113 C  CB  . MET B 1 367 ? 39.508 120.301 27.475  1.00 27.35 ? 367 MET B CB  1 
ATOM   6114 C  CG  . MET B 1 367 ? 40.219 120.812 26.231  1.00 29.46 ? 367 MET B CG  1 
ATOM   6115 S  SD  . MET B 1 367 ? 41.894 121.411 26.556  1.00 32.56 ? 367 MET B SD  1 
ATOM   6116 C  CE  . MET B 1 367 ? 42.470 121.698 24.868  1.00 30.43 ? 367 MET B CE  1 
ATOM   6117 N  N   . ALA B 1 368 ? 38.229 118.399 29.482  1.00 23.15 ? 368 ALA B N   1 
ATOM   6118 C  CA  . ALA B 1 368 ? 37.506 118.135 30.727  1.00 22.09 ? 368 ALA B CA  1 
ATOM   6119 C  C   . ALA B 1 368 ? 38.194 117.059 31.555  1.00 21.91 ? 368 ALA B C   1 
ATOM   6120 O  O   . ALA B 1 368 ? 38.353 117.204 32.768  1.00 21.68 ? 368 ALA B O   1 
ATOM   6121 C  CB  . ALA B 1 368 ? 36.080 117.713 30.419  1.00 21.43 ? 368 ALA B CB  1 
ATOM   6122 N  N   . GLN B 1 369 ? 38.593 115.976 30.898  1.00 22.18 ? 369 GLN B N   1 
ATOM   6123 C  CA  . GLN B 1 369 ? 39.270 114.881 31.583  1.00 24.12 ? 369 GLN B CA  1 
ATOM   6124 C  C   . GLN B 1 369 ? 40.545 115.366 32.259  1.00 24.38 ? 369 GLN B C   1 
ATOM   6125 O  O   . GLN B 1 369 ? 40.763 115.112 33.446  1.00 25.03 ? 369 GLN B O   1 
ATOM   6126 C  CB  . GLN B 1 369 ? 39.599 113.756 30.596  1.00 24.37 ? 369 GLN B CB  1 
ATOM   6127 C  CG  . GLN B 1 369 ? 38.372 113.003 30.086  1.00 25.59 ? 369 GLN B CG  1 
ATOM   6128 C  CD  . GLN B 1 369 ? 37.617 112.286 31.195  1.00 26.79 ? 369 GLN B CD  1 
ATOM   6129 O  OE1 . GLN B 1 369 ? 38.155 111.391 31.845  1.00 27.67 ? 369 GLN B OE1 1 
ATOM   6130 N  NE2 . GLN B 1 369 ? 36.367 112.677 31.414  1.00 27.04 ? 369 GLN B NE2 1 
ATOM   6131 N  N   . ILE B 1 370 ? 41.378 116.070 31.498  1.00 24.45 ? 370 ILE B N   1 
ATOM   6132 C  CA  . ILE B 1 370 ? 42.631 116.605 32.011  1.00 23.75 ? 370 ILE B CA  1 
ATOM   6133 C  C   . ILE B 1 370 ? 42.393 117.549 33.189  1.00 25.24 ? 370 ILE B C   1 
ATOM   6134 O  O   . ILE B 1 370 ? 43.132 117.521 34.174  1.00 26.79 ? 370 ILE B O   1 
ATOM   6135 C  CB  . ILE B 1 370 ? 43.406 117.347 30.890  1.00 22.98 ? 370 ILE B CB  1 
ATOM   6136 C  CG1 . ILE B 1 370 ? 43.829 116.341 29.818  1.00 20.89 ? 370 ILE B CG1 1 
ATOM   6137 C  CG2 . ILE B 1 370 ? 44.627 118.065 31.462  1.00 22.44 ? 370 ILE B CG2 1 
ATOM   6138 C  CD1 . ILE B 1 370 ? 44.713 116.913 28.739  1.00 18.92 ? 370 ILE B CD1 1 
ATOM   6139 N  N   . GLU B 1 371 ? 41.355 118.373 33.088  1.00 25.64 ? 371 GLU B N   1 
ATOM   6140 C  CA  . GLU B 1 371 ? 41.011 119.326 34.141  1.00 27.19 ? 371 GLU B CA  1 
ATOM   6141 C  C   . GLU B 1 371 ? 40.654 118.690 35.477  1.00 27.17 ? 371 GLU B C   1 
ATOM   6142 O  O   . GLU B 1 371 ? 41.196 119.059 36.514  1.00 27.99 ? 371 GLU B O   1 
ATOM   6143 C  CB  . GLU B 1 371 ? 39.842 120.201 33.696  1.00 28.62 ? 371 GLU B CB  1 
ATOM   6144 C  CG  . GLU B 1 371 ? 40.258 121.556 33.193  1.00 31.38 ? 371 GLU B CG  1 
ATOM   6145 C  CD  . GLU B 1 371 ? 40.843 122.428 34.282  1.00 32.67 ? 371 GLU B CD  1 
ATOM   6146 O  OE1 . GLU B 1 371 ? 40.078 122.850 35.179  1.00 32.44 ? 371 GLU B OE1 1 
ATOM   6147 O  OE2 . GLU B 1 371 ? 42.068 122.687 34.238  1.00 32.77 ? 371 GLU B OE2 1 
ATOM   6148 N  N   . LEU B 1 372 ? 39.725 117.744 35.448  1.00 28.09 ? 372 LEU B N   1 
ATOM   6149 C  CA  . LEU B 1 372 ? 39.290 117.071 36.663  1.00 28.34 ? 372 LEU B CA  1 
ATOM   6150 C  C   . LEU B 1 372 ? 40.389 116.196 37.272  1.00 28.76 ? 372 LEU B C   1 
ATOM   6151 O  O   . LEU B 1 372 ? 40.553 116.145 38.496  1.00 27.84 ? 372 LEU B O   1 
ATOM   6152 C  CB  . LEU B 1 372 ? 38.048 116.230 36.357  1.00 26.64 ? 372 LEU B CB  1 
ATOM   6153 C  CG  . LEU B 1 372 ? 36.769 117.026 36.067  1.00 25.16 ? 372 LEU B CG  1 
ATOM   6154 C  CD1 . LEU B 1 372 ? 35.796 116.163 35.295  1.00 26.18 ? 372 LEU B CD1 1 
ATOM   6155 C  CD2 . LEU B 1 372 ? 36.141 117.508 37.369  1.00 22.30 ? 372 LEU B CD2 1 
ATOM   6156 N  N   . TRP B 1 373 ? 41.152 115.525 36.415  1.00 28.87 ? 373 TRP B N   1 
ATOM   6157 C  CA  . TRP B 1 373 ? 42.216 114.648 36.881  1.00 29.22 ? 373 TRP B CA  1 
ATOM   6158 C  C   . TRP B 1 373 ? 43.403 115.394 37.486  1.00 29.73 ? 373 TRP B C   1 
ATOM   6159 O  O   . TRP B 1 373 ? 43.948 114.960 38.507  1.00 28.77 ? 373 TRP B O   1 
ATOM   6160 C  CB  . TRP B 1 373 ? 42.697 113.749 35.739  1.00 29.36 ? 373 TRP B CB  1 
ATOM   6161 C  CG  . TRP B 1 373 ? 43.678 112.698 36.174  1.00 30.34 ? 373 TRP B CG  1 
ATOM   6162 C  CD1 . TRP B 1 373 ? 45.019 112.655 35.896  1.00 30.28 ? 373 TRP B CD1 1 
ATOM   6163 C  CD2 . TRP B 1 373 ? 43.399 111.547 36.983  1.00 29.76 ? 373 TRP B CD2 1 
ATOM   6164 N  NE1 . TRP B 1 373 ? 45.588 111.547 36.484  1.00 29.53 ? 373 TRP B NE1 1 
ATOM   6165 C  CE2 . TRP B 1 373 ? 44.615 110.852 37.156  1.00 29.57 ? 373 TRP B CE2 1 
ATOM   6166 C  CE3 . TRP B 1 373 ? 42.241 111.037 37.578  1.00 29.40 ? 373 TRP B CE3 1 
ATOM   6167 C  CZ2 . TRP B 1 373 ? 44.702 109.676 37.899  1.00 28.82 ? 373 TRP B CZ2 1 
ATOM   6168 C  CZ3 . TRP B 1 373 ? 42.330 109.867 38.315  1.00 27.84 ? 373 TRP B CZ3 1 
ATOM   6169 C  CH2 . TRP B 1 373 ? 43.551 109.201 38.469  1.00 28.15 ? 373 TRP B CH2 1 
ATOM   6170 N  N   . THR B 1 374 ? 43.794 116.514 36.875  1.00 29.64 ? 374 THR B N   1 
ATOM   6171 C  CA  . THR B 1 374 ? 44.933 117.291 37.367  1.00 29.95 ? 374 THR B CA  1 
ATOM   6172 C  C   . THR B 1 374 ? 44.575 118.383 38.375  1.00 31.25 ? 374 THR B C   1 
ATOM   6173 O  O   . THR B 1 374 ? 45.418 118.795 39.170  1.00 31.53 ? 374 THR B O   1 
ATOM   6174 C  CB  . THR B 1 374 ? 45.710 117.957 36.210  1.00 29.88 ? 374 THR B CB  1 
ATOM   6175 O  OG1 . THR B 1 374 ? 44.855 118.878 35.524  1.00 30.39 ? 374 THR B OG1 1 
ATOM   6176 C  CG2 . THR B 1 374 ? 46.214 116.912 35.230  1.00 27.84 ? 374 THR B CG2 1 
ATOM   6177 N  N   . HIS B 1 375 ? 43.333 118.854 38.350  1.00 32.34 ? 375 HIS B N   1 
ATOM   6178 C  CA  . HIS B 1 375 ? 42.916 119.899 39.277  1.00 33.44 ? 375 HIS B CA  1 
ATOM   6179 C  C   . HIS B 1 375 ? 41.636 119.562 40.029  1.00 35.43 ? 375 HIS B C   1 
ATOM   6180 O  O   . HIS B 1 375 ? 40.635 120.277 39.937  1.00 34.82 ? 375 HIS B O   1 
ATOM   6181 C  CB  . HIS B 1 375 ? 42.745 121.220 38.531  1.00 32.68 ? 375 HIS B CB  1 
ATOM   6182 C  CG  . HIS B 1 375 ? 43.995 121.686 37.855  1.00 33.77 ? 375 HIS B CG  1 
ATOM   6183 N  ND1 . HIS B 1 375 ? 44.076 121.887 36.493  1.00 33.15 ? 375 HIS B ND1 1 
ATOM   6184 C  CD2 . HIS B 1 375 ? 45.226 121.960 38.350  1.00 33.08 ? 375 HIS B CD2 1 
ATOM   6185 C  CE1 . HIS B 1 375 ? 45.304 122.262 36.178  1.00 33.30 ? 375 HIS B CE1 1 
ATOM   6186 N  NE2 . HIS B 1 375 ? 46.021 122.314 37.287  1.00 33.22 ? 375 HIS B NE2 1 
ATOM   6187 N  N   . PRO B 1 376 ? 41.660 118.463 40.796  1.00 37.08 ? 376 PRO B N   1 
ATOM   6188 C  CA  . PRO B 1 376 ? 40.500 118.018 41.579  1.00 37.49 ? 376 PRO B CA  1 
ATOM   6189 C  C   . PRO B 1 376 ? 40.094 119.141 42.529  1.00 38.53 ? 376 PRO B C   1 
ATOM   6190 O  O   . PRO B 1 376 ? 38.925 119.522 42.611  1.00 39.16 ? 376 PRO B O   1 
ATOM   6191 C  CB  . PRO B 1 376 ? 41.034 116.802 42.344  1.00 37.56 ? 376 PRO B CB  1 
ATOM   6192 C  CG  . PRO B 1 376 ? 42.212 116.338 41.526  1.00 38.06 ? 376 PRO B CG  1 
ATOM   6193 C  CD  . PRO B 1 376 ? 42.841 117.628 41.075  1.00 36.94 ? 376 PRO B CD  1 
ATOM   6194 N  N   . ASP B 1 377 ? 41.092 119.662 43.236  1.00 39.19 ? 377 ASP B N   1 
ATOM   6195 C  CA  . ASP B 1 377 ? 40.911 120.741 44.204  1.00 40.31 ? 377 ASP B CA  1 
ATOM   6196 C  C   . ASP B 1 377 ? 39.984 121.859 43.727  1.00 39.81 ? 377 ASP B C   1 
ATOM   6197 O  O   . ASP B 1 377 ? 39.267 122.453 44.530  1.00 40.64 ? 377 ASP B O   1 
ATOM   6198 C  CB  . ASP B 1 377 ? 42.277 121.334 44.571  1.00 41.12 ? 377 ASP B CB  1 
ATOM   6199 C  CG  . ASP B 1 377 ? 43.111 121.683 43.343  1.00 42.47 ? 377 ASP B CG  1 
ATOM   6200 O  OD1 . ASP B 1 377 ? 43.409 120.759 42.552  1.00 42.98 ? 377 ASP B OD1 1 
ATOM   6201 O  OD2 . ASP B 1 377 ? 43.464 122.872 43.168  1.00 41.29 ? 377 ASP B OD2 1 
ATOM   6202 N  N   . LYS B 1 378 ? 39.994 122.132 42.424  1.00 39.17 ? 378 LYS B N   1 
ATOM   6203 C  CA  . LYS B 1 378 ? 39.169 123.195 41.846  1.00 38.17 ? 378 LYS B CA  1 
ATOM   6204 C  C   . LYS B 1 378 ? 37.720 122.820 41.574  1.00 37.41 ? 378 LYS B C   1 
ATOM   6205 O  O   . LYS B 1 378 ? 36.934 123.670 41.151  1.00 38.02 ? 378 LYS B O   1 
ATOM   6206 C  CB  . LYS B 1 378 ? 39.786 123.691 40.531  1.00 37.39 ? 378 LYS B CB  1 
ATOM   6207 C  CG  . LYS B 1 378 ? 41.136 124.369 40.689  1.00 40.03 ? 378 LYS B CG  1 
ATOM   6208 C  CD  . LYS B 1 378 ? 41.812 124.572 39.339  1.00 41.81 ? 378 LYS B CD  1 
ATOM   6209 C  CE  . LYS B 1 378 ? 40.920 125.338 38.375  1.00 41.92 ? 378 LYS B CE  1 
ATOM   6210 N  NZ  . LYS B 1 378 ? 41.510 125.376 37.008  1.00 42.70 ? 378 LYS B NZ  1 
ATOM   6211 N  N   . TYR B 1 379 ? 37.351 121.565 41.810  1.00 35.91 ? 379 TYR B N   1 
ATOM   6212 C  CA  . TYR B 1 379 ? 35.984 121.166 41.516  1.00 34.46 ? 379 TYR B CA  1 
ATOM   6213 C  C   . TYR B 1 379 ? 35.200 120.399 42.560  1.00 34.33 ? 379 TYR B C   1 
ATOM   6214 O  O   . TYR B 1 379 ? 35.279 119.174 42.641  1.00 35.10 ? 379 TYR B O   1 
ATOM   6215 C  CB  . TYR B 1 379 ? 35.944 120.376 40.210  1.00 32.93 ? 379 TYR B CB  1 
ATOM   6216 C  CG  . TYR B 1 379 ? 36.415 121.171 39.022  1.00 31.71 ? 379 TYR B CG  1 
ATOM   6217 C  CD1 . TYR B 1 379 ? 37.768 121.281 38.726  1.00 31.31 ? 379 TYR B CD1 1 
ATOM   6218 C  CD2 . TYR B 1 379 ? 35.509 121.835 38.209  1.00 30.77 ? 379 TYR B CD2 1 
ATOM   6219 C  CE1 . TYR B 1 379 ? 38.204 122.032 37.650  1.00 30.14 ? 379 TYR B CE1 1 
ATOM   6220 C  CE2 . TYR B 1 379 ? 35.934 122.586 37.135  1.00 30.07 ? 379 TYR B CE2 1 
ATOM   6221 C  CZ  . TYR B 1 379 ? 37.281 122.682 36.861  1.00 29.64 ? 379 TYR B CZ  1 
ATOM   6222 O  OH  . TYR B 1 379 ? 37.704 123.446 35.802  1.00 30.88 ? 379 TYR B OH  1 
ATOM   6223 N  N   . PRO B 1 380 ? 34.420 121.114 43.377  1.00 33.52 ? 380 PRO B N   1 
ATOM   6224 C  CA  . PRO B 1 380 ? 33.632 120.417 44.391  1.00 32.87 ? 380 PRO B CA  1 
ATOM   6225 C  C   . PRO B 1 380 ? 32.561 119.642 43.633  1.00 32.43 ? 380 PRO B C   1 
ATOM   6226 O  O   . PRO B 1 380 ? 32.369 119.865 42.436  1.00 31.94 ? 380 PRO B O   1 
ATOM   6227 C  CB  . PRO B 1 380 ? 33.048 121.558 45.217  1.00 33.10 ? 380 PRO B CB  1 
ATOM   6228 C  CG  . PRO B 1 380 ? 32.892 122.654 44.208  1.00 33.01 ? 380 PRO B CG  1 
ATOM   6229 C  CD  . PRO B 1 380 ? 34.191 122.567 43.432  1.00 33.34 ? 380 PRO B CD  1 
ATOM   6230 N  N   . VAL B 1 381 ? 31.871 118.733 44.309  1.00 31.45 ? 381 VAL B N   1 
ATOM   6231 C  CA  . VAL B 1 381 ? 30.828 117.970 43.641  1.00 29.86 ? 381 VAL B CA  1 
ATOM   6232 C  C   . VAL B 1 381 ? 29.816 118.954 43.063  1.00 29.95 ? 381 VAL B C   1 
ATOM   6233 O  O   . VAL B 1 381 ? 29.362 119.860 43.751  1.00 31.51 ? 381 VAL B O   1 
ATOM   6234 C  CB  . VAL B 1 381 ? 30.132 117.001 44.624  1.00 28.08 ? 381 VAL B CB  1 
ATOM   6235 C  CG1 . VAL B 1 381 ? 28.900 116.382 43.983  1.00 25.14 ? 381 VAL B CG1 1 
ATOM   6236 C  CG2 . VAL B 1 381 ? 31.111 115.901 45.024  1.00 27.13 ? 381 VAL B CG2 1 
ATOM   6237 N  N   . GLY B 1 382 ? 29.482 118.783 41.791  1.00 29.87 ? 382 GLY B N   1 
ATOM   6238 C  CA  . GLY B 1 382 ? 28.527 119.669 41.152  1.00 30.51 ? 382 GLY B CA  1 
ATOM   6239 C  C   . GLY B 1 382 ? 28.770 119.727 39.659  1.00 31.43 ? 382 GLY B C   1 
ATOM   6240 O  O   . GLY B 1 382 ? 29.782 119.216 39.174  1.00 33.43 ? 382 GLY B O   1 
ATOM   6241 N  N   . VAL B 1 383 ? 27.850 120.341 38.924  1.00 30.54 ? 383 VAL B N   1 
ATOM   6242 C  CA  . VAL B 1 383 ? 27.987 120.456 37.473  1.00 29.34 ? 383 VAL B CA  1 
ATOM   6243 C  C   . VAL B 1 383 ? 28.725 121.752 37.125  1.00 28.77 ? 383 VAL B C   1 
ATOM   6244 O  O   . VAL B 1 383 ? 28.227 122.842 37.390  1.00 30.64 ? 383 VAL B O   1 
ATOM   6245 C  CB  . VAL B 1 383 ? 26.603 120.457 36.792  1.00 27.62 ? 383 VAL B CB  1 
ATOM   6246 C  CG1 . VAL B 1 383 ? 26.765 120.468 35.286  1.00 27.16 ? 383 VAL B CG1 1 
ATOM   6247 C  CG2 . VAL B 1 383 ? 25.810 119.240 37.237  1.00 26.44 ? 383 VAL B CG2 1 
ATOM   6248 N  N   . HIS B 1 384 ? 29.908 121.631 36.533  1.00 27.10 ? 384 HIS B N   1 
ATOM   6249 C  CA  . HIS B 1 384 ? 30.707 122.799 36.184  1.00 26.59 ? 384 HIS B CA  1 
ATOM   6250 C  C   . HIS B 1 384 ? 30.869 123.005 34.674  1.00 27.43 ? 384 HIS B C   1 
ATOM   6251 O  O   . HIS B 1 384 ? 31.056 122.048 33.920  1.00 28.56 ? 384 HIS B O   1 
ATOM   6252 C  CB  . HIS B 1 384 ? 32.100 122.682 36.807  1.00 26.94 ? 384 HIS B CB  1 
ATOM   6253 C  CG  . HIS B 1 384 ? 32.090 122.405 38.279  1.00 30.34 ? 384 HIS B CG  1 
ATOM   6254 N  ND1 . HIS B 1 384 ? 31.729 123.350 39.215  1.00 31.52 ? 384 HIS B ND1 1 
ATOM   6255 C  CD2 . HIS B 1 384 ? 32.396 121.285 38.977  1.00 31.50 ? 384 HIS B CD2 1 
ATOM   6256 C  CE1 . HIS B 1 384 ? 31.812 122.826 40.426  1.00 31.67 ? 384 HIS B CE1 1 
ATOM   6257 N  NE2 . HIS B 1 384 ? 32.216 121.573 40.309  1.00 32.62 ? 384 HIS B NE2 1 
ATOM   6258 N  N   . PHE B 1 385 ? 30.799 124.260 34.237  1.00 26.52 ? 385 PHE B N   1 
ATOM   6259 C  CA  . PHE B 1 385 ? 30.985 124.598 32.830  1.00 24.08 ? 385 PHE B CA  1 
ATOM   6260 C  C   . PHE B 1 385 ? 32.471 124.527 32.529  1.00 24.61 ? 385 PHE B C   1 
ATOM   6261 O  O   . PHE B 1 385 ? 33.298 124.872 33.375  1.00 25.84 ? 385 PHE B O   1 
ATOM   6262 C  CB  . PHE B 1 385 ? 30.520 126.024 32.543  1.00 22.02 ? 385 PHE B CB  1 
ATOM   6263 C  CG  . PHE B 1 385 ? 29.043 126.169 32.415  1.00 21.98 ? 385 PHE B CG  1 
ATOM   6264 C  CD1 . PHE B 1 385 ? 28.361 125.548 31.378  1.00 22.13 ? 385 PHE B CD1 1 
ATOM   6265 C  CD2 . PHE B 1 385 ? 28.330 126.932 33.326  1.00 20.15 ? 385 PHE B CD2 1 
ATOM   6266 C  CE1 . PHE B 1 385 ? 26.995 125.688 31.252  1.00 23.63 ? 385 PHE B CE1 1 
ATOM   6267 C  CE2 . PHE B 1 385 ? 26.967 127.078 33.210  1.00 21.20 ? 385 PHE B CE2 1 
ATOM   6268 C  CZ  . PHE B 1 385 ? 26.293 126.457 32.172  1.00 23.70 ? 385 PHE B CZ  1 
ATOM   6269 N  N   . LEU B 1 386 ? 32.817 124.086 31.331  1.00 24.03 ? 386 LEU B N   1 
ATOM   6270 C  CA  . LEU B 1 386 ? 34.217 124.022 30.958  1.00 25.41 ? 386 LEU B CA  1 
ATOM   6271 C  C   . LEU B 1 386 ? 34.748 125.452 30.952  1.00 26.31 ? 386 LEU B C   1 
ATOM   6272 O  O   . LEU B 1 386 ? 34.194 126.320 30.273  1.00 27.31 ? 386 LEU B O   1 
ATOM   6273 C  CB  . LEU B 1 386 ? 34.369 123.424 29.560  1.00 25.92 ? 386 LEU B CB  1 
ATOM   6274 C  CG  . LEU B 1 386 ? 35.801 123.387 29.027  1.00 25.54 ? 386 LEU B CG  1 
ATOM   6275 C  CD1 . LEU B 1 386 ? 36.612 122.333 29.783  1.00 27.30 ? 386 LEU B CD1 1 
ATOM   6276 C  CD2 . LEU B 1 386 ? 35.777 123.076 27.543  1.00 24.63 ? 386 LEU B CD2 1 
ATOM   6277 N  N   . PRO B 1 387 ? 35.814 125.728 31.720  1.00 26.10 ? 387 PRO B N   1 
ATOM   6278 C  CA  . PRO B 1 387 ? 36.341 127.094 31.723  1.00 25.94 ? 387 PRO B CA  1 
ATOM   6279 C  C   . PRO B 1 387 ? 36.621 127.612 30.310  1.00 25.32 ? 387 PRO B C   1 
ATOM   6280 O  O   . PRO B 1 387 ? 37.133 126.888 29.456  1.00 25.79 ? 387 PRO B O   1 
ATOM   6281 C  CB  . PRO B 1 387 ? 37.598 126.987 32.594  1.00 25.61 ? 387 PRO B CB  1 
ATOM   6282 C  CG  . PRO B 1 387 ? 37.933 125.525 32.585  1.00 26.37 ? 387 PRO B CG  1 
ATOM   6283 C  CD  . PRO B 1 387 ? 36.581 124.872 32.634  1.00 26.18 ? 387 PRO B CD  1 
ATOM   6284 N  N   . LYS B 1 388 ? 36.267 128.871 30.078  1.00 24.48 ? 388 LYS B N   1 
ATOM   6285 C  CA  . LYS B 1 388 ? 36.436 129.503 28.782  1.00 23.18 ? 388 LYS B CA  1 
ATOM   6286 C  C   . LYS B 1 388 ? 37.829 129.388 28.190  1.00 23.91 ? 388 LYS B C   1 
ATOM   6287 O  O   . LYS B 1 388 ? 37.978 129.234 26.977  1.00 21.95 ? 388 LYS B O   1 
ATOM   6288 C  CB  . LYS B 1 388 ? 36.053 130.978 28.865  1.00 23.67 ? 388 LYS B CB  1 
ATOM   6289 C  CG  . LYS B 1 388 ? 36.190 131.713 27.540  1.00 24.20 ? 388 LYS B CG  1 
ATOM   6290 C  CD  . LYS B 1 388 ? 35.669 133.136 27.631  1.00 24.06 ? 388 LYS B CD  1 
ATOM   6291 C  CE  . LYS B 1 388 ? 34.171 133.163 27.835  1.00 22.32 ? 388 LYS B CE  1 
ATOM   6292 N  NZ  . LYS B 1 388 ? 33.501 132.432 26.732  1.00 23.27 ? 388 LYS B NZ  1 
ATOM   6293 N  N   . LYS B 1 389 ? 38.850 129.473 29.037  1.00 25.03 ? 389 LYS B N   1 
ATOM   6294 C  CA  . LYS B 1 389 ? 40.220 129.395 28.552  1.00 25.32 ? 389 LYS B CA  1 
ATOM   6295 C  C   . LYS B 1 389 ? 40.479 128.068 27.844  1.00 24.86 ? 389 LYS B C   1 
ATOM   6296 O  O   . LYS B 1 389 ? 41.259 128.002 26.891  1.00 24.60 ? 389 LYS B O   1 
ATOM   6297 C  CB  . LYS B 1 389 ? 41.209 129.589 29.708  1.00 26.76 ? 389 LYS B CB  1 
ATOM   6298 C  CG  . LYS B 1 389 ? 42.659 129.624 29.259  1.00 29.07 ? 389 LYS B CG  1 
ATOM   6299 C  CD  . LYS B 1 389 ? 43.513 130.416 30.225  1.00 31.23 ? 389 LYS B CD  1 
ATOM   6300 C  CE  . LYS B 1 389 ? 44.937 130.576 29.703  1.00 31.94 ? 389 LYS B CE  1 
ATOM   6301 N  NZ  . LYS B 1 389 ? 45.716 131.513 30.569  1.00 35.33 ? 389 LYS B NZ  1 
ATOM   6302 N  N   . LEU B 1 390 ? 39.810 127.015 28.300  1.00 23.35 ? 390 LEU B N   1 
ATOM   6303 C  CA  . LEU B 1 390 ? 39.976 125.699 27.698  1.00 22.58 ? 390 LEU B CA  1 
ATOM   6304 C  C   . LEU B 1 390 ? 39.182 125.579 26.400  1.00 22.37 ? 390 LEU B C   1 
ATOM   6305 O  O   . LEU B 1 390 ? 39.616 124.918 25.449  1.00 21.02 ? 390 LEU B O   1 
ATOM   6306 C  CB  . LEU B 1 390 ? 39.543 124.624 28.689  1.00 22.77 ? 390 LEU B CB  1 
ATOM   6307 C  CG  . LEU B 1 390 ? 40.387 124.648 29.966  1.00 22.08 ? 390 LEU B CG  1 
ATOM   6308 C  CD1 . LEU B 1 390 ? 40.062 123.455 30.825  1.00 17.51 ? 390 LEU B CD1 1 
ATOM   6309 C  CD2 . LEU B 1 390 ? 41.864 124.651 29.587  1.00 20.42 ? 390 LEU B CD2 1 
ATOM   6310 N  N   . ASP B 1 391 ? 38.019 126.224 26.367  1.00 21.10 ? 391 ASP B N   1 
ATOM   6311 C  CA  . ASP B 1 391 ? 37.168 126.218 25.187  1.00 19.67 ? 391 ASP B CA  1 
ATOM   6312 C  C   . ASP B 1 391 ? 37.945 126.904 24.050  1.00 20.08 ? 391 ASP B C   1 
ATOM   6313 O  O   . ASP B 1 391 ? 37.866 126.486 22.890  1.00 20.27 ? 391 ASP B O   1 
ATOM   6314 C  CB  . ASP B 1 391 ? 35.870 126.963 25.501  1.00 19.10 ? 391 ASP B CB  1 
ATOM   6315 C  CG  . ASP B 1 391 ? 34.824 126.817 24.412  1.00 22.15 ? 391 ASP B CG  1 
ATOM   6316 O  OD1 . ASP B 1 391 ? 35.081 126.118 23.413  1.00 23.17 ? 391 ASP B OD1 1 
ATOM   6317 O  OD2 . ASP B 1 391 ? 33.732 127.403 24.560  1.00 23.23 ? 391 ASP B OD2 1 
ATOM   6318 N  N   . GLU B 1 392 ? 38.712 127.940 24.396  1.00 19.18 ? 392 GLU B N   1 
ATOM   6319 C  CA  . GLU B 1 392 ? 39.517 128.675 23.418  1.00 19.65 ? 392 GLU B CA  1 
ATOM   6320 C  C   . GLU B 1 392 ? 40.671 127.793 22.961  1.00 19.57 ? 392 GLU B C   1 
ATOM   6321 O  O   . GLU B 1 392 ? 41.080 127.838 21.796  1.00 20.15 ? 392 GLU B O   1 
ATOM   6322 C  CB  . GLU B 1 392 ? 40.073 129.964 24.031  1.00 19.99 ? 392 GLU B CB  1 
ATOM   6323 C  CG  . GLU B 1 392 ? 39.015 130.823 24.696  1.00 23.12 ? 392 GLU B CG  1 
ATOM   6324 C  CD  . GLU B 1 392 ? 39.574 132.087 25.317  1.00 24.20 ? 392 GLU B CD  1 
ATOM   6325 O  OE1 . GLU B 1 392 ? 40.654 132.017 25.946  1.00 24.27 ? 392 GLU B OE1 1 
ATOM   6326 O  OE2 . GLU B 1 392 ? 38.922 133.147 25.188  1.00 23.93 ? 392 GLU B OE2 1 
ATOM   6327 N  N   . ALA B 1 393 ? 41.199 127.002 23.891  1.00 18.22 ? 393 ALA B N   1 
ATOM   6328 C  CA  . ALA B 1 393 ? 42.283 126.079 23.588  1.00 16.59 ? 393 ALA B CA  1 
ATOM   6329 C  C   . ALA B 1 393 ? 41.767 125.012 22.612  1.00 16.91 ? 393 ALA B C   1 
ATOM   6330 O  O   . ALA B 1 393 ? 42.501 124.560 21.728  1.00 18.20 ? 393 ALA B O   1 
ATOM   6331 C  CB  . ALA B 1 393 ? 42.785 125.427 24.863  1.00 15.17 ? 393 ALA B CB  1 
ATOM   6332 N  N   . VAL B 1 394 ? 40.509 124.603 22.763  1.00 14.29 ? 394 VAL B N   1 
ATOM   6333 C  CA  . VAL B 1 394 ? 39.963 123.612 21.845  1.00 14.63 ? 394 VAL B CA  1 
ATOM   6334 C  C   . VAL B 1 394 ? 39.989 124.228 20.454  1.00 14.40 ? 394 VAL B C   1 
ATOM   6335 O  O   . VAL B 1 394 ? 40.450 123.612 19.504  1.00 15.49 ? 394 VAL B O   1 
ATOM   6336 C  CB  . VAL B 1 394 ? 38.495 123.216 22.191  1.00 14.40 ? 394 VAL B CB  1 
ATOM   6337 C  CG1 . VAL B 1 394 ? 37.939 122.296 21.109  1.00 13.25 ? 394 VAL B CG1 1 
ATOM   6338 C  CG2 . VAL B 1 394 ? 38.436 122.514 23.539  1.00 13.03 ? 394 VAL B CG2 1 
ATOM   6339 N  N   . ALA B 1 395 ? 39.500 125.456 20.348  1.00 16.29 ? 395 ALA B N   1 
ATOM   6340 C  CA  . ALA B 1 395 ? 39.473 126.160 19.073  1.00 18.11 ? 395 ALA B CA  1 
ATOM   6341 C  C   . ALA B 1 395 ? 40.874 126.393 18.502  1.00 19.22 ? 395 ALA B C   1 
ATOM   6342 O  O   . ALA B 1 395 ? 41.106 126.203 17.301  1.00 17.33 ? 395 ALA B O   1 
ATOM   6343 C  CB  . ALA B 1 395 ? 38.749 127.491 19.235  1.00 18.47 ? 395 ALA B CB  1 
ATOM   6344 N  N   . GLU B 1 396 ? 41.808 126.800 19.357  1.00 20.94 ? 396 GLU B N   1 
ATOM   6345 C  CA  . GLU B 1 396 ? 43.162 127.065 18.896  1.00 24.36 ? 396 GLU B CA  1 
ATOM   6346 C  C   . GLU B 1 396 ? 43.777 125.798 18.330  1.00 23.86 ? 396 GLU B C   1 
ATOM   6347 O  O   . GLU B 1 396 ? 44.485 125.834 17.320  1.00 26.03 ? 396 GLU B O   1 
ATOM   6348 C  CB  . GLU B 1 396 ? 44.027 127.605 20.037  1.00 27.67 ? 396 GLU B CB  1 
ATOM   6349 C  CG  . GLU B 1 396 ? 45.275 128.347 19.558  1.00 33.86 ? 396 GLU B CG  1 
ATOM   6350 C  CD  . GLU B 1 396 ? 45.978 129.108 20.676  1.00 39.27 ? 396 GLU B CD  1 
ATOM   6351 O  OE1 . GLU B 1 396 ? 45.314 129.425 21.691  1.00 42.19 ? 396 GLU B OE1 1 
ATOM   6352 O  OE2 . GLU B 1 396 ? 47.187 129.405 20.535  1.00 40.56 ? 396 GLU B OE2 1 
ATOM   6353 N  N   . ALA B 1 397 ? 43.487 124.676 18.976  1.00 23.16 ? 397 ALA B N   1 
ATOM   6354 C  CA  . ALA B 1 397 ? 44.007 123.384 18.552  1.00 21.85 ? 397 ALA B CA  1 
ATOM   6355 C  C   . ALA B 1 397 ? 43.592 123.025 17.130  1.00 21.62 ? 397 ALA B C   1 
ATOM   6356 O  O   . ALA B 1 397 ? 44.248 122.203 16.484  1.00 20.68 ? 397 ALA B O   1 
ATOM   6357 C  CB  . ALA B 1 397 ? 43.545 122.304 19.512  1.00 22.40 ? 397 ALA B CB  1 
ATOM   6358 N  N   . HIS B 1 398 ? 42.514 123.637 16.642  1.00 20.66 ? 398 HIS B N   1 
ATOM   6359 C  CA  . HIS B 1 398 ? 42.037 123.362 15.287  1.00 21.30 ? 398 HIS B CA  1 
ATOM   6360 C  C   . HIS B 1 398 ? 42.475 124.418 14.268  1.00 21.46 ? 398 HIS B C   1 
ATOM   6361 O  O   . HIS B 1 398 ? 42.286 124.242 13.064  1.00 21.65 ? 398 HIS B O   1 
ATOM   6362 C  CB  . HIS B 1 398 ? 40.505 123.247 15.262  1.00 21.77 ? 398 HIS B CB  1 
ATOM   6363 C  CG  . HIS B 1 398 ? 39.965 122.090 16.048  1.00 22.10 ? 398 HIS B CG  1 
ATOM   6364 N  ND1 . HIS B 1 398 ? 39.915 122.081 17.426  1.00 20.03 ? 398 HIS B ND1 1 
ATOM   6365 C  CD2 . HIS B 1 398 ? 39.465 120.895 15.647  1.00 21.92 ? 398 HIS B CD2 1 
ATOM   6366 C  CE1 . HIS B 1 398 ? 39.409 120.933 17.840  1.00 20.92 ? 398 HIS B CE1 1 
ATOM   6367 N  NE2 . HIS B 1 398 ? 39.129 120.195 16.780  1.00 20.72 ? 398 HIS B NE2 1 
ATOM   6368 N  N   . LEU B 1 399 ? 43.071 125.508 14.744  1.00 21.25 ? 399 LEU B N   1 
ATOM   6369 C  CA  . LEU B 1 399 ? 43.506 126.578 13.853  1.00 20.28 ? 399 LEU B CA  1 
ATOM   6370 C  C   . LEU B 1 399 ? 44.699 126.209 12.978  1.00 21.53 ? 399 LEU B C   1 
ATOM   6371 O  O   . LEU B 1 399 ? 44.825 126.697 11.852  1.00 20.91 ? 399 LEU B O   1 
ATOM   6372 C  CB  . LEU B 1 399 ? 43.824 127.828 14.666  1.00 18.98 ? 399 LEU B CB  1 
ATOM   6373 C  CG  . LEU B 1 399 ? 42.625 128.401 15.426  1.00 17.95 ? 399 LEU B CG  1 
ATOM   6374 C  CD1 . LEU B 1 399 ? 43.051 129.665 16.145  1.00 17.47 ? 399 LEU B CD1 1 
ATOM   6375 C  CD2 . LEU B 1 399 ? 41.480 128.687 14.459  1.00 13.95 ? 399 LEU B CD2 1 
ATOM   6376 N  N   . GLY B 1 400 ? 45.572 125.349 13.494  1.00 21.83 ? 400 GLY B N   1 
ATOM   6377 C  CA  . GLY B 1 400 ? 46.733 124.932 12.728  1.00 21.30 ? 400 GLY B CA  1 
ATOM   6378 C  C   . GLY B 1 400 ? 46.365 124.236 11.427  1.00 22.59 ? 400 GLY B C   1 
ATOM   6379 O  O   . GLY B 1 400 ? 46.906 124.557 10.374  1.00 22.63 ? 400 GLY B O   1 
ATOM   6380 N  N   . LYS B 1 401 ? 45.447 123.278 11.490  1.00 23.42 ? 401 LYS B N   1 
ATOM   6381 C  CA  . LYS B 1 401 ? 45.030 122.563 10.293  1.00 24.49 ? 401 LYS B CA  1 
ATOM   6382 C  C   . LYS B 1 401 ? 44.424 123.531 9.279   1.00 25.68 ? 401 LYS B C   1 
ATOM   6383 O  O   . LYS B 1 401 ? 44.739 123.483 8.091   1.00 26.56 ? 401 LYS B O   1 
ATOM   6384 C  CB  . LYS B 1 401 ? 43.994 121.495 10.634  1.00 26.20 ? 401 LYS B CB  1 
ATOM   6385 C  CG  . LYS B 1 401 ? 43.468 120.780 9.395   1.00 29.06 ? 401 LYS B CG  1 
ATOM   6386 C  CD  . LYS B 1 401 ? 42.169 120.032 9.659   1.00 31.35 ? 401 LYS B CD  1 
ATOM   6387 C  CE  . LYS B 1 401 ? 41.662 119.382 8.377   1.00 32.15 ? 401 LYS B CE  1 
ATOM   6388 N  NZ  . LYS B 1 401 ? 42.741 118.564 7.744   1.00 32.20 ? 401 LYS B NZ  1 
ATOM   6389 N  N   . LEU B 1 402 ? 43.539 124.402 9.749   1.00 25.69 ? 402 LEU B N   1 
ATOM   6390 C  CA  . LEU B 1 402 ? 42.909 125.379 8.876   1.00 25.96 ? 402 LEU B CA  1 
ATOM   6391 C  C   . LEU B 1 402 ? 43.981 126.336 8.388   1.00 27.25 ? 402 LEU B C   1 
ATOM   6392 O  O   . LEU B 1 402 ? 43.744 127.170 7.515   1.00 25.87 ? 402 LEU B O   1 
ATOM   6393 C  CB  . LEU B 1 402 ? 41.834 126.146 9.634   1.00 24.83 ? 402 LEU B CB  1 
ATOM   6394 C  CG  . LEU B 1 402 ? 40.776 125.215 10.216  1.00 24.05 ? 402 LEU B CG  1 
ATOM   6395 C  CD1 . LEU B 1 402 ? 39.782 126.024 11.033  1.00 24.11 ? 402 LEU B CD1 1 
ATOM   6396 C  CD2 . LEU B 1 402 ? 40.097 124.451 9.085   1.00 20.09 ? 402 LEU B CD2 1 
ATOM   6397 N  N   . ASN B 1 403 ? 45.168 126.198 8.967   1.00 28.50 ? 403 ASN B N   1 
ATOM   6398 C  CA  . ASN B 1 403 ? 46.300 127.028 8.601   1.00 29.93 ? 403 ASN B CA  1 
ATOM   6399 C  C   . ASN B 1 403 ? 45.992 128.510 8.846   1.00 28.39 ? 403 ASN B C   1 
ATOM   6400 O  O   . ASN B 1 403 ? 46.399 129.389 8.079   1.00 28.19 ? 403 ASN B O   1 
ATOM   6401 C  CB  . ASN B 1 403 ? 46.658 126.783 7.134   1.00 33.75 ? 403 ASN B CB  1 
ATOM   6402 C  CG  . ASN B 1 403 ? 48.060 127.242 6.794   1.00 38.54 ? 403 ASN B CG  1 
ATOM   6403 O  OD1 . ASN B 1 403 ? 48.494 127.147 5.640   1.00 42.61 ? 403 ASN B OD1 1 
ATOM   6404 N  ND2 . ASN B 1 403 ? 48.782 127.742 7.797   1.00 37.18 ? 403 ASN B ND2 1 
ATOM   6405 N  N   . VAL B 1 404 ? 45.259 128.769 9.922   1.00 25.04 ? 404 VAL B N   1 
ATOM   6406 C  CA  . VAL B 1 404 ? 44.904 130.122 10.316  1.00 22.56 ? 404 VAL B CA  1 
ATOM   6407 C  C   . VAL B 1 404 ? 46.022 130.658 11.198  1.00 23.03 ? 404 VAL B C   1 
ATOM   6408 O  O   . VAL B 1 404 ? 46.537 129.937 12.059  1.00 22.21 ? 404 VAL B O   1 
ATOM   6409 C  CB  . VAL B 1 404 ? 43.599 130.137 11.136  1.00 21.28 ? 404 VAL B CB  1 
ATOM   6410 C  CG1 . VAL B 1 404 ? 43.531 131.394 11.990  1.00 17.50 ? 404 VAL B CG1 1 
ATOM   6411 C  CG2 . VAL B 1 404 ? 42.409 130.055 10.205  1.00 21.16 ? 404 VAL B CG2 1 
ATOM   6412 N  N   . LYS B 1 405 ? 46.411 131.911 10.980  1.00 22.07 ? 405 LYS B N   1 
ATOM   6413 C  CA  . LYS B 1 405 ? 47.459 132.509 11.796  1.00 21.53 ? 405 LYS B CA  1 
ATOM   6414 C  C   . LYS B 1 405 ? 46.839 133.493 12.767  1.00 21.40 ? 405 LYS B C   1 
ATOM   6415 O  O   . LYS B 1 405 ? 46.480 134.610 12.400  1.00 22.36 ? 405 LYS B O   1 
ATOM   6416 C  CB  . LYS B 1 405 ? 48.492 133.212 10.923  1.00 21.76 ? 405 LYS B CB  1 
ATOM   6417 C  CG  . LYS B 1 405 ? 49.243 132.266 10.021  1.00 24.50 ? 405 LYS B CG  1 
ATOM   6418 C  CD  . LYS B 1 405 ? 50.210 133.012 9.142   1.00 31.08 ? 405 LYS B CD  1 
ATOM   6419 C  CE  . LYS B 1 405 ? 50.471 132.237 7.852   1.00 35.87 ? 405 LYS B CE  1 
ATOM   6420 N  NZ  . LYS B 1 405 ? 51.239 133.061 6.866   1.00 38.36 ? 405 LYS B NZ  1 
ATOM   6421 N  N   . LEU B 1 406 ? 46.704 133.055 14.012  1.00 19.56 ? 406 LEU B N   1 
ATOM   6422 C  CA  . LEU B 1 406 ? 46.126 133.872 15.060  1.00 18.45 ? 406 LEU B CA  1 
ATOM   6423 C  C   . LEU B 1 406 ? 47.071 135.018 15.418  1.00 20.83 ? 406 LEU B C   1 
ATOM   6424 O  O   . LEU B 1 406 ? 48.296 134.887 15.332  1.00 22.08 ? 406 LEU B O   1 
ATOM   6425 C  CB  . LEU B 1 406 ? 45.875 133.004 16.289  1.00 15.11 ? 406 LEU B CB  1 
ATOM   6426 C  CG  . LEU B 1 406 ? 44.921 133.505 17.368  1.00 14.33 ? 406 LEU B CG  1 
ATOM   6427 C  CD1 . LEU B 1 406 ? 43.513 133.632 16.799  1.00 13.73 ? 406 LEU B CD1 1 
ATOM   6428 C  CD2 . LEU B 1 406 ? 44.929 132.522 18.526  1.00 12.95 ? 406 LEU B CD2 1 
ATOM   6429 N  N   . THR B 1 407 ? 46.500 136.147 15.812  1.00 21.66 ? 407 THR B N   1 
ATOM   6430 C  CA  . THR B 1 407 ? 47.295 137.301 16.203  1.00 22.33 ? 407 THR B CA  1 
ATOM   6431 C  C   . THR B 1 407 ? 47.460 137.216 17.714  1.00 22.20 ? 407 THR B C   1 
ATOM   6432 O  O   . THR B 1 407 ? 46.582 136.704 18.406  1.00 21.35 ? 407 THR B O   1 
ATOM   6433 C  CB  . THR B 1 407 ? 46.577 138.623 15.826  1.00 23.60 ? 407 THR B CB  1 
ATOM   6434 O  OG1 . THR B 1 407 ? 46.563 138.762 14.403  1.00 26.75 ? 407 THR B OG1 1 
ATOM   6435 C  CG2 . THR B 1 407 ? 47.277 139.827 16.438  1.00 22.94 ? 407 THR B CG2 1 
ATOM   6436 N  N   . LYS B 1 408 ? 48.589 137.702 18.220  1.00 22.36 ? 408 LYS B N   1 
ATOM   6437 C  CA  . LYS B 1 408 ? 48.862 137.674 19.653  1.00 22.87 ? 408 LYS B CA  1 
ATOM   6438 C  C   . LYS B 1 408 ? 48.878 139.099 20.199  1.00 24.28 ? 408 LYS B C   1 
ATOM   6439 O  O   . LYS B 1 408 ? 49.570 139.966 19.668  1.00 25.57 ? 408 LYS B O   1 
ATOM   6440 C  CB  . LYS B 1 408 ? 50.219 137.018 19.907  1.00 21.96 ? 408 LYS B CB  1 
ATOM   6441 C  CG  . LYS B 1 408 ? 50.485 136.668 21.360  1.00 23.42 ? 408 LYS B CG  1 
ATOM   6442 C  CD  . LYS B 1 408 ? 49.681 135.450 21.772  1.00 25.69 ? 408 LYS B CD  1 
ATOM   6443 C  CE  . LYS B 1 408 ? 49.798 135.179 23.260  1.00 24.97 ? 408 LYS B CE  1 
ATOM   6444 N  NZ  . LYS B 1 408 ? 49.060 133.943 23.629  1.00 25.06 ? 408 LYS B NZ  1 
ATOM   6445 N  N   . LEU B 1 409 ? 48.114 139.354 21.253  1.00 23.92 ? 409 LEU B N   1 
ATOM   6446 C  CA  . LEU B 1 409 ? 48.086 140.693 21.827  1.00 24.88 ? 409 LEU B CA  1 
ATOM   6447 C  C   . LEU B 1 409 ? 49.456 141.078 22.375  1.00 24.90 ? 409 LEU B C   1 
ATOM   6448 O  O   . LEU B 1 409 ? 50.168 140.236 22.926  1.00 27.25 ? 409 LEU B O   1 
ATOM   6449 C  CB  . LEU B 1 409 ? 47.064 140.764 22.964  1.00 24.88 ? 409 LEU B CB  1 
ATOM   6450 C  CG  . LEU B 1 409 ? 45.580 140.740 22.606  1.00 24.42 ? 409 LEU B CG  1 
ATOM   6451 C  CD1 . LEU B 1 409 ? 44.767 140.576 23.872  1.00 23.76 ? 409 LEU B CD1 1 
ATOM   6452 C  CD2 . LEU B 1 409 ? 45.202 142.018 21.882  1.00 22.46 ? 409 LEU B CD2 1 
ATOM   6453 N  N   . THR B 1 410 ? 49.830 142.344 22.219  1.00 22.90 ? 410 THR B N   1 
ATOM   6454 C  CA  . THR B 1 410 ? 51.104 142.812 22.755  1.00 21.93 ? 410 THR B CA  1 
ATOM   6455 C  C   . THR B 1 410 ? 50.801 143.090 24.221  1.00 24.83 ? 410 THR B C   1 
ATOM   6456 O  O   . THR B 1 410 ? 49.628 143.161 24.606  1.00 24.22 ? 410 THR B O   1 
ATOM   6457 C  CB  . THR B 1 410 ? 51.566 144.126 22.109  1.00 18.49 ? 410 THR B CB  1 
ATOM   6458 O  OG1 . THR B 1 410 ? 50.631 145.163 22.433  1.00 19.92 ? 410 THR B OG1 1 
ATOM   6459 C  CG2 . THR B 1 410 ? 51.669 143.983 20.606  1.00 12.13 ? 410 THR B CG2 1 
ATOM   6460 N  N   . GLU B 1 411 ? 51.833 143.245 25.045  1.00 27.25 ? 411 GLU B N   1 
ATOM   6461 C  CA  . GLU B 1 411 ? 51.585 143.512 26.455  1.00 30.24 ? 411 GLU B CA  1 
ATOM   6462 C  C   . GLU B 1 411 ? 50.776 144.801 26.595  1.00 29.82 ? 411 GLU B C   1 
ATOM   6463 O  O   . GLU B 1 411 ? 49.860 144.886 27.416  1.00 28.48 ? 411 GLU B O   1 
ATOM   6464 C  CB  . GLU B 1 411 ? 52.896 143.625 27.231  1.00 33.03 ? 411 GLU B CB  1 
ATOM   6465 C  CG  . GLU B 1 411 ? 52.674 143.789 28.729  1.00 41.58 ? 411 GLU B CG  1 
ATOM   6466 C  CD  . GLU B 1 411 ? 53.965 143.757 29.526  1.00 47.11 ? 411 GLU B CD  1 
ATOM   6467 O  OE1 . GLU B 1 411 ? 54.663 142.717 29.475  1.00 50.19 ? 411 GLU B OE1 1 
ATOM   6468 O  OE2 . GLU B 1 411 ? 54.278 144.767 30.202  1.00 47.77 ? 411 GLU B OE2 1 
ATOM   6469 N  N   . LYS B 1 412 ? 51.115 145.791 25.773  1.00 29.22 ? 412 LYS B N   1 
ATOM   6470 C  CA  . LYS B 1 412 ? 50.432 147.078 25.778  1.00 28.21 ? 412 LYS B CA  1 
ATOM   6471 C  C   . LYS B 1 412 ? 48.949 146.891 25.439  1.00 27.70 ? 412 LYS B C   1 
ATOM   6472 O  O   . LYS B 1 412 ? 48.072 147.465 26.090  1.00 26.85 ? 412 LYS B O   1 
ATOM   6473 C  CB  . LYS B 1 412 ? 51.101 148.012 24.766  1.00 29.88 ? 412 LYS B CB  1 
ATOM   6474 C  CG  . LYS B 1 412 ? 50.537 149.429 24.716  1.00 32.26 ? 412 LYS B CG  1 
ATOM   6475 C  CD  . LYS B 1 412 ? 51.239 150.241 23.628  1.00 34.05 ? 412 LYS B CD  1 
ATOM   6476 C  CE  . LYS B 1 412 ? 50.594 151.610 23.424  1.00 35.48 ? 412 LYS B CE  1 
ATOM   6477 N  NZ  . LYS B 1 412 ? 51.280 152.423 22.370  1.00 34.86 ? 412 LYS B NZ  1 
ATOM   6478 N  N   . GLN B 1 413 ? 48.667 146.076 24.428  1.00 27.14 ? 413 GLN B N   1 
ATOM   6479 C  CA  . GLN B 1 413 ? 47.283 145.820 24.030  1.00 26.36 ? 413 GLN B CA  1 
ATOM   6480 C  C   . GLN B 1 413 ? 46.529 145.033 25.096  1.00 27.20 ? 413 GLN B C   1 
ATOM   6481 O  O   . GLN B 1 413 ? 45.387 145.350 25.419  1.00 27.78 ? 413 GLN B O   1 
ATOM   6482 C  CB  . GLN B 1 413 ? 47.246 145.057 22.710  1.00 24.49 ? 413 GLN B CB  1 
ATOM   6483 C  CG  . GLN B 1 413 ? 47.884 145.805 21.561  1.00 22.51 ? 413 GLN B CG  1 
ATOM   6484 C  CD  . GLN B 1 413 ? 47.861 145.005 20.289  1.00 22.31 ? 413 GLN B CD  1 
ATOM   6485 O  OE1 . GLN B 1 413 ? 48.232 143.835 20.284  1.00 23.42 ? 413 GLN B OE1 1 
ATOM   6486 N  NE2 . GLN B 1 413 ? 47.432 145.627 19.196  1.00 21.90 ? 413 GLN B NE2 1 
ATOM   6487 N  N   . ALA B 1 414 ? 47.169 144.002 25.639  1.00 28.24 ? 414 ALA B N   1 
ATOM   6488 C  CA  . ALA B 1 414 ? 46.553 143.185 26.680  1.00 27.52 ? 414 ALA B CA  1 
ATOM   6489 C  C   . ALA B 1 414 ? 46.243 144.060 27.895  1.00 28.16 ? 414 ALA B C   1 
ATOM   6490 O  O   . ALA B 1 414 ? 45.143 144.007 28.451  1.00 27.97 ? 414 ALA B O   1 
ATOM   6491 C  CB  . ALA B 1 414 ? 47.489 142.047 27.076  1.00 25.88 ? 414 ALA B CB  1 
ATOM   6492 N  N   . GLN B 1 415 ? 47.211 144.870 28.308  1.00 29.04 ? 415 GLN B N   1 
ATOM   6493 C  CA  . GLN B 1 415 ? 46.995 145.736 29.456  1.00 31.35 ? 415 GLN B CA  1 
ATOM   6494 C  C   . GLN B 1 415 ? 45.886 146.723 29.134  1.00 31.84 ? 415 GLN B C   1 
ATOM   6495 O  O   . GLN B 1 415 ? 45.049 147.036 29.984  1.00 32.38 ? 415 GLN B O   1 
ATOM   6496 C  CB  . GLN B 1 415 ? 48.291 146.461 29.837  1.00 33.60 ? 415 GLN B CB  1 
ATOM   6497 C  CG  . GLN B 1 415 ? 49.381 145.493 30.314  1.00 39.68 ? 415 GLN B CG  1 
ATOM   6498 C  CD  . GLN B 1 415 ? 50.589 146.187 30.921  1.00 42.35 ? 415 GLN B CD  1 
ATOM   6499 O  OE1 . GLN B 1 415 ? 51.221 147.035 30.287  1.00 44.03 ? 415 GLN B OE1 1 
ATOM   6500 N  NE2 . GLN B 1 415 ? 50.922 145.820 32.157  1.00 43.35 ? 415 GLN B NE2 1 
ATOM   6501 N  N   . TYR B 1 416 ? 45.865 147.195 27.894  1.00 31.21 ? 416 TYR B N   1 
ATOM   6502 C  CA  . TYR B 1 416 ? 44.833 148.129 27.475  1.00 29.75 ? 416 TYR B CA  1 
ATOM   6503 C  C   . TYR B 1 416 ? 43.467 147.455 27.552  1.00 29.97 ? 416 TYR B C   1 
ATOM   6504 O  O   . TYR B 1 416 ? 42.504 148.040 28.043  1.00 30.85 ? 416 TYR B O   1 
ATOM   6505 C  CB  . TYR B 1 416 ? 45.077 148.588 26.040  1.00 29.58 ? 416 TYR B CB  1 
ATOM   6506 C  CG  . TYR B 1 416 ? 43.983 149.484 25.511  1.00 28.99 ? 416 TYR B CG  1 
ATOM   6507 C  CD1 . TYR B 1 416 ? 43.981 150.848 25.782  1.00 27.69 ? 416 TYR B CD1 1 
ATOM   6508 C  CD2 . TYR B 1 416 ? 42.925 148.959 24.776  1.00 29.58 ? 416 TYR B CD2 1 
ATOM   6509 C  CE1 . TYR B 1 416 ? 42.950 151.667 25.336  1.00 27.59 ? 416 TYR B CE1 1 
ATOM   6510 C  CE2 . TYR B 1 416 ? 41.887 149.770 24.326  1.00 29.21 ? 416 TYR B CE2 1 
ATOM   6511 C  CZ  . TYR B 1 416 ? 41.906 151.120 24.610  1.00 28.38 ? 416 TYR B CZ  1 
ATOM   6512 O  OH  . TYR B 1 416 ? 40.883 151.922 24.166  1.00 28.15 ? 416 TYR B OH  1 
ATOM   6513 N  N   . LEU B 1 417 ? 43.395 146.220 27.062  1.00 29.10 ? 417 LEU B N   1 
ATOM   6514 C  CA  . LEU B 1 417 ? 42.150 145.454 27.044  1.00 27.96 ? 417 LEU B CA  1 
ATOM   6515 C  C   . LEU B 1 417 ? 41.785 144.832 28.384  1.00 27.87 ? 417 LEU B C   1 
ATOM   6516 O  O   . LEU B 1 417 ? 40.676 144.325 28.554  1.00 27.75 ? 417 LEU B O   1 
ATOM   6517 C  CB  . LEU B 1 417 ? 42.226 144.348 25.985  1.00 26.05 ? 417 LEU B CB  1 
ATOM   6518 C  CG  . LEU B 1 417 ? 42.267 144.781 24.518  1.00 26.01 ? 417 LEU B CG  1 
ATOM   6519 C  CD1 . LEU B 1 417 ? 42.500 143.570 23.629  1.00 25.02 ? 417 LEU B CD1 1 
ATOM   6520 C  CD2 . LEU B 1 417 ? 40.966 145.476 24.152  1.00 22.48 ? 417 LEU B CD2 1 
ATOM   6521 N  N   . GLY B 1 418 ? 42.714 144.859 29.331  1.00 28.08 ? 418 GLY B N   1 
ATOM   6522 C  CA  . GLY B 1 418 ? 42.434 144.283 30.633  1.00 28.23 ? 418 GLY B CA  1 
ATOM   6523 C  C   . GLY B 1 418 ? 42.312 142.770 30.590  1.00 29.07 ? 418 GLY B C   1 
ATOM   6524 O  O   . GLY B 1 418 ? 41.479 142.183 31.281  1.00 28.93 ? 418 GLY B O   1 
ATOM   6525 N  N   . MET B 1 419 ? 43.135 142.129 29.769  1.00 28.63 ? 419 MET B N   1 
ATOM   6526 C  CA  . MET B 1 419 ? 43.098 140.678 29.678  1.00 29.36 ? 419 MET B CA  1 
ATOM   6527 C  C   . MET B 1 419 ? 44.490 140.107 29.482  1.00 28.52 ? 419 MET B C   1 
ATOM   6528 O  O   . MET B 1 419 ? 45.413 140.818 29.092  1.00 27.29 ? 419 MET B O   1 
ATOM   6529 C  CB  . MET B 1 419 ? 42.166 140.223 28.540  1.00 30.43 ? 419 MET B CB  1 
ATOM   6530 C  CG  . MET B 1 419 ? 42.471 140.806 27.169  1.00 31.85 ? 419 MET B CG  1 
ATOM   6531 S  SD  . MET B 1 419 ? 41.286 140.267 25.897  1.00 32.14 ? 419 MET B SD  1 
ATOM   6532 C  CE  . MET B 1 419 ? 39.884 141.261 26.290  1.00 31.68 ? 419 MET B CE  1 
ATOM   6533 N  N   . SER B 1 420 ? 44.641 138.822 29.775  1.00 28.56 ? 420 SER B N   1 
ATOM   6534 C  CA  . SER B 1 420 ? 45.930 138.166 29.621  1.00 29.08 ? 420 SER B CA  1 
ATOM   6535 C  C   . SER B 1 420 ? 46.213 137.879 28.150  1.00 29.42 ? 420 SER B C   1 
ATOM   6536 O  O   . SER B 1 420 ? 45.298 137.623 27.372  1.00 29.40 ? 420 SER B O   1 
ATOM   6537 C  CB  . SER B 1 420 ? 45.960 136.857 30.412  1.00 27.84 ? 420 SER B CB  1 
ATOM   6538 O  OG  . SER B 1 420 ? 47.150 136.136 30.132  1.00 29.59 ? 420 SER B OG  1 
ATOM   6539 N  N   . CYS B 1 421 ? 47.484 137.937 27.773  1.00 29.55 ? 421 CYS B N   1 
ATOM   6540 C  CA  . CYS B 1 421 ? 47.885 137.658 26.405  1.00 30.37 ? 421 CYS B CA  1 
ATOM   6541 C  C   . CYS B 1 421 ? 47.392 136.276 25.988  1.00 28.93 ? 421 CYS B C   1 
ATOM   6542 O  O   . CYS B 1 421 ? 47.250 135.991 24.801  1.00 28.48 ? 421 CYS B O   1 
ATOM   6543 C  CB  . CYS B 1 421 ? 49.411 137.691 26.286  1.00 32.15 ? 421 CYS B CB  1 
ATOM   6544 S  SG  . CYS B 1 421 ? 50.143 139.335 26.387  1.00 45.90 ? 421 CYS B SG  1 
ATOM   6545 N  N   . ASP B 1 422 ? 47.133 135.419 26.971  1.00 27.68 ? 422 ASP B N   1 
ATOM   6546 C  CA  . ASP B 1 422 ? 46.695 134.062 26.686  1.00 26.46 ? 422 ASP B CA  1 
ATOM   6547 C  C   . ASP B 1 422 ? 45.206 133.814 26.915  1.00 25.81 ? 422 ASP B C   1 
ATOM   6548 O  O   . ASP B 1 422 ? 44.743 132.674 26.856  1.00 25.68 ? 422 ASP B O   1 
ATOM   6549 C  CB  . ASP B 1 422 ? 47.525 133.072 27.514  1.00 26.68 ? 422 ASP B CB  1 
ATOM   6550 C  CG  . ASP B 1 422 ? 49.021 133.243 27.297  1.00 26.96 ? 422 ASP B CG  1 
ATOM   6551 O  OD1 . ASP B 1 422 ? 49.430 133.451 26.137  1.00 25.76 ? 422 ASP B OD1 1 
ATOM   6552 O  OD2 . ASP B 1 422 ? 49.789 133.164 28.278  1.00 27.33 ? 422 ASP B OD2 1 
ATOM   6553 N  N   . GLY B 1 423 ? 44.455 134.877 27.166  1.00 24.90 ? 423 GLY B N   1 
ATOM   6554 C  CA  . GLY B 1 423 ? 43.033 134.718 27.395  1.00 23.76 ? 423 GLY B CA  1 
ATOM   6555 C  C   . GLY B 1 423 ? 42.779 134.398 28.848  1.00 22.96 ? 423 GLY B C   1 
ATOM   6556 O  O   . GLY B 1 423 ? 43.739 134.261 29.606  1.00 23.19 ? 423 GLY B O   1 
ATOM   6557 N  N   . PRO B 1 424 ? 41.507 134.256 29.268  1.00 22.57 ? 424 PRO B N   1 
ATOM   6558 C  CA  . PRO B 1 424 ? 40.310 134.372 28.421  1.00 22.37 ? 424 PRO B CA  1 
ATOM   6559 C  C   . PRO B 1 424 ? 40.196 135.745 27.744  1.00 21.99 ? 424 PRO B C   1 
ATOM   6560 O  O   . PRO B 1 424 ? 40.511 136.779 28.343  1.00 21.32 ? 424 PRO B O   1 
ATOM   6561 C  CB  . PRO B 1 424 ? 39.154 134.132 29.402  1.00 21.52 ? 424 PRO B CB  1 
ATOM   6562 C  CG  . PRO B 1 424 ? 39.785 133.445 30.563  1.00 21.65 ? 424 PRO B CG  1 
ATOM   6563 C  CD  . PRO B 1 424 ? 41.118 134.124 30.680  1.00 21.13 ? 424 PRO B CD  1 
ATOM   6564 N  N   . PHE B 1 425 ? 39.727 135.748 26.504  1.00 20.54 ? 425 PHE B N   1 
ATOM   6565 C  CA  . PHE B 1 425 ? 39.594 136.983 25.752  1.00 20.59 ? 425 PHE B CA  1 
ATOM   6566 C  C   . PHE B 1 425 ? 38.190 137.548 25.806  1.00 20.76 ? 425 PHE B C   1 
ATOM   6567 O  O   . PHE B 1 425 ? 37.955 138.681 25.393  1.00 21.88 ? 425 PHE B O   1 
ATOM   6568 C  CB  . PHE B 1 425 ? 39.983 136.738 24.298  1.00 20.08 ? 425 PHE B CB  1 
ATOM   6569 C  CG  . PHE B 1 425 ? 41.359 136.183 24.135  1.00 22.59 ? 425 PHE B CG  1 
ATOM   6570 C  CD1 . PHE B 1 425 ? 42.473 136.955 24.444  1.00 20.18 ? 425 PHE B CD1 1 
ATOM   6571 C  CD2 . PHE B 1 425 ? 41.547 134.875 23.694  1.00 21.86 ? 425 PHE B CD2 1 
ATOM   6572 C  CE1 . PHE B 1 425 ? 43.750 136.433 24.316  1.00 21.60 ? 425 PHE B CE1 1 
ATOM   6573 C  CE2 . PHE B 1 425 ? 42.822 134.349 23.565  1.00 21.21 ? 425 PHE B CE2 1 
ATOM   6574 C  CZ  . PHE B 1 425 ? 43.926 135.127 23.876  1.00 20.57 ? 425 PHE B CZ  1 
ATOM   6575 N  N   . LYS B 1 426 ? 37.257 136.763 26.328  1.00 21.14 ? 426 LYS B N   1 
ATOM   6576 C  CA  . LYS B 1 426 ? 35.868 137.192 26.396  1.00 20.05 ? 426 LYS B CA  1 
ATOM   6577 C  C   . LYS B 1 426 ? 35.255 136.916 27.758  1.00 21.10 ? 426 LYS B C   1 
ATOM   6578 O  O   . LYS B 1 426 ? 35.698 136.022 28.479  1.00 20.83 ? 426 LYS B O   1 
ATOM   6579 C  CB  . LYS B 1 426 ? 35.049 136.438 25.344  1.00 18.69 ? 426 LYS B CB  1 
ATOM   6580 C  CG  . LYS B 1 426 ? 35.509 136.613 23.913  1.00 16.52 ? 426 LYS B CG  1 
ATOM   6581 C  CD  . LYS B 1 426 ? 35.130 137.978 23.366  1.00 13.05 ? 426 LYS B CD  1 
ATOM   6582 C  CE  . LYS B 1 426 ? 35.494 138.079 21.903  1.00 12.84 ? 426 LYS B CE  1 
ATOM   6583 N  NZ  . LYS B 1 426 ? 36.923 137.716 21.667  1.00 10.34 ? 426 LYS B NZ  1 
ATOM   6584 N  N   . PRO B 1 427 ? 34.226 137.692 28.133  1.00 22.43 ? 427 PRO B N   1 
ATOM   6585 C  CA  . PRO B 1 427 ? 33.537 137.513 29.417  1.00 23.17 ? 427 PRO B CA  1 
ATOM   6586 C  C   . PRO B 1 427 ? 32.623 136.278 29.307  1.00 25.04 ? 427 PRO B C   1 
ATOM   6587 O  O   . PRO B 1 427 ? 32.315 135.812 28.201  1.00 23.88 ? 427 PRO B O   1 
ATOM   6588 C  CB  . PRO B 1 427 ? 32.745 138.808 29.566  1.00 22.10 ? 427 PRO B CB  1 
ATOM   6589 C  CG  . PRO B 1 427 ? 32.413 139.150 28.148  1.00 21.56 ? 427 PRO B CG  1 
ATOM   6590 C  CD  . PRO B 1 427 ? 33.734 138.895 27.440  1.00 21.00 ? 427 PRO B CD  1 
ATOM   6591 N  N   . ASP B 1 428 ? 32.183 135.759 30.445  1.00 25.52 ? 428 ASP B N   1 
ATOM   6592 C  CA  . ASP B 1 428 ? 31.338 134.572 30.453  1.00 27.20 ? 428 ASP B CA  1 
ATOM   6593 C  C   . ASP B 1 428 ? 30.028 134.701 29.681  1.00 26.46 ? 428 ASP B C   1 
ATOM   6594 O  O   . ASP B 1 428 ? 29.513 133.708 29.167  1.00 26.91 ? 428 ASP B O   1 
ATOM   6595 C  CB  . ASP B 1 428 ? 31.029 134.160 31.897  1.00 30.70 ? 428 ASP B CB  1 
ATOM   6596 C  CG  . ASP B 1 428 ? 32.283 133.869 32.701  1.00 35.25 ? 428 ASP B CG  1 
ATOM   6597 O  OD1 . ASP B 1 428 ? 33.108 133.050 32.235  1.00 35.74 ? 428 ASP B OD1 1 
ATOM   6598 O  OD2 . ASP B 1 428 ? 32.442 134.457 33.796  1.00 35.71 ? 428 ASP B OD2 1 
ATOM   6599 N  N   . HIS B 1 429 ? 29.493 135.915 29.591  1.00 24.78 ? 429 HIS B N   1 
ATOM   6600 C  CA  . HIS B 1 429 ? 28.220 136.131 28.912  1.00 23.65 ? 429 HIS B CA  1 
ATOM   6601 C  C   . HIS B 1 429 ? 28.310 136.409 27.414  1.00 22.96 ? 429 HIS B C   1 
ATOM   6602 O  O   . HIS B 1 429 ? 27.286 136.542 26.745  1.00 22.40 ? 429 HIS B O   1 
ATOM   6603 C  CB  . HIS B 1 429 ? 27.460 137.269 29.590  1.00 23.86 ? 429 HIS B CB  1 
ATOM   6604 C  CG  . HIS B 1 429 ? 28.161 138.589 29.517  1.00 26.03 ? 429 HIS B CG  1 
ATOM   6605 N  ND1 . HIS B 1 429 ? 29.274 138.887 30.274  1.00 27.96 ? 429 HIS B ND1 1 
ATOM   6606 C  CD2 . HIS B 1 429 ? 27.918 139.685 28.760  1.00 26.05 ? 429 HIS B CD2 1 
ATOM   6607 C  CE1 . HIS B 1 429 ? 29.685 140.109 29.989  1.00 27.90 ? 429 HIS B CE1 1 
ATOM   6608 N  NE2 . HIS B 1 429 ? 28.880 140.616 29.073  1.00 27.92 ? 429 HIS B NE2 1 
ATOM   6609 N  N   . TYR B 1 430 ? 29.526 136.507 26.890  1.00 22.81 ? 430 TYR B N   1 
ATOM   6610 C  CA  . TYR B 1 430 ? 29.729 136.767 25.468  1.00 22.40 ? 430 TYR B CA  1 
ATOM   6611 C  C   . TYR B 1 430 ? 29.016 135.671 24.677  1.00 22.23 ? 430 TYR B C   1 
ATOM   6612 O  O   . TYR B 1 430 ? 29.170 134.494 24.981  1.00 23.59 ? 430 TYR B O   1 
ATOM   6613 C  CB  . TYR B 1 430 ? 31.227 136.759 25.148  1.00 22.75 ? 430 TYR B CB  1 
ATOM   6614 C  CG  . TYR B 1 430 ? 31.557 137.256 23.762  1.00 22.70 ? 430 TYR B CG  1 
ATOM   6615 C  CD1 . TYR B 1 430 ? 31.499 138.611 23.458  1.00 20.11 ? 430 TYR B CD1 1 
ATOM   6616 C  CD2 . TYR B 1 430 ? 31.901 136.368 22.751  1.00 22.99 ? 430 TYR B CD2 1 
ATOM   6617 C  CE1 . TYR B 1 430 ? 31.775 139.070 22.185  1.00 19.68 ? 430 TYR B CE1 1 
ATOM   6618 C  CE2 . TYR B 1 430 ? 32.178 136.816 21.475  1.00 23.83 ? 430 TYR B CE2 1 
ATOM   6619 C  CZ  . TYR B 1 430 ? 32.116 138.170 21.198  1.00 22.33 ? 430 TYR B CZ  1 
ATOM   6620 O  OH  . TYR B 1 430 ? 32.424 138.618 19.935  1.00 20.79 ? 430 TYR B OH  1 
ATOM   6621 N  N   . ARG B 1 431 ? 28.250 136.051 23.658  1.00 21.64 ? 431 ARG B N   1 
ATOM   6622 C  CA  . ARG B 1 431 ? 27.500 135.072 22.872  1.00 20.77 ? 431 ARG B CA  1 
ATOM   6623 C  C   . ARG B 1 431 ? 28.130 134.598 21.565  1.00 20.78 ? 431 ARG B C   1 
ATOM   6624 O  O   . ARG B 1 431 ? 27.663 133.624 20.973  1.00 20.66 ? 431 ARG B O   1 
ATOM   6625 C  CB  . ARG B 1 431 ? 26.105 135.616 22.561  1.00 21.05 ? 431 ARG B CB  1 
ATOM   6626 C  CG  . ARG B 1 431 ? 25.319 136.037 23.779  1.00 22.17 ? 431 ARG B CG  1 
ATOM   6627 C  CD  . ARG B 1 431 ? 23.871 136.307 23.428  1.00 23.46 ? 431 ARG B CD  1 
ATOM   6628 N  NE  . ARG B 1 431 ? 23.089 136.581 24.628  1.00 26.12 ? 431 ARG B NE  1 
ATOM   6629 C  CZ  . ARG B 1 431 ? 22.983 137.777 25.196  1.00 26.03 ? 431 ARG B CZ  1 
ATOM   6630 N  NH1 . ARG B 1 431 ? 23.605 138.822 24.664  1.00 25.88 ? 431 ARG B NH1 1 
ATOM   6631 N  NH2 . ARG B 1 431 ? 22.272 137.917 26.308  1.00 25.63 ? 431 ARG B NH2 1 
ATOM   6632 N  N   . TYR B 1 432 ? 29.170 135.285 21.105  1.00 19.85 ? 432 TYR B N   1 
ATOM   6633 C  CA  . TYR B 1 432 ? 29.829 134.913 19.854  1.00 19.37 ? 432 TYR B CA  1 
ATOM   6634 C  C   . TYR B 1 432 ? 28.866 134.983 18.676  1.00 18.01 ? 432 TYR B C   1 
ATOM   6635 O  O   . TYR B 1 432 ? 27.838 135.674 18.798  1.00 17.35 ? 432 TYR B O   1 
ATOM   6636 C  CB  . TYR B 1 432 ? 30.426 133.498 19.942  1.00 19.02 ? 432 TYR B CB  1 
ATOM   6637 C  CG  . TYR B 1 432 ? 31.452 133.333 21.040  1.00 17.80 ? 432 TYR B CG  1 
ATOM   6638 C  CD1 . TYR B 1 432 ? 31.074 132.968 22.324  1.00 17.08 ? 432 TYR B CD1 1 
ATOM   6639 C  CD2 . TYR B 1 432 ? 32.796 133.580 20.798  1.00 17.67 ? 432 TYR B CD2 1 
ATOM   6640 C  CE1 . TYR B 1 432 ? 32.010 132.855 23.337  1.00 17.17 ? 432 TYR B CE1 1 
ATOM   6641 C  CE2 . TYR B 1 432 ? 33.738 133.471 21.803  1.00 15.79 ? 432 TYR B CE2 1 
ATOM   6642 C  CZ  . TYR B 1 432 ? 33.340 133.106 23.067  1.00 15.36 ? 432 TYR B CZ  1 
ATOM   6643 O  OH  . TYR B 1 432 ? 34.275 132.974 24.063  1.00 15.53 ? 432 TYR B OH  1 
ATOM   6644 O  OXT . TYR B 1 432 ? 29.161 134.357 17.636  1.00 19.65 ? 432 TYR B OXT 1 
HETATM 6645 P  PA  . NAI C 2 .   ? 33.566 142.168 20.316  1.00 18.73 ? 501 NAI A PA  1 
HETATM 6646 O  O1A . NAI C 2 .   ? 34.264 141.938 21.617  1.00 15.70 ? 501 NAI A O1A 1 
HETATM 6647 O  O2A . NAI C 2 .   ? 32.433 141.289 19.923  1.00 19.08 ? 501 NAI A O2A 1 
HETATM 6648 O  O5B . NAI C 2 .   ? 34.585 142.167 19.101  1.00 15.76 ? 501 NAI A O5B 1 
HETATM 6649 C  C5B . NAI C 2 .   ? 35.928 142.576 19.296  1.00 14.37 ? 501 NAI A C5B 1 
HETATM 6650 C  C4B . NAI C 2 .   ? 36.741 141.509 18.646  1.00 13.14 ? 501 NAI A C4B 1 
HETATM 6651 O  O4B . NAI C 2 .   ? 38.017 142.047 18.256  1.00 13.21 ? 501 NAI A O4B 1 
HETATM 6652 C  C3B . NAI C 2 .   ? 36.964 140.364 19.624  1.00 13.83 ? 501 NAI A C3B 1 
HETATM 6653 O  O3B . NAI C 2 .   ? 36.436 139.141 19.120  1.00 12.23 ? 501 NAI A O3B 1 
HETATM 6654 C  C2B . NAI C 2 .   ? 38.482 140.285 19.773  1.00 14.90 ? 501 NAI A C2B 1 
HETATM 6655 O  O2B . NAI C 2 .   ? 38.935 138.928 19.918  1.00 18.05 ? 501 NAI A O2B 1 
HETATM 6656 C  C1B . NAI C 2 .   ? 39.017 141.030 18.531  1.00 14.88 ? 501 NAI A C1B 1 
HETATM 6657 N  N9A . NAI C 2 .   ? 40.351 141.672 18.734  1.00 15.09 ? 501 NAI A N9A 1 
HETATM 6658 C  C8A . NAI C 2 .   ? 40.781 142.374 19.816  1.00 13.32 ? 501 NAI A C8A 1 
HETATM 6659 N  N7A . NAI C 2 .   ? 42.050 142.816 19.657  1.00 11.80 ? 501 NAI A N7A 1 
HETATM 6660 C  C5A . NAI C 2 .   ? 42.355 142.359 18.458  1.00 14.58 ? 501 NAI A C5A 1 
HETATM 6661 C  C6A . NAI C 2 .   ? 43.577 142.550 17.822  1.00 15.88 ? 501 NAI A C6A 1 
HETATM 6662 N  N6A . NAI C 2 .   ? 44.513 143.237 18.443  1.00 15.68 ? 501 NAI A N6A 1 
HETATM 6663 N  N1A . NAI C 2 .   ? 43.775 142.030 16.581  1.00 15.94 ? 501 NAI A N1A 1 
HETATM 6664 C  C2A . NAI C 2 .   ? 42.779 141.334 15.992  1.00 17.02 ? 501 NAI A C2A 1 
HETATM 6665 N  N3A . NAI C 2 .   ? 41.589 141.151 16.620  1.00 16.22 ? 501 NAI A N3A 1 
HETATM 6666 C  C4A . NAI C 2 .   ? 41.338 141.650 17.863  1.00 14.72 ? 501 NAI A C4A 1 
HETATM 6667 O  O3  . NAI C 2 .   ? 33.054 143.648 20.121  1.00 18.22 ? 501 NAI A O3  1 
HETATM 6668 P  PN  . NAI C 2 .   ? 32.106 144.352 19.064  1.00 17.44 ? 501 NAI A PN  1 
HETATM 6669 O  O1N . NAI C 2 .   ? 32.300 143.748 17.738  1.00 18.33 ? 501 NAI A O1N 1 
HETATM 6670 O  O2N . NAI C 2 .   ? 30.713 144.365 19.645  1.00 20.81 ? 501 NAI A O2N 1 
HETATM 6671 O  O5D . NAI C 2 .   ? 32.696 145.824 19.097  1.00 20.25 ? 501 NAI A O5D 1 
HETATM 6672 C  C5D . NAI C 2 .   ? 34.054 146.155 18.986  1.00 19.73 ? 501 NAI A C5D 1 
HETATM 6673 C  C4D . NAI C 2 .   ? 34.192 147.682 18.993  1.00 22.29 ? 501 NAI A C4D 1 
HETATM 6674 O  O4D . NAI C 2 .   ? 33.303 148.404 18.094  1.00 24.20 ? 501 NAI A O4D 1 
HETATM 6675 C  C3D . NAI C 2 .   ? 33.943 148.220 20.358  1.00 22.11 ? 501 NAI A C3D 1 
HETATM 6676 O  O3D . NAI C 2 .   ? 34.886 149.208 20.729  1.00 21.86 ? 501 NAI A O3D 1 
HETATM 6677 C  C2D . NAI C 2 .   ? 32.536 148.724 20.220  1.00 22.06 ? 501 NAI A C2D 1 
HETATM 6678 O  O2D . NAI C 2 .   ? 32.189 149.604 21.268  1.00 23.79 ? 501 NAI A O2D 1 
HETATM 6679 C  C1D . NAI C 2 .   ? 32.540 149.339 18.858  1.00 23.04 ? 501 NAI A C1D 1 
HETATM 6680 N  N1N . NAI C 2 .   ? 31.219 149.461 18.213  1.00 22.84 ? 501 NAI A N1N 1 
HETATM 6681 C  C2N . NAI C 2 .   ? 31.125 150.463 17.198  1.00 21.07 ? 501 NAI A C2N 1 
HETATM 6682 C  C3N . NAI C 2 .   ? 29.893 150.644 16.528  1.00 21.80 ? 501 NAI A C3N 1 
HETATM 6683 C  C7N . NAI C 2 .   ? 29.730 151.712 15.436  1.00 22.61 ? 501 NAI A C7N 1 
HETATM 6684 O  O7N . NAI C 2 .   ? 28.642 152.171 15.120  1.00 21.89 ? 501 NAI A O7N 1 
HETATM 6685 N  N7N . NAI C 2 .   ? 30.832 152.126 14.842  1.00 24.21 ? 501 NAI A N7N 1 
HETATM 6686 C  C4N . NAI C 2 .   ? 28.785 149.804 16.899  1.00 22.94 ? 501 NAI A C4N 1 
HETATM 6687 C  C5N . NAI C 2 .   ? 28.857 148.801 17.906  1.00 22.01 ? 501 NAI A C5N 1 
HETATM 6688 C  C6N . NAI C 2 .   ? 30.088 148.629 18.571  1.00 21.83 ? 501 NAI A C6N 1 
HETATM 6689 C  C2  . XFA D 3 .   ? 26.434 160.254 17.172  1.00 17.94 ? 502 XFA A C2  1 
HETATM 6690 C  C4  . XFA D 3 .   ? 25.209 158.183 17.764  1.00 19.62 ? 502 XFA A C4  1 
HETATM 6691 C  C6  . XFA D 3 .   ? 27.549 158.544 18.536  1.00 13.38 ? 502 XFA A C6  1 
HETATM 6692 C  C9  . XFA D 3 .   ? 24.185 160.480 15.141  1.00 19.79 ? 502 XFA A C9  1 
HETATM 6693 C  C14 . XFA D 3 .   ? 23.727 161.808 14.916  1.00 18.46 ? 502 XFA A C14 1 
HETATM 6694 C  C13 . XFA D 3 .   ? 23.712 162.348 13.606  1.00 20.11 ? 502 XFA A C13 1 
HETATM 6695 C  C12 . XFA D 3 .   ? 24.153 161.567 12.516  1.00 19.49 ? 502 XFA A C12 1 
HETATM 6696 C  C11 . XFA D 3 .   ? 24.611 160.251 12.728  1.00 21.52 ? 502 XFA A C11 1 
HETATM 6697 C  C1  . XFA D 3 .   ? 27.582 159.797 17.887  1.00 14.55 ? 502 XFA A C1  1 
HETATM 6698 C  C3  . XFA D 3 .   ? 25.234 159.445 17.102  1.00 19.91 ? 502 XFA A C3  1 
HETATM 6699 C  C5  . XFA D 3 .   ? 26.365 157.741 18.476  1.00 15.96 ? 502 XFA A C5  1 
HETATM 6700 CL CL1 . XFA D 3 .   ? 28.939 157.998 19.390  1.00 2.81  ? 502 XFA A CL1 1 
HETATM 6701 O  O8  . XFA D 3 .   ? 24.201 159.964 16.393  1.00 19.87 ? 502 XFA A O8  1 
HETATM 6702 C  C10 . XFA D 3 .   ? 24.628 159.701 14.046  1.00 20.50 ? 502 XFA A C10 1 
HETATM 6703 CL CL2 . XFA D 3 .   ? 24.133 162.215 10.938  1.00 20.16 ? 502 XFA A CL2 1 
HETATM 6704 N  N16 . XFA D 3 .   ? 24.058 157.307 17.752  1.00 22.47 ? 502 XFA A N16 1 
HETATM 6705 C  C17 . XFA D 3 .   ? 24.210 155.887 17.346  1.00 20.71 ? 502 XFA A C17 1 
HETATM 6706 C  C18 . XFA D 3 .   ? 24.832 155.458 16.061  1.00 20.30 ? 502 XFA A C18 1 
HETATM 6707 N  N19 . XFA D 3 .   ? 25.998 154.725 16.001  1.00 18.96 ? 502 XFA A N19 1 
HETATM 6708 N  N20 . XFA D 3 .   ? 26.630 154.372 17.242  1.00 20.25 ? 502 XFA A N20 1 
HETATM 6709 C  C21 . XFA D 3 .   ? 26.546 154.333 14.678  1.00 14.89 ? 502 XFA A C21 1 
HETATM 6710 O  O22 . XFA D 3 .   ? 24.272 155.775 14.993  1.00 20.45 ? 502 XFA A O22 1 
HETATM 6711 C  C23 . XFA D 3 .   ? 26.515 153.040 17.817  1.00 20.66 ? 502 XFA A C23 1 
HETATM 6712 C  C24 . XFA D 3 .   ? 27.730 152.846 18.709  1.00 19.39 ? 502 XFA A C24 1 
HETATM 6713 C  C25 . XFA D 3 .   ? 28.669 153.850 18.385  1.00 20.15 ? 502 XFA A C25 1 
HETATM 6714 C  C26 . XFA D 3 .   ? 28.077 154.704 17.288  1.00 20.31 ? 502 XFA A C26 1 
HETATM 6715 C  C27 . XFA D 3 .   ? 28.019 151.895 19.709  1.00 18.84 ? 502 XFA A C27 1 
HETATM 6716 C  C28 . XFA D 3 .   ? 29.260 151.945 20.392  1.00 17.97 ? 502 XFA A C28 1 
HETATM 6717 C  C29 . XFA D 3 .   ? 30.205 152.950 20.069  1.00 19.07 ? 502 XFA A C29 1 
HETATM 6718 C  C30 . XFA D 3 .   ? 29.908 153.905 19.064  1.00 19.66 ? 502 XFA A C30 1 
HETATM 6719 C  C31 . XFA D 3 .   ? 22.719 157.767 18.182  1.00 23.34 ? 502 XFA A C31 1 
HETATM 6720 C  C32 . XFA D 3 .   ? 21.658 157.768 17.077  1.00 24.53 ? 502 XFA A C32 1 
HETATM 6721 N  N33 . XFA D 3 .   ? 21.964 157.374 15.806  1.00 25.73 ? 502 XFA A N33 1 
HETATM 6722 C  C34 . XFA D 3 .   ? 20.983 157.370 14.710  1.00 25.22 ? 502 XFA A C34 1 
HETATM 6723 C  C35 . XFA D 3 .   ? 21.073 158.729 13.984  1.00 27.58 ? 502 XFA A C35 1 
HETATM 6724 N  N36 . XFA D 3 .   ? 20.216 158.742 12.797  1.00 31.04 ? 502 XFA A N36 1 
HETATM 6725 C  C37 . XFA D 3 .   ? 20.329 160.048 12.133  1.00 29.98 ? 502 XFA A C37 1 
HETATM 6726 O  O38 . XFA D 3 .   ? 20.528 158.131 17.342  1.00 26.77 ? 502 XFA A O38 1 
HETATM 6727 P  PA  . NAI E 2 .   ? 17.943 125.458 19.888  1.00 17.25 ? 501 NAI B PA  1 
HETATM 6728 O  O1A . NAI E 2 .   ? 17.267 125.726 21.179  1.00 14.72 ? 501 NAI B O1A 1 
HETATM 6729 O  O2A . NAI E 2 .   ? 19.085 126.304 19.472  1.00 19.04 ? 501 NAI B O2A 1 
HETATM 6730 O  O5B . NAI E 2 .   ? 16.910 125.447 18.695  1.00 17.41 ? 501 NAI B O5B 1 
HETATM 6731 C  C5B . NAI E 2 .   ? 15.588 124.982 18.897  1.00 18.43 ? 501 NAI B C5B 1 
HETATM 6732 C  C4B . NAI E 2 .   ? 14.746 126.048 18.289  1.00 18.99 ? 501 NAI B C4B 1 
HETATM 6733 O  O4B . NAI E 2 .   ? 13.475 125.511 17.869  1.00 19.90 ? 501 NAI B O4B 1 
HETATM 6734 C  C3B . NAI E 2 .   ? 14.510 127.156 19.308  1.00 20.48 ? 501 NAI B C3B 1 
HETATM 6735 O  O3B . NAI E 2 .   ? 15.061 128.397 18.885  1.00 18.84 ? 501 NAI B O3B 1 
HETATM 6736 C  C2B . NAI E 2 .   ? 12.987 127.236 19.436  1.00 20.78 ? 501 NAI B C2B 1 
HETATM 6737 O  O2B . NAI E 2 .   ? 12.538 128.595 19.612  1.00 20.84 ? 501 NAI B O2B 1 
HETATM 6738 C  C1B . NAI E 2 .   ? 12.469 126.519 18.163  1.00 20.13 ? 501 NAI B C1B 1 
HETATM 6739 N  N9A . NAI E 2 .   ? 11.131 125.873 18.339  1.00 18.25 ? 501 NAI B N9A 1 
HETATM 6740 C  C8A . NAI E 2 .   ? 10.705 125.130 19.388  1.00 16.43 ? 501 NAI B C8A 1 
HETATM 6741 N  N7A . NAI E 2 .   ? 9.433  124.704 19.217  1.00 15.56 ? 501 NAI B N7A 1 
HETATM 6742 C  C5A . NAI E 2 .   ? 9.119  125.215 18.040  1.00 15.13 ? 501 NAI B C5A 1 
HETATM 6743 C  C6A . NAI E 2 .   ? 7.885  125.062 17.403  1.00 16.60 ? 501 NAI B C6A 1 
HETATM 6744 N  N6A . NAI E 2 .   ? 6.942  124.358 17.999  1.00 13.37 ? 501 NAI B N6A 1 
HETATM 6745 N  N1A . NAI E 2 .   ? 7.684  125.641 16.185  1.00 16.41 ? 501 NAI B N1A 1 
HETATM 6746 C  C2A . NAI E 2 .   ? 8.686  126.351 15.625  1.00 17.11 ? 501 NAI B C2A 1 
HETATM 6747 N  N3A . NAI E 2 .   ? 9.880  126.494 16.257  1.00 16.31 ? 501 NAI B N3A 1 
HETATM 6748 C  C4A . NAI E 2 .   ? 10.136 125.938 17.473  1.00 15.88 ? 501 NAI B C4A 1 
HETATM 6749 O  O3  . NAI E 2 .   ? 18.425 123.963 19.705  1.00 18.98 ? 501 NAI B O3  1 
HETATM 6750 P  PN  . NAI E 2 .   ? 19.380 123.213 18.672  1.00 18.35 ? 501 NAI B PN  1 
HETATM 6751 O  O1N . NAI E 2 .   ? 19.157 123.741 17.313  1.00 16.99 ? 501 NAI B O1N 1 
HETATM 6752 O  O2N . NAI E 2 .   ? 20.779 123.248 19.240  1.00 19.30 ? 501 NAI B O2N 1 
HETATM 6753 O  O5D . NAI E 2 .   ? 18.806 121.743 18.812  1.00 20.02 ? 501 NAI B O5D 1 
HETATM 6754 C  C5D . NAI E 2 .   ? 17.476 121.388 18.560  1.00 18.29 ? 501 NAI B C5D 1 
HETATM 6755 C  C4D . NAI E 2 .   ? 17.360 119.867 18.480  1.00 18.65 ? 501 NAI B C4D 1 
HETATM 6756 O  O4D . NAI E 2 .   ? 18.260 119.208 17.560  1.00 19.96 ? 501 NAI B O4D 1 
HETATM 6757 C  C3D . NAI E 2 .   ? 17.583 119.254 19.815  1.00 19.96 ? 501 NAI B C3D 1 
HETATM 6758 O  O3D . NAI E 2 .   ? 16.630 118.245 20.124  1.00 18.26 ? 501 NAI B O3D 1 
HETATM 6759 C  C2D . NAI E 2 .   ? 18.987 118.753 19.673  1.00 20.96 ? 501 NAI B C2D 1 
HETATM 6760 O  O2D . NAI E 2 .   ? 19.295 117.802 20.672  1.00 25.76 ? 501 NAI B O2D 1 
HETATM 6761 C  C1D . NAI E 2 .   ? 19.009 118.227 18.273  1.00 21.09 ? 501 NAI B C1D 1 
HETATM 6762 N  N1N . NAI E 2 .   ? 20.337 118.152 17.630  1.00 21.41 ? 501 NAI B N1N 1 
HETATM 6763 C  C2N . NAI E 2 .   ? 20.431 117.250 16.531  1.00 21.51 ? 501 NAI B C2N 1 
HETATM 6764 C  C3N . NAI E 2 .   ? 21.661 117.119 15.852  1.00 20.96 ? 501 NAI B C3N 1 
HETATM 6765 C  C7N . NAI E 2 .   ? 21.816 116.158 14.659  1.00 21.15 ? 501 NAI B C7N 1 
HETATM 6766 O  O7N . NAI E 2 .   ? 22.901 115.705 14.304  1.00 19.07 ? 501 NAI B O7N 1 
HETATM 6767 N  N7N . NAI E 2 .   ? 20.707 115.836 14.018  1.00 19.51 ? 501 NAI B N7N 1 
HETATM 6768 C  C4N . NAI E 2 .   ? 22.763 117.904 16.304  1.00 21.26 ? 501 NAI B C4N 1 
HETATM 6769 C  C5N . NAI E 2 .   ? 22.693 118.805 17.395  1.00 21.56 ? 501 NAI B C5N 1 
HETATM 6770 C  C6N . NAI E 2 .   ? 21.466 118.932 18.067  1.00 20.14 ? 501 NAI B C6N 1 
HETATM 6771 C  C2  . XFA F 3 .   ? 25.235 107.539 15.896  1.00 19.24 ? 502 XFA B C2  1 
HETATM 6772 C  C4  . XFA F 3 .   ? 26.481 109.564 16.587  1.00 20.04 ? 502 XFA B C4  1 
HETATM 6773 C  C6  . XFA F 3 .   ? 24.144 109.168 17.369  1.00 15.53 ? 502 XFA B C6  1 
HETATM 6774 C  C9  . XFA F 3 .   ? 27.437 107.338 13.848  1.00 22.09 ? 502 XFA B C9  1 
HETATM 6775 C  C14 . XFA F 3 .   ? 27.841 105.992 13.616  1.00 21.86 ? 502 XFA B C14 1 
HETATM 6776 C  C13 . XFA F 3 .   ? 27.829 105.457 12.295  1.00 23.41 ? 502 XFA B C13 1 
HETATM 6777 C  C12 . XFA F 3 .   ? 27.415 106.265 11.212  1.00 21.68 ? 502 XFA B C12 1 
HETATM 6778 C  C11 . XFA F 3 .   ? 27.011 107.599 11.436  1.00 23.85 ? 502 XFA B C11 1 
HETATM 6779 C  C1  . XFA F 3 .   ? 24.102 107.957 16.650  1.00 16.65 ? 502 XFA B C1  1 
HETATM 6780 C  C3  . XFA F 3 .   ? 26.438 108.341 15.854  1.00 21.39 ? 502 XFA B C3  1 
HETATM 6781 C  C5  . XFA F 3 .   ? 25.330 109.971 17.341  1.00 18.40 ? 502 XFA B C5  1 
HETATM 6782 CL CL1 . XFA F 3 .   ? 22.764 109.661 18.267  1.00 5.01  ? 502 XFA B CL1 1 
HETATM 6783 O  O8  . XFA F 3 .   ? 27.451 107.850 15.103  1.00 24.09 ? 502 XFA B O8  1 
HETATM 6784 C  C10 . XFA F 3 .   ? 27.021 108.142 12.758  1.00 22.16 ? 502 XFA B C10 1 
HETATM 6785 CL CL2 . XFA F 3 .   ? 27.401 105.634 9.631   1.00 23.42 ? 502 XFA B CL2 1 
HETATM 6786 N  N16 . XFA F 3 .   ? 27.630 110.441 16.618  1.00 21.88 ? 502 XFA B N16 1 
HETATM 6787 C  C17 . XFA F 3 .   ? 27.459 111.886 16.295  1.00 22.20 ? 502 XFA B C17 1 
HETATM 6788 C  C18 . XFA F 3 .   ? 26.807 112.373 15.053  1.00 22.17 ? 502 XFA B C18 1 
HETATM 6789 N  N19 . XFA F 3 .   ? 25.631 113.095 15.046  1.00 21.34 ? 502 XFA B N19 1 
HETATM 6790 N  N20 . XFA F 3 .   ? 25.006 113.389 16.304  1.00 22.27 ? 502 XFA B N20 1 
HETATM 6791 C  C21 . XFA F 3 .   ? 25.060 113.542 13.743  1.00 18.66 ? 502 XFA B C21 1 
HETATM 6792 O  O22 . XFA F 3 .   ? 27.352 112.111 13.965  1.00 21.42 ? 502 XFA B O22 1 
HETATM 6793 C  C23 . XFA F 3 .   ? 25.139 114.689 16.946  1.00 23.30 ? 502 XFA B C23 1 
HETATM 6794 C  C24 . XFA F 3 .   ? 23.951 114.831 17.892  1.00 22.65 ? 502 XFA B C24 1 
HETATM 6795 C  C25 . XFA F 3 .   ? 22.990 113.867 17.520  1.00 23.15 ? 502 XFA B C25 1 
HETATM 6796 C  C26 . XFA F 3 .   ? 23.547 113.092 16.337  1.00 23.04 ? 502 XFA B C26 1 
HETATM 6797 C  C27 . XFA F 3 .   ? 23.704 115.706 18.973  1.00 22.53 ? 502 XFA B C27 1 
HETATM 6798 C  C28 . XFA F 3 .   ? 22.480 115.616 19.688  1.00 23.33 ? 502 XFA B C28 1 
HETATM 6799 C  C29 . XFA F 3 .   ? 21.511 114.649 19.316  1.00 22.08 ? 502 XFA B C29 1 
HETATM 6800 C  C30 . XFA F 3 .   ? 21.768 113.773 18.232  1.00 22.76 ? 502 XFA B C30 1 
HETATM 6801 C  C31 . XFA F 3 .   ? 28.975 109.991 17.025  1.00 19.80 ? 502 XFA B C31 1 
HETATM 6802 C  C32 . XFA F 3 .   ? 30.013 110.042 15.903  1.00 18.86 ? 502 XFA B C32 1 
HETATM 6803 N  N33 . XFA F 3 .   ? 29.662 110.460 14.655  1.00 17.67 ? 502 XFA B N33 1 
HETATM 6804 C  C34 . XFA F 3 .   ? 30.606 110.516 13.527  1.00 17.42 ? 502 XFA B C34 1 
HETATM 6805 C  C35 . XFA F 3 .   ? 30.507 109.177 12.756  1.00 17.87 ? 502 XFA B C35 1 
HETATM 6806 N  N36 . XFA F 3 .   ? 31.152 109.274 11.445  1.00 19.22 ? 502 XFA B N36 1 
HETATM 6807 C  C37 . XFA F 3 .   ? 31.036 107.984 10.759  1.00 16.73 ? 502 XFA B C37 1 
HETATM 6808 O  O38 . XFA F 3 .   ? 31.164 109.701 16.132  1.00 19.41 ? 502 XFA B O38 1 
HETATM 6809 O  O   . HOH G 4 .   ? 30.928 130.845 11.382  1.00 2.19  ? 601 HOH A O   1 
HETATM 6810 O  O   . HOH G 4 .   ? 14.622 133.774 23.876  1.00 17.28 ? 602 HOH A O   1 
HETATM 6811 O  O   . HOH G 4 .   ? 27.648 175.989 22.048  1.00 16.00 ? 603 HOH A O   1 
HETATM 6812 O  O   . HOH G 4 .   ? 26.978 137.020 16.454  1.00 22.86 ? 604 HOH A O   1 
HETATM 6813 O  O   . HOH G 4 .   ? 5.638  131.925 20.355  1.00 21.34 ? 605 HOH A O   1 
HETATM 6814 O  O   . HOH G 4 .   ? 37.412 155.644 9.989   1.00 19.39 ? 606 HOH A O   1 
HETATM 6815 O  O   . HOH G 4 .   ? 22.914 168.327 25.483  1.00 26.26 ? 607 HOH A O   1 
HETATM 6816 O  O   . HOH G 4 .   ? 6.582  130.722 12.867  1.00 18.51 ? 608 HOH A O   1 
HETATM 6817 O  O   . HOH G 4 .   ? 17.575 176.984 32.766  1.00 37.49 ? 609 HOH A O   1 
HETATM 6818 O  O   . HOH G 4 .   ? 41.751 135.084 1.156   1.00 13.68 ? 610 HOH A O   1 
HETATM 6819 O  O   . HOH G 4 .   ? 24.700 130.646 16.708  1.00 19.71 ? 611 HOH A O   1 
HETATM 6820 O  O   . HOH G 4 .   ? 29.445 144.117 -6.270  1.00 14.08 ? 612 HOH A O   1 
HETATM 6821 O  O   . HOH G 4 .   ? 6.152  145.372 14.907  1.00 14.89 ? 613 HOH A O   1 
HETATM 6822 O  O   . HOH G 4 .   ? 49.066 153.087 -7.825  1.00 24.50 ? 614 HOH A O   1 
HETATM 6823 O  O   . HOH G 4 .   ? 9.484  155.336 7.087   1.00 11.38 ? 615 HOH A O   1 
HETATM 6824 O  O   . HOH G 4 .   ? 13.203 127.782 22.794  1.00 19.07 ? 616 HOH A O   1 
HETATM 6825 O  O   . HOH G 4 .   ? 21.389 142.727 29.527  1.00 32.59 ? 617 HOH A O   1 
HETATM 6826 O  O   . HOH G 4 .   ? 19.286 171.813 19.059  1.00 15.99 ? 618 HOH A O   1 
HETATM 6827 O  O   . HOH G 4 .   ? 24.892 135.137 19.054  1.00 25.24 ? 619 HOH A O   1 
HETATM 6828 O  O   . HOH G 4 .   ? 20.632 157.068 10.899  1.00 12.90 ? 620 HOH A O   1 
HETATM 6829 O  O   . HOH G 4 .   ? 47.880 146.577 0.958   1.00 24.24 ? 621 HOH A O   1 
HETATM 6830 O  O   . HOH G 4 .   ? 1.456  161.039 9.666   1.00 27.65 ? 622 HOH A O   1 
HETATM 6831 O  O   . HOH G 4 .   ? 39.978 161.382 7.498   1.00 15.43 ? 623 HOH A O   1 
HETATM 6832 O  O   . HOH G 4 .   ? 24.716 167.638 20.828  1.00 23.43 ? 624 HOH A O   1 
HETATM 6833 O  O   . HOH G 4 .   ? 2.642  125.177 17.782  1.00 13.56 ? 625 HOH A O   1 
HETATM 6834 O  O   . HOH G 4 .   ? 22.287 144.148 6.831   1.00 16.83 ? 626 HOH A O   1 
HETATM 6835 O  O   . HOH G 4 .   ? 5.801  162.434 14.326  1.00 26.32 ? 627 HOH A O   1 
HETATM 6836 O  O   . HOH G 4 .   ? 33.978 159.933 -4.329  1.00 14.97 ? 628 HOH A O   1 
HETATM 6837 O  O   . HOH G 4 .   ? 20.670 129.756 17.777  1.00 32.02 ? 629 HOH A O   1 
HETATM 6838 O  O   . HOH G 4 .   ? 26.623 139.093 2.763   1.00 29.64 ? 630 HOH A O   1 
HETATM 6839 O  O   . HOH G 4 .   ? 7.902  160.107 17.916  1.00 10.85 ? 631 HOH A O   1 
HETATM 6840 O  O   . HOH G 4 .   ? 8.565  136.198 25.351  1.00 21.78 ? 632 HOH A O   1 
HETATM 6841 O  O   . HOH G 4 .   ? 30.772 137.628 18.033  1.00 21.96 ? 633 HOH A O   1 
HETATM 6842 O  O   . HOH G 4 .   ? 52.615 151.958 1.530   1.00 30.46 ? 634 HOH A O   1 
HETATM 6843 O  O   . HOH G 4 .   ? 20.021 164.283 31.128  1.00 13.51 ? 635 HOH A O   1 
HETATM 6844 O  O   . HOH G 4 .   ? 30.906 159.932 33.092  1.00 28.65 ? 636 HOH A O   1 
HETATM 6845 O  O   . HOH G 4 .   ? 44.924 137.120 12.994  1.00 20.99 ? 637 HOH A O   1 
HETATM 6846 O  O   . HOH G 4 .   ? 27.542 154.147 34.264  1.00 11.00 ? 638 HOH A O   1 
HETATM 6847 O  O   . HOH G 4 .   ? 6.288  151.692 13.265  1.00 25.48 ? 639 HOH A O   1 
HETATM 6848 O  O   . HOH G 4 .   ? 9.388  129.479 29.990  1.00 5.18  ? 640 HOH A O   1 
HETATM 6849 O  O   . HOH G 4 .   ? 27.685 148.050 4.601   1.00 29.36 ? 641 HOH A O   1 
HETATM 6850 O  O   . HOH G 4 .   ? 24.624 143.189 33.837  1.00 15.92 ? 642 HOH A O   1 
HETATM 6851 O  O   . HOH G 4 .   ? 24.580 155.623 7.926   1.00 25.79 ? 643 HOH A O   1 
HETATM 6852 O  O   . HOH G 4 .   ? 27.752 173.420 36.234  1.00 24.71 ? 644 HOH A O   1 
HETATM 6853 O  O   . HOH G 4 .   ? 17.404 155.150 9.224   1.00 16.56 ? 645 HOH A O   1 
HETATM 6854 O  O   . HOH G 4 .   ? 30.610 146.047 21.751  1.00 19.36 ? 646 HOH A O   1 
HETATM 6855 O  O   . HOH G 4 .   ? 41.548 154.940 14.955  1.00 29.33 ? 647 HOH A O   1 
HETATM 6856 O  O   . HOH G 4 .   ? 39.288 135.211 2.355   1.00 7.04  ? 648 HOH A O   1 
HETATM 6857 O  O   . HOH G 4 .   ? 47.176 144.476 14.079  1.00 13.94 ? 649 HOH A O   1 
HETATM 6858 O  O   . HOH G 4 .   ? 17.215 170.927 36.614  1.00 32.18 ? 650 HOH A O   1 
HETATM 6859 O  O   . HOH G 4 .   ? 4.582  130.165 22.309  1.00 22.85 ? 651 HOH A O   1 
HETATM 6860 O  O   . HOH G 4 .   ? 9.277  152.755 6.320   1.00 21.47 ? 652 HOH A O   1 
HETATM 6861 O  O   . HOH G 4 .   ? 20.804 134.295 26.727  1.00 21.23 ? 653 HOH A O   1 
HETATM 6862 O  O   . HOH G 4 .   ? 0.826  120.456 19.907  1.00 23.45 ? 654 HOH A O   1 
HETATM 6863 O  O   . HOH G 4 .   ? 33.551 151.956 21.650  1.00 28.34 ? 655 HOH A O   1 
HETATM 6864 O  O   . HOH G 4 .   ? 23.584 173.999 16.773  1.00 19.61 ? 656 HOH A O   1 
HETATM 6865 O  O   . HOH G 4 .   ? 16.598 164.150 9.377   1.00 21.13 ? 657 HOH A O   1 
HETATM 6866 O  O   . HOH G 4 .   ? 0.937  129.935 16.113  1.00 29.93 ? 658 HOH A O   1 
HETATM 6867 O  O   . HOH G 4 .   ? 38.720 165.271 6.889   1.00 32.17 ? 659 HOH A O   1 
HETATM 6868 O  O   . HOH G 4 .   ? 15.529 151.737 9.597   1.00 18.33 ? 660 HOH A O   1 
HETATM 6869 O  O   . HOH G 4 .   ? 8.383  145.139 32.790  1.00 37.39 ? 661 HOH A O   1 
HETATM 6870 O  O   . HOH G 4 .   ? 16.971 159.440 10.681  1.00 28.14 ? 662 HOH A O   1 
HETATM 6871 O  O   . HOH G 4 .   ? 33.757 153.620 19.529  1.00 29.87 ? 663 HOH A O   1 
HETATM 6872 O  O   . HOH G 4 .   ? 30.032 160.117 -2.554  1.00 10.63 ? 664 HOH A O   1 
HETATM 6873 O  O   . HOH G 4 .   ? 30.539 133.509 11.776  1.00 10.92 ? 665 HOH A O   1 
HETATM 6874 O  O   . HOH G 4 .   ? 36.940 134.263 1.459   1.00 12.44 ? 666 HOH A O   1 
HETATM 6875 O  O   . HOH G 4 .   ? 53.059 152.913 14.212  1.00 18.57 ? 667 HOH A O   1 
HETATM 6876 O  O   . HOH G 4 .   ? 34.355 142.823 16.064  1.00 17.50 ? 668 HOH A O   1 
HETATM 6877 O  O   . HOH G 4 .   ? 29.556 130.357 4.540   1.00 22.83 ? 669 HOH A O   1 
HETATM 6878 O  O   . HOH G 4 .   ? 31.240 129.296 28.036  1.00 22.01 ? 670 HOH A O   1 
HETATM 6879 O  O   . HOH G 4 .   ? 23.671 128.626 22.739  1.00 10.74 ? 671 HOH A O   1 
HETATM 6880 O  O   . HOH G 4 .   ? 17.362 172.984 17.841  1.00 22.29 ? 672 HOH A O   1 
HETATM 6881 O  O   . HOH G 4 .   ? 49.475 162.150 -4.522  1.00 16.97 ? 673 HOH A O   1 
HETATM 6882 O  O   . HOH G 4 .   ? 24.966 154.221 34.116  1.00 24.13 ? 674 HOH A O   1 
HETATM 6883 O  O   . HOH G 4 .   ? 23.840 153.076 22.491  1.00 25.13 ? 675 HOH A O   1 
HETATM 6884 O  O   . HOH G 4 .   ? 51.588 145.979 -1.170  1.00 29.49 ? 676 HOH A O   1 
HETATM 6885 O  O   . HOH G 4 .   ? 19.745 140.069 28.888  1.00 24.96 ? 677 HOH A O   1 
HETATM 6886 O  O   . HOH G 4 .   ? 46.885 143.798 16.875  1.00 19.27 ? 678 HOH A O   1 
HETATM 6887 O  O   . HOH G 4 .   ? 30.516 136.885 8.596   1.00 21.49 ? 679 HOH A O   1 
HETATM 6888 O  O   . HOH G 4 .   ? 46.805 153.638 18.059  1.00 33.47 ? 680 HOH A O   1 
HETATM 6889 O  O   . HOH G 4 .   ? 35.196 149.624 23.593  1.00 24.21 ? 681 HOH A O   1 
HETATM 6890 O  O   . HOH G 4 .   ? 5.026  134.317 22.211  1.00 20.10 ? 682 HOH A O   1 
HETATM 6891 O  O   . HOH G 4 .   ? 57.986 156.354 5.842   1.00 34.03 ? 683 HOH A O   1 
HETATM 6892 O  O   . HOH G 4 .   ? 45.082 142.800 14.045  1.00 16.90 ? 684 HOH A O   1 
HETATM 6893 O  O   . HOH G 4 .   ? 17.087 153.988 45.480  1.00 26.19 ? 685 HOH A O   1 
HETATM 6894 O  O   . HOH G 4 .   ? 50.505 149.551 -5.126  1.00 19.00 ? 686 HOH A O   1 
HETATM 6895 O  O   . HOH G 4 .   ? 28.727 145.259 29.414  1.00 19.86 ? 687 HOH A O   1 
HETATM 6896 O  O   . HOH G 4 .   ? 12.674 136.679 32.016  1.00 18.72 ? 688 HOH A O   1 
HETATM 6897 O  O   . HOH G 4 .   ? 50.318 146.374 18.025  1.00 26.03 ? 689 HOH A O   1 
HETATM 6898 O  O   . HOH G 4 .   ? -1.061 127.316 18.680  1.00 23.08 ? 690 HOH A O   1 
HETATM 6899 O  O   . HOH G 4 .   ? 25.748 143.879 40.783  1.00 23.11 ? 691 HOH A O   1 
HETATM 6900 O  O   . HOH G 4 .   ? 17.918 138.010 27.253  1.00 13.20 ? 692 HOH A O   1 
HETATM 6901 O  O   . HOH G 4 .   ? 4.276  157.569 10.924  1.00 28.67 ? 693 HOH A O   1 
HETATM 6902 O  O   . HOH G 4 .   ? 22.423 152.233 20.401  1.00 22.69 ? 694 HOH A O   1 
HETATM 6903 O  O   . HOH G 4 .   ? 30.627 152.257 25.148  1.00 24.22 ? 695 HOH A O   1 
HETATM 6904 O  O   . HOH G 4 .   ? 50.051 141.721 13.103  1.00 8.04  ? 696 HOH A O   1 
HETATM 6905 O  O   . HOH G 4 .   ? 35.427 136.512 1.164   1.00 22.26 ? 697 HOH A O   1 
HETATM 6906 O  O   . HOH G 4 .   ? 57.035 155.559 3.449   1.00 36.52 ? 698 HOH A O   1 
HETATM 6907 O  O   . HOH G 4 .   ? 37.412 148.642 24.527  1.00 29.19 ? 699 HOH A O   1 
HETATM 6908 O  O   . HOH G 4 .   ? 26.789 155.695 22.302  1.00 14.62 ? 700 HOH A O   1 
HETATM 6909 O  O   . HOH G 4 .   ? 25.946 151.769 22.657  1.00 33.07 ? 701 HOH A O   1 
HETATM 6910 O  O   . HOH G 4 .   ? 29.939 143.633 27.941  1.00 15.60 ? 702 HOH A O   1 
HETATM 6911 O  O   . HOH G 4 .   ? -2.232 121.449 23.516  1.00 20.61 ? 703 HOH A O   1 
HETATM 6912 O  O   . HOH G 4 .   ? 49.854 144.140 14.268  1.00 24.12 ? 704 HOH A O   1 
HETATM 6913 O  O   . HOH G 4 .   ? 51.719 165.495 6.816   1.00 25.18 ? 705 HOH A O   1 
HETATM 6914 O  O   . HOH G 4 .   ? 27.320 141.890 24.288  1.00 21.94 ? 706 HOH A O   1 
HETATM 6915 O  O   . HOH G 4 .   ? 32.132 145.971 23.606  1.00 28.56 ? 707 HOH A O   1 
HETATM 6916 O  O   . HOH G 4 .   ? 4.358  136.210 23.957  1.00 18.26 ? 708 HOH A O   1 
HETATM 6917 O  O   . HOH G 4 .   ? 50.603 144.065 16.739  1.00 16.30 ? 709 HOH A O   1 
HETATM 6918 O  O   . HOH G 4 .   ? 37.345 167.092 7.720   1.00 24.39 ? 710 HOH A O   1 
HETATM 6919 O  O   . HOH G 4 .   ? 55.062 151.200 13.687  1.00 16.18 ? 711 HOH A O   1 
HETATM 6920 O  O   . HOH G 4 .   ? 24.010 154.792 20.661  1.00 27.43 ? 712 HOH A O   1 
HETATM 6921 O  O   . HOH G 4 .   ? 6.669  136.280 22.819  1.00 23.89 ? 713 HOH A O   1 
HETATM 6922 O  O   . HOH G 4 .   ? 29.008 154.881 22.668  1.00 27.17 ? 714 HOH A O   1 
HETATM 6923 O  O   . HOH H 4 .   ? 25.566 112.571 -0.577  1.00 35.21 ? 601 HOH B O   1 
HETATM 6924 O  O   . HOH H 4 .   ? 44.735 99.574  7.583   1.00 25.77 ? 602 HOH B O   1 
HETATM 6925 O  O   . HOH H 4 .   ? 40.758 89.359  29.943  1.00 26.26 ? 603 HOH B O   1 
HETATM 6926 O  O   . HOH H 4 .   ? 42.935 131.259 25.364  1.00 15.34 ? 604 HOH B O   1 
HETATM 6927 O  O   . HOH H 4 .   ? 42.174 112.785 6.242   1.00 10.32 ? 605 HOH B O   1 
HETATM 6928 O  O   . HOH H 4 .   ? 30.078 124.111 28.982  1.00 16.70 ? 606 HOH B O   1 
HETATM 6929 O  O   . HOH H 4 .   ? 32.343 95.814  17.296  1.00 21.06 ? 607 HOH B O   1 
HETATM 6930 O  O   . HOH H 4 .   ? 36.797 133.712 23.984  1.00 23.22 ? 608 HOH B O   1 
HETATM 6931 O  O   . HOH H 4 .   ? -4.804 107.639 -2.422  1.00 22.55 ? 609 HOH B O   1 
HETATM 6932 O  O   . HOH H 4 .   ? 45.898 135.435 20.506  1.00 20.05 ? 610 HOH B O   1 
HETATM 6933 O  O   . HOH H 4 .   ? 16.592 94.732  22.506  1.00 26.64 ? 611 HOH B O   1 
HETATM 6934 O  O   . HOH H 4 .   ? 20.707 137.184 11.467  1.00 4.65  ? 612 HOH B O   1 
HETATM 6935 O  O   . HOH H 4 .   ? 49.032 142.430 18.289  1.00 6.30  ? 613 HOH B O   1 
HETATM 6936 O  O   . HOH H 4 .   ? 31.331 110.765 9.360   1.00 23.27 ? 614 HOH B O   1 
HETATM 6937 O  O   . HOH H 4 .   ? 21.251 102.291 22.622  1.00 30.29 ? 615 HOH B O   1 
HETATM 6938 O  O   . HOH H 4 .   ? 27.215 123.641 33.655  1.00 16.51 ? 616 HOH B O   1 
HETATM 6939 O  O   . HOH H 4 .   ? 20.822 134.218 11.702  1.00 19.53 ? 617 HOH B O   1 
HETATM 6940 O  O   . HOH H 4 .   ? 43.616 107.373 16.538  1.00 14.11 ? 618 HOH B O   1 
HETATM 6941 O  O   . HOH H 4 .   ? 16.708 118.213 22.708  1.00 20.99 ? 619 HOH B O   1 
HETATM 6942 O  O   . HOH H 4 .   ? 28.539 99.037  23.753  1.00 22.73 ? 620 HOH B O   1 
HETATM 6943 O  O   . HOH H 4 .   ? 4.358  126.867 12.827  1.00 14.79 ? 621 HOH B O   1 
HETATM 6944 O  O   . HOH H 4 .   ? 49.397 94.938  12.935  1.00 19.75 ? 622 HOH B O   1 
HETATM 6945 O  O   . HOH H 4 .   ? 9.917  113.128 13.921  1.00 23.16 ? 623 HOH B O   1 
HETATM 6946 O  O   . HOH H 4 .   ? 47.124 141.059 13.304  1.00 4.45  ? 624 HOH B O   1 
HETATM 6947 O  O   . HOH H 4 .   ? 32.773 137.047 32.636  1.00 31.84 ? 625 HOH B O   1 
HETATM 6948 O  O   . HOH H 4 .   ? 14.901 125.444 22.248  1.00 25.67 ? 626 HOH B O   1 
HETATM 6949 O  O   . HOH H 4 .   ? 10.086 133.277 1.022   1.00 10.40 ? 627 HOH B O   1 
HETATM 6950 O  O   . HOH H 4 .   ? 27.174 96.758  42.406  1.00 25.10 ? 628 HOH B O   1 
HETATM 6951 O  O   . HOH H 4 .   ? 47.003 106.165 17.033  1.00 20.81 ? 629 HOH B O   1 
HETATM 6952 O  O   . HOH H 4 .   ? -0.723 116.235 0.553   1.00 30.97 ? 630 HOH B O   1 
HETATM 6953 O  O   . HOH H 4 .   ? 24.153 112.569 33.191  1.00 31.75 ? 631 HOH B O   1 
HETATM 6954 O  O   . HOH H 4 .   ? 26.937 112.435 33.136  1.00 25.54 ? 632 HOH B O   1 
HETATM 6955 O  O   . HOH H 4 .   ? 26.435 132.440 18.925  1.00 18.06 ? 633 HOH B O   1 
HETATM 6956 O  O   . HOH H 4 .   ? 22.998 106.751 25.875  1.00 15.57 ? 634 HOH B O   1 
HETATM 6957 O  O   . HOH H 4 .   ? 45.564 122.268 14.163  1.00 13.01 ? 635 HOH B O   1 
HETATM 6958 O  O   . HOH H 4 .   ? 46.841 137.311 22.415  1.00 18.35 ? 636 HOH B O   1 
HETATM 6959 O  O   . HOH H 4 .   ? 31.568 102.550 29.638  1.00 18.14 ? 637 HOH B O   1 
HETATM 6960 O  O   . HOH H 4 .   ? 3.772  121.608 0.256   1.00 13.37 ? 638 HOH B O   1 
HETATM 6961 O  O   . HOH H 4 .   ? 14.322 112.388 8.794   1.00 15.74 ? 639 HOH B O   1 
HETATM 6962 O  O   . HOH H 4 .   ? -1.298 115.080 13.682  1.00 18.95 ? 640 HOH B O   1 
HETATM 6963 O  O   . HOH H 4 .   ? 11.547 106.916 6.140   1.00 23.34 ? 641 HOH B O   1 
HETATM 6964 O  O   . HOH H 4 .   ? 38.291 139.745 22.936  1.00 15.97 ? 642 HOH B O   1 
HETATM 6965 O  O   . HOH H 4 .   ? 46.571 104.603 38.868  1.00 24.26 ? 643 HOH B O   1 
HETATM 6966 O  O   . HOH H 4 .   ? 27.921 137.806 20.455  1.00 23.05 ? 644 HOH B O   1 
HETATM 6967 O  O   . HOH H 4 .   ? 14.027 123.264 21.821  1.00 31.91 ? 645 HOH B O   1 
HETATM 6968 O  O   . HOH H 4 .   ? 34.031 112.642 8.428   1.00 16.91 ? 646 HOH B O   1 
HETATM 6969 O  O   . HOH H 4 .   ? 26.547 100.079 18.931  1.00 10.58 ? 647 HOH B O   1 
HETATM 6970 O  O   . HOH H 4 .   ? 6.428  132.206 0.079   1.00 33.30 ? 648 HOH B O   1 
HETATM 6971 O  O   . HOH H 4 .   ? 42.251 137.623 30.262  1.00 5.60  ? 649 HOH B O   1 
HETATM 6972 O  O   . HOH H 4 .   ? 10.459 117.885 -2.964  1.00 20.17 ? 650 HOH B O   1 
HETATM 6973 O  O   . HOH H 4 .   ? 27.198 112.501 6.452   1.00 25.45 ? 651 HOH B O   1 
HETATM 6974 O  O   . HOH H 4 .   ? 9.507  125.135 -5.809  1.00 33.67 ? 652 HOH B O   1 
HETATM 6975 O  O   . HOH H 4 .   ? 20.944 121.334 21.183  1.00 20.59 ? 653 HOH B O   1 
HETATM 6976 O  O   . HOH H 4 .   ? 12.383 102.685 6.310   1.00 24.92 ? 654 HOH B O   1 
HETATM 6977 O  O   . HOH H 4 .   ? 12.318 133.053 2.252   1.00 6.45  ? 655 HOH B O   1 
HETATM 6978 O  O   . HOH H 4 .   ? 16.028 131.527 1.052   1.00 15.46 ? 656 HOH B O   1 
HETATM 6979 O  O   . HOH H 4 .   ? 27.559 93.968  14.417  1.00 17.98 ? 657 HOH B O   1 
HETATM 6980 O  O   . HOH H 4 .   ? 23.193 121.824 29.042  1.00 15.50 ? 658 HOH B O   1 
HETATM 6981 O  O   . HOH H 4 .   ? 6.569  125.275 13.619  1.00 7.62  ? 659 HOH B O   1 
HETATM 6982 O  O   . HOH H 4 .   ? 22.711 115.815 -7.173  1.00 24.61 ? 660 HOH B O   1 
HETATM 6983 O  O   . HOH H 4 .   ? 36.085 116.071 8.707   1.00 17.80 ? 661 HOH B O   1 
HETATM 6984 O  O   . HOH H 4 .   ? 34.071 94.718  15.203  1.00 23.58 ? 662 HOH B O   1 
HETATM 6985 O  O   . HOH H 4 .   ? 1.391  121.126 17.329  1.00 16.48 ? 663 HOH B O   1 
HETATM 6986 O  O   . HOH H 4 .   ? 1.591  126.186 12.476  1.00 16.44 ? 664 HOH B O   1 
HETATM 6987 O  O   . HOH H 4 .   ? 4.054  105.425 -2.324  1.00 18.31 ? 665 HOH B O   1 
HETATM 6988 O  O   . HOH H 4 .   ? 30.710 132.741 26.689  1.00 18.86 ? 666 HOH B O   1 
HETATM 6989 O  O   . HOH H 4 .   ? 37.550 107.912 8.299   1.00 21.71 ? 667 HOH B O   1 
HETATM 6990 O  O   . HOH H 4 .   ? 4.439  123.322 13.870  1.00 9.31  ? 668 HOH B O   1 
HETATM 6991 O  O   . HOH H 4 .   ? -6.724 116.444 9.473   1.00 31.28 ? 669 HOH B O   1 
HETATM 6992 O  O   . HOH H 4 .   ? 8.536  105.106 8.077   1.00 25.26 ? 670 HOH B O   1 
HETATM 6993 O  O   . HOH H 4 .   ? 18.075 115.332 21.308  1.00 25.12 ? 671 HOH B O   1 
HETATM 6994 O  O   . HOH H 4 .   ? 34.644 104.045 7.581   1.00 13.10 ? 672 HOH B O   1 
HETATM 6995 O  O   . HOH H 4 .   ? 17.025 124.858 15.677  1.00 12.51 ? 673 HOH B O   1 
HETATM 6996 O  O   . HOH H 4 .   ? 29.044 115.626 6.442   1.00 13.44 ? 674 HOH B O   1 
HETATM 6997 O  O   . HOH H 4 .   ? -5.240 112.734 2.303   1.00 20.74 ? 675 HOH B O   1 
HETATM 6998 O  O   . HOH H 4 .   ? 47.169 110.181 9.297   1.00 29.08 ? 676 HOH B O   1 
HETATM 6999 O  O   . HOH H 4 .   ? 31.823 126.551 28.669  1.00 25.31 ? 677 HOH B O   1 
HETATM 7000 O  O   . HOH H 4 .   ? 4.596  124.090 16.360  1.00 6.62  ? 678 HOH B O   1 
HETATM 7001 O  O   . HOH H 4 .   ? 53.633 145.772 24.385  1.00 18.93 ? 679 HOH B O   1 
HETATM 7002 O  O   . HOH H 4 .   ? 37.676 110.845 8.466   1.00 20.97 ? 680 HOH B O   1 
HETATM 7003 O  O   . HOH H 4 .   ? 20.845 115.533 24.493  1.00 28.85 ? 681 HOH B O   1 
HETATM 7004 O  O   . HOH H 4 .   ? 18.614 94.909  18.964  1.00 31.09 ? 682 HOH B O   1 
HETATM 7005 O  O   . HOH H 4 .   ? 47.492 111.434 11.248  1.00 19.27 ? 683 HOH B O   1 
HETATM 7006 O  O   . HOH H 4 .   ? 24.961 111.815 21.330  1.00 28.22 ? 684 HOH B O   1 
HETATM 7007 O  O   . HOH H 4 .   ? 20.060 137.740 28.165  1.00 21.25 ? 685 HOH B O   1 
HETATM 7008 O  O   . HOH H 4 .   ? 1.126  118.582 -5.888  1.00 19.46 ? 686 HOH B O   1 
HETATM 7009 O  O   . HOH H 4 .   ? 39.133 94.488  31.076  1.00 20.69 ? 687 HOH B O   1 
HETATM 7010 O  O   . HOH H 4 .   ? 38.709 130.363 31.832  1.00 24.17 ? 688 HOH B O   1 
HETATM 7011 O  O   . HOH H 4 .   ? 12.876 121.803 -8.395  1.00 23.00 ? 689 HOH B O   1 
HETATM 7012 O  O   . HOH H 4 .   ? 23.704 129.279 20.220  1.00 29.64 ? 690 HOH B O   1 
HETATM 7013 O  O   . HOH H 4 .   ? 10.763 115.196 -4.093  1.00 19.06 ? 691 HOH B O   1 
HETATM 7014 O  O   . HOH H 4 .   ? 35.926 88.638  16.501  1.00 27.17 ? 692 HOH B O   1 
HETATM 7015 O  O   . HOH H 4 .   ? 43.886 121.469 32.237  1.00 31.02 ? 693 HOH B O   1 
HETATM 7016 O  O   . HOH H 4 .   ? 43.882 100.737 28.406  1.00 26.32 ? 694 HOH B O   1 
HETATM 7017 O  O   . HOH H 4 .   ? 14.413 101.271 6.170   1.00 22.97 ? 695 HOH B O   1 
HETATM 7018 O  O   . HOH H 4 .   ? 27.541 114.301 21.360  1.00 24.96 ? 696 HOH B O   1 
HETATM 7019 O  O   . HOH H 4 .   ? 48.168 130.675 15.054  1.00 25.04 ? 697 HOH B O   1 
HETATM 7020 O  O   . HOH H 4 .   ? 43.867 128.765 25.630  1.00 25.43 ? 698 HOH B O   1 
HETATM 7021 O  O   . HOH H 4 .   ? 52.798 139.111 23.857  1.00 26.81 ? 699 HOH B O   1 
HETATM 7022 O  O   . HOH H 4 .   ? 14.554 133.773 1.370   1.00 16.71 ? 700 HOH B O   1 
HETATM 7023 O  O   . HOH H 4 .   ? 46.582 132.916 22.198  1.00 17.92 ? 701 HOH B O   1 
HETATM 7024 O  O   . HOH H 4 .   ? 28.901 115.359 19.710  1.00 30.29 ? 702 HOH B O   1 
HETATM 7025 O  O   . HOH H 4 .   ? -0.271 122.175 -2.203  1.00 28.03 ? 703 HOH B O   1 
HETATM 7026 O  O   . HOH H 4 .   ? 9.751  137.400 7.166   1.00 12.30 ? 704 HOH B O   1 
HETATM 7027 O  O   . HOH H 4 .   ? 30.328 102.308 8.776   1.00 25.99 ? 705 HOH B O   1 
HETATM 7028 O  O   . HOH H 4 .   ? 0.196  127.650 14.688  1.00 31.33 ? 706 HOH B O   1 
HETATM 7029 O  O   . HOH H 4 .   ? 46.862 93.296  39.694  1.00 27.93 ? 707 HOH B O   1 
HETATM 7030 O  O   . HOH H 4 .   ? 45.222 116.801 11.639  1.00 22.38 ? 708 HOH B O   1 
HETATM 7031 O  O   . HOH H 4 .   ? 27.846 139.061 22.825  1.00 20.49 ? 709 HOH B O   1 
HETATM 7032 O  O   . HOH H 4 .   ? 19.619 93.026  17.562  1.00 27.72 ? 710 HOH B O   1 
HETATM 7033 O  O   . HOH H 4 .   ? 19.298 123.753 28.289  1.00 24.99 ? 711 HOH B O   1 
HETATM 7034 O  O   . HOH H 4 .   ? 21.649 123.354 27.746  1.00 10.87 ? 712 HOH B O   1 
HETATM 7035 O  O   . HOH H 4 .   ? 20.147 121.790 23.336  1.00 20.98 ? 713 HOH B O   1 
HETATM 7036 O  O   . HOH H 4 .   ? 25.685 115.689 22.044  1.00 33.45 ? 714 HOH B O   1 
HETATM 7037 O  O   . HOH H 4 .   ? 25.232 126.307 24.836  1.00 33.54 ? 715 HOH B O   1 
HETATM 7038 O  O   . HOH H 4 .   ? 33.365 129.031 27.319  1.00 15.10 ? 716 HOH B O   1 
HETATM 7039 O  O   . HOH H 4 .   ? 22.035 107.233 22.275  1.00 24.49 ? 717 HOH B O   1 
HETATM 7040 O  O   . HOH H 4 .   ? 26.566 132.689 28.102  1.00 31.38 ? 718 HOH B O   1 
HETATM 7041 O  O   . HOH H 4 .   ? 24.928 134.649 28.068  1.00 20.63 ? 719 HOH B O   1 
HETATM 7042 O  O   . HOH H 4 .   ? 50.941 138.210 15.892  1.00 19.00 ? 720 HOH B O   1 
HETATM 7043 O  O   . HOH H 4 .   ? -3.378 117.046 12.796  1.00 16.17 ? 721 HOH B O   1 
HETATM 7044 O  O   . HOH H 4 .   ? 1.662  124.130 13.656  1.00 27.21 ? 722 HOH B O   1 
HETATM 7045 O  O   . HOH H 4 .   ? 11.339 138.645 5.794   1.00 26.35 ? 723 HOH B O   1 
HETATM 7046 O  O   . HOH H 4 .   ? 5.756  104.815 -3.900  1.00 15.16 ? 724 HOH B O   1 
HETATM 7047 O  O   . HOH H 4 .   ? 0.898  123.660 16.352  1.00 21.13 ? 725 HOH B O   1 
HETATM 7048 O  O   . HOH H 4 .   ? 27.633 112.880 19.642  1.00 11.35 ? 726 HOH B O   1 
HETATM 7049 O  O   . HOH H 4 .   ? 27.304 102.412 9.387   1.00 37.58 ? 727 HOH B O   1 
HETATM 7050 O  O   . HOH H 4 .   ? 23.469 125.540 23.523  1.00 27.23 ? 728 HOH B O   1 
HETATM 7051 O  O   . HOH H 4 .   ? 20.417 102.564 24.965  1.00 30.55 ? 729 HOH B O   1 
HETATM 7052 O  O   . HOH H 4 .   ? 22.510 111.984 21.678  1.00 29.26 ? 730 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   4   LYS LYS A . n 
A 1 5   LEU 5   5   5   LEU LEU A . n 
A 1 6   PRO 6   6   6   PRO PRO A . n 
A 1 7   TYR 7   7   7   TYR TYR A . n 
A 1 8   LYS 8   8   8   LYS LYS A . n 
A 1 9   VAL 9   9   9   VAL VAL A . n 
A 1 10  ALA 10  10  10  ALA ALA A . n 
A 1 11  ASP 11  11  11  ASP ASP A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  ALA 15  15  15  ALA ALA A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  TRP 17  17  17  TRP TRP A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  LYS 20  20  20  LYS LYS A . n 
A 1 21  ALA 21  21  21  ALA ALA A . n 
A 1 22  LEU 22  22  22  LEU LEU A . n 
A 1 23  ASP 23  23  23  ASP ASP A . n 
A 1 24  ILE 24  24  24  ILE ILE A . n 
A 1 25  ALA 25  25  25  ALA ALA A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  MET 29  29  29  MET MET A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  LEU 32  32  32  LEU LEU A . n 
A 1 33  MET 33  33  33  MET MET A . n 
A 1 34  ARG 34  34  34  ARG ARG A . n 
A 1 35  MET 35  35  35  MET MET A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  ARG 38  38  38  ARG ARG A . n 
A 1 39  TYR 39  39  39  TYR TYR A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  PRO 44  44  44  PRO PRO A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  LYS 46  46  46  LYS LYS A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  ALA 48  48  48  ALA ALA A . n 
A 1 49  ARG 49  49  49  ARG ARG A . n 
A 1 50  ILE 50  50  50  ILE ILE A . n 
A 1 51  ALA 51  51  51  ALA ALA A . n 
A 1 52  GLY 52  52  52  GLY GLY A . n 
A 1 53  CYS 53  53  53  CYS CYS A . n 
A 1 54  LEU 54  54  54  LEU LEU A . n 
A 1 55  HIS 55  55  55  HIS HIS A . n 
A 1 56  MET 56  56  56  MET MET A . n 
A 1 57  THR 57  57  57  THR THR A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  GLU 59  59  59  GLU GLU A . n 
A 1 60  THR 60  60  60  THR THR A . n 
A 1 61  ALA 61  61  61  ALA ALA A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ILE 64  64  64  ILE ILE A . n 
A 1 65  GLU 65  65  65  GLU GLU A . n 
A 1 66  THR 66  66  66  THR THR A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  VAL 68  68  68  VAL VAL A . n 
A 1 69  THR 69  69  69  THR THR A . n 
A 1 70  LEU 70  70  70  LEU LEU A . n 
A 1 71  GLY 71  71  71  GLY GLY A . n 
A 1 72  ALA 72  72  72  ALA ALA A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  VAL 74  74  74  VAL VAL A . n 
A 1 75  GLN 75  75  75  GLN GLN A . n 
A 1 76  TRP 76  76  76  TRP TRP A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  SER 78  78  78  SER SER A . n 
A 1 79  CYS 79  79  79  CYS CYS A . n 
A 1 80  ASN 80  80  80  ASN ASN A . n 
A 1 81  ILE 81  81  81  ILE ILE A . n 
A 1 82  PHE 82  82  82  PHE PHE A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  THR 84  84  84  THR THR A . n 
A 1 85  GLN 85  85  85  GLN GLN A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  HIS 87  87  87  HIS HIS A . n 
A 1 88  ALA 88  88  88  ALA ALA A . n 
A 1 89  ALA 89  89  89  ALA ALA A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  ALA 91  91  91  ALA ALA A . n 
A 1 92  ILE 92  92  92  ILE ILE A . n 
A 1 93  ALA 93  93  93  ALA ALA A . n 
A 1 94  LYS 94  94  94  LYS LYS A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  VAL 99  99  99  VAL VAL A . n 
A 1 100 TYR 100 100 100 TYR TYR A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 TRP 102 102 102 TRP TRP A . n 
A 1 103 LYS 103 103 103 LYS LYS A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 ASP 107 107 107 ASP ASP A . n 
A 1 108 GLU 108 108 108 GLU GLU A . n 
A 1 109 GLU 109 109 109 GLU GLU A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 TRP 112 112 112 TRP TRP A . n 
A 1 113 CYS 113 113 113 CYS CYS A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 GLU 115 115 115 GLU GLU A . n 
A 1 116 GLN 116 116 116 GLN GLN A . n 
A 1 117 THR 117 117 117 THR THR A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 TYR 119 119 119 TYR TYR A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 LYS 121 121 121 LYS LYS A . n 
A 1 122 ASP 122 122 122 ASP ASP A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 PRO 124 124 124 PRO PRO A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ASN 126 126 126 ASN ASN A . n 
A 1 127 MET 127 127 127 MET MET A . n 
A 1 128 ILE 128 128 128 ILE ILE A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 ASP 130 130 130 ASP ASP A . n 
A 1 131 ASP 131 131 131 ASP ASP A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 GLY 133 133 133 GLY GLY A . n 
A 1 134 ASP 134 134 134 ASP ASP A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 LEU 138 138 138 LEU LEU A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 HIS 140 140 140 HIS HIS A . n 
A 1 141 THR 141 141 141 THR THR A . n 
A 1 142 LYS 142 142 142 LYS LYS A . n 
A 1 143 TYR 143 143 143 TYR TYR A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 GLN 145 145 145 GLN GLN A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 LEU 147 147 147 LEU LEU A . n 
A 1 148 PRO 148 148 148 PRO PRO A . n 
A 1 149 GLY 149 149 149 GLY GLY A . n 
A 1 150 ILE 150 150 150 ILE ILE A . n 
A 1 151 ARG 151 151 151 ARG ARG A . n 
A 1 152 GLY 152 152 152 GLY GLY A . n 
A 1 153 ILE 153 153 153 ILE ILE A . n 
A 1 154 SER 154 154 154 SER SER A . n 
A 1 155 GLU 155 155 155 GLU GLU A . n 
A 1 156 GLU 156 156 156 GLU GLU A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 THR 158 158 158 THR THR A . n 
A 1 159 THR 159 159 159 THR THR A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 VAL 161 161 161 VAL VAL A . n 
A 1 162 HIS 162 162 162 HIS HIS A . n 
A 1 163 ASN 163 163 163 ASN ASN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 TYR 165 165 165 TYR TYR A . n 
A 1 166 LYS 166 166 166 LYS LYS A . n 
A 1 167 MET 167 167 167 MET MET A . n 
A 1 168 MET 168 168 168 MET MET A . n 
A 1 169 ALA 169 169 169 ALA ALA A . n 
A 1 170 ASN 170 170 170 ASN ASN A . n 
A 1 171 GLY 171 171 171 GLY GLY A . n 
A 1 172 ILE 172 172 172 ILE ILE A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 LYS 174 174 174 LYS LYS A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 PRO 176 176 176 PRO PRO A . n 
A 1 177 ALA 177 177 177 ALA ALA A . n 
A 1 178 ILE 178 178 178 ILE ILE A . n 
A 1 179 ASN 179 179 179 ASN ASN A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 ASN 181 181 181 ASN ASN A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 SER 183 183 183 SER SER A . n 
A 1 184 VAL 184 184 184 VAL VAL A . n 
A 1 185 THR 185 185 185 THR THR A . n 
A 1 186 LYS 186 186 186 LYS LYS A . n 
A 1 187 SER 187 187 187 SER SER A . n 
A 1 188 LYS 188 188 188 LYS LYS A . n 
A 1 189 PHE 189 189 189 PHE PHE A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 ASN 191 191 191 ASN ASN A . n 
A 1 192 LEU 192 192 192 LEU LEU A . n 
A 1 193 TYR 193 193 193 TYR TYR A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 CYS 195 195 195 CYS CYS A . n 
A 1 196 ARG 196 196 196 ARG ARG A . n 
A 1 197 GLU 197 197 197 GLU GLU A . n 
A 1 198 SER 198 198 198 SER SER A . n 
A 1 199 LEU 199 199 199 LEU LEU A . n 
A 1 200 ILE 200 200 200 ILE ILE A . n 
A 1 201 ASP 201 201 201 ASP ASP A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 ILE 203 203 203 ILE ILE A . n 
A 1 204 LYS 204 204 204 LYS LYS A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 ALA 206 206 206 ALA ALA A . n 
A 1 207 THR 207 207 207 THR THR A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 VAL 209 209 209 VAL VAL A . n 
A 1 210 MET 210 210 210 MET MET A . n 
A 1 211 ILE 211 211 211 ILE ILE A . n 
A 1 212 ALA 212 212 212 ALA ALA A . n 
A 1 213 GLY 213 213 213 GLY GLY A . n 
A 1 214 LYS 214 214 214 LYS LYS A . n 
A 1 215 VAL 215 215 215 VAL VAL A . n 
A 1 216 ALA 216 216 216 ALA ALA A . n 
A 1 217 VAL 217 217 217 VAL VAL A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 ALA 219 219 219 ALA ALA A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 TYR 221 221 221 TYR TYR A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 ASP 223 223 223 ASP ASP A . n 
A 1 224 VAL 224 224 224 VAL VAL A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 LYS 226 226 226 LYS LYS A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 CYS 228 228 228 CYS CYS A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 GLN 230 230 230 GLN GLN A . n 
A 1 231 ALA 231 231 231 ALA ALA A . n 
A 1 232 LEU 232 232 232 LEU LEU A . n 
A 1 233 ARG 233 233 233 ARG ARG A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 GLY 236 236 236 GLY GLY A . n 
A 1 237 ALA 237 237 237 ALA ALA A . n 
A 1 238 ARG 238 238 238 ARG ARG A . n 
A 1 239 VAL 239 239 239 VAL VAL A . n 
A 1 240 ILE 240 240 240 ILE ILE A . n 
A 1 241 ILE 241 241 241 ILE ILE A . n 
A 1 242 THR 242 242 242 THR THR A . n 
A 1 243 GLU 243 243 243 GLU GLU A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 ASP 245 245 245 ASP ASP A . n 
A 1 246 PRO 246 246 246 PRO PRO A . n 
A 1 247 ILE 247 247 247 ILE ILE A . n 
A 1 248 ASN 248 248 248 ASN ASN A . n 
A 1 249 ALA 249 249 249 ALA ALA A . n 
A 1 250 LEU 250 250 250 LEU LEU A . n 
A 1 251 GLN 251 251 251 GLN GLN A . n 
A 1 252 ALA 252 252 252 ALA ALA A . n 
A 1 253 ALA 253 253 253 ALA ALA A . n 
A 1 254 MET 254 254 254 MET MET A . n 
A 1 255 GLU 255 255 255 GLU GLU A . n 
A 1 256 GLY 256 256 256 GLY GLY A . n 
A 1 257 TYR 257 257 257 TYR TYR A . n 
A 1 258 GLU 258 258 258 GLU GLU A . n 
A 1 259 VAL 259 259 259 VAL VAL A . n 
A 1 260 THR 260 260 260 THR THR A . n 
A 1 261 THR 261 261 261 THR THR A . n 
A 1 262 MET 262 262 262 MET MET A . n 
A 1 263 ASP 263 263 263 ASP ASP A . n 
A 1 264 GLU 264 264 264 GLU GLU A . n 
A 1 265 ALA 265 265 265 ALA ALA A . n 
A 1 266 CYS 266 266 266 CYS CYS A . n 
A 1 267 GLN 267 267 267 GLN GLN A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 GLY 269 269 269 GLY GLY A . n 
A 1 270 ASN 270 270 270 ASN ASN A . n 
A 1 271 ILE 271 271 271 ILE ILE A . n 
A 1 272 PHE 272 272 272 PHE PHE A . n 
A 1 273 VAL 273 273 273 VAL VAL A . n 
A 1 274 THR 274 274 274 THR THR A . n 
A 1 275 THR 275 275 275 THR THR A . n 
A 1 276 THR 276 276 276 THR THR A . n 
A 1 277 GLY 277 277 277 GLY GLY A . n 
A 1 278 CYS 278 278 278 CYS CYS A . n 
A 1 279 ILE 279 279 279 ILE ILE A . n 
A 1 280 ASP 280 280 280 ASP ASP A . n 
A 1 281 ILE 281 281 281 ILE ILE A . n 
A 1 282 ILE 282 282 282 ILE ILE A . n 
A 1 283 LEU 283 283 283 LEU LEU A . n 
A 1 284 GLY 284 284 284 GLY GLY A . n 
A 1 285 ARG 285 285 285 ARG ARG A . n 
A 1 286 HIS 286 286 286 HIS HIS A . n 
A 1 287 PHE 287 287 287 PHE PHE A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 GLN 289 289 289 GLN GLN A . n 
A 1 290 MET 290 290 290 MET MET A . n 
A 1 291 LYS 291 291 291 LYS LYS A . n 
A 1 292 ASP 292 292 292 ASP ASP A . n 
A 1 293 ASP 293 293 293 ASP ASP A . n 
A 1 294 ALA 294 294 294 ALA ALA A . n 
A 1 295 ILE 295 295 295 ILE ILE A . n 
A 1 296 VAL 296 296 296 VAL VAL A . n 
A 1 297 CYS 297 297 297 CYS CYS A . n 
A 1 298 ASN 298 298 298 ASN ASN A . n 
A 1 299 ILE 299 299 299 ILE ILE A . n 
A 1 300 GLY 300 300 300 GLY GLY A . n 
A 1 301 HIS 301 301 301 HIS HIS A . n 
A 1 302 PHE 302 302 302 PHE PHE A . n 
A 1 303 ASP 303 303 303 ASP ASP A . n 
A 1 304 VAL 304 304 304 VAL VAL A . n 
A 1 305 GLU 305 305 305 GLU GLU A . n 
A 1 306 ILE 306 306 306 ILE ILE A . n 
A 1 307 ASP 307 307 307 ASP ASP A . n 
A 1 308 VAL 308 308 308 VAL VAL A . n 
A 1 309 LYS 309 309 309 LYS LYS A . n 
A 1 310 TRP 310 310 310 TRP TRP A . n 
A 1 311 LEU 311 311 311 LEU LEU A . n 
A 1 312 ASN 312 312 312 ASN ASN A . n 
A 1 313 GLU 313 313 313 GLU GLU A . n 
A 1 314 ASN 314 314 314 ASN ASN A . n 
A 1 315 ALA 315 315 315 ALA ALA A . n 
A 1 316 VAL 316 316 316 VAL VAL A . n 
A 1 317 GLU 317 317 317 GLU GLU A . n 
A 1 318 LYS 318 318 318 LYS LYS A . n 
A 1 319 VAL 319 319 319 VAL VAL A . n 
A 1 320 ASN 320 320 320 ASN ASN A . n 
A 1 321 ILE 321 321 321 ILE ILE A . n 
A 1 322 LYS 322 322 322 LYS LYS A . n 
A 1 323 PRO 323 323 323 PRO PRO A . n 
A 1 324 GLN 324 324 324 GLN GLN A . n 
A 1 325 VAL 325 325 325 VAL VAL A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 ARG 327 327 327 ARG ARG A . n 
A 1 328 TYR 328 328 328 TYR TYR A . n 
A 1 329 ARG 329 329 329 ARG ARG A . n 
A 1 330 LEU 330 330 330 LEU LEU A . n 
A 1 331 LYS 331 331 331 LYS LYS A . n 
A 1 332 ASN 332 332 332 ASN ASN A . n 
A 1 333 GLY 333 333 333 GLY GLY A . n 
A 1 334 ARG 334 334 334 ARG ARG A . n 
A 1 335 ARG 335 335 335 ARG ARG A . n 
A 1 336 ILE 336 336 336 ILE ILE A . n 
A 1 337 ILE 337 337 337 ILE ILE A . n 
A 1 338 LEU 338 338 338 LEU LEU A . n 
A 1 339 LEU 339 339 339 LEU LEU A . n 
A 1 340 ALA 340 340 340 ALA ALA A . n 
A 1 341 GLU 341 341 341 GLU GLU A . n 
A 1 342 GLY 342 342 342 GLY GLY A . n 
A 1 343 ARG 343 343 343 ARG ARG A . n 
A 1 344 LEU 344 344 344 LEU LEU A . n 
A 1 345 VAL 345 345 345 VAL VAL A . n 
A 1 346 ASN 346 346 346 ASN ASN A . n 
A 1 347 LEU 347 347 347 LEU LEU A . n 
A 1 348 GLY 348 348 348 GLY GLY A . n 
A 1 349 CYS 349 349 349 CYS CYS A . n 
A 1 350 ALA 350 350 350 ALA ALA A . n 
A 1 351 MET 351 351 351 MET MET A . n 
A 1 352 GLY 352 352 352 GLY GLY A . n 
A 1 353 HIS 353 353 353 HIS HIS A . n 
A 1 354 PRO 354 354 354 PRO PRO A . n 
A 1 355 SER 355 355 355 SER SER A . n 
A 1 356 PHE 356 356 356 PHE PHE A . n 
A 1 357 VAL 357 357 357 VAL VAL A . n 
A 1 358 MET 358 358 358 MET MET A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 ASN 360 360 360 ASN ASN A . n 
A 1 361 SER 361 361 361 SER SER A . n 
A 1 362 PHE 362 362 362 PHE PHE A . n 
A 1 363 THR 363 363 363 THR THR A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 GLN 365 365 365 GLN GLN A . n 
A 1 366 VAL 366 366 366 VAL VAL A . n 
A 1 367 MET 367 367 367 MET MET A . n 
A 1 368 ALA 368 368 368 ALA ALA A . n 
A 1 369 GLN 369 369 369 GLN GLN A . n 
A 1 370 ILE 370 370 370 ILE ILE A . n 
A 1 371 GLU 371 371 371 GLU GLU A . n 
A 1 372 LEU 372 372 372 LEU LEU A . n 
A 1 373 TRP 373 373 373 TRP TRP A . n 
A 1 374 THR 374 374 374 THR THR A . n 
A 1 375 HIS 375 375 375 HIS HIS A . n 
A 1 376 PRO 376 376 376 PRO PRO A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 LYS 378 378 378 LYS LYS A . n 
A 1 379 TYR 379 379 379 TYR TYR A . n 
A 1 380 PRO 380 380 380 PRO PRO A . n 
A 1 381 VAL 381 381 381 VAL VAL A . n 
A 1 382 GLY 382 382 382 GLY GLY A . n 
A 1 383 VAL 383 383 383 VAL VAL A . n 
A 1 384 HIS 384 384 384 HIS HIS A . n 
A 1 385 PHE 385 385 385 PHE PHE A . n 
A 1 386 LEU 386 386 386 LEU LEU A . n 
A 1 387 PRO 387 387 387 PRO PRO A . n 
A 1 388 LYS 388 388 388 LYS LYS A . n 
A 1 389 LYS 389 389 389 LYS LYS A . n 
A 1 390 LEU 390 390 390 LEU LEU A . n 
A 1 391 ASP 391 391 391 ASP ASP A . n 
A 1 392 GLU 392 392 392 GLU GLU A . n 
A 1 393 ALA 393 393 393 ALA ALA A . n 
A 1 394 VAL 394 394 394 VAL VAL A . n 
A 1 395 ALA 395 395 395 ALA ALA A . n 
A 1 396 GLU 396 396 396 GLU GLU A . n 
A 1 397 ALA 397 397 397 ALA ALA A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 LEU 399 399 399 LEU LEU A . n 
A 1 400 GLY 400 400 400 GLY GLY A . n 
A 1 401 LYS 401 401 401 LYS LYS A . n 
A 1 402 LEU 402 402 402 LEU LEU A . n 
A 1 403 ASN 403 403 403 ASN ASN A . n 
A 1 404 VAL 404 404 404 VAL VAL A . n 
A 1 405 LYS 405 405 405 LYS LYS A . n 
A 1 406 LEU 406 406 406 LEU LEU A . n 
A 1 407 THR 407 407 407 THR THR A . n 
A 1 408 LYS 408 408 408 LYS LYS A . n 
A 1 409 LEU 409 409 409 LEU LEU A . n 
A 1 410 THR 410 410 410 THR THR A . n 
A 1 411 GLU 411 411 411 GLU GLU A . n 
A 1 412 LYS 412 412 412 LYS LYS A . n 
A 1 413 GLN 413 413 413 GLN GLN A . n 
A 1 414 ALA 414 414 414 ALA ALA A . n 
A 1 415 GLN 415 415 415 GLN GLN A . n 
A 1 416 TYR 416 416 416 TYR TYR A . n 
A 1 417 LEU 417 417 417 LEU LEU A . n 
A 1 418 GLY 418 418 418 GLY GLY A . n 
A 1 419 MET 419 419 419 MET MET A . n 
A 1 420 SER 420 420 420 SER SER A . n 
A 1 421 CYS 421 421 421 CYS CYS A . n 
A 1 422 ASP 422 422 422 ASP ASP A . n 
A 1 423 GLY 423 423 423 GLY GLY A . n 
A 1 424 PRO 424 424 424 PRO PRO A . n 
A 1 425 PHE 425 425 425 PHE PHE A . n 
A 1 426 LYS 426 426 426 LYS LYS A . n 
A 1 427 PRO 427 427 427 PRO PRO A . n 
A 1 428 ASP 428 428 428 ASP ASP A . n 
A 1 429 HIS 429 429 429 HIS HIS A . n 
A 1 430 TYR 430 430 430 TYR TYR A . n 
A 1 431 ARG 431 431 431 ARG ARG A . n 
A 1 432 TYR 432 432 432 TYR TYR A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   ASP 3   3   ?   ?   ?   B . n 
B 1 4   LYS 4   4   4   LYS LYS B . n 
B 1 5   LEU 5   5   5   LEU LEU B . n 
B 1 6   PRO 6   6   6   PRO PRO B . n 
B 1 7   TYR 7   7   7   TYR TYR B . n 
B 1 8   LYS 8   8   8   LYS LYS B . n 
B 1 9   VAL 9   9   9   VAL VAL B . n 
B 1 10  ALA 10  10  10  ALA ALA B . n 
B 1 11  ASP 11  11  11  ASP ASP B . n 
B 1 12  ILE 12  12  12  ILE ILE B . n 
B 1 13  GLY 13  13  13  GLY GLY B . n 
B 1 14  LEU 14  14  14  LEU LEU B . n 
B 1 15  ALA 15  15  15  ALA ALA B . n 
B 1 16  ALA 16  16  16  ALA ALA B . n 
B 1 17  TRP 17  17  17  TRP TRP B . n 
B 1 18  GLY 18  18  18  GLY GLY B . n 
B 1 19  ARG 19  19  19  ARG ARG B . n 
B 1 20  LYS 20  20  20  LYS LYS B . n 
B 1 21  ALA 21  21  21  ALA ALA B . n 
B 1 22  LEU 22  22  22  LEU LEU B . n 
B 1 23  ASP 23  23  23  ASP ASP B . n 
B 1 24  ILE 24  24  24  ILE ILE B . n 
B 1 25  ALA 25  25  25  ALA ALA B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  GLU 28  28  28  GLU GLU B . n 
B 1 29  MET 29  29  29  MET MET B . n 
B 1 30  PRO 30  30  30  PRO PRO B . n 
B 1 31  GLY 31  31  31  GLY GLY B . n 
B 1 32  LEU 32  32  32  LEU LEU B . n 
B 1 33  MET 33  33  33  MET MET B . n 
B 1 34  ARG 34  34  34  ARG ARG B . n 
B 1 35  MET 35  35  35  MET MET B . n 
B 1 36  ARG 36  36  36  ARG ARG B . n 
B 1 37  GLU 37  37  37  GLU GLU B . n 
B 1 38  ARG 38  38  38  ARG ARG B . n 
B 1 39  TYR 39  39  39  TYR TYR B . n 
B 1 40  SER 40  40  40  SER SER B . n 
B 1 41  ALA 41  41  41  ALA ALA B . n 
B 1 42  SER 42  42  42  SER SER B . n 
B 1 43  LYS 43  43  43  LYS LYS B . n 
B 1 44  PRO 44  44  44  PRO PRO B . n 
B 1 45  LEU 45  45  45  LEU LEU B . n 
B 1 46  LYS 46  46  46  LYS LYS B . n 
B 1 47  GLY 47  47  47  GLY GLY B . n 
B 1 48  ALA 48  48  48  ALA ALA B . n 
B 1 49  ARG 49  49  49  ARG ARG B . n 
B 1 50  ILE 50  50  50  ILE ILE B . n 
B 1 51  ALA 51  51  51  ALA ALA B . n 
B 1 52  GLY 52  52  52  GLY GLY B . n 
B 1 53  CYS 53  53  53  CYS CYS B . n 
B 1 54  LEU 54  54  54  LEU LEU B . n 
B 1 55  HIS 55  55  55  HIS HIS B . n 
B 1 56  MET 56  56  56  MET MET B . n 
B 1 57  THR 57  57  57  THR THR B . n 
B 1 58  VAL 58  58  58  VAL VAL B . n 
B 1 59  GLU 59  59  59  GLU GLU B . n 
B 1 60  THR 60  60  60  THR THR B . n 
B 1 61  ALA 61  61  61  ALA ALA B . n 
B 1 62  VAL 62  62  62  VAL VAL B . n 
B 1 63  LEU 63  63  63  LEU LEU B . n 
B 1 64  ILE 64  64  64  ILE ILE B . n 
B 1 65  GLU 65  65  65  GLU GLU B . n 
B 1 66  THR 66  66  66  THR THR B . n 
B 1 67  LEU 67  67  67  LEU LEU B . n 
B 1 68  VAL 68  68  68  VAL VAL B . n 
B 1 69  THR 69  69  69  THR THR B . n 
B 1 70  LEU 70  70  70  LEU LEU B . n 
B 1 71  GLY 71  71  71  GLY GLY B . n 
B 1 72  ALA 72  72  72  ALA ALA B . n 
B 1 73  GLU 73  73  73  GLU GLU B . n 
B 1 74  VAL 74  74  74  VAL VAL B . n 
B 1 75  GLN 75  75  75  GLN GLN B . n 
B 1 76  TRP 76  76  76  TRP TRP B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  SER 78  78  78  SER SER B . n 
B 1 79  CYS 79  79  79  CYS CYS B . n 
B 1 80  ASN 80  80  80  ASN ASN B . n 
B 1 81  ILE 81  81  81  ILE ILE B . n 
B 1 82  PHE 82  82  82  PHE PHE B . n 
B 1 83  SER 83  83  83  SER SER B . n 
B 1 84  THR 84  84  84  THR THR B . n 
B 1 85  GLN 85  85  85  GLN GLN B . n 
B 1 86  ASP 86  86  86  ASP ASP B . n 
B 1 87  HIS 87  87  87  HIS HIS B . n 
B 1 88  ALA 88  88  88  ALA ALA B . n 
B 1 89  ALA 89  89  89  ALA ALA B . n 
B 1 90  ALA 90  90  90  ALA ALA B . n 
B 1 91  ALA 91  91  91  ALA ALA B . n 
B 1 92  ILE 92  92  92  ILE ILE B . n 
B 1 93  ALA 93  93  93  ALA ALA B . n 
B 1 94  LYS 94  94  94  LYS LYS B . n 
B 1 95  ALA 95  95  95  ALA ALA B . n 
B 1 96  GLY 96  96  96  GLY GLY B . n 
B 1 97  ILE 97  97  97  ILE ILE B . n 
B 1 98  PRO 98  98  98  PRO PRO B . n 
B 1 99  VAL 99  99  99  VAL VAL B . n 
B 1 100 TYR 100 100 100 TYR TYR B . n 
B 1 101 ALA 101 101 101 ALA ALA B . n 
B 1 102 TRP 102 102 102 TRP TRP B . n 
B 1 103 LYS 103 103 103 LYS LYS B . n 
B 1 104 GLY 104 104 104 GLY GLY B . n 
B 1 105 GLU 105 105 105 GLU GLU B . n 
B 1 106 THR 106 106 106 THR THR B . n 
B 1 107 ASP 107 107 107 ASP ASP B . n 
B 1 108 GLU 108 108 108 GLU GLU B . n 
B 1 109 GLU 109 109 109 GLU GLU B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 LEU 111 111 111 LEU LEU B . n 
B 1 112 TRP 112 112 112 TRP TRP B . n 
B 1 113 CYS 113 113 113 CYS CYS B . n 
B 1 114 ILE 114 114 114 ILE ILE B . n 
B 1 115 GLU 115 115 115 GLU GLU B . n 
B 1 116 GLN 116 116 116 GLN GLN B . n 
B 1 117 THR 117 117 117 THR THR B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 TYR 119 119 119 TYR TYR B . n 
B 1 120 PHE 120 120 120 PHE PHE B . n 
B 1 121 LYS 121 121 121 LYS LYS B . n 
B 1 122 ASP 122 122 122 ASP ASP B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 PRO 124 124 124 PRO PRO B . n 
B 1 125 LEU 125 125 125 LEU LEU B . n 
B 1 126 ASN 126 126 126 ASN ASN B . n 
B 1 127 MET 127 127 127 MET MET B . n 
B 1 128 ILE 128 128 128 ILE ILE B . n 
B 1 129 LEU 129 129 129 LEU LEU B . n 
B 1 130 ASP 130 130 130 ASP ASP B . n 
B 1 131 ASP 131 131 131 ASP ASP B . n 
B 1 132 GLY 132 132 132 GLY GLY B . n 
B 1 133 GLY 133 133 133 GLY GLY B . n 
B 1 134 ASP 134 134 134 ASP ASP B . n 
B 1 135 LEU 135 135 135 LEU LEU B . n 
B 1 136 THR 136 136 136 THR THR B . n 
B 1 137 ASN 137 137 137 ASN ASN B . n 
B 1 138 LEU 138 138 138 LEU LEU B . n 
B 1 139 ILE 139 139 139 ILE ILE B . n 
B 1 140 HIS 140 140 140 HIS HIS B . n 
B 1 141 THR 141 141 141 THR THR B . n 
B 1 142 LYS 142 142 142 LYS LYS B . n 
B 1 143 TYR 143 143 143 TYR TYR B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 GLN 145 145 145 GLN GLN B . n 
B 1 146 LEU 146 146 146 LEU LEU B . n 
B 1 147 LEU 147 147 147 LEU LEU B . n 
B 1 148 PRO 148 148 148 PRO PRO B . n 
B 1 149 GLY 149 149 149 GLY GLY B . n 
B 1 150 ILE 150 150 150 ILE ILE B . n 
B 1 151 ARG 151 151 151 ARG ARG B . n 
B 1 152 GLY 152 152 152 GLY GLY B . n 
B 1 153 ILE 153 153 153 ILE ILE B . n 
B 1 154 SER 154 154 154 SER SER B . n 
B 1 155 GLU 155 155 155 GLU GLU B . n 
B 1 156 GLU 156 156 156 GLU GLU B . n 
B 1 157 THR 157 157 157 THR THR B . n 
B 1 158 THR 158 158 158 THR THR B . n 
B 1 159 THR 159 159 159 THR THR B . n 
B 1 160 GLY 160 160 160 GLY GLY B . n 
B 1 161 VAL 161 161 161 VAL VAL B . n 
B 1 162 HIS 162 162 162 HIS HIS B . n 
B 1 163 ASN 163 163 163 ASN ASN B . n 
B 1 164 LEU 164 164 164 LEU LEU B . n 
B 1 165 TYR 165 165 165 TYR TYR B . n 
B 1 166 LYS 166 166 166 LYS LYS B . n 
B 1 167 MET 167 167 167 MET MET B . n 
B 1 168 MET 168 168 168 MET MET B . n 
B 1 169 ALA 169 169 169 ALA ALA B . n 
B 1 170 ASN 170 170 170 ASN ASN B . n 
B 1 171 GLY 171 171 171 GLY GLY B . n 
B 1 172 ILE 172 172 172 ILE ILE B . n 
B 1 173 LEU 173 173 173 LEU LEU B . n 
B 1 174 LYS 174 174 174 LYS LYS B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 PRO 176 176 176 PRO PRO B . n 
B 1 177 ALA 177 177 177 ALA ALA B . n 
B 1 178 ILE 178 178 178 ILE ILE B . n 
B 1 179 ASN 179 179 179 ASN ASN B . n 
B 1 180 VAL 180 180 180 VAL VAL B . n 
B 1 181 ASN 181 181 181 ASN ASN B . n 
B 1 182 ASP 182 182 182 ASP ASP B . n 
B 1 183 SER 183 183 183 SER SER B . n 
B 1 184 VAL 184 184 184 VAL VAL B . n 
B 1 185 THR 185 185 185 THR THR B . n 
B 1 186 LYS 186 186 186 LYS LYS B . n 
B 1 187 SER 187 187 187 SER SER B . n 
B 1 188 LYS 188 188 188 LYS LYS B . n 
B 1 189 PHE 189 189 189 PHE PHE B . n 
B 1 190 ASP 190 190 190 ASP ASP B . n 
B 1 191 ASN 191 191 191 ASN ASN B . n 
B 1 192 LEU 192 192 192 LEU LEU B . n 
B 1 193 TYR 193 193 193 TYR TYR B . n 
B 1 194 GLY 194 194 194 GLY GLY B . n 
B 1 195 CYS 195 195 195 CYS CYS B . n 
B 1 196 ARG 196 196 196 ARG ARG B . n 
B 1 197 GLU 197 197 197 GLU GLU B . n 
B 1 198 SER 198 198 198 SER SER B . n 
B 1 199 LEU 199 199 199 LEU LEU B . n 
B 1 200 ILE 200 200 200 ILE ILE B . n 
B 1 201 ASP 201 201 201 ASP ASP B . n 
B 1 202 GLY 202 202 202 GLY GLY B . n 
B 1 203 ILE 203 203 203 ILE ILE B . n 
B 1 204 LYS 204 204 204 LYS LYS B . n 
B 1 205 ARG 205 205 205 ARG ARG B . n 
B 1 206 ALA 206 206 206 ALA ALA B . n 
B 1 207 THR 207 207 207 THR THR B . n 
B 1 208 ASP 208 208 208 ASP ASP B . n 
B 1 209 VAL 209 209 209 VAL VAL B . n 
B 1 210 MET 210 210 210 MET MET B . n 
B 1 211 ILE 211 211 211 ILE ILE B . n 
B 1 212 ALA 212 212 212 ALA ALA B . n 
B 1 213 GLY 213 213 213 GLY GLY B . n 
B 1 214 LYS 214 214 214 LYS LYS B . n 
B 1 215 VAL 215 215 215 VAL VAL B . n 
B 1 216 ALA 216 216 216 ALA ALA B . n 
B 1 217 VAL 217 217 217 VAL VAL B . n 
B 1 218 VAL 218 218 218 VAL VAL B . n 
B 1 219 ALA 219 219 219 ALA ALA B . n 
B 1 220 GLY 220 220 220 GLY GLY B . n 
B 1 221 TYR 221 221 221 TYR TYR B . n 
B 1 222 GLY 222 222 222 GLY GLY B . n 
B 1 223 ASP 223 223 223 ASP ASP B . n 
B 1 224 VAL 224 224 224 VAL VAL B . n 
B 1 225 GLY 225 225 225 GLY GLY B . n 
B 1 226 LYS 226 226 226 LYS LYS B . n 
B 1 227 GLY 227 227 227 GLY GLY B . n 
B 1 228 CYS 228 228 228 CYS CYS B . n 
B 1 229 ALA 229 229 229 ALA ALA B . n 
B 1 230 GLN 230 230 230 GLN GLN B . n 
B 1 231 ALA 231 231 231 ALA ALA B . n 
B 1 232 LEU 232 232 232 LEU LEU B . n 
B 1 233 ARG 233 233 233 ARG ARG B . n 
B 1 234 GLY 234 234 234 GLY GLY B . n 
B 1 235 PHE 235 235 235 PHE PHE B . n 
B 1 236 GLY 236 236 236 GLY GLY B . n 
B 1 237 ALA 237 237 237 ALA ALA B . n 
B 1 238 ARG 238 238 238 ARG ARG B . n 
B 1 239 VAL 239 239 239 VAL VAL B . n 
B 1 240 ILE 240 240 240 ILE ILE B . n 
B 1 241 ILE 241 241 241 ILE ILE B . n 
B 1 242 THR 242 242 242 THR THR B . n 
B 1 243 GLU 243 243 243 GLU GLU B . n 
B 1 244 ILE 244 244 244 ILE ILE B . n 
B 1 245 ASP 245 245 245 ASP ASP B . n 
B 1 246 PRO 246 246 246 PRO PRO B . n 
B 1 247 ILE 247 247 247 ILE ILE B . n 
B 1 248 ASN 248 248 248 ASN ASN B . n 
B 1 249 ALA 249 249 249 ALA ALA B . n 
B 1 250 LEU 250 250 250 LEU LEU B . n 
B 1 251 GLN 251 251 251 GLN GLN B . n 
B 1 252 ALA 252 252 252 ALA ALA B . n 
B 1 253 ALA 253 253 253 ALA ALA B . n 
B 1 254 MET 254 254 254 MET MET B . n 
B 1 255 GLU 255 255 255 GLU GLU B . n 
B 1 256 GLY 256 256 256 GLY GLY B . n 
B 1 257 TYR 257 257 257 TYR TYR B . n 
B 1 258 GLU 258 258 258 GLU GLU B . n 
B 1 259 VAL 259 259 259 VAL VAL B . n 
B 1 260 THR 260 260 260 THR THR B . n 
B 1 261 THR 261 261 261 THR THR B . n 
B 1 262 MET 262 262 262 MET MET B . n 
B 1 263 ASP 263 263 263 ASP ASP B . n 
B 1 264 GLU 264 264 264 GLU GLU B . n 
B 1 265 ALA 265 265 265 ALA ALA B . n 
B 1 266 CYS 266 266 266 CYS CYS B . n 
B 1 267 GLN 267 267 267 GLN GLN B . n 
B 1 268 GLU 268 268 268 GLU GLU B . n 
B 1 269 GLY 269 269 269 GLY GLY B . n 
B 1 270 ASN 270 270 270 ASN ASN B . n 
B 1 271 ILE 271 271 271 ILE ILE B . n 
B 1 272 PHE 272 272 272 PHE PHE B . n 
B 1 273 VAL 273 273 273 VAL VAL B . n 
B 1 274 THR 274 274 274 THR THR B . n 
B 1 275 THR 275 275 275 THR THR B . n 
B 1 276 THR 276 276 276 THR THR B . n 
B 1 277 GLY 277 277 277 GLY GLY B . n 
B 1 278 CYS 278 278 278 CYS CYS B . n 
B 1 279 ILE 279 279 279 ILE ILE B . n 
B 1 280 ASP 280 280 280 ASP ASP B . n 
B 1 281 ILE 281 281 281 ILE ILE B . n 
B 1 282 ILE 282 282 282 ILE ILE B . n 
B 1 283 LEU 283 283 283 LEU LEU B . n 
B 1 284 GLY 284 284 284 GLY GLY B . n 
B 1 285 ARG 285 285 285 ARG ARG B . n 
B 1 286 HIS 286 286 286 HIS HIS B . n 
B 1 287 PHE 287 287 287 PHE PHE B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 GLN 289 289 289 GLN GLN B . n 
B 1 290 MET 290 290 290 MET MET B . n 
B 1 291 LYS 291 291 291 LYS LYS B . n 
B 1 292 ASP 292 292 292 ASP ASP B . n 
B 1 293 ASP 293 293 293 ASP ASP B . n 
B 1 294 ALA 294 294 294 ALA ALA B . n 
B 1 295 ILE 295 295 295 ILE ILE B . n 
B 1 296 VAL 296 296 296 VAL VAL B . n 
B 1 297 CYS 297 297 297 CYS CYS B . n 
B 1 298 ASN 298 298 298 ASN ASN B . n 
B 1 299 ILE 299 299 299 ILE ILE B . n 
B 1 300 GLY 300 300 300 GLY GLY B . n 
B 1 301 HIS 301 301 301 HIS HIS B . n 
B 1 302 PHE 302 302 302 PHE PHE B . n 
B 1 303 ASP 303 303 303 ASP ASP B . n 
B 1 304 VAL 304 304 304 VAL VAL B . n 
B 1 305 GLU 305 305 305 GLU GLU B . n 
B 1 306 ILE 306 306 306 ILE ILE B . n 
B 1 307 ASP 307 307 307 ASP ASP B . n 
B 1 308 VAL 308 308 308 VAL VAL B . n 
B 1 309 LYS 309 309 309 LYS LYS B . n 
B 1 310 TRP 310 310 310 TRP TRP B . n 
B 1 311 LEU 311 311 311 LEU LEU B . n 
B 1 312 ASN 312 312 312 ASN ASN B . n 
B 1 313 GLU 313 313 313 GLU GLU B . n 
B 1 314 ASN 314 314 314 ASN ASN B . n 
B 1 315 ALA 315 315 315 ALA ALA B . n 
B 1 316 VAL 316 316 316 VAL VAL B . n 
B 1 317 GLU 317 317 317 GLU GLU B . n 
B 1 318 LYS 318 318 318 LYS LYS B . n 
B 1 319 VAL 319 319 319 VAL VAL B . n 
B 1 320 ASN 320 320 320 ASN ASN B . n 
B 1 321 ILE 321 321 321 ILE ILE B . n 
B 1 322 LYS 322 322 322 LYS LYS B . n 
B 1 323 PRO 323 323 323 PRO PRO B . n 
B 1 324 GLN 324 324 324 GLN GLN B . n 
B 1 325 VAL 325 325 325 VAL VAL B . n 
B 1 326 ASP 326 326 326 ASP ASP B . n 
B 1 327 ARG 327 327 327 ARG ARG B . n 
B 1 328 TYR 328 328 328 TYR TYR B . n 
B 1 329 ARG 329 329 329 ARG ARG B . n 
B 1 330 LEU 330 330 330 LEU LEU B . n 
B 1 331 LYS 331 331 331 LYS LYS B . n 
B 1 332 ASN 332 332 332 ASN ASN B . n 
B 1 333 GLY 333 333 333 GLY GLY B . n 
B 1 334 ARG 334 334 334 ARG ARG B . n 
B 1 335 ARG 335 335 335 ARG ARG B . n 
B 1 336 ILE 336 336 336 ILE ILE B . n 
B 1 337 ILE 337 337 337 ILE ILE B . n 
B 1 338 LEU 338 338 338 LEU LEU B . n 
B 1 339 LEU 339 339 339 LEU LEU B . n 
B 1 340 ALA 340 340 340 ALA ALA B . n 
B 1 341 GLU 341 341 341 GLU GLU B . n 
B 1 342 GLY 342 342 342 GLY GLY B . n 
B 1 343 ARG 343 343 343 ARG ARG B . n 
B 1 344 LEU 344 344 344 LEU LEU B . n 
B 1 345 VAL 345 345 345 VAL VAL B . n 
B 1 346 ASN 346 346 346 ASN ASN B . n 
B 1 347 LEU 347 347 347 LEU LEU B . n 
B 1 348 GLY 348 348 348 GLY GLY B . n 
B 1 349 CYS 349 349 349 CYS CYS B . n 
B 1 350 ALA 350 350 350 ALA ALA B . n 
B 1 351 MET 351 351 351 MET MET B . n 
B 1 352 GLY 352 352 352 GLY GLY B . n 
B 1 353 HIS 353 353 353 HIS HIS B . n 
B 1 354 PRO 354 354 354 PRO PRO B . n 
B 1 355 SER 355 355 355 SER SER B . n 
B 1 356 PHE 356 356 356 PHE PHE B . n 
B 1 357 VAL 357 357 357 VAL VAL B . n 
B 1 358 MET 358 358 358 MET MET B . n 
B 1 359 SER 359 359 359 SER SER B . n 
B 1 360 ASN 360 360 360 ASN ASN B . n 
B 1 361 SER 361 361 361 SER SER B . n 
B 1 362 PHE 362 362 362 PHE PHE B . n 
B 1 363 THR 363 363 363 THR THR B . n 
B 1 364 ASN 364 364 364 ASN ASN B . n 
B 1 365 GLN 365 365 365 GLN GLN B . n 
B 1 366 VAL 366 366 366 VAL VAL B . n 
B 1 367 MET 367 367 367 MET MET B . n 
B 1 368 ALA 368 368 368 ALA ALA B . n 
B 1 369 GLN 369 369 369 GLN GLN B . n 
B 1 370 ILE 370 370 370 ILE ILE B . n 
B 1 371 GLU 371 371 371 GLU GLU B . n 
B 1 372 LEU 372 372 372 LEU LEU B . n 
B 1 373 TRP 373 373 373 TRP TRP B . n 
B 1 374 THR 374 374 374 THR THR B . n 
B 1 375 HIS 375 375 375 HIS HIS B . n 
B 1 376 PRO 376 376 376 PRO PRO B . n 
B 1 377 ASP 377 377 377 ASP ASP B . n 
B 1 378 LYS 378 378 378 LYS LYS B . n 
B 1 379 TYR 379 379 379 TYR TYR B . n 
B 1 380 PRO 380 380 380 PRO PRO B . n 
B 1 381 VAL 381 381 381 VAL VAL B . n 
B 1 382 GLY 382 382 382 GLY GLY B . n 
B 1 383 VAL 383 383 383 VAL VAL B . n 
B 1 384 HIS 384 384 384 HIS HIS B . n 
B 1 385 PHE 385 385 385 PHE PHE B . n 
B 1 386 LEU 386 386 386 LEU LEU B . n 
B 1 387 PRO 387 387 387 PRO PRO B . n 
B 1 388 LYS 388 388 388 LYS LYS B . n 
B 1 389 LYS 389 389 389 LYS LYS B . n 
B 1 390 LEU 390 390 390 LEU LEU B . n 
B 1 391 ASP 391 391 391 ASP ASP B . n 
B 1 392 GLU 392 392 392 GLU GLU B . n 
B 1 393 ALA 393 393 393 ALA ALA B . n 
B 1 394 VAL 394 394 394 VAL VAL B . n 
B 1 395 ALA 395 395 395 ALA ALA B . n 
B 1 396 GLU 396 396 396 GLU GLU B . n 
B 1 397 ALA 397 397 397 ALA ALA B . n 
B 1 398 HIS 398 398 398 HIS HIS B . n 
B 1 399 LEU 399 399 399 LEU LEU B . n 
B 1 400 GLY 400 400 400 GLY GLY B . n 
B 1 401 LYS 401 401 401 LYS LYS B . n 
B 1 402 LEU 402 402 402 LEU LEU B . n 
B 1 403 ASN 403 403 403 ASN ASN B . n 
B 1 404 VAL 404 404 404 VAL VAL B . n 
B 1 405 LYS 405 405 405 LYS LYS B . n 
B 1 406 LEU 406 406 406 LEU LEU B . n 
B 1 407 THR 407 407 407 THR THR B . n 
B 1 408 LYS 408 408 408 LYS LYS B . n 
B 1 409 LEU 409 409 409 LEU LEU B . n 
B 1 410 THR 410 410 410 THR THR B . n 
B 1 411 GLU 411 411 411 GLU GLU B . n 
B 1 412 LYS 412 412 412 LYS LYS B . n 
B 1 413 GLN 413 413 413 GLN GLN B . n 
B 1 414 ALA 414 414 414 ALA ALA B . n 
B 1 415 GLN 415 415 415 GLN GLN B . n 
B 1 416 TYR 416 416 416 TYR TYR B . n 
B 1 417 LEU 417 417 417 LEU LEU B . n 
B 1 418 GLY 418 418 418 GLY GLY B . n 
B 1 419 MET 419 419 419 MET MET B . n 
B 1 420 SER 420 420 420 SER SER B . n 
B 1 421 CYS 421 421 421 CYS CYS B . n 
B 1 422 ASP 422 422 422 ASP ASP B . n 
B 1 423 GLY 423 423 423 GLY GLY B . n 
B 1 424 PRO 424 424 424 PRO PRO B . n 
B 1 425 PHE 425 425 425 PHE PHE B . n 
B 1 426 LYS 426 426 426 LYS LYS B . n 
B 1 427 PRO 427 427 427 PRO PRO B . n 
B 1 428 ASP 428 428 428 ASP ASP B . n 
B 1 429 HIS 429 429 429 HIS HIS B . n 
B 1 430 TYR 430 430 430 TYR TYR B . n 
B 1 431 ARG 431 431 431 ARG ARG B . n 
B 1 432 TYR 432 432 432 TYR TYR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAI 1   501 433 NAI NAI A . 
D 3 XFA 1   502 434 XFA FA  A . 
E 2 NAI 1   501 433 NAI NAI B . 
F 3 XFA 1   502 434 XFA FA  B . 
G 4 HOH 1   601 68  HOH HOH A . 
G 4 HOH 2   602 183 HOH HOH A . 
G 4 HOH 3   603 77  HOH HOH A . 
G 4 HOH 4   604 188 HOH HOH A . 
G 4 HOH 5   605 84  HOH HOH A . 
G 4 HOH 6   606 11  HOH HOH A . 
G 4 HOH 7   607 100 HOH HOH A . 
G 4 HOH 8   608 25  HOH HOH A . 
G 4 HOH 9   609 135 HOH HOH A . 
G 4 HOH 10  610 52  HOH HOH A . 
G 4 HOH 11  611 116 HOH HOH A . 
G 4 HOH 12  612 7   HOH HOH A . 
G 4 HOH 13  613 141 HOH HOH A . 
G 4 HOH 14  614 155 HOH HOH A . 
G 4 HOH 15  615 31  HOH HOH A . 
G 4 HOH 16  616 24  HOH HOH A . 
G 4 HOH 17  617 197 HOH HOH A . 
G 4 HOH 18  618 13  HOH HOH A . 
G 4 HOH 19  619 156 HOH HOH A . 
G 4 HOH 20  620 152 HOH HOH A . 
G 4 HOH 21  621 186 HOH HOH A . 
G 4 HOH 22  622 234 HOH HOH A . 
G 4 HOH 23  623 106 HOH HOH A . 
G 4 HOH 24  624 15  HOH HOH A . 
G 4 HOH 25  625 83  HOH HOH A . 
G 4 HOH 26  626 8   HOH HOH A . 
G 4 HOH 27  627 207 HOH HOH A . 
G 4 HOH 28  628 28  HOH HOH A . 
G 4 HOH 29  629 143 HOH HOH A . 
G 4 HOH 30  630 62  HOH HOH A . 
G 4 HOH 31  631 23  HOH HOH A . 
G 4 HOH 32  632 140 HOH HOH A . 
G 4 HOH 33  633 35  HOH HOH A . 
G 4 HOH 34  634 235 HOH HOH A . 
G 4 HOH 35  635 90  HOH HOH A . 
G 4 HOH 36  636 89  HOH HOH A . 
G 4 HOH 37  637 32  HOH HOH A . 
G 4 HOH 38  638 75  HOH HOH A . 
G 4 HOH 39  639 136 HOH HOH A . 
G 4 HOH 40  640 1   HOH HOH A . 
G 4 HOH 41  641 150 HOH HOH A . 
G 4 HOH 42  642 74  HOH HOH A . 
G 4 HOH 43  643 12  HOH HOH A . 
G 4 HOH 44  644 137 HOH HOH A . 
G 4 HOH 45  645 29  HOH HOH A . 
G 4 HOH 46  646 119 HOH HOH A . 
G 4 HOH 47  647 212 HOH HOH A . 
G 4 HOH 48  648 30  HOH HOH A . 
G 4 HOH 49  649 166 HOH HOH A . 
G 4 HOH 50  650 130 HOH HOH A . 
G 4 HOH 51  651 65  HOH HOH A . 
G 4 HOH 52  652 185 HOH HOH A . 
G 4 HOH 53  653 6   HOH HOH A . 
G 4 HOH 54  654 179 HOH HOH A . 
G 4 HOH 55  655 121 HOH HOH A . 
G 4 HOH 56  656 41  HOH HOH A . 
G 4 HOH 57  657 213 HOH HOH A . 
G 4 HOH 58  658 71  HOH HOH A . 
G 4 HOH 59  659 168 HOH HOH A . 
G 4 HOH 60  660 88  HOH HOH A . 
G 4 HOH 61  661 236 HOH HOH A . 
G 4 HOH 62  662 200 HOH HOH A . 
G 4 HOH 63  663 167 HOH HOH A . 
G 4 HOH 64  664 101 HOH HOH A . 
G 4 HOH 65  665 122 HOH HOH A . 
G 4 HOH 66  666 56  HOH HOH A . 
G 4 HOH 67  667 33  HOH HOH A . 
G 4 HOH 68  668 10  HOH HOH A . 
G 4 HOH 69  669 102 HOH HOH A . 
G 4 HOH 70  670 142 HOH HOH A . 
G 4 HOH 71  671 79  HOH HOH A . 
G 4 HOH 72  672 81  HOH HOH A . 
G 4 HOH 73  673 104 HOH HOH A . 
G 4 HOH 74  674 184 HOH HOH A . 
G 4 HOH 75  675 232 HOH HOH A . 
G 4 HOH 76  676 64  HOH HOH A . 
G 4 HOH 77  677 217 HOH HOH A . 
G 4 HOH 78  678 50  HOH HOH A . 
G 4 HOH 79  679 189 HOH HOH A . 
G 4 HOH 80  680 139 HOH HOH A . 
G 4 HOH 81  681 194 HOH HOH A . 
G 4 HOH 82  682 238 HOH HOH A . 
G 4 HOH 83  683 201 HOH HOH A . 
G 4 HOH 84  684 195 HOH HOH A . 
G 4 HOH 85  685 138 HOH HOH A . 
G 4 HOH 86  686 105 HOH HOH A . 
G 4 HOH 87  687 67  HOH HOH A . 
G 4 HOH 88  688 60  HOH HOH A . 
G 4 HOH 89  689 120 HOH HOH A . 
G 4 HOH 90  690 154 HOH HOH A . 
G 4 HOH 91  691 118 HOH HOH A . 
G 4 HOH 92  692 219 HOH HOH A . 
G 4 HOH 93  693 97  HOH HOH A . 
G 4 HOH 94  694 231 HOH HOH A . 
G 4 HOH 95  695 123 HOH HOH A . 
G 4 HOH 96  696 82  HOH HOH A . 
G 4 HOH 97  697 63  HOH HOH A . 
G 4 HOH 98  698 216 HOH HOH A . 
G 4 HOH 99  699 215 HOH HOH A . 
G 4 HOH 100 700 229 HOH HOH A . 
G 4 HOH 101 701 244 HOH HOH A . 
G 4 HOH 102 702 27  HOH HOH A . 
G 4 HOH 103 703 107 HOH HOH A . 
G 4 HOH 104 704 163 HOH HOH A . 
G 4 HOH 105 705 40  HOH HOH A . 
G 4 HOH 106 706 133 HOH HOH A . 
G 4 HOH 107 707 211 HOH HOH A . 
G 4 HOH 108 708 239 HOH HOH A . 
G 4 HOH 109 709 128 HOH HOH A . 
G 4 HOH 110 710 39  HOH HOH A . 
G 4 HOH 111 711 103 HOH HOH A . 
G 4 HOH 112 712 233 HOH HOH A . 
G 4 HOH 113 713 237 HOH HOH A . 
G 4 HOH 114 714 230 HOH HOH A . 
H 4 HOH 1   601 191 HOH HOH B . 
H 4 HOH 2   602 241 HOH HOH B . 
H 4 HOH 3   603 190 HOH HOH B . 
H 4 HOH 4   604 98  HOH HOH B . 
H 4 HOH 5   605 57  HOH HOH B . 
H 4 HOH 6   606 95  HOH HOH B . 
H 4 HOH 7   607 22  HOH HOH B . 
H 4 HOH 8   608 4   HOH HOH B . 
H 4 HOH 9   609 164 HOH HOH B . 
H 4 HOH 10  610 36  HOH HOH B . 
H 4 HOH 11  611 162 HOH HOH B . 
H 4 HOH 12  612 21  HOH HOH B . 
H 4 HOH 13  613 38  HOH HOH B . 
H 4 HOH 14  614 171 HOH HOH B . 
H 4 HOH 15  615 94  HOH HOH B . 
H 4 HOH 16  616 80  HOH HOH B . 
H 4 HOH 17  617 59  HOH HOH B . 
H 4 HOH 18  618 20  HOH HOH B . 
H 4 HOH 19  619 222 HOH HOH B . 
H 4 HOH 20  620 208 HOH HOH B . 
H 4 HOH 21  621 70  HOH HOH B . 
H 4 HOH 22  622 114 HOH HOH B . 
H 4 HOH 23  623 180 HOH HOH B . 
H 4 HOH 24  624 14  HOH HOH B . 
H 4 HOH 25  625 99  HOH HOH B . 
H 4 HOH 26  626 131 HOH HOH B . 
H 4 HOH 27  627 51  HOH HOH B . 
H 4 HOH 28  628 37  HOH HOH B . 
H 4 HOH 29  629 170 HOH HOH B . 
H 4 HOH 30  630 153 HOH HOH B . 
H 4 HOH 31  631 16  HOH HOH B . 
H 4 HOH 32  632 87  HOH HOH B . 
H 4 HOH 33  633 18  HOH HOH B . 
H 4 HOH 34  634 192 HOH HOH B . 
H 4 HOH 35  635 45  HOH HOH B . 
H 4 HOH 36  636 76  HOH HOH B . 
H 4 HOH 37  637 93  HOH HOH B . 
H 4 HOH 38  638 46  HOH HOH B . 
H 4 HOH 39  639 17  HOH HOH B . 
H 4 HOH 40  640 44  HOH HOH B . 
H 4 HOH 41  641 34  HOH HOH B . 
H 4 HOH 42  642 9   HOH HOH B . 
H 4 HOH 43  643 92  HOH HOH B . 
H 4 HOH 44  644 161 HOH HOH B . 
H 4 HOH 45  645 209 HOH HOH B . 
H 4 HOH 46  646 53  HOH HOH B . 
H 4 HOH 47  647 5   HOH HOH B . 
H 4 HOH 48  648 203 HOH HOH B . 
H 4 HOH 49  649 19  HOH HOH B . 
H 4 HOH 50  650 144 HOH HOH B . 
H 4 HOH 51  651 127 HOH HOH B . 
H 4 HOH 52  652 221 HOH HOH B . 
H 4 HOH 53  653 112 HOH HOH B . 
H 4 HOH 54  654 110 HOH HOH B . 
H 4 HOH 55  655 55  HOH HOH B . 
H 4 HOH 56  656 72  HOH HOH B . 
H 4 HOH 57  657 134 HOH HOH B . 
H 4 HOH 58  658 73  HOH HOH B . 
H 4 HOH 59  659 108 HOH HOH B . 
H 4 HOH 60  660 78  HOH HOH B . 
H 4 HOH 61  661 61  HOH HOH B . 
H 4 HOH 62  662 48  HOH HOH B . 
H 4 HOH 63  663 178 HOH HOH B . 
H 4 HOH 64  664 175 HOH HOH B . 
H 4 HOH 65  665 181 HOH HOH B . 
H 4 HOH 66  666 86  HOH HOH B . 
H 4 HOH 67  667 157 HOH HOH B . 
H 4 HOH 68  668 126 HOH HOH B . 
H 4 HOH 69  669 145 HOH HOH B . 
H 4 HOH 70  670 214 HOH HOH B . 
H 4 HOH 71  671 117 HOH HOH B . 
H 4 HOH 72  672 115 HOH HOH B . 
H 4 HOH 73  673 2   HOH HOH B . 
H 4 HOH 74  674 3   HOH HOH B . 
H 4 HOH 75  675 58  HOH HOH B . 
H 4 HOH 76  676 109 HOH HOH B . 
H 4 HOH 77  677 66  HOH HOH B . 
H 4 HOH 78  678 69  HOH HOH B . 
H 4 HOH 79  679 43  HOH HOH B . 
H 4 HOH 80  680 129 HOH HOH B . 
H 4 HOH 81  681 125 HOH HOH B . 
H 4 HOH 82  682 243 HOH HOH B . 
H 4 HOH 83  683 169 HOH HOH B . 
H 4 HOH 84  684 223 HOH HOH B . 
H 4 HOH 85  685 218 HOH HOH B . 
H 4 HOH 86  686 146 HOH HOH B . 
H 4 HOH 87  687 160 HOH HOH B . 
H 4 HOH 88  688 147 HOH HOH B . 
H 4 HOH 89  689 96  HOH HOH B . 
H 4 HOH 90  690 42  HOH HOH B . 
H 4 HOH 91  691 210 HOH HOH B . 
H 4 HOH 92  692 91  HOH HOH B . 
H 4 HOH 93  693 182 HOH HOH B . 
H 4 HOH 94  694 187 HOH HOH B . 
H 4 HOH 95  695 85  HOH HOH B . 
H 4 HOH 96  696 226 HOH HOH B . 
H 4 HOH 97  697 148 HOH HOH B . 
H 4 HOH 98  698 159 HOH HOH B . 
H 4 HOH 99  699 124 HOH HOH B . 
H 4 HOH 100 700 132 HOH HOH B . 
H 4 HOH 101 701 205 HOH HOH B . 
H 4 HOH 102 702 225 HOH HOH B . 
H 4 HOH 103 703 47  HOH HOH B . 
H 4 HOH 104 704 149 HOH HOH B . 
H 4 HOH 105 705 172 HOH HOH B . 
H 4 HOH 106 706 176 HOH HOH B . 
H 4 HOH 107 707 174 HOH HOH B . 
H 4 HOH 108 708 165 HOH HOH B . 
H 4 HOH 109 709 204 HOH HOH B . 
H 4 HOH 110 710 206 HOH HOH B . 
H 4 HOH 111 711 193 HOH HOH B . 
H 4 HOH 112 712 26  HOH HOH B . 
H 4 HOH 113 713 202 HOH HOH B . 
H 4 HOH 114 714 227 HOH HOH B . 
H 4 HOH 115 715 196 HOH HOH B . 
H 4 HOH 116 716 49  HOH HOH B . 
H 4 HOH 117 717 158 HOH HOH B . 
H 4 HOH 118 718 198 HOH HOH B . 
H 4 HOH 119 719 151 HOH HOH B . 
H 4 HOH 120 720 113 HOH HOH B . 
H 4 HOH 121 721 111 HOH HOH B . 
H 4 HOH 122 722 54  HOH HOH B . 
H 4 HOH 123 723 220 HOH HOH B . 
H 4 HOH 124 724 199 HOH HOH B . 
H 4 HOH 125 725 177 HOH HOH B . 
H 4 HOH 126 726 224 HOH HOH B . 
H 4 HOH 127 727 173 HOH HOH B . 
H 4 HOH 128 728 240 HOH HOH B . 
H 4 HOH 129 729 242 HOH HOH B . 
H 4 HOH 130 730 228 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 24610 ? 
1 MORE         -108  ? 
1 'SSA (A^2)'  55510 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 4_575 x,-y+2,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 268.3000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-11-25 
2 'Structure model' 1 1 2020-02-05 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'      
2 2 'Structure model' 'Database references'  
3 2 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation              
2 2 'Structure model' diffrn_source         
3 2 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_id_CSD'                  
2 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
3 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? CNX      ? ? ? 2002 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .    2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .    3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? AMoRE    ? ? ? .    4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 TYR A 7   ? ? -177.59 -173.48 
2  1 LYS A 8   ? ? -174.05 99.45   
3  1 LYS A 43  ? ? 37.15   72.72   
4  1 HIS A 55  ? ? -27.92  110.75  
5  1 PRO A 98  ? ? -56.28  103.61  
6  1 ASN A 191 ? ? -100.71 -62.89  
7  1 THR A 275 ? ? -144.66 24.27   
8  1 PHE A 302 ? ? 3.64    -90.85  
9  1 ASP A 303 ? ? -147.25 24.55   
10 1 TYR B 7   ? ? 172.60  177.45  
11 1 ALA B 10  ? ? -45.93  -75.02  
12 1 HIS B 55  ? ? -26.32  115.33  
13 1 ASN B 191 ? ? -101.98 -60.87  
14 1 PHE B 302 ? ? 13.51   -80.92  
15 1 ASP B 303 ? ? -155.96 26.15   
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1 ? A MET 1 
2 1 Y 1 A SER 2 ? A SER 2 
3 1 Y 1 A ASP 3 ? A ASP 3 
4 1 Y 1 B MET 1 ? B MET 1 
5 1 Y 1 B SER 2 ? B SER 2 
6 1 Y 1 B ASP 3 ? B ASP 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '1,4-DIHYDRONICOTINAMIDE ADENINE DINUCLEOTIDE' NAI 
3 
;2-{[5-chloro-2-(4-chlorophenoxy)phenyl](2-{[2-(methylamino)ethyl]amino}-2-oxoethyl)amino}-N-(1,3-dihydro-2H-isoindol-2-yl)-N-methylacetamide
;
XFA 
4 water HOH 
#