data_4YVG
# 
_entry.id   4YVG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YVG         
WWPDB D_1000208141 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4YVH unspecified 
PDB . 4YVI unspecified 
PDB . 4YVJ unspecified 
PDB . 4YVK unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YVG 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-20 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ito, T.'      1 
'Yokoyama, S.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            112 
_citation.language                  ? 
_citation.page_first                E4197 
_citation.page_last                 E4205 
_citation.title                     
'Structural basis for methyl-donor-dependent and sequence-specific binding to tRNA substrates by knotted methyltransferase TrmD.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1422981112 
_citation.pdbx_database_id_PubMed   26183229 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ito, T.'      1 ? 
primary 'Masuda, I.'   2 ? 
primary 'Yoshida, K.'  3 ? 
primary 'Goto-Ito, S.' 4 ? 
primary 'Sekine, S.'   5 ? 
primary 'Suh, S.W.'    6 ? 
primary 'Hou, Y.M.'    7 ? 
primary 'Yokoyama, S.' 8 ? 
# 
_cell.entry_id           4YVG 
_cell.length_a           93.869 
_cell.length_b           93.869 
_cell.length_c           177.952 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              18 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4YVG 
_symmetry.space_group_name_H-M             'H 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                155 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'tRNA (guanine-N(1)-)-methyltransferase' 29750.016 1   2.1.1.228 ? ? ? 
2 non-polymer syn S-ADENOSYLMETHIONINE                     398.437   1   ?         ? ? ? 
3 water       nat water                                    18.015    280 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'M1G-methyltransferase,tRNA [GM37] methyltransferase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGM
LMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTG
GELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRR
PELLEGLALTDEQRKLLKEAQAEHNS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGM
LMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTG
GELPAMTLIDAVARFIPGVLGKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRR
PELLEGLALTDEQRKLLKEAQAEHNS
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  TRP n 
1 23  ILE n 
1 24  GLY n 
1 25  VAL n 
1 26  ILE n 
1 27  SER n 
1 28  LEU n 
1 29  PHE n 
1 30  PRO n 
1 31  GLU n 
1 32  MET n 
1 33  PHE n 
1 34  LYS n 
1 35  ALA n 
1 36  ILE n 
1 37  THR n 
1 38  GLU n 
1 39  PHE n 
1 40  GLY n 
1 41  VAL n 
1 42  THR n 
1 43  GLY n 
1 44  ARG n 
1 45  ALA n 
1 46  VAL n 
1 47  LYS n 
1 48  HIS n 
1 49  ASN n 
1 50  LEU n 
1 51  LEU n 
1 52  LYS n 
1 53  VAL n 
1 54  GLU n 
1 55  CYS n 
1 56  TRP n 
1 57  ASN n 
1 58  PRO n 
1 59  ARG n 
1 60  ASP n 
1 61  PHE n 
1 62  THR n 
1 63  PHE n 
1 64  ASP n 
1 65  LYS n 
1 66  HIS n 
1 67  LYS n 
1 68  THR n 
1 69  VAL n 
1 70  ASP n 
1 71  ASP n 
1 72  ARG n 
1 73  PRO n 
1 74  TYR n 
1 75  GLY n 
1 76  GLY n 
1 77  GLY n 
1 78  PRO n 
1 79  GLY n 
1 80  MET n 
1 81  LEU n 
1 82  MET n 
1 83  MET n 
1 84  VAL n 
1 85  GLN n 
1 86  PRO n 
1 87  LEU n 
1 88  ARG n 
1 89  ASP n 
1 90  ALA n 
1 91  ILE n 
1 92  HIS n 
1 93  THR n 
1 94  ALA n 
1 95  LYS n 
1 96  ALA n 
1 97  ALA n 
1 98  ALA n 
1 99  GLY n 
1 100 GLU n 
1 101 GLY n 
1 102 ALA n 
1 103 LYS n 
1 104 VAL n 
1 105 ILE n 
1 106 TYR n 
1 107 LEU n 
1 108 SER n 
1 109 PRO n 
1 110 GLN n 
1 111 GLY n 
1 112 ARG n 
1 113 LYS n 
1 114 LEU n 
1 115 ASP n 
1 116 GLN n 
1 117 GLY n 
1 118 GLY n 
1 119 VAL n 
1 120 THR n 
1 121 GLU n 
1 122 LEU n 
1 123 ALA n 
1 124 GLN n 
1 125 ASN n 
1 126 GLN n 
1 127 LYS n 
1 128 LEU n 
1 129 ILE n 
1 130 LEU n 
1 131 VAL n 
1 132 CYS n 
1 133 GLY n 
1 134 ARG n 
1 135 TYR n 
1 136 GLU n 
1 137 GLY n 
1 138 ILE n 
1 139 ASP n 
1 140 GLU n 
1 141 ARG n 
1 142 LEU n 
1 143 ILE n 
1 144 GLN n 
1 145 THR n 
1 146 GLU n 
1 147 ILE n 
1 148 ASP n 
1 149 GLU n 
1 150 GLU n 
1 151 TRP n 
1 152 SER n 
1 153 ILE n 
1 154 GLY n 
1 155 ASP n 
1 156 TYR n 
1 157 VAL n 
1 158 LEU n 
1 159 THR n 
1 160 GLY n 
1 161 GLY n 
1 162 GLU n 
1 163 LEU n 
1 164 PRO n 
1 165 ALA n 
1 166 MET n 
1 167 THR n 
1 168 LEU n 
1 169 ILE n 
1 170 ASP n 
1 171 ALA n 
1 172 VAL n 
1 173 ALA n 
1 174 ARG n 
1 175 PHE n 
1 176 ILE n 
1 177 PRO n 
1 178 GLY n 
1 179 VAL n 
1 180 LEU n 
1 181 GLY n 
1 182 LYS n 
1 183 GLN n 
1 184 ALA n 
1 185 SER n 
1 186 ALA n 
1 187 GLU n 
1 188 GLU n 
1 189 ASP n 
1 190 SER n 
1 191 PHE n 
1 192 ALA n 
1 193 ASP n 
1 194 GLY n 
1 195 LEU n 
1 196 LEU n 
1 197 ASP n 
1 198 CYS n 
1 199 PRO n 
1 200 HIS n 
1 201 TYR n 
1 202 THR n 
1 203 ARG n 
1 204 PRO n 
1 205 GLU n 
1 206 VAL n 
1 207 LEU n 
1 208 GLU n 
1 209 GLY n 
1 210 LEU n 
1 211 THR n 
1 212 VAL n 
1 213 PRO n 
1 214 PRO n 
1 215 VAL n 
1 216 LEU n 
1 217 MET n 
1 218 SER n 
1 219 GLY n 
1 220 HIS n 
1 221 HIS n 
1 222 GLU n 
1 223 GLU n 
1 224 ILE n 
1 225 ARG n 
1 226 LYS n 
1 227 TRP n 
1 228 ARG n 
1 229 LEU n 
1 230 LYS n 
1 231 GLN n 
1 232 SER n 
1 233 LEU n 
1 234 GLN n 
1 235 ARG n 
1 236 THR n 
1 237 TRP n 
1 238 LEU n 
1 239 ARG n 
1 240 ARG n 
1 241 PRO n 
1 242 GLU n 
1 243 LEU n 
1 244 LEU n 
1 245 GLU n 
1 246 GLY n 
1 247 LEU n 
1 248 ALA n 
1 249 LEU n 
1 250 THR n 
1 251 ASP n 
1 252 GLU n 
1 253 GLN n 
1 254 ARG n 
1 255 LYS n 
1 256 LEU n 
1 257 LEU n 
1 258 LYS n 
1 259 GLU n 
1 260 ALA n 
1 261 GLN n 
1 262 ALA n 
1 263 GLU n 
1 264 HIS n 
1 265 ASN n 
1 266 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   266 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'trmD, HI_0202' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'ATCC 51907 / DSM 11121 / KW20 / Rd' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     71421 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.db_code                    TRMD_HAEIN 
_struct_ref.db_name                    UNP 
_struct_ref.details                    ? 
_struct_ref.entity_id                  1 
_struct_ref.id                         1 
_struct_ref.seq_align                  ? 
_struct_ref.seq_dif                    ? 
_struct_ref.pdbx_db_accession          P43912 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   
;MWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGE
GAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVL
GKQASAEEDSFADGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEA
QAEHNS
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_align_end             ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4YVG 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 21 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 266 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P43912 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  246 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       246 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4YVG MET A 1  ? UNP P43912 ? ? 'expression tag' -19 1  
1 4YVG GLY A 2  ? UNP P43912 ? ? 'expression tag' -18 2  
1 4YVG SER A 3  ? UNP P43912 ? ? 'expression tag' -17 3  
1 4YVG SER A 4  ? UNP P43912 ? ? 'expression tag' -16 4  
1 4YVG HIS A 5  ? UNP P43912 ? ? 'expression tag' -15 5  
1 4YVG HIS A 6  ? UNP P43912 ? ? 'expression tag' -14 6  
1 4YVG HIS A 7  ? UNP P43912 ? ? 'expression tag' -13 7  
1 4YVG HIS A 8  ? UNP P43912 ? ? 'expression tag' -12 8  
1 4YVG HIS A 9  ? UNP P43912 ? ? 'expression tag' -11 9  
1 4YVG HIS A 10 ? UNP P43912 ? ? 'expression tag' -10 10 
1 4YVG SER A 11 ? UNP P43912 ? ? 'expression tag' -9  11 
1 4YVG SER A 12 ? UNP P43912 ? ? 'expression tag' -8  12 
1 4YVG GLY A 13 ? UNP P43912 ? ? 'expression tag' -7  13 
1 4YVG LEU A 14 ? UNP P43912 ? ? 'expression tag' -6  14 
1 4YVG VAL A 15 ? UNP P43912 ? ? 'expression tag' -5  15 
1 4YVG PRO A 16 ? UNP P43912 ? ? 'expression tag' -4  16 
1 4YVG ARG A 17 ? UNP P43912 ? ? 'expression tag' -3  17 
1 4YVG GLY A 18 ? UNP P43912 ? ? 'expression tag' -2  18 
1 4YVG SER A 19 ? UNP P43912 ? ? 'expression tag' -1  19 
1 4YVG HIS A 20 ? UNP P43912 ? ? 'expression tag' 0   20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'      115.130 
SAM non-polymer         . S-ADENOSYLMETHIONINE ? 'C15 H22 N6 O5 S' 398.437 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YVG 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.54 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.50 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;sodium citrate,
CHES
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 210' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-02-23 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE AR-NW12A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   AR-NW12A 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4YVG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.549 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       83679 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            31.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4YVG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     40917 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             36.806 
_refine.ls_d_res_high                            1.549 
_refine.ls_percent_reflns_obs                    92.75 
_refine.ls_R_factor_obs                          0.1752 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1740 
_refine.ls_R_factor_R_free                       0.2005 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.62 
_refine.ls_number_reflns_R_free                  1889 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            2.3371 
_refine.aniso_B[2][2]                            2.3371 
_refine.aniso_B[3][3]                            -4.6741 
_refine.aniso_B[1][2]                            -0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.392 
_refine.solvent_model_param_bsol                 59.930 
_refine.pdbx_solvent_vdw_probe_radii             0.90 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.61 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1UAJ 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.18 
_refine.pdbx_overall_phase_error                 19.68 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1891 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         27 
_refine_hist.number_atoms_solvent             280 
_refine_hist.number_atoms_total               2198 
_refine_hist.d_res_high                       1.549 
_refine_hist.d_res_low                        36.806 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.020  ? ? 1961 'X-RAY DIFFRACTION' ? 
f_angle_d          1.952  ? ? 2656 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.517 ? ? 742  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.136  ? ? 292  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.010  ? ? 341  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 1.5489 1.5908  2671 0.2254 84.00 0.2177 . . 127 . . . . 
'X-RAY DIFFRACTION' . 1.5908 1.6376  2760 0.2222 86.00 0.2532 . . 132 . . . . 
'X-RAY DIFFRACTION' . 1.6376 1.6905  2844 0.2131 88.00 0.2606 . . 138 . . . . 
'X-RAY DIFFRACTION' . 1.6905 1.7509  2810 0.1943 88.00 0.2418 . . 142 . . . . 
'X-RAY DIFFRACTION' . 1.7509 1.8210  2863 0.1934 89.00 0.2458 . . 139 . . . . 
'X-RAY DIFFRACTION' . 1.8210 1.9039  2843 0.1848 88.00 0.2329 . . 136 . . . . 
'X-RAY DIFFRACTION' . 1.9039 2.0042  3067 0.1788 95.00 0.1914 . . 148 . . . . 
'X-RAY DIFFRACTION' . 2.0042 2.1298  3147 0.1674 98.00 0.2097 . . 153 . . . . 
'X-RAY DIFFRACTION' . 2.1298 2.2942  3128 0.1706 96.00 0.1978 . . 149 . . . . 
'X-RAY DIFFRACTION' . 2.2942 2.5251  3115 0.1739 97.00 0.2097 . . 151 . . . . 
'X-RAY DIFFRACTION' . 2.5251 2.8903  3161 0.1771 97.00 0.2167 . . 154 . . . . 
'X-RAY DIFFRACTION' . 2.8903 3.6410  3267 0.1652 99.00 0.1809 . . 158 . . . . 
'X-RAY DIFFRACTION' . 3.6410 36.8167 3352 0.1611 99.00 0.1750 . . 162 . . . . 
# 
_struct.entry_id                     4YVG 
_struct.title                        'Crystal Structure of H. influenzae TrmD in complex with AdoMet' 
_struct.pdbx_descriptor              'tRNA (guanine-N(1)-)-methyltransferase' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YVG 
_struct_keywords.text            'MTase, SPOUT, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 PHE A 29  ? MET A 32  ? PHE A 9   MET A 12  5 ? 4  
HELX_P HELX_P2  AA2 PHE A 33  ? GLU A 38  ? PHE A 13  GLU A 18  1 ? 6  
HELX_P HELX_P3  AA3 PHE A 39  ? HIS A 48  ? PHE A 19  HIS A 28  1 ? 10 
HELX_P HELX_P4  AA4 ASN A 57  ? THR A 62  ? ASN A 37  THR A 42  5 ? 6  
HELX_P HELX_P5  AA5 MET A 83  ? GLY A 99  ? MET A 63  GLY A 79  1 ? 17 
HELX_P HELX_P6  AA6 ASP A 115 ? ALA A 123 ? ASP A 95  ALA A 103 1 ? 9  
HELX_P HELX_P7  AA7 ASP A 139 ? ILE A 147 ? ASP A 119 ILE A 127 1 ? 9  
HELX_P HELX_P8  AA8 GLY A 161 ? ARG A 174 ? GLY A 141 ARG A 154 1 ? 14 
HELX_P HELX_P9  AA9 PRO A 213 ? SER A 218 ? PRO A 193 SER A 198 1 ? 6  
HELX_P HELX_P10 AB1 HIS A 220 ? ARG A 240 ? HIS A 200 ARG A 220 1 ? 21 
HELX_P HELX_P11 AB2 ARG A 240 ? GLY A 246 ? ARG A 220 GLY A 226 1 ? 7  
HELX_P HELX_P12 AB3 THR A 250 ? ASN A 265 ? THR A 230 ASN A 245 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ARG 
_struct_mon_prot_cis.label_seq_id           203 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ARG 
_struct_mon_prot_cis.auth_seq_id            183 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    204 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     184 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       2.27 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? parallel      
AA1 3 4 ? parallel      
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 51  ? TRP A 56  ? LEU A 31  TRP A 36  
AA1 2 MET A 21  ? ILE A 26  ? MET A 1   ILE A 6   
AA1 3 LYS A 127 ? VAL A 131 ? LYS A 107 VAL A 111 
AA1 4 LYS A 103 ? LEU A 107 ? LYS A 83  LEU A 87  
AA1 5 GLU A 149 ? SER A 152 ? GLU A 129 SER A 132 
AA1 6 ARG A 112 ? LYS A 113 ? ARG A 92  LYS A 93  
AA2 1 ASP A 70  ? ASP A 71  ? ASP A 50  ASP A 51  
AA2 2 LEU A 81  ? MET A 82  ? LEU A 61  MET A 62  
AA3 1 VAL A 206 ? LEU A 207 ? VAL A 186 LEU A 187 
AA3 2 LEU A 210 ? THR A 211 ? LEU A 190 THR A 191 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O LYS A 52  ? O LYS A 32  N ILE A 23  ? N ILE A 3   
AA1 2 3 N GLY A 24  ? N GLY A 4   O LEU A 130 ? O LEU A 110 
AA1 3 4 O ILE A 129 ? O ILE A 109 N ILE A 105 ? N ILE A 85  
AA1 4 5 N TYR A 106 ? N TYR A 86  O TRP A 151 ? O TRP A 131 
AA1 5 6 O SER A 152 ? O SER A 132 N ARG A 112 ? N ARG A 92  
AA2 1 2 N ASP A 71  ? N ASP A 51  O LEU A 81  ? O LEU A 61  
AA3 1 2 N LEU A 207 ? N LEU A 187 O LEU A 210 ? O LEU A 190 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    SAM 
_struct_site.pdbx_auth_seq_id     301 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    22 
_struct_site.details              'binding site for residue SAM A 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 TYR A 106 ? TYR A 86  . ? 1_555 ? 
2  AC1 22 LEU A 107 ? LEU A 87  . ? 1_555 ? 
3  AC1 22 SER A 108 ? SER A 88  . ? 1_555 ? 
4  AC1 22 PRO A 109 ? PRO A 89  . ? 1_555 ? 
5  AC1 22 GLN A 110 ? GLN A 90  . ? 1_555 ? 
6  AC1 22 GLY A 133 ? GLY A 113 . ? 1_555 ? 
7  AC1 22 TYR A 135 ? TYR A 115 . ? 1_555 ? 
8  AC1 22 GLU A 136 ? GLU A 116 . ? 1_555 ? 
9  AC1 22 SER A 152 ? SER A 132 . ? 1_555 ? 
10 AC1 22 ILE A 153 ? ILE A 133 . ? 1_555 ? 
11 AC1 22 GLY A 154 ? GLY A 134 . ? 1_555 ? 
12 AC1 22 TYR A 156 ? TYR A 136 . ? 1_555 ? 
13 AC1 22 LEU A 158 ? LEU A 138 . ? 1_555 ? 
14 AC1 22 GLY A 160 ? GLY A 140 . ? 1_555 ? 
15 AC1 22 GLY A 161 ? GLY A 141 . ? 1_555 ? 
16 AC1 22 PRO A 164 ? PRO A 144 . ? 1_555 ? 
17 AC1 22 ASP A 189 ? ASP A 169 . ? 5_555 ? 
18 AC1 22 SER A 190 ? SER A 170 . ? 5_555 ? 
19 AC1 22 ASP A 197 ? ASP A 177 . ? 5_555 ? 
20 AC1 22 HOH C .   ? HOH A 467 . ? 1_555 ? 
21 AC1 22 HOH C .   ? HOH A 474 . ? 5_555 ? 
22 AC1 22 HOH C .   ? HOH A 549 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YVG 
_atom_sites.fract_transf_matrix[1][1]   0.010653 
_atom_sites.fract_transf_matrix[1][2]   0.006151 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012301 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005619 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . HIS A 1 20  ? 38.223 -22.382 2.087   1.00 44.92 ? 0   HIS A N     1 
ATOM   2    C CA    . HIS A 1 20  ? 37.349 -21.714 3.040   1.00 28.95 ? 0   HIS A CA    1 
ATOM   3    C C     . HIS A 1 20  ? 38.183 -20.820 3.997   1.00 30.83 ? 0   HIS A C     1 
ATOM   4    O O     . HIS A 1 20  ? 39.173 -21.209 4.604   1.00 30.16 ? 0   HIS A O     1 
ATOM   5    C CB    . HIS A 1 20  ? 36.429 -22.670 3.806   1.00 43.37 ? 0   HIS A CB    1 
ATOM   6    C CG    . HIS A 1 20  ? 35.230 -22.007 4.429   1.00 50.56 ? 0   HIS A CG    1 
ATOM   7    N ND1   . HIS A 1 20  ? 34.747 -20.780 4.013   1.00 62.48 ? 0   HIS A ND1   1 
ATOM   8    C CD2   . HIS A 1 20  ? 34.411 -22.406 5.433   1.00 42.87 ? 0   HIS A CD2   1 
ATOM   9    C CE1   . HIS A 1 20  ? 33.685 -20.449 4.732   1.00 43.04 ? 0   HIS A CE1   1 
ATOM   10   N NE2   . HIS A 1 20  ? 33.453 -21.426 5.592   1.00 73.34 ? 0   HIS A NE2   1 
ATOM   11   N N     . MET A 1 21  ? 37.758 -19.576 4.062   1.00 24.66 ? 1   MET A N     1 
ATOM   12   C CA    . MET A 1 21  ? 38.396 -18.649 4.952   1.00 27.75 ? 1   MET A CA    1 
ATOM   13   C C     . MET A 1 21  ? 37.283 -17.871 5.645   1.00 20.58 ? 1   MET A C     1 
ATOM   14   O O     . MET A 1 21  ? 36.275 -17.533 5.040   1.00 23.06 ? 1   MET A O     1 
ATOM   15   C CB    . MET A 1 21  ? 39.301 -17.739 4.142   1.00 26.36 ? 1   MET A CB    1 
ATOM   16   C CG    . MET A 1 21  ? 40.154 -16.868 5.013   1.00 38.08 ? 1   MET A CG    1 
ATOM   17   S SD    . MET A 1 21  ? 41.450 -15.953 4.171   1.00 37.33 ? 1   MET A SD    1 
ATOM   18   C CE    . MET A 1 21  ? 42.079 -17.100 2.972   1.00 36.41 ? 1   MET A CE    1 
ATOM   19   N N     . TRP A 1 22  ? 37.495 -17.631 6.928   1.00 19.84 ? 2   TRP A N     1 
ATOM   20   C CA    . TRP A 1 22  ? 36.574 -16.838 7.796   1.00 20.00 ? 2   TRP A CA    1 
ATOM   21   C C     . TRP A 1 22  ? 37.302 -15.598 8.292   1.00 15.11 ? 2   TRP A C     1 
ATOM   22   O O     . TRP A 1 22  ? 38.410 -15.696 8.795   1.00 17.76 ? 2   TRP A O     1 
ATOM   23   C CB    . TRP A 1 22  ? 36.065 -17.680 8.980   1.00 19.26 ? 2   TRP A CB    1 
ATOM   24   C CG    . TRP A 1 22  ? 35.112 -16.997 9.900   1.00 21.54 ? 2   TRP A CG    1 
ATOM   25   C CD1   . TRP A 1 22  ? 33.760 -17.075 9.872   1.00 22.64 ? 2   TRP A CD1   1 
ATOM   26   C CD2   . TRP A 1 22  ? 35.445 -16.164 11.023  1.00 20.56 ? 2   TRP A CD2   1 
ATOM   27   N NE1   . TRP A 1 22  ? 33.215 -16.321 10.887  1.00 26.53 ? 2   TRP A NE1   1 
ATOM   28   C CE2   . TRP A 1 22  ? 34.226 -15.755 11.611  1.00 20.65 ? 2   TRP A CE2   1 
ATOM   29   C CE3   . TRP A 1 22  ? 36.653 -15.721 11.592  1.00 16.48 ? 2   TRP A CE3   1 
ATOM   30   C CZ2   . TRP A 1 22  ? 34.181 -14.932 12.776  1.00 20.56 ? 2   TRP A CZ2   1 
ATOM   31   C CZ3   . TRP A 1 22  ? 36.586 -14.891 12.738  1.00 18.53 ? 2   TRP A CZ3   1 
ATOM   32   C CH2   . TRP A 1 22  ? 35.384 -14.515 13.296  1.00 17.58 ? 2   TRP A CH2   1 
ATOM   33   N N     . ILE A 1 23  ? 36.651 -14.432 8.061   1.00 16.02 ? 3   ILE A N     1 
ATOM   34   C CA    . ILE A 1 23  ? 37.254 -13.193 8.511   1.00 15.29 ? 3   ILE A CA    1 
ATOM   35   C C     . ILE A 1 23  ? 36.245 -12.459 9.396   1.00 14.30 ? 3   ILE A C     1 
ATOM   36   O O     . ILE A 1 23  ? 35.138 -12.131 8.948   1.00 16.78 ? 3   ILE A O     1 
ATOM   37   C CB    . ILE A 1 23  ? 37.649 -12.306 7.307   1.00 16.63 ? 3   ILE A CB    1 
ATOM   38   C CG1   . ILE A 1 23  ? 38.514 -13.098 6.332   1.00 22.08 ? 3   ILE A CG1   1 
ATOM   39   C CG2   . ILE A 1 23  ? 38.429 -11.086 7.860   1.00 18.81 ? 3   ILE A CG2   1 
ATOM   40   C CD1   . ILE A 1 23  ? 39.921 -13.124 6.599   1.00 32.78 ? 3   ILE A CD1   1 
ATOM   41   N N     . GLY A 1 24  ? 36.617 -12.196 10.654  1.00 13.01 ? 4   GLY A N     1 
ATOM   42   C CA    . GLY A 1 24  ? 35.818 -11.389 11.567  1.00 16.41 ? 4   GLY A CA    1 
ATOM   43   C C     . GLY A 1 24  ? 36.357 -9.967  11.439  1.00 14.35 ? 4   GLY A C     1 
ATOM   44   O O     . GLY A 1 24  ? 37.563 -9.757  11.314  1.00 20.23 ? 4   GLY A O     1 
ATOM   45   N N     . VAL A 1 25  ? 35.464 -9.018  11.440  1.00 12.78 ? 5   VAL A N     1 
ATOM   46   C CA    . VAL A 1 25  ? 35.873 -7.600  11.308  1.00 12.74 ? 5   VAL A CA    1 
ATOM   47   C C     . VAL A 1 25  ? 35.260 -6.812  12.462  1.00 12.98 ? 5   VAL A C     1 
ATOM   48   O O     . VAL A 1 25  ? 34.097 -6.991  12.800  1.00 12.87 ? 5   VAL A O     1 
ATOM   49   C CB    . VAL A 1 25  ? 35.253 -7.043  10.041  1.00 14.74 ? 5   VAL A CB    1 
ATOM   50   C CG1   . VAL A 1 25  ? 35.364 -5.486  10.014  1.00 18.27 ? 5   VAL A CG1   1 
ATOM   51   C CG2   . VAL A 1 25  ? 35.956 -7.671  8.844   1.00 14.22 ? 5   VAL A CG2   1 
ATOM   52   N N     . ILE A 1 26  ? 36.045 -5.962  13.082  1.00 12.90 ? 6   ILE A N     1 
ATOM   53   C CA    . ILE A 1 26  ? 35.538 -5.032  14.104  1.00 10.52 ? 6   ILE A CA    1 
ATOM   54   C C     . ILE A 1 26  ? 35.596 -3.628  13.486  1.00 13.27 ? 6   ILE A C     1 
ATOM   55   O O     . ILE A 1 26  ? 36.688 -3.144  13.114  1.00 13.18 ? 6   ILE A O     1 
ATOM   56   C CB    . ILE A 1 26  ? 36.431 -5.028  15.377  1.00 12.30 ? 6   ILE A CB    1 
ATOM   57   C CG1   . ILE A 1 26  ? 36.679 -6.453  15.938  1.00 17.23 ? 6   ILE A CG1   1 
ATOM   58   C CG2   . ILE A 1 26  ? 35.815 -4.097  16.424  1.00 13.08 ? 6   ILE A CG2   1 
ATOM   59   C CD1   . ILE A 1 26  ? 35.427 -7.131  16.192  1.00 17.26 ? 6   ILE A CD1   1 
ATOM   60   N N     . SER A 1 27  ? 34.449 -2.987  13.314  1.00 11.66 ? 7   SER A N     1 
ATOM   61   C CA    . SER A 1 27  ? 34.372 -1.707  12.643  1.00 10.64 ? 7   SER A CA    1 
ATOM   62   C C     . SER A 1 27  ? 33.185 -0.922  13.083  1.00 12.05 ? 7   SER A C     1 
ATOM   63   O O     . SER A 1 27  ? 32.075 -1.476  13.218  1.00 12.18 ? 7   SER A O     1 
ATOM   64   C CB    . SER A 1 27  ? 34.258 -1.935  11.075  1.00 12.11 ? 7   SER A CB    1 
ATOM   65   O OG    . SER A 1 27  ? 34.032 -0.679  10.412  1.00 13.19 ? 7   SER A OG    1 
ATOM   66   N N     . LEU A 1 28  ? 33.368 0.409   13.199  1.00 11.81 ? 8   LEU A N     1 
ATOM   67   C CA    . LEU A 1 28  ? 32.278 1.351   13.393  1.00 12.56 ? 8   LEU A CA    1 
ATOM   68   C C     . LEU A 1 28  ? 31.380 1.518   12.176  1.00 12.87 ? 8   LEU A C     1 
ATOM   69   O O     . LEU A 1 28  ? 30.320 2.129   12.280  1.00 13.73 ? 8   LEU A O     1 
ATOM   70   C CB    . LEU A 1 28  ? 32.802 2.773   13.845  1.00 11.84 ? 8   LEU A CB    1 
ATOM   71   C CG    . LEU A 1 28  ? 33.505 2.752   15.219  1.00 12.94 ? 8   LEU A CG    1 
ATOM   72   C CD1   . LEU A 1 28  ? 34.151 4.108   15.467  1.00 16.17 ? 8   LEU A CD1   1 
ATOM   73   C CD2   . LEU A 1 28  ? 32.425 2.497   16.284  1.00 14.21 ? 8   LEU A CD2   1 
ATOM   74   N N     . PHE A 1 29  ? 31.862 1.072   10.993  1.00 12.51 ? 9   PHE A N     1 
ATOM   75   C CA    . PHE A 1 29  ? 31.119 1.281   9.739   1.00 12.62 ? 9   PHE A CA    1 
ATOM   76   C C     . PHE A 1 29  ? 31.068 -0.015  8.954   1.00 15.46 ? 9   PHE A C     1 
ATOM   77   O O     . PHE A 1 29  ? 31.626 -0.141  7.841   1.00 15.42 ? 9   PHE A O     1 
ATOM   78   C CB    . PHE A 1 29  ? 31.866 2.360   8.915   1.00 13.26 ? 9   PHE A CB    1 
ATOM   79   C CG    . PHE A 1 29  ? 31.902 3.691   9.585   1.00 14.57 ? 9   PHE A CG    1 
ATOM   80   C CD1   . PHE A 1 29  ? 30.760 4.432   9.759   1.00 18.34 ? 9   PHE A CD1   1 
ATOM   81   C CD2   . PHE A 1 29  ? 33.101 4.192   10.069  1.00 16.64 ? 9   PHE A CD2   1 
ATOM   82   C CE1   . PHE A 1 29  ? 30.820 5.688   10.413  1.00 20.23 ? 9   PHE A CE1   1 
ATOM   83   C CE2   . PHE A 1 29  ? 33.148 5.434   10.721  1.00 18.55 ? 9   PHE A CE2   1 
ATOM   84   C CZ    . PHE A 1 29  ? 32.032 6.166   10.846  1.00 18.72 ? 9   PHE A CZ    1 
ATOM   85   N N     . PRO A 1 30  ? 30.428 -1.045  9.496   1.00 12.19 ? 10  PRO A N     1 
ATOM   86   C CA    . PRO A 1 30  ? 30.401 -2.354  8.844   1.00 15.00 ? 10  PRO A CA    1 
ATOM   87   C C     . PRO A 1 30  ? 29.786 -2.300  7.452   1.00 14.28 ? 10  PRO A C     1 
ATOM   88   O O     . PRO A 1 30  ? 30.179 -3.159  6.618   1.00 14.40 ? 10  PRO A O     1 
ATOM   89   C CB    . PRO A 1 30  ? 29.547 -3.247  9.783   1.00 18.66 ? 10  PRO A CB    1 
ATOM   90   C CG    . PRO A 1 30  ? 28.976 -2.330  10.817  1.00 18.86 ? 10  PRO A CG    1 
ATOM   91   C CD    . PRO A 1 30  ? 29.673 -0.988  10.772  1.00 14.22 ? 10  PRO A CD    1 
ATOM   92   N N     . GLU A 1 31  ? 28.879 -1.362  7.190   1.00 12.82 ? 11  GLU A N     1 
ATOM   93   C CA    . GLU A 1 31  ? 28.309 -1.269  5.832   1.00 14.80 ? 11  GLU A CA    1 
ATOM   94   C C     . GLU A 1 31  ? 29.363 -1.008  4.760   1.00 15.39 ? 11  GLU A C     1 
ATOM   95   O O     . GLU A 1 31  ? 29.133 -1.243  3.576   1.00 13.85 ? 11  GLU A O     1 
ATOM   96   C CB    . GLU A 1 31  ? 27.229 -0.216  5.787   1.00 19.35 ? 11  GLU A CB    1 
ATOM   97   C CG    . GLU A 1 31  ? 25.991 -0.684  6.569   1.00 22.56 ? 11  GLU A CG    1 
ATOM   98   C CD    . GLU A 1 31  ? 25.070 0.499   6.787   1.00 42.27 ? 11  GLU A CD    1 
ATOM   99   O OE1   . GLU A 1 31  ? 25.215 1.201   7.841   1.00 52.86 ? 11  GLU A OE1   1 
ATOM   100  O OE2   . GLU A 1 31  ? 24.248 0.774   5.871   1.00 44.47 ? 11  GLU A OE2   1 
ATOM   101  N N     . MET A 1 32  ? 30.480 -0.435  5.145   1.00 12.56 ? 12  MET A N     1 
ATOM   102  C CA    . MET A 1 32  ? 31.541 -0.263  4.122   1.00 11.86 ? 12  MET A CA    1 
ATOM   103  C C     . MET A 1 32  ? 31.959 -1.569  3.468   1.00 12.51 ? 12  MET A C     1 
ATOM   104  O O     . MET A 1 32  ? 32.368 -1.566  2.304   1.00 12.13 ? 12  MET A O     1 
ATOM   105  C CB    . MET A 1 32  ? 32.805 0.391   4.770   1.00 13.50 ? 12  MET A CB    1 
ATOM   106  C CG    . MET A 1 32  ? 32.621 1.823   5.138   1.00 10.71 ? 12  MET A CG    1 
ATOM   107  S SD    . MET A 1 32  ? 34.106 2.567   5.935   1.00 12.68 ? 12  MET A SD    1 
ATOM   108  C CE    . MET A 1 32  ? 35.313 2.538   4.579   1.00 11.51 ? 12  MET A CE    1 
ATOM   109  N N     . PHE A 1 33  ? 31.879 -2.667  4.234   1.00 11.92 ? 13  PHE A N     1 
ATOM   110  C CA    . PHE A 1 33  ? 32.352 -3.949  3.722   1.00 11.85 ? 13  PHE A CA    1 
ATOM   111  C C     . PHE A 1 33  ? 31.461 -4.489  2.588   1.00 15.35 ? 13  PHE A C     1 
ATOM   112  O O     . PHE A 1 33  ? 31.868 -5.419  1.916   1.00 14.19 ? 13  PHE A O     1 
ATOM   113  C CB    . PHE A 1 33  ? 32.537 -4.932  4.872   1.00 13.45 ? 13  PHE A CB    1 
ATOM   114  C CG    . PHE A 1 33  ? 33.727 -4.524  5.721   1.00 14.08 ? 13  PHE A CG    1 
ATOM   115  C CD1   . PHE A 1 33  ? 34.968 -5.079  5.453   1.00 10.70 ? 13  PHE A CD1   1 
ATOM   116  C CD2   . PHE A 1 33  ? 33.612 -3.487  6.706   1.00 12.67 ? 13  PHE A CD2   1 
ATOM   117  C CE1   . PHE A 1 33  ? 36.105 -4.718  6.160   1.00 13.15 ? 13  PHE A CE1   1 
ATOM   118  C CE2   . PHE A 1 33  ? 34.792 -3.099  7.390   1.00 10.88 ? 13  PHE A CE2   1 
ATOM   119  C CZ    . PHE A 1 33  ? 35.986 -3.661  7.124   1.00 11.56 ? 13  PHE A CZ    1 
ATOM   120  N N     . LYS A 1 34  ? 30.283 -3.895  2.396   1.00 13.00 ? 14  LYS A N     1 
ATOM   121  C CA    . LYS A 1 34  ? 29.483 -4.259  1.195   1.00 14.76 ? 14  LYS A CA    1 
ATOM   122  C C     . LYS A 1 34  ? 30.286 -4.098  -0.059  1.00 15.69 ? 14  LYS A C     1 
ATOM   123  O O     . LYS A 1 34  ? 30.066 -4.782  -1.081  1.00 13.92 ? 14  LYS A O     1 
ATOM   124  C CB    . LYS A 1 34  ? 28.212 -3.425  1.112   1.00 13.89 ? 14  LYS A CB    1 
ATOM   125  C CG    . LYS A 1 34  ? 27.219 -3.795  2.225   1.00 17.90 ? 14  LYS A CG    1 
ATOM   126  C CD    . LYS A 1 34  ? 25.988 -2.923  2.097   1.00 22.70 ? 14  LYS A CD    1 
ATOM   127  C CE    . LYS A 1 34  ? 25.071 -3.142  3.251   1.00 30.19 ? 14  LYS A CE    1 
ATOM   128  N NZ    . LYS A 1 34  ? 23.815 -2.286  2.984   1.00 36.23 ? 14  LYS A NZ    1 
ATOM   129  N N     . ALA A 1 35  ? 31.276 -3.206  -0.064  1.00 13.13 ? 15  ALA A N     1 
ATOM   130  C CA    . ALA A 1 35  ? 32.072 -2.985  -1.258  1.00 12.37 ? 15  ALA A CA    1 
ATOM   131  C C     . ALA A 1 35  ? 32.797 -4.250  -1.705  1.00 14.30 ? 15  ALA A C     1 
ATOM   132  O O     . ALA A 1 35  ? 32.988 -4.446  -2.916  1.00 15.81 ? 15  ALA A O     1 
ATOM   133  C CB    . ALA A 1 35  ? 33.119 -1.843  -1.043  1.00 11.67 ? 15  ALA A CB    1 
ATOM   134  N N     . ILE A 1 36  ? 33.212 -5.099  -0.752  1.00 13.07 ? 16  ILE A N     1 
ATOM   135  C CA    . ILE A 1 36  ? 33.783 -6.385  -1.150  1.00 16.07 ? 16  ILE A CA    1 
ATOM   136  C C     . ILE A 1 36  ? 32.778 -7.527  -1.041  1.00 15.94 ? 16  ILE A C     1 
ATOM   137  O O     . ILE A 1 36  ? 32.929 -8.480  -1.823  1.00 15.60 ? 16  ILE A O     1 
ATOM   138  C CB    . ILE A 1 36  ? 35.091 -6.714  -0.421  1.00 17.84 ? 16  ILE A CB    1 
ATOM   139  C CG1   . ILE A 1 36  ? 34.862 -6.798  1.060   1.00 15.81 ? 16  ILE A CG1   1 
ATOM   140  C CG2   . ILE A 1 36  ? 36.176 -5.655  -0.770  1.00 19.88 ? 16  ILE A CG2   1 
ATOM   141  C CD1   . ILE A 1 36  ? 36.146 -7.370  1.774   1.00 17.33 ? 16  ILE A CD1   1 
ATOM   142  N N     . THR A 1 37  ? 31.819 -7.517  -0.144  1.00 15.81 ? 17  THR A N     1 
ATOM   143  C CA    . THR A 1 37  ? 30.946 -8.685  -0.042  1.00 15.69 ? 17  THR A CA    1 
ATOM   144  C C     . THR A 1 37  ? 29.860 -8.735  -1.125  1.00 16.82 ? 17  THR A C     1 
ATOM   145  O O     . THR A 1 37  ? 29.271 -9.803  -1.328  1.00 17.75 ? 17  THR A O     1 
ATOM   146  C CB    . THR A 1 37  ? 30.315 -8.803  1.357   1.00 17.92 ? 17  THR A CB    1 
ATOM   147  O OG1   . THR A 1 37  ? 29.406 -7.723  1.546   1.00 16.12 ? 17  THR A OG1   1 
ATOM   148  C CG2   . THR A 1 37  ? 31.409 -8.813  2.469   1.00 17.17 ? 17  THR A CG2   1 
ATOM   149  N N     . GLU A 1 38  ? 29.542 -7.610  -1.772  1.00 16.12 ? 18  GLU A N     1 
ATOM   150  C CA    . GLU A 1 38  ? 28.422 -7.608  -2.726  1.00 17.66 ? 18  GLU A CA    1 
ATOM   151  C C     . GLU A 1 38  ? 28.844 -7.489  -4.208  1.00 19.21 ? 18  GLU A C     1 
ATOM   152  O O     . GLU A 1 38  ? 27.972 -7.515  -5.100  1.00 22.44 ? 18  GLU A O     1 
ATOM   153  C CB    . GLU A 1 38  ? 27.404 -6.473  -2.418  1.00 18.37 ? 18  GLU A CB    1 
ATOM   154  C CG    . GLU A 1 38  ? 26.752 -6.465  -1.015  1.00 17.91 ? 18  GLU A CG    1 
ATOM   155  C CD    . GLU A 1 38  ? 25.638 -5.346  -0.808  1.00 30.39 ? 18  GLU A CD    1 
ATOM   156  O OE1   . GLU A 1 38  ? 25.527 -4.302  -1.569  1.00 29.93 ? 18  GLU A OE1   1 
ATOM   157  O OE2   . GLU A 1 38  ? 24.840 -5.502  0.156   1.00 36.15 ? 18  GLU A OE2   1 
ATOM   158  N N     . PHE A 1 39  ? 30.119 -7.321  -4.516  1.00 15.22 ? 19  PHE A N     1 
ATOM   159  C CA    . PHE A 1 39  ? 30.542 -6.994  -5.850  1.00 15.48 ? 19  PHE A CA    1 
ATOM   160  C C     . PHE A 1 39  ? 31.739 -7.779  -6.337  1.00 20.19 ? 19  PHE A C     1 
ATOM   161  O O     . PHE A 1 39  ? 32.713 -8.038  -5.564  1.00 18.73 ? 19  PHE A O     1 
ATOM   162  C CB    . PHE A 1 39  ? 30.883 -5.508  -5.925  1.00 15.21 ? 19  PHE A CB    1 
ATOM   163  C CG    . PHE A 1 39  ? 29.748 -4.617  -5.529  1.00 18.31 ? 19  PHE A CG    1 
ATOM   164  C CD1   . PHE A 1 39  ? 28.683 -4.411  -6.408  1.00 20.92 ? 19  PHE A CD1   1 
ATOM   165  C CD2   . PHE A 1 39  ? 29.732 -4.021  -4.270  1.00 18.82 ? 19  PHE A CD2   1 
ATOM   166  C CE1   . PHE A 1 39  ? 27.601 -3.614  -6.020  1.00 22.32 ? 19  PHE A CE1   1 
ATOM   167  C CE2   . PHE A 1 39  ? 28.671 -3.192  -3.884  1.00 18.64 ? 19  PHE A CE2   1 
ATOM   168  C CZ    . PHE A 1 39  ? 27.625 -2.971  -4.779  1.00 20.37 ? 19  PHE A CZ    1 
ATOM   169  N N     . GLY A 1 40  ? 31.690 -8.161  -7.609  1.00 17.78 ? 20  GLY A N     1 
ATOM   170  C CA    . GLY A 1 40  ? 32.867 -8.710  -8.249  1.00 17.15 ? 20  GLY A CA    1 
ATOM   171  C C     . GLY A 1 40  ? 33.261 -10.083 -7.739  1.00 15.77 ? 20  GLY A C     1 
ATOM   172  O O     . GLY A 1 40  ? 32.435 -10.828 -7.229  1.00 14.20 ? 20  GLY A O     1 
ATOM   173  N N     . VAL A 1 41  ? 34.492 -10.441 -8.015  1.00 17.13 ? 21  VAL A N     1 
ATOM   174  C CA    . VAL A 1 41  ? 35.016 -11.736 -7.621  1.00 19.93 ? 21  VAL A CA    1 
ATOM   175  C C     . VAL A 1 41  ? 34.905 -11.985 -6.106  1.00 18.58 ? 21  VAL A C     1 
ATOM   176  O O     . VAL A 1 41  ? 34.556 -13.106 -5.667  1.00 18.50 ? 21  VAL A O     1 
ATOM   177  C CB    . VAL A 1 41  ? 36.502 -11.789 -8.081  1.00 21.79 ? 21  VAL A CB    1 
ATOM   178  C CG1   . VAL A 1 41  ? 37.303 -12.715 -7.190  1.00 29.11 ? 21  VAL A CG1   1 
ATOM   179  C CG2   . VAL A 1 41  ? 36.498 -12.208 -9.554  1.00 28.64 ? 21  VAL A CG2   1 
ATOM   180  N N     . THR A 1 42  ? 35.134 -10.974 -5.254  1.00 15.78 ? 22  THR A N     1 
ATOM   181  C CA    . THR A 1 42  ? 35.015 -11.209 -3.841  1.00 14.00 ? 22  THR A CA    1 
ATOM   182  C C     . THR A 1 42  ? 33.572 -11.410 -3.407  1.00 14.71 ? 22  THR A C     1 
ATOM   183  O O     . THR A 1 42  ? 33.276 -12.190 -2.506  1.00 16.86 ? 22  THR A O     1 
ATOM   184  C CB    . THR A 1 42  ? 35.673 -10.110 -3.028  1.00 20.62 ? 22  THR A CB    1 
ATOM   185  O OG1   . THR A 1 42  ? 35.141 -8.820  -3.395  1.00 17.27 ? 22  THR A OG1   1 
ATOM   186  C CG2   . THR A 1 42  ? 37.188 -10.122 -3.209  1.00 18.84 ? 22  THR A CG2   1 
ATOM   187  N N     . GLY A 1 43  ? 32.642 -10.717 -4.081  1.00 17.33 ? 23  GLY A N     1 
ATOM   188  C CA    . GLY A 1 43  ? 31.243 -10.805 -3.763  1.00 15.54 ? 23  GLY A CA    1 
ATOM   189  C C     . GLY A 1 43  ? 30.764 -12.227 -4.110  1.00 15.20 ? 23  GLY A C     1 
ATOM   190  O O     . GLY A 1 43  ? 29.988 -12.840 -3.388  1.00 18.10 ? 23  GLY A O     1 
ATOM   191  N N     . ARG A 1 44  ? 31.250 -12.739 -5.243  1.00 15.28 ? 24  ARG A N     1 
ATOM   192  C CA    . ARG A 1 44  ? 30.861 -14.112 -5.631  1.00 16.22 ? 24  ARG A CA    1 
ATOM   193  C C     . ARG A 1 44  ? 31.468 -15.068 -4.610  1.00 17.46 ? 24  ARG A C     1 
ATOM   194  O O     . ARG A 1 44  ? 30.804 -16.057 -4.200  1.00 20.96 ? 24  ARG A O     1 
ATOM   195  C CB    . ARG A 1 44  ? 31.374 -14.459 -7.051  1.00 17.75 ? 24  ARG A CB    1 
ATOM   196  C CG    . ARG A 1 44  ? 31.223 -15.964 -7.485  1.00 27.07 ? 24  ARG A CG    1 
ATOM   197  C CD    . ARG A 1 44  ? 31.409 -16.127 -9.059  1.00 29.85 ? 24  ARG A CD    1 
ATOM   198  N NE    . ARG A 1 44  ? 32.302 -15.099 -9.618  1.00 56.14 ? 24  ARG A NE    1 
ATOM   199  C CZ    . ARG A 1 44  ? 31.897 -13.948 -10.166 1.00 35.18 ? 24  ARG A CZ    1 
ATOM   200  N NH1   . ARG A 1 44  ? 32.807 -13.066 -10.631 1.00 33.58 ? 24  ARG A NH1   1 
ATOM   201  N NH2   . ARG A 1 44  ? 30.581 -13.665 -10.252 1.00 38.45 ? 24  ARG A NH2   1 
ATOM   202  N N     . ALA A 1 45  ? 32.714 -14.853 -4.201  1.00 17.25 ? 25  ALA A N     1 
ATOM   203  C CA    . ALA A 1 45  ? 33.300 -15.709 -3.143  1.00 17.91 ? 25  ALA A CA    1 
ATOM   204  C C     . ALA A 1 45  ? 32.447 -15.750 -1.889  1.00 19.26 ? 25  ALA A C     1 
ATOM   205  O O     . ALA A 1 45  ? 32.279 -16.801 -1.282  1.00 19.28 ? 25  ALA A O     1 
ATOM   206  C CB    . ALA A 1 45  ? 34.742 -15.264 -2.796  1.00 19.17 ? 25  ALA A CB    1 
ATOM   207  N N     . VAL A 1 46  ? 31.913 -14.605 -1.467  1.00 18.12 ? 26  VAL A N     1 
ATOM   208  C CA    . VAL A 1 46  ? 31.067 -14.560 -0.279  1.00 17.28 ? 26  VAL A CA    1 
ATOM   209  C C     . VAL A 1 46  ? 29.733 -15.275 -0.519  1.00 19.52 ? 26  VAL A C     1 
ATOM   210  O O     . VAL A 1 46  ? 29.308 -16.101 0.312   1.00 20.02 ? 26  VAL A O     1 
ATOM   211  C CB    . VAL A 1 46  ? 30.808 -13.078 0.122   1.00 18.98 ? 26  VAL A CB    1 
ATOM   212  C CG1   . VAL A 1 46  ? 29.746 -13.030 1.236   1.00 23.57 ? 26  VAL A CG1   1 
ATOM   213  C CG2   . VAL A 1 46  ? 32.082 -12.428 0.579   1.00 18.53 ? 26  VAL A CG2   1 
ATOM   214  N N     . LYS A 1 47  ? 29.044 -15.006 -1.636  1.00 18.94 ? 27  LYS A N     1 
ATOM   215  C CA    . LYS A 1 47  ? 27.755 -15.677 -1.923  1.00 19.45 ? 27  LYS A CA    1 
ATOM   216  C C     . LYS A 1 47  ? 27.897 -17.202 -2.028  1.00 24.18 ? 27  LYS A C     1 
ATOM   217  O O     . LYS A 1 47  ? 27.030 -17.970 -1.596  1.00 26.29 ? 27  LYS A O     1 
ATOM   218  C CB    . LYS A 1 47  ? 27.182 -15.117 -3.216  1.00 23.62 ? 27  LYS A CB    1 
ATOM   219  C CG    . LYS A 1 47  ? 25.880 -15.766 -3.691  1.00 31.45 ? 27  LYS A CG    1 
ATOM   220  C CD    . LYS A 1 47  ? 24.643 -15.152 -3.051  1.00 49.24 ? 27  LYS A CD    1 
ATOM   221  C CE    . LYS A 1 47  ? 23.400 -15.307 -3.979  1.00 46.50 ? 27  LYS A CE    1 
ATOM   222  N NZ    . LYS A 1 47  ? 23.435 -14.473 -5.248  1.00 51.71 ? 27  LYS A NZ    1 
ATOM   223  N N     . HIS A 1 48  ? 29.024 -17.655 -2.541  1.00 19.34 ? 28  HIS A N     1 
ATOM   224  C CA    . HIS A 1 48  ? 29.265 -19.091 -2.691  1.00 20.54 ? 28  HIS A CA    1 
ATOM   225  C C     . HIS A 1 48  ? 29.879 -19.737 -1.454  1.00 24.46 ? 28  HIS A C     1 
ATOM   226  O O     . HIS A 1 48  ? 30.335 -20.885 -1.501  1.00 25.30 ? 28  HIS A O     1 
ATOM   227  C CB    . HIS A 1 48  ? 30.150 -19.324 -3.869  1.00 19.48 ? 28  HIS A CB    1 
ATOM   228  C CG    . HIS A 1 48  ? 29.487 -18.979 -5.181  1.00 25.19 ? 28  HIS A CG    1 
ATOM   229  N ND1   . HIS A 1 48  ? 30.050 -19.297 -6.394  1.00 27.72 ? 28  HIS A ND1   1 
ATOM   230  C CD2   . HIS A 1 48  ? 28.301 -18.389 -5.463  1.00 26.39 ? 28  HIS A CD2   1 
ATOM   231  C CE1   . HIS A 1 48  ? 29.254 -18.903 -7.370  1.00 27.11 ? 28  HIS A CE1   1 
ATOM   232  N NE2   . HIS A 1 48  ? 28.197 -18.325 -6.843  1.00 24.53 ? 28  HIS A NE2   1 
ATOM   233  N N     . ASN A 1 49  ? 30.019 -18.981 -0.372  1.00 21.94 ? 29  ASN A N     1 
ATOM   234  C CA    . ASN A 1 49  ? 30.579 -19.557 0.850   1.00 23.47 ? 29  ASN A CA    1 
ATOM   235  C C     . ASN A 1 49  ? 32.047 -19.963 0.819   1.00 25.69 ? 29  ASN A C     1 
ATOM   236  O O     . ASN A 1 49  ? 32.455 -20.797 1.638   1.00 30.98 ? 29  ASN A O     1 
ATOM   237  C CB    . ASN A 1 49  ? 29.729 -20.738 1.351   1.00 29.71 ? 29  ASN A CB    1 
ATOM   238  C CG    . ASN A 1 49  ? 28.261 -20.392 1.488   1.00 36.75 ? 29  ASN A CG    1 
ATOM   239  O OD1   . ASN A 1 49  ? 27.895 -19.431 2.150   1.00 38.52 ? 29  ASN A OD1   1 
ATOM   240  N ND2   . ASN A 1 49  ? 27.404 -21.178 0.841   1.00 44.68 ? 29  ASN A ND2   1 
ATOM   241  N N     . LEU A 1 50  ? 32.853 -19.404 -0.085  1.00 19.37 ? 30  LEU A N     1 
ATOM   242  C CA    . LEU A 1 50  ? 34.271 -19.680 -0.136  1.00 21.10 ? 30  LEU A CA    1 
ATOM   243  C C     . LEU A 1 50  ? 34.914 -18.792 0.932   1.00 25.97 ? 30  LEU A C     1 
ATOM   244  O O     . LEU A 1 50  ? 35.914 -19.154 1.547   1.00 26.57 ? 30  LEU A O     1 
ATOM   245  C CB    . LEU A 1 50  ? 34.855 -19.337 -1.516  1.00 21.45 ? 30  LEU A CB    1 
ATOM   246  C CG    . LEU A 1 50  ? 34.152 -20.089 -2.679  1.00 24.12 ? 30  LEU A CG    1 
ATOM   247  C CD1   . LEU A 1 50  ? 34.837 -19.757 -4.027  1.00 24.87 ? 30  LEU A CD1   1 
ATOM   248  C CD2   . LEU A 1 50  ? 34.185 -21.552 -2.366  1.00 28.80 ? 30  LEU A CD2   1 
ATOM   249  N N     . LEU A 1 51  ? 34.326 -17.605 1.090   1.00 19.79 ? 31  LEU A N     1 
ATOM   250  C CA    . LEU A 1 51  ? 34.820 -16.595 2.061   1.00 23.02 ? 31  LEU A CA    1 
ATOM   251  C C     . LEU A 1 51  ? 33.656 -16.174 2.946   1.00 23.66 ? 31  LEU A C     1 
ATOM   252  O O     . LEU A 1 51  ? 32.595 -15.848 2.419   1.00 21.11 ? 31  LEU A O     1 
ATOM   253  C CB    . LEU A 1 51  ? 35.343 -15.371 1.271   1.00 23.97 ? 31  LEU A CB    1 
ATOM   254  C CG    . LEU A 1 51  ? 35.705 -14.142 2.102   1.00 23.70 ? 31  LEU A CG    1 
ATOM   255  C CD1   . LEU A 1 51  ? 36.824 -14.466 3.007   1.00 24.15 ? 31  LEU A CD1   1 
ATOM   256  C CD2   . LEU A 1 51  ? 36.045 -13.003 1.089   1.00 22.57 ? 31  LEU A CD2   1 
ATOM   257  N N     . LYS A 1 52  ? 33.808 -16.177 4.276   1.00 20.81 ? 32  LYS A N     1 
ATOM   258  C CA    . LYS A 1 52  ? 32.749 -15.614 5.107   1.00 22.36 ? 32  LYS A CA    1 
ATOM   259  C C     . LYS A 1 52  ? 33.324 -14.417 5.852   1.00 20.20 ? 32  LYS A C     1 
ATOM   260  O O     . LYS A 1 52  ? 34.419 -14.494 6.346   1.00 20.05 ? 32  LYS A O     1 
ATOM   261  C CB    . LYS A 1 52  ? 32.287 -16.623 6.151   1.00 22.93 ? 32  LYS A CB    1 
ATOM   262  C CG    . LYS A 1 52  ? 31.300 -16.011 7.099   1.00 31.13 ? 32  LYS A CG    1 
ATOM   263  C CD    . LYS A 1 52  ? 30.328 -17.008 7.678   1.00 55.18 ? 32  LYS A CD    1 
ATOM   264  C CE    . LYS A 1 52  ? 28.938 -16.493 7.393   1.00 50.24 ? 32  LYS A CE    1 
ATOM   265  N NZ    . LYS A 1 52  ? 28.896 -14.998 7.191   1.00 55.47 ? 32  LYS A NZ    1 
ATOM   266  N N     . VAL A 1 53  ? 32.569 -13.356 5.853   1.00 17.66 ? 33  VAL A N     1 
ATOM   267  C CA    . VAL A 1 53  ? 32.971 -12.121 6.534   1.00 16.32 ? 33  VAL A CA    1 
ATOM   268  C C     . VAL A 1 53  ? 31.907 -11.759 7.544   1.00 20.08 ? 33  VAL A C     1 
ATOM   269  O O     . VAL A 1 53  ? 30.746 -11.581 7.164   1.00 21.92 ? 33  VAL A O     1 
ATOM   270  C CB    . VAL A 1 53  ? 33.143 -10.975 5.561   1.00 17.56 ? 33  VAL A CB    1 
ATOM   271  C CG1   . VAL A 1 53  ? 33.620 -9.698  6.332   1.00 20.09 ? 33  VAL A CG1   1 
ATOM   272  C CG2   . VAL A 1 53  ? 34.145 -11.333 4.425   1.00 18.60 ? 33  VAL A CG2   1 
ATOM   273  N N     . GLU A 1 54  ? 32.274 -11.649 8.823   1.00 15.99 ? 34  GLU A N     1 
ATOM   274  C CA    . GLU A 1 54  ? 31.285 -11.380 9.864   1.00 15.98 ? 34  GLU A CA    1 
ATOM   275  C C     . GLU A 1 54  ? 31.785 -10.116 10.594  1.00 13.84 ? 34  GLU A C     1 
ATOM   276  O O     . GLU A 1 54  ? 32.984 -10.019 10.873  1.00 16.12 ? 34  GLU A O     1 
ATOM   277  C CB    . GLU A 1 54  ? 31.200 -12.531 10.873  1.00 20.06 ? 34  GLU A CB    1 
ATOM   278  C CG    . GLU A 1 54  ? 30.344 -13.706 10.453  1.00 33.49 ? 34  GLU A CG    1 
ATOM   279  C CD    . GLU A 1 54  ? 30.157 -14.619 11.630  1.00 39.99 ? 34  GLU A CD    1 
ATOM   280  O OE1   . GLU A 1 54  ? 29.454 -14.235 12.600  1.00 39.59 ? 34  GLU A OE1   1 
ATOM   281  O OE2   . GLU A 1 54  ? 30.773 -15.687 11.607  1.00 35.14 ? 34  GLU A OE2   1 
ATOM   282  N N     . CYS A 1 55  ? 30.860 -9.207  10.856  1.00 15.17 ? 35  CYS A N     1 
ATOM   283  C CA    . CYS A 1 55  ? 31.260 -7.887  11.453  1.00 14.60 ? 35  CYS A CA    1 
ATOM   284  C C     . CYS A 1 55  ? 30.630 -7.662  12.815  1.00 15.73 ? 35  CYS A C     1 
ATOM   285  O O     . CYS A 1 55  ? 29.481 -8.038  13.098  1.00 17.44 ? 35  CYS A O     1 
ATOM   286  C CB    . CYS A 1 55  ? 30.815 -6.735  10.567  1.00 17.28 ? 35  CYS A CB    1 
ATOM   287  S SG    . CYS A 1 55  ? 31.584 -6.787  8.890   1.00 22.77 ? 35  CYS A SG    1 
ATOM   288  N N     . TRP A 1 56  ? 31.399 -7.036  13.676  1.00 14.53 ? 36  TRP A N     1 
ATOM   289  C CA    . TRP A 1 56  ? 30.879 -6.529  14.948  1.00 15.70 ? 36  TRP A CA    1 
ATOM   290  C C     . TRP A 1 56  ? 31.209 -5.050  15.059  1.00 14.16 ? 36  TRP A C     1 
ATOM   291  O O     . TRP A 1 56  ? 32.316 -4.659  14.673  1.00 16.12 ? 36  TRP A O     1 
ATOM   292  C CB    . TRP A 1 56  ? 31.558 -7.239  16.096  1.00 12.65 ? 36  TRP A CB    1 
ATOM   293  C CG    . TRP A 1 56  ? 31.081 -8.672  16.208  1.00 15.54 ? 36  TRP A CG    1 
ATOM   294  C CD1   . TRP A 1 56  ? 30.047 -9.090  16.979  1.00 17.96 ? 36  TRP A CD1   1 
ATOM   295  C CD2   . TRP A 1 56  ? 31.578 -9.835  15.522  1.00 14.50 ? 36  TRP A CD2   1 
ATOM   296  N NE1   . TRP A 1 56  ? 29.847 -10.453 16.800  1.00 20.64 ? 36  TRP A NE1   1 
ATOM   297  C CE2   . TRP A 1 56  ? 30.814 -10.943 15.976  1.00 17.62 ? 36  TRP A CE2   1 
ATOM   298  C CE3   . TRP A 1 56  ? 32.657 -10.064 14.683  1.00 15.85 ? 36  TRP A CE3   1 
ATOM   299  C CZ2   . TRP A 1 56  ? 30.995 -12.255 15.472  1.00 16.55 ? 36  TRP A CZ2   1 
ATOM   300  C CZ3   . TRP A 1 56  ? 32.862 -11.337 14.220  1.00 18.79 ? 36  TRP A CZ3   1 
ATOM   301  C CH2   . TRP A 1 56  ? 32.050 -12.430 14.618  1.00 19.03 ? 36  TRP A CH2   1 
ATOM   302  N N     . ASN A 1 57  ? 30.273 -4.260  15.550  1.00 12.90 ? 37  ASN A N     1 
ATOM   303  C CA    . ASN A 1 57  ? 30.380 -2.803  15.613  1.00 13.50 ? 37  ASN A CA    1 
ATOM   304  C C     . ASN A 1 57  ? 30.500 -2.372  17.066  1.00 12.50 ? 37  ASN A C     1 
ATOM   305  O O     . ASN A 1 57  ? 29.607 -2.633  17.870  1.00 11.49 ? 37  ASN A O     1 
ATOM   306  C CB    . ASN A 1 57  ? 29.134 -2.207  15.003  1.00 11.89 ? 37  ASN A CB    1 
ATOM   307  C CG    . ASN A 1 57  ? 29.203 -0.712  14.879  1.00 13.39 ? 37  ASN A CG    1 
ATOM   308  O OD1   . ASN A 1 57  ? 30.002 -0.075  15.592  1.00 13.02 ? 37  ASN A OD1   1 
ATOM   309  N ND2   . ASN A 1 57  ? 28.322 -0.129  14.059  1.00 15.21 ? 37  ASN A ND2   1 
ATOM   310  N N     . PRO A 1 58  ? 31.625 -1.771  17.490  1.00 10.25 ? 38  PRO A N     1 
ATOM   311  C CA    . PRO A 1 58  ? 31.739 -1.257  18.863  1.00 11.97 ? 38  PRO A CA    1 
ATOM   312  C C     . PRO A 1 58  ? 30.525 -0.426  19.345  1.00 13.03 ? 38  PRO A C     1 
ATOM   313  O O     . PRO A 1 58  ? 30.238 -0.508  20.544  1.00 13.87 ? 38  PRO A O     1 
ATOM   314  C CB    . PRO A 1 58  ? 33.025 -0.419  18.818  1.00 11.95 ? 38  PRO A CB    1 
ATOM   315  C CG    . PRO A 1 58  ? 33.878 -1.146  17.714  1.00 10.85 ? 38  PRO A CG    1 
ATOM   316  C CD    . PRO A 1 58  ? 32.839 -1.478  16.657  1.00 11.81 ? 38  PRO A CD    1 
ATOM   317  N N     . ARG A 1 59  ? 29.804 0.230   18.467  1.00 11.22 ? 39  ARG A N     1 
ATOM   318  C CA    . ARG A 1 59  ? 28.659 1.004   18.885  1.00 11.53 ? 39  ARG A CA    1 
ATOM   319  C C     . ARG A 1 59  ? 27.650 0.119   19.550  1.00 16.53 ? 39  ARG A C     1 
ATOM   320  O O     . ARG A 1 59  ? 26.937 0.571   20.455  1.00 15.24 ? 39  ARG A O     1 
ATOM   321  C CB    . ARG A 1 59  ? 28.004 1.640   17.656  1.00 14.53 ? 39  ARG A CB    1 
ATOM   322  C CG    . ARG A 1 59  ? 27.149 2.725   18.217  1.00 23.31 ? 39  ARG A CG    1 
ATOM   323  C CD    . ARG A 1 59  ? 26.831 3.778   17.261  1.00 27.97 ? 39  ARG A CD    1 
ATOM   324  N NE    . ARG A 1 59  ? 27.913 4.424   16.513  1.00 30.24 ? 39  ARG A NE    1 
ATOM   325  C CZ    . ARG A 1 59  ? 28.442 5.631   16.781  1.00 30.48 ? 39  ARG A CZ    1 
ATOM   326  N NH1   . ARG A 1 59  ? 28.090 6.317   17.911  1.00 23.46 ? 39  ARG A NH1   1 
ATOM   327  N NH2   . ARG A 1 59  ? 29.314 6.147   15.896  1.00 21.20 ? 39  ARG A NH2   1 
ATOM   328  N N     . ASP A 1 60  ? 27.571 -1.122  19.082  1.00 11.14 ? 40  ASP A N     1 
ATOM   329  C CA    . ASP A 1 60  ? 26.539 -1.998  19.665  1.00 12.35 ? 40  ASP A CA    1 
ATOM   330  C C     . ASP A 1 60  ? 26.917 -2.511  21.046  1.00 12.71 ? 40  ASP A C     1 
ATOM   331  O O     . ASP A 1 60  ? 26.104 -3.158  21.762  1.00 15.50 ? 40  ASP A O     1 
ATOM   332  C CB    . ASP A 1 60  ? 26.354 -3.204  18.762  1.00 12.14 ? 40  ASP A CB    1 
ATOM   333  C CG    . ASP A 1 60  ? 25.799 -2.838  17.429  1.00 14.02 ? 40  ASP A CG    1 
ATOM   334  O OD1   . ASP A 1 60  ? 25.035 -1.849  17.325  1.00 18.97 ? 40  ASP A OD1   1 
ATOM   335  O OD2   . ASP A 1 60  ? 26.105 -3.508  16.398  1.00 18.17 ? 40  ASP A OD2   1 
ATOM   336  N N     . PHE A 1 61  ? 28.131 -2.242  21.486  1.00 11.55 ? 41  PHE A N     1 
ATOM   337  C CA    . PHE A 1 61  ? 28.611 -2.650  22.797  1.00 13.63 ? 41  PHE A CA    1 
ATOM   338  C C     . PHE A 1 61  ? 28.662 -1.475  23.758  1.00 10.61 ? 41  PHE A C     1 
ATOM   339  O O     . PHE A 1 61  ? 29.248 -1.641  24.846  1.00 13.30 ? 41  PHE A O     1 
ATOM   340  C CB    . PHE A 1 61  ? 30.002 -3.293  22.662  1.00 11.63 ? 41  PHE A CB    1 
ATOM   341  C CG    . PHE A 1 61  ? 29.940 -4.592  21.881  1.00 11.26 ? 41  PHE A CG    1 
ATOM   342  C CD1   . PHE A 1 61  ? 29.768 -5.799  22.550  1.00 11.10 ? 41  PHE A CD1   1 
ATOM   343  C CD2   . PHE A 1 61  ? 29.937 -4.587  20.492  1.00 12.13 ? 41  PHE A CD2   1 
ATOM   344  C CE1   . PHE A 1 61  ? 29.590 -6.997  21.806  1.00 13.55 ? 41  PHE A CE1   1 
ATOM   345  C CE2   . PHE A 1 61  ? 29.765 -5.763  19.764  1.00 12.96 ? 41  PHE A CE2   1 
ATOM   346  C CZ    . PHE A 1 61  ? 29.626 -6.962  20.403  1.00 14.24 ? 41  PHE A CZ    1 
ATOM   347  N N     . THR A 1 62  ? 28.078 -0.327  23.404  1.00 10.89 ? 42  THR A N     1 
ATOM   348  C CA    . THR A 1 62  ? 28.054 0.811   24.327  1.00 12.47 ? 42  THR A CA    1 
ATOM   349  C C     . THR A 1 62  ? 26.871 0.670   25.258  1.00 15.00 ? 42  THR A C     1 
ATOM   350  O O     . THR A 1 62  ? 25.866 -0.013  24.924  1.00 14.54 ? 42  THR A O     1 
ATOM   351  C CB    . THR A 1 62  ? 27.922 2.158   23.578  1.00 12.58 ? 42  THR A CB    1 
ATOM   352  O OG1   . THR A 1 62  ? 26.766 2.104   22.761  1.00 13.96 ? 42  THR A OG1   1 
ATOM   353  C CG2   . THR A 1 62  ? 29.124 2.354   22.651  1.00 13.95 ? 42  THR A CG2   1 
ATOM   354  N N     . PHE A 1 63  ? 26.914 1.414   26.360  1.00 12.14 ? 43  PHE A N     1 
ATOM   355  C CA    . PHE A 1 63  ? 25.778 1.400   27.327  1.00 13.24 ? 43  PHE A CA    1 
ATOM   356  C C     . PHE A 1 63  ? 25.243 2.766   27.620  1.00 16.12 ? 43  PHE A C     1 
ATOM   357  O O     . PHE A 1 63  ? 24.164 2.911   28.238  1.00 17.17 ? 43  PHE A O     1 
ATOM   358  C CB    . PHE A 1 63  ? 26.214 0.717   28.639  1.00 14.28 ? 43  PHE A CB    1 
ATOM   359  C CG    . PHE A 1 63  ? 26.539 -0.717  28.470  1.00 11.89 ? 43  PHE A CG    1 
ATOM   360  C CD1   . PHE A 1 63  ? 25.473 -1.626  28.283  1.00 11.77 ? 43  PHE A CD1   1 
ATOM   361  C CD2   . PHE A 1 63  ? 27.863 -1.224  28.380  1.00 11.06 ? 43  PHE A CD2   1 
ATOM   362  C CE1   . PHE A 1 63  ? 25.721 -2.971  28.078  1.00 12.82 ? 43  PHE A CE1   1 
ATOM   363  C CE2   . PHE A 1 63  ? 28.113 -2.598  28.199  1.00 13.39 ? 43  PHE A CE2   1 
ATOM   364  C CZ    . PHE A 1 63  ? 27.035 -3.471  28.013  1.00 12.62 ? 43  PHE A CZ    1 
ATOM   365  N N     . ASP A 1 64  ? 25.935 3.831   27.239  1.00 15.39 ? 44  ASP A N     1 
ATOM   366  C CA    . ASP A 1 64  ? 25.422 5.176   27.532  1.00 17.78 ? 44  ASP A CA    1 
ATOM   367  C C     . ASP A 1 64  ? 24.359 5.593   26.520  1.00 15.52 ? 44  ASP A C     1 
ATOM   368  O O     . ASP A 1 64  ? 24.215 5.047   25.410  1.00 16.16 ? 44  ASP A O     1 
ATOM   369  C CB    . ASP A 1 64  ? 26.518 6.235   27.601  1.00 17.87 ? 44  ASP A CB    1 
ATOM   370  C CG    . ASP A 1 64  ? 27.181 6.461   26.248  1.00 17.96 ? 44  ASP A CG    1 
ATOM   371  O OD1   . ASP A 1 64  ? 27.523 5.472   25.577  1.00 16.06 ? 44  ASP A OD1   1 
ATOM   372  O OD2   . ASP A 1 64  ? 27.322 7.649   25.900  1.00 22.52 ? 44  ASP A OD2   1 
ATOM   373  N N     . LYS A 1 65  ? 23.534 6.561   26.894  1.00 20.56 ? 45  LYS A N     1 
ATOM   374  C CA    . LYS A 1 65  ? 22.411 6.985   26.062  1.00 17.39 ? 45  LYS A CA    1 
ATOM   375  C C     . LYS A 1 65  ? 22.803 7.357   24.614  1.00 19.29 ? 45  LYS A C     1 
ATOM   376  O O     . LYS A 1 65  ? 22.087 7.120   23.647  1.00 22.71 ? 45  LYS A O     1 
ATOM   377  C CB    . LYS A 1 65  ? 21.755 8.207   26.737  1.00 25.89 ? 45  LYS A CB    1 
ATOM   378  C CG    . LYS A 1 65  ? 20.681 8.872   25.957  1.00 32.95 ? 45  LYS A CG    1 
ATOM   379  C CD    . LYS A 1 65  ? 20.107 10.041  26.799  1.00 34.35 ? 45  LYS A CD    1 
ATOM   380  C CE    . LYS A 1 65  ? 18.849 10.595  26.150  1.00 52.10 ? 45  LYS A CE    1 
ATOM   381  N NZ    . LYS A 1 65  ? 17.638 9.705   26.305  1.00 64.86 ? 45  LYS A NZ    1 
ATOM   382  N N     . HIS A 1 66  ? 23.983 7.975   24.492  1.00 20.82 ? 46  HIS A N     1 
ATOM   383  C CA    . HIS A 1 66  ? 24.375 8.426   23.172  1.00 20.14 ? 46  HIS A CA    1 
ATOM   384  C C     . HIS A 1 66  ? 25.384 7.507   22.484  1.00 18.15 ? 46  HIS A C     1 
ATOM   385  O O     . HIS A 1 66  ? 25.916 7.871   21.450  1.00 17.72 ? 46  HIS A O     1 
ATOM   386  C CB    . HIS A 1 66  ? 24.926 9.845   23.262  1.00 21.62 ? 46  HIS A CB    1 
ATOM   387  C CG    . HIS A 1 66  ? 23.868 10.842  23.619  1.00 27.29 ? 46  HIS A CG    1 
ATOM   388  N ND1   . HIS A 1 66  ? 23.781 11.427  24.868  1.00 35.00 ? 46  HIS A ND1   1 
ATOM   389  C CD2   . HIS A 1 66  ? 22.813 11.296  22.902  1.00 22.83 ? 46  HIS A CD2   1 
ATOM   390  C CE1   . HIS A 1 66  ? 22.720 12.226  24.887  1.00 29.52 ? 46  HIS A CE1   1 
ATOM   391  N NE2   . HIS A 1 66  ? 22.123 12.162  23.711  1.00 31.86 ? 46  HIS A NE2   1 
ATOM   392  N N     . LYS A 1 67  ? 25.551 6.298   23.005  1.00 15.92 ? 47  LYS A N     1 
ATOM   393  C CA    . LYS A 1 67  ? 26.342 5.248   22.304  1.00 13.71 ? 47  LYS A CA    1 
ATOM   394  C C     . LYS A 1 67  ? 27.741 5.811   21.898  1.00 13.92 ? 47  LYS A C     1 
ATOM   395  O O     . LYS A 1 67  ? 28.178 5.710   20.733  1.00 14.78 ? 47  LYS A O     1 
ATOM   396  C CB    . LYS A 1 67  ? 25.569 4.756   21.091  1.00 15.27 ? 47  LYS A CB    1 
ATOM   397  C CG    . LYS A 1 67  ? 24.206 4.179   21.537  1.00 19.71 ? 47  LYS A CG    1 
ATOM   398  C CD    . LYS A 1 67  ? 23.617 3.447   20.315  1.00 26.02 ? 47  LYS A CD    1 
ATOM   399  C CE    . LYS A 1 67  ? 22.375 2.633   20.774  1.00 35.84 ? 47  LYS A CE    1 
ATOM   400  N NZ    . LYS A 1 67  ? 21.319 3.514   21.362  1.00 52.32 ? 47  LYS A NZ    1 
ATOM   401  N N     . THR A 1 68  ? 28.432 6.324   22.921  1.00 14.47 ? 48  THR A N     1 
ATOM   402  C CA    . THR A 1 68  ? 29.734 6.957   22.720  1.00 13.22 ? 48  THR A CA    1 
ATOM   403  C C     . THR A 1 68  ? 30.844 5.922   22.429  1.00 10.36 ? 48  THR A C     1 
ATOM   404  O O     . THR A 1 68  ? 31.030 4.957   23.138  1.00 12.22 ? 48  THR A O     1 
ATOM   405  C CB    . THR A 1 68  ? 30.116 7.771   23.993  1.00 15.41 ? 48  THR A CB    1 
ATOM   406  O OG1   . THR A 1 68  ? 29.096 8.733   24.185  1.00 18.56 ? 48  THR A OG1   1 
ATOM   407  C CG2   . THR A 1 68  ? 31.446 8.526   23.765  1.00 15.62 ? 48  THR A CG2   1 
ATOM   408  N N     . VAL A 1 69  ? 31.540 6.153   21.289  1.00 12.13 ? 49  VAL A N     1 
ATOM   409  C CA    . VAL A 1 69  ? 32.557 5.199   20.892  1.00 13.19 ? 49  VAL A CA    1 
ATOM   410  C C     . VAL A 1 69  ? 33.962 5.794   20.805  1.00 11.46 ? 49  VAL A C     1 
ATOM   411  O O     . VAL A 1 69  ? 34.885 5.074   20.439  1.00 11.79 ? 49  VAL A O     1 
ATOM   412  C CB    . VAL A 1 69  ? 32.208 4.555   19.534  1.00 13.29 ? 49  VAL A CB    1 
ATOM   413  C CG1   . VAL A 1 69  ? 31.004 3.588   19.673  1.00 13.58 ? 49  VAL A CG1   1 
ATOM   414  C CG2   . VAL A 1 69  ? 31.989 5.632   18.449  1.00 12.63 ? 49  VAL A CG2   1 
ATOM   415  N N     . ASP A 1 70  ? 34.085 7.105   21.148  1.00 12.01 ? 50  ASP A N     1 
ATOM   416  C CA    . ASP A 1 70  ? 35.419 7.746   21.205  1.00 12.88 ? 50  ASP A CA    1 
ATOM   417  C C     . ASP A 1 70  ? 35.718 8.211   22.588  1.00 13.47 ? 50  ASP A C     1 
ATOM   418  O O     . ASP A 1 70  ? 34.837 8.164   23.512  1.00 14.42 ? 50  ASP A O     1 
ATOM   419  C CB    . ASP A 1 70  ? 35.532 8.894   20.165  1.00 13.54 ? 50  ASP A CB    1 
ATOM   420  C CG    . ASP A 1 70  ? 34.590 10.041  20.415  1.00 17.58 ? 50  ASP A CG    1 
ATOM   421  O OD1   . ASP A 1 70  ? 33.662 9.975   21.268  1.00 18.51 ? 50  ASP A OD1   1 
ATOM   422  O OD2   . ASP A 1 70  ? 34.706 11.035  19.663  1.00 16.71 ? 50  ASP A OD2   1 
ATOM   423  N N     . ASP A 1 71  ? 36.946 8.636   22.815  1.00 13.52 ? 51  ASP A N     1 
ATOM   424  C CA    . ASP A 1 71  ? 37.375 9.035   24.198  1.00 12.85 ? 51  ASP A CA    1 
ATOM   425  C C     . ASP A 1 71  ? 38.609 9.929   24.045  1.00 13.81 ? 51  ASP A C     1 
ATOM   426  O O     . ASP A 1 71  ? 39.258 9.932   23.004  1.00 14.44 ? 51  ASP A O     1 
ATOM   427  C CB    . ASP A 1 71  ? 37.631 7.813   25.122  1.00 12.65 ? 51  ASP A CB    1 
ATOM   428  C CG    . ASP A 1 71  ? 37.470 8.144   26.634  1.00 13.83 ? 51  ASP A CG    1 
ATOM   429  O OD1   . ASP A 1 71  ? 37.371 9.357   27.004  1.00 16.42 ? 51  ASP A OD1   1 
ATOM   430  O OD2   . ASP A 1 71  ? 37.511 7.196   27.408  1.00 14.82 ? 51  ASP A OD2   1 
ATOM   431  N N     . ARG A 1 72  ? 38.929 10.736  25.049  1.00 16.09 ? 52  ARG A N     1 
ATOM   432  C CA    . ARG A 1 72  ? 40.013 11.714  24.945  1.00 17.22 ? 52  ARG A CA    1 
ATOM   433  C C     . ARG A 1 72  ? 41.338 11.078  25.273  1.00 15.30 ? 52  ARG A C     1 
ATOM   434  O O     . ARG A 1 72  ? 41.464 10.232  26.185  1.00 16.83 ? 52  ARG A O     1 
ATOM   435  C CB    . ARG A 1 72  ? 39.752 12.798  25.980  1.00 16.95 ? 52  ARG A CB    1 
ATOM   436  C CG    . ARG A 1 72  ? 38.519 13.589  25.607  1.00 23.52 ? 52  ARG A CG    1 
ATOM   437  C CD    . ARG A 1 72  ? 38.193 14.731  26.648  1.00 36.62 ? 52  ARG A CD    1 
ATOM   438  N NE    . ARG A 1 72  ? 38.960 15.944  26.333  1.00 56.75 ? 52  ARG A NE    1 
ATOM   439  C CZ    . ARG A 1 72  ? 39.151 16.958  27.185  1.00 50.56 ? 52  ARG A CZ    1 
ATOM   440  N NH1   . ARG A 1 72  ? 38.624 16.908  28.404  1.00 40.54 ? 52  ARG A NH1   1 
ATOM   441  N NH2   . ARG A 1 72  ? 39.869 18.016  26.815  1.00 49.80 ? 52  ARG A NH2   1 
ATOM   442  N N     . PRO A 1 73  ? 42.387 11.439  24.544  1.00 17.80 ? 53  PRO A N     1 
ATOM   443  C CA    . PRO A 1 73  ? 43.685 10.862  24.876  1.00 15.45 ? 53  PRO A CA    1 
ATOM   444  C C     . PRO A 1 73  ? 44.286 11.477  26.132  1.00 15.84 ? 53  PRO A C     1 
ATOM   445  O O     . PRO A 1 73  ? 44.173 12.720  26.234  1.00 18.65 ? 53  PRO A O     1 
ATOM   446  C CB    . PRO A 1 73  ? 44.567 11.264  23.676  1.00 21.11 ? 53  PRO A CB    1 
ATOM   447  C CG    . PRO A 1 73  ? 43.914 12.441  23.120  1.00 24.19 ? 53  PRO A CG    1 
ATOM   448  C CD    . PRO A 1 73  ? 42.405 12.221  23.290  1.00 23.24 ? 53  PRO A CD    1 
ATOM   449  N N     . TYR A 1 74  ? 44.889 10.653  26.955  1.00 17.60 ? 54  TYR A N     1 
ATOM   450  C CA    . TYR A 1 74  ? 45.690 11.200  28.062  1.00 19.18 ? 54  TYR A CA    1 
ATOM   451  C C     . TYR A 1 74  ? 46.819 11.982  27.442  1.00 21.52 ? 54  TYR A C     1 
ATOM   452  O O     . TYR A 1 74  ? 47.398 11.572  26.420  1.00 18.51 ? 54  TYR A O     1 
ATOM   453  C CB    . TYR A 1 74  ? 46.281 10.084  28.892  1.00 17.67 ? 54  TYR A CB    1 
ATOM   454  C CG    . TYR A 1 74  ? 45.230 9.432   29.806  1.00 19.97 ? 54  TYR A CG    1 
ATOM   455  C CD1   . TYR A 1 74  ? 44.636 10.179  30.818  1.00 25.02 ? 54  TYR A CD1   1 
ATOM   456  C CD2   . TYR A 1 74  ? 44.843 8.104   29.637  1.00 16.27 ? 54  TYR A CD2   1 
ATOM   457  C CE1   . TYR A 1 74  ? 43.688 9.598   31.667  1.00 21.21 ? 54  TYR A CE1   1 
ATOM   458  C CE2   . TYR A 1 74  ? 43.944 7.494   30.522  1.00 16.11 ? 54  TYR A CE2   1 
ATOM   459  C CZ    . TYR A 1 74  ? 43.352 8.262   31.494  1.00 20.13 ? 54  TYR A CZ    1 
ATOM   460  O OH    . TYR A 1 74  ? 42.384 7.700   32.357  1.00 22.06 ? 54  TYR A OH    1 
ATOM   461  N N     . GLY A 1 75  ? 47.134 13.131  28.070  1.00 20.36 ? 55  GLY A N     1 
ATOM   462  C CA    . GLY A 1 75  ? 48.243 13.923  27.604  1.00 21.51 ? 55  GLY A CA    1 
ATOM   463  C C     . GLY A 1 75  ? 47.784 15.056  26.747  1.00 26.19 ? 55  GLY A C     1 
ATOM   464  O O     . GLY A 1 75  ? 48.617 15.887  26.326  1.00 24.00 ? 55  GLY A O     1 
ATOM   465  N N     . GLY A 1 76  ? 46.487 15.060  26.381  1.00 27.10 ? 56  GLY A N     1 
ATOM   466  C CA    . GLY A 1 76  ? 45.907 16.095  25.570  1.00 32.33 ? 56  GLY A CA    1 
ATOM   467  C C     . GLY A 1 76  ? 46.340 15.945  24.143  1.00 28.92 ? 56  GLY A C     1 
ATOM   468  O O     . GLY A 1 76  ? 46.734 14.858  23.652  1.00 30.45 ? 56  GLY A O     1 
ATOM   469  N N     . GLY A 1 77  ? 46.318 17.057  23.450  1.00 50.47 ? 57  GLY A N     1 
ATOM   470  C CA    . GLY A 1 77  ? 46.739 17.015  22.074  1.00 53.19 ? 57  GLY A CA    1 
ATOM   471  C C     . GLY A 1 77  ? 45.439 16.953  21.347  1.00 39.08 ? 57  GLY A C     1 
ATOM   472  O O     . GLY A 1 77  ? 44.401 16.751  21.970  1.00 47.63 ? 57  GLY A O     1 
ATOM   473  N N     . PRO A 1 78  ? 45.480 17.156  20.045  1.00 44.51 ? 58  PRO A N     1 
ATOM   474  C CA    . PRO A 1 78  ? 44.205 17.182  19.369  1.00 41.87 ? 58  PRO A CA    1 
ATOM   475  C C     . PRO A 1 78  ? 43.813 15.732  19.147  1.00 50.35 ? 58  PRO A C     1 
ATOM   476  O O     . PRO A 1 78  ? 44.585 14.776  19.293  1.00 36.29 ? 58  PRO A O     1 
ATOM   477  C CB    . PRO A 1 78  ? 44.551 17.834  18.033  1.00 39.05 ? 58  PRO A CB    1 
ATOM   478  C CG    . PRO A 1 78  ? 45.925 17.287  17.741  1.00 42.29 ? 58  PRO A CG    1 
ATOM   479  C CD    . PRO A 1 78  ? 46.608 17.180  19.102  1.00 58.03 ? 58  PRO A CD    1 
ATOM   480  N N     . GLY A 1 79  ? 42.569 15.577  18.793  1.00 29.09 ? 59  GLY A N     1 
ATOM   481  C CA    . GLY A 1 79  ? 42.105 14.280  18.383  1.00 23.79 ? 59  GLY A CA    1 
ATOM   482  C C     . GLY A 1 79  ? 41.480 13.444  19.473  1.00 19.89 ? 59  GLY A C     1 
ATOM   483  O O     . GLY A 1 79  ? 41.528 13.729  20.686  1.00 23.33 ? 59  GLY A O     1 
ATOM   484  N N     . MET A 1 80  ? 40.834 12.401  18.982  1.00 15.95 ? 60  MET A N     1 
ATOM   485  C CA    . MET A 1 80  ? 40.230 11.437  19.887  1.00 15.51 ? 60  MET A CA    1 
ATOM   486  C C     . MET A 1 80  ? 40.724 10.062  19.581  1.00 16.33 ? 60  MET A C     1 
ATOM   487  O O     . MET A 1 80  ? 41.390 9.864   18.559  1.00 17.30 ? 60  MET A O     1 
ATOM   488  C CB    . MET A 1 80  ? 38.698 11.481  19.709  1.00 16.63 ? 60  MET A CB    1 
ATOM   489  C CG    . MET A 1 80  ? 38.089 12.841  20.008  1.00 18.96 ? 60  MET A CG    1 
ATOM   490  S SD    . MET A 1 80  ? 38.153 13.250  21.749  1.00 20.63 ? 60  MET A SD    1 
ATOM   491  C CE    . MET A 1 80  ? 36.683 12.358  22.280  1.00 19.62 ? 60  MET A CE    1 
ATOM   492  N N     . LEU A 1 81  ? 40.537 9.150   20.507  1.00 13.15 ? 61  LEU A N     1 
ATOM   493  C CA    . LEU A 1 81  ? 40.831 7.697   20.348  1.00 14.87 ? 61  LEU A CA    1 
ATOM   494  C C     . LEU A 1 81  ? 39.556 6.874   20.361  1.00 13.10 ? 61  LEU A C     1 
ATOM   495  O O     . LEU A 1 81  ? 38.544 7.373   20.834  1.00 14.03 ? 61  LEU A O     1 
ATOM   496  C CB    . LEU A 1 81  ? 41.772 7.148   21.427  1.00 13.81 ? 61  LEU A CB    1 
ATOM   497  C CG    . LEU A 1 81  ? 43.197 7.675   21.531  1.00 23.22 ? 61  LEU A CG    1 
ATOM   498  C CD1   . LEU A 1 81  ? 43.821 6.698   22.532  1.00 24.51 ? 61  LEU A CD1   1 
ATOM   499  C CD2   . LEU A 1 81  ? 43.926 7.508   20.220  1.00 17.20 ? 61  LEU A CD2   1 
ATOM   500  N N     . MET A 1 82  ? 39.594 5.666   19.796  1.00 12.76 ? 62  MET A N     1 
ATOM   501  C CA    . MET A 1 82  ? 38.483 4.771   20.088  1.00 13.15 ? 62  MET A CA    1 
ATOM   502  C C     . MET A 1 82  ? 38.407 4.520   21.603  1.00 9.41  ? 62  MET A C     1 
ATOM   503  O O     . MET A 1 82  ? 39.397 4.345   22.324  1.00 12.32 ? 62  MET A O     1 
ATOM   504  C CB    . MET A 1 82  ? 38.705 3.462   19.363  1.00 14.48 ? 62  MET A CB    1 
ATOM   505  C CG    . MET A 1 82  ? 38.727 3.671   17.835  1.00 14.24 ? 62  MET A CG    1 
ATOM   506  S SD    . MET A 1 82  ? 38.654 2.194   16.886  1.00 23.19 ? 62  MET A SD    1 
ATOM   507  C CE    . MET A 1 82  ? 36.837 1.762   17.062  1.00 20.71 ? 62  MET A CE    1 
ATOM   508  N N     . MET A 1 83  ? 37.162 4.565   22.072  1.00 11.70 ? 63  MET A N     1 
ATOM   509  C CA    . MET A 1 83  ? 36.890 4.263   23.507  1.00 12.97 ? 63  MET A CA    1 
ATOM   510  C C     . MET A 1 83  ? 37.209 2.774   23.749  1.00 11.72 ? 63  MET A C     1 
ATOM   511  O O     . MET A 1 83  ? 36.866 1.883   22.934  1.00 12.73 ? 63  MET A O     1 
ATOM   512  C CB    . MET A 1 83  ? 35.397 4.558   23.771  1.00 10.66 ? 63  MET A CB    1 
ATOM   513  C CG    . MET A 1 83  ? 35.086 4.377   25.312  1.00 13.13 ? 63  MET A CG    1 
ATOM   514  S SD    . MET A 1 83  ? 33.340 4.670   25.581  1.00 13.30 ? 63  MET A SD    1 
ATOM   515  C CE    . MET A 1 83  ? 33.272 4.352   27.327  1.00 15.14 ? 63  MET A CE    1 
ATOM   516  N N     . VAL A 1 84  ? 37.923 2.510   24.819  1.00 11.86 ? 64  VAL A N     1 
ATOM   517  C CA    . VAL A 1 84  ? 38.378 1.154   25.127  1.00 11.29 ? 64  VAL A CA    1 
ATOM   518  C C     . VAL A 1 84  ? 37.282 0.131   25.384  1.00 10.58 ? 64  VAL A C     1 
ATOM   519  O O     . VAL A 1 84  ? 37.263 -0.910  24.725  1.00 11.38 ? 64  VAL A O     1 
ATOM   520  C CB    . VAL A 1 84  ? 39.351 1.202   26.373  1.00 11.75 ? 64  VAL A CB    1 
ATOM   521  C CG1   . VAL A 1 84  ? 39.607 -0.224  26.885  1.00 13.07 ? 64  VAL A CG1   1 
ATOM   522  C CG2   . VAL A 1 84  ? 40.676 1.786   25.877  1.00 12.97 ? 64  VAL A CG2   1 
ATOM   523  N N     . GLN A 1 85  ? 36.341 0.453   26.298  1.00 11.78 ? 65  GLN A N     1 
ATOM   524  C CA    . GLN A 1 85  ? 35.395 -0.589  26.650  1.00 13.61 ? 65  GLN A CA    1 
ATOM   525  C C     . GLN A 1 85  ? 34.548 -1.160  25.471  1.00 11.43 ? 65  GLN A C     1 
ATOM   526  O O     . GLN A 1 85  ? 34.443 -2.387  25.325  1.00 11.44 ? 65  GLN A O     1 
ATOM   527  C CB    . GLN A 1 85  ? 34.586 -0.062  27.845  1.00 13.37 ? 65  GLN A CB    1 
ATOM   528  C CG    . GLN A 1 85  ? 33.358 -1.007  28.228  1.00 13.27 ? 65  GLN A CG    1 
ATOM   529  C CD    . GLN A 1 85  ? 32.117 -0.650  27.464  1.00 12.04 ? 65  GLN A CD    1 
ATOM   530  O OE1   . GLN A 1 85  ? 31.758 0.506   27.377  1.00 13.43 ? 65  GLN A OE1   1 
ATOM   531  N NE2   . GLN A 1 85  ? 31.455 -1.662  26.880  1.00 13.21 ? 65  GLN A NE2   1 
ATOM   532  N N     . PRO A 1 86  ? 33.919 -0.318  24.645  1.00 10.94 ? 66  PRO A N     1 
ATOM   533  C CA    . PRO A 1 86  ? 33.106 -0.896  23.561  1.00 9.67  ? 66  PRO A CA    1 
ATOM   534  C C     . PRO A 1 86  ? 33.949 -1.700  22.575  1.00 10.96 ? 66  PRO A C     1 
ATOM   535  O O     . PRO A 1 86  ? 33.513 -2.733  22.038  1.00 11.89 ? 66  PRO A O     1 
ATOM   536  C CB    . PRO A 1 86  ? 32.425 0.310   22.894  1.00 14.03 ? 66  PRO A CB    1 
ATOM   537  C CG    . PRO A 1 86  ? 32.466 1.401   24.001  1.00 14.02 ? 66  PRO A CG    1 
ATOM   538  C CD    . PRO A 1 86  ? 33.763 1.153   24.728  1.00 10.28 ? 66  PRO A CD    1 
ATOM   539  N N     . LEU A 1 87  ? 35.167 -1.163  22.297  1.00 11.35 ? 67  LEU A N     1 
ATOM   540  C CA    . LEU A 1 87  ? 36.059 -1.813  21.335  1.00 11.45 ? 67  LEU A CA    1 
ATOM   541  C C     . LEU A 1 87  ? 36.542 -3.152  21.878  1.00 11.79 ? 67  LEU A C     1 
ATOM   542  O O     . LEU A 1 87  ? 36.548 -4.166  21.163  1.00 11.40 ? 67  LEU A O     1 
ATOM   543  C CB    . LEU A 1 87  ? 37.198 -0.857  20.987  1.00 12.41 ? 67  LEU A CB    1 
ATOM   544  C CG    . LEU A 1 87  ? 38.318 -1.494  20.163  1.00 11.32 ? 67  LEU A CG    1 
ATOM   545  C CD1   . LEU A 1 87  ? 37.754 -1.975  18.778  1.00 11.17 ? 67  LEU A CD1   1 
ATOM   546  C CD2   . LEU A 1 87  ? 39.419 -0.465  19.888  1.00 14.60 ? 67  LEU A CD2   1 
ATOM   547  N N     . ARG A 1 88  ? 36.944 -3.144  23.154  1.00 10.66 ? 68  ARG A N     1 
ATOM   548  C CA    . ARG A 1 88  ? 37.432 -4.409  23.803  1.00 10.78 ? 68  ARG A CA    1 
ATOM   549  C C     . ARG A 1 88  ? 36.313 -5.440  23.815  1.00 12.75 ? 68  ARG A C     1 
ATOM   550  O O     . ARG A 1 88  ? 36.562 -6.593  23.517  1.00 13.30 ? 68  ARG A O     1 
ATOM   551  C CB    . ARG A 1 88  ? 37.848 -4.069  25.218  1.00 13.97 ? 68  ARG A CB    1 
ATOM   552  C CG    . ARG A 1 88  ? 38.410 -5.226  26.016  1.00 16.57 ? 68  ARG A CG    1 
ATOM   553  C CD    . ARG A 1 88  ? 38.925 -4.634  27.347  1.00 22.14 ? 68  ARG A CD    1 
ATOM   554  N NE    . ARG A 1 88  ? 39.715 -5.630  28.067  1.00 27.98 ? 68  ARG A NE    1 
ATOM   555  C CZ    . ARG A 1 88  ? 39.170 -6.374  29.035  1.00 30.91 ? 68  ARG A CZ    1 
ATOM   556  N NH1   . ARG A 1 88  ? 37.886 -6.163  29.344  1.00 26.73 ? 68  ARG A NH1   1 
ATOM   557  N NH2   . ARG A 1 88  ? 39.876 -7.312  29.674  1.00 25.68 ? 68  ARG A NH2   1 
ATOM   558  N N     . ASP A 1 89  ? 35.108 -5.008  24.154  1.00 13.53 ? 69  ASP A N     1 
ATOM   559  C CA    . ASP A 1 89  ? 33.989 -5.956  24.199  1.00 13.64 ? 69  ASP A CA    1 
ATOM   560  C C     . ASP A 1 89  ? 33.665 -6.546  22.834  1.00 15.12 ? 69  ASP A C     1 
ATOM   561  O O     . ASP A 1 89  ? 33.352 -7.739  22.705  1.00 14.07 ? 69  ASP A O     1 
ATOM   562  C CB    . ASP A 1 89  ? 32.748 -5.316  24.841  1.00 12.03 ? 69  ASP A CB    1 
ATOM   563  C CG    . ASP A 1 89  ? 32.933 -5.088  26.363  1.00 12.88 ? 69  ASP A CG    1 
ATOM   564  O OD1   . ASP A 1 89  ? 33.987 -5.470  26.965  1.00 15.15 ? 69  ASP A OD1   1 
ATOM   565  O OD2   . ASP A 1 89  ? 31.997 -4.412  26.880  1.00 15.65 ? 69  ASP A OD2   1 
ATOM   566  N N     . ALA A 1 90  ? 33.751 -5.697  21.812  1.00 13.11 ? 70  ALA A N     1 
ATOM   567  C CA    . ALA A 1 90  ? 33.530 -6.168  20.469  1.00 11.89 ? 70  ALA A CA    1 
ATOM   568  C C     . ALA A 1 90  ? 34.606 -7.185  20.071  1.00 14.51 ? 70  ALA A C     1 
ATOM   569  O O     . ALA A 1 90  ? 34.297 -8.211  19.475  1.00 13.62 ? 70  ALA A O     1 
ATOM   570  C CB    . ALA A 1 90  ? 33.541 -4.976  19.451  1.00 13.02 ? 70  ALA A CB    1 
ATOM   571  N N     . ILE A 1 91  ? 35.858 -6.905  20.414  1.00 13.34 ? 71  ILE A N     1 
ATOM   572  C CA    . ILE A 1 91  ? 36.925 -7.824  20.088  1.00 14.36 ? 71  ILE A CA    1 
ATOM   573  C C     . ILE A 1 91  ? 36.695 -9.189  20.800  1.00 14.65 ? 71  ILE A C     1 
ATOM   574  O O     . ILE A 1 91  ? 36.863 -10.249 20.180  1.00 16.31 ? 71  ILE A O     1 
ATOM   575  C CB    . ILE A 1 91  ? 38.273 -7.251  20.500  1.00 15.82 ? 71  ILE A CB    1 
ATOM   576  C CG1   . ILE A 1 91  ? 38.603 -6.102  19.548  1.00 12.21 ? 71  ILE A CG1   1 
ATOM   577  C CG2   . ILE A 1 91  ? 39.346 -8.306  20.386  1.00 16.50 ? 71  ILE A CG2   1 
ATOM   578  C CD1   . ILE A 1 91  ? 39.872 -5.282  20.015  1.00 12.46 ? 71  ILE A CD1   1 
ATOM   579  N N     . HIS A 1 92  ? 36.334 -9.140  22.066  1.00 14.73 ? 72  HIS A N     1 
ATOM   580  C CA    . HIS A 1 92  ? 36.131 -10.396 22.743  1.00 16.18 ? 72  HIS A CA    1 
ATOM   581  C C     . HIS A 1 92  ? 34.988 -11.165 22.156  1.00 15.79 ? 72  HIS A C     1 
ATOM   582  O O     . HIS A 1 92  ? 35.055 -12.413 22.100  1.00 16.61 ? 72  HIS A O     1 
ATOM   583  C CB    . HIS A 1 92  ? 35.796 -10.076 24.175  1.00 13.49 ? 72  HIS A CB    1 
ATOM   584  C CG    . HIS A 1 92  ? 36.975 -9.623  24.950  1.00 15.86 ? 72  HIS A CG    1 
ATOM   585  N ND1   . HIS A 1 92  ? 36.855 -9.174  26.242  1.00 17.60 ? 72  HIS A ND1   1 
ATOM   586  C CD2   . HIS A 1 92  ? 38.285 -9.477  24.619  1.00 16.81 ? 72  HIS A CD2   1 
ATOM   587  C CE1   . HIS A 1 92  ? 38.041 -8.824  26.703  1.00 18.97 ? 72  HIS A CE1   1 
ATOM   588  N NE2   . HIS A 1 92  ? 38.922 -8.985  25.736  1.00 16.93 ? 72  HIS A NE2   1 
ATOM   589  N N     . THR A 1 93  ? 33.923 -10.507 21.707  1.00 14.25 ? 73  THR A N     1 
ATOM   590  C CA    . THR A 1 93  ? 32.846 -11.255 21.055  1.00 14.42 ? 73  THR A CA    1 
ATOM   591  C C     . THR A 1 93  ? 33.302 -11.904 19.768  1.00 19.31 ? 73  THR A C     1 
ATOM   592  O O     . THR A 1 93  ? 33.015 -13.060 19.507  1.00 18.08 ? 73  THR A O     1 
ATOM   593  C CB    . THR A 1 93  ? 31.651 -10.352 20.835  1.00 15.48 ? 73  THR A CB    1 
ATOM   594  O OG1   . THR A 1 93  ? 31.290 -9.809  22.105  1.00 23.38 ? 73  THR A OG1   1 
ATOM   595  C CG2   . THR A 1 93  ? 30.470 -11.037 20.161  1.00 18.96 ? 73  THR A CG2   1 
ATOM   596  N N     . ALA A 1 94  ? 34.039 -11.173 18.942  1.00 14.38 ? 74  ALA A N     1 
ATOM   597  C CA    . ALA A 1 94  ? 34.550 -11.759 17.752  1.00 15.62 ? 74  ALA A CA    1 
ATOM   598  C C     . ALA A 1 94  ? 35.459 -12.955 18.040  1.00 15.42 ? 74  ALA A C     1 
ATOM   599  O O     . ALA A 1 94  ? 35.413 -13.924 17.289  1.00 16.73 ? 74  ALA A O     1 
ATOM   600  C CB    . ALA A 1 94  ? 35.342 -10.665 16.959  1.00 16.48 ? 74  ALA A CB    1 
ATOM   601  N N     . LYS A 1 95  ? 36.325 -12.870 19.029  1.00 17.53 ? 75  LYS A N     1 
ATOM   602  C CA    . LYS A 1 95  ? 37.280 -13.950 19.384  1.00 18.46 ? 75  LYS A CA    1 
ATOM   603  C C     . LYS A 1 95  ? 36.462 -15.181 19.801  1.00 19.99 ? 75  LYS A C     1 
ATOM   604  O O     . LYS A 1 95  ? 36.803 -16.313 19.411  1.00 22.02 ? 75  LYS A O     1 
ATOM   605  C CB    . LYS A 1 95  ? 38.180 -13.495 20.529  1.00 17.51 ? 75  LYS A CB    1 
ATOM   606  C CG    . LYS A 1 95  ? 39.367 -12.632 20.057  1.00 19.32 ? 75  LYS A CG    1 
ATOM   607  C CD    . LYS A 1 95  ? 40.166 -12.119 21.243  1.00 23.68 ? 75  LYS A CD    1 
ATOM   608  C CE    . LYS A 1 95  ? 41.000 -13.228 21.915  1.00 33.94 ? 75  LYS A CE    1 
ATOM   609  N NZ    . LYS A 1 95  ? 42.100 -13.739 20.991  1.00 44.11 ? 75  LYS A NZ    1 
ATOM   610  N N     . ALA A 1 96  ? 35.393 -14.965 20.535  1.00 19.74 ? 76  ALA A N     1 
ATOM   611  C CA    . ALA A 1 96  ? 34.599 -16.111 20.922  1.00 21.97 ? 76  ALA A CA    1 
ATOM   612  C C     . ALA A 1 96  ? 33.939 -16.768 19.745  1.00 22.93 ? 76  ALA A C     1 
ATOM   613  O O     . ALA A 1 96  ? 33.848 -17.998 19.715  1.00 28.69 ? 76  ALA A O     1 
ATOM   614  C CB    . ALA A 1 96  ? 33.574 -15.715 21.961  1.00 21.89 ? 76  ALA A CB    1 
ATOM   615  N N     . ALA A 1 97  ? 33.456 -15.994 18.778  1.00 20.39 ? 77  ALA A N     1 
ATOM   616  C CA    . ALA A 1 97  ? 32.806 -16.513 17.583  1.00 19.64 ? 77  ALA A CA    1 
ATOM   617  C C     . ALA A 1 97  ? 33.801 -17.273 16.741  1.00 27.21 ? 77  ALA A C     1 
ATOM   618  O O     . ALA A 1 97  ? 33.419 -18.227 16.061  1.00 28.65 ? 77  ALA A O     1 
ATOM   619  C CB    . ALA A 1 97  ? 32.222 -15.362 16.738  1.00 22.23 ? 77  ALA A CB    1 
ATOM   620  N N     . ALA A 1 98  ? 35.066 -16.844 16.736  1.00 21.92 ? 78  ALA A N     1 
ATOM   621  C CA    . ALA A 1 98  ? 36.078 -17.455 15.871  1.00 24.89 ? 78  ALA A CA    1 
ATOM   622  C C     . ALA A 1 98  ? 36.531 -18.791 16.416  1.00 32.15 ? 78  ALA A C     1 
ATOM   623  O O     . ALA A 1 98  ? 37.016 -19.646 15.670  1.00 32.71 ? 78  ALA A O     1 
ATOM   624  C CB    . ALA A 1 98  ? 37.291 -16.563 15.702  1.00 23.04 ? 78  ALA A CB    1 
ATOM   625  N N     . GLY A 1 99  ? 36.401 -18.939 17.729  1.00 31.99 ? 79  GLY A N     1 
ATOM   626  C CA    . GLY A 1 99  ? 36.940 -20.068 18.447  1.00 39.43 ? 79  GLY A CA    1 
ATOM   627  C C     . GLY A 1 99  ? 38.445 -20.021 18.466  1.00 40.42 ? 79  GLY A C     1 
ATOM   628  O O     . GLY A 1 99  ? 39.088 -18.984 18.280  1.00 44.10 ? 79  GLY A O     1 
ATOM   629  N N     . GLU A 1 100 ? 39.028 -21.190 18.681  1.00 56.65 ? 80  GLU A N     1 
ATOM   630  C CA    . GLU A 1 100 ? 40.469 -21.302 18.740  1.00 54.62 ? 80  GLU A CA    1 
ATOM   631  C C     . GLU A 1 100 ? 41.146 -21.148 17.383  1.00 43.34 ? 80  GLU A C     1 
ATOM   632  O O     . GLU A 1 100 ? 40.598 -21.536 16.314  1.00 48.41 ? 80  GLU A O     1 
ATOM   633  C CB    . GLU A 1 100 ? 40.880 -22.617 19.412  1.00 61.07 ? 80  GLU A CB    1 
ATOM   634  C CG    . GLU A 1 100 ? 40.559 -22.647 20.896  1.00 63.61 ? 80  GLU A CG    1 
ATOM   635  C CD    . GLU A 1 100 ? 41.066 -21.412 21.635  1.00 61.52 ? 80  GLU A CD    1 
ATOM   636  O OE1   . GLU A 1 100 ? 42.156 -20.898 21.296  1.00 66.90 ? 80  GLU A OE1   1 
ATOM   637  O OE2   . GLU A 1 100 ? 40.367 -20.950 22.560  1.00 74.60 ? 80  GLU A OE2   1 
ATOM   638  N N     . GLY A 1 101 ? 42.322 -20.517 17.450  1.00 41.68 ? 81  GLY A N     1 
ATOM   639  C CA    . GLY A 1 101 ? 43.235 -20.368 16.327  1.00 45.13 ? 81  GLY A CA    1 
ATOM   640  C C     . GLY A 1 101 ? 43.048 -19.178 15.371  1.00 37.72 ? 81  GLY A C     1 
ATOM   641  O O     . GLY A 1 101 ? 43.532 -19.222 14.241  1.00 54.77 ? 81  GLY A O     1 
ATOM   642  N N     . ALA A 1 102 ? 42.355 -18.129 15.802  1.00 33.07 ? 82  ALA A N     1 
ATOM   643  C CA    . ALA A 1 102 ? 42.205 -16.984 14.927  1.00 26.45 ? 82  ALA A CA    1 
ATOM   644  C C     . ALA A 1 102 ? 43.213 -15.935 15.278  1.00 26.04 ? 82  ALA A C     1 
ATOM   645  O O     . ALA A 1 102 ? 43.315 -15.528 16.430  1.00 30.52 ? 82  ALA A O     1 
ATOM   646  C CB    . ALA A 1 102 ? 40.824 -16.430 15.074  1.00 24.87 ? 82  ALA A CB    1 
ATOM   647  N N     . LYS A 1 103 ? 43.961 -15.486 14.278  1.00 21.27 ? 83  LYS A N     1 
ATOM   648  C CA    . LYS A 1 103 ? 44.939 -14.446 14.489  1.00 20.13 ? 83  LYS A CA    1 
ATOM   649  C C     . LYS A 1 103 ? 44.213 -13.101 14.454  1.00 21.05 ? 83  LYS A C     1 
ATOM   650  O O     . LYS A 1 103 ? 43.404 -12.862 13.552  1.00 19.23 ? 83  LYS A O     1 
ATOM   651  C CB    . LYS A 1 103 ? 45.946 -14.608 13.356  1.00 20.45 ? 83  LYS A CB    1 
ATOM   652  C CG    . LYS A 1 103 ? 46.959 -13.553 13.307  1.00 23.77 ? 83  LYS A CG    1 
ATOM   653  C CD    . LYS A 1 103 ? 48.068 -13.941 12.397  1.00 34.19 ? 83  LYS A CD    1 
ATOM   654  C CE    . LYS A 1 103 ? 48.836 -15.068 13.036  1.00 34.03 ? 83  LYS A CE    1 
ATOM   655  N NZ    . LYS A 1 103 ? 49.985 -15.344 12.184  1.00 34.60 ? 83  LYS A NZ    1 
ATOM   656  N N     . VAL A 1 104 ? 44.501 -12.243 15.422  1.00 17.25 ? 84  VAL A N     1 
ATOM   657  C CA    . VAL A 1 104 ? 43.848 -10.903 15.519  1.00 15.74 ? 84  VAL A CA    1 
ATOM   658  C C     . VAL A 1 104 ? 44.847 -9.866  14.971  1.00 17.27 ? 84  VAL A C     1 
ATOM   659  O O     . VAL A 1 104 ? 45.968 -9.738  15.453  1.00 14.53 ? 84  VAL A O     1 
ATOM   660  C CB    . VAL A 1 104 ? 43.486 -10.554 16.956  1.00 17.80 ? 84  VAL A CB    1 
ATOM   661  C CG1   . VAL A 1 104 ? 42.700 -9.295  17.006  1.00 18.57 ? 84  VAL A CG1   1 
ATOM   662  C CG2   . VAL A 1 104 ? 42.583 -11.719 17.492  1.00 16.63 ? 84  VAL A CG2   1 
ATOM   663  N N     . ILE A 1 105 ? 44.411 -9.095  13.952  1.00 14.28 ? 85  ILE A N     1 
ATOM   664  C CA    . ILE A 1 105 ? 45.277 -8.131  13.286  1.00 13.55 ? 85  ILE A CA    1 
ATOM   665  C C     . ILE A 1 105 ? 44.704 -6.758  13.502  1.00 14.03 ? 85  ILE A C     1 
ATOM   666  O O     . ILE A 1 105 ? 43.509 -6.577  13.410  1.00 13.61 ? 85  ILE A O     1 
ATOM   667  C CB    . ILE A 1 105 ? 45.321 -8.471  11.779  1.00 12.97 ? 85  ILE A CB    1 
ATOM   668  C CG1   . ILE A 1 105 ? 46.085 -9.794  11.583  1.00 15.92 ? 85  ILE A CG1   1 
ATOM   669  C CG2   . ILE A 1 105 ? 45.937 -7.319  10.949  1.00 14.24 ? 85  ILE A CG2   1 
ATOM   670  C CD1   . ILE A 1 105 ? 46.180 -10.121 10.163  1.00 22.96 ? 85  ILE A CD1   1 
ATOM   671  N N     . TYR A 1 106 ? 45.557 -5.819  13.864  1.00 12.83 ? 86  TYR A N     1 
ATOM   672  C CA    . TYR A 1 106 ? 45.191 -4.410  13.888  1.00 11.63 ? 86  TYR A CA    1 
ATOM   673  C C     . TYR A 1 106 ? 45.758 -3.706  12.657  1.00 13.70 ? 86  TYR A C     1 
ATOM   674  O O     . TYR A 1 106 ? 46.959 -3.796  12.389  1.00 12.82 ? 86  TYR A O     1 
ATOM   675  C CB    . TYR A 1 106 ? 45.680 -3.756  15.131  1.00 11.85 ? 86  TYR A CB    1 
ATOM   676  C CG    . TYR A 1 106 ? 45.409 -2.275  15.187  1.00 12.15 ? 86  TYR A CG    1 
ATOM   677  C CD1   . TYR A 1 106 ? 44.139 -1.725  14.907  1.00 13.61 ? 86  TYR A CD1   1 
ATOM   678  C CD2   . TYR A 1 106 ? 46.435 -1.380  15.536  1.00 12.02 ? 86  TYR A CD2   1 
ATOM   679  C CE1   . TYR A 1 106 ? 43.906 -0.363  15.022  1.00 13.17 ? 86  TYR A CE1   1 
ATOM   680  C CE2   . TYR A 1 106 ? 46.237 -0.021  15.620  1.00 11.35 ? 86  TYR A CE2   1 
ATOM   681  C CZ    . TYR A 1 106 ? 44.954 0.512   15.352  1.00 11.69 ? 86  TYR A CZ    1 
ATOM   682  O OH    . TYR A 1 106 ? 44.741 1.860   15.431  1.00 14.04 ? 86  TYR A OH    1 
ATOM   683  N N     . LEU A 1 107 ? 44.867 -3.048  11.915  1.00 12.01 ? 87  LEU A N     1 
ATOM   684  C CA    . LEU A 1 107 ? 45.344 -2.270  10.733  1.00 14.06 ? 87  LEU A CA    1 
ATOM   685  C C     . LEU A 1 107 ? 45.926 -0.949  11.190  1.00 14.19 ? 87  LEU A C     1 
ATOM   686  O O     . LEU A 1 107 ? 45.264 -0.126  11.818  1.00 13.64 ? 87  LEU A O     1 
ATOM   687  C CB    . LEU A 1 107 ? 44.149 -2.040  9.740   1.00 11.95 ? 87  LEU A CB    1 
ATOM   688  C CG    . LEU A 1 107 ? 43.702 -3.250  8.873   1.00 13.99 ? 87  LEU A CG    1 
ATOM   689  C CD1   . LEU A 1 107 ? 44.834 -3.852  8.031   1.00 15.05 ? 87  LEU A CD1   1 
ATOM   690  C CD2   . LEU A 1 107 ? 42.997 -4.338  9.621   1.00 13.98 ? 87  LEU A CD2   1 
ATOM   691  N N     . SER A 1 108 ? 47.222 -0.746  10.888  1.00 12.44 ? 88  SER A N     1 
ATOM   692  C CA    . SER A 1 108 ? 47.846 0.501   11.300  1.00 13.32 ? 88  SER A CA    1 
ATOM   693  C C     . SER A 1 108 ? 49.054 0.839   10.427  1.00 12.31 ? 88  SER A C     1 
ATOM   694  O O     . SER A 1 108 ? 49.737 -0.090  9.955   1.00 12.74 ? 88  SER A O     1 
ATOM   695  C CB    . SER A 1 108 ? 48.309 0.210   12.737  1.00 18.35 ? 88  SER A CB    1 
ATOM   696  O OG    . SER A 1 108 ? 49.321 1.050   13.117  1.00 20.54 ? 88  SER A OG    1 
ATOM   697  N N     . PRO A 1 109 ? 49.315 2.145   10.163  1.00 16.53 ? 89  PRO A N     1 
ATOM   698  C CA    . PRO A 1 109 ? 50.565 2.476   9.468   1.00 17.41 ? 89  PRO A CA    1 
ATOM   699  C C     . PRO A 1 109 ? 51.835 2.180   10.235  1.00 19.23 ? 89  PRO A C     1 
ATOM   700  O O     . PRO A 1 109 ? 52.892 2.222   9.634   1.00 20.12 ? 89  PRO A O     1 
ATOM   701  C CB    . PRO A 1 109 ? 50.407 3.967   9.130   1.00 23.71 ? 89  PRO A CB    1 
ATOM   702  C CG    . PRO A 1 109 ? 49.333 4.442   9.926   1.00 20.96 ? 89  PRO A CG    1 
ATOM   703  C CD    . PRO A 1 109 ? 48.507 3.330   10.482  1.00 16.90 ? 89  PRO A CD    1 
ATOM   704  N N     . GLN A 1 110 ? 51.754 1.838   11.509  1.00 17.05 ? 90  GLN A N     1 
ATOM   705  C CA    . GLN A 1 110 ? 52.925 1.417   12.343  1.00 17.94 ? 90  GLN A CA    1 
ATOM   706  C C     . GLN A 1 110 ? 53.145 -0.092  12.181  1.00 19.14 ? 90  GLN A C     1 
ATOM   707  O O     . GLN A 1 110 ? 54.053 -0.683  12.794  1.00 20.78 ? 90  GLN A O     1 
ATOM   708  C CB    . GLN A 1 110 ? 52.704 1.723   13.845  1.00 20.10 ? 90  GLN A CB    1 
ATOM   709  C CG    . GLN A 1 110 ? 52.825 3.200   14.270  1.00 29.10 ? 90  GLN A CG    1 
ATOM   710  C CD    . GLN A 1 110 ? 51.769 4.092   13.685  1.00 26.71 ? 90  GLN A CD    1 
ATOM   711  O OE1   . GLN A 1 110 ? 52.083 5.064   12.980  1.00 27.96 ? 90  GLN A OE1   1 
ATOM   712  N NE2   . GLN A 1 110 ? 50.488 3.804   14.000  1.00 28.69 ? 90  GLN A NE2   1 
ATOM   713  N N     . GLY A 1 111 ? 52.305 -0.792  11.409  1.00 14.47 ? 91  GLY A N     1 
ATOM   714  C CA    . GLY A 1 111 ? 52.470 -2.186  11.263  1.00 15.98 ? 91  GLY A CA    1 
ATOM   715  C C     . GLY A 1 111 ? 53.353 -2.612  10.111  1.00 13.35 ? 91  GLY A C     1 
ATOM   716  O O     . GLY A 1 111 ? 53.971 -1.789  9.411   1.00 17.01 ? 91  GLY A O     1 
ATOM   717  N N     . ARG A 1 112 ? 53.462 -3.933  9.979   1.00 14.16 ? 92  ARG A N     1 
ATOM   718  C CA    . ARG A 1 112 ? 54.234 -4.547  8.892   1.00 16.61 ? 92  ARG A CA    1 
ATOM   719  C C     . ARG A 1 112 ? 53.649 -4.153  7.541   1.00 17.79 ? 92  ARG A C     1 
ATOM   720  O O     . ARG A 1 112 ? 52.448 -4.290  7.335   1.00 16.54 ? 92  ARG A O     1 
ATOM   721  C CB    . ARG A 1 112 ? 54.253 -6.073  9.037   1.00 17.04 ? 92  ARG A CB    1 
ATOM   722  C CG    . ARG A 1 112 ? 54.781 -6.793  7.787   1.00 22.30 ? 92  ARG A CG    1 
ATOM   723  C CD    . ARG A 1 112 ? 54.885 -8.286  8.043   1.00 24.60 ? 92  ARG A CD    1 
ATOM   724  N NE    . ARG A 1 112 ? 55.317 -9.036  6.864   1.00 26.23 ? 92  ARG A NE    1 
ATOM   725  C CZ    . ARG A 1 112 ? 55.395 -10.359 6.837   1.00 31.12 ? 92  ARG A CZ    1 
ATOM   726  N NH1   . ARG A 1 112 ? 55.737 -10.987 5.705   1.00 26.64 ? 92  ARG A NH1   1 
ATOM   727  N NH2   . ARG A 1 112 ? 55.064 -11.052 7.923   1.00 28.23 ? 92  ARG A NH2   1 
ATOM   728  N N     . LYS A 1 113 ? 54.485 -3.620  6.646   1.00 18.10 ? 93  LYS A N     1 
ATOM   729  C CA    . LYS A 1 113 ? 53.943 -3.137  5.376   1.00 18.49 ? 93  LYS A CA    1 
ATOM   730  C C     . LYS A 1 113 ? 53.548 -4.330  4.497   1.00 18.15 ? 93  LYS A C     1 
ATOM   731  O O     . LYS A 1 113 ? 54.385 -5.184  4.213   1.00 18.67 ? 93  LYS A O     1 
ATOM   732  C CB    . LYS A 1 113 ? 54.942 -2.165  4.691   1.00 20.88 ? 93  LYS A CB    1 
ATOM   733  C CG    . LYS A 1 113 ? 54.395 -1.622  3.347   1.00 19.35 ? 93  LYS A CG    1 
ATOM   734  C CD    . LYS A 1 113 ? 55.083 -0.306  2.926   1.00 26.45 ? 93  LYS A CD    1 
ATOM   735  C CE    . LYS A 1 113 ? 56.556 -0.517  2.909   1.00 30.33 ? 93  LYS A CE    1 
ATOM   736  N NZ    . LYS A 1 113 ? 57.253 0.622   2.263   1.00 29.92 ? 93  LYS A NZ    1 
ATOM   737  N N     . LEU A 1 114 ? 52.293 -4.365  4.046   1.00 15.91 ? 94  LEU A N     1 
ATOM   738  C CA    . LEU A 1 114 ? 51.856 -5.479  3.225   1.00 16.49 ? 94  LEU A CA    1 
ATOM   739  C C     . LEU A 1 114 ? 52.580 -5.511  1.868   1.00 15.26 ? 94  LEU A C     1 
ATOM   740  O O     . LEU A 1 114 ? 52.744 -4.472  1.221   1.00 16.25 ? 94  LEU A O     1 
ATOM   741  C CB    . LEU A 1 114 ? 50.350 -5.350  2.948   1.00 16.30 ? 94  LEU A CB    1 
ATOM   742  C CG    . LEU A 1 114 ? 49.616 -6.514  2.321   1.00 17.05 ? 94  LEU A CG    1 
ATOM   743  C CD1   . LEU A 1 114 ? 49.626 -7.759  3.202   1.00 18.14 ? 94  LEU A CD1   1 
ATOM   744  C CD2   . LEU A 1 114 ? 48.179 -6.086  1.908   1.00 14.28 ? 94  LEU A CD2   1 
ATOM   745  N N     . ASP A 1 115 ? 52.925 -6.738  1.457   1.00 17.50 ? 95  ASP A N     1 
ATOM   746  C CA    . ASP A 1 115 ? 53.452 -7.004  0.115   1.00 17.34 ? 95  ASP A CA    1 
ATOM   747  C C     . ASP A 1 115 ? 53.023 -8.408  -0.239  1.00 17.42 ? 95  ASP A C     1 
ATOM   748  O O     . ASP A 1 115 ? 52.332 -9.105  0.498   1.00 15.98 ? 95  ASP A O     1 
ATOM   749  C CB    . ASP A 1 115 ? 54.964 -6.754  -0.026  1.00 17.67 ? 95  ASP A CB    1 
ATOM   750  C CG    . ASP A 1 115 ? 55.795 -7.558  0.935   1.00 24.55 ? 95  ASP A CG    1 
ATOM   751  O OD1   . ASP A 1 115 ? 55.338 -8.576  1.401   1.00 20.92 ? 95  ASP A OD1   1 
ATOM   752  O OD2   . ASP A 1 115 ? 56.917 -7.115  1.245   1.00 27.90 ? 95  ASP A OD2   1 
ATOM   753  N N     . GLN A 1 116 ? 53.351 -8.858  -1.455  1.00 19.62 ? 96  GLN A N     1 
ATOM   754  C CA    . GLN A 1 116 ? 52.758 -10.116 -1.900  1.00 22.27 ? 96  GLN A CA    1 
ATOM   755  C C     . GLN A 1 116 ? 53.230 -11.321 -1.038  1.00 20.91 ? 96  GLN A C     1 
ATOM   756  O O     . GLN A 1 116 ? 52.467 -12.237 -0.788  1.00 18.87 ? 96  GLN A O     1 
ATOM   757  C CB    . GLN A 1 116 ? 52.921 -10.308 -3.445  1.00 27.34 ? 96  GLN A CB    1 
ATOM   758  C CG    . GLN A 1 116 ? 51.928 -11.314 -4.135  1.00 23.66 ? 96  GLN A CG    1 
ATOM   759  C CD    . GLN A 1 116 ? 50.374 -11.011 -4.048  1.00 32.38 ? 96  GLN A CD    1 
ATOM   760  O OE1   . GLN A 1 116 ? 49.886 -9.877  -3.870  1.00 28.10 ? 96  GLN A OE1   1 
ATOM   761  N NE2   . GLN A 1 116 ? 49.598 -12.085 -4.169  1.00 36.83 ? 96  GLN A NE2   1 
ATOM   762  N N     . GLY A 1 117 ? 54.458 -11.280 -0.549  1.00 21.60 ? 97  GLY A N     1 
ATOM   763  C CA    . GLY A 1 117 ? 54.930 -12.284 0.413   1.00 22.36 ? 97  GLY A CA    1 
ATOM   764  C C     . GLY A 1 117 ? 54.111 -12.273 1.700   1.00 24.25 ? 97  GLY A C     1 
ATOM   765  O O     . GLY A 1 117 ? 53.720 -13.313 2.233   1.00 21.37 ? 97  GLY A O     1 
ATOM   766  N N     . GLY A 1 118 ? 53.832 -11.077 2.184   1.00 17.16 ? 98  GLY A N     1 
ATOM   767  C CA    . GLY A 1 118 ? 52.975 -10.973 3.355   1.00 17.94 ? 98  GLY A CA    1 
ATOM   768  C C     . GLY A 1 118 ? 51.555 -11.490 3.088   1.00 18.29 ? 98  GLY A C     1 
ATOM   769  O O     . GLY A 1 118 ? 50.940 -12.123 3.952   1.00 17.32 ? 98  GLY A O     1 
ATOM   770  N N     . VAL A 1 119 ? 51.011 -11.196 1.899   1.00 15.53 ? 99  VAL A N     1 
ATOM   771  C CA    . VAL A 1 119 ? 49.720 -11.763 1.506   1.00 15.98 ? 99  VAL A CA    1 
ATOM   772  C C     . VAL A 1 119 ? 49.687 -13.280 1.503   1.00 17.44 ? 99  VAL A C     1 
ATOM   773  O O     . VAL A 1 119 ? 48.732 -13.886 1.984   1.00 18.35 ? 99  VAL A O     1 
ATOM   774  C CB    . VAL A 1 119 ? 49.282 -11.269 0.081   1.00 16.16 ? 99  VAL A CB    1 
ATOM   775  C CG1   . VAL A 1 119 ? 48.029 -11.987 -0.404  1.00 17.46 ? 99  VAL A CG1   1 
ATOM   776  C CG2   . VAL A 1 119 ? 49.105 -9.697  0.066   1.00 16.91 ? 99  VAL A CG2   1 
ATOM   777  N N     . THR A 1 120 ? 50.754 -13.883 0.962   1.00 21.72 ? 100 THR A N     1 
ATOM   778  C CA    . THR A 1 120 ? 50.817 -15.347 0.960   1.00 24.21 ? 100 THR A CA    1 
ATOM   779  C C     . THR A 1 120 ? 50.885 -15.950 2.375   1.00 21.98 ? 100 THR A C     1 
ATOM   780  O O     . THR A 1 120 ? 50.235 -16.943 2.665   1.00 24.87 ? 100 THR A O     1 
ATOM   781  C CB    . THR A 1 120 ? 51.971 -15.884 0.026   1.00 27.50 ? 100 THR A CB    1 
ATOM   782  O OG1   . THR A 1 120 ? 53.245 -15.491 0.503   1.00 35.34 ? 100 THR A OG1   1 
ATOM   783  C CG2   . THR A 1 120 ? 51.869 -15.257 -1.259  1.00 24.28 ? 100 THR A CG2   1 
ATOM   784  N N     . GLU A 1 121 ? 51.602 -15.285 3.247   1.00 20.98 ? 101 GLU A N     1 
ATOM   785  C CA    . GLU A 1 121 ? 51.626 -15.690 4.664   1.00 23.77 ? 101 GLU A CA    1 
ATOM   786  C C     . GLU A 1 121 ? 50.251 -15.536 5.321   1.00 22.44 ? 101 GLU A C     1 
ATOM   787  O O     . GLU A 1 121 ? 49.744 -16.445 6.001   1.00 24.48 ? 101 GLU A O     1 
ATOM   788  C CB    . GLU A 1 121 ? 52.696 -14.884 5.381   1.00 24.55 ? 101 GLU A CB    1 
ATOM   789  C CG    . GLU A 1 121 ? 52.958 -15.227 6.784   1.00 37.58 ? 101 GLU A CG    1 
ATOM   790  C CD    . GLU A 1 121 ? 53.958 -14.249 7.403   1.00 38.92 ? 101 GLU A CD    1 
ATOM   791  O OE1   . GLU A 1 121 ? 54.971 -13.917 6.740   1.00 31.94 ? 101 GLU A OE1   1 
ATOM   792  O OE2   . GLU A 1 121 ? 53.679 -13.779 8.530   1.00 52.04 ? 101 GLU A OE2   1 
ATOM   793  N N     . LEU A 1 122 ? 49.599 -14.399 5.113   1.00 19.32 ? 102 LEU A N     1 
ATOM   794  C CA    . LEU A 1 122 ? 48.269 -14.251 5.747   1.00 20.95 ? 102 LEU A CA    1 
ATOM   795  C C     . LEU A 1 122 ? 47.255 -15.242 5.213   1.00 21.23 ? 102 LEU A C     1 
ATOM   796  O O     . LEU A 1 122 ? 46.314 -15.631 5.928   1.00 21.73 ? 102 LEU A O     1 
ATOM   797  C CB    . LEU A 1 122 ? 47.701 -12.847 5.484   1.00 17.74 ? 102 LEU A CB    1 
ATOM   798  C CG    . LEU A 1 122 ? 48.504 -11.788 6.212   1.00 17.89 ? 102 LEU A CG    1 
ATOM   799  C CD1   . LEU A 1 122 ? 48.204 -10.377 5.644   1.00 18.84 ? 102 LEU A CD1   1 
ATOM   800  C CD2   . LEU A 1 122 ? 48.096 -11.833 7.670   1.00 22.73 ? 102 LEU A CD2   1 
ATOM   801  N N     . ALA A 1 123 ? 47.328 -15.539 3.929   1.00 20.32 ? 103 ALA A N     1 
ATOM   802  C CA    . ALA A 1 123 ? 46.421 -16.503 3.291   1.00 22.07 ? 103 ALA A CA    1 
ATOM   803  C C     . ALA A 1 123 ? 46.527 -17.935 3.890   1.00 26.08 ? 103 ALA A C     1 
ATOM   804  O O     . ALA A 1 123 ? 45.666 -18.737 3.638   1.00 29.67 ? 103 ALA A O     1 
ATOM   805  C CB    . ALA A 1 123 ? 46.629 -16.533 1.775   1.00 23.97 ? 103 ALA A CB    1 
ATOM   806  N N     . GLN A 1 124 ? 47.584 -18.205 4.639   1.00 22.99 ? 104 GLN A N     1 
ATOM   807  C CA    . GLN A 1 124 ? 47.743 -19.508 5.343   1.00 29.62 ? 104 GLN A CA    1 
ATOM   808  C C     . GLN A 1 124 ? 46.783 -19.666 6.546   1.00 34.92 ? 104 GLN A C     1 
ATOM   809  O O     . GLN A 1 124 ? 46.619 -20.764 7.112   1.00 34.39 ? 104 GLN A O     1 
ATOM   810  C CB    . GLN A 1 124 ? 49.204 -19.678 5.788   1.00 27.80 ? 104 GLN A CB    1 
ATOM   811  C CG    . GLN A 1 124 ? 50.137 -19.782 4.637   1.00 31.32 ? 104 GLN A CG    1 
ATOM   812  C CD    . GLN A 1 124 ? 49.635 -20.842 3.691   1.00 52.50 ? 104 GLN A CD    1 
ATOM   813  O OE1   . GLN A 1 124 ? 49.567 -22.023 4.057   1.00 57.40 ? 104 GLN A OE1   1 
ATOM   814  N NE2   . GLN A 1 124 ? 49.232 -20.429 2.475   1.00 56.83 ? 104 GLN A NE2   1 
ATOM   815  N N     . ASN A 1 125 ? 46.164 -18.569 6.964   1.00 23.16 ? 105 ASN A N     1 
ATOM   816  C CA    . ASN A 1 125 ? 45.230 -18.592 8.113   1.00 21.72 ? 105 ASN A CA    1 
ATOM   817  C C     . ASN A 1 125 ? 43.833 -18.952 7.688   1.00 28.16 ? 105 ASN A C     1 
ATOM   818  O O     . ASN A 1 125 ? 43.296 -18.400 6.707   1.00 27.57 ? 105 ASN A O     1 
ATOM   819  C CB    . ASN A 1 125 ? 45.219 -17.234 8.803   1.00 25.77 ? 105 ASN A CB    1 
ATOM   820  C CG    . ASN A 1 125 ? 46.548 -16.881 9.412   1.00 29.71 ? 105 ASN A CG    1 
ATOM   821  O OD1   . ASN A 1 125 ? 46.906 -17.345 10.492  1.00 31.93 ? 105 ASN A OD1   1 
ATOM   822  N ND2   . ASN A 1 125 ? 47.279 -15.996 8.746   1.00 25.49 ? 105 ASN A ND2   1 
ATOM   823  N N     . GLN A 1 126 ? 43.204 -19.875 8.393   1.00 24.19 ? 106 GLN A N     1 
ATOM   824  C CA    . GLN A 1 126 ? 41.839 -20.203 8.040   1.00 25.71 ? 106 GLN A CA    1 
ATOM   825  C C     . GLN A 1 126 ? 40.882 -19.170 8.679   1.00 19.88 ? 106 GLN A C     1 
ATOM   826  O O     . GLN A 1 126 ? 39.759 -19.024 8.183   1.00 24.77 ? 106 GLN A O     1 
ATOM   827  C CB    . GLN A 1 126 ? 41.501 -21.629 8.520   1.00 36.88 ? 106 GLN A CB    1 
ATOM   828  C CG    . GLN A 1 126 ? 42.346 -22.734 7.791   1.00 57.12 ? 106 GLN A CG    1 
ATOM   829  C CD    . GLN A 1 126 ? 42.225 -24.144 8.428   1.00 60.46 ? 106 GLN A CD    1 
ATOM   830  O OE1   . GLN A 1 126 ? 42.412 -24.316 9.637   1.00 55.16 ? 106 GLN A OE1   1 
ATOM   831  N NE2   . GLN A 1 126 ? 41.905 -25.146 7.605   1.00 61.14 ? 106 GLN A NE2   1 
ATOM   832  N N     . LYS A 1 127 ? 41.325 -18.518 9.764   1.00 24.26 ? 107 LYS A N     1 
ATOM   833  C CA    . LYS A 1 127 ? 40.532 -17.498 10.448  1.00 19.90 ? 107 LYS A CA    1 
ATOM   834  C C     . LYS A 1 127 ? 41.396 -16.291 10.747  1.00 19.84 ? 107 LYS A C     1 
ATOM   835  O O     . LYS A 1 127 ? 42.496 -16.415 11.223  1.00 23.57 ? 107 LYS A O     1 
ATOM   836  C CB    . LYS A 1 127 ? 40.009 -18.019 11.818  1.00 21.77 ? 107 LYS A CB    1 
ATOM   837  C CG    . LYS A 1 127 ? 39.094 -19.267 11.678  1.00 29.64 ? 107 LYS A CG    1 
ATOM   838  C CD    . LYS A 1 127 ? 38.912 -19.869 13.064  1.00 37.81 ? 107 LYS A CD    1 
ATOM   839  C CE    . LYS A 1 127 ? 38.142 -21.180 13.088  1.00 41.00 ? 107 LYS A CE    1 
ATOM   840  N NZ    . LYS A 1 127 ? 38.128 -21.629 14.538  1.00 37.23 ? 107 LYS A NZ    1 
ATOM   841  N N     . LEU A 1 128 ? 40.877 -15.111 10.459  1.00 16.66 ? 108 LEU A N     1 
ATOM   842  C CA    . LEU A 1 128 ? 41.503 -13.850 10.951  1.00 16.13 ? 108 LEU A CA    1 
ATOM   843  C C     . LEU A 1 128 ? 40.435 -12.957 11.527  1.00 13.68 ? 108 LEU A C     1 
ATOM   844  O O     . LEU A 1 128 ? 39.271 -13.046 11.152  1.00 15.15 ? 108 LEU A O     1 
ATOM   845  C CB    . LEU A 1 128 ? 42.083 -13.065 9.735   1.00 15.30 ? 108 LEU A CB    1 
ATOM   846  C CG    . LEU A 1 128 ? 43.184 -13.759 8.931   1.00 18.20 ? 108 LEU A CG    1 
ATOM   847  C CD1   . LEU A 1 128 ? 43.458 -12.933 7.669   1.00 20.87 ? 108 LEU A CD1   1 
ATOM   848  C CD2   . LEU A 1 128 ? 44.435 -13.949 9.874   1.00 22.50 ? 108 LEU A CD2   1 
ATOM   849  N N     . ILE A 1 129 ? 40.810 -12.119 12.487  1.00 13.95 ? 109 ILE A N     1 
ATOM   850  C CA    . ILE A 1 129 ? 39.931 -11.066 12.960  1.00 12.48 ? 109 ILE A CA    1 
ATOM   851  C C     . ILE A 1 129 ? 40.678 -9.778  12.675  1.00 13.82 ? 109 ILE A C     1 
ATOM   852  O O     . ILE A 1 129 ? 41.871 -9.653  13.002  1.00 14.97 ? 109 ILE A O     1 
ATOM   853  C CB    . ILE A 1 129 ? 39.643 -11.193 14.472  1.00 15.24 ? 109 ILE A CB    1 
ATOM   854  C CG1   . ILE A 1 129 ? 38.815 -12.472 14.724  1.00 15.08 ? 109 ILE A CG1   1 
ATOM   855  C CG2   . ILE A 1 129 ? 39.021 -9.893  14.991  1.00 13.97 ? 109 ILE A CG2   1 
ATOM   856  C CD1   . ILE A 1 129 ? 38.811 -12.898 16.234  1.00 14.74 ? 109 ILE A CD1   1 
ATOM   857  N N     . LEU A 1 130 ? 39.977 -8.865  11.993  1.00 12.33 ? 110 LEU A N     1 
ATOM   858  C CA    . LEU A 1 130 ? 40.614 -7.627  11.598  1.00 12.21 ? 110 LEU A CA    1 
ATOM   859  C C     . LEU A 1 130 ? 39.999 -6.432  12.370  1.00 11.70 ? 110 LEU A C     1 
ATOM   860  O O     . LEU A 1 130 ? 38.796 -6.187  12.287  1.00 12.74 ? 110 LEU A O     1 
ATOM   861  C CB    . LEU A 1 130 ? 40.376 -7.407  10.118  1.00 10.66 ? 110 LEU A CB    1 
ATOM   862  C CG    . LEU A 1 130 ? 40.885 -8.504  9.171   1.00 10.49 ? 110 LEU A CG    1 
ATOM   863  C CD1   . LEU A 1 130 ? 40.665 -8.054  7.684   1.00 11.00 ? 110 LEU A CD1   1 
ATOM   864  C CD2   . LEU A 1 130 ? 42.322 -8.750  9.400   1.00 13.07 ? 110 LEU A CD2   1 
ATOM   865  N N     . VAL A 1 131 ? 40.848 -5.701  13.127  1.00 12.48 ? 111 VAL A N     1 
ATOM   866  C CA    . VAL A 1 131 ? 40.383 -4.620  13.969  1.00 10.50 ? 111 VAL A CA    1 
ATOM   867  C C     . VAL A 1 131 ? 40.614 -3.293  13.233  1.00 10.02 ? 111 VAL A C     1 
ATOM   868  O O     . VAL A 1 131 ? 41.766 -2.949  12.890  1.00 11.74 ? 111 VAL A O     1 
ATOM   869  C CB    . VAL A 1 131 ? 41.119 -4.640  15.323  1.00 11.07 ? 111 VAL A CB    1 
ATOM   870  C CG1   . VAL A 1 131 ? 40.613 -3.456  16.178  1.00 13.18 ? 111 VAL A CG1   1 
ATOM   871  C CG2   . VAL A 1 131 ? 40.840 -5.978  16.066  1.00 13.07 ? 111 VAL A CG2   1 
ATOM   872  N N     . CYS A 1 132 ? 39.528 -2.558  12.974  1.00 10.97 ? 112 CYS A N     1 
ATOM   873  C CA    . CYS A 1 132 ? 39.600 -1.294  12.223  1.00 10.56 ? 112 CYS A CA    1 
ATOM   874  C C     . CYS A 1 132 ? 39.482 -0.122  13.155  1.00 12.61 ? 112 CYS A C     1 
ATOM   875  O O     . CYS A 1 132 ? 38.419 0.069   13.756  1.00 14.07 ? 112 CYS A O     1 
ATOM   876  C CB    . CYS A 1 132 ? 38.472 -1.229  11.122  1.00 9.96  ? 112 CYS A CB    1 
ATOM   877  S SG    . CYS A 1 132 ? 38.463 -2.656  10.029  1.00 12.06 ? 112 CYS A SG    1 
ATOM   878  N N     . GLY A 1 133 ? 40.565 0.682   13.181  1.00 14.28 ? 113 GLY A N     1 
ATOM   879  C CA    . GLY A 1 133 ? 40.533 1.879   14.030  1.00 13.35 ? 113 GLY A CA    1 
ATOM   880  C C     . GLY A 1 133 ? 39.898 3.038   13.267  1.00 14.18 ? 113 GLY A C     1 
ATOM   881  O O     . GLY A 1 133 ? 39.797 3.022   12.054  1.00 13.72 ? 113 GLY A O     1 
ATOM   882  N N     . ARG A 1 134 ? 39.508 4.060   14.016  1.00 14.21 ? 114 ARG A N     1 
ATOM   883  C CA    . ARG A 1 134 ? 39.033 5.357   13.502  1.00 15.47 ? 114 ARG A CA    1 
ATOM   884  C C     . ARG A 1 134 ? 39.698 6.399   14.398  1.00 14.36 ? 114 ARG A C     1 
ATOM   885  O O     . ARG A 1 134 ? 40.410 6.051   15.344  1.00 14.21 ? 114 ARG A O     1 
ATOM   886  C CB    . ARG A 1 134 ? 37.491 5.472   13.494  1.00 14.94 ? 114 ARG A CB    1 
ATOM   887  C CG    . ARG A 1 134 ? 36.895 4.692   12.223  1.00 14.52 ? 114 ARG A CG    1 
ATOM   888  C CD    . ARG A 1 134 ? 36.765 5.628   10.971  1.00 13.14 ? 114 ARG A CD    1 
ATOM   889  N NE    . ARG A 1 134 ? 36.656 4.846   9.740   1.00 15.89 ? 114 ARG A NE    1 
ATOM   890  C CZ    . ARG A 1 134 ? 36.358 5.350   8.610   1.00 15.92 ? 114 ARG A CZ    1 
ATOM   891  N NH1   . ARG A 1 134 ? 36.291 4.560   7.539   1.00 19.11 ? 114 ARG A NH1   1 
ATOM   892  N NH2   . ARG A 1 134 ? 36.058 6.687   8.554   1.00 18.33 ? 114 ARG A NH2   1 
ATOM   893  N N     . TYR A 1 135 ? 39.489 7.665   14.052  1.00 15.70 ? 115 TYR A N     1 
ATOM   894  C CA    . TYR A 1 135 ? 40.027 8.777   14.840  1.00 12.55 ? 115 TYR A CA    1 
ATOM   895  C C     . TYR A 1 135 ? 41.546 8.674   14.884  1.00 14.18 ? 115 TYR A C     1 
ATOM   896  O O     . TYR A 1 135 ? 42.144 8.433   13.780  1.00 17.13 ? 115 TYR A O     1 
ATOM   897  C CB    . TYR A 1 135 ? 39.388 8.807   16.239  1.00 16.08 ? 115 TYR A CB    1 
ATOM   898  C CG    . TYR A 1 135 ? 37.913 8.556   16.214  1.00 15.52 ? 115 TYR A CG    1 
ATOM   899  C CD1   . TYR A 1 135 ? 37.056 9.265   15.401  1.00 25.77 ? 115 TYR A CD1   1 
ATOM   900  C CD2   . TYR A 1 135 ? 37.394 7.501   16.979  1.00 15.86 ? 115 TYR A CD2   1 
ATOM   901  C CE1   . TYR A 1 135 ? 35.634 8.947   15.383  1.00 29.66 ? 115 TYR A CE1   1 
ATOM   902  C CE2   . TYR A 1 135 ? 36.015 7.201   16.978  1.00 16.34 ? 115 TYR A CE2   1 
ATOM   903  C CZ    . TYR A 1 135 ? 35.156 7.888   16.200  1.00 23.23 ? 115 TYR A CZ    1 
ATOM   904  O OH    . TYR A 1 135 ? 33.784 7.561   16.233  1.00 24.17 ? 115 TYR A OH    1 
ATOM   905  N N     . GLU A 1 136 ? 42.215 8.924   16.010  1.00 14.83 ? 116 GLU A N     1 
ATOM   906  C CA    . GLU A 1 136 ? 43.670 8.833   16.058  1.00 14.51 ? 116 GLU A CA    1 
ATOM   907  C C     . GLU A 1 136 ? 44.171 7.425   16.270  1.00 16.02 ? 116 GLU A C     1 
ATOM   908  O O     . GLU A 1 136 ? 45.367 7.220   16.337  1.00 21.39 ? 116 GLU A O     1 
ATOM   909  C CB    . GLU A 1 136 ? 44.275 9.724   17.151  1.00 21.21 ? 116 GLU A CB    1 
ATOM   910  C CG    . GLU A 1 136 ? 43.972 11.174  16.890  1.00 31.63 ? 116 GLU A CG    1 
ATOM   911  C CD    . GLU A 1 136 ? 44.443 11.605  15.522  1.00 41.11 ? 116 GLU A CD    1 
ATOM   912  O OE1   . GLU A 1 136 ? 45.669 11.445  15.218  1.00 34.76 ? 116 GLU A OE1   1 
ATOM   913  O OE2   . GLU A 1 136 ? 43.564 12.040  14.737  1.00 55.26 ? 116 GLU A OE2   1 
ATOM   914  N N     . GLY A 1 137 ? 43.243 6.472   16.447  1.00 13.06 ? 117 GLY A N     1 
ATOM   915  C CA    . GLY A 1 137 ? 43.627 5.082   16.640  1.00 14.92 ? 117 GLY A CA    1 
ATOM   916  C C     . GLY A 1 137 ? 43.040 4.468   17.891  1.00 14.39 ? 117 GLY A C     1 
ATOM   917  O O     . GLY A 1 137 ? 41.998 4.865   18.332  1.00 14.81 ? 117 GLY A O     1 
ATOM   918  N N     . ILE A 1 138 ? 43.782 3.528   18.423  1.00 13.23 ? 118 ILE A N     1 
ATOM   919  C CA    . ILE A 1 138 ? 43.337 2.777   19.607  1.00 12.64 ? 118 ILE A CA    1 
ATOM   920  C C     . ILE A 1 138 ? 44.390 2.774   20.691  1.00 11.43 ? 118 ILE A C     1 
ATOM   921  O O     . ILE A 1 138 ? 45.558 3.090   20.474  1.00 15.63 ? 118 ILE A O     1 
ATOM   922  C CB    . ILE A 1 138 ? 42.987 1.320   19.221  1.00 11.71 ? 118 ILE A CB    1 
ATOM   923  C CG1   . ILE A 1 138 ? 44.185 0.425   19.063  1.00 13.27 ? 118 ILE A CG1   1 
ATOM   924  C CG2   . ILE A 1 138 ? 42.037 1.239   18.022  1.00 13.81 ? 118 ILE A CG2   1 
ATOM   925  C CD1   . ILE A 1 138 ? 43.821 -1.069  18.798  1.00 14.84 ? 118 ILE A CD1   1 
ATOM   926  N N     . ASP A 1 139 ? 43.922 2.514   21.901  1.00 12.05 ? 119 ASP A N     1 
ATOM   927  C CA    . ASP A 1 139 ? 44.840 2.491   23.067  1.00 13.65 ? 119 ASP A CA    1 
ATOM   928  C C     . ASP A 1 139 ? 45.962 1.478   22.941  1.00 12.42 ? 119 ASP A C     1 
ATOM   929  O O     . ASP A 1 139 ? 45.752 0.328   22.576  1.00 13.18 ? 119 ASP A O     1 
ATOM   930  C CB    . ASP A 1 139 ? 44.013 2.125   24.322  1.00 11.12 ? 119 ASP A CB    1 
ATOM   931  C CG    . ASP A 1 139 ? 44.781 2.341   25.634  1.00 11.14 ? 119 ASP A CG    1 
ATOM   932  O OD1   . ASP A 1 139 ? 44.577 3.345   26.322  1.00 13.66 ? 119 ASP A OD1   1 
ATOM   933  O OD2   . ASP A 1 139 ? 45.630 1.505   25.934  1.00 14.34 ? 119 ASP A OD2   1 
ATOM   934  N N     . GLU A 1 140 ? 47.210 1.937   23.135  1.00 12.47 ? 120 GLU A N     1 
ATOM   935  C CA    . GLU A 1 140 ? 48.367 1.061   23.019  1.00 14.23 ? 120 GLU A CA    1 
ATOM   936  C C     . GLU A 1 140 ? 48.256 -0.225  23.797  1.00 15.21 ? 120 GLU A C     1 
ATOM   937  O O     . GLU A 1 140 ? 48.736 -1.259  23.360  1.00 13.91 ? 120 GLU A O     1 
ATOM   938  C CB    . GLU A 1 140 ? 49.638 1.848   23.410  1.00 14.20 ? 120 GLU A CB    1 
ATOM   939  C CG    . GLU A 1 140 ? 50.952 1.098   23.115  1.00 20.46 ? 120 GLU A CG    1 
ATOM   940  C CD    . GLU A 1 140 ? 51.243 0.945   21.589  1.00 24.67 ? 120 GLU A CD    1 
ATOM   941  O OE1   . GLU A 1 140 ? 50.556 1.558   20.785  1.00 22.67 ? 120 GLU A OE1   1 
ATOM   942  O OE2   . GLU A 1 140 ? 52.180 0.243   21.221  1.00 40.02 ? 120 GLU A OE2   1 
ATOM   943  N N     . ARG A 1 141 ? 47.603 -0.155  24.973  1.00 15.70 ? 121 ARG A N     1 
ATOM   944  C CA    . ARG A 1 141 ? 47.522 -1.382  25.810  1.00 14.68 ? 121 ARG A CA    1 
ATOM   945  C C     . ARG A 1 141 ? 46.572 -2.415  25.210  1.00 18.04 ? 121 ARG A C     1 
ATOM   946  O O     . ARG A 1 141 ? 46.782 -3.608  25.422  1.00 16.52 ? 121 ARG A O     1 
ATOM   947  C CB    . ARG A 1 141 ? 47.065 -1.039  27.183  1.00 14.22 ? 121 ARG A CB    1 
ATOM   948  C CG    . ARG A 1 141 ? 48.116 -0.215  27.909  1.00 16.98 ? 121 ARG A CG    1 
ATOM   949  C CD    . ARG A 1 141 ? 47.477 0.561   29.146  1.00 17.37 ? 121 ARG A CD    1 
ATOM   950  N NE    . ARG A 1 141 ? 46.444 1.477   28.701  1.00 14.21 ? 121 ARG A NE    1 
ATOM   951  C CZ    . ARG A 1 141 ? 45.600 2.075   29.537  1.00 14.39 ? 121 ARG A CZ    1 
ATOM   952  N NH1   . ARG A 1 141 ? 44.633 2.859   29.084  1.00 14.53 ? 121 ARG A NH1   1 
ATOM   953  N NH2   . ARG A 1 141 ? 45.761 1.869   30.880  1.00 14.96 ? 121 ARG A NH2   1 
ATOM   954  N N     . LEU A 1 142 ? 45.574 -1.989  24.401  1.00 15.42 ? 122 LEU A N     1 
ATOM   955  C CA    . LEU A 1 142 ? 44.797 -2.999  23.660  1.00 15.42 ? 122 LEU A CA    1 
ATOM   956  C C     . LEU A 1 142 ? 45.609 -3.687  22.610  1.00 16.56 ? 122 LEU A C     1 
ATOM   957  O O     . LEU A 1 142 ? 45.410 -4.864  22.269  1.00 16.67 ? 122 LEU A O     1 
ATOM   958  C CB    . LEU A 1 142 ? 43.606 -2.340  22.912  1.00 18.37 ? 122 LEU A CB    1 
ATOM   959  C CG    . LEU A 1 142 ? 42.487 -1.961  23.852  1.00 16.99 ? 122 LEU A CG    1 
ATOM   960  C CD1   . LEU A 1 142 ? 41.397 -1.282  22.975  1.00 16.04 ? 122 LEU A CD1   1 
ATOM   961  C CD2   . LEU A 1 142 ? 41.850 -3.183  24.533  1.00 19.43 ? 122 LEU A CD2   1 
ATOM   962  N N     . ILE A 1 143 ? 46.532 -2.951  21.972  1.00 14.94 ? 123 ILE A N     1 
ATOM   963  C CA    . ILE A 1 143 ? 47.432 -3.625  21.054  1.00 17.98 ? 123 ILE A CA    1 
ATOM   964  C C     . ILE A 1 143 ? 48.236 -4.676  21.789  1.00 20.21 ? 123 ILE A C     1 
ATOM   965  O O     . ILE A 1 143 ? 48.381 -5.814  21.317  1.00 19.51 ? 123 ILE A O     1 
ATOM   966  C CB    . ILE A 1 143 ? 48.338 -2.631  20.297  1.00 18.58 ? 123 ILE A CB    1 
ATOM   967  C CG1   . ILE A 1 143 ? 47.432 -1.697  19.496  1.00 18.64 ? 123 ILE A CG1   1 
ATOM   968  C CG2   . ILE A 1 143 ? 49.251 -3.402  19.395  1.00 22.23 ? 123 ILE A CG2   1 
ATOM   969  C CD1   . ILE A 1 143 ? 48.229 -0.511  18.821  1.00 19.64 ? 123 ILE A CD1   1 
ATOM   970  N N     . GLN A 1 144 ? 48.744 -4.333  22.974  1.00 16.86 ? 124 GLN A N     1 
ATOM   971  C CA    . GLN A 1 144 ? 49.510 -5.313  23.730  1.00 17.91 ? 124 GLN A CA    1 
ATOM   972  C C     . GLN A 1 144 ? 48.697 -6.503  24.184  1.00 22.60 ? 124 GLN A C     1 
ATOM   973  O O     . GLN A 1 144 ? 49.176 -7.621  24.186  1.00 24.91 ? 124 GLN A O     1 
ATOM   974  C CB    . GLN A 1 144 ? 50.222 -4.626  24.925  1.00 20.22 ? 124 GLN A CB    1 
ATOM   975  C CG    . GLN A 1 144 ? 51.225 -3.559  24.518  1.00 26.64 ? 124 GLN A CG    1 
ATOM   976  C CD    . GLN A 1 144 ? 51.686 -2.842  25.737  1.00 35.07 ? 124 GLN A CD    1 
ATOM   977  O OE1   . GLN A 1 144 ? 51.347 -1.678  25.953  1.00 39.48 ? 124 GLN A OE1   1 
ATOM   978  N NE2   . GLN A 1 144 ? 52.350 -3.580  26.623  1.00 46.14 ? 124 GLN A NE2   1 
ATOM   979  N N     . THR A 1 145 ? 47.460 -6.265  24.574  1.00 16.94 ? 125 THR A N     1 
ATOM   980  C CA    . THR A 1 145 ? 46.685 -7.355  25.212  1.00 17.75 ? 125 THR A CA    1 
ATOM   981  C C     . THR A 1 145 ? 45.764 -8.150  24.245  1.00 18.27 ? 125 THR A C     1 
ATOM   982  O O     . THR A 1 145 ? 45.368 -9.304  24.539  1.00 20.50 ? 125 THR A O     1 
ATOM   983  C CB    . THR A 1 145 ? 45.810 -6.820  26.366  1.00 18.73 ? 125 THR A CB    1 
ATOM   984  O OG1   . THR A 1 145 ? 44.905 -5.836  25.895  1.00 19.60 ? 125 THR A OG1   1 
ATOM   985  C CG2   . THR A 1 145 ? 46.639 -6.215  27.510  1.00 21.49 ? 125 THR A CG2   1 
ATOM   986  N N     . GLU A 1 146 ? 45.372 -7.555  23.101  1.00 14.13 ? 126 GLU A N     1 
ATOM   987  C CA    . GLU A 1 146 ? 44.383 -8.218  22.267  1.00 15.50 ? 126 GLU A CA    1 
ATOM   988  C C     . GLU A 1 146 ? 44.893 -8.462  20.857  1.00 16.18 ? 126 GLU A C     1 
ATOM   989  O O     . GLU A 1 146 ? 44.310 -9.264  20.143  1.00 18.84 ? 126 GLU A O     1 
ATOM   990  C CB    . GLU A 1 146 ? 43.110 -7.326  22.096  1.00 16.96 ? 126 GLU A CB    1 
ATOM   991  C CG    . GLU A 1 146 ? 42.411 -6.961  23.469  1.00 17.46 ? 126 GLU A CG    1 
ATOM   992  C CD    . GLU A 1 146 ? 41.792 -8.162  24.148  1.00 19.67 ? 126 GLU A CD    1 
ATOM   993  O OE1   . GLU A 1 146 ? 41.559 -9.197  23.479  1.00 20.66 ? 126 GLU A OE1   1 
ATOM   994  O OE2   . GLU A 1 146 ? 41.517 -8.011  25.350  1.00 23.35 ? 126 GLU A OE2   1 
ATOM   995  N N     . ILE A 1 147 ? 45.950 -7.752  20.436  1.00 15.15 ? 127 ILE A N     1 
ATOM   996  C CA    . ILE A 1 147 ? 46.342 -7.861  19.002  1.00 15.25 ? 127 ILE A CA    1 
ATOM   997  C C     . ILE A 1 147 ? 47.535 -8.790  18.832  1.00 17.87 ? 127 ILE A C     1 
ATOM   998  O O     . ILE A 1 147 ? 48.549 -8.653  19.568  1.00 19.10 ? 127 ILE A O     1 
ATOM   999  C CB    . ILE A 1 147 ? 46.675 -6.452  18.443  1.00 14.40 ? 127 ILE A CB    1 
ATOM   1000 C CG1   . ILE A 1 147 ? 45.479 -5.488  18.568  1.00 14.74 ? 127 ILE A CG1   1 
ATOM   1001 C CG2   . ILE A 1 147 ? 47.183 -6.526  16.980  1.00 13.67 ? 127 ILE A CG2   1 
ATOM   1002 C CD1   . ILE A 1 147 ? 44.219 -5.964  17.906  1.00 16.06 ? 127 ILE A CD1   1 
ATOM   1003 N N     . ASP A 1 148 ? 47.445 -9.716  17.880  1.00 15.31 ? 128 ASP A N     1 
ATOM   1004 C CA    . ASP A 1 148 ? 48.597 -10.550 17.568  1.00 15.69 ? 128 ASP A CA    1 
ATOM   1005 C C     . ASP A 1 148 ? 49.606 -9.853  16.650  1.00 17.73 ? 128 ASP A C     1 
ATOM   1006 O O     . ASP A 1 148 ? 50.834 -9.916  16.837  1.00 18.04 ? 128 ASP A O     1 
ATOM   1007 C CB    . ASP A 1 148 ? 48.176 -11.849 16.946  1.00 16.92 ? 128 ASP A CB    1 
ATOM   1008 C CG    . ASP A 1 148 ? 47.321 -12.668 17.890  1.00 19.25 ? 128 ASP A CG    1 
ATOM   1009 O OD1   . ASP A 1 148 ? 47.753 -12.829 19.061  1.00 23.28 ? 128 ASP A OD1   1 
ATOM   1010 O OD2   . ASP A 1 148 ? 46.230 -13.140 17.513  1.00 21.47 ? 128 ASP A OD2   1 
ATOM   1011 N N     . GLU A 1 149 ? 49.101 -9.201  15.586  1.00 14.31 ? 129 GLU A N     1 
ATOM   1012 C CA    . GLU A 1 149 ? 49.989 -8.581  14.605  1.00 17.95 ? 129 GLU A CA    1 
ATOM   1013 C C     . GLU A 1 149 ? 49.407 -7.252  14.128  1.00 15.70 ? 129 GLU A C     1 
ATOM   1014 O O     . GLU A 1 149 ? 48.194 -7.173  13.933  1.00 15.78 ? 129 GLU A O     1 
ATOM   1015 C CB    . GLU A 1 149 ? 50.117 -9.499  13.370  1.00 18.63 ? 129 GLU A CB    1 
ATOM   1016 C CG    . GLU A 1 149 ? 50.760 -10.827 13.739  1.00 18.71 ? 129 GLU A CG    1 
ATOM   1017 C CD    . GLU A 1 149 ? 50.941 -11.782 12.575  1.00 24.87 ? 129 GLU A CD    1 
ATOM   1018 O OE1   . GLU A 1 149 ? 50.632 -11.444 11.416  1.00 21.61 ? 129 GLU A OE1   1 
ATOM   1019 O OE2   . GLU A 1 149 ? 51.389 -12.941 12.831  1.00 24.78 ? 129 GLU A OE2   1 
ATOM   1020 N N     . GLU A 1 150 ? 50.265 -6.279  13.860  1.00 14.99 ? 130 GLU A N     1 
ATOM   1021 C CA    . GLU A 1 150 ? 49.851 -5.034  13.221  1.00 15.93 ? 130 GLU A CA    1 
ATOM   1022 C C     . GLU A 1 150 ? 50.330 -5.041  11.781  1.00 14.64 ? 130 GLU A C     1 
ATOM   1023 O O     . GLU A 1 150 ? 51.448 -5.462  11.479  1.00 17.60 ? 130 GLU A O     1 
ATOM   1024 C CB    . GLU A 1 150 ? 50.498 -3.816  13.911  1.00 15.34 ? 130 GLU A CB    1 
ATOM   1025 C CG    . GLU A 1 150 ? 49.981 -3.498  15.317  1.00 16.12 ? 130 GLU A CG    1 
ATOM   1026 C CD    . GLU A 1 150 ? 50.531 -2.185  15.878  1.00 20.00 ? 130 GLU A CD    1 
ATOM   1027 O OE1   . GLU A 1 150 ? 51.566 -2.286  16.477  1.00 30.73 ? 130 GLU A OE1   1 
ATOM   1028 O OE2   . GLU A 1 150 ? 49.931 -1.113  15.579  1.00 28.31 ? 130 GLU A OE2   1 
ATOM   1029 N N     . TRP A 1 151 ? 49.431 -4.665  10.879  1.00 12.94 ? 131 TRP A N     1 
ATOM   1030 C CA    . TRP A 1 151 ? 49.747 -4.610  9.436   1.00 15.04 ? 131 TRP A CA    1 
ATOM   1031 C C     . TRP A 1 151 ? 49.312 -3.305  8.828   1.00 14.15 ? 131 TRP A C     1 
ATOM   1032 O O     . TRP A 1 151 ? 48.237 -2.785  9.138   1.00 14.42 ? 131 TRP A O     1 
ATOM   1033 C CB    . TRP A 1 151 ? 49.001 -5.755  8.705   1.00 16.68 ? 131 TRP A CB    1 
ATOM   1034 C CG    . TRP A 1 151 ? 49.576 -7.113  8.919   1.00 12.31 ? 131 TRP A CG    1 
ATOM   1035 C CD1   . TRP A 1 151 ? 49.363 -7.947  10.001  1.00 17.03 ? 131 TRP A CD1   1 
ATOM   1036 C CD2   . TRP A 1 151 ? 50.435 -7.812  8.025   1.00 14.31 ? 131 TRP A CD2   1 
ATOM   1037 N NE1   . TRP A 1 151 ? 50.065 -9.134  9.811   1.00 17.44 ? 131 TRP A NE1   1 
ATOM   1038 C CE2   . TRP A 1 151 ? 50.753 -9.044  8.628   1.00 15.75 ? 131 TRP A CE2   1 
ATOM   1039 C CE3   . TRP A 1 151 ? 50.990 -7.509  6.774   1.00 17.09 ? 131 TRP A CE3   1 
ATOM   1040 C CZ2   . TRP A 1 151 ? 51.538 -10.003 7.969   1.00 20.67 ? 131 TRP A CZ2   1 
ATOM   1041 C CZ3   . TRP A 1 151 ? 51.814 -8.441  6.156   1.00 18.84 ? 131 TRP A CZ3   1 
ATOM   1042 C CH2   . TRP A 1 151 ? 52.084 -9.664  6.765   1.00 23.10 ? 131 TRP A CH2   1 
ATOM   1043 N N     . SER A 1 152 ? 50.166 -2.759  7.976   1.00 12.61 ? 132 SER A N     1 
ATOM   1044 C CA    . SER A 1 152 ? 49.880 -1.552  7.183   1.00 11.99 ? 132 SER A CA    1 
ATOM   1045 C C     . SER A 1 152 ? 49.692 -1.903  5.741   1.00 13.89 ? 132 SER A C     1 
ATOM   1046 O O     . SER A 1 152 ? 50.360 -2.777  5.180   1.00 15.03 ? 132 SER A O     1 
ATOM   1047 C CB    . SER A 1 152 ? 51.127 -0.677  7.233   1.00 14.05 ? 132 SER A CB    1 
ATOM   1048 O OG    . SER A 1 152 ? 50.947 0.485   6.418   1.00 14.31 ? 132 SER A OG    1 
ATOM   1049 N N     . ILE A 1 153 ? 48.814 -1.177  5.052   1.00 12.06 ? 133 ILE A N     1 
ATOM   1050 C CA    . ILE A 1 153 ? 48.728 -1.396  3.592   1.00 13.07 ? 133 ILE A CA    1 
ATOM   1051 C C     . ILE A 1 153 ? 49.721 -0.520  2.770   1.00 12.45 ? 133 ILE A C     1 
ATOM   1052 O O     . ILE A 1 153 ? 49.847 -0.674  1.557   1.00 14.24 ? 133 ILE A O     1 
ATOM   1053 C CB    . ILE A 1 153 ? 47.268 -1.328  2.985   1.00 13.99 ? 133 ILE A CB    1 
ATOM   1054 C CG1   . ILE A 1 153 ? 46.646 0.042   3.213   1.00 14.48 ? 133 ILE A CG1   1 
ATOM   1055 C CG2   . ILE A 1 153 ? 46.426 -2.449  3.558   1.00 15.07 ? 133 ILE A CG2   1 
ATOM   1056 C CD1   . ILE A 1 153 ? 45.552 0.352   2.162   1.00 14.08 ? 133 ILE A CD1   1 
ATOM   1057 N N     . GLY A 1 154 ? 50.403 0.405   3.468   1.00 14.40 ? 134 GLY A N     1 
ATOM   1058 C CA    . GLY A 1 154 ? 51.351 1.277   2.784   1.00 15.15 ? 134 GLY A CA    1 
ATOM   1059 C C     . GLY A 1 154 ? 51.710 2.479   3.613   1.00 13.43 ? 134 GLY A C     1 
ATOM   1060 O O     . GLY A 1 154 ? 51.023 2.781   4.615   1.00 14.20 ? 134 GLY A O     1 
ATOM   1061 N N     . ASP A 1 155 ? 52.758 3.202   3.187   1.00 15.47 ? 135 ASP A N     1 
ATOM   1062 C CA    . ASP A 1 155 ? 53.292 4.289   3.986   1.00 15.14 ? 135 ASP A CA    1 
ATOM   1063 C C     . ASP A 1 155 ? 52.548 5.555   3.654   1.00 17.22 ? 135 ASP A C     1 
ATOM   1064 O O     . ASP A 1 155 ? 53.090 6.500   3.068   1.00 17.18 ? 135 ASP A O     1 
ATOM   1065 C CB    . ASP A 1 155 ? 54.792 4.452   3.709   1.00 19.01 ? 135 ASP A CB    1 
ATOM   1066 C CG    . ASP A 1 155 ? 55.624 3.320   4.275   1.00 19.13 ? 135 ASP A CG    1 
ATOM   1067 O OD1   . ASP A 1 155 ? 55.200 2.678   5.249   1.00 18.89 ? 135 ASP A OD1   1 
ATOM   1068 O OD2   . ASP A 1 155 ? 56.740 3.106   3.774   1.00 21.27 ? 135 ASP A OD2   1 
ATOM   1069 N N     . TYR A 1 156 ? 51.283 5.612   4.073   1.00 15.32 ? 136 TYR A N     1 
ATOM   1070 C CA    . TYR A 1 156 ? 50.403 6.768   3.872   1.00 13.61 ? 136 TYR A CA    1 
ATOM   1071 C C     . TYR A 1 156 ? 49.313 6.641   4.906   1.00 15.52 ? 136 TYR A C     1 
ATOM   1072 O O     . TYR A 1 156 ? 49.137 5.534   5.457   1.00 17.42 ? 136 TYR A O     1 
ATOM   1073 C CB    . TYR A 1 156 ? 49.784 6.797   2.440   1.00 14.56 ? 136 TYR A CB    1 
ATOM   1074 C CG    . TYR A 1 156 ? 49.345 5.472   1.866   1.00 11.96 ? 136 TYR A CG    1 
ATOM   1075 C CD1   . TYR A 1 156 ? 48.092 4.904   2.225   1.00 14.42 ? 136 TYR A CD1   1 
ATOM   1076 C CD2   . TYR A 1 156 ? 50.163 4.738   0.975   1.00 14.29 ? 136 TYR A CD2   1 
ATOM   1077 C CE1   . TYR A 1 156 ? 47.684 3.688   1.715   1.00 14.72 ? 136 TYR A CE1   1 
ATOM   1078 C CE2   . TYR A 1 156 ? 49.783 3.475   0.475   1.00 13.80 ? 136 TYR A CE2   1 
ATOM   1079 C CZ    . TYR A 1 156 ? 48.510 2.961   0.844   1.00 13.58 ? 136 TYR A CZ    1 
ATOM   1080 O OH    . TYR A 1 156 ? 48.166 1.781   0.318   1.00 14.23 ? 136 TYR A OH    1 
ATOM   1081 N N     . VAL A 1 157 ? 48.627 7.717   5.231   1.00 14.91 ? 137 VAL A N     1 
ATOM   1082 C CA    . VAL A 1 157 ? 47.635 7.687   6.360   1.00 14.17 ? 137 VAL A CA    1 
ATOM   1083 C C     . VAL A 1 157 ? 46.237 7.846   5.798   1.00 13.15 ? 137 VAL A C     1 
ATOM   1084 O O     . VAL A 1 157 ? 45.926 8.757   5.012   1.00 14.93 ? 137 VAL A O     1 
ATOM   1085 C CB    . VAL A 1 157 ? 47.881 8.822   7.352   1.00 18.61 ? 137 VAL A CB    1 
ATOM   1086 C CG1   . VAL A 1 157 ? 46.852 8.735   8.514   1.00 18.79 ? 137 VAL A CG1   1 
ATOM   1087 C CG2   . VAL A 1 157 ? 49.316 8.685   7.904   1.00 22.64 ? 137 VAL A CG2   1 
ATOM   1088 N N     . LEU A 1 158 ? 45.389 6.873   6.142   1.00 12.33 ? 138 LEU A N     1 
ATOM   1089 C CA    . LEU A 1 158 ? 43.960 6.920   5.809   1.00 12.28 ? 138 LEU A CA    1 
ATOM   1090 C C     . LEU A 1 158 ? 43.089 7.303   7.013   1.00 12.96 ? 138 LEU A C     1 
ATOM   1091 O O     . LEU A 1 158 ? 43.564 7.362   8.152   1.00 13.81 ? 138 LEU A O     1 
ATOM   1092 C CB    . LEU A 1 158 ? 43.505 5.534   5.295   1.00 13.57 ? 138 LEU A CB    1 
ATOM   1093 C CG    . LEU A 1 158 ? 44.344 5.006   4.108   1.00 12.86 ? 138 LEU A CG    1 
ATOM   1094 C CD1   . LEU A 1 158 ? 43.646 3.749   3.675   1.00 18.65 ? 138 LEU A CD1   1 
ATOM   1095 C CD2   . LEU A 1 158 ? 44.399 6.024   2.995   1.00 14.66 ? 138 LEU A CD2   1 
ATOM   1096 N N     . THR A 1 159 ? 41.808 7.571   6.763   1.00 11.55 ? 139 THR A N     1 
ATOM   1097 C CA    . THR A 1 159 ? 40.902 7.985   7.853   1.00 11.41 ? 139 THR A CA    1 
ATOM   1098 C C     . THR A 1 159 ? 40.398 6.869   8.734   1.00 11.08 ? 139 THR A C     1 
ATOM   1099 O O     . THR A 1 159 ? 39.799 7.123   9.764   1.00 14.28 ? 139 THR A O     1 
ATOM   1100 C CB    . THR A 1 159 ? 39.678 8.756   7.297   1.00 10.44 ? 139 THR A CB    1 
ATOM   1101 O OG1   . THR A 1 159 ? 38.899 7.881   6.462   1.00 12.73 ? 139 THR A OG1   1 
ATOM   1102 C CG2   . THR A 1 159 ? 40.113 10.003  6.479   1.00 14.28 ? 139 THR A CG2   1 
ATOM   1103 N N     . GLY A 1 160 ? 40.652 5.632   8.314   1.00 10.97 ? 140 GLY A N     1 
ATOM   1104 C CA    . GLY A 1 160 ? 40.123 4.527   9.089   1.00 12.07 ? 140 GLY A CA    1 
ATOM   1105 C C     . GLY A 1 160 ? 40.783 3.266   8.605   1.00 10.87 ? 140 GLY A C     1 
ATOM   1106 O O     . GLY A 1 160 ? 41.366 3.202   7.512   1.00 11.54 ? 140 GLY A O     1 
ATOM   1107 N N     . GLY A 1 161 ? 40.668 2.218   9.403   1.00 10.28 ? 141 GLY A N     1 
ATOM   1108 C CA    . GLY A 1 161 ? 41.168 0.895   9.014   1.00 11.46 ? 141 GLY A CA    1 
ATOM   1109 C C     . GLY A 1 161 ? 40.315 0.035   8.089   1.00 10.43 ? 141 GLY A C     1 
ATOM   1110 O O     . GLY A 1 161 ? 40.785 -1.043  7.710   1.00 11.07 ? 141 GLY A O     1 
ATOM   1111 N N     . GLU A 1 162 ? 39.136 0.486   7.721   1.00 10.26 ? 142 GLU A N     1 
ATOM   1112 C CA    . GLU A 1 162 ? 38.235 -0.272  6.849   1.00 11.13 ? 142 GLU A CA    1 
ATOM   1113 C C     . GLU A 1 162 ? 38.784 -0.474  5.446   1.00 10.51 ? 142 GLU A C     1 
ATOM   1114 O O     . GLU A 1 162 ? 38.726 -1.621  4.970   1.00 12.30 ? 142 GLU A O     1 
ATOM   1115 C CB    . GLU A 1 162 ? 36.841 0.417   6.779   1.00 12.13 ? 142 GLU A CB    1 
ATOM   1116 C CG    . GLU A 1 162 ? 36.031 0.277   8.117   1.00 9.96  ? 142 GLU A CG    1 
ATOM   1117 C CD    . GLU A 1 162 ? 36.426 1.270   9.196   1.00 13.57 ? 142 GLU A CD    1 
ATOM   1118 O OE1   . GLU A 1 162 ? 37.250 2.198   8.922   1.00 12.88 ? 142 GLU A OE1   1 
ATOM   1119 O OE2   . GLU A 1 162 ? 35.866 1.109   10.323  1.00 12.19 ? 142 GLU A OE2   1 
ATOM   1120 N N     . LEU A 1 163 ? 39.270 0.561   4.758   1.00 11.34 ? 143 LEU A N     1 
ATOM   1121 C CA    . LEU A 1 163 ? 39.847 0.339   3.426   1.00 10.19 ? 143 LEU A CA    1 
ATOM   1122 C C     . LEU A 1 163 ? 41.072 -0.557  3.563   1.00 10.12 ? 143 LEU A C     1 
ATOM   1123 O O     . LEU A 1 163 ? 41.185 -1.498  2.742   1.00 11.15 ? 143 LEU A O     1 
ATOM   1124 C CB    . LEU A 1 163 ? 40.150 1.664   2.725   1.00 10.14 ? 143 LEU A CB    1 
ATOM   1125 C CG    . LEU A 1 163 ? 38.883 2.429   2.292   1.00 11.50 ? 143 LEU A CG    1 
ATOM   1126 C CD1   . LEU A 1 163 ? 39.395 3.826   1.787   1.00 14.33 ? 143 LEU A CD1   1 
ATOM   1127 C CD2   . LEU A 1 163 ? 38.117 1.740   1.159   1.00 13.88 ? 143 LEU A CD2   1 
ATOM   1128 N N     . PRO A 1 164 ? 41.959 -0.374  4.563   1.00 10.84 ? 144 PRO A N     1 
ATOM   1129 C CA    . PRO A 1 164 ? 43.045 -1.345  4.693   1.00 10.67 ? 144 PRO A CA    1 
ATOM   1130 C C     . PRO A 1 164 ? 42.556 -2.787  4.922   1.00 11.69 ? 144 PRO A C     1 
ATOM   1131 O O     . PRO A 1 164 ? 43.101 -3.738  4.332   1.00 10.86 ? 144 PRO A O     1 
ATOM   1132 C CB    . PRO A 1 164 ? 43.823 -0.773  5.862   1.00 11.40 ? 144 PRO A CB    1 
ATOM   1133 C CG    . PRO A 1 164 ? 43.648 0.714   5.787   1.00 12.07 ? 144 PRO A CG    1 
ATOM   1134 C CD    . PRO A 1 164 ? 42.215 0.878   5.359   1.00 11.13 ? 144 PRO A CD    1 
ATOM   1135 N N     . ALA A 1 165 ? 41.526 -2.973  5.778   1.00 10.52 ? 145 ALA A N     1 
ATOM   1136 C CA    . ALA A 1 165 ? 41.038 -4.331  6.030   1.00 9.07  ? 145 ALA A CA    1 
ATOM   1137 C C     . ALA A 1 165 ? 40.462 -4.904  4.762   1.00 10.97 ? 145 ALA A C     1 
ATOM   1138 O O     . ALA A 1 165 ? 40.700 -6.094  4.455   1.00 11.00 ? 145 ALA A O     1 
ATOM   1139 C CB    . ALA A 1 165 ? 39.938 -4.254  7.126   1.00 10.05 ? 145 ALA A CB    1 
ATOM   1140 N N     . MET A 1 166 ? 39.715 -4.117  3.994   1.00 10.80 ? 146 MET A N     1 
ATOM   1141 C CA    . MET A 1 166 ? 39.169 -4.645  2.765   1.00 10.57 ? 146 MET A CA    1 
ATOM   1142 C C     . MET A 1 166 ? 40.216 -4.997  1.743   1.00 10.85 ? 146 MET A C     1 
ATOM   1143 O O     . MET A 1 166 ? 40.111 -5.989  1.011   1.00 12.24 ? 146 MET A O     1 
ATOM   1144 C CB    . MET A 1 166 ? 38.156 -3.673  2.165   1.00 12.03 ? 146 MET A CB    1 
ATOM   1145 C CG    . MET A 1 166 ? 36.840 -3.669  2.892   1.00 12.84 ? 146 MET A CG    1 
ATOM   1146 S SD    . MET A 1 166 ? 35.544 -2.804  2.054   1.00 16.17 ? 146 MET A SD    1 
ATOM   1147 C CE    . MET A 1 166 ? 36.018 -1.290  2.899   1.00 12.35 ? 146 MET A CE    1 
ATOM   1148 N N     . THR A 1 167 ? 41.278 -4.192  1.713   1.00 10.50 ? 147 THR A N     1 
ATOM   1149 C CA    . THR A 1 167 ? 42.433 -4.454  0.830   1.00 10.55 ? 147 THR A CA    1 
ATOM   1150 C C     . THR A 1 167 ? 43.047 -5.797  1.190   1.00 12.61 ? 147 THR A C     1 
ATOM   1151 O O     . THR A 1 167 ? 43.353 -6.606  0.301   1.00 13.28 ? 147 THR A O     1 
ATOM   1152 C CB    . THR A 1 167 ? 43.429 -3.288  0.996   1.00 12.11 ? 147 THR A CB    1 
ATOM   1153 O OG1   . THR A 1 167 ? 42.792 -2.147  0.413   1.00 12.52 ? 147 THR A OG1   1 
ATOM   1154 C CG2   . THR A 1 167 ? 44.749 -3.529  0.204   1.00 12.03 ? 147 THR A CG2   1 
ATOM   1155 N N     . LEU A 1 168 ? 43.253 -6.016  2.484   1.00 13.22 ? 148 LEU A N     1 
ATOM   1156 C CA    . LEU A 1 168 ? 43.835 -7.290  2.933   1.00 10.69 ? 148 LEU A CA    1 
ATOM   1157 C C     . LEU A 1 168 ? 42.908 -8.454  2.559   1.00 12.41 ? 148 LEU A C     1 
ATOM   1158 O O     . LEU A 1 168 ? 43.414 -9.470  2.072   1.00 13.41 ? 148 LEU A O     1 
ATOM   1159 C CB    . LEU A 1 168 ? 44.059 -7.165  4.426   1.00 11.35 ? 148 LEU A CB    1 
ATOM   1160 C CG    . LEU A 1 168 ? 44.954 -8.232  5.106   1.00 13.58 ? 148 LEU A CG    1 
ATOM   1161 C CD1   . LEU A 1 168 ? 45.451 -7.702  6.445   1.00 17.12 ? 148 LEU A CD1   1 
ATOM   1162 C CD2   . LEU A 1 168 ? 44.090 -9.451  5.378   1.00 18.93 ? 148 LEU A CD2   1 
ATOM   1163 N N     . ILE A 1 169 ? 41.596 -8.328  2.853   1.00 13.10 ? 149 ILE A N     1 
ATOM   1164 C CA    . ILE A 1 169 ? 40.637 -9.360  2.512   1.00 11.60 ? 149 ILE A CA    1 
ATOM   1165 C C     . ILE A 1 169 ? 40.733 -9.671  1.011   1.00 11.83 ? 149 ILE A C     1 
ATOM   1166 O O     . ILE A 1 169 ? 40.798 -10.834 0.645   1.00 13.08 ? 149 ILE A O     1 
ATOM   1167 C CB    . ILE A 1 169 ? 39.241 -9.027  2.927   1.00 11.92 ? 149 ILE A CB    1 
ATOM   1168 C CG1   . ILE A 1 169 ? 39.140 -8.957  4.494   1.00 13.98 ? 149 ILE A CG1   1 
ATOM   1169 C CG2   . ILE A 1 169 ? 38.282 -10.138 2.471   1.00 15.51 ? 149 ILE A CG2   1 
ATOM   1170 C CD1   . ILE A 1 169 ? 37.841 -8.243  5.004   1.00 14.46 ? 149 ILE A CD1   1 
ATOM   1171 N N     . ASP A 1 170 ? 40.655 -8.652  0.187   1.00 11.79 ? 150 ASP A N     1 
ATOM   1172 C CA    . ASP A 1 170 ? 40.643 -8.836  -1.252  1.00 12.09 ? 150 ASP A CA    1 
ATOM   1173 C C     . ASP A 1 170 ? 41.933 -9.585  -1.671  1.00 12.16 ? 150 ASP A C     1 
ATOM   1174 O O     . ASP A 1 170 ? 41.898 -10.544 -2.489  1.00 12.75 ? 150 ASP A O     1 
ATOM   1175 C CB    . ASP A 1 170 ? 40.472 -7.444  -1.946  1.00 10.64 ? 150 ASP A CB    1 
ATOM   1176 C CG    . ASP A 1 170 ? 40.428 -7.565  -3.427  1.00 12.47 ? 150 ASP A CG    1 
ATOM   1177 O OD1   . ASP A 1 170 ? 39.353 -7.478  -4.012  1.00 15.74 ? 150 ASP A OD1   1 
ATOM   1178 O OD2   . ASP A 1 170 ? 41.496 -7.791  -4.061  1.00 12.95 ? 150 ASP A OD2   1 
ATOM   1179 N N     . ALA A 1 171 ? 43.082 -9.139  -1.187  1.00 12.47 ? 151 ALA A N     1 
ATOM   1180 C CA    . ALA A 1 171 ? 44.349 -9.726  -1.625  1.00 13.12 ? 151 ALA A CA    1 
ATOM   1181 C C     . ALA A 1 171 ? 44.432 -11.206 -1.242  1.00 16.08 ? 151 ALA A C     1 
ATOM   1182 O O     . ALA A 1 171 ? 44.851 -12.043 -2.029  1.00 15.60 ? 151 ALA A O     1 
ATOM   1183 C CB    . ALA A 1 171 ? 45.542 -8.920  -0.999  1.00 15.06 ? 151 ALA A CB    1 
ATOM   1184 N N     . VAL A 1 172 ? 43.996 -11.538 -0.040  1.00 14.02 ? 152 VAL A N     1 
ATOM   1185 C CA    . VAL A 1 172 ? 44.062 -12.953 0.408   1.00 15.19 ? 152 VAL A CA    1 
ATOM   1186 C C     . VAL A 1 172 ? 43.025 -13.801 -0.253  1.00 18.23 ? 152 VAL A C     1 
ATOM   1187 O O     . VAL A 1 172 ? 43.205 -14.981 -0.473  1.00 20.06 ? 152 VAL A O     1 
ATOM   1188 C CB    . VAL A 1 172 ? 43.998 -13.100 1.958   1.00 17.33 ? 152 VAL A CB    1 
ATOM   1189 C CG1   . VAL A 1 172 ? 45.170 -12.292 2.606   1.00 18.37 ? 152 VAL A CG1   1 
ATOM   1190 C CG2   . VAL A 1 172 ? 42.613 -12.777 2.570   1.00 26.07 ? 152 VAL A CG2   1 
ATOM   1191 N N     . ALA A 1 173 ? 41.907 -13.219 -0.578  1.00 16.41 ? 153 ALA A N     1 
ATOM   1192 C CA    . ALA A 1 173 ? 40.807 -13.988 -1.158  1.00 15.21 ? 153 ALA A CA    1 
ATOM   1193 C C     . ALA A 1 173 ? 41.240 -14.528 -2.482  1.00 23.05 ? 153 ALA A C     1 
ATOM   1194 O O     . ALA A 1 173 ? 40.712 -15.559 -2.908  1.00 20.63 ? 153 ALA A O     1 
ATOM   1195 C CB    . ALA A 1 173 ? 39.514 -13.095 -1.298  1.00 20.21 ? 153 ALA A CB    1 
ATOM   1196 N N     . ARG A 1 174 ? 42.128 -13.821 -3.182  1.00 18.48 ? 154 ARG A N     1 
ATOM   1197 C CA    . ARG A 1 174 ? 42.618 -14.333 -4.484  1.00 21.08 ? 154 ARG A CA    1 
ATOM   1198 C C     . ARG A 1 174 ? 43.302 -15.708 -4.362  1.00 26.26 ? 154 ARG A C     1 
ATOM   1199 O O     . ARG A 1 174 ? 43.384 -16.444 -5.352  1.00 26.56 ? 154 ARG A O     1 
ATOM   1200 C CB    . ARG A 1 174 ? 43.561 -13.330 -5.094  1.00 20.35 ? 154 ARG A CB    1 
ATOM   1201 C CG    . ARG A 1 174 ? 42.794 -12.071 -5.488  1.00 20.66 ? 154 ARG A CG    1 
ATOM   1202 C CD    . ARG A 1 174 ? 43.781 -11.099 -6.058  1.00 19.89 ? 154 ARG A CD    1 
ATOM   1203 N NE    . ARG A 1 174 ? 44.243 -11.469 -7.412  1.00 23.15 ? 154 ARG A NE    1 
ATOM   1204 C CZ    . ARG A 1 174 ? 45.449 -11.977 -7.673  1.00 25.46 ? 154 ARG A CZ    1 
ATOM   1205 N NH1   . ARG A 1 174 ? 46.335 -12.226 -6.711  1.00 23.41 ? 154 ARG A NH1   1 
ATOM   1206 N NH2   . ARG A 1 174 ? 45.775 -12.275 -8.954  1.00 31.35 ? 154 ARG A NH2   1 
ATOM   1207 N N     . PHE A 1 175 ? 43.780 -16.054 -3.182  1.00 23.01 ? 155 PHE A N     1 
ATOM   1208 C CA    . PHE A 1 175 ? 44.405 -17.362 -2.940  1.00 27.25 ? 155 PHE A CA    1 
ATOM   1209 C C     . PHE A 1 175 ? 43.448 -18.476 -2.557  1.00 28.66 ? 155 PHE A C     1 
ATOM   1210 O O     . PHE A 1 175 ? 43.831 -19.642 -2.429  1.00 30.03 ? 155 PHE A O     1 
ATOM   1211 C CB    . PHE A 1 175 ? 45.483 -17.232 -1.892  1.00 22.62 ? 155 PHE A CB    1 
ATOM   1212 C CG    . PHE A 1 175 ? 46.690 -16.531 -2.396  1.00 31.71 ? 155 PHE A CG    1 
ATOM   1213 C CD1   . PHE A 1 175 ? 47.777 -17.237 -2.892  1.00 44.39 ? 155 PHE A CD1   1 
ATOM   1214 C CD2   . PHE A 1 175 ? 46.705 -15.168 -2.484  1.00 25.43 ? 155 PHE A CD2   1 
ATOM   1215 C CE1   . PHE A 1 175 ? 48.883 -16.567 -3.424  1.00 53.26 ? 155 PHE A CE1   1 
ATOM   1216 C CE2   . PHE A 1 175 ? 47.783 -14.487 -3.008  1.00 32.28 ? 155 PHE A CE2   1 
ATOM   1217 C CZ    . PHE A 1 175 ? 48.891 -15.186 -3.475  1.00 47.95 ? 155 PHE A CZ    1 
ATOM   1218 N N     . ILE A 1 176 ? 42.189 -18.164 -2.359  1.00 26.26 ? 156 ILE A N     1 
ATOM   1219 C CA    . ILE A 1 176 ? 41.272 -19.203 -1.942  1.00 28.60 ? 156 ILE A CA    1 
ATOM   1220 C C     . ILE A 1 176 ? 40.866 -19.962 -3.167  1.00 27.43 ? 156 ILE A C     1 
ATOM   1221 O O     . ILE A 1 176 ? 40.471 -19.368 -4.168  1.00 29.31 ? 156 ILE A O     1 
ATOM   1222 C CB    . ILE A 1 176 ? 40.032 -18.587 -1.264  1.00 30.91 ? 156 ILE A CB    1 
ATOM   1223 C CG1   . ILE A 1 176 ? 40.477 -17.816 -0.025  1.00 26.82 ? 156 ILE A CG1   1 
ATOM   1224 C CG2   . ILE A 1 176 ? 38.951 -19.640 -1.001  1.00 36.93 ? 156 ILE A CG2   1 
ATOM   1225 C CD1   . ILE A 1 176 ? 39.306 -16.977 0.581   1.00 26.40 ? 156 ILE A CD1   1 
ATOM   1226 N N     . PRO A 1 177 ? 40.991 -21.310 -3.125  1.00 36.30 ? 157 PRO A N     1 
ATOM   1227 C CA    . PRO A 1 177 ? 40.693 -22.043 -4.353  1.00 39.77 ? 157 PRO A CA    1 
ATOM   1228 C C     . PRO A 1 177 ? 39.274 -21.782 -4.809  1.00 34.57 ? 157 PRO A C     1 
ATOM   1229 O O     . PRO A 1 177 ? 38.326 -21.771 -3.993  1.00 36.66 ? 157 PRO A O     1 
ATOM   1230 C CB    . PRO A 1 177 ? 40.844 -23.510 -3.930  1.00 47.65 ? 157 PRO A CB    1 
ATOM   1231 C CG    . PRO A 1 177 ? 41.767 -23.481 -2.758  1.00 41.58 ? 157 PRO A CG    1 
ATOM   1232 C CD    . PRO A 1 177 ? 41.383 -22.210 -2.024  1.00 40.04 ? 157 PRO A CD    1 
ATOM   1233 N N     . GLY A 1 178 ? 39.112 -21.534 -6.098  1.00 32.71 ? 158 GLY A N     1 
ATOM   1234 C CA    . GLY A 1 178 ? 37.762 -21.323 -6.599  1.00 30.89 ? 158 GLY A CA    1 
ATOM   1235 C C     . GLY A 1 178 ? 37.357 -19.865 -6.755  1.00 33.83 ? 158 GLY A C     1 
ATOM   1236 O O     . GLY A 1 178 ? 36.357 -19.554 -7.390  1.00 38.09 ? 158 GLY A O     1 
ATOM   1237 N N     . VAL A 1 179 ? 38.109 -18.959 -6.149  1.00 31.45 ? 159 VAL A N     1 
ATOM   1238 C CA    . VAL A 1 179 ? 37.724 -17.560 -6.211  1.00 29.27 ? 159 VAL A CA    1 
ATOM   1239 C C     . VAL A 1 179 ? 37.984 -16.963 -7.580  1.00 29.16 ? 159 VAL A C     1 
ATOM   1240 O O     . VAL A 1 179 ? 37.113 -16.289 -8.175  1.00 29.23 ? 159 VAL A O     1 
ATOM   1241 C CB    . VAL A 1 179 ? 38.388 -16.789 -5.044  1.00 25.37 ? 159 VAL A CB    1 
ATOM   1242 C CG1   . VAL A 1 179 ? 38.356 -15.211 -5.241  1.00 27.13 ? 159 VAL A CG1   1 
ATOM   1243 C CG2   . VAL A 1 179 ? 37.758 -17.307 -3.716  1.00 24.60 ? 159 VAL A CG2   1 
ATOM   1244 N N     . LEU A 1 180 ? 39.192 -17.218 -8.067  1.00 35.66 ? 160 LEU A N     1 
ATOM   1245 C CA    . LEU A 1 180 ? 39.558 -16.848 -9.419  1.00 42.69 ? 160 LEU A CA    1 
ATOM   1246 C C     . LEU A 1 180 ? 39.313 -18.084 -10.287 1.00 45.86 ? 160 LEU A C     1 
ATOM   1247 O O     . LEU A 1 180 ? 38.351 -18.124 -11.061 1.00 61.05 ? 160 LEU A O     1 
ATOM   1248 C CB    . LEU A 1 180 ? 41.023 -16.410 -9.482  1.00 39.01 ? 160 LEU A CB    1 
ATOM   1249 C CG    . LEU A 1 180 ? 41.452 -15.279 -8.547  1.00 31.06 ? 160 LEU A CG    1 
ATOM   1250 C CD1   . LEU A 1 180 ? 42.939 -15.011 -8.716  1.00 36.58 ? 160 LEU A CD1   1 
ATOM   1251 C CD2   . LEU A 1 180 ? 40.626 -14.039 -8.812  1.00 28.61 ? 160 LEU A CD2   1 
ATOM   1252 N N     . ASP A 1 189 ? 52.011 -12.849 -13.357 1.00 57.52 ? 169 ASP A N     1 
ATOM   1253 C CA    . ASP A 1 189 ? 51.198 -12.032 -12.450 1.00 49.21 ? 169 ASP A CA    1 
ATOM   1254 C C     . ASP A 1 189 ? 52.101 -11.186 -11.584 1.00 52.63 ? 169 ASP A C     1 
ATOM   1255 O O     . ASP A 1 189 ? 53.080 -11.702 -11.045 1.00 60.55 ? 169 ASP A O     1 
ATOM   1256 C CB    . ASP A 1 189 ? 50.370 -12.913 -11.534 1.00 56.34 ? 169 ASP A CB    1 
ATOM   1257 C CG    . ASP A 1 189 ? 49.176 -12.177 -10.963 1.00 67.63 ? 169 ASP A CG    1 
ATOM   1258 O OD1   . ASP A 1 189 ? 48.856 -11.074 -11.501 1.00 63.60 ? 169 ASP A OD1   1 
ATOM   1259 O OD2   . ASP A 1 189 ? 48.544 -12.714 -10.010 1.00 57.39 ? 169 ASP A OD2   1 
ATOM   1260 N N     . SER A 1 190 ? 51.776 -9.893  -11.444 1.00 43.35 ? 170 SER A N     1 
ATOM   1261 C CA    . SER A 1 190 ? 52.659 -8.956  -10.748 1.00 47.26 ? 170 SER A CA    1 
ATOM   1262 C C     . SER A 1 190 ? 53.050 -9.522  -9.400  1.00 55.13 ? 170 SER A C     1 
ATOM   1263 O O     . SER A 1 190 ? 52.188 -9.917  -8.616  1.00 55.94 ? 170 SER A O     1 
ATOM   1264 C CB    . SER A 1 190 ? 51.983 -7.590  -10.541 1.00 46.70 ? 170 SER A CB    1 
ATOM   1265 O OG    . SER A 1 190 ? 51.868 -6.874  -11.761 1.00 33.55 ? 170 SER A OG    1 
ATOM   1266 N N     . PHE A 1 191 ? 54.353 -9.565  -9.138  1.00 57.07 ? 171 PHE A N     1 
ATOM   1267 C CA    . PHE A 1 191 ? 54.893 -10.010 -7.843  1.00 55.91 ? 171 PHE A CA    1 
ATOM   1268 C C     . PHE A 1 191 ? 54.817 -11.507 -7.572  1.00 52.57 ? 171 PHE A C     1 
ATOM   1269 O O     . PHE A 1 191 ? 55.387 -11.977 -6.562  1.00 53.30 ? 171 PHE A O     1 
ATOM   1270 C CB    . PHE A 1 191 ? 54.247 -9.255  -6.684  1.00 43.26 ? 171 PHE A CB    1 
ATOM   1271 C CG    . PHE A 1 191 ? 54.191 -7.799  -6.914  1.00 45.14 ? 171 PHE A CG    1 
ATOM   1272 C CD1   . PHE A 1 191 ? 55.357 -7.063  -7.015  1.00 42.07 ? 171 PHE A CD1   1 
ATOM   1273 C CD2   . PHE A 1 191 ? 52.988 -7.179  -7.102  1.00 39.59 ? 171 PHE A CD2   1 
ATOM   1274 C CE1   . PHE A 1 191 ? 55.314 -5.726  -7.268  1.00 39.17 ? 171 PHE A CE1   1 
ATOM   1275 C CE2   . PHE A 1 191 ? 52.940 -5.856  -7.371  1.00 37.50 ? 171 PHE A CE2   1 
ATOM   1276 C CZ    . PHE A 1 191 ? 54.094 -5.123  -7.446  1.00 32.92 ? 171 PHE A CZ    1 
ATOM   1277 N N     . ALA A 1 192 ? 54.104 -12.225 -8.441  1.00 44.87 ? 172 ALA A N     1 
ATOM   1278 C CA    . ALA A 1 192 ? 53.889 -13.669 -8.278  1.00 58.17 ? 172 ALA A CA    1 
ATOM   1279 C C     . ALA A 1 192 ? 55.247 -14.336 -8.311  1.00 67.59 ? 172 ALA A C     1 
ATOM   1280 O O     . ALA A 1 192 ? 55.622 -15.088 -7.394  1.00 61.01 ? 172 ALA A O     1 
ATOM   1281 C CB    . ALA A 1 192 ? 52.994 -14.229 -9.393  1.00 59.76 ? 172 ALA A CB    1 
ATOM   1282 N N     . ASP A 1 193 ? 55.981 -14.036 -9.380  1.00 55.23 ? 173 ASP A N     1 
ATOM   1283 C CA    . ASP A 1 193 ? 57.372 -14.444 -9.498  1.00 56.97 ? 173 ASP A CA    1 
ATOM   1284 C C     . ASP A 1 193 ? 58.278 -13.219 -9.270  1.00 48.55 ? 173 ASP A C     1 
ATOM   1285 O O     . ASP A 1 193 ? 59.480 -13.231 -9.602  1.00 42.84 ? 173 ASP A O     1 
ATOM   1286 C CB    . ASP A 1 193 ? 57.607 -15.088 -10.860 1.00 51.41 ? 173 ASP A CB    1 
ATOM   1287 C CG    . ASP A 1 193 ? 57.317 -14.145 -12.008 1.00 55.85 ? 173 ASP A CG    1 
ATOM   1288 O OD1   . ASP A 1 193 ? 56.758 -13.035 -11.749 1.00 46.85 ? 173 ASP A OD1   1 
ATOM   1289 O OD2   . ASP A 1 193 ? 57.650 -14.526 -13.168 1.00 52.35 ? 173 ASP A OD2   1 
ATOM   1290 N N     . GLY A 1 194 ? 57.685 -12.155 -8.717  1.00 35.32 ? 174 GLY A N     1 
ATOM   1291 C CA    . GLY A 1 194 ? 58.472 -11.056 -8.232  1.00 33.69 ? 174 GLY A CA    1 
ATOM   1292 C C     . GLY A 1 194 ? 58.591 -9.931  -9.250  1.00 29.80 ? 174 GLY A C     1 
ATOM   1293 O O     . GLY A 1 194 ? 59.244 -8.924  -8.961  1.00 27.86 ? 174 GLY A O     1 
ATOM   1294 N N     . LEU A 1 195 ? 57.999 -10.135 -10.426 1.00 25.46 ? 175 LEU A N     1 
ATOM   1295 C CA    . LEU A 1 195 ? 58.152 -9.191  -11.536 1.00 18.96 ? 175 LEU A CA    1 
ATOM   1296 C C     . LEU A 1 195 ? 56.847 -8.445  -11.814 1.00 20.36 ? 175 LEU A C     1 
ATOM   1297 O O     . LEU A 1 195 ? 55.764 -8.949  -11.529 1.00 23.03 ? 175 LEU A O     1 
ATOM   1298 C CB    . LEU A 1 195 ? 58.553 -9.915  -12.822 1.00 19.18 ? 175 LEU A CB    1 
ATOM   1299 C CG    . LEU A 1 195 ? 59.857 -10.751 -12.782 1.00 19.91 ? 175 LEU A CG    1 
ATOM   1300 C CD1   . LEU A 1 195 ? 60.010 -11.607 -14.001 1.00 21.51 ? 175 LEU A CD1   1 
ATOM   1301 C CD2   . LEU A 1 195 ? 61.046 -9.788  -12.600 1.00 20.85 ? 175 LEU A CD2   1 
ATOM   1302 N N     . LEU A 1 196 ? 56.960 -7.263  -12.399 1.00 18.73 ? 176 LEU A N     1 
ATOM   1303 C CA    . LEU A 1 196 ? 55.749 -6.560  -12.884 1.00 18.41 ? 176 LEU A CA    1 
ATOM   1304 C C     . LEU A 1 196 ? 55.181 -7.370  -14.050 1.00 19.55 ? 176 LEU A C     1 
ATOM   1305 O O     . LEU A 1 196 ? 55.879 -8.128  -14.723 1.00 18.29 ? 176 LEU A O     1 
ATOM   1306 C CB    . LEU A 1 196 ? 56.070 -5.161  -13.340 1.00 16.53 ? 176 LEU A CB    1 
ATOM   1307 C CG    . LEU A 1 196 ? 56.669 -4.174  -12.311 1.00 22.01 ? 176 LEU A CG    1 
ATOM   1308 C CD1   . LEU A 1 196 ? 56.820 -2.741  -12.863 1.00 20.44 ? 176 LEU A CD1   1 
ATOM   1309 C CD2   . LEU A 1 196 ? 55.959 -4.260  -10.959 1.00 27.05 ? 176 LEU A CD2   1 
ATOM   1310 N N     . ASP A 1 197 ? 53.870 -7.254  -14.259 1.00 18.36 ? 177 ASP A N     1 
ATOM   1311 C CA    . ASP A 1 197 ? 53.194 -7.983  -15.331 1.00 22.57 ? 177 ASP A CA    1 
ATOM   1312 C C     . ASP A 1 197 ? 53.612 -7.353  -16.689 1.00 18.07 ? 177 ASP A C     1 
ATOM   1313 O O     . ASP A 1 197 ? 54.062 -6.194  -16.767 1.00 19.43 ? 177 ASP A O     1 
ATOM   1314 C CB    . ASP A 1 197 ? 51.677 -7.860  -15.095 1.00 23.84 ? 177 ASP A CB    1 
ATOM   1315 C CG    . ASP A 1 197 ? 50.869 -8.887  -15.836 1.00 21.39 ? 177 ASP A CG    1 
ATOM   1316 O OD1   . ASP A 1 197 ? 51.439 -9.857  -16.409 1.00 27.72 ? 177 ASP A OD1   1 
ATOM   1317 O OD2   . ASP A 1 197 ? 49.625 -8.663  -15.866 1.00 30.22 ? 177 ASP A OD2   1 
ATOM   1318 N N     . CYS A 1 198 ? 53.439 -8.141  -17.748 1.00 18.31 ? 178 CYS A N     1 
ATOM   1319 C CA    . CYS A 1 198 ? 53.656 -7.674  -19.132 1.00 16.54 ? 178 CYS A CA    1 
ATOM   1320 C C     . CYS A 1 198 ? 52.431 -6.850  -19.589 1.00 18.35 ? 178 CYS A C     1 
ATOM   1321 O O     . CYS A 1 198 ? 51.370 -6.925  -18.946 1.00 18.01 ? 178 CYS A O     1 
ATOM   1322 C CB    . CYS A 1 198 ? 53.826 -8.864  -20.056 1.00 16.71 ? 178 CYS A CB    1 
ATOM   1323 S SG    . CYS A 1 198 ? 52.499 -9.978  -20.085 1.00 22.30 ? 178 CYS A SG    1 
ATOM   1324 N N     . PRO A 1 199 ? 52.609 -6.071  -20.630 1.00 17.55 ? 179 PRO A N     1 
ATOM   1325 C CA    . PRO A 1 199 ? 51.470 -5.329  -21.191 1.00 16.70 ? 179 PRO A CA    1 
ATOM   1326 C C     . PRO A 1 199 ? 50.537 -6.310  -21.826 1.00 17.93 ? 179 PRO A C     1 
ATOM   1327 O O     . PRO A 1 199 ? 50.904 -7.432  -22.230 1.00 17.90 ? 179 PRO A O     1 
ATOM   1328 C CB    . PRO A 1 199 ? 52.074 -4.422  -22.210 1.00 19.24 ? 179 PRO A CB    1 
ATOM   1329 C CG    . PRO A 1 199 ? 53.509 -4.786  -22.355 1.00 24.48 ? 179 PRO A CG    1 
ATOM   1330 C CD    . PRO A 1 199 ? 53.872 -5.818  -21.362 1.00 16.07 ? 179 PRO A CD    1 
ATOM   1331 N N     . HIS A 1 200 ? 49.261 -5.922  -21.896 1.00 14.57 ? 180 HIS A N     1 
ATOM   1332 C CA    . HIS A 1 200 ? 48.247 -6.801  -22.451 1.00 14.88 ? 180 HIS A CA    1 
ATOM   1333 C C     . HIS A 1 200 ? 47.519 -5.993  -23.520 1.00 13.00 ? 180 HIS A C     1 
ATOM   1334 O O     . HIS A 1 200 ? 47.447 -4.749  -23.478 1.00 16.02 ? 180 HIS A O     1 
ATOM   1335 C CB    . HIS A 1 200 ? 47.210 -7.209  -21.391 1.00 22.36 ? 180 HIS A CB    1 
ATOM   1336 C CG    . HIS A 1 200 ? 47.803 -8.013  -20.265 1.00 23.72 ? 180 HIS A CG    1 
ATOM   1337 N ND1   . HIS A 1 200 ? 48.408 -9.221  -20.504 1.00 26.80 ? 180 HIS A ND1   1 
ATOM   1338 C CD2   . HIS A 1 200 ? 47.962 -7.748  -18.956 1.00 27.69 ? 180 HIS A CD2   1 
ATOM   1339 C CE1   . HIS A 1 200 ? 48.885 -9.701  -19.361 1.00 31.56 ? 180 HIS A CE1   1 
ATOM   1340 N NE2   . HIS A 1 200 ? 48.649 -8.810  -18.420 1.00 25.26 ? 180 HIS A NE2   1 
ATOM   1341 N N     . TYR A 1 201 ? 46.989 -6.711  -24.499 1.00 13.11 ? 181 TYR A N     1 
ATOM   1342 C CA    . TYR A 1 201 ? 46.281 -6.073  -25.645 1.00 14.98 ? 181 TYR A CA    1 
ATOM   1343 C C     . TYR A 1 201 ? 45.068 -6.870  -26.006 1.00 15.02 ? 181 TYR A C     1 
ATOM   1344 O O     . TYR A 1 201 ? 45.031 -8.114  -25.924 1.00 14.96 ? 181 TYR A O     1 
ATOM   1345 C CB    . TYR A 1 201 ? 47.202 -6.130  -26.897 1.00 15.62 ? 181 TYR A CB    1 
ATOM   1346 C CG    . TYR A 1 201 ? 48.458 -5.331  -26.729 1.00 13.88 ? 181 TYR A CG    1 
ATOM   1347 C CD1   . TYR A 1 201 ? 48.580 -4.018  -27.169 1.00 15.57 ? 181 TYR A CD1   1 
ATOM   1348 C CD2   . TYR A 1 201 ? 49.579 -5.914  -26.091 1.00 15.26 ? 181 TYR A CD2   1 
ATOM   1349 C CE1   . TYR A 1 201 ? 49.719 -3.299  -26.962 1.00 19.66 ? 181 TYR A CE1   1 
ATOM   1350 C CE2   . TYR A 1 201 ? 50.762 -5.160  -25.911 1.00 16.91 ? 181 TYR A CE2   1 
ATOM   1351 C CZ    . TYR A 1 201 ? 50.821 -3.904  -26.375 1.00 20.14 ? 181 TYR A CZ    1 
ATOM   1352 O OH    . TYR A 1 201 ? 51.951 -3.198  -26.158 1.00 24.14 ? 181 TYR A OH    1 
ATOM   1353 N N     . THR A 1 202 ? 44.027 -6.128  -26.405 1.00 12.93 ? 182 THR A N     1 
ATOM   1354 C CA    . THR A 1 202 ? 42.811 -6.783  -26.906 1.00 13.29 ? 182 THR A CA    1 
ATOM   1355 C C     . THR A 1 202 ? 42.341 -5.989  -28.149 1.00 12.84 ? 182 THR A C     1 
ATOM   1356 O O     . THR A 1 202 ? 43.022 -5.089  -28.611 1.00 15.00 ? 182 THR A O     1 
ATOM   1357 C CB    . THR A 1 202 ? 41.720 -6.914  -25.786 1.00 13.61 ? 182 THR A CB    1 
ATOM   1358 O OG1   . THR A 1 202 ? 40.616 -7.679  -26.253 1.00 13.83 ? 182 THR A OG1   1 
ATOM   1359 C CG2   . THR A 1 202 ? 41.260 -5.514  -25.305 1.00 13.60 ? 182 THR A CG2   1 
ATOM   1360 N N     . ARG A 1 203 ? 41.152 -6.308  -28.656 1.00 12.73 ? 183 ARG A N     1 
ATOM   1361 C CA    . ARG A 1 203 ? 40.674 -5.631  -29.851 1.00 13.33 ? 183 ARG A CA    1 
ATOM   1362 C C     . ARG A 1 203 ? 40.508 -4.161  -29.615 1.00 13.31 ? 183 ARG A C     1 
ATOM   1363 O O     . ARG A 1 203 ? 40.187 -3.700  -28.494 1.00 13.80 ? 183 ARG A O     1 
ATOM   1364 C CB    . ARG A 1 203 ? 39.296 -6.206  -30.224 1.00 13.99 ? 183 ARG A CB    1 
ATOM   1365 C CG    . ARG A 1 203 ? 39.331 -7.698  -30.563 1.00 15.83 ? 183 ARG A CG    1 
ATOM   1366 C CD    . ARG A 1 203 ? 37.933 -8.143  -31.102 1.00 14.13 ? 183 ARG A CD    1 
ATOM   1367 N NE    . ARG A 1 203 ? 36.933 -7.947  -30.044 1.00 15.41 ? 183 ARG A NE    1 
ATOM   1368 C CZ    . ARG A 1 203 ? 35.612 -8.005  -30.235 1.00 15.91 ? 183 ARG A CZ    1 
ATOM   1369 N NH1   . ARG A 1 203 ? 35.141 -8.237  -31.494 1.00 16.00 ? 183 ARG A NH1   1 
ATOM   1370 N NH2   . ARG A 1 203 ? 34.791 -7.874  -29.218 1.00 14.64 ? 183 ARG A NH2   1 
ATOM   1371 N N     . PRO A 1 204 ? 40.692 -3.363  -30.647 1.00 14.06 ? 184 PRO A N     1 
ATOM   1372 C CA    . PRO A 1 204 ? 40.999 -3.698  -32.035 1.00 15.54 ? 184 PRO A CA    1 
ATOM   1373 C C     . PRO A 1 204 ? 42.477 -3.850  -32.311 1.00 16.36 ? 184 PRO A C     1 
ATOM   1374 O O     . PRO A 1 204 ? 43.340 -3.431  -31.546 1.00 15.10 ? 184 PRO A O     1 
ATOM   1375 C CB    . PRO A 1 204 ? 40.484 -2.462  -32.785 1.00 14.86 ? 184 PRO A CB    1 
ATOM   1376 C CG    . PRO A 1 204 ? 40.698 -1.316  -31.822 1.00 14.64 ? 184 PRO A CG    1 
ATOM   1377 C CD    . PRO A 1 204 ? 40.525 -1.913  -30.411 1.00 13.58 ? 184 PRO A CD    1 
ATOM   1378 N N     . GLU A 1 205 ? 42.805 -4.422  -33.473 1.00 17.92 ? 185 GLU A N     1 
ATOM   1379 C CA    . GLU A 1 205 ? 44.211 -4.567  -33.849 1.00 17.04 ? 185 GLU A CA    1 
ATOM   1380 C C     . GLU A 1 205 ? 45.004 -3.279  -33.924 1.00 18.48 ? 185 GLU A C     1 
ATOM   1381 O O     . GLU A 1 205 ? 46.204 -3.272  -33.584 1.00 18.68 ? 185 GLU A O     1 
ATOM   1382 C CB    . GLU A 1 205 ? 44.282 -5.237  -35.227 1.00 19.90 ? 185 GLU A CB    1 
ATOM   1383 C CG    . GLU A 1 205 ? 43.770 -6.568  -35.266 1.00 29.24 ? 185 GLU A CG    1 
ATOM   1384 C CD    . GLU A 1 205 ? 44.295 -7.320  -36.494 1.00 52.15 ? 185 GLU A CD    1 
ATOM   1385 O OE1   . GLU A 1 205 ? 45.393 -6.951  -37.002 1.00 32.47 ? 185 GLU A OE1   1 
ATOM   1386 O OE2   . GLU A 1 205 ? 43.587 -8.256  -36.942 1.00 52.54 ? 185 GLU A OE2   1 
ATOM   1387 N N     . VAL A 1 206 ? 44.385 -2.173  -34.328 1.00 17.32 ? 186 VAL A N     1 
ATOM   1388 C CA    . VAL A 1 206 ? 45.025 -0.863  -34.384 1.00 15.44 ? 186 VAL A CA    1 
ATOM   1389 C C     . VAL A 1 206 ? 44.138 0.127   -33.610 1.00 17.30 ? 186 VAL A C     1 
ATOM   1390 O O     . VAL A 1 206 ? 42.932 0.178   -33.837 1.00 21.85 ? 186 VAL A O     1 
ATOM   1391 C CB    . VAL A 1 206 ? 45.214 -0.328  -35.818 1.00 22.51 ? 186 VAL A CB    1 
ATOM   1392 C CG1   . VAL A 1 206 ? 46.057 0.924   -35.817 1.00 22.92 ? 186 VAL A CG1   1 
ATOM   1393 C CG2   . VAL A 1 206 ? 45.876 -1.407  -36.642 1.00 25.32 ? 186 VAL A CG2   1 
ATOM   1394 N N     . LEU A 1 207 ? 44.768 0.839   -32.692 1.00 17.35 ? 187 LEU A N     1 
ATOM   1395 C CA    . LEU A 1 207 ? 44.050 1.784   -31.838 1.00 18.69 ? 187 LEU A CA    1 
ATOM   1396 C C     . LEU A 1 207 ? 44.800 3.087   -31.818 1.00 21.74 ? 187 LEU A C     1 
ATOM   1397 O O     . LEU A 1 207 ? 45.935 3.138   -31.372 1.00 20.08 ? 187 LEU A O     1 
ATOM   1398 C CB    . LEU A 1 207 ? 43.907 1.174   -30.410 1.00 18.11 ? 187 LEU A CB    1 
ATOM   1399 C CG    . LEU A 1 207 ? 43.201 2.185   -29.496 1.00 17.95 ? 187 LEU A CG    1 
ATOM   1400 C CD1   . LEU A 1 207 ? 41.739 2.218   -29.923 1.00 23.54 ? 187 LEU A CD1   1 
ATOM   1401 C CD2   . LEU A 1 207 ? 43.240 1.721   -28.057 1.00 22.77 ? 187 LEU A CD2   1 
ATOM   1402 N N     . GLU A 1 208 ? 44.199 4.160   -32.350 1.00 22.70 ? 188 GLU A N     1 
ATOM   1403 C CA    . GLU A 1 208 ? 44.867 5.434   -32.526 1.00 25.74 ? 188 GLU A CA    1 
ATOM   1404 C C     . GLU A 1 208 ? 46.254 5.265   -33.144 1.00 19.73 ? 188 GLU A C     1 
ATOM   1405 O O     . GLU A 1 208 ? 47.243 5.911   -32.712 1.00 23.36 ? 188 GLU A O     1 
ATOM   1406 C CB    . GLU A 1 208 ? 44.896 6.249   -31.246 1.00 30.10 ? 188 GLU A CB    1 
ATOM   1407 C CG    . GLU A 1 208 ? 43.488 6.670   -30.836 1.00 31.65 ? 188 GLU A CG    1 
ATOM   1408 C CD    . GLU A 1 208 ? 43.493 7.769   -29.812 1.00 28.73 ? 188 GLU A CD    1 
ATOM   1409 O OE1   . GLU A 1 208 ? 44.468 8.532   -29.730 1.00 44.31 ? 188 GLU A OE1   1 
ATOM   1410 O OE2   . GLU A 1 208 ? 42.498 7.931   -29.095 1.00 33.17 ? 188 GLU A OE2   1 
ATOM   1411 N N     . GLY A 1 209 ? 46.269 4.431   -34.182 1.00 25.06 ? 189 GLY A N     1 
ATOM   1412 C CA    . GLY A 1 209 ? 47.442 4.121   -34.979 1.00 22.37 ? 189 GLY A CA    1 
ATOM   1413 C C     . GLY A 1 209 ? 48.488 3.244   -34.292 1.00 27.61 ? 189 GLY A C     1 
ATOM   1414 O O     . GLY A 1 209 ? 49.574 2.995   -34.850 1.00 26.51 ? 189 GLY A O     1 
ATOM   1415 N N     . LEU A 1 210 ? 48.173 2.765   -33.083 1.00 20.63 ? 190 LEU A N     1 
ATOM   1416 C CA    . LEU A 1 210 ? 49.087 1.902   -32.342 1.00 19.55 ? 190 LEU A CA    1 
ATOM   1417 C C     . LEU A 1 210 ? 48.694 0.467   -32.565 1.00 19.96 ? 190 LEU A C     1 
ATOM   1418 O O     . LEU A 1 210 ? 47.530 0.047   -32.391 1.00 17.92 ? 190 LEU A O     1 
ATOM   1419 C CB    . LEU A 1 210 ? 49.020 2.191   -30.817 1.00 19.00 ? 190 LEU A CB    1 
ATOM   1420 C CG    . LEU A 1 210 ? 49.449 3.603   -30.447 1.00 19.31 ? 190 LEU A CG    1 
ATOM   1421 C CD1   . LEU A 1 210 ? 49.164 3.785   -28.947 1.00 24.11 ? 190 LEU A CD1   1 
ATOM   1422 C CD2   . LEU A 1 210 ? 50.924 3.821   -30.823 1.00 25.79 ? 190 LEU A CD2   1 
ATOM   1423 N N     . THR A 1 211 ? 49.644 -0.334  -33.018 1.00 20.99 ? 191 THR A N     1 
ATOM   1424 C CA    . THR A 1 211 ? 49.307 -1.685  -33.395 1.00 18.76 ? 191 THR A CA    1 
ATOM   1425 C C     . THR A 1 211 ? 49.655 -2.687  -32.307 1.00 20.96 ? 191 THR A C     1 
ATOM   1426 O O     . THR A 1 211 ? 50.469 -2.399  -31.437 1.00 26.14 ? 191 THR A O     1 
ATOM   1427 C CB    . THR A 1 211 ? 50.026 -2.071  -34.686 1.00 28.11 ? 191 THR A CB    1 
ATOM   1428 O OG1   . THR A 1 211 ? 51.430 -1.944  -34.459 1.00 35.67 ? 191 THR A OG1   1 
ATOM   1429 C CG2   . THR A 1 211 ? 49.597 -1.107  -35.783 1.00 24.34 ? 191 THR A CG2   1 
ATOM   1430 N N     . VAL A 1 212 ? 48.929 -3.780  -32.287 1.00 17.23 ? 192 VAL A N     1 
ATOM   1431 C CA    . VAL A 1 212 ? 49.263 -4.876  -31.377 1.00 19.19 ? 192 VAL A CA    1 
ATOM   1432 C C     . VAL A 1 212 ? 50.629 -5.485  -31.848 1.00 22.16 ? 192 VAL A C     1 
ATOM   1433 O O     . VAL A 1 212 ? 50.836 -5.751  -33.049 1.00 21.26 ? 192 VAL A O     1 
ATOM   1434 C CB    . VAL A 1 212 ? 48.162 -5.937  -31.364 1.00 19.88 ? 192 VAL A CB    1 
ATOM   1435 C CG1   . VAL A 1 212 ? 48.587 -7.185  -30.544 1.00 20.00 ? 192 VAL A CG1   1 
ATOM   1436 C CG2   . VAL A 1 212 ? 46.782 -5.375  -30.833 1.00 17.77 ? 192 VAL A CG2   1 
ATOM   1437 N N     . PRO A 1 213 ? 51.559 -5.730  -30.916 1.00 17.83 ? 193 PRO A N     1 
ATOM   1438 C CA    . PRO A 1 213 ? 52.784 -6.435  -31.317 1.00 21.42 ? 193 PRO A CA    1 
ATOM   1439 C C     . PRO A 1 213 ? 52.480 -7.701  -32.113 1.00 17.79 ? 193 PRO A C     1 
ATOM   1440 O O     . PRO A 1 213 ? 51.753 -8.638  -31.698 1.00 20.44 ? 193 PRO A O     1 
ATOM   1441 C CB    . PRO A 1 213 ? 53.441 -6.758  -29.987 1.00 17.77 ? 193 PRO A CB    1 
ATOM   1442 C CG    . PRO A 1 213 ? 52.986 -5.600  -29.060 1.00 17.89 ? 193 PRO A CG    1 
ATOM   1443 C CD    . PRO A 1 213 ? 51.538 -5.389  -29.485 1.00 20.10 ? 193 PRO A CD    1 
ATOM   1444 N N     . PRO A 1 214 ? 53.089 -7.767  -33.323 1.00 21.92 ? 194 PRO A N     1 
ATOM   1445 C CA    . PRO A 1 214 ? 52.753 -8.903  -34.183 1.00 21.36 ? 194 PRO A CA    1 
ATOM   1446 C C     . PRO A 1 214 ? 53.069 -10.243 -33.573 1.00 19.85 ? 194 PRO A C     1 
ATOM   1447 O O     . PRO A 1 214 ? 52.403 -11.211 -33.903 1.00 21.65 ? 194 PRO A O     1 
ATOM   1448 C CB    . PRO A 1 214 ? 53.686 -8.702  -35.398 1.00 23.86 ? 194 PRO A CB    1 
ATOM   1449 C CG    . PRO A 1 214 ? 53.900 -7.227  -35.482 1.00 29.73 ? 194 PRO A CG    1 
ATOM   1450 C CD    . PRO A 1 214 ? 53.877 -6.738  -34.022 1.00 24.44 ? 194 PRO A CD    1 
ATOM   1451 N N     . VAL A 1 215 ? 54.052 -10.336 -32.670 1.00 20.14 ? 195 VAL A N     1 
ATOM   1452 C CA    . VAL A 1 215 ? 54.258 -11.629 -32.020 1.00 20.23 ? 195 VAL A CA    1 
ATOM   1453 C C     . VAL A 1 215 ? 53.005 -12.151 -31.361 1.00 23.67 ? 195 VAL A C     1 
ATOM   1454 O O     . VAL A 1 215 ? 52.745 -13.325 -31.323 1.00 21.82 ? 195 VAL A O     1 
ATOM   1455 C CB    . VAL A 1 215 ? 55.434 -11.595 -31.017 1.00 23.35 ? 195 VAL A CB    1 
ATOM   1456 C CG1   . VAL A 1 215 ? 55.074 -10.686 -29.859 1.00 22.38 ? 195 VAL A CG1   1 
ATOM   1457 C CG2   . VAL A 1 215 ? 55.727 -12.999 -30.532 1.00 25.14 ? 195 VAL A CG2   1 
ATOM   1458 N N     . LEU A 1 216 ? 52.183 -11.253 -30.803 1.00 21.64 ? 196 LEU A N     1 
ATOM   1459 C CA    . LEU A 1 216 ? 50.999 -11.760 -30.160 1.00 19.32 ? 196 LEU A CA    1 
ATOM   1460 C C     . LEU A 1 216 ? 49.886 -12.216 -31.104 1.00 21.88 ? 196 LEU A C     1 
ATOM   1461 O O     . LEU A 1 216 ? 48.969 -12.930 -30.658 1.00 23.02 ? 196 LEU A O     1 
ATOM   1462 C CB    . LEU A 1 216 ? 50.443 -10.696 -29.196 1.00 19.31 ? 196 LEU A CB    1 
ATOM   1463 C CG    . LEU A 1 216 ? 51.428 -10.180 -28.172 1.00 15.85 ? 196 LEU A CG    1 
ATOM   1464 C CD1   . LEU A 1 216 ? 50.747 -8.933  -27.417 1.00 20.39 ? 196 LEU A CD1   1 
ATOM   1465 C CD2   . LEU A 1 216 ? 51.683 -11.239 -27.118 1.00 19.21 ? 196 LEU A CD2   1 
ATOM   1466 N N     . MET A 1 217 ? 50.005 -11.815 -32.373 1.00 22.53 ? 197 MET A N     1 
ATOM   1467 C CA    . MET A 1 217 ? 49.084 -12.323 -33.398 1.00 24.13 ? 197 MET A CA    1 
ATOM   1468 C C     . MET A 1 217 ? 49.623 -13.566 -34.137 1.00 29.76 ? 197 MET A C     1 
ATOM   1469 O O     . MET A 1 217 ? 48.917 -14.116 -34.972 1.00 36.85 ? 197 MET A O     1 
ATOM   1470 C CB    . MET A 1 217 ? 48.863 -11.247 -34.446 1.00 26.87 ? 197 MET A CB    1 
ATOM   1471 C CG    . MET A 1 217 ? 48.667 -9.864  -33.912 1.00 28.93 ? 197 MET A CG    1 
ATOM   1472 S SD    . MET A 1 217 ? 47.082 -9.669  -33.046 1.00 34.97 ? 197 MET A SD    1 
ATOM   1473 C CE    . MET A 1 217 ? 45.873 -10.159 -34.328 1.00 27.79 ? 197 MET A CE    1 
ATOM   1474 N N     . SER A 1 218 ? 50.852 -13.999 -33.834 1.00 31.74 ? 198 SER A N     1 
ATOM   1475 C CA    . SER A 1 218 ? 51.583 -15.049 -34.592 1.00 29.48 ? 198 SER A CA    1 
ATOM   1476 C C     . SER A 1 218 ? 51.052 -16.442 -34.305 1.00 32.47 ? 198 SER A C     1 
ATOM   1477 O O     . SER A 1 218 ? 51.258 -17.365 -35.100 1.00 40.65 ? 198 SER A O     1 
ATOM   1478 C CB    . SER A 1 218 ? 53.068 -15.049 -34.177 1.00 30.22 ? 198 SER A CB    1 
ATOM   1479 O OG    . SER A 1 218 ? 53.241 -15.543 -32.836 1.00 29.32 ? 198 SER A OG    1 
ATOM   1480 N N     . GLY A 1 219 ? 50.408 -16.620 -33.155 1.00 28.48 ? 199 GLY A N     1 
ATOM   1481 C CA    . GLY A 1 219 ? 49.947 -17.930 -32.740 1.00 27.13 ? 199 GLY A CA    1 
ATOM   1482 C C     . GLY A 1 219 ? 51.084 -18.822 -32.229 1.00 40.11 ? 199 GLY A C     1 
ATOM   1483 O O     . GLY A 1 219 ? 50.858 -20.003 -31.964 1.00 38.79 ? 199 GLY A O     1 
ATOM   1484 N N     . HIS A 1 220 ? 52.296 -18.268 -32.094 1.00 32.99 ? 200 HIS A N     1 
ATOM   1485 C CA    . HIS A 1 220 ? 53.471 -19.059 -31.660 1.00 32.06 ? 200 HIS A CA    1 
ATOM   1486 C C     . HIS A 1 220 ? 53.589 -19.020 -30.143 1.00 30.32 ? 200 HIS A C     1 
ATOM   1487 O O     . HIS A 1 220 ? 54.116 -18.056 -29.568 1.00 28.91 ? 200 HIS A O     1 
ATOM   1488 C CB    . HIS A 1 220 ? 54.738 -18.496 -32.319 1.00 29.03 ? 200 HIS A CB    1 
ATOM   1489 C CG    . HIS A 1 220 ? 55.939 -19.410 -32.255 1.00 53.05 ? 200 HIS A CG    1 
ATOM   1490 N ND1   . HIS A 1 220 ? 56.384 -20.002 -31.087 1.00 38.23 ? 200 HIS A ND1   1 
ATOM   1491 C CD2   . HIS A 1 220 ? 56.808 -19.803 -33.219 1.00 50.99 ? 200 HIS A CD2   1 
ATOM   1492 C CE1   . HIS A 1 220 ? 57.461 -20.727 -31.338 1.00 44.59 ? 200 HIS A CE1   1 
ATOM   1493 N NE2   . HIS A 1 220 ? 57.736 -20.630 -32.626 1.00 45.00 ? 200 HIS A NE2   1 
ATOM   1494 N N     . HIS A 1 221 ? 53.084 -20.050 -29.485 1.00 30.23 ? 201 HIS A N     1 
ATOM   1495 C CA    . HIS A 1 221 ? 53.027 -20.064 -28.034 1.00 33.19 ? 201 HIS A CA    1 
ATOM   1496 C C     . HIS A 1 221 ? 54.355 -19.786 -27.348 1.00 33.80 ? 201 HIS A C     1 
ATOM   1497 O O     . HIS A 1 221 ? 54.391 -19.032 -26.378 1.00 25.73 ? 201 HIS A O     1 
ATOM   1498 C CB    . HIS A 1 221 ? 52.420 -21.369 -27.547 1.00 39.37 ? 201 HIS A CB    1 
ATOM   1499 C CG    . HIS A 1 221 ? 50.992 -21.527 -27.967 1.00 47.12 ? 201 HIS A CG    1 
ATOM   1500 N ND1   . HIS A 1 221 ? 49.954 -20.890 -27.317 1.00 57.16 ? 201 HIS A ND1   1 
ATOM   1501 C CD2   . HIS A 1 221 ? 50.434 -22.184 -29.013 1.00 60.39 ? 201 HIS A CD2   1 
ATOM   1502 C CE1   . HIS A 1 221 ? 48.815 -21.173 -27.927 1.00 60.89 ? 201 HIS A CE1   1 
ATOM   1503 N NE2   . HIS A 1 221 ? 49.078 -21.958 -28.957 1.00 54.86 ? 201 HIS A NE2   1 
ATOM   1504 N N     . GLU A 1 222 ? 55.438 -20.361 -27.848 1.00 25.68 ? 202 GLU A N     1 
ATOM   1505 C CA    . GLU A 1 222 ? 56.723 -20.249 -27.178 1.00 25.73 ? 202 GLU A CA    1 
ATOM   1506 C C     . GLU A 1 222 ? 57.332 -18.853 -27.381 1.00 25.83 ? 202 GLU A C     1 
ATOM   1507 O O     . GLU A 1 222 ? 57.871 -18.245 -26.400 1.00 25.97 ? 202 GLU A O     1 
ATOM   1508 C CB    . GLU A 1 222 ? 57.642 -21.383 -27.647 1.00 32.25 ? 202 GLU A CB    1 
ATOM   1509 C CG    . GLU A 1 222 ? 59.041 -21.372 -27.140 1.00 41.74 ? 202 GLU A CG    1 
ATOM   1510 C CD    . GLU A 1 222 ? 59.188 -21.646 -25.634 1.00 32.33 ? 202 GLU A CD    1 
ATOM   1511 O OE1   . GLU A 1 222 ? 58.191 -21.848 -24.907 1.00 34.18 ? 202 GLU A OE1   1 
ATOM   1512 O OE2   . GLU A 1 222 ? 60.355 -21.606 -25.189 1.00 41.90 ? 202 GLU A OE2   1 
ATOM   1513 N N     . GLU A 1 223 ? 57.184 -18.302 -28.569 1.00 24.27 ? 203 GLU A N     1 
ATOM   1514 C CA    . GLU A 1 223 ? 57.598 -16.933 -28.836 1.00 25.12 ? 203 GLU A CA    1 
ATOM   1515 C C     . GLU A 1 223 ? 56.794 -15.982 -27.934 1.00 21.56 ? 203 GLU A C     1 
ATOM   1516 O O     . GLU A 1 223 ? 57.357 -15.012 -27.412 1.00 18.67 ? 203 GLU A O     1 
ATOM   1517 C CB    . GLU A 1 223 ? 57.412 -16.537 -30.301 1.00 27.17 ? 203 GLU A CB    1 
ATOM   1518 C CG    . GLU A 1 223 ? 58.537 -17.070 -31.248 1.00 39.17 ? 203 GLU A CG    1 
ATOM   1519 C CD    . GLU A 1 223 ? 59.926 -17.110 -30.590 1.00 56.32 ? 203 GLU A CD    1 
ATOM   1520 O OE1   . GLU A 1 223 ? 60.440 -16.044 -30.161 1.00 50.84 ? 203 GLU A OE1   1 
ATOM   1521 O OE2   . GLU A 1 223 ? 60.504 -18.221 -30.491 1.00 61.77 ? 203 GLU A OE2   1 
ATOM   1522 N N     . ILE A 1 224 ? 55.503 -16.244 -27.796 1.00 21.84 ? 204 ILE A N     1 
ATOM   1523 C CA    . ILE A 1 224 ? 54.650 -15.348 -26.980 1.00 19.39 ? 204 ILE A CA    1 
ATOM   1524 C C     . ILE A 1 224 ? 55.082 -15.411 -25.522 1.00 20.10 ? 204 ILE A C     1 
ATOM   1525 O O     . ILE A 1 224 ? 55.203 -14.365 -24.877 1.00 17.86 ? 204 ILE A O     1 
ATOM   1526 C CB    . ILE A 1 224 ? 53.184 -15.698 -27.160 1.00 19.66 ? 204 ILE A CB    1 
ATOM   1527 C CG1   . ILE A 1 224 ? 52.753 -15.279 -28.572 1.00 19.84 ? 204 ILE A CG1   1 
ATOM   1528 C CG2   . ILE A 1 224 ? 52.271 -15.049 -26.025 1.00 19.26 ? 204 ILE A CG2   1 
ATOM   1529 C CD1   . ILE A 1 224 ? 51.397 -15.871 -28.953 1.00 21.83 ? 204 ILE A CD1   1 
ATOM   1530 N N     . ARG A 1 225 ? 55.306 -16.615 -25.006 1.00 22.96 ? 205 ARG A N     1 
ATOM   1531 C CA    . ARG A 1 225 ? 55.751 -16.816 -23.631 1.00 19.93 ? 205 ARG A CA    1 
ATOM   1532 C C     . ARG A 1 225 ? 57.052 -16.012 -23.390 1.00 21.78 ? 205 ARG A C     1 
ATOM   1533 O O     . ARG A 1 225 ? 57.160 -15.275 -22.407 1.00 21.12 ? 205 ARG A O     1 
ATOM   1534 C CB    . ARG A 1 225 ? 56.020 -18.297 -23.362 1.00 26.42 ? 205 ARG A CB    1 
ATOM   1535 C CG    . ARG A 1 225 ? 56.373 -18.554 -21.929 1.00 29.03 ? 205 ARG A CG    1 
ATOM   1536 C CD    . ARG A 1 225 ? 56.894 -20.001 -21.722 1.00 25.08 ? 205 ARG A CD    1 
ATOM   1537 N NE    . ARG A 1 225 ? 58.135 -20.279 -22.429 1.00 27.22 ? 205 ARG A NE    1 
ATOM   1538 C CZ    . ARG A 1 225 ? 59.366 -19.946 -21.983 1.00 25.86 ? 205 ARG A CZ    1 
ATOM   1539 N NH1   . ARG A 1 225 ? 59.522 -19.307 -20.844 1.00 27.82 ? 205 ARG A NH1   1 
ATOM   1540 N NH2   . ARG A 1 225 ? 60.432 -20.258 -22.709 1.00 28.88 ? 205 ARG A NH2   1 
ATOM   1541 N N     . LYS A 1 226 ? 58.014 -16.146 -24.294 1.00 22.60 ? 206 LYS A N     1 
ATOM   1542 C CA    . LYS A 1 226 ? 59.272 -15.407 -24.146 1.00 18.46 ? 206 LYS A CA    1 
ATOM   1543 C C     . LYS A 1 226 ? 59.102 -13.879 -24.201 1.00 17.70 ? 206 LYS A C     1 
ATOM   1544 O O     . LYS A 1 226 ? 59.729 -13.139 -23.447 1.00 16.71 ? 206 LYS A O     1 
ATOM   1545 C CB    . LYS A 1 226 ? 60.295 -15.916 -25.181 1.00 21.67 ? 206 LYS A CB    1 
ATOM   1546 C CG    . LYS A 1 226 ? 60.743 -17.341 -24.761 1.00 25.95 ? 206 LYS A CG    1 
ATOM   1547 C CD    . LYS A 1 226 ? 61.939 -17.815 -25.526 1.00 30.68 ? 206 LYS A CD    1 
ATOM   1548 C CE    . LYS A 1 226 ? 61.631 -17.767 -26.995 1.00 40.59 ? 206 LYS A CE    1 
ATOM   1549 N NZ    . LYS A 1 226 ? 62.541 -18.593 -27.882 1.00 61.80 ? 206 LYS A NZ    1 
ATOM   1550 N N     . TRP A 1 227 ? 58.255 -13.438 -25.109 1.00 17.56 ? 207 TRP A N     1 
ATOM   1551 C CA    . TRP A 1 227 ? 58.009 -12.022 -25.213 1.00 17.19 ? 207 TRP A CA    1 
ATOM   1552 C C     . TRP A 1 227 ? 57.421 -11.465 -23.900 1.00 14.53 ? 207 TRP A C     1 
ATOM   1553 O O     . TRP A 1 227 ? 57.861 -10.422 -23.410 1.00 15.96 ? 207 TRP A O     1 
ATOM   1554 C CB    . TRP A 1 227 ? 57.025 -11.758 -26.402 1.00 18.82 ? 207 TRP A CB    1 
ATOM   1555 C CG    . TRP A 1 227 ? 56.636 -10.317 -26.563 1.00 18.10 ? 207 TRP A CG    1 
ATOM   1556 C CD1   . TRP A 1 227 ? 57.280 -9.394  -27.335 1.00 24.31 ? 207 TRP A CD1   1 
ATOM   1557 C CD2   . TRP A 1 227 ? 55.529 -9.617  -25.952 1.00 20.11 ? 207 TRP A CD2   1 
ATOM   1558 N NE1   . TRP A 1 227 ? 56.666 -8.163  -27.218 1.00 21.09 ? 207 TRP A NE1   1 
ATOM   1559 C CE2   . TRP A 1 227 ? 55.612 -8.279  -26.361 1.00 23.68 ? 207 TRP A CE2   1 
ATOM   1560 C CE3   . TRP A 1 227 ? 54.546 -9.984  -25.050 1.00 19.63 ? 207 TRP A CE3   1 
ATOM   1561 C CZ2   . TRP A 1 227 ? 54.681 -7.318  -25.973 1.00 23.50 ? 207 TRP A CZ2   1 
ATOM   1562 C CZ3   . TRP A 1 227 ? 53.601 -8.981  -24.654 1.00 22.20 ? 207 TRP A CZ3   1 
ATOM   1563 C CH2   . TRP A 1 227 ? 53.726 -7.701  -25.112 1.00 22.31 ? 207 TRP A CH2   1 
ATOM   1564 N N     . ARG A 1 228 ? 56.447 -12.178 -23.357 1.00 17.55 ? 208 ARG A N     1 
ATOM   1565 C CA    . ARG A 1 228 ? 55.790 -11.735 -22.128 1.00 16.18 ? 208 ARG A CA    1 
ATOM   1566 C C     . ARG A 1 228 ? 56.809 -11.693 -20.992 1.00 16.90 ? 208 ARG A C     1 
ATOM   1567 O O     . ARG A 1 228 ? 56.845 -10.725 -20.212 1.00 18.00 ? 208 ARG A O     1 
ATOM   1568 C CB    . ARG A 1 228 ? 54.617 -12.641 -21.777 1.00 19.40 ? 208 ARG A CB    1 
ATOM   1569 C CG    . ARG A 1 228 ? 53.447 -12.283 -22.732 1.00 20.08 ? 208 ARG A CG    1 
ATOM   1570 C CD    . ARG A 1 228 ? 52.228 -13.140 -22.468 1.00 23.59 ? 208 ARG A CD    1 
ATOM   1571 N NE    . ARG A 1 228 ? 51.055 -12.682 -23.314 1.00 21.74 ? 208 ARG A NE    1 
ATOM   1572 C CZ    . ARG A 1 228 ? 50.004 -13.469 -23.564 1.00 26.47 ? 208 ARG A CZ    1 
ATOM   1573 N NH1   . ARG A 1 228 ? 49.976 -14.735 -23.132 1.00 26.52 ? 208 ARG A NH1   1 
ATOM   1574 N NH2   . ARG A 1 228 ? 48.967 -13.008 -24.266 1.00 27.02 ? 208 ARG A NH2   1 
ATOM   1575 N N     . LEU A 1 229 ? 57.643 -12.737 -20.902 1.00 18.50 ? 209 LEU A N     1 
ATOM   1576 C CA    . LEU A 1 229 ? 58.626 -12.773 -19.843 1.00 17.35 ? 209 LEU A CA    1 
ATOM   1577 C C     . LEU A 1 229 ? 59.662 -11.649 -20.011 1.00 14.75 ? 209 LEU A C     1 
ATOM   1578 O O     . LEU A 1 229 ? 60.041 -10.962 -19.050 1.00 16.39 ? 209 LEU A O     1 
ATOM   1579 C CB    . LEU A 1 229 ? 59.305 -14.156 -19.847 1.00 18.38 ? 209 LEU A CB    1 
ATOM   1580 C CG    . LEU A 1 229 ? 60.354 -14.366 -18.766 1.00 22.83 ? 209 LEU A CG    1 
ATOM   1581 C CD1   . LEU A 1 229 ? 59.821 -13.942 -17.398 1.00 21.89 ? 209 LEU A CD1   1 
ATOM   1582 C CD2   . LEU A 1 229 ? 60.616 -15.823 -18.756 1.00 27.76 ? 209 LEU A CD2   1 
ATOM   1583 N N     . LYS A 1 230 ? 60.137 -11.446 -21.221 1.00 15.39 ? 210 LYS A N     1 
ATOM   1584 C CA    . LYS A 1 230 ? 61.091 -10.400 -21.478 1.00 14.03 ? 210 LYS A CA    1 
ATOM   1585 C C     . LYS A 1 230 ? 60.470 -9.011  -21.147 1.00 15.30 ? 210 LYS A C     1 
ATOM   1586 O O     . LYS A 1 230 ? 61.108 -8.112  -20.578 1.00 14.44 ? 210 LYS A O     1 
ATOM   1587 C CB    . LYS A 1 230 ? 61.500 -10.420 -22.956 1.00 15.34 ? 210 LYS A CB    1 
ATOM   1588 C CG    . LYS A 1 230 ? 62.489 -9.331  -23.341 1.00 15.87 ? 210 LYS A CG    1 
ATOM   1589 C CD    . LYS A 1 230 ? 62.959 -9.697  -24.765 1.00 21.61 ? 210 LYS A CD    1 
ATOM   1590 C CE    . LYS A 1 230 ? 63.847 -8.651  -25.321 1.00 22.72 ? 210 LYS A CE    1 
ATOM   1591 N NZ    . LYS A 1 230 ? 64.263 -9.140  -26.702 1.00 28.76 ? 210 LYS A NZ    1 
ATOM   1592 N N     . GLN A 1 231 ? 59.194 -8.838  -21.531 1.00 15.64 ? 211 GLN A N     1 
ATOM   1593 C CA    . GLN A 1 231 ? 58.522 -7.569  -21.175 1.00 17.37 ? 211 GLN A CA    1 
ATOM   1594 C C     . GLN A 1 231 ? 58.417 -7.345  -19.679 1.00 16.12 ? 211 GLN A C     1 
ATOM   1595 O O     . GLN A 1 231 ? 58.624 -6.239  -19.189 1.00 16.28 ? 211 GLN A O     1 
ATOM   1596 C CB    . GLN A 1 231 ? 57.100 -7.531  -21.782 1.00 16.23 ? 211 GLN A CB    1 
ATOM   1597 C CG    . GLN A 1 231 ? 57.061 -7.340  -23.245 1.00 17.90 ? 211 GLN A CG    1 
ATOM   1598 C CD    . GLN A 1 231 ? 57.392 -5.929  -23.613 1.00 25.96 ? 211 GLN A CD    1 
ATOM   1599 O OE1   . GLN A 1 231 ? 56.920 -4.981  -22.962 1.00 29.69 ? 211 GLN A OE1   1 
ATOM   1600 N NE2   . GLN A 1 231 ? 58.233 -5.768  -24.591 1.00 28.32 ? 211 GLN A NE2   1 
ATOM   1601 N N     . SER A 1 232 ? 58.114 -8.396  -18.941 1.00 15.36 ? 212 SER A N     1 
ATOM   1602 C CA    . SER A 1 232 ? 58.032 -8.311  -17.479 1.00 14.23 ? 212 SER A CA    1 
ATOM   1603 C C     . SER A 1 232 ? 59.371 -7.918  -16.894 1.00 15.29 ? 212 SER A C     1 
ATOM   1604 O O     . SER A 1 232 ? 59.458 -7.011  -16.072 1.00 16.94 ? 212 SER A O     1 
ATOM   1605 C CB    . SER A 1 232 ? 57.597 -9.603  -16.870 1.00 17.86 ? 212 SER A CB    1 
ATOM   1606 O OG    . SER A 1 232 ? 56.219 -9.746  -17.123 1.00 25.81 ? 212 SER A OG    1 
ATOM   1607 N N     . LEU A 1 233 ? 60.430 -8.508  -17.475 1.00 13.36 ? 213 LEU A N     1 
ATOM   1608 C CA    . LEU A 1 233 ? 61.775 -8.174  -17.003 1.00 14.45 ? 213 LEU A CA    1 
ATOM   1609 C C     . LEU A 1 233 ? 62.144 -6.755  -17.295 1.00 14.80 ? 213 LEU A C     1 
ATOM   1610 O O     . LEU A 1 233 ? 62.630 -6.045  -16.412 1.00 16.37 ? 213 LEU A O     1 
ATOM   1611 C CB    . LEU A 1 233 ? 62.817 -9.159  -17.572 1.00 15.46 ? 213 LEU A CB    1 
ATOM   1612 C CG    . LEU A 1 233 ? 62.698 -10.623 -17.004 1.00 15.44 ? 213 LEU A CG    1 
ATOM   1613 C CD1   . LEU A 1 233 ? 63.194 -11.678 -17.983 1.00 15.43 ? 213 LEU A CD1   1 
ATOM   1614 C CD2   . LEU A 1 233 ? 63.417 -10.775 -15.614 1.00 18.62 ? 213 LEU A CD2   1 
ATOM   1615 N N     . GLN A 1 234 ? 61.894 -6.337  -18.527 1.00 14.63 ? 214 GLN A N     1 
ATOM   1616 C CA    . GLN A 1 234 ? 62.180 -4.975  -18.957 1.00 15.96 ? 214 GLN A CA    1 
ATOM   1617 C C     . GLN A 1 234 ? 61.419 -3.944  -18.103 1.00 19.01 ? 214 GLN A C     1 
ATOM   1618 O O     . GLN A 1 234 ? 61.995 -2.976  -17.638 1.00 17.04 ? 214 GLN A O     1 
ATOM   1619 C CB    . GLN A 1 234 ? 61.778 -4.851  -20.433 1.00 17.96 ? 214 GLN A CB    1 
ATOM   1620 C CG    . GLN A 1 234 ? 62.045 -3.487  -20.879 1.00 22.48 ? 214 GLN A CG    1 
ATOM   1621 C CD    . GLN A 1 234 ? 61.816 -3.326  -22.346 1.00 30.67 ? 214 GLN A CD    1 
ATOM   1622 O OE1   . GLN A 1 234 ? 62.742 -3.457  -23.139 1.00 35.38 ? 214 GLN A OE1   1 
ATOM   1623 N NE2   . GLN A 1 234 ? 60.590 -3.057  -22.717 1.00 27.47 ? 214 GLN A NE2   1 
ATOM   1624 N N     . ARG A 1 235 ? 60.138 -4.202  -17.879 1.00 16.32 ? 215 ARG A N     1 
ATOM   1625 C CA    . ARG A 1 235 ? 59.329 -3.238  -17.146 1.00 15.31 ? 215 ARG A CA    1 
ATOM   1626 C C     . ARG A 1 235 ? 59.751 -3.168  -15.681 1.00 17.26 ? 215 ARG A C     1 
ATOM   1627 O O     . ARG A 1 235 ? 59.767 -2.074  -15.078 1.00 16.08 ? 215 ARG A O     1 
ATOM   1628 C CB    . ARG A 1 235 ? 57.824 -3.589  -17.266 1.00 18.70 ? 215 ARG A CB    1 
ATOM   1629 C CG    . ARG A 1 235 ? 57.299 -3.145  -18.604 1.00 21.42 ? 215 ARG A CG    1 
ATOM   1630 C CD    . ARG A 1 235 ? 56.104 -4.012  -19.041 1.00 29.56 ? 215 ARG A CD    1 
ATOM   1631 N NE    . ARG A 1 235 ? 54.861 -3.832  -18.283 1.00 30.69 ? 215 ARG A NE    1 
ATOM   1632 C CZ    . ARG A 1 235 ? 53.938 -2.885  -18.539 1.00 28.06 ? 215 ARG A CZ    1 
ATOM   1633 N NH1   . ARG A 1 235 ? 54.116 -1.976  -19.489 1.00 26.18 ? 215 ARG A NH1   1 
ATOM   1634 N NH2   . ARG A 1 235 ? 52.822 -2.858  -17.834 1.00 31.20 ? 215 ARG A NH2   1 
ATOM   1635 N N     . THR A 1 236 ? 60.049 -4.320  -15.079 1.00 15.99 ? 216 THR A N     1 
ATOM   1636 C CA    . THR A 1 236 ? 60.596 -4.299  -13.744 1.00 15.18 ? 216 THR A CA    1 
ATOM   1637 C C     . THR A 1 236 ? 61.913 -3.514  -13.660 1.00 20.86 ? 216 THR A C     1 
ATOM   1638 O O     . THR A 1 236 ? 62.128 -2.671  -12.764 1.00 21.10 ? 216 THR A O     1 
ATOM   1639 C CB    . THR A 1 236 ? 60.781 -5.698  -13.218 1.00 14.97 ? 216 THR A CB    1 
ATOM   1640 O OG1   . THR A 1 236 ? 59.561 -6.403  -13.394 1.00 17.55 ? 216 THR A OG1   1 
ATOM   1641 C CG2   . THR A 1 236 ? 61.129 -5.671  -11.684 1.00 17.31 ? 216 THR A CG2   1 
ATOM   1642 N N     . TRP A 1 237 ? 62.803 -3.774  -14.602 1.00 17.83 ? 217 TRP A N     1 
ATOM   1643 C CA    . TRP A 1 237 ? 64.086 -3.098  -14.599 1.00 18.97 ? 217 TRP A CA    1 
ATOM   1644 C C     . TRP A 1 237 ? 63.956 -1.579  -14.724 1.00 21.04 ? 217 TRP A C     1 
ATOM   1645 O O     . TRP A 1 237 ? 64.615 -0.805  -13.992 1.00 22.21 ? 217 TRP A O     1 
ATOM   1646 C CB    . TRP A 1 237 ? 64.968 -3.702  -15.722 1.00 17.98 ? 217 TRP A CB    1 
ATOM   1647 C CG    . TRP A 1 237 ? 66.253 -2.921  -16.009 1.00 19.24 ? 217 TRP A CG    1 
ATOM   1648 C CD1   . TRP A 1 237 ? 67.280 -2.601  -15.125 1.00 24.10 ? 217 TRP A CD1   1 
ATOM   1649 C CD2   . TRP A 1 237 ? 66.580 -2.299  -17.252 1.00 23.08 ? 217 TRP A CD2   1 
ATOM   1650 N NE1   . TRP A 1 237 ? 68.222 -1.830  -15.793 1.00 24.91 ? 217 TRP A NE1   1 
ATOM   1651 C CE2   . TRP A 1 237 ? 67.810 -1.630  -17.082 1.00 26.41 ? 217 TRP A CE2   1 
ATOM   1652 C CE3   . TRP A 1 237 ? 65.939 -2.257  -18.494 1.00 22.23 ? 217 TRP A CE3   1 
ATOM   1653 C CZ2   . TRP A 1 237 ? 68.450 -0.970  -18.139 1.00 22.83 ? 217 TRP A CZ2   1 
ATOM   1654 C CZ3   . TRP A 1 237 ? 66.561 -1.602  -19.539 1.00 26.16 ? 217 TRP A CZ3   1 
ATOM   1655 C CH2   . TRP A 1 237 ? 67.779 -0.921  -19.325 1.00 20.80 ? 217 TRP A CH2   1 
ATOM   1656 N N     . LEU A 1 238 ? 63.101 -1.147  -15.632 1.00 19.81 ? 218 LEU A N     1 
ATOM   1657 C CA    . LEU A 1 238 ? 62.923 0.283   -15.881 1.00 18.62 ? 218 LEU A CA    1 
ATOM   1658 C C     . LEU A 1 238 ? 62.156 1.005   -14.759 1.00 21.83 ? 218 LEU A C     1 
ATOM   1659 O O     . LEU A 1 238 ? 62.515 2.115   -14.392 1.00 26.33 ? 218 LEU A O     1 
ATOM   1660 C CB    . LEU A 1 238 ? 62.202 0.534   -17.210 1.00 18.69 ? 218 LEU A CB    1 
ATOM   1661 C CG    . LEU A 1 238 ? 62.928 0.113   -18.510 1.00 21.53 ? 218 LEU A CG    1 
ATOM   1662 C CD1   . LEU A 1 238 ? 62.062 0.241   -19.743 1.00 26.77 ? 218 LEU A CD1   1 
ATOM   1663 C CD2   . LEU A 1 238 ? 64.179 0.978   -18.667 1.00 25.72 ? 218 LEU A CD2   1 
ATOM   1664 N N     . ARG A 1 239 ? 61.120 0.370   -14.224 1.00 19.01 ? 219 ARG A N     1 
ATOM   1665 C CA    . ARG A 1 239 ? 60.227 1.055   -13.272 1.00 20.30 ? 219 ARG A CA    1 
ATOM   1666 C C     . ARG A 1 239 ? 60.567 0.812   -11.834 1.00 23.70 ? 219 ARG A C     1 
ATOM   1667 O O     . ARG A 1 239 ? 60.343 1.691   -11.006 1.00 21.60 ? 219 ARG A O     1 
ATOM   1668 C CB    . ARG A 1 239 ? 58.785 0.555   -13.469 1.00 20.89 ? 219 ARG A CB    1 
ATOM   1669 C CG    . ARG A 1 239 ? 58.198 1.031   -14.790 1.00 24.78 ? 219 ARG A CG    1 
ATOM   1670 C CD    . ARG A 1 239 ? 56.808 0.454   -14.993 1.00 20.42 ? 219 ARG A CD    1 
ATOM   1671 N NE    . ARG A 1 239 ? 56.406 0.690   -16.379 1.00 23.40 ? 219 ARG A NE    1 
ATOM   1672 C CZ    . ARG A 1 239 ? 55.141 0.915   -16.725 1.00 20.29 ? 219 ARG A CZ    1 
ATOM   1673 N NH1   . ARG A 1 239 ? 54.222 0.906   -15.759 1.00 20.44 ? 219 ARG A NH1   1 
ATOM   1674 N NH2   . ARG A 1 239 ? 54.809 1.141   -17.995 1.00 22.00 ? 219 ARG A NH2   1 
ATOM   1675 N N     . ARG A 1 240 ? 60.990 -0.408  -11.503 1.00 20.46 ? 220 ARG A N     1 
ATOM   1676 C CA    . ARG A 1 240 ? 61.214 -0.866  -10.135 1.00 23.68 ? 220 ARG A CA    1 
ATOM   1677 C C     . ARG A 1 240 ? 62.492 -1.712  -10.032 1.00 21.29 ? 220 ARG A C     1 
ATOM   1678 O O     . ARG A 1 240 ? 62.448 -2.894  -9.735  1.00 22.43 ? 220 ARG A O     1 
ATOM   1679 C CB    . ARG A 1 240 ? 60.003 -1.706  -9.645  1.00 22.25 ? 220 ARG A CB    1 
ATOM   1680 C CG    . ARG A 1 240 ? 58.679 -0.991  -9.706  1.00 23.80 ? 220 ARG A CG    1 
ATOM   1681 C CD    . ARG A 1 240 ? 58.560 0.122   -8.655  1.00 22.07 ? 220 ARG A CD    1 
ATOM   1682 N NE    . ARG A 1 240 ? 58.867 -0.442  -7.350  1.00 24.93 ? 220 ARG A NE    1 
ATOM   1683 C CZ    . ARG A 1 240 ? 58.015 -1.124  -6.582  1.00 22.27 ? 220 ARG A CZ    1 
ATOM   1684 N NH1   . ARG A 1 240 ? 56.751 -1.331  -6.980  1.00 20.34 ? 220 ARG A NH1   1 
ATOM   1685 N NH2   . ARG A 1 240 ? 58.430 -1.615  -5.408  1.00 23.44 ? 220 ARG A NH2   1 
ATOM   1686 N N     . PRO A 1 241 ? 63.648 -1.106  -10.343 1.00 23.13 ? 221 PRO A N     1 
ATOM   1687 C CA    . PRO A 1 241 ? 64.870 -1.896  -10.449 1.00 22.34 ? 221 PRO A CA    1 
ATOM   1688 C C     . PRO A 1 241 ? 65.257 -2.507  -9.116  1.00 22.66 ? 221 PRO A C     1 
ATOM   1689 O O     . PRO A 1 241 ? 65.955 -3.535  -9.080  1.00 23.24 ? 221 PRO A O     1 
ATOM   1690 C CB    . PRO A 1 241 ? 65.913 -0.873  -10.942 1.00 23.91 ? 221 PRO A CB    1 
ATOM   1691 C CG    . PRO A 1 241 ? 65.364 0.443   -10.598 1.00 20.78 ? 221 PRO A CG    1 
ATOM   1692 C CD    . PRO A 1 241 ? 63.845 0.259   -10.849 1.00 22.08 ? 221 PRO A CD    1 
ATOM   1693 N N     . GLU A 1 242 ? 64.750 -1.943  -8.027  1.00 23.32 ? 222 GLU A N     1 
ATOM   1694 C CA    . GLU A 1 242 ? 65.085 -2.486  -6.722  1.00 27.36 ? 222 GLU A CA    1 
ATOM   1695 C C     . GLU A 1 242 ? 64.453 -3.862  -6.542  1.00 34.07 ? 222 GLU A C     1 
ATOM   1696 O O     . GLU A 1 242 ? 64.985 -4.718  -5.826  1.00 31.58 ? 222 GLU A O     1 
ATOM   1697 C CB    . GLU A 1 242 ? 64.695 -1.535  -5.582  1.00 24.39 ? 222 GLU A CB    1 
ATOM   1698 C CG    . GLU A 1 242 ? 63.181 -1.504  -5.296  1.00 34.81 ? 222 GLU A CG    1 
ATOM   1699 C CD    . GLU A 1 242 ? 62.387 -0.578  -6.232  1.00 28.12 ? 222 GLU A CD    1 
ATOM   1700 O OE1   . GLU A 1 242 ? 62.912 -0.091  -7.279  1.00 31.60 ? 222 GLU A OE1   1 
ATOM   1701 O OE2   . GLU A 1 242 ? 61.235 -0.285  -5.859  1.00 38.17 ? 222 GLU A OE2   1 
ATOM   1702 N N     . LEU A 1 243 ? 63.326 -4.099  -7.214  1.00 24.24 ? 223 LEU A N     1 
ATOM   1703 C CA    . LEU A 1 243 ? 62.683 -5.416  -7.129  1.00 25.39 ? 223 LEU A CA    1 
ATOM   1704 C C     . LEU A 1 243 ? 63.546 -6.537  -7.743  1.00 30.40 ? 223 LEU A C     1 
ATOM   1705 O O     . LEU A 1 243 ? 63.470 -7.708  -7.358  1.00 25.41 ? 223 LEU A O     1 
ATOM   1706 C CB    . LEU A 1 243 ? 61.279 -5.396  -7.767  1.00 24.41 ? 223 LEU A CB    1 
ATOM   1707 C CG    . LEU A 1 243 ? 60.200 -4.523  -7.084  1.00 25.06 ? 223 LEU A CG    1 
ATOM   1708 C CD1   . LEU A 1 243 ? 58.900 -4.574  -7.901  1.00 29.23 ? 223 LEU A CD1   1 
ATOM   1709 C CD2   . LEU A 1 243 ? 59.975 -4.941  -5.624  1.00 27.23 ? 223 LEU A CD2   1 
ATOM   1710 N N     . LEU A 1 244 ? 64.378 -6.197  -8.714  1.00 24.98 ? 224 LEU A N     1 
ATOM   1711 C CA    . LEU A 1 244 ? 65.194 -7.225  -9.353  1.00 31.59 ? 224 LEU A CA    1 
ATOM   1712 C C     . LEU A 1 244 ? 66.351 -7.664  -8.479  1.00 40.65 ? 224 LEU A C     1 
ATOM   1713 O O     . LEU A 1 244 ? 66.814 -8.792  -8.587  1.00 48.48 ? 224 LEU A O     1 
ATOM   1714 C CB    . LEU A 1 244 ? 65.769 -6.713  -10.667 1.00 46.46 ? 224 LEU A CB    1 
ATOM   1715 C CG    . LEU A 1 244 ? 64.825 -6.630  -11.849 1.00 26.97 ? 224 LEU A CG    1 
ATOM   1716 C CD1   . LEU A 1 244 ? 65.613 -6.039  -13.017 1.00 33.02 ? 224 LEU A CD1   1 
ATOM   1717 C CD2   . LEU A 1 244 ? 64.367 -7.986  -12.245 1.00 28.55 ? 224 LEU A CD2   1 
ATOM   1718 N N     . GLU A 1 245 ? 66.834 -6.764  -7.634  1.00 36.00 ? 225 GLU A N     1 
ATOM   1719 C CA    . GLU A 1 245 ? 67.882 -7.092  -6.671  1.00 45.94 ? 225 GLU A CA    1 
ATOM   1720 C C     . GLU A 1 245 ? 67.519 -8.338  -5.849  1.00 45.66 ? 225 GLU A C     1 
ATOM   1721 O O     . GLU A 1 245 ? 68.387 -9.114  -5.447  1.00 41.30 ? 225 GLU A O     1 
ATOM   1722 C CB    . GLU A 1 245 ? 68.104 -5.928  -5.689  1.00 45.05 ? 225 GLU A CB    1 
ATOM   1723 C CG    . GLU A 1 245 ? 68.362 -4.555  -6.309  1.00 55.54 ? 225 GLU A CG    1 
ATOM   1724 C CD    . GLU A 1 245 ? 69.573 -4.547  -7.222  1.00 65.64 ? 225 GLU A CD    1 
ATOM   1725 O OE1   . GLU A 1 245 ? 70.357 -5.527  -7.181  1.00 67.36 ? 225 GLU A OE1   1 
ATOM   1726 O OE2   . GLU A 1 245 ? 69.733 -3.560  -7.980  1.00 65.90 ? 225 GLU A OE2   1 
ATOM   1727 N N     . GLY A 1 246 ? 66.224 -8.498  -5.589  1.00 42.37 ? 226 GLY A N     1 
ATOM   1728 C CA    . GLY A 1 246 ? 65.744 -9.485  -4.648  1.00 41.91 ? 226 GLY A CA    1 
ATOM   1729 C C     . GLY A 1 246 ? 65.585 -10.850 -5.286  1.00 47.48 ? 226 GLY A C     1 
ATOM   1730 O O     . GLY A 1 246 ? 65.109 -11.809 -4.655  1.00 44.67 ? 226 GLY A O     1 
ATOM   1731 N N     . LEU A 1 247 ? 65.950 -10.951 -6.557  1.00 36.14 ? 227 LEU A N     1 
ATOM   1732 C CA    . LEU A 1 247 ? 65.533 -12.116 -7.284  1.00 29.96 ? 227 LEU A CA    1 
ATOM   1733 C C     . LEU A 1 247 ? 66.684 -12.942 -7.690  1.00 22.17 ? 227 LEU A C     1 
ATOM   1734 O O     . LEU A 1 247 ? 67.727 -12.412 -8.076  1.00 31.69 ? 227 LEU A O     1 
ATOM   1735 C CB    . LEU A 1 247 ? 64.673 -11.745 -8.532  1.00 32.84 ? 227 LEU A CB    1 
ATOM   1736 C CG    . LEU A 1 247 ? 63.369 -11.019 -8.261  1.00 28.96 ? 227 LEU A CG    1 
ATOM   1737 C CD1   . LEU A 1 247 ? 62.747 -10.810 -9.626  1.00 26.79 ? 227 LEU A CD1   1 
ATOM   1738 C CD2   . LEU A 1 247 ? 62.407 -11.787 -7.352  1.00 31.06 ? 227 LEU A CD2   1 
ATOM   1739 N N     . ALA A 1 248 ? 66.443 -14.271 -7.697  1.00 23.42 ? 228 ALA A N     1 
ATOM   1740 C CA    . ALA A 1 248 ? 67.376 -15.216 -8.251  1.00 25.75 ? 228 ALA A CA    1 
ATOM   1741 C C     . ALA A 1 248 ? 66.844 -15.560 -9.642  1.00 21.72 ? 228 ALA A C     1 
ATOM   1742 O O     . ALA A 1 248 ? 66.020 -16.467 -9.819  1.00 25.32 ? 228 ALA A O     1 
ATOM   1743 C CB    . ALA A 1 248 ? 67.455 -16.470 -7.355  1.00 24.79 ? 228 ALA A CB    1 
ATOM   1744 N N     . LEU A 1 249 ? 67.298 -14.800 -10.638 1.00 21.82 ? 229 LEU A N     1 
ATOM   1745 C CA    . LEU A 1 249 ? 66.830 -15.044 -12.012 1.00 21.34 ? 229 LEU A CA    1 
ATOM   1746 C C     . LEU A 1 249 ? 67.216 -16.430 -12.558 1.00 19.29 ? 229 LEU A C     1 
ATOM   1747 O O     . LEU A 1 249 ? 68.359 -16.925 -12.364 1.00 23.01 ? 229 LEU A O     1 
ATOM   1748 C CB    . LEU A 1 249 ? 67.339 -13.963 -12.959 1.00 20.80 ? 229 LEU A CB    1 
ATOM   1749 C CG    . LEU A 1 249 ? 66.911 -12.528 -12.551 1.00 26.47 ? 229 LEU A CG    1 
ATOM   1750 C CD1   . LEU A 1 249 ? 67.460 -11.472 -13.560 1.00 26.35 ? 229 LEU A CD1   1 
ATOM   1751 C CD2   . LEU A 1 249 ? 65.396 -12.382 -12.422 1.00 24.33 ? 229 LEU A CD2   1 
ATOM   1752 N N     . THR A 1 250 ? 66.343 -17.021 -13.347 1.00 17.63 ? 230 THR A N     1 
ATOM   1753 C CA    . THR A 1 250 ? 66.698 -18.228 -14.076 1.00 18.02 ? 230 THR A CA    1 
ATOM   1754 C C     . THR A 1 250 ? 67.636 -17.909 -15.196 1.00 19.98 ? 230 THR A C     1 
ATOM   1755 O O     . THR A 1 250 ? 67.817 -16.712 -15.578 1.00 17.31 ? 230 THR A O     1 
ATOM   1756 C CB    . THR A 1 250 ? 65.469 -18.930 -14.676 1.00 21.47 ? 230 THR A CB    1 
ATOM   1757 O OG1   . THR A 1 250 ? 64.891 -18.095 -15.706 1.00 22.99 ? 230 THR A OG1   1 
ATOM   1758 C CG2   . THR A 1 250 ? 64.386 -19.181 -13.568 1.00 21.09 ? 230 THR A CG2   1 
ATOM   1759 N N     . ASP A 1 251 ? 68.242 -18.914 -15.790 1.00 19.23 ? 231 ASP A N     1 
ATOM   1760 C CA    . ASP A 1 251 ? 69.167 -18.595 -16.904 1.00 17.25 ? 231 ASP A CA    1 
ATOM   1761 C C     . ASP A 1 251 ? 68.410 -17.862 -18.059 1.00 19.18 ? 231 ASP A C     1 
ATOM   1762 O O     . ASP A 1 251 ? 68.917 -16.918 -18.670 1.00 19.93 ? 231 ASP A O     1 
ATOM   1763 C CB    . ASP A 1 251 ? 69.843 -19.823 -17.497 1.00 21.33 ? 231 ASP A CB    1 
ATOM   1764 C CG    . ASP A 1 251 ? 70.893 -20.465 -16.540 1.00 25.12 ? 231 ASP A CG    1 
ATOM   1765 O OD1   . ASP A 1 251 ? 71.253 -19.839 -15.524 1.00 25.42 ? 231 ASP A OD1   1 
ATOM   1766 O OD2   . ASP A 1 251 ? 71.396 -21.573 -16.937 1.00 25.35 ? 231 ASP A OD2   1 
ATOM   1767 N N     . GLU A 1 252 ? 67.203 -18.351 -18.347 1.00 18.40 ? 232 GLU A N     1 
ATOM   1768 C CA    . GLU A 1 252 ? 66.391 -17.742 -19.416 1.00 17.35 ? 232 GLU A CA    1 
ATOM   1769 C C     . GLU A 1 252 ? 66.084 -16.306 -19.063 1.00 16.54 ? 232 GLU A C     1 
ATOM   1770 O O     . GLU A 1 252 ? 66.150 -15.435 -19.923 1.00 19.53 ? 232 GLU A O     1 
ATOM   1771 C CB    . GLU A 1 252 ? 65.096 -18.502 -19.592 1.00 22.98 ? 232 GLU A CB    1 
ATOM   1772 C CG    . GLU A 1 252 ? 64.184 -17.826 -20.629 1.00 20.30 ? 232 GLU A CG    1 
ATOM   1773 C CD    . GLU A 1 252 ? 62.996 -18.706 -20.918 1.00 20.44 ? 232 GLU A CD    1 
ATOM   1774 O OE1   . GLU A 1 252 ? 62.308 -19.037 -19.940 1.00 25.01 ? 232 GLU A OE1   1 
ATOM   1775 O OE2   . GLU A 1 252 ? 62.822 -19.063 -22.109 1.00 30.90 ? 232 GLU A OE2   1 
ATOM   1776 N N     . GLN A 1 253 ? 65.691 -16.061 -17.801 1.00 17.34 ? 233 GLN A N     1 
ATOM   1777 C CA    . GLN A 1 253 ? 65.388 -14.679 -17.392 1.00 16.18 ? 233 GLN A CA    1 
ATOM   1778 C C     . GLN A 1 253 ? 66.614 -13.800 -17.495 1.00 19.14 ? 233 GLN A C     1 
ATOM   1779 O O     . GLN A 1 253 ? 66.538 -12.667 -17.923 1.00 19.06 ? 233 GLN A O     1 
ATOM   1780 C CB    . GLN A 1 253 ? 64.843 -14.613 -15.966 1.00 17.47 ? 233 GLN A CB    1 
ATOM   1781 C CG    . GLN A 1 253 ? 63.409 -15.226 -15.824 1.00 19.70 ? 233 GLN A CG    1 
ATOM   1782 C CD    . GLN A 1 253 ? 63.037 -15.423 -14.359 1.00 23.38 ? 233 GLN A CD    1 
ATOM   1783 O OE1   . GLN A 1 253 ? 63.886 -15.583 -13.486 1.00 20.22 ? 233 GLN A OE1   1 
ATOM   1784 N NE2   . GLN A 1 253 ? 61.751 -15.402 -14.086 1.00 30.04 ? 233 GLN A NE2   1 
ATOM   1785 N N     . ARG A 1 254 ? 67.798 -14.307 -17.142 1.00 19.17 ? 234 ARG A N     1 
ATOM   1786 C CA    . ARG A 1 254 ? 69.012 -13.487 -17.261 1.00 19.31 ? 234 ARG A CA    1 
ATOM   1787 C C     . ARG A 1 254 ? 69.264 -13.100 -18.716 1.00 19.72 ? 234 ARG A C     1 
ATOM   1788 O O     . ARG A 1 254 ? 69.637 -11.969 -19.024 1.00 20.21 ? 234 ARG A O     1 
ATOM   1789 C CB    . ARG A 1 254 ? 70.232 -14.279 -16.721 1.00 19.99 ? 234 ARG A CB    1 
ATOM   1790 C CG    . ARG A 1 254 ? 70.197 -14.430 -15.273 1.00 23.03 ? 234 ARG A CG    1 
ATOM   1791 C CD    . ARG A 1 254 ? 71.601 -14.991 -14.718 1.00 31.85 ? 234 ARG A CD    1 
ATOM   1792 N NE    . ARG A 1 254 ? 71.883 -16.360 -15.179 1.00 38.96 ? 234 ARG A NE    1 
ATOM   1793 C CZ    . ARG A 1 254 ? 72.794 -16.668 -16.120 1.00 51.70 ? 234 ARG A CZ    1 
ATOM   1794 N NH1   . ARG A 1 254 ? 72.999 -17.934 -16.488 1.00 41.11 ? 234 ARG A NH1   1 
ATOM   1795 N NH2   . ARG A 1 254 ? 73.514 -15.707 -16.693 1.00 55.99 ? 234 ARG A NH2   1 
ATOM   1796 N N     . LYS A 1 255 ? 69.113 -14.060 -19.615 1.00 18.65 ? 235 LYS A N     1 
ATOM   1797 C CA    . LYS A 1 255 ? 69.275 -13.836 -21.036 1.00 18.35 ? 235 LYS A CA    1 
ATOM   1798 C C     . LYS A 1 255 ? 68.276 -12.778 -21.598 1.00 20.00 ? 235 LYS A C     1 
ATOM   1799 O O     . LYS A 1 255 ? 68.683 -11.855 -22.261 1.00 19.07 ? 235 LYS A O     1 
ATOM   1800 C CB    . LYS A 1 255 ? 69.092 -15.149 -21.796 1.00 18.31 ? 235 LYS A CB    1 
ATOM   1801 C CG    . LYS A 1 255 ? 69.069 -14.958 -23.255 1.00 19.82 ? 235 LYS A CG    1 
ATOM   1802 C CD    . LYS A 1 255 ? 68.817 -16.286 -23.952 1.00 22.49 ? 235 LYS A CD    1 
ATOM   1803 C CE    . LYS A 1 255 ? 67.557 -17.001 -23.500 1.00 36.20 ? 235 LYS A CE    1 
ATOM   1804 N NZ    . LYS A 1 255 ? 67.397 -18.238 -24.329 1.00 42.83 ? 235 LYS A NZ    1 
ATOM   1805 N N     . LEU A 1 256 ? 67.005 -12.957 -21.270 1.00 18.84 ? 236 LEU A N     1 
ATOM   1806 C CA    . LEU A 1 256 ? 65.987 -12.053 -21.801 1.00 18.83 ? 236 LEU A CA    1 
ATOM   1807 C C     . LEU A 1 256 ? 66.154 -10.678 -21.218 1.00 17.35 ? 236 LEU A C     1 
ATOM   1808 O O     . LEU A 1 256 ? 65.956 -9.673  -21.965 1.00 16.84 ? 236 LEU A O     1 
ATOM   1809 C CB    . LEU A 1 256 ? 64.578 -12.621 -21.565 1.00 16.39 ? 236 LEU A CB    1 
ATOM   1810 C CG    . LEU A 1 256 ? 64.146 -13.897 -22.285 1.00 16.13 ? 236 LEU A CG    1 
ATOM   1811 C CD1   . LEU A 1 256 ? 62.896 -14.457 -21.788 1.00 18.00 ? 236 LEU A CD1   1 
ATOM   1812 C CD2   . LEU A 1 256 ? 64.107 -13.716 -23.815 1.00 21.73 ? 236 LEU A CD2   1 
ATOM   1813 N N     . LEU A 1 257 ? 66.513 -10.562 -19.947 1.00 15.53 ? 237 LEU A N     1 
ATOM   1814 C CA    . LEU A 1 257 ? 66.817 -9.275  -19.353 1.00 16.10 ? 237 LEU A CA    1 
ATOM   1815 C C     . LEU A 1 257 ? 68.013 -8.617  -20.059 1.00 21.65 ? 237 LEU A C     1 
ATOM   1816 O O     . LEU A 1 257 ? 67.975 -7.404  -20.345 1.00 19.64 ? 237 LEU A O     1 
ATOM   1817 C CB    . LEU A 1 257 ? 67.073 -9.353  -17.856 1.00 17.60 ? 237 LEU A CB    1 
ATOM   1818 C CG    . LEU A 1 257 ? 67.508 -8.049  -17.203 1.00 18.24 ? 237 LEU A CG    1 
ATOM   1819 C CD1   . LEU A 1 257 ? 66.398 -6.974  -17.285 1.00 17.66 ? 237 LEU A CD1   1 
ATOM   1820 C CD2   . LEU A 1 257 ? 67.872 -8.271  -15.703 1.00 19.96 ? 237 LEU A CD2   1 
ATOM   1821 N N     . LYS A 1 258 ? 69.070 -9.407  -20.340 1.00 19.21 ? 238 LYS A N     1 
ATOM   1822 C CA    . LYS A 1 258 ? 70.228 -8.832  -21.044 1.00 18.48 ? 238 LYS A CA    1 
ATOM   1823 C C     . LYS A 1 258 ? 69.827 -8.364  -22.416 1.00 21.58 ? 238 LYS A C     1 
ATOM   1824 O O     . LYS A 1 258 ? 70.286 -7.292  -22.854 1.00 23.83 ? 238 LYS A O     1 
ATOM   1825 C CB    . LYS A 1 258 ? 71.369 -9.873  -21.144 1.00 21.75 ? 238 LYS A CB    1 
ATOM   1826 C CG    . LYS A 1 258 ? 72.121 -9.988  -19.862 1.00 26.00 ? 238 LYS A CG    1 
ATOM   1827 C CD    . LYS A 1 258 ? 73.093 -11.201 -20.005 1.00 33.42 ? 238 LYS A CD    1 
ATOM   1828 C CE    . LYS A 1 258 ? 73.811 -11.475 -18.702 1.00 33.07 ? 238 LYS A CE    1 
ATOM   1829 N NZ    . LYS A 1 258 ? 74.652 -12.710 -18.837 1.00 42.99 ? 238 LYS A NZ    1 
ATOM   1830 N N     . GLU A 1 259 ? 68.984 -9.121  -23.104 1.00 19.70 ? 239 GLU A N     1 
ATOM   1831 C CA    . GLU A 1 259 ? 68.533 -8.689  -24.458 1.00 18.31 ? 239 GLU A CA    1 
ATOM   1832 C C     . GLU A 1 259 ? 67.772 -7.381  -24.358 1.00 25.00 ? 239 GLU A C     1 
ATOM   1833 O O     . GLU A 1 259 ? 67.962 -6.502  -25.171 1.00 24.73 ? 239 GLU A O     1 
ATOM   1834 C CB    . GLU A 1 259 ? 67.651 -9.746  -25.130 1.00 22.06 ? 239 GLU A CB    1 
ATOM   1835 C CG    . GLU A 1 259 ? 68.322 -11.088 -25.527 1.00 28.69 ? 239 GLU A CG    1 
ATOM   1836 C CD    . GLU A 1 259 ? 67.302 -12.012 -26.233 1.00 31.97 ? 239 GLU A CD    1 
ATOM   1837 O OE1   . GLU A 1 259 ? 66.163 -11.555 -26.573 1.00 36.96 ? 239 GLU A OE1   1 
ATOM   1838 O OE2   . GLU A 1 259 ? 67.626 -13.196 -26.467 1.00 46.42 ? 239 GLU A OE2   1 
ATOM   1839 N N     . ALA A 1 260 ? 66.906 -7.254  -23.365 1.00 20.28 ? 240 ALA A N     1 
ATOM   1840 C CA    . ALA A 1 260 ? 66.121 -6.030  -23.247 1.00 21.66 ? 240 ALA A CA    1 
ATOM   1841 C C     . ALA A 1 260 ? 66.993 -4.840  -22.928 1.00 24.08 ? 240 ALA A C     1 
ATOM   1842 O O     . ALA A 1 260 ? 66.754 -3.736  -23.463 1.00 23.32 ? 240 ALA A O     1 
ATOM   1843 C CB    . ALA A 1 260 ? 64.993 -6.211  -22.195 1.00 16.69 ? 240 ALA A CB    1 
ATOM   1844 N N     . GLN A 1 261 ? 68.004 -5.040  -22.098 1.00 18.34 ? 241 GLN A N     1 
ATOM   1845 C CA    . GLN A 1 261 ? 68.920 -3.973  -21.707 1.00 23.44 ? 241 GLN A CA    1 
ATOM   1846 C C     . GLN A 1 261 ? 69.774 -3.558  -22.941 1.00 24.43 ? 241 GLN A C     1 
ATOM   1847 O O     . GLN A 1 261 ? 70.051 -2.399  -23.145 1.00 29.05 ? 241 GLN A O     1 
ATOM   1848 C CB    . GLN A 1 261 ? 69.795 -4.413  -20.518 1.00 24.26 ? 241 GLN A CB    1 
ATOM   1849 C CG    . GLN A 1 261 ? 68.990 -4.548  -19.198 1.00 20.57 ? 241 GLN A CG    1 
ATOM   1850 C CD    . GLN A 1 261 ? 69.779 -5.143  -18.046 1.00 20.75 ? 241 GLN A CD    1 
ATOM   1851 O OE1   . GLN A 1 261 ? 70.716 -5.912  -18.268 1.00 26.64 ? 241 GLN A OE1   1 
ATOM   1852 N NE2   . GLN A 1 261 ? 69.404 -4.813  -16.809 1.00 22.40 ? 241 GLN A NE2   1 
ATOM   1853 N N     . ALA A 1 262 ? 70.161 -4.515  -23.774 1.00 22.50 ? 242 ALA A N     1 
ATOM   1854 C CA    . ALA A 1 262 ? 70.922 -4.163  -24.987 1.00 25.10 ? 242 ALA A CA    1 
ATOM   1855 C C     . ALA A 1 262 ? 70.032 -3.394  -25.954 1.00 30.53 ? 242 ALA A C     1 
ATOM   1856 O O     . ALA A 1 262 ? 70.505 -2.507  -26.681 1.00 28.37 ? 242 ALA A O     1 
ATOM   1857 C CB    . ALA A 1 262 ? 71.419 -5.390  -25.663 1.00 24.20 ? 242 ALA A CB    1 
ATOM   1858 N N     . GLU A 1 263 ? 68.752 -3.738  -26.012 1.00 23.08 ? 243 GLU A N     1 
ATOM   1859 C CA    . GLU A 1 263 ? 67.906 -3.031  -26.920 1.00 25.13 ? 243 GLU A CA    1 
ATOM   1860 C C     . GLU A 1 263 ? 67.720 -1.594  -26.451 1.00 31.93 ? 243 GLU A C     1 
ATOM   1861 O O     . GLU A 1 263 ? 67.597 -0.659  -27.267 1.00 28.03 ? 243 GLU A O     1 
ATOM   1862 C CB    . GLU A 1 263 ? 66.577 -3.736  -27.101 1.00 24.92 ? 243 GLU A CB    1 
ATOM   1863 C CG    . GLU A 1 263 ? 66.776 -5.147  -27.651 1.00 32.09 ? 243 GLU A CG    1 
ATOM   1864 C CD    . GLU A 1 263 ? 65.505 -5.981  -27.621 1.00 38.65 ? 243 GLU A CD    1 
ATOM   1865 O OE1   . GLU A 1 263 ? 64.419 -5.421  -27.400 1.00 35.31 ? 243 GLU A OE1   1 
ATOM   1866 O OE2   . GLU A 1 263 ? 65.601 -7.204  -27.815 1.00 32.28 ? 243 GLU A OE2   1 
ATOM   1867 N N     . HIS A 1 264 ? 67.719 -1.410  -25.141 1.00 34.63 ? 244 HIS A N     1 
ATOM   1868 C CA    . HIS A 1 264 ? 67.589 -0.089  -24.554 1.00 33.20 ? 244 HIS A CA    1 
ATOM   1869 C C     . HIS A 1 264 ? 68.815 0.778   -24.854 1.00 33.58 ? 244 HIS A C     1 
ATOM   1870 O O     . HIS A 1 264 ? 68.660 1.986   -25.022 1.00 46.07 ? 244 HIS A O     1 
ATOM   1871 C CB    . HIS A 1 264 ? 67.402 -0.228  -23.033 1.00 29.85 ? 244 HIS A CB    1 
ATOM   1872 C CG    . HIS A 1 264 ? 66.716 0.945   -22.421 1.00 37.28 ? 244 HIS A CG    1 
ATOM   1873 N ND1   . HIS A 1 264 ? 65.370 1.178   -22.598 1.00 37.39 ? 244 HIS A ND1   1 
ATOM   1874 C CD2   . HIS A 1 264 ? 67.190 1.971   -21.676 1.00 44.51 ? 244 HIS A CD2   1 
ATOM   1875 C CE1   . HIS A 1 264 ? 65.041 2.302   -21.981 1.00 43.10 ? 244 HIS A CE1   1 
ATOM   1876 N NE2   . HIS A 1 264 ? 66.126 2.799   -21.411 1.00 49.30 ? 244 HIS A NE2   1 
ATOM   1877 N N     . ASN A 1 265 ? 70.015 0.161   -24.924 1.00 35.75 ? 245 ASN A N     1 
ATOM   1878 C CA    . ASN A 1 265 ? 71.333 0.811   -25.159 1.00 38.28 ? 245 ASN A CA    1 
ATOM   1879 C C     . ASN A 1 265 ? 71.707 1.011   -26.658 1.00 30.49 ? 245 ASN A C     1 
ATOM   1880 O O     . ASN A 1 265 ? 72.901 1.352   -27.045 1.00 27.99 ? 245 ASN A O     1 
ATOM   1881 C CB    . ASN A 1 265 ? 72.445 0.009   -24.468 1.00 40.18 ? 245 ASN A CB    1 
ATOM   1882 C CG    . ASN A 1 265 ? 72.305 -0.005  -22.923 1.00 46.03 ? 245 ASN A CG    1 
ATOM   1883 O OD1   . ASN A 1 265 ? 71.754 0.925   -22.307 1.00 41.90 ? 245 ASN A OD1   1 
ATOM   1884 N ND2   . ASN A 1 265 ? 72.809 -1.070  -22.302 1.00 56.34 ? 245 ASN A ND2   1 
ATOM   1885 N N     . SER A 1 266 ? 70.699 0.723   -27.479 1.00 37.49 ? 246 SER A N     1 
ATOM   1886 C CA    . SER A 1 266 ? 70.818 0.683   -28.945 1.00 26.02 ? 246 SER A CA    1 
ATOM   1887 C C     . SER A 1 266 ? 70.066 1.811   -29.577 1.00 39.97 ? 246 SER A C     1 
ATOM   1888 O O     . SER A 1 266 ? 70.196 2.018   -30.796 1.00 34.40 ? 246 SER A O     1 
ATOM   1889 C CB    . SER A 1 266 ? 70.290 -0.664  -29.480 1.00 29.13 ? 246 SER A CB    1 
ATOM   1890 O OG    . SER A 1 266 ? 71.207 -1.680  -29.076 1.00 41.17 ? 246 SER A OG    1 
ATOM   1891 O OXT   . SER A 1 266 ? 69.352 2.507   -28.854 1.00 36.98 ? 246 SER A OXT   1 
HETATM 1892 N N     . SAM B 2 .   ? 47.834 9.390   14.127  1.00 41.05 ? 301 SAM A N     1 
HETATM 1893 C CA    . SAM B 2 .   ? 47.443 8.015   13.807  1.00 25.53 ? 301 SAM A CA    1 
HETATM 1894 C C     . SAM B 2 .   ? 48.595 7.140   13.231  1.00 48.35 ? 301 SAM A C     1 
HETATM 1895 O O     . SAM B 2 .   ? 48.710 5.912   13.474  1.00 32.99 ? 301 SAM A O     1 
HETATM 1896 O OXT   . SAM B 2 .   ? 49.434 7.635   12.452  1.00 38.48 ? 301 SAM A OXT   1 
HETATM 1897 C CB    . SAM B 2 .   ? 46.382 8.031   12.686  1.00 31.53 ? 301 SAM A CB    1 
HETATM 1898 C CG    . SAM B 2 .   ? 45.195 7.073   12.874  1.00 16.89 ? 301 SAM A CG    1 
HETATM 1899 S SD    . SAM B 2 .   ? 44.432 6.932   11.257  1.00 15.92 ? 301 SAM A SD    1 
HETATM 1900 C CE    . SAM B 2 .   ? 43.785 8.610   11.223  1.00 39.87 ? 301 SAM A CE    1 
HETATM 1901 C "C5'" . SAM B 2 .   ? 42.873 6.074   11.692  1.00 16.64 ? 301 SAM A "C5'" 1 
HETATM 1902 C "C4'" . SAM B 2 .   ? 42.819 4.548   11.609  1.00 14.60 ? 301 SAM A "C4'" 1 
HETATM 1903 O "O4'" . SAM B 2 .   ? 43.151 4.161   10.270  1.00 14.28 ? 301 SAM A "O4'" 1 
HETATM 1904 C "C3'" . SAM B 2 .   ? 43.879 4.036   12.539  1.00 16.84 ? 301 SAM A "C3'" 1 
HETATM 1905 O "O3'" . SAM B 2 .   ? 43.388 3.018   13.363  1.00 19.06 ? 301 SAM A "O3'" 1 
HETATM 1906 C "C2'" . SAM B 2 .   ? 44.881 3.418   11.632  1.00 19.43 ? 301 SAM A "C2'" 1 
HETATM 1907 O "O2'" . SAM B 2 .   ? 45.814 2.435   12.241  1.00 20.68 ? 301 SAM A "O2'" 1 
HETATM 1908 C "C1'" . SAM B 2 .   ? 44.112 3.148   10.280  1.00 18.71 ? 301 SAM A "C1'" 1 
HETATM 1909 N N9    . SAM B 2 .   ? 45.063 3.404   9.172   1.00 15.01 ? 301 SAM A N9    1 
HETATM 1910 C C8    . SAM B 2 .   ? 45.436 4.634   8.645   1.00 14.34 ? 301 SAM A C8    1 
HETATM 1911 N N7    . SAM B 2 .   ? 46.310 4.389   7.661   1.00 13.34 ? 301 SAM A N7    1 
HETATM 1912 C C5    . SAM B 2 .   ? 46.521 3.040   7.543   1.00 10.40 ? 301 SAM A C5    1 
HETATM 1913 C C6    . SAM B 2 .   ? 47.375 2.323   6.729   1.00 13.58 ? 301 SAM A C6    1 
HETATM 1914 N N6    . SAM B 2 .   ? 48.211 2.913   5.835   1.00 13.92 ? 301 SAM A N6    1 
HETATM 1915 N N1    . SAM B 2 .   ? 47.374 0.976   6.875   1.00 11.50 ? 301 SAM A N1    1 
HETATM 1916 C C2    . SAM B 2 .   ? 46.535 0.405   7.796   1.00 11.22 ? 301 SAM A C2    1 
HETATM 1917 N N3    . SAM B 2 .   ? 45.687 1.109   8.631   1.00 12.62 ? 301 SAM A N3    1 
HETATM 1918 C C4    . SAM B 2 .   ? 45.729 2.433   8.513   1.00 11.76 ? 301 SAM A C4    1 
HETATM 1919 O O     . HOH C 3 .   ? 48.887 -12.761 -7.795  1.00 35.90 ? 401 HOH A O     1 
HETATM 1920 O O     . HOH C 3 .   ? 64.474 -2.719  -24.361 1.00 40.76 ? 402 HOH A O     1 
HETATM 1921 O O     . HOH C 3 .   ? 39.537 -16.802 18.878  1.00 41.69 ? 403 HOH A O     1 
HETATM 1922 O O     . HOH C 3 .   ? 41.418 8.832   34.251  1.00 31.16 ? 404 HOH A O     1 
HETATM 1923 O O     . HOH C 3 .   ? 49.782 1.293   15.739  1.00 28.15 ? 405 HOH A O     1 
HETATM 1924 O O     . HOH C 3 .   ? 42.551 9.571   -27.306 1.00 34.51 ? 406 HOH A O     1 
HETATM 1925 O O     . HOH C 3 .   ? 69.454 4.251   -27.134 1.00 41.58 ? 407 HOH A O     1 
HETATM 1926 O O     . HOH C 3 .   ? 28.479 -7.149  3.746   1.00 37.21 ? 408 HOH A O     1 
HETATM 1927 O O     . HOH C 3 .   ? 24.485 0.419   3.430   1.00 28.86 ? 409 HOH A O     1 
HETATM 1928 O O     . HOH C 3 .   ? 25.251 -7.124  2.011   1.00 36.54 ? 410 HOH A O     1 
HETATM 1929 O O     . HOH C 3 .   ? 49.768 -11.661 -16.927 1.00 40.72 ? 411 HOH A O     1 
HETATM 1930 O O     . HOH C 3 .   ? 41.663 15.681  22.265  1.00 30.28 ? 412 HOH A O     1 
HETATM 1931 O O     . HOH C 3 .   ? 67.157 -7.930  -29.658 0.50 39.83 ? 413 HOH A O     1 
HETATM 1932 O O     . HOH C 3 .   ? 68.929 3.917   -31.897 1.00 31.29 ? 414 HOH A O     1 
HETATM 1933 O O     . HOH C 3 .   ? 38.230 -23.816 -0.035  1.00 54.28 ? 415 HOH A O     1 
HETATM 1934 O O     . HOH C 3 .   ? 42.709 -0.057  11.988  1.00 25.76 ? 416 HOH A O     1 
HETATM 1935 O O     . HOH C 3 .   ? 52.474 -4.477  17.448  1.00 43.09 ? 417 HOH A O     1 
HETATM 1936 O O     . HOH C 3 .   ? 68.353 -10.086 -10.190 1.00 41.22 ? 418 HOH A O     1 
HETATM 1937 O O     . HOH C 3 .   ? 44.447 -17.693 12.342  1.00 34.10 ? 419 HOH A O     1 
HETATM 1938 O O     . HOH C 3 .   ? 46.893 9.424   -29.581 1.00 38.75 ? 420 HOH A O     1 
HETATM 1939 O O     . HOH C 3 .   ? 28.858 3.465   14.299  1.00 32.05 ? 421 HOH A O     1 
HETATM 1940 O O     . HOH C 3 .   ? 35.748 11.956  17.473  1.00 33.09 ? 422 HOH A O     1 
HETATM 1941 O O     . HOH C 3 .   ? 26.258 -17.671 1.153   1.00 44.31 ? 423 HOH A O     1 
HETATM 1942 O O     . HOH C 3 .   ? 63.589 -16.334 -10.738 1.00 26.45 ? 424 HOH A O     1 
HETATM 1943 O O     . HOH C 3 .   ? 31.992 -9.036  24.509  1.00 33.86 ? 425 HOH A O     1 
HETATM 1944 O O     . HOH C 3 .   ? 27.656 -12.431 13.147  1.00 45.39 ? 426 HOH A O     1 
HETATM 1945 O O     . HOH C 3 .   ? 42.286 -6.049  26.883  1.00 22.51 ? 427 HOH A O     1 
HETATM 1946 O O     . HOH C 3 .   ? 69.470 -23.268 -17.400 1.00 28.20 ? 428 HOH A O     1 
HETATM 1947 O O     . HOH C 3 .   ? 54.408 -3.811  -25.534 1.00 37.64 ? 429 HOH A O     1 
HETATM 1948 O O     . HOH C 3 .   ? 40.788 1.303   -34.817 1.00 28.00 ? 430 HOH A O     1 
HETATM 1949 O O     . HOH C 3 .   ? 26.032 -3.645  13.785  1.00 42.53 ? 431 HOH A O     1 
HETATM 1950 O O     . HOH C 3 .   ? 53.152 1.847   6.841   1.00 22.98 ? 432 HOH A O     1 
HETATM 1951 O O     . HOH C 3 .   ? 52.122 -0.759  18.547  1.00 30.24 ? 433 HOH A O     1 
HETATM 1952 O O     . HOH C 3 .   ? 24.345 -1.257  14.848  1.00 37.80 ? 434 HOH A O     1 
HETATM 1953 O O     . HOH C 3 .   ? 58.141 4.880   2.395   1.00 33.66 ? 435 HOH A O     1 
HETATM 1954 O O     . HOH C 3 .   ? 44.761 -11.829 20.630  1.00 36.58 ? 436 HOH A O     1 
HETATM 1955 O O     . HOH C 3 .   ? 37.809 11.115  28.941  1.00 30.11 ? 437 HOH A O     1 
HETATM 1956 O O     . HOH C 3 .   ? 41.084 2.298   22.221  1.00 14.28 ? 438 HOH A O     1 
HETATM 1957 O O     . HOH C 3 .   ? 27.653 0.775   8.801   1.00 21.09 ? 439 HOH A O     1 
HETATM 1958 O O     . HOH C 3 .   ? 40.543 -23.497 1.436   1.00 50.92 ? 440 HOH A O     1 
HETATM 1959 O O     . HOH C 3 .   ? 73.007 -5.784  -19.604 1.00 32.96 ? 441 HOH A O     1 
HETATM 1960 O O     . HOH C 3 .   ? 52.988 -11.907 -15.723 1.00 40.06 ? 442 HOH A O     1 
HETATM 1961 O O     . HOH C 3 .   ? 31.431 11.137  20.400  1.00 35.64 ? 443 HOH A O     1 
HETATM 1962 O O     . HOH C 3 .   ? 31.069 -5.135  29.269  1.00 25.25 ? 444 HOH A O     1 
HETATM 1963 O O     . HOH C 3 .   ? 50.328 -13.035 19.714  1.00 39.64 ? 445 HOH A O     1 
HETATM 1964 O O     . HOH C 3 .   ? 42.740 14.920  25.759  1.00 42.47 ? 446 HOH A O     1 
HETATM 1965 O O     . HOH C 3 .   ? 34.750 -15.669 -7.101  1.00 25.17 ? 447 HOH A O     1 
HETATM 1966 O O     . HOH C 3 .   ? 71.553 -7.951  -16.763 1.00 33.31 ? 448 HOH A O     1 
HETATM 1967 O O     . HOH C 3 .   ? 48.563 -15.463 -31.404 1.00 28.43 ? 449 HOH A O     1 
HETATM 1968 O O     . HOH C 3 .   ? 43.455 -18.752 19.108  1.00 49.54 ? 450 HOH A O     1 
HETATM 1969 O O     . HOH C 3 .   ? 33.406 13.348  20.002  1.00 27.84 ? 451 HOH A O     1 
HETATM 1970 O O     . HOH C 3 .   ? 38.208 -4.588  -26.925 1.00 13.45 ? 452 HOH A O     1 
HETATM 1971 O O     . HOH C 3 .   ? 23.134 2.616   25.103  1.00 29.59 ? 453 HOH A O     1 
HETATM 1972 O O     . HOH C 3 .   ? 36.069 1.408   12.989  1.00 13.99 ? 454 HOH A O     1 
HETATM 1973 O O     . HOH C 3 .   ? 52.143 -13.432 15.369  1.00 39.92 ? 455 HOH A O     1 
HETATM 1974 O O     . HOH C 3 .   ? 50.206 -5.075  -17.365 1.00 30.36 ? 456 HOH A O     1 
HETATM 1975 O O     . HOH C 3 .   ? 27.201 -7.015  14.114  1.00 32.73 ? 457 HOH A O     1 
HETATM 1976 O O     . HOH C 3 .   ? 57.029 -5.638  4.507   1.00 35.64 ? 458 HOH A O     1 
HETATM 1977 O O     . HOH C 3 .   ? 29.785 -16.262 2.966   1.00 25.35 ? 459 HOH A O     1 
HETATM 1978 O O     . HOH C 3 .   ? 70.615 -18.035 -13.480 1.00 27.81 ? 460 HOH A O     1 
HETATM 1979 O O     . HOH C 3 .   ? 46.594 3.310   16.770  1.00 24.80 ? 461 HOH A O     1 
HETATM 1980 O O     . HOH C 3 .   ? 41.326 -11.519 24.854  1.00 29.60 ? 462 HOH A O     1 
HETATM 1981 O O     . HOH C 3 .   ? 30.031 4.457   25.752  1.00 13.54 ? 463 HOH A O     1 
HETATM 1982 O O     . HOH C 3 .   ? 73.604 -3.591  -22.932 1.00 45.92 ? 464 HOH A O     1 
HETATM 1983 O O     . HOH C 3 .   ? 72.766 -6.341  -22.273 1.00 27.62 ? 465 HOH A O     1 
HETATM 1984 O O     . HOH C 3 .   ? 29.196 -18.685 4.422   1.00 42.99 ? 466 HOH A O     1 
HETATM 1985 O O     . HOH C 3 .   ? 47.662 5.563   15.970  1.00 37.53 ? 467 HOH A O     1 
HETATM 1986 O O     . HOH C 3 .   ? 29.603 2.173   27.172  1.00 13.34 ? 468 HOH A O     1 
HETATM 1987 O O     . HOH C 3 .   ? 27.817 8.969   19.823  1.00 29.30 ? 469 HOH A O     1 
HETATM 1988 O O     . HOH C 3 .   ? 49.784 18.288  25.739  1.00 31.81 ? 470 HOH A O     1 
HETATM 1989 O O     . HOH C 3 .   ? 51.400 -0.372  -29.856 1.00 34.20 ? 471 HOH A O     1 
HETATM 1990 O O     . HOH C 3 .   ? 44.264 3.899   -35.964 1.00 30.49 ? 472 HOH A O     1 
HETATM 1991 O O     . HOH C 3 .   ? 44.407 -14.586 18.958  1.00 36.21 ? 473 HOH A O     1 
HETATM 1992 O O     . HOH C 3 .   ? 43.363 -9.989  -9.543  1.00 30.34 ? 474 HOH A O     1 
HETATM 1993 O O     . HOH C 3 .   ? 34.609 -8.143  27.427  1.00 22.68 ? 475 HOH A O     1 
HETATM 1994 O O     . HOH C 3 .   ? 27.865 -5.613  16.353  1.00 18.66 ? 476 HOH A O     1 
HETATM 1995 O O     . HOH C 3 .   ? 34.888 -19.798 21.511  1.00 39.24 ? 477 HOH A O     1 
HETATM 1996 O O     . HOH C 3 .   ? 41.305 -18.246 -6.535  1.00 32.78 ? 478 HOH A O     1 
HETATM 1997 O O     . HOH C 3 .   ? 64.881 -19.279 -23.949 1.00 41.76 ? 479 HOH A O     1 
HETATM 1998 O O     . HOH C 3 .   ? 36.201 8.362   6.241   1.00 13.93 ? 480 HOH A O     1 
HETATM 1999 O O     . HOH C 3 .   ? 51.710 0.556   27.519  1.00 35.69 ? 481 HOH A O     1 
HETATM 2000 O O     . HOH C 3 .   ? 29.802 -14.000 4.788   1.00 30.07 ? 482 HOH A O     1 
HETATM 2001 O O     . HOH C 3 .   ? 57.021 -10.019 3.042   1.00 34.02 ? 483 HOH A O     1 
HETATM 2002 O O     . HOH C 3 .   ? 37.563 -5.403  -4.327  1.00 18.57 ? 484 HOH A O     1 
HETATM 2003 O O     . HOH C 3 .   ? 55.226 0.758   9.443   1.00 24.93 ? 485 HOH A O     1 
HETATM 2004 O O     . HOH C 3 .   ? 70.087 -17.050 -10.213 1.00 37.53 ? 486 HOH A O     1 
HETATM 2005 O O     . HOH C 3 .   ? 41.661 10.399  28.936  1.00 34.85 ? 487 HOH A O     1 
HETATM 2006 O O     . HOH C 3 .   ? 50.850 -13.502 9.583   1.00 32.25 ? 488 HOH A O     1 
HETATM 2007 O O     . HOH C 3 .   ? 29.445 -5.418  26.528  1.00 27.39 ? 489 HOH A O     1 
HETATM 2008 O O     . HOH C 3 .   ? 53.676 -2.506  -0.487  1.00 20.00 ? 490 HOH A O     1 
HETATM 2009 O O     . HOH C 3 .   ? 42.516 -11.026 21.334  1.00 30.86 ? 491 HOH A O     1 
HETATM 2010 O O     . HOH C 3 .   ? 54.469 -7.945  4.028   1.00 20.95 ? 492 HOH A O     1 
HETATM 2011 O O     . HOH C 3 .   ? 38.378 8.766   11.482  1.00 22.70 ? 493 HOH A O     1 
HETATM 2012 O O     . HOH C 3 .   ? 25.582 9.706   26.550  1.00 30.71 ? 494 HOH A O     1 
HETATM 2013 O O     . HOH C 3 .   ? 60.634 -8.731  -6.567  1.00 35.46 ? 495 HOH A O     1 
HETATM 2014 O O     . HOH C 3 .   ? 30.811 -18.787 15.292  1.00 46.98 ? 496 HOH A O     1 
HETATM 2015 O O     . HOH C 3 .   ? 46.682 11.215  3.960   1.00 15.85 ? 497 HOH A O     1 
HETATM 2016 O O     . HOH C 3 .   ? 47.817 9.477   24.643  1.00 19.41 ? 498 HOH A O     1 
HETATM 2017 O O     . HOH C 3 .   ? 55.938 -15.753 -19.956 1.00 28.81 ? 499 HOH A O     1 
HETATM 2018 O O     . HOH C 3 .   ? 62.609 -18.771 -17.143 1.00 30.29 ? 500 HOH A O     1 
HETATM 2019 O O     . HOH C 3 .   ? 23.608 0.586   23.412  1.00 28.97 ? 501 HOH A O     1 
HETATM 2020 O O     . HOH C 3 .   ? 70.546 -5.581  -14.390 1.00 37.83 ? 502 HOH A O     1 
HETATM 2021 O O     . HOH C 3 .   ? 57.101 -12.814 -15.300 1.00 41.22 ? 503 HOH A O     1 
HETATM 2022 O O     . HOH C 3 .   ? 27.092 -10.959 -0.022  1.00 40.51 ? 504 HOH A O     1 
HETATM 2023 O O     . HOH C 3 .   ? 50.171 -9.907  -23.300 1.00 20.63 ? 505 HOH A O     1 
HETATM 2024 O O     . HOH C 3 .   ? 20.131 5.147   23.949  1.00 37.85 ? 506 HOH A O     1 
HETATM 2025 O O     . HOH C 3 .   ? 49.644 -12.781 -14.845 1.00 46.53 ? 507 HOH A O     1 
HETATM 2026 O O     . HOH C 3 .   ? 59.612 -13.747 -28.478 1.00 27.11 ? 508 HOH A O     1 
HETATM 2027 O O     . HOH C 3 .   ? 72.930 -14.616 -19.948 1.00 27.42 ? 509 HOH A O     1 
HETATM 2028 O O     . HOH C 3 .   ? 51.878 -16.636 -22.355 1.00 30.01 ? 510 HOH A O     1 
HETATM 2029 O O     . HOH C 3 .   ? 23.249 -0.312  18.836  1.00 41.28 ? 511 HOH A O     1 
HETATM 2030 O O     . HOH C 3 .   ? 52.238 -11.561 18.615  1.00 51.11 ? 512 HOH A O     1 
HETATM 2031 O O     . HOH C 3 .   ? 62.403 -6.833  -28.763 1.00 33.61 ? 513 HOH A O     1 
HETATM 2032 O O     . HOH C 3 .   ? 25.529 -2.782  24.556  1.00 18.41 ? 514 HOH A O     1 
HETATM 2033 O O     . HOH C 3 .   ? 45.588 13.904  30.293  1.00 25.13 ? 515 HOH A O     1 
HETATM 2034 O O     . HOH C 3 .   ? 49.944 -6.827  -35.494 1.00 37.75 ? 516 HOH A O     1 
HETATM 2035 O O     . HOH C 3 .   ? 39.151 3.246   5.604   1.00 14.53 ? 517 HOH A O     1 
HETATM 2036 O O     . HOH C 3 .   ? 36.619 -13.784 24.004  1.00 24.39 ? 518 HOH A O     1 
HETATM 2037 O O     . HOH C 3 .   ? 29.192 -8.335  -8.909  1.00 26.27 ? 519 HOH A O     1 
HETATM 2038 O O     . HOH C 3 .   ? 55.958 -2.652  12.119  1.00 32.71 ? 520 HOH A O     1 
HETATM 2039 O O     . HOH C 3 .   ? 66.492 1.265   -14.390 1.00 35.96 ? 521 HOH A O     1 
HETATM 2040 O O     . HOH C 3 .   ? 44.560 -21.491 10.270  1.00 43.59 ? 522 HOH A O     1 
HETATM 2041 O O     . HOH C 3 .   ? 25.497 -6.450  -5.955  1.00 41.81 ? 523 HOH A O     1 
HETATM 2042 O O     . HOH C 3 .   ? 30.629 -14.485 20.048  1.00 27.21 ? 524 HOH A O     1 
HETATM 2043 O O     . HOH C 3 .   ? 56.440 2.532   0.334   1.00 31.62 ? 525 HOH A O     1 
HETATM 2044 O O     . HOH C 3 .   ? 29.350 11.175  25.604  1.00 36.58 ? 526 HOH A O     1 
HETATM 2045 O O     . HOH C 3 .   ? 73.669 -2.964  -29.658 1.00 46.84 ? 527 HOH A O     1 
HETATM 2046 O O     . HOH C 3 .   ? 24.231 -4.717  -4.061  1.00 42.20 ? 528 HOH A O     1 
HETATM 2047 O O     . HOH C 3 .   ? 51.237 -17.896 7.937   1.00 39.35 ? 529 HOH A O     1 
HETATM 2048 O O     . HOH C 3 .   ? 58.260 0.371   -18.514 1.00 27.61 ? 530 HOH A O     1 
HETATM 2049 O O     . HOH C 3 .   ? 68.068 -21.466 -14.523 1.00 27.58 ? 531 HOH A O     1 
HETATM 2050 O O     . HOH C 3 .   ? 27.816 2.413   10.938  1.00 27.50 ? 532 HOH A O     1 
HETATM 2051 O O     . HOH C 3 .   ? 43.493 -19.696 11.424  1.00 38.09 ? 533 HOH A O     1 
HETATM 2052 O O     . HOH C 3 .   ? 35.191 11.089  26.338  1.00 32.33 ? 534 HOH A O     1 
HETATM 2053 O O     . HOH C 3 .   ? 36.405 2.775   27.973  1.00 13.17 ? 535 HOH A O     1 
HETATM 2054 O O     . HOH C 3 .   ? 38.897 -9.403  31.372  1.00 34.32 ? 536 HOH A O     1 
HETATM 2055 O O     . HOH C 3 .   ? 41.308 -15.118 18.605  1.00 35.04 ? 537 HOH A O     1 
HETATM 2056 O O     . HOH C 3 .   ? 29.629 -11.221 -7.696  1.00 38.72 ? 538 HOH A O     1 
HETATM 2057 O O     . HOH C 3 .   ? 48.599 -9.855  22.179  1.00 36.66 ? 539 HOH A O     1 
HETATM 2058 O O     . HOH C 3 .   ? 34.159 7.892   26.299  1.00 16.31 ? 540 HOH A O     1 
HETATM 2059 O O     . HOH C 3 .   ? 53.074 -7.821  11.805  1.00 27.96 ? 541 HOH A O     1 
HETATM 2060 O O     . HOH C 3 .   ? 28.929 0.545   1.322   1.00 17.39 ? 542 HOH A O     1 
HETATM 2061 O O     . HOH C 3 .   ? 63.757 -12.937 -27.368 1.00 34.64 ? 543 HOH A O     1 
HETATM 2062 O O     . HOH C 3 .   ? 38.481 18.944  30.449  1.00 47.65 ? 544 HOH A O     1 
HETATM 2063 O O     . HOH C 3 .   ? 26.274 -1.745  12.817  1.00 26.04 ? 545 HOH A O     1 
HETATM 2064 O O     . HOH C 3 .   ? 40.745 -5.412  -35.243 1.00 24.90 ? 546 HOH A O     1 
HETATM 2065 O O     . HOH C 3 .   ? 33.574 11.323  23.825  1.00 21.85 ? 547 HOH A O     1 
HETATM 2066 O O     . HOH C 3 .   ? 50.109 -15.683 9.264   1.00 35.12 ? 548 HOH A O     1 
HETATM 2067 O O     . HOH C 3 .   ? 40.807 9.318   11.370  1.00 34.12 ? 549 HOH A O     1 
HETATM 2068 O O     . HOH C 3 .   ? 35.194 2.174   20.585  1.00 14.50 ? 550 HOH A O     1 
HETATM 2069 O O     . HOH C 3 .   ? 27.747 -12.098 17.936  1.00 34.23 ? 551 HOH A O     1 
HETATM 2070 O O     . HOH C 3 .   ? 71.983 -21.450 -13.223 1.00 38.80 ? 552 HOH A O     1 
HETATM 2071 O O     . HOH C 3 .   ? 28.207 -5.000  5.544   1.00 27.14 ? 553 HOH A O     1 
HETATM 2072 O O     . HOH C 3 .   ? 48.433 -3.599  -20.356 1.00 20.93 ? 554 HOH A O     1 
HETATM 2073 O O     . HOH C 3 .   ? 70.562 -10.532 -16.655 1.00 28.64 ? 555 HOH A O     1 
HETATM 2074 O O     . HOH C 3 .   ? 71.741 -16.916 -19.420 1.00 30.75 ? 556 HOH A O     1 
HETATM 2075 O O     . HOH C 3 .   ? 26.305 -1.486  -1.646  1.00 23.15 ? 557 HOH A O     1 
HETATM 2076 O O     . HOH C 3 .   ? 24.410 7.769   18.947  1.00 39.05 ? 558 HOH A O     1 
HETATM 2077 O O     . HOH C 3 .   ? 68.316 -19.734 -21.991 1.00 39.93 ? 559 HOH A O     1 
HETATM 2078 O O     . HOH C 3 .   ? 54.758 -12.146 -17.984 1.00 34.15 ? 560 HOH A O     1 
HETATM 2079 O O     . HOH C 3 .   ? 34.668 -5.929  -4.948  1.00 17.64 ? 561 HOH A O     1 
HETATM 2080 O O     . HOH C 3 .   ? 23.856 7.445   29.683  1.00 25.83 ? 562 HOH A O     1 
HETATM 2081 O O     . HOH C 3 .   ? 35.795 8.893   10.488  1.00 21.30 ? 563 HOH A O     1 
HETATM 2082 O O     . HOH C 3 .   ? 69.672 -13.094 -10.271 1.00 30.53 ? 564 HOH A O     1 
HETATM 2083 O O     . HOH C 3 .   ? 40.767 -23.668 4.920   1.00 47.41 ? 565 HOH A O     1 
HETATM 2084 O O     . HOH C 3 .   ? 30.828 8.667   19.905  1.00 18.87 ? 566 HOH A O     1 
HETATM 2085 O O     . HOH C 3 .   ? 52.459 -0.376  0.194   0.50 16.88 ? 567 HOH A O     1 
HETATM 2086 O O     . HOH C 3 .   ? 40.353 12.117  16.066  1.00 24.12 ? 568 HOH A O     1 
HETATM 2087 O O     . HOH C 3 .   ? 52.255 -18.409 -24.409 1.00 28.72 ? 569 HOH A O     1 
HETATM 2088 O O     . HOH C 3 .   ? 41.292 4.357   -32.946 1.00 34.00 ? 570 HOH A O     1 
HETATM 2089 O O     . HOH C 3 .   ? 55.426 -22.797 -29.554 1.00 38.88 ? 571 HOH A O     1 
HETATM 2090 O O     . HOH C 3 .   ? 57.387 -3.353  7.278   1.00 25.54 ? 572 HOH A O     1 
HETATM 2091 O O     . HOH C 3 .   ? 53.021 -6.660  14.955  1.00 29.58 ? 573 HOH A O     1 
HETATM 2092 O O     . HOH C 3 .   ? 38.144 -21.541 8.155   1.00 48.53 ? 574 HOH A O     1 
HETATM 2093 O O     . HOH C 3 .   ? 66.146 -21.045 -17.521 1.00 25.02 ? 575 HOH A O     1 
HETATM 2094 O O     . HOH C 3 .   ? 27.987 -9.902  10.277  1.00 27.71 ? 576 HOH A O     1 
HETATM 2095 O O     . HOH C 3 .   ? 27.896 -10.495 13.824  1.00 32.41 ? 577 HOH A O     1 
HETATM 2096 O O     . HOH C 3 .   ? 51.836 -16.983 13.906  1.00 47.24 ? 578 HOH A O     1 
HETATM 2097 O O     . HOH C 3 .   ? 57.852 -4.445  0.201   1.00 36.26 ? 579 HOH A O     1 
HETATM 2098 O O     . HOH C 3 .   ? 36.446 -7.837  -34.201 1.00 31.83 ? 580 HOH A O     1 
HETATM 2099 O O     . HOH C 3 .   ? 52.473 0.777   -32.985 1.00 39.78 ? 581 HOH A O     1 
HETATM 2100 O O     . HOH C 3 .   ? 21.678 4.510   28.965  1.00 35.07 ? 582 HOH A O     1 
HETATM 2101 O O     . HOH C 3 .   ? 59.539 -8.455  -25.190 1.00 37.08 ? 583 HOH A O     1 
HETATM 2102 O O     . HOH C 3 .   ? 57.411 -15.636 7.433   1.00 50.04 ? 584 HOH A O     1 
HETATM 2103 O O     . HOH C 3 .   ? 32.080 -8.375  -27.854 1.00 30.65 ? 585 HOH A O     1 
HETATM 2104 O O     . HOH C 3 .   ? 57.586 -18.169 -18.700 1.00 39.10 ? 586 HOH A O     1 
HETATM 2105 O O     . HOH C 3 .   ? 59.202 -16.840 -15.123 1.00 47.92 ? 587 HOH A O     1 
HETATM 2106 O O     . HOH C 3 .   ? 48.397 7.801   -30.531 1.00 35.66 ? 588 HOH A O     1 
HETATM 2107 O O     . HOH C 3 .   ? 57.118 -10.151 -4.725  1.00 42.80 ? 589 HOH A O     1 
HETATM 2108 O O     . HOH C 3 .   ? 57.735 3.203   -10.182 1.00 33.24 ? 590 HOH A O     1 
HETATM 2109 O O     . HOH C 3 .   ? 68.804 -7.534  -28.008 1.00 31.90 ? 591 HOH A O     1 
HETATM 2110 O O     . HOH C 3 .   ? 41.862 -2.568  -36.146 1.00 25.33 ? 592 HOH A O     1 
HETATM 2111 O O     . HOH C 3 .   ? 28.262 -10.528 22.524  1.00 34.25 ? 593 HOH A O     1 
HETATM 2112 O O     . HOH C 3 .   ? 51.097 -6.902  20.150  1.00 40.69 ? 594 HOH A O     1 
HETATM 2113 O O     . HOH C 3 .   ? 29.494 8.537   28.011  1.00 30.51 ? 595 HOH A O     1 
HETATM 2114 O O     . HOH C 3 .   ? 27.951 -10.501 -6.140  1.00 42.18 ? 596 HOH A O     1 
HETATM 2115 O O     . HOH C 3 .   ? 32.112 8.756   13.824  1.00 40.40 ? 597 HOH A O     1 
HETATM 2116 O O     . HOH C 3 .   ? 26.339 2.157   13.087  1.00 44.53 ? 598 HOH A O     1 
HETATM 2117 O O     . HOH C 3 .   ? 71.645 -3.353  -31.747 1.00 27.40 ? 599 HOH A O     1 
HETATM 2118 O O     . HOH C 3 .   ? 53.533 -2.814  -32.198 1.00 45.86 ? 600 HOH A O     1 
HETATM 2119 O O     . HOH C 3 .   ? 23.671 -5.043  15.021  1.00 52.62 ? 601 HOH A O     1 
HETATM 2120 O O     . HOH C 3 .   ? 29.410 -11.400 4.261   1.00 36.79 ? 602 HOH A O     1 
HETATM 2121 O O     . HOH C 3 .   ? 53.030 -3.962  -36.365 1.00 48.14 ? 603 HOH A O     1 
HETATM 2122 O O     . HOH C 3 .   ? 46.399 -11.676 22.602  1.00 44.54 ? 604 HOH A O     1 
HETATM 2123 O O     . HOH C 3 .   ? 57.238 -9.733  -1.118  1.00 39.63 ? 605 HOH A O     1 
HETATM 2124 O O     . HOH C 3 .   ? 39.337 -6.346  32.766  1.00 43.28 ? 606 HOH A O     1 
HETATM 2125 O O     . HOH C 3 .   ? 53.865 -10.125 10.852  1.00 30.87 ? 607 HOH A O     1 
HETATM 2126 O O     . HOH C 3 .   ? 56.045 7.970   3.306   1.00 41.45 ? 608 HOH A O     1 
HETATM 2127 O O     . HOH C 3 .   ? 25.550 -1.088  10.220  1.00 35.81 ? 609 HOH A O     1 
HETATM 2128 O O     . HOH C 3 .   ? 36.633 -10.191 -33.730 1.00 44.43 ? 610 HOH A O     1 
HETATM 2129 O O     . HOH C 3 .   ? 26.061 -6.335  20.781  1.00 32.08 ? 611 HOH A O     1 
HETATM 2130 O O     . HOH C 3 .   ? 19.690 13.917  25.264  1.00 39.88 ? 612 HOH A O     1 
HETATM 2131 O O     . HOH C 3 .   ? 54.292 4.301   -15.690 1.00 43.85 ? 613 HOH A O     1 
HETATM 2132 O O     . HOH C 3 .   ? 51.154 -6.667  17.875  1.00 39.31 ? 614 HOH A O     1 
HETATM 2133 O O     . HOH C 3 .   ? 58.046 -7.765  5.193   1.00 45.63 ? 615 HOH A O     1 
HETATM 2134 O O     . HOH C 3 .   ? 24.805 -0.127  0.439   0.50 22.09 ? 616 HOH A O     1 
HETATM 2135 O O     . HOH C 3 .   ? 64.814 -21.865 -22.739 1.00 48.81 ? 617 HOH A O     1 
HETATM 2136 O O     . HOH C 3 .   ? 58.528 -0.889  -20.909 1.00 33.77 ? 618 HOH A O     1 
HETATM 2137 O O     . HOH C 3 .   ? 40.748 10.885  -28.415 1.00 48.97 ? 619 HOH A O     1 
HETATM 2138 O O     . HOH C 3 .   ? 76.753 -15.514 -18.638 1.00 46.81 ? 620 HOH A O     1 
HETATM 2139 O O     . HOH C 3 .   ? 63.577 -9.097  -30.195 1.00 35.29 ? 621 HOH A O     1 
HETATM 2140 O O     . HOH C 3 .   ? 47.751 17.371  29.456  1.00 39.47 ? 622 HOH A O     1 
HETATM 2141 O O     . HOH C 3 .   ? 27.696 -4.977  12.638  1.00 31.63 ? 623 HOH A O     1 
HETATM 2142 O O     . HOH C 3 .   ? 61.311 -12.302 -26.574 1.00 29.22 ? 624 HOH A O     1 
HETATM 2143 O O     . HOH C 3 .   ? 32.058 -11.958 24.910  1.00 39.86 ? 625 HOH A O     1 
HETATM 2144 O O     . HOH C 3 .   ? 35.336 -11.906 -12.950 1.00 35.84 ? 626 HOH A O     1 
HETATM 2145 O O     . HOH C 3 .   ? 45.266 8.195   -34.763 1.00 40.44 ? 627 HOH A O     1 
HETATM 2146 O O     . HOH C 3 .   ? 49.177 -2.950  -17.637 1.00 30.94 ? 628 HOH A O     1 
HETATM 2147 O O     . HOH C 3 .   ? 63.455 -21.325 -16.662 1.00 36.70 ? 629 HOH A O     1 
HETATM 2148 O O     . HOH C 3 .   ? 27.023 -17.970 6.105   1.00 54.14 ? 630 HOH A O     1 
HETATM 2149 O O     . HOH C 3 .   ? 55.905 -14.034 -17.930 1.00 33.46 ? 631 HOH A O     1 
HETATM 2150 O O     . HOH C 3 .   ? 26.195 -13.176 -0.196  1.00 36.89 ? 632 HOH A O     1 
HETATM 2151 O O     . HOH C 3 .   ? 67.932 -21.666 -25.583 1.00 34.81 ? 633 HOH A O     1 
HETATM 2152 O O     . HOH C 3 .   ? 37.353 -16.434 23.320  1.00 37.91 ? 634 HOH A O     1 
HETATM 2153 O O     . HOH C 3 .   ? 27.480 6.072   12.667  1.00 43.90 ? 635 HOH A O     1 
HETATM 2154 O O     . HOH C 3 .   ? 24.284 -12.508 -8.302  1.00 49.94 ? 636 HOH A O     1 
HETATM 2155 O O     . HOH C 3 .   ? 54.566 -4.354  13.543  1.00 43.79 ? 637 HOH A O     1 
HETATM 2156 O O     . HOH C 3 .   ? 33.767 -10.865 -33.882 1.00 43.06 ? 638 HOH A O     1 
HETATM 2157 O O     . HOH C 3 .   ? 33.754 -9.580  -11.894 1.00 25.63 ? 639 HOH A O     1 
HETATM 2158 O O     . HOH C 3 .   ? 26.807 3.842   30.982  1.00 20.20 ? 640 HOH A O     1 
HETATM 2159 O O     . HOH C 3 .   ? 43.784 6.510   -36.279 1.00 34.34 ? 641 HOH A O     1 
HETATM 2160 O O     . HOH C 3 .   ? 26.279 -6.793  23.174  1.00 26.29 ? 642 HOH A O     1 
HETATM 2161 O O     . HOH C 3 .   ? 65.752 -20.640 -26.997 1.00 38.94 ? 643 HOH A O     1 
HETATM 2162 O O     . HOH C 3 .   ? 27.278 -5.111  24.955  1.00 18.07 ? 644 HOH A O     1 
HETATM 2163 O O     . HOH C 3 .   ? 38.517 -11.040 29.639  0.50 35.04 ? 645 HOH A O     1 
HETATM 2164 O O     . HOH C 3 .   ? 35.614 -12.037 -30.450 1.00 46.93 ? 646 HOH A O     1 
HETATM 2165 O O     . HOH C 3 .   ? 26.484 -11.211 -4.526  1.00 45.36 ? 647 HOH A O     1 
HETATM 2166 O O     . HOH C 3 .   ? 29.202 3.484   29.587  0.50 13.84 ? 648 HOH A O     1 
HETATM 2167 O O     . HOH C 3 .   ? 29.523 -7.035  28.709  1.00 40.66 ? 649 HOH A O     1 
HETATM 2168 O O     . HOH C 3 .   ? 49.450 -16.158 -7.927  1.00 47.54 ? 650 HOH A O     1 
HETATM 2169 O O     . HOH C 3 .   ? 59.306 3.062   -18.144 1.00 41.96 ? 651 HOH A O     1 
HETATM 2170 O O     . HOH C 3 .   ? 38.957 -13.055 24.962  1.00 38.97 ? 652 HOH A O     1 
HETATM 2171 O O     . HOH C 3 .   ? 39.242 -12.624 27.693  1.00 47.68 ? 653 HOH A O     1 
HETATM 2172 O O     . HOH C 3 .   ? 46.924 -16.229 -7.652  1.00 49.33 ? 654 HOH A O     1 
HETATM 2173 O O     . HOH C 3 .   ? 51.622 -16.681 -11.801 1.00 46.82 ? 655 HOH A O     1 
HETATM 2174 O O     . HOH C 3 .   ? 29.896 -8.424  25.800  1.00 33.71 ? 656 HOH A O     1 
HETATM 2175 O O     . HOH C 3 .   ? 41.849 12.888  29.720  1.00 45.22 ? 657 HOH A O     1 
HETATM 2176 O O     . HOH C 3 .   ? 39.519 11.397  12.138  1.00 41.31 ? 658 HOH A O     1 
HETATM 2177 O O     . HOH C 3 .   ? 45.375 -13.254 -32.846 1.00 46.38 ? 659 HOH A O     1 
HETATM 2178 O O     . HOH C 3 .   ? 27.044 -6.176  10.193  1.00 38.74 ? 660 HOH A O     1 
HETATM 2179 O O     . HOH C 3 .   ? 26.818 -7.166  18.414  1.00 30.42 ? 661 HOH A O     1 
HETATM 2180 O O     . HOH C 3 .   ? 37.826 12.912  16.000  1.00 33.39 ? 662 HOH A O     1 
HETATM 2181 O O     . HOH C 3 .   ? 69.194 -8.356  -12.118 1.00 51.07 ? 663 HOH A O     1 
HETATM 2182 O O     . HOH C 3 .   ? 25.358 9.568   29.351  0.50 26.19 ? 664 HOH A O     1 
HETATM 2183 O O     . HOH C 3 .   ? 45.301 -16.565 20.481  1.00 37.71 ? 665 HOH A O     1 
HETATM 2184 O O     . HOH C 3 .   ? 42.963 -2.115  -38.399 1.00 36.56 ? 666 HOH A O     1 
HETATM 2185 O O     . HOH C 3 .   ? 42.934 8.896   -33.747 1.00 49.54 ? 667 HOH A O     1 
HETATM 2186 O O     . HOH C 3 .   ? 76.124 -3.807  -21.726 1.00 49.56 ? 668 HOH A O     1 
HETATM 2187 O O     . HOH C 3 .   ? 47.462 7.271   -37.286 1.00 53.65 ? 669 HOH A O     1 
HETATM 2188 O O     . HOH C 3 .   ? 38.325 -5.499  -33.720 1.00 20.05 ? 670 HOH A O     1 
HETATM 2189 O O     . HOH C 3 .   ? 46.725 3.717   -38.547 1.00 43.13 ? 671 HOH A O     1 
HETATM 2190 O O     . HOH C 3 .   ? 67.755 2.525   -16.577 1.00 50.29 ? 672 HOH A O     1 
HETATM 2191 O O     . HOH C 3 .   ? 71.056 -8.867  -27.330 1.00 42.18 ? 673 HOH A O     1 
HETATM 2192 O O     . HOH C 3 .   ? 27.035 4.822   9.818   1.00 35.70 ? 674 HOH A O     1 
HETATM 2193 O O     . HOH C 3 .   ? 53.387 -16.371 -20.178 1.00 39.16 ? 675 HOH A O     1 
HETATM 2194 O O     . HOH C 3 .   ? 55.093 -11.398 15.523  1.00 39.47 ? 676 HOH A O     1 
HETATM 2195 O O     . HOH C 3 .   ? 37.569 12.135  13.205  1.00 37.66 ? 677 HOH A O     1 
HETATM 2196 O O     . HOH C 3 .   ? 26.680 -12.589 20.240  1.00 50.04 ? 678 HOH A O     1 
HETATM 2197 O O     . HOH C 3 .   ? 51.739 -17.847 -9.684  1.00 50.08 ? 679 HOH A O     1 
HETATM 2198 O O     . HOH C 3 .   ? 42.841 21.437  15.320  1.00 50.84 ? 680 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   0   HIS HIS A . n 
A 1 21  MET 21  1   1   MET MET A . n 
A 1 22  TRP 22  2   2   TRP TRP A . n 
A 1 23  ILE 23  3   3   ILE ILE A . n 
A 1 24  GLY 24  4   4   GLY GLY A . n 
A 1 25  VAL 25  5   5   VAL VAL A . n 
A 1 26  ILE 26  6   6   ILE ILE A . n 
A 1 27  SER 27  7   7   SER SER A . n 
A 1 28  LEU 28  8   8   LEU LEU A . n 
A 1 29  PHE 29  9   9   PHE PHE A . n 
A 1 30  PRO 30  10  10  PRO PRO A . n 
A 1 31  GLU 31  11  11  GLU GLU A . n 
A 1 32  MET 32  12  12  MET MET A . n 
A 1 33  PHE 33  13  13  PHE PHE A . n 
A 1 34  LYS 34  14  14  LYS LYS A . n 
A 1 35  ALA 35  15  15  ALA ALA A . n 
A 1 36  ILE 36  16  16  ILE ILE A . n 
A 1 37  THR 37  17  17  THR THR A . n 
A 1 38  GLU 38  18  18  GLU GLU A . n 
A 1 39  PHE 39  19  19  PHE PHE A . n 
A 1 40  GLY 40  20  20  GLY GLY A . n 
A 1 41  VAL 41  21  21  VAL VAL A . n 
A 1 42  THR 42  22  22  THR THR A . n 
A 1 43  GLY 43  23  23  GLY GLY A . n 
A 1 44  ARG 44  24  24  ARG ARG A . n 
A 1 45  ALA 45  25  25  ALA ALA A . n 
A 1 46  VAL 46  26  26  VAL VAL A . n 
A 1 47  LYS 47  27  27  LYS LYS A . n 
A 1 48  HIS 48  28  28  HIS HIS A . n 
A 1 49  ASN 49  29  29  ASN ASN A . n 
A 1 50  LEU 50  30  30  LEU LEU A . n 
A 1 51  LEU 51  31  31  LEU LEU A . n 
A 1 52  LYS 52  32  32  LYS LYS A . n 
A 1 53  VAL 53  33  33  VAL VAL A . n 
A 1 54  GLU 54  34  34  GLU GLU A . n 
A 1 55  CYS 55  35  35  CYS CYS A . n 
A 1 56  TRP 56  36  36  TRP TRP A . n 
A 1 57  ASN 57  37  37  ASN ASN A . n 
A 1 58  PRO 58  38  38  PRO PRO A . n 
A 1 59  ARG 59  39  39  ARG ARG A . n 
A 1 60  ASP 60  40  40  ASP ASP A . n 
A 1 61  PHE 61  41  41  PHE PHE A . n 
A 1 62  THR 62  42  42  THR THR A . n 
A 1 63  PHE 63  43  43  PHE PHE A . n 
A 1 64  ASP 64  44  44  ASP ASP A . n 
A 1 65  LYS 65  45  45  LYS LYS A . n 
A 1 66  HIS 66  46  46  HIS HIS A . n 
A 1 67  LYS 67  47  47  LYS LYS A . n 
A 1 68  THR 68  48  48  THR THR A . n 
A 1 69  VAL 69  49  49  VAL VAL A . n 
A 1 70  ASP 70  50  50  ASP ASP A . n 
A 1 71  ASP 71  51  51  ASP ASP A . n 
A 1 72  ARG 72  52  52  ARG ARG A . n 
A 1 73  PRO 73  53  53  PRO PRO A . n 
A 1 74  TYR 74  54  54  TYR TYR A . n 
A 1 75  GLY 75  55  55  GLY GLY A . n 
A 1 76  GLY 76  56  56  GLY GLY A . n 
A 1 77  GLY 77  57  57  GLY GLY A . n 
A 1 78  PRO 78  58  58  PRO PRO A . n 
A 1 79  GLY 79  59  59  GLY GLY A . n 
A 1 80  MET 80  60  60  MET MET A . n 
A 1 81  LEU 81  61  61  LEU LEU A . n 
A 1 82  MET 82  62  62  MET MET A . n 
A 1 83  MET 83  63  63  MET MET A . n 
A 1 84  VAL 84  64  64  VAL VAL A . n 
A 1 85  GLN 85  65  65  GLN GLN A . n 
A 1 86  PRO 86  66  66  PRO PRO A . n 
A 1 87  LEU 87  67  67  LEU LEU A . n 
A 1 88  ARG 88  68  68  ARG ARG A . n 
A 1 89  ASP 89  69  69  ASP ASP A . n 
A 1 90  ALA 90  70  70  ALA ALA A . n 
A 1 91  ILE 91  71  71  ILE ILE A . n 
A 1 92  HIS 92  72  72  HIS HIS A . n 
A 1 93  THR 93  73  73  THR THR A . n 
A 1 94  ALA 94  74  74  ALA ALA A . n 
A 1 95  LYS 95  75  75  LYS LYS A . n 
A 1 96  ALA 96  76  76  ALA ALA A . n 
A 1 97  ALA 97  77  77  ALA ALA A . n 
A 1 98  ALA 98  78  78  ALA ALA A . n 
A 1 99  GLY 99  79  79  GLY GLY A . n 
A 1 100 GLU 100 80  80  GLU GLU A . n 
A 1 101 GLY 101 81  81  GLY GLY A . n 
A 1 102 ALA 102 82  82  ALA ALA A . n 
A 1 103 LYS 103 83  83  LYS LYS A . n 
A 1 104 VAL 104 84  84  VAL VAL A . n 
A 1 105 ILE 105 85  85  ILE ILE A . n 
A 1 106 TYR 106 86  86  TYR TYR A . n 
A 1 107 LEU 107 87  87  LEU LEU A . n 
A 1 108 SER 108 88  88  SER SER A . n 
A 1 109 PRO 109 89  89  PRO PRO A . n 
A 1 110 GLN 110 90  90  GLN GLN A . n 
A 1 111 GLY 111 91  91  GLY GLY A . n 
A 1 112 ARG 112 92  92  ARG ARG A . n 
A 1 113 LYS 113 93  93  LYS LYS A . n 
A 1 114 LEU 114 94  94  LEU LEU A . n 
A 1 115 ASP 115 95  95  ASP ASP A . n 
A 1 116 GLN 116 96  96  GLN GLN A . n 
A 1 117 GLY 117 97  97  GLY GLY A . n 
A 1 118 GLY 118 98  98  GLY GLY A . n 
A 1 119 VAL 119 99  99  VAL VAL A . n 
A 1 120 THR 120 100 100 THR THR A . n 
A 1 121 GLU 121 101 101 GLU GLU A . n 
A 1 122 LEU 122 102 102 LEU LEU A . n 
A 1 123 ALA 123 103 103 ALA ALA A . n 
A 1 124 GLN 124 104 104 GLN GLN A . n 
A 1 125 ASN 125 105 105 ASN ASN A . n 
A 1 126 GLN 126 106 106 GLN GLN A . n 
A 1 127 LYS 127 107 107 LYS LYS A . n 
A 1 128 LEU 128 108 108 LEU LEU A . n 
A 1 129 ILE 129 109 109 ILE ILE A . n 
A 1 130 LEU 130 110 110 LEU LEU A . n 
A 1 131 VAL 131 111 111 VAL VAL A . n 
A 1 132 CYS 132 112 112 CYS CYS A . n 
A 1 133 GLY 133 113 113 GLY GLY A . n 
A 1 134 ARG 134 114 114 ARG ARG A . n 
A 1 135 TYR 135 115 115 TYR TYR A . n 
A 1 136 GLU 136 116 116 GLU GLU A . n 
A 1 137 GLY 137 117 117 GLY GLY A . n 
A 1 138 ILE 138 118 118 ILE ILE A . n 
A 1 139 ASP 139 119 119 ASP ASP A . n 
A 1 140 GLU 140 120 120 GLU GLU A . n 
A 1 141 ARG 141 121 121 ARG ARG A . n 
A 1 142 LEU 142 122 122 LEU LEU A . n 
A 1 143 ILE 143 123 123 ILE ILE A . n 
A 1 144 GLN 144 124 124 GLN GLN A . n 
A 1 145 THR 145 125 125 THR THR A . n 
A 1 146 GLU 146 126 126 GLU GLU A . n 
A 1 147 ILE 147 127 127 ILE ILE A . n 
A 1 148 ASP 148 128 128 ASP ASP A . n 
A 1 149 GLU 149 129 129 GLU GLU A . n 
A 1 150 GLU 150 130 130 GLU GLU A . n 
A 1 151 TRP 151 131 131 TRP TRP A . n 
A 1 152 SER 152 132 132 SER SER A . n 
A 1 153 ILE 153 133 133 ILE ILE A . n 
A 1 154 GLY 154 134 134 GLY GLY A . n 
A 1 155 ASP 155 135 135 ASP ASP A . n 
A 1 156 TYR 156 136 136 TYR TYR A . n 
A 1 157 VAL 157 137 137 VAL VAL A . n 
A 1 158 LEU 158 138 138 LEU LEU A . n 
A 1 159 THR 159 139 139 THR THR A . n 
A 1 160 GLY 160 140 140 GLY GLY A . n 
A 1 161 GLY 161 141 141 GLY GLY A . n 
A 1 162 GLU 162 142 142 GLU GLU A . n 
A 1 163 LEU 163 143 143 LEU LEU A . n 
A 1 164 PRO 164 144 144 PRO PRO A . n 
A 1 165 ALA 165 145 145 ALA ALA A . n 
A 1 166 MET 166 146 146 MET MET A . n 
A 1 167 THR 167 147 147 THR THR A . n 
A 1 168 LEU 168 148 148 LEU LEU A . n 
A 1 169 ILE 169 149 149 ILE ILE A . n 
A 1 170 ASP 170 150 150 ASP ASP A . n 
A 1 171 ALA 171 151 151 ALA ALA A . n 
A 1 172 VAL 172 152 152 VAL VAL A . n 
A 1 173 ALA 173 153 153 ALA ALA A . n 
A 1 174 ARG 174 154 154 ARG ARG A . n 
A 1 175 PHE 175 155 155 PHE PHE A . n 
A 1 176 ILE 176 156 156 ILE ILE A . n 
A 1 177 PRO 177 157 157 PRO PRO A . n 
A 1 178 GLY 178 158 158 GLY GLY A . n 
A 1 179 VAL 179 159 159 VAL VAL A . n 
A 1 180 LEU 180 160 160 LEU LEU A . n 
A 1 181 GLY 181 161 ?   ?   ?   A . n 
A 1 182 LYS 182 162 ?   ?   ?   A . n 
A 1 183 GLN 183 163 ?   ?   ?   A . n 
A 1 184 ALA 184 164 ?   ?   ?   A . n 
A 1 185 SER 185 165 ?   ?   ?   A . n 
A 1 186 ALA 186 166 ?   ?   ?   A . n 
A 1 187 GLU 187 167 ?   ?   ?   A . n 
A 1 188 GLU 188 168 ?   ?   ?   A . n 
A 1 189 ASP 189 169 169 ASP ASP A . n 
A 1 190 SER 190 170 170 SER SER A . n 
A 1 191 PHE 191 171 171 PHE PHE A . n 
A 1 192 ALA 192 172 172 ALA ALA A . n 
A 1 193 ASP 193 173 173 ASP ASP A . n 
A 1 194 GLY 194 174 174 GLY GLY A . n 
A 1 195 LEU 195 175 175 LEU LEU A . n 
A 1 196 LEU 196 176 176 LEU LEU A . n 
A 1 197 ASP 197 177 177 ASP ASP A . n 
A 1 198 CYS 198 178 178 CYS CYS A . n 
A 1 199 PRO 199 179 179 PRO PRO A . n 
A 1 200 HIS 200 180 180 HIS HIS A . n 
A 1 201 TYR 201 181 181 TYR TYR A . n 
A 1 202 THR 202 182 182 THR THR A . n 
A 1 203 ARG 203 183 183 ARG ARG A . n 
A 1 204 PRO 204 184 184 PRO PRO A . n 
A 1 205 GLU 205 185 185 GLU GLU A . n 
A 1 206 VAL 206 186 186 VAL VAL A . n 
A 1 207 LEU 207 187 187 LEU LEU A . n 
A 1 208 GLU 208 188 188 GLU GLU A . n 
A 1 209 GLY 209 189 189 GLY GLY A . n 
A 1 210 LEU 210 190 190 LEU LEU A . n 
A 1 211 THR 211 191 191 THR THR A . n 
A 1 212 VAL 212 192 192 VAL VAL A . n 
A 1 213 PRO 213 193 193 PRO PRO A . n 
A 1 214 PRO 214 194 194 PRO PRO A . n 
A 1 215 VAL 215 195 195 VAL VAL A . n 
A 1 216 LEU 216 196 196 LEU LEU A . n 
A 1 217 MET 217 197 197 MET MET A . n 
A 1 218 SER 218 198 198 SER SER A . n 
A 1 219 GLY 219 199 199 GLY GLY A . n 
A 1 220 HIS 220 200 200 HIS HIS A . n 
A 1 221 HIS 221 201 201 HIS HIS A . n 
A 1 222 GLU 222 202 202 GLU GLU A . n 
A 1 223 GLU 223 203 203 GLU GLU A . n 
A 1 224 ILE 224 204 204 ILE ILE A . n 
A 1 225 ARG 225 205 205 ARG ARG A . n 
A 1 226 LYS 226 206 206 LYS LYS A . n 
A 1 227 TRP 227 207 207 TRP TRP A . n 
A 1 228 ARG 228 208 208 ARG ARG A . n 
A 1 229 LEU 229 209 209 LEU LEU A . n 
A 1 230 LYS 230 210 210 LYS LYS A . n 
A 1 231 GLN 231 211 211 GLN GLN A . n 
A 1 232 SER 232 212 212 SER SER A . n 
A 1 233 LEU 233 213 213 LEU LEU A . n 
A 1 234 GLN 234 214 214 GLN GLN A . n 
A 1 235 ARG 235 215 215 ARG ARG A . n 
A 1 236 THR 236 216 216 THR THR A . n 
A 1 237 TRP 237 217 217 TRP TRP A . n 
A 1 238 LEU 238 218 218 LEU LEU A . n 
A 1 239 ARG 239 219 219 ARG ARG A . n 
A 1 240 ARG 240 220 220 ARG ARG A . n 
A 1 241 PRO 241 221 221 PRO PRO A . n 
A 1 242 GLU 242 222 222 GLU GLU A . n 
A 1 243 LEU 243 223 223 LEU LEU A . n 
A 1 244 LEU 244 224 224 LEU LEU A . n 
A 1 245 GLU 245 225 225 GLU GLU A . n 
A 1 246 GLY 246 226 226 GLY GLY A . n 
A 1 247 LEU 247 227 227 LEU LEU A . n 
A 1 248 ALA 248 228 228 ALA ALA A . n 
A 1 249 LEU 249 229 229 LEU LEU A . n 
A 1 250 THR 250 230 230 THR THR A . n 
A 1 251 ASP 251 231 231 ASP ASP A . n 
A 1 252 GLU 252 232 232 GLU GLU A . n 
A 1 253 GLN 253 233 233 GLN GLN A . n 
A 1 254 ARG 254 234 234 ARG ARG A . n 
A 1 255 LYS 255 235 235 LYS LYS A . n 
A 1 256 LEU 256 236 236 LEU LEU A . n 
A 1 257 LEU 257 237 237 LEU LEU A . n 
A 1 258 LYS 258 238 238 LYS LYS A . n 
A 1 259 GLU 259 239 239 GLU GLU A . n 
A 1 260 ALA 260 240 240 ALA ALA A . n 
A 1 261 GLN 261 241 241 GLN GLN A . n 
A 1 262 ALA 262 242 242 ALA ALA A . n 
A 1 263 GLU 263 243 243 GLU GLU A . n 
A 1 264 HIS 264 244 244 HIS HIS A . n 
A 1 265 ASN 265 245 245 ASN ASN A . n 
A 1 266 SER 266 246 246 SER SER A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SAM 1   301 301 SAM SAM A . 
C 3 HOH 1   401 403 HOH HOH A . 
C 3 HOH 2   402 409 HOH HOH A . 
C 3 HOH 3   403 402 HOH HOH A . 
C 3 HOH 4   404 404 HOH HOH A . 
C 3 HOH 5   405 401 HOH HOH A . 
C 3 HOH 6   406 407 HOH HOH A . 
C 3 HOH 7   407 416 HOH HOH A . 
C 3 HOH 8   408 411 HOH HOH A . 
C 3 HOH 9   409 421 HOH HOH A . 
C 3 HOH 10  410 410 HOH HOH A . 
C 3 HOH 11  411 454 HOH HOH A . 
C 3 HOH 12  412 420 HOH HOH A . 
C 3 HOH 13  413 408 HOH HOH A . 
C 3 HOH 14  414 417 HOH HOH A . 
C 3 HOH 15  415 457 HOH HOH A . 
C 3 HOH 16  416 405 HOH HOH A . 
C 3 HOH 17  417 406 HOH HOH A . 
C 3 HOH 18  418 453 HOH HOH A . 
C 3 HOH 19  419 423 HOH HOH A . 
C 3 HOH 20  420 427 HOH HOH A . 
C 3 HOH 21  421 413 HOH HOH A . 
C 3 HOH 22  422 444 HOH HOH A . 
C 3 HOH 23  423 431 HOH HOH A . 
C 3 HOH 24  424 498 HOH HOH A . 
C 3 HOH 25  425 426 HOH HOH A . 
C 3 HOH 26  426 509 HOH HOH A . 
C 3 HOH 27  427 436 HOH HOH A . 
C 3 HOH 28  428 419 HOH HOH A . 
C 3 HOH 29  429 424 HOH HOH A . 
C 3 HOH 30  430 415 HOH HOH A . 
C 3 HOH 31  431 412 HOH HOH A . 
C 3 HOH 32  432 432 HOH HOH A . 
C 3 HOH 33  433 418 HOH HOH A . 
C 3 HOH 34  434 425 HOH HOH A . 
C 3 HOH 35  435 414 HOH HOH A . 
C 3 HOH 36  436 528 HOH HOH A . 
C 3 HOH 37  437 446 HOH HOH A . 
C 3 HOH 38  438 441 HOH HOH A . 
C 3 HOH 39  439 433 HOH HOH A . 
C 3 HOH 40  440 501 HOH HOH A . 
C 3 HOH 41  441 490 HOH HOH A . 
C 3 HOH 42  442 439 HOH HOH A . 
C 3 HOH 43  443 460 HOH HOH A . 
C 3 HOH 44  444 428 HOH HOH A . 
C 3 HOH 45  445 458 HOH HOH A . 
C 3 HOH 46  446 448 HOH HOH A . 
C 3 HOH 47  447 537 HOH HOH A . 
C 3 HOH 48  448 430 HOH HOH A . 
C 3 HOH 49  449 461 HOH HOH A . 
C 3 HOH 50  450 447 HOH HOH A . 
C 3 HOH 51  451 434 HOH HOH A . 
C 3 HOH 52  452 443 HOH HOH A . 
C 3 HOH 53  453 471 HOH HOH A . 
C 3 HOH 54  454 464 HOH HOH A . 
C 3 HOH 55  455 514 HOH HOH A . 
C 3 HOH 56  456 462 HOH HOH A . 
C 3 HOH 57  457 459 HOH HOH A . 
C 3 HOH 58  458 468 HOH HOH A . 
C 3 HOH 59  459 451 HOH HOH A . 
C 3 HOH 60  460 466 HOH HOH A . 
C 3 HOH 61  461 440 HOH HOH A . 
C 3 HOH 62  462 450 HOH HOH A . 
C 3 HOH 63  463 438 HOH HOH A . 
C 3 HOH 64  464 583 HOH HOH A . 
C 3 HOH 65  465 452 HOH HOH A . 
C 3 HOH 66  466 449 HOH HOH A . 
C 3 HOH 67  467 467 HOH HOH A . 
C 3 HOH 68  468 455 HOH HOH A . 
C 3 HOH 69  469 437 HOH HOH A . 
C 3 HOH 70  470 476 HOH HOH A . 
C 3 HOH 71  471 470 HOH HOH A . 
C 3 HOH 72  472 512 HOH HOH A . 
C 3 HOH 73  473 472 HOH HOH A . 
C 3 HOH 74  474 422 HOH HOH A . 
C 3 HOH 75  475 503 HOH HOH A . 
C 3 HOH 76  476 465 HOH HOH A . 
C 3 HOH 77  477 484 HOH HOH A . 
C 3 HOH 78  478 493 HOH HOH A . 
C 3 HOH 79  479 481 HOH HOH A . 
C 3 HOH 80  480 491 HOH HOH A . 
C 3 HOH 81  481 435 HOH HOH A . 
C 3 HOH 82  482 578 HOH HOH A . 
C 3 HOH 83  483 477 HOH HOH A . 
C 3 HOH 84  484 516 HOH HOH A . 
C 3 HOH 85  485 492 HOH HOH A . 
C 3 HOH 86  486 511 HOH HOH A . 
C 3 HOH 87  487 497 HOH HOH A . 
C 3 HOH 88  488 508 HOH HOH A . 
C 3 HOH 89  489 504 HOH HOH A . 
C 3 HOH 90  490 463 HOH HOH A . 
C 3 HOH 91  491 445 HOH HOH A . 
C 3 HOH 92  492 488 HOH HOH A . 
C 3 HOH 93  493 469 HOH HOH A . 
C 3 HOH 94  494 494 HOH HOH A . 
C 3 HOH 95  495 524 HOH HOH A . 
C 3 HOH 96  496 522 HOH HOH A . 
C 3 HOH 97  497 480 HOH HOH A . 
C 3 HOH 98  498 483 HOH HOH A . 
C 3 HOH 99  499 505 HOH HOH A . 
C 3 HOH 100 500 473 HOH HOH A . 
C 3 HOH 101 501 520 HOH HOH A . 
C 3 HOH 102 502 544 HOH HOH A . 
C 3 HOH 103 503 429 HOH HOH A . 
C 3 HOH 104 504 442 HOH HOH A . 
C 3 HOH 105 505 507 HOH HOH A . 
C 3 HOH 106 506 502 HOH HOH A . 
C 3 HOH 107 507 499 HOH HOH A . 
C 3 HOH 108 508 475 HOH HOH A . 
C 3 HOH 109 509 530 HOH HOH A . 
C 3 HOH 110 510 500 HOH HOH A . 
C 3 HOH 111 511 487 HOH HOH A . 
C 3 HOH 112 512 474 HOH HOH A . 
C 3 HOH 113 513 536 HOH HOH A . 
C 3 HOH 114 514 510 HOH HOH A . 
C 3 HOH 115 515 538 HOH HOH A . 
C 3 HOH 116 516 525 HOH HOH A . 
C 3 HOH 117 517 513 HOH HOH A . 
C 3 HOH 118 518 478 HOH HOH A . 
C 3 HOH 119 519 526 HOH HOH A . 
C 3 HOH 120 520 541 HOH HOH A . 
C 3 HOH 121 521 486 HOH HOH A . 
C 3 HOH 122 522 555 HOH HOH A . 
C 3 HOH 123 523 479 HOH HOH A . 
C 3 HOH 124 524 489 HOH HOH A . 
C 3 HOH 125 525 539 HOH HOH A . 
C 3 HOH 126 526 495 HOH HOH A . 
C 3 HOH 127 527 517 HOH HOH A . 
C 3 HOH 128 528 456 HOH HOH A . 
C 3 HOH 129 529 554 HOH HOH A . 
C 3 HOH 130 530 549 HOH HOH A . 
C 3 HOH 131 531 556 HOH HOH A . 
C 3 HOH 132 532 485 HOH HOH A . 
C 3 HOH 133 533 519 HOH HOH A . 
C 3 HOH 134 534 496 HOH HOH A . 
C 3 HOH 135 535 529 HOH HOH A . 
C 3 HOH 136 536 482 HOH HOH A . 
C 3 HOH 137 537 543 HOH HOH A . 
C 3 HOH 138 538 521 HOH HOH A . 
C 3 HOH 139 539 527 HOH HOH A . 
C 3 HOH 140 540 533 HOH HOH A . 
C 3 HOH 141 541 506 HOH HOH A . 
C 3 HOH 142 542 534 HOH HOH A . 
C 3 HOH 143 543 515 HOH HOH A . 
C 3 HOH 144 544 535 HOH HOH A . 
C 3 HOH 145 545 540 HOH HOH A . 
C 3 HOH 146 546 553 HOH HOH A . 
C 3 HOH 147 547 562 HOH HOH A . 
C 3 HOH 148 548 518 HOH HOH A . 
C 3 HOH 149 549 547 HOH HOH A . 
C 3 HOH 150 550 551 HOH HOH A . 
C 3 HOH 151 551 523 HOH HOH A . 
C 3 HOH 152 552 552 HOH HOH A . 
C 3 HOH 153 553 542 HOH HOH A . 
C 3 HOH 154 554 531 HOH HOH A . 
C 3 HOH 155 555 559 HOH HOH A . 
C 3 HOH 156 556 548 HOH HOH A . 
C 3 HOH 157 557 586 HOH HOH A . 
C 3 HOH 158 558 563 HOH HOH A . 
C 3 HOH 159 559 585 HOH HOH A . 
C 3 HOH 160 560 546 HOH HOH A . 
C 3 HOH 161 561 550 HOH HOH A . 
C 3 HOH 162 562 545 HOH HOH A . 
C 3 HOH 163 563 567 HOH HOH A . 
C 3 HOH 164 564 569 HOH HOH A . 
C 3 HOH 165 565 557 HOH HOH A . 
C 3 HOH 166 566 561 HOH HOH A . 
C 3 HOH 167 567 588 HOH HOH A . 
C 3 HOH 168 568 564 HOH HOH A . 
C 3 HOH 169 569 566 HOH HOH A . 
C 3 HOH 170 570 576 HOH HOH A . 
C 3 HOH 171 571 558 HOH HOH A . 
C 3 HOH 172 572 572 HOH HOH A . 
C 3 HOH 173 573 573 HOH HOH A . 
C 3 HOH 174 574 575 HOH HOH A . 
C 3 HOH 175 575 580 HOH HOH A . 
C 3 HOH 176 576 574 HOH HOH A . 
C 3 HOH 177 577 532 HOH HOH A . 
C 3 HOH 178 578 582 HOH HOH A . 
C 3 HOH 179 579 560 HOH HOH A . 
C 3 HOH 180 580 590 HOH HOH A . 
C 3 HOH 181 581 587 HOH HOH A . 
C 3 HOH 182 582 589 HOH HOH A . 
C 3 HOH 183 583 570 HOH HOH A . 
C 3 HOH 184 584 571 HOH HOH A . 
C 3 HOH 185 585 598 HOH HOH A . 
C 3 HOH 186 586 606 HOH HOH A . 
C 3 HOH 187 587 565 HOH HOH A . 
C 3 HOH 188 588 584 HOH HOH A . 
C 3 HOH 189 589 597 HOH HOH A . 
C 3 HOH 190 590 603 HOH HOH A . 
C 3 HOH 191 591 592 HOH HOH A . 
C 3 HOH 192 592 579 HOH HOH A . 
C 3 HOH 193 593 596 HOH HOH A . 
C 3 HOH 194 594 593 HOH HOH A . 
C 3 HOH 195 595 595 HOH HOH A . 
C 3 HOH 196 596 604 HOH HOH A . 
C 3 HOH 197 597 581 HOH HOH A . 
C 3 HOH 198 598 599 HOH HOH A . 
C 3 HOH 199 599 601 HOH HOH A . 
C 3 HOH 200 600 577 HOH HOH A . 
C 3 HOH 201 601 568 HOH HOH A . 
C 3 HOH 202 602 600 HOH HOH A . 
C 3 HOH 203 603 605 HOH HOH A . 
C 3 HOH 204 604 594 HOH HOH A . 
C 3 HOH 205 605 591 HOH HOH A . 
C 3 HOH 206 606 602 HOH HOH A . 
C 3 HOH 207 607 610 HOH HOH A . 
C 3 HOH 208 608 611 HOH HOH A . 
C 3 HOH 209 609 617 HOH HOH A . 
C 3 HOH 210 610 612 HOH HOH A . 
C 3 HOH 211 611 607 HOH HOH A . 
C 3 HOH 212 612 613 HOH HOH A . 
C 3 HOH 213 613 615 HOH HOH A . 
C 3 HOH 214 614 614 HOH HOH A . 
C 3 HOH 215 615 618 HOH HOH A . 
C 3 HOH 216 616 642 HOH HOH A . 
C 3 HOH 217 617 620 HOH HOH A . 
C 3 HOH 218 618 609 HOH HOH A . 
C 3 HOH 219 619 608 HOH HOH A . 
C 3 HOH 220 620 619 HOH HOH A . 
C 3 HOH 221 621 621 HOH HOH A . 
C 3 HOH 222 622 625 HOH HOH A . 
C 3 HOH 223 623 616 HOH HOH A . 
C 3 HOH 224 624 624 HOH HOH A . 
C 3 HOH 225 625 626 HOH HOH A . 
C 3 HOH 226 626 630 HOH HOH A . 
C 3 HOH 227 627 627 HOH HOH A . 
C 3 HOH 228 628 623 HOH HOH A . 
C 3 HOH 229 629 628 HOH HOH A . 
C 3 HOH 230 630 635 HOH HOH A . 
C 3 HOH 231 631 629 HOH HOH A . 
C 3 HOH 232 632 634 HOH HOH A . 
C 3 HOH 233 633 631 HOH HOH A . 
C 3 HOH 234 634 636 HOH HOH A . 
C 3 HOH 235 635 637 HOH HOH A . 
C 3 HOH 236 636 646 HOH HOH A . 
C 3 HOH 237 637 622 HOH HOH A . 
C 3 HOH 238 638 632 HOH HOH A . 
C 3 HOH 239 639 638 HOH HOH A . 
C 3 HOH 240 640 639 HOH HOH A . 
C 3 HOH 241 641 640 HOH HOH A . 
C 3 HOH 242 642 645 HOH HOH A . 
C 3 HOH 243 643 633 HOH HOH A . 
C 3 HOH 244 644 641 HOH HOH A . 
C 3 HOH 245 645 651 HOH HOH A . 
C 3 HOH 246 646 647 HOH HOH A . 
C 3 HOH 247 647 650 HOH HOH A . 
C 3 HOH 248 648 655 HOH HOH A . 
C 3 HOH 249 649 654 HOH HOH A . 
C 3 HOH 250 650 662 HOH HOH A . 
C 3 HOH 251 651 653 HOH HOH A . 
C 3 HOH 252 652 652 HOH HOH A . 
C 3 HOH 253 653 648 HOH HOH A . 
C 3 HOH 254 654 656 HOH HOH A . 
C 3 HOH 255 655 643 HOH HOH A . 
C 3 HOH 256 656 660 HOH HOH A . 
C 3 HOH 257 657 665 HOH HOH A . 
C 3 HOH 258 658 658 HOH HOH A . 
C 3 HOH 259 659 644 HOH HOH A . 
C 3 HOH 260 660 657 HOH HOH A . 
C 3 HOH 261 661 661 HOH HOH A . 
C 3 HOH 262 662 667 HOH HOH A . 
C 3 HOH 263 663 649 HOH HOH A . 
C 3 HOH 264 664 675 HOH HOH A . 
C 3 HOH 265 665 670 HOH HOH A . 
C 3 HOH 266 666 664 HOH HOH A . 
C 3 HOH 267 667 659 HOH HOH A . 
C 3 HOH 268 668 663 HOH HOH A . 
C 3 HOH 269 669 674 HOH HOH A . 
C 3 HOH 270 670 668 HOH HOH A . 
C 3 HOH 271 671 669 HOH HOH A . 
C 3 HOH 272 672 672 HOH HOH A . 
C 3 HOH 273 673 671 HOH HOH A . 
C 3 HOH 274 674 666 HOH HOH A . 
C 3 HOH 275 675 673 HOH HOH A . 
C 3 HOH 276 676 681 HOH HOH A . 
C 3 HOH 277 677 676 HOH HOH A . 
C 3 HOH 278 678 677 HOH HOH A . 
C 3 HOH 279 679 679 HOH HOH A . 
C 3 HOH 280 680 680 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7160  ? 
1 MORE         -27   ? 
1 'SSA (A^2)'  20990 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z     1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000 
2 'crystal symmetry operation' 5_555 x-y,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 413 ? C HOH . 
2 1 A HOH 648 ? C HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-07-15 
2 'Structure model' 1 1 2015-07-29 
3 'Structure model' 1 2 2015-08-19 
4 'Structure model' 1 3 2020-02-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Database references'  
3 4 'Structure model' 'Data collection'      
4 4 'Structure model' 'Database references'  
5 4 'Structure model' 'Derived calculations' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' citation              
2 4 'Structure model' diffrn_source         
3 4 'Structure model' pdbx_struct_oper_list 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_citation.journal_id_CSD'                  
2 4 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
3 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.7_650 1 
? 'data processing' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .       2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .       3 
? 'model building'  ? ? ? ? ? ? ? ? ? ? ? Coot     ? ? ? .       4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 426 ? ? O A HOH 577 ? ? 2.06 
2 1 O A HOH 431 ? ? O A HOH 545 ? ? 2.15 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O   A HOH 613 ? ? 1_555 O  A HOH 637 ? ? 5_555  2.17 
2 1 O   A HOH 407 ? ? 1_555 O  A HOH 600 ? ? 18_654 2.18 
3 1 OE1 A GLN 90  ? ? 1_555 OG A SER 170 ? ? 5_555  2.19 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_1              146 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             SD 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_2              146 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CE 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             MET 
_pdbx_validate_rmsd_angle.auth_seq_id_3              146 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                89.77 
_pdbx_validate_rmsd_angle.angle_target_value         100.20 
_pdbx_validate_rmsd_angle.angle_deviation            -10.43 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.60 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TYR A 115 ? ? 59.94 -138.96 
2 1 PHE A 171 ? ? 73.22 -9.25   
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       680 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.82 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1   
2  1 Y 1 A GLY -18 ? A GLY 2   
3  1 Y 1 A SER -17 ? A SER 3   
4  1 Y 1 A SER -16 ? A SER 4   
5  1 Y 1 A HIS -15 ? A HIS 5   
6  1 Y 1 A HIS -14 ? A HIS 6   
7  1 Y 1 A HIS -13 ? A HIS 7   
8  1 Y 1 A HIS -12 ? A HIS 8   
9  1 Y 1 A HIS -11 ? A HIS 9   
10 1 Y 1 A HIS -10 ? A HIS 10  
11 1 Y 1 A SER -9  ? A SER 11  
12 1 Y 1 A SER -8  ? A SER 12  
13 1 Y 1 A GLY -7  ? A GLY 13  
14 1 Y 1 A LEU -6  ? A LEU 14  
15 1 Y 1 A VAL -5  ? A VAL 15  
16 1 Y 1 A PRO -4  ? A PRO 16  
17 1 Y 1 A ARG -3  ? A ARG 17  
18 1 Y 1 A GLY -2  ? A GLY 18  
19 1 Y 1 A SER -1  ? A SER 19  
20 1 Y 1 A GLY 161 ? A GLY 181 
21 1 Y 1 A LYS 162 ? A LYS 182 
22 1 Y 1 A GLN 163 ? A GLN 183 
23 1 Y 1 A ALA 164 ? A ALA 184 
24 1 Y 1 A SER 165 ? A SER 185 
25 1 Y 1 A ALA 166 ? A ALA 186 
26 1 Y 1 A GLU 167 ? A GLU 187 
27 1 Y 1 A GLU 168 ? A GLU 188 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 S-ADENOSYLMETHIONINE SAM 
3 water                HOH 
#