data_4YXH
# 
_entry.id   4YXH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YXH         
WWPDB D_1000208247 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4YX2 unspecified 
PDB . 4YXK unspecified 
PDB . 4YXL unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YXH 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Baral, P.K.'      1 
'Swayampakula, M.' 2 
'James, M.N.G.'    3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Struct.Biol. 
_citation.journal_id_ASTM           JSBIEM 
_citation.journal_id_CSD            0803 
_citation.journal_id_ISSN           1095-8657 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            192 
_citation.language                  ? 
_citation.page_first                37 
_citation.page_last                 47 
_citation.title                     
'X-ray structural and molecular dynamical studies of the globular domains of cow, deer, elk and Syrian hamster prion proteins.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jsb.2015.08.014 
_citation.pdbx_database_id_PubMed   26320075 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Baral, P.K.'      1 
primary 'Swayampakula, M.' 2 
primary 'Aguzzi, A.'       3 
primary 'James, M.N.'      4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   95.81 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4YXH 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     84.282 
_cell.length_a_esd                 ? 
_cell.length_b                     106.580 
_cell.length_b_esd                 ? 
_cell.length_c                     75.775 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4YXH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Major prion protein'  15957.789 1  ? ? ? ? 
2 polymer     man 'POM1 FAB HEAVY CHAIN' 23397.078 1  ? ? ? ? 
3 polymer     man 'POM1 FAB LIGHT CHAIN' 23509.701 1  ? ? ? ? 
4 non-polymer syn 'SODIUM ION'           22.990    1  ? ? ? ? 
5 water       nat water                  18.015    77 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PrP 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSSHHHHHHSSGLVPRGSHMLEDPHMVVGGLGGYMLGSAMNRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQN
TFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQR
;
;MGSSHHHHHHSSGLVPRGSHMLEDPHMVVGGLGGYMLGSAMNRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQN
TFVHDCVNITVKQHTVTTTTKGENFTETDIKMMERVVEQMCITQYQRESQAYYQR
;
A ? 
2 'polypeptide(L)' no no 
;QVQLQQSGTELVMPGASVKMSCKASGYTFTDYWMHWVKQRPGQGLEWIGSIDPSDSYTSHNEKFKGKATLTVDESSSTAY
MQLSSLTSEDSAVYFCSRSGYGYYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWN
SGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
;
;QVQLQQSGTELVMPGASVKMSCKASGYTFTDYWMHWVKQRPGQGLEWIGSIDPSDSYTSHNEKFKGKATLTVDESSSTAY
MQLSSLTSEDSAVYFCSRSGYGYYAMEYWGQGTSVTVSSAKTTPPSVYPLAPGGGATNSMVTLGCLVKGYFPEPVTVTWN
SGSLSGGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
;
H ? 
3 'polypeptide(L)' no no 
;DIVLTQSPAILSVSPGERVSFSCRASQNIGTSIHWYQQRTNESPRLIIKYASESISGIPSRFSGSGSGTDFTLSINSVES
EDIADYYCQQSNTWPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE
;
;DIVLTQSPAILSVSPGERVSFSCRASQNIGTSIHWYQQRTNESPRLIIKYASESISGIPSRFSGSGSGTDFTLSINSVES
EDIADYYCQQSNTWPYTFGGGTKLELKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVL
NSETDQDSKDSTYSMSSTLTLTKDEYERHNTYTCEATHKTSTSPIVKSFNRNE
;
L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  LEU n 
1 23  GLU n 
1 24  ASP n 
1 25  PRO n 
1 26  HIS n 
1 27  MET n 
1 28  VAL n 
1 29  VAL n 
1 30  GLY n 
1 31  GLY n 
1 32  LEU n 
1 33  GLY n 
1 34  GLY n 
1 35  TYR n 
1 36  MET n 
1 37  LEU n 
1 38  GLY n 
1 39  SER n 
1 40  ALA n 
1 41  MET n 
1 42  ASN n 
1 43  ARG n 
1 44  PRO n 
1 45  LEU n 
1 46  ILE n 
1 47  HIS n 
1 48  PHE n 
1 49  GLY n 
1 50  ASN n 
1 51  ASP n 
1 52  TYR n 
1 53  GLU n 
1 54  ASP n 
1 55  ARG n 
1 56  TYR n 
1 57  TYR n 
1 58  ARG n 
1 59  GLU n 
1 60  ASN n 
1 61  MET n 
1 62  TYR n 
1 63  ARG n 
1 64  TYR n 
1 65  PRO n 
1 66  ASN n 
1 67  GLN n 
1 68  VAL n 
1 69  TYR n 
1 70  TYR n 
1 71  ARG n 
1 72  PRO n 
1 73  VAL n 
1 74  ASP n 
1 75  GLN n 
1 76  TYR n 
1 77  ASN n 
1 78  ASN n 
1 79  GLN n 
1 80  ASN n 
1 81  THR n 
1 82  PHE n 
1 83  VAL n 
1 84  HIS n 
1 85  ASP n 
1 86  CYS n 
1 87  VAL n 
1 88  ASN n 
1 89  ILE n 
1 90  THR n 
1 91  VAL n 
1 92  LYS n 
1 93  GLN n 
1 94  HIS n 
1 95  THR n 
1 96  VAL n 
1 97  THR n 
1 98  THR n 
1 99  THR n 
1 100 THR n 
1 101 LYS n 
1 102 GLY n 
1 103 GLU n 
1 104 ASN n 
1 105 PHE n 
1 106 THR n 
1 107 GLU n 
1 108 THR n 
1 109 ASP n 
1 110 ILE n 
1 111 LYS n 
1 112 MET n 
1 113 MET n 
1 114 GLU n 
1 115 ARG n 
1 116 VAL n 
1 117 VAL n 
1 118 GLU n 
1 119 GLN n 
1 120 MET n 
1 121 CYS n 
1 122 ILE n 
1 123 THR n 
1 124 GLN n 
1 125 TYR n 
1 126 GLN n 
1 127 ARG n 
1 128 GLU n 
1 129 SER n 
1 130 GLN n 
1 131 ALA n 
1 132 TYR n 
1 133 TYR n 
1 134 GLN n 
1 135 ARG n 
2 1   GLN n 
2 2   VAL n 
2 3   GLN n 
2 4   LEU n 
2 5   GLN n 
2 6   GLN n 
2 7   SER n 
2 8   GLY n 
2 9   THR n 
2 10  GLU n 
2 11  LEU n 
2 12  VAL n 
2 13  MET n 
2 14  PRO n 
2 15  GLY n 
2 16  ALA n 
2 17  SER n 
2 18  VAL n 
2 19  LYS n 
2 20  MET n 
2 21  SER n 
2 22  CYS n 
2 23  LYS n 
2 24  ALA n 
2 25  SER n 
2 26  GLY n 
2 27  TYR n 
2 28  THR n 
2 29  PHE n 
2 30  THR n 
2 31  ASP n 
2 32  TYR n 
2 33  TRP n 
2 34  MET n 
2 35  HIS n 
2 36  TRP n 
2 37  VAL n 
2 38  LYS n 
2 39  GLN n 
2 40  ARG n 
2 41  PRO n 
2 42  GLY n 
2 43  GLN n 
2 44  GLY n 
2 45  LEU n 
2 46  GLU n 
2 47  TRP n 
2 48  ILE n 
2 49  GLY n 
2 50  SER n 
2 51  ILE n 
2 52  ASP n 
2 53  PRO n 
2 54  SER n 
2 55  ASP n 
2 56  SER n 
2 57  TYR n 
2 58  THR n 
2 59  SER n 
2 60  HIS n 
2 61  ASN n 
2 62  GLU n 
2 63  LYS n 
2 64  PHE n 
2 65  LYS n 
2 66  GLY n 
2 67  LYS n 
2 68  ALA n 
2 69  THR n 
2 70  LEU n 
2 71  THR n 
2 72  VAL n 
2 73  ASP n 
2 74  GLU n 
2 75  SER n 
2 76  SER n 
2 77  SER n 
2 78  THR n 
2 79  ALA n 
2 80  TYR n 
2 81  MET n 
2 82  GLN n 
2 83  LEU n 
2 84  SER n 
2 85  SER n 
2 86  LEU n 
2 87  THR n 
2 88  SER n 
2 89  GLU n 
2 90  ASP n 
2 91  SER n 
2 92  ALA n 
2 93  VAL n 
2 94  TYR n 
2 95  PHE n 
2 96  CYS n 
2 97  SER n 
2 98  ARG n 
2 99  SER n 
2 100 GLY n 
2 101 TYR n 
2 102 GLY n 
2 103 TYR n 
2 104 TYR n 
2 105 ALA n 
2 106 MET n 
2 107 GLU n 
2 108 TYR n 
2 109 TRP n 
2 110 GLY n 
2 111 GLN n 
2 112 GLY n 
2 113 THR n 
2 114 SER n 
2 115 VAL n 
2 116 THR n 
2 117 VAL n 
2 118 SER n 
2 119 SER n 
2 120 ALA n 
2 121 LYS n 
2 122 THR n 
2 123 THR n 
2 124 PRO n 
2 125 PRO n 
2 126 SER n 
2 127 VAL n 
2 128 TYR n 
2 129 PRO n 
2 130 LEU n 
2 131 ALA n 
2 132 PRO n 
2 133 GLY n 
2 134 GLY n 
2 135 GLY n 
2 136 ALA n 
2 137 THR n 
2 138 ASN n 
2 139 SER n 
2 140 MET n 
2 141 VAL n 
2 142 THR n 
2 143 LEU n 
2 144 GLY n 
2 145 CYS n 
2 146 LEU n 
2 147 VAL n 
2 148 LYS n 
2 149 GLY n 
2 150 TYR n 
2 151 PHE n 
2 152 PRO n 
2 153 GLU n 
2 154 PRO n 
2 155 VAL n 
2 156 THR n 
2 157 VAL n 
2 158 THR n 
2 159 TRP n 
2 160 ASN n 
2 161 SER n 
2 162 GLY n 
2 163 SER n 
2 164 LEU n 
2 165 SER n 
2 166 GLY n 
2 167 GLY n 
2 168 VAL n 
2 169 HIS n 
2 170 THR n 
2 171 PHE n 
2 172 PRO n 
2 173 ALA n 
2 174 VAL n 
2 175 LEU n 
2 176 GLN n 
2 177 SER n 
2 178 ASP n 
2 179 LEU n 
2 180 TYR n 
2 181 THR n 
2 182 LEU n 
2 183 SER n 
2 184 SER n 
2 185 SER n 
2 186 VAL n 
2 187 THR n 
2 188 VAL n 
2 189 PRO n 
2 190 SER n 
2 191 SER n 
2 192 THR n 
2 193 TRP n 
2 194 PRO n 
2 195 SER n 
2 196 GLU n 
2 197 THR n 
2 198 VAL n 
2 199 THR n 
2 200 CYS n 
2 201 ASN n 
2 202 VAL n 
2 203 ALA n 
2 204 HIS n 
2 205 PRO n 
2 206 ALA n 
2 207 SER n 
2 208 SER n 
2 209 THR n 
2 210 LYS n 
2 211 VAL n 
2 212 ASP n 
2 213 LYS n 
2 214 LYS n 
2 215 ILE n 
2 216 VAL n 
2 217 PRO n 
2 218 ARG n 
3 1   ASP n 
3 2   ILE n 
3 3   VAL n 
3 4   LEU n 
3 5   THR n 
3 6   GLN n 
3 7   SER n 
3 8   PRO n 
3 9   ALA n 
3 10  ILE n 
3 11  LEU n 
3 12  SER n 
3 13  VAL n 
3 14  SER n 
3 15  PRO n 
3 16  GLY n 
3 17  GLU n 
3 18  ARG n 
3 19  VAL n 
3 20  SER n 
3 21  PHE n 
3 22  SER n 
3 23  CYS n 
3 24  ARG n 
3 25  ALA n 
3 26  SER n 
3 27  GLN n 
3 28  ASN n 
3 29  ILE n 
3 30  GLY n 
3 31  THR n 
3 32  SER n 
3 33  ILE n 
3 34  HIS n 
3 35  TRP n 
3 36  TYR n 
3 37  GLN n 
3 38  GLN n 
3 39  ARG n 
3 40  THR n 
3 41  ASN n 
3 42  GLU n 
3 43  SER n 
3 44  PRO n 
3 45  ARG n 
3 46  LEU n 
3 47  ILE n 
3 48  ILE n 
3 49  LYS n 
3 50  TYR n 
3 51  ALA n 
3 52  SER n 
3 53  GLU n 
3 54  SER n 
3 55  ILE n 
3 56  SER n 
3 57  GLY n 
3 58  ILE n 
3 59  PRO n 
3 60  SER n 
3 61  ARG n 
3 62  PHE n 
3 63  SER n 
3 64  GLY n 
3 65  SER n 
3 66  GLY n 
3 67  SER n 
3 68  GLY n 
3 69  THR n 
3 70  ASP n 
3 71  PHE n 
3 72  THR n 
3 73  LEU n 
3 74  SER n 
3 75  ILE n 
3 76  ASN n 
3 77  SER n 
3 78  VAL n 
3 79  GLU n 
3 80  SER n 
3 81  GLU n 
3 82  ASP n 
3 83  ILE n 
3 84  ALA n 
3 85  ASP n 
3 86  TYR n 
3 87  TYR n 
3 88  CYS n 
3 89  GLN n 
3 90  GLN n 
3 91  SER n 
3 92  ASN n 
3 93  THR n 
3 94  TRP n 
3 95  PRO n 
3 96  TYR n 
3 97  THR n 
3 98  PHE n 
3 99  GLY n 
3 100 GLY n 
3 101 GLY n 
3 102 THR n 
3 103 LYS n 
3 104 LEU n 
3 105 GLU n 
3 106 LEU n 
3 107 LYS n 
3 108 ARG n 
3 109 ALA n 
3 110 ASP n 
3 111 ALA n 
3 112 ALA n 
3 113 PRO n 
3 114 THR n 
3 115 VAL n 
3 116 SER n 
3 117 ILE n 
3 118 PHE n 
3 119 PRO n 
3 120 PRO n 
3 121 SER n 
3 122 SER n 
3 123 GLU n 
3 124 GLN n 
3 125 LEU n 
3 126 THR n 
3 127 SER n 
3 128 GLY n 
3 129 GLY n 
3 130 ALA n 
3 131 SER n 
3 132 VAL n 
3 133 VAL n 
3 134 CYS n 
3 135 PHE n 
3 136 LEU n 
3 137 ASN n 
3 138 ASN n 
3 139 PHE n 
3 140 TYR n 
3 141 PRO n 
3 142 LYS n 
3 143 ASP n 
3 144 ILE n 
3 145 ASN n 
3 146 VAL n 
3 147 LYS n 
3 148 TRP n 
3 149 LYS n 
3 150 ILE n 
3 151 ASP n 
3 152 GLY n 
3 153 SER n 
3 154 GLU n 
3 155 ARG n 
3 156 GLN n 
3 157 ASN n 
3 158 GLY n 
3 159 VAL n 
3 160 LEU n 
3 161 ASN n 
3 162 SER n 
3 163 GLU n 
3 164 THR n 
3 165 ASP n 
3 166 GLN n 
3 167 ASP n 
3 168 SER n 
3 169 LYS n 
3 170 ASP n 
3 171 SER n 
3 172 THR n 
3 173 TYR n 
3 174 SER n 
3 175 MET n 
3 176 SER n 
3 177 SER n 
3 178 THR n 
3 179 LEU n 
3 180 THR n 
3 181 LEU n 
3 182 THR n 
3 183 LYS n 
3 184 ASP n 
3 185 GLU n 
3 186 TYR n 
3 187 GLU n 
3 188 ARG n 
3 189 HIS n 
3 190 ASN n 
3 191 THR n 
3 192 TYR n 
3 193 THR n 
3 194 CYS n 
3 195 GLU n 
3 196 ALA n 
3 197 THR n 
3 198 HIS n 
3 199 LYS n 
3 200 THR n 
3 201 SER n 
3 202 THR n 
3 203 SER n 
3 204 PRO n 
3 205 ILE n 
3 206 VAL n 
3 207 LYS n 
3 208 SER n 
3 209 PHE n 
3 210 ASN n 
3 211 ARG n 
3 212 ASN n 
3 213 GLU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 135 'Mule deer' ? 'PRNP, PRP' ? ? ? ? ? ? 'Odocoileus hemionus' 9872  ? ? ? ? ? ? ? ? 
'Escherichia coli' 562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 218 ?           ? ?           ? ? ? ? ? ? 'Mus musculus'        10090 ? ? ? ? ? ? ? ? 
'Mus musculus'     10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 213 ?           ? ?           ? ? ? ? ? ? 'Mus musculus'        10090 ? ? ? ? ? ? ? ? 
'Mus musculus'     10090 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.db_code 
_struct_ref.db_name 
_struct_ref.details 
_struct_ref.entity_id 
_struct_ref.id 
_struct_ref.seq_align 
_struct_ref.seq_dif 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_align_end 
PRIO_ODOHE UNP ? 1 1 ? ? P47852 ? 
;VVGGLGGYMLGSAMNRPLIHFGNDYEDRYYRENMYRYPNQVYYRPVDQYNNQNTFVHDCVNITVKQHTVTTTTKGENFTE
TDIKMMERVVEQMCITQYQRESQAYYQR
;
124 ? 
4YXH       PDB ? 2 2 ? ? 4YXH   ? ? 1   ? 
4YXH       PDB ? 3 3 ? ? 4YXH   ? ? 1   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YXH A 28 ? 135 ? P47852 124 ? 231 ? 113 220 
2 2 4YXH H 1  ? 218 ? 4YXH   1   ? 218 ? 1   218 
3 3 4YXH L 1  ? 213 ? 4YXH   1   ? 213 ? 1   213 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4YXH MET A 1  ? UNP P47852 ? ? 'expression tag' 86  1  
1 4YXH GLY A 2  ? UNP P47852 ? ? 'expression tag' 87  2  
1 4YXH SER A 3  ? UNP P47852 ? ? 'expression tag' 88  3  
1 4YXH SER A 4  ? UNP P47852 ? ? 'expression tag' 89  4  
1 4YXH HIS A 5  ? UNP P47852 ? ? 'expression tag' 90  5  
1 4YXH HIS A 6  ? UNP P47852 ? ? 'expression tag' 91  6  
1 4YXH HIS A 7  ? UNP P47852 ? ? 'expression tag' 92  7  
1 4YXH HIS A 8  ? UNP P47852 ? ? 'expression tag' 93  8  
1 4YXH HIS A 9  ? UNP P47852 ? ? 'expression tag' 94  9  
1 4YXH HIS A 10 ? UNP P47852 ? ? 'expression tag' 95  10 
1 4YXH SER A 11 ? UNP P47852 ? ? 'expression tag' 96  11 
1 4YXH SER A 12 ? UNP P47852 ? ? 'expression tag' 97  12 
1 4YXH GLY A 13 ? UNP P47852 ? ? 'expression tag' 98  13 
1 4YXH LEU A 14 ? UNP P47852 ? ? 'expression tag' 99  14 
1 4YXH VAL A 15 ? UNP P47852 ? ? 'expression tag' 100 15 
1 4YXH PRO A 16 ? UNP P47852 ? ? 'expression tag' 101 16 
1 4YXH ARG A 17 ? UNP P47852 ? ? 'expression tag' 102 17 
1 4YXH GLY A 18 ? UNP P47852 ? ? 'expression tag' 103 18 
1 4YXH SER A 19 ? UNP P47852 ? ? 'expression tag' 104 19 
1 4YXH HIS A 20 ? UNP P47852 ? ? 'expression tag' 105 20 
1 4YXH MET A 21 ? UNP P47852 ? ? 'expression tag' 106 21 
1 4YXH LEU A 22 ? UNP P47852 ? ? 'expression tag' 107 22 
1 4YXH GLU A 23 ? UNP P47852 ? ? 'expression tag' 108 23 
1 4YXH ASP A 24 ? UNP P47852 ? ? 'expression tag' 109 24 
1 4YXH PRO A 25 ? UNP P47852 ? ? 'expression tag' 110 25 
1 4YXH HIS A 26 ? UNP P47852 ? ? 'expression tag' 111 26 
1 4YXH MET A 27 ? UNP P47852 ? ? 'expression tag' 112 27 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YXH 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.82 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         56.43 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '25% PEG3350, 0.1 M BIS-TRIS, 0.2 M lithium sulphate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-03-31 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97945 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL9-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97945 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL9-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4YXH 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.7 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       18203 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.8 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.12 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            10 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.7 
_reflns_shell.d_res_low                   2.8 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.8 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.9 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4YXH 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.700 
_refine.ls_d_res_low                             38.326 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     18042 
_refine.ls_number_reflns_R_free                  920 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.33 
_refine.ls_percent_reflns_R_free                 5.10 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2449 
_refine.ls_R_factor_R_free                       0.2879 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2425 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.38 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '4H88, 4DGI' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 31.86 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.45 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4145 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               4223 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        38.326 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.019  ? 4250 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 2.652  ? 5774 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.817 ? 1532 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.120  ? 635  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.014  ? 744  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7001 2.8424  . . 136 2438 99.00 . . . 0.3966 . 0.3121 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8424 3.0205  . . 113 2439 98.00 . . . 0.3097 . 0.2751 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0205 3.2536  . . 127 2419 97.00 . . . 0.2795 . 0.2550 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2536 3.5808  . . 133 2458 99.00 . . . 0.3119 . 0.2350 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5808 4.0984  . . 142 2446 99.00 . . . 0.2935 . 0.2356 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0984 5.1615  . . 136 2415 97.00 . . . 0.2611 . 0.2141 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.1615 38.3294 . . 133 2507 99.00 . . . 0.2730 . 0.2507 . . . . . . . . . . 
# 
_struct.entry_id                     4YXH 
_struct.title                        'Crystal structure of Deer prion protein complexed with POM1 FAB' 
_struct.pdbx_descriptor              'Deer prion protein, POM1 FAB CHAIN H, POM1 FAB CHAIN L' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YXH 
_struct_keywords.text            'prion, antibody, Immune system complex, IMMUNE SYSTEM' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 50  ? MET A 61  ? ASN A 135 MET A 146 1 ? 12 
HELX_P HELX_P2  AA2 TYR A 62  ? TYR A 64  ? TYR A 147 TYR A 149 5 ? 3  
HELX_P HELX_P3  AA3 PRO A 72  ? TYR A 76  ? PRO A 157 TYR A 161 5 ? 5  
HELX_P HELX_P4  AA4 ASN A 78  ? LYS A 101 ? ASN A 163 LYS A 186 1 ? 24 
HELX_P HELX_P5  AA5 THR A 106 ? GLN A 130 ? THR A 191 GLN A 215 1 ? 25 
HELX_P HELX_P6  AA6 THR B 28  ? TYR B 32  ? THR H 28  TYR H 32  5 ? 5  
HELX_P HELX_P7  AA7 GLU B 62  ? LYS B 65  ? GLU H 62  LYS H 65  5 ? 4  
HELX_P HELX_P8  AA8 GLU B 74  ? SER B 76  ? GLU H 74  SER H 76  5 ? 3  
HELX_P HELX_P9  AA9 THR B 87  ? SER B 91  ? THR H 87  SER H 91  5 ? 5  
HELX_P HELX_P10 AB1 PRO B 205 ? SER B 208 ? PRO H 205 SER H 208 5 ? 4  
HELX_P HELX_P11 AB2 GLU C 79  ? ILE C 83  ? GLU L 79  ILE L 83  5 ? 5  
HELX_P HELX_P12 AB3 SER C 121 ? SER C 127 ? SER L 121 SER L 127 1 ? 7  
HELX_P HELX_P13 AB4 LYS C 183 ? ARG C 188 ? LYS L 183 ARG L 188 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 86  SG  ? ? ? 1_555 A CYS 121 SG ? ? A CYS 171 A CYS 206 1_555 ? ? ? ? ? ? ? 2.069 ? 
disulf2 disulf ? ? B CYS 22  SG  ? ? ? 1_555 B CYS 96  SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.074 ? 
disulf3 disulf ? ? B CYS 145 SG  ? ? ? 1_555 B CYS 200 SG ? ? H CYS 145 H CYS 200 1_555 ? ? ? ? ? ? ? 2.618 ? 
disulf4 disulf ? ? C CYS 23  SG  ? ? ? 1_555 C CYS 88  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.065 ? 
metalc1 metalc ? ? C GLU 79  OE1 ? ? ? 1_555 D NA  .   NA ? ? L GLU 79  L NA  301 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc2 metalc ? ? C GLU 79  OE2 ? ? ? 1_555 D NA  .   NA ? ? L GLU 79  L NA  301 1_555 ? ? ? ? ? ? ? 2.881 ? 
metalc3 metalc ? ? B SER 191 O   ? ? ? 1_555 D NA  .   NA ? ? H SER 191 L NA  301 2_655 ? ? ? ? ? ? ? 1.904 ? 
metalc4 metalc ? ? B SER 195 OG  ? ? ? 1_555 D NA  .   NA ? ? H SER 195 L NA  301 2_655 ? ? ? ? ? ? ? 2.904 ? 
metalc5 metalc ? ? B GLU 196 OE1 ? ? ? 1_555 D NA  .   NA ? ? H GLU 196 L NA  301 2_655 ? ? ? ? ? ? ? 2.330 ? 
metalc6 metalc ? ? B GLU 196 OE2 ? ? ? 1_555 D NA  .   NA ? ? H GLU 196 L NA  301 2_655 ? ? ? ? ? ? ? 1.942 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 151 B . ? PHE 151 H PRO 152 B ? PRO 152 H 1 -2.14 
2 GLU 153 B . ? GLU 153 H PRO 154 B ? PRO 154 H 1 0.99  
3 TRP 193 B . ? TRP 193 H PRO 194 B ? PRO 194 H 1 5.25  
4 SER 7   C . ? SER 7   L PRO 8   C ? PRO 8   L 1 -9.17 
5 TRP 94  C . ? TRP 94  L PRO 95  C ? PRO 95  L 1 -5.41 
6 TYR 140 C . ? TYR 140 L PRO 141 C ? PRO 141 L 1 1.77  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 4 ? 
AA3 ? 6 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 3 ? 
AA8 ? 4 ? 
AA9 ? 5 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
AB3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 36  ? LEU A 37  ? MET A 121 LEU A 122 
AA1 2 TYR A 69  ? TYR A 70  ? TYR A 154 TYR A 155 
AA2 1 GLN B 3   ? GLN B 5   ? GLN H 3   GLN H 5   
AA2 2 VAL B 18  ? SER B 25  ? VAL H 18  SER H 25  
AA2 3 THR B 78  ? LEU B 83  ? THR H 78  LEU H 83  
AA2 4 ALA B 68  ? ASP B 73  ? ALA H 68  ASP H 73  
AA3 1 THR B 9   ? VAL B 12  ? THR H 9   VAL H 12  
AA3 2 THR B 113 ? VAL B 117 ? THR H 113 VAL H 117 
AA3 3 ALA B 92  ? SER B 99  ? ALA H 92  SER H 99  
AA3 4 MET B 34  ? GLN B 39  ? MET H 34  GLN H 39  
AA3 5 LEU B 45  ? ILE B 51  ? LEU H 45  ILE H 51  
AA3 6 THR B 58  ? HIS B 60  ? THR H 58  HIS H 60  
AA4 1 THR B 9   ? VAL B 12  ? THR H 9   VAL H 12  
AA4 2 THR B 113 ? VAL B 117 ? THR H 113 VAL H 117 
AA4 3 ALA B 92  ? SER B 99  ? ALA H 92  SER H 99  
AA4 4 MET B 106 ? TRP B 109 ? MET H 106 TRP H 109 
AA5 1 SER B 126 ? LEU B 130 ? SER H 126 LEU H 130 
AA5 2 MET B 140 ? TYR B 150 ? MET H 140 TYR H 150 
AA5 3 LEU B 179 ? PRO B 189 ? LEU H 179 PRO H 189 
AA5 4 GLY B 167 ? THR B 170 ? GLY H 167 THR H 170 
AA6 1 SER B 126 ? LEU B 130 ? SER H 126 LEU H 130 
AA6 2 MET B 140 ? TYR B 150 ? MET H 140 TYR H 150 
AA6 3 LEU B 179 ? PRO B 189 ? LEU H 179 PRO H 189 
AA6 4 VAL B 174 ? GLN B 176 ? VAL H 174 GLN H 176 
AA7 1 THR B 156 ? TRP B 159 ? THR H 156 TRP H 159 
AA7 2 THR B 199 ? HIS B 204 ? THR H 199 HIS H 204 
AA7 3 THR B 209 ? LYS B 214 ? THR H 209 LYS H 214 
AA8 1 LEU C 4   ? SER C 7   ? LEU L 4   SER L 7   
AA8 2 VAL C 19  ? ALA C 25  ? VAL L 19  ALA L 25  
AA8 3 ASP C 70  ? ILE C 75  ? ASP L 70  ILE L 75  
AA8 4 PHE C 62  ? GLY C 66  ? PHE L 62  GLY L 66  
AA9 1 ILE C 10  ? VAL C 13  ? ILE L 10  VAL L 13  
AA9 2 THR C 102 ? LEU C 106 ? THR L 102 LEU L 106 
AA9 3 ASP C 85  ? GLN C 90  ? ASP L 85  GLN L 90  
AA9 4 ILE C 33  ? GLN C 38  ? ILE L 33  GLN L 38  
AA9 5 ARG C 45  ? ILE C 48  ? ARG L 45  ILE L 48  
AB1 1 ILE C 10  ? VAL C 13  ? ILE L 10  VAL L 13  
AB1 2 THR C 102 ? LEU C 106 ? THR L 102 LEU L 106 
AB1 3 ASP C 85  ? GLN C 90  ? ASP L 85  GLN L 90  
AB1 4 THR C 97  ? PHE C 98  ? THR L 97  PHE L 98  
AB2 1 THR C 114 ? PHE C 118 ? THR L 114 PHE L 118 
AB2 2 GLY C 129 ? PHE C 139 ? GLY L 129 PHE L 139 
AB2 3 TYR C 173 ? THR C 182 ? TYR L 173 THR L 182 
AB2 4 VAL C 159 ? GLU C 163 ? VAL L 159 GLU L 163 
AB3 1 CYS C 194 ? GLU C 195 ? CYS L 194 GLU L 195 
AB3 2 VAL C 206 ? LYS C 207 ? VAL L 206 LYS L 207 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N MET A 36  ? N MET A 121 O TYR A 70  ? O TYR A 155 
AA2 1 2 N GLN B 5   ? N GLN H 5   O LYS B 23  ? O LYS H 23  
AA2 2 3 N CYS B 22  ? N CYS H 22  O ALA B 79  ? O ALA H 79  
AA2 3 4 O TYR B 80  ? O TYR H 80  N THR B 71  ? N THR H 71  
AA3 1 2 N GLU B 10  ? N GLU H 10  O THR B 116 ? O THR H 116 
AA3 2 3 O VAL B 115 ? O VAL H 115 N ALA B 92  ? N ALA H 92  
AA3 3 4 O VAL B 93  ? O VAL H 93  N GLN B 39  ? N GLN H 39  
AA3 4 5 N LYS B 38  ? N LYS H 38  O GLU B 46  ? O GLU H 46  
AA3 5 6 N SER B 50  ? N SER H 50  O SER B 59  ? O SER H 59  
AA4 1 2 N GLU B 10  ? N GLU H 10  O THR B 116 ? O THR H 116 
AA4 2 3 O VAL B 115 ? O VAL H 115 N ALA B 92  ? N ALA H 92  
AA4 3 4 N ARG B 98  ? N ARG H 98  O TYR B 108 ? O TYR H 108 
AA5 1 2 N TYR B 128 ? N TYR H 128 O LEU B 146 ? O LEU H 146 
AA5 2 3 N TYR B 150 ? N TYR H 150 O TYR B 180 ? O TYR H 180 
AA5 3 4 O SER B 185 ? O SER H 185 N HIS B 169 ? N HIS H 169 
AA6 1 2 N TYR B 128 ? N TYR H 128 O LEU B 146 ? O LEU H 146 
AA6 2 3 N TYR B 150 ? N TYR H 150 O TYR B 180 ? O TYR H 180 
AA6 3 4 O LEU B 179 ? O LEU H 179 N GLN B 176 ? N GLN H 176 
AA7 1 2 N THR B 156 ? N THR H 156 O ALA B 203 ? O ALA H 203 
AA7 2 3 N HIS B 204 ? N HIS H 204 O THR B 209 ? O THR H 209 
AA8 1 2 N THR C 5   ? N THR L 5   O ARG C 24  ? O ARG L 24  
AA8 2 3 N VAL C 19  ? N VAL L 19  O ILE C 75  ? O ILE L 75  
AA8 3 4 O SER C 74  ? O SER L 74  N SER C 63  ? N SER L 63  
AA9 1 2 N LEU C 11  ? N LEU L 11  O LYS C 103 ? O LYS L 103 
AA9 2 3 O THR C 102 ? O THR L 102 N TYR C 86  ? N TYR L 86  
AA9 3 4 O TYR C 87  ? O TYR L 87  N TYR C 36  ? N TYR L 36  
AA9 4 5 N TRP C 35  ? N TRP L 35  O ILE C 48  ? O ILE L 48  
AB1 1 2 N LEU C 11  ? N LEU L 11  O LYS C 103 ? O LYS L 103 
AB1 2 3 O THR C 102 ? O THR L 102 N TYR C 86  ? N TYR L 86  
AB1 3 4 N GLN C 90  ? N GLN L 90  O THR C 97  ? O THR L 97  
AB2 1 2 N THR C 114 ? N THR L 114 O ASN C 137 ? O ASN L 137 
AB2 2 3 N PHE C 139 ? N PHE L 139 O TYR C 173 ? O TYR L 173 
AB2 3 4 O SER C 176 ? O SER L 176 N SER C 162 ? N SER L 162 
AB3 1 2 N CYS C 194 ? N CYS L 194 O LYS C 207 ? O LYS L 207 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    L 
_struct_site.pdbx_auth_comp_id    NA 
_struct_site.pdbx_auth_seq_id     301 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'binding site for residue NA L 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 SER B 191 ? SER H 191 . ? 2_655 ? 
2 AC1 5 SER B 195 ? SER H 195 . ? 2_655 ? 
3 AC1 5 GLU B 196 ? GLU H 196 . ? 2_655 ? 
4 AC1 5 GLU C 79  ? GLU L 79  . ? 1_555 ? 
5 AC1 5 GLU C 81  ? GLU L 81  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YXH 
_atom_sites.fract_transf_matrix[1][1]   0.011865 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001208 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009383 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.013265 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LEU A 1 32  ? -21.948 25.997  -32.163 1.00 101.79 ? 117 LEU A N   1 
ATOM   2    C  CA  . LEU A 1 32  ? -22.904 27.103  -32.103 1.00 104.76 ? 117 LEU A CA  1 
ATOM   3    C  C   . LEU A 1 32  ? -22.390 28.327  -32.877 1.00 98.90  ? 117 LEU A C   1 
ATOM   4    O  O   . LEU A 1 32  ? -21.538 28.216  -33.775 1.00 88.53  ? 117 LEU A O   1 
ATOM   5    C  CB  . LEU A 1 32  ? -23.226 27.492  -30.635 1.00 103.52 ? 117 LEU A CB  1 
ATOM   6    C  CG  . LEU A 1 32  ? -24.687 27.879  -30.263 1.00 106.74 ? 117 LEU A CG  1 
ATOM   7    C  CD1 . LEU A 1 32  ? -25.579 26.658  -29.975 1.00 97.93  ? 117 LEU A CD1 1 
ATOM   8    C  CD2 . LEU A 1 32  ? -24.789 28.891  -29.106 1.00 105.48 ? 117 LEU A CD2 1 
ATOM   9    N  N   . GLY A 1 33  ? -22.932 29.487  -32.505 1.00 102.34 ? 118 GLY A N   1 
ATOM   10   C  CA  . GLY A 1 33  ? -22.599 30.767  -33.105 1.00 99.43  ? 118 GLY A CA  1 
ATOM   11   C  C   . GLY A 1 33  ? -21.395 31.475  -32.521 1.00 93.02  ? 118 GLY A C   1 
ATOM   12   O  O   . GLY A 1 33  ? -21.085 31.357  -31.330 1.00 85.94  ? 118 GLY A O   1 
ATOM   13   N  N   . GLY A 1 34  ? -20.712 32.224  -33.378 1.00 90.88  ? 119 GLY A N   1 
ATOM   14   C  CA  . GLY A 1 34  ? -19.552 32.967  -32.952 1.00 85.87  ? 119 GLY A CA  1 
ATOM   15   C  C   . GLY A 1 34  ? -18.320 32.104  -33.116 1.00 86.92  ? 119 GLY A C   1 
ATOM   16   O  O   . GLY A 1 34  ? -17.199 32.607  -33.025 1.00 82.72  ? 119 GLY A O   1 
ATOM   17   N  N   . TYR A 1 35  ? -18.506 30.825  -33.444 1.00 87.67  ? 120 TYR A N   1 
ATOM   18   C  CA  . TYR A 1 35  ? -17.333 29.987  -33.598 1.00 84.64  ? 120 TYR A CA  1 
ATOM   19   C  C   . TYR A 1 35  ? -16.880 30.194  -34.995 1.00 81.76  ? 120 TYR A C   1 
ATOM   20   O  O   . TYR A 1 35  ? -17.658 30.559  -35.874 1.00 83.83  ? 120 TYR A O   1 
ATOM   21   C  CB  . TYR A 1 35  ? -17.570 28.504  -33.302 1.00 86.05  ? 120 TYR A CB  1 
ATOM   22   C  CG  . TYR A 1 35  ? -18.044 28.239  -31.903 1.00 88.86  ? 120 TYR A CG  1 
ATOM   23   C  CD1 . TYR A 1 35  ? -17.391 28.829  -30.830 1.00 87.84  ? 120 TYR A CD1 1 
ATOM   24   C  CD2 . TYR A 1 35  ? -19.086 27.357  -31.639 1.00 94.68  ? 120 TYR A CD2 1 
ATOM   25   C  CE1 . TYR A 1 35  ? -17.787 28.599  -29.536 1.00 88.88  ? 120 TYR A CE1 1 
ATOM   26   C  CE2 . TYR A 1 35  ? -19.496 27.111  -30.330 1.00 93.67  ? 120 TYR A CE2 1 
ATOM   27   C  CZ  . TYR A 1 35  ? -18.838 27.745  -29.287 1.00 93.80  ? 120 TYR A CZ  1 
ATOM   28   O  OH  . TYR A 1 35  ? -19.207 27.534  -27.978 1.00 100.49 ? 120 TYR A OH  1 
ATOM   29   N  N   . MET A 1 36  ? -15.591 29.947  -35.159 1.00 75.74  ? 121 MET A N   1 
ATOM   30   C  CA  . MET A 1 36  ? -14.899 29.930  -36.423 1.00 80.67  ? 121 MET A CA  1 
ATOM   31   C  C   . MET A 1 36  ? -14.117 28.641  -36.625 1.00 78.78  ? 121 MET A C   1 
ATOM   32   O  O   . MET A 1 36  ? -13.808 27.952  -35.671 1.00 77.08  ? 121 MET A O   1 
ATOM   33   C  CB  . MET A 1 36  ? -13.975 31.151  -36.482 1.00 75.80  ? 121 MET A CB  1 
ATOM   34   C  CG  . MET A 1 36  ? -14.765 32.450  -36.571 1.00 75.90  ? 121 MET A CG  1 
ATOM   35   S  SD  . MET A 1 36  ? -13.851 33.834  -37.258 1.00 89.18  ? 121 MET A SD  1 
ATOM   36   C  CE  . MET A 1 36  ? -12.611 34.100  -35.982 1.00 74.60  ? 121 MET A CE  1 
ATOM   37   N  N   . LEU A 1 37  ? -13.892 28.278  -37.882 1.00 78.64  ? 122 LEU A N   1 
ATOM   38   C  CA  . LEU A 1 37  ? -13.151 27.081  -38.222 1.00 73.07  ? 122 LEU A CA  1 
ATOM   39   C  C   . LEU A 1 37  ? -11.807 27.532  -38.767 1.00 72.12  ? 122 LEU A C   1 
ATOM   40   O  O   . LEU A 1 37  ? -11.738 28.265  -39.751 1.00 66.52  ? 122 LEU A O   1 
ATOM   41   C  CB  . LEU A 1 37  ? -13.899 26.242  -39.253 1.00 75.99  ? 122 LEU A CB  1 
ATOM   42   C  CG  . LEU A 1 37  ? -13.321 24.861  -39.557 1.00 76.53  ? 122 LEU A CG  1 
ATOM   43   C  CD1 . LEU A 1 37  ? -13.240 24.018  -38.287 1.00 72.53  ? 122 LEU A CD1 1 
ATOM   44   C  CD2 . LEU A 1 37  ? -14.145 24.176  -40.620 1.00 71.24  ? 122 LEU A CD2 1 
ATOM   45   N  N   . GLY A 1 38  ? -10.744 27.099  -38.092 1.00 73.39  ? 123 GLY A N   1 
ATOM   46   C  CA  . GLY A 1 38  ? -9.371  27.384  -38.488 1.00 73.79  ? 123 GLY A CA  1 
ATOM   47   C  C   . GLY A 1 38  ? -8.962  26.678  -39.759 1.00 66.76  ? 123 GLY A C   1 
ATOM   48   O  O   . GLY A 1 38  ? -9.596  25.707  -40.158 1.00 66.77  ? 123 GLY A O   1 
ATOM   49   N  N   . SER A 1 39  ? -7.874  27.121  -40.375 1.00 69.42  ? 124 SER A N   1 
ATOM   50   C  CA  . SER A 1 39  ? -7.367  26.407  -41.544 1.00 72.26  ? 124 SER A CA  1 
ATOM   51   C  C   . SER A 1 39  ? -6.781  25.048  -41.123 1.00 72.10  ? 124 SER A C   1 
ATOM   52   O  O   . SER A 1 39  ? -6.329  24.880  -39.975 1.00 71.61  ? 124 SER A O   1 
ATOM   53   C  CB  . SER A 1 39  ? -6.341  27.275  -42.296 1.00 72.41  ? 124 SER A CB  1 
ATOM   54   O  OG  . SER A 1 39  ? -5.280  27.712  -41.460 1.00 78.20  ? 124 SER A OG  1 
ATOM   55   N  N   . ALA A 1 40  ? -6.771  24.101  -42.068 1.00 70.82  ? 125 ALA A N   1 
ATOM   56   C  CA  . ALA A 1 40  ? -6.245  22.753  -41.836 1.00 69.44  ? 125 ALA A CA  1 
ATOM   57   C  C   . ALA A 1 40  ? -4.764  22.761  -41.526 1.00 69.48  ? 125 ALA A C   1 
ATOM   58   O  O   . ALA A 1 40  ? -3.993  23.603  -42.003 1.00 69.29  ? 125 ALA A O   1 
ATOM   59   C  CB  . ALA A 1 40  ? -6.514  21.849  -43.023 1.00 67.34  ? 125 ALA A CB  1 
ATOM   60   N  N   . MET A 1 41  ? -4.341  21.799  -40.722 1.00 63.11  ? 126 MET A N   1 
ATOM   61   C  CA  . MET A 1 41  ? -2.937  21.703  -40.373 1.00 62.05  ? 126 MET A CA  1 
ATOM   62   C  C   . MET A 1 41  ? -2.370  20.313  -40.505 1.00 60.81  ? 126 MET A C   1 
ATOM   63   O  O   . MET A 1 41  ? -3.094  19.355  -40.585 1.00 66.31  ? 126 MET A O   1 
ATOM   64   C  CB  . MET A 1 41  ? -2.674  22.219  -38.976 1.00 62.51  ? 126 MET A CB  1 
ATOM   65   C  CG  . MET A 1 41  ? -3.880  22.497  -38.128 1.00 64.38  ? 126 MET A CG  1 
ATOM   66   S  SD  . MET A 1 41  ? -3.319  23.190  -36.581 1.00 68.95  ? 126 MET A SD  1 
ATOM   67   C  CE  . MET A 1 41  ? -4.233  24.697  -36.510 1.00 66.16  ? 126 MET A CE  1 
ATOM   68   N  N   . ASN A 1 42  ? -1.055  20.211  -40.532 1.00 57.54  ? 127 ASN A N   1 
ATOM   69   C  CA  . ASN A 1 42  ? -0.409  18.923  -40.646 1.00 62.21  ? 127 ASN A CA  1 
ATOM   70   C  C   . ASN A 1 42  ? -0.670  18.111  -39.431 1.00 62.78  ? 127 ASN A C   1 
ATOM   71   O  O   . ASN A 1 42  ? -0.527  18.596  -38.343 1.00 63.52  ? 127 ASN A O   1 
ATOM   72   C  CB  . ASN A 1 42  ? 1.084   19.104  -40.695 1.00 60.02  ? 127 ASN A CB  1 
ATOM   73   C  CG  . ASN A 1 42  ? 1.580   19.379  -42.064 1.00 72.13  ? 127 ASN A CG  1 
ATOM   74   O  OD1 . ASN A 1 42  ? 0.824   19.752  -42.926 1.00 87.07  ? 127 ASN A OD1 1 
ATOM   75   N  ND2 . ASN A 1 42  ? 2.864   19.199  -42.272 1.00 81.81  ? 127 ASN A ND2 1 
ATOM   76   N  N   . ARG A 1 43  ? -1.028  16.860  -39.611 1.00 59.99  ? 128 ARG A N   1 
ATOM   77   C  CA  . ARG A 1 43  ? -1.261  15.980  -38.498 1.00 59.26  ? 128 ARG A CA  1 
ATOM   78   C  C   . ARG A 1 43  ? 0.083   15.642  -37.942 1.00 61.04  ? 128 ARG A C   1 
ATOM   79   O  O   . ARG A 1 43  ? 0.915   15.145  -38.650 1.00 63.12  ? 128 ARG A O   1 
ATOM   80   C  CB  . ARG A 1 43  ? -1.887  14.710  -38.995 1.00 60.06  ? 128 ARG A CB  1 
ATOM   81   C  CG  . ARG A 1 43  ? -2.864  14.909  -40.115 1.00 59.23  ? 128 ARG A CG  1 
ATOM   82   C  CD  . ARG A 1 43  ? -3.967  13.922  -39.913 1.00 60.50  ? 128 ARG A CD  1 
ATOM   83   N  NE  . ARG A 1 43  ? -5.144  14.238  -40.667 1.00 59.57  ? 128 ARG A NE  1 
ATOM   84   C  CZ  . ARG A 1 43  ? -6.352  13.928  -40.266 1.00 62.76  ? 128 ARG A CZ  1 
ATOM   85   N  NH1 . ARG A 1 43  ? -6.512  13.293  -39.127 1.00 55.37  ? 128 ARG A NH1 1 
ATOM   86   N  NH2 . ARG A 1 43  ? -7.383  14.232  -41.014 1.00 60.49  ? 128 ARG A NH2 1 
ATOM   87   N  N   . PRO A 1 44  ? 0.322   15.899  -36.674 1.00 61.66  ? 129 PRO A N   1 
ATOM   88   C  CA  . PRO A 1 44  ? 1.657   15.589  -36.170 1.00 62.74  ? 129 PRO A CA  1 
ATOM   89   C  C   . PRO A 1 44  ? 1.802   14.099  -35.956 1.00 57.77  ? 129 PRO A C   1 
ATOM   90   O  O   . PRO A 1 44  ? 0.816   13.358  -35.762 1.00 53.21  ? 129 PRO A O   1 
ATOM   91   C  CB  . PRO A 1 44  ? 1.711   16.337  -34.836 1.00 60.63  ? 129 PRO A CB  1 
ATOM   92   C  CG  . PRO A 1 44  ? 0.307   16.340  -34.398 1.00 58.68  ? 129 PRO A CG  1 
ATOM   93   C  CD  . PRO A 1 44  ? -0.513  16.522  -35.638 1.00 60.23  ? 129 PRO A CD  1 
ATOM   94   N  N   . LEU A 1 45  ? 3.028   13.638  -36.059 1.00 54.94  ? 130 LEU A N   1 
ATOM   95   C  CA  . LEU A 1 45  ? 3.295   12.315  -35.586 1.00 54.82  ? 130 LEU A CA  1 
ATOM   96   C  C   . LEU A 1 45  ? 3.193   12.414  -34.031 1.00 55.27  ? 130 LEU A C   1 
ATOM   97   O  O   . LEU A 1 45  ? 3.834   13.266  -33.426 1.00 54.14  ? 130 LEU A O   1 
ATOM   98   C  CB  . LEU A 1 45  ? 4.637   11.830  -36.112 1.00 48.22  ? 130 LEU A CB  1 
ATOM   99   C  CG  . LEU A 1 45  ? 5.213   10.664  -35.370 1.00 55.85  ? 130 LEU A CG  1 
ATOM   100  C  CD1 . LEU A 1 45  ? 4.117   9.574   -35.347 1.00 55.23  ? 130 LEU A CD1 1 
ATOM   101  C  CD2 . LEU A 1 45  ? 6.391   10.206  -36.175 1.00 50.50  ? 130 LEU A CD2 1 
ATOM   102  N  N   . ILE A 1 46  ? 2.347   11.617  -33.397 1.00 53.02  ? 131 ILE A N   1 
ATOM   103  C  CA  . ILE A 1 46  ? 2.244   11.610  -31.925 1.00 52.91  ? 131 ILE A CA  1 
ATOM   104  C  C   . ILE A 1 46  ? 2.532   10.218  -31.317 1.00 52.45  ? 131 ILE A C   1 
ATOM   105  O  O   . ILE A 1 46  ? 1.953   9.211   -31.749 1.00 57.94  ? 131 ILE A O   1 
ATOM   106  C  CB  . ILE A 1 46  ? 0.903   12.101  -31.439 1.00 52.74  ? 131 ILE A CB  1 
ATOM   107  C  CG1 . ILE A 1 46  ? 0.711   13.542  -31.893 1.00 50.08  ? 131 ILE A CG1 1 
ATOM   108  C  CG2 . ILE A 1 46  ? 0.852   12.027  -29.898 1.00 47.63  ? 131 ILE A CG2 1 
ATOM   109  C  CD1 . ILE A 1 46  ? -0.606  14.100  -31.458 1.00 56.76  ? 131 ILE A CD1 1 
ATOM   110  N  N   . HIS A 1 47  ? 3.364   10.168  -30.281 1.00 50.47  ? 132 HIS A N   1 
ATOM   111  C  CA  . HIS A 1 47  ? 3.693   8.901   -29.608 1.00 49.47  ? 132 HIS A CA  1 
ATOM   112  C  C   . HIS A 1 47  ? 2.930   8.824   -28.263 1.00 46.75  ? 132 HIS A C   1 
ATOM   113  O  O   . HIS A 1 47  ? 2.883   9.779   -27.453 1.00 45.34  ? 132 HIS A O   1 
ATOM   114  C  CB  . HIS A 1 47  ? 5.210   8.876   -29.354 1.00 47.11  ? 132 HIS A CB  1 
ATOM   115  C  CG  . HIS A 1 47  ? 6.030   8.745   -30.606 1.00 48.07  ? 132 HIS A CG  1 
ATOM   116  N  ND1 . HIS A 1 47  ? 6.143   7.570   -31.320 1.00 48.37  ? 132 HIS A ND1 1 
ATOM   117  C  CD2 . HIS A 1 47  ? 6.754   9.668   -31.286 1.00 41.38  ? 132 HIS A CD2 1 
ATOM   118  C  CE1 . HIS A 1 47  ? 6.903   7.775   -32.384 1.00 47.65  ? 132 HIS A CE1 1 
ATOM   119  N  NE2 . HIS A 1 47  ? 7.284   9.039   -32.388 1.00 45.51  ? 132 HIS A NE2 1 
ATOM   120  N  N   . PHE A 1 48  ? 2.253   7.710   -28.064 1.00 41.37  ? 133 PHE A N   1 
ATOM   121  C  CA  . PHE A 1 48  ? 1.387   7.593   -26.897 1.00 44.57  ? 133 PHE A CA  1 
ATOM   122  C  C   . PHE A 1 48  ? 1.930   6.771   -25.736 1.00 51.12  ? 133 PHE A C   1 
ATOM   123  O  O   . PHE A 1 48  ? 1.236   6.585   -24.727 1.00 49.93  ? 133 PHE A O   1 
ATOM   124  C  CB  . PHE A 1 48  ? 0.045   7.080   -27.339 1.00 43.23  ? 133 PHE A CB  1 
ATOM   125  C  CG  . PHE A 1 48  ? -0.841  8.166   -27.864 1.00 48.31  ? 133 PHE A CG  1 
ATOM   126  C  CD1 . PHE A 1 48  ? -1.647  8.911   -27.008 1.00 47.89  ? 133 PHE A CD1 1 
ATOM   127  C  CD2 . PHE A 1 48  ? -0.838  8.482   -29.229 1.00 45.06  ? 133 PHE A CD2 1 
ATOM   128  C  CE1 . PHE A 1 48  ? -2.490  9.925   -27.523 1.00 51.45  ? 133 PHE A CE1 1 
ATOM   129  C  CE2 . PHE A 1 48  ? -1.671  9.488   -29.743 1.00 45.55  ? 133 PHE A CE2 1 
ATOM   130  C  CZ  . PHE A 1 48  ? -2.503  10.207  -28.892 1.00 44.35  ? 133 PHE A CZ  1 
ATOM   131  N  N   . GLY A 1 49  ? 3.161   6.279   -25.879 1.00 49.62  ? 134 GLY A N   1 
ATOM   132  C  CA  . GLY A 1 49  ? 3.867   5.676   -24.769 1.00 45.94  ? 134 GLY A CA  1 
ATOM   133  C  C   . GLY A 1 49  ? 3.790   4.155   -24.678 1.00 47.40  ? 134 GLY A C   1 
ATOM   134  O  O   . GLY A 1 49  ? 4.458   3.562   -23.832 1.00 47.06  ? 134 GLY A O   1 
ATOM   135  N  N   . ASN A 1 50  ? 3.016   3.506   -25.546 1.00 44.90  ? 135 ASN A N   1 
ATOM   136  C  CA  . ASN A 1 50  ? 3.000   2.033   -25.583 1.00 48.23  ? 135 ASN A CA  1 
ATOM   137  C  C   . ASN A 1 50  ? 2.724   1.506   -27.024 1.00 47.77  ? 135 ASN A C   1 
ATOM   138  O  O   . ASN A 1 50  ? 2.245   2.261   -27.870 1.00 47.45  ? 135 ASN A O   1 
ATOM   139  C  CB  . ASN A 1 50  ? 2.012   1.490   -24.500 1.00 46.17  ? 135 ASN A CB  1 
ATOM   140  C  CG  . ASN A 1 50  ? 0.567   1.831   -24.789 1.00 47.03  ? 135 ASN A CG  1 
ATOM   141  O  OD1 . ASN A 1 50  ? 0.055   1.560   -25.881 1.00 44.46  ? 135 ASN A OD1 1 
ATOM   142  N  ND2 . ASN A 1 50  ? -0.080  2.515   -23.833 1.00 48.43  ? 135 ASN A ND2 1 
ATOM   143  N  N   . ASP A 1 51  ? 2.985   0.222   -27.292 1.00 46.83  ? 136 ASP A N   1 
ATOM   144  C  CA  . ASP A 1 51  ? 2.986   -0.301  -28.658 1.00 45.36  ? 136 ASP A CA  1 
ATOM   145  C  C   . ASP A 1 51  ? 1.556   -0.219  -29.211 1.00 53.17  ? 136 ASP A C   1 
ATOM   146  O  O   . ASP A 1 51  ? 1.335   0.197   -30.373 1.00 56.32  ? 136 ASP A O   1 
ATOM   147  C  CB  . ASP A 1 51  ? 3.522   -1.735  -28.678 1.00 45.82  ? 136 ASP A CB  1 
ATOM   148  C  CG  . ASP A 1 51  ? 4.945   -1.836  -28.088 1.00 47.61  ? 136 ASP A CG  1 
ATOM   149  O  OD1 . ASP A 1 51  ? 5.802   -1.054  -28.552 1.00 51.05  ? 136 ASP A OD1 1 
ATOM   150  O  OD2 . ASP A 1 51  ? 5.225   -2.678  -27.192 1.00 38.95  ? 136 ASP A OD2 1 
ATOM   151  N  N   . TYR A 1 52  ? 0.569   -0.566  -28.390 1.00 51.69  ? 137 TYR A N   1 
ATOM   152  C  CA  . TYR A 1 52  ? -0.799  -0.570  -28.896 1.00 49.52  ? 137 TYR A CA  1 
ATOM   153  C  C   . TYR A 1 52  ? -1.348  0.784   -29.247 1.00 48.24  ? 137 TYR A C   1 
ATOM   154  O  O   . TYR A 1 52  ? -1.894  0.954   -30.324 1.00 47.93  ? 137 TYR A O   1 
ATOM   155  C  CB  . TYR A 1 52  ? -1.761  -1.230  -27.886 1.00 50.70  ? 137 TYR A CB  1 
ATOM   156  C  CG  . TYR A 1 52  ? -3.176  -1.323  -28.425 1.00 56.09  ? 137 TYR A CG  1 
ATOM   157  C  CD1 . TYR A 1 52  ? -3.614  -2.414  -29.168 1.00 60.29  ? 137 TYR A CD1 1 
ATOM   158  C  CD2 . TYR A 1 52  ? -4.112  -0.342  -28.088 1.00 52.11  ? 137 TYR A CD2 1 
ATOM   159  C  CE1 . TYR A 1 52  ? -4.907  -2.467  -29.648 1.00 58.87  ? 137 TYR A CE1 1 
ATOM   160  C  CE2 . TYR A 1 52  ? -5.402  -0.394  -28.548 1.00 51.63  ? 137 TYR A CE2 1 
ATOM   161  C  CZ  . TYR A 1 52  ? -5.802  -1.458  -29.323 1.00 57.34  ? 137 TYR A CZ  1 
ATOM   162  O  OH  . TYR A 1 52  ? -7.105  -1.513  -29.780 1.00 62.98  ? 137 TYR A OH  1 
ATOM   163  N  N   . GLU A 1 53  ? -1.189  1.758   -28.371 1.00 45.53  ? 138 GLU A N   1 
ATOM   164  C  CA  . GLU A 1 53  ? -1.708  3.049   -28.710 1.00 45.40  ? 138 GLU A CA  1 
ATOM   165  C  C   . GLU A 1 53  ? -0.954  3.675   -29.876 1.00 48.07  ? 138 GLU A C   1 
ATOM   166  O  O   . GLU A 1 53  ? -1.557  4.351   -30.694 1.00 46.91  ? 138 GLU A O   1 
ATOM   167  C  CB  . GLU A 1 53  ? -1.705  3.938   -27.484 1.00 39.48  ? 138 GLU A CB  1 
ATOM   168  C  CG  . GLU A 1 53  ? -2.683  3.396   -26.506 1.00 41.11  ? 138 GLU A CG  1 
ATOM   169  C  CD  . GLU A 1 53  ? -2.950  4.316   -25.358 1.00 47.25  ? 138 GLU A CD  1 
ATOM   170  O  OE1 . GLU A 1 53  ? -3.264  3.813   -24.255 1.00 56.27  ? 138 GLU A OE1 1 
ATOM   171  O  OE2 . GLU A 1 53  ? -2.921  5.543   -25.575 1.00 45.48  ? 138 GLU A OE2 1 
ATOM   172  N  N   . ASP A 1 54  ? 0.353   3.449   -29.969 1.00 48.04  ? 139 ASP A N   1 
ATOM   173  C  CA  . ASP A 1 54  ? 1.111   4.017   -31.081 1.00 46.86  ? 139 ASP A CA  1 
ATOM   174  C  C   . ASP A 1 54  ? 0.567   3.450   -32.384 1.00 48.54  ? 139 ASP A C   1 
ATOM   175  O  O   . ASP A 1 54  ? 0.197   4.201   -33.312 1.00 47.60  ? 139 ASP A O   1 
ATOM   176  C  CB  . ASP A 1 54  ? 2.590   3.746   -30.887 1.00 43.27  ? 139 ASP A CB  1 
ATOM   177  C  CG  . ASP A 1 54  ? 3.277   4.814   -30.024 1.00 45.42  ? 139 ASP A CG  1 
ATOM   178  O  OD1 . ASP A 1 54  ? 2.597   5.567   -29.289 1.00 45.40  ? 139 ASP A OD1 1 
ATOM   179  O  OD2 . ASP A 1 54  ? 4.529   4.836   -30.003 1.00 48.59  ? 139 ASP A OD2 1 
ATOM   180  N  N   . ARG A 1 55  ? 0.393   2.134   -32.393 1.00 45.38  ? 140 ARG A N   1 
ATOM   181  C  CA  . ARG A 1 55  ? -0.127  1.485   -33.567 1.00 48.90  ? 140 ARG A CA  1 
ATOM   182  C  C   . ARG A 1 55  ? -1.579  1.936   -33.873 1.00 53.71  ? 140 ARG A C   1 
ATOM   183  O  O   . ARG A 1 55  ? -1.900  2.315   -35.027 1.00 50.97  ? 140 ARG A O   1 
ATOM   184  C  CB  . ARG A 1 55  ? -0.048  -0.023  -33.384 1.00 48.64  ? 140 ARG A CB  1 
ATOM   185  C  CG  . ARG A 1 55  ? -0.533  -0.789  -34.591 1.00 56.10  ? 140 ARG A CG  1 
ATOM   186  C  CD  . ARG A 1 55  ? -0.291  -2.268  -34.436 1.00 60.71  ? 140 ARG A CD  1 
ATOM   187  N  NE  . ARG A 1 55  ? -1.062  -3.022  -35.412 1.00 74.40  ? 140 ARG A NE  1 
ATOM   188  C  CZ  . ARG A 1 55  ? -0.675  -3.242  -36.668 1.00 81.68  ? 140 ARG A CZ  1 
ATOM   189  N  NH1 . ARG A 1 55  ? 0.496   -2.774  -37.103 1.00 79.71  ? 140 ARG A NH1 1 
ATOM   190  N  NH2 . ARG A 1 55  ? -1.455  -3.944  -37.488 1.00 81.52  ? 140 ARG A NH2 1 
ATOM   191  N  N   . TYR A 1 56  ? -2.429  1.924   -32.839 1.00 48.68  ? 141 TYR A N   1 
ATOM   192  C  CA  . TYR A 1 56  ? -3.826  2.368   -32.944 1.00 49.29  ? 141 TYR A CA  1 
ATOM   193  C  C   . TYR A 1 56  ? -3.924  3.776   -33.496 1.00 48.43  ? 141 TYR A C   1 
ATOM   194  O  O   . TYR A 1 56  ? -4.662  4.040   -34.421 1.00 49.29  ? 141 TYR A O   1 
ATOM   195  C  CB  . TYR A 1 56  ? -4.537  2.288   -31.594 1.00 50.80  ? 141 TYR A CB  1 
ATOM   196  C  CG  . TYR A 1 56  ? -5.989  2.657   -31.719 1.00 49.28  ? 141 TYR A CG  1 
ATOM   197  C  CD1 . TYR A 1 56  ? -6.416  3.982   -31.601 1.00 45.31  ? 141 TYR A CD1 1 
ATOM   198  C  CD2 . TYR A 1 56  ? -6.938  1.675   -32.042 1.00 53.61  ? 141 TYR A CD2 1 
ATOM   199  C  CE1 . TYR A 1 56  ? -7.769  4.305   -31.772 1.00 51.47  ? 141 TYR A CE1 1 
ATOM   200  C  CE2 . TYR A 1 56  ? -8.284  1.979   -32.223 1.00 45.99  ? 141 TYR A CE2 1 
ATOM   201  C  CZ  . TYR A 1 56  ? -8.695  3.286   -32.092 1.00 52.41  ? 141 TYR A CZ  1 
ATOM   202  O  OH  . TYR A 1 56  ? -10.031 3.564   -32.255 1.00 55.09  ? 141 TYR A OH  1 
ATOM   203  N  N   . TYR A 1 57  ? -3.150  4.680   -32.939 1.00 50.14  ? 142 TYR A N   1 
ATOM   204  C  CA  . TYR A 1 57  ? -3.142  6.037   -33.432 1.00 52.01  ? 142 TYR A CA  1 
ATOM   205  C  C   . TYR A 1 57  ? -2.775  6.109   -34.911 1.00 51.41  ? 142 TYR A C   1 
ATOM   206  O  O   . TYR A 1 57  ? -3.465  6.772   -35.678 1.00 47.52  ? 142 TYR A O   1 
ATOM   207  C  CB  . TYR A 1 57  ? -2.154  6.875   -32.643 1.00 43.29  ? 142 TYR A CB  1 
ATOM   208  C  CG  . TYR A 1 57  ? -2.206  8.302   -33.043 1.00 42.88  ? 142 TYR A CG  1 
ATOM   209  C  CD1 . TYR A 1 57  ? -3.286  9.120   -32.806 1.00 41.89  ? 142 TYR A CD1 1 
ATOM   210  C  CD2 . TYR A 1 57  ? -1.184  8.781   -33.846 1.00 48.25  ? 142 TYR A CD2 1 
ATOM   211  C  CE1 . TYR A 1 57  ? -3.269  10.447  -33.272 1.00 43.88  ? 142 TYR A CE1 1 
ATOM   212  C  CE2 . TYR A 1 57  ? -1.165  10.052  -34.317 1.00 48.90  ? 142 TYR A CE2 1 
ATOM   213  C  CZ  . TYR A 1 57  ? -2.196  10.882  -34.046 1.00 44.00  ? 142 TYR A CZ  1 
ATOM   214  O  OH  . TYR A 1 57  ? -2.065  12.146  -34.560 1.00 45.24  ? 142 TYR A OH  1 
ATOM   215  N  N   . ARG A 1 58  ? -1.660  5.472   -35.283 1.00 54.65  ? 143 ARG A N   1 
ATOM   216  C  CA  . ARG A 1 58  ? -1.215  5.456   -36.683 1.00 53.89  ? 143 ARG A CA  1 
ATOM   217  C  C   . ARG A 1 58  ? -2.368  5.002   -37.586 1.00 52.75  ? 143 ARG A C   1 
ATOM   218  O  O   . ARG A 1 58  ? -2.605  5.592   -38.629 1.00 50.16  ? 143 ARG A O   1 
ATOM   219  C  CB  . ARG A 1 58  ? 0.036   4.581   -36.828 1.00 56.49  ? 143 ARG A CB  1 
ATOM   220  C  CG  . ARG A 1 58  ? 0.625   4.342   -38.261 1.00 57.94  ? 143 ARG A CG  1 
ATOM   221  C  CD  . ARG A 1 58  ? 1.764   3.293   -38.117 1.00 61.23  ? 143 ARG A CD  1 
ATOM   222  N  NE  . ARG A 1 58  ? 2.432   3.484   -36.805 1.00 52.29  ? 143 ARG A NE  1 
ATOM   223  C  CZ  . ARG A 1 58  ? 2.756   2.484   -35.998 1.00 46.58  ? 143 ARG A CZ  1 
ATOM   224  N  NH1 . ARG A 1 58  ? 3.313   2.731   -34.823 1.00 45.85  ? 143 ARG A NH1 1 
ATOM   225  N  NH2 . ARG A 1 58  ? 2.496   1.232   -36.369 1.00 50.81  ? 143 ARG A NH2 1 
ATOM   226  N  N   . GLU A 1 59  ? -3.118  3.994   -37.148 1.00 51.56  ? 144 GLU A N   1 
ATOM   227  C  CA  . GLU A 1 59  ? -4.208  3.458   -37.962 1.00 52.29  ? 144 GLU A CA  1 
ATOM   228  C  C   . GLU A 1 59  ? -5.525  4.279   -37.954 1.00 56.47  ? 144 GLU A C   1 
ATOM   229  O  O   . GLU A 1 59  ? -6.241  4.335   -38.961 1.00 55.85  ? 144 GLU A O   1 
ATOM   230  C  CB  . GLU A 1 59  ? -4.532  2.021   -37.523 1.00 46.93  ? 144 GLU A CB  1 
ATOM   231  C  CG  . GLU A 1 59  ? -3.426  1.038   -37.685 1.00 48.33  ? 144 GLU A CG  1 
ATOM   232  C  CD  . GLU A 1 59  ? -3.787  -0.344  -37.186 1.00 57.42  ? 144 GLU A CD  1 
ATOM   233  O  OE1 . GLU A 1 59  ? -4.827  -0.489  -36.504 1.00 60.11  ? 144 GLU A OE1 1 
ATOM   234  O  OE2 . GLU A 1 59  ? -3.095  -1.316  -37.580 1.00 64.86  ? 144 GLU A OE2 1 
ATOM   235  N  N   . ASN A 1 60  ? -5.843  4.910   -36.831 1.00 51.59  ? 145 ASN A N   1 
ATOM   236  C  CA  . ASN A 1 60  ? -7.122  5.561   -36.692 1.00 50.68  ? 145 ASN A CA  1 
ATOM   237  C  C   . ASN A 1 60  ? -7.105  7.071   -36.850 1.00 52.20  ? 145 ASN A C   1 
ATOM   238  O  O   . ASN A 1 60  ? -8.172  7.704   -36.798 1.00 51.64  ? 145 ASN A O   1 
ATOM   239  C  CB  . ASN A 1 60  ? -7.705  5.149   -35.360 1.00 47.60  ? 145 ASN A CB  1 
ATOM   240  C  CG  . ASN A 1 60  ? -8.168  3.714   -35.392 1.00 54.57  ? 145 ASN A CG  1 
ATOM   241  O  OD1 . ASN A 1 60  ? -9.340  3.425   -35.710 1.00 58.00  ? 145 ASN A OD1 1 
ATOM   242  N  ND2 . ASN A 1 60  ? -7.226  2.796   -35.208 1.00 46.22  ? 145 ASN A ND2 1 
ATOM   243  N  N   . MET A 1 61  ? -5.914  7.649   -37.002 1.00 39.19  ? 146 MET A N   1 
ATOM   244  C  CA  . MET A 1 61  ? -5.791  9.100   -36.942 1.00 42.83  ? 146 MET A CA  1 
ATOM   245  C  C   . MET A 1 61  ? -6.521  9.838   -38.106 1.00 51.89  ? 146 MET A C   1 
ATOM   246  O  O   . MET A 1 61  ? -6.763  11.059  -38.044 1.00 49.07  ? 146 MET A O   1 
ATOM   247  C  CB  . MET A 1 61  ? -4.322  9.524   -36.896 1.00 45.07  ? 146 MET A CB  1 
ATOM   248  C  CG  . MET A 1 61  ? -3.454  8.973   -38.025 1.00 48.13  ? 146 MET A CG  1 
ATOM   249  S  SD  . MET A 1 61  ? -1.721  9.372   -37.717 1.00 56.12  ? 146 MET A SD  1 
ATOM   250  C  CE  . MET A 1 61  ? -1.806  11.172  -37.797 1.00 47.53  ? 146 MET A CE  1 
ATOM   251  N  N   . TYR A 1 62  ? -6.803  9.126   -39.203 1.00 52.85  ? 147 TYR A N   1 
ATOM   252  C  CA  . TYR A 1 62  ? -7.496  9.767   -40.315 1.00 54.26  ? 147 TYR A CA  1 
ATOM   253  C  C   . TYR A 1 62  ? -8.923  10.147  -39.911 1.00 52.94  ? 147 TYR A C   1 
ATOM   254  O  O   . TYR A 1 62  ? -9.526  11.037  -40.511 1.00 53.32  ? 147 TYR A O   1 
ATOM   255  C  CB  . TYR A 1 62  ? -7.484  8.851   -41.553 1.00 49.36  ? 147 TYR A CB  1 
ATOM   256  C  CG  . TYR A 1 62  ? -8.380  7.648   -41.428 1.00 44.97  ? 147 TYR A CG  1 
ATOM   257  C  CD1 . TYR A 1 62  ? -7.979  6.533   -40.702 1.00 46.66  ? 147 TYR A CD1 1 
ATOM   258  C  CD2 . TYR A 1 62  ? -9.630  7.635   -42.002 1.00 39.68  ? 147 TYR A CD2 1 
ATOM   259  C  CE1 . TYR A 1 62  ? -8.800  5.414   -40.579 1.00 43.76  ? 147 TYR A CE1 1 
ATOM   260  C  CE2 . TYR A 1 62  ? -10.465 6.537   -41.868 1.00 42.85  ? 147 TYR A CE2 1 
ATOM   261  C  CZ  . TYR A 1 62  ? -10.041 5.423   -41.161 1.00 41.99  ? 147 TYR A CZ  1 
ATOM   262  O  OH  . TYR A 1 62  ? -10.869 4.328   -41.037 1.00 44.54  ? 147 TYR A OH  1 
ATOM   263  N  N   . ARG A 1 63  ? -9.407  9.503   -38.855 1.00 46.38  ? 148 ARG A N   1 
ATOM   264  C  CA  . ARG A 1 63  ? -10.749 9.674   -38.303 1.00 45.64  ? 148 ARG A CA  1 
ATOM   265  C  C   . ARG A 1 63  ? -10.877 10.896  -37.385 1.00 49.54  ? 148 ARG A C   1 
ATOM   266  O  O   . ARG A 1 63  ? -11.963 11.212  -36.905 1.00 51.88  ? 148 ARG A O   1 
ATOM   267  C  CB  . ARG A 1 63  ? -11.165 8.417   -37.564 1.00 46.93  ? 148 ARG A CB  1 
ATOM   268  C  CG  . ARG A 1 63  ? -11.217 7.220   -38.454 1.00 46.42  ? 148 ARG A CG  1 
ATOM   269  C  CD  . ARG A 1 63  ? -11.434 6.024   -37.618 1.00 48.06  ? 148 ARG A CD  1 
ATOM   270  N  NE  . ARG A 1 63  ? -12.612 6.092   -36.786 1.00 51.32  ? 148 ARG A NE  1 
ATOM   271  C  CZ  . ARG A 1 63  ? -12.703 5.442   -35.629 1.00 56.77  ? 148 ARG A CZ  1 
ATOM   272  N  NH1 . ARG A 1 63  ? -11.682 4.710   -35.194 1.00 52.33  ? 148 ARG A NH1 1 
ATOM   273  N  NH2 . ARG A 1 63  ? -13.799 5.535   -34.892 1.00 65.43  ? 148 ARG A NH2 1 
ATOM   274  N  N   . TYR A 1 64  ? -9.769  11.574  -37.124 1.00 49.46  ? 149 TYR A N   1 
ATOM   275  C  CA  . TYR A 1 64  ? -9.790  12.686  -36.189 1.00 52.94  ? 149 TYR A CA  1 
ATOM   276  C  C   . TYR A 1 64  ? -9.665  14.028  -36.888 1.00 54.46  ? 149 TYR A C   1 
ATOM   277  O  O   . TYR A 1 64  ? -9.185  14.083  -38.018 1.00 53.38  ? 149 TYR A O   1 
ATOM   278  C  CB  . TYR A 1 64  ? -8.673  12.507  -35.132 1.00 51.08  ? 149 TYR A CB  1 
ATOM   279  C  CG  . TYR A 1 64  ? -8.550  11.121  -34.485 1.00 50.86  ? 149 TYR A CG  1 
ATOM   280  C  CD1 . TYR A 1 64  ? -9.681  10.405  -34.091 1.00 50.41  ? 149 TYR A CD1 1 
ATOM   281  C  CD2 . TYR A 1 64  ? -7.309  10.565  -34.206 1.00 48.08  ? 149 TYR A CD2 1 
ATOM   282  C  CE1 . TYR A 1 64  ? -9.580  9.157   -33.482 1.00 47.58  ? 149 TYR A CE1 1 
ATOM   283  C  CE2 . TYR A 1 64  ? -7.193  9.318   -33.592 1.00 47.09  ? 149 TYR A CE2 1 
ATOM   284  C  CZ  . TYR A 1 64  ? -8.338  8.611   -33.231 1.00 49.26  ? 149 TYR A CZ  1 
ATOM   285  O  OH  . TYR A 1 64  ? -8.231  7.360   -32.609 1.00 45.79  ? 149 TYR A OH  1 
ATOM   286  N  N   . PRO A 1 65  ? -10.108 15.120  -36.216 1.00 58.12  ? 150 PRO A N   1 
ATOM   287  C  CA  . PRO A 1 65  ? -10.128 16.404  -36.933 1.00 56.82  ? 150 PRO A CA  1 
ATOM   288  C  C   . PRO A 1 65  ? -8.769  16.809  -37.381 1.00 56.31  ? 150 PRO A C   1 
ATOM   289  O  O   . PRO A 1 65  ? -7.828  16.470  -36.682 1.00 59.27  ? 150 PRO A O   1 
ATOM   290  C  CB  . PRO A 1 65  ? -10.588 17.410  -35.860 1.00 56.21  ? 150 PRO A CB  1 
ATOM   291  C  CG  . PRO A 1 65  ? -11.179 16.571  -34.762 1.00 58.85  ? 150 PRO A CG  1 
ATOM   292  C  CD  . PRO A 1 65  ? -10.473 15.268  -34.793 1.00 52.00  ? 150 PRO A CD  1 
ATOM   293  N  N   . ASN A 1 66  ? -8.662  17.518  -38.498 1.00 59.92  ? 151 ASN A N   1 
ATOM   294  C  CA  . ASN A 1 66  ? -7.408  18.170  -38.873 1.00 64.78  ? 151 ASN A CA  1 
ATOM   295  C  C   . ASN A 1 66  ? -7.544  19.687  -38.841 1.00 66.05  ? 151 ASN A C   1 
ATOM   296  O  O   . ASN A 1 66  ? -6.718  20.400  -39.422 1.00 69.70  ? 151 ASN A O   1 
ATOM   297  C  CB  . ASN A 1 66  ? -6.906  17.713  -40.245 1.00 66.65  ? 151 ASN A CB  1 
ATOM   298  C  CG  . ASN A 1 66  ? -7.749  18.232  -41.361 1.00 62.37  ? 151 ASN A CG  1 
ATOM   299  O  OD1 . ASN A 1 66  ? -8.861  18.697  -41.134 1.00 57.03  ? 151 ASN A OD1 1 
ATOM   300  N  ND2 . ASN A 1 66  ? -7.204  18.220  -42.572 1.00 65.26  ? 151 ASN A ND2 1 
ATOM   301  N  N   . GLN A 1 67  ? -8.632  20.171  -38.249 1.00 67.43  ? 152 GLN A N   1 
ATOM   302  C  CA  . GLN A 1 67  ? -8.785  21.606  -38.017 1.00 68.90  ? 152 GLN A CA  1 
ATOM   303  C  C   . GLN A 1 67  ? -9.685  21.851  -36.818 1.00 66.67  ? 152 GLN A C   1 
ATOM   304  O  O   . GLN A 1 67  ? -10.540 21.020  -36.475 1.00 64.92  ? 152 GLN A O   1 
ATOM   305  C  CB  . GLN A 1 67  ? -9.317  22.287  -39.286 1.00 69.93  ? 152 GLN A CB  1 
ATOM   306  C  CG  . GLN A 1 67  ? -10.573 21.649  -39.893 1.00 71.39  ? 152 GLN A CG  1 
ATOM   307  C  CD  . GLN A 1 67  ? -10.914 22.220  -41.293 1.00 71.27  ? 152 GLN A CD  1 
ATOM   308  O  OE1 . GLN A 1 67  ? -10.431 23.295  -41.671 1.00 68.36  ? 152 GLN A OE1 1 
ATOM   309  N  NE2 . GLN A 1 67  ? -11.703 21.465  -42.079 1.00 57.87  ? 152 GLN A NE2 1 
ATOM   310  N  N   . VAL A 1 68  ? -9.578  23.041  -36.246 1.00 64.55  ? 153 VAL A N   1 
ATOM   311  C  CA  . VAL A 1 68  ? -10.280 23.307  -34.995 1.00 69.81  ? 153 VAL A CA  1 
ATOM   312  C  C   . VAL A 1 68  ? -11.307 24.427  -35.116 1.00 73.51  ? 153 VAL A C   1 
ATOM   313  O  O   . VAL A 1 68  ? -11.129 25.389  -35.881 1.00 75.46  ? 153 VAL A O   1 
ATOM   314  C  CB  . VAL A 1 68  ? -9.289  23.641  -33.867 1.00 66.13  ? 153 VAL A CB  1 
ATOM   315  C  CG1 . VAL A 1 68  ? -8.376  22.443  -33.580 1.00 58.37  ? 153 VAL A CG1 1 
ATOM   316  C  CG2 . VAL A 1 68  ? -8.487  24.880  -34.218 1.00 61.77  ? 153 VAL A CG2 1 
ATOM   317  N  N   . TYR A 1 69  ? -12.339 24.330  -34.283 1.00 72.00  ? 154 TYR A N   1 
ATOM   318  C  CA  . TYR A 1 69  ? -13.290 25.420  -34.110 1.00 73.70  ? 154 TYR A CA  1 
ATOM   319  C  C   . TYR A 1 69  ? -12.913 26.216  -32.872 1.00 72.82  ? 154 TYR A C   1 
ATOM   320  O  O   . TYR A 1 69  ? -12.449 25.658  -31.873 1.00 70.58  ? 154 TYR A O   1 
ATOM   321  C  CB  . TYR A 1 69  ? -14.706 24.870  -33.914 1.00 71.33  ? 154 TYR A CB  1 
ATOM   322  C  CG  . TYR A 1 69  ? -15.416 24.323  -35.142 1.00 78.13  ? 154 TYR A CG  1 
ATOM   323  C  CD1 . TYR A 1 69  ? -15.818 25.148  -36.186 1.00 80.70  ? 154 TYR A CD1 1 
ATOM   324  C  CD2 . TYR A 1 69  ? -15.721 22.962  -35.229 1.00 73.97  ? 154 TYR A CD2 1 
ATOM   325  C  CE1 . TYR A 1 69  ? -16.481 24.620  -37.293 1.00 77.60  ? 154 TYR A CE1 1 
ATOM   326  C  CE2 . TYR A 1 69  ? -16.378 22.439  -36.318 1.00 74.63  ? 154 TYR A CE2 1 
ATOM   327  C  CZ  . TYR A 1 69  ? -16.754 23.267  -37.341 1.00 79.33  ? 154 TYR A CZ  1 
ATOM   328  O  OH  . TYR A 1 69  ? -17.410 22.727  -38.414 1.00 91.39  ? 154 TYR A OH  1 
ATOM   329  N  N   . TYR A 1 70  ? -13.071 27.529  -32.949 1.00 72.72  ? 155 TYR A N   1 
ATOM   330  C  CA  . TYR A 1 70  ? -12.756 28.355  -31.811 1.00 69.77  ? 155 TYR A CA  1 
ATOM   331  C  C   . TYR A 1 70  ? -13.543 29.666  -31.760 1.00 73.50  ? 155 TYR A C   1 
ATOM   332  O  O   . TYR A 1 70  ? -14.059 30.124  -32.765 1.00 74.33  ? 155 TYR A O   1 
ATOM   333  C  CB  . TYR A 1 70  ? -11.266 28.654  -31.837 1.00 69.74  ? 155 TYR A CB  1 
ATOM   334  C  CG  . TYR A 1 70  ? -10.774 29.287  -33.114 1.00 64.67  ? 155 TYR A CG  1 
ATOM   335  C  CD1 . TYR A 1 70  ? -10.580 28.543  -34.272 1.00 68.79  ? 155 TYR A CD1 1 
ATOM   336  C  CD2 . TYR A 1 70  ? -10.478 30.636  -33.146 1.00 65.42  ? 155 TYR A CD2 1 
ATOM   337  C  CE1 . TYR A 1 70  ? -10.104 29.151  -35.440 1.00 73.68  ? 155 TYR A CE1 1 
ATOM   338  C  CE2 . TYR A 1 70  ? -10.016 31.249  -34.288 1.00 73.37  ? 155 TYR A CE2 1 
ATOM   339  C  CZ  . TYR A 1 70  ? -9.823  30.515  -35.430 1.00 73.62  ? 155 TYR A CZ  1 
ATOM   340  O  OH  . TYR A 1 70  ? -9.357  31.180  -36.536 1.00 72.96  ? 155 TYR A OH  1 
ATOM   341  N  N   . ARG A 1 71  ? -13.543 30.318  -30.603 1.00 75.77  ? 156 ARG A N   1 
ATOM   342  C  CA  . ARG A 1 71  ? -14.029 31.686  -30.511 1.00 74.06  ? 156 ARG A CA  1 
ATOM   343  C  C   . ARG A 1 71  ? -12.882 32.653  -30.694 1.00 69.21  ? 156 ARG A C   1 
ATOM   344  O  O   . ARG A 1 71  ? -11.749 32.317  -30.395 1.00 66.70  ? 156 ARG A O   1 
ATOM   345  C  CB  . ARG A 1 71  ? -14.696 31.927  -29.160 1.00 74.68  ? 156 ARG A CB  1 
ATOM   346  C  CG  . ARG A 1 71  ? -16.122 31.471  -29.066 1.00 80.21  ? 156 ARG A CG  1 
ATOM   347  C  CD  . ARG A 1 71  ? -17.053 32.665  -29.275 1.00 83.55  ? 156 ARG A CD  1 
ATOM   348  N  NE  . ARG A 1 71  ? -18.438 32.263  -29.470 1.00 85.42  ? 156 ARG A NE  1 
ATOM   349  C  CZ  . ARG A 1 71  ? -19.226 31.829  -28.494 1.00 86.07  ? 156 ARG A CZ  1 
ATOM   350  N  NH1 . ARG A 1 71  ? -20.478 31.484  -28.762 1.00 93.42  ? 156 ARG A NH1 1 
ATOM   351  N  NH2 . ARG A 1 71  ? -18.761 31.742  -27.254 1.00 76.75  ? 156 ARG A NH2 1 
ATOM   352  N  N   . PRO A 1 72  ? -13.170 33.864  -31.179 1.00 68.52  ? 157 PRO A N   1 
ATOM   353  C  CA  . PRO A 1 72  ? -12.121 34.863  -31.403 1.00 66.18  ? 157 PRO A CA  1 
ATOM   354  C  C   . PRO A 1 72  ? -11.196 35.008  -30.185 1.00 67.60  ? 157 PRO A C   1 
ATOM   355  O  O   . PRO A 1 72  ? -11.632 34.893  -29.040 1.00 71.43  ? 157 PRO A O   1 
ATOM   356  C  CB  . PRO A 1 72  ? -12.912 36.135  -31.674 1.00 61.45  ? 157 PRO A CB  1 
ATOM   357  C  CG  . PRO A 1 72  ? -14.167 35.648  -32.283 1.00 66.81  ? 157 PRO A CG  1 
ATOM   358  C  CD  . PRO A 1 72  ? -14.489 34.344  -31.622 1.00 67.46  ? 157 PRO A CD  1 
ATOM   359  N  N   . VAL A 1 73  ? -9.904  35.124  -30.418 1.00 69.31  ? 158 VAL A N   1 
ATOM   360  C  CA  . VAL A 1 73  ? -8.958  35.120  -29.302 1.00 75.02  ? 158 VAL A CA  1 
ATOM   361  C  C   . VAL A 1 73  ? -9.170  36.246  -28.234 1.00 73.76  ? 158 VAL A C   1 
ATOM   362  O  O   . VAL A 1 73  ? -8.881  36.020  -27.052 1.00 68.64  ? 158 VAL A O   1 
ATOM   363  C  CB  . VAL A 1 73  ? -7.473  35.180  -29.855 1.00 70.07  ? 158 VAL A CB  1 
ATOM   364  C  CG1 . VAL A 1 73  ? -7.198  36.481  -30.611 1.00 72.39  ? 158 VAL A CG1 1 
ATOM   365  C  CG2 . VAL A 1 73  ? -6.483  35.010  -28.749 1.00 67.92  ? 158 VAL A CG2 1 
ATOM   366  N  N   . ASP A 1 74  ? -9.675  37.430  -28.619 1.00 70.57  ? 159 ASP A N   1 
ATOM   367  C  CA  . ASP A 1 74  ? -9.884  38.517  -27.637 1.00 72.73  ? 159 ASP A CA  1 
ATOM   368  C  C   . ASP A 1 74  ? -10.836 38.129  -26.492 1.00 73.92  ? 159 ASP A C   1 
ATOM   369  O  O   . ASP A 1 74  ? -10.769 38.680  -25.378 1.00 75.97  ? 159 ASP A O   1 
ATOM   370  C  CB  . ASP A 1 74  ? -10.407 39.810  -28.298 1.00 74.10  ? 159 ASP A CB  1 
ATOM   371  C  CG  . ASP A 1 74  ? -11.389 39.557  -29.433 1.00 78.64  ? 159 ASP A CG  1 
ATOM   372  O  OD1 . ASP A 1 74  ? -11.341 38.470  -30.045 1.00 83.03  ? 159 ASP A OD1 1 
ATOM   373  O  OD2 . ASP A 1 74  ? -12.219 40.456  -29.719 1.00 75.32  ? 159 ASP A OD2 1 
ATOM   374  N  N   . GLN A 1 75  ? -11.657 37.119  -26.754 1.00 70.47  ? 160 GLN A N   1 
ATOM   375  C  CA  . GLN A 1 75  ? -12.733 36.721  -25.857 1.00 68.07  ? 160 GLN A CA  1 
ATOM   376  C  C   . GLN A 1 75  ? -12.365 35.724  -24.776 1.00 69.67  ? 160 GLN A C   1 
ATOM   377  O  O   . GLN A 1 75  ? -13.249 35.154  -24.136 1.00 70.78  ? 160 GLN A O   1 
ATOM   378  C  CB  . GLN A 1 75  ? -13.902 36.198  -26.673 1.00 65.95  ? 160 GLN A CB  1 
ATOM   379  C  CG  . GLN A 1 75  ? -14.361 37.244  -27.677 1.00 68.03  ? 160 GLN A CG  1 
ATOM   380  C  CD  . GLN A 1 75  ? -15.622 36.847  -28.387 1.00 65.15  ? 160 GLN A CD  1 
ATOM   381  O  OE1 . GLN A 1 75  ? -16.316 35.915  -27.960 1.00 67.46  ? 160 GLN A OE1 1 
ATOM   382  N  NE2 . GLN A 1 75  ? -15.976 37.597  -29.430 1.00 56.93  ? 160 GLN A NE2 1 
ATOM   383  N  N   . TYR A 1 76  ? -11.076 35.514  -24.581 1.00 69.40  ? 161 TYR A N   1 
ATOM   384  C  CA  . TYR A 1 76  ? -10.587 34.571  -23.596 1.00 68.08  ? 161 TYR A CA  1 
ATOM   385  C  C   . TYR A 1 76  ? -9.579  35.226  -22.657 1.00 76.44  ? 161 TYR A C   1 
ATOM   386  O  O   . TYR A 1 76  ? -8.887  36.163  -23.009 1.00 70.61  ? 161 TYR A O   1 
ATOM   387  C  CB  . TYR A 1 76  ? -9.989  33.362  -24.287 1.00 66.28  ? 161 TYR A CB  1 
ATOM   388  C  CG  . TYR A 1 76  ? -10.983 32.462  -24.963 1.00 65.72  ? 161 TYR A CG  1 
ATOM   389  C  CD1 . TYR A 1 76  ? -11.650 31.501  -24.258 1.00 67.91  ? 161 TYR A CD1 1 
ATOM   390  C  CD2 . TYR A 1 76  ? -11.233 32.558  -26.310 1.00 62.37  ? 161 TYR A CD2 1 
ATOM   391  C  CE1 . TYR A 1 76  ? -12.546 30.665  -24.869 1.00 63.69  ? 161 TYR A CE1 1 
ATOM   392  C  CE2 . TYR A 1 76  ? -12.128 31.728  -26.924 1.00 62.91  ? 161 TYR A CE2 1 
ATOM   393  C  CZ  . TYR A 1 76  ? -12.774 30.784  -26.195 1.00 68.58  ? 161 TYR A CZ  1 
ATOM   394  O  OH  . TYR A 1 76  ? -13.661 29.945  -26.792 1.00 76.28  ? 161 TYR A OH  1 
ATOM   395  N  N   . ASN A 1 77  ? -9.501  34.710  -21.447 1.00 76.63  ? 162 ASN A N   1 
ATOM   396  C  CA  . ASN A 1 77  ? -8.658  35.294  -20.435 1.00 78.25  ? 162 ASN A CA  1 
ATOM   397  C  C   . ASN A 1 77  ? -7.190  34.936  -20.526 1.00 81.69  ? 162 ASN A C   1 
ATOM   398  O  O   . ASN A 1 77  ? -6.342  35.709  -20.077 1.00 91.34  ? 162 ASN A O   1 
ATOM   399  C  CB  . ASN A 1 77  ? -9.280  34.827  -19.103 1.00 84.31  ? 162 ASN A CB  1 
ATOM   400  C  CG  . ASN A 1 77  ? -8.342  34.875  -17.935 1.00 92.05  ? 162 ASN A CG  1 
ATOM   401  O  OD1 . ASN A 1 77  ? -8.351  34.012  -17.049 1.00 95.52  ? 162 ASN A OD1 1 
ATOM   402  N  ND2 . ASN A 1 77  ? -7.488  35.902  -17.937 1.00 85.58  ? 162 ASN A ND2 1 
ATOM   403  N  N   . ASN A 1 78  ? -6.892  33.862  -21.251 1.00 81.63  ? 163 ASN A N   1 
ATOM   404  C  CA  . ASN A 1 78  ? -5.526  33.374  -21.448 1.00 77.41  ? 163 ASN A CA  1 
ATOM   405  C  C   . ASN A 1 78  ? -5.538  32.143  -22.340 1.00 78.85  ? 163 ASN A C   1 
ATOM   406  O  O   . ASN A 1 78  ? -6.613  31.650  -22.709 1.00 76.66  ? 163 ASN A O   1 
ATOM   407  C  CB  . ASN A 1 78  ? -4.872  33.070  -20.097 1.00 76.41  ? 163 ASN A CB  1 
ATOM   408  C  CG  . ASN A 1 78  ? -5.583  31.958  -19.341 1.00 76.96  ? 163 ASN A CG  1 
ATOM   409  O  OD1 . ASN A 1 78  ? -6.065  30.999  -19.926 1.00 75.29  ? 163 ASN A OD1 1 
ATOM   410  N  ND2 . ASN A 1 78  ? -5.720  32.131  -18.036 1.00 79.15  ? 163 ASN A ND2 1 
ATOM   411  N  N   . GLN A 1 79  ? -4.359  31.587  -22.589 1.00 77.59  ? 164 GLN A N   1 
ATOM   412  C  CA  . GLN A 1 79  ? -4.210  30.448  -23.475 1.00 71.21  ? 164 GLN A CA  1 
ATOM   413  C  C   . GLN A 1 79  ? -4.961  29.197  -22.977 1.00 70.50  ? 164 GLN A C   1 
ATOM   414  O  O   . GLN A 1 79  ? -5.705  28.591  -23.748 1.00 69.26  ? 164 GLN A O   1 
ATOM   415  C  CB  . GLN A 1 79  ? -2.752  30.100  -23.630 1.00 74.60  ? 164 GLN A CB  1 
ATOM   416  C  CG  . GLN A 1 79  ? -2.484  29.001  -24.629 1.00 69.91  ? 164 GLN A CG  1 
ATOM   417  C  CD  . GLN A 1 79  ? -1.013  28.678  -24.672 1.00 68.51  ? 164 GLN A CD  1 
ATOM   418  O  OE1 . GLN A 1 79  ? -0.585  27.658  -24.136 1.00 63.51  ? 164 GLN A OE1 1 
ATOM   419  N  NE2 . GLN A 1 79  ? -0.227  29.553  -25.276 1.00 70.12  ? 164 GLN A NE2 1 
ATOM   420  N  N   . ASN A 1 80  ? -4.805  28.821  -21.708 1.00 63.12  ? 165 ASN A N   1 
ATOM   421  C  CA  . ASN A 1 80  ? -5.449  27.595  -21.231 1.00 64.34  ? 165 ASN A CA  1 
ATOM   422  C  C   . ASN A 1 80  ? -6.947  27.552  -21.438 1.00 67.37  ? 165 ASN A C   1 
ATOM   423  O  O   . ASN A 1 80  ? -7.497  26.508  -21.788 1.00 66.22  ? 165 ASN A O   1 
ATOM   424  C  CB  . ASN A 1 80  ? -5.244  27.388  -19.727 1.00 64.07  ? 165 ASN A CB  1 
ATOM   425  C  CG  . ASN A 1 80  ? -3.831  27.052  -19.359 1.00 81.71  ? 165 ASN A CG  1 
ATOM   426  O  OD1 . ASN A 1 80  ? -3.028  26.596  -20.189 1.00 82.55  ? 165 ASN A OD1 1 
ATOM   427  N  ND2 . ASN A 1 80  ? -3.518  27.239  -18.084 1.00 84.52  ? 165 ASN A ND2 1 
ATOM   428  N  N   . THR A 1 81  ? -7.613  28.674  -21.191 1.00 69.76  ? 166 THR A N   1 
ATOM   429  C  CA  . THR A 1 81  ? -9.056  28.754  -21.376 1.00 65.95  ? 166 THR A CA  1 
ATOM   430  C  C   . THR A 1 81  ? -9.468  28.585  -22.818 1.00 60.00  ? 166 THR A C   1 
ATOM   431  O  O   . THR A 1 81  ? -10.279 27.718  -23.127 1.00 59.37  ? 166 THR A O   1 
ATOM   432  C  CB  . THR A 1 81  ? -9.625  30.098  -20.854 1.00 70.57  ? 166 THR A CB  1 
ATOM   433  O  OG1 . THR A 1 81  ? -8.865  31.186  -21.406 1.00 78.98  ? 166 THR A OG1 1 
ATOM   434  C  CG2 . THR A 1 81  ? -9.573  30.157  -19.335 1.00 56.38  ? 166 THR A CG2 1 
ATOM   435  N  N   . PHE A 1 82  ? -8.805  29.334  -23.696 1.00 62.66  ? 167 PHE A N   1 
ATOM   436  C  CA  . PHE A 1 82  ? -9.039  29.261  -25.138 1.00 63.54  ? 167 PHE A CA  1 
ATOM   437  C  C   . PHE A 1 82  ? -8.869  27.834  -25.604 1.00 64.22  ? 167 PHE A C   1 
ATOM   438  O  O   . PHE A 1 82  ? -9.692  27.320  -26.359 1.00 64.51  ? 167 PHE A O   1 
ATOM   439  C  CB  . PHE A 1 82  ? -8.070  30.171  -25.879 1.00 64.64  ? 167 PHE A CB  1 
ATOM   440  C  CG  . PHE A 1 82  ? -8.124  30.032  -27.370 1.00 64.47  ? 167 PHE A CG  1 
ATOM   441  C  CD1 . PHE A 1 82  ? -7.348  29.087  -28.022 1.00 66.25  ? 167 PHE A CD1 1 
ATOM   442  C  CD2 . PHE A 1 82  ? -8.919  30.873  -28.130 1.00 60.41  ? 167 PHE A CD2 1 
ATOM   443  C  CE1 . PHE A 1 82  ? -7.394  28.967  -29.404 1.00 60.63  ? 167 PHE A CE1 1 
ATOM   444  C  CE2 . PHE A 1 82  ? -8.962  30.762  -29.490 1.00 56.30  ? 167 PHE A CE2 1 
ATOM   445  C  CZ  . PHE A 1 82  ? -8.202  29.806  -30.129 1.00 59.92  ? 167 PHE A CZ  1 
ATOM   446  N  N   . VAL A 1 83  ? -7.736  27.244  -25.263 1.00 60.36  ? 168 VAL A N   1 
ATOM   447  C  CA  . VAL A 1 83  ? -7.447  25.901  -25.702 1.00 61.65  ? 168 VAL A CA  1 
ATOM   448  C  C   . VAL A 1 83  ? -8.529  24.929  -25.215 1.00 56.41  ? 168 VAL A C   1 
ATOM   449  O  O   . VAL A 1 83  ? -9.075  24.177  -25.999 1.00 55.74  ? 168 VAL A O   1 
ATOM   450  C  CB  . VAL A 1 83  ? -6.041  25.440  -25.240 1.00 59.00  ? 168 VAL A CB  1 
ATOM   451  C  CG1 . VAL A 1 83  ? -5.847  23.955  -25.454 1.00 50.73  ? 168 VAL A CG1 1 
ATOM   452  C  CG2 . VAL A 1 83  ? -4.969  26.245  -25.961 1.00 58.88  ? 168 VAL A CG2 1 
ATOM   453  N  N   . HIS A 1 84  ? -8.827  24.972  -23.920 1.00 60.29  ? 169 HIS A N   1 
ATOM   454  C  CA  . HIS A 1 84  ? -9.827  24.109  -23.262 1.00 62.75  ? 169 HIS A CA  1 
ATOM   455  C  C   . HIS A 1 84  ? -11.149 24.195  -24.064 1.00 66.87  ? 169 HIS A C   1 
ATOM   456  O  O   . HIS A 1 84  ? -11.820 23.177  -24.393 1.00 67.15  ? 169 HIS A O   1 
ATOM   457  C  CB  . HIS A 1 84  ? -10.001 24.486  -21.784 1.00 63.34  ? 169 HIS A CB  1 
ATOM   458  C  CG  . HIS A 1 84  ? -10.942 23.593  -21.027 1.00 74.06  ? 169 HIS A CG  1 
ATOM   459  N  ND1 . HIS A 1 84  ? -10.542 22.371  -20.524 1.00 78.45  ? 169 HIS A ND1 1 
ATOM   460  C  CD2 . HIS A 1 84  ? -12.248 23.726  -20.689 1.00 78.15  ? 169 HIS A CD2 1 
ATOM   461  C  CE1 . HIS A 1 84  ? -11.557 21.791  -19.907 1.00 74.32  ? 169 HIS A CE1 1 
ATOM   462  N  NE2 . HIS A 1 84  ? -12.605 22.590  -19.994 1.00 78.37  ? 169 HIS A NE2 1 
ATOM   463  N  N   . ASP A 1 85  ? -11.514 25.418  -24.427 1.00 64.29  ? 170 ASP A N   1 
ATOM   464  C  CA  . ASP A 1 85  ? -12.772 25.597  -25.115 1.00 61.54  ? 170 ASP A CA  1 
ATOM   465  C  C   . ASP A 1 85  ? -12.735 25.060  -26.511 1.00 64.08  ? 170 ASP A C   1 
ATOM   466  O  O   . ASP A 1 85  ? -13.647 24.316  -26.922 1.00 68.74  ? 170 ASP A O   1 
ATOM   467  C  CB  . ASP A 1 85  ? -13.087 27.088  -25.197 1.00 62.38  ? 170 ASP A CB  1 
ATOM   468  C  CG  . ASP A 1 85  ? -14.543 27.357  -25.370 1.00 68.37  ? 170 ASP A CG  1 
ATOM   469  O  OD1 . ASP A 1 85  ? -15.366 26.786  -24.623 1.00 74.85  ? 170 ASP A OD1 1 
ATOM   470  O  OD2 . ASP A 1 85  ? -14.868 28.132  -26.278 1.00 73.54  ? 170 ASP A OD2 1 
ATOM   471  N  N   . CYS A 1 86  ? -11.668 25.401  -27.223 1.00 63.05  ? 171 CYS A N   1 
ATOM   472  C  CA  . CYS A 1 86  ? -11.411 24.915  -28.567 1.00 56.95  ? 171 CYS A CA  1 
ATOM   473  C  C   . CYS A 1 86  ? -11.472 23.383  -28.636 1.00 52.55  ? 171 CYS A C   1 
ATOM   474  O  O   . CYS A 1 86  ? -12.088 22.781  -29.514 1.00 52.31  ? 171 CYS A O   1 
ATOM   475  C  CB  . CYS A 1 86  ? -10.046 25.449  -28.993 1.00 56.74  ? 171 CYS A CB  1 
ATOM   476  S  SG  . CYS A 1 86  ? -9.358  24.859  -30.527 1.00 66.77  ? 171 CYS A SG  1 
ATOM   477  N  N   . VAL A 1 87  ? -10.888 22.753  -27.636 1.00 53.73  ? 172 VAL A N   1 
ATOM   478  C  CA  . VAL A 1 87  ? -10.881 21.307  -27.588 1.00 58.83  ? 172 VAL A CA  1 
ATOM   479  C  C   . VAL A 1 87  ? -12.293 20.725  -27.411 1.00 61.62  ? 172 VAL A C   1 
ATOM   480  O  O   . VAL A 1 87  ? -12.741 19.916  -28.229 1.00 64.73  ? 172 VAL A O   1 
ATOM   481  C  CB  . VAL A 1 87  ? -9.922  20.809  -26.452 1.00 54.65  ? 172 VAL A CB  1 
ATOM   482  C  CG1 . VAL A 1 87  ? -10.054 19.302  -26.223 1.00 50.46  ? 172 VAL A CG1 1 
ATOM   483  C  CG2 . VAL A 1 87  ? -8.504  21.122  -26.827 1.00 53.43  ? 172 VAL A CG2 1 
ATOM   484  N  N   . ASN A 1 88  ? -13.015 21.190  -26.392 1.00 59.95  ? 173 ASN A N   1 
ATOM   485  C  CA  . ASN A 1 88  ? -14.357 20.662  -26.195 1.00 62.67  ? 173 ASN A CA  1 
ATOM   486  C  C   . ASN A 1 88  ? -15.341 20.870  -27.364 1.00 68.07  ? 173 ASN A C   1 
ATOM   487  O  O   . ASN A 1 88  ? -16.041 19.941  -27.829 1.00 62.97  ? 173 ASN A O   1 
ATOM   488  C  CB  . ASN A 1 88  ? -14.884 21.284  -24.919 1.00 64.01  ? 173 ASN A CB  1 
ATOM   489  C  CG  . ASN A 1 88  ? -14.148 20.732  -23.707 1.00 82.80  ? 173 ASN A CG  1 
ATOM   490  O  OD1 . ASN A 1 88  ? -13.576 19.634  -23.775 1.00 85.24  ? 173 ASN A OD1 1 
ATOM   491  N  ND2 . ASN A 1 88  ? -14.127 21.495  -22.617 1.00 87.18  ? 173 ASN A ND2 1 
ATOM   492  N  N   . ILE A 1 89  ? -15.349 22.080  -27.881 1.00 64.20  ? 174 ILE A N   1 
ATOM   493  C  CA  . ILE A 1 89  ? -16.219 22.403  -28.973 1.00 67.81  ? 174 ILE A CA  1 
ATOM   494  C  C   . ILE A 1 89  ? -15.883 21.584  -30.209 1.00 67.91  ? 174 ILE A C   1 
ATOM   495  O  O   . ILE A 1 89  ? -16.780 20.988  -30.822 1.00 66.67  ? 174 ILE A O   1 
ATOM   496  C  CB  . ILE A 1 89  ? -16.117 23.879  -29.242 1.00 74.96  ? 174 ILE A CB  1 
ATOM   497  C  CG1 . ILE A 1 89  ? -16.614 24.590  -27.980 1.00 82.46  ? 174 ILE A CG1 1 
ATOM   498  C  CG2 . ILE A 1 89  ? -16.910 24.236  -30.504 1.00 71.79  ? 174 ILE A CG2 1 
ATOM   499  C  CD1 . ILE A 1 89  ? -16.453 26.067  -27.991 1.00 87.01  ? 174 ILE A CD1 1 
ATOM   500  N  N   . THR A 1 90  ? -14.598 21.543  -30.571 1.00 68.78  ? 175 THR A N   1 
ATOM   501  C  CA  . THR A 1 90  ? -14.146 20.791  -31.745 1.00 61.69  ? 175 THR A CA  1 
ATOM   502  C  C   . THR A 1 90  ? -14.470 19.315  -31.650 1.00 59.34  ? 175 THR A C   1 
ATOM   503  O  O   . THR A 1 90  ? -14.931 18.698  -32.623 1.00 57.00  ? 175 THR A O   1 
ATOM   504  C  CB  . THR A 1 90  ? -12.666 20.997  -31.976 1.00 58.14  ? 175 THR A CB  1 
ATOM   505  O  OG1 . THR A 1 90  ? -12.476 22.370  -32.332 1.00 61.43  ? 175 THR A OG1 1 
ATOM   506  C  CG2 . THR A 1 90  ? -12.197 20.196  -33.134 1.00 60.30  ? 175 THR A CG2 1 
ATOM   507  N  N   . VAL A 1 91  ? -14.223 18.738  -30.490 1.00 55.87  ? 176 VAL A N   1 
ATOM   508  C  CA  . VAL A 1 91  ? -14.464 17.321  -30.348 1.00 59.73  ? 176 VAL A CA  1 
ATOM   509  C  C   . VAL A 1 91  ? -15.963 17.029  -30.391 1.00 64.61  ? 176 VAL A C   1 
ATOM   510  O  O   . VAL A 1 91  ? -16.387 16.041  -30.997 1.00 62.70  ? 176 VAL A O   1 
ATOM   511  C  CB  . VAL A 1 91  ? -13.847 16.775  -29.055 1.00 58.70  ? 176 VAL A CB  1 
ATOM   512  C  CG1 . VAL A 1 91  ? -14.430 15.402  -28.731 1.00 61.89  ? 176 VAL A CG1 1 
ATOM   513  C  CG2 . VAL A 1 91  ? -12.340 16.710  -29.196 1.00 54.27  ? 176 VAL A CG2 1 
ATOM   514  N  N   . LYS A 1 92  ? -16.759 17.900  -29.761 1.00 68.36  ? 177 LYS A N   1 
ATOM   515  C  CA  . LYS A 1 92  ? -18.212 17.746  -29.760 1.00 63.95  ? 177 LYS A CA  1 
ATOM   516  C  C   . LYS A 1 92  ? -18.743 17.746  -31.163 1.00 61.69  ? 177 LYS A C   1 
ATOM   517  O  O   . LYS A 1 92  ? -19.437 16.807  -31.579 1.00 66.54  ? 177 LYS A O   1 
ATOM   518  C  CB  . LYS A 1 92  ? -18.890 18.852  -28.951 1.00 64.26  ? 177 LYS A CB  1 
ATOM   519  C  CG  . LYS A 1 92  ? -19.569 18.288  -27.730 1.00 71.08  ? 177 LYS A CG  1 
ATOM   520  C  CD  . LYS A 1 92  ? -20.141 16.908  -28.093 1.00 79.62  ? 177 LYS A CD  1 
ATOM   521  C  CE  . LYS A 1 92  ? -20.663 16.122  -26.896 1.00 82.33  ? 177 LYS A CE  1 
ATOM   522  N  NZ  . LYS A 1 92  ? -20.976 14.714  -27.317 1.00 75.67  ? 177 LYS A NZ  1 
ATOM   523  N  N   . GLN A 1 93  ? -18.321 18.749  -31.920 1.00 57.21  ? 178 GLN A N   1 
ATOM   524  C  CA  . GLN A 1 93  ? -18.745 18.877  -33.295 1.00 62.91  ? 178 GLN A CA  1 
ATOM   525  C  C   . GLN A 1 93  ? -18.287 17.744  -34.207 1.00 68.57  ? 178 GLN A C   1 
ATOM   526  O  O   . GLN A 1 93  ? -19.032 17.288  -35.109 1.00 68.72  ? 178 GLN A O   1 
ATOM   527  C  CB  . GLN A 1 93  ? -18.298 20.234  -33.828 1.00 57.59  ? 178 GLN A CB  1 
ATOM   528  C  CG  . GLN A 1 93  ? -18.842 20.504  -35.213 1.00 73.84  ? 178 GLN A CG  1 
ATOM   529  C  CD  . GLN A 1 93  ? -20.346 20.489  -35.306 1.00 76.98  ? 178 GLN A CD  1 
ATOM   530  O  OE1 . GLN A 1 93  ? -21.071 20.505  -34.295 1.00 73.08  ? 178 GLN A OE1 1 
ATOM   531  N  NE2 . GLN A 1 93  ? -20.834 20.414  -36.540 1.00 76.07  ? 178 GLN A NE2 1 
ATOM   532  N  N   . HIS A 1 94  ? -17.069 17.283  -33.985 1.00 67.62  ? 179 HIS A N   1 
ATOM   533  C  CA  . HIS A 1 94  ? -16.570 16.204  -34.795 1.00 68.67  ? 179 HIS A CA  1 
ATOM   534  C  C   . HIS A 1 94  ? -17.346 14.949  -34.473 1.00 66.46  ? 179 HIS A C   1 
ATOM   535  O  O   . HIS A 1 94  ? -17.617 14.147  -35.355 1.00 69.23  ? 179 HIS A O   1 
ATOM   536  C  CB  . HIS A 1 94  ? -15.102 15.949  -34.524 1.00 70.24  ? 179 HIS A CB  1 
ATOM   537  C  CG  . HIS A 1 94  ? -14.439 15.120  -35.568 1.00 62.71  ? 179 HIS A CG  1 
ATOM   538  N  ND1 . HIS A 1 94  ? -14.165 15.599  -36.828 1.00 64.13  ? 179 HIS A ND1 1 
ATOM   539  C  CD2 . HIS A 1 94  ? -14.084 13.815  -35.571 1.00 59.25  ? 179 HIS A CD2 1 
ATOM   540  C  CE1 . HIS A 1 94  ? -13.586 14.647  -37.537 1.00 62.30  ? 179 HIS A CE1 1 
ATOM   541  N  NE2 . HIS A 1 94  ? -13.535 13.551  -36.800 1.00 61.36  ? 179 HIS A NE2 1 
ATOM   542  N  N   . THR A 1 95  ? -17.735 14.806  -33.207 1.00 63.83  ? 180 THR A N   1 
ATOM   543  C  CA  . THR A 1 95  ? -18.440 13.607  -32.780 1.00 67.24  ? 180 THR A CA  1 
ATOM   544  C  C   . THR A 1 95  ? -19.821 13.601  -33.386 1.00 78.40  ? 180 THR A C   1 
ATOM   545  O  O   . THR A 1 95  ? -20.314 12.543  -33.801 1.00 84.14  ? 180 THR A O   1 
ATOM   546  C  CB  . THR A 1 95  ? -18.549 13.523  -31.235 1.00 67.20  ? 180 THR A CB  1 
ATOM   547  O  OG1 . THR A 1 95  ? -17.236 13.436  -30.651 1.00 61.65  ? 180 THR A OG1 1 
ATOM   548  C  CG2 . THR A 1 95  ? -19.342 12.316  -30.824 1.00 62.47  ? 180 THR A CG2 1 
ATOM   549  N  N   . VAL A 1 96  ? -20.477 14.758  -33.443 1.00 76.64  ? 181 VAL A N   1 
ATOM   550  C  CA  . VAL A 1 96  ? -21.783 14.735  -34.093 1.00 79.72  ? 181 VAL A CA  1 
ATOM   551  C  C   . VAL A 1 96  ? -21.651 14.447  -35.608 1.00 75.91  ? 181 VAL A C   1 
ATOM   552  O  O   . VAL A 1 96  ? -22.378 13.586  -36.117 1.00 82.40  ? 181 VAL A O   1 
ATOM   553  C  CB  . VAL A 1 96  ? -22.636 16.035  -33.806 1.00 76.83  ? 181 VAL A CB  1 
ATOM   554  C  CG1 . VAL A 1 96  ? -22.744 16.268  -32.291 1.00 75.51  ? 181 VAL A CG1 1 
ATOM   555  C  CG2 . VAL A 1 96  ? -22.154 17.283  -34.578 1.00 69.31  ? 181 VAL A CG2 1 
ATOM   556  N  N   . THR A 1 97  ? -20.658 15.022  -36.300 1.00 71.23  ? 182 THR A N   1 
ATOM   557  C  CA  . THR A 1 97  ? -20.579 14.743  -37.753 1.00 80.90  ? 182 THR A CA  1 
ATOM   558  C  C   . THR A 1 97  ? -20.120 13.315  -38.074 1.00 85.20  ? 182 THR A C   1 
ATOM   559  O  O   . THR A 1 97  ? -20.515 12.736  -39.087 1.00 86.89  ? 182 THR A O   1 
ATOM   560  C  CB  . THR A 1 97  ? -19.647 15.720  -38.516 1.00 73.71  ? 182 THR A CB  1 
ATOM   561  O  OG1 . THR A 1 97  ? -18.280 15.373  -38.282 1.00 80.00  ? 182 THR A OG1 1 
ATOM   562  C  CG2 . THR A 1 97  ? -19.898 17.159  -38.104 1.00 75.95  ? 182 THR A CG2 1 
ATOM   563  N  N   . THR A 1 98  ? -19.279 12.749  -37.229 1.00 79.83  ? 183 THR A N   1 
ATOM   564  C  CA  . THR A 1 98  ? -18.864 11.379  -37.443 1.00 83.79  ? 183 THR A CA  1 
ATOM   565  C  C   . THR A 1 98  ? -20.039 10.456  -37.129 1.00 85.89  ? 183 THR A C   1 
ATOM   566  O  O   . THR A 1 98  ? -20.272 9.496   -37.860 1.00 89.97  ? 183 THR A O   1 
ATOM   567  C  CB  . THR A 1 98  ? -17.645 10.961  -36.613 1.00 79.45  ? 183 THR A CB  1 
ATOM   568  O  OG1 . THR A 1 98  ? -17.841 11.349  -35.254 1.00 82.31  ? 183 THR A OG1 1 
ATOM   569  C  CG2 . THR A 1 98  ? -16.382 11.615  -37.162 1.00 78.28  ? 183 THR A CG2 1 
ATOM   570  N  N   . THR A 1 99  ? -20.778 10.740  -36.050 1.00 80.22  ? 184 THR A N   1 
ATOM   571  C  CA  . THR A 1 99  ? -21.949 9.920   -35.729 1.00 89.52  ? 184 THR A CA  1 
ATOM   572  C  C   . THR A 1 99  ? -23.024 9.889   -36.843 1.00 89.77  ? 184 THR A C   1 
ATOM   573  O  O   . THR A 1 99  ? -23.579 8.820   -37.166 1.00 84.07  ? 184 THR A O   1 
ATOM   574  C  CB  . THR A 1 99  ? -22.640 10.458  -34.446 1.00 88.29  ? 184 THR A CB  1 
ATOM   575  O  OG1 . THR A 1 99  ? -21.808 10.248  -33.306 1.00 84.71  ? 184 THR A OG1 1 
ATOM   576  C  CG2 . THR A 1 99  ? -24.017 9.840   -34.239 1.00 83.14  ? 184 THR A CG2 1 
ATOM   577  N  N   . THR A 1 100 ? -23.317 11.051  -37.425 1.00 87.20  ? 185 THR A N   1 
ATOM   578  C  CA  . THR A 1 100 ? -24.230 11.162  -38.561 1.00 93.33  ? 185 THR A CA  1 
ATOM   579  C  C   . THR A 1 100 ? -23.809 10.230  -39.719 1.00 93.39  ? 185 THR A C   1 
ATOM   580  O  O   . THR A 1 100 ? -24.659 9.636   -40.392 1.00 100.25 ? 185 THR A O   1 
ATOM   581  C  CB  . THR A 1 100 ? -24.446 12.614  -39.011 1.00 99.08  ? 185 THR A CB  1 
ATOM   582  O  OG1 . THR A 1 100 ? -25.199 13.277  -37.989 1.00 103.19 ? 185 THR A OG1 1 
ATOM   583  C  CG2 . THR A 1 100 ? -25.306 12.662  -40.282 1.00 98.40  ? 185 THR A CG2 1 
ATOM   584  N  N   . LYS A 1 101 ? -22.513 10.043  -39.898 1.00 89.70  ? 186 LYS A N   1 
ATOM   585  C  CA  . LYS A 1 101 ? -22.019 9.188   -40.987 1.00 88.96  ? 186 LYS A CA  1 
ATOM   586  C  C   . LYS A 1 101 ? -22.135 7.741   -40.548 1.00 88.94  ? 186 LYS A C   1 
ATOM   587  O  O   . LYS A 1 101 ? -21.699 6.847   -41.249 1.00 87.70  ? 186 LYS A O   1 
ATOM   588  C  CB  . LYS A 1 101 ? -20.546 9.445   -41.302 1.00 91.68  ? 186 LYS A CB  1 
ATOM   589  C  CG  . LYS A 1 101 ? -20.216 10.715  -42.029 1.00 94.74  ? 186 LYS A CG  1 
ATOM   590  C  CD  . LYS A 1 101 ? -18.992 11.303  -41.320 1.00 97.44  ? 186 LYS A CD  1 
ATOM   591  C  CE  . LYS A 1 101 ? -18.838 12.797  -41.577 1.00 98.42  ? 186 LYS A CE  1 
ATOM   592  N  NZ  . LYS A 1 101 ? -17.688 13.353  -40.804 1.00 86.47  ? 186 LYS A NZ  1 
ATOM   593  N  N   . GLY A 1 102 ? -22.689 7.539   -39.359 1.00 90.12  ? 187 GLY A N   1 
ATOM   594  C  CA  . GLY A 1 102 ? -22.933 6.226   -38.792 1.00 88.00  ? 187 GLY A CA  1 
ATOM   595  C  C   . GLY A 1 102 ? -21.695 5.579   -38.124 1.00 97.93  ? 187 GLY A C   1 
ATOM   596  O  O   . GLY A 1 102 ? -21.722 4.395   -37.801 1.00 98.98  ? 187 GLY A O   1 
ATOM   597  N  N   . GLU A 1 103 ? -20.643 6.355   -37.852 1.00 92.81  ? 188 GLU A N   1 
ATOM   598  C  CA  . GLU A 1 103 ? -19.432 5.818   -37.273 1.00 91.65  ? 188 GLU A CA  1 
ATOM   599  C  C   . GLU A 1 103 ? -19.309 6.299   -35.799 1.00 95.44  ? 188 GLU A C   1 
ATOM   600  O  O   . GLU A 1 103 ? -19.972 7.272   -35.372 1.00 93.90  ? 188 GLU A O   1 
ATOM   601  C  CB  . GLU A 1 103 ? -18.271 6.359   -38.086 1.00 89.84  ? 188 GLU A CB  1 
ATOM   602  C  CG  . GLU A 1 103 ? -18.244 5.926   -39.557 1.00 95.39  ? 188 GLU A CG  1 
ATOM   603  C  CD  . GLU A 1 103 ? -17.219 6.756   -40.335 1.00 96.58  ? 188 GLU A CD  1 
ATOM   604  O  OE1 . GLU A 1 103 ? -16.308 7.387   -39.726 1.00 92.93  ? 188 GLU A OE1 1 
ATOM   605  O  OE2 . GLU A 1 103 ? -17.408 6.891   -41.566 1.00 92.74  ? 188 GLU A OE2 1 
ATOM   606  N  N   . ASN A 1 104 ? -18.502 5.601   -34.998 1.00 90.87  ? 189 ASN A N   1 
ATOM   607  C  CA  . ASN A 1 104 ? -18.422 6.013   -33.597 1.00 84.74  ? 189 ASN A CA  1 
ATOM   608  C  C   . ASN A 1 104 ? -17.014 6.047   -33.015 1.00 79.52  ? 189 ASN A C   1 
ATOM   609  O  O   . ASN A 1 104 ? -16.130 5.257   -33.358 1.00 78.96  ? 189 ASN A O   1 
ATOM   610  C  CB  . ASN A 1 104 ? -19.309 5.304   -32.571 1.00 96.57  ? 189 ASN A CB  1 
ATOM   611  C  CG  . ASN A 1 104 ? -20.776 5.358   -32.890 1.00 108.48 ? 189 ASN A CG  1 
ATOM   612  O  OD1 . ASN A 1 104 ? -21.449 6.318   -32.444 1.00 106.95 ? 189 ASN A OD1 1 
ATOM   613  N  ND2 . ASN A 1 104 ? -21.332 4.186   -33.191 1.00 117.60 ? 189 ASN A ND2 1 
ATOM   614  N  N   . PHE A 1 105 ? -16.844 6.943   -32.060 1.00 72.34  ? 190 PHE A N   1 
ATOM   615  C  CA  . PHE A 1 105 ? -15.598 7.020   -31.352 1.00 67.38  ? 190 PHE A CA  1 
ATOM   616  C  C   . PHE A 1 105 ? -15.620 6.283   -30.048 1.00 64.24  ? 190 PHE A C   1 
ATOM   617  O  O   . PHE A 1 105 ? -16.484 6.469   -29.217 1.00 70.08  ? 190 PHE A O   1 
ATOM   618  C  CB  . PHE A 1 105 ? -15.273 8.460   -31.053 1.00 65.47  ? 190 PHE A CB  1 
ATOM   619  C  CG  . PHE A 1 105 ? -15.017 9.240   -32.269 1.00 65.62  ? 190 PHE A CG  1 
ATOM   620  C  CD1 . PHE A 1 105 ? -14.041 8.829   -33.169 1.00 59.47  ? 190 PHE A CD1 1 
ATOM   621  C  CD2 . PHE A 1 105 ? -15.668 10.446  -32.468 1.00 60.92  ? 190 PHE A CD2 1 
ATOM   622  C  CE1 . PHE A 1 105 ? -13.794 9.558   -34.300 1.00 62.74  ? 190 PHE A CE1 1 
ATOM   623  C  CE2 . PHE A 1 105 ? -15.407 11.197  -33.585 1.00 66.36  ? 190 PHE A CE2 1 
ATOM   624  C  CZ  . PHE A 1 105 ? -14.472 10.753  -34.511 1.00 65.60  ? 190 PHE A CZ  1 
ATOM   625  N  N   . THR A 1 106 ? -14.582 5.488   -29.862 1.00 59.92  ? 191 THR A N   1 
ATOM   626  C  CA  . THR A 1 106 ? -14.413 4.756   -28.653 1.00 61.73  ? 191 THR A CA  1 
ATOM   627  C  C   . THR A 1 106 ? -13.774 5.714   -27.658 1.00 65.14  ? 191 THR A C   1 
ATOM   628  O  O   . THR A 1 106 ? -13.466 6.862   -27.987 1.00 64.34  ? 191 THR A O   1 
ATOM   629  C  CB  . THR A 1 106 ? -13.535 3.507   -28.825 1.00 67.80  ? 191 THR A CB  1 
ATOM   630  O  OG1 . THR A 1 106 ? -13.280 2.935   -27.537 1.00 85.85  ? 191 THR A OG1 1 
ATOM   631  C  CG2 . THR A 1 106 ? -12.160 3.866   -29.428 1.00 65.53  ? 191 THR A CG2 1 
ATOM   632  N  N   . GLU A 1 107 ? -13.587 5.227   -26.438 1.00 62.91  ? 192 GLU A N   1 
ATOM   633  C  CA  . GLU A 1 107 ? -13.011 6.001   -25.356 1.00 67.31  ? 192 GLU A CA  1 
ATOM   634  C  C   . GLU A 1 107 ? -11.553 6.374   -25.618 1.00 61.15  ? 192 GLU A C   1 
ATOM   635  O  O   . GLU A 1 107 ? -11.133 7.509   -25.355 1.00 56.25  ? 192 GLU A O   1 
ATOM   636  C  CB  . GLU A 1 107 ? -13.142 5.100   -24.137 1.00 75.41  ? 192 GLU A CB  1 
ATOM   637  C  CG  . GLU A 1 107 ? -14.571 4.530   -24.134 1.00 87.64  ? 192 GLU A CG  1 
ATOM   638  C  CD  . GLU A 1 107 ? -14.825 3.468   -23.093 1.00 101.63 ? 192 GLU A CD  1 
ATOM   639  O  OE1 . GLU A 1 107 ? -14.604 3.713   -21.889 1.00 101.86 ? 192 GLU A OE1 1 
ATOM   640  O  OE2 . GLU A 1 107 ? -15.232 2.357   -23.518 1.00 103.97 ? 192 GLU A OE2 1 
ATOM   641  N  N   . THR A 1 108 ? -10.850 5.468   -26.296 1.00 65.14  ? 193 THR A N   1 
ATOM   642  C  CA  . THR A 1 108 ? -9.489  5.704   -26.749 1.00 56.21  ? 193 THR A CA  1 
ATOM   643  C  C   . THR A 1 108 ? -9.506  6.770   -27.830 1.00 51.94  ? 193 THR A C   1 
ATOM   644  O  O   . THR A 1 108 ? -8.648  7.661   -27.834 1.00 51.41  ? 193 THR A O   1 
ATOM   645  C  CB  . THR A 1 108 ? -8.808  4.449   -27.308 1.00 48.01  ? 193 THR A CB  1 
ATOM   646  O  OG1 . THR A 1 108 ? -8.763  3.440   -26.300 1.00 44.38  ? 193 THR A OG1 1 
ATOM   647  C  CG2 . THR A 1 108 ? -7.434  4.772   -27.635 1.00 45.25  ? 193 THR A CG2 1 
ATOM   648  N  N   . ASP A 1 109 ? -10.469 6.665   -28.744 1.00 49.22  ? 194 ASP A N   1 
ATOM   649  C  CA  . ASP A 1 109 ? -10.579 7.658   -29.805 1.00 54.85  ? 194 ASP A CA  1 
ATOM   650  C  C   . ASP A 1 109 ? -10.670 9.041   -29.220 1.00 52.23  ? 194 ASP A C   1 
ATOM   651  O  O   . ASP A 1 109 ? -9.979  9.956   -29.665 1.00 43.52  ? 194 ASP A O   1 
ATOM   652  C  CB  . ASP A 1 109 ? -11.810 7.424   -30.702 1.00 57.96  ? 194 ASP A CB  1 
ATOM   653  C  CG  . ASP A 1 109 ? -11.662 6.237   -31.624 1.00 54.06  ? 194 ASP A CG  1 
ATOM   654  O  OD1 . ASP A 1 109 ? -10.534 5.917   -32.004 1.00 55.41  ? 194 ASP A OD1 1 
ATOM   655  O  OD2 . ASP A 1 109 ? -12.684 5.619   -31.982 1.00 59.41  ? 194 ASP A OD2 1 
ATOM   656  N  N   . ILE A 1 110 ? -11.538 9.170   -28.221 1.00 55.38  ? 195 ILE A N   1 
ATOM   657  C  CA  . ILE A 1 110 ? -11.769 10.440  -27.552 1.00 52.90  ? 195 ILE A CA  1 
ATOM   658  C  C   . ILE A 1 110 ? -10.518 10.945  -26.850 1.00 50.75  ? 195 ILE A C   1 
ATOM   659  O  O   . ILE A 1 110 ? -10.209 12.124  -26.945 1.00 46.98  ? 195 ILE A O   1 
ATOM   660  C  CB  . ILE A 1 110 ? -12.942 10.331  -26.585 1.00 57.69  ? 195 ILE A CB  1 
ATOM   661  C  CG1 . ILE A 1 110 ? -14.250 10.323  -27.403 1.00 64.90  ? 195 ILE A CG1 1 
ATOM   662  C  CG2 . ILE A 1 110 ? -12.943 11.508  -25.622 1.00 55.56  ? 195 ILE A CG2 1 
ATOM   663  C  CD1 . ILE A 1 110 ? -15.470 9.877   -26.633 1.00 63.27  ? 195 ILE A CD1 1 
ATOM   664  N  N   . LYS A 1 111 ? -9.803  10.060  -26.155 1.00 48.72  ? 196 LYS A N   1 
ATOM   665  C  CA  . LYS A 1 111 ? -8.550  10.446  -25.512 1.00 49.30  ? 196 LYS A CA  1 
ATOM   666  C  C   . LYS A 1 111 ? -7.471  10.954  -26.490 1.00 51.59  ? 196 LYS A C   1 
ATOM   667  O  O   . LYS A 1 111 ? -6.899  12.053  -26.310 1.00 52.44  ? 196 LYS A O   1 
ATOM   668  C  CB  . LYS A 1 111 ? -7.998  9.263   -24.712 1.00 45.26  ? 196 LYS A CB  1 
ATOM   669  C  CG  . LYS A 1 111 ? -6.618  9.519   -24.028 1.00 53.68  ? 196 LYS A CG  1 
ATOM   670  C  CD  . LYS A 1 111 ? -6.216  8.273   -23.196 1.00 48.85  ? 196 LYS A CD  1 
ATOM   671  C  CE  . LYS A 1 111 ? -5.495  7.226   -24.014 1.00 37.78  ? 196 LYS A CE  1 
ATOM   672  N  NZ  . LYS A 1 111 ? -5.080  6.115   -23.178 1.00 37.09  ? 196 LYS A NZ  1 
ATOM   673  N  N   . MET A 1 112 ? -7.315  10.246  -27.601 1.00 45.32  ? 197 MET A N   1 
ATOM   674  C  CA  . MET A 1 112 ? -6.297  10.589  -28.574 1.00 45.92  ? 197 MET A CA  1 
ATOM   675  C  C   . MET A 1 112 ? -6.669  11.856  -29.283 1.00 49.33  ? 197 MET A C   1 
ATOM   676  O  O   . MET A 1 112 ? -5.851  12.771  -29.441 1.00 49.49  ? 197 MET A O   1 
ATOM   677  C  CB  . MET A 1 112 ? -6.143  9.460   -29.596 1.00 41.77  ? 197 MET A CB  1 
ATOM   678  C  CG  . MET A 1 112 ? -5.605  8.224   -28.957 1.00 45.76  ? 197 MET A CG  1 
ATOM   679  S  SD  . MET A 1 112 ? -5.443  6.847   -30.060 1.00 41.85  ? 197 MET A SD  1 
ATOM   680  C  CE  . MET A 1 112 ? -4.358  5.795   -29.088 1.00 42.82  ? 197 MET A CE  1 
ATOM   681  N  N   . MET A 1 113 ? -7.939  11.920  -29.645 1.00 50.12  ? 198 MET A N   1 
ATOM   682  C  CA  . MET A 1 113 ? -8.503  13.077  -30.286 1.00 49.84  ? 198 MET A CA  1 
ATOM   683  C  C   . MET A 1 113 ? -8.314  14.273  -29.379 1.00 47.96  ? 198 MET A C   1 
ATOM   684  O  O   . MET A 1 113 ? -7.961  15.330  -29.853 1.00 51.92  ? 198 MET A O   1 
ATOM   685  C  CB  . MET A 1 113 ? -9.977  12.790  -30.592 1.00 49.62  ? 198 MET A CB  1 
ATOM   686  C  CG  . MET A 1 113 ? -10.773 13.862  -31.257 1.00 50.61  ? 198 MET A CG  1 
ATOM   687  S  SD  . MET A 1 113 ? -12.075 13.001  -32.175 1.00 69.28  ? 198 MET A SD  1 
ATOM   688  C  CE  . MET A 1 113 ? -12.762 11.920  -30.923 1.00 62.97  ? 198 MET A CE  1 
ATOM   689  N  N   . GLU A 1 114 ? -8.589  14.126  -28.091 1.00 45.90  ? 199 GLU A N   1 
ATOM   690  C  CA  . GLU A 1 114 ? -8.381  15.209  -27.147 1.00 49.28  ? 199 GLU A CA  1 
ATOM   691  C  C   . GLU A 1 114 ? -6.920  15.703  -27.184 1.00 52.04  ? 199 GLU A C   1 
ATOM   692  O  O   . GLU A 1 114 ? -6.638  16.901  -27.317 1.00 44.08  ? 199 GLU A O   1 
ATOM   693  C  CB  . GLU A 1 114 ? -8.758  14.769  -25.720 1.00 54.46  ? 199 GLU A CB  1 
ATOM   694  C  CG  . GLU A 1 114 ? -10.254 14.985  -25.357 1.00 64.59  ? 199 GLU A CG  1 
ATOM   695  C  CD  . GLU A 1 114 ? -10.635 14.473  -23.953 1.00 69.76  ? 199 GLU A CD  1 
ATOM   696  O  OE1 . GLU A 1 114 ? -9.733  14.337  -23.088 1.00 75.51  ? 199 GLU A OE1 1 
ATOM   697  O  OE2 . GLU A 1 114 ? -11.841 14.209  -23.716 1.00 71.60  ? 199 GLU A OE2 1 
ATOM   698  N  N   . ARG A 1 115 ? -5.984  14.760  -27.135 1.00 46.77  ? 200 ARG A N   1 
ATOM   699  C  CA  . ARG A 1 115 ? -4.599  15.167  -27.080 1.00 47.39  ? 200 ARG A CA  1 
ATOM   700  C  C   . ARG A 1 115 ? -4.204  15.928  -28.346 1.00 52.95  ? 200 ARG A C   1 
ATOM   701  O  O   . ARG A 1 115 ? -3.612  17.028  -28.271 1.00 53.63  ? 200 ARG A O   1 
ATOM   702  C  CB  . ARG A 1 115 ? -3.676  13.975  -26.822 1.00 49.77  ? 200 ARG A CB  1 
ATOM   703  C  CG  . ARG A 1 115 ? -2.215  14.359  -26.671 1.00 38.77  ? 200 ARG A CG  1 
ATOM   704  C  CD  . ARG A 1 115 ? -1.326  13.128  -26.584 1.00 42.60  ? 200 ARG A CD  1 
ATOM   705  N  NE  . ARG A 1 115 ? 0.079   13.543  -26.424 1.00 46.58  ? 200 ARG A NE  1 
ATOM   706  C  CZ  . ARG A 1 115 ? 1.134   12.727  -26.405 1.00 42.47  ? 200 ARG A CZ  1 
ATOM   707  N  NH1 . ARG A 1 115 ? 1.002   11.411  -26.519 1.00 42.92  ? 200 ARG A NH1 1 
ATOM   708  N  NH2 . ARG A 1 115 ? 2.338   13.237  -26.234 1.00 45.83  ? 200 ARG A NH2 1 
ATOM   709  N  N   . VAL A 1 116 ? -4.558  15.377  -29.505 1.00 48.89  ? 201 VAL A N   1 
ATOM   710  C  CA  . VAL A 1 116 ? -4.143  15.998  -30.756 1.00 51.91  ? 201 VAL A CA  1 
ATOM   711  C  C   . VAL A 1 116 ? -4.890  17.301  -31.067 1.00 48.19  ? 201 VAL A C   1 
ATOM   712  O  O   . VAL A 1 116 ? -4.300  18.280  -31.557 1.00 47.03  ? 201 VAL A O   1 
ATOM   713  C  CB  . VAL A 1 116 ? -4.310  14.976  -31.946 1.00 55.77  ? 201 VAL A CB  1 
ATOM   714  C  CG1 . VAL A 1 116 ? -5.755  14.532  -32.088 1.00 53.00  ? 201 VAL A CG1 1 
ATOM   715  C  CG2 . VAL A 1 116 ? -3.778  15.542  -33.259 1.00 54.03  ? 201 VAL A CG2 1 
ATOM   716  N  N   . VAL A 1 117 ? -6.160  17.357  -30.719 1.00 49.30  ? 202 VAL A N   1 
ATOM   717  C  CA  . VAL A 1 117 ? -6.886  18.591  -30.888 1.00 47.90  ? 202 VAL A CA  1 
ATOM   718  C  C   . VAL A 1 117 ? -6.317  19.631  -29.917 1.00 49.28  ? 202 VAL A C   1 
ATOM   719  O  O   . VAL A 1 117 ? -6.284  20.802  -30.263 1.00 48.61  ? 202 VAL A O   1 
ATOM   720  C  CB  . VAL A 1 117 ? -8.362  18.394  -30.721 1.00 51.51  ? 202 VAL A CB  1 
ATOM   721  C  CG1 . VAL A 1 117 ? -9.086  19.754  -30.794 1.00 56.77  ? 202 VAL A CG1 1 
ATOM   722  C  CG2 . VAL A 1 117 ? -8.850  17.529  -31.848 1.00 47.86  ? 202 VAL A CG2 1 
ATOM   723  N  N   . GLU A 1 118 ? -5.884  19.229  -28.713 1.00 47.41  ? 203 GLU A N   1 
ATOM   724  C  CA  . GLU A 1 118 ? -5.240  20.191  -27.810 1.00 47.74  ? 203 GLU A CA  1 
ATOM   725  C  C   . GLU A 1 118 ? -4.000  20.761  -28.463 1.00 46.10  ? 203 GLU A C   1 
ATOM   726  O  O   . GLU A 1 118 ? -3.804  21.992  -28.437 1.00 44.95  ? 203 GLU A O   1 
ATOM   727  C  CB  . GLU A 1 118 ? -4.891  19.584  -26.426 1.00 54.15  ? 203 GLU A CB  1 
ATOM   728  C  CG  . GLU A 1 118 ? -4.242  20.603  -25.425 1.00 47.77  ? 203 GLU A CG  1 
ATOM   729  C  CD  . GLU A 1 118 ? -4.059  20.083  -23.998 1.00 59.57  ? 203 GLU A CD  1 
ATOM   730  O  OE1 . GLU A 1 118 ? -3.039  20.430  -23.382 1.00 69.84  ? 203 GLU A OE1 1 
ATOM   731  O  OE2 . GLU A 1 118 ? -4.927  19.361  -23.461 1.00 67.25  ? 203 GLU A OE2 1 
ATOM   732  N  N   . GLN A 1 119 ? -3.149  19.897  -29.034 1.00 48.00  ? 204 GLN A N   1 
ATOM   733  C  CA  . GLN A 1 119 ? -1.984  20.430  -29.796 1.00 48.28  ? 204 GLN A CA  1 
ATOM   734  C  C   . GLN A 1 119 ? -2.361  21.411  -30.902 1.00 47.64  ? 204 GLN A C   1 
ATOM   735  O  O   . GLN A 1 119 ? -1.778  22.506  -31.012 1.00 50.58  ? 204 GLN A O   1 
ATOM   736  C  CB  . GLN A 1 119 ? -1.078  19.350  -30.414 1.00 46.43  ? 204 GLN A CB  1 
ATOM   737  C  CG  . GLN A 1 119 ? -0.304  18.502  -29.416 1.00 54.20  ? 204 GLN A CG  1 
ATOM   738  C  CD  . GLN A 1 119 ? 0.731   17.587  -30.067 1.00 52.92  ? 204 GLN A CD  1 
ATOM   739  O  OE1 . GLN A 1 119 ? 0.951   17.638  -31.286 1.00 54.14  ? 204 GLN A OE1 1 
ATOM   740  N  NE2 . GLN A 1 119 ? 1.387   16.754  -29.247 1.00 53.04  ? 204 GLN A NE2 1 
ATOM   741  N  N   . MET A 1 120 ? -3.376  21.049  -31.681 1.00 47.57  ? 205 MET A N   1 
ATOM   742  C  CA  . MET A 1 120 ? -3.790  21.905  -32.780 1.00 51.21  ? 205 MET A CA  1 
ATOM   743  C  C   . MET A 1 120 ? -4.344  23.225  -32.266 1.00 52.85  ? 205 MET A C   1 
ATOM   744  O  O   . MET A 1 120 ? -4.001  24.283  -32.792 1.00 52.67  ? 205 MET A O   1 
ATOM   745  C  CB  . MET A 1 120 ? -4.853  21.209  -33.638 1.00 48.66  ? 205 MET A CB  1 
ATOM   746  C  CG  . MET A 1 120 ? -4.399  20.093  -34.594 1.00 48.87  ? 205 MET A CG  1 
ATOM   747  S  SD  . MET A 1 120 ? -5.803  19.459  -35.648 1.00 53.56  ? 205 MET A SD  1 
ATOM   748  C  CE  . MET A 1 120 ? -6.704  18.490  -34.446 1.00 52.89  ? 205 MET A CE  1 
ATOM   749  N  N   . CYS A 1 121 ? -5.081  23.183  -31.164 1.00 50.98  ? 206 CYS A N   1 
ATOM   750  C  CA  . CYS A 1 121 ? -5.630  24.402  -30.577 1.00 53.73  ? 206 CYS A CA  1 
ATOM   751  C  C   . CYS A 1 121 ? -4.530  25.325  -30.072 1.00 54.39  ? 206 CYS A C   1 
ATOM   752  O  O   . CYS A 1 121 ? -4.633  26.547  -30.169 1.00 55.39  ? 206 CYS A O   1 
ATOM   753  C  CB  . CYS A 1 121 ? -6.599  24.051  -29.438 1.00 57.12  ? 206 CYS A CB  1 
ATOM   754  S  SG  . CYS A 1 121 ? -8.141  23.272  -29.996 1.00 55.51  ? 206 CYS A SG  1 
ATOM   755  N  N   . ILE A 1 122 ? -3.482  24.744  -29.515 1.00 55.36  ? 207 ILE A N   1 
ATOM   756  C  CA  . ILE A 1 122 ? -2.343  25.555  -29.101 1.00 57.99  ? 207 ILE A CA  1 
ATOM   757  C  C   . ILE A 1 122 ? -1.717  26.243  -30.334 1.00 61.11  ? 207 ILE A C   1 
ATOM   758  O  O   . ILE A 1 122 ? -1.396  27.447  -30.306 1.00 61.26  ? 207 ILE A O   1 
ATOM   759  C  CB  . ILE A 1 122 ? -1.326  24.742  -28.334 1.00 56.46  ? 207 ILE A CB  1 
ATOM   760  C  CG1 . ILE A 1 122 ? -2.053  24.074  -27.169 1.00 51.11  ? 207 ILE A CG1 1 
ATOM   761  C  CG2 . ILE A 1 122 ? -0.216  25.646  -27.847 1.00 52.65  ? 207 ILE A CG2 1 
ATOM   762  C  CD1 . ILE A 1 122 ? -1.170  23.691  -26.036 1.00 54.48  ? 207 ILE A CD1 1 
ATOM   763  N  N   . THR A 1 123 ? -1.544  25.486  -31.416 1.00 60.10  ? 208 THR A N   1 
ATOM   764  C  CA  . THR A 1 123 ? -1.011  26.109  -32.621 1.00 64.18  ? 208 THR A CA  1 
ATOM   765  C  C   . THR A 1 123 ? -1.912  27.235  -33.112 1.00 65.11  ? 208 THR A C   1 
ATOM   766  O  O   . THR A 1 123 ? -1.428  28.331  -33.398 1.00 66.05  ? 208 THR A O   1 
ATOM   767  C  CB  . THR A 1 123 ? -0.874  25.090  -33.786 1.00 60.62  ? 208 THR A CB  1 
ATOM   768  O  OG1 . THR A 1 123 ? 0.052   24.073  -33.424 1.00 59.62  ? 208 THR A OG1 1 
ATOM   769  C  CG2 . THR A 1 123 ? -0.385  25.773  -35.044 1.00 59.48  ? 208 THR A CG2 1 
ATOM   770  N  N   . GLN A 1 124 ? -3.223  27.003  -33.091 1.00 61.61  ? 209 GLN A N   1 
ATOM   771  C  CA  . GLN A 1 124 ? -4.169  28.010  -33.562 1.00 66.45  ? 209 GLN A CA  1 
ATOM   772  C  C   . GLN A 1 124 ? -4.094  29.265  -32.725 1.00 70.37  ? 209 GLN A C   1 
ATOM   773  O  O   . GLN A 1 124 ? -4.088  30.361  -33.262 1.00 74.00  ? 209 GLN A O   1 
ATOM   774  C  CB  . GLN A 1 124 ? -5.614  27.481  -33.560 1.00 57.46  ? 209 GLN A CB  1 
ATOM   775  C  CG  . GLN A 1 124 ? -6.596  28.333  -34.399 1.00 66.79  ? 209 GLN A CG  1 
ATOM   776  C  CD  . GLN A 1 124 ? -6.427  28.291  -35.920 1.00 70.89  ? 209 GLN A CD  1 
ATOM   777  O  OE1 . GLN A 1 124 ? -6.164  27.248  -36.518 1.00 69.80  ? 209 GLN A OE1 1 
ATOM   778  N  NE2 . GLN A 1 124 ? -6.521  29.460  -36.542 1.00 78.12  ? 209 GLN A NE2 1 
ATOM   779  N  N   . TYR A 1 125 ? -4.013  29.097  -31.413 1.00 70.26  ? 210 TYR A N   1 
ATOM   780  C  CA  . TYR A 1 125 ? -3.909  30.231  -30.517 1.00 71.33  ? 210 TYR A CA  1 
ATOM   781  C  C   . TYR A 1 125 ? -2.632  30.995  -30.840 1.00 73.71  ? 210 TYR A C   1 
ATOM   782  O  O   . TYR A 1 125 ? -2.653  32.204  -30.888 1.00 75.73  ? 210 TYR A O   1 
ATOM   783  C  CB  . TYR A 1 125 ? -3.940  29.781  -29.072 1.00 65.26  ? 210 TYR A CB  1 
ATOM   784  C  CG  . TYR A 1 125 ? -3.714  30.862  -28.032 1.00 76.39  ? 210 TYR A CG  1 
ATOM   785  C  CD1 . TYR A 1 125 ? -2.434  31.313  -27.671 1.00 73.02  ? 210 TYR A CD1 1 
ATOM   786  C  CD2 . TYR A 1 125 ? -4.814  31.405  -27.362 1.00 77.49  ? 210 TYR A CD2 1 
ATOM   787  C  CE1 . TYR A 1 125 ? -2.273  32.293  -26.679 1.00 74.50  ? 210 TYR A CE1 1 
ATOM   788  C  CE2 . TYR A 1 125 ? -4.656  32.364  -26.371 1.00 81.92  ? 210 TYR A CE2 1 
ATOM   789  C  CZ  . TYR A 1 125 ? -3.398  32.807  -26.033 1.00 77.50  ? 210 TYR A CZ  1 
ATOM   790  O  OH  . TYR A 1 125 ? -3.317  33.770  -25.055 1.00 75.08  ? 210 TYR A OH  1 
ATOM   791  N  N   . GLN A 1 126 ? -1.507  30.296  -30.970 1.00 74.73  ? 211 GLN A N   1 
ATOM   792  C  CA  . GLN A 1 126 ? -0.241  30.955  -31.307 1.00 76.76  ? 211 GLN A CA  1 
ATOM   793  C  C   . GLN A 1 126 ? -0.350  31.777  -32.586 1.00 80.69  ? 211 GLN A C   1 
ATOM   794  O  O   . GLN A 1 126 ? 0.105   32.922  -32.654 1.00 83.34  ? 211 GLN A O   1 
ATOM   795  C  CB  . GLN A 1 126 ? 0.902   29.954  -31.488 1.00 73.52  ? 211 GLN A CB  1 
ATOM   796  C  CG  . GLN A 1 126 ? 1.470   29.372  -30.210 1.00 73.75  ? 211 GLN A CG  1 
ATOM   797  C  CD  . GLN A 1 126 ? 2.479   28.238  -30.476 1.00 77.56  ? 211 GLN A CD  1 
ATOM   798  O  OE1 . GLN A 1 126 ? 2.656   27.779  -31.616 1.00 74.54  ? 211 GLN A OE1 1 
ATOM   799  N  NE2 . GLN A 1 126 ? 3.102   27.752  -29.409 1.00 79.33  ? 211 GLN A NE2 1 
ATOM   800  N  N   . ARG A 1 127 ? -1.009  31.188  -33.581 1.00 78.13  ? 212 ARG A N   1 
ATOM   801  C  CA  . ARG A 1 127 ? -1.174  31.840  -34.866 1.00 82.48  ? 212 ARG A CA  1 
ATOM   802  C  C   . ARG A 1 127 ? -2.129  33.041  -34.732 1.00 85.22  ? 212 ARG A C   1 
ATOM   803  O  O   . ARG A 1 127 ? -1.787  34.126  -35.198 1.00 88.15  ? 212 ARG A O   1 
ATOM   804  C  CB  . ARG A 1 127 ? -1.666  30.791  -35.911 1.00 83.42  ? 212 ARG A CB  1 
ATOM   805  C  CG  . ARG A 1 127 ? -0.705  29.666  -36.275 1.00 91.29  ? 212 ARG A CG  1 
ATOM   806  C  CD  . ARG A 1 127 ? -1.434  28.888  -37.338 1.00 98.85  ? 212 ARG A CD  1 
ATOM   807  N  NE  . ARG A 1 127 ? -0.790  27.696  -37.909 1.00 109.66 ? 212 ARG A NE  1 
ATOM   808  C  CZ  . ARG A 1 127 ? 0.114   27.687  -38.892 1.00 113.60 ? 212 ARG A CZ  1 
ATOM   809  N  NH1 . ARG A 1 127 ? 0.657   26.541  -39.233 1.00 120.98 ? 212 ARG A NH1 1 
ATOM   810  N  NH2 . ARG A 1 127 ? 0.395   28.754  -39.617 1.00 105.13 ? 212 ARG A NH2 1 
ATOM   811  N  N   . GLU A 1 128 ? -3.223  32.915  -33.989 1.00 82.61  ? 213 GLU A N   1 
ATOM   812  C  CA  . GLU A 1 128 ? -4.174  34.023  -33.780 1.00 83.43  ? 213 GLU A CA  1 
ATOM   813  C  C   . GLU A 1 128 ? -3.519  35.134  -33.025 1.00 88.39  ? 213 GLU A C   1 
ATOM   814  O  O   . GLU A 1 128 ? -3.775  36.310  -33.258 1.00 92.13  ? 213 GLU A O   1 
ATOM   815  C  CB  . GLU A 1 128 ? -5.470  33.601  -33.077 1.00 85.16  ? 213 GLU A CB  1 
ATOM   816  C  CG  . GLU A 1 128 ? -6.395  32.670  -33.891 1.00 85.34  ? 213 GLU A CG  1 
ATOM   817  C  CD  . GLU A 1 128 ? -6.914  33.303  -35.212 1.00 92.44  ? 213 GLU A CD  1 
ATOM   818  O  OE1 . GLU A 1 128 ? -6.771  34.537  -35.413 1.00 97.06  ? 213 GLU A OE1 1 
ATOM   819  O  OE2 . GLU A 1 128 ? -7.497  32.565  -36.039 1.00 95.51  ? 213 GLU A OE2 1 
ATOM   820  N  N   . SER A 1 129 ? -2.760  34.741  -32.029 1.00 92.34  ? 214 SER A N   1 
ATOM   821  C  CA  . SER A 1 129 ? -2.041  35.652  -31.182 1.00 88.75  ? 214 SER A CA  1 
ATOM   822  C  C   . SER A 1 129 ? -1.002  36.560  -31.849 1.00 94.98  ? 214 SER A C   1 
ATOM   823  O  O   . SER A 1 129 ? -0.976  37.734  -31.475 1.00 97.87  ? 214 SER A O   1 
ATOM   824  C  CB  . SER A 1 129 ? -1.354  34.846  -30.087 1.00 89.06  ? 214 SER A CB  1 
ATOM   825  O  OG  . SER A 1 129 ? -0.650  35.697  -29.204 1.00 101.79 ? 214 SER A OG  1 
ATOM   826  N  N   . GLN A 1 130 ? -0.176  36.150  -32.831 1.00 95.71  ? 215 GLN A N   1 
ATOM   827  C  CA  . GLN A 1 130 ? 0.717   37.204  -33.322 1.00 103.62 ? 215 GLN A CA  1 
ATOM   828  C  C   . GLN A 1 130 ? 0.063   37.770  -34.569 1.00 108.20 ? 215 GLN A C   1 
ATOM   829  O  O   . GLN A 1 130 ? 0.365   37.428  -35.714 1.00 115.60 ? 215 GLN A O   1 
ATOM   830  C  CB  . GLN A 1 130 ? 2.119   36.668  -33.619 1.00 20.00  ? 215 GLN A CB  1 
ATOM   831  C  CG  . GLN A 1 130 ? 2.905   36.263  -32.384 1.00 20.00  ? 215 GLN A CG  1 
ATOM   832  C  CD  . GLN A 1 130 ? 4.257   35.670  -32.720 1.00 20.00  ? 215 GLN A CD  1 
ATOM   833  O  OE1 . GLN A 1 130 ? 4.454   35.137  -33.812 1.00 20.00  ? 215 GLN A OE1 1 
ATOM   834  N  NE2 . GLN A 1 130 ? 5.196   35.763  -31.783 1.00 20.00  ? 215 GLN A NE2 1 
ATOM   835  N  N   . ALA A 1 131 ? -0.903  38.633  -34.268 1.00 104.72 ? 216 ALA A N   1 
ATOM   836  C  CA  . ALA A 1 131 ? -1.600  39.569  -35.115 1.00 109.50 ? 216 ALA A CA  1 
ATOM   837  C  C   . ALA A 1 131 ? -1.794  40.622  -34.032 1.00 109.01 ? 216 ALA A C   1 
ATOM   838  O  O   . ALA A 1 131 ? -1.118  41.666  -33.947 1.00 106.32 ? 216 ALA A O   1 
ATOM   839  C  CB  . ALA A 1 131 ? -2.922  39.012  -35.654 1.00 103.48 ? 216 ALA A CB  1 
ATOM   840  N  N   . TYR A 1 132 ? -2.689  40.188  -33.142 1.00 104.92 ? 217 TYR A N   1 
ATOM   841  C  CA  . TYR A 1 132 ? -3.155  40.823  -31.920 1.00 102.42 ? 217 TYR A CA  1 
ATOM   842  C  C   . TYR A 1 132 ? -2.051  41.011  -30.864 1.00 107.18 ? 217 TYR A C   1 
ATOM   843  O  O   . TYR A 1 132 ? -0.906  41.349  -31.182 1.00 106.62 ? 217 TYR A O   1 
ATOM   844  C  CB  . TYR A 1 132 ? -4.292  39.959  -31.350 1.00 101.38 ? 217 TYR A CB  1 
ATOM   845  C  CG  . TYR A 1 132 ? -5.088  40.532  -30.199 1.00 105.97 ? 217 TYR A CG  1 
ATOM   846  C  CD1 . TYR A 1 132 ? -5.939  41.626  -30.346 1.00 101.73 ? 217 TYR A CD1 1 
ATOM   847  C  CD2 . TYR A 1 132 ? -4.976  39.947  -28.940 1.00 106.80 ? 217 TYR A CD2 1 
ATOM   848  C  CE1 . TYR A 1 132 ? -6.651  42.122  -29.247 1.00 104.34 ? 217 TYR A CE1 1 
ATOM   849  C  CE2 . TYR A 1 132 ? -5.671  40.420  -27.855 1.00 106.92 ? 217 TYR A CE2 1 
ATOM   850  C  CZ  . TYR A 1 132 ? -6.504  41.503  -28.000 1.00 111.65 ? 217 TYR A CZ  1 
ATOM   851  O  OH  . TYR A 1 132 ? -7.183  41.943  -26.879 1.00 117.41 ? 217 TYR A OH  1 
ATOM   852  N  N   . GLN B 2 1   ? 26.801  10.529  -25.999 1.00 66.95  ? 1   GLN H N   1 
ATOM   853  C  CA  . GLN B 2 1   ? 26.434  9.456   -25.071 1.00 69.58  ? 1   GLN H CA  1 
ATOM   854  C  C   . GLN B 2 1   ? 25.301  9.966   -24.159 1.00 64.20  ? 1   GLN H C   1 
ATOM   855  O  O   . GLN B 2 1   ? 25.396  11.039  -23.528 1.00 61.54  ? 1   GLN H O   1 
ATOM   856  C  CB  . GLN B 2 1   ? 27.637  8.981   -24.251 1.00 62.64  ? 1   GLN H CB  1 
ATOM   857  C  CG  . GLN B 2 1   ? 28.372  10.057  -23.478 1.00 69.16  ? 1   GLN H CG  1 
ATOM   858  C  CD  . GLN B 2 1   ? 28.786  11.233  -24.327 1.00 78.26  ? 1   GLN H CD  1 
ATOM   859  O  OE1 . GLN B 2 1   ? 29.448  11.069  -25.358 1.00 87.69  ? 1   GLN H OE1 1 
ATOM   860  N  NE2 . GLN B 2 1   ? 28.388  12.430  -23.909 1.00 78.05  ? 1   GLN H NE2 1 
ATOM   861  N  N   . VAL B 2 2   ? 24.213  9.207   -24.124 1.00 56.09  ? 2   VAL H N   1 
ATOM   862  C  CA  . VAL B 2 2   ? 23.086  9.554   -23.278 1.00 56.89  ? 2   VAL H CA  1 
ATOM   863  C  C   . VAL B 2 2   ? 23.390  9.425   -21.790 1.00 55.81  ? 2   VAL H C   1 
ATOM   864  O  O   . VAL B 2 2   ? 23.865  8.385   -21.331 1.00 51.62  ? 2   VAL H O   1 
ATOM   865  C  CB  . VAL B 2 2   ? 21.889  8.672   -23.613 1.00 56.71  ? 2   VAL H CB  1 
ATOM   866  C  CG1 . VAL B 2 2   ? 20.693  9.024   -22.706 1.00 58.34  ? 2   VAL H CG1 1 
ATOM   867  C  CG2 . VAL B 2 2   ? 21.545  8.797   -25.088 1.00 47.77  ? 2   VAL H CG2 1 
ATOM   868  N  N   . GLN B 2 3   ? 23.105  10.484  -21.040 1.00 53.98  ? 3   GLN H N   1 
ATOM   869  C  CA  . GLN B 2 3   ? 23.155  10.407  -19.586 1.00 52.56  ? 3   GLN H CA  1 
ATOM   870  C  C   . GLN B 2 3   ? 21.862  10.945  -18.945 1.00 50.27  ? 3   GLN H C   1 
ATOM   871  O  O   . GLN B 2 3   ? 21.235  11.893  -19.453 1.00 47.49  ? 3   GLN H O   1 
ATOM   872  C  CB  . GLN B 2 3   ? 24.370  11.127  -19.044 1.00 58.38  ? 3   GLN H CB  1 
ATOM   873  C  CG  . GLN B 2 3   ? 25.687  10.686  -19.682 1.00 64.82  ? 3   GLN H CG  1 
ATOM   874  C  CD  . GLN B 2 3   ? 26.892  11.389  -19.074 1.00 71.34  ? 3   GLN H CD  1 
ATOM   875  O  OE1 . GLN B 2 3   ? 26.872  11.783  -17.894 1.00 69.64  ? 3   GLN H OE1 1 
ATOM   876  N  NE2 . GLN B 2 3   ? 27.935  11.592  -19.887 1.00 79.11  ? 3   GLN H NE2 1 
ATOM   877  N  N   . LEU B 2 4   ? 21.483  10.364  -17.815 1.00 48.88  ? 4   LEU H N   1 
ATOM   878  C  CA  . LEU B 2 4   ? 20.306  10.845  -17.059 1.00 50.43  ? 4   LEU H CA  1 
ATOM   879  C  C   . LEU B 2 4   ? 20.789  11.125  -15.647 1.00 48.33  ? 4   LEU H C   1 
ATOM   880  O  O   . LEU B 2 4   ? 21.199  10.196  -14.935 1.00 51.89  ? 4   LEU H O   1 
ATOM   881  C  CB  . LEU B 2 4   ? 19.173  9.797   -17.031 1.00 41.19  ? 4   LEU H CB  1 
ATOM   882  C  CG  . LEU B 2 4   ? 18.513  9.327   -18.336 1.00 49.61  ? 4   LEU H CG  1 
ATOM   883  C  CD1 . LEU B 2 4   ? 17.440  8.232   -18.087 1.00 46.15  ? 4   LEU H CD1 1 
ATOM   884  C  CD2 . LEU B 2 4   ? 17.894  10.516  -19.101 1.00 41.24  ? 4   LEU H CD2 1 
ATOM   885  N  N   . GLN B 2 5   ? 20.829  12.401  -15.265 1.00 42.10  ? 5   GLN H N   1 
ATOM   886  C  CA  . GLN B 2 5   ? 21.408  12.747  -13.978 1.00 49.81  ? 5   GLN H CA  1 
ATOM   887  C  C   . GLN B 2 5   ? 20.382  13.024  -12.874 1.00 45.53  ? 5   GLN H C   1 
ATOM   888  O  O   . GLN B 2 5   ? 19.694  14.049  -12.881 1.00 45.47  ? 5   GLN H O   1 
ATOM   889  C  CB  . GLN B 2 5   ? 22.382  13.918  -14.174 1.00 49.35  ? 5   GLN H CB  1 
ATOM   890  C  CG  . GLN B 2 5   ? 22.801  14.651  -12.930 1.00 53.18  ? 5   GLN H CG  1 
ATOM   891  C  CD  . GLN B 2 5   ? 23.369  16.005  -13.267 1.00 64.62  ? 5   GLN H CD  1 
ATOM   892  O  OE1 . GLN B 2 5   ? 23.216  16.472  -14.398 1.00 70.15  ? 5   GLN H OE1 1 
ATOM   893  N  NE2 . GLN B 2 5   ? 23.990  16.672  -12.283 1.00 70.52  ? 5   GLN H NE2 1 
ATOM   894  N  N   . GLN B 2 6   ? 20.462  12.195  -11.839 1.00 36.47  ? 6   GLN H N   1 
ATOM   895  C  CA  . GLN B 2 6   ? 19.619  12.297  -10.646 1.00 49.77  ? 6   GLN H CA  1 
ATOM   896  C  C   . GLN B 2 6   ? 20.450  12.541  -9.380  1.00 51.90  ? 6   GLN H C   1 
ATOM   897  O  O   . GLN B 2 6   ? 21.521  11.938  -9.170  1.00 44.76  ? 6   GLN H O   1 
ATOM   898  C  CB  . GLN B 2 6   ? 18.806  10.996  -10.456 1.00 49.43  ? 6   GLN H CB  1 
ATOM   899  C  CG  . GLN B 2 6   ? 17.838  10.615  -11.577 1.00 46.14  ? 6   GLN H CG  1 
ATOM   900  C  CD  . GLN B 2 6   ? 17.060  9.344   -11.250 1.00 49.31  ? 6   GLN H CD  1 
ATOM   901  O  OE1 . GLN B 2 6   ? 17.441  8.251   -11.689 1.00 48.17  ? 6   GLN H OE1 1 
ATOM   902  N  NE2 . GLN B 2 6   ? 15.992  9.468   -10.452 1.00 41.77  ? 6   GLN H NE2 1 
ATOM   903  N  N   . SER B 2 7   ? 19.902  13.385  -8.514  1.00 51.71  ? 7   SER H N   1 
ATOM   904  C  CA  . SER B 2 7   ? 20.455  13.615  -7.200  1.00 45.93  ? 7   SER H CA  1 
ATOM   905  C  C   . SER B 2 7   ? 20.549  12.280  -6.473  1.00 49.08  ? 7   SER H C   1 
ATOM   906  O  O   . SER B 2 7   ? 19.680  11.408  -6.663  1.00 52.65  ? 7   SER H O   1 
ATOM   907  C  CB  . SER B 2 7   ? 19.558  14.598  -6.480  1.00 59.86  ? 7   SER H CB  1 
ATOM   908  O  OG  . SER B 2 7   ? 18.909  15.403  -7.458  1.00 66.71  ? 7   SER H OG  1 
ATOM   909  N  N   . GLY B 2 8   ? 21.605  12.085  -5.685  1.00 43.82  ? 8   GLY H N   1 
ATOM   910  C  CA  . GLY B 2 8   ? 21.806  10.813  -5.008  1.00 42.63  ? 8   GLY H CA  1 
ATOM   911  C  C   . GLY B 2 8   ? 20.801  10.377  -3.957  1.00 47.90  ? 8   GLY H C   1 
ATOM   912  O  O   . GLY B 2 8   ? 20.411  9.204   -3.897  1.00 47.26  ? 8   GLY H O   1 
ATOM   913  N  N   . THR B 2 9   ? 20.473  11.317  -3.075  1.00 42.00  ? 9   THR H N   1 
ATOM   914  C  CA  . THR B 2 9   ? 19.668  11.087  -1.898  1.00 44.51  ? 9   THR H CA  1 
ATOM   915  C  C   . THR B 2 9   ? 18.745  12.261  -1.540  1.00 53.77  ? 9   THR H C   1 
ATOM   916  O  O   . THR B 2 9   ? 18.986  13.403  -1.942  1.00 52.30  ? 9   THR H O   1 
ATOM   917  C  CB  . THR B 2 9   ? 20.561  10.818  -0.640  1.00 50.82  ? 9   THR H CB  1 
ATOM   918  O  OG1 . THR B 2 9   ? 21.384  11.971  -0.414  1.00 44.11  ? 9   THR H OG1 1 
ATOM   919  C  CG2 . THR B 2 9   ? 21.477  9.630   -0.811  1.00 42.61  ? 9   THR H CG2 1 
ATOM   920  N  N   . GLU B 2 10  ? 17.683  11.983  -0.788  1.00 48.67  ? 10  GLU H N   1 
ATOM   921  C  CA  . GLU B 2 10  ? 16.895  13.057  -0.201  1.00 54.29  ? 10  GLU H CA  1 
ATOM   922  C  C   . GLU B 2 10  ? 16.428  12.648  1.199   1.00 60.20  ? 10  GLU H C   1 
ATOM   923  O  O   . GLU B 2 10  ? 15.869  11.554  1.418   1.00 55.12  ? 10  GLU H O   1 
ATOM   924  C  CB  . GLU B 2 10  ? 15.708  13.474  -1.053  1.00 54.84  ? 10  GLU H CB  1 
ATOM   925  C  CG  . GLU B 2 10  ? 16.014  13.756  -2.499  1.00 62.62  ? 10  GLU H CG  1 
ATOM   926  C  CD  . GLU B 2 10  ? 16.377  15.215  -2.757  1.00 73.72  ? 10  GLU H CD  1 
ATOM   927  O  OE1 . GLU B 2 10  ? 16.581  15.973  -1.780  1.00 75.53  ? 10  GLU H OE1 1 
ATOM   928  O  OE2 . GLU B 2 10  ? 16.408  15.612  -3.947  1.00 78.84  ? 10  GLU H OE2 1 
ATOM   929  N  N   . LEU B 2 11  ? 16.663  13.539  2.155   1.00 60.75  ? 11  LEU H N   1 
ATOM   930  C  CA  . LEU B 2 11  ? 16.115  13.331  3.481   1.00 62.14  ? 11  LEU H CA  1 
ATOM   931  C  C   . LEU B 2 11  ? 14.915  14.232  3.632   1.00 61.36  ? 11  LEU H C   1 
ATOM   932  O  O   . LEU B 2 11  ? 15.004  15.448  3.459   1.00 66.93  ? 11  LEU H O   1 
ATOM   933  C  CB  . LEU B 2 11  ? 17.151  13.629  4.570   1.00 58.58  ? 11  LEU H CB  1 
ATOM   934  C  CG  . LEU B 2 11  ? 16.736  13.418  6.041   1.00 68.98  ? 11  LEU H CG  1 
ATOM   935  C  CD1 . LEU B 2 11  ? 16.217  14.714  6.670   1.00 66.76  ? 11  LEU H CD1 1 
ATOM   936  C  CD2 . LEU B 2 11  ? 15.677  12.328  6.210   1.00 67.46  ? 11  LEU H CD2 1 
ATOM   937  N  N   . VAL B 2 12  ? 13.774  13.614  3.915   1.00 59.50  ? 12  VAL H N   1 
ATOM   938  C  CA  . VAL B 2 12  ? 12.489  14.324  3.912   1.00 57.79  ? 12  VAL H CA  1 
ATOM   939  C  C   . VAL B 2 12  ? 11.715  14.057  5.197   1.00 57.60  ? 12  VAL H C   1 
ATOM   940  O  O   . VAL B 2 12  ? 11.750  12.949  5.764   1.00 55.93  ? 12  VAL H O   1 
ATOM   941  C  CB  . VAL B 2 12  ? 11.590  13.941  2.704   1.00 56.30  ? 12  VAL H CB  1 
ATOM   942  C  CG1 . VAL B 2 12  ? 10.390  14.864  2.630   1.00 65.54  ? 12  VAL H CG1 1 
ATOM   943  C  CG2 . VAL B 2 12  ? 12.357  13.954  1.381   1.00 51.96  ? 12  VAL H CG2 1 
ATOM   944  N  N   . MET B 2 13  ? 11.057  15.096  5.686   1.00 57.30  ? 13  MET H N   1 
ATOM   945  C  CA  . MET B 2 13  ? 10.247  14.951  6.874   1.00 56.78  ? 13  MET H CA  1 
ATOM   946  C  C   . MET B 2 13  ? 8.922   14.322  6.467   1.00 57.44  ? 13  MET H C   1 
ATOM   947  O  O   . MET B 2 13  ? 8.398   14.613  5.386   1.00 58.57  ? 13  MET H O   1 
ATOM   948  C  CB  . MET B 2 13  ? 9.999   16.295  7.557   1.00 57.54  ? 13  MET H CB  1 
ATOM   949  C  CG  . MET B 2 13  ? 11.233  17.071  7.939   1.00 60.63  ? 13  MET H CG  1 
ATOM   950  S  SD  . MET B 2 13  ? 11.828  16.460  9.511   1.00 73.99  ? 13  MET H SD  1 
ATOM   951  C  CE  . MET B 2 13  ? 10.378  16.623  10.556  1.00 62.23  ? 13  MET H CE  1 
ATOM   952  N  N   . PRO B 2 14  ? 8.362   13.470  7.326   1.00 56.79  ? 14  PRO H N   1 
ATOM   953  C  CA  . PRO B 2 14  ? 7.018   12.961  7.043   1.00 52.73  ? 14  PRO H CA  1 
ATOM   954  C  C   . PRO B 2 14  ? 6.046   14.110  6.809   1.00 51.62  ? 14  PRO H C   1 
ATOM   955  O  O   . PRO B 2 14  ? 6.111   15.137  7.509   1.00 45.59  ? 14  PRO H O   1 
ATOM   956  C  CB  . PRO B 2 14  ? 6.650   12.181  8.327   1.00 47.00  ? 14  PRO H CB  1 
ATOM   957  C  CG  . PRO B 2 14  ? 7.956   11.767  8.877   1.00 58.16  ? 14  PRO H CG  1 
ATOM   958  C  CD  . PRO B 2 14  ? 8.923   12.897  8.561   1.00 57.93  ? 14  PRO H CD  1 
ATOM   959  N  N   . GLY B 2 15  ? 5.215   13.966  5.780   1.00 52.73  ? 15  GLY H N   1 
ATOM   960  C  CA  . GLY B 2 15  ? 4.219   14.969  5.447   1.00 50.56  ? 15  GLY H CA  1 
ATOM   961  C  C   . GLY B 2 15  ? 4.668   16.028  4.462   1.00 54.30  ? 15  GLY H C   1 
ATOM   962  O  O   . GLY B 2 15  ? 3.815   16.640  3.797   1.00 54.18  ? 15  GLY H O   1 
ATOM   963  N  N   . ALA B 2 16  ? 5.983   16.151  4.267   1.00 52.51  ? 16  ALA H N   1 
ATOM   964  C  CA  . ALA B 2 16  ? 6.533   17.154  3.356   1.00 55.32  ? 16  ALA H CA  1 
ATOM   965  C  C   . ALA B 2 16  ? 6.518   16.628  1.925   1.00 58.67  ? 16  ALA H C   1 
ATOM   966  O  O   . ALA B 2 16  ? 6.075   15.498  1.685   1.00 60.71  ? 16  ALA H O   1 
ATOM   967  C  CB  . ALA B 2 16  ? 7.929   17.492  3.738   1.00 50.64  ? 16  ALA H CB  1 
ATOM   968  N  N   . SER B 2 17  ? 6.914   17.470  0.971   1.00 56.24  ? 17  SER H N   1 
ATOM   969  C  CA  . SER B 2 17  ? 7.034   17.023  -0.422  1.00 58.75  ? 17  SER H CA  1 
ATOM   970  C  C   . SER B 2 17  ? 8.470   17.066  -0.839  1.00 53.97  ? 17  SER H C   1 
ATOM   971  O  O   . SER B 2 17  ? 9.304   17.669  -0.181  1.00 62.36  ? 17  SER H O   1 
ATOM   972  C  CB  . SER B 2 17  ? 6.203   17.830  -1.434  1.00 53.08  ? 17  SER H CB  1 
ATOM   973  O  OG  . SER B 2 17  ? 4.810   17.697  -1.226  1.00 62.32  ? 17  SER H OG  1 
ATOM   974  N  N   . VAL B 2 18  ? 8.763   16.340  -1.899  1.00 50.84  ? 18  VAL H N   1 
ATOM   975  C  CA  . VAL B 2 18  ? 10.074  16.412  -2.516  1.00 55.92  ? 18  VAL H CA  1 
ATOM   976  C  C   . VAL B 2 18  ? 9.877   16.438  -4.035  1.00 54.85  ? 18  VAL H C   1 
ATOM   977  O  O   . VAL B 2 18  ? 8.997   15.764  -4.590  1.00 54.50  ? 18  VAL H O   1 
ATOM   978  C  CB  . VAL B 2 18  ? 10.991  15.269  -2.051  1.00 50.80  ? 18  VAL H CB  1 
ATOM   979  C  CG1 . VAL B 2 18  ? 10.438  13.916  -2.428  1.00 52.99  ? 18  VAL H CG1 1 
ATOM   980  C  CG2 . VAL B 2 18  ? 12.389  15.491  -2.562  1.00 55.22  ? 18  VAL H CG2 1 
ATOM   981  N  N   . LYS B 2 19  ? 10.710  17.213  -4.709  1.00 53.74  ? 19  LYS H N   1 
ATOM   982  C  CA  . LYS B 2 19  ? 10.640  17.272  -6.148  1.00 51.01  ? 19  LYS H CA  1 
ATOM   983  C  C   . LYS B 2 19  ? 11.960  16.802  -6.701  1.00 45.17  ? 19  LYS H C   1 
ATOM   984  O  O   . LYS B 2 19  ? 12.918  17.553  -6.712  1.00 44.57  ? 19  LYS H O   1 
ATOM   985  C  CB  . LYS B 2 19  ? 10.309  18.712  -6.577  1.00 52.37  ? 19  LYS H CB  1 
ATOM   986  C  CG  . LYS B 2 19  ? 10.096  18.933  -8.076  1.00 59.01  ? 19  LYS H CG  1 
ATOM   987  C  CD  . LYS B 2 19  ? 9.523   20.331  -8.349  1.00 62.12  ? 19  LYS H CD  1 
ATOM   988  C  CE  . LYS B 2 19  ? 9.417   20.621  -9.848  1.00 64.09  ? 19  LYS H CE  1 
ATOM   989  N  NZ  . LYS B 2 19  ? 8.719   21.924  -10.156 1.00 61.54  ? 19  LYS H NZ  1 
ATOM   990  N  N   . MET B 2 20  ? 11.926  15.653  -7.365  1.00 46.65  ? 20  MET H N   1 
ATOM   991  C  CA  . MET B 2 20  ? 13.123  14.982  -7.860  1.00 47.80  ? 20  MET H CA  1 
ATOM   992  C  C   . MET B 2 20  ? 13.376  15.338  -9.303  1.00 49.81  ? 20  MET H C   1 
ATOM   993  O  O   . MET B 2 20  ? 12.468  15.311  -10.151 1.00 45.75  ? 20  MET H O   1 
ATOM   994  C  CB  . MET B 2 20  ? 12.923  13.463  -7.774  1.00 44.34  ? 20  MET H CB  1 
ATOM   995  C  CG  . MET B 2 20  ? 13.141  12.857  -6.441  1.00 56.38  ? 20  MET H CG  1 
ATOM   996  S  SD  . MET B 2 20  ? 12.672  11.122  -6.359  1.00 50.37  ? 20  MET H SD  1 
ATOM   997  C  CE  . MET B 2 20  ? 11.137  11.346  -5.472  1.00 52.51  ? 20  MET H CE  1 
ATOM   998  N  N   . SER B 2 21  ? 14.643  15.570  -9.596  1.00 44.83  ? 21  SER H N   1 
ATOM   999  C  CA  . SER B 2 21  ? 15.008  15.961  -10.935 1.00 48.66  ? 21  SER H CA  1 
ATOM   1000 C  C   . SER B 2 21  ? 15.723  14.807  -11.623 1.00 49.31  ? 21  SER H C   1 
ATOM   1001 O  O   . SER B 2 21  ? 16.272  13.910  -10.957 1.00 46.67  ? 21  SER H O   1 
ATOM   1002 C  CB  . SER B 2 21  ? 15.877  17.233  -10.897 1.00 47.94  ? 21  SER H CB  1 
ATOM   1003 O  OG  . SER B 2 21  ? 17.116  17.000  -10.214 1.00 50.85  ? 21  SER H OG  1 
ATOM   1004 N  N   . CYS B 2 22  ? 15.645  14.808  -12.952 1.00 46.84  ? 22  CYS H N   1 
ATOM   1005 C  CA  . CYS B 2 22  ? 16.329  13.842  -13.811 1.00 50.18  ? 22  CYS H CA  1 
ATOM   1006 C  C   . CYS B 2 22  ? 16.788  14.654  -15.002 1.00 48.54  ? 22  CYS H C   1 
ATOM   1007 O  O   . CYS B 2 22  ? 16.013  14.927  -15.910 1.00 49.56  ? 22  CYS H O   1 
ATOM   1008 C  CB  . CYS B 2 22  ? 15.400  12.694  -14.237 1.00 53.66  ? 22  CYS H CB  1 
ATOM   1009 S  SG  . CYS B 2 22  ? 16.021  11.513  -15.517 1.00 56.57  ? 22  CYS H SG  1 
ATOM   1010 N  N   . LYS B 2 23  ? 18.058  14.984  -15.055 1.00 48.31  ? 23  LYS H N   1 
ATOM   1011 C  CA  . LYS B 2 23  ? 18.516  15.871  -16.112 1.00 53.11  ? 23  LYS H CA  1 
ATOM   1012 C  C   . LYS B 2 23  ? 19.062  15.060  -17.265 1.00 50.93  ? 23  LYS H C   1 
ATOM   1013 O  O   . LYS B 2 23  ? 20.016  14.309  -17.095 1.00 48.38  ? 23  LYS H O   1 
ATOM   1014 C  CB  . LYS B 2 23  ? 19.642  16.759  -15.601 1.00 55.66  ? 23  LYS H CB  1 
ATOM   1015 C  CG  . LYS B 2 23  ? 20.229  17.635  -16.665 1.00 63.05  ? 23  LYS H CG  1 
ATOM   1016 C  CD  . LYS B 2 23  ? 21.372  18.454  -16.109 1.00 67.91  ? 23  LYS H CD  1 
ATOM   1017 C  CE  . LYS B 2 23  ? 22.009  19.231  -17.217 1.00 74.88  ? 23  LYS H CE  1 
ATOM   1018 N  NZ  . LYS B 2 23  ? 23.135  20.031  -16.724 1.00 90.16  ? 23  LYS H NZ  1 
ATOM   1019 N  N   . ALA B 2 24  ? 18.495  15.239  -18.455 1.00 49.55  ? 24  ALA H N   1 
ATOM   1020 C  CA  . ALA B 2 24  ? 18.885  14.387  -19.568 1.00 44.47  ? 24  ALA H CA  1 
ATOM   1021 C  C   . ALA B 2 24  ? 19.934  15.102  -20.418 1.00 44.26  ? 24  ALA H C   1 
ATOM   1022 O  O   . ALA B 2 24  ? 19.948  16.328  -20.485 1.00 44.35  ? 24  ALA H O   1 
ATOM   1023 C  CB  . ALA B 2 24  ? 17.693  14.029  -20.393 1.00 45.89  ? 24  ALA H CB  1 
ATOM   1024 N  N   . SER B 2 25  ? 20.843  14.350  -21.030 1.00 39.98  ? 25  SER H N   1 
ATOM   1025 C  CA  . SER B 2 25  ? 21.763  14.980  -21.954 1.00 41.55  ? 25  SER H CA  1 
ATOM   1026 C  C   . SER B 2 25  ? 22.181  13.978  -23.013 1.00 50.86  ? 25  SER H C   1 
ATOM   1027 O  O   . SER B 2 25  ? 22.148  12.744  -22.769 1.00 51.40  ? 25  SER H O   1 
ATOM   1028 C  CB  . SER B 2 25  ? 23.019  15.537  -21.251 1.00 46.98  ? 25  SER H CB  1 
ATOM   1029 O  OG  . SER B 2 25  ? 23.782  14.512  -20.626 1.00 51.65  ? 25  SER H OG  1 
ATOM   1030 N  N   . GLY B 2 26  ? 22.676  14.518  -24.138 1.00 48.47  ? 26  GLY H N   1 
ATOM   1031 C  CA  . GLY B 2 26  ? 23.297  13.715  -25.174 1.00 44.66  ? 26  GLY H CA  1 
ATOM   1032 C  C   . GLY B 2 26  ? 22.372  13.249  -26.283 1.00 57.37  ? 26  GLY H C   1 
ATOM   1033 O  O   . GLY B 2 26  ? 22.774  12.381  -27.067 1.00 66.25  ? 26  GLY H O   1 
ATOM   1034 N  N   . TYR B 2 27  ? 21.142  13.784  -26.326 1.00 49.57  ? 27  TYR H N   1 
ATOM   1035 C  CA  . TYR B 2 27  ? 20.164  13.477  -27.355 1.00 40.22  ? 27  TYR H CA  1 
ATOM   1036 C  C   . TYR B 2 27  ? 19.051  14.532  -27.354 1.00 45.59  ? 27  TYR H C   1 
ATOM   1037 O  O   . TYR B 2 27  ? 19.007  15.403  -26.514 1.00 42.45  ? 27  TYR H O   1 
ATOM   1038 C  CB  . TYR B 2 27  ? 19.557  12.093  -27.137 1.00 43.91  ? 27  TYR H CB  1 
ATOM   1039 C  CG  . TYR B 2 27  ? 18.658  12.052  -25.911 1.00 49.53  ? 27  TYR H CG  1 
ATOM   1040 C  CD1 . TYR B 2 27  ? 19.181  11.784  -24.636 1.00 48.04  ? 27  TYR H CD1 1 
ATOM   1041 C  CD2 . TYR B 2 27  ? 17.288  12.327  -26.016 1.00 43.84  ? 27  TYR H CD2 1 
ATOM   1042 C  CE1 . TYR B 2 27  ? 18.361  11.762  -23.519 1.00 46.69  ? 27  TYR H CE1 1 
ATOM   1043 C  CE2 . TYR B 2 27  ? 16.471  12.324  -24.909 1.00 41.79  ? 27  TYR H CE2 1 
ATOM   1044 C  CZ  . TYR B 2 27  ? 16.997  12.036  -23.665 1.00 48.85  ? 27  TYR H CZ  1 
ATOM   1045 O  OH  . TYR B 2 27  ? 16.157  12.023  -22.564 1.00 45.89  ? 27  TYR H OH  1 
ATOM   1046 N  N   . THR B 2 28  ? 18.152  14.474  -28.328 1.00 50.43  ? 28  THR H N   1 
ATOM   1047 C  CA  . THR B 2 28  ? 17.071  15.451  -28.395 1.00 48.08  ? 28  THR H CA  1 
ATOM   1048 C  C   . THR B 2 28  ? 15.929  15.174  -27.404 1.00 53.27  ? 28  THR H C   1 
ATOM   1049 O  O   . THR B 2 28  ? 15.101  14.249  -27.610 1.00 51.48  ? 28  THR H O   1 
ATOM   1050 C  CB  . THR B 2 28  ? 16.525  15.483  -29.785 1.00 48.54  ? 28  THR H CB  1 
ATOM   1051 O  OG1 . THR B 2 28  ? 17.609  15.702  -30.678 1.00 51.82  ? 28  THR H OG1 1 
ATOM   1052 C  CG2 . THR B 2 28  ? 15.457  16.565  -29.916 1.00 50.39  ? 28  THR H CG2 1 
ATOM   1053 N  N   . PHE B 2 29  ? 15.844  16.021  -26.381 1.00 47.50  ? 29  PHE H N   1 
ATOM   1054 C  CA  . PHE B 2 29  ? 14.987  15.776  -25.218 1.00 46.92  ? 29  PHE H CA  1 
ATOM   1055 C  C   . PHE B 2 29  ? 13.512  15.482  -25.496 1.00 55.69  ? 29  PHE H C   1 
ATOM   1056 O  O   . PHE B 2 29  ? 12.939  14.605  -24.854 1.00 58.61  ? 29  PHE H O   1 
ATOM   1057 C  CB  . PHE B 2 29  ? 15.079  16.990  -24.305 1.00 51.58  ? 29  PHE H CB  1 
ATOM   1058 C  CG  . PHE B 2 29  ? 14.344  16.860  -23.000 1.00 52.27  ? 29  PHE H CG  1 
ATOM   1059 C  CD1 . PHE B 2 29  ? 14.719  15.917  -22.055 1.00 50.25  ? 29  PHE H CD1 1 
ATOM   1060 C  CD2 . PHE B 2 29  ? 13.328  17.753  -22.680 1.00 53.49  ? 29  PHE H CD2 1 
ATOM   1061 C  CE1 . PHE B 2 29  ? 14.058  15.844  -20.835 1.00 48.40  ? 29  PHE H CE1 1 
ATOM   1062 C  CE2 . PHE B 2 29  ? 12.674  17.683  -21.456 1.00 51.81  ? 29  PHE H CE2 1 
ATOM   1063 C  CZ  . PHE B 2 29  ? 13.039  16.723  -20.539 1.00 44.78  ? 29  PHE H CZ  1 
ATOM   1064 N  N   . THR B 2 30  ? 12.882  16.226  -26.402 1.00 54.35  ? 30  THR H N   1 
ATOM   1065 C  CA  . THR B 2 30  ? 11.443  16.086  -26.616 1.00 53.60  ? 30  THR H CA  1 
ATOM   1066 C  C   . THR B 2 30  ? 11.138  14.864  -27.516 1.00 55.55  ? 30  THR H C   1 
ATOM   1067 O  O   . THR B 2 30  ? 9.989   14.582  -27.832 1.00 57.74  ? 30  THR H O   1 
ATOM   1068 C  CB  . THR B 2 30  ? 10.808  17.338  -27.230 1.00 52.46  ? 30  THR H CB  1 
ATOM   1069 O  OG1 . THR B 2 30  ? 11.432  17.648  -28.480 1.00 60.47  ? 30  THR H OG1 1 
ATOM   1070 C  CG2 . THR B 2 30  ? 10.857  18.522  -26.239 1.00 48.73  ? 30  THR H CG2 1 
ATOM   1071 N  N   . ASP B 2 31  ? 12.161  14.175  -27.989 1.00 51.64  ? 31  ASP H N   1 
ATOM   1072 C  CA  . ASP B 2 31  ? 11.923  13.078  -28.918 1.00 51.61  ? 31  ASP H CA  1 
ATOM   1073 C  C   . ASP B 2 31  ? 11.614  11.734  -28.223 1.00 47.84  ? 31  ASP H C   1 
ATOM   1074 O  O   . ASP B 2 31  ? 11.200  10.783  -28.873 1.00 48.88  ? 31  ASP H O   1 
ATOM   1075 C  CB  . ASP B 2 31  ? 13.183  12.848  -29.810 1.00 56.17  ? 31  ASP H CB  1 
ATOM   1076 C  CG  . ASP B 2 31  ? 13.231  13.751  -31.044 1.00 53.28  ? 31  ASP H CG  1 
ATOM   1077 O  OD1 . ASP B 2 31  ? 12.183  14.280  -31.447 1.00 56.09  ? 31  ASP H OD1 1 
ATOM   1078 O  OD2 . ASP B 2 31  ? 14.314  13.858  -31.662 1.00 54.70  ? 31  ASP H OD2 1 
ATOM   1079 N  N   . TYR B 2 32  ? 11.766  11.670  -26.903 1.00 46.72  ? 32  TYR H N   1 
ATOM   1080 C  CA  . TYR B 2 32  ? 11.664  10.412  -26.139 1.00 40.94  ? 32  TYR H CA  1 
ATOM   1081 C  C   . TYR B 2 32  ? 10.825  10.521  -24.884 1.00 39.41  ? 32  TYR H C   1 
ATOM   1082 O  O   . TYR B 2 32  ? 10.717  11.588  -24.296 1.00 41.53  ? 32  TYR H O   1 
ATOM   1083 C  CB  . TYR B 2 32  ? 13.066  9.885   -25.765 1.00 44.44  ? 32  TYR H CB  1 
ATOM   1084 C  CG  . TYR B 2 32  ? 13.973  9.585   -26.953 1.00 45.17  ? 32  TYR H CG  1 
ATOM   1085 C  CD1 . TYR B 2 32  ? 14.635  10.602  -27.642 1.00 46.04  ? 32  TYR H CD1 1 
ATOM   1086 C  CD2 . TYR B 2 32  ? 14.150  8.266   -27.385 1.00 41.56  ? 32  TYR H CD2 1 
ATOM   1087 C  CE1 . TYR B 2 32  ? 15.430  10.320  -28.722 1.00 44.74  ? 32  TYR H CE1 1 
ATOM   1088 C  CE2 . TYR B 2 32  ? 14.941  7.967   -28.450 1.00 41.48  ? 32  TYR H CE2 1 
ATOM   1089 C  CZ  . TYR B 2 32  ? 15.585  8.997   -29.131 1.00 47.16  ? 32  TYR H CZ  1 
ATOM   1090 O  OH  . TYR B 2 32  ? 16.393  8.692   -30.216 1.00 42.96  ? 32  TYR H OH  1 
ATOM   1091 N  N   . TRP B 2 33  ? 10.026  9.499   -24.629 1.00 39.09  ? 33  TRP H N   1 
ATOM   1092 C  CA  . TRP B 2 33  ? 9.336   9.388   -23.352 1.00 41.32  ? 33  TRP H CA  1 
ATOM   1093 C  C   . TRP B 2 33  ? 10.268  9.197   -22.157 1.00 44.41  ? 33  TRP H C   1 
ATOM   1094 O  O   . TRP B 2 33  ? 11.220  8.406   -22.219 1.00 43.53  ? 33  TRP H O   1 
ATOM   1095 C  CB  . TRP B 2 33  ? 8.340   8.253   -23.401 1.00 41.31  ? 33  TRP H CB  1 
ATOM   1096 C  CG  . TRP B 2 33  ? 7.059   8.634   -24.044 1.00 46.17  ? 33  TRP H CG  1 
ATOM   1097 C  CD1 . TRP B 2 33  ? 6.863   9.028   -25.338 1.00 47.26  ? 33  TRP H CD1 1 
ATOM   1098 C  CD2 . TRP B 2 33  ? 5.776   8.684   -23.410 1.00 48.50  ? 33  TRP H CD2 1 
ATOM   1099 N  NE1 . TRP B 2 33  ? 5.523   9.287   -25.559 1.00 48.26  ? 33  TRP H NE1 1 
ATOM   1100 C  CE2 . TRP B 2 33  ? 4.839   9.090   -24.386 1.00 47.80  ? 33  TRP H CE2 1 
ATOM   1101 C  CE3 . TRP B 2 33  ? 5.327   8.411   -22.114 1.00 46.53  ? 33  TRP H CE3 1 
ATOM   1102 C  CZ2 . TRP B 2 33  ? 3.481   9.228   -24.106 1.00 46.66  ? 33  TRP H CZ2 1 
ATOM   1103 C  CZ3 . TRP B 2 33  ? 3.976   8.548   -21.837 1.00 52.78  ? 33  TRP H CZ3 1 
ATOM   1104 C  CH2 . TRP B 2 33  ? 3.065   8.955   -22.832 1.00 51.35  ? 33  TRP H CH2 1 
ATOM   1105 N  N   . MET B 2 34  ? 9.890   9.785   -21.026 1.00 44.49  ? 34  MET H N   1 
ATOM   1106 C  CA  . MET B 2 34  ? 10.624  9.580   -19.787 1.00 40.92  ? 34  MET H CA  1 
ATOM   1107 C  C   . MET B 2 34  ? 9.750   8.846   -18.771 1.00 41.42  ? 34  MET H C   1 
ATOM   1108 O  O   . MET B 2 34  ? 8.528   9.000   -18.753 1.00 39.38  ? 34  MET H O   1 
ATOM   1109 C  CB  . MET B 2 34  ? 11.078  10.908  -19.197 1.00 43.82  ? 34  MET H CB  1 
ATOM   1110 C  CG  . MET B 2 34  ? 12.183  10.696  -18.176 1.00 53.65  ? 34  MET H CG  1 
ATOM   1111 S  SD  . MET B 2 34  ? 13.842  10.746  -18.943 1.00 58.24  ? 34  MET H SD  1 
ATOM   1112 C  CE  . MET B 2 34  ? 13.593  11.900  -20.276 1.00 46.55  ? 34  MET H CE  1 
ATOM   1113 N  N   . HIS B 2 35  ? 10.381  8.046   -17.923 1.00 40.10  ? 35  HIS H N   1 
ATOM   1114 C  CA  . HIS B 2 35  ? 9.638   7.141   -17.056 1.00 42.24  ? 35  HIS H CA  1 
ATOM   1115 C  C   . HIS B 2 35  ? 10.179  7.207   -15.642 1.00 45.10  ? 35  HIS H C   1 
ATOM   1116 O  O   . HIS B 2 35  ? 11.367  7.471   -15.454 1.00 45.97  ? 35  HIS H O   1 
ATOM   1117 C  CB  . HIS B 2 35  ? 9.756   5.734   -17.608 1.00 38.78  ? 35  HIS H CB  1 
ATOM   1118 C  CG  . HIS B 2 35  ? 9.436   5.659   -19.068 1.00 44.32  ? 35  HIS H CG  1 
ATOM   1119 N  ND1 . HIS B 2 35  ? 8.154   5.503   -19.540 1.00 44.32  ? 35  HIS H ND1 1 
ATOM   1120 C  CD2 . HIS B 2 35  ? 10.225  5.800   -20.165 1.00 42.94  ? 35  HIS H CD2 1 
ATOM   1121 C  CE1 . HIS B 2 35  ? 8.172   5.502   -20.865 1.00 43.36  ? 35  HIS H CE1 1 
ATOM   1122 N  NE2 . HIS B 2 35  ? 9.413   5.688   -21.269 1.00 39.19  ? 35  HIS H NE2 1 
ATOM   1123 N  N   . TRP B 2 36  ? 9.322   6.938   -14.660 1.00 43.79  ? 36  TRP H N   1 
ATOM   1124 C  CA  . TRP B 2 36  ? 9.714   6.929   -13.249 1.00 41.85  ? 36  TRP H CA  1 
ATOM   1125 C  C   . TRP B 2 36  ? 9.342   5.612   -12.618 1.00 44.41  ? 36  TRP H C   1 
ATOM   1126 O  O   . TRP B 2 36  ? 8.228   5.084   -12.849 1.00 47.07  ? 36  TRP H O   1 
ATOM   1127 C  CB  . TRP B 2 36  ? 9.072   8.073   -12.487 1.00 43.22  ? 36  TRP H CB  1 
ATOM   1128 C  CG  . TRP B 2 36  ? 9.557   9.363   -13.000 1.00 46.49  ? 36  TRP H CG  1 
ATOM   1129 C  CD1 . TRP B 2 36  ? 9.052   10.081  -14.062 1.00 44.82  ? 36  TRP H CD1 1 
ATOM   1130 C  CD2 . TRP B 2 36  ? 10.659  10.115  -12.490 1.00 45.75  ? 36  TRP H CD2 1 
ATOM   1131 N  NE1 . TRP B 2 36  ? 9.774   11.234  -14.232 1.00 40.12  ? 36  TRP H NE1 1 
ATOM   1132 C  CE2 . TRP B 2 36  ? 10.766  11.283  -13.281 1.00 44.28  ? 36  TRP H CE2 1 
ATOM   1133 C  CE3 . TRP B 2 36  ? 11.565  9.920   -11.428 1.00 43.90  ? 36  TRP H CE3 1 
ATOM   1134 C  CZ2 . TRP B 2 36  ? 11.750  12.255  -13.047 1.00 47.15  ? 36  TRP H CZ2 1 
ATOM   1135 C  CZ3 . TRP B 2 36  ? 12.550  10.882  -11.201 1.00 44.01  ? 36  TRP H CZ3 1 
ATOM   1136 C  CH2 . TRP B 2 36  ? 12.638  12.033  -12.009 1.00 46.06  ? 36  TRP H CH2 1 
ATOM   1137 N  N   . VAL B 2 37  ? 10.293  5.044   -11.894 1.00 34.60  ? 37  VAL H N   1 
ATOM   1138 C  CA  . VAL B 2 37  ? 10.142  3.708   -11.392 1.00 39.37  ? 37  VAL H CA  1 
ATOM   1139 C  C   . VAL B 2 37  ? 10.511  3.709   -9.914  1.00 43.62  ? 37  VAL H C   1 
ATOM   1140 O  O   . VAL B 2 37  ? 11.514  4.326   -9.524  1.00 40.55  ? 37  VAL H O   1 
ATOM   1141 C  CB  . VAL B 2 37  ? 11.065  2.736   -12.117 1.00 41.49  ? 37  VAL H CB  1 
ATOM   1142 C  CG1 . VAL B 2 37  ? 10.987  1.364   -11.455 1.00 42.55  ? 37  VAL H CG1 1 
ATOM   1143 C  CG2 . VAL B 2 37  ? 10.677  2.618   -13.554 1.00 43.82  ? 37  VAL H CG2 1 
ATOM   1144 N  N   . LYS B 2 38  ? 9.677   3.093   -9.084  1.00 39.74  ? 38  LYS H N   1 
ATOM   1145 C  CA  . LYS B 2 38  ? 9.950   3.048   -7.656  1.00 39.62  ? 38  LYS H CA  1 
ATOM   1146 C  C   . LYS B 2 38  ? 10.537  1.694   -7.302  1.00 43.14  ? 38  LYS H C   1 
ATOM   1147 O  O   . LYS B 2 38  ? 10.112  0.665   -7.847  1.00 41.44  ? 38  LYS H O   1 
ATOM   1148 C  CB  . LYS B 2 38  ? 8.685   3.301   -6.833  1.00 44.74  ? 38  LYS H CB  1 
ATOM   1149 C  CG  . LYS B 2 38  ? 8.894   3.335   -5.319  1.00 40.50  ? 38  LYS H CG  1 
ATOM   1150 C  CD  . LYS B 2 38  ? 7.607   3.563   -4.639  1.00 35.62  ? 38  LYS H CD  1 
ATOM   1151 C  CE  . LYS B 2 38  ? 7.707   3.465   -3.173  1.00 38.85  ? 38  LYS H CE  1 
ATOM   1152 N  NZ  . LYS B 2 38  ? 6.406   3.773   -2.513  1.00 41.22  ? 38  LYS H NZ  1 
ATOM   1153 N  N   . GLN B 2 39  ? 11.486  1.680   -6.365  1.00 45.58  ? 39  GLN H N   1 
ATOM   1154 C  CA  . GLN B 2 39  ? 11.949  0.416   -5.812  1.00 46.82  ? 39  GLN H CA  1 
ATOM   1155 C  C   . GLN B 2 39  ? 12.178  0.515   -4.290  1.00 48.59  ? 39  GLN H C   1 
ATOM   1156 O  O   . GLN B 2 39  ? 13.056  1.251   -3.814  1.00 45.30  ? 39  GLN H O   1 
ATOM   1157 C  CB  . GLN B 2 39  ? 13.252  -0.035  -6.498  1.00 42.94  ? 39  GLN H CB  1 
ATOM   1158 C  CG  . GLN B 2 39  ? 13.803  -1.398  -6.019  1.00 41.96  ? 39  GLN H CG  1 
ATOM   1159 C  CD  . GLN B 2 39  ? 14.979  -1.922  -6.890  1.00 43.46  ? 39  GLN H CD  1 
ATOM   1160 O  OE1 . GLN B 2 39  ? 15.925  -1.175  -7.210  1.00 39.04  ? 39  GLN H OE1 1 
ATOM   1161 N  NE2 . GLN B 2 39  ? 14.888  -3.191  -7.315  1.00 37.39  ? 39  GLN H NE2 1 
ATOM   1162 N  N   . ARG B 2 40  ? 11.343  -0.201  -3.544  1.00 46.32  ? 40  ARG H N   1 
ATOM   1163 C  CA  . ARG B 2 40  ? 11.476  -0.324  -2.103  1.00 50.34  ? 40  ARG H CA  1 
ATOM   1164 C  C   . ARG B 2 40  ? 12.634  -1.264  -1.819  1.00 53.19  ? 40  ARG H C   1 
ATOM   1165 O  O   . ARG B 2 40  ? 12.838  -2.210  -2.577  1.00 53.75  ? 40  ARG H O   1 
ATOM   1166 C  CB  . ARG B 2 40  ? 10.176  -0.835  -1.493  1.00 51.97  ? 40  ARG H CB  1 
ATOM   1167 C  CG  . ARG B 2 40  ? 9.108   0.151   -1.760  1.00 52.66  ? 40  ARG H CG  1 
ATOM   1168 C  CD  . ARG B 2 40  ? 8.904   1.129   -0.643  1.00 47.67  ? 40  ARG H CD  1 
ATOM   1169 N  NE  . ARG B 2 40  ? 8.376   0.485   0.552   1.00 59.48  ? 40  ARG H NE  1 
ATOM   1170 C  CZ  . ARG B 2 40  ? 8.606   0.888   1.801   1.00 55.75  ? 40  ARG H CZ  1 
ATOM   1171 N  NH1 . ARG B 2 40  ? 9.372   1.955   2.038   1.00 45.97  ? 40  ARG H NH1 1 
ATOM   1172 N  NH2 . ARG B 2 40  ? 8.048   0.226   2.809   1.00 48.77  ? 40  ARG H NH2 1 
ATOM   1173 N  N   . PRO B 2 41  ? 13.331  -1.076  -0.681  1.00 58.28  ? 41  PRO H N   1 
ATOM   1174 C  CA  . PRO B 2 41  ? 14.511  -1.888  -0.328  1.00 53.09  ? 41  PRO H CA  1 
ATOM   1175 C  C   . PRO B 2 41  ? 14.302  -3.411  -0.387  1.00 57.25  ? 41  PRO H C   1 
ATOM   1176 O  O   . PRO B 2 41  ? 13.323  -3.946  0.149   1.00 56.77  ? 41  PRO H O   1 
ATOM   1177 C  CB  . PRO B 2 41  ? 14.824  -1.444  1.109   1.00 50.34  ? 41  PRO H CB  1 
ATOM   1178 C  CG  . PRO B 2 41  ? 14.314  -0.031  1.196   1.00 54.92  ? 41  PRO H CG  1 
ATOM   1179 C  CD  . PRO B 2 41  ? 13.043  -0.046  0.343   1.00 56.96  ? 41  PRO H CD  1 
ATOM   1180 N  N   . GLY B 2 42  ? 15.196  -4.101  -1.093  1.00 57.29  ? 42  GLY H N   1 
ATOM   1181 C  CA  . GLY B 2 42  ? 15.083  -5.540  -1.229  1.00 54.81  ? 42  GLY H CA  1 
ATOM   1182 C  C   . GLY B 2 42  ? 13.907  -6.020  -2.045  1.00 59.16  ? 42  GLY H C   1 
ATOM   1183 O  O   . GLY B 2 42  ? 13.670  -7.229  -2.142  1.00 61.74  ? 42  GLY H O   1 
ATOM   1184 N  N   . GLN B 2 43  ? 13.164  -5.089  -2.641  1.00 61.15  ? 43  GLN H N   1 
ATOM   1185 C  CA  . GLN B 2 43  ? 11.994  -5.462  -3.437  1.00 57.68  ? 43  GLN H CA  1 
ATOM   1186 C  C   . GLN B 2 43  ? 12.219  -5.201  -4.926  1.00 52.81  ? 43  GLN H C   1 
ATOM   1187 O  O   . GLN B 2 43  ? 13.283  -4.712  -5.346  1.00 46.19  ? 43  GLN H O   1 
ATOM   1188 C  CB  . GLN B 2 43  ? 10.750  -4.693  -2.973  1.00 55.71  ? 43  GLN H CB  1 
ATOM   1189 C  CG  . GLN B 2 43  ? 10.411  -4.850  -1.503  1.00 62.11  ? 43  GLN H CG  1 
ATOM   1190 C  CD  . GLN B 2 43  ? 10.201  -6.301  -1.125  1.00 70.20  ? 43  GLN H CD  1 
ATOM   1191 O  OE1 . GLN B 2 43  ? 9.266   -6.962  -1.600  1.00 78.63  ? 43  GLN H OE1 1 
ATOM   1192 N  NE2 . GLN B 2 43  ? 11.093  -6.818  -0.294  1.00 66.72  ? 43  GLN H NE2 1 
ATOM   1193 N  N   . GLY B 2 44  ? 11.170  -5.466  -5.700  1.00 49.61  ? 44  GLY H N   1 
ATOM   1194 C  CA  . GLY B 2 44  ? 11.234  -5.384  -7.137  1.00 45.61  ? 44  GLY H CA  1 
ATOM   1195 C  C   . GLY B 2 44  ? 10.938  -3.995  -7.633  1.00 47.46  ? 44  GLY H C   1 
ATOM   1196 O  O   . GLY B 2 44  ? 10.813  -3.049  -6.846  1.00 46.73  ? 44  GLY H O   1 
ATOM   1197 N  N   . LEU B 2 45  ? 10.890  -3.863  -8.951  1.00 45.54  ? 45  LEU H N   1 
ATOM   1198 C  CA  . LEU B 2 45  ? 10.572  -2.594  -9.569  1.00 44.76  ? 45  LEU H CA  1 
ATOM   1199 C  C   . LEU B 2 45  ? 9.066   -2.342  -9.681  1.00 46.71  ? 45  LEU H C   1 
ATOM   1200 O  O   . LEU B 2 45  ? 8.294   -3.245  -10.037 1.00 50.39  ? 45  LEU H O   1 
ATOM   1201 C  CB  . LEU B 2 45  ? 11.194  -2.512  -10.966 1.00 48.93  ? 45  LEU H CB  1 
ATOM   1202 C  CG  . LEU B 2 45  ? 12.708  -2.676  -11.018 1.00 49.43  ? 45  LEU H CG  1 
ATOM   1203 C  CD1 . LEU B 2 45  ? 13.152  -2.721  -12.471 1.00 43.88  ? 45  LEU H CD1 1 
ATOM   1204 C  CD2 . LEU B 2 45  ? 13.456  -1.622  -10.187 1.00 42.50  ? 45  LEU H CD2 1 
ATOM   1205 N  N   . GLU B 2 46  ? 8.651   -1.113  -9.400  1.00 46.34  ? 46  GLU H N   1 
ATOM   1206 C  CA  . GLU B 2 46  ? 7.248   -0.716  -9.598  1.00 48.31  ? 46  GLU H CA  1 
ATOM   1207 C  C   . GLU B 2 46  ? 7.126   0.557   -10.449 1.00 46.48  ? 46  GLU H C   1 
ATOM   1208 O  O   . GLU B 2 46  ? 7.811   1.560   -10.179 1.00 46.73  ? 46  GLU H O   1 
ATOM   1209 C  CB  . GLU B 2 46  ? 6.559   -0.497  -8.246  1.00 50.38  ? 46  GLU H CB  1 
ATOM   1210 C  CG  . GLU B 2 46  ? 5.116   -0.019  -8.347  1.00 44.27  ? 46  GLU H CG  1 
ATOM   1211 C  CD  . GLU B 2 46  ? 4.446   0.134   -6.984  1.00 50.23  ? 46  GLU H CD  1 
ATOM   1212 O  OE1 . GLU B 2 46  ? 3.238   -0.152  -6.937  1.00 51.54  ? 46  GLU H OE1 1 
ATOM   1213 O  OE2 . GLU B 2 46  ? 5.094   0.563   -5.982  1.00 44.66  ? 46  GLU H OE2 1 
ATOM   1214 N  N   . TRP B 2 47  ? 6.308   0.502   -11.504 1.00 47.68  ? 47  TRP H N   1 
ATOM   1215 C  CA  . TRP B 2 47  ? 6.118   1.670   -12.383 1.00 44.23  ? 47  TRP H CA  1 
ATOM   1216 C  C   . TRP B 2 47  ? 5.253   2.723   -11.701 1.00 43.91  ? 47  TRP H C   1 
ATOM   1217 O  O   . TRP B 2 47  ? 4.242   2.387   -11.072 1.00 48.67  ? 47  TRP H O   1 
ATOM   1218 C  CB  . TRP B 2 47  ? 5.536   1.267   -13.761 1.00 40.55  ? 47  TRP H CB  1 
ATOM   1219 C  CG  . TRP B 2 47  ? 5.202   2.489   -14.637 1.00 45.00  ? 47  TRP H CG  1 
ATOM   1220 C  CD1 . TRP B 2 47  ? 6.077   3.433   -15.118 1.00 44.17  ? 47  TRP H CD1 1 
ATOM   1221 C  CD2 . TRP B 2 47  ? 3.908   2.861   -15.149 1.00 42.99  ? 47  TRP H CD2 1 
ATOM   1222 N  NE1 . TRP B 2 47  ? 5.400   4.387   -15.849 1.00 38.44  ? 47  TRP H NE1 1 
ATOM   1223 C  CE2 . TRP B 2 47  ? 4.074   4.054   -15.893 1.00 42.07  ? 47  TRP H CE2 1 
ATOM   1224 C  CE3 . TRP B 2 47  ? 2.629   2.304   -15.052 1.00 43.60  ? 47  TRP H CE3 1 
ATOM   1225 C  CZ2 . TRP B 2 47  ? 2.998   4.702   -16.531 1.00 44.95  ? 47  TRP H CZ2 1 
ATOM   1226 C  CZ3 . TRP B 2 47  ? 1.553   2.959   -15.685 1.00 41.51  ? 47  TRP H CZ3 1 
ATOM   1227 C  CH2 . TRP B 2 47  ? 1.748   4.134   -16.412 1.00 42.29  ? 47  TRP H CH2 1 
ATOM   1228 N  N   . ILE B 2 48  ? 5.705   3.980   -11.741 1.00 39.47  ? 48  ILE H N   1 
ATOM   1229 C  CA  . ILE B 2 48  ? 4.924   5.111   -11.208 1.00 44.18  ? 48  ILE H CA  1 
ATOM   1230 C  C   . ILE B 2 48  ? 4.082   5.885   -12.247 1.00 47.41  ? 48  ILE H C   1 
ATOM   1231 O  O   . ILE B 2 48  ? 2.845   6.115   -12.097 1.00 39.22  ? 48  ILE H O   1 
ATOM   1232 C  CB  . ILE B 2 48  ? 5.838   6.075   -10.536 1.00 38.14  ? 48  ILE H CB  1 
ATOM   1233 C  CG1 . ILE B 2 48  ? 6.440   5.376   -9.303  1.00 41.35  ? 48  ILE H CG1 1 
ATOM   1234 C  CG2 . ILE B 2 48  ? 5.073   7.340   -10.154 1.00 32.89  ? 48  ILE H CG2 1 
ATOM   1235 C  CD1 . ILE B 2 48  ? 7.576   6.174   -8.589  1.00 38.52  ? 48  ILE H CD1 1 
ATOM   1236 N  N   . GLY B 2 49  ? 4.786   6.265   -13.302 1.00 41.60  ? 49  GLY H N   1 
ATOM   1237 C  CA  . GLY B 2 49  ? 4.234   7.075   -14.343 1.00 38.03  ? 49  GLY H CA  1 
ATOM   1238 C  C   . GLY B 2 49  ? 5.288   7.532   -15.332 1.00 41.22  ? 49  GLY H C   1 
ATOM   1239 O  O   . GLY B 2 49  ? 6.514   7.445   -15.134 1.00 42.15  ? 49  GLY H O   1 
ATOM   1240 N  N   . SER B 2 50  ? 4.780   8.017   -16.441 1.00 38.98  ? 50  SER H N   1 
ATOM   1241 C  CA  . SER B 2 50  ? 5.600   8.375   -17.541 1.00 40.53  ? 50  SER H CA  1 
ATOM   1242 C  C   . SER B 2 50  ? 5.078   9.633   -18.157 1.00 41.33  ? 50  SER H C   1 
ATOM   1243 O  O   . SER B 2 50  ? 3.891   9.936   -18.024 1.00 47.87  ? 50  SER H O   1 
ATOM   1244 C  CB  . SER B 2 50  ? 5.646   7.243   -18.544 1.00 43.86  ? 50  SER H CB  1 
ATOM   1245 O  OG  . SER B 2 50  ? 6.114   6.064   -17.896 1.00 46.03  ? 50  SER H OG  1 
ATOM   1246 N  N   . ILE B 2 51  ? 5.960   10.343  -18.853 1.00 43.85  ? 51  ILE H N   1 
ATOM   1247 C  CA  . ILE B 2 51  ? 5.628   11.606  -19.486 1.00 43.92  ? 51  ILE H CA  1 
ATOM   1248 C  C   . ILE B 2 51  ? 6.260   11.777  -20.877 1.00 47.50  ? 51  ILE H C   1 
ATOM   1249 O  O   . ILE B 2 51  ? 7.391   11.332  -21.134 1.00 46.10  ? 51  ILE H O   1 
ATOM   1250 C  CB  . ILE B 2 51  ? 6.020   12.786  -18.603 1.00 43.01  ? 51  ILE H CB  1 
ATOM   1251 C  CG1 . ILE B 2 51  ? 5.543   14.094  -19.248 1.00 48.19  ? 51  ILE H CG1 1 
ATOM   1252 C  CG2 . ILE B 2 51  ? 7.508   12.789  -18.352 1.00 42.10  ? 51  ILE H CG2 1 
ATOM   1253 C  CD1 . ILE B 2 51  ? 5.436   15.282  -18.296 1.00 50.64  ? 51  ILE H CD1 1 
ATOM   1254 N  N   . ASP B 2 52  ? 5.489   12.373  -21.783 1.00 47.37  ? 52  ASP H N   1 
ATOM   1255 C  CA  . ASP B 2 52  ? 5.978   12.775  -23.095 1.00 47.10  ? 52  ASP H CA  1 
ATOM   1256 C  C   . ASP B 2 52  ? 6.406   14.230  -22.967 1.00 46.28  ? 52  ASP H C   1 
ATOM   1257 O  O   . ASP B 2 52  ? 5.561   15.125  -22.828 1.00 47.06  ? 52  ASP H O   1 
ATOM   1258 C  CB  . ASP B 2 52  ? 4.862   12.636  -24.132 1.00 51.27  ? 52  ASP H CB  1 
ATOM   1259 C  CG  . ASP B 2 52  ? 5.331   12.855  -25.557 1.00 49.42  ? 52  ASP H CG  1 
ATOM   1260 O  OD1 . ASP B 2 52  ? 6.331   13.585  -25.789 1.00 46.30  ? 52  ASP H OD1 1 
ATOM   1261 O  OD2 . ASP B 2 52  ? 4.628   12.328  -26.451 1.00 47.90  ? 52  ASP H OD2 1 
ATOM   1262 N  N   . PRO B 2 53  ? 7.718   14.475  -23.001 1.00 46.49  ? 53  PRO H N   1 
ATOM   1263 C  CA  . PRO B 2 53  ? 8.267   15.837  -22.839 1.00 50.09  ? 53  PRO H CA  1 
ATOM   1264 C  C   . PRO B 2 53  ? 7.841   16.811  -23.915 1.00 49.00  ? 53  PRO H C   1 
ATOM   1265 O  O   . PRO B 2 53  ? 7.994   18.011  -23.721 1.00 50.61  ? 53  PRO H O   1 
ATOM   1266 C  CB  . PRO B 2 53  ? 9.785   15.620  -22.867 1.00 48.62  ? 53  PRO H CB  1 
ATOM   1267 C  CG  . PRO B 2 53  ? 9.950   14.166  -22.491 1.00 51.83  ? 53  PRO H CG  1 
ATOM   1268 C  CD  . PRO B 2 53  ? 8.775   13.462  -23.097 1.00 45.12  ? 53  PRO H CD  1 
ATOM   1269 N  N   . SER B 2 54  ? 7.372   16.310  -25.047 1.00 49.38  ? 54  SER H N   1 
ATOM   1270 C  CA  . SER B 2 54  ? 6.974   17.197  -26.129 1.00 50.24  ? 54  SER H CA  1 
ATOM   1271 C  C   . SER B 2 54  ? 5.811   18.091  -25.768 1.00 48.54  ? 54  SER H C   1 
ATOM   1272 O  O   . SER B 2 54  ? 5.782   19.260  -26.145 1.00 48.86  ? 54  SER H O   1 
ATOM   1273 C  CB  . SER B 2 54  ? 6.560   16.399  -27.341 1.00 46.74  ? 54  SER H CB  1 
ATOM   1274 O  OG  . SER B 2 54  ? 5.451   15.597  -26.966 1.00 56.59  ? 54  SER H OG  1 
ATOM   1275 N  N   . ASP B 2 55  ? 4.816   17.499  -25.107 1.00 45.64  ? 55  ASP H N   1 
ATOM   1276 C  CA  . ASP B 2 55  ? 3.612   18.230  -24.700 1.00 49.46  ? 55  ASP H CA  1 
ATOM   1277 C  C   . ASP B 2 55  ? 3.178   18.016  -23.247 1.00 50.29  ? 55  ASP H C   1 
ATOM   1278 O  O   . ASP B 2 55  ? 2.052   18.390  -22.891 1.00 49.64  ? 55  ASP H O   1 
ATOM   1279 C  CB  . ASP B 2 55  ? 2.452   17.879  -25.643 1.00 42.51  ? 55  ASP H CB  1 
ATOM   1280 C  CG  . ASP B 2 55  ? 2.041   16.442  -25.544 1.00 43.83  ? 55  ASP H CG  1 
ATOM   1281 O  OD1 . ASP B 2 55  ? 2.819   15.632  -24.992 1.00 52.36  ? 55  ASP H OD1 1 
ATOM   1282 O  OD2 . ASP B 2 55  ? 0.988   16.088  -26.092 1.00 43.20  ? 55  ASP H OD2 1 
ATOM   1283 N  N   . SER B 2 56  ? 4.001   17.312  -22.469 1.00 43.65  ? 56  SER H N   1 
ATOM   1284 C  CA  . SER B 2 56  ? 3.723   17.027  -21.051 1.00 47.23  ? 56  SER H CA  1 
ATOM   1285 C  C   . SER B 2 56  ? 2.503   16.163  -20.808 1.00 47.94  ? 56  SER H C   1 
ATOM   1286 O  O   . SER B 2 56  ? 1.991   16.086  -19.689 1.00 48.75  ? 56  SER H O   1 
ATOM   1287 C  CB  . SER B 2 56  ? 3.581   18.314  -20.240 1.00 42.59  ? 56  SER H CB  1 
ATOM   1288 O  OG  . SER B 2 56  ? 4.854   18.925  -20.104 1.00 54.49  ? 56  SER H OG  1 
ATOM   1289 N  N   . TYR B 2 57  ? 2.112   15.433  -21.832 1.00 42.06  ? 57  TYR H N   1 
ATOM   1290 C  CA  . TYR B 2 57  ? 1.148   14.383  -21.676 1.00 43.49  ? 57  TYR H CA  1 
ATOM   1291 C  C   . TYR B 2 57  ? 1.630   13.292  -20.707 1.00 46.13  ? 57  TYR H C   1 
ATOM   1292 O  O   . TYR B 2 57  ? 2.792   12.913  -20.723 1.00 48.99  ? 57  TYR H O   1 
ATOM   1293 C  CB  . TYR B 2 57  ? 0.845   13.809  -23.047 1.00 43.57  ? 57  TYR H CB  1 
ATOM   1294 C  CG  . TYR B 2 57  ? -0.091  12.644  -23.058 1.00 42.95  ? 57  TYR H CG  1 
ATOM   1295 C  CD1 . TYR B 2 57  ? -1.477  12.821  -22.946 1.00 45.71  ? 57  TYR H CD1 1 
ATOM   1296 C  CD2 . TYR B 2 57  ? 0.395   11.365  -23.198 1.00 46.17  ? 57  TYR H CD2 1 
ATOM   1297 C  CE1 . TYR B 2 57  ? -2.348  11.728  -22.978 1.00 42.64  ? 57  TYR H CE1 1 
ATOM   1298 C  CE2 . TYR B 2 57  ? -0.456  10.273  -23.219 1.00 47.73  ? 57  TYR H CE2 1 
ATOM   1299 C  CZ  . TYR B 2 57  ? -1.816  10.451  -23.119 1.00 42.66  ? 57  TYR H CZ  1 
ATOM   1300 O  OH  . TYR B 2 57  ? -2.585  9.315   -23.171 1.00 40.29  ? 57  TYR H OH  1 
ATOM   1301 N  N   . THR B 2 58  ? 0.757   12.793  -19.838 1.00 48.77  ? 58  THR H N   1 
ATOM   1302 C  CA  . THR B 2 58  ? 1.204   11.792  -18.866 1.00 43.88  ? 58  THR H CA  1 
ATOM   1303 C  C   . THR B 2 58  ? 0.353   10.535  -18.836 1.00 43.42  ? 58  THR H C   1 
ATOM   1304 O  O   . THR B 2 58  ? -0.743  10.475  -19.410 1.00 43.51  ? 58  THR H O   1 
ATOM   1305 C  CB  . THR B 2 58  ? 1.217   12.338  -17.467 1.00 43.16  ? 58  THR H CB  1 
ATOM   1306 O  OG1 . THR B 2 58  ? -0.091  12.838  -17.127 1.00 39.92  ? 58  THR H OG1 1 
ATOM   1307 C  CG2 . THR B 2 58  ? 2.264   13.434  -17.359 1.00 45.75  ? 58  THR H CG2 1 
ATOM   1308 N  N   . SER B 2 59  ? 0.944   9.493   -18.274 1.00 41.58  ? 59  SER H N   1 
ATOM   1309 C  CA  . SER B 2 59  ? 0.223   8.263   -17.963 1.00 42.86  ? 59  SER H CA  1 
ATOM   1310 C  C   . SER B 2 59  ? 0.719   7.840   -16.558 1.00 46.72  ? 59  SER H C   1 
ATOM   1311 O  O   . SER B 2 59  ? 1.904   7.913   -16.280 1.00 42.65  ? 59  SER H O   1 
ATOM   1312 C  CB  . SER B 2 59  ? 0.459   7.197   -19.007 1.00 43.02  ? 59  SER H CB  1 
ATOM   1313 O  OG  . SER B 2 59  ? -0.332  6.070   -18.700 1.00 48.11  ? 59  SER H OG  1 
ATOM   1314 N  N   . HIS B 2 60  ? -0.161  7.379   -15.684 1.00 42.27  ? 60  HIS H N   1 
ATOM   1315 C  CA  . HIS B 2 60  ? 0.250   7.026   -14.330 1.00 39.88  ? 60  HIS H CA  1 
ATOM   1316 C  C   . HIS B 2 60  ? -0.135  5.635   -13.978 1.00 38.97  ? 60  HIS H C   1 
ATOM   1317 O  O   . HIS B 2 60  ? -1.121  5.127   -14.473 1.00 43.08  ? 60  HIS H O   1 
ATOM   1318 C  CB  . HIS B 2 60  ? -0.384  7.958   -13.301 1.00 40.01  ? 60  HIS H CB  1 
ATOM   1319 C  CG  . HIS B 2 60  ? 0.140   9.356   -13.328 1.00 39.82  ? 60  HIS H CG  1 
ATOM   1320 N  ND1 . HIS B 2 60  ? -0.200  10.257  -14.309 1.00 42.51  ? 60  HIS H ND1 1 
ATOM   1321 C  CD2 . HIS B 2 60  ? 0.877   10.047  -12.425 1.00 41.49  ? 60  HIS H CD2 1 
ATOM   1322 C  CE1 . HIS B 2 60  ? 0.362   11.424  -14.047 1.00 43.84  ? 60  HIS H CE1 1 
ATOM   1323 N  NE2 . HIS B 2 60  ? 1.018   11.324  -12.907 1.00 42.69  ? 60  HIS H NE2 1 
ATOM   1324 N  N   . ASN B 2 61  ? 0.669   5.005   -13.146 1.00 40.80  ? 61  ASN H N   1 
ATOM   1325 C  CA  . ASN B 2 61  ? 0.181   3.856   -12.401 1.00 46.07  ? 61  ASN H CA  1 
ATOM   1326 C  C   . ASN B 2 61  ? -1.015  4.428   -11.636 1.00 44.81  ? 61  ASN H C   1 
ATOM   1327 O  O   . ASN B 2 61  ? -0.897  5.490   -11.021 1.00 42.93  ? 61  ASN H O   1 
ATOM   1328 C  CB  . ASN B 2 61  ? 1.264   3.289   -11.464 1.00 50.26  ? 61  ASN H CB  1 
ATOM   1329 C  CG  . ASN B 2 61  ? 0.765   2.131   -10.606 1.00 53.24  ? 61  ASN H CG  1 
ATOM   1330 O  OD1 . ASN B 2 61  ? -0.414  2.051   -10.268 1.00 58.10  ? 61  ASN H OD1 1 
ATOM   1331 N  ND2 . ASN B 2 61  ? 1.676   1.242   -10.227 1.00 52.56  ? 61  ASN H ND2 1 
ATOM   1332 N  N   . GLU B 2 62  ? -2.172  3.777   -11.740 1.00 47.77  ? 62  GLU H N   1 
ATOM   1333 C  CA  . GLU B 2 62  ? -3.423  4.279   -11.140 1.00 50.28  ? 62  GLU H CA  1 
ATOM   1334 C  C   . GLU B 2 62  ? -3.242  4.723   -9.673  1.00 51.21  ? 62  GLU H C   1 
ATOM   1335 O  O   . GLU B 2 62  ? -3.764  5.768   -9.246  1.00 48.41  ? 62  GLU H O   1 
ATOM   1336 C  CB  . GLU B 2 62  ? -4.486  3.173   -11.227 1.00 50.11  ? 62  GLU H CB  1 
ATOM   1337 C  CG  . GLU B 2 62  ? -5.705  3.252   -10.315 1.00 57.55  ? 62  GLU H CG  1 
ATOM   1338 C  CD  . GLU B 2 62  ? -6.860  4.004   -10.951 1.00 74.28  ? 62  GLU H CD  1 
ATOM   1339 O  OE1 . GLU B 2 62  ? -6.624  4.945   -11.748 1.00 80.49  ? 62  GLU H OE1 1 
ATOM   1340 O  OE2 . GLU B 2 62  ? -8.024  3.613   -10.687 1.00 83.22  ? 62  GLU H OE2 1 
ATOM   1341 N  N   . LYS B 2 63  ? -2.460  3.967   -8.912  1.00 46.11  ? 63  LYS H N   1 
ATOM   1342 C  CA  . LYS B 2 63  ? -2.307  4.295   -7.506  1.00 50.43  ? 63  LYS H CA  1 
ATOM   1343 C  C   . LYS B 2 63  ? -1.407  5.526   -7.257  1.00 49.02  ? 63  LYS H C   1 
ATOM   1344 O  O   . LYS B 2 63  ? -1.314  6.012   -6.123  1.00 44.71  ? 63  LYS H O   1 
ATOM   1345 C  CB  . LYS B 2 63  ? -1.828  3.084   -6.703  1.00 52.15  ? 63  LYS H CB  1 
ATOM   1346 C  CG  . LYS B 2 63  ? -0.453  2.641   -7.012  1.00 55.18  ? 63  LYS H CG  1 
ATOM   1347 C  CD  . LYS B 2 63  ? -0.213  1.263   -6.398  1.00 63.24  ? 63  LYS H CD  1 
ATOM   1348 C  CE  . LYS B 2 63  ? -1.270  0.241   -6.826  1.00 65.51  ? 63  LYS H CE  1 
ATOM   1349 N  NZ  . LYS B 2 63  ? -0.672  -1.143  -6.831  1.00 66.57  ? 63  LYS H NZ  1 
ATOM   1350 N  N   . PHE B 2 64  ? -0.737  6.027   -8.297  1.00 50.97  ? 64  PHE H N   1 
ATOM   1351 C  CA  . PHE B 2 64  ? 0.126   7.208   -8.124  1.00 46.20  ? 64  PHE H CA  1 
ATOM   1352 C  C   . PHE B 2 64  ? -0.481  8.516   -8.658  1.00 43.67  ? 64  PHE H C   1 
ATOM   1353 O  O   . PHE B 2 64  ? 0.113   9.588   -8.526  1.00 44.33  ? 64  PHE H O   1 
ATOM   1354 C  CB  . PHE B 2 64  ? 1.483   6.961   -8.755  1.00 38.72  ? 64  PHE H CB  1 
ATOM   1355 C  CG  . PHE B 2 64  ? 2.330   6.009   -7.965  1.00 40.97  ? 64  PHE H CG  1 
ATOM   1356 C  CD1 . PHE B 2 64  ? 3.164   6.467   -6.950  1.00 38.35  ? 64  PHE H CD1 1 
ATOM   1357 C  CD2 . PHE B 2 64  ? 2.326   4.646   -8.269  1.00 44.10  ? 64  PHE H CD2 1 
ATOM   1358 C  CE1 . PHE B 2 64  ? 3.971   5.569   -6.224  1.00 35.28  ? 64  PHE H CE1 1 
ATOM   1359 C  CE2 . PHE B 2 64  ? 3.111   3.751   -7.543  1.00 43.23  ? 64  PHE H CE2 1 
ATOM   1360 C  CZ  . PHE B 2 64  ? 3.939   4.217   -6.517  1.00 35.90  ? 64  PHE H CZ  1 
ATOM   1361 N  N   . LYS B 2 65  ? -1.678  8.440   -9.227  1.00 45.31  ? 65  LYS H N   1 
ATOM   1362 C  CA  . LYS B 2 65  ? -2.323  9.631   -9.761  1.00 44.22  ? 65  LYS H CA  1 
ATOM   1363 C  C   . LYS B 2 65  ? -2.860  10.437  -8.580  1.00 43.48  ? 65  LYS H C   1 
ATOM   1364 O  O   . LYS B 2 65  ? -3.723  9.956   -7.831  1.00 45.66  ? 65  LYS H O   1 
ATOM   1365 C  CB  . LYS B 2 65  ? -3.484  9.276   -10.706 1.00 43.83  ? 65  LYS H CB  1 
ATOM   1366 C  CG  . LYS B 2 65  ? -3.835  10.404  -11.650 1.00 46.36  ? 65  LYS H CG  1 
ATOM   1367 C  CD  . LYS B 2 65  ? -4.880  10.033  -12.697 1.00 64.06  ? 65  LYS H CD  1 
ATOM   1368 C  CE  . LYS B 2 65  ? -4.971  8.539   -13.011 1.00 69.64  ? 65  LYS H CE  1 
ATOM   1369 N  NZ  . LYS B 2 65  ? -5.899  8.286   -14.173 1.00 80.03  ? 65  LYS H NZ  1 
ATOM   1370 N  N   . GLY B 2 66  ? -2.281  11.601  -8.333  1.00 39.95  ? 66  GLY H N   1 
ATOM   1371 C  CA  . GLY B 2 66  ? -2.660  12.371  -7.164  1.00 42.98  ? 66  GLY H CA  1 
ATOM   1372 C  C   . GLY B 2 66  ? -1.515  12.319  -6.160  1.00 46.42  ? 66  GLY H C   1 
ATOM   1373 O  O   . GLY B 2 66  ? -1.481  13.050  -5.182  1.00 48.41  ? 66  GLY H O   1 
ATOM   1374 N  N   . LYS B 2 67  ? -0.557  11.445  -6.422  1.00 39.01  ? 67  LYS H N   1 
ATOM   1375 C  CA  . LYS B 2 67  ? 0.553   11.283  -5.533  1.00 45.61  ? 67  LYS H CA  1 
ATOM   1376 C  C   . LYS B 2 67  ? 1.813   11.773  -6.247  1.00 49.63  ? 67  LYS H C   1 
ATOM   1377 O  O   . LYS B 2 67  ? 2.640   12.479  -5.683  1.00 50.93  ? 67  LYS H O   1 
ATOM   1378 C  CB  . LYS B 2 67  ? 0.683   9.826   -5.116  1.00 44.86  ? 67  LYS H CB  1 
ATOM   1379 C  CG  . LYS B 2 67  ? 1.946   9.522   -4.345  1.00 44.89  ? 67  LYS H CG  1 
ATOM   1380 C  CD  . LYS B 2 67  ? 1.803   9.961   -2.856  1.00 48.23  ? 67  LYS H CD  1 
ATOM   1381 C  CE  . LYS B 2 67  ? 2.881   9.308   -1.940  1.00 40.15  ? 67  LYS H CE  1 
ATOM   1382 N  NZ  . LYS B 2 67  ? 2.677   9.693   -0.517  1.00 41.20  ? 67  LYS H NZ  1 
ATOM   1383 N  N   . ALA B 2 68  ? 1.954   11.409  -7.505  1.00 45.20  ? 68  ALA H N   1 
ATOM   1384 C  CA  . ALA B 2 68  ? 3.140   11.775  -8.227  1.00 42.40  ? 68  ALA H CA  1 
ATOM   1385 C  C   . ALA B 2 68  ? 2.761   12.754  -9.335  1.00 47.42  ? 68  ALA H C   1 
ATOM   1386 O  O   . ALA B 2 68  ? 1.964   12.426  -10.226 1.00 44.55  ? 68  ALA H O   1 
ATOM   1387 C  CB  . ALA B 2 68  ? 3.803   10.552  -8.795  1.00 41.96  ? 68  ALA H CB  1 
ATOM   1388 N  N   . THR B 2 69  ? 3.372   13.935  -9.302  1.00 42.42  ? 69  THR H N   1 
ATOM   1389 C  CA  . THR B 2 69  ? 3.079   14.956  -10.293 1.00 45.39  ? 69  THR H CA  1 
ATOM   1390 C  C   . THR B 2 69  ? 4.288   15.034  -11.214 1.00 48.80  ? 69  THR H C   1 
ATOM   1391 O  O   . THR B 2 69  ? 5.407   15.297  -10.757 1.00 48.81  ? 69  THR H O   1 
ATOM   1392 C  CB  . THR B 2 69  ? 2.782   16.318  -9.635  1.00 48.23  ? 69  THR H CB  1 
ATOM   1393 O  OG1 . THR B 2 69  ? 1.613   16.204  -8.788  1.00 40.10  ? 69  THR H OG1 1 
ATOM   1394 C  CG2 . THR B 2 69  ? 2.501   17.364  -10.710 1.00 44.58  ? 69  THR H CG2 1 
ATOM   1395 N  N   . LEU B 2 70  ? 4.060   14.767  -12.503 1.00 44.66  ? 70  LEU H N   1 
ATOM   1396 C  CA  . LEU B 2 70  ? 5.159   14.712  -13.457 1.00 45.94  ? 70  LEU H CA  1 
ATOM   1397 C  C   . LEU B 2 70  ? 5.191   15.920  -14.359 1.00 48.73  ? 70  LEU H C   1 
ATOM   1398 O  O   . LEU B 2 70  ? 4.194   16.286  -14.987 1.00 51.95  ? 70  LEU H O   1 
ATOM   1399 C  CB  . LEU B 2 70  ? 5.097   13.436  -14.298 1.00 45.11  ? 70  LEU H CB  1 
ATOM   1400 C  CG  . LEU B 2 70  ? 5.029   12.121  -13.498 1.00 47.11  ? 70  LEU H CG  1 
ATOM   1401 C  CD1 . LEU B 2 70  ? 5.121   10.845  -14.417 1.00 42.60  ? 70  LEU H CD1 1 
ATOM   1402 C  CD2 . LEU B 2 70  ? 6.048   12.106  -12.405 1.00 44.30  ? 70  LEU H CD2 1 
ATOM   1403 N  N   . THR B 2 71  ? 6.374   16.518  -14.451 1.00 47.62  ? 71  THR H N   1 
ATOM   1404 C  CA  . THR B 2 71  ? 6.551   17.644  -15.339 1.00 50.97  ? 71  THR H CA  1 
ATOM   1405 C  C   . THR B 2 71  ? 7.899   17.622  -16.056 1.00 57.35  ? 71  THR H C   1 
ATOM   1406 O  O   . THR B 2 71  ? 8.774   16.821  -15.722 1.00 54.63  ? 71  THR H O   1 
ATOM   1407 C  CB  . THR B 2 71  ? 6.475   18.959  -14.527 1.00 52.23  ? 71  THR H CB  1 
ATOM   1408 O  OG1 . THR B 2 71  ? 7.537   18.978  -13.551 1.00 50.00  ? 71  THR H OG1 1 
ATOM   1409 C  CG2 . THR B 2 71  ? 5.097   19.143  -13.852 1.00 40.01  ? 71  THR H CG2 1 
ATOM   1410 N  N   . VAL B 2 72  ? 8.083   18.514  -17.027 1.00 58.08  ? 72  VAL H N   1 
ATOM   1411 C  CA  . VAL B 2 72  ? 9.425   18.729  -17.574 1.00 56.23  ? 72  VAL H CA  1 
ATOM   1412 C  C   . VAL B 2 72  ? 9.754   20.208  -17.674 1.00 54.35  ? 72  VAL H C   1 
ATOM   1413 O  O   . VAL B 2 72  ? 8.873   21.055  -17.650 1.00 57.02  ? 72  VAL H O   1 
ATOM   1414 C  CB  . VAL B 2 72  ? 9.620   18.100  -18.972 1.00 53.09  ? 72  VAL H CB  1 
ATOM   1415 C  CG1 . VAL B 2 72  ? 9.520   16.585  -18.927 1.00 51.03  ? 72  VAL H CG1 1 
ATOM   1416 C  CG2 . VAL B 2 72  ? 8.677   18.749  -19.978 1.00 55.29  ? 72  VAL H CG2 1 
ATOM   1417 N  N   . ASP B 2 73  ? 11.038  20.512  -17.753 1.00 55.89  ? 73  ASP H N   1 
ATOM   1418 C  CA  . ASP B 2 73  ? 11.478  21.839  -18.137 1.00 60.92  ? 73  ASP H CA  1 
ATOM   1419 C  C   . ASP B 2 73  ? 12.289  21.648  -19.411 1.00 59.75  ? 73  ASP H C   1 
ATOM   1420 O  O   . ASP B 2 73  ? 13.447  21.187  -19.400 1.00 59.41  ? 73  ASP H O   1 
ATOM   1421 C  CB  . ASP B 2 73  ? 12.291  22.516  -17.022 1.00 60.16  ? 73  ASP H CB  1 
ATOM   1422 C  CG  . ASP B 2 73  ? 12.869  23.868  -17.434 1.00 63.68  ? 73  ASP H CG  1 
ATOM   1423 O  OD1 . ASP B 2 73  ? 12.626  24.334  -18.557 1.00 61.58  ? 73  ASP H OD1 1 
ATOM   1424 O  OD2 . ASP B 2 73  ? 13.579  24.487  -16.614 1.00 73.49  ? 73  ASP H OD2 1 
ATOM   1425 N  N   . GLU B 2 74  ? 11.618  21.961  -20.506 1.00 58.48  ? 74  GLU H N   1 
ATOM   1426 C  CA  . GLU B 2 74  ? 12.107  21.669  -21.830 1.00 64.74  ? 74  GLU H CA  1 
ATOM   1427 C  C   . GLU B 2 74  ? 13.378  22.471  -22.002 1.00 65.79  ? 74  GLU H C   1 
ATOM   1428 O  O   . GLU B 2 74  ? 14.344  22.031  -22.635 1.00 63.98  ? 74  GLU H O   1 
ATOM   1429 C  CB  . GLU B 2 74  ? 11.010  22.000  -22.848 1.00 66.37  ? 74  GLU H CB  1 
ATOM   1430 C  CG  . GLU B 2 74  ? 11.241  21.672  -24.277 1.00 63.64  ? 74  GLU H CG  1 
ATOM   1431 C  CD  . GLU B 2 74  ? 10.018  22.067  -25.075 1.00 78.42  ? 74  GLU H CD  1 
ATOM   1432 O  OE1 . GLU B 2 74  ? 8.949   22.188  -24.428 1.00 72.77  ? 74  GLU H OE1 1 
ATOM   1433 O  OE2 . GLU B 2 74  ? 10.112  22.281  -26.310 1.00 87.70  ? 74  GLU H OE2 1 
ATOM   1434 N  N   . SER B 2 75  ? 13.373  23.657  -21.399 1.00 65.62  ? 75  SER H N   1 
ATOM   1435 C  CA  . SER B 2 75  ? 14.492  24.570  -21.548 1.00 63.54  ? 75  SER H CA  1 
ATOM   1436 C  C   . SER B 2 75  ? 15.747  24.021  -20.886 1.00 65.38  ? 75  SER H C   1 
ATOM   1437 O  O   . SER B 2 75  ? 16.826  24.236  -21.410 1.00 77.05  ? 75  SER H O   1 
ATOM   1438 C  CB  . SER B 2 75  ? 14.153  25.946  -20.967 1.00 69.42  ? 75  SER H CB  1 
ATOM   1439 O  OG  . SER B 2 75  ? 14.150  25.915  -19.542 1.00 76.78  ? 75  SER H OG  1 
ATOM   1440 N  N   . SER B 2 76  ? 15.623  23.316  -19.750 1.00 63.39  ? 76  SER H N   1 
ATOM   1441 C  CA  . SER B 2 76  ? 16.793  22.690  -19.090 1.00 57.09  ? 76  SER H CA  1 
ATOM   1442 C  C   . SER B 2 76  ? 16.895  21.188  -19.321 1.00 59.18  ? 76  SER H C   1 
ATOM   1443 O  O   . SER B 2 76  ? 17.666  20.532  -18.610 1.00 58.52  ? 76  SER H O   1 
ATOM   1444 C  CB  . SER B 2 76  ? 16.820  22.915  -17.577 1.00 56.58  ? 76  SER H CB  1 
ATOM   1445 O  OG  . SER B 2 76  ? 15.755  22.261  -16.914 1.00 61.19  ? 76  SER H OG  1 
ATOM   1446 N  N   . SER B 2 77  ? 16.097  20.643  -20.251 1.00 55.70  ? 77  SER H N   1 
ATOM   1447 C  CA  . SER B 2 77  ? 16.077  19.197  -20.547 1.00 53.55  ? 77  SER H CA  1 
ATOM   1448 C  C   . SER B 2 77  ? 15.991  18.406  -19.265 1.00 54.38  ? 77  SER H C   1 
ATOM   1449 O  O   . SER B 2 77  ? 16.681  17.381  -19.102 1.00 52.25  ? 77  SER H O   1 
ATOM   1450 C  CB  . SER B 2 77  ? 17.336  18.749  -21.287 1.00 52.93  ? 77  SER H CB  1 
ATOM   1451 O  OG  . SER B 2 77  ? 17.428  19.381  -22.547 1.00 73.37  ? 77  SER H OG  1 
ATOM   1452 N  N   . THR B 2 78  ? 15.030  18.776  -18.429 1.00 49.43  ? 78  THR H N   1 
ATOM   1453 C  CA  . THR B 2 78  ? 14.942  18.120  -17.141 1.00 51.90  ? 78  THR H CA  1 
ATOM   1454 C  C   . THR B 2 78  ? 13.564  17.571  -16.863 1.00 53.20  ? 78  THR H C   1 
ATOM   1455 O  O   . THR B 2 78  ? 12.549  18.240  -17.113 1.00 50.93  ? 78  THR H O   1 
ATOM   1456 C  CB  . THR B 2 78  ? 15.345  19.093  -16.044 1.00 52.98  ? 78  THR H CB  1 
ATOM   1457 O  OG1 . THR B 2 78  ? 16.678  19.534  -16.318 1.00 58.19  ? 78  THR H OG1 1 
ATOM   1458 C  CG2 . THR B 2 78  ? 15.279  18.443  -14.673 1.00 46.39  ? 78  THR H CG2 1 
ATOM   1459 N  N   . ALA B 2 79  ? 13.528  16.342  -16.356 1.00 47.37  ? 79  ALA H N   1 
ATOM   1460 C  CA  . ALA B 2 79  ? 12.244  15.762  -16.003 1.00 52.40  ? 79  ALA H CA  1 
ATOM   1461 C  C   . ALA B 2 79  ? 12.117  15.829  -14.493 1.00 49.18  ? 79  ALA H C   1 
ATOM   1462 O  O   . ALA B 2 79  ? 13.096  15.720  -13.774 1.00 50.82  ? 79  ALA H O   1 
ATOM   1463 C  CB  . ALA B 2 79  ? 12.150  14.341  -16.493 1.00 45.68  ? 79  ALA H CB  1 
ATOM   1464 N  N   . TYR B 2 80  ? 10.922  16.108  -14.024 1.00 43.24  ? 80  TYR H N   1 
ATOM   1465 C  CA  . TYR B 2 80  ? 10.689  16.172  -12.603 1.00 46.76  ? 80  TYR H CA  1 
ATOM   1466 C  C   . TYR B 2 80  ? 9.553   15.271  -12.168 1.00 48.54  ? 80  TYR H C   1 
ATOM   1467 O  O   . TYR B 2 80  ? 8.476   15.203  -12.837 1.00 47.46  ? 80  TYR H O   1 
ATOM   1468 C  CB  . TYR B 2 80  ? 10.345  17.616  -12.203 1.00 47.33  ? 80  TYR H CB  1 
ATOM   1469 C  CG  . TYR B 2 80  ? 11.422  18.634  -12.455 1.00 50.59  ? 80  TYR H CG  1 
ATOM   1470 C  CD1 . TYR B 2 80  ? 12.409  18.878  -11.503 1.00 56.70  ? 80  TYR H CD1 1 
ATOM   1471 C  CD2 . TYR B 2 80  ? 11.412  19.417  -13.598 1.00 53.00  ? 80  TYR H CD2 1 
ATOM   1472 C  CE1 . TYR B 2 80  ? 13.405  19.833  -11.726 1.00 59.58  ? 80  TYR H CE1 1 
ATOM   1473 C  CE2 . TYR B 2 80  ? 12.396  20.372  -13.835 1.00 51.62  ? 80  TYR H CE2 1 
ATOM   1474 C  CZ  . TYR B 2 80  ? 13.384  20.582  -12.893 1.00 56.17  ? 80  TYR H CZ  1 
ATOM   1475 O  OH  . TYR B 2 80  ? 14.355  21.525  -13.111 1.00 55.84  ? 80  TYR H OH  1 
ATOM   1476 N  N   . MET B 2 81  ? 9.722   14.693  -10.983 1.00 46.66  ? 81  MET H N   1 
ATOM   1477 C  CA  . MET B 2 81  ? 8.604   14.028  -10.322 1.00 48.28  ? 81  MET H CA  1 
ATOM   1478 C  C   . MET B 2 81  ? 8.440   14.604  -8.925  1.00 45.57  ? 81  MET H C   1 
ATOM   1479 O  O   . MET B 2 81  ? 9.349   14.535  -8.105  1.00 42.23  ? 81  MET H O   1 
ATOM   1480 C  CB  . MET B 2 81  ? 8.823   12.525  -10.225 1.00 45.87  ? 81  MET H CB  1 
ATOM   1481 C  CG  . MET B 2 81  ? 7.828   11.895  -9.257  1.00 46.52  ? 81  MET H CG  1 
ATOM   1482 S  SD  . MET B 2 81  ? 7.768   10.125  -9.446  1.00 50.42  ? 81  MET H SD  1 
ATOM   1483 C  CE  . MET B 2 81  ? 9.281   9.716   -8.589  1.00 47.45  ? 81  MET H CE  1 
ATOM   1484 N  N   . GLN B 2 82  ? 7.282   15.150  -8.629  1.00 46.77  ? 82  GLN H N   1 
ATOM   1485 C  CA  . GLN B 2 82  ? 7.054   15.595  -7.262  1.00 50.00  ? 82  GLN H CA  1 
ATOM   1486 C  C   . GLN B 2 82  ? 6.164   14.612  -6.487  1.00 49.80  ? 82  GLN H C   1 
ATOM   1487 O  O   . GLN B 2 82  ? 5.018   14.303  -6.906  1.00 48.76  ? 82  GLN H O   1 
ATOM   1488 C  CB  . GLN B 2 82  ? 6.441   16.977  -7.255  1.00 52.01  ? 82  GLN H CB  1 
ATOM   1489 C  CG  . GLN B 2 82  ? 6.115   17.469  -5.858  1.00 58.72  ? 82  GLN H CG  1 
ATOM   1490 C  CD  . GLN B 2 82  ? 5.771   18.942  -5.871  1.00 68.97  ? 82  GLN H CD  1 
ATOM   1491 O  OE1 . GLN B 2 82  ? 5.731   19.573  -6.943  1.00 72.17  ? 82  GLN H OE1 1 
ATOM   1492 N  NE2 . GLN B 2 82  ? 5.538   19.511  -4.689  1.00 69.07  ? 82  GLN H NE2 1 
ATOM   1493 N  N   . LEU B 2 83  ? 6.684   14.138  -5.359  1.00 46.58  ? 83  LEU H N   1 
ATOM   1494 C  CA  . LEU B 2 83  ? 5.899   13.288  -4.464  1.00 50.08  ? 83  LEU H CA  1 
ATOM   1495 C  C   . LEU B 2 83  ? 5.516   14.112  -3.241  1.00 54.59  ? 83  LEU H C   1 
ATOM   1496 O  O   . LEU B 2 83  ? 6.374   14.805  -2.635  1.00 50.64  ? 83  LEU H O   1 
ATOM   1497 C  CB  . LEU B 2 83  ? 6.694   12.056  -4.006  1.00 50.21  ? 83  LEU H CB  1 
ATOM   1498 C  CG  . LEU B 2 83  ? 7.136   10.964  -4.988  1.00 50.01  ? 83  LEU H CG  1 
ATOM   1499 C  CD1 . LEU B 2 83  ? 7.866   9.854   -4.228  1.00 38.17  ? 83  LEU H CD1 1 
ATOM   1500 C  CD2 . LEU B 2 83  ? 6.030   10.426  -5.920  1.00 45.43  ? 83  LEU H CD2 1 
ATOM   1501 N  N   . SER B 2 84  ? 4.239   14.026  -2.878  1.00 48.49  ? 84  SER H N   1 
ATOM   1502 C  CA  . SER B 2 84  ? 3.679   14.822  -1.791  1.00 50.53  ? 84  SER H CA  1 
ATOM   1503 C  C   . SER B 2 84  ? 3.187   13.971  -0.620  1.00 51.38  ? 84  SER H C   1 
ATOM   1504 O  O   . SER B 2 84  ? 2.963   12.758  -0.783  1.00 43.87  ? 84  SER H O   1 
ATOM   1505 C  CB  . SER B 2 84  ? 2.542   15.667  -2.285  1.00 48.87  ? 84  SER H CB  1 
ATOM   1506 O  OG  . SER B 2 84  ? 1.573   14.810  -2.860  1.00 62.33  ? 84  SER H OG  1 
ATOM   1507 N  N   . SER B 2 85  ? 3.022   14.624  0.545   1.00 55.02  ? 85  SER H N   1 
ATOM   1508 C  CA  . SER B 2 85  ? 2.531   13.987  1.763   1.00 45.09  ? 85  SER H CA  1 
ATOM   1509 C  C   . SER B 2 85  ? 3.313   12.750  2.051   1.00 54.05  ? 85  SER H C   1 
ATOM   1510 O  O   . SER B 2 85  ? 2.728   11.666  2.054   1.00 50.00  ? 85  SER H O   1 
ATOM   1511 C  CB  . SER B 2 85  ? 1.083   13.563  1.576   1.00 46.67  ? 85  SER H CB  1 
ATOM   1512 O  OG  . SER B 2 85  ? 0.244   14.665  1.273   1.00 55.17  ? 85  SER H OG  1 
ATOM   1513 N  N   . LEU B 2 86  ? 4.631   12.891  2.244   1.00 53.75  ? 86  LEU H N   1 
ATOM   1514 C  CA  . LEU B 2 86  ? 5.471   11.719  2.315   1.00 45.99  ? 86  LEU H CA  1 
ATOM   1515 C  C   . LEU B 2 86  ? 5.283   10.914  3.618   1.00 53.00  ? 86  LEU H C   1 
ATOM   1516 O  O   . LEU B 2 86  ? 5.125   11.477  4.723   1.00 50.55  ? 86  LEU H O   1 
ATOM   1517 C  CB  . LEU B 2 86  ? 6.910   12.170  2.170   1.00 52.59  ? 86  LEU H CB  1 
ATOM   1518 C  CG  . LEU B 2 86  ? 7.313   12.631  0.762   1.00 54.94  ? 86  LEU H CG  1 
ATOM   1519 C  CD1 . LEU B 2 86  ? 8.799   12.563  0.563   1.00 47.85  ? 86  LEU H CD1 1 
ATOM   1520 C  CD2 . LEU B 2 86  ? 6.626   11.784  -0.291  1.00 47.85  ? 86  LEU H CD2 1 
ATOM   1521 N  N   . THR B 2 87  ? 5.304   9.588   3.487   1.00 51.07  ? 87  THR H N   1 
ATOM   1522 C  CA  . THR B 2 87  ? 5.335   8.701   4.640   1.00 48.10  ? 87  THR H CA  1 
ATOM   1523 C  C   . THR B 2 87  ? 6.468   7.719   4.496   1.00 47.72  ? 87  THR H C   1 
ATOM   1524 O  O   . THR B 2 87  ? 7.057   7.637   3.421   1.00 47.13  ? 87  THR H O   1 
ATOM   1525 C  CB  . THR B 2 87  ? 4.011   7.935   4.794   1.00 49.41  ? 87  THR H CB  1 
ATOM   1526 O  OG1 . THR B 2 87  ? 3.900   6.963   3.746   1.00 45.31  ? 87  THR H OG1 1 
ATOM   1527 C  CG2 . THR B 2 87  ? 2.827   8.909   4.760   1.00 44.54  ? 87  THR H CG2 1 
ATOM   1528 N  N   . SER B 2 88  ? 6.661   6.857   5.498   1.00 51.13  ? 88  SER H N   1 
ATOM   1529 C  CA  . SER B 2 88  ? 7.716   5.841   5.418   1.00 47.23  ? 88  SER H CA  1 
ATOM   1530 C  C   . SER B 2 88  ? 7.491   4.885   4.238   1.00 48.14  ? 88  SER H C   1 
ATOM   1531 O  O   . SER B 2 88  ? 8.437   4.331   3.719   1.00 50.94  ? 88  SER H O   1 
ATOM   1532 C  CB  . SER B 2 88  ? 7.822   5.053   6.738   1.00 46.27  ? 88  SER H CB  1 
ATOM   1533 O  OG  . SER B 2 88  ? 6.595   4.477   7.157   1.00 50.31  ? 88  SER H OG  1 
ATOM   1534 N  N   . GLU B 2 89  ? 6.256   4.780   3.755   1.00 49.89  ? 89  GLU H N   1 
ATOM   1535 C  CA  . GLU B 2 89  ? 5.922   3.969   2.580   1.00 48.31  ? 89  GLU H CA  1 
ATOM   1536 C  C   . GLU B 2 89  ? 6.586   4.510   1.325   1.00 51.06  ? 89  GLU H C   1 
ATOM   1537 O  O   . GLU B 2 89  ? 6.771   3.768   0.342   1.00 49.30  ? 89  GLU H O   1 
ATOM   1538 C  CB  . GLU B 2 89  ? 4.394   3.982   2.368   1.00 57.90  ? 89  GLU H CB  1 
ATOM   1539 C  CG  . GLU B 2 89  ? 3.535   3.360   3.464   1.00 58.80  ? 89  GLU H CG  1 
ATOM   1540 C  CD  . GLU B 2 89  ? 3.521   1.853   3.358   1.00 61.34  ? 89  GLU H CD  1 
ATOM   1541 O  OE1 . GLU B 2 89  ? 2.672   1.364   2.577   1.00 62.01  ? 89  GLU H OE1 1 
ATOM   1542 O  OE2 . GLU B 2 89  ? 4.415   1.182   3.929   1.00 60.74  ? 89  GLU H OE2 1 
ATOM   1543 N  N   . ASP B 2 90  ? 6.963   5.794   1.370   1.00 47.55  ? 90  ASP H N   1 
ATOM   1544 C  CA  . ASP B 2 90  ? 7.569   6.435   0.216   1.00 45.14  ? 90  ASP H CA  1 
ATOM   1545 C  C   . ASP B 2 90  ? 9.106   6.320   0.222   1.00 48.83  ? 90  ASP H C   1 
ATOM   1546 O  O   . ASP B 2 90  ? 9.754   6.669   -0.766  1.00 48.13  ? 90  ASP H O   1 
ATOM   1547 C  CB  . ASP B 2 90  ? 7.163   7.930   0.135   1.00 43.23  ? 90  ASP H CB  1 
ATOM   1548 C  CG  . ASP B 2 90  ? 5.639   8.141   0.078   1.00 46.96  ? 90  ASP H CG  1 
ATOM   1549 O  OD1 . ASP B 2 90  ? 4.985   7.443   -0.717  1.00 50.51  ? 90  ASP H OD1 1 
ATOM   1550 O  OD2 . ASP B 2 90  ? 5.091   9.042   0.782   1.00 44.33  ? 90  ASP H OD2 1 
ATOM   1551 N  N   . SER B 2 91  ? 9.695   5.790   1.295   1.00 50.63  ? 91  SER H N   1 
ATOM   1552 C  CA  . SER B 2 91  ? 11.147  5.539   1.311   1.00 42.99  ? 91  SER H CA  1 
ATOM   1553 C  C   . SER B 2 91  ? 11.575  4.503   0.329   1.00 43.75  ? 91  SER H C   1 
ATOM   1554 O  O   . SER B 2 91  ? 11.211  3.337   0.460   1.00 54.01  ? 91  SER H O   1 
ATOM   1555 C  CB  . SER B 2 91  ? 11.584  5.128   2.682   1.00 39.36  ? 91  SER H CB  1 
ATOM   1556 O  OG  . SER B 2 91  ? 11.622  6.303   3.462   1.00 51.20  ? 91  SER H OG  1 
ATOM   1557 N  N   . ALA B 2 92  ? 12.333  4.925   -0.670  1.00 38.08  ? 92  ALA H N   1 
ATOM   1558 C  CA  . ALA B 2 92  ? 12.690  4.000   -1.742  1.00 39.45  ? 92  ALA H CA  1 
ATOM   1559 C  C   . ALA B 2 92  ? 13.668  4.682   -2.642  1.00 39.64  ? 92  ALA H C   1 
ATOM   1560 O  O   . ALA B 2 92  ? 13.877  5.884   -2.496  1.00 41.04  ? 92  ALA H O   1 
ATOM   1561 C  CB  . ALA B 2 92  ? 11.465  3.561   -2.533  1.00 45.44  ? 92  ALA H CB  1 
ATOM   1562 N  N   . VAL B 2 93  ? 14.194  3.942   -3.619  1.00 36.94  ? 93  VAL H N   1 
ATOM   1563 C  CA  . VAL B 2 93  ? 14.946  4.562   -4.703  1.00 38.39  ? 93  VAL H CA  1 
ATOM   1564 C  C   . VAL B 2 93  ? 14.001  4.822   -5.895  1.00 43.15  ? 93  VAL H C   1 
ATOM   1565 O  O   . VAL B 2 93  ? 13.198  3.961   -6.297  1.00 40.85  ? 93  VAL H O   1 
ATOM   1566 C  CB  . VAL B 2 93  ? 16.099  3.675   -5.140  1.00 37.71  ? 93  VAL H CB  1 
ATOM   1567 C  CG1 . VAL B 2 93  ? 16.709  4.148   -6.440  1.00 35.45  ? 93  VAL H CG1 1 
ATOM   1568 C  CG2 . VAL B 2 93  ? 17.104  3.528   -3.988  1.00 43.47  ? 93  VAL H CG2 1 
ATOM   1569 N  N   . TYR B 2 94  ? 14.092  6.026   -6.457  1.00 39.85  ? 94  TYR H N   1 
ATOM   1570 C  CA  . TYR B 2 94  ? 13.261  6.363   -7.613  1.00 44.23  ? 94  TYR H CA  1 
ATOM   1571 C  C   . TYR B 2 94  ? 14.201  6.540   -8.790  1.00 42.44  ? 94  TYR H C   1 
ATOM   1572 O  O   . TYR B 2 94  ? 15.049  7.442   -8.822  1.00 43.69  ? 94  TYR H O   1 
ATOM   1573 C  CB  . TYR B 2 94  ? 12.417  7.628   -7.347  1.00 45.50  ? 94  TYR H CB  1 
ATOM   1574 C  CG  . TYR B 2 94  ? 11.432  7.425   -6.217  1.00 42.55  ? 94  TYR H CG  1 
ATOM   1575 C  CD1 . TYR B 2 94  ? 11.828  7.660   -4.880  1.00 40.62  ? 94  TYR H CD1 1 
ATOM   1576 C  CD2 . TYR B 2 94  ? 10.133  6.971   -6.464  1.00 40.71  ? 94  TYR H CD2 1 
ATOM   1577 C  CE1 . TYR B 2 94  ? 10.966  7.450   -3.831  1.00 42.31  ? 94  TYR H CE1 1 
ATOM   1578 C  CE2 . TYR B 2 94  ? 9.228   6.756   -5.408  1.00 40.99  ? 94  TYR H CE2 1 
ATOM   1579 C  CZ  . TYR B 2 94  ? 9.660   7.005   -4.089  1.00 44.58  ? 94  TYR H CZ  1 
ATOM   1580 O  OH  . TYR B 2 94  ? 8.815   6.809   -3.034  1.00 40.37  ? 94  TYR H OH  1 
ATOM   1581 N  N   . PHE B 2 95  ? 14.014  5.687   -9.779  1.00 42.24  ? 95  PHE H N   1 
ATOM   1582 C  CA  . PHE B 2 95  ? 14.792  5.775   -11.002 1.00 47.44  ? 95  PHE H CA  1 
ATOM   1583 C  C   . PHE B 2 95  ? 13.993  6.535   -12.048 1.00 45.23  ? 95  PHE H C   1 
ATOM   1584 O  O   . PHE B 2 95  ? 12.774  6.472   -12.087 1.00 44.78  ? 95  PHE H O   1 
ATOM   1585 C  CB  . PHE B 2 95  ? 15.139  4.388   -11.573 1.00 44.01  ? 95  PHE H CB  1 
ATOM   1586 C  CG  . PHE B 2 95  ? 15.875  3.484   -10.627 1.00 47.59  ? 95  PHE H CG  1 
ATOM   1587 C  CD1 . PHE B 2 95  ? 17.261  3.579   -10.489 1.00 45.07  ? 95  PHE H CD1 1 
ATOM   1588 C  CD2 . PHE B 2 95  ? 15.194  2.492   -9.918  1.00 43.63  ? 95  PHE H CD2 1 
ATOM   1589 C  CE1 . PHE B 2 95  ? 17.950  2.731   -9.627  1.00 41.48  ? 95  PHE H CE1 1 
ATOM   1590 C  CE2 . PHE B 2 95  ? 15.880  1.630   -9.068  1.00 39.15  ? 95  PHE H CE2 1 
ATOM   1591 C  CZ  . PHE B 2 95  ? 17.262  1.756   -8.922  1.00 40.49  ? 95  PHE H CZ  1 
ATOM   1592 N  N   . CYS B 2 96  ? 14.683  7.348   -12.828 1.00 48.35  ? 96  CYS H N   1 
ATOM   1593 C  CA  . CYS B 2 96  ? 14.122  7.795   -14.082 1.00 45.90  ? 96  CYS H CA  1 
ATOM   1594 C  C   . CYS B 2 96  ? 14.771  6.998   -15.195 1.00 44.41  ? 96  CYS H C   1 
ATOM   1595 O  O   . CYS B 2 96  ? 15.872  6.461   -15.016 1.00 41.00  ? 96  CYS H O   1 
ATOM   1596 C  CB  . CYS B 2 96  ? 14.325  9.293   -14.263 1.00 46.01  ? 96  CYS H CB  1 
ATOM   1597 S  SG  . CYS B 2 96  ? 16.048  9.728   -14.461 1.00 57.40  ? 96  CYS H SG  1 
ATOM   1598 N  N   . SER B 2 97  ? 14.070  6.887   -16.326 1.00 42.93  ? 97  SER H N   1 
ATOM   1599 C  CA  . SER B 2 97  ? 14.576  6.101   -17.452 1.00 43.66  ? 97  SER H CA  1 
ATOM   1600 C  C   . SER B 2 97  ? 14.014  6.642   -18.729 1.00 40.55  ? 97  SER H C   1 
ATOM   1601 O  O   . SER B 2 97  ? 13.070  7.406   -18.726 1.00 40.25  ? 97  SER H O   1 
ATOM   1602 C  CB  . SER B 2 97  ? 14.244  4.629   -17.358 1.00 39.94  ? 97  SER H CB  1 
ATOM   1603 O  OG  . SER B 2 97  ? 12.885  4.467   -17.547 1.00 43.51  ? 97  SER H OG  1 
ATOM   1604 N  N   . ARG B 2 98  ? 14.665  6.309   -19.830 1.00 42.56  ? 98  ARG H N   1 
ATOM   1605 C  CA  . ARG B 2 98  ? 14.252  6.826   -21.101 1.00 43.17  ? 98  ARG H CA  1 
ATOM   1606 C  C   . ARG B 2 98  ? 14.068  5.709   -22.108 1.00 47.62  ? 98  ARG H C   1 
ATOM   1607 O  O   . ARG B 2 98  ? 14.995  4.861   -22.300 1.00 47.49  ? 98  ARG H O   1 
ATOM   1608 C  CB  . ARG B 2 98  ? 15.285  7.817   -21.621 1.00 39.65  ? 98  ARG H CB  1 
ATOM   1609 C  CG  . ARG B 2 98  ? 14.757  8.587   -22.775 1.00 45.53  ? 98  ARG H CG  1 
ATOM   1610 C  CD  . ARG B 2 98  ? 15.827  8.918   -23.762 1.00 44.93  ? 98  ARG H CD  1 
ATOM   1611 N  NE  . ARG B 2 98  ? 16.067  7.736   -24.587 1.00 44.93  ? 98  ARG H NE  1 
ATOM   1612 C  CZ  . ARG B 2 98  ? 16.887  7.731   -25.625 1.00 42.09  ? 98  ARG H CZ  1 
ATOM   1613 N  NH1 . ARG B 2 98  ? 17.073  6.628   -26.340 1.00 36.96  ? 98  ARG H NH1 1 
ATOM   1614 N  NH2 . ARG B 2 98  ? 17.536  8.841   -25.912 1.00 45.00  ? 98  ARG H NH2 1 
ATOM   1615 N  N   . SER B 2 99  ? 12.913  5.733   -22.793 1.00 39.77  ? 99  SER H N   1 
ATOM   1616 C  CA  . SER B 2 99  ? 12.689  4.714   -23.807 1.00 45.47  ? 99  SER H CA  1 
ATOM   1617 C  C   . SER B 2 99  ? 13.235  5.161   -25.192 1.00 44.10  ? 99  SER H C   1 
ATOM   1618 O  O   . SER B 2 99  ? 13.862  6.216   -25.324 1.00 39.71  ? 99  SER H O   1 
ATOM   1619 C  CB  . SER B 2 99  ? 11.203  4.333   -23.879 1.00 39.24  ? 99  SER H CB  1 
ATOM   1620 O  OG  . SER B 2 99  ? 10.382  5.466   -23.934 1.00 38.23  ? 99  SER H OG  1 
ATOM   1621 N  N   . GLY B 2 100 ? 12.896  4.395   -26.221 1.00 41.90  ? 100 GLY H N   1 
ATOM   1622 C  CA  . GLY B 2 100 ? 13.375  4.642   -27.563 1.00 47.67  ? 100 GLY H CA  1 
ATOM   1623 C  C   . GLY B 2 100 ? 12.403  5.551   -28.322 1.00 48.91  ? 100 GLY H C   1 
ATOM   1624 O  O   . GLY B 2 100 ? 11.437  6.081   -27.740 1.00 35.76  ? 100 GLY H O   1 
ATOM   1625 N  N   . TYR B 2 101 ? 12.592  5.657   -29.642 1.00 51.45  ? 101 TYR H N   1 
ATOM   1626 C  CA  . TYR B 2 101 ? 11.728  6.551   -30.403 1.00 49.61  ? 101 TYR H CA  1 
ATOM   1627 C  C   . TYR B 2 101 ? 10.555  5.783   -30.935 1.00 48.52  ? 101 TYR H C   1 
ATOM   1628 O  O   . TYR B 2 101 ? 10.651  5.030   -31.908 1.00 52.54  ? 101 TYR H O   1 
ATOM   1629 C  CB  . TYR B 2 101 ? 12.497  7.204   -31.565 1.00 46.39  ? 101 TYR H CB  1 
ATOM   1630 C  CG  . TYR B 2 101 ? 11.702  8.318   -32.195 1.00 46.25  ? 101 TYR H CG  1 
ATOM   1631 C  CD1 . TYR B 2 101 ? 11.631  9.572   -31.586 1.00 45.25  ? 101 TYR H CD1 1 
ATOM   1632 C  CD2 . TYR B 2 101 ? 11.001  8.117   -33.359 1.00 44.26  ? 101 TYR H CD2 1 
ATOM   1633 C  CE1 . TYR B 2 101 ? 10.895  10.598  -32.134 1.00 45.38  ? 101 TYR H CE1 1 
ATOM   1634 C  CE2 . TYR B 2 101 ? 10.239  9.137   -33.918 1.00 44.91  ? 101 TYR H CE2 1 
ATOM   1635 C  CZ  . TYR B 2 101 ? 10.183  10.372  -33.303 1.00 44.74  ? 101 TYR H CZ  1 
ATOM   1636 O  OH  . TYR B 2 101 ? 9.428   11.379  -33.856 1.00 33.92  ? 101 TYR H OH  1 
ATOM   1637 N  N   . GLY B 2 102 ? 9.441   5.947   -30.233 1.00 43.87  ? 102 GLY H N   1 
ATOM   1638 C  CA  . GLY B 2 102 ? 8.244   5.230   -30.585 1.00 45.03  ? 102 GLY H CA  1 
ATOM   1639 C  C   . GLY B 2 102 ? 8.405   3.776   -30.190 1.00 41.32  ? 102 GLY H C   1 
ATOM   1640 O  O   . GLY B 2 102 ? 7.660   2.917   -30.623 1.00 47.37  ? 102 GLY H O   1 
ATOM   1641 N  N   . TYR B 2 103 ? 9.423   3.486   -29.406 1.00 48.07  ? 103 TYR H N   1 
ATOM   1642 C  CA  . TYR B 2 103 ? 9.591   2.144   -28.876 1.00 49.13  ? 103 TYR H CA  1 
ATOM   1643 C  C   . TYR B 2 103 ? 9.845   2.340   -27.357 1.00 49.03  ? 103 TYR H C   1 
ATOM   1644 O  O   . TYR B 2 103 ? 10.463  3.348   -26.931 1.00 40.65  ? 103 TYR H O   1 
ATOM   1645 C  CB  . TYR B 2 103 ? 10.727  1.426   -29.598 1.00 48.69  ? 103 TYR H CB  1 
ATOM   1646 C  CG  . TYR B 2 103 ? 10.418  1.121   -31.067 1.00 57.26  ? 103 TYR H CG  1 
ATOM   1647 C  CD1 . TYR B 2 103 ? 9.672   -0.002  -31.428 1.00 55.65  ? 103 TYR H CD1 1 
ATOM   1648 C  CD2 . TYR B 2 103 ? 10.877  1.956   -32.096 1.00 58.42  ? 103 TYR H CD2 1 
ATOM   1649 C  CE1 . TYR B 2 103 ? 9.388   -0.293  -32.761 1.00 56.09  ? 103 TYR H CE1 1 
ATOM   1650 C  CE2 . TYR B 2 103 ? 10.596  1.667   -33.444 1.00 59.98  ? 103 TYR H CE2 1 
ATOM   1651 C  CZ  . TYR B 2 103 ? 9.853   0.537   -33.761 1.00 61.70  ? 103 TYR H CZ  1 
ATOM   1652 O  OH  . TYR B 2 103 ? 9.562   0.220   -35.071 1.00 64.91  ? 103 TYR H OH  1 
ATOM   1653 N  N   . TYR B 2 104 ? 9.355   1.382   -26.564 1.00 47.40  ? 104 TYR H N   1 
ATOM   1654 C  CA  . TYR B 2 104 ? 9.216   1.585   -25.118 1.00 44.97  ? 104 TYR H CA  1 
ATOM   1655 C  C   . TYR B 2 104 ? 9.962   0.596   -24.200 1.00 47.35  ? 104 TYR H C   1 
ATOM   1656 O  O   . TYR B 2 104 ? 9.497   0.326   -23.075 1.00 46.20  ? 104 TYR H O   1 
ATOM   1657 C  CB  . TYR B 2 104 ? 7.729   1.620   -24.802 1.00 45.49  ? 104 TYR H CB  1 
ATOM   1658 C  CG  . TYR B 2 104 ? 7.098   2.718   -25.640 1.00 47.18  ? 104 TYR H CG  1 
ATOM   1659 C  CD1 . TYR B 2 104 ? 7.314   4.056   -25.366 1.00 42.19  ? 104 TYR H CD1 1 
ATOM   1660 C  CD2 . TYR B 2 104 ? 6.374   2.392   -26.791 1.00 44.06  ? 104 TYR H CD2 1 
ATOM   1661 C  CE1 . TYR B 2 104 ? 6.796   5.038   -26.176 1.00 42.94  ? 104 TYR H CE1 1 
ATOM   1662 C  CE2 . TYR B 2 104 ? 5.822   3.372   -27.586 1.00 44.32  ? 104 TYR H CE2 1 
ATOM   1663 C  CZ  . TYR B 2 104 ? 6.037   4.691   -27.276 1.00 44.57  ? 104 TYR H CZ  1 
ATOM   1664 O  OH  . TYR B 2 104 ? 5.503   5.666   -28.082 1.00 47.52  ? 104 TYR H OH  1 
ATOM   1665 N  N   . ALA B 2 105 ? 11.074  0.030   -24.669 1.00 42.26  ? 105 ALA H N   1 
ATOM   1666 C  CA  . ALA B 2 105 ? 12.020  -0.571  -23.718 1.00 48.09  ? 105 ALA H CA  1 
ATOM   1667 C  C   . ALA B 2 105 ? 12.719  0.576   -23.023 1.00 44.19  ? 105 ALA H C   1 
ATOM   1668 O  O   . ALA B 2 105 ? 12.928  1.633   -23.620 1.00 43.87  ? 105 ALA H O   1 
ATOM   1669 C  CB  . ALA B 2 105 ? 13.025  -1.515  -24.390 1.00 41.11  ? 105 ALA H CB  1 
ATOM   1670 N  N   . MET B 2 106 ? 12.997  0.415   -21.734 1.00 41.93  ? 106 MET H N   1 
ATOM   1671 C  CA  . MET B 2 106 ? 13.697  1.480   -21.046 1.00 45.87  ? 106 MET H CA  1 
ATOM   1672 C  C   . MET B 2 106 ? 15.189  1.296   -21.271 1.00 46.10  ? 106 MET H C   1 
ATOM   1673 O  O   . MET B 2 106 ? 15.827  0.468   -20.634 1.00 47.72  ? 106 MET H O   1 
ATOM   1674 C  CB  . MET B 2 106 ? 13.310  1.469   -19.574 1.00 46.64  ? 106 MET H CB  1 
ATOM   1675 C  CG  . MET B 2 106 ? 11.794  1.700   -19.359 1.00 40.09  ? 106 MET H CG  1 
ATOM   1676 S  SD  . MET B 2 106 ? 11.249  1.558   -17.647 1.00 43.84  ? 106 MET H SD  1 
ATOM   1677 C  CE  . MET B 2 106 ? 9.502   1.905   -17.770 1.00 47.79  ? 106 MET H CE  1 
ATOM   1678 N  N   . GLU B 2 107 ? 15.688  2.081   -22.232 1.00 45.70  ? 107 GLU H N   1 
ATOM   1679 C  CA  . GLU B 2 107 ? 17.031  2.005   -22.830 1.00 47.60  ? 107 GLU H CA  1 
ATOM   1680 C  C   . GLU B 2 107 ? 18.090  2.644   -21.933 1.00 50.40  ? 107 GLU H C   1 
ATOM   1681 O  O   . GLU B 2 107 ? 19.196  2.110   -21.737 1.00 47.05  ? 107 GLU H O   1 
ATOM   1682 C  CB  . GLU B 2 107 ? 17.016  2.703   -24.199 1.00 44.42  ? 107 GLU H CB  1 
ATOM   1683 C  CG  . GLU B 2 107 ? 16.143  2.019   -25.244 1.00 45.66  ? 107 GLU H CG  1 
ATOM   1684 C  CD  . GLU B 2 107 ? 16.198  2.678   -26.626 1.00 45.03  ? 107 GLU H CD  1 
ATOM   1685 O  OE1 . GLU B 2 107 ? 16.628  3.850   -26.751 1.00 38.75  ? 107 GLU H OE1 1 
ATOM   1686 O  OE2 . GLU B 2 107 ? 15.786  2.007   -27.589 1.00 53.23  ? 107 GLU H OE2 1 
ATOM   1687 N  N   . TYR B 2 108 ? 17.710  3.768   -21.330 1.00 45.04  ? 108 TYR H N   1 
ATOM   1688 C  CA  . TYR B 2 108 ? 18.654  4.455   -20.471 1.00 48.00  ? 108 TYR H CA  1 
ATOM   1689 C  C   . TYR B 2 108 ? 18.108  4.670   -19.077 1.00 49.64  ? 108 TYR H C   1 
ATOM   1690 O  O   . TYR B 2 108 ? 16.954  4.964   -18.900 1.00 48.17  ? 108 TYR H O   1 
ATOM   1691 C  CB  . TYR B 2 108 ? 19.067  5.780   -21.122 1.00 47.80  ? 108 TYR H CB  1 
ATOM   1692 C  CG  . TYR B 2 108 ? 19.844  5.604   -22.411 1.00 51.40  ? 108 TYR H CG  1 
ATOM   1693 C  CD1 . TYR B 2 108 ? 21.205  5.287   -22.359 1.00 48.76  ? 108 TYR H CD1 1 
ATOM   1694 C  CD2 . TYR B 2 108 ? 19.238  5.718   -23.668 1.00 42.52  ? 108 TYR H CD2 1 
ATOM   1695 C  CE1 . TYR B 2 108 ? 21.950  5.108   -23.501 1.00 48.31  ? 108 TYR H CE1 1 
ATOM   1696 C  CE2 . TYR B 2 108 ? 19.977  5.543   -24.821 1.00 43.24  ? 108 TYR H CE2 1 
ATOM   1697 C  CZ  . TYR B 2 108 ? 21.348  5.237   -24.732 1.00 52.60  ? 108 TYR H CZ  1 
ATOM   1698 O  OH  . TYR B 2 108 ? 22.139  5.055   -25.852 1.00 49.38  ? 108 TYR H OH  1 
ATOM   1699 N  N   . TRP B 2 109 ? 18.970  4.505   -18.081 1.00 49.03  ? 109 TRP H N   1 
ATOM   1700 C  CA  . TRP B 2 109 ? 18.544  4.623   -16.689 1.00 49.90  ? 109 TRP H CA  1 
ATOM   1701 C  C   . TRP B 2 109 ? 19.356  5.640   -15.901 1.00 47.32  ? 109 TRP H C   1 
ATOM   1702 O  O   . TRP B 2 109 ? 20.583  5.710   -16.020 1.00 51.32  ? 109 TRP H O   1 
ATOM   1703 C  CB  . TRP B 2 109 ? 18.606  3.252   -16.038 1.00 52.07  ? 109 TRP H CB  1 
ATOM   1704 C  CG  . TRP B 2 109 ? 17.575  2.309   -16.572 1.00 47.71  ? 109 TRP H CG  1 
ATOM   1705 C  CD1 . TRP B 2 109 ? 17.574  1.687   -17.791 1.00 43.94  ? 109 TRP H CD1 1 
ATOM   1706 C  CD2 . TRP B 2 109 ? 16.434  1.820   -15.870 1.00 49.20  ? 109 TRP H CD2 1 
ATOM   1707 N  NE1 . TRP B 2 109 ? 16.485  0.858   -17.901 1.00 45.91  ? 109 TRP H NE1 1 
ATOM   1708 C  CE2 . TRP B 2 109 ? 15.767  0.922   -16.730 1.00 52.24  ? 109 TRP H CE2 1 
ATOM   1709 C  CE3 . TRP B 2 109 ? 15.901  2.064   -14.606 1.00 48.14  ? 109 TRP H CE3 1 
ATOM   1710 C  CZ2 . TRP B 2 109 ? 14.588  0.270   -16.355 1.00 51.06  ? 109 TRP H CZ2 1 
ATOM   1711 C  CZ3 . TRP B 2 109 ? 14.739  1.409   -14.242 1.00 49.07  ? 109 TRP H CZ3 1 
ATOM   1712 C  CH2 . TRP B 2 109 ? 14.093  0.536   -15.111 1.00 48.46  ? 109 TRP H CH2 1 
ATOM   1713 N  N   . GLY B 2 110 ? 18.667  6.420   -15.084 1.00 45.79  ? 110 GLY H N   1 
ATOM   1714 C  CA  . GLY B 2 110 ? 19.344  7.252   -14.127 1.00 48.18  ? 110 GLY H CA  1 
ATOM   1715 C  C   . GLY B 2 110 ? 19.980  6.422   -13.047 1.00 47.64  ? 110 GLY H C   1 
ATOM   1716 O  O   . GLY B 2 110 ? 19.771  5.218   -12.972 1.00 43.70  ? 110 GLY H O   1 
ATOM   1717 N  N   . GLN B 2 111 ? 20.785  7.044   -12.220 1.00 46.29  ? 111 GLN H N   1 
ATOM   1718 C  CA  . GLN B 2 111 ? 21.429  6.267   -11.208 1.00 49.93  ? 111 GLN H CA  1 
ATOM   1719 C  C   . GLN B 2 111 ? 20.486  6.048   -10.008 1.00 51.44  ? 111 GLN H C   1 
ATOM   1720 O  O   . GLN B 2 111 ? 20.789  5.263   -9.110  1.00 55.88  ? 111 GLN H O   1 
ATOM   1721 C  CB  . GLN B 2 111 ? 22.767  6.952   -10.862 1.00 57.15  ? 111 GLN H CB  1 
ATOM   1722 C  CG  . GLN B 2 111 ? 23.348  7.794   -12.094 1.00 58.28  ? 111 GLN H CG  1 
ATOM   1723 C  CD  . GLN B 2 111 ? 24.357  8.912   -11.700 1.00 67.69  ? 111 GLN H CD  1 
ATOM   1724 O  OE1 . GLN B 2 111 ? 25.328  8.672   -10.945 1.00 72.14  ? 111 GLN H OE1 1 
ATOM   1725 N  NE2 . GLN B 2 111 ? 24.046  10.145  -12.106 1.00 62.17  ? 111 GLN H NE2 1 
ATOM   1726 N  N   . GLY B 2 112 ? 19.342  6.732   -10.010 1.00 49.04  ? 112 GLY H N   1 
ATOM   1727 C  CA  . GLY B 2 112 ? 18.330  6.579   -8.963  1.00 47.91  ? 112 GLY H CA  1 
ATOM   1728 C  C   . GLY B 2 112 ? 18.531  7.564   -7.812  1.00 48.20  ? 112 GLY H C   1 
ATOM   1729 O  O   . GLY B 2 112 ? 19.654  7.775   -7.368  1.00 53.84  ? 112 GLY H O   1 
ATOM   1730 N  N   . THR B 2 113 ? 17.447  8.132   -7.300  1.00 44.84  ? 113 THR H N   1 
ATOM   1731 C  CA  . THR B 2 113 ? 17.497  8.998   -6.147  1.00 44.45  ? 113 THR H CA  1 
ATOM   1732 C  C   . THR B 2 113 ? 16.963  8.256   -4.940  1.00 44.11  ? 113 THR H C   1 
ATOM   1733 O  O   . THR B 2 113 ? 15.839  7.778   -4.934  1.00 43.70  ? 113 THR H O   1 
ATOM   1734 C  CB  . THR B 2 113 ? 16.706  10.266  -6.407  1.00 50.22  ? 113 THR H CB  1 
ATOM   1735 O  OG1 . THR B 2 113 ? 17.364  11.008  -7.449  1.00 52.22  ? 113 THR H OG1 1 
ATOM   1736 C  CG2 . THR B 2 113 ? 16.582  11.102  -5.148  1.00 43.23  ? 113 THR H CG2 1 
ATOM   1737 N  N   . SER B 2 114 ? 17.817  8.091   -3.951  1.00 48.76  ? 114 SER H N   1 
ATOM   1738 C  CA  . SER B 2 114 ? 17.431  7.409   -2.750  1.00 46.17  ? 114 SER H CA  1 
ATOM   1739 C  C   . SER B 2 114 ? 16.757  8.343   -1.775  1.00 48.91  ? 114 SER H C   1 
ATOM   1740 O  O   . SER B 2 114 ? 17.416  9.227   -1.210  1.00 49.00  ? 114 SER H O   1 
ATOM   1741 C  CB  . SER B 2 114 ? 18.650  6.786   -2.100  1.00 48.24  ? 114 SER H CB  1 
ATOM   1742 O  OG  . SER B 2 114 ? 18.261  6.037   -0.958  1.00 57.79  ? 114 SER H OG  1 
ATOM   1743 N  N   . VAL B 2 115 ? 15.461  8.115   -1.561  1.00 42.80  ? 115 VAL H N   1 
ATOM   1744 C  CA  . VAL B 2 115 ? 14.654  8.935   -0.664  1.00 46.79  ? 115 VAL H CA  1 
ATOM   1745 C  C   . VAL B 2 115 ? 14.438  8.256   0.687   1.00 45.16  ? 115 VAL H C   1 
ATOM   1746 O  O   . VAL B 2 115 ? 14.039  7.081   0.774   1.00 47.17  ? 115 VAL H O   1 
ATOM   1747 C  CB  . VAL B 2 115 ? 13.285  9.286   -1.260  1.00 46.73  ? 115 VAL H CB  1 
ATOM   1748 C  CG1 . VAL B 2 115 ? 12.393  9.974   -0.224  1.00 40.17  ? 115 VAL H CG1 1 
ATOM   1749 C  CG2 . VAL B 2 115 ? 13.469  10.112  -2.511  1.00 48.51  ? 115 VAL H CG2 1 
ATOM   1750 N  N   . THR B 2 116 ? 14.772  9.017   1.724   1.00 46.19  ? 116 THR H N   1 
ATOM   1751 C  CA  . THR B 2 116 ? 14.559  8.656   3.119   1.00 51.74  ? 116 THR H CA  1 
ATOM   1752 C  C   . THR B 2 116 ? 13.561  9.561   3.821   1.00 46.42  ? 116 THR H C   1 
ATOM   1753 O  O   . THR B 2 116 ? 13.807  10.772  3.951   1.00 47.91  ? 116 THR H O   1 
ATOM   1754 C  CB  . THR B 2 116 ? 15.924  8.686   3.901   1.00 48.09  ? 116 THR H CB  1 
ATOM   1755 O  OG1 . THR B 2 116 ? 16.787  7.664   3.376   1.00 45.79  ? 116 THR H OG1 1 
ATOM   1756 C  CG2 . THR B 2 116 ? 15.715  8.394   5.348   1.00 47.79  ? 116 THR H CG2 1 
ATOM   1757 N  N   . VAL B 2 117 ? 12.470  8.981   4.311   1.00 40.93  ? 117 VAL H N   1 
ATOM   1758 C  CA  . VAL B 2 117 ? 11.465  9.767   5.036   1.00 47.24  ? 117 VAL H CA  1 
ATOM   1759 C  C   . VAL B 2 117 ? 11.639  9.585   6.546   1.00 50.79  ? 117 VAL H C   1 
ATOM   1760 O  O   . VAL B 2 117 ? 11.417  8.485   7.095   1.00 48.78  ? 117 VAL H O   1 
ATOM   1761 C  CB  . VAL B 2 117 ? 10.013  9.361   4.623   1.00 48.16  ? 117 VAL H CB  1 
ATOM   1762 C  CG1 . VAL B 2 117 ? 8.947   10.205  5.337   1.00 44.89  ? 117 VAL H CG1 1 
ATOM   1763 C  CG2 . VAL B 2 117 ? 9.852   9.483   3.115   1.00 50.34  ? 117 VAL H CG2 1 
ATOM   1764 N  N   . SER B 2 118 ? 12.022  10.664  7.228   1.00 53.38  ? 118 SER H N   1 
ATOM   1765 C  CA  . SER B 2 118 ? 12.324  10.543  8.651   1.00 60.13  ? 118 SER H CA  1 
ATOM   1766 C  C   . SER B 2 118 ? 12.255  11.889  9.378   1.00 67.94  ? 118 SER H C   1 
ATOM   1767 O  O   . SER B 2 118 ? 12.638  12.938  8.824   1.00 66.15  ? 118 SER H O   1 
ATOM   1768 C  CB  . SER B 2 118 ? 13.693  9.900   8.840   1.00 58.14  ? 118 SER H CB  1 
ATOM   1769 O  OG  . SER B 2 118 ? 14.062  9.907   10.197  1.00 69.32  ? 118 SER H OG  1 
ATOM   1770 N  N   . SER B 2 119 ? 11.847  11.819  10.651  1.00 72.64  ? 119 SER H N   1 
ATOM   1771 C  CA  . SER B 2 119 ? 11.834  12.966  11.556  1.00 74.13  ? 119 SER H CA  1 
ATOM   1772 C  C   . SER B 2 119 ? 13.052  13.061  12.453  1.00 73.25  ? 119 SER H C   1 
ATOM   1773 O  O   . SER B 2 119 ? 13.159  13.980  13.253  1.00 77.35  ? 119 SER H O   1 
ATOM   1774 C  CB  . SER B 2 119 ? 10.593  12.901  12.435  1.00 65.75  ? 119 SER H CB  1 
ATOM   1775 O  OG  . SER B 2 119 ? 9.461   13.293  11.705  1.00 71.11  ? 119 SER H OG  1 
ATOM   1776 N  N   . ALA B 2 120 ? 13.963  12.112  12.310  1.00 74.46  ? 120 ALA H N   1 
ATOM   1777 C  CA  . ALA B 2 120 ? 15.169  12.051  13.114  1.00 76.89  ? 120 ALA H CA  1 
ATOM   1778 C  C   . ALA B 2 120 ? 16.028  13.271  12.827  1.00 76.44  ? 120 ALA H C   1 
ATOM   1779 O  O   . ALA B 2 120 ? 16.034  13.784  11.702  1.00 76.33  ? 120 ALA H O   1 
ATOM   1780 C  CB  . ALA B 2 120 ? 15.932  10.762  12.826  1.00 74.16  ? 120 ALA H CB  1 
ATOM   1781 N  N   . LYS B 2 121 ? 16.760  13.770  13.823  1.00 80.72  ? 121 LYS H N   1 
ATOM   1782 C  CA  . LYS B 2 121 ? 17.697  14.853  13.525  1.00 87.01  ? 121 LYS H CA  1 
ATOM   1783 C  C   . LYS B 2 121 ? 19.048  14.227  13.327  1.00 81.36  ? 121 LYS H C   1 
ATOM   1784 O  O   . LYS B 2 121 ? 19.206  13.055  13.695  1.00 80.75  ? 121 LYS H O   1 
ATOM   1785 C  CB  . LYS B 2 121 ? 17.684  15.954  14.605  1.00 82.93  ? 121 LYS H CB  1 
ATOM   1786 C  CG  . LYS B 2 121 ? 16.252  16.479  14.707  1.00 88.48  ? 121 LYS H CG  1 
ATOM   1787 C  CD  . LYS B 2 121 ? 16.047  17.716  15.515  1.00 83.77  ? 121 LYS H CD  1 
ATOM   1788 C  CE  . LYS B 2 121 ? 16.912  18.788  14.854  1.00 79.67  ? 121 LYS H CE  1 
ATOM   1789 N  NZ  . LYS B 2 121 ? 16.011  19.966  14.632  1.00 85.12  ? 121 LYS H NZ  1 
ATOM   1790 N  N   . THR B 2 122 ? 19.998  14.942  12.716  1.00 78.28  ? 122 THR H N   1 
ATOM   1791 C  CA  . THR B 2 122 ? 21.327  14.369  12.534  1.00 84.46  ? 122 THR H CA  1 
ATOM   1792 C  C   . THR B 2 122 ? 21.802  13.945  13.931  1.00 89.58  ? 122 THR H C   1 
ATOM   1793 O  O   . THR B 2 122 ? 22.007  14.762  14.843  1.00 87.51  ? 122 THR H O   1 
ATOM   1794 C  CB  . THR B 2 122 ? 22.316  15.373  11.940  1.00 88.76  ? 122 THR H CB  1 
ATOM   1795 O  OG1 . THR B 2 122 ? 21.770  15.980  10.761  1.00 90.83  ? 122 THR H OG1 1 
ATOM   1796 C  CG2 . THR B 2 122 ? 23.619  14.680  11.602  1.00 92.51  ? 122 THR H CG2 1 
ATOM   1797 N  N   . THR B 2 123 ? 22.132  12.671  14.034  1.00 85.11  ? 123 THR H N   1 
ATOM   1798 C  CA  . THR B 2 123 ? 22.456  12.097  15.321  1.00 86.41  ? 123 THR H CA  1 
ATOM   1799 C  C   . THR B 2 123 ? 23.692  11.281  15.256  1.00 94.28  ? 123 THR H C   1 
ATOM   1800 O  O   . THR B 2 123 ? 23.739  10.280  14.520  1.00 89.38  ? 123 THR H O   1 
ATOM   1801 C  CB  . THR B 2 123 ? 21.319  11.161  15.818  1.00 87.39  ? 123 THR H CB  1 
ATOM   1802 O  OG1 . THR B 2 123 ? 20.069  11.860  15.852  1.00 94.97  ? 123 THR H OG1 1 
ATOM   1803 C  CG2 . THR B 2 123 ? 21.638  10.597  17.199  1.00 84.35  ? 123 THR H CG2 1 
ATOM   1804 N  N   . PRO B 2 124 ? 24.694  11.679  16.059  1.00 97.86  ? 124 PRO H N   1 
ATOM   1805 C  CA  . PRO B 2 124 ? 25.934  10.909  16.012  1.00 94.96  ? 124 PRO H CA  1 
ATOM   1806 C  C   . PRO B 2 124 ? 25.643  9.545   16.605  1.00 89.97  ? 124 PRO H C   1 
ATOM   1807 O  O   . PRO B 2 124 ? 24.742  9.415   17.428  1.00 92.20  ? 124 PRO H O   1 
ATOM   1808 C  CB  . PRO B 2 124 ? 26.897  11.728  16.886  1.00 96.53  ? 124 PRO H CB  1 
ATOM   1809 C  CG  . PRO B 2 124 ? 26.227  13.095  17.067  1.00 97.09  ? 124 PRO H CG  1 
ATOM   1810 C  CD  . PRO B 2 124 ? 24.755  12.824  16.986  1.00 90.40  ? 124 PRO H CD  1 
ATOM   1811 N  N   . PRO B 2 125 ? 26.371  8.534   16.163  1.00 92.86  ? 125 PRO H N   1 
ATOM   1812 C  CA  . PRO B 2 125 ? 26.087  7.208   16.694  1.00 95.41  ? 125 PRO H CA  1 
ATOM   1813 C  C   . PRO B 2 125 ? 26.672  7.071   18.061  1.00 98.97  ? 125 PRO H C   1 
ATOM   1814 O  O   . PRO B 2 125 ? 27.703  7.692   18.321  1.00 100.03 ? 125 PRO H O   1 
ATOM   1815 C  CB  . PRO B 2 125 ? 26.790  6.279   15.706  1.00 97.97  ? 125 PRO H CB  1 
ATOM   1816 C  CG  . PRO B 2 125 ? 27.938  7.087   15.204  1.00 99.18  ? 125 PRO H CG  1 
ATOM   1817 C  CD  . PRO B 2 125 ? 27.442  8.518   15.150  1.00 97.57  ? 125 PRO H CD  1 
ATOM   1818 N  N   . SER B 2 126 ? 26.062  6.256   18.907  1.00 101.50 ? 126 SER H N   1 
ATOM   1819 C  CA  . SER B 2 126 ? 26.852  5.901   20.053  1.00 108.48 ? 126 SER H CA  1 
ATOM   1820 C  C   . SER B 2 126 ? 27.496  4.648   19.487  1.00 109.18 ? 126 SER H C   1 
ATOM   1821 O  O   . SER B 2 126 ? 26.846  3.806   18.839  1.00 99.53  ? 126 SER H O   1 
ATOM   1822 C  CB  . SER B 2 126 ? 26.057  5.691   21.356  1.00 104.84 ? 126 SER H CB  1 
ATOM   1823 O  OG  . SER B 2 126 ? 25.540  6.909   21.842  1.00 99.55  ? 126 SER H OG  1 
ATOM   1824 N  N   . VAL B 2 127 ? 28.808  4.603   19.659  1.00 119.30 ? 127 VAL H N   1 
ATOM   1825 C  CA  . VAL B 2 127 ? 29.561  3.514   19.100  1.00 122.02 ? 127 VAL H CA  1 
ATOM   1826 C  C   . VAL B 2 127 ? 30.153  2.749   20.262  1.00 123.42 ? 127 VAL H C   1 
ATOM   1827 O  O   . VAL B 2 127 ? 30.831  3.331   21.129  1.00 123.34 ? 127 VAL H O   1 
ATOM   1828 C  CB  . VAL B 2 127 ? 30.650  4.049   18.099  1.00 118.84 ? 127 VAL H CB  1 
ATOM   1829 C  CG1 . VAL B 2 127 ? 30.435  5.547   17.827  1.00 114.56 ? 127 VAL H CG1 1 
ATOM   1830 C  CG2 . VAL B 2 127 ? 32.096  3.770   18.562  1.00 123.32 ? 127 VAL H CG2 1 
ATOM   1831 N  N   . TYR B 2 128 ? 29.744  1.487   20.395  1.00 123.41 ? 128 TYR H N   1 
ATOM   1832 C  CA  . TYR B 2 128 ? 30.228  0.705   21.517  1.00 128.84 ? 128 TYR H CA  1 
ATOM   1833 C  C   . TYR B 2 128 ? 31.071  -0.460  20.983  1.00 128.29 ? 128 TYR H C   1 
ATOM   1834 O  O   . TYR B 2 128 ? 30.610  -1.227  20.098  1.00 122.96 ? 128 TYR H O   1 
ATOM   1835 C  CB  . TYR B 2 128 ? 29.031  0.283   22.401  1.00 130.58 ? 128 TYR H CB  1 
ATOM   1836 C  CG  . TYR B 2 128 ? 28.236  1.492   22.966  1.00 127.23 ? 128 TYR H CG  1 
ATOM   1837 C  CD1 . TYR B 2 128 ? 28.858  2.401   23.812  1.00 125.66 ? 128 TYR H CD1 1 
ATOM   1838 C  CD2 . TYR B 2 128 ? 26.935  1.790   22.570  1.00 122.89 ? 128 TYR H CD2 1 
ATOM   1839 C  CE1 . TYR B 2 128 ? 28.183  3.524   24.307  1.00 127.82 ? 128 TYR H CE1 1 
ATOM   1840 C  CE2 . TYR B 2 128 ? 26.253  2.921   23.067  1.00 120.96 ? 128 TYR H CE2 1 
ATOM   1841 C  CZ  . TYR B 2 128 ? 26.879  3.783   23.943  1.00 125.98 ? 128 TYR H CZ  1 
ATOM   1842 O  OH  . TYR B 2 128 ? 26.214  4.891   24.433  1.00 119.36 ? 128 TYR H OH  1 
ATOM   1843 N  N   . PRO B 2 129 ? 32.238  -0.682  21.561  1.00 129.33 ? 129 PRO H N   1 
ATOM   1844 C  CA  . PRO B 2 129 ? 33.051  -1.813  21.141  1.00 128.00 ? 129 PRO H CA  1 
ATOM   1845 C  C   . PRO B 2 129 ? 32.650  -3.035  21.947  1.00 127.03 ? 129 PRO H C   1 
ATOM   1846 O  O   . PRO B 2 129 ? 32.872  -3.028  23.139  1.00 127.98 ? 129 PRO H O   1 
ATOM   1847 C  CB  . PRO B 2 129 ? 34.458  -1.380  21.536  1.00 126.57 ? 129 PRO H CB  1 
ATOM   1848 C  CG  . PRO B 2 129 ? 34.287  -0.240  22.495  1.00 128.17 ? 129 PRO H CG  1 
ATOM   1849 C  CD  . PRO B 2 129 ? 32.830  -0.017  22.721  1.00 126.51 ? 129 PRO H CD  1 
ATOM   1850 N  N   . LEU B 2 130 ? 32.068  -4.051  21.324  1.00 124.94 ? 130 LEU H N   1 
ATOM   1851 C  CA  . LEU B 2 130 ? 31.678  -5.255  22.032  1.00 121.93 ? 130 LEU H CA  1 
ATOM   1852 C  C   . LEU B 2 130 ? 32.769  -6.296  21.888  1.00 129.80 ? 130 LEU H C   1 
ATOM   1853 O  O   . LEU B 2 130 ? 32.894  -6.915  20.841  1.00 127.86 ? 130 LEU H O   1 
ATOM   1854 C  CB  . LEU B 2 130 ? 30.389  -5.827  21.460  1.00 20.00  ? 130 LEU H CB  1 
ATOM   1855 C  CG  . LEU B 2 130 ? 29.140  -4.955  21.628  1.00 20.00  ? 130 LEU H CG  1 
ATOM   1856 C  CD1 . LEU B 2 130 ? 27.953  -5.544  20.902  1.00 20.00  ? 130 LEU H CD1 1 
ATOM   1857 C  CD2 . LEU B 2 130 ? 28.767  -4.672  23.072  1.00 20.00  ? 130 LEU H CD2 1 
ATOM   1858 N  N   . ALA B 2 131 ? 33.560  -6.495  22.936  1.00 135.70 ? 131 ALA H N   1 
ATOM   1859 C  CA  . ALA B 2 131 ? 34.627  -7.490  22.895  1.00 132.13 ? 131 ALA H CA  1 
ATOM   1860 C  C   . ALA B 2 131 ? 34.152  -8.739  23.617  1.00 134.22 ? 131 ALA H C   1 
ATOM   1861 O  O   . ALA B 2 131 ? 33.062  -8.742  24.186  1.00 133.90 ? 131 ALA H O   1 
ATOM   1862 C  CB  . ALA B 2 131 ? 35.901  -6.953  23.515  1.00 123.87 ? 131 ALA H CB  1 
ATOM   1863 N  N   . PRO B 2 132 ? 35.001  -9.831  23.579  1.00 135.32 ? 132 PRO H N   1 
ATOM   1864 C  CA  . PRO B 2 132 ? 34.489  -11.016 24.267  1.00 138.61 ? 132 PRO H CA  1 
ATOM   1865 C  C   . PRO B 2 132 ? 35.211  -11.357 25.560  1.00 139.85 ? 132 PRO H C   1 
ATOM   1866 O  O   . PRO B 2 132 ? 36.045  -10.594 26.047  1.00 136.31 ? 132 PRO H O   1 
ATOM   1867 C  CB  . PRO B 2 132 ? 34.808  -12.112 23.268  1.00 134.43 ? 132 PRO H CB  1 
ATOM   1868 C  CG  . PRO B 2 132 ? 36.174  -11.744 22.788  1.00 130.94 ? 132 PRO H CG  1 
ATOM   1869 C  CD  . PRO B 2 132 ? 36.330  -10.251 22.957  1.00 130.66 ? 132 PRO H CD  1 
ATOM   1870 N  N   . GLY B 2 133 ? 34.867  -12.527 26.093  1.00 139.55 ? 133 GLY H N   1 
ATOM   1871 C  CA  . GLY B 2 133 ? 35.497  -13.071 27.278  1.00 139.66 ? 133 GLY H CA  1 
ATOM   1872 C  C   . GLY B 2 133 ? 35.404  -14.589 27.166  1.00 141.42 ? 133 GLY H C   1 
ATOM   1873 O  O   . GLY B 2 133 ? 34.316  -15.143 27.354  1.00 139.83 ? 133 GLY H O   1 
ATOM   1874 N  N   . GLY B 2 134 ? 36.509  -15.295 26.925  1.00 141.37 ? 134 GLY H N   1 
ATOM   1875 C  CA  . GLY B 2 134 ? 36.439  -16.758 26.907  1.00 140.34 ? 134 GLY H CA  1 
ATOM   1876 C  C   . GLY B 2 134 ? 36.756  -17.634 25.701  1.00 139.65 ? 134 GLY H C   1 
ATOM   1877 O  O   . GLY B 2 134 ? 37.657  -17.361 24.926  1.00 142.54 ? 134 GLY H O   1 
ATOM   1878 N  N   . GLY B 2 135 ? 35.997  -18.714 25.572  1.00 140.07 ? 135 GLY H N   1 
ATOM   1879 C  CA  . GLY B 2 135 ? 36.127  -19.666 24.483  1.00 141.00 ? 135 GLY H CA  1 
ATOM   1880 C  C   . GLY B 2 135 ? 37.363  -19.697 23.599  1.00 142.07 ? 135 GLY H C   1 
ATOM   1881 O  O   . GLY B 2 135 ? 37.620  -18.794 22.818  1.00 141.94 ? 135 GLY H O   1 
ATOM   1882 N  N   . ALA B 2 136 ? 38.121  -20.778 23.710  1.00 140.43 ? 136 ALA H N   1 
ATOM   1883 C  CA  . ALA B 2 136 ? 39.319  -20.966 22.906  1.00 145.90 ? 136 ALA H CA  1 
ATOM   1884 C  C   . ALA B 2 136 ? 39.232  -22.277 22.113  1.00 149.35 ? 136 ALA H C   1 
ATOM   1885 O  O   . ALA B 2 136 ? 39.900  -23.250 22.446  1.00 147.87 ? 136 ALA H O   1 
ATOM   1886 C  CB  . ALA B 2 136 ? 40.553  -20.968 23.794  1.00 143.76 ? 136 ALA H CB  1 
ATOM   1887 N  N   . THR B 2 137 ? 38.413  -22.302 21.066  1.00 152.85 ? 137 THR H N   1 
ATOM   1888 C  CA  . THR B 2 137 ? 38.263  -23.513 20.267  1.00 152.02 ? 137 THR H CA  1 
ATOM   1889 C  C   . THR B 2 137 ? 38.406  -23.276 18.764  1.00 150.28 ? 137 THR H C   1 
ATOM   1890 O  O   . THR B 2 137 ? 37.640  -23.846 17.971  1.00 148.30 ? 137 THR H O   1 
ATOM   1891 C  CB  . THR B 2 137 ? 36.926  -24.251 20.585  1.00 141.63 ? 137 THR H CB  1 
ATOM   1892 O  OG1 . THR B 2 137 ? 36.471  -25.010 19.453  1.00 140.01 ? 137 THR H OG1 1 
ATOM   1893 C  CG2 . THR B 2 137 ? 35.841  -23.274 20.992  1.00 135.31 ? 137 THR H CG2 1 
ATOM   1894 N  N   . ASN B 2 138 ? 39.367  -22.459 18.350  1.00 146.95 ? 138 ASN H N   1 
ATOM   1895 C  CA  . ASN B 2 138 ? 39.485  -22.256 16.927  1.00 145.53 ? 138 ASN H CA  1 
ATOM   1896 C  C   . ASN B 2 138 ? 40.656  -21.409 16.534  1.00 147.42 ? 138 ASN H C   1 
ATOM   1897 O  O   . ASN B 2 138 ? 41.136  -21.488 15.405  1.00 147.01 ? 138 ASN H O   1 
ATOM   1898 C  CB  . ASN B 2 138 ? 38.236  -21.522 16.467  1.00 143.98 ? 138 ASN H CB  1 
ATOM   1899 C  CG  . ASN B 2 138 ? 38.062  -20.180 17.164  1.00 141.21 ? 138 ASN H CG  1 
ATOM   1900 O  OD1 . ASN B 2 138 ? 39.031  -19.457 17.420  1.00 143.24 ? 138 ASN H OD1 1 
ATOM   1901 N  ND2 . ASN B 2 138 ? 36.816  -19.841 17.477  1.00 140.59 ? 138 ASN H ND2 1 
ATOM   1902 N  N   . SER B 2 139 ? 41.072  -20.538 17.449  1.00 147.22 ? 139 SER H N   1 
ATOM   1903 C  CA  . SER B 2 139 ? 42.161  -19.615 17.168  1.00 142.05 ? 139 SER H CA  1 
ATOM   1904 C  C   . SER B 2 139 ? 41.628  -18.558 16.215  1.00 140.74 ? 139 SER H C   1 
ATOM   1905 O  O   . SER B 2 139 ? 42.142  -17.458 16.153  1.00 138.76 ? 139 SER H O   1 
ATOM   1906 C  CB  . SER B 2 139 ? 43.313  -20.338 16.499  1.00 136.64 ? 139 SER H CB  1 
ATOM   1907 O  OG  . SER B 2 139 ? 42.929  -20.689 15.178  1.00 138.44 ? 139 SER H OG  1 
ATOM   1908 N  N   . MET B 2 140 ? 40.593  -18.927 15.470  1.00 141.16 ? 140 MET H N   1 
ATOM   1909 C  CA  . MET B 2 140 ? 39.908  -18.072 14.538  1.00 140.57 ? 140 MET H CA  1 
ATOM   1910 C  C   . MET B 2 140 ? 38.941  -17.341 15.429  1.00 139.60 ? 140 MET H C   1 
ATOM   1911 O  O   . MET B 2 140 ? 37.895  -17.867 15.779  1.00 140.65 ? 140 MET H O   1 
ATOM   1912 C  CB  . MET B 2 140 ? 39.127  -18.903 13.522  1.00 137.27 ? 140 MET H CB  1 
ATOM   1913 C  CG  . MET B 2 140 ? 38.839  -20.341 13.941  1.00 139.49 ? 140 MET H CG  1 
ATOM   1914 S  SD  . MET B 2 140 ? 37.242  -21.003 13.415  1.00 140.70 ? 140 MET H SD  1 
ATOM   1915 C  CE  . MET B 2 140 ? 37.769  -22.350 12.374  1.00 132.42 ? 140 MET H CE  1 
ATOM   1916 N  N   . VAL B 2 141 ? 39.294  -16.130 15.822  1.00 133.69 ? 141 VAL H N   1 
ATOM   1917 C  CA  . VAL B 2 141 ? 38.425  -15.382 16.701  1.00 131.94 ? 141 VAL H CA  1 
ATOM   1918 C  C   . VAL B 2 141 ? 37.669  -14.309 15.939  1.00 130.90 ? 141 VAL H C   1 
ATOM   1919 O  O   . VAL B 2 141 ? 38.037  -13.987 14.816  1.00 129.55 ? 141 VAL H O   1 
ATOM   1920 C  CB  . VAL B 2 141 ? 39.201  -14.774 17.874  1.00 134.04 ? 141 VAL H CB  1 
ATOM   1921 C  CG1 . VAL B 2 141 ? 39.275  -15.764 19.019  1.00 131.91 ? 141 VAL H CG1 1 
ATOM   1922 C  CG2 . VAL B 2 141 ? 40.595  -14.370 17.444  1.00 133.20 ? 141 VAL H CG2 1 
ATOM   1923 N  N   . THR B 2 142 ? 36.634  -13.715 16.542  1.00 131.63 ? 142 THR H N   1 
ATOM   1924 C  CA  . THR B 2 142 ? 35.858  -12.627 15.909  1.00 129.87 ? 142 THR H CA  1 
ATOM   1925 C  C   . THR B 2 142 ? 35.561  -11.468 16.874  1.00 126.09 ? 142 THR H C   1 
ATOM   1926 O  O   . THR B 2 142 ? 34.854  -11.645 17.850  1.00 121.57 ? 142 THR H O   1 
ATOM   1927 C  CB  . THR B 2 142 ? 34.508  -13.082 15.288  1.00 20.00  ? 142 THR H CB  1 
ATOM   1928 O  OG1 . THR B 2 142 ? 33.800  -13.954 16.182  1.00 20.00  ? 142 THR H OG1 1 
ATOM   1929 C  CG2 . THR B 2 142 ? 34.706  -13.751 13.932  1.00 20.00  ? 142 THR H CG2 1 
ATOM   1930 N  N   . LEU B 2 143 ? 36.102  -10.288 16.579  1.00 125.54 ? 143 LEU H N   1 
ATOM   1931 C  CA  . LEU B 2 143 ? 35.904  -9.084  17.382  1.00 127.48 ? 143 LEU H CA  1 
ATOM   1932 C  C   . LEU B 2 143 ? 34.779  -8.258  16.766  1.00 127.60 ? 143 LEU H C   1 
ATOM   1933 O  O   . LEU B 2 143 ? 34.611  -8.296  15.555  1.00 124.65 ? 143 LEU H O   1 
ATOM   1934 C  CB  . LEU B 2 143 ? 37.170  -8.237  17.360  1.00 126.31 ? 143 LEU H CB  1 
ATOM   1935 C  CG  . LEU B 2 143 ? 38.429  -8.627  18.120  1.00 120.81 ? 143 LEU H CG  1 
ATOM   1936 C  CD1 . LEU B 2 143 ? 38.885  -9.983  17.625  1.00 120.26 ? 143 LEU H CD1 1 
ATOM   1937 C  CD2 . LEU B 2 143 ? 39.500  -7.576  17.866  1.00 114.32 ? 143 LEU H CD2 1 
ATOM   1938 N  N   . GLY B 2 144 ? 34.001  -7.498  17.537  1.00 128.08 ? 144 GLY H N   1 
ATOM   1939 C  CA  . GLY B 2 144 ? 32.982  -6.790  16.813  1.00 126.81 ? 144 GLY H CA  1 
ATOM   1940 C  C   . GLY B 2 144 ? 32.790  -5.381  17.260  1.00 124.95 ? 144 GLY H C   1 
ATOM   1941 O  O   . GLY B 2 144 ? 33.201  -4.960  18.362  1.00 128.36 ? 144 GLY H O   1 
ATOM   1942 N  N   . CYS B 2 145 ? 32.073  -4.658  16.417  1.00 120.95 ? 145 CYS H N   1 
ATOM   1943 C  CA  . CYS B 2 145 ? 31.760  -3.337  16.795  1.00 120.83 ? 145 CYS H CA  1 
ATOM   1944 C  C   . CYS B 2 145 ? 30.282  -3.016  16.563  1.00 119.72 ? 145 CYS H C   1 
ATOM   1945 O  O   . CYS B 2 145 ? 29.727  -3.324  15.476  1.00 118.58 ? 145 CYS H O   1 
ATOM   1946 C  CB  . CYS B 2 145 ? 32.651  -2.496  15.901  1.00 118.28 ? 145 CYS H CB  1 
ATOM   1947 S  SG  . CYS B 2 145 ? 34.394  -2.321  16.433  1.00 124.13 ? 145 CYS H SG  1 
ATOM   1948 N  N   . LEU B 2 146 ? 29.632  -2.450  17.585  1.00 120.36 ? 146 LEU H N   1 
ATOM   1949 C  CA  . LEU B 2 146 ? 28.236  -2.060  17.421  1.00 117.04 ? 146 LEU H CA  1 
ATOM   1950 C  C   . LEU B 2 146 ? 27.980  -0.566  17.232  1.00 111.91 ? 146 LEU H C   1 
ATOM   1951 O  O   . LEU B 2 146 ? 28.308  0.252   18.104  1.00 114.72 ? 146 LEU H O   1 
ATOM   1952 C  CB  . LEU B 2 146 ? 27.413  -2.549  18.599  1.00 117.04 ? 146 LEU H CB  1 
ATOM   1953 C  CG  . LEU B 2 146 ? 25.947  -2.149  18.508  1.00 112.01 ? 146 LEU H CG  1 
ATOM   1954 C  CD1 . LEU B 2 146 ? 25.340  -2.721  17.221  1.00 110.14 ? 146 LEU H CD1 1 
ATOM   1955 C  CD2 . LEU B 2 146 ? 25.194  -2.708  19.683  1.00 117.49 ? 146 LEU H CD2 1 
ATOM   1956 N  N   . VAL B 2 147 ? 27.369  -0.212  16.105  1.00 110.15 ? 147 VAL H N   1 
ATOM   1957 C  CA  . VAL B 2 147 ? 27.110  1.198   15.822  1.00 107.14 ? 147 VAL H CA  1 
ATOM   1958 C  C   . VAL B 2 147 ? 25.617  1.497   15.915  1.00 105.38 ? 147 VAL H C   1 
ATOM   1959 O  O   . VAL B 2 147 ? 24.846  1.112   15.032  1.00 108.18 ? 147 VAL H O   1 
ATOM   1960 C  CB  . VAL B 2 147 ? 27.625  1.641   14.444  1.00 106.11 ? 147 VAL H CB  1 
ATOM   1961 C  CG1 . VAL B 2 147 ? 27.482  3.151   14.310  1.00 103.46 ? 147 VAL H CG1 1 
ATOM   1962 C  CG2 . VAL B 2 147 ? 29.087  1.224   14.250  1.00 112.74 ? 147 VAL H CG2 1 
ATOM   1963 N  N   . LYS B 2 148 ? 25.186  2.093   17.021  1.00 103.38 ? 148 LYS H N   1 
ATOM   1964 C  CA  . LYS B 2 148 ? 23.755  2.110   17.308  1.00 99.01  ? 148 LYS H CA  1 
ATOM   1965 C  C   . LYS B 2 148 ? 23.244  3.545   17.375  1.00 96.46  ? 148 LYS H C   1 
ATOM   1966 O  O   . LYS B 2 148 ? 23.933  4.434   17.903  1.00 94.06  ? 148 LYS H O   1 
ATOM   1967 C  CB  . LYS B 2 148 ? 23.413  1.339   18.580  1.00 105.18 ? 148 LYS H CB  1 
ATOM   1968 C  CG  . LYS B 2 148 ? 21.904  1.205   18.813  1.00 102.95 ? 148 LYS H CG  1 
ATOM   1969 C  CD  . LYS B 2 148 ? 21.564  0.447   20.092  1.00 101.95 ? 148 LYS H CD  1 
ATOM   1970 C  CE  . LYS B 2 148 ? 20.065  0.442   20.312  1.00 101.93 ? 148 LYS H CE  1 
ATOM   1971 N  NZ  . LYS B 2 148 ? 19.613  -0.603  21.265  1.00 102.79 ? 148 LYS H NZ  1 
ATOM   1972 N  N   . GLY B 2 149 ? 22.094  3.785   16.745  1.00 91.84  ? 149 GLY H N   1 
ATOM   1973 C  CA  . GLY B 2 149 ? 21.356  5.017   16.969  1.00 92.02  ? 149 GLY H CA  1 
ATOM   1974 C  C   . GLY B 2 149 ? 21.876  6.265   16.284  1.00 92.31  ? 149 GLY H C   1 
ATOM   1975 O  O   . GLY B 2 149 ? 21.995  7.329   16.902  1.00 88.44  ? 149 GLY H O   1 
ATOM   1976 N  N   . TYR B 2 150 ? 22.277  6.120   15.028  1.00 92.79  ? 150 TYR H N   1 
ATOM   1977 C  CA  . TYR B 2 150 ? 22.761  7.261   14.266  1.00 89.69  ? 150 TYR H CA  1 
ATOM   1978 C  C   . TYR B 2 150 ? 21.783  7.629   13.129  1.00 88.30  ? 150 TYR H C   1 
ATOM   1979 O  O   . TYR B 2 150 ? 20.911  6.838   12.743  1.00 78.89  ? 150 TYR H O   1 
ATOM   1980 C  CB  . TYR B 2 150 ? 24.136  6.969   13.693  1.00 88.66  ? 150 TYR H CB  1 
ATOM   1981 C  CG  . TYR B 2 150 ? 24.124  5.896   12.650  1.00 90.97  ? 150 TYR H CG  1 
ATOM   1982 C  CD1 . TYR B 2 150 ? 24.203  4.538   12.961  1.00 87.46  ? 150 TYR H CD1 1 
ATOM   1983 C  CD2 . TYR B 2 150 ? 24.078  6.269   11.315  1.00 94.87  ? 150 TYR H CD2 1 
ATOM   1984 C  CE1 . TYR B 2 150 ? 24.196  3.588   11.936  1.00 90.74  ? 150 TYR H CE1 1 
ATOM   1985 C  CE2 . TYR B 2 150 ? 24.078  5.359   10.316  1.00 89.47  ? 150 TYR H CE2 1 
ATOM   1986 C  CZ  . TYR B 2 150 ? 24.141  4.030   10.614  1.00 89.05  ? 150 TYR H CZ  1 
ATOM   1987 O  OH  . TYR B 2 150 ? 24.127  3.208   9.529   1.00 86.55  ? 150 TYR H OH  1 
ATOM   1988 N  N   . PHE B 2 151 ? 21.986  8.817   12.570  1.00 87.85  ? 151 PHE H N   1 
ATOM   1989 C  CA  . PHE B 2 151 ? 21.208  9.318   11.453  1.00 79.84  ? 151 PHE H CA  1 
ATOM   1990 C  C   . PHE B 2 151 ? 21.921  10.557  10.907  1.00 83.28  ? 151 PHE H C   1 
ATOM   1991 O  O   . PHE B 2 151 ? 22.395  11.386  11.678  1.00 89.86  ? 151 PHE H O   1 
ATOM   1992 C  CB  . PHE B 2 151 ? 19.777  9.645   11.906  1.00 83.83  ? 151 PHE H CB  1 
ATOM   1993 C  CG  . PHE B 2 151 ? 18.842  9.982   10.771  1.00 81.47  ? 151 PHE H CG  1 
ATOM   1994 C  CD1 . PHE B 2 151 ? 18.708  11.292  10.327  1.00 78.34  ? 151 PHE H CD1 1 
ATOM   1995 C  CD2 . PHE B 2 151 ? 18.135  8.982   10.124  1.00 76.42  ? 151 PHE H CD2 1 
ATOM   1996 C  CE1 . PHE B 2 151 ? 17.882  11.594  9.281   1.00 76.88  ? 151 PHE H CE1 1 
ATOM   1997 C  CE2 . PHE B 2 151 ? 17.309  9.279   9.081   1.00 74.26  ? 151 PHE H CE2 1 
ATOM   1998 C  CZ  . PHE B 2 151 ? 17.184  10.585  8.654   1.00 74.49  ? 151 PHE H CZ  1 
ATOM   1999 N  N   . PRO B 2 152 ? 21.977  10.703  9.569   1.00 83.29  ? 152 PRO H N   1 
ATOM   2000 C  CA  . PRO B 2 152 ? 21.432  9.716   8.635   1.00 79.81  ? 152 PRO H CA  1 
ATOM   2001 C  C   . PRO B 2 152 ? 22.425  8.638   8.273   1.00 78.09  ? 152 PRO H C   1 
ATOM   2002 O  O   . PRO B 2 152 ? 23.505  8.630   8.834   1.00 85.57  ? 152 PRO H O   1 
ATOM   2003 C  CB  . PRO B 2 152 ? 21.145  10.561  7.405   1.00 78.08  ? 152 PRO H CB  1 
ATOM   2004 C  CG  . PRO B 2 152 ? 22.245  11.572  7.431   1.00 79.13  ? 152 PRO H CG  1 
ATOM   2005 C  CD  . PRO B 2 152 ? 22.495  11.891  8.870   1.00 82.12  ? 152 PRO H CD  1 
ATOM   2006 N  N   . GLU B 2 153 ? 22.102  7.804   7.291   1.00 71.23  ? 153 GLU H N   1 
ATOM   2007 C  CA  . GLU B 2 153 ? 23.089  6.896   6.736   1.00 72.80  ? 153 GLU H CA  1 
ATOM   2008 C  C   . GLU B 2 153 ? 24.007  7.744   5.847   1.00 72.29  ? 153 GLU H C   1 
ATOM   2009 O  O   . GLU B 2 153 ? 23.602  8.821   5.415   1.00 76.42  ? 153 GLU H O   1 
ATOM   2010 C  CB  . GLU B 2 153 ? 22.389  5.749   5.996   1.00 70.76  ? 153 GLU H CB  1 
ATOM   2011 C  CG  . GLU B 2 153 ? 23.209  4.464   5.921   1.00 77.48  ? 153 GLU H CG  1 
ATOM   2012 C  CD  . GLU B 2 153 ? 22.402  3.213   6.060   1.00 74.32  ? 153 GLU H CD  1 
ATOM   2013 O  OE1 . GLU B 2 153 ? 21.216  3.340   6.379   1.00 84.00  ? 153 GLU H OE1 1 
ATOM   2014 O  OE2 . GLU B 2 153 ? 22.948  2.107   5.855   1.00 73.04  ? 153 GLU H OE2 1 
ATOM   2015 N  N   . PRO B 2 154 ? 25.260  7.302   5.592   1.00 67.95  ? 154 PRO H N   1 
ATOM   2016 C  CA  . PRO B 2 154 ? 25.934  6.076   6.023   1.00 76.16  ? 154 PRO H CA  1 
ATOM   2017 C  C   . PRO B 2 154 ? 26.940  6.284   7.148   1.00 87.83  ? 154 PRO H C   1 
ATOM   2018 O  O   . PRO B 2 154 ? 27.255  7.419   7.566   1.00 87.45  ? 154 PRO H O   1 
ATOM   2019 C  CB  . PRO B 2 154 ? 26.681  5.653   4.770   1.00 72.72  ? 154 PRO H CB  1 
ATOM   2020 C  CG  . PRO B 2 154 ? 27.125  6.984   4.207   1.00 70.39  ? 154 PRO H CG  1 
ATOM   2021 C  CD  . PRO B 2 154 ? 26.065  8.012   4.590   1.00 69.22  ? 154 PRO H CD  1 
ATOM   2022 N  N   . VAL B 2 155 ? 27.457  5.160   7.631   1.00 85.24  ? 155 VAL H N   1 
ATOM   2023 C  CA  . VAL B 2 155 ? 28.675  5.213   8.387   1.00 92.69  ? 155 VAL H CA  1 
ATOM   2024 C  C   . VAL B 2 155 ? 29.738  4.569   7.542   1.00 98.58  ? 155 VAL H C   1 
ATOM   2025 O  O   . VAL B 2 155 ? 29.448  3.732   6.683   1.00 98.07  ? 155 VAL H O   1 
ATOM   2026 C  CB  . VAL B 2 155 ? 28.567  4.486   9.765   1.00 97.13  ? 155 VAL H CB  1 
ATOM   2027 C  CG1 . VAL B 2 155 ? 27.790  5.336   10.781  1.00 92.92  ? 155 VAL H CG1 1 
ATOM   2028 C  CG2 . VAL B 2 155 ? 27.966  3.077   9.616   1.00 90.40  ? 155 VAL H CG2 1 
ATOM   2029 N  N   . THR B 2 156 ? 30.979  4.907   7.851   1.00 101.27 ? 156 THR H N   1 
ATOM   2030 C  CA  . THR B 2 156 ? 32.098  4.240   7.229   1.00 99.79  ? 156 THR H CA  1 
ATOM   2031 C  C   . THR B 2 156 ? 32.802  3.554   8.371   1.00 104.62 ? 156 THR H C   1 
ATOM   2032 O  O   . THR B 2 156 ? 33.109  4.151   9.408   1.00 103.47 ? 156 THR H O   1 
ATOM   2033 C  CB  . THR B 2 156 ? 33.035  5.204   6.485   1.00 98.92  ? 156 THR H CB  1 
ATOM   2034 O  OG1 . THR B 2 156 ? 33.607  6.129   7.414   1.00 108.15 ? 156 THR H OG1 1 
ATOM   2035 C  CG2 . THR B 2 156 ? 32.277  5.974   5.440   1.00 87.08  ? 156 THR H CG2 1 
ATOM   2036 N  N   . VAL B 2 157 ? 33.047  2.274   8.159   1.00 104.37 ? 157 VAL H N   1 
ATOM   2037 C  CA  . VAL B 2 157 ? 33.717  1.457   9.137   1.00 107.19 ? 157 VAL H CA  1 
ATOM   2038 C  C   . VAL B 2 157 ? 35.054  0.971   8.594   1.00 110.24 ? 157 VAL H C   1 
ATOM   2039 O  O   . VAL B 2 157 ? 35.110  0.402   7.506   1.00 110.50 ? 157 VAL H O   1 
ATOM   2040 C  CB  . VAL B 2 157 ? 32.833  0.243   9.484   1.00 93.96  ? 157 VAL H CB  1 
ATOM   2041 C  CG1 . VAL B 2 157 ? 33.547  -0.679  10.426  1.00 106.35 ? 157 VAL H CG1 1 
ATOM   2042 C  CG2 . VAL B 2 157 ? 31.546  0.695   10.071  1.00 93.97  ? 157 VAL H CG2 1 
ATOM   2043 N  N   . THR B 2 158 ? 36.141  1.210   9.324   1.00 110.29 ? 158 THR H N   1 
ATOM   2044 C  CA  . THR B 2 158 ? 37.394  0.557   8.960   1.00 113.88 ? 158 THR H CA  1 
ATOM   2045 C  C   . THR B 2 158 ? 37.979  -0.176  10.179  1.00 116.15 ? 158 THR H C   1 
ATOM   2046 O  O   . THR B 2 158 ? 37.494  -0.012  11.300  1.00 116.99 ? 158 THR H O   1 
ATOM   2047 C  CB  . THR B 2 158 ? 38.411  1.598   8.380   1.00 112.43 ? 158 THR H CB  1 
ATOM   2048 O  OG1 . THR B 2 158 ? 38.762  2.563   9.378   1.00 113.15 ? 158 THR H OG1 1 
ATOM   2049 C  CG2 . THR B 2 158 ? 37.794  2.345   7.206   1.00 104.25 ? 158 THR H CG2 1 
ATOM   2050 N  N   . TRP B 2 159 ? 38.984  -1.023  9.952   1.00 116.31 ? 159 TRP H N   1 
ATOM   2051 C  CA  . TRP B 2 159 ? 39.686  -1.722  11.045  1.00 118.98 ? 159 TRP H CA  1 
ATOM   2052 C  C   . TRP B 2 159 ? 41.171  -1.505  11.011  1.00 117.17 ? 159 TRP H C   1 
ATOM   2053 O  O   . TRP B 2 159 ? 41.853  -1.904  10.068  1.00 119.73 ? 159 TRP H O   1 
ATOM   2054 C  CB  . TRP B 2 159 ? 39.368  -3.209  11.003  1.00 118.34 ? 159 TRP H CB  1 
ATOM   2055 C  CG  . TRP B 2 159 ? 37.992  -3.502  11.438  1.00 114.98 ? 159 TRP H CG  1 
ATOM   2056 C  CD1 . TRP B 2 159 ? 36.900  -3.558  10.657  1.00 110.55 ? 159 TRP H CD1 1 
ATOM   2057 C  CD2 . TRP B 2 159 ? 37.588  -3.988  12.724  1.00 119.20 ? 159 TRP H CD2 1 
ATOM   2058 N  NE1 . TRP B 2 159 ? 35.802  -3.906  11.393  1.00 109.67 ? 159 TRP H NE1 1 
ATOM   2059 C  CE2 . TRP B 2 159 ? 36.196  -4.190  12.669  1.00 112.09 ? 159 TRP H CE2 1 
ATOM   2060 C  CE3 . TRP B 2 159 ? 38.260  -4.234  13.924  1.00 121.68 ? 159 TRP H CE3 1 
ATOM   2061 C  CZ2 . TRP B 2 159 ? 35.462  -4.664  13.749  1.00 114.56 ? 159 TRP H CZ2 1 
ATOM   2062 C  CZ3 . TRP B 2 159 ? 37.528  -4.671  15.008  1.00 121.05 ? 159 TRP H CZ3 1 
ATOM   2063 C  CH2 . TRP B 2 159 ? 36.138  -4.893  14.914  1.00 120.30 ? 159 TRP H CH2 1 
ATOM   2064 N  N   . ASN B 2 160 ? 41.667  -1.063  12.154  1.00 119.26 ? 160 ASN H N   1 
ATOM   2065 C  CA  . ASN B 2 160 ? 43.046  -0.678  12.321  1.00 120.17 ? 160 ASN H CA  1 
ATOM   2066 C  C   . ASN B 2 160 ? 43.226  0.295   11.145  1.00 122.79 ? 160 ASN H C   1 
ATOM   2067 O  O   . ASN B 2 160 ? 44.193  0.244   10.388  1.00 125.75 ? 160 ASN H O   1 
ATOM   2068 C  CB  . ASN B 2 160 ? 43.983  -1.901  12.292  1.00 123.27 ? 160 ASN H CB  1 
ATOM   2069 C  CG  . ASN B 2 160 ? 43.945  -2.728  13.604  1.00 119.23 ? 160 ASN H CG  1 
ATOM   2070 O  OD1 . ASN B 2 160 ? 43.103  -2.490  14.481  1.00 119.38 ? 160 ASN H OD1 1 
ATOM   2071 N  ND2 . ASN B 2 160 ? 44.816  -3.730  13.707  1.00 117.46 ? 160 ASN H ND2 1 
ATOM   2072 N  N   . SER B 2 161 ? 42.292  1.243   11.040  1.00 122.49 ? 161 SER H N   1 
ATOM   2073 C  CA  . SER B 2 161 ? 42.315  2.275   9.966   1.00 124.59 ? 161 SER H CA  1 
ATOM   2074 C  C   . SER B 2 161 ? 42.403  1.658   8.533   1.00 118.94 ? 161 SER H C   1 
ATOM   2075 O  O   . SER B 2 161 ? 42.968  2.273   7.607   1.00 122.26 ? 161 SER H O   1 
ATOM   2076 C  CB  . SER B 2 161 ? 43.406  3.361   10.208  1.00 121.04 ? 161 SER H CB  1 
ATOM   2077 O  OG  . SER B 2 161 ? 42.900  4.690   9.932   1.00 126.28 ? 161 SER H OG  1 
ATOM   2078 N  N   . GLY B 2 162 ? 41.809  0.473   8.335   1.00 119.61 ? 162 GLY H N   1 
ATOM   2079 C  CA  . GLY B 2 162 ? 41.746  -0.273  7.063   1.00 118.81 ? 162 GLY H CA  1 
ATOM   2080 C  C   . GLY B 2 162 ? 42.747  -1.318  6.651   1.00 123.12 ? 162 GLY H C   1 
ATOM   2081 O  O   . GLY B 2 162 ? 42.615  -1.860  5.542   1.00 125.31 ? 162 GLY H O   1 
ATOM   2082 N  N   . SER B 2 163 ? 43.746  -1.596  7.493   1.00 122.44 ? 163 SER H N   1 
ATOM   2083 C  CA  . SER B 2 163 ? 44.739  -2.650  7.211   1.00 124.34 ? 163 SER H CA  1 
ATOM   2084 C  C   . SER B 2 163 ? 44.132  -4.049  7.514   1.00 122.69 ? 163 SER H C   1 
ATOM   2085 O  O   . SER B 2 163 ? 44.630  -5.073  7.007   1.00 122.77 ? 163 SER H O   1 
ATOM   2086 C  CB  . SER B 2 163 ? 46.052  -2.446  7.970   1.00 121.94 ? 163 SER H CB  1 
ATOM   2087 O  OG  . SER B 2 163 ? 46.609  -1.165  7.751   1.00 121.98 ? 163 SER H OG  1 
ATOM   2088 N  N   . LEU B 2 164 ? 43.081  -4.089  8.329   1.00 116.83 ? 164 LEU H N   1 
ATOM   2089 C  CA  . LEU B 2 164 ? 42.372  -5.340  8.542   1.00 115.88 ? 164 LEU H CA  1 
ATOM   2090 C  C   . LEU B 2 164 ? 41.179  -5.410  7.606   1.00 118.58 ? 164 LEU H C   1 
ATOM   2091 O  O   . LEU B 2 164 ? 40.208  -4.661  7.749   1.00 118.32 ? 164 LEU H O   1 
ATOM   2092 C  CB  . LEU B 2 164 ? 41.879  -5.465  9.977   1.00 116.93 ? 164 LEU H CB  1 
ATOM   2093 C  CG  . LEU B 2 164 ? 42.886  -5.349  11.107  1.00 117.85 ? 164 LEU H CG  1 
ATOM   2094 C  CD1 . LEU B 2 164 ? 42.150  -5.330  12.430  1.00 115.83 ? 164 LEU H CD1 1 
ATOM   2095 C  CD2 . LEU B 2 164 ? 43.872  -6.488  11.025  1.00 117.71 ? 164 LEU H CD2 1 
ATOM   2096 N  N   . SER B 2 165 ? 41.279  -6.319  6.637   1.00 114.40 ? 165 SER H N   1 
ATOM   2097 C  CA  . SER B 2 165 ? 40.290  -6.432  5.574   1.00 111.91 ? 165 SER H CA  1 
ATOM   2098 C  C   . SER B 2 165 ? 39.967  -7.881  5.169   1.00 110.22 ? 165 SER H C   1 
ATOM   2099 O  O   . SER B 2 165 ? 39.387  -8.109  4.111   1.00 109.45 ? 165 SER H O   1 
ATOM   2100 C  CB  . SER B 2 165 ? 40.794  -5.683  4.341   1.00 109.46 ? 165 SER H CB  1 
ATOM   2101 O  OG  . SER B 2 165 ? 41.179  -4.365  4.672   1.00 111.73 ? 165 SER H OG  1 
ATOM   2102 N  N   . GLY B 2 166 ? 40.280  -8.867  5.999   1.00 107.41 ? 166 GLY H N   1 
ATOM   2103 C  CA  . GLY B 2 166 ? 40.088  -10.229 5.532   1.00 104.16 ? 166 GLY H CA  1 
ATOM   2104 C  C   . GLY B 2 166 ? 38.823  -10.945 5.932   1.00 101.37 ? 166 GLY H C   1 
ATOM   2105 O  O   . GLY B 2 166 ? 38.126  -11.523 5.105   1.00 103.21 ? 166 GLY H O   1 
ATOM   2106 N  N   . GLY B 2 167 ? 38.519  -10.902 7.214   1.00 101.74 ? 167 GLY H N   1 
ATOM   2107 C  CA  . GLY B 2 167 ? 37.404  -11.643 7.746   1.00 104.82 ? 167 GLY H CA  1 
ATOM   2108 C  C   . GLY B 2 167 ? 36.482  -10.625 8.374   1.00 109.48 ? 167 GLY H C   1 
ATOM   2109 O  O   . GLY B 2 167 ? 35.925  -10.875 9.439   1.00 112.52 ? 167 GLY H O   1 
ATOM   2110 N  N   . VAL B 2 168 ? 36.221  -9.528  7.667   1.00 108.25 ? 168 VAL H N   1 
ATOM   2111 C  CA  . VAL B 2 168 ? 35.373  -8.490  8.227   1.00 107.58 ? 168 VAL H CA  1 
ATOM   2112 C  C   . VAL B 2 168 ? 34.013  -8.646  7.555   1.00 104.09 ? 168 VAL H C   1 
ATOM   2113 O  O   . VAL B 2 168 ? 33.955  -8.884  6.357   1.00 106.88 ? 168 VAL H O   1 
ATOM   2114 C  CB  . VAL B 2 168 ? 36.006  -7.071  7.962   1.00 109.91 ? 168 VAL H CB  1 
ATOM   2115 C  CG1 . VAL B 2 168 ? 37.531  -7.114  8.131   1.00 109.03 ? 168 VAL H CG1 1 
ATOM   2116 C  CG2 . VAL B 2 168 ? 35.718  -6.569  6.556   1.00 108.81 ? 168 VAL H CG2 1 
ATOM   2117 N  N   . HIS B 2 169 ? 32.910  -8.623  8.314   1.00 105.54 ? 169 HIS H N   1 
ATOM   2118 C  CA  . HIS B 2 169 ? 31.625  -8.573  7.627   1.00 103.39 ? 169 HIS H CA  1 
ATOM   2119 C  C   . HIS B 2 169 ? 30.815  -7.371  8.083   1.00 98.15  ? 169 HIS H C   1 
ATOM   2120 O  O   . HIS B 2 169 ? 30.388  -7.355  9.230   1.00 100.78 ? 169 HIS H O   1 
ATOM   2121 C  CB  . HIS B 2 169 ? 30.788  -9.809  7.821   1.00 101.62 ? 169 HIS H CB  1 
ATOM   2122 C  CG  . HIS B 2 169 ? 31.434  -11.004 7.215   1.00 104.60 ? 169 HIS H CG  1 
ATOM   2123 N  ND1 . HIS B 2 169 ? 32.247  -10.914 6.098   1.00 105.55 ? 169 HIS H ND1 1 
ATOM   2124 C  CD2 . HIS B 2 169 ? 31.138  -12.318 7.358   1.00 108.74 ? 169 HIS H CD2 1 
ATOM   2125 C  CE1 . HIS B 2 169 ? 32.646  -12.128 5.767   1.00 109.32 ? 169 HIS H CE1 1 
ATOM   2126 N  NE2 . HIS B 2 169 ? 31.938  -12.999 6.470   1.00 114.41 ? 169 HIS H NE2 1 
ATOM   2127 N  N   . THR B 2 170 ? 30.629  -6.354  7.260   1.00 100.29 ? 170 THR H N   1 
ATOM   2128 C  CA  . THR B 2 170 ? 29.744  -5.251  7.656   1.00 98.97  ? 170 THR H CA  1 
ATOM   2129 C  C   . THR B 2 170 ? 28.323  -5.282  7.038   1.00 99.34  ? 170 THR H C   1 
ATOM   2130 O  O   . THR B 2 170 ? 28.146  -5.236  5.815   1.00 101.98 ? 170 THR H O   1 
ATOM   2131 C  CB  . THR B 2 170 ? 30.359  -3.870  7.311   1.00 103.84 ? 170 THR H CB  1 
ATOM   2132 O  OG1 . THR B 2 170 ? 31.601  -3.699  8.000   1.00 108.19 ? 170 THR H OG1 1 
ATOM   2133 C  CG2 . THR B 2 170 ? 29.403  -2.750  7.710   1.00 102.78 ? 170 THR H CG2 1 
ATOM   2134 N  N   . PHE B 2 171 ? 27.314  -5.373  7.902   1.00 101.52 ? 171 PHE H N   1 
ATOM   2135 C  CA  . PHE B 2 171 ? 25.912  -5.586  7.489   1.00 100.28 ? 171 PHE H CA  1 
ATOM   2136 C  C   . PHE B 2 171 ? 25.056  -4.395  7.158   1.00 93.57  ? 171 PHE H C   1 
ATOM   2137 O  O   . PHE B 2 171 ? 25.314  -3.286  7.620   1.00 92.54  ? 171 PHE H O   1 
ATOM   2138 C  CB  . PHE B 2 171 ? 25.088  -6.374  8.514   1.00 96.24  ? 171 PHE H CB  1 
ATOM   2139 C  CG  . PHE B 2 171 ? 25.560  -7.736  8.751   1.00 99.67  ? 171 PHE H CG  1 
ATOM   2140 C  CD1 . PHE B 2 171 ? 26.675  -8.023  9.528   1.00 98.55  ? 171 PHE H CD1 1 
ATOM   2141 C  CD2 . PHE B 2 171 ? 24.847  -8.765  8.167   1.00 99.86  ? 171 PHE H CD2 1 
ATOM   2142 C  CE1 . PHE B 2 171 ? 27.058  -9.351  9.698   1.00 98.62  ? 171 PHE H CE1 1 
ATOM   2143 C  CE2 . PHE B 2 171 ? 25.223  -10.053 8.314   1.00 102.12 ? 171 PHE H CE2 1 
ATOM   2144 C  CZ  . PHE B 2 171 ? 26.309  -10.366 9.093   1.00 101.60 ? 171 PHE H CZ  1 
ATOM   2145 N  N   . PRO B 2 172 ? 24.068  -4.630  6.266   1.00 95.00  ? 172 PRO H N   1 
ATOM   2146 C  CA  . PRO B 2 172 ? 23.114  -3.572  5.940   1.00 92.90  ? 172 PRO H CA  1 
ATOM   2147 C  C   . PRO B 2 172 ? 22.419  -3.037  7.185   1.00 91.67  ? 172 PRO H C   1 
ATOM   2148 O  O   . PRO B 2 172 ? 22.037  -3.822  8.060   1.00 88.44  ? 172 PRO H O   1 
ATOM   2149 C  CB  . PRO B 2 172 ? 22.085  -4.300  5.068   1.00 90.54  ? 172 PRO H CB  1 
ATOM   2150 C  CG  . PRO B 2 172 ? 22.822  -5.441  4.459   1.00 91.76  ? 172 PRO H CG  1 
ATOM   2151 C  CD  . PRO B 2 172 ? 23.789  -5.877  5.515   1.00 94.66  ? 172 PRO H CD  1 
ATOM   2152 N  N   . ALA B 2 173 ? 22.233  -1.720  7.232   1.00 90.42  ? 173 ALA H N   1 
ATOM   2153 C  CA  . ALA B 2 173 ? 21.524  -1.027  8.309   1.00 93.55  ? 173 ALA H CA  1 
ATOM   2154 C  C   . ALA B 2 173 ? 20.035  -1.358  8.482   1.00 98.65  ? 173 ALA H C   1 
ATOM   2155 O  O   . ALA B 2 173 ? 19.356  -1.736  7.517   1.00 91.77  ? 173 ALA H O   1 
ATOM   2156 C  CB  . ALA B 2 173 ? 21.638  0.464   8.095   1.00 91.50  ? 173 ALA H CB  1 
ATOM   2157 N  N   . VAL B 2 174 ? 19.553  -1.282  9.727   1.00 106.37 ? 174 VAL H N   1 
ATOM   2158 C  CA  . VAL B 2 174 ? 18.112  -1.443  9.994   1.00 96.99  ? 174 VAL H CA  1 
ATOM   2159 C  C   . VAL B 2 174 ? 17.573  -0.241  10.822  1.00 96.27  ? 174 VAL H C   1 
ATOM   2160 O  O   . VAL B 2 174 ? 18.339  0.432   11.560  1.00 93.52  ? 174 VAL H O   1 
ATOM   2161 C  CB  . VAL B 2 174 ? 17.788  -2.782  10.686  1.00 98.36  ? 174 VAL H CB  1 
ATOM   2162 C  CG1 . VAL B 2 174 ? 17.937  -3.935  9.689   1.00 97.29  ? 174 VAL H CG1 1 
ATOM   2163 C  CG2 . VAL B 2 174 ? 18.660  -2.991  11.913  1.00 104.49 ? 174 VAL H CG2 1 
ATOM   2164 N  N   . LEU B 2 175 ? 16.266  0.033   10.685  1.00 109.00 ? 175 LEU H N   1 
ATOM   2165 C  CA  . LEU B 2 175 ? 15.602  1.114   11.433  1.00 102.82 ? 175 LEU H CA  1 
ATOM   2166 C  C   . LEU B 2 175 ? 15.172  0.604   12.779  1.00 104.01 ? 175 LEU H C   1 
ATOM   2167 O  O   . LEU B 2 175 ? 14.431  -0.375  12.883  1.00 99.75  ? 175 LEU H O   1 
ATOM   2168 C  CB  . LEU B 2 175 ? 14.381  1.719   10.716  1.00 100.18 ? 175 LEU H CB  1 
ATOM   2169 C  CG  . LEU B 2 175 ? 13.573  2.775   11.530  1.00 108.47 ? 175 LEU H CG  1 
ATOM   2170 C  CD1 . LEU B 2 175 ? 12.956  3.812   10.575  1.00 108.12 ? 175 LEU H CD1 1 
ATOM   2171 C  CD2 . LEU B 2 175 ? 12.456  2.263   12.525  1.00 98.03  ? 175 LEU H CD2 1 
ATOM   2172 N  N   . GLN B 2 176 ? 15.693  1.264   13.801  1.00 106.58 ? 176 GLN H N   1 
ATOM   2173 C  CA  . GLN B 2 176 ? 15.472  0.964   15.194  1.00 102.02 ? 176 GLN H CA  1 
ATOM   2174 C  C   . GLN B 2 176 ? 15.140  2.246   15.945  1.00 101.42 ? 176 GLN H C   1 
ATOM   2175 O  O   . GLN B 2 176 ? 15.993  3.144   16.075  1.00 98.68  ? 176 GLN H O   1 
ATOM   2176 C  CB  . GLN B 2 176 ? 16.676  0.288   15.822  1.00 105.50 ? 176 GLN H CB  1 
ATOM   2177 C  CG  . GLN B 2 176 ? 16.429  -0.046  17.270  1.00 105.79 ? 176 GLN H CG  1 
ATOM   2178 C  CD  . GLN B 2 176 ? 17.341  -1.122  17.754  1.00 108.05 ? 176 GLN H CD  1 
ATOM   2179 O  OE1 . GLN B 2 176 ? 16.891  -2.207  18.131  1.00 111.29 ? 176 GLN H OE1 1 
ATOM   2180 N  NE2 . GLN B 2 176 ? 18.642  -0.853  17.714  1.00 105.10 ? 176 GLN H NE2 1 
ATOM   2181 N  N   . SER B 2 177 ? 13.869  2.390   16.306  1.00 104.01 ? 177 SER H N   1 
ATOM   2182 C  CA  . SER B 2 177 ? 13.364  3.590   16.970  1.00 104.89 ? 177 SER H CA  1 
ATOM   2183 C  C   . SER B 2 177 ? 13.717  4.849   16.172  1.00 105.44 ? 177 SER H C   1 
ATOM   2184 O  O   . SER B 2 177 ? 14.370  5.769   16.693  1.00 104.91 ? 177 SER H O   1 
ATOM   2185 C  CB  . SER B 2 177 ? 13.897  3.678   18.417  1.00 102.20 ? 177 SER H CB  1 
ATOM   2186 O  OG  . SER B 2 177 ? 15.317  3.707   18.495  1.00 102.35 ? 177 SER H OG  1 
ATOM   2187 N  N   . ASP B 2 178 ? 13.265  4.880   14.916  1.00 102.94 ? 178 ASP H N   1 
ATOM   2188 C  CA  . ASP B 2 178 ? 13.453  6.032   14.041  1.00 100.22 ? 178 ASP H CA  1 
ATOM   2189 C  C   . ASP B 2 178 ? 14.945  6.345   13.790  1.00 97.91  ? 178 ASP H C   1 
ATOM   2190 O  O   . ASP B 2 178 ? 15.282  7.410   13.271  1.00 96.78  ? 178 ASP H O   1 
ATOM   2191 C  CB  . ASP B 2 178 ? 12.765  7.240   14.675  1.00 101.92 ? 178 ASP H CB  1 
ATOM   2192 C  CG  . ASP B 2 178 ? 11.257  7.108   14.668  1.00 108.03 ? 178 ASP H CG  1 
ATOM   2193 O  OD1 . ASP B 2 178 ? 10.768  6.058   14.194  1.00 112.33 ? 178 ASP H OD1 1 
ATOM   2194 O  OD2 . ASP B 2 178 ? 10.563  8.014   15.184  1.00 105.49 ? 178 ASP H OD2 1 
ATOM   2195 N  N   . LEU B 2 179 ? 15.834  5.416   14.140  1.00 96.59  ? 179 LEU H N   1 
ATOM   2196 C  CA  . LEU B 2 179 ? 17.269  5.594   13.889  1.00 94.67  ? 179 LEU H CA  1 
ATOM   2197 C  C   . LEU B 2 179 ? 17.964  4.396   13.278  1.00 89.63  ? 179 LEU H C   1 
ATOM   2198 O  O   . LEU B 2 179 ? 17.431  3.310   13.236  1.00 90.12  ? 179 LEU H O   1 
ATOM   2199 C  CB  . LEU B 2 179 ? 18.025  5.981   15.162  1.00 94.14  ? 179 LEU H CB  1 
ATOM   2200 C  CG  . LEU B 2 179 ? 17.685  7.312   15.821  1.00 88.66  ? 179 LEU H CG  1 
ATOM   2201 C  CD1 . LEU B 2 179 ? 18.470  7.425   17.101  1.00 85.61  ? 179 LEU H CD1 1 
ATOM   2202 C  CD2 . LEU B 2 179 ? 17.962  8.486   14.900  1.00 83.48  ? 179 LEU H CD2 1 
ATOM   2203 N  N   . TYR B 2 180 ? 19.165  4.612   12.774  1.00 86.90  ? 180 TYR H N   1 
ATOM   2204 C  CA  . TYR B 2 180 ? 19.866  3.540   12.101  1.00 92.10  ? 180 TYR H CA  1 
ATOM   2205 C  C   . TYR B 2 180 ? 20.802  2.825   13.053  1.00 95.79  ? 180 TYR H C   1 
ATOM   2206 O  O   . TYR B 2 180 ? 21.420  3.410   13.958  1.00 94.91  ? 180 TYR H O   1 
ATOM   2207 C  CB  . TYR B 2 180 ? 20.651  4.027   10.878  1.00 91.51  ? 180 TYR H CB  1 
ATOM   2208 C  CG  . TYR B 2 180 ? 19.839  4.491   9.682   1.00 83.14  ? 180 TYR H CG  1 
ATOM   2209 C  CD1 . TYR B 2 180 ? 19.232  3.559   8.869   1.00 80.95  ? 180 TYR H CD1 1 
ATOM   2210 C  CD2 . TYR B 2 180 ? 19.734  5.833   9.339   1.00 77.85  ? 180 TYR H CD2 1 
ATOM   2211 C  CE1 . TYR B 2 180 ? 18.520  3.934   7.761   1.00 86.55  ? 180 TYR H CE1 1 
ATOM   2212 C  CE2 . TYR B 2 180 ? 19.024  6.227   8.239   1.00 79.91  ? 180 TYR H CE2 1 
ATOM   2213 C  CZ  . TYR B 2 180 ? 18.410  5.266   7.442   1.00 85.85  ? 180 TYR H CZ  1 
ATOM   2214 O  OH  . TYR B 2 180 ? 17.682  5.607   6.315   1.00 80.08  ? 180 TYR H OH  1 
ATOM   2215 N  N   . THR B 2 181 ? 20.925  1.533   12.770  1.00 97.37  ? 181 THR H N   1 
ATOM   2216 C  CA  . THR B 2 181 ? 21.816  0.643   13.500  1.00 102.80 ? 181 THR H CA  1 
ATOM   2217 C  C   . THR B 2 181 ? 22.513  -0.288  12.512  1.00 104.15 ? 181 THR H C   1 
ATOM   2218 O  O   . THR B 2 181 ? 21.884  -0.814  11.574  1.00 100.96 ? 181 THR H O   1 
ATOM   2219 C  CB  . THR B 2 181 ? 21.051  -0.167  14.579  1.00 103.84 ? 181 THR H CB  1 
ATOM   2220 O  OG1 . THR B 2 181 ? 20.453  0.736   15.520  1.00 104.77 ? 181 THR H OG1 1 
ATOM   2221 C  CG2 . THR B 2 181 ? 21.990  -1.091  15.338  1.00 105.25 ? 181 THR H CG2 1 
ATOM   2222 N  N   . LEU B 2 182 ? 23.808  -0.504  12.786  1.00 106.08 ? 182 LEU H N   1 
ATOM   2223 C  CA  . LEU B 2 182 ? 24.674  -1.487  12.105  1.00 109.14 ? 182 LEU H CA  1 
ATOM   2224 C  C   . LEU B 2 182 ? 25.647  -2.231  12.994  1.00 113.36 ? 182 LEU H C   1 
ATOM   2225 O  O   . LEU B 2 182 ? 25.887  -1.880  14.163  1.00 108.78 ? 182 LEU H O   1 
ATOM   2226 C  CB  . LEU B 2 182 ? 25.624  -0.829  11.084  1.00 106.21 ? 182 LEU H CB  1 
ATOM   2227 C  CG  . LEU B 2 182 ? 25.373  -0.586  9.613   1.00 104.00 ? 182 LEU H CG  1 
ATOM   2228 C  CD1 . LEU B 2 182 ? 24.410  0.484   9.641   1.00 100.72 ? 182 LEU H CD1 1 
ATOM   2229 C  CD2 . LEU B 2 182 ? 26.638  -0.163  8.862   1.00 102.53 ? 182 LEU H CD2 1 
ATOM   2230 N  N   . SER B 2 183 ? 26.262  -3.221  12.367  1.00 115.96 ? 183 SER H N   1 
ATOM   2231 C  CA  . SER B 2 183 ? 27.225  -4.019  13.056  1.00 115.20 ? 183 SER H CA  1 
ATOM   2232 C  C   . SER B 2 183 ? 28.397  -4.188  12.126  1.00 111.69 ? 183 SER H C   1 
ATOM   2233 O  O   . SER B 2 183 ? 28.240  -4.041  10.900  1.00 111.82 ? 183 SER H O   1 
ATOM   2234 C  CB  . SER B 2 183 ? 26.662  -5.424  13.310  1.00 110.52 ? 183 SER H CB  1 
ATOM   2235 O  OG  . SER B 2 183 ? 25.251  -5.411  13.333  1.00 107.78 ? 183 SER H OG  1 
ATOM   2236 N  N   . SER B 2 184 ? 29.560  -4.491  12.683  1.00 109.75 ? 184 SER H N   1 
ATOM   2237 C  CA  . SER B 2 184 ? 30.692  -4.776  11.823  1.00 108.17 ? 184 SER H CA  1 
ATOM   2238 C  C   . SER B 2 184 ? 31.349  -5.946  12.557  1.00 113.83 ? 184 SER H C   1 
ATOM   2239 O  O   . SER B 2 184 ? 31.623  -5.854  13.762  1.00 119.78 ? 184 SER H O   1 
ATOM   2240 C  CB  . SER B 2 184 ? 31.568  -3.521  11.629  1.00 105.90 ? 184 SER H CB  1 
ATOM   2241 O  OG  . SER B 2 184 ? 32.585  -3.757  10.685  1.00 100.79 ? 184 SER H OG  1 
ATOM   2242 N  N   . SER B 2 185 ? 31.653  -7.021  11.826  1.00 110.94 ? 185 SER H N   1 
ATOM   2243 C  CA  . SER B 2 185 ? 32.440  -8.132  12.383  1.00 111.50 ? 185 SER H CA  1 
ATOM   2244 C  C   . SER B 2 185 ? 33.893  -8.212  11.850  1.00 109.88 ? 185 SER H C   1 
ATOM   2245 O  O   . SER B 2 185 ? 34.173  -7.684  10.780  1.00 105.32 ? 185 SER H O   1 
ATOM   2246 C  CB  . SER B 2 185 ? 31.742  -9.489  12.091  1.00 110.13 ? 185 SER H CB  1 
ATOM   2247 O  OG  . SER B 2 185 ? 30.331  -9.392  12.058  1.00 109.52 ? 185 SER H OG  1 
ATOM   2248 N  N   . VAL B 2 186 ? 34.832  -8.752  12.654  1.00 117.85 ? 186 VAL H N   1 
ATOM   2249 C  CA  . VAL B 2 186 ? 36.183  -9.107  12.097  1.00 117.80 ? 186 VAL H CA  1 
ATOM   2250 C  C   . VAL B 2 186 ? 36.722  -10.453 12.619  1.00 119.42 ? 186 VAL H C   1 
ATOM   2251 O  O   . VAL B 2 186 ? 36.715  -10.722 13.820  1.00 118.99 ? 186 VAL H O   1 
ATOM   2252 C  CB  . VAL B 2 186 ? 37.316  -8.066  12.300  1.00 115.64 ? 186 VAL H CB  1 
ATOM   2253 C  CG1 . VAL B 2 186 ? 37.162  -6.862  11.391  1.00 113.65 ? 186 VAL H CG1 1 
ATOM   2254 C  CG2 . VAL B 2 186 ? 37.416  -7.675  13.688  1.00 117.41 ? 186 VAL H CG2 1 
ATOM   2255 N  N   . THR B 2 187 ? 37.234  -11.281 11.715  1.00 121.29 ? 187 THR H N   1 
ATOM   2256 C  CA  . THR B 2 187 ? 37.770  -12.591 12.088  1.00 124.01 ? 187 THR H CA  1 
ATOM   2257 C  C   . THR B 2 187 ? 39.262  -12.431 11.863  1.00 122.97 ? 187 THR H C   1 
ATOM   2258 O  O   . THR B 2 187 ? 39.698  -11.993 10.802  1.00 120.68 ? 187 THR H O   1 
ATOM   2259 C  CB  . THR B 2 187 ? 37.271  -13.742 11.234  1.00 122.73 ? 187 THR H CB  1 
ATOM   2260 O  OG1 . THR B 2 187 ? 35.843  -13.828 11.269  1.00 125.81 ? 187 THR H OG1 1 
ATOM   2261 C  CG2 . THR B 2 187 ? 37.892  -15.038 11.708  1.00 118.29 ? 187 THR H CG2 1 
ATOM   2262 N  N   . VAL B 2 188 ? 40.016  -12.768 12.902  1.00 129.70 ? 188 VAL H N   1 
ATOM   2263 C  CA  . VAL B 2 188 ? 41.450  -12.568 12.948  1.00 127.11 ? 188 VAL H CA  1 
ATOM   2264 C  C   . VAL B 2 188 ? 42.224  -13.732 13.601  1.00 126.63 ? 188 VAL H C   1 
ATOM   2265 O  O   . VAL B 2 188 ? 41.610  -14.490 14.371  1.00 129.09 ? 188 VAL H O   1 
ATOM   2266 C  CB  . VAL B 2 188 ? 41.675  -11.226 13.829  1.00 125.43 ? 188 VAL H CB  1 
ATOM   2267 C  CG1 . VAL B 2 188 ? 43.013  -11.127 14.587  1.00 125.96 ? 188 VAL H CG1 1 
ATOM   2268 C  CG2 . VAL B 2 188 ? 41.310  -9.907  13.097  1.00 123.28 ? 188 VAL H CG2 1 
ATOM   2269 N  N   . PRO B 2 189 ? 43.574  -13.851 13.346  1.00 127.95 ? 189 PRO H N   1 
ATOM   2270 C  CA  . PRO B 2 189 ? 44.458  -14.811 14.071  1.00 124.87 ? 189 PRO H CA  1 
ATOM   2271 C  C   . PRO B 2 189 ? 44.575  -14.492 15.549  1.00 117.73 ? 189 PRO H C   1 
ATOM   2272 O  O   . PRO B 2 189 ? 44.668  -13.290 15.885  1.00 112.18 ? 189 PRO H O   1 
ATOM   2273 C  CB  . PRO B 2 189 ? 45.812  -14.693 13.332  1.00 122.68 ? 189 PRO H CB  1 
ATOM   2274 C  CG  . PRO B 2 189 ? 45.389  -14.177 12.035  1.00 121.58 ? 189 PRO H CG  1 
ATOM   2275 C  CD  . PRO B 2 189 ? 44.254  -13.280 12.176  1.00 125.55 ? 189 PRO H CD  1 
ATOM   2276 N  N   . SER B 2 190 ? 44.561  -15.507 16.431  1.00 121.34 ? 190 SER H N   1 
ATOM   2277 C  CA  . SER B 2 190 ? 44.677  -15.278 17.893  1.00 119.24 ? 190 SER H CA  1 
ATOM   2278 C  C   . SER B 2 190 ? 46.066  -14.691 18.263  1.00 108.48 ? 190 SER H C   1 
ATOM   2279 O  O   . SER B 2 190 ? 46.185  -14.023 19.299  1.00 100.75 ? 190 SER H O   1 
ATOM   2280 C  CB  . SER B 2 190 ? 44.296  -16.548 18.727  1.00 119.98 ? 190 SER H CB  1 
ATOM   2281 O  OG  . SER B 2 190 ? 43.718  -16.156 20.007  1.00 131.53 ? 190 SER H OG  1 
ATOM   2282 N  N   . SER B 2 191 ? 47.066  -14.875 17.389  1.00 106.42 ? 191 SER H N   1 
ATOM   2283 C  CA  . SER B 2 191 ? 48.384  -14.280 17.630  1.00 101.52 ? 191 SER H CA  1 
ATOM   2284 C  C   . SER B 2 191 ? 48.465  -12.771 17.644  1.00 96.20  ? 191 SER H C   1 
ATOM   2285 O  O   . SER B 2 191 ? 49.411  -12.233 18.229  1.00 82.05  ? 191 SER H O   1 
ATOM   2286 C  CB  . SER B 2 191 ? 49.376  -14.763 16.561  1.00 96.41  ? 191 SER H CB  1 
ATOM   2287 O  OG  . SER B 2 191 ? 50.284  -13.731 16.167  1.00 86.22  ? 191 SER H OG  1 
ATOM   2288 N  N   . THR B 2 192 ? 47.501  -12.112 16.991  1.00 104.43 ? 192 THR H N   1 
ATOM   2289 C  CA  . THR B 2 192 ? 47.513  -10.656 16.916  1.00 101.09 ? 192 THR H CA  1 
ATOM   2290 C  C   . THR B 2 192 ? 46.594  -9.951  17.921  1.00 103.89 ? 192 THR H C   1 
ATOM   2291 O  O   . THR B 2 192 ? 46.772  -8.764  18.148  1.00 104.05 ? 192 THR H O   1 
ATOM   2292 C  CB  . THR B 2 192 ? 47.123  -10.159 15.507  1.00 106.23 ? 192 THR H CB  1 
ATOM   2293 O  OG1 . THR B 2 192 ? 45.774  -10.545 15.231  1.00 105.28 ? 192 THR H OG1 1 
ATOM   2294 C  CG2 . THR B 2 192 ? 48.061  -10.731 14.449  1.00 99.08  ? 192 THR H CG2 1 
ATOM   2295 N  N   . TRP B 2 193 ? 45.608  -10.646 18.500  1.00 107.70 ? 193 TRP H N   1 
ATOM   2296 C  CA  . TRP B 2 193 ? 44.755  -9.993  19.505  1.00 104.68 ? 193 TRP H CA  1 
ATOM   2297 C  C   . TRP B 2 193 ? 44.398  -11.060 20.547  1.00 104.87 ? 193 TRP H C   1 
ATOM   2298 O  O   . TRP B 2 193 ? 44.118  -12.211 20.194  1.00 105.31 ? 193 TRP H O   1 
ATOM   2299 C  CB  . TRP B 2 193 ? 43.507  -9.325  18.889  1.00 106.82 ? 193 TRP H CB  1 
ATOM   2300 C  CG  . TRP B 2 193 ? 42.685  -8.483  19.884  1.00 109.54 ? 193 TRP H CG  1 
ATOM   2301 C  CD1 . TRP B 2 193 ? 42.841  -7.139  20.128  1.00 111.26 ? 193 TRP H CD1 1 
ATOM   2302 C  CD2 . TRP B 2 193 ? 41.583  -8.905  20.711  1.00 108.33 ? 193 TRP H CD2 1 
ATOM   2303 N  NE1 . TRP B 2 193 ? 41.937  -6.717  21.078  1.00 109.09 ? 193 TRP H NE1 1 
ATOM   2304 C  CE2 . TRP B 2 193 ? 41.152  -7.778  21.446  1.00 108.80 ? 193 TRP H CE2 1 
ATOM   2305 C  CE3 . TRP B 2 193 ? 40.931  -10.124 20.913  1.00 108.45 ? 193 TRP H CE3 1 
ATOM   2306 C  CZ2 . TRP B 2 193 ? 40.099  -7.839  22.356  1.00 114.02 ? 193 TRP H CZ2 1 
ATOM   2307 C  CZ3 . TRP B 2 193 ? 39.882  -10.180 21.830  1.00 110.25 ? 193 TRP H CZ3 1 
ATOM   2308 C  CH2 . TRP B 2 193 ? 39.477  -9.044  22.532  1.00 115.42 ? 193 TRP H CH2 1 
ATOM   2309 N  N   . PRO B 2 194 ? 44.468  -10.699 21.829  1.00 102.90 ? 194 PRO H N   1 
ATOM   2310 C  CA  . PRO B 2 194 ? 44.753  -9.334  22.268  1.00 104.45 ? 194 PRO H CA  1 
ATOM   2311 C  C   . PRO B 2 194 ? 46.270  -9.120  22.469  1.00 103.64 ? 194 PRO H C   1 
ATOM   2312 O  O   . PRO B 2 194 ? 46.697  -8.229  23.232  1.00 97.11  ? 194 PRO H O   1 
ATOM   2313 C  CB  . PRO B 2 194 ? 43.929  -9.221  23.556  1.00 104.57 ? 194 PRO H CB  1 
ATOM   2314 C  CG  . PRO B 2 194 ? 43.952  -10.608 24.119  1.00 102.83 ? 194 PRO H CG  1 
ATOM   2315 C  CD  . PRO B 2 194 ? 43.920  -11.536 22.919  1.00 98.71  ? 194 PRO H CD  1 
ATOM   2316 N  N   . SER B 2 195 ? 47.063  -9.956  21.812  1.00 100.09 ? 195 SER H N   1 
ATOM   2317 C  CA  . SER B 2 195 ? 48.517  -9.899  21.915  1.00 95.78  ? 195 SER H CA  1 
ATOM   2318 C  C   . SER B 2 195 ? 49.072  -8.546  21.440  1.00 97.20  ? 195 SER H C   1 
ATOM   2319 O  O   . SER B 2 195 ? 49.992  -7.984  22.059  1.00 98.67  ? 195 SER H O   1 
ATOM   2320 C  CB  . SER B 2 195 ? 49.097  -11.035 21.034  1.00 90.79  ? 195 SER H CB  1 
ATOM   2321 O  OG  . SER B 2 195 ? 49.164  -12.304 21.652  1.00 79.72  ? 195 SER H OG  1 
ATOM   2322 N  N   . GLU B 2 196 ? 48.526  -8.041  20.333  1.00 100.95 ? 196 GLU H N   1 
ATOM   2323 C  CA  . GLU B 2 196 ? 48.626  -6.632  19.911  1.00 103.75 ? 196 GLU H CA  1 
ATOM   2324 C  C   . GLU B 2 196 ? 47.218  -5.988  19.616  1.00 106.12 ? 196 GLU H C   1 
ATOM   2325 O  O   . GLU B 2 196 ? 46.194  -6.669  19.649  1.00 105.94 ? 196 GLU H O   1 
ATOM   2326 C  CB  . GLU B 2 196 ? 49.718  -6.510  18.822  1.00 96.74  ? 196 GLU H CB  1 
ATOM   2327 C  CG  . GLU B 2 196 ? 49.824  -7.622  17.766  1.00 87.27  ? 196 GLU H CG  1 
ATOM   2328 C  CD  . GLU B 2 196 ? 50.496  -8.930  18.339  1.00 85.68  ? 196 GLU H CD  1 
ATOM   2329 O  OE1 . GLU B 2 196 ? 51.277  -8.910  19.336  1.00 65.81  ? 196 GLU H OE1 1 
ATOM   2330 O  OE2 . GLU B 2 196 ? 50.280  -10.000 17.743  1.00 85.58  ? 196 GLU H OE2 1 
ATOM   2331 N  N   . THR B 2 197 ? 47.174  -4.689  19.297  1.00 107.38 ? 197 THR H N   1 
ATOM   2332 C  CA  . THR B 2 197 ? 45.911  -3.911  19.303  1.00 113.47 ? 197 THR H CA  1 
ATOM   2333 C  C   . THR B 2 197 ? 45.035  -4.199  18.051  1.00 117.15 ? 197 THR H C   1 
ATOM   2334 O  O   . THR B 2 197 ? 45.559  -4.257  16.935  1.00 118.13 ? 197 THR H O   1 
ATOM   2335 C  CB  . THR B 2 197 ? 46.180  -2.382  19.493  1.00 118.30 ? 197 THR H CB  1 
ATOM   2336 O  OG1 . THR B 2 197 ? 46.759  -1.819  18.310  1.00 121.52 ? 197 THR H OG1 1 
ATOM   2337 C  CG2 . THR B 2 197 ? 47.111  -2.131  20.693  1.00 117.08 ? 197 THR H CG2 1 
ATOM   2338 N  N   . VAL B 2 198 ? 43.716  -4.364  18.244  1.00 117.17 ? 198 VAL H N   1 
ATOM   2339 C  CA  . VAL B 2 198 ? 42.717  -4.391  17.145  1.00 120.14 ? 198 VAL H CA  1 
ATOM   2340 C  C   . VAL B 2 198 ? 41.700  -3.275  17.320  1.00 122.84 ? 198 VAL H C   1 
ATOM   2341 O  O   . VAL B 2 198 ? 41.058  -3.125  18.357  1.00 120.44 ? 198 VAL H O   1 
ATOM   2342 C  CB  . VAL B 2 198 ? 41.933  -5.714  17.066  1.00 115.49 ? 198 VAL H CB  1 
ATOM   2343 C  CG1 . VAL B 2 198 ? 40.720  -5.556  16.145  1.00 117.32 ? 198 VAL H CG1 1 
ATOM   2344 C  CG2 . VAL B 2 198 ? 42.810  -6.831  16.587  1.00 114.50 ? 198 VAL H CG2 1 
ATOM   2345 N  N   . THR B 2 199 ? 41.666  -2.413  16.317  1.00 122.84 ? 199 THR H N   1 
ATOM   2346 C  CA  . THR B 2 199 ? 40.865  -1.199  16.365  1.00 125.47 ? 199 THR H CA  1 
ATOM   2347 C  C   . THR B 2 199 ? 39.885  -0.869  15.175  1.00 122.93 ? 199 THR H C   1 
ATOM   2348 O  O   . THR B 2 199 ? 40.242  -1.102  14.007  1.00 120.23 ? 199 THR H O   1 
ATOM   2349 C  CB  . THR B 2 199 ? 41.870  -0.080  16.467  1.00 121.93 ? 199 THR H CB  1 
ATOM   2350 O  OG1 . THR B 2 199 ? 42.689  -0.150  15.304  1.00 124.78 ? 199 THR H OG1 1 
ATOM   2351 C  CG2 . THR B 2 199 ? 42.877  -0.384  17.590  1.00 119.41 ? 199 THR H CG2 1 
ATOM   2352 N  N   . CYS B 2 200 ? 38.658  -0.402  15.473  1.00 121.57 ? 200 CYS H N   1 
ATOM   2353 C  CA  . CYS B 2 200 ? 37.720  0.114   14.418  1.00 122.35 ? 200 CYS H CA  1 
ATOM   2354 C  C   . CYS B 2 200 ? 37.635  1.598   14.307  1.00 123.72 ? 200 CYS H C   1 
ATOM   2355 O  O   . CYS B 2 200 ? 37.549  2.199   15.367  1.00 124.09 ? 200 CYS H O   1 
ATOM   2356 C  CB  . CYS B 2 200 ? 36.319  -0.447  14.667  1.00 20.00  ? 200 CYS H CB  1 
ATOM   2357 S  SG  . CYS B 2 200 ? 36.201  -2.245  14.540  1.00 20.00  ? 200 CYS H SG  1 
ATOM   2358 N  N   . ASN B 2 201 ? 37.692  2.221   13.124  1.00 123.73 ? 201 ASN H N   1 
ATOM   2359 C  CA  . ASN B 2 201 ? 37.570  3.690   13.057  1.00 121.19 ? 201 ASN H CA  1 
ATOM   2360 C  C   . ASN B 2 201 ? 36.238  3.936   12.329  1.00 118.62 ? 201 ASN H C   1 
ATOM   2361 O  O   . ASN B 2 201 ? 36.079  3.488   11.186  1.00 118.50 ? 201 ASN H O   1 
ATOM   2362 C  CB  . ASN B 2 201 ? 38.804  4.352   12.420  1.00 121.49 ? 201 ASN H CB  1 
ATOM   2363 C  CG  . ASN B 2 201 ? 40.125  3.639   12.798  1.00 122.17 ? 201 ASN H CG  1 
ATOM   2364 O  OD1 . ASN B 2 201 ? 40.893  4.072   13.675  1.00 128.00 ? 201 ASN H OD1 1 
ATOM   2365 N  ND2 . ASN B 2 201 ? 40.355  2.528   12.167  1.00 119.20 ? 201 ASN H ND2 1 
ATOM   2366 N  N   . VAL B 2 202 ? 35.294  4.627   12.979  1.00 119.97 ? 202 VAL H N   1 
ATOM   2367 C  CA  . VAL B 2 202 ? 33.939  4.814   12.416  1.00 111.95 ? 202 VAL H CA  1 
ATOM   2368 C  C   . VAL B 2 202 ? 33.583  6.289   12.185  1.00 109.12 ? 202 VAL H C   1 
ATOM   2369 O  O   . VAL B 2 202 ? 33.569  7.121   13.115  1.00 107.35 ? 202 VAL H O   1 
ATOM   2370 C  CB  . VAL B 2 202 ? 32.834  4.105   13.284  1.00 106.59 ? 202 VAL H CB  1 
ATOM   2371 C  CG1 . VAL B 2 202 ? 33.109  2.600   13.397  1.00 103.85 ? 202 VAL H CG1 1 
ATOM   2372 C  CG2 . VAL B 2 202 ? 32.679  4.714   14.659  1.00 113.16 ? 202 VAL H CG2 1 
ATOM   2373 N  N   . ALA B 2 203 ? 33.348  6.619   10.914  1.00 106.18 ? 203 ALA H N   1 
ATOM   2374 C  CA  . ALA B 2 203 ? 32.969  7.980   10.570  1.00 107.76 ? 203 ALA H CA  1 
ATOM   2375 C  C   . ALA B 2 203 ? 31.497  8.157   10.231  1.00 104.95 ? 203 ALA H C   1 
ATOM   2376 O  O   . ALA B 2 203 ? 30.895  7.416   9.436   1.00 98.79  ? 203 ALA H O   1 
ATOM   2377 C  CB  . ALA B 2 203 ? 33.799  8.466   9.414   1.00 102.92 ? 203 ALA H CB  1 
ATOM   2378 N  N   . HIS B 2 204 ? 30.910  9.149   10.882  1.00 104.76 ? 204 HIS H N   1 
ATOM   2379 C  CA  . HIS B 2 204 ? 29.605  9.565   10.513  1.00 99.77  ? 204 HIS H CA  1 
ATOM   2380 C  C   . HIS B 2 204 ? 29.742  11.064  10.215  1.00 100.81 ? 204 HIS H C   1 
ATOM   2381 O  O   . HIS B 2 204 ? 29.634  11.902  11.124  1.00 103.22 ? 204 HIS H O   1 
ATOM   2382 C  CB  . HIS B 2 204 ? 28.608  9.257   11.612  1.00 103.76 ? 204 HIS H CB  1 
ATOM   2383 C  CG  . HIS B 2 204 ? 27.201  9.488   11.189  1.00 103.82 ? 204 HIS H CG  1 
ATOM   2384 N  ND1 . HIS B 2 204 ? 26.663  10.746  11.036  1.00 101.87 ? 204 HIS H ND1 1 
ATOM   2385 C  CD2 . HIS B 2 204 ? 26.243  8.613   10.801  1.00 97.88  ? 204 HIS H CD2 1 
ATOM   2386 C  CE1 . HIS B 2 204 ? 25.419  10.634  10.605  1.00 100.76 ? 204 HIS H CE1 1 
ATOM   2387 N  NE2 . HIS B 2 204 ? 25.140  9.351   10.455  1.00 96.58  ? 204 HIS H NE2 1 
ATOM   2388 N  N   . PRO B 2 205 ? 30.097  11.388  8.962   1.00 101.68 ? 205 PRO H N   1 
ATOM   2389 C  CA  . PRO B 2 205 ? 30.375  12.741  8.459   1.00 104.17 ? 205 PRO H CA  1 
ATOM   2390 C  C   . PRO B 2 205 ? 29.303  13.794  8.763   1.00 107.52 ? 205 PRO H C   1 
ATOM   2391 O  O   . PRO B 2 205 ? 29.642  14.939  9.066   1.00 112.00 ? 205 PRO H O   1 
ATOM   2392 C  CB  . PRO B 2 205 ? 30.521  12.535  6.935   1.00 96.42  ? 205 PRO H CB  1 
ATOM   2393 C  CG  . PRO B 2 205 ? 30.113  11.120  6.660   1.00 97.21  ? 205 PRO H CG  1 
ATOM   2394 C  CD  . PRO B 2 205 ? 30.345  10.368  7.928   1.00 102.68 ? 205 PRO H CD  1 
ATOM   2395 N  N   . ALA B 2 206 ? 28.032  13.408  8.678   1.00 104.62 ? 206 ALA H N   1 
ATOM   2396 C  CA  . ALA B 2 206 ? 26.933  14.349  8.844   1.00 101.92 ? 206 ALA H CA  1 
ATOM   2397 C  C   . ALA B 2 206 ? 26.816  14.932  10.247  1.00 107.61 ? 206 ALA H C   1 
ATOM   2398 O  O   . ALA B 2 206 ? 26.436  16.098  10.407  1.00 108.23 ? 206 ALA H O   1 
ATOM   2399 C  CB  . ALA B 2 206 ? 25.625  13.667  8.465   1.00 103.98 ? 206 ALA H CB  1 
ATOM   2400 N  N   . SER B 2 207 ? 27.212  14.148  11.246  1.00 107.00 ? 207 SER H N   1 
ATOM   2401 C  CA  . SER B 2 207 ? 27.189  14.557  12.654  1.00 106.27 ? 207 SER H CA  1 
ATOM   2402 C  C   . SER B 2 207 ? 28.559  14.993  13.162  1.00 110.97 ? 207 SER H C   1 
ATOM   2403 O  O   . SER B 2 207 ? 28.775  15.231  14.363  1.00 109.48 ? 207 SER H O   1 
ATOM   2404 C  CB  . SER B 2 207 ? 26.663  13.394  13.502  1.00 104.87 ? 207 SER H CB  1 
ATOM   2405 O  OG  . SER B 2 207 ? 27.565  12.291  13.476  1.00 103.05 ? 207 SER H OG  1 
ATOM   2406 N  N   . SER B 2 208 ? 29.472  15.077  12.197  1.00 109.11 ? 208 SER H N   1 
ATOM   2407 C  CA  . SER B 2 208 ? 30.897  15.361  12.317  1.00 109.96 ? 208 SER H CA  1 
ATOM   2408 C  C   . SER B 2 208 ? 31.551  14.438  13.347  1.00 112.24 ? 208 SER H C   1 
ATOM   2409 O  O   . SER B 2 208 ? 32.300  14.909  14.216  1.00 114.97 ? 208 SER H O   1 
ATOM   2410 C  CB  . SER B 2 208 ? 31.096  16.805  12.800  1.00 111.71 ? 208 SER H CB  1 
ATOM   2411 O  OG  . SER B 2 208 ? 30.208  17.721  12.170  1.00 109.78 ? 208 SER H OG  1 
ATOM   2412 N  N   . THR B 2 209 ? 31.262  13.145  13.279  1.00 109.01 ? 209 THR H N   1 
ATOM   2413 C  CA  . THR B 2 209 ? 31.794  12.221  14.282  1.00 109.41 ? 209 THR H CA  1 
ATOM   2414 C  C   . THR B 2 209 ? 32.825  11.299  13.635  1.00 107.86 ? 209 THR H C   1 
ATOM   2415 O  O   . THR B 2 209 ? 32.573  10.762  12.563  1.00 107.67 ? 209 THR H O   1 
ATOM   2416 C  CB  . THR B 2 209 ? 30.665  11.426  15.011  1.00 113.23 ? 209 THR H CB  1 
ATOM   2417 O  OG1 . THR B 2 209 ? 30.243  12.163  16.171  1.00 112.74 ? 209 THR H OG1 1 
ATOM   2418 C  CG2 . THR B 2 209 ? 31.121  10.034  15.418  1.00 109.44 ? 209 THR H CG2 1 
ATOM   2419 N  N   . LYS B 2 210 ? 33.939  11.049  14.320  1.00 116.50 ? 210 LYS H N   1 
ATOM   2420 C  CA  . LYS B 2 210 ? 34.923  10.141  13.753  1.00 115.46 ? 210 LYS H CA  1 
ATOM   2421 C  C   . LYS B 2 210 ? 35.514  9.564   15.033  1.00 114.68 ? 210 LYS H C   1 
ATOM   2422 O  O   . LYS B 2 210 ? 36.188  10.285  15.781  1.00 106.04 ? 210 LYS H O   1 
ATOM   2423 C  CB  . LYS B 2 210 ? 35.951  10.866  12.880  1.00 110.73 ? 210 LYS H CB  1 
ATOM   2424 C  CG  . LYS B 2 210 ? 36.943  9.978   12.092  1.00 114.05 ? 210 LYS H CG  1 
ATOM   2425 C  CD  . LYS B 2 210 ? 36.198  8.686   11.749  1.00 114.46 ? 210 LYS H CD  1 
ATOM   2426 C  CE  . LYS B 2 210 ? 37.041  7.525   11.242  1.00 115.30 ? 210 LYS H CE  1 
ATOM   2427 N  NZ  . LYS B 2 210 ? 37.489  7.751   9.802   1.00 103.25 ? 210 LYS H NZ  1 
ATOM   2428 N  N   . VAL B 2 211 ? 35.243  8.285   15.308  1.00 117.83 ? 211 VAL H N   1 
ATOM   2429 C  CA  . VAL B 2 211 ? 35.664  7.715   16.594  1.00 118.62 ? 211 VAL H CA  1 
ATOM   2430 C  C   . VAL B 2 211 ? 36.494  6.459   16.396  1.00 123.14 ? 211 VAL H C   1 
ATOM   2431 O  O   . VAL B 2 211 ? 36.131  5.571   15.606  1.00 119.16 ? 211 VAL H O   1 
ATOM   2432 C  CB  . VAL B 2 211 ? 34.440  7.334   17.489  1.00 115.73 ? 211 VAL H CB  1 
ATOM   2433 C  CG1 . VAL B 2 211 ? 34.878  6.657   18.791  1.00 121.96 ? 211 VAL H CG1 1 
ATOM   2434 C  CG2 . VAL B 2 211 ? 33.560  8.539   17.766  1.00 114.35 ? 211 VAL H CG2 1 
ATOM   2435 N  N   . ASP B 2 212 ? 37.578  6.371   17.181  1.00 125.45 ? 212 ASP H N   1 
ATOM   2436 C  CA  . ASP B 2 212 ? 38.403  5.180   17.207  1.00 124.38 ? 212 ASP H CA  1 
ATOM   2437 C  C   . ASP B 2 212 ? 38.080  4.391   18.466  1.00 127.24 ? 212 ASP H C   1 
ATOM   2438 O  O   . ASP B 2 212 ? 37.930  4.935   19.572  1.00 124.31 ? 212 ASP H O   1 
ATOM   2439 C  CB  . ASP B 2 212 ? 39.874  5.540   17.165  1.00 119.97 ? 212 ASP H CB  1 
ATOM   2440 C  CG  . ASP B 2 212 ? 40.241  6.201   15.877  1.00 122.53 ? 212 ASP H CG  1 
ATOM   2441 O  OD1 . ASP B 2 212 ? 39.547  5.923   14.882  1.00 122.43 ? 212 ASP H OD1 1 
ATOM   2442 O  OD2 . ASP B 2 212 ? 41.243  6.950   15.841  1.00 124.77 ? 212 ASP H OD2 1 
ATOM   2443 N  N   . LYS B 2 213 ? 37.918  3.093   18.267  1.00 125.15 ? 213 LYS H N   1 
ATOM   2444 C  CA  . LYS B 2 213 ? 37.691  2.198   19.387  1.00 118.96 ? 213 LYS H CA  1 
ATOM   2445 C  C   . LYS B 2 213 ? 38.620  0.995   19.491  1.00 125.56 ? 213 LYS H C   1 
ATOM   2446 O  O   . LYS B 2 213 ? 38.617  0.111   18.571  1.00 122.90 ? 213 LYS H O   1 
ATOM   2447 C  CB  . LYS B 2 213 ? 36.246  1.698   19.342  1.00 20.00  ? 213 LYS H CB  1 
ATOM   2448 C  CG  . LYS B 2 213 ? 35.204  2.800   19.450  1.00 20.00  ? 213 LYS H CG  1 
ATOM   2449 C  CD  . LYS B 2 213 ? 35.279  3.503   20.795  1.00 20.00  ? 213 LYS H CD  1 
ATOM   2450 C  CE  . LYS B 2 213 ? 34.190  4.554   20.932  1.00 20.00  ? 213 LYS H CE  1 
ATOM   2451 N  NZ  . LYS B 2 213 ? 34.266  5.267   22.236  1.00 20.00  ? 213 LYS H NZ  1 
ATOM   2452 N  N   . LYS B 2 214 ? 39.536  1.048   20.463  1.00 128.50 ? 214 LYS H N   1 
ATOM   2453 C  CA  . LYS B 2 214 ? 40.379  -0.104  20.691  1.00 125.95 ? 214 LYS H CA  1 
ATOM   2454 C  C   . LYS B 2 214 ? 39.482  -1.107  21.434  1.00 124.12 ? 214 LYS H C   1 
ATOM   2455 O  O   . LYS B 2 214 ? 38.796  -0.743  22.405  1.00 115.04 ? 214 LYS H O   1 
ATOM   2456 C  CB  . LYS B 2 214 ? 41.601  0.315   21.557  1.00 121.59 ? 214 LYS H CB  1 
ATOM   2457 C  CG  . LYS B 2 214 ? 42.785  0.999   20.842  1.00 121.29 ? 214 LYS H CG  1 
ATOM   2458 C  CD  . LYS B 2 214 ? 42.342  1.916   19.744  1.00 123.90 ? 214 LYS H CD  1 
ATOM   2459 C  CE  . LYS B 2 214 ? 43.497  2.617   19.009  1.00 124.12 ? 214 LYS H CE  1 
ATOM   2460 N  NZ  . LYS B 2 214 ? 42.937  3.261   17.774  1.00 126.57 ? 214 LYS H NZ  1 
ATOM   2461 N  N   . ILE B 2 215 ? 39.372  -2.342  20.943  1.00 125.10 ? 215 ILE H N   1 
ATOM   2462 C  CA  . ILE B 2 215 ? 38.584  -3.398  21.651  1.00 120.96 ? 215 ILE H CA  1 
ATOM   2463 C  C   . ILE B 2 215 ? 39.424  -4.275  22.553  1.00 121.87 ? 215 ILE H C   1 
ATOM   2464 O  O   . ILE B 2 215 ? 40.303  -4.960  22.070  1.00 115.76 ? 215 ILE H O   1 
ATOM   2465 C  CB  . ILE B 2 215 ? 37.741  -4.236  20.642  1.00 119.83 ? 215 ILE H CB  1 
ATOM   2466 C  CG1 . ILE B 2 215 ? 38.546  -4.378  19.374  1.00 123.07 ? 215 ILE H CG1 1 
ATOM   2467 C  CG2 . ILE B 2 215 ? 36.444  -3.534  20.187  1.00 120.34 ? 215 ILE H CG2 1 
ATOM   2468 C  CD1 . ILE B 2 215 ? 37.814  -4.875  18.171  1.00 127.45 ? 215 ILE H CD1 1 
ATOM   2469 N  N   . VAL B 2 216 ? 39.137  -4.241  23.844  1.00 125.55 ? 216 VAL H N   1 
ATOM   2470 C  CA  . VAL B 2 216 ? 39.896  -5.017  24.847  1.00 125.91 ? 216 VAL H CA  1 
ATOM   2471 C  C   . VAL B 2 216 ? 38.743  -5.885  25.461  1.00 124.99 ? 216 VAL H C   1 
ATOM   2472 O  O   . VAL B 2 216 ? 37.655  -5.350  25.652  1.00 127.19 ? 216 VAL H O   1 
ATOM   2473 C  CB  . VAL B 2 216 ? 40.601  -4.158  25.912  1.00 20.00  ? 216 VAL H CB  1 
ATOM   2474 C  CG1 . VAL B 2 216 ? 41.143  -5.034  27.031  1.00 20.00  ? 216 VAL H CG1 1 
ATOM   2475 C  CG2 . VAL B 2 216 ? 41.716  -3.337  25.282  1.00 20.00  ? 216 VAL H CG2 1 
ATOM   2476 N  N   . PRO B 2 217 ? 38.990  -7.197  25.782  1.00 126.04 ? 217 PRO H N   1 
ATOM   2477 C  CA  . PRO B 2 217 ? 37.985  -8.191  26.312  1.00 130.11 ? 217 PRO H CA  1 
ATOM   2478 C  C   . PRO B 2 217 ? 37.015  -8.004  27.511  1.00 133.58 ? 217 PRO H C   1 
ATOM   2479 O  O   . PRO B 2 217 ? 37.175  -7.177  28.408  1.00 132.43 ? 217 PRO H O   1 
ATOM   2480 C  CB  . PRO B 2 217 ? 38.881  -9.381  26.733  1.00 132.43 ? 217 PRO H CB  1 
ATOM   2481 C  CG  . PRO B 2 217 ? 40.030  -9.294  25.915  1.00 127.40 ? 217 PRO H CG  1 
ATOM   2482 C  CD  . PRO B 2 217 ? 40.347  -7.829  25.691  1.00 123.51 ? 217 PRO H CD  1 
ATOM   2483 N  N   . ARG B 2 218 ? 35.948  -8.802  27.400  1.00 137.14 ? 218 ARG H N   1 
ATOM   2484 C  CA  . ARG B 2 218 ? 34.831  -8.863  28.359  1.00 142.32 ? 218 ARG H CA  1 
ATOM   2485 C  C   . ARG B 2 218 ? 34.006  -7.590  28.438  1.00 144.48 ? 218 ARG H C   1 
ATOM   2486 O  O   . ARG B 2 218 ? 32.926  -7.523  27.854  1.00 142.35 ? 218 ARG H O   1 
ATOM   2487 C  CB  . ARG B 2 218 ? 35.367  -9.166  29.762  1.00 138.31 ? 218 ARG H CB  1 
ATOM   2488 C  CG  . ARG B 2 218 ? 34.243  -9.352  30.747  1.00 139.12 ? 218 ARG H CG  1 
ATOM   2489 C  CD  . ARG B 2 218 ? 34.708  -9.349  32.187  1.00 137.92 ? 218 ARG H CD  1 
ATOM   2490 N  NE  . ARG B 2 218 ? 33.541  -9.554  33.037  1.00 134.41 ? 218 ARG H NE  1 
ATOM   2491 C  CZ  . ARG B 2 218 ? 33.532  -9.433  34.357  1.00 141.57 ? 218 ARG H CZ  1 
ATOM   2492 N  NH1 . ARG B 2 218 ? 34.613  -9.019  35.021  1.00 142.26 ? 218 ARG H NH1 1 
ATOM   2493 N  NH2 . ARG B 2 218 ? 32.403  -9.639  35.009  1.00 140.47 ? 218 ARG H NH2 1 
ATOM   2494 N  N   . ASP C 3 1   ? -5.097  -5.056  -15.817 1.00 49.57  ? 1   ASP L N   1 
ATOM   2495 C  CA  . ASP C 3 1   ? -3.642  -5.074  -15.693 1.00 61.37  ? 1   ASP L CA  1 
ATOM   2496 C  C   . ASP C 3 1   ? -3.003  -6.375  -16.238 1.00 62.30  ? 1   ASP L C   1 
ATOM   2497 O  O   . ASP C 3 1   ? -3.475  -7.482  -15.932 1.00 58.32  ? 1   ASP L O   1 
ATOM   2498 C  CB  . ASP C 3 1   ? -3.249  -4.883  -14.233 1.00 49.37  ? 1   ASP L CB  1 
ATOM   2499 C  CG  . ASP C 3 1   ? -3.331  -3.434  -13.796 1.00 52.32  ? 1   ASP L CG  1 
ATOM   2500 O  OD1 . ASP C 3 1   ? -4.211  -2.698  -14.290 1.00 53.96  ? 1   ASP L OD1 1 
ATOM   2501 O  OD2 . ASP C 3 1   ? -2.535  -3.028  -12.937 1.00 56.14  ? 1   ASP L OD2 1 
ATOM   2502 N  N   . ILE C 3 2   ? -1.939  -6.254  -17.038 1.00 54.78  ? 2   ILE L N   1 
ATOM   2503 C  CA  . ILE C 3 2   ? -1.224  -7.457  -17.435 1.00 52.65  ? 2   ILE L CA  1 
ATOM   2504 C  C   . ILE C 3 2   ? -0.270  -7.843  -16.306 1.00 55.34  ? 2   ILE L C   1 
ATOM   2505 O  O   . ILE C 3 2   ? 0.644   -7.110  -15.966 1.00 54.19  ? 2   ILE L O   1 
ATOM   2506 C  CB  . ILE C 3 2   ? -0.480  -7.222  -18.744 1.00 53.01  ? 2   ILE L CB  1 
ATOM   2507 C  CG1 . ILE C 3 2   ? -1.490  -6.874  -19.840 1.00 57.75  ? 2   ILE L CG1 1 
ATOM   2508 C  CG2 . ILE C 3 2   ? 0.222   -8.461  -19.173 1.00 55.91  ? 2   ILE L CG2 1 
ATOM   2509 C  CD1 . ILE C 3 2   ? -0.864  -6.355  -21.089 1.00 47.95  ? 2   ILE L CD1 1 
ATOM   2510 N  N   . VAL C 3 3   ? -0.465  -9.024  -15.743 1.00 57.23  ? 3   VAL L N   1 
ATOM   2511 C  CA  . VAL C 3 3   ? 0.398   -9.505  -14.682 1.00 56.70  ? 3   VAL L CA  1 
ATOM   2512 C  C   . VAL C 3 3   ? 1.507   -10.360 -15.310 1.00 59.56  ? 3   VAL L C   1 
ATOM   2513 O  O   . VAL C 3 3   ? 1.234   -11.183 -16.192 1.00 58.74  ? 3   VAL L O   1 
ATOM   2514 C  CB  . VAL C 3 3   ? -0.418  -10.290 -13.584 1.00 65.24  ? 3   VAL L CB  1 
ATOM   2515 C  CG1 . VAL C 3 3   ? 0.508   -10.916 -12.520 1.00 65.81  ? 3   VAL L CG1 1 
ATOM   2516 C  CG2 . VAL C 3 3   ? -1.468  -9.377  -12.892 1.00 56.96  ? 3   VAL L CG2 1 
ATOM   2517 N  N   . LEU C 3 4   ? 2.760   -10.077 -14.960 1.00 58.95  ? 4   LEU L N   1 
ATOM   2518 C  CA  . LEU C 3 4   ? 3.905   -10.858 -15.449 1.00 53.08  ? 4   LEU L CA  1 
ATOM   2519 C  C   . LEU C 3 4   ? 4.457   -11.717 -14.326 1.00 59.67  ? 4   LEU L C   1 
ATOM   2520 O  O   . LEU C 3 4   ? 4.980   -11.217 -13.297 1.00 58.55  ? 4   LEU L O   1 
ATOM   2521 C  CB  . LEU C 3 4   ? 4.985   -9.961  -16.036 1.00 47.49  ? 4   LEU L CB  1 
ATOM   2522 C  CG  . LEU C 3 4   ? 4.424   -9.172  -17.224 1.00 55.58  ? 4   LEU L CG  1 
ATOM   2523 C  CD1 . LEU C 3 4   ? 5.055   -7.804  -17.367 1.00 49.49  ? 4   LEU L CD1 1 
ATOM   2524 C  CD2 . LEU C 3 4   ? 4.633   -10.004 -18.502 1.00 53.83  ? 4   LEU L CD2 1 
ATOM   2525 N  N   . THR C 3 5   ? 4.411   -13.022 -14.548 1.00 61.91  ? 5   THR L N   1 
ATOM   2526 C  CA  . THR C 3 5   ? 4.914   -13.954 -13.551 1.00 59.68  ? 5   THR L CA  1 
ATOM   2527 C  C   . THR C 3 5   ? 6.237   -14.546 -13.960 1.00 59.40  ? 5   THR L C   1 
ATOM   2528 O  O   . THR C 3 5   ? 6.337   -15.208 -14.990 1.00 59.32  ? 5   THR L O   1 
ATOM   2529 C  CB  . THR C 3 5   ? 3.939   -15.103 -13.313 1.00 56.16  ? 5   THR L CB  1 
ATOM   2530 O  OG1 . THR C 3 5   ? 2.657   -14.577 -12.925 1.00 60.81  ? 5   THR L OG1 1 
ATOM   2531 C  CG2 . THR C 3 5   ? 4.496   -16.024 -12.242 1.00 50.98  ? 5   THR L CG2 1 
ATOM   2532 N  N   . GLN C 3 6   ? 7.251   -14.308 -13.134 1.00 59.47  ? 6   GLN L N   1 
ATOM   2533 C  CA  . GLN C 3 6   ? 8.566   -14.839 -13.418 1.00 60.83  ? 6   GLN L CA  1 
ATOM   2534 C  C   . GLN C 3 6   ? 8.824   -16.021 -12.530 1.00 65.00  ? 6   GLN L C   1 
ATOM   2535 O  O   . GLN C 3 6   ? 8.541   -15.986 -11.328 1.00 65.99  ? 6   GLN L O   1 
ATOM   2536 C  CB  . GLN C 3 6   ? 9.639   -13.800 -13.165 1.00 56.67  ? 6   GLN L CB  1 
ATOM   2537 C  CG  . GLN C 3 6   ? 9.665   -12.731 -14.202 1.00 60.01  ? 6   GLN L CG  1 
ATOM   2538 C  CD  . GLN C 3 6   ? 10.744  -11.728 -13.936 1.00 53.46  ? 6   GLN L CD  1 
ATOM   2539 O  OE1 . GLN C 3 6   ? 10.468  -10.623 -13.473 1.00 52.05  ? 6   GLN L OE1 1 
ATOM   2540 N  NE2 . GLN C 3 6   ? 11.962  -12.053 -14.343 1.00 48.68  ? 6   GLN L NE2 1 
ATOM   2541 N  N   . SER C 3 7   ? 9.449   -17.042 -13.090 1.00 71.31  ? 7   SER L N   1 
ATOM   2542 C  CA  . SER C 3 7   ? 9.803   -18.179 -12.246 1.00 73.56  ? 7   SER L CA  1 
ATOM   2543 C  C   . SER C 3 7   ? 11.102  -18.789 -12.719 1.00 76.09  ? 7   SER L C   1 
ATOM   2544 O  O   . SER C 3 7   ? 11.492  -18.671 -13.928 1.00 79.22  ? 7   SER L O   1 
ATOM   2545 C  CB  . SER C 3 7   ? 8.741   -19.273 -12.258 1.00 69.29  ? 7   SER L CB  1 
ATOM   2546 O  OG  . SER C 3 7   ? 8.565   -19.716 -13.583 1.00 69.89  ? 7   SER L OG  1 
ATOM   2547 N  N   . PRO C 3 8   ? 11.818  -19.385 -11.762 1.00 77.12  ? 8   PRO L N   1 
ATOM   2548 C  CA  . PRO C 3 8   ? 11.543  -19.322 -10.315 1.00 77.05  ? 8   PRO L CA  1 
ATOM   2549 C  C   . PRO C 3 8   ? 11.928  -17.979 -9.717  1.00 75.45  ? 8   PRO L C   1 
ATOM   2550 O  O   . PRO C 3 8   ? 12.432  -17.105 -10.421 1.00 77.85  ? 8   PRO L O   1 
ATOM   2551 C  CB  . PRO C 3 8   ? 12.426  -20.427 -9.745  1.00 86.64  ? 8   PRO L CB  1 
ATOM   2552 C  CG  . PRO C 3 8   ? 13.601  -20.461 -10.681 1.00 81.32  ? 8   PRO L CG  1 
ATOM   2553 C  CD  . PRO C 3 8   ? 12.987  -20.236 -12.052 1.00 77.11  ? 8   PRO L CD  1 
ATOM   2554 N  N   . ALA C 3 9   ? 11.601  -17.766 -8.457  1.00 74.95  ? 9   ALA L N   1 
ATOM   2555 C  CA  . ALA C 3 9   ? 11.991  -16.527 -7.804  1.00 71.29  ? 9   ALA L CA  1 
ATOM   2556 C  C   . ALA C 3 9   ? 13.514  -16.541 -7.613  1.00 75.92  ? 9   ALA L C   1 
ATOM   2557 O  O   . ALA C 3 9   ? 14.174  -15.495 -7.652  1.00 72.21  ? 9   ALA L O   1 
ATOM   2558 C  CB  . ALA C 3 9   ? 11.291  -16.368 -6.479  1.00 63.61  ? 9   ALA L CB  1 
ATOM   2559 N  N   . ILE C 3 10  ? 14.077  -17.739 -7.450  1.00 79.54  ? 10  ILE L N   1 
ATOM   2560 C  CA  . ILE C 3 10  ? 15.521  -17.872 -7.307  1.00 77.15  ? 10  ILE L CA  1 
ATOM   2561 C  C   . ILE C 3 10  ? 16.005  -19.025 -8.138  1.00 79.68  ? 10  ILE L C   1 
ATOM   2562 O  O   . ILE C 3 10  ? 15.414  -20.102 -8.138  1.00 81.42  ? 10  ILE L O   1 
ATOM   2563 C  CB  . ILE C 3 10  ? 15.950  -18.179 -5.853  1.00 71.45  ? 10  ILE L CB  1 
ATOM   2564 C  CG1 . ILE C 3 10  ? 15.240  -17.267 -4.842  1.00 78.74  ? 10  ILE L CG1 1 
ATOM   2565 C  CG2 . ILE C 3 10  ? 17.474  -18.135 -5.739  1.00 74.70  ? 10  ILE L CG2 1 
ATOM   2566 C  CD1 . ILE C 3 10  ? 13.936  -17.848 -4.271  1.00 81.23  ? 10  ILE L CD1 1 
ATOM   2567 N  N   . LEU C 3 11  ? 17.130  -18.804 -8.801  1.00 78.32  ? 11  LEU L N   1 
ATOM   2568 C  CA  . LEU C 3 11  ? 17.754  -19.840 -9.580  1.00 78.40  ? 11  LEU L CA  1 
ATOM   2569 C  C   . LEU C 3 11  ? 19.233  -19.971 -9.214  1.00 80.33  ? 11  LEU L C   1 
ATOM   2570 O  O   . LEU C 3 11  ? 19.976  -18.981 -9.256  1.00 75.92  ? 11  LEU L O   1 
ATOM   2571 C  CB  . LEU C 3 11  ? 17.547  -19.516 -11.042 1.00 77.81  ? 11  LEU L CB  1 
ATOM   2572 C  CG  . LEU C 3 11  ? 18.007  -20.582 -11.996 1.00 84.75  ? 11  LEU L CG  1 
ATOM   2573 C  CD1 . LEU C 3 11  ? 17.546  -21.927 -11.448 1.00 91.53  ? 11  LEU L CD1 1 
ATOM   2574 C  CD2 . LEU C 3 11  ? 17.334  -20.291 -13.324 1.00 81.44  ? 11  LEU L CD2 1 
ATOM   2575 N  N   . SER C 3 12  ? 19.660  -21.186 -8.862  1.00 83.19  ? 12  SER L N   1 
ATOM   2576 C  CA  . SER C 3 12  ? 21.077  -21.456 -8.575  1.00 87.66  ? 12  SER L CA  1 
ATOM   2577 C  C   . SER C 3 12  ? 21.879  -22.016 -9.745  1.00 82.44  ? 12  SER L C   1 
ATOM   2578 O  O   . SER C 3 12  ? 21.428  -22.918 -10.461 1.00 77.21  ? 12  SER L O   1 
ATOM   2579 C  CB  . SER C 3 12  ? 21.212  -22.396 -7.359  1.00 89.06  ? 12  SER L CB  1 
ATOM   2580 O  OG  . SER C 3 12  ? 20.660  -21.832 -6.172  1.00 85.64  ? 12  SER L OG  1 
ATOM   2581 N  N   . VAL C 3 13  ? 23.047  -21.421 -9.979  1.00 80.66  ? 13  VAL L N   1 
ATOM   2582 C  CA  . VAL C 3 13  ? 23.864  -21.800 -11.135 1.00 84.62  ? 13  VAL L CA  1 
ATOM   2583 C  C   . VAL C 3 13  ? 25.364  -21.904 -10.844 1.00 81.75  ? 13  VAL L C   1 
ATOM   2584 O  O   . VAL C 3 13  ? 25.900  -21.235 -9.959  1.00 82.18  ? 13  VAL L O   1 
ATOM   2585 C  CB  . VAL C 3 13  ? 23.670  -20.803 -12.297 1.00 83.79  ? 13  VAL L CB  1 
ATOM   2586 C  CG1 . VAL C 3 13  ? 22.203  -20.655 -12.610 1.00 81.93  ? 13  VAL L CG1 1 
ATOM   2587 C  CG2 . VAL C 3 13  ? 24.310  -19.449 -11.961 1.00 78.38  ? 13  VAL L CG2 1 
ATOM   2588 N  N   . SER C 3 14  ? 26.036  -22.722 -11.644 1.00 81.86  ? 14  SER L N   1 
ATOM   2589 C  CA  . SER C 3 14  ? 27.482  -22.929 -11.553 1.00 78.64  ? 14  SER L CA  1 
ATOM   2590 C  C   . SER C 3 14  ? 28.129  -22.164 -12.696 1.00 76.97  ? 14  SER L C   1 
ATOM   2591 O  O   . SER C 3 14  ? 27.636  -22.202 -13.822 1.00 77.15  ? 14  SER L O   1 
ATOM   2592 C  CB  . SER C 3 14  ? 27.830  -24.417 -11.598 1.00 78.50  ? 14  SER L CB  1 
ATOM   2593 O  OG  . SER C 3 14  ? 27.031  -25.099 -12.559 1.00 88.30  ? 14  SER L OG  1 
ATOM   2594 N  N   . PRO C 3 15  ? 29.250  -21.488 -12.425 1.00 74.44  ? 15  PRO L N   1 
ATOM   2595 C  CA  . PRO C 3 15  ? 29.921  -20.691 -13.460 1.00 69.18  ? 15  PRO L CA  1 
ATOM   2596 C  C   . PRO C 3 15  ? 30.097  -21.438 -14.772 1.00 70.89  ? 15  PRO L C   1 
ATOM   2597 O  O   . PRO C 3 15  ? 30.441  -22.623 -14.773 1.00 71.78  ? 15  PRO L O   1 
ATOM   2598 C  CB  . PRO C 3 15  ? 31.288  -20.394 -12.833 1.00 74.90  ? 15  PRO L CB  1 
ATOM   2599 C  CG  . PRO C 3 15  ? 31.050  -20.466 -11.365 1.00 76.32  ? 15  PRO L CG  1 
ATOM   2600 C  CD  . PRO C 3 15  ? 30.017  -21.537 -11.171 1.00 77.52  ? 15  PRO L CD  1 
ATOM   2601 N  N   . GLY C 3 16  ? 29.779  -20.753 -15.871 1.00 67.09  ? 16  GLY L N   1 
ATOM   2602 C  CA  . GLY C 3 16  ? 29.921  -21.299 -17.206 1.00 64.99  ? 16  GLY L CA  1 
ATOM   2603 C  C   . GLY C 3 16  ? 28.691  -22.012 -17.713 1.00 64.45  ? 16  GLY L C   1 
ATOM   2604 O  O   . GLY C 3 16  ? 28.518  -22.202 -18.915 1.00 63.42  ? 16  GLY L O   1 
ATOM   2605 N  N   . GLU C 3 17  ? 27.774  -22.296 -16.799 1.00 69.93  ? 17  GLU L N   1 
ATOM   2606 C  CA  . GLU C 3 17  ? 26.537  -23.011 -17.113 1.00 72.17  ? 17  GLU L CA  1 
ATOM   2607 C  C   . GLU C 3 17  ? 25.535  -22.146 -17.923 1.00 66.80  ? 17  GLU L C   1 
ATOM   2608 O  O   . GLU C 3 17  ? 25.533  -20.913 -17.868 1.00 59.25  ? 17  GLU L O   1 
ATOM   2609 C  CB  . GLU C 3 17  ? 25.957  -23.549 -15.802 1.00 76.09  ? 17  GLU L CB  1 
ATOM   2610 C  CG  . GLU C 3 17  ? 24.718  -24.411 -15.863 1.00 79.81  ? 17  GLU L CG  1 
ATOM   2611 C  CD  . GLU C 3 17  ? 24.228  -24.770 -14.460 1.00 89.08  ? 17  GLU L CD  1 
ATOM   2612 O  OE1 . GLU C 3 17  ? 24.703  -24.161 -13.458 1.00 81.76  ? 17  GLU L OE1 1 
ATOM   2613 O  OE2 . GLU C 3 17  ? 23.380  -25.682 -14.358 1.00 99.36  ? 17  GLU L OE2 1 
ATOM   2614 N  N   . ARG C 3 18  ? 24.745  -22.815 -18.750 1.00 68.02  ? 18  ARG L N   1 
ATOM   2615 C  CA  . ARG C 3 18  ? 23.679  -22.156 -19.482 1.00 66.22  ? 18  ARG L CA  1 
ATOM   2616 C  C   . ARG C 3 18  ? 22.404  -22.141 -18.678 1.00 70.20  ? 18  ARG L C   1 
ATOM   2617 O  O   . ARG C 3 18  ? 21.978  -23.171 -18.157 1.00 73.42  ? 18  ARG L O   1 
ATOM   2618 C  CB  . ARG C 3 18  ? 23.464  -22.848 -20.830 1.00 64.91  ? 18  ARG L CB  1 
ATOM   2619 C  CG  . ARG C 3 18  ? 22.237  -22.406 -21.585 1.00 72.71  ? 18  ARG L CG  1 
ATOM   2620 C  CD  . ARG C 3 18  ? 22.176  -23.147 -22.882 1.00 68.19  ? 18  ARG L CD  1 
ATOM   2621 N  NE  . ARG C 3 18  ? 23.400  -22.861 -23.616 1.00 78.29  ? 18  ARG L NE  1 
ATOM   2622 C  CZ  . ARG C 3 18  ? 24.190  -23.795 -24.156 1.00 81.65  ? 18  ARG L CZ  1 
ATOM   2623 N  NH1 . ARG C 3 18  ? 23.858  -25.084 -24.080 1.00 82.21  ? 18  ARG L NH1 1 
ATOM   2624 N  NH2 . ARG C 3 18  ? 25.297  -23.441 -24.804 1.00 72.01  ? 18  ARG L NH2 1 
ATOM   2625 N  N   . VAL C 3 19  ? 21.820  -20.949 -18.548 1.00 70.59  ? 19  VAL L N   1 
ATOM   2626 C  CA  . VAL C 3 19  ? 20.572  -20.770 -17.796 1.00 68.64  ? 19  VAL L CA  1 
ATOM   2627 C  C   . VAL C 3 19  ? 19.499  -20.055 -18.598 1.00 69.75  ? 19  VAL L C   1 
ATOM   2628 O  O   . VAL C 3 19  ? 19.793  -19.327 -19.543 1.00 65.69  ? 19  VAL L O   1 
ATOM   2629 C  CB  . VAL C 3 19  ? 20.799  -20.002 -16.490 1.00 69.15  ? 19  VAL L CB  1 
ATOM   2630 C  CG1 . VAL C 3 19  ? 22.023  -20.531 -15.850 1.00 78.29  ? 19  VAL L CG1 1 
ATOM   2631 C  CG2 . VAL C 3 19  ? 21.014  -18.527 -16.762 1.00 70.54  ? 19  VAL L CG2 1 
ATOM   2632 N  N   . SER C 3 20  ? 18.257  -20.268 -18.182 1.00 69.58  ? 20  SER L N   1 
ATOM   2633 C  CA  . SER C 3 20  ? 17.089  -19.665 -18.790 1.00 63.73  ? 20  SER L CA  1 
ATOM   2634 C  C   . SER C 3 20  ? 16.129  -19.274 -17.668 1.00 70.50  ? 20  SER L C   1 
ATOM   2635 O  O   . SER C 3 20  ? 16.011  -20.008 -16.675 1.00 72.09  ? 20  SER L O   1 
ATOM   2636 C  CB  . SER C 3 20  ? 16.407  -20.631 -19.759 1.00 66.77  ? 20  SER L CB  1 
ATOM   2637 O  OG  . SER C 3 20  ? 17.229  -20.966 -20.856 1.00 64.68  ? 20  SER L OG  1 
ATOM   2638 N  N   . PHE C 3 21  ? 15.344  -18.211 -17.862 1.00 64.64  ? 21  PHE L N   1 
ATOM   2639 C  CA  . PHE C 3 21  ? 14.302  -17.944 -16.886 1.00 66.69  ? 21  PHE L CA  1 
ATOM   2640 C  C   . PHE C 3 21  ? 13.075  -17.467 -17.565 1.00 66.63  ? 21  PHE L C   1 
ATOM   2641 O  O   . PHE C 3 21  ? 13.141  -17.018 -18.728 1.00 61.62  ? 21  PHE L O   1 
ATOM   2642 C  CB  . PHE C 3 21  ? 14.669  -16.787 -15.929 1.00 64.93  ? 21  PHE L CB  1 
ATOM   2643 C  CG  . PHE C 3 21  ? 16.132  -16.527 -15.773 1.00 69.64  ? 21  PHE L CG  1 
ATOM   2644 C  CD1 . PHE C 3 21  ? 16.874  -17.259 -14.863 1.00 72.22  ? 21  PHE L CD1 1 
ATOM   2645 C  CD2 . PHE C 3 21  ? 16.764  -15.519 -16.499 1.00 64.83  ? 21  PHE L CD2 1 
ATOM   2646 C  CE1 . PHE C 3 21  ? 18.228  -17.024 -14.703 1.00 74.67  ? 21  PHE L CE1 1 
ATOM   2647 C  CE2 . PHE C 3 21  ? 18.131  -15.272 -16.337 1.00 60.06  ? 21  PHE L CE2 1 
ATOM   2648 C  CZ  . PHE C 3 21  ? 18.859  -16.025 -15.449 1.00 66.38  ? 21  PHE L CZ  1 
ATOM   2649 N  N   . SER C 3 22  ? 11.947  -17.521 -16.842 1.00 61.24  ? 22  SER L N   1 
ATOM   2650 C  CA  . SER C 3 22  ? 10.758  -17.387 -17.631 1.00 61.00  ? 22  SER L CA  1 
ATOM   2651 C  C   . SER C 3 22  ? 9.916   -16.234 -17.113 1.00 62.96  ? 22  SER L C   1 
ATOM   2652 O  O   . SER C 3 22  ? 9.915   -15.934 -15.898 1.00 59.99  ? 22  SER L O   1 
ATOM   2653 C  CB  . SER C 3 22  ? 9.989   -18.715 -17.666 1.00 61.61  ? 22  SER L CB  1 
ATOM   2654 O  OG  . SER C 3 22  ? 9.289   -18.956 -16.464 1.00 70.46  ? 22  SER L OG  1 
ATOM   2655 N  N   . CYS C 3 23  ? 9.177   -15.640 -18.059 1.00 58.01  ? 23  CYS L N   1 
ATOM   2656 C  CA  . CYS C 3 23  ? 8.216   -14.580 -17.815 1.00 58.57  ? 23  CYS L CA  1 
ATOM   2657 C  C   . CYS C 3 23  ? 6.932   -14.920 -18.528 1.00 60.99  ? 23  CYS L C   1 
ATOM   2658 O  O   . CYS C 3 23  ? 6.912   -15.043 -19.749 1.00 66.20  ? 23  CYS L O   1 
ATOM   2659 C  CB  . CYS C 3 23  ? 8.781   -13.253 -18.339 1.00 61.83  ? 23  CYS L CB  1 
ATOM   2660 S  SG  . CYS C 3 23  ? 7.748   -11.751 -18.189 1.00 66.76  ? 23  CYS L SG  1 
ATOM   2661 N  N   . ARG C 3 24  ? 5.839   -15.045 -17.798 1.00 63.56  ? 24  ARG L N   1 
ATOM   2662 C  CA  . ARG C 3 24  ? 4.601   -15.360 -18.474 1.00 63.43  ? 24  ARG L CA  1 
ATOM   2663 C  C   . ARG C 3 24  ? 3.553   -14.279 -18.239 1.00 67.14  ? 24  ARG L C   1 
ATOM   2664 O  O   . ARG C 3 24  ? 3.323   -13.867 -17.089 1.00 64.22  ? 24  ARG L O   1 
ATOM   2665 C  CB  . ARG C 3 24  ? 4.073   -16.726 -18.057 1.00 65.49  ? 24  ARG L CB  1 
ATOM   2666 C  CG  . ARG C 3 24  ? 3.641   -17.532 -19.284 1.00 76.92  ? 24  ARG L CG  1 
ATOM   2667 C  CD  . ARG C 3 24  ? 3.150   -18.937 -18.958 1.00 82.73  ? 24  ARG L CD  1 
ATOM   2668 N  NE  . ARG C 3 24  ? 2.228   -18.895 -17.827 1.00 90.16  ? 24  ARG L NE  1 
ATOM   2669 C  CZ  . ARG C 3 24  ? 1.639   -19.961 -17.298 1.00 91.58  ? 24  ARG L CZ  1 
ATOM   2670 N  NH1 . ARG C 3 24  ? 1.846   -21.160 -17.821 1.00 88.61  ? 24  ARG L NH1 1 
ATOM   2671 N  NH2 . ARG C 3 24  ? 0.824   -19.823 -16.260 1.00 101.12 ? 24  ARG L NH2 1 
ATOM   2672 N  N   . ALA C 3 25  ? 2.932   -13.810 -19.319 1.00 61.45  ? 25  ALA L N   1 
ATOM   2673 C  CA  . ALA C 3 25  ? 1.953   -12.732 -19.220 1.00 64.22  ? 25  ALA L CA  1 
ATOM   2674 C  C   . ALA C 3 25  ? 0.501   -13.258 -19.227 1.00 64.68  ? 25  ALA L C   1 
ATOM   2675 O  O   . ALA C 3 25  ? 0.146   -14.148 -19.999 1.00 66.05  ? 25  ALA L O   1 
ATOM   2676 C  CB  . ALA C 3 25  ? 2.154   -11.743 -20.353 1.00 60.05  ? 25  ALA L CB  1 
ATOM   2677 N  N   . SER C 3 26  ? -0.352  -12.629 -18.431 1.00 62.54  ? 26  SER L N   1 
ATOM   2678 C  CA  . SER C 3 26  ? -1.744  -13.040 -18.305 1.00 62.96  ? 26  SER L CA  1 
ATOM   2679 C  C   . SER C 3 26  ? -2.520  -12.740 -19.584 1.00 63.68  ? 26  SER L C   1 
ATOM   2680 O  O   . SER C 3 26  ? -3.579  -13.307 -19.802 1.00 72.92  ? 26  SER L O   1 
ATOM   2681 C  CB  . SER C 3 26  ? -2.416  -12.395 -17.082 1.00 63.29  ? 26  SER L CB  1 
ATOM   2682 O  OG  . SER C 3 26  ? -2.488  -10.990 -17.169 1.00 60.34  ? 26  SER L OG  1 
ATOM   2683 N  N   . GLN C 3 27  ? -2.004  -11.855 -20.430 1.00 61.93  ? 27  GLN L N   1 
ATOM   2684 C  CA  . GLN C 3 27  ? -2.660  -11.594 -21.717 1.00 66.31  ? 27  GLN L CA  1 
ATOM   2685 C  C   . GLN C 3 27  ? -1.636  -11.615 -22.845 1.00 64.86  ? 27  GLN L C   1 
ATOM   2686 O  O   . GLN C 3 27  ? -0.435  -11.473 -22.591 1.00 64.73  ? 27  GLN L O   1 
ATOM   2687 C  CB  . GLN C 3 27  ? -3.307  -10.219 -21.780 1.00 67.49  ? 27  GLN L CB  1 
ATOM   2688 C  CG  . GLN C 3 27  ? -4.245  -9.805  -20.712 1.00 67.22  ? 27  GLN L CG  1 
ATOM   2689 C  CD  . GLN C 3 27  ? -4.712  -8.392  -20.996 1.00 74.15  ? 27  GLN L CD  1 
ATOM   2690 O  OE1 . GLN C 3 27  ? -4.496  -7.868  -22.102 1.00 60.54  ? 27  GLN L OE1 1 
ATOM   2691 N  NE2 . GLN C 3 27  ? -5.209  -7.712  -19.969 1.00 77.68  ? 27  GLN L NE2 1 
ATOM   2692 N  N   . ASN C 3 28  ? -2.090  -11.820 -24.081 1.00 54.07  ? 28  ASN L N   1 
ATOM   2693 C  CA  . ASN C 3 28  ? -1.154  -11.787 -25.187 1.00 57.13  ? 28  ASN L CA  1 
ATOM   2694 C  C   . ASN C 3 28  ? -0.550  -10.394 -25.383 1.00 61.15  ? 28  ASN L C   1 
ATOM   2695 O  O   . ASN C 3 28  ? -1.272  -9.430  -25.689 1.00 59.86  ? 28  ASN L O   1 
ATOM   2696 C  CB  . ASN C 3 28  ? -1.859  -12.232 -26.458 1.00 52.30  ? 28  ASN L CB  1 
ATOM   2697 C  CG  . ASN C 3 28  ? -0.901  -12.524 -27.574 1.00 61.43  ? 28  ASN L CG  1 
ATOM   2698 O  OD1 . ASN C 3 28  ? -0.203  -11.615 -28.064 1.00 60.77  ? 28  ASN L OD1 1 
ATOM   2699 N  ND2 . ASN C 3 28  ? -0.818  -13.797 -27.970 1.00 61.48  ? 28  ASN L ND2 1 
ATOM   2700 N  N   . ILE C 3 29  ? 0.783   -10.317 -25.367 1.00 50.45  ? 29  ILE L N   1 
ATOM   2701 C  CA  . ILE C 3 29  ? 1.408   -9.025  -25.514 1.00 51.51  ? 29  ILE L CA  1 
ATOM   2702 C  C   . ILE C 3 29  ? 2.313   -8.953  -26.710 1.00 51.84  ? 29  ILE L C   1 
ATOM   2703 O  O   . ILE C 3 29  ? 3.085   -8.003  -26.868 1.00 50.11  ? 29  ILE L O   1 
ATOM   2704 C  CB  . ILE C 3 29  ? 2.188   -8.639  -24.244 1.00 55.23  ? 29  ILE L CB  1 
ATOM   2705 C  CG1 . ILE C 3 29  ? 3.175   -9.733  -23.820 1.00 56.50  ? 29  ILE L CG1 1 
ATOM   2706 C  CG2 . ILE C 3 29  ? 1.213   -8.311  -23.128 1.00 50.63  ? 29  ILE L CG2 1 
ATOM   2707 C  CD1 . ILE C 3 29  ? 4.058   -9.338  -22.668 1.00 47.06  ? 29  ILE L CD1 1 
ATOM   2708 N  N   . GLY C 3 30  ? 2.151   -9.917  -27.603 1.00 57.43  ? 30  GLY L N   1 
ATOM   2709 C  CA  . GLY C 3 30  ? 2.971   -9.958  -28.790 1.00 52.37  ? 30  GLY L CA  1 
ATOM   2710 C  C   . GLY C 3 30  ? 4.409   -10.074 -28.410 1.00 53.58  ? 30  GLY L C   1 
ATOM   2711 O  O   . GLY C 3 30  ? 4.765   -11.028 -27.718 1.00 57.09  ? 30  GLY L O   1 
ATOM   2712 N  N   . THR C 3 31  ? 5.239   -9.157  -28.908 1.00 51.14  ? 31  THR L N   1 
ATOM   2713 C  CA  . THR C 3 31  ? 6.663   -9.155  -28.564 1.00 48.77  ? 31  THR L CA  1 
ATOM   2714 C  C   . THR C 3 31  ? 7.008   -8.020  -27.600 1.00 48.91  ? 31  THR L C   1 
ATOM   2715 O  O   . THR C 3 31  ? 8.164   -7.663  -27.441 1.00 47.94  ? 31  THR L O   1 
ATOM   2716 C  CB  . THR C 3 31  ? 7.557   -9.041  -29.812 1.00 46.98  ? 31  THR L CB  1 
ATOM   2717 O  OG1 . THR C 3 31  ? 7.274   -7.829  -30.521 1.00 44.07  ? 31  THR L OG1 1 
ATOM   2718 C  CG2 . THR C 3 31  ? 7.366   -10.244 -30.699 1.00 42.82  ? 31  THR L CG2 1 
ATOM   2719 N  N   . SER C 3 32  ? 6.001   -7.455  -26.961 1.00 47.21  ? 32  SER L N   1 
ATOM   2720 C  CA  . SER C 3 32  ? 6.184   -6.281  -26.147 1.00 45.49  ? 32  SER L CA  1 
ATOM   2721 C  C   . SER C 3 32  ? 6.717   -6.620  -24.767 1.00 49.10  ? 32  SER L C   1 
ATOM   2722 O  O   . SER C 3 32  ? 6.205   -6.131  -23.762 1.00 47.95  ? 32  SER L O   1 
ATOM   2723 C  CB  . SER C 3 32  ? 4.867   -5.545  -26.007 1.00 45.47  ? 32  SER L CB  1 
ATOM   2724 O  OG  . SER C 3 32  ? 4.400   -5.125  -27.264 1.00 49.41  ? 32  SER L OG  1 
ATOM   2725 N  N   . ILE C 3 33  ? 7.773   -7.420  -24.710 1.00 50.44  ? 33  ILE L N   1 
ATOM   2726 C  CA  . ILE C 3 33  ? 8.389   -7.726  -23.419 1.00 51.70  ? 33  ILE L CA  1 
ATOM   2727 C  C   . ILE C 3 33  ? 9.862   -7.380  -23.492 1.00 46.57  ? 33  ILE L C   1 
ATOM   2728 O  O   . ILE C 3 33  ? 10.503  -7.529  -24.541 1.00 46.70  ? 33  ILE L O   1 
ATOM   2729 C  CB  . ILE C 3 33  ? 8.249   -9.203  -23.029 1.00 53.58  ? 33  ILE L CB  1 
ATOM   2730 C  CG1 . ILE C 3 33  ? 8.365   -9.379  -21.517 1.00 55.87  ? 33  ILE L CG1 1 
ATOM   2731 C  CG2 . ILE C 3 33  ? 9.236   -10.067 -23.798 1.00 53.27  ? 33  ILE L CG2 1 
ATOM   2732 C  CD1 . ILE C 3 33  ? 7.093   -9.050  -20.797 1.00 51.67  ? 33  ILE L CD1 1 
ATOM   2733 N  N   . HIS C 3 34  ? 10.358  -6.798  -22.412 1.00 46.84  ? 34  HIS L N   1 
ATOM   2734 C  CA  . HIS C 3 34  ? 11.749  -6.387  -22.355 1.00 49.61  ? 34  HIS L CA  1 
ATOM   2735 C  C   . HIS C 3 34  ? 12.356  -6.939  -21.061 1.00 49.30  ? 34  HIS L C   1 
ATOM   2736 O  O   . HIS C 3 34  ? 11.634  -7.139  -20.084 1.00 45.75  ? 34  HIS L O   1 
ATOM   2737 C  CB  . HIS C 3 34  ? 11.845  -4.865  -22.460 1.00 46.91  ? 34  HIS L CB  1 
ATOM   2738 C  CG  . HIS C 3 34  ? 10.899  -4.299  -23.471 1.00 47.52  ? 34  HIS L CG  1 
ATOM   2739 N  ND1 . HIS C 3 34  ? 10.959  -4.625  -24.809 1.00 49.69  ? 34  HIS L ND1 1 
ATOM   2740 C  CD2 . HIS C 3 34  ? 9.926   -3.361  -23.358 1.00 49.79  ? 34  HIS L CD2 1 
ATOM   2741 C  CE1 . HIS C 3 34  ? 10.006  -3.980  -25.462 1.00 46.94  ? 34  HIS L CE1 1 
ATOM   2742 N  NE2 . HIS C 3 34  ? 9.376   -3.190  -24.611 1.00 45.98  ? 34  HIS L NE2 1 
ATOM   2743 N  N   . TRP C 3 35  ? 13.662  -7.195  -21.054 1.00 50.28  ? 35  TRP L N   1 
ATOM   2744 C  CA  . TRP C 3 35  ? 14.330  -7.783  -19.888 1.00 46.12  ? 35  TRP L CA  1 
ATOM   2745 C  C   . TRP C 3 35  ? 15.370  -6.861  -19.297 1.00 47.98  ? 35  TRP L C   1 
ATOM   2746 O  O   . TRP C 3 35  ? 16.114  -6.211  -20.030 1.00 51.40  ? 35  TRP L O   1 
ATOM   2747 C  CB  . TRP C 3 35  ? 15.003  -9.087  -20.263 1.00 43.93  ? 35  TRP L CB  1 
ATOM   2748 C  CG  . TRP C 3 35  ? 14.060  -10.207 -20.579 1.00 45.85  ? 35  TRP L CG  1 
ATOM   2749 C  CD1 . TRP C 3 35  ? 13.534  -10.484 -21.805 1.00 47.67  ? 35  TRP L CD1 1 
ATOM   2750 C  CD2 . TRP C 3 35  ? 13.556  -11.213 -19.692 1.00 43.91  ? 35  TRP L CD2 1 
ATOM   2751 N  NE1 . TRP C 3 35  ? 12.728  -11.596 -21.740 1.00 49.84  ? 35  TRP L NE1 1 
ATOM   2752 C  CE2 . TRP C 3 35  ? 12.735  -12.076 -20.461 1.00 43.71  ? 35  TRP L CE2 1 
ATOM   2753 C  CE3 . TRP C 3 35  ? 13.712  -11.467 -18.331 1.00 46.24  ? 35  TRP L CE3 1 
ATOM   2754 C  CZ2 . TRP C 3 35  ? 12.067  -13.167 -19.918 1.00 47.44  ? 35  TRP L CZ2 1 
ATOM   2755 C  CZ3 . TRP C 3 35  ? 13.054  -12.566 -17.785 1.00 53.32  ? 35  TRP L CZ3 1 
ATOM   2756 C  CH2 . TRP C 3 35  ? 12.231  -13.398 -18.583 1.00 54.51  ? 35  TRP L CH2 1 
ATOM   2757 N  N   . TYR C 3 36  ? 15.434  -6.796  -17.973 1.00 47.84  ? 36  TYR L N   1 
ATOM   2758 C  CA  . TYR C 3 36  ? 16.429  -5.968  -17.302 1.00 51.63  ? 36  TYR L CA  1 
ATOM   2759 C  C   . TYR C 3 36  ? 17.316  -6.711  -16.285 1.00 50.19  ? 36  TYR L C   1 
ATOM   2760 O  O   . TYR C 3 36  ? 16.869  -7.572  -15.490 1.00 48.28  ? 36  TYR L O   1 
ATOM   2761 C  CB  . TYR C 3 36  ? 15.699  -4.834  -16.593 1.00 48.07  ? 36  TYR L CB  1 
ATOM   2762 C  CG  . TYR C 3 36  ? 14.845  -4.053  -17.513 1.00 44.86  ? 36  TYR L CG  1 
ATOM   2763 C  CD1 . TYR C 3 36  ? 15.349  -2.961  -18.206 1.00 46.53  ? 36  TYR L CD1 1 
ATOM   2764 C  CD2 . TYR C 3 36  ? 13.497  -4.345  -17.632 1.00 48.41  ? 36  TYR L CD2 1 
ATOM   2765 C  CE1 . TYR C 3 36  ? 14.523  -2.211  -19.058 1.00 50.10  ? 36  TYR L CE1 1 
ATOM   2766 C  CE2 . TYR C 3 36  ? 12.666  -3.618  -18.482 1.00 47.53  ? 36  TYR L CE2 1 
ATOM   2767 C  CZ  . TYR C 3 36  ? 13.170  -2.553  -19.192 1.00 46.43  ? 36  TYR L CZ  1 
ATOM   2768 O  OH  . TYR C 3 36  ? 12.317  -1.851  -20.036 1.00 41.29  ? 36  TYR L OH  1 
ATOM   2769 N  N   . GLN C 3 37  ? 18.568  -6.294  -16.252 1.00 48.77  ? 37  GLN L N   1 
ATOM   2770 C  CA  . GLN C 3 37  ? 19.500  -6.831  -15.271 1.00 52.18  ? 37  GLN L CA  1 
ATOM   2771 C  C   . GLN C 3 37  ? 19.825  -5.783  -14.234 1.00 49.22  ? 37  GLN L C   1 
ATOM   2772 O  O   . GLN C 3 37  ? 20.030  -4.621  -14.570 1.00 51.91  ? 37  GLN L O   1 
ATOM   2773 C  CB  . GLN C 3 37  ? 20.752  -7.356  -15.959 1.00 52.40  ? 37  GLN L CB  1 
ATOM   2774 C  CG  . GLN C 3 37  ? 21.818  -7.885  -15.017 1.00 55.63  ? 37  GLN L CG  1 
ATOM   2775 C  CD  . GLN C 3 37  ? 23.168  -8.049  -15.707 1.00 52.26  ? 37  GLN L CD  1 
ATOM   2776 O  OE1 . GLN C 3 37  ? 23.842  -7.082  -16.016 1.00 52.59  ? 37  GLN L OE1 1 
ATOM   2777 N  NE2 . GLN C 3 37  ? 23.574  -9.294  -15.914 1.00 51.73  ? 37  GLN L NE2 1 
ATOM   2778 N  N   . GLN C 3 38  ? 19.790  -6.183  -12.966 1.00 48.33  ? 38  GLN L N   1 
ATOM   2779 C  CA  . GLN C 3 38  ? 20.108  -5.266  -11.899 1.00 53.57  ? 38  GLN L CA  1 
ATOM   2780 C  C   . GLN C 3 38  ? 21.074  -5.922  -10.888 1.00 54.62  ? 38  GLN L C   1 
ATOM   2781 O  O   . GLN C 3 38  ? 20.708  -6.856  -10.185 1.00 58.03  ? 38  GLN L O   1 
ATOM   2782 C  CB  . GLN C 3 38  ? 18.823  -4.801  -11.204 1.00 47.72  ? 38  GLN L CB  1 
ATOM   2783 C  CG  . GLN C 3 38  ? 19.055  -3.631  -10.218 1.00 49.31  ? 38  GLN L CG  1 
ATOM   2784 C  CD  . GLN C 3 38  ? 17.822  -3.251  -9.397  1.00 51.18  ? 38  GLN L CD  1 
ATOM   2785 O  OE1 . GLN C 3 38  ? 16.974  -4.096  -9.060  1.00 53.97  ? 38  GLN L OE1 1 
ATOM   2786 N  NE2 . GLN C 3 38  ? 17.680  -1.955  -9.135  1.00 45.46  ? 38  GLN L NE2 1 
ATOM   2787 N  N   . ARG C 3 39  ? 22.331  -5.510  -10.893 1.00 53.51  ? 39  ARG L N   1 
ATOM   2788 C  CA  . ARG C 3 39  ? 23.289  -5.996  -9.888  1.00 59.20  ? 39  ARG L CA  1 
ATOM   2789 C  C   . ARG C 3 39  ? 23.091  -5.214  -8.601  1.00 60.01  ? 39  ARG L C   1 
ATOM   2790 O  O   . ARG C 3 39  ? 22.583  -4.089  -8.654  1.00 58.62  ? 39  ARG L O   1 
ATOM   2791 C  CB  . ARG C 3 39  ? 24.726  -5.845  -10.403 1.00 61.26  ? 39  ARG L CB  1 
ATOM   2792 C  CG  . ARG C 3 39  ? 24.967  -6.635  -11.688 1.00 62.49  ? 39  ARG L CG  1 
ATOM   2793 C  CD  . ARG C 3 39  ? 26.406  -6.771  -12.039 1.00 61.14  ? 39  ARG L CD  1 
ATOM   2794 N  NE  . ARG C 3 39  ? 26.797  -5.637  -12.867 1.00 61.99  ? 39  ARG L NE  1 
ATOM   2795 C  CZ  . ARG C 3 39  ? 27.226  -5.733  -14.132 1.00 67.47  ? 39  ARG L CZ  1 
ATOM   2796 N  NH1 . ARG C 3 39  ? 27.351  -6.917  -14.729 1.00 62.71  ? 39  ARG L NH1 1 
ATOM   2797 N  NH2 . ARG C 3 39  ? 27.555  -4.637  -14.807 1.00 68.43  ? 39  ARG L NH2 1 
ATOM   2798 N  N   . THR C 3 40  ? 23.476  -5.796  -7.464  1.00 60.02  ? 40  THR L N   1 
ATOM   2799 C  CA  . THR C 3 40  ? 23.340  -5.132  -6.163  1.00 60.75  ? 40  THR L CA  1 
ATOM   2800 C  C   . THR C 3 40  ? 23.863  -3.696  -6.233  1.00 60.41  ? 40  THR L C   1 
ATOM   2801 O  O   . THR C 3 40  ? 24.989  -3.453  -6.679  1.00 61.14  ? 40  THR L O   1 
ATOM   2802 C  CB  . THR C 3 40  ? 24.044  -5.919  -5.060  1.00 62.29  ? 40  THR L CB  1 
ATOM   2803 O  OG1 . THR C 3 40  ? 23.455  -7.226  -5.016  1.00 70.39  ? 40  THR L OG1 1 
ATOM   2804 C  CG2 . THR C 3 40  ? 23.808  -5.273  -3.711  1.00 55.49  ? 40  THR L CG2 1 
ATOM   2805 N  N   . ASN C 3 41  ? 23.043  -2.775  -5.731  1.00 60.50  ? 41  ASN L N   1 
ATOM   2806 C  CA  . ASN C 3 41  ? 23.307  -1.332  -5.684  1.00 61.35  ? 41  ASN L CA  1 
ATOM   2807 C  C   . ASN C 3 41  ? 23.604  -0.688  -7.020  1.00 58.78  ? 41  ASN L C   1 
ATOM   2808 O  O   . ASN C 3 41  ? 24.315  0.314   -7.098  1.00 59.12  ? 41  ASN L O   1 
ATOM   2809 C  CB  . ASN C 3 41  ? 24.465  -1.025  -4.737  1.00 62.84  ? 41  ASN L CB  1 
ATOM   2810 C  CG  . ASN C 3 41  ? 24.174  -1.454  -3.338  1.00 71.03  ? 41  ASN L CG  1 
ATOM   2811 O  OD1 . ASN C 3 41  ? 22.998  -1.456  -2.913  1.00 67.92  ? 41  ASN L OD1 1 
ATOM   2812 N  ND2 . ASN C 3 41  ? 25.226  -1.851  -2.599  1.00 67.88  ? 41  ASN L ND2 1 
ATOM   2813 N  N   . GLU C 3 42  ? 22.989  -1.211  -8.071  1.00 60.53  ? 42  GLU L N   1 
ATOM   2814 C  CA  . GLU C 3 42  ? 23.149  -0.572  -9.363  1.00 62.24  ? 42  GLU L CA  1 
ATOM   2815 C  C   . GLU C 3 42  ? 21.794  -0.337  -9.986  1.00 53.53  ? 42  GLU L C   1 
ATOM   2816 O  O   . GLU C 3 42  ? 20.803  -0.928  -9.577  1.00 53.25  ? 42  GLU L O   1 
ATOM   2817 C  CB  . GLU C 3 42  ? 24.031  -1.401  -10.272 1.00 62.68  ? 42  GLU L CB  1 
ATOM   2818 C  CG  . GLU C 3 42  ? 25.456  -1.494  -9.775  1.00 59.58  ? 42  GLU L CG  1 
ATOM   2819 C  CD  . GLU C 3 42  ? 26.354  -2.169  -10.786 1.00 67.90  ? 42  GLU L CD  1 
ATOM   2820 O  OE1 . GLU C 3 42  ? 27.532  -2.436  -10.451 1.00 77.95  ? 42  GLU L OE1 1 
ATOM   2821 O  OE2 . GLU C 3 42  ? 25.876  -2.451  -11.912 1.00 66.53  ? 42  GLU L OE2 1 
ATOM   2822 N  N   . SER C 3 43  ? 21.762  0.498   -11.013 1.00 53.75  ? 43  SER L N   1 
ATOM   2823 C  CA  . SER C 3 43  ? 20.537  0.675   -11.757 1.00 48.36  ? 43  SER L CA  1 
ATOM   2824 C  C   . SER C 3 43  ? 20.298  -0.538  -12.596 1.00 53.01  ? 43  SER L C   1 
ATOM   2825 O  O   . SER C 3 43  ? 21.238  -1.262  -12.930 1.00 59.66  ? 43  SER L O   1 
ATOM   2826 C  CB  . SER C 3 43  ? 20.607  1.911   -12.650 1.00 46.24  ? 43  SER L CB  1 
ATOM   2827 O  OG  . SER C 3 43  ? 20.874  3.068   -11.892 1.00 50.44  ? 43  SER L OG  1 
ATOM   2828 N  N   . PRO C 3 44  ? 19.034  -0.765  -12.955 1.00 51.70  ? 44  PRO L N   1 
ATOM   2829 C  CA  . PRO C 3 44  ? 18.726  -1.812  -13.933 1.00 51.15  ? 44  PRO L CA  1 
ATOM   2830 C  C   . PRO C 3 44  ? 19.307  -1.439  -15.307 1.00 46.78  ? 44  PRO L C   1 
ATOM   2831 O  O   . PRO C 3 44  ? 19.566  -0.258  -15.626 1.00 43.65  ? 44  PRO L O   1 
ATOM   2832 C  CB  . PRO C 3 44  ? 17.185  -1.874  -13.916 1.00 52.47  ? 44  PRO L CB  1 
ATOM   2833 C  CG  . PRO C 3 44  ? 16.778  -1.184  -12.622 1.00 47.39  ? 44  PRO L CG  1 
ATOM   2834 C  CD  . PRO C 3 44  ? 17.823  -0.147  -12.385 1.00 47.44  ? 44  PRO L CD  1 
ATOM   2835 N  N   . ARG C 3 45  ? 19.501  -2.461  -16.124 1.00 48.46  ? 45  ARG L N   1 
ATOM   2836 C  CA  . ARG C 3 45  ? 20.064  -2.278  -17.452 1.00 49.23  ? 45  ARG L CA  1 
ATOM   2837 C  C   . ARG C 3 45  ? 19.324  -3.100  -18.493 1.00 50.09  ? 45  ARG L C   1 
ATOM   2838 O  O   . ARG C 3 45  ? 18.998  -4.270  -18.248 1.00 51.63  ? 45  ARG L O   1 
ATOM   2839 C  CB  . ARG C 3 45  ? 21.544  -2.658  -17.384 1.00 52.29  ? 45  ARG L CB  1 
ATOM   2840 C  CG  . ARG C 3 45  ? 22.381  -2.541  -18.636 1.00 51.84  ? 45  ARG L CG  1 
ATOM   2841 C  CD  . ARG C 3 45  ? 23.798  -2.914  -18.260 1.00 51.92  ? 45  ARG L CD  1 
ATOM   2842 N  NE  . ARG C 3 45  ? 23.942  -2.838  -16.794 1.00 74.34  ? 45  ARG L NE  1 
ATOM   2843 C  CZ  . ARG C 3 45  ? 24.209  -3.874  -15.990 1.00 70.07  ? 45  ARG L CZ  1 
ATOM   2844 N  NH1 . ARG C 3 45  ? 24.770  -4.971  -16.496 1.00 73.45  ? 45  ARG L NH1 1 
ATOM   2845 N  NH2 . ARG C 3 45  ? 23.938  -3.812  -14.684 1.00 60.76  ? 45  ARG L NH2 1 
ATOM   2846 N  N   . LEU C 3 46  ? 19.001  -2.486  -19.628 1.00 52.06  ? 46  LEU L N   1 
ATOM   2847 C  CA  . LEU C 3 46  ? 18.321  -3.219  -20.690 1.00 46.95  ? 46  LEU L CA  1 
ATOM   2848 C  C   . LEU C 3 46  ? 19.270  -4.231  -21.318 1.00 53.08  ? 46  LEU L C   1 
ATOM   2849 O  O   . LEU C 3 46  ? 20.442  -3.938  -21.624 1.00 51.35  ? 46  LEU L O   1 
ATOM   2850 C  CB  . LEU C 3 46  ? 17.781  -2.261  -21.753 1.00 48.72  ? 46  LEU L CB  1 
ATOM   2851 C  CG  . LEU C 3 46  ? 16.999  -2.842  -22.939 1.00 50.20  ? 46  LEU L CG  1 
ATOM   2852 C  CD1 . LEU C 3 46  ? 15.707  -3.504  -22.502 1.00 48.25  ? 46  LEU L CD1 1 
ATOM   2853 C  CD2 . LEU C 3 46  ? 16.676  -1.713  -23.908 1.00 49.83  ? 46  LEU L CD2 1 
ATOM   2854 N  N   . ILE C 3 47  ? 18.785  -5.459  -21.408 1.00 50.19  ? 47  ILE L N   1 
ATOM   2855 C  CA  . ILE C 3 47  ? 19.606  -6.582  -21.848 1.00 51.29  ? 47  ILE L CA  1 
ATOM   2856 C  C   . ILE C 3 47  ? 18.972  -7.147  -23.120 1.00 52.26  ? 47  ILE L C   1 
ATOM   2857 O  O   . ILE C 3 47  ? 19.677  -7.619  -24.014 1.00 53.46  ? 47  ILE L O   1 
ATOM   2858 C  CB  . ILE C 3 47  ? 19.841  -7.636  -20.767 1.00 50.78  ? 47  ILE L CB  1 
ATOM   2859 C  CG1 . ILE C 3 47  ? 18.556  -8.014  -20.083 1.00 46.30  ? 47  ILE L CG1 1 
ATOM   2860 C  CG2 . ILE C 3 47  ? 20.850  -7.091  -19.728 1.00 48.75  ? 47  ILE L CG2 1 
ATOM   2861 C  CD1 . ILE C 3 47  ? 18.763  -9.044  -19.071 1.00 52.32  ? 47  ILE L CD1 1 
ATOM   2862 N  N   . ILE C 3 48  ? 17.636  -7.167  -23.166 1.00 52.40  ? 48  ILE L N   1 
ATOM   2863 C  CA  . ILE C 3 48  ? 16.918  -7.600  -24.363 1.00 48.84  ? 48  ILE L CA  1 
ATOM   2864 C  C   . ILE C 3 48  ? 15.642  -6.783  -24.491 1.00 51.88  ? 48  ILE L C   1 
ATOM   2865 O  O   . ILE C 3 48  ? 14.941  -6.524  -23.517 1.00 49.64  ? 48  ILE L O   1 
ATOM   2866 C  CB  . ILE C 3 48  ? 16.507  -9.107  -24.297 1.00 45.73  ? 48  ILE L CB  1 
ATOM   2867 C  CG1 . ILE C 3 48  ? 17.716  -10.062 -24.134 1.00 50.03  ? 48  ILE L CG1 1 
ATOM   2868 C  CG2 . ILE C 3 48  ? 15.541  -9.460  -25.455 1.00 47.62  ? 48  ILE L CG2 1 
ATOM   2869 C  CD1 . ILE C 3 48  ? 18.614  -10.305 -25.340 1.00 44.92  ? 48  ILE L CD1 1 
ATOM   2870 N  N   . LYS C 3 49  ? 15.351  -6.340  -25.704 1.00 51.95  ? 49  LYS L N   1 
ATOM   2871 C  CA  . LYS C 3 49  ? 14.116  -5.615  -25.938 1.00 48.72  ? 49  LYS L CA  1 
ATOM   2872 C  C   . LYS C 3 49  ? 13.286  -6.416  -26.922 1.00 53.50  ? 49  LYS L C   1 
ATOM   2873 O  O   . LYS C 3 49  ? 13.840  -7.129  -27.769 1.00 56.07  ? 49  LYS L O   1 
ATOM   2874 C  CB  . LYS C 3 49  ? 14.391  -4.227  -26.484 1.00 48.87  ? 49  LYS L CB  1 
ATOM   2875 C  CG  . LYS C 3 49  ? 15.059  -4.215  -27.860 1.00 44.52  ? 49  LYS L CG  1 
ATOM   2876 C  CD  . LYS C 3 49  ? 15.358  -2.780  -28.231 1.00 42.93  ? 49  LYS L CD  1 
ATOM   2877 C  CE  . LYS C 3 49  ? 16.219  -2.674  -29.484 1.00 52.15  ? 49  LYS L CE  1 
ATOM   2878 N  NZ  . LYS C 3 49  ? 16.622  -1.239  -29.738 1.00 59.50  ? 49  LYS L NZ  1 
ATOM   2879 N  N   . TYR C 3 50  ? 11.972  -6.244  -26.849 1.00 48.75  ? 50  TYR L N   1 
ATOM   2880 C  CA  . TYR C 3 50  ? 11.031  -6.915  -27.742 1.00 50.42  ? 50  TYR L CA  1 
ATOM   2881 C  C   . TYR C 3 50  ? 11.291  -8.393  -27.901 1.00 50.75  ? 50  TYR L C   1 
ATOM   2882 O  O   . TYR C 3 50  ? 11.447  -8.914  -29.000 1.00 46.42  ? 50  TYR L O   1 
ATOM   2883 C  CB  . TYR C 3 50  ? 10.966  -6.196  -29.093 1.00 46.21  ? 50  TYR L CB  1 
ATOM   2884 C  CG  . TYR C 3 50  ? 10.260  -4.874  -28.883 1.00 47.60  ? 50  TYR L CG  1 
ATOM   2885 C  CD1 . TYR C 3 50  ? 8.921   -4.857  -28.502 1.00 40.93  ? 50  TYR L CD1 1 
ATOM   2886 C  CD2 . TYR C 3 50  ? 10.919  -3.658  -28.996 1.00 52.15  ? 50  TYR L CD2 1 
ATOM   2887 C  CE1 . TYR C 3 50  ? 8.259   -3.684  -28.270 1.00 40.16  ? 50  TYR L CE1 1 
ATOM   2888 C  CE2 . TYR C 3 50  ? 10.241  -2.454  -28.765 1.00 47.11  ? 50  TYR L CE2 1 
ATOM   2889 C  CZ  . TYR C 3 50  ? 8.914   -2.484  -28.397 1.00 40.19  ? 50  TYR L CZ  1 
ATOM   2890 O  OH  . TYR C 3 50  ? 8.252   -1.303  -28.131 1.00 40.08  ? 50  TYR L OH  1 
ATOM   2891 N  N   . ALA C 3 51  ? 11.349  -9.036  -26.733 1.00 51.53  ? 51  ALA L N   1 
ATOM   2892 C  CA  . ALA C 3 51  ? 11.451  -10.483 -26.557 1.00 51.37  ? 51  ALA L CA  1 
ATOM   2893 C  C   . ALA C 3 51  ? 12.808  -10.990 -26.987 1.00 50.42  ? 51  ALA L C   1 
ATOM   2894 O  O   . ALA C 3 51  ? 13.347  -11.873 -26.330 1.00 55.47  ? 51  ALA L O   1 
ATOM   2895 C  CB  . ALA C 3 51  ? 10.315  -11.215 -27.314 1.00 51.99  ? 51  ALA L CB  1 
ATOM   2896 N  N   . SER C 3 52  ? 13.338  -10.468 -28.104 1.00 50.31  ? 52  SER L N   1 
ATOM   2897 C  CA  . SER C 3 52  ? 14.526  -11.084 -28.732 1.00 57.65  ? 52  SER L CA  1 
ATOM   2898 C  C   . SER C 3 52  ? 15.596  -10.149 -29.370 1.00 53.38  ? 52  SER L C   1 
ATOM   2899 O  O   . SER C 3 52  ? 16.642  -10.642 -29.772 1.00 57.42  ? 52  SER L O   1 
ATOM   2900 C  CB  . SER C 3 52  ? 14.090  -12.062 -29.822 1.00 51.83  ? 52  SER L CB  1 
ATOM   2901 O  OG  . SER C 3 52  ? 13.559  -11.357 -30.925 1.00 51.93  ? 52  SER L OG  1 
ATOM   2902 N  N   . GLU C 3 53  ? 15.429  -8.832  -29.346 1.00 45.78  ? 53  GLU L N   1 
ATOM   2903 C  CA  . GLU C 3 53  ? 16.350  -7.965  -30.069 1.00 44.30  ? 53  GLU L CA  1 
ATOM   2904 C  C   . GLU C 3 53  ? 17.553  -7.651  -29.196 1.00 56.24  ? 53  GLU L C   1 
ATOM   2905 O  O   . GLU C 3 53  ? 17.397  -7.353  -28.005 1.00 63.27  ? 53  GLU L O   1 
ATOM   2906 C  CB  . GLU C 3 53  ? 15.629  -6.714  -30.531 1.00 45.73  ? 53  GLU L CB  1 
ATOM   2907 C  CG  . GLU C 3 53  ? 14.488  -7.092  -31.472 1.00 52.59  ? 53  GLU L CG  1 
ATOM   2908 C  CD  . GLU C 3 53  ? 13.616  -5.938  -31.976 1.00 56.21  ? 53  GLU L CD  1 
ATOM   2909 O  OE1 . GLU C 3 53  ? 13.904  -4.751  -31.720 1.00 54.58  ? 53  GLU L OE1 1 
ATOM   2910 O  OE2 . GLU C 3 53  ? 12.605  -6.237  -32.651 1.00 66.41  ? 53  GLU L OE2 1 
ATOM   2911 N  N   . SER C 3 54  ? 18.763  -7.786  -29.747 1.00 51.54  ? 54  SER L N   1 
ATOM   2912 C  CA  . SER C 3 54  ? 19.971  -7.571  -28.922 1.00 55.87  ? 54  SER L CA  1 
ATOM   2913 C  C   . SER C 3 54  ? 20.144  -6.089  -28.674 1.00 49.63  ? 54  SER L C   1 
ATOM   2914 O  O   . SER C 3 54  ? 19.556  -5.258  -29.364 1.00 49.98  ? 54  SER L O   1 
ATOM   2915 C  CB  . SER C 3 54  ? 21.278  -8.143  -29.533 1.00 47.45  ? 54  SER L CB  1 
ATOM   2916 O  OG  . SER C 3 54  ? 21.649  -7.495  -30.731 1.00 54.12  ? 54  SER L OG  1 
ATOM   2917 N  N   . ILE C 3 55  ? 20.939  -5.773  -27.663 1.00 48.86  ? 55  ILE L N   1 
ATOM   2918 C  CA  . ILE C 3 55  ? 21.138  -4.399  -27.250 1.00 49.90  ? 55  ILE L CA  1 
ATOM   2919 C  C   . ILE C 3 55  ? 22.609  -4.029  -27.377 1.00 52.33  ? 55  ILE L C   1 
ATOM   2920 O  O   . ILE C 3 55  ? 23.516  -4.824  -27.055 1.00 55.15  ? 55  ILE L O   1 
ATOM   2921 C  CB  . ILE C 3 55  ? 20.640  -4.229  -25.753 1.00 54.44  ? 55  ILE L CB  1 
ATOM   2922 C  CG1 . ILE C 3 55  ? 19.144  -4.588  -25.631 1.00 50.34  ? 55  ILE L CG1 1 
ATOM   2923 C  CG2 . ILE C 3 55  ? 20.871  -2.843  -25.221 1.00 51.21  ? 55  ILE L CG2 1 
ATOM   2924 C  CD1 . ILE C 3 55  ? 18.216  -3.674  -26.431 1.00 42.16  ? 55  ILE L CD1 1 
ATOM   2925 N  N   . SER C 3 56  ? 22.844  -2.832  -27.911 1.00 54.64  ? 56  SER L N   1 
ATOM   2926 C  CA  . SER C 3 56  ? 24.211  -2.317  -28.095 1.00 49.61  ? 56  SER L CA  1 
ATOM   2927 C  C   . SER C 3 56  ? 24.958  -2.343  -26.781 1.00 54.83  ? 56  SER L C   1 
ATOM   2928 O  O   . SER C 3 56  ? 24.476  -1.801  -25.771 1.00 55.10  ? 56  SER L O   1 
ATOM   2929 C  CB  . SER C 3 56  ? 24.219  -0.917  -28.670 1.00 48.46  ? 56  SER L CB  1 
ATOM   2930 O  OG  . SER C 3 56  ? 25.533  -0.410  -28.653 1.00 66.41  ? 56  SER L OG  1 
ATOM   2931 N  N   . GLY C 3 57  ? 26.133  -2.959  -26.819 1.00 56.99  ? 57  GLY L N   1 
ATOM   2932 C  CA  . GLY C 3 57  ? 27.069  -3.043  -25.705 1.00 55.07  ? 57  GLY L CA  1 
ATOM   2933 C  C   . GLY C 3 57  ? 26.780  -4.144  -24.699 1.00 52.41  ? 57  GLY L C   1 
ATOM   2934 O  O   . GLY C 3 57  ? 27.469  -4.267  -23.701 1.00 59.65  ? 57  GLY L O   1 
ATOM   2935 N  N   . ILE C 3 58  ? 25.780  -4.972  -24.972 1.00 54.39  ? 58  ILE L N   1 
ATOM   2936 C  CA  . ILE C 3 58  ? 25.478  -6.138  -24.134 1.00 55.13  ? 58  ILE L CA  1 
ATOM   2937 C  C   . ILE C 3 58  ? 26.071  -7.430  -24.728 1.00 52.91  ? 58  ILE L C   1 
ATOM   2938 O  O   . ILE C 3 58  ? 25.929  -7.685  -25.918 1.00 53.09  ? 58  ILE L O   1 
ATOM   2939 C  CB  . ILE C 3 58  ? 23.942  -6.270  -23.924 1.00 59.16  ? 58  ILE L CB  1 
ATOM   2940 C  CG1 . ILE C 3 58  ? 23.415  -5.043  -23.167 1.00 59.90  ? 58  ILE L CG1 1 
ATOM   2941 C  CG2 . ILE C 3 58  ? 23.569  -7.571  -23.191 1.00 54.39  ? 58  ILE L CG2 1 
ATOM   2942 C  CD1 . ILE C 3 58  ? 24.045  -4.851  -21.782 1.00 44.32  ? 58  ILE L CD1 1 
ATOM   2943 N  N   . PRO C 3 59  ? 26.694  -8.274  -23.891 1.00 60.40  ? 59  PRO L N   1 
ATOM   2944 C  CA  . PRO C 3 59  ? 27.349  -9.510  -24.354 1.00 57.74  ? 59  PRO L CA  1 
ATOM   2945 C  C   . PRO C 3 59  ? 26.410  -10.417 -25.150 1.00 56.64  ? 59  PRO L C   1 
ATOM   2946 O  O   . PRO C 3 59  ? 25.239  -10.558 -24.802 1.00 58.39  ? 59  PRO L O   1 
ATOM   2947 C  CB  . PRO C 3 59  ? 27.756  -10.197 -23.047 1.00 51.02  ? 59  PRO L CB  1 
ATOM   2948 C  CG  . PRO C 3 59  ? 27.981  -9.087  -22.127 1.00 55.08  ? 59  PRO L CG  1 
ATOM   2949 C  CD  . PRO C 3 59  ? 26.920  -8.064  -22.450 1.00 60.58  ? 59  PRO L CD  1 
ATOM   2950 N  N   . SER C 3 60  ? 26.908  -10.973 -26.241 1.00 51.84  ? 60  SER L N   1 
ATOM   2951 C  CA  . SER C 3 60  ? 26.088  -11.798 -27.114 1.00 59.53  ? 60  SER L CA  1 
ATOM   2952 C  C   . SER C 3 60  ? 25.554  -13.084 -26.441 1.00 59.94  ? 60  SER L C   1 
ATOM   2953 O  O   . SER C 3 60  ? 24.638  -13.745 -26.985 1.00 54.49  ? 60  SER L O   1 
ATOM   2954 C  CB  . SER C 3 60  ? 26.887  -12.141 -28.370 1.00 64.71  ? 60  SER L CB  1 
ATOM   2955 O  OG  . SER C 3 60  ? 28.105  -12.781 -28.032 1.00 70.98  ? 60  SER L OG  1 
ATOM   2956 N  N   . ARG C 3 61  ? 26.103  -13.425 -25.263 1.00 57.75  ? 61  ARG L N   1 
ATOM   2957 C  CA  . ARG C 3 61  ? 25.652  -14.613 -24.523 1.00 61.39  ? 61  ARG L CA  1 
ATOM   2958 C  C   . ARG C 3 61  ? 24.207  -14.501 -24.041 1.00 62.86  ? 61  ARG L C   1 
ATOM   2959 O  O   . ARG C 3 61  ? 23.582  -15.514 -23.693 1.00 62.07  ? 61  ARG L O   1 
ATOM   2960 C  CB  . ARG C 3 61  ? 26.573  -14.920 -23.332 1.00 53.78  ? 61  ARG L CB  1 
ATOM   2961 C  CG  . ARG C 3 61  ? 26.635  -13.877 -22.228 1.00 58.30  ? 61  ARG L CG  1 
ATOM   2962 C  CD  . ARG C 3 61  ? 27.407  -14.427 -20.977 1.00 59.20  ? 61  ARG L CD  1 
ATOM   2963 N  NE  . ARG C 3 61  ? 27.633  -13.416 -19.940 1.00 54.56  ? 61  ARG L NE  1 
ATOM   2964 C  CZ  . ARG C 3 61  ? 28.566  -12.462 -19.992 1.00 59.11  ? 61  ARG L CZ  1 
ATOM   2965 N  NH1 . ARG C 3 61  ? 29.443  -12.399 -21.001 1.00 56.93  ? 61  ARG L NH1 1 
ATOM   2966 N  NH2 . ARG C 3 61  ? 28.669  -11.598 -18.990 1.00 58.90  ? 61  ARG L NH2 1 
ATOM   2967 N  N   . PHE C 3 62  ? 23.702  -13.272 -23.960 1.00 60.67  ? 62  PHE L N   1 
ATOM   2968 C  CA  . PHE C 3 62  ? 22.301  -13.038 -23.628 1.00 57.70  ? 62  PHE L CA  1 
ATOM   2969 C  C   . PHE C 3 62  ? 21.430  -13.135 -24.881 1.00 57.63  ? 62  PHE L C   1 
ATOM   2970 O  O   . PHE C 3 62  ? 21.768  -12.550 -25.918 1.00 56.82  ? 62  PHE L O   1 
ATOM   2971 C  CB  . PHE C 3 62  ? 22.130  -11.671 -22.999 1.00 55.87  ? 62  PHE L CB  1 
ATOM   2972 C  CG  . PHE C 3 62  ? 22.773  -11.547 -21.656 1.00 56.72  ? 62  PHE L CG  1 
ATOM   2973 C  CD1 . PHE C 3 62  ? 22.113  -11.937 -20.505 1.00 57.88  ? 62  PHE L CD1 1 
ATOM   2974 C  CD2 . PHE C 3 62  ? 24.055  -11.029 -21.550 1.00 57.07  ? 62  PHE L CD2 1 
ATOM   2975 C  CE1 . PHE C 3 62  ? 22.718  -11.807 -19.262 1.00 60.82  ? 62  PHE L CE1 1 
ATOM   2976 C  CE2 . PHE C 3 62  ? 24.658  -10.892 -20.326 1.00 58.98  ? 62  PHE L CE2 1 
ATOM   2977 C  CZ  . PHE C 3 62  ? 23.995  -11.288 -19.175 1.00 59.31  ? 62  PHE L CZ  1 
ATOM   2978 N  N   . SER C 3 63  ? 20.334  -13.881 -24.811 1.00 58.96  ? 63  SER L N   1 
ATOM   2979 C  CA  . SER C 3 63  ? 19.365  -13.917 -25.913 1.00 56.82  ? 63  SER L CA  1 
ATOM   2980 C  C   . SER C 3 63  ? 17.980  -14.093 -25.308 1.00 58.67  ? 63  SER L C   1 
ATOM   2981 O  O   . SER C 3 63  ? 17.861  -14.527 -24.153 1.00 50.37  ? 63  SER L O   1 
ATOM   2982 C  CB  . SER C 3 63  ? 19.638  -15.047 -26.889 1.00 51.60  ? 63  SER L CB  1 
ATOM   2983 O  OG  . SER C 3 63  ? 19.432  -16.271 -26.220 1.00 54.55  ? 63  SER L OG  1 
ATOM   2984 N  N   . GLY C 3 64  ? 16.936  -13.763 -26.071 1.00 57.44  ? 64  GLY L N   1 
ATOM   2985 C  CA  . GLY C 3 64  ? 15.589  -13.999 -25.590 1.00 51.92  ? 64  GLY L CA  1 
ATOM   2986 C  C   . GLY C 3 64  ? 14.711  -14.535 -26.690 1.00 55.85  ? 64  GLY L C   1 
ATOM   2987 O  O   . GLY C 3 64  ? 14.949  -14.280 -27.866 1.00 63.95  ? 64  GLY L O   1 
ATOM   2988 N  N   . SER C 3 65  ? 13.670  -15.266 -26.316 1.00 60.59  ? 65  SER L N   1 
ATOM   2989 C  CA  . SER C 3 65  ? 12.720  -15.810 -27.293 1.00 55.58  ? 65  SER L CA  1 
ATOM   2990 C  C   . SER C 3 65  ? 11.315  -15.769 -26.712 1.00 55.89  ? 65  SER L C   1 
ATOM   2991 O  O   . SER C 3 65  ? 11.131  -15.627 -25.498 1.00 61.41  ? 65  SER L O   1 
ATOM   2992 C  CB  . SER C 3 65  ? 13.054  -17.246 -27.696 1.00 54.66  ? 65  SER L CB  1 
ATOM   2993 O  OG  . SER C 3 65  ? 13.011  -18.106 -26.556 1.00 60.60  ? 65  SER L OG  1 
ATOM   2994 N  N   . GLY C 3 66  ? 10.350  -15.990 -27.589 1.00 56.56  ? 66  GLY L N   1 
ATOM   2995 C  CA  . GLY C 3 66  ? 8.944   -16.106 -27.259 1.00 58.82  ? 66  GLY L CA  1 
ATOM   2996 C  C   . GLY C 3 66  ? 8.091   -15.058 -27.928 1.00 57.89  ? 66  GLY L C   1 
ATOM   2997 O  O   . GLY C 3 66  ? 8.586   -14.019 -28.337 1.00 60.26  ? 66  GLY L O   1 
ATOM   2998 N  N   . SER C 3 67  ? 6.801   -15.351 -28.063 1.00 59.81  ? 67  SER L N   1 
ATOM   2999 C  CA  . SER C 3 67  ? 5.857   -14.411 -28.658 1.00 56.65  ? 67  SER L CA  1 
ATOM   3000 C  C   . SER C 3 67  ? 4.464   -14.843 -28.252 1.00 63.53  ? 67  SER L C   1 
ATOM   3001 O  O   . SER C 3 67  ? 4.085   -16.021 -28.399 1.00 66.05  ? 67  SER L O   1 
ATOM   3002 C  CB  . SER C 3 67  ? 5.986   -14.359 -30.186 1.00 56.25  ? 67  SER L CB  1 
ATOM   3003 O  OG  . SER C 3 67  ? 5.030   -13.505 -30.801 1.00 53.46  ? 67  SER L OG  1 
ATOM   3004 N  N   . GLY C 3 68  ? 3.696   -13.887 -27.748 1.00 60.53  ? 68  GLY L N   1 
ATOM   3005 C  CA  . GLY C 3 68  ? 2.367   -14.183 -27.265 1.00 60.87  ? 68  GLY L CA  1 
ATOM   3006 C  C   . GLY C 3 68  ? 2.347   -14.049 -25.768 1.00 61.42  ? 68  GLY L C   1 
ATOM   3007 O  O   . GLY C 3 68  ? 2.186   -12.940 -25.277 1.00 62.58  ? 68  GLY L O   1 
ATOM   3008 N  N   . THR C 3 69  ? 2.470   -15.142 -25.029 1.00 62.76  ? 69  THR L N   1 
ATOM   3009 C  CA  . THR C 3 69  ? 2.346   -15.029 -23.576 1.00 66.07  ? 69  THR L CA  1 
ATOM   3010 C  C   . THR C 3 69  ? 3.513   -15.621 -22.784 1.00 68.87  ? 69  THR L C   1 
ATOM   3011 O  O   . THR C 3 69  ? 3.703   -15.294 -21.607 1.00 70.91  ? 69  THR L O   1 
ATOM   3012 C  CB  . THR C 3 69  ? 1.086   -15.756 -23.083 1.00 63.13  ? 69  THR L CB  1 
ATOM   3013 O  OG1 . THR C 3 69  ? 1.190   -17.146 -23.412 1.00 62.58  ? 69  THR L OG1 1 
ATOM   3014 C  CG2 . THR C 3 69  ? -0.166  -15.167 -23.721 1.00 61.15  ? 69  THR L CG2 1 
ATOM   3015 N  N   . ASP C 3 70  ? 4.263   -16.519 -23.419 1.00 67.03  ? 70  ASP L N   1 
ATOM   3016 C  CA  . ASP C 3 70  ? 5.298   -17.250 -22.723 1.00 62.02  ? 70  ASP L CA  1 
ATOM   3017 C  C   . ASP C 3 70  ? 6.668   -16.839 -23.238 1.00 67.26  ? 70  ASP L C   1 
ATOM   3018 O  O   . ASP C 3 70  ? 6.964   -17.025 -24.430 1.00 64.75  ? 70  ASP L O   1 
ATOM   3019 C  CB  . ASP C 3 70  ? 5.047   -18.742 -22.886 1.00 63.50  ? 70  ASP L CB  1 
ATOM   3020 C  CG  . ASP C 3 70  ? 5.866   -19.576 -21.942 1.00 83.29  ? 70  ASP L CG  1 
ATOM   3021 O  OD1 . ASP C 3 70  ? 7.099   -19.347 -21.822 1.00 88.24  ? 70  ASP L OD1 1 
ATOM   3022 O  OD2 . ASP C 3 70  ? 5.239   -20.431 -21.255 1.00 85.42  ? 70  ASP L OD2 1 
ATOM   3023 N  N   . PHE C 3 71  ? 7.466   -16.193 -22.381 1.00 65.35  ? 71  PHE L N   1 
ATOM   3024 C  CA  . PHE C 3 71  ? 8.768   -15.681 -22.812 1.00 61.80  ? 71  PHE L CA  1 
ATOM   3025 C  C   . PHE C 3 71  ? 9.925   -16.232 -21.982 1.00 64.64  ? 71  PHE L C   1 
ATOM   3026 O  O   . PHE C 3 71  ? 9.774   -16.495 -20.769 1.00 64.25  ? 71  PHE L O   1 
ATOM   3027 C  CB  . PHE C 3 71  ? 8.777   -14.165 -22.752 1.00 56.04  ? 71  PHE L CB  1 
ATOM   3028 C  CG  . PHE C 3 71  ? 7.660   -13.548 -23.499 1.00 59.67  ? 71  PHE L CG  1 
ATOM   3029 C  CD1 . PHE C 3 71  ? 7.761   -13.326 -24.851 1.00 56.67  ? 71  PHE L CD1 1 
ATOM   3030 C  CD2 . PHE C 3 71  ? 6.471   -13.238 -22.853 1.00 59.72  ? 71  PHE L CD2 1 
ATOM   3031 C  CE1 . PHE C 3 71  ? 6.709   -12.763 -25.550 1.00 57.46  ? 71  PHE L CE1 1 
ATOM   3032 C  CE2 . PHE C 3 71  ? 5.411   -12.680 -23.550 1.00 60.95  ? 71  PHE L CE2 1 
ATOM   3033 C  CZ  . PHE C 3 71  ? 5.538   -12.440 -24.904 1.00 58.52  ? 71  PHE L CZ  1 
ATOM   3034 N  N   . THR C 3 72  ? 11.090  -16.367 -22.625 1.00 59.06  ? 72  THR L N   1 
ATOM   3035 C  CA  . THR C 3 72  ? 12.281  -16.897 -21.944 1.00 59.33  ? 72  THR L CA  1 
ATOM   3036 C  C   . THR C 3 72  ? 13.519  -16.080 -22.255 1.00 59.31  ? 72  THR L C   1 
ATOM   3037 O  O   . THR C 3 72  ? 13.734  -15.618 -23.400 1.00 57.26  ? 72  THR L O   1 
ATOM   3038 C  CB  . THR C 3 72  ? 12.560  -18.383 -22.263 1.00 58.64  ? 72  THR L CB  1 
ATOM   3039 O  OG1 . THR C 3 72  ? 12.879  -18.487 -23.656 1.00 69.87  ? 72  THR L OG1 1 
ATOM   3040 C  CG2 . THR C 3 72  ? 11.327  -19.245 -22.025 1.00 62.43  ? 72  THR L CG2 1 
ATOM   3041 N  N   . LEU C 3 73  ? 14.293  -15.849 -21.196 1.00 54.82  ? 73  LEU L N   1 
ATOM   3042 C  CA  . LEU C 3 73  ? 15.618  -15.262 -21.333 1.00 55.43  ? 73  LEU L CA  1 
ATOM   3043 C  C   . LEU C 3 73  ? 16.720  -16.276 -21.103 1.00 60.40  ? 73  LEU L C   1 
ATOM   3044 O  O   . LEU C 3 73  ? 16.675  -17.034 -20.142 1.00 66.19  ? 73  LEU L O   1 
ATOM   3045 C  CB  . LEU C 3 73  ? 15.806  -14.118 -20.326 1.00 54.82  ? 73  LEU L CB  1 
ATOM   3046 C  CG  . LEU C 3 73  ? 17.135  -13.347 -20.368 1.00 51.46  ? 73  LEU L CG  1 
ATOM   3047 C  CD1 . LEU C 3 73  ? 17.225  -12.623 -21.681 1.00 51.87  ? 73  LEU L CD1 1 
ATOM   3048 C  CD2 . LEU C 3 73  ? 17.236  -12.372 -19.236 1.00 45.94  ? 73  LEU L CD2 1 
ATOM   3049 N  N   . SER C 3 74  ? 17.717  -16.298 -21.969 1.00 54.60  ? 74  SER L N   1 
ATOM   3050 C  CA  . SER C 3 74  ? 18.799  -17.226 -21.754 1.00 60.00  ? 74  SER L CA  1 
ATOM   3051 C  C   . SER C 3 74  ? 20.187  -16.540 -21.697 1.00 63.33  ? 74  SER L C   1 
ATOM   3052 O  O   . SER C 3 74  ? 20.476  -15.541 -22.395 1.00 60.19  ? 74  SER L O   1 
ATOM   3053 C  CB  . SER C 3 74  ? 18.776  -18.319 -22.818 1.00 59.99  ? 74  SER L CB  1 
ATOM   3054 O  OG  . SER C 3 74  ? 17.495  -18.898 -22.894 1.00 65.99  ? 74  SER L OG  1 
ATOM   3055 N  N   . ILE C 3 75  ? 21.025  -17.083 -20.824 1.00 63.28  ? 75  ILE L N   1 
ATOM   3056 C  CA  . ILE C 3 75  ? 22.409  -16.695 -20.742 1.00 61.37  ? 75  ILE L CA  1 
ATOM   3057 C  C   . ILE C 3 75  ? 23.198  -17.930 -21.086 1.00 63.45  ? 75  ILE L C   1 
ATOM   3058 O  O   . ILE C 3 75  ? 23.098  -18.978 -20.400 1.00 59.14  ? 75  ILE L O   1 
ATOM   3059 C  CB  . ILE C 3 75  ? 22.812  -16.184 -19.342 1.00 66.26  ? 75  ILE L CB  1 
ATOM   3060 C  CG1 . ILE C 3 75  ? 21.792  -15.149 -18.843 1.00 57.59  ? 75  ILE L CG1 1 
ATOM   3061 C  CG2 . ILE C 3 75  ? 24.271  -15.658 -19.354 1.00 55.51  ? 75  ILE L CG2 1 
ATOM   3062 C  CD1 . ILE C 3 75  ? 21.975  -14.714 -17.433 1.00 53.27  ? 75  ILE L CD1 1 
ATOM   3063 N  N   . ASN C 3 76  ? 23.913  -17.827 -22.205 1.00 70.10  ? 76  ASN L N   1 
ATOM   3064 C  CA  . ASN C 3 76  ? 24.624  -18.974 -22.758 1.00 70.22  ? 76  ASN L CA  1 
ATOM   3065 C  C   . ASN C 3 76  ? 25.625  -19.580 -21.800 1.00 66.48  ? 76  ASN L C   1 
ATOM   3066 O  O   . ASN C 3 76  ? 25.662  -20.791 -21.636 1.00 71.86  ? 76  ASN L O   1 
ATOM   3067 C  CB  . ASN C 3 76  ? 25.354  -18.603 -24.043 1.00 67.08  ? 76  ASN L CB  1 
ATOM   3068 C  CG  . ASN C 3 76  ? 25.932  -19.825 -24.746 1.00 73.87  ? 76  ASN L CG  1 
ATOM   3069 O  OD1 . ASN C 3 76  ? 25.212  -20.801 -25.001 1.00 69.53  ? 76  ASN L OD1 1 
ATOM   3070 N  ND2 . ASN C 3 76  ? 27.234  -19.780 -25.063 1.00 69.79  ? 76  ASN L ND2 1 
ATOM   3071 N  N   . SER C 3 77  ? 26.423  -18.720 -21.172 1.00 61.35  ? 77  SER L N   1 
ATOM   3072 C  CA  . SER C 3 77  ? 27.497  -19.142 -20.278 1.00 64.73  ? 77  SER L CA  1 
ATOM   3073 C  C   . SER C 3 77  ? 27.673  -18.139 -19.124 1.00 62.89  ? 77  SER L C   1 
ATOM   3074 O  O   . SER C 3 77  ? 28.148  -17.021 -19.332 1.00 64.34  ? 77  SER L O   1 
ATOM   3075 C  CB  . SER C 3 77  ? 28.789  -19.326 -21.092 1.00 65.83  ? 77  SER L CB  1 
ATOM   3076 O  OG  . SER C 3 77  ? 29.896  -19.643 -20.279 1.00 66.62  ? 77  SER L OG  1 
ATOM   3077 N  N   . VAL C 3 78  ? 27.230  -18.487 -17.928 1.00 58.04  ? 78  VAL L N   1 
ATOM   3078 C  CA  . VAL C 3 78  ? 27.202  -17.502 -16.854 1.00 59.65  ? 78  VAL L CA  1 
ATOM   3079 C  C   . VAL C 3 78  ? 28.578  -17.013 -16.379 1.00 66.52  ? 78  VAL L C   1 
ATOM   3080 O  O   . VAL C 3 78  ? 29.466  -17.809 -16.077 1.00 73.97  ? 78  VAL L O   1 
ATOM   3081 C  CB  . VAL C 3 78  ? 26.441  -18.049 -15.635 1.00 60.24  ? 78  VAL L CB  1 
ATOM   3082 C  CG1 . VAL C 3 78  ? 26.666  -17.161 -14.458 1.00 60.64  ? 78  VAL L CG1 1 
ATOM   3083 C  CG2 . VAL C 3 78  ? 24.943  -18.111 -15.932 1.00 65.56  ? 78  VAL L CG2 1 
ATOM   3084 N  N   . GLU C 3 79  ? 28.746  -15.703 -16.249 1.00 64.39  ? 79  GLU L N   1 
ATOM   3085 C  CA  . GLU C 3 79  ? 29.998  -15.197 -15.724 1.00 60.12  ? 79  GLU L CA  1 
ATOM   3086 C  C   . GLU C 3 79  ? 29.558  -14.523 -14.430 1.00 62.12  ? 79  GLU L C   1 
ATOM   3087 O  O   . GLU C 3 79  ? 28.379  -14.255 -14.237 1.00 62.32  ? 79  GLU L O   1 
ATOM   3088 C  CB  . GLU C 3 79  ? 30.751  -14.192 -16.641 1.00 64.68  ? 79  GLU L CB  1 
ATOM   3089 C  CG  . GLU C 3 79  ? 31.176  -14.567 -18.098 1.00 63.73  ? 79  GLU L CG  1 
ATOM   3090 C  CD  . GLU C 3 79  ? 32.077  -13.459 -18.747 1.00 71.98  ? 79  GLU L CD  1 
ATOM   3091 O  OE1 . GLU C 3 79  ? 32.299  -12.419 -18.102 1.00 70.57  ? 79  GLU L OE1 1 
ATOM   3092 O  OE2 . GLU C 3 79  ? 32.544  -13.597 -19.901 1.00 71.90  ? 79  GLU L OE2 1 
ATOM   3093 N  N   . SER C 3 80  ? 30.496  -14.318 -13.511 1.00 71.70  ? 80  SER L N   1 
ATOM   3094 C  CA  . SER C 3 80  ? 30.186  -13.786 -12.181 1.00 59.17  ? 80  SER L CA  1 
ATOM   3095 C  C   . SER C 3 80  ? 29.449  -12.465 -12.248 1.00 54.90  ? 80  SER L C   1 
ATOM   3096 O  O   . SER C 3 80  ? 28.566  -12.204 -11.457 1.00 60.69  ? 80  SER L O   1 
ATOM   3097 C  CB  . SER C 3 80  ? 31.467  -13.633 -11.366 1.00 56.83  ? 80  SER L CB  1 
ATOM   3098 O  OG  . SER C 3 80  ? 32.323  -12.673 -11.953 1.00 70.07  ? 80  SER L OG  1 
ATOM   3099 N  N   . GLU C 3 81  ? 29.744  -11.678 -13.264 1.00 55.02  ? 81  GLU L N   1 
ATOM   3100 C  CA  . GLU C 3 81  ? 29.170  -10.355 -13.418 1.00 57.53  ? 81  GLU L CA  1 
ATOM   3101 C  C   . GLU C 3 81  ? 27.682  -10.486 -13.819 1.00 60.66  ? 81  GLU L C   1 
ATOM   3102 O  O   . GLU C 3 81  ? 26.920  -9.522  -13.818 1.00 60.30  ? 81  GLU L O   1 
ATOM   3103 C  CB  . GLU C 3 81  ? 30.002  -9.610  -14.443 1.00 57.15  ? 81  GLU L CB  1 
ATOM   3104 C  CG  . GLU C 3 81  ? 29.682  -10.024 -15.858 1.00 64.89  ? 81  GLU L CG  1 
ATOM   3105 C  CD  . GLU C 3 81  ? 30.934  -10.166 -16.689 1.00 68.06  ? 81  GLU L CD  1 
ATOM   3106 O  OE1 . GLU C 3 81  ? 30.924  -9.855  -17.904 1.00 71.29  ? 81  GLU L OE1 1 
ATOM   3107 O  OE2 . GLU C 3 81  ? 31.928  -10.661 -16.109 1.00 73.88  ? 81  GLU L OE2 1 
ATOM   3108 N  N   . ASP C 3 82  ? 27.259  -11.703 -14.133 1.00 57.94  ? 82  ASP L N   1 
ATOM   3109 C  CA  . ASP C 3 82  ? 25.875  -11.931 -14.501 1.00 57.22  ? 82  ASP L CA  1 
ATOM   3110 C  C   . ASP C 3 82  ? 25.046  -12.174 -13.247 1.00 59.39  ? 82  ASP L C   1 
ATOM   3111 O  O   . ASP C 3 82  ? 23.808  -12.227 -13.299 1.00 62.52  ? 82  ASP L O   1 
ATOM   3112 C  CB  . ASP C 3 82  ? 25.774  -13.115 -15.473 1.00 54.12  ? 82  ASP L CB  1 
ATOM   3113 C  CG  . ASP C 3 82  ? 26.567  -12.880 -16.735 1.00 59.26  ? 82  ASP L CG  1 
ATOM   3114 O  OD1 . ASP C 3 82  ? 26.770  -11.687 -17.070 1.00 58.71  ? 82  ASP L OD1 1 
ATOM   3115 O  OD2 . ASP C 3 82  ? 27.040  -13.862 -17.360 1.00 59.13  ? 82  ASP L OD2 1 
ATOM   3116 N  N   . ILE C 3 83  ? 25.715  -12.332 -12.108 1.00 62.59  ? 83  ILE L N   1 
ATOM   3117 C  CA  . ILE C 3 83  ? 24.979  -12.518 -10.860 1.00 62.17  ? 83  ILE L CA  1 
ATOM   3118 C  C   . ILE C 3 83  ? 24.236  -11.230 -10.478 1.00 62.28  ? 83  ILE L C   1 
ATOM   3119 O  O   . ILE C 3 83  ? 24.863  -10.181 -10.202 1.00 63.20  ? 83  ILE L O   1 
ATOM   3120 C  CB  . ILE C 3 83  ? 25.902  -12.937 -9.734  1.00 57.57  ? 83  ILE L CB  1 
ATOM   3121 C  CG1 . ILE C 3 83  ? 26.447  -14.337 -10.004 1.00 62.75  ? 83  ILE L CG1 1 
ATOM   3122 C  CG2 . ILE C 3 83  ? 25.165  -12.887 -8.396  1.00 60.57  ? 83  ILE L CG2 1 
ATOM   3123 C  CD1 . ILE C 3 83  ? 25.433  -15.385 -10.279 1.00 63.86  ? 83  ILE L CD1 1 
ATOM   3124 N  N   . ALA C 3 84  ? 22.912  -11.342 -10.402 1.00 59.53  ? 84  ALA L N   1 
ATOM   3125 C  CA  . ALA C 3 84  ? 22.030  -10.178 -10.368 1.00 59.37  ? 84  ALA L CA  1 
ATOM   3126 C  C   . ALA C 3 84  ? 20.553  -10.590 -10.318 1.00 62.16  ? 84  ALA L C   1 
ATOM   3127 O  O   . ALA C 3 84  ? 20.198  -11.777 -10.474 1.00 58.66  ? 84  ALA L O   1 
ATOM   3128 C  CB  . ALA C 3 84  ? 22.283  -9.273  -11.580 1.00 52.28  ? 84  ALA L CB  1 
ATOM   3129 N  N   . ASP C 3 85  ? 19.692  -9.592  -10.143 1.00 58.98  ? 85  ASP L N   1 
ATOM   3130 C  CA  . ASP C 3 85  ? 18.273  -9.813  -10.306 1.00 55.70  ? 85  ASP L CA  1 
ATOM   3131 C  C   . ASP C 3 85  ? 17.883  -9.450  -11.719 1.00 53.58  ? 85  ASP L C   1 
ATOM   3132 O  O   . ASP C 3 85  ? 18.476  -8.575  -12.338 1.00 51.45  ? 85  ASP L O   1 
ATOM   3133 C  CB  . ASP C 3 85  ? 17.442  -8.961  -9.354  1.00 62.62  ? 85  ASP L CB  1 
ATOM   3134 C  CG  . ASP C 3 85  ? 17.704  -9.251  -7.929  1.00 62.36  ? 85  ASP L CG  1 
ATOM   3135 O  OD1 . ASP C 3 85  ? 17.844  -10.441 -7.588  1.00 64.42  ? 85  ASP L OD1 1 
ATOM   3136 O  OD2 . ASP C 3 85  ? 17.684  -8.280  -7.150  1.00 66.34  ? 85  ASP L OD2 1 
ATOM   3137 N  N   . TYR C 3 86  ? 16.910  -10.185 -12.239 1.00 56.04  ? 86  TYR L N   1 
ATOM   3138 C  CA  . TYR C 3 86  ? 16.411  -10.025 -13.611 1.00 59.66  ? 86  TYR L CA  1 
ATOM   3139 C  C   . TYR C 3 86  ? 14.889  -9.812  -13.628 1.00 56.42  ? 86  TYR L C   1 
ATOM   3140 O  O   . TYR C 3 86  ? 14.152  -10.551 -12.966 1.00 52.60  ? 86  TYR L O   1 
ATOM   3141 C  CB  . TYR C 3 86  ? 16.822  -11.234 -14.459 1.00 54.78  ? 86  TYR L CB  1 
ATOM   3142 C  CG  . TYR C 3 86  ? 18.315  -11.266 -14.756 1.00 58.29  ? 86  TYR L CG  1 
ATOM   3143 C  CD1 . TYR C 3 86  ? 19.233  -11.801 -13.821 1.00 56.47  ? 86  TYR L CD1 1 
ATOM   3144 C  CD2 . TYR C 3 86  ? 18.795  -10.873 -16.009 1.00 53.26  ? 86  TYR L CD2 1 
ATOM   3145 C  CE1 . TYR C 3 86  ? 20.596  -11.861 -14.100 1.00 57.02  ? 86  TYR L CE1 1 
ATOM   3146 C  CE2 . TYR C 3 86  ? 20.147  -10.946 -16.311 1.00 56.99  ? 86  TYR L CE2 1 
ATOM   3147 C  CZ  . TYR C 3 86  ? 21.050  -11.439 -15.355 1.00 61.45  ? 86  TYR L CZ  1 
ATOM   3148 O  OH  . TYR C 3 86  ? 22.395  -11.482 -15.659 1.00 53.21  ? 86  TYR L OH  1 
ATOM   3149 N  N   . TYR C 3 87  ? 14.443  -8.759  -14.309 1.00 50.70  ? 87  TYR L N   1 
ATOM   3150 C  CA  . TYR C 3 87  ? 13.033  -8.429  -14.362 1.00 46.75  ? 87  TYR L CA  1 
ATOM   3151 C  C   . TYR C 3 87  ? 12.543  -8.411  -15.811 1.00 52.36  ? 87  TYR L C   1 
ATOM   3152 O  O   . TYR C 3 87  ? 13.255  -7.938  -16.696 1.00 50.69  ? 87  TYR L O   1 
ATOM   3153 C  CB  . TYR C 3 87  ? 12.770  -7.073  -13.708 1.00 47.12  ? 87  TYR L CB  1 
ATOM   3154 C  CG  . TYR C 3 87  ? 13.092  -6.998  -12.231 1.00 52.61  ? 87  TYR L CG  1 
ATOM   3155 C  CD1 . TYR C 3 87  ? 12.161  -7.393  -11.271 1.00 53.19  ? 87  TYR L CD1 1 
ATOM   3156 C  CD2 . TYR C 3 87  ? 14.323  -6.524  -11.796 1.00 49.97  ? 87  TYR L CD2 1 
ATOM   3157 C  CE1 . TYR C 3 87  ? 12.445  -7.310  -9.919  1.00 49.85  ? 87  TYR L CE1 1 
ATOM   3158 C  CE2 . TYR C 3 87  ? 14.618  -6.434  -10.476 1.00 49.12  ? 87  TYR L CE2 1 
ATOM   3159 C  CZ  . TYR C 3 87  ? 13.674  -6.821  -9.531  1.00 52.07  ? 87  TYR L CZ  1 
ATOM   3160 O  OH  . TYR C 3 87  ? 13.988  -6.731  -8.201  1.00 48.52  ? 87  TYR L OH  1 
ATOM   3161 N  N   . CYS C 3 88  ? 11.329  -8.894  -16.070 1.00 54.90  ? 88  CYS L N   1 
ATOM   3162 C  CA  . CYS C 3 88  ? 10.703  -8.661  -17.378 1.00 48.15  ? 88  CYS L CA  1 
ATOM   3163 C  C   . CYS C 3 88  ? 9.691   -7.574  -17.208 1.00 47.28  ? 88  CYS L C   1 
ATOM   3164 O  O   . CYS C 3 88  ? 9.153   -7.381  -16.121 1.00 50.86  ? 88  CYS L O   1 
ATOM   3165 C  CB  . CYS C 3 88  ? 10.028  -9.909  -17.932 1.00 50.43  ? 88  CYS L CB  1 
ATOM   3166 S  SG  . CYS C 3 88  ? 8.788   -10.599 -16.827 1.00 49.99  ? 88  CYS L SG  1 
ATOM   3167 N  N   . GLN C 3 89  ? 9.379   -6.899  -18.298 1.00 48.94  ? 89  GLN L N   1 
ATOM   3168 C  CA  . GLN C 3 89  ? 8.444   -5.784  -18.267 1.00 48.88  ? 89  GLN L CA  1 
ATOM   3169 C  C   . GLN C 3 89  ? 7.703   -5.720  -19.569 1.00 50.10  ? 89  GLN L C   1 
ATOM   3170 O  O   . GLN C 3 89  ? 8.280   -6.036  -20.611 1.00 50.55  ? 89  GLN L O   1 
ATOM   3171 C  CB  . GLN C 3 89  ? 9.162   -4.460  -18.015 1.00 45.89  ? 89  GLN L CB  1 
ATOM   3172 C  CG  . GLN C 3 89  ? 8.252   -3.253  -18.118 1.00 48.38  ? 89  GLN L CG  1 
ATOM   3173 C  CD  . GLN C 3 89  ? 8.770   -2.208  -19.095 1.00 47.59  ? 89  GLN L CD  1 
ATOM   3174 O  OE1 . GLN C 3 89  ? 9.976   -2.123  -19.317 1.00 49.57  ? 89  GLN L OE1 1 
ATOM   3175 N  NE2 . GLN C 3 89  ? 7.860   -1.406  -19.686 1.00 40.01  ? 89  GLN L NE2 1 
ATOM   3176 N  N   . GLN C 3 90  ? 6.411   -5.418  -19.517 1.00 43.90  ? 90  GLN L N   1 
ATOM   3177 C  CA  . GLN C 3 90  ? 5.648   -5.227  -20.753 1.00 43.39  ? 90  GLN L CA  1 
ATOM   3178 C  C   . GLN C 3 90  ? 5.303   -3.760  -20.989 1.00 44.40  ? 90  GLN L C   1 
ATOM   3179 O  O   . GLN C 3 90  ? 5.195   -2.974  -20.053 1.00 47.33  ? 90  GLN L O   1 
ATOM   3180 C  CB  . GLN C 3 90  ? 4.383   -6.112  -20.768 1.00 45.39  ? 90  GLN L CB  1 
ATOM   3181 C  CG  . GLN C 3 90  ? 3.319   -5.744  -19.707 1.00 47.27  ? 90  GLN L CG  1 
ATOM   3182 C  CD  . GLN C 3 90  ? 2.441   -4.568  -20.082 1.00 47.44  ? 90  GLN L CD  1 
ATOM   3183 O  OE1 . GLN C 3 90  ? 2.258   -4.260  -21.262 1.00 46.15  ? 90  GLN L OE1 1 
ATOM   3184 N  NE2 . GLN C 3 90  ? 1.894   -3.897  -19.066 1.00 45.88  ? 90  GLN L NE2 1 
ATOM   3185 N  N   . SER C 3 91  ? 5.278   -3.393  -22.261 1.00 43.67  ? 91  SER L N   1 
ATOM   3186 C  CA  . SER C 3 91  ? 5.019   -2.044  -22.732 1.00 42.75  ? 91  SER L CA  1 
ATOM   3187 C  C   . SER C 3 91  ? 3.881   -2.038  -23.771 1.00 48.68  ? 91  SER L C   1 
ATOM   3188 O  O   . SER C 3 91  ? 3.762   -1.124  -24.607 1.00 46.40  ? 91  SER L O   1 
ATOM   3189 C  CB  . SER C 3 91  ? 6.301   -1.435  -23.280 1.00 42.17  ? 91  SER L CB  1 
ATOM   3190 O  OG  . SER C 3 91  ? 6.723   -2.153  -24.424 1.00 45.40  ? 91  SER L OG  1 
ATOM   3191 N  N   . ASN C 3 92  ? 3.112   -3.114  -23.802 1.00 46.58  ? 92  ASN L N   1 
ATOM   3192 C  CA  . ASN C 3 92  ? 2.043   -3.213  -24.765 1.00 44.30  ? 92  ASN L CA  1 
ATOM   3193 C  C   . ASN C 3 92  ? 0.889   -2.210  -24.485 1.00 49.48  ? 92  ASN L C   1 
ATOM   3194 O  O   . ASN C 3 92  ? 0.439   -1.476  -25.389 1.00 49.48  ? 92  ASN L O   1 
ATOM   3195 C  CB  . ASN C 3 92  ? 1.519   -4.638  -24.773 1.00 49.03  ? 92  ASN L CB  1 
ATOM   3196 C  CG  . ASN C 3 92  ? 0.715   -4.960  -26.031 1.00 55.87  ? 92  ASN L CG  1 
ATOM   3197 O  OD1 . ASN C 3 92  ? -0.482  -5.216  -25.957 1.00 48.88  ? 92  ASN L OD1 1 
ATOM   3198 N  ND2 . ASN C 3 92  ? 1.379   -4.930  -27.195 1.00 57.91  ? 92  ASN L ND2 1 
ATOM   3199 N  N   . THR C 3 93  ? 0.441   -2.148  -23.237 1.00 41.80  ? 93  THR L N   1 
ATOM   3200 C  CA  . THR C 3 93  ? -0.647  -1.247  -22.858 1.00 47.54  ? 93  THR L CA  1 
ATOM   3201 C  C   . THR C 3 93  ? -0.455  -0.718  -21.444 1.00 47.07  ? 93  THR L C   1 
ATOM   3202 O  O   . THR C 3 93  ? 0.374   -1.255  -20.670 1.00 44.14  ? 93  THR L O   1 
ATOM   3203 C  CB  . THR C 3 93  ? -2.029  -1.945  -22.898 1.00 48.14  ? 93  THR L CB  1 
ATOM   3204 O  OG1 . THR C 3 93  ? -1.970  -3.181  -22.165 1.00 53.23  ? 93  THR L OG1 1 
ATOM   3205 C  CG2 . THR C 3 93  ? -2.496  -2.197  -24.321 1.00 40.84  ? 93  THR L CG2 1 
ATOM   3206 N  N   . TRP C 3 94  ? -1.197  0.334   -21.098 1.00 44.57  ? 94  TRP L N   1 
ATOM   3207 C  CA  . TRP C 3 94  ? -1.117  0.867   -19.729 1.00 44.00  ? 94  TRP L CA  1 
ATOM   3208 C  C   . TRP C 3 94  ? -1.901  -0.074  -18.843 1.00 41.54  ? 94  TRP L C   1 
ATOM   3209 O  O   . TRP C 3 94  ? -2.883  -0.659  -19.312 1.00 45.86  ? 94  TRP L O   1 
ATOM   3210 C  CB  . TRP C 3 94  ? -1.770  2.244   -19.638 1.00 42.99  ? 94  TRP L CB  1 
ATOM   3211 C  CG  . TRP C 3 94  ? -1.145  3.276   -20.493 1.00 45.69  ? 94  TRP L CG  1 
ATOM   3212 C  CD1 . TRP C 3 94  ? -1.769  4.025   -21.449 1.00 51.17  ? 94  TRP L CD1 1 
ATOM   3213 C  CD2 . TRP C 3 94  ? 0.206   3.724   -20.447 1.00 44.47  ? 94  TRP L CD2 1 
ATOM   3214 N  NE1 . TRP C 3 94  ? -0.876  4.891   -22.019 1.00 54.21  ? 94  TRP L NE1 1 
ATOM   3215 C  CE2 . TRP C 3 94  ? 0.340   4.738   -21.410 1.00 43.86  ? 94  TRP L CE2 1 
ATOM   3216 C  CE3 . TRP C 3 94  ? 1.323   3.356   -19.685 1.00 47.53  ? 94  TRP L CE3 1 
ATOM   3217 C  CZ2 . TRP C 3 94  ? 1.539   5.380   -21.651 1.00 48.11  ? 94  TRP L CZ2 1 
ATOM   3218 C  CZ3 . TRP C 3 94  ? 2.515   3.992   -19.916 1.00 47.49  ? 94  TRP L CZ3 1 
ATOM   3219 C  CH2 . TRP C 3 94  ? 2.617   4.999   -20.900 1.00 52.06  ? 94  TRP L CH2 1 
ATOM   3220 N  N   . PRO C 3 95  ? -1.472  -0.266  -17.578 1.00 45.73  ? 95  PRO L N   1 
ATOM   3221 C  CA  . PRO C 3 95  ? -0.239  0.265   -16.983 1.00 44.00  ? 95  PRO L CA  1 
ATOM   3222 C  C   . PRO C 3 95  ? 0.951   -0.606  -17.394 1.00 44.58  ? 95  PRO L C   1 
ATOM   3223 O  O   . PRO C 3 95  ? 0.758   -1.785  -17.691 1.00 44.75  ? 95  PRO L O   1 
ATOM   3224 C  CB  . PRO C 3 95  ? -0.484  0.132   -15.476 1.00 37.77  ? 95  PRO L CB  1 
ATOM   3225 C  CG  . PRO C 3 95  ? -1.344  -1.068  -15.375 1.00 39.90  ? 95  PRO L CG  1 
ATOM   3226 C  CD  . PRO C 3 95  ? -2.302  -0.939  -16.555 1.00 44.34  ? 95  PRO L CD  1 
ATOM   3227 N  N   . TYR C 3 96  ? 2.151   -0.039  -17.443 1.00 46.87  ? 96  TYR L N   1 
ATOM   3228 C  CA  . TYR C 3 96  ? 3.360   -0.837  -17.535 1.00 44.15  ? 96  TYR L CA  1 
ATOM   3229 C  C   . TYR C 3 96  ? 3.339   -1.789  -16.364 1.00 44.94  ? 96  TYR L C   1 
ATOM   3230 O  O   . TYR C 3 96  ? 2.892   -1.416  -15.272 1.00 42.62  ? 96  TYR L O   1 
ATOM   3231 C  CB  . TYR C 3 96  ? 4.625   0.000   -17.462 1.00 42.34  ? 96  TYR L CB  1 
ATOM   3232 C  CG  . TYR C 3 96  ? 4.998   0.809   -18.675 1.00 42.42  ? 96  TYR L CG  1 
ATOM   3233 C  CD1 . TYR C 3 96  ? 4.419   0.600   -19.939 1.00 49.11  ? 96  TYR L CD1 1 
ATOM   3234 C  CD2 . TYR C 3 96  ? 5.908   1.830   -18.542 1.00 44.62  ? 96  TYR L CD2 1 
ATOM   3235 C  CE1 . TYR C 3 96  ? 4.779   1.412   -21.018 1.00 43.99  ? 96  TYR L CE1 1 
ATOM   3236 C  CE2 . TYR C 3 96  ? 6.269   2.623   -19.585 1.00 44.80  ? 96  TYR L CE2 1 
ATOM   3237 C  CZ  . TYR C 3 96  ? 5.720   2.428   -20.807 1.00 44.78  ? 96  TYR L CZ  1 
ATOM   3238 O  OH  . TYR C 3 96  ? 6.162   3.286   -21.787 1.00 48.74  ? 96  TYR L OH  1 
ATOM   3239 N  N   . THR C 3 97  ? 3.773   -3.017  -16.564 1.00 41.76  ? 97  THR L N   1 
ATOM   3240 C  CA  . THR C 3 97  ? 3.892   -3.876  -15.406 1.00 43.33  ? 97  THR L CA  1 
ATOM   3241 C  C   . THR C 3 97  ? 5.227   -4.563  -15.423 1.00 46.40  ? 97  THR L C   1 
ATOM   3242 O  O   . THR C 3 97  ? 5.805   -4.786  -16.491 1.00 50.18  ? 97  THR L O   1 
ATOM   3243 C  CB  . THR C 3 97  ? 2.771   -4.901  -15.365 1.00 45.69  ? 97  THR L CB  1 
ATOM   3244 O  OG1 . THR C 3 97  ? 2.677   -5.514  -16.657 1.00 45.39  ? 97  THR L OG1 1 
ATOM   3245 C  CG2 . THR C 3 97  ? 1.462   -4.218  -15.030 1.00 36.86  ? 97  THR L CG2 1 
ATOM   3246 N  N   . PHE C 3 98  ? 5.705   -4.941  -14.248 1.00 47.04  ? 98  PHE L N   1 
ATOM   3247 C  CA  . PHE C 3 98  ? 6.985   -5.623  -14.137 1.00 42.51  ? 98  PHE L CA  1 
ATOM   3248 C  C   . PHE C 3 98  ? 6.778   -7.002  -13.534 1.00 46.69  ? 98  PHE L C   1 
ATOM   3249 O  O   . PHE C 3 98  ? 5.909   -7.188  -12.662 1.00 43.55  ? 98  PHE L O   1 
ATOM   3250 C  CB  . PHE C 3 98  ? 7.921   -4.834  -13.237 1.00 43.62  ? 98  PHE L CB  1 
ATOM   3251 C  CG  . PHE C 3 98  ? 8.525   -3.642  -13.879 1.00 47.85  ? 98  PHE L CG  1 
ATOM   3252 C  CD1 . PHE C 3 98  ? 9.714   -3.755  -14.600 1.00 50.90  ? 98  PHE L CD1 1 
ATOM   3253 C  CD2 . PHE C 3 98  ? 7.942   -2.403  -13.732 1.00 46.12  ? 98  PHE L CD2 1 
ATOM   3254 C  CE1 . PHE C 3 98  ? 10.291  -2.650  -15.192 1.00 51.29  ? 98  PHE L CE1 1 
ATOM   3255 C  CE2 . PHE C 3 98  ? 8.507   -1.290  -14.302 1.00 51.52  ? 98  PHE L CE2 1 
ATOM   3256 C  CZ  . PHE C 3 98  ? 9.685   -1.403  -15.043 1.00 55.02  ? 98  PHE L CZ  1 
ATOM   3257 N  N   . GLY C 3 99  ? 7.584   -7.969  -13.958 1.00 47.35  ? 99  GLY L N   1 
ATOM   3258 C  CA  . GLY C 3 99  ? 7.646   -9.220  -13.222 1.00 48.96  ? 99  GLY L CA  1 
ATOM   3259 C  C   . GLY C 3 99  ? 8.236   -9.003  -11.837 1.00 45.79  ? 99  GLY L C   1 
ATOM   3260 O  O   . GLY C 3 99  ? 8.804   -7.950  -11.542 1.00 41.72  ? 99  GLY L O   1 
ATOM   3261 N  N   . GLY C 3 100 ? 8.068   -9.992  -10.971 1.00 44.00  ? 100 GLY L N   1 
ATOM   3262 C  CA  . GLY C 3 100 ? 8.564   -9.882  -9.625  1.00 45.41  ? 100 GLY L CA  1 
ATOM   3263 C  C   . GLY C 3 100 ? 10.037  -10.200 -9.547  1.00 55.04  ? 100 GLY L C   1 
ATOM   3264 O  O   . GLY C 3 100 ? 10.670  -10.009 -8.509  1.00 50.41  ? 100 GLY L O   1 
ATOM   3265 N  N   . GLY C 3 101 ? 10.613  -10.642 -10.655 1.00 53.33  ? 101 GLY L N   1 
ATOM   3266 C  CA  . GLY C 3 101 ? 12.043  -10.840 -10.640 1.00 57.09  ? 101 GLY L CA  1 
ATOM   3267 C  C   . GLY C 3 101 ? 12.471  -12.273 -10.344 1.00 60.87  ? 101 GLY L C   1 
ATOM   3268 O  O   . GLY C 3 101 ? 11.819  -13.008 -9.595  1.00 64.34  ? 101 GLY L O   1 
ATOM   3269 N  N   . THR C 3 102 ? 13.615  -12.634 -10.910 1.00 59.30  ? 102 THR L N   1 
ATOM   3270 C  CA  . THR C 3 102 ? 14.301  -13.889 -10.641 1.00 66.55  ? 102 THR L CA  1 
ATOM   3271 C  C   . THR C 3 102 ? 15.719  -13.564 -10.176 1.00 60.46  ? 102 THR L C   1 
ATOM   3272 O  O   . THR C 3 102 ? 16.437  -12.827 -10.840 1.00 55.74  ? 102 THR L O   1 
ATOM   3273 C  CB  . THR C 3 102 ? 14.367  -14.786 -11.867 1.00 64.46  ? 102 THR L CB  1 
ATOM   3274 O  OG1 . THR C 3 102 ? 13.062  -15.297 -12.150 1.00 61.32  ? 102 THR L OG1 1 
ATOM   3275 C  CG2 . THR C 3 102 ? 15.351  -15.935 -11.619 1.00 62.07  ? 102 THR L CG2 1 
ATOM   3276 N  N   . LYS C 3 103 ? 16.109  -14.060 -9.007  1.00 67.09  ? 103 LYS L N   1 
ATOM   3277 C  CA  . LYS C 3 103 ? 17.459  -13.775 -8.513  1.00 69.44  ? 103 LYS L CA  1 
ATOM   3278 C  C   . LYS C 3 103 ? 18.412  -14.869 -8.949  1.00 69.26  ? 103 LYS L C   1 
ATOM   3279 O  O   . LYS C 3 103 ? 18.137  -16.063 -8.774  1.00 71.77  ? 103 LYS L O   1 
ATOM   3280 C  CB  . LYS C 3 103 ? 17.469  -13.639 -6.985  1.00 68.33  ? 103 LYS L CB  1 
ATOM   3281 C  CG  . LYS C 3 103 ? 18.836  -13.226 -6.439  1.00 78.57  ? 103 LYS L CG  1 
ATOM   3282 C  CD  . LYS C 3 103 ? 18.844  -13.104 -4.924  1.00 83.91  ? 103 LYS L CD  1 
ATOM   3283 C  CE  . LYS C 3 103 ? 17.814  -12.097 -4.457  1.00 80.37  ? 103 LYS L CE  1 
ATOM   3284 N  NZ  . LYS C 3 103 ? 18.200  -10.747 -4.984  1.00 78.04  ? 103 LYS L NZ  1 
ATOM   3285 N  N   . LEU C 3 104 ? 19.527  -14.464 -9.547  1.00 66.13  ? 104 LEU L N   1 
ATOM   3286 C  CA  . LEU C 3 104 ? 20.521  -15.457 -9.899  1.00 71.87  ? 104 LEU L CA  1 
ATOM   3287 C  C   . LEU C 3 104 ? 21.593  -15.479 -8.828  1.00 72.87  ? 104 LEU L C   1 
ATOM   3288 O  O   . LEU C 3 104 ? 22.099  -14.434 -8.404  1.00 72.87  ? 104 LEU L O   1 
ATOM   3289 C  CB  . LEU C 3 104 ? 21.136  -15.115 -11.257 1.00 71.43  ? 104 LEU L CB  1 
ATOM   3290 C  CG  . LEU C 3 104 ? 20.941  -16.055 -12.448 1.00 71.20  ? 104 LEU L CG  1 
ATOM   3291 C  CD1 . LEU C 3 104 ? 21.864  -15.671 -13.596 1.00 63.05  ? 104 LEU L CD1 1 
ATOM   3292 C  CD2 . LEU C 3 104 ? 21.176  -17.458 -12.013 1.00 80.97  ? 104 LEU L CD2 1 
ATOM   3293 N  N   . GLU C 3 105 ? 21.926  -16.679 -8.368  1.00 77.49  ? 105 GLU L N   1 
ATOM   3294 C  CA  . GLU C 3 105 ? 23.049  -16.841 -7.448  1.00 76.70  ? 105 GLU L CA  1 
ATOM   3295 C  C   . GLU C 3 105 ? 23.806  -18.077 -7.911  1.00 78.69  ? 105 GLU L C   1 
ATOM   3296 O  O   . GLU C 3 105 ? 23.301  -18.902 -8.687  1.00 74.78  ? 105 GLU L O   1 
ATOM   3297 C  CB  . GLU C 3 105 ? 22.649  -16.863 -5.952  1.00 82.16  ? 105 GLU L CB  1 
ATOM   3298 C  CG  . GLU C 3 105 ? 22.765  -18.149 -5.132  1.00 88.61  ? 105 GLU L CG  1 
ATOM   3299 C  CD  . GLU C 3 105 ? 21.714  -19.189 -5.470  1.00 87.16  ? 105 GLU L CD  1 
ATOM   3300 O  OE1 . GLU C 3 105 ? 21.237  -19.240 -6.627  1.00 86.00  ? 105 GLU L OE1 1 
ATOM   3301 O  OE2 . GLU C 3 105 ? 21.357  -19.956 -4.553  1.00 82.40  ? 105 GLU L OE2 1 
ATOM   3302 N  N   . LEU C 3 106 ? 25.040  -18.145 -7.440  1.00 83.85  ? 106 LEU L N   1 
ATOM   3303 C  CA  . LEU C 3 106 ? 26.002  -19.194 -7.712  1.00 82.16  ? 106 LEU L CA  1 
ATOM   3304 C  C   . LEU C 3 106 ? 25.760  -20.411 -6.819  1.00 86.58  ? 106 LEU L C   1 
ATOM   3305 O  O   . LEU C 3 106 ? 25.555  -20.249 -5.604  1.00 90.90  ? 106 LEU L O   1 
ATOM   3306 C  CB  . LEU C 3 106 ? 27.393  -18.651 -7.418  1.00 82.87  ? 106 LEU L CB  1 
ATOM   3307 C  CG  . LEU C 3 106 ? 27.826  -17.545 -8.367  1.00 83.37  ? 106 LEU L CG  1 
ATOM   3308 C  CD1 . LEU C 3 106 ? 29.110  -16.920 -7.877  1.00 88.12  ? 106 LEU L CD1 1 
ATOM   3309 C  CD2 . LEU C 3 106 ? 28.003  -18.116 -9.768  1.00 79.20  ? 106 LEU L CD2 1 
ATOM   3310 N  N   . LYS C 3 107 ? 25.764  -21.615 -7.398  1.00 82.95  ? 107 LYS L N   1 
ATOM   3311 C  CA  . LYS C 3 107 ? 25.648  -22.819 -6.570  1.00 88.22  ? 107 LYS L CA  1 
ATOM   3312 C  C   . LYS C 3 107 ? 26.995  -23.157 -5.964  1.00 96.86  ? 107 LYS L C   1 
ATOM   3313 O  O   . LYS C 3 107 ? 28.031  -23.167 -6.631  1.00 92.69  ? 107 LYS L O   1 
ATOM   3314 C  CB  . LYS C 3 107 ? 25.105  -24.038 -7.323  1.00 86.72  ? 107 LYS L CB  1 
ATOM   3315 C  CG  . LYS C 3 107 ? 25.211  -25.274 -6.418  1.00 92.06  ? 107 LYS L CG  1 
ATOM   3316 C  CD  . LYS C 3 107 ? 24.275  -25.194 -5.220  1.00 97.41  ? 107 LYS L CD  1 
ATOM   3317 C  CE  . LYS C 3 107 ? 24.071  -26.546 -4.548  1.00 98.59  ? 107 LYS L CE  1 
ATOM   3318 N  NZ  . LYS C 3 107 ? 25.153  -26.786 -3.540  1.00 101.22 ? 107 LYS L NZ  1 
ATOM   3319 N  N   . ARG C 3 108 ? 26.957  -23.428 -4.666  1.00 102.24 ? 108 ARG L N   1 
ATOM   3320 C  CA  . ARG C 3 108 ? 28.134  -23.862 -3.971  1.00 104.02 ? 108 ARG L CA  1 
ATOM   3321 C  C   . ARG C 3 108 ? 27.852  -24.893 -2.913  1.00 107.08 ? 108 ARG L C   1 
ATOM   3322 O  O   . ARG C 3 108 ? 26.700  -25.253 -2.633  1.00 98.28  ? 108 ARG L O   1 
ATOM   3323 C  CB  . ARG C 3 108 ? 28.777  -22.684 -3.280  1.00 105.86 ? 108 ARG L CB  1 
ATOM   3324 C  CG  . ARG C 3 108 ? 27.815  -22.042 -2.306  1.00 103.60 ? 108 ARG L CG  1 
ATOM   3325 C  CD  . ARG C 3 108 ? 28.582  -21.535 -1.136  1.00 106.14 ? 108 ARG L CD  1 
ATOM   3326 N  NE  . ARG C 3 108 ? 29.173  -22.668 -0.443  1.00 109.33 ? 108 ARG L NE  1 
ATOM   3327 C  CZ  . ARG C 3 108 ? 30.338  -22.626 0.192   1.00 112.11 ? 108 ARG L CZ  1 
ATOM   3328 N  NH1 . ARG C 3 108 ? 30.806  -23.710 0.798   1.00 112.02 ? 108 ARG L NH1 1 
ATOM   3329 N  NH2 . ARG C 3 108 ? 31.032  -21.501 0.218   1.00 109.40 ? 108 ARG L NH2 1 
ATOM   3330 N  N   . ALA C 3 109 ? 28.948  -25.349 -2.318  1.00 114.12 ? 109 ALA L N   1 
ATOM   3331 C  CA  . ALA C 3 109 ? 28.885  -26.326 -1.259  1.00 114.27 ? 109 ALA L CA  1 
ATOM   3332 C  C   . ALA C 3 109 ? 28.175  -25.777 -0.049  1.00 109.62 ? 109 ALA L C   1 
ATOM   3333 O  O   . ALA C 3 109 ? 28.265  -24.592 0.246   1.00 107.93 ? 109 ALA L O   1 
ATOM   3334 C  CB  . ALA C 3 109 ? 30.291  -26.762 -0.885  1.00 115.58 ? 109 ALA L CB  1 
ATOM   3335 N  N   . ASP C 3 110 ? 27.401  -26.632 0.601   1.00 113.22 ? 110 ASP L N   1 
ATOM   3336 C  CA  . ASP C 3 110 ? 26.767  -26.266 1.849   1.00 117.60 ? 110 ASP L CA  1 
ATOM   3337 C  C   . ASP C 3 110 ? 27.914  -25.953 2.837   1.00 113.17 ? 110 ASP L C   1 
ATOM   3338 O  O   . ASP C 3 110 ? 28.919  -26.660 2.813   1.00 116.85 ? 110 ASP L O   1 
ATOM   3339 C  CB  . ASP C 3 110 ? 25.854  -27.404 2.286   1.00 114.64 ? 110 ASP L CB  1 
ATOM   3340 C  CG  . ASP C 3 110 ? 24.627  -27.510 1.391   1.00 107.61 ? 110 ASP L CG  1 
ATOM   3341 O  OD1 . ASP C 3 110 ? 24.598  -26.807 0.357   1.00 106.24 ? 110 ASP L OD1 1 
ATOM   3342 O  OD2 . ASP C 3 110 ? 23.713  -28.295 1.692   1.00 111.40 ? 110 ASP L OD2 1 
ATOM   3343 N  N   . ALA C 3 111 ? 27.791  -24.942 3.700   1.00 114.36 ? 111 ALA L N   1 
ATOM   3344 C  CA  . ALA C 3 111 ? 28.872  -24.611 4.666   1.00 120.81 ? 111 ALA L CA  1 
ATOM   3345 C  C   . ALA C 3 111 ? 28.254  -24.152 5.985   1.00 120.05 ? 111 ALA L C   1 
ATOM   3346 O  O   . ALA C 3 111 ? 27.691  -23.086 5.985   1.00 120.26 ? 111 ALA L O   1 
ATOM   3347 C  CB  . ALA C 3 111 ? 29.801  -23.538 4.095   1.00 113.21 ? 111 ALA L CB  1 
ATOM   3348 N  N   . ALA C 3 112 ? 28.602  -24.726 7.133   1.00 118.36 ? 112 ALA L N   1 
ATOM   3349 C  CA  . ALA C 3 112 ? 27.976  -24.267 8.383   1.00 120.72 ? 112 ALA L CA  1 
ATOM   3350 C  C   . ALA C 3 112 ? 28.384  -22.872 8.880   1.00 121.79 ? 112 ALA L C   1 
ATOM   3351 O  O   . ALA C 3 112 ? 29.484  -22.383 8.589   1.00 116.80 ? 112 ALA L O   1 
ATOM   3352 C  CB  . ALA C 3 112 ? 28.250  -25.310 9.485   1.00 122.76 ? 112 ALA L CB  1 
ATOM   3353 N  N   . PRO C 3 113 ? 27.469  -22.222 9.639   1.00 123.65 ? 113 PRO L N   1 
ATOM   3354 C  CA  . PRO C 3 113 ? 27.743  -20.870 10.142  1.00 119.56 ? 113 PRO L CA  1 
ATOM   3355 C  C   . PRO C 3 113 ? 28.770  -20.749 11.257  1.00 115.33 ? 113 PRO L C   1 
ATOM   3356 O  O   . PRO C 3 113 ? 28.841  -21.623 12.122  1.00 110.95 ? 113 PRO L O   1 
ATOM   3357 C  CB  . PRO C 3 113 ? 26.376  -20.414 10.692  1.00 115.07 ? 113 PRO L CB  1 
ATOM   3358 C  CG  . PRO C 3 113 ? 25.367  -21.400 10.174  1.00 119.57 ? 113 PRO L CG  1 
ATOM   3359 C  CD  . PRO C 3 113 ? 26.112  -22.678 10.001  1.00 120.86 ? 113 PRO L CD  1 
ATOM   3360 N  N   . THR C 3 114 ? 29.585  -19.693 11.177  1.00 114.25 ? 114 THR L N   1 
ATOM   3361 C  CA  . THR C 3 114 ? 30.383  -19.219 12.296  1.00 117.49 ? 114 THR L CA  1 
ATOM   3362 C  C   . THR C 3 114 ? 29.458  -18.284 13.079  1.00 119.43 ? 114 THR L C   1 
ATOM   3363 O  O   . THR C 3 114 ? 29.103  -17.204 12.616  1.00 118.36 ? 114 THR L O   1 
ATOM   3364 C  CB  . THR C 3 114 ? 31.680  -18.483 11.849  1.00 119.23 ? 114 THR L CB  1 
ATOM   3365 O  OG1 . THR C 3 114 ? 31.458  -17.068 11.800  1.00 124.10 ? 114 THR L OG1 1 
ATOM   3366 C  CG2 . THR C 3 114 ? 32.129  -18.967 10.466  1.00 117.73 ? 114 THR L CG2 1 
ATOM   3367 N  N   . VAL C 3 115 ? 29.140  -18.663 14.301  1.00 121.46 ? 115 VAL L N   1 
ATOM   3368 C  CA  . VAL C 3 115 ? 28.123  -17.973 15.083  1.00 119.95 ? 115 VAL L CA  1 
ATOM   3369 C  C   . VAL C 3 115 ? 28.826  -17.210 16.195  1.00 126.23 ? 115 VAL L C   1 
ATOM   3370 O  O   . VAL C 3 115 ? 29.797  -17.734 16.728  1.00 131.71 ? 115 VAL L O   1 
ATOM   3371 C  CB  . VAL C 3 115 ? 27.069  -18.946 15.673  1.00 117.47 ? 115 VAL L CB  1 
ATOM   3372 C  CG1 . VAL C 3 115 ? 25.953  -18.171 16.342  1.00 121.29 ? 115 VAL L CG1 1 
ATOM   3373 C  CG2 . VAL C 3 115 ? 26.494  -19.810 14.590  1.00 116.81 ? 115 VAL L CG2 1 
ATOM   3374 N  N   . SER C 3 116 ? 28.527  -15.925 16.405  1.00 128.76 ? 116 SER L N   1 
ATOM   3375 C  CA  . SER C 3 116 ? 29.204  -15.245 17.521  1.00 129.06 ? 116 SER L CA  1 
ATOM   3376 C  C   . SER C 3 116 ? 28.213  -14.472 18.413  1.00 127.70 ? 116 SER L C   1 
ATOM   3377 O  O   . SER C 3 116 ? 27.387  -13.700 17.913  1.00 128.39 ? 116 SER L O   1 
ATOM   3378 C  CB  . SER C 3 116 ? 30.292  -14.297 16.956  1.00 128.81 ? 116 SER L CB  1 
ATOM   3379 O  OG  . SER C 3 116 ? 31.268  -13.927 17.915  1.00 128.11 ? 116 SER L OG  1 
ATOM   3380 N  N   . ILE C 3 117 ? 28.268  -14.677 19.730  1.00 132.34 ? 117 ILE L N   1 
ATOM   3381 C  CA  . ILE C 3 117 ? 27.360  -13.905 20.569  1.00 133.04 ? 117 ILE L CA  1 
ATOM   3382 C  C   . ILE C 3 117 ? 28.173  -12.973 21.445  1.00 132.99 ? 117 ILE L C   1 
ATOM   3383 O  O   . ILE C 3 117 ? 29.222  -13.340 21.979  1.00 133.83 ? 117 ILE L O   1 
ATOM   3384 C  CB  . ILE C 3 117 ? 26.403  -14.774 21.451  1.00 130.38 ? 117 ILE L CB  1 
ATOM   3385 C  CG1 . ILE C 3 117 ? 25.347  -13.875 22.113  1.00 130.76 ? 117 ILE L CG1 1 
ATOM   3386 C  CG2 . ILE C 3 117 ? 27.150  -15.566 22.500  1.00 133.01 ? 117 ILE L CG2 1 
ATOM   3387 C  CD1 . ILE C 3 117 ? 24.169  -14.594 22.720  1.00 137.02 ? 117 ILE L CD1 1 
ATOM   3388 N  N   . PHE C 3 118 ? 27.615  -11.788 21.634  1.00 132.41 ? 118 PHE L N   1 
ATOM   3389 C  CA  . PHE C 3 118 ? 28.216  -10.694 22.380  1.00 133.24 ? 118 PHE L CA  1 
ATOM   3390 C  C   . PHE C 3 118 ? 27.366  -9.939  23.389  1.00 138.76 ? 118 PHE L C   1 
ATOM   3391 O  O   . PHE C 3 118 ? 26.290  -9.433  23.063  1.00 139.86 ? 118 PHE L O   1 
ATOM   3392 C  CB  . PHE C 3 118 ? 28.768  -9.663  21.435  1.00 129.86 ? 118 PHE L CB  1 
ATOM   3393 C  CG  . PHE C 3 118 ? 29.931  -10.100 20.620  1.00 130.60 ? 118 PHE L CG  1 
ATOM   3394 C  CD1 . PHE C 3 118 ? 31.172  -10.236 21.223  1.00 129.67 ? 118 PHE L CD1 1 
ATOM   3395 C  CD2 . PHE C 3 118 ? 29.835  -10.245 19.249  1.00 132.64 ? 118 PHE L CD2 1 
ATOM   3396 C  CE1 . PHE C 3 118 ? 32.277  -10.602 20.485  1.00 132.67 ? 118 PHE L CE1 1 
ATOM   3397 C  CE2 . PHE C 3 118 ? 30.933  -10.615 18.502  1.00 130.67 ? 118 PHE L CE2 1 
ATOM   3398 C  CZ  . PHE C 3 118 ? 32.156  -10.793 19.117  1.00 132.77 ? 118 PHE L CZ  1 
ATOM   3399 N  N   . PRO C 3 119 ? 27.905  -9.752  24.592  1.00 137.16 ? 119 PRO L N   1 
ATOM   3400 C  CA  . PRO C 3 119 ? 27.272  -8.962  25.655  1.00 136.58 ? 119 PRO L CA  1 
ATOM   3401 C  C   . PRO C 3 119 ? 27.390  -7.430  25.532  1.00 134.07 ? 119 PRO L C   1 
ATOM   3402 O  O   . PRO C 3 119 ? 28.252  -6.947  24.795  1.00 132.34 ? 119 PRO L O   1 
ATOM   3403 C  CB  . PRO C 3 119 ? 27.986  -9.473  26.899  1.00 136.30 ? 119 PRO L CB  1 
ATOM   3404 C  CG  . PRO C 3 119 ? 29.353  -9.845  26.412  1.00 133.13 ? 119 PRO L CG  1 
ATOM   3405 C  CD  . PRO C 3 119 ? 29.170  -10.372 25.027  1.00 129.67 ? 119 PRO L CD  1 
ATOM   3406 N  N   . PRO C 3 120 ? 26.552  -6.690  26.296  1.00 133.74 ? 120 PRO L N   1 
ATOM   3407 C  CA  . PRO C 3 120 ? 26.545  -5.227  26.377  1.00 133.93 ? 120 PRO L CA  1 
ATOM   3408 C  C   . PRO C 3 120 ? 27.889  -4.651  26.715  1.00 134.07 ? 120 PRO L C   1 
ATOM   3409 O  O   . PRO C 3 120 ? 28.614  -5.204  27.546  1.00 135.25 ? 120 PRO L O   1 
ATOM   3410 C  CB  . PRO C 3 120 ? 25.580  -4.948  27.524  1.00 132.42 ? 120 PRO L CB  1 
ATOM   3411 C  CG  . PRO C 3 120 ? 24.662  -6.040  27.478  1.00 133.50 ? 120 PRO L CG  1 
ATOM   3412 C  CD  . PRO C 3 120 ? 25.449  -7.247  27.099  1.00 132.65 ? 120 PRO L CD  1 
ATOM   3413 N  N   . SER C 3 121 ? 28.217  -3.530  26.095  1.00 131.83 ? 121 SER L N   1 
ATOM   3414 C  CA  . SER C 3 121 ? 29.439  -2.895  26.489  1.00 127.29 ? 121 SER L CA  1 
ATOM   3415 C  C   . SER C 3 121 ? 29.248  -2.391  27.904  1.00 128.86 ? 121 SER L C   1 
ATOM   3416 O  O   . SER C 3 121 ? 28.121  -2.110  28.314  1.00 130.73 ? 121 SER L O   1 
ATOM   3417 C  CB  . SER C 3 121 ? 29.730  -1.746  25.525  1.00 127.26 ? 121 SER L CB  1 
ATOM   3418 O  OG  . SER C 3 121 ? 31.112  -1.591  25.306  1.00 130.16 ? 121 SER L OG  1 
ATOM   3419 N  N   . SER C 3 122 ? 30.339  -2.260  28.653  1.00 132.90 ? 122 SER L N   1 
ATOM   3420 C  CA  . SER C 3 122 ? 30.270  -1.629  29.969  1.00 134.45 ? 122 SER L CA  1 
ATOM   3421 C  C   . SER C 3 122 ? 29.829  -0.181  29.774  1.00 134.70 ? 122 SER L C   1 
ATOM   3422 O  O   . SER C 3 122 ? 29.009  0.342   30.532  1.00 134.21 ? 122 SER L O   1 
ATOM   3423 C  CB  . SER C 3 122 ? 31.611  -1.707  30.702  1.00 130.98 ? 122 SER L CB  1 
ATOM   3424 O  OG  . SER C 3 122 ? 32.043  -3.042  30.920  1.00 134.17 ? 122 SER L OG  1 
ATOM   3425 N  N   . GLU C 3 123 ? 30.366  0.401   28.682  1.00 131.50 ? 123 GLU L N   1 
ATOM   3426 C  CA  . GLU C 3 123 ? 30.090  1.752   28.193  1.00 128.00 ? 123 GLU L CA  1 
ATOM   3427 C  C   . GLU C 3 123 ? 28.576  1.904   28.067  1.00 129.41 ? 123 GLU L C   1 
ATOM   3428 O  O   . GLU C 3 123 ? 27.988  2.868   28.556  1.00 128.21 ? 123 GLU L O   1 
ATOM   3429 C  CB  . GLU C 3 123 ? 30.689  2.018   26.797  1.00 130.92 ? 123 GLU L CB  1 
ATOM   3430 C  CG  . GLU C 3 123 ? 30.538  3.394   26.204  1.00 131.07 ? 123 GLU L CG  1 
ATOM   3431 C  CD  . GLU C 3 123 ? 31.225  3.476   24.865  1.00 132.29 ? 123 GLU L CD  1 
ATOM   3432 O  OE1 . GLU C 3 123 ? 31.757  2.442   24.441  1.00 134.62 ? 123 GLU L OE1 1 
ATOM   3433 O  OE2 . GLU C 3 123 ? 31.261  4.564   24.243  1.00 130.65 ? 123 GLU L OE2 1 
ATOM   3434 N  N   . GLN C 3 124 ? 27.976  0.967   27.340  1.00 128.44 ? 124 GLN L N   1 
ATOM   3435 C  CA  . GLN C 3 124 ? 26.545  0.966   27.099  1.00 123.00 ? 124 GLN L CA  1 
ATOM   3436 C  C   . GLN C 3 124 ? 25.731  0.697   28.366  1.00 125.80 ? 124 GLN L C   1 
ATOM   3437 O  O   . GLN C 3 124 ? 24.623  1.232   28.522  1.00 125.67 ? 124 GLN L O   1 
ATOM   3438 C  CB  . GLN C 3 124 ? 26.197  -0.046  26.017  1.00 123.21 ? 124 GLN L CB  1 
ATOM   3439 C  CG  . GLN C 3 124 ? 25.188  0.556   25.047  1.00 123.80 ? 124 GLN L CG  1 
ATOM   3440 C  CD  . GLN C 3 124 ? 24.620  -0.436  24.056  1.00 120.54 ? 124 GLN L CD  1 
ATOM   3441 O  OE1 . GLN C 3 124 ? 24.718  -1.659  24.245  1.00 124.46 ? 124 GLN L OE1 1 
ATOM   3442 N  NE2 . GLN C 3 124 ? 23.975  0.076   23.014  1.00 111.46 ? 124 GLN L NE2 1 
ATOM   3443 N  N   . LEU C 3 125 ? 26.216  -0.202  29.221  1.00 128.36 ? 125 LEU L N   1 
ATOM   3444 C  CA  . LEU C 3 125 ? 25.489  -0.497  30.447  1.00 126.19 ? 125 LEU L CA  1 
ATOM   3445 C  C   . LEU C 3 125 ? 25.428  0.790   31.284  1.00 123.73 ? 125 LEU L C   1 
ATOM   3446 O  O   . LEU C 3 125 ? 24.461  1.005   32.020  1.00 122.10 ? 125 LEU L O   1 
ATOM   3447 C  CB  . LEU C 3 125 ? 26.190  -1.646  31.182  1.00 123.41 ? 125 LEU L CB  1 
ATOM   3448 C  CG  . LEU C 3 125 ? 25.887  -2.946  30.430  1.00 125.98 ? 125 LEU L CG  1 
ATOM   3449 C  CD1 . LEU C 3 125 ? 26.668  -4.119  31.001  1.00 126.77 ? 125 LEU L CD1 1 
ATOM   3450 C  CD2 . LEU C 3 125 ? 24.391  -3.226  30.404  1.00 121.98 ? 125 LEU L CD2 1 
ATOM   3451 N  N   . THR C 3 126 ? 26.462  1.622   31.208  1.00 124.85 ? 126 THR L N   1 
ATOM   3452 C  CA  . THR C 3 126 ? 26.438  2.911   31.932  1.00 125.16 ? 126 THR L CA  1 
ATOM   3453 C  C   . THR C 3 126 ? 25.407  3.947   31.457  1.00 125.26 ? 126 THR L C   1 
ATOM   3454 O  O   . THR C 3 126 ? 24.879  4.745   32.236  1.00 123.58 ? 126 THR L O   1 
ATOM   3455 C  CB  . THR C 3 126 ? 27.786  3.745   31.837  1.00 126.52 ? 126 THR L CB  1 
ATOM   3456 O  OG1 . THR C 3 126 ? 27.801  4.571   30.673  1.00 127.62 ? 126 THR L OG1 1 
ATOM   3457 C  CG2 . THR C 3 126 ? 29.060  2.901   31.940  1.00 124.01 ? 126 THR L CG2 1 
ATOM   3458 N  N   . SER C 3 127 ? 25.106  3.878   30.148  1.00 125.89 ? 127 SER L N   1 
ATOM   3459 C  CA  . SER C 3 127 ? 24.227  4.779   29.365  1.00 123.94 ? 127 SER L CA  1 
ATOM   3460 C  C   . SER C 3 127 ? 22.746  4.517   29.101  1.00 124.13 ? 127 SER L C   1 
ATOM   3461 O  O   . SER C 3 127 ? 22.056  5.266   28.371  1.00 126.60 ? 127 SER L O   1 
ATOM   3462 C  CB  . SER C 3 127 ? 24.871  4.957   27.997  1.00 126.55 ? 127 SER L CB  1 
ATOM   3463 O  OG  . SER C 3 127 ? 26.204  5.422   28.075  1.00 128.41 ? 127 SER L OG  1 
ATOM   3464 N  N   . GLY C 3 128 ? 22.254  3.452   29.686  1.00 123.19 ? 128 GLY L N   1 
ATOM   3465 C  CA  . GLY C 3 128 ? 20.878  2.978   29.610  1.00 124.24 ? 128 GLY L CA  1 
ATOM   3466 C  C   . GLY C 3 128 ? 20.491  2.000   28.504  1.00 133.23 ? 128 GLY L C   1 
ATOM   3467 O  O   . GLY C 3 128 ? 19.311  1.740   28.230  1.00 136.20 ? 128 GLY L O   1 
ATOM   3468 N  N   . GLY C 3 129 ? 21.483  1.496   27.782  1.00 131.60 ? 129 GLY L N   1 
ATOM   3469 C  CA  . GLY C 3 129 ? 21.190  0.510   26.743  1.00 128.77 ? 129 GLY L CA  1 
ATOM   3470 C  C   . GLY C 3 129 ? 21.730  -0.850  27.090  1.00 126.11 ? 129 GLY L C   1 
ATOM   3471 O  O   . GLY C 3 129 ? 22.683  -0.910  27.865  1.00 124.84 ? 129 GLY L O   1 
ATOM   3472 N  N   . ALA C 3 130 ? 21.169  -1.925  26.574  1.00 126.50 ? 130 ALA L N   1 
ATOM   3473 C  CA  . ALA C 3 130 ? 21.792  -3.189  26.852  1.00 126.16 ? 130 ALA L CA  1 
ATOM   3474 C  C   . ALA C 3 130 ? 21.546  -3.934  25.560  1.00 129.50 ? 130 ALA L C   1 
ATOM   3475 O  O   . ALA C 3 130 ? 20.469  -4.487  25.382  1.00 130.01 ? 130 ALA L O   1 
ATOM   3476 C  CB  . ALA C 3 130 ? 21.153  -3.864  28.019  1.00 126.66 ? 130 ALA L CB  1 
ATOM   3477 N  N   . SER C 3 131 ? 22.554  -4.042  24.698  1.00 126.25 ? 131 SER L N   1 
ATOM   3478 C  CA  . SER C 3 131 ? 22.330  -4.840  23.520  1.00 127.73 ? 131 SER L CA  1 
ATOM   3479 C  C   . SER C 3 131 ? 23.226  -6.089  23.452  1.00 133.28 ? 131 SER L C   1 
ATOM   3480 O  O   . SER C 3 131 ? 24.454  -5.962  23.388  1.00 132.46 ? 131 SER L O   1 
ATOM   3481 C  CB  . SER C 3 131 ? 22.529  -3.948  22.292  1.00 126.94 ? 131 SER L CB  1 
ATOM   3482 O  OG  . SER C 3 131 ? 21.613  -2.863  22.333  1.00 126.45 ? 131 SER L OG  1 
ATOM   3483 N  N   . VAL C 3 132 ? 22.620  -7.271  23.373  1.00 134.15 ? 132 VAL L N   1 
ATOM   3484 C  CA  . VAL C 3 132 ? 23.336  -8.539  23.216  1.00 135.19 ? 132 VAL L CA  1 
ATOM   3485 C  C   . VAL C 3 132 ? 23.176  -8.899  21.713  1.00 134.57 ? 132 VAL L C   1 
ATOM   3486 O  O   . VAL C 3 132 ? 22.064  -8.957  21.206  1.00 134.56 ? 132 VAL L O   1 
ATOM   3487 C  CB  . VAL C 3 132 ? 22.874  -9.643  24.220  1.00 139.20 ? 132 VAL L CB  1 
ATOM   3488 C  CG1 . VAL C 3 132 ? 23.898  -10.798 24.214  1.00 139.82 ? 132 VAL L CG1 1 
ATOM   3489 C  CG2 . VAL C 3 132 ? 22.723  -9.058  25.671  1.00 135.12 ? 132 VAL L CG2 1 
ATOM   3490 N  N   . VAL C 3 133 ? 24.285  -9.150  21.027  1.00 134.04 ? 133 VAL L N   1 
ATOM   3491 C  CA  . VAL C 3 133 ? 24.320  -9.353  19.575  1.00 131.01 ? 133 VAL L CA  1 
ATOM   3492 C  C   . VAL C 3 133 ? 24.613  -10.802 19.111  1.00 129.70 ? 133 VAL L C   1 
ATOM   3493 O  O   . VAL C 3 133 ? 25.450  -11.499 19.695  1.00 136.35 ? 133 VAL L O   1 
ATOM   3494 C  CB  . VAL C 3 133 ? 25.369  -8.384  18.963  1.00 126.40 ? 133 VAL L CB  1 
ATOM   3495 C  CG1 . VAL C 3 133 ? 25.660  -8.711  17.534  1.00 126.91 ? 133 VAL L CG1 1 
ATOM   3496 C  CG2 . VAL C 3 133 ? 24.905  -6.931  19.102  1.00 123.70 ? 133 VAL L CG2 1 
ATOM   3497 N  N   . CYS C 3 134 ? 23.937  -11.230 18.036  1.00 121.88 ? 134 CYS L N   1 
ATOM   3498 C  CA  . CYS C 3 134 ? 24.182  -12.562 17.469  1.00 125.59 ? 134 CYS L CA  1 
ATOM   3499 C  C   . CYS C 3 134 ? 24.501  -12.539 15.952  1.00 126.24 ? 134 CYS L C   1 
ATOM   3500 O  O   . CYS C 3 134 ? 23.671  -12.173 15.118  1.00 122.42 ? 134 CYS L O   1 
ATOM   3501 C  CB  . CYS C 3 134 ? 22.920  -13.403 17.724  1.00 128.32 ? 134 CYS L CB  1 
ATOM   3502 S  SG  . CYS C 3 134 ? 22.957  -15.150 17.382  1.00 139.46 ? 134 CYS L SG  1 
ATOM   3503 N  N   . PHE C 3 135 ? 25.682  -13.074 15.610  1.00 122.38 ? 135 PHE L N   1 
ATOM   3504 C  CA  . PHE C 3 135 ? 26.151  -13.251 14.232  1.00 115.06 ? 135 PHE L CA  1 
ATOM   3505 C  C   . PHE C 3 135 ? 26.077  -14.657 13.663  1.00 116.02 ? 135 PHE L C   1 
ATOM   3506 O  O   . PHE C 3 135 ? 26.455  -15.610 14.323  1.00 121.23 ? 135 PHE L O   1 
ATOM   3507 C  CB  . PHE C 3 135 ? 27.630  -12.823 14.132  1.00 109.76 ? 135 PHE L CB  1 
ATOM   3508 C  CG  . PHE C 3 135 ? 27.868  -11.358 14.334  1.00 115.05 ? 135 PHE L CG  1 
ATOM   3509 C  CD1 . PHE C 3 135 ? 26.840  -10.453 14.163  1.00 118.07 ? 135 PHE L CD1 1 
ATOM   3510 C  CD2 . PHE C 3 135 ? 29.130  -10.876 14.677  1.00 117.14 ? 135 PHE L CD2 1 
ATOM   3511 C  CE1 . PHE C 3 135 ? 27.062  -9.085  14.337  1.00 120.59 ? 135 PHE L CE1 1 
ATOM   3512 C  CE2 . PHE C 3 135 ? 29.357  -9.512  14.872  1.00 112.85 ? 135 PHE L CE2 1 
ATOM   3513 C  CZ  . PHE C 3 135 ? 28.327  -8.616  14.685  1.00 119.27 ? 135 PHE L CZ  1 
ATOM   3514 N  N   . LEU C 3 136 ? 25.554  -14.797 12.455  1.00 112.72 ? 136 LEU L N   1 
ATOM   3515 C  CA  . LEU C 3 136 ? 25.570  -16.090 11.780  1.00 113.59 ? 136 LEU L CA  1 
ATOM   3516 C  C   . LEU C 3 136 ? 26.330  -15.998 10.457  1.00 108.58 ? 136 LEU L C   1 
ATOM   3517 O  O   . LEU C 3 136 ? 25.756  -15.654 9.444   1.00 114.30 ? 136 LEU L O   1 
ATOM   3518 C  CB  . LEU C 3 136 ? 24.141  -16.571 11.566  1.00 111.05 ? 136 LEU L CB  1 
ATOM   3519 C  CG  . LEU C 3 136 ? 23.287  -16.714 12.822  1.00 113.07 ? 136 LEU L CG  1 
ATOM   3520 C  CD1 . LEU C 3 136 ? 22.777  -15.416 13.433  1.00 114.83 ? 136 LEU L CD1 1 
ATOM   3521 C  CD2 . LEU C 3 136 ? 22.110  -17.535 12.356  1.00 115.07 ? 136 LEU L CD2 1 
ATOM   3522 N  N   . ASN C 3 137 ? 27.586  -16.397 10.428  1.00 101.56 ? 137 ASN L N   1 
ATOM   3523 C  CA  . ASN C 3 137 ? 28.398  -16.036 9.283   1.00 107.50 ? 137 ASN L CA  1 
ATOM   3524 C  C   . ASN C 3 137 ? 28.704  -17.213 8.345   1.00 114.92 ? 137 ASN L C   1 
ATOM   3525 O  O   . ASN C 3 137 ? 28.818  -18.367 8.748   1.00 118.35 ? 137 ASN L O   1 
ATOM   3526 C  CB  . ASN C 3 137 ? 29.703  -15.391 9.757   1.00 107.52 ? 137 ASN L CB  1 
ATOM   3527 C  CG  . ASN C 3 137 ? 29.476  -14.035 10.404  1.00 106.15 ? 137 ASN L CG  1 
ATOM   3528 O  OD1 . ASN C 3 137 ? 28.338  -13.678 10.698  1.00 106.12 ? 137 ASN L OD1 1 
ATOM   3529 N  ND2 . ASN C 3 137 ? 30.552  -13.283 10.647  1.00 105.03 ? 137 ASN L ND2 1 
ATOM   3530 N  N   . ASN C 3 138 ? 28.782  -16.881 7.063   1.00 112.40 ? 138 ASN L N   1 
ATOM   3531 C  CA  . ASN C 3 138 ? 29.220  -17.745 5.984   1.00 107.03 ? 138 ASN L CA  1 
ATOM   3532 C  C   . ASN C 3 138 ? 28.492  -19.086 5.831   1.00 110.67 ? 138 ASN L C   1 
ATOM   3533 O  O   . ASN C 3 138 ? 29.166  -20.101 5.705   1.00 112.52 ? 138 ASN L O   1 
ATOM   3534 C  CB  . ASN C 3 138 ? 30.709  -17.996 6.128   1.00 98.91  ? 138 ASN L CB  1 
ATOM   3535 C  CG  . ASN C 3 138 ? 31.512  -16.718 6.081   1.00 105.50 ? 138 ASN L CG  1 
ATOM   3536 O  OD1 . ASN C 3 138 ? 30.945  -15.642 5.912   1.00 107.46 ? 138 ASN L OD1 1 
ATOM   3537 N  ND2 . ASN C 3 138 ? 32.828  -16.818 6.253   1.00 99.96  ? 138 ASN L ND2 1 
ATOM   3538 N  N   . PHE C 3 139 ? 27.150  -19.120 5.782   1.00 107.08 ? 139 PHE L N   1 
ATOM   3539 C  CA  . PHE C 3 139 ? 26.477  -20.412 5.550   1.00 110.39 ? 139 PHE L CA  1 
ATOM   3540 C  C   . PHE C 3 139 ? 25.746  -20.435 4.144   1.00 114.99 ? 139 PHE L C   1 
ATOM   3541 O  O   . PHE C 3 139 ? 25.404  -19.375 3.628   1.00 115.67 ? 139 PHE L O   1 
ATOM   3542 C  CB  . PHE C 3 139 ? 25.553  -20.794 6.692   1.00 119.30 ? 139 PHE L CB  1 
ATOM   3543 C  CG  . PHE C 3 139 ? 24.608  -21.891 6.312   1.00 123.72 ? 139 PHE L CG  1 
ATOM   3544 C  CD1 . PHE C 3 139 ? 25.083  -23.186 6.209   1.00 126.70 ? 139 PHE L CD1 1 
ATOM   3545 C  CD2 . PHE C 3 139 ? 23.286  -21.650 6.025   1.00 119.23 ? 139 PHE L CD2 1 
ATOM   3546 C  CE1 . PHE C 3 139 ? 24.303  -24.217 5.803   1.00 124.23 ? 139 PHE L CE1 1 
ATOM   3547 C  CE2 . PHE C 3 139 ? 22.480  -22.706 5.648   1.00 122.74 ? 139 PHE L CE2 1 
ATOM   3548 C  CZ  . PHE C 3 139 ? 23.004  -23.992 5.542   1.00 123.94 ? 139 PHE L CZ  1 
ATOM   3549 N  N   . TYR C 3 140 ? 25.414  -21.620 3.602   1.00 115.01 ? 140 TYR L N   1 
ATOM   3550 C  CA  . TYR C 3 140 ? 24.710  -21.828 2.300   1.00 113.75 ? 140 TYR L CA  1 
ATOM   3551 C  C   . TYR C 3 140 ? 23.915  -23.135 2.082   1.00 115.51 ? 140 TYR L C   1 
ATOM   3552 O  O   . TYR C 3 140 ? 24.370  -24.201 2.503   1.00 119.95 ? 140 TYR L O   1 
ATOM   3553 C  CB  . TYR C 3 140 ? 25.715  -21.723 1.107   1.00 111.52 ? 140 TYR L CB  1 
ATOM   3554 C  CG  . TYR C 3 140 ? 25.052  -21.901 -0.283  1.00 114.76 ? 140 TYR L CG  1 
ATOM   3555 C  CD1 . TYR C 3 140 ? 24.817  -23.189 -0.800  1.00 112.68 ? 140 TYR L CD1 1 
ATOM   3556 C  CD2 . TYR C 3 140 ? 24.586  -20.815 -1.033  1.00 110.12 ? 140 TYR L CD2 1 
ATOM   3557 C  CE1 . TYR C 3 140 ? 24.165  -23.383 -2.008  1.00 106.77 ? 140 TYR L CE1 1 
ATOM   3558 C  CE2 . TYR C 3 140 ? 23.929  -21.013 -2.265  1.00 104.03 ? 140 TYR L CE2 1 
ATOM   3559 C  CZ  . TYR C 3 140 ? 23.723  -22.293 -2.737  1.00 101.12 ? 140 TYR L CZ  1 
ATOM   3560 O  OH  . TYR C 3 140 ? 23.086  -22.495 -3.947  1.00 95.74  ? 140 TYR L OH  1 
ATOM   3561 N  N   . PRO C 3 141 ? 22.746  -23.078 1.381   1.00 114.79 ? 141 PRO L N   1 
ATOM   3562 C  CA  . PRO C 3 141 ? 21.932  -22.061 0.669   1.00 120.80 ? 141 PRO L CA  1 
ATOM   3563 C  C   . PRO C 3 141 ? 21.052  -21.085 1.479   1.00 122.52 ? 141 PRO L C   1 
ATOM   3564 O  O   . PRO C 3 141 ? 21.185  -21.046 2.703   1.00 120.35 ? 141 PRO L O   1 
ATOM   3565 C  CB  . PRO C 3 141 ? 21.020  -22.948 -0.183  1.00 20.00  ? 141 PRO L CB  1 
ATOM   3566 C  CG  . PRO C 3 141 ? 20.789  -24.162 0.648   1.00 20.00  ? 141 PRO L CG  1 
ATOM   3567 C  CD  . PRO C 3 141 ? 21.557  -23.931 1.912   1.00 20.00  ? 141 PRO L CD  1 
ATOM   3568 N  N   . LYS C 3 142 ? 20.305  -20.190 0.824   1.00 120.49 ? 142 LYS L N   1 
ATOM   3569 C  CA  . LYS C 3 142 ? 19.647  -19.097 1.574   1.00 122.26 ? 142 LYS L CA  1 
ATOM   3570 C  C   . LYS C 3 142 ? 18.529  -19.276 2.574   1.00 116.35 ? 142 LYS L C   1 
ATOM   3571 O  O   . LYS C 3 142 ? 18.519  -18.570 3.581   1.00 114.81 ? 142 LYS L O   1 
ATOM   3572 C  CB  . LYS C 3 142 ? 19.016  -18.135 0.557   1.00 120.53 ? 142 LYS L CB  1 
ATOM   3573 C  CG  . LYS C 3 142 ? 19.861  -17.837 -0.628  1.00 119.59 ? 142 LYS L CG  1 
ATOM   3574 C  CD  . LYS C 3 142 ? 21.256  -17.424 -0.203  1.00 121.60 ? 142 LYS L CD  1 
ATOM   3575 C  CE  . LYS C 3 142 ? 22.159  -17.134 -1.427  1.00 116.96 ? 142 LYS L CE  1 
ATOM   3576 N  NZ  . LYS C 3 142 ? 21.385  -16.097 -2.177  1.00 124.76 ? 142 LYS L NZ  1 
ATOM   3577 N  N   . ASP C 3 143 ? 17.605  -20.203 2.326   1.00 115.89 ? 143 ASP L N   1 
ATOM   3578 C  CA  . ASP C 3 143 ? 16.469  -20.275 3.225   1.00 120.39 ? 143 ASP L CA  1 
ATOM   3579 C  C   . ASP C 3 143 ? 16.789  -20.624 4.651   1.00 125.32 ? 143 ASP L C   1 
ATOM   3580 O  O   . ASP C 3 143 ? 17.470  -21.615 4.920   1.00 127.93 ? 143 ASP L O   1 
ATOM   3581 C  CB  . ASP C 3 143 ? 15.422  -21.242 2.661   1.00 121.51 ? 143 ASP L CB  1 
ATOM   3582 C  CG  . ASP C 3 143 ? 14.689  -20.660 1.449   1.00 126.43 ? 143 ASP L CG  1 
ATOM   3583 O  OD1 . ASP C 3 143 ? 14.755  -19.425 1.227   1.00 132.64 ? 143 ASP L OD1 1 
ATOM   3584 O  OD2 . ASP C 3 143 ? 14.019  -21.427 0.733   1.00 119.42 ? 143 ASP L OD2 1 
ATOM   3585 N  N   . ILE C 3 144 ? 16.265  -19.808 5.564   1.00 125.18 ? 144 ILE L N   1 
ATOM   3586 C  CA  . ILE C 3 144 ? 16.457  -20.031 6.988   1.00 123.55 ? 144 ILE L CA  1 
ATOM   3587 C  C   . ILE C 3 144 ? 15.495  -19.193 7.845   1.00 126.55 ? 144 ILE L C   1 
ATOM   3588 O  O   . ILE C 3 144 ? 15.216  -18.028 7.530   1.00 128.29 ? 144 ILE L O   1 
ATOM   3589 C  CB  . ILE C 3 144 ? 17.926  -19.749 7.422   1.00 122.17 ? 144 ILE L CB  1 
ATOM   3590 C  CG1 . ILE C 3 144 ? 18.166  -20.286 8.828   1.00 127.94 ? 144 ILE L CG1 1 
ATOM   3591 C  CG2 . ILE C 3 144 ? 18.217  -18.271 7.483   1.00 119.38 ? 144 ILE L CG2 1 
ATOM   3592 C  CD1 . ILE C 3 144 ? 19.578  -20.055 9.342   1.00 126.30 ? 144 ILE L CD1 1 
ATOM   3593 N  N   . ASN C 3 145 ? 14.981  -19.766 8.920   1.00 126.69 ? 145 ASN L N   1 
ATOM   3594 C  CA  . ASN C 3 145 ? 14.128  -18.992 9.814   1.00 129.28 ? 145 ASN L CA  1 
ATOM   3595 C  C   . ASN C 3 145 ? 14.869  -19.015 11.134  1.00 130.22 ? 145 ASN L C   1 
ATOM   3596 O  O   . ASN C 3 145 ? 15.324  -20.060 11.565  1.00 132.51 ? 145 ASN L O   1 
ATOM   3597 C  CB  . ASN C 3 145 ? 12.688  -19.468 9.931   1.00 130.20 ? 145 ASN L CB  1 
ATOM   3598 C  CG  . ASN C 3 145 ? 11.740  -18.306 10.236  1.00 129.88 ? 145 ASN L CG  1 
ATOM   3599 O  OD1 . ASN C 3 145 ? 12.168  -17.146 10.249  1.00 127.46 ? 145 ASN L OD1 1 
ATOM   3600 N  ND2 . ASN C 3 145 ? 10.468  -18.602 10.476  1.00 129.95 ? 145 ASN L ND2 1 
ATOM   3601 N  N   . VAL C 3 146 ? 14.922  -17.879 11.810  1.00 131.08 ? 146 VAL L N   1 
ATOM   3602 C  CA  . VAL C 3 146 ? 15.628  -17.781 13.073  1.00 134.06 ? 146 VAL L CA  1 
ATOM   3603 C  C   . VAL C 3 146 ? 14.553  -17.504 14.083  1.00 138.92 ? 146 VAL L C   1 
ATOM   3604 O  O   . VAL C 3 146 ? 13.613  -16.723 13.948  1.00 138.27 ? 146 VAL L O   1 
ATOM   3605 C  CB  . VAL C 3 146 ? 16.784  -16.796 13.082  1.00 132.10 ? 146 VAL L CB  1 
ATOM   3606 C  CG1 . VAL C 3 146 ? 17.975  -17.417 12.349  1.00 127.74 ? 146 VAL L CG1 1 
ATOM   3607 C  CG2 . VAL C 3 146 ? 16.385  -15.472 12.485  1.00 130.15 ? 146 VAL L CG2 1 
ATOM   3608 N  N   . LYS C 3 147 ? 14.797  -18.330 15.075  1.00 145.39 ? 147 LYS L N   1 
ATOM   3609 C  CA  . LYS C 3 147 ? 14.166  -18.581 16.307  1.00 148.72 ? 147 LYS L CA  1 
ATOM   3610 C  C   . LYS C 3 147 ? 15.144  -18.284 17.468  1.00 151.31 ? 147 LYS L C   1 
ATOM   3611 O  O   . LYS C 3 147 ? 16.288  -18.430 17.295  1.00 149.35 ? 147 LYS L O   1 
ATOM   3612 C  CB  . LYS C 3 147 ? 13.867  -20.087 16.147  1.00 147.20 ? 147 LYS L CB  1 
ATOM   3613 C  CG  . LYS C 3 147 ? 13.290  -20.954 17.164  1.00 147.28 ? 147 LYS L CG  1 
ATOM   3614 C  CD  . LYS C 3 147 ? 12.042  -20.552 17.772  1.00 153.43 ? 147 LYS L CD  1 
ATOM   3615 C  CE  . LYS C 3 147 ? 11.913  -21.426 18.974  1.00 155.58 ? 147 LYS L CE  1 
ATOM   3616 N  NZ  . LYS C 3 147 ? 13.217  -21.392 19.590  1.00 151.15 ? 147 LYS L NZ  1 
ATOM   3617 N  N   . TRP C 3 148 ? 14.623  -17.598 18.455  1.00 153.01 ? 148 TRP L N   1 
ATOM   3618 C  CA  . TRP C 3 148 ? 15.031  -17.114 19.787  1.00 153.49 ? 148 TRP L CA  1 
ATOM   3619 C  C   . TRP C 3 148 ? 14.459  -17.943 21.044  1.00 153.90 ? 148 TRP L C   1 
ATOM   3620 O  O   . TRP C 3 148 ? 13.776  -18.849 20.662  1.00 152.89 ? 148 TRP L O   1 
ATOM   3621 C  CB  . TRP C 3 148 ? 14.620  -15.648 19.937  1.00 20.00  ? 148 TRP L CB  1 
ATOM   3622 C  CG  . TRP C 3 148 ? 15.365  -14.721 19.026  1.00 20.00  ? 148 TRP L CG  1 
ATOM   3623 C  CD1 . TRP C 3 148 ? 14.964  -14.274 17.800  1.00 20.00  ? 148 TRP L CD1 1 
ATOM   3624 C  CD2 . TRP C 3 148 ? 16.645  -14.124 19.269  1.00 20.00  ? 148 TRP L CD2 1 
ATOM   3625 N  NE1 . TRP C 3 148 ? 15.914  -13.439 17.265  1.00 20.00  ? 148 TRP L NE1 1 
ATOM   3626 C  CE2 . TRP C 3 148 ? 16.956  -13.328 18.147  1.00 20.00  ? 148 TRP L CE2 1 
ATOM   3627 C  CE3 . TRP C 3 148 ? 17.564  -14.180 20.322  1.00 20.00  ? 148 TRP L CE3 1 
ATOM   3628 C  CZ2 . TRP C 3 148 ? 18.140  -12.600 18.050  1.00 20.00  ? 148 TRP L CZ2 1 
ATOM   3629 C  CZ3 . TRP C 3 148 ? 18.738  -13.456 20.223  1.00 20.00  ? 148 TRP L CZ3 1 
ATOM   3630 C  CH2 . TRP C 3 148 ? 19.016  -12.677 19.096  1.00 20.00  ? 148 TRP L CH2 1 
ATOM   3631 N  N   . LYS C 3 149 ? 14.877  -18.172 22.287  1.00 151.45 ? 149 LYS L N   1 
ATOM   3632 C  CA  . LYS C 3 149 ? 13.910  -18.923 23.167  1.00 150.21 ? 149 LYS L CA  1 
ATOM   3633 C  C   . LYS C 3 149 ? 13.925  -18.097 24.463  1.00 151.62 ? 149 LYS L C   1 
ATOM   3634 O  O   . LYS C 3 149 ? 15.046  -17.710 24.800  1.00 148.54 ? 149 LYS L O   1 
ATOM   3635 C  CB  . LYS C 3 149 ? 14.327  -20.376 23.398  1.00 20.00  ? 149 LYS L CB  1 
ATOM   3636 C  CG  . LYS C 3 149 ? 14.183  -21.267 22.174  1.00 20.00  ? 149 LYS L CG  1 
ATOM   3637 C  CD  . LYS C 3 149 ? 14.636  -22.687 22.467  1.00 20.00  ? 149 LYS L CD  1 
ATOM   3638 C  CE  . LYS C 3 149 ? 14.470  -23.583 21.251  1.00 20.00  ? 149 LYS L CE  1 
ATOM   3639 N  NZ  . LYS C 3 149 ? 14.934  -24.972 21.516  1.00 20.00  ? 149 LYS L NZ  1 
ATOM   3640 N  N   . ILE C 3 150 ? 12.823  -17.893 25.263  1.00 152.10 ? 150 ILE L N   1 
ATOM   3641 C  CA  . ILE C 3 150 ? 12.970  -17.163 26.591  1.00 150.46 ? 150 ILE L CA  1 
ATOM   3642 C  C   . ILE C 3 150 ? 12.611  -18.186 27.610  1.00 151.98 ? 150 ILE L C   1 
ATOM   3643 O  O   . ILE C 3 150 ? 11.444  -18.631 27.656  1.00 153.84 ? 150 ILE L O   1 
ATOM   3644 C  CB  . ILE C 3 150 ? 12.065  -15.919 26.680  1.00 20.00  ? 150 ILE L CB  1 
ATOM   3645 C  CG1 . ILE C 3 150 ? 12.557  -14.832 25.722  1.00 20.00  ? 150 ILE L CG1 1 
ATOM   3646 C  CG2 . ILE C 3 150 ? 12.018  -15.396 28.107  1.00 20.00  ? 150 ILE L CG2 1 
ATOM   3647 C  CD1 . ILE C 3 150 ? 11.586  -13.686 25.550  1.00 20.00  ? 150 ILE L CD1 1 
ATOM   3648 N  N   . ASP C 3 151 ? 13.604  -18.644 28.355  1.00 150.28 ? 151 ASP L N   1 
ATOM   3649 C  CA  . ASP C 3 151 ? 13.417  -19.658 29.407  1.00 148.52 ? 151 ASP L CA  1 
ATOM   3650 C  C   . ASP C 3 151 ? 12.436  -20.711 28.947  1.00 148.95 ? 151 ASP L C   1 
ATOM   3651 O  O   . ASP C 3 151 ? 11.619  -21.221 29.757  1.00 147.10 ? 151 ASP L O   1 
ATOM   3652 C  CB  . ASP C 3 151 ? 13.044  -19.042 30.759  1.00 142.24 ? 151 ASP L CB  1 
ATOM   3653 C  CG  . ASP C 3 151 ? 14.207  -18.311 31.409  1.00 140.23 ? 151 ASP L CG  1 
ATOM   3654 O  OD1 . ASP C 3 151 ? 15.053  -17.789 30.683  1.00 139.19 ? 151 ASP L OD1 1 
ATOM   3655 O  OD2 . ASP C 3 151 ? 14.246  -18.232 32.671  1.00 141.02 ? 151 ASP L OD2 1 
ATOM   3656 N  N   . GLY C 3 152 ? 12.464  -21.068 27.682  1.00 149.58 ? 152 GLY L N   1 
ATOM   3657 C  CA  . GLY C 3 152 ? 11.582  -22.086 27.164  1.00 152.21 ? 152 GLY L CA  1 
ATOM   3658 C  C   . GLY C 3 152 ? 10.303  -21.480 26.559  1.00 155.72 ? 152 GLY L C   1 
ATOM   3659 O  O   . GLY C 3 152 ? 9.543   -22.232 25.941  1.00 153.82 ? 152 GLY L O   1 
ATOM   3660 N  N   . SER C 3 153 ? 9.977   -20.240 26.885  1.00 157.76 ? 153 SER L N   1 
ATOM   3661 C  CA  . SER C 3 153 ? 8.816   -19.537 26.407  1.00 155.70 ? 153 SER L CA  1 
ATOM   3662 C  C   . SER C 3 153 ? 9.481   -18.638 25.278  1.00 154.69 ? 153 SER L C   1 
ATOM   3663 O  O   . SER C 3 153 ? 10.683  -18.688 25.178  1.00 154.06 ? 153 SER L O   1 
ATOM   3664 C  CB  . SER C 3 153 ? 8.137   -18.614 27.530  1.00 151.10 ? 153 SER L CB  1 
ATOM   3665 O  OG  . SER C 3 153 ? 7.973   -19.247 28.789  1.00 153.46 ? 153 SER L OG  1 
ATOM   3666 N  N   . GLU C 3 154 ? 8.721   -17.911 24.419  1.00 156.54 ? 154 GLU L N   1 
ATOM   3667 C  CA  . GLU C 3 154 ? 9.204   -16.932 23.337  1.00 154.03 ? 154 GLU L CA  1 
ATOM   3668 C  C   . GLU C 3 154 ? 8.468   -16.729 22.010  1.00 151.69 ? 154 GLU L C   1 
ATOM   3669 O  O   . GLU C 3 154 ? 7.648   -17.551 21.604  1.00 150.58 ? 154 GLU L O   1 
ATOM   3670 C  CB  . GLU C 3 154 ? 10.664  -17.055 22.917  1.00 151.67 ? 154 GLU L CB  1 
ATOM   3671 C  CG  . GLU C 3 154 ? 11.407  -15.849 23.504  1.00 152.79 ? 154 GLU L CG  1 
ATOM   3672 C  CD  . GLU C 3 154 ? 12.780  -15.653 23.035  1.00 157.90 ? 154 GLU L CD  1 
ATOM   3673 O  OE1 . GLU C 3 154 ? 12.927  -15.613 21.828  1.00 158.46 ? 154 GLU L OE1 1 
ATOM   3674 O  OE2 . GLU C 3 154 ? 13.689  -15.496 23.865  1.00 158.09 ? 154 GLU L OE2 1 
ATOM   3675 N  N   . ARG C 3 155 ? 8.751   -15.551 21.415  1.00 150.60 ? 155 ARG L N   1 
ATOM   3676 C  CA  . ARG C 3 155 ? 8.305   -15.020 20.061  1.00 149.22 ? 155 ARG L CA  1 
ATOM   3677 C  C   . ARG C 3 155 ? 8.373   -13.458 19.958  1.00 142.49 ? 155 ARG L C   1 
ATOM   3678 O  O   . ARG C 3 155 ? 8.635   -12.879 21.016  1.00 140.53 ? 155 ARG L O   1 
ATOM   3679 C  CB  . ARG C 3 155 ? 6.881   -15.492 19.759  1.00 20.00  ? 155 ARG L CB  1 
ATOM   3680 C  CG  . ARG C 3 155 ? 6.753   -16.994 19.568  1.00 20.00  ? 155 ARG L CG  1 
ATOM   3681 C  CD  . ARG C 3 155 ? 5.348   -17.458 19.220  1.00 20.00  ? 155 ARG L CD  1 
ATOM   3682 N  NE  . ARG C 3 155 ? 5.261   -18.912 19.116  1.00 20.00  ? 155 ARG L NE  1 
ATOM   3683 C  CZ  . ARG C 3 155 ? 4.131   -19.580 18.937  1.00 20.00  ? 155 ARG L CZ  1 
ATOM   3684 N  NH1 . ARG C 3 155 ? 2.980   -18.926 18.837  1.00 20.00  ? 155 ARG L NH1 1 
ATOM   3685 N  NH2 . ARG C 3 155 ? 4.145   -20.904 18.854  1.00 20.00  ? 155 ARG L NH2 1 
ATOM   3686 N  N   . GLN C 3 156 ? 8.707   -12.907 18.772  1.00 138.85 ? 156 GLN L N   1 
ATOM   3687 C  CA  . GLN C 3 156 ? 8.843   -11.459 18.574  1.00 130.67 ? 156 GLN L CA  1 
ATOM   3688 C  C   . GLN C 3 156 ? 9.907   -10.572 19.199  1.00 130.29 ? 156 GLN L C   1 
ATOM   3689 O  O   . GLN C 3 156 ? 10.871  -10.169 18.524  1.00 128.03 ? 156 GLN L O   1 
ATOM   3690 C  CB  . GLN C 3 156 ? 7.456   -10.825 18.886  1.00 118.40 ? 156 GLN L CB  1 
ATOM   3691 C  CG  . GLN C 3 156 ? 7.246   -9.305  18.874  1.00 115.13 ? 156 GLN L CG  1 
ATOM   3692 C  CD  . GLN C 3 156 ? 8.110   -8.468  17.914  1.00 117.13 ? 156 GLN L CD  1 
ATOM   3693 O  OE1 . GLN C 3 156 ? 9.102   -7.863  18.321  1.00 121.87 ? 156 GLN L OE1 1 
ATOM   3694 N  NE2 . GLN C 3 156 ? 7.697   -8.379  16.660  1.00 113.45 ? 156 GLN L NE2 1 
ATOM   3695 N  N   . ASN C 3 157 ? 9.651   -10.068 20.403  1.00 131.76 ? 157 ASN L N   1 
ATOM   3696 C  CA  . ASN C 3 157 ? 10.255  -8.799  20.895  1.00 129.40 ? 157 ASN L CA  1 
ATOM   3697 C  C   . ASN C 3 157 ? 11.745  -8.513  20.640  1.00 130.56 ? 157 ASN L C   1 
ATOM   3698 O  O   . ASN C 3 157 ? 12.629  -9.380  20.725  1.00 137.02 ? 157 ASN L O   1 
ATOM   3699 C  CB  . ASN C 3 157 ? 10.072  -8.640  22.431  1.00 125.00 ? 157 ASN L CB  1 
ATOM   3700 C  CG  . ASN C 3 157 ? 9.002   -9.589  23.053  1.00 123.02 ? 157 ASN L CG  1 
ATOM   3701 O  OD1 . ASN C 3 157 ? 7.792   -9.315  23.276  1.00 108.92 ? 157 ASN L OD1 1 
ATOM   3702 N  ND2 . ASN C 3 157 ? 9.488   -10.823 23.239  1.00 128.83 ? 157 ASN L ND2 1 
ATOM   3703 N  N   . GLY C 3 158 ? 11.938  -7.251  20.310  1.00 127.48 ? 158 GLY L N   1 
ATOM   3704 C  CA  . GLY C 3 158 ? 13.203  -6.564  20.069  1.00 127.04 ? 158 GLY L CA  1 
ATOM   3705 C  C   . GLY C 3 158 ? 14.360  -7.034  19.224  1.00 126.98 ? 158 GLY L C   1 
ATOM   3706 O  O   . GLY C 3 158 ? 15.390  -6.385  19.277  1.00 125.79 ? 158 GLY L O   1 
ATOM   3707 N  N   . VAL C 3 159 ? 14.110  -7.960  18.306  1.00 125.10 ? 159 VAL L N   1 
ATOM   3708 C  CA  . VAL C 3 159 ? 15.115  -8.480  17.384  1.00 123.07 ? 159 VAL L CA  1 
ATOM   3709 C  C   . VAL C 3 159 ? 14.974  -8.004  15.956  1.00 119.40 ? 159 VAL L C   1 
ATOM   3710 O  O   . VAL C 3 159 ? 13.945  -8.192  15.371  1.00 115.49 ? 159 VAL L O   1 
ATOM   3711 C  CB  . VAL C 3 159 ? 15.293  -10.053 17.393  1.00 123.65 ? 159 VAL L CB  1 
ATOM   3712 C  CG1 . VAL C 3 159 ? 14.020  -10.898 17.076  1.00 119.42 ? 159 VAL L CG1 1 
ATOM   3713 C  CG2 . VAL C 3 159 ? 16.436  -10.365 16.463  1.00 122.82 ? 159 VAL L CG2 1 
ATOM   3714 N  N   . LEU C 3 160 ? 16.009  -7.353  15.436  1.00 117.62 ? 160 LEU L N   1 
ATOM   3715 C  CA  . LEU C 3 160 ? 16.050  -6.875  14.064  1.00 115.60 ? 160 LEU L CA  1 
ATOM   3716 C  C   . LEU C 3 160 ? 17.150  -7.643  13.319  1.00 114.64 ? 160 LEU L C   1 
ATOM   3717 O  O   . LEU C 3 160 ? 18.298  -7.765  13.775  1.00 113.82 ? 160 LEU L O   1 
ATOM   3718 C  CB  . LEU C 3 160 ? 16.351  -5.393  14.038  1.00 113.90 ? 160 LEU L CB  1 
ATOM   3719 C  CG  . LEU C 3 160 ? 15.189  -4.487  14.426  1.00 116.09 ? 160 LEU L CG  1 
ATOM   3720 C  CD1 . LEU C 3 160 ? 15.687  -3.082  14.677  1.00 109.76 ? 160 LEU L CD1 1 
ATOM   3721 C  CD2 . LEU C 3 160 ? 14.149  -4.479  13.307  1.00 117.48 ? 160 LEU L CD2 1 
ATOM   3722 N  N   . ASN C 3 161 ? 16.765  -8.157  12.144  1.00 111.98 ? 161 ASN L N   1 
ATOM   3723 C  CA  . ASN C 3 161 ? 17.621  -9.016  11.351  1.00 112.98 ? 161 ASN L CA  1 
ATOM   3724 C  C   . ASN C 3 161 ? 18.072  -8.325  10.065  1.00 111.92 ? 161 ASN L C   1 
ATOM   3725 O  O   . ASN C 3 161 ? 17.325  -7.534  9.498   1.00 110.32 ? 161 ASN L O   1 
ATOM   3726 C  CB  . ASN C 3 161 ? 16.822  -10.267 10.932  1.00 110.98 ? 161 ASN L CB  1 
ATOM   3727 C  CG  . ASN C 3 161 ? 16.382  -11.138 12.108  1.00 111.17 ? 161 ASN L CG  1 
ATOM   3728 O  OD1 . ASN C 3 161 ? 17.015  -11.152 13.169  1.00 114.44 ? 161 ASN L OD1 1 
ATOM   3729 N  ND2 . ASN C 3 161 ? 15.286  -11.870 11.916  1.00 96.49  ? 161 ASN L ND2 1 
ATOM   3730 N  N   . SER C 3 162 ? 19.268  -8.691  9.582   1.00 110.58 ? 162 SER L N   1 
ATOM   3731 C  CA  . SER C 3 162 ? 19.843  -8.162  8.330   1.00 107.43 ? 162 SER L CA  1 
ATOM   3732 C  C   . SER C 3 162 ? 20.683  -9.202  7.599   1.00 108.13 ? 162 SER L C   1 
ATOM   3733 O  O   . SER C 3 162 ? 21.497  -9.871  8.235   1.00 110.49 ? 162 SER L O   1 
ATOM   3734 C  CB  . SER C 3 162 ? 20.688  -6.916  8.603   1.00 101.32 ? 162 SER L CB  1 
ATOM   3735 O  OG  . SER C 3 162 ? 21.864  -7.245  9.317   1.00 100.67 ? 162 SER L OG  1 
ATOM   3736 N  N   . GLU C 3 163 ? 20.554  -9.305  6.273   1.00 106.06 ? 163 GLU L N   1 
ATOM   3737 C  CA  . GLU C 3 163 ? 21.251  -10.372 5.546   1.00 102.53 ? 163 GLU L CA  1 
ATOM   3738 C  C   . GLU C 3 163 ? 22.209  -9.830  4.520   1.00 104.88 ? 163 GLU L C   1 
ATOM   3739 O  O   . GLU C 3 163 ? 21.902  -8.844  3.889   1.00 111.67 ? 163 GLU L O   1 
ATOM   3740 C  CB  . GLU C 3 163 ? 20.204  -11.194 4.786   1.00 106.06 ? 163 GLU L CB  1 
ATOM   3741 C  CG  . GLU C 3 163 ? 18.786  -11.156 5.387   1.00 106.08 ? 163 GLU L CG  1 
ATOM   3742 C  CD  . GLU C 3 163 ? 18.701  -11.532 6.855   1.00 109.54 ? 163 GLU L CD  1 
ATOM   3743 O  OE1 . GLU C 3 163 ? 19.718  -11.981 7.434   1.00 103.94 ? 163 GLU L OE1 1 
ATOM   3744 O  OE2 . GLU C 3 163 ? 17.627  -11.299 7.439   1.00 110.78 ? 163 GLU L OE2 1 
ATOM   3745 N  N   . THR C 3 164 ? 23.392  -10.407 4.355   1.00 104.47 ? 164 THR L N   1 
ATOM   3746 C  CA  . THR C 3 164 ? 24.186  -9.905  3.249   1.00 102.94 ? 164 THR L CA  1 
ATOM   3747 C  C   . THR C 3 164 ? 23.760  -10.756 2.051   1.00 107.57 ? 164 THR L C   1 
ATOM   3748 O  O   . THR C 3 164 ? 23.217  -11.808 2.294   1.00 107.44 ? 164 THR L O   1 
ATOM   3749 C  CB  . THR C 3 164 ? 25.668  -10.147 3.538   1.00 104.64 ? 164 THR L CB  1 
ATOM   3750 O  OG1 . THR C 3 164 ? 25.861  -11.554 3.696   1.00 102.90 ? 164 THR L OG1 1 
ATOM   3751 C  CG2 . THR C 3 164 ? 26.102  -9.505  4.833   1.00 99.95  ? 164 THR L CG2 1 
ATOM   3752 N  N   . ASP C 3 165 ? 23.951  -10.343 0.791   1.00 113.61 ? 165 ASP L N   1 
ATOM   3753 C  CA  . ASP C 3 165 ? 23.758  -11.242 -0.364  1.00 110.90 ? 165 ASP L CA  1 
ATOM   3754 C  C   . ASP C 3 165 ? 25.085  -11.981 -0.416  1.00 104.52 ? 165 ASP L C   1 
ATOM   3755 O  O   . ASP C 3 165 ? 26.054  -11.581 0.244   1.00 101.10 ? 165 ASP L O   1 
ATOM   3756 C  CB  . ASP C 3 165 ? 23.293  -10.663 -1.714  1.00 106.90 ? 165 ASP L CB  1 
ATOM   3757 C  CG  . ASP C 3 165 ? 22.743  -11.804 -2.672  1.00 113.86 ? 165 ASP L CG  1 
ATOM   3758 O  OD1 . ASP C 3 165 ? 23.140  -12.993 -2.552  1.00 118.53 ? 165 ASP L OD1 1 
ATOM   3759 O  OD2 . ASP C 3 165 ? 21.733  -11.619 -3.364  1.00 108.89 ? 165 ASP L OD2 1 
ATOM   3760 N  N   . GLN C 3 166 ? 25.133  -13.009 -1.244  1.00 105.31 ? 166 GLN L N   1 
ATOM   3761 C  CA  . GLN C 3 166 ? 26.281  -13.859 -1.395  1.00 102.85 ? 166 GLN L CA  1 
ATOM   3762 C  C   . GLN C 3 166 ? 27.592  -13.149 -1.728  1.00 96.41  ? 166 GLN L C   1 
ATOM   3763 O  O   . GLN C 3 166 ? 27.684  -12.283 -2.590  1.00 96.86  ? 166 GLN L O   1 
ATOM   3764 C  CB  . GLN C 3 166 ? 25.881  -14.762 -2.570  1.00 100.11 ? 166 GLN L CB  1 
ATOM   3765 C  CG  . GLN C 3 166 ? 26.652  -15.950 -2.907  1.00 97.50  ? 166 GLN L CG  1 
ATOM   3766 C  CD  . GLN C 3 166 ? 26.033  -16.785 -4.045  1.00 90.06  ? 166 GLN L CD  1 
ATOM   3767 O  OE1 . GLN C 3 166 ? 25.547  -16.245 -5.030  1.00 94.29  ? 166 GLN L OE1 1 
ATOM   3768 N  NE2 . GLN C 3 166 ? 26.005  -18.096 -3.875  1.00 87.19  ? 166 GLN L NE2 1 
ATOM   3769 N  N   . ASP C 3 167 ? 28.593  -13.541 -0.945  1.00 102.34 ? 167 ASP L N   1 
ATOM   3770 C  CA  . ASP C 3 167 ? 29.968  -13.069 -1.013  1.00 104.15 ? 167 ASP L CA  1 
ATOM   3771 C  C   . ASP C 3 167 ? 30.586  -13.500 -2.336  1.00 100.39 ? 167 ASP L C   1 
ATOM   3772 O  O   . ASP C 3 167 ? 30.432  -14.635 -2.789  1.00 96.43  ? 167 ASP L O   1 
ATOM   3773 C  CB  . ASP C 3 167 ? 30.777  -13.468 0.237   1.00 105.34 ? 167 ASP L CB  1 
ATOM   3774 C  CG  . ASP C 3 167 ? 31.190  -14.909 0.263   1.00 106.42 ? 167 ASP L CG  1 
ATOM   3775 O  OD1 . ASP C 3 167 ? 30.340  -15.799 0.053   1.00 108.84 ? 167 ASP L OD1 1 
ATOM   3776 O  OD2 . ASP C 3 167 ? 32.382  -15.139 0.543   1.00 105.68 ? 167 ASP L OD2 1 
ATOM   3777 N  N   . SER C 3 168 ? 31.259  -12.562 -2.967  1.00 97.53  ? 168 SER L N   1 
ATOM   3778 C  CA  . SER C 3 168 ? 31.847  -12.784 -4.266  1.00 97.07  ? 168 SER L CA  1 
ATOM   3779 C  C   . SER C 3 168 ? 32.937  -13.840 -4.263  1.00 101.98 ? 168 SER L C   1 
ATOM   3780 O  O   . SER C 3 168 ? 33.111  -14.536 -5.262  1.00 98.30  ? 168 SER L O   1 
ATOM   3781 C  CB  . SER C 3 168 ? 32.441  -11.468 -4.787  1.00 91.61  ? 168 SER L CB  1 
ATOM   3782 O  OG  . SER C 3 168 ? 33.386  -10.953 -3.863  1.00 85.68  ? 168 SER L OG  1 
ATOM   3783 N  N   . LYS C 3 169 ? 33.631  -13.997 -3.141  1.00 107.72 ? 169 LYS L N   1 
ATOM   3784 C  CA  . LYS C 3 169 ? 34.722  -14.935 -3.078  1.00 103.62 ? 169 LYS L CA  1 
ATOM   3785 C  C   . LYS C 3 169 ? 34.228  -16.367 -2.730  1.00 103.03 ? 169 LYS L C   1 
ATOM   3786 O  O   . LYS C 3 169 ? 34.454  -17.322 -3.471  1.00 103.77 ? 169 LYS L O   1 
ATOM   3787 C  CB  . LYS C 3 169 ? 35.726  -14.530 -2.024  1.00 104.16 ? 169 LYS L CB  1 
ATOM   3788 C  CG  . LYS C 3 169 ? 36.386  -13.173 -2.306  1.00 104.89 ? 169 LYS L CG  1 
ATOM   3789 C  CD  . LYS C 3 169 ? 37.489  -12.939 -1.282  1.00 96.40  ? 169 LYS L CD  1 
ATOM   3790 C  CE  . LYS C 3 169 ? 37.106  -13.264 0.152   1.00 99.61  ? 169 LYS L CE  1 
ATOM   3791 N  NZ  . LYS C 3 169 ? 35.983  -12.717 0.880   1.00 110.93 ? 169 LYS L NZ  1 
ATOM   3792 N  N   . ASP C 3 170 ? 33.545  -16.528 -1.593  1.00 103.67 ? 170 ASP L N   1 
ATOM   3793 C  CA  . ASP C 3 170 ? 33.154  -17.877 -1.144  1.00 103.18 ? 170 ASP L CA  1 
ATOM   3794 C  C   . ASP C 3 170 ? 31.660  -18.237 -1.415  1.00 105.63 ? 170 ASP L C   1 
ATOM   3795 O  O   . ASP C 3 170 ? 31.213  -19.354 -1.161  1.00 106.61 ? 170 ASP L O   1 
ATOM   3796 C  CB  . ASP C 3 170 ? 33.519  -17.887 0.376   1.00 109.46 ? 170 ASP L CB  1 
ATOM   3797 C  CG  . ASP C 3 170 ? 35.019  -17.911 0.710   1.00 114.44 ? 170 ASP L CG  1 
ATOM   3798 O  OD1 . ASP C 3 170 ? 35.885  -18.192 -0.132  1.00 110.09 ? 170 ASP L OD1 1 
ATOM   3799 O  OD2 . ASP C 3 170 ? 35.323  -17.639 1.900   1.00 116.95 ? 170 ASP L OD2 1 
ATOM   3800 N  N   . SER C 3 171 ? 30.917  -17.313 -2.029  1.00 107.29 ? 171 SER L N   1 
ATOM   3801 C  CA  . SER C 3 171 ? 29.512  -17.494 -2.496  1.00 102.53 ? 171 SER L CA  1 
ATOM   3802 C  C   . SER C 3 171 ? 28.490  -17.867 -1.402  1.00 104.07 ? 171 SER L C   1 
ATOM   3803 O  O   . SER C 3 171 ? 27.455  -18.490 -1.654  1.00 105.45 ? 171 SER L O   1 
ATOM   3804 C  CB  . SER C 3 171 ? 29.438  -18.525 -3.620  1.00 101.08 ? 171 SER L CB  1 
ATOM   3805 O  OG  . SER C 3 171 ? 29.902  -19.785 -3.189  1.00 104.99 ? 171 SER L OG  1 
ATOM   3806 N  N   . THR C 3 172 ? 28.886  -17.608 -0.180  1.00 106.71 ? 172 THR L N   1 
ATOM   3807 C  CA  . THR C 3 172 ? 28.136  -17.816 1.031   1.00 110.82 ? 172 THR L CA  1 
ATOM   3808 C  C   . THR C 3 172 ? 27.472  -16.541 1.631   1.00 114.90 ? 172 THR L C   1 
ATOM   3809 O  O   . THR C 3 172 ? 27.568  -15.435 1.086   1.00 106.39 ? 172 THR L O   1 
ATOM   3810 C  CB  . THR C 3 172 ? 29.049  -18.453 2.095   1.00 20.00  ? 172 THR L CB  1 
ATOM   3811 O  OG1 . THR C 3 172 ? 30.143  -17.573 2.378   1.00 20.00  ? 172 THR L OG1 1 
ATOM   3812 C  CG2 . THR C 3 172 ? 29.731  -19.694 1.541   1.00 20.00  ? 172 THR L CG2 1 
ATOM   3813 N  N   . TYR C 3 173 ? 26.732  -16.773 2.709   1.00 118.58 ? 173 TYR L N   1 
ATOM   3814 C  CA  . TYR C 3 173 ? 26.107  -15.768 3.562   1.00 117.80 ? 173 TYR L CA  1 
ATOM   3815 C  C   . TYR C 3 173 ? 26.419  -15.677 5.020   1.00 112.98 ? 173 TYR L C   1 
ATOM   3816 O  O   . TYR C 3 173 ? 26.623  -16.650 5.725   1.00 111.71 ? 173 TYR L O   1 
ATOM   3817 C  CB  . TYR C 3 173 ? 24.592  -15.745 3.615   1.00 112.80 ? 173 TYR L CB  1 
ATOM   3818 C  CG  . TYR C 3 173 ? 23.780  -15.329 2.500   1.00 117.06 ? 173 TYR L CG  1 
ATOM   3819 C  CD1 . TYR C 3 173 ? 24.210  -15.328 1.199   1.00 114.06 ? 173 TYR L CD1 1 
ATOM   3820 C  CD2 . TYR C 3 173 ? 22.539  -14.712 2.829   1.00 120.31 ? 173 TYR L CD2 1 
ATOM   3821 C  CE1 . TYR C 3 173 ? 23.371  -14.775 0.236   1.00 114.65 ? 173 TYR L CE1 1 
ATOM   3822 C  CE2 . TYR C 3 173 ? 21.679  -14.178 1.886   1.00 120.11 ? 173 TYR L CE2 1 
ATOM   3823 C  CZ  . TYR C 3 173 ? 22.094  -14.221 0.545   1.00 123.14 ? 173 TYR L CZ  1 
ATOM   3824 O  OH  . TYR C 3 173 ? 21.298  -13.717 -0.462  1.00 129.57 ? 173 TYR L OH  1 
ATOM   3825 N  N   . SER C 3 174 ? 26.147  -14.464 5.468   1.00 113.33 ? 174 SER L N   1 
ATOM   3826 C  CA  . SER C 3 174 ? 26.252  -14.046 6.833   1.00 106.00 ? 174 SER L CA  1 
ATOM   3827 C  C   . SER C 3 174 ? 24.961  -13.294 7.127   1.00 109.99 ? 174 SER L C   1 
ATOM   3828 O  O   . SER C 3 174 ? 24.332  -12.705 6.256   1.00 116.63 ? 174 SER L O   1 
ATOM   3829 C  CB  . SER C 3 174 ? 27.504  -13.158 7.002   1.00 104.91 ? 174 SER L CB  1 
ATOM   3830 O  OG  . SER C 3 174 ? 28.720  -13.896 6.800   1.00 102.51 ? 174 SER L OG  1 
ATOM   3831 N  N   . MET C 3 175 ? 24.600  -13.311 8.386   1.00 109.55 ? 175 MET L N   1 
ATOM   3832 C  CA  . MET C 3 175 ? 23.421  -12.705 8.929   1.00 106.94 ? 175 MET L CA  1 
ATOM   3833 C  C   . MET C 3 175 ? 23.703  -12.028 10.261  1.00 111.24 ? 175 MET L C   1 
ATOM   3834 O  O   . MET C 3 175 ? 24.525  -12.507 11.039  1.00 113.20 ? 175 MET L O   1 
ATOM   3835 C  CB  . MET C 3 175 ? 22.410  -13.867 8.993   1.00 105.71 ? 175 MET L CB  1 
ATOM   3836 C  CG  . MET C 3 175 ? 21.229  -13.830 9.877   1.00 107.64 ? 175 MET L CG  1 
ATOM   3837 S  SD  . MET C 3 175 ? 20.537  -12.298 10.428  1.00 118.18 ? 175 MET L SD  1 
ATOM   3838 C  CE  . MET C 3 175 ? 19.388  -12.909 11.664  1.00 113.82 ? 175 MET L CE  1 
ATOM   3839 N  N   . SER C 3 176 ? 23.043  -10.903 10.519  1.00 110.58 ? 176 SER L N   1 
ATOM   3840 C  CA  . SER C 3 176 ? 23.189  -10.233 11.816  1.00 109.77 ? 176 SER L CA  1 
ATOM   3841 C  C   . SER C 3 176 ? 21.828  -10.120 12.492  1.00 113.74 ? 176 SER L C   1 
ATOM   3842 O  O   . SER C 3 176 ? 20.854  -9.592  11.905  1.00 115.91 ? 176 SER L O   1 
ATOM   3843 C  CB  . SER C 3 176 ? 23.847  -8.865  11.679  1.00 104.20 ? 176 SER L CB  1 
ATOM   3844 O  OG  . SER C 3 176 ? 23.990  -8.257  12.943  1.00 99.03  ? 176 SER L OG  1 
ATOM   3845 N  N   . SER C 3 177 ? 21.762  -10.523 13.752  1.00 115.25 ? 177 SER L N   1 
ATOM   3846 C  CA  . SER C 3 177 ? 20.502  -10.448 14.467  1.00 119.15 ? 177 SER L CA  1 
ATOM   3847 C  C   . SER C 3 177 ? 20.643  -9.784  15.823  1.00 117.12 ? 177 SER L C   1 
ATOM   3848 O  O   . SER C 3 177 ? 21.452  -10.221 16.664  1.00 122.89 ? 177 SER L O   1 
ATOM   3849 C  CB  . SER C 3 177 ? 19.962  -11.873 14.652  1.00 118.42 ? 177 SER L CB  1 
ATOM   3850 O  OG  . SER C 3 177 ? 18.714  -11.875 15.301  1.00 112.64 ? 177 SER L OG  1 
ATOM   3851 N  N   . THR C 3 178 ? 19.873  -8.727  16.083  1.00 116.46 ? 178 THR L N   1 
ATOM   3852 C  CA  . THR C 3 178 ? 20.094  -8.099  17.369  1.00 121.07 ? 178 THR L CA  1 
ATOM   3853 C  C   . THR C 3 178 ? 18.733  -8.011  18.090  1.00 124.62 ? 178 THR L C   1 
ATOM   3854 O  O   . THR C 3 178 ? 17.821  -7.350  17.610  1.00 126.36 ? 178 THR L O   1 
ATOM   3855 C  CB  . THR C 3 178 ? 20.771  -6.687  17.234  1.00 121.61 ? 178 THR L CB  1 
ATOM   3856 O  OG1 . THR C 3 178 ? 21.979  -6.766  16.463  1.00 120.76 ? 178 THR L OG1 1 
ATOM   3857 C  CG2 . THR C 3 178 ? 21.062  -6.072  18.620  1.00 123.31 ? 178 THR L CG2 1 
ATOM   3858 N  N   . LEU C 3 179 ? 18.648  -8.655  19.266  1.00 131.65 ? 179 LEU L N   1 
ATOM   3859 C  CA  . LEU C 3 179 ? 17.443  -8.538  20.098  1.00 131.95 ? 179 LEU L CA  1 
ATOM   3860 C  C   . LEU C 3 179 ? 17.770  -7.541  21.213  1.00 133.53 ? 179 LEU L C   1 
ATOM   3861 O  O   . LEU C 3 179 ? 18.703  -7.722  22.005  1.00 129.31 ? 179 LEU L O   1 
ATOM   3862 C  CB  . LEU C 3 179 ? 16.860  -9.867  20.599  1.00 129.58 ? 179 LEU L CB  1 
ATOM   3863 C  CG  . LEU C 3 179 ? 16.908  -11.040 21.536  1.00 132.92 ? 179 LEU L CG  1 
ATOM   3864 C  CD1 . LEU C 3 179 ? 16.244  -10.525 22.802  1.00 130.81 ? 179 LEU L CD1 1 
ATOM   3865 C  CD2 . LEU C 3 179 ? 15.950  -11.973 20.829  1.00 137.11 ? 179 LEU L CD2 1 
ATOM   3866 N  N   . THR C 3 180 ? 17.030  -6.450  21.185  1.00 131.14 ? 180 THR L N   1 
ATOM   3867 C  CA  . THR C 3 180 ? 17.162  -5.342  22.085  1.00 131.08 ? 180 THR L CA  1 
ATOM   3868 C  C   . THR C 3 180 ? 16.112  -5.145  23.145  1.00 131.44 ? 180 THR L C   1 
ATOM   3869 O  O   . THR C 3 180 ? 14.924  -5.270  22.869  1.00 134.53 ? 180 THR L O   1 
ATOM   3870 C  CB  . THR C 3 180 ? 17.147  -4.095  21.223  1.00 131.51 ? 180 THR L CB  1 
ATOM   3871 O  OG1 . THR C 3 180 ? 15.990  -4.180  20.348  1.00 133.64 ? 180 THR L OG1 1 
ATOM   3872 C  CG2 . THR C 3 180 ? 18.409  -4.074  20.362  1.00 121.85 ? 180 THR L CG2 1 
ATOM   3873 N  N   . LEU C 3 181 ? 16.563  -4.970  24.374  1.00 133.04 ? 181 LEU L N   1 
ATOM   3874 C  CA  . LEU C 3 181 ? 15.647  -4.758  25.446  1.00 134.93 ? 181 LEU L CA  1 
ATOM   3875 C  C   . LEU C 3 181 ? 16.246  -3.522  26.100  1.00 135.98 ? 181 LEU L C   1 
ATOM   3876 O  O   . LEU C 3 181 ? 17.430  -3.259  25.895  1.00 134.20 ? 181 LEU L O   1 
ATOM   3877 C  CB  . LEU C 3 181 ? 15.635  -5.957  26.393  1.00 134.82 ? 181 LEU L CB  1 
ATOM   3878 C  CG  . LEU C 3 181 ? 15.466  -7.337  25.758  1.00 132.99 ? 181 LEU L CG  1 
ATOM   3879 C  CD1 . LEU C 3 181 ? 15.764  -8.440  26.768  1.00 136.06 ? 181 LEU L CD1 1 
ATOM   3880 C  CD2 . LEU C 3 181 ? 14.053  -7.475  25.207  1.00 130.14 ? 181 LEU L CD2 1 
ATOM   3881 N  N   . THR C 3 182 ? 15.465  -2.799  26.913  1.00 135.39 ? 182 THR L N   1 
ATOM   3882 C  CA  . THR C 3 182 ? 16.018  -1.751  27.792  1.00 133.69 ? 182 THR L CA  1 
ATOM   3883 C  C   . THR C 3 182 ? 16.726  -2.575  28.874  1.00 136.84 ? 182 THR L C   1 
ATOM   3884 O  O   . THR C 3 182 ? 16.349  -3.714  29.039  1.00 138.22 ? 182 THR L O   1 
ATOM   3885 C  CB  . THR C 3 182 ? 14.943  -0.800  28.336  1.00 131.39 ? 182 THR L CB  1 
ATOM   3886 O  OG1 . THR C 3 182 ? 15.524  0.075   29.303  1.00 129.66 ? 182 THR L OG1 1 
ATOM   3887 C  CG2 . THR C 3 182 ? 13.782  -1.573  28.964  1.00 132.04 ? 182 THR L CG2 1 
ATOM   3888 N  N   . LYS C 3 183 ? 17.799  -2.142  29.522  1.00 137.04 ? 183 LYS L N   1 
ATOM   3889 C  CA  . LYS C 3 183 ? 18.306  -3.032  30.580  1.00 136.97 ? 183 LYS L CA  1 
ATOM   3890 C  C   . LYS C 3 183 ? 17.478  -3.486  31.735  1.00 139.73 ? 183 LYS L C   1 
ATOM   3891 O  O   . LYS C 3 183 ? 17.916  -4.423  32.272  1.00 141.83 ? 183 LYS L O   1 
ATOM   3892 C  CB  . LYS C 3 183 ? 19.554  -2.370  31.166  1.00 20.00  ? 183 LYS L CB  1 
ATOM   3893 C  CG  . LYS C 3 183 ? 20.253  -3.197  32.234  1.00 20.00  ? 183 LYS L CG  1 
ATOM   3894 C  CD  . LYS C 3 183 ? 21.508  -2.504  32.737  1.00 20.00  ? 183 LYS L CD  1 
ATOM   3895 C  CE  . LYS C 3 183 ? 22.193  -3.319  33.821  1.00 20.00  ? 183 LYS L CE  1 
ATOM   3896 N  NZ  . LYS C 3 183 ? 23.425  -2.651  34.323  1.00 20.00  ? 183 LYS L NZ  1 
ATOM   3897 N  N   . ASP C 3 184 ? 16.498  -2.808  32.323  1.00 138.55 ? 184 ASP L N   1 
ATOM   3898 C  CA  . ASP C 3 184 ? 15.898  -3.598  33.420  1.00 139.88 ? 184 ASP L CA  1 
ATOM   3899 C  C   . ASP C 3 184 ? 15.268  -4.803  32.757  1.00 139.36 ? 184 ASP L C   1 
ATOM   3900 O  O   . ASP C 3 184 ? 15.103  -5.854  33.397  1.00 141.36 ? 184 ASP L O   1 
ATOM   3901 C  CB  . ASP C 3 184 ? 14.980  -2.866  34.402  1.00 135.77 ? 184 ASP L CB  1 
ATOM   3902 C  CG  . ASP C 3 184 ? 14.273  -1.644  33.866  1.00 134.26 ? 184 ASP L CG  1 
ATOM   3903 O  OD1 . ASP C 3 184 ? 13.465  -1.707  32.919  1.00 139.87 ? 184 ASP L OD1 1 
ATOM   3904 O  OD2 . ASP C 3 184 ? 14.466  -0.603  34.538  1.00 122.36 ? 184 ASP L OD2 1 
ATOM   3905 N  N   . GLU C 3 185 ? 14.856  -4.647  31.506  1.00 138.32 ? 185 GLU L N   1 
ATOM   3906 C  CA  . GLU C 3 185 ? 14.290  -5.769  30.784  1.00 138.54 ? 185 GLU L CA  1 
ATOM   3907 C  C   . GLU C 3 185 ? 15.410  -6.815  30.837  1.00 140.88 ? 185 GLU L C   1 
ATOM   3908 O  O   . GLU C 3 185 ? 15.179  -8.014  31.032  1.00 140.11 ? 185 GLU L O   1 
ATOM   3909 C  CB  . GLU C 3 185 ? 13.968  -5.405  29.339  1.00 134.79 ? 185 GLU L CB  1 
ATOM   3910 C  CG  . GLU C 3 185 ? 12.523  -5.467  28.945  1.00 135.61 ? 185 GLU L CG  1 
ATOM   3911 C  CD  . GLU C 3 185 ? 11.819  -6.696  29.470  1.00 136.85 ? 185 GLU L CD  1 
ATOM   3912 O  OE1 . GLU C 3 185 ? 12.433  -7.781  29.549  1.00 136.59 ? 185 GLU L OE1 1 
ATOM   3913 O  OE2 . GLU C 3 185 ? 10.633  -6.582  29.813  1.00 142.72 ? 185 GLU L OE2 1 
ATOM   3914 N  N   . TYR C 3 186 ? 16.624  -6.309  30.584  1.00 140.96 ? 186 TYR L N   1 
ATOM   3915 C  CA  . TYR C 3 186 ? 17.867  -7.038  30.578  1.00 141.77 ? 186 TYR L CA  1 
ATOM   3916 C  C   . TYR C 3 186 ? 18.098  -7.619  31.989  1.00 141.40 ? 186 TYR L C   1 
ATOM   3917 O  O   . TYR C 3 186 ? 18.623  -8.741  32.130  1.00 143.45 ? 186 TYR L O   1 
ATOM   3918 C  CB  . TYR C 3 186 ? 19.036  -6.122  30.091  1.00 141.66 ? 186 TYR L CB  1 
ATOM   3919 C  CG  . TYR C 3 186 ? 20.433  -6.667  30.199  1.00 139.16 ? 186 TYR L CG  1 
ATOM   3920 C  CD1 . TYR C 3 186 ? 20.875  -7.645  29.320  1.00 139.35 ? 186 TYR L CD1 1 
ATOM   3921 C  CD2 . TYR C 3 186 ? 21.323  -6.169  31.127  1.00 139.63 ? 186 TYR L CD2 1 
ATOM   3922 C  CE1 . TYR C 3 186 ? 22.150  -8.140  29.388  1.00 141.99 ? 186 TYR L CE1 1 
ATOM   3923 C  CE2 . TYR C 3 186 ? 22.610  -6.658  31.204  1.00 141.25 ? 186 TYR L CE2 1 
ATOM   3924 C  CZ  . TYR C 3 186 ? 23.017  -7.646  30.332  1.00 142.25 ? 186 TYR L CZ  1 
ATOM   3925 O  OH  . TYR C 3 186 ? 24.302  -8.141  30.400  1.00 144.33 ? 186 TYR L OH  1 
ATOM   3926 N  N   . GLU C 3 187 ? 17.753  -6.827  33.017  1.00 140.27 ? 187 GLU L N   1 
ATOM   3927 C  CA  . GLU C 3 187 ? 17.965  -7.124  34.429  1.00 140.02 ? 187 GLU L CA  1 
ATOM   3928 C  C   . GLU C 3 187 ? 17.017  -8.191  35.023  1.00 140.81 ? 187 GLU L C   1 
ATOM   3929 O  O   . GLU C 3 187 ? 17.371  -8.739  36.089  1.00 136.48 ? 187 GLU L O   1 
ATOM   3930 C  CB  . GLU C 3 187 ? 17.803  -5.821  35.308  1.00 137.33 ? 187 GLU L CB  1 
ATOM   3931 C  CG  . GLU C 3 187 ? 18.777  -4.619  35.097  1.00 141.79 ? 187 GLU L CG  1 
ATOM   3932 C  CD  . GLU C 3 187 ? 18.380  -3.378  35.974  1.00 144.04 ? 187 GLU L CD  1 
ATOM   3933 O  OE1 . GLU C 3 187 ? 18.163  -3.426  37.236  1.00 139.50 ? 187 GLU L OE1 1 
ATOM   3934 O  OE2 . GLU C 3 187 ? 18.141  -2.351  35.346  1.00 143.95 ? 187 GLU L OE2 1 
ATOM   3935 N  N   . ARG C 3 188 ? 15.856  -8.517  34.409  1.00 142.67 ? 188 ARG L N   1 
ATOM   3936 C  CA  . ARG C 3 188 ? 15.051  -9.586  35.015  1.00 142.48 ? 188 ARG L CA  1 
ATOM   3937 C  C   . ARG C 3 188 ? 15.612  -10.960 34.771  1.00 141.40 ? 188 ARG L C   1 
ATOM   3938 O  O   . ARG C 3 188 ? 15.092  -11.946 35.278  1.00 140.24 ? 188 ARG L O   1 
ATOM   3939 C  CB  . ARG C 3 188 ? 13.651  -9.616  34.477  1.00 138.19 ? 188 ARG L CB  1 
ATOM   3940 C  CG  . ARG C 3 188 ? 12.736  -8.584  34.939  1.00 136.66 ? 188 ARG L CG  1 
ATOM   3941 C  CD  . ARG C 3 188 ? 11.488  -9.394  35.272  1.00 138.20 ? 188 ARG L CD  1 
ATOM   3942 N  NE  . ARG C 3 188 ? 10.965  -10.023 34.048  1.00 142.12 ? 188 ARG L NE  1 
ATOM   3943 C  CZ  . ARG C 3 188 ? 11.004  -11.327 33.762  1.00 142.55 ? 188 ARG L CZ  1 
ATOM   3944 N  NH1 . ARG C 3 188 ? 11.584  -12.187 34.596  1.00 147.04 ? 188 ARG L NH1 1 
ATOM   3945 N  NH2 . ARG C 3 188 ? 10.492  -11.760 32.612  1.00 128.96 ? 188 ARG L NH2 1 
ATOM   3946 N  N   . HIS C 3 189 ? 16.654  -11.048 33.981  1.00 142.48 ? 189 HIS L N   1 
ATOM   3947 C  CA  . HIS C 3 189 ? 17.158  -12.349 33.782  1.00 142.15 ? 189 HIS L CA  1 
ATOM   3948 C  C   . HIS C 3 189 ? 18.627  -12.031 33.750  1.00 143.78 ? 189 HIS L C   1 
ATOM   3949 O  O   . HIS C 3 189 ? 19.021  -10.860 33.623  1.00 145.67 ? 189 HIS L O   1 
ATOM   3950 C  CB  . HIS C 3 189 ? 16.574  -13.066 32.556  1.00 137.99 ? 189 HIS L CB  1 
ATOM   3951 C  CG  . HIS C 3 189 ? 16.972  -14.506 32.475  1.00 137.27 ? 189 HIS L CG  1 
ATOM   3952 N  ND1 . HIS C 3 189 ? 16.208  -15.535 32.983  1.00 135.26 ? 189 HIS L ND1 1 
ATOM   3953 C  CD2 . HIS C 3 189 ? 18.054  -15.085 31.915  1.00 137.83 ? 189 HIS L CD2 1 
ATOM   3954 C  CE1 . HIS C 3 189 ? 16.823  -16.682 32.762  1.00 132.99 ? 189 HIS L CE1 1 
ATOM   3955 N  NE2 . HIS C 3 189 ? 17.947  -16.435 32.120  1.00 132.65 ? 189 HIS L NE2 1 
ATOM   3956 N  N   . ASN C 3 190 ? 19.437  -13.076 33.789  1.00 142.01 ? 190 ASN L N   1 
ATOM   3957 C  CA  . ASN C 3 190 ? 20.877  -12.995 33.936  1.00 143.35 ? 190 ASN L CA  1 
ATOM   3958 C  C   . ASN C 3 190 ? 21.391  -13.696 32.595  1.00 144.94 ? 190 ASN L C   1 
ATOM   3959 O  O   . ASN C 3 190 ? 22.339  -13.195 32.009  1.00 147.42 ? 190 ASN L O   1 
ATOM   3960 C  CB  . ASN C 3 190 ? 21.368  -13.329 35.421  1.00 149.08 ? 190 ASN L CB  1 
ATOM   3961 C  CG  . ASN C 3 190 ? 22.198  -14.569 35.635  1.00 147.73 ? 190 ASN L CG  1 
ATOM   3962 O  OD1 . ASN C 3 190 ? 22.240  -15.534 34.868  1.00 142.58 ? 190 ASN L OD1 1 
ATOM   3963 N  ND2 . ASN C 3 190 ? 22.890  -14.528 36.788  1.00 146.05 ? 190 ASN L ND2 1 
ATOM   3964 N  N   . THR C 3 191 ? 20.826  -14.797 32.079  1.00 142.22 ? 191 THR L N   1 
ATOM   3965 C  CA  . THR C 3 191 ? 21.481  -15.504 30.935  1.00 144.83 ? 191 THR L CA  1 
ATOM   3966 C  C   . THR C 3 191 ? 20.861  -15.351 29.566  1.00 147.09 ? 191 THR L C   1 
ATOM   3967 O  O   . THR C 3 191 ? 19.635  -15.451 29.322  1.00 143.41 ? 191 THR L O   1 
ATOM   3968 C  CB  . THR C 3 191 ? 21.638  -17.012 31.076  1.00 144.48 ? 191 THR L CB  1 
ATOM   3969 O  OG1 . THR C 3 191 ? 22.470  -17.390 29.981  1.00 147.99 ? 191 THR L OG1 1 
ATOM   3970 C  CG2 . THR C 3 191 ? 20.399  -17.772 30.858  1.00 144.14 ? 191 THR L CG2 1 
ATOM   3971 N  N   . TYR C 3 192 ? 21.767  -15.049 28.648  1.00 149.80 ? 192 TYR L N   1 
ATOM   3972 C  CA  . TYR C 3 192 ? 21.428  -14.800 27.269  1.00 147.55 ? 192 TYR L CA  1 
ATOM   3973 C  C   . TYR C 3 192 ? 22.133  -15.735 26.327  1.00 146.21 ? 192 TYR L C   1 
ATOM   3974 O  O   . TYR C 3 192 ? 23.348  -15.925 26.304  1.00 143.10 ? 192 TYR L O   1 
ATOM   3975 C  CB  . TYR C 3 192 ? 21.749  -13.361 26.930  1.00 145.02 ? 192 TYR L CB  1 
ATOM   3976 C  CG  . TYR C 3 192 ? 20.830  -12.408 27.620  1.00 145.04 ? 192 TYR L CG  1 
ATOM   3977 C  CD1 . TYR C 3 192 ? 19.566  -12.167 27.120  1.00 150.47 ? 192 TYR L CD1 1 
ATOM   3978 C  CD2 . TYR C 3 192 ? 21.213  -11.751 28.771  1.00 141.67 ? 192 TYR L CD2 1 
ATOM   3979 C  CE1 . TYR C 3 192 ? 18.707  -11.298 27.745  1.00 147.09 ? 192 TYR L CE1 1 
ATOM   3980 C  CE2 . TYR C 3 192 ? 20.353  -10.877 29.397  1.00 138.28 ? 192 TYR L CE2 1 
ATOM   3981 C  CZ  . TYR C 3 192 ? 19.110  -10.653 28.880  1.00 142.64 ? 192 TYR L CZ  1 
ATOM   3982 O  OH  . TYR C 3 192 ? 18.258  -9.787  29.503  1.00 138.18 ? 192 TYR L OH  1 
ATOM   3983 N  N   . THR C 3 193 ? 21.221  -16.246 25.528  1.00 150.54 ? 193 THR L N   1 
ATOM   3984 C  CA  . THR C 3 193 ? 21.277  -17.326 24.560  1.00 149.36 ? 193 THR L CA  1 
ATOM   3985 C  C   . THR C 3 193 ? 21.318  -17.014 23.059  1.00 151.99 ? 193 THR L C   1 
ATOM   3986 O  O   . THR C 3 193 ? 20.440  -16.243 22.638  1.00 152.01 ? 193 THR L O   1 
ATOM   3987 C  CB  . THR C 3 193 ? 19.971  -18.163 24.735  1.00 145.82 ? 193 THR L CB  1 
ATOM   3988 O  OG1 . THR C 3 193 ? 18.885  -17.272 24.901  1.00 141.59 ? 193 THR L OG1 1 
ATOM   3989 C  CG2 . THR C 3 193 ? 19.995  -19.039 25.957  1.00 143.32 ? 193 THR L CG2 1 
ATOM   3990 N  N   . CYS C 3 194 ? 22.163  -17.645 22.244  1.00 149.89 ? 194 CYS L N   1 
ATOM   3991 C  CA  . CYS C 3 194 ? 22.084  -17.441 20.794  1.00 147.10 ? 194 CYS L CA  1 
ATOM   3992 C  C   . CYS C 3 194 ? 21.413  -18.716 20.237  1.00 150.09 ? 194 CYS L C   1 
ATOM   3993 O  O   . CYS C 3 194 ? 21.636  -19.812 20.762  1.00 151.73 ? 194 CYS L O   1 
ATOM   3994 C  CB  . CYS C 3 194 ? 23.455  -17.205 20.154  1.00 142.40 ? 194 CYS L CB  1 
ATOM   3995 S  SG  . CYS C 3 194 ? 23.413  -16.263 18.604  1.00 146.08 ? 194 CYS L SG  1 
ATOM   3996 N  N   . GLU C 3 195 ? 20.585  -18.594 19.199  1.00 147.67 ? 195 GLU L N   1 
ATOM   3997 C  CA  . GLU C 3 195 ? 19.922  -19.772 18.637  1.00 145.26 ? 195 GLU L CA  1 
ATOM   3998 C  C   . GLU C 3 195 ? 19.767  -19.683 17.130  1.00 145.64 ? 195 GLU L C   1 
ATOM   3999 O  O   . GLU C 3 195 ? 20.054  -18.644 16.562  1.00 146.50 ? 195 GLU L O   1 
ATOM   4000 C  CB  . GLU C 3 195 ? 18.582  -20.008 19.307  1.00 145.32 ? 195 GLU L CB  1 
ATOM   4001 C  CG  . GLU C 3 195 ? 17.886  -21.256 18.813  1.00 148.66 ? 195 GLU L CG  1 
ATOM   4002 C  CD  . GLU C 3 195 ? 16.574  -21.504 19.524  1.00 151.99 ? 195 GLU L CD  1 
ATOM   4003 O  OE1 . GLU C 3 195 ? 16.193  -20.680 20.374  1.00 154.58 ? 195 GLU L OE1 1 
ATOM   4004 O  OE2 . GLU C 3 195 ? 15.919  -22.518 19.222  1.00 148.56 ? 195 GLU L OE2 1 
ATOM   4005 N  N   . ALA C 3 196 ? 19.324  -20.775 16.493  1.00 148.01 ? 196 ALA L N   1 
ATOM   4006 C  CA  . ALA C 3 196 ? 19.168  -20.850 15.021  1.00 148.53 ? 196 ALA L CA  1 
ATOM   4007 C  C   . ALA C 3 196 ? 18.120  -21.844 14.428  1.00 143.72 ? 196 ALA L C   1 
ATOM   4008 O  O   . ALA C 3 196 ? 17.074  -22.089 15.019  1.00 144.13 ? 196 ALA L O   1 
ATOM   4009 C  CB  . ALA C 3 196 ? 20.526  -21.163 14.411  1.00 20.00  ? 196 ALA L CB  1 
ATOM   4010 N  N   . THR C 3 197 ? 18.428  -22.388 13.248  1.00 137.18 ? 197 THR L N   1 
ATOM   4011 C  CA  . THR C 3 197 ? 17.602  -23.364 12.534  1.00 135.47 ? 197 THR L CA  1 
ATOM   4012 C  C   . THR C 3 197 ? 18.412  -23.966 11.404  1.00 137.63 ? 197 THR L C   1 
ATOM   4013 O  O   . THR C 3 197 ? 18.800  -25.130 11.451  1.00 138.81 ? 197 THR L O   1 
ATOM   4014 C  CB  . THR C 3 197 ? 16.333  -22.754 11.930  1.00 134.71 ? 197 THR L CB  1 
ATOM   4015 O  OG1 . THR C 3 197 ? 15.450  -22.382 12.986  1.00 135.32 ? 197 THR L OG1 1 
ATOM   4016 C  CG2 . THR C 3 197 ? 15.611  -23.748 11.012  1.00 128.61 ? 197 THR L CG2 1 
ATOM   4017 N  N   . HIS C 3 198 ? 18.651  -23.162 10.375  1.00 139.61 ? 198 HIS L N   1 
ATOM   4018 C  CA  . HIS C 3 198 ? 19.439  -23.628 9.182   1.00 137.41 ? 198 HIS L CA  1 
ATOM   4019 C  C   . HIS C 3 198 ? 19.242  -25.067 8.611   1.00 135.83 ? 198 HIS L C   1 
ATOM   4020 O  O   . HIS C 3 198 ? 18.621  -25.925 9.241   1.00 135.95 ? 198 HIS L O   1 
ATOM   4021 C  CB  . HIS C 3 198 ? 20.945  -23.539 9.529   1.00 127.15 ? 198 HIS L CB  1 
ATOM   4022 C  CG  . HIS C 3 198 ? 21.339  -24.455 10.657  1.00 136.92 ? 198 HIS L CG  1 
ATOM   4023 N  ND1 . HIS C 3 198 ? 21.264  -24.087 11.986  1.00 144.58 ? 198 HIS L ND1 1 
ATOM   4024 C  CD2 . HIS C 3 198 ? 21.734  -25.752 10.657  1.00 135.25 ? 198 HIS L CD2 1 
ATOM   4025 C  CE1 . HIS C 3 198 ? 21.620  -25.108 12.749  1.00 140.02 ? 198 HIS L CE1 1 
ATOM   4026 N  NE2 . HIS C 3 198 ? 21.919  -26.128 11.968  1.00 136.64 ? 198 HIS L NE2 1 
ATOM   4027 N  N   . LYS C 3 199 ? 19.710  -25.284 7.377   1.00 128.21 ? 199 LYS L N   1 
ATOM   4028 C  CA  . LYS C 3 199 ? 19.621  -26.588 6.631   1.00 127.36 ? 199 LYS L CA  1 
ATOM   4029 C  C   . LYS C 3 199 ? 20.486  -27.723 7.039   1.00 130.82 ? 199 LYS L C   1 
ATOM   4030 O  O   . LYS C 3 199 ? 20.135  -28.880 6.861   1.00 129.73 ? 199 LYS L O   1 
ATOM   4031 C  CB  . LYS C 3 199 ? 19.882  -26.310 5.150   1.00 20.00  ? 199 LYS L CB  1 
ATOM   4032 C  CG  . LYS C 3 199 ? 18.849  -25.406 4.495   1.00 20.00  ? 199 LYS L CG  1 
ATOM   4033 C  CD  . LYS C 3 199 ? 19.181  -25.153 3.035   1.00 20.00  ? 199 LYS L CD  1 
ATOM   4034 C  CE  . LYS C 3 199 ? 18.136  -24.269 2.375   1.00 20.00  ? 199 LYS L CE  1 
ATOM   4035 N  NZ  . LYS C 3 199 ? 18.462  -23.992 0.949   1.00 20.00  ? 199 LYS L NZ  1 
ATOM   4036 N  N   . THR C 3 200 ? 21.687  -27.365 7.494   1.00 131.43 ? 200 THR L N   1 
ATOM   4037 C  CA  . THR C 3 200 ? 22.696  -28.375 7.790   1.00 130.75 ? 200 THR L CA  1 
ATOM   4038 C  C   . THR C 3 200 ? 22.204  -29.399 8.817   1.00 133.55 ? 200 THR L C   1 
ATOM   4039 O  O   . THR C 3 200 ? 22.792  -30.476 8.963   1.00 137.01 ? 200 THR L O   1 
ATOM   4040 C  CB  . THR C 3 200 ? 24.079  -27.732 8.216   1.00 128.69 ? 200 THR L CB  1 
ATOM   4041 O  OG1 . THR C 3 200 ? 23.835  -26.565 9.006   1.00 135.43 ? 200 THR L OG1 1 
ATOM   4042 C  CG2 . THR C 3 200 ? 24.875  -27.246 7.065   1.00 113.69 ? 200 THR L CG2 1 
ATOM   4043 N  N   . SER C 3 201 ? 21.147  -29.052 9.542   1.00 130.40 ? 201 SER L N   1 
ATOM   4044 C  CA  . SER C 3 201 ? 20.598  -29.956 10.545  1.00 128.35 ? 201 SER L CA  1 
ATOM   4045 C  C   . SER C 3 201 ? 19.166  -29.596 10.950  1.00 130.05 ? 201 SER L C   1 
ATOM   4046 O  O   . SER C 3 201 ? 18.831  -28.411 11.055  1.00 132.05 ? 201 SER L O   1 
ATOM   4047 C  CB  . SER C 3 201 ? 21.504  -29.996 11.766  1.00 128.05 ? 201 SER L CB  1 
ATOM   4048 O  OG  . SER C 3 201 ? 21.015  -30.961 12.674  1.00 123.17 ? 201 SER L OG  1 
ATOM   4049 N  N   . THR C 3 202 ? 18.316  -30.602 11.158  1.00 128.06 ? 202 THR L N   1 
ATOM   4050 C  CA  . THR C 3 202 ? 16.952  -30.376 11.657  1.00 128.18 ? 202 THR L CA  1 
ATOM   4051 C  C   . THR C 3 202 ? 17.120  -29.958 13.134  1.00 124.53 ? 202 THR L C   1 
ATOM   4052 O  O   . THR C 3 202 ? 16.197  -29.445 13.784  1.00 116.98 ? 202 THR L O   1 
ATOM   4053 C  CB  . THR C 3 202 ? 16.038  -31.636 11.514  1.00 123.79 ? 202 THR L CB  1 
ATOM   4054 O  OG1 . THR C 3 202 ? 15.891  -31.990 10.133  1.00 116.31 ? 202 THR L OG1 1 
ATOM   4055 C  CG2 . THR C 3 202 ? 14.642  -31.390 12.118  1.00 116.69 ? 202 THR L CG2 1 
ATOM   4056 N  N   . SER C 3 203 ? 18.344  -30.146 13.625  1.00 128.15 ? 203 SER L N   1 
ATOM   4057 C  CA  . SER C 3 203 ? 18.744  -29.775 14.980  1.00 129.10 ? 203 SER L CA  1 
ATOM   4058 C  C   . SER C 3 203 ? 19.331  -28.397 15.078  1.00 134.91 ? 203 SER L C   1 
ATOM   4059 O  O   . SER C 3 203 ? 20.363  -28.084 14.491  1.00 136.54 ? 203 SER L O   1 
ATOM   4060 C  CB  . SER C 3 203 ? 19.776  -30.743 15.550  1.00 122.69 ? 203 SER L CB  1 
ATOM   4061 O  OG  . SER C 3 203 ? 20.515  -30.184 16.620  1.00 122.40 ? 203 SER L OG  1 
ATOM   4062 N  N   . PRO C 3 204 ? 18.619  -27.540 15.776  1.00 137.20 ? 204 PRO L N   1 
ATOM   4063 C  CA  . PRO C 3 204 ? 19.121  -26.206 16.078  1.00 136.04 ? 204 PRO L CA  1 
ATOM   4064 C  C   . PRO C 3 204 ? 20.493  -26.003 16.817  1.00 136.33 ? 204 PRO L C   1 
ATOM   4065 O  O   . PRO C 3 204 ? 20.876  -26.691 17.750  1.00 133.60 ? 204 PRO L O   1 
ATOM   4066 C  CB  . PRO C 3 204 ? 18.014  -25.635 16.963  1.00 135.74 ? 204 PRO L CB  1 
ATOM   4067 C  CG  . PRO C 3 204 ? 16.774  -26.280 16.501  1.00 131.71 ? 204 PRO L CG  1 
ATOM   4068 C  CD  . PRO C 3 204 ? 17.198  -27.679 16.148  1.00 134.87 ? 204 PRO L CD  1 
ATOM   4069 N  N   . ILE C 3 205 ? 21.162  -24.986 16.298  1.00 141.60 ? 205 ILE L N   1 
ATOM   4070 C  CA  . ILE C 3 205 ? 22.362  -24.224 16.649  1.00 145.55 ? 205 ILE L CA  1 
ATOM   4071 C  C   . ILE C 3 205 ? 22.443  -23.813 18.116  1.00 145.96 ? 205 ILE L C   1 
ATOM   4072 O  O   . ILE C 3 205 ? 21.439  -23.441 18.572  1.00 145.85 ? 205 ILE L O   1 
ATOM   4073 C  CB  . ILE C 3 205 ? 22.182  -22.913 15.926  1.00 148.25 ? 205 ILE L CB  1 
ATOM   4074 C  CG1 . ILE C 3 205 ? 22.020  -23.350 14.451  1.00 146.06 ? 205 ILE L CG1 1 
ATOM   4075 C  CG2 . ILE C 3 205 ? 23.468  -21.970 16.058  1.00 141.80 ? 205 ILE L CG2 1 
ATOM   4076 C  CD1 . ILE C 3 205 ? 23.247  -23.612 13.530  1.00 145.12 ? 205 ILE L CD1 1 
ATOM   4077 N  N   . VAL C 3 206 ? 23.413  -24.038 18.978  1.00 144.22 ? 206 VAL L N   1 
ATOM   4078 C  CA  . VAL C 3 206 ? 23.492  -23.067 20.139  1.00 147.56 ? 206 VAL L CA  1 
ATOM   4079 C  C   . VAL C 3 206 ? 24.851  -22.686 20.762  1.00 152.34 ? 206 VAL L C   1 
ATOM   4080 O  O   . VAL C 3 206 ? 25.696  -23.550 21.108  1.00 151.05 ? 206 VAL L O   1 
ATOM   4081 C  CB  . VAL C 3 206 ? 22.560  -23.435 21.385  1.00 149.57 ? 206 VAL L CB  1 
ATOM   4082 C  CG1 . VAL C 3 206 ? 23.167  -22.905 22.703  1.00 150.20 ? 206 VAL L CG1 1 
ATOM   4083 C  CG2 . VAL C 3 206 ? 21.053  -23.006 21.239  1.00 149.34 ? 206 VAL L CG2 1 
ATOM   4084 N  N   . LYS C 3 207 ? 25.094  -21.384 20.888  1.00 151.05 ? 207 LYS L N   1 
ATOM   4085 C  CA  . LYS C 3 207 ? 26.250  -20.984 21.690  1.00 149.44 ? 207 LYS L CA  1 
ATOM   4086 C  C   . LYS C 3 207 ? 25.498  -20.173 22.716  1.00 150.35 ? 207 LYS L C   1 
ATOM   4087 O  O   . LYS C 3 207 ? 24.677  -19.321 22.344  1.00 147.95 ? 207 LYS L O   1 
ATOM   4088 C  CB  . LYS C 3 207 ? 27.254  -20.257 20.858  1.00 141.08 ? 207 LYS L CB  1 
ATOM   4089 C  CG  . LYS C 3 207 ? 27.503  -21.290 19.678  1.00 137.03 ? 207 LYS L CG  1 
ATOM   4090 C  CD  . LYS C 3 207 ? 28.823  -21.066 19.022  1.00 127.84 ? 207 LYS L CD  1 
ATOM   4091 C  CE  . LYS C 3 207 ? 28.986  -19.684 18.660  1.00 130.76 ? 207 LYS L CE  1 
ATOM   4092 N  NZ  . LYS C 3 207 ? 30.255  -19.599 17.844  1.00 130.64 ? 207 LYS L NZ  1 
ATOM   4093 N  N   . SER C 3 208 ? 25.904  -20.308 23.981  1.00 149.67 ? 208 SER L N   1 
ATOM   4094 C  CA  . SER C 3 208 ? 25.175  -19.678 25.095  1.00 150.95 ? 208 SER L CA  1 
ATOM   4095 C  C   . SER C 3 208 ? 25.732  -19.383 26.527  1.00 154.19 ? 208 SER L C   1 
ATOM   4096 O  O   . SER C 3 208 ? 26.848  -19.742 26.932  1.00 155.02 ? 208 SER L O   1 
ATOM   4097 C  CB  . SER C 3 208 ? 23.872  -20.446 25.316  1.00 148.33 ? 208 SER L CB  1 
ATOM   4098 O  OG  . SER C 3 208 ? 22.904  -19.584 25.884  1.00 147.85 ? 208 SER L OG  1 
ATOM   4099 N  N   . PHE C 3 209 ? 24.832  -18.685 27.222  1.00 152.95 ? 209 PHE L N   1 
ATOM   4100 C  CA  . PHE C 3 209 ? 24.709  -18.188 28.606  1.00 151.67 ? 209 PHE L CA  1 
ATOM   4101 C  C   . PHE C 3 209 ? 25.505  -16.889 28.823  1.00 150.32 ? 209 PHE L C   1 
ATOM   4102 O  O   . PHE C 3 209 ? 26.015  -16.292 27.871  1.00 148.20 ? 209 PHE L O   1 
ATOM   4103 C  CB  . PHE C 3 209 ? 25.099  -19.371 29.568  1.00 151.53 ? 209 PHE L CB  1 
ATOM   4104 C  CG  . PHE C 3 209 ? 24.758  -19.183 31.087  1.00 151.27 ? 209 PHE L CG  1 
ATOM   4105 C  CD1 . PHE C 3 209 ? 23.525  -19.551 31.615  1.00 152.27 ? 209 PHE L CD1 1 
ATOM   4106 C  CD2 . PHE C 3 209 ? 25.720  -18.820 32.000  1.00 149.21 ? 209 PHE L CD2 1 
ATOM   4107 C  CE1 . PHE C 3 209 ? 23.250  -19.411 32.989  1.00 151.92 ? 209 PHE L CE1 1 
ATOM   4108 C  CE2 . PHE C 3 209 ? 25.421  -18.693 33.363  1.00 143.30 ? 209 PHE L CE2 1 
ATOM   4109 C  CZ  . PHE C 3 209 ? 24.200  -18.989 33.840  1.00 145.80 ? 209 PHE L CZ  1 
ATOM   4110 N  N   . ASN C 3 210 ? 25.616  -16.487 30.077  1.00 152.20 ? 210 ASN L N   1 
ATOM   4111 C  CA  . ASN C 3 210 ? 26.323  -15.270 30.527  1.00 152.35 ? 210 ASN L CA  1 
ATOM   4112 C  C   . ASN C 3 210 ? 27.616  -15.039 31.349  1.00 148.99 ? 210 ASN L C   1 
ATOM   4113 O  O   . ASN C 3 210 ? 28.549  -15.858 31.468  1.00 145.80 ? 210 ASN L O   1 
ATOM   4114 C  CB  . ASN C 3 210 ? 25.285  -14.408 31.250  1.00 148.94 ? 210 ASN L CB  1 
ATOM   4115 C  CG  . ASN C 3 210 ? 24.580  -15.139 32.346  1.00 148.02 ? 210 ASN L CG  1 
ATOM   4116 O  OD1 . ASN C 3 210 ? 24.299  -16.321 32.238  1.00 148.72 ? 210 ASN L OD1 1 
ATOM   4117 N  ND2 . ASN C 3 210 ? 24.417  -14.476 33.458  1.00 147.12 ? 210 ASN L ND2 1 
ATOM   4118 N  N   . ARG C 3 211 ? 27.532  -13.815 31.907  1.00 148.65 ? 211 ARG L N   1 
ATOM   4119 C  CA  . ARG C 3 211 ? 28.464  -13.041 32.756  1.00 146.23 ? 211 ARG L CA  1 
ATOM   4120 C  C   . ARG C 3 211 ? 28.772  -13.788 34.058  1.00 146.19 ? 211 ARG L C   1 
ATOM   4121 O  O   . ARG C 3 211 ? 29.897  -13.693 34.566  1.00 142.22 ? 211 ARG L O   1 
ATOM   4122 C  CB  . ARG C 3 211 ? 27.801  -11.688 33.160  1.00 143.08 ? 211 ARG L CB  1 
ATOM   4123 C  CG  . ARG C 3 211 ? 27.551  -10.717 31.997  1.00 147.56 ? 211 ARG L CG  1 
ATOM   4124 C  CD  . ARG C 3 211 ? 26.959  -9.331  32.365  1.00 147.82 ? 211 ARG L CD  1 
ATOM   4125 N  NE  . ARG C 3 211 ? 26.766  -8.552  31.140  1.00 148.17 ? 211 ARG L NE  1 
ATOM   4126 C  CZ  . ARG C 3 211 ? 27.723  -7.853  30.541  1.00 148.86 ? 211 ARG L CZ  1 
ATOM   4127 N  NH1 . ARG C 3 211 ? 28.943  -7.809  31.063  1.00 148.93 ? 211 ARG L NH1 1 
ATOM   4128 N  NH2 . ARG C 3 211 ? 27.468  -7.172  29.430  1.00 150.13 ? 211 ARG L NH2 1 
ATOM   4129 N  N   . ASN C 3 212 ? 27.784  -14.457 34.660  1.00 144.17 ? 212 ASN L N   1 
ATOM   4130 C  CA  . ASN C 3 212 ? 28.040  -15.154 35.924  1.00 139.37 ? 212 ASN L CA  1 
ATOM   4131 C  C   . ASN C 3 212 ? 29.045  -16.272 35.671  1.00 137.96 ? 212 ASN L C   1 
ATOM   4132 O  O   . ASN C 3 212 ? 29.424  -16.965 36.610  1.00 130.72 ? 212 ASN L O   1 
ATOM   4133 C  CB  . ASN C 3 212 ? 26.808  -15.782 36.566  1.00 139.79 ? 212 ASN L CB  1 
ATOM   4134 C  CG  . ASN C 3 212 ? 25.537  -15.175 36.120  1.00 144.18 ? 212 ASN L CG  1 
ATOM   4135 O  OD1 . ASN C 3 212 ? 25.369  -13.950 36.058  1.00 142.39 ? 212 ASN L OD1 1 
ATOM   4136 N  ND2 . ASN C 3 212 ? 24.610  -16.057 35.744  1.00 143.41 ? 212 ASN L ND2 1 
ATOM   4137 N  N   . GLU C 3 213 ? 29.429  -16.461 34.396  1.00 140.60 ? 213 GLU L N   1 
ATOM   4138 C  CA  . GLU C 3 213 ? 30.407  -17.462 33.946  1.00 138.99 ? 213 GLU L CA  1 
ATOM   4139 C  C   . GLU C 3 213 ? 31.343  -16.912 32.876  1.00 142.74 ? 213 GLU L C   1 
ATOM   4140 O  O   . GLU C 3 213 ? 32.276  -16.173 33.189  1.00 142.15 ? 213 GLU L O   1 
ATOM   4141 C  CB  . GLU C 3 213 ? 29.684  -18.673 33.345  1.00 134.41 ? 213 GLU L CB  1 
ATOM   4142 C  CG  . GLU C 3 213 ? 28.642  -19.382 34.234  1.00 130.51 ? 213 GLU L CG  1 
ATOM   4143 C  CD  . GLU C 3 213 ? 29.202  -20.171 35.421  1.00 120.45 ? 213 GLU L CD  1 
ATOM   4144 O  OE1 . GLU C 3 213 ? 30.256  -20.813 35.242  1.00 118.23 ? 213 GLU L OE1 1 
ATOM   4145 O  OE2 . GLU C 3 213 ? 28.560  -20.181 36.491  1.00 113.77 ? 213 GLU L OE2 1 
HETATM 4146 NA NA  . NA  D 4 .   ? 33.841  -11.085 -19.346 1.00 36.81  ? 301 NA  L NA  1 
HETATM 4147 O  O   . HOH E 5 .   ? -11.303 3.309   -38.924 1.00 62.13  ? 301 HOH A O   1 
HETATM 4148 O  O   . HOH E 5 .   ? -3.046  1.543   -23.457 1.00 45.58  ? 302 HOH A O   1 
HETATM 4149 O  O   . HOH E 5 .   ? -3.139  27.720  -38.738 1.00 57.04  ? 303 HOH A O   1 
HETATM 4150 O  O   . HOH E 5 .   ? -8.769  12.653  -21.489 1.00 68.16  ? 304 HOH A O   1 
HETATM 4151 O  O   . HOH E 5 .   ? -7.758  24.461  -37.453 1.00 67.74  ? 305 HOH A O   1 
HETATM 4152 O  O   . HOH E 5 .   ? -13.368 2.833   -34.524 1.00 77.68  ? 306 HOH A O   1 
HETATM 4153 O  O   . HOH E 5 .   ? -14.221 39.085  -30.719 1.00 69.98  ? 307 HOH A O   1 
HETATM 4154 O  O   . HOH E 5 .   ? -15.420 5.796   -36.977 1.00 65.80  ? 308 HOH A O   1 
HETATM 4155 O  O   . HOH E 5 .   ? 3.473   15.117  -29.120 1.00 56.88  ? 309 HOH A O   1 
HETATM 4156 O  O   . HOH E 5 .   ? -14.649 7.972   -37.666 1.00 56.05  ? 310 HOH A O   1 
HETATM 4157 O  O   . HOH E 5 .   ? -7.739  4.492   -23.955 1.00 53.53  ? 311 HOH A O   1 
HETATM 4158 O  O   . HOH E 5 .   ? -6.011  12.745  -23.661 1.00 56.55  ? 312 HOH A O   1 
HETATM 4159 O  O   . HOH E 5 .   ? -21.847 28.191  -36.638 1.00 84.21  ? 313 HOH A O   1 
HETATM 4160 O  O   . HOH E 5 .   ? -5.278  29.864  -39.161 1.00 85.02  ? 314 HOH A O   1 
HETATM 4161 O  O   . HOH E 5 .   ? -15.738 19.116  -35.940 1.00 71.75  ? 315 HOH A O   1 
HETATM 4162 O  O   . HOH E 5 .   ? -20.144 23.530  -39.887 1.00 85.03  ? 316 HOH A O   1 
HETATM 4163 O  O   . HOH E 5 .   ? -1.971  17.686  -22.028 1.00 54.22  ? 317 HOH A O   1 
HETATM 4164 O  O   . HOH E 5 .   ? -10.199 10.231  -21.870 1.00 65.22  ? 318 HOH A O   1 
HETATM 4165 O  O   . HOH F 5 .   ? 1.990   -1.061  -8.551  1.00 55.00  ? 301 HOH H O   1 
HETATM 4166 O  O   . HOH F 5 .   ? 15.554  12.392  -9.475  1.00 50.67  ? 302 HOH H O   1 
HETATM 4167 O  O   . HOH F 5 .   ? 10.375  6.920   -25.932 1.00 43.39  ? 303 HOH H O   1 
HETATM 4168 O  O   . HOH F 5 .   ? 21.477  10.197  -12.391 1.00 42.49  ? 304 HOH H O   1 
HETATM 4169 O  O   . HOH F 5 .   ? 22.229  4.111   -15.477 1.00 53.65  ? 305 HOH H O   1 
HETATM 4170 O  O   . HOH F 5 .   ? 28.317  19.029  11.581  1.00 85.01  ? 306 HOH H O   1 
HETATM 4171 O  O   . HOH F 5 .   ? -0.411  12.425  -10.127 1.00 52.10  ? 307 HOH H O   1 
HETATM 4172 O  O   . HOH F 5 .   ? 10.023  -1.728  -4.899  1.00 50.63  ? 308 HOH H O   1 
HETATM 4173 O  O   . HOH F 5 .   ? 28.701  13.823  -20.596 1.00 66.77  ? 309 HOH H O   1 
HETATM 4174 O  O   . HOH F 5 .   ? 11.480  17.284  4.553   1.00 51.47  ? 310 HOH H O   1 
HETATM 4175 O  O   . HOH F 5 .   ? 13.480  23.720  -14.232 1.00 60.35  ? 311 HOH H O   1 
HETATM 4176 O  O   . HOH F 5 .   ? -5.135  7.850   -7.870  1.00 36.85  ? 312 HOH H O   1 
HETATM 4177 O  O   . HOH F 5 .   ? 5.625   17.613  7.071   1.00 46.18  ? 313 HOH H O   1 
HETATM 4178 O  O   . HOH F 5 .   ? 19.192  16.336  -11.604 1.00 43.93  ? 314 HOH H O   1 
HETATM 4179 O  O   . HOH F 5 .   ? 6.928   17.891  -11.271 1.00 44.08  ? 315 HOH H O   1 
HETATM 4180 O  O   . HOH F 5 .   ? 8.893   13.506  -15.203 1.00 43.39  ? 316 HOH H O   1 
HETATM 4181 O  O   . HOH F 5 .   ? 15.681  -5.466  -4.472  1.00 49.59  ? 317 HOH H O   1 
HETATM 4182 O  O   . HOH F 5 .   ? -1.533  6.907   -23.684 1.00 40.71  ? 318 HOH H O   1 
HETATM 4183 O  O   . HOH F 5 .   ? 18.301  8.755   1.400   1.00 46.07  ? 319 HOH H O   1 
HETATM 4184 O  O   . HOH F 5 .   ? -2.812  1.285   -12.778 1.00 44.30  ? 320 HOH H O   1 
HETATM 4185 O  O   . HOH F 5 .   ? 4.229   1.817   -3.654  1.00 44.77  ? 321 HOH H O   1 
HETATM 4186 O  O   . HOH F 5 .   ? 5.534   19.715  -9.770  1.00 58.71  ? 322 HOH H O   1 
HETATM 4187 O  O   . HOH F 5 .   ? 12.534  1.170   -26.854 1.00 45.92  ? 323 HOH H O   1 
HETATM 4188 O  O   . HOH F 5 .   ? 1.930   -0.635  -12.449 1.00 49.84  ? 324 HOH H O   1 
HETATM 4189 O  O   . HOH F 5 .   ? 21.992  3.954   -18.697 1.00 54.82  ? 325 HOH H O   1 
HETATM 4190 O  O   . HOH F 5 .   ? 8.409   7.836   -27.841 1.00 35.58  ? 326 HOH H O   1 
HETATM 4191 O  O   . HOH F 5 .   ? -2.306  13.668  -19.331 1.00 49.75  ? 327 HOH H O   1 
HETATM 4192 O  O   . HOH F 5 .   ? 0.891   14.835  -13.905 1.00 52.13  ? 328 HOH H O   1 
HETATM 4193 O  O   . HOH F 5 .   ? 20.234  6.650   1.849   1.00 54.93  ? 329 HOH H O   1 
HETATM 4194 O  O   . HOH F 5 .   ? 27.407  20.046  13.825  1.00 69.77  ? 330 HOH H O   1 
HETATM 4195 O  O   . HOH G 5 .   ? 30.156  -14.035 -22.416 1.00 64.75  ? 401 HOH L O   1 
HETATM 4196 O  O   . HOH G 5 .   ? 2.155   -18.581 -21.866 1.00 62.67  ? 402 HOH L O   1 
HETATM 4197 O  O   . HOH G 5 .   ? 8.039   -20.363 -19.881 1.00 67.07  ? 403 HOH L O   1 
HETATM 4198 O  O   . HOH G 5 .   ? -5.940  -6.008  -18.439 1.00 65.22  ? 404 HOH L O   1 
HETATM 4199 O  O   . HOH G 5 .   ? 12.323  -14.367 -14.982 1.00 59.18  ? 405 HOH L O   1 
HETATM 4200 O  O   . HOH G 5 .   ? 22.891  -10.382 -26.220 1.00 52.20  ? 406 HOH L O   1 
HETATM 4201 O  O   . HOH G 5 .   ? 15.232  -10.743 7.112   1.00 88.40  ? 407 HOH L O   1 
HETATM 4202 O  O   . HOH G 5 .   ? 7.288   -12.392 -10.998 1.00 52.86  ? 408 HOH L O   1 
HETATM 4203 O  O   . HOH G 5 .   ? 28.677  -12.506 -25.294 1.00 60.18  ? 409 HOH L O   1 
HETATM 4204 O  O   . HOH G 5 .   ? 21.586  -1.651  -21.549 1.00 42.90  ? 410 HOH L O   1 
HETATM 4205 O  O   . HOH G 5 .   ? 26.301  -9.128  -17.598 1.00 50.65  ? 411 HOH L O   1 
HETATM 4206 O  O   . HOH G 5 .   ? 19.803  -7.616  -5.622  1.00 61.73  ? 412 HOH L O   1 
HETATM 4207 O  O   . HOH G 5 .   ? 19.793  -9.140  -3.436  1.00 61.62  ? 413 HOH L O   1 
HETATM 4208 O  O   . HOH G 5 .   ? 17.883  -12.907 -28.532 1.00 57.00  ? 414 HOH L O   1 
HETATM 4209 O  O   . HOH G 5 .   ? 37.033  -14.002 3.115   1.00 78.93  ? 415 HOH L O   1 
HETATM 4210 O  O   . HOH G 5 .   ? 1.358   -17.469 17.018  1.00 71.23  ? 416 HOH L O   1 
HETATM 4211 O  O   . HOH G 5 .   ? 3.448   -17.927 -26.378 1.00 58.08  ? 417 HOH L O   1 
HETATM 4212 O  O   . HOH G 5 .   ? 4.192   -3.669  -12.178 1.00 43.91  ? 418 HOH L O   1 
HETATM 4213 O  O   . HOH G 5 .   ? 0.944   -14.466 -15.227 1.00 59.87  ? 419 HOH L O   1 
HETATM 4214 O  O   . HOH G 5 .   ? 20.765  -9.790  -6.208  1.00 59.20  ? 420 HOH L O   1 
HETATM 4215 O  O   . HOH G 5 .   ? 17.729  -7.815  -4.003  1.00 64.55  ? 421 HOH L O   1 
HETATM 4216 O  O   . HOH G 5 .   ? 20.763  -25.661 -23.487 1.00 71.57  ? 422 HOH L O   1 
HETATM 4217 O  O   . HOH G 5 .   ? 29.749  -5.667  -25.473 1.00 59.76  ? 423 HOH L O   1 
HETATM 4218 O  O   . HOH G 5 .   ? 21.652  1.576   -17.237 1.00 53.96  ? 424 HOH L O   1 
HETATM 4219 O  O   . HOH G 5 .   ? 6.095   -6.071  -9.649  1.00 59.06  ? 425 HOH L O   1 
HETATM 4220 O  O   . HOH G 5 .   ? 17.636  -22.819 -15.738 1.00 66.97  ? 426 HOH L O   1 
HETATM 4221 O  O   . HOH G 5 .   ? 6.186   -21.874 -24.241 1.00 76.50  ? 427 HOH L O   1 
HETATM 4222 O  O   . HOH G 5 .   ? 6.378   -21.304 -18.050 1.00 71.20  ? 428 HOH L O   1 
HETATM 4223 O  O   . HOH G 5 .   ? 2.370   -5.767  -11.292 1.00 39.66  ? 429 HOH L O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   86  ?   ?   ?   A . n 
A 1 2   GLY 2   87  ?   ?   ?   A . n 
A 1 3   SER 3   88  ?   ?   ?   A . n 
A 1 4   SER 4   89  ?   ?   ?   A . n 
A 1 5   HIS 5   90  ?   ?   ?   A . n 
A 1 6   HIS 6   91  ?   ?   ?   A . n 
A 1 7   HIS 7   92  ?   ?   ?   A . n 
A 1 8   HIS 8   93  ?   ?   ?   A . n 
A 1 9   HIS 9   94  ?   ?   ?   A . n 
A 1 10  HIS 10  95  ?   ?   ?   A . n 
A 1 11  SER 11  96  ?   ?   ?   A . n 
A 1 12  SER 12  97  ?   ?   ?   A . n 
A 1 13  GLY 13  98  ?   ?   ?   A . n 
A 1 14  LEU 14  99  ?   ?   ?   A . n 
A 1 15  VAL 15  100 ?   ?   ?   A . n 
A 1 16  PRO 16  101 ?   ?   ?   A . n 
A 1 17  ARG 17  102 ?   ?   ?   A . n 
A 1 18  GLY 18  103 ?   ?   ?   A . n 
A 1 19  SER 19  104 ?   ?   ?   A . n 
A 1 20  HIS 20  105 ?   ?   ?   A . n 
A 1 21  MET 21  106 ?   ?   ?   A . n 
A 1 22  LEU 22  107 ?   ?   ?   A . n 
A 1 23  GLU 23  108 ?   ?   ?   A . n 
A 1 24  ASP 24  109 ?   ?   ?   A . n 
A 1 25  PRO 25  110 ?   ?   ?   A . n 
A 1 26  HIS 26  111 ?   ?   ?   A . n 
A 1 27  MET 27  112 ?   ?   ?   A . n 
A 1 28  VAL 28  113 ?   ?   ?   A . n 
A 1 29  VAL 29  114 ?   ?   ?   A . n 
A 1 30  GLY 30  115 ?   ?   ?   A . n 
A 1 31  GLY 31  116 ?   ?   ?   A . n 
A 1 32  LEU 32  117 117 LEU LEU A . n 
A 1 33  GLY 33  118 118 GLY GLY A . n 
A 1 34  GLY 34  119 119 GLY GLY A . n 
A 1 35  TYR 35  120 120 TYR TYR A . n 
A 1 36  MET 36  121 121 MET MET A . n 
A 1 37  LEU 37  122 122 LEU LEU A . n 
A 1 38  GLY 38  123 123 GLY GLY A . n 
A 1 39  SER 39  124 124 SER SER A . n 
A 1 40  ALA 40  125 125 ALA ALA A . n 
A 1 41  MET 41  126 126 MET MET A . n 
A 1 42  ASN 42  127 127 ASN ASN A . n 
A 1 43  ARG 43  128 128 ARG ARG A . n 
A 1 44  PRO 44  129 129 PRO PRO A . n 
A 1 45  LEU 45  130 130 LEU LEU A . n 
A 1 46  ILE 46  131 131 ILE ILE A . n 
A 1 47  HIS 47  132 132 HIS HIS A . n 
A 1 48  PHE 48  133 133 PHE PHE A . n 
A 1 49  GLY 49  134 134 GLY GLY A . n 
A 1 50  ASN 50  135 135 ASN ASN A . n 
A 1 51  ASP 51  136 136 ASP ASP A . n 
A 1 52  TYR 52  137 137 TYR TYR A . n 
A 1 53  GLU 53  138 138 GLU GLU A . n 
A 1 54  ASP 54  139 139 ASP ASP A . n 
A 1 55  ARG 55  140 140 ARG ARG A . n 
A 1 56  TYR 56  141 141 TYR TYR A . n 
A 1 57  TYR 57  142 142 TYR TYR A . n 
A 1 58  ARG 58  143 143 ARG ARG A . n 
A 1 59  GLU 59  144 144 GLU GLU A . n 
A 1 60  ASN 60  145 145 ASN ASN A . n 
A 1 61  MET 61  146 146 MET MET A . n 
A 1 62  TYR 62  147 147 TYR TYR A . n 
A 1 63  ARG 63  148 148 ARG ARG A . n 
A 1 64  TYR 64  149 149 TYR TYR A . n 
A 1 65  PRO 65  150 150 PRO PRO A . n 
A 1 66  ASN 66  151 151 ASN ASN A . n 
A 1 67  GLN 67  152 152 GLN GLN A . n 
A 1 68  VAL 68  153 153 VAL VAL A . n 
A 1 69  TYR 69  154 154 TYR TYR A . n 
A 1 70  TYR 70  155 155 TYR TYR A . n 
A 1 71  ARG 71  156 156 ARG ARG A . n 
A 1 72  PRO 72  157 157 PRO PRO A . n 
A 1 73  VAL 73  158 158 VAL VAL A . n 
A 1 74  ASP 74  159 159 ASP ASP A . n 
A 1 75  GLN 75  160 160 GLN GLN A . n 
A 1 76  TYR 76  161 161 TYR TYR A . n 
A 1 77  ASN 77  162 162 ASN ASN A . n 
A 1 78  ASN 78  163 163 ASN ASN A . n 
A 1 79  GLN 79  164 164 GLN GLN A . n 
A 1 80  ASN 80  165 165 ASN ASN A . n 
A 1 81  THR 81  166 166 THR THR A . n 
A 1 82  PHE 82  167 167 PHE PHE A . n 
A 1 83  VAL 83  168 168 VAL VAL A . n 
A 1 84  HIS 84  169 169 HIS HIS A . n 
A 1 85  ASP 85  170 170 ASP ASP A . n 
A 1 86  CYS 86  171 171 CYS CYS A . n 
A 1 87  VAL 87  172 172 VAL VAL A . n 
A 1 88  ASN 88  173 173 ASN ASN A . n 
A 1 89  ILE 89  174 174 ILE ILE A . n 
A 1 90  THR 90  175 175 THR THR A . n 
A 1 91  VAL 91  176 176 VAL VAL A . n 
A 1 92  LYS 92  177 177 LYS LYS A . n 
A 1 93  GLN 93  178 178 GLN GLN A . n 
A 1 94  HIS 94  179 179 HIS HIS A . n 
A 1 95  THR 95  180 180 THR THR A . n 
A 1 96  VAL 96  181 181 VAL VAL A . n 
A 1 97  THR 97  182 182 THR THR A . n 
A 1 98  THR 98  183 183 THR THR A . n 
A 1 99  THR 99  184 184 THR THR A . n 
A 1 100 THR 100 185 185 THR THR A . n 
A 1 101 LYS 101 186 186 LYS LYS A . n 
A 1 102 GLY 102 187 187 GLY GLY A . n 
A 1 103 GLU 103 188 188 GLU GLU A . n 
A 1 104 ASN 104 189 189 ASN ASN A . n 
A 1 105 PHE 105 190 190 PHE PHE A . n 
A 1 106 THR 106 191 191 THR THR A . n 
A 1 107 GLU 107 192 192 GLU GLU A . n 
A 1 108 THR 108 193 193 THR THR A . n 
A 1 109 ASP 109 194 194 ASP ASP A . n 
A 1 110 ILE 110 195 195 ILE ILE A . n 
A 1 111 LYS 111 196 196 LYS LYS A . n 
A 1 112 MET 112 197 197 MET MET A . n 
A 1 113 MET 113 198 198 MET MET A . n 
A 1 114 GLU 114 199 199 GLU GLU A . n 
A 1 115 ARG 115 200 200 ARG ARG A . n 
A 1 116 VAL 116 201 201 VAL VAL A . n 
A 1 117 VAL 117 202 202 VAL VAL A . n 
A 1 118 GLU 118 203 203 GLU GLU A . n 
A 1 119 GLN 119 204 204 GLN GLN A . n 
A 1 120 MET 120 205 205 MET MET A . n 
A 1 121 CYS 121 206 206 CYS CYS A . n 
A 1 122 ILE 122 207 207 ILE ILE A . n 
A 1 123 THR 123 208 208 THR THR A . n 
A 1 124 GLN 124 209 209 GLN GLN A . n 
A 1 125 TYR 125 210 210 TYR TYR A . n 
A 1 126 GLN 126 211 211 GLN GLN A . n 
A 1 127 ARG 127 212 212 ARG ARG A . n 
A 1 128 GLU 128 213 213 GLU GLU A . n 
A 1 129 SER 129 214 214 SER SER A . n 
A 1 130 GLN 130 215 215 GLN GLN A . n 
A 1 131 ALA 131 216 216 ALA ALA A . n 
A 1 132 TYR 132 217 217 TYR TYR A . n 
A 1 133 TYR 133 218 ?   ?   ?   A . n 
A 1 134 GLN 134 219 ?   ?   ?   A . n 
A 1 135 ARG 135 220 ?   ?   ?   A . n 
B 2 1   GLN 1   1   1   GLN GLN H . n 
B 2 2   VAL 2   2   2   VAL VAL H . n 
B 2 3   GLN 3   3   3   GLN GLN H . n 
B 2 4   LEU 4   4   4   LEU LEU H . n 
B 2 5   GLN 5   5   5   GLN GLN H . n 
B 2 6   GLN 6   6   6   GLN GLN H . n 
B 2 7   SER 7   7   7   SER SER H . n 
B 2 8   GLY 8   8   8   GLY GLY H . n 
B 2 9   THR 9   9   9   THR THR H . n 
B 2 10  GLU 10  10  10  GLU GLU H . n 
B 2 11  LEU 11  11  11  LEU LEU H . n 
B 2 12  VAL 12  12  12  VAL VAL H . n 
B 2 13  MET 13  13  13  MET MET H . n 
B 2 14  PRO 14  14  14  PRO PRO H . n 
B 2 15  GLY 15  15  15  GLY GLY H . n 
B 2 16  ALA 16  16  16  ALA ALA H . n 
B 2 17  SER 17  17  17  SER SER H . n 
B 2 18  VAL 18  18  18  VAL VAL H . n 
B 2 19  LYS 19  19  19  LYS LYS H . n 
B 2 20  MET 20  20  20  MET MET H . n 
B 2 21  SER 21  21  21  SER SER H . n 
B 2 22  CYS 22  22  22  CYS CYS H . n 
B 2 23  LYS 23  23  23  LYS LYS H . n 
B 2 24  ALA 24  24  24  ALA ALA H . n 
B 2 25  SER 25  25  25  SER SER H . n 
B 2 26  GLY 26  26  26  GLY GLY H . n 
B 2 27  TYR 27  27  27  TYR TYR H . n 
B 2 28  THR 28  28  28  THR THR H . n 
B 2 29  PHE 29  29  29  PHE PHE H . n 
B 2 30  THR 30  30  30  THR THR H . n 
B 2 31  ASP 31  31  31  ASP ASP H . n 
B 2 32  TYR 32  32  32  TYR TYR H . n 
B 2 33  TRP 33  33  33  TRP TRP H . n 
B 2 34  MET 34  34  34  MET MET H . n 
B 2 35  HIS 35  35  35  HIS HIS H . n 
B 2 36  TRP 36  36  36  TRP TRP H . n 
B 2 37  VAL 37  37  37  VAL VAL H . n 
B 2 38  LYS 38  38  38  LYS LYS H . n 
B 2 39  GLN 39  39  39  GLN GLN H . n 
B 2 40  ARG 40  40  40  ARG ARG H . n 
B 2 41  PRO 41  41  41  PRO PRO H . n 
B 2 42  GLY 42  42  42  GLY GLY H . n 
B 2 43  GLN 43  43  43  GLN GLN H . n 
B 2 44  GLY 44  44  44  GLY GLY H . n 
B 2 45  LEU 45  45  45  LEU LEU H . n 
B 2 46  GLU 46  46  46  GLU GLU H . n 
B 2 47  TRP 47  47  47  TRP TRP H . n 
B 2 48  ILE 48  48  48  ILE ILE H . n 
B 2 49  GLY 49  49  49  GLY GLY H . n 
B 2 50  SER 50  50  50  SER SER H . n 
B 2 51  ILE 51  51  51  ILE ILE H . n 
B 2 52  ASP 52  52  52  ASP ASP H . n 
B 2 53  PRO 53  53  53  PRO PRO H . n 
B 2 54  SER 54  54  54  SER SER H . n 
B 2 55  ASP 55  55  55  ASP ASP H . n 
B 2 56  SER 56  56  56  SER SER H . n 
B 2 57  TYR 57  57  57  TYR TYR H . n 
B 2 58  THR 58  58  58  THR THR H . n 
B 2 59  SER 59  59  59  SER SER H . n 
B 2 60  HIS 60  60  60  HIS HIS H . n 
B 2 61  ASN 61  61  61  ASN ASN H . n 
B 2 62  GLU 62  62  62  GLU GLU H . n 
B 2 63  LYS 63  63  63  LYS LYS H . n 
B 2 64  PHE 64  64  64  PHE PHE H . n 
B 2 65  LYS 65  65  65  LYS LYS H . n 
B 2 66  GLY 66  66  66  GLY GLY H . n 
B 2 67  LYS 67  67  67  LYS LYS H . n 
B 2 68  ALA 68  68  68  ALA ALA H . n 
B 2 69  THR 69  69  69  THR THR H . n 
B 2 70  LEU 70  70  70  LEU LEU H . n 
B 2 71  THR 71  71  71  THR THR H . n 
B 2 72  VAL 72  72  72  VAL VAL H . n 
B 2 73  ASP 73  73  73  ASP ASP H . n 
B 2 74  GLU 74  74  74  GLU GLU H . n 
B 2 75  SER 75  75  75  SER SER H . n 
B 2 76  SER 76  76  76  SER SER H . n 
B 2 77  SER 77  77  77  SER SER H . n 
B 2 78  THR 78  78  78  THR THR H . n 
B 2 79  ALA 79  79  79  ALA ALA H . n 
B 2 80  TYR 80  80  80  TYR TYR H . n 
B 2 81  MET 81  81  81  MET MET H . n 
B 2 82  GLN 82  82  82  GLN GLN H . n 
B 2 83  LEU 83  83  83  LEU LEU H . n 
B 2 84  SER 84  84  84  SER SER H . n 
B 2 85  SER 85  85  85  SER SER H . n 
B 2 86  LEU 86  86  86  LEU LEU H . n 
B 2 87  THR 87  87  87  THR THR H . n 
B 2 88  SER 88  88  88  SER SER H . n 
B 2 89  GLU 89  89  89  GLU GLU H . n 
B 2 90  ASP 90  90  90  ASP ASP H . n 
B 2 91  SER 91  91  91  SER SER H . n 
B 2 92  ALA 92  92  92  ALA ALA H . n 
B 2 93  VAL 93  93  93  VAL VAL H . n 
B 2 94  TYR 94  94  94  TYR TYR H . n 
B 2 95  PHE 95  95  95  PHE PHE H . n 
B 2 96  CYS 96  96  96  CYS CYS H . n 
B 2 97  SER 97  97  97  SER SER H . n 
B 2 98  ARG 98  98  98  ARG ARG H . n 
B 2 99  SER 99  99  99  SER SER H . n 
B 2 100 GLY 100 100 100 GLY GLY H . n 
B 2 101 TYR 101 101 101 TYR TYR H . n 
B 2 102 GLY 102 102 102 GLY GLY H . n 
B 2 103 TYR 103 103 103 TYR TYR H . n 
B 2 104 TYR 104 104 104 TYR TYR H . n 
B 2 105 ALA 105 105 105 ALA ALA H . n 
B 2 106 MET 106 106 106 MET MET H . n 
B 2 107 GLU 107 107 107 GLU GLU H . n 
B 2 108 TYR 108 108 108 TYR TYR H . n 
B 2 109 TRP 109 109 109 TRP TRP H . n 
B 2 110 GLY 110 110 110 GLY GLY H . n 
B 2 111 GLN 111 111 111 GLN GLN H . n 
B 2 112 GLY 112 112 112 GLY GLY H . n 
B 2 113 THR 113 113 113 THR THR H . n 
B 2 114 SER 114 114 114 SER SER H . n 
B 2 115 VAL 115 115 115 VAL VAL H . n 
B 2 116 THR 116 116 116 THR THR H . n 
B 2 117 VAL 117 117 117 VAL VAL H . n 
B 2 118 SER 118 118 118 SER SER H . n 
B 2 119 SER 119 119 119 SER SER H . n 
B 2 120 ALA 120 120 120 ALA ALA H . n 
B 2 121 LYS 121 121 121 LYS LYS H . n 
B 2 122 THR 122 122 122 THR THR H . n 
B 2 123 THR 123 123 123 THR THR H . n 
B 2 124 PRO 124 124 124 PRO PRO H . n 
B 2 125 PRO 125 125 125 PRO PRO H . n 
B 2 126 SER 126 126 126 SER SER H . n 
B 2 127 VAL 127 127 127 VAL VAL H . n 
B 2 128 TYR 128 128 128 TYR TYR H . n 
B 2 129 PRO 129 129 129 PRO PRO H . n 
B 2 130 LEU 130 130 130 LEU LEU H . n 
B 2 131 ALA 131 131 131 ALA ALA H . n 
B 2 132 PRO 132 132 132 PRO PRO H . n 
B 2 133 GLY 133 133 133 GLY GLY H . n 
B 2 134 GLY 134 134 134 GLY GLY H . n 
B 2 135 GLY 135 135 135 GLY GLY H . n 
B 2 136 ALA 136 136 136 ALA ALA H . n 
B 2 137 THR 137 137 137 THR THR H . n 
B 2 138 ASN 138 138 138 ASN ASN H . n 
B 2 139 SER 139 139 139 SER SER H . n 
B 2 140 MET 140 140 140 MET MET H . n 
B 2 141 VAL 141 141 141 VAL VAL H . n 
B 2 142 THR 142 142 142 THR THR H . n 
B 2 143 LEU 143 143 143 LEU LEU H . n 
B 2 144 GLY 144 144 144 GLY GLY H . n 
B 2 145 CYS 145 145 145 CYS CYS H . n 
B 2 146 LEU 146 146 146 LEU LEU H . n 
B 2 147 VAL 147 147 147 VAL VAL H . n 
B 2 148 LYS 148 148 148 LYS LYS H . n 
B 2 149 GLY 149 149 149 GLY GLY H . n 
B 2 150 TYR 150 150 150 TYR TYR H . n 
B 2 151 PHE 151 151 151 PHE PHE H . n 
B 2 152 PRO 152 152 152 PRO PRO H . n 
B 2 153 GLU 153 153 153 GLU GLU H . n 
B 2 154 PRO 154 154 154 PRO PRO H . n 
B 2 155 VAL 155 155 155 VAL VAL H . n 
B 2 156 THR 156 156 156 THR THR H . n 
B 2 157 VAL 157 157 157 VAL VAL H . n 
B 2 158 THR 158 158 158 THR THR H . n 
B 2 159 TRP 159 159 159 TRP TRP H . n 
B 2 160 ASN 160 160 160 ASN ASN H . n 
B 2 161 SER 161 161 161 SER SER H . n 
B 2 162 GLY 162 162 162 GLY GLY H . n 
B 2 163 SER 163 163 163 SER SER H . n 
B 2 164 LEU 164 164 164 LEU LEU H . n 
B 2 165 SER 165 165 165 SER SER H . n 
B 2 166 GLY 166 166 166 GLY GLY H . n 
B 2 167 GLY 167 167 167 GLY GLY H . n 
B 2 168 VAL 168 168 168 VAL VAL H . n 
B 2 169 HIS 169 169 169 HIS HIS H . n 
B 2 170 THR 170 170 170 THR THR H . n 
B 2 171 PHE 171 171 171 PHE PHE H . n 
B 2 172 PRO 172 172 172 PRO PRO H . n 
B 2 173 ALA 173 173 173 ALA ALA H . n 
B 2 174 VAL 174 174 174 VAL VAL H . n 
B 2 175 LEU 175 175 175 LEU LEU H . n 
B 2 176 GLN 176 176 176 GLN GLN H . n 
B 2 177 SER 177 177 177 SER SER H . n 
B 2 178 ASP 178 178 178 ASP ASP H . n 
B 2 179 LEU 179 179 179 LEU LEU H . n 
B 2 180 TYR 180 180 180 TYR TYR H . n 
B 2 181 THR 181 181 181 THR THR H . n 
B 2 182 LEU 182 182 182 LEU LEU H . n 
B 2 183 SER 183 183 183 SER SER H . n 
B 2 184 SER 184 184 184 SER SER H . n 
B 2 185 SER 185 185 185 SER SER H . n 
B 2 186 VAL 186 186 186 VAL VAL H . n 
B 2 187 THR 187 187 187 THR THR H . n 
B 2 188 VAL 188 188 188 VAL VAL H . n 
B 2 189 PRO 189 189 189 PRO PRO H . n 
B 2 190 SER 190 190 190 SER SER H . n 
B 2 191 SER 191 191 191 SER SER H . n 
B 2 192 THR 192 192 192 THR THR H . n 
B 2 193 TRP 193 193 193 TRP TRP H . n 
B 2 194 PRO 194 194 194 PRO PRO H . n 
B 2 195 SER 195 195 195 SER SER H . n 
B 2 196 GLU 196 196 196 GLU GLU H . n 
B 2 197 THR 197 197 197 THR THR H . n 
B 2 198 VAL 198 198 198 VAL VAL H . n 
B 2 199 THR 199 199 199 THR THR H . n 
B 2 200 CYS 200 200 200 CYS CYS H . n 
B 2 201 ASN 201 201 201 ASN ASN H . n 
B 2 202 VAL 202 202 202 VAL VAL H . n 
B 2 203 ALA 203 203 203 ALA ALA H . n 
B 2 204 HIS 204 204 204 HIS HIS H . n 
B 2 205 PRO 205 205 205 PRO PRO H . n 
B 2 206 ALA 206 206 206 ALA ALA H . n 
B 2 207 SER 207 207 207 SER SER H . n 
B 2 208 SER 208 208 208 SER SER H . n 
B 2 209 THR 209 209 209 THR THR H . n 
B 2 210 LYS 210 210 210 LYS LYS H . n 
B 2 211 VAL 211 211 211 VAL VAL H . n 
B 2 212 ASP 212 212 212 ASP ASP H . n 
B 2 213 LYS 213 213 213 LYS LYS H . n 
B 2 214 LYS 214 214 214 LYS LYS H . n 
B 2 215 ILE 215 215 215 ILE ILE H . n 
B 2 216 VAL 216 216 216 VAL VAL H . n 
B 2 217 PRO 217 217 217 PRO PRO H . n 
B 2 218 ARG 218 218 218 ARG ARG H . n 
C 3 1   ASP 1   1   1   ASP ASP L . n 
C 3 2   ILE 2   2   2   ILE ILE L . n 
C 3 3   VAL 3   3   3   VAL VAL L . n 
C 3 4   LEU 4   4   4   LEU LEU L . n 
C 3 5   THR 5   5   5   THR THR L . n 
C 3 6   GLN 6   6   6   GLN GLN L . n 
C 3 7   SER 7   7   7   SER SER L . n 
C 3 8   PRO 8   8   8   PRO PRO L . n 
C 3 9   ALA 9   9   9   ALA ALA L . n 
C 3 10  ILE 10  10  10  ILE ILE L . n 
C 3 11  LEU 11  11  11  LEU LEU L . n 
C 3 12  SER 12  12  12  SER SER L . n 
C 3 13  VAL 13  13  13  VAL VAL L . n 
C 3 14  SER 14  14  14  SER SER L . n 
C 3 15  PRO 15  15  15  PRO PRO L . n 
C 3 16  GLY 16  16  16  GLY GLY L . n 
C 3 17  GLU 17  17  17  GLU GLU L . n 
C 3 18  ARG 18  18  18  ARG ARG L . n 
C 3 19  VAL 19  19  19  VAL VAL L . n 
C 3 20  SER 20  20  20  SER SER L . n 
C 3 21  PHE 21  21  21  PHE PHE L . n 
C 3 22  SER 22  22  22  SER SER L . n 
C 3 23  CYS 23  23  23  CYS CYS L . n 
C 3 24  ARG 24  24  24  ARG ARG L . n 
C 3 25  ALA 25  25  25  ALA ALA L . n 
C 3 26  SER 26  26  26  SER SER L . n 
C 3 27  GLN 27  27  27  GLN GLN L . n 
C 3 28  ASN 28  28  28  ASN ASN L . n 
C 3 29  ILE 29  29  29  ILE ILE L . n 
C 3 30  GLY 30  30  30  GLY GLY L . n 
C 3 31  THR 31  31  31  THR THR L . n 
C 3 32  SER 32  32  32  SER SER L . n 
C 3 33  ILE 33  33  33  ILE ILE L . n 
C 3 34  HIS 34  34  34  HIS HIS L . n 
C 3 35  TRP 35  35  35  TRP TRP L . n 
C 3 36  TYR 36  36  36  TYR TYR L . n 
C 3 37  GLN 37  37  37  GLN GLN L . n 
C 3 38  GLN 38  38  38  GLN GLN L . n 
C 3 39  ARG 39  39  39  ARG ARG L . n 
C 3 40  THR 40  40  40  THR THR L . n 
C 3 41  ASN 41  41  41  ASN ASN L . n 
C 3 42  GLU 42  42  42  GLU GLU L . n 
C 3 43  SER 43  43  43  SER SER L . n 
C 3 44  PRO 44  44  44  PRO PRO L . n 
C 3 45  ARG 45  45  45  ARG ARG L . n 
C 3 46  LEU 46  46  46  LEU LEU L . n 
C 3 47  ILE 47  47  47  ILE ILE L . n 
C 3 48  ILE 48  48  48  ILE ILE L . n 
C 3 49  LYS 49  49  49  LYS LYS L . n 
C 3 50  TYR 50  50  50  TYR TYR L . n 
C 3 51  ALA 51  51  51  ALA ALA L . n 
C 3 52  SER 52  52  52  SER SER L . n 
C 3 53  GLU 53  53  53  GLU GLU L . n 
C 3 54  SER 54  54  54  SER SER L . n 
C 3 55  ILE 55  55  55  ILE ILE L . n 
C 3 56  SER 56  56  56  SER SER L . n 
C 3 57  GLY 57  57  57  GLY GLY L . n 
C 3 58  ILE 58  58  58  ILE ILE L . n 
C 3 59  PRO 59  59  59  PRO PRO L . n 
C 3 60  SER 60  60  60  SER SER L . n 
C 3 61  ARG 61  61  61  ARG ARG L . n 
C 3 62  PHE 62  62  62  PHE PHE L . n 
C 3 63  SER 63  63  63  SER SER L . n 
C 3 64  GLY 64  64  64  GLY GLY L . n 
C 3 65  SER 65  65  65  SER SER L . n 
C 3 66  GLY 66  66  66  GLY GLY L . n 
C 3 67  SER 67  67  67  SER SER L . n 
C 3 68  GLY 68  68  68  GLY GLY L . n 
C 3 69  THR 69  69  69  THR THR L . n 
C 3 70  ASP 70  70  70  ASP ASP L . n 
C 3 71  PHE 71  71  71  PHE PHE L . n 
C 3 72  THR 72  72  72  THR THR L . n 
C 3 73  LEU 73  73  73  LEU LEU L . n 
C 3 74  SER 74  74  74  SER SER L . n 
C 3 75  ILE 75  75  75  ILE ILE L . n 
C 3 76  ASN 76  76  76  ASN ASN L . n 
C 3 77  SER 77  77  77  SER SER L . n 
C 3 78  VAL 78  78  78  VAL VAL L . n 
C 3 79  GLU 79  79  79  GLU GLU L . n 
C 3 80  SER 80  80  80  SER SER L . n 
C 3 81  GLU 81  81  81  GLU GLU L . n 
C 3 82  ASP 82  82  82  ASP ASP L . n 
C 3 83  ILE 83  83  83  ILE ILE L . n 
C 3 84  ALA 84  84  84  ALA ALA L . n 
C 3 85  ASP 85  85  85  ASP ASP L . n 
C 3 86  TYR 86  86  86  TYR TYR L . n 
C 3 87  TYR 87  87  87  TYR TYR L . n 
C 3 88  CYS 88  88  88  CYS CYS L . n 
C 3 89  GLN 89  89  89  GLN GLN L . n 
C 3 90  GLN 90  90  90  GLN GLN L . n 
C 3 91  SER 91  91  91  SER SER L . n 
C 3 92  ASN 92  92  92  ASN ASN L . n 
C 3 93  THR 93  93  93  THR THR L . n 
C 3 94  TRP 94  94  94  TRP TRP L . n 
C 3 95  PRO 95  95  95  PRO PRO L . n 
C 3 96  TYR 96  96  96  TYR TYR L . n 
C 3 97  THR 97  97  97  THR THR L . n 
C 3 98  PHE 98  98  98  PHE PHE L . n 
C 3 99  GLY 99  99  99  GLY GLY L . n 
C 3 100 GLY 100 100 100 GLY GLY L . n 
C 3 101 GLY 101 101 101 GLY GLY L . n 
C 3 102 THR 102 102 102 THR THR L . n 
C 3 103 LYS 103 103 103 LYS LYS L . n 
C 3 104 LEU 104 104 104 LEU LEU L . n 
C 3 105 GLU 105 105 105 GLU GLU L . n 
C 3 106 LEU 106 106 106 LEU LEU L . n 
C 3 107 LYS 107 107 107 LYS LYS L . n 
C 3 108 ARG 108 108 108 ARG ARG L . n 
C 3 109 ALA 109 109 109 ALA ALA L . n 
C 3 110 ASP 110 110 110 ASP ASP L . n 
C 3 111 ALA 111 111 111 ALA ALA L . n 
C 3 112 ALA 112 112 112 ALA ALA L . n 
C 3 113 PRO 113 113 113 PRO PRO L . n 
C 3 114 THR 114 114 114 THR THR L . n 
C 3 115 VAL 115 115 115 VAL VAL L . n 
C 3 116 SER 116 116 116 SER SER L . n 
C 3 117 ILE 117 117 117 ILE ILE L . n 
C 3 118 PHE 118 118 118 PHE PHE L . n 
C 3 119 PRO 119 119 119 PRO PRO L . n 
C 3 120 PRO 120 120 120 PRO PRO L . n 
C 3 121 SER 121 121 121 SER SER L . n 
C 3 122 SER 122 122 122 SER SER L . n 
C 3 123 GLU 123 123 123 GLU GLU L . n 
C 3 124 GLN 124 124 124 GLN GLN L . n 
C 3 125 LEU 125 125 125 LEU LEU L . n 
C 3 126 THR 126 126 126 THR THR L . n 
C 3 127 SER 127 127 127 SER SER L . n 
C 3 128 GLY 128 128 128 GLY GLY L . n 
C 3 129 GLY 129 129 129 GLY GLY L . n 
C 3 130 ALA 130 130 130 ALA ALA L . n 
C 3 131 SER 131 131 131 SER SER L . n 
C 3 132 VAL 132 132 132 VAL VAL L . n 
C 3 133 VAL 133 133 133 VAL VAL L . n 
C 3 134 CYS 134 134 134 CYS CYS L . n 
C 3 135 PHE 135 135 135 PHE PHE L . n 
C 3 136 LEU 136 136 136 LEU LEU L . n 
C 3 137 ASN 137 137 137 ASN ASN L . n 
C 3 138 ASN 138 138 138 ASN ASN L . n 
C 3 139 PHE 139 139 139 PHE PHE L . n 
C 3 140 TYR 140 140 140 TYR TYR L . n 
C 3 141 PRO 141 141 141 PRO PRO L . n 
C 3 142 LYS 142 142 142 LYS LYS L . n 
C 3 143 ASP 143 143 143 ASP ASP L . n 
C 3 144 ILE 144 144 144 ILE ILE L . n 
C 3 145 ASN 145 145 145 ASN ASN L . n 
C 3 146 VAL 146 146 146 VAL VAL L . n 
C 3 147 LYS 147 147 147 LYS LYS L . n 
C 3 148 TRP 148 148 148 TRP TRP L . n 
C 3 149 LYS 149 149 149 LYS LYS L . n 
C 3 150 ILE 150 150 150 ILE ILE L . n 
C 3 151 ASP 151 151 151 ASP ASP L . n 
C 3 152 GLY 152 152 152 GLY GLY L . n 
C 3 153 SER 153 153 153 SER SER L . n 
C 3 154 GLU 154 154 154 GLU GLU L . n 
C 3 155 ARG 155 155 155 ARG ARG L . n 
C 3 156 GLN 156 156 156 GLN GLN L . n 
C 3 157 ASN 157 157 157 ASN ASN L . n 
C 3 158 GLY 158 158 158 GLY GLY L . n 
C 3 159 VAL 159 159 159 VAL VAL L . n 
C 3 160 LEU 160 160 160 LEU LEU L . n 
C 3 161 ASN 161 161 161 ASN ASN L . n 
C 3 162 SER 162 162 162 SER SER L . n 
C 3 163 GLU 163 163 163 GLU GLU L . n 
C 3 164 THR 164 164 164 THR THR L . n 
C 3 165 ASP 165 165 165 ASP ASP L . n 
C 3 166 GLN 166 166 166 GLN GLN L . n 
C 3 167 ASP 167 167 167 ASP ASP L . n 
C 3 168 SER 168 168 168 SER SER L . n 
C 3 169 LYS 169 169 169 LYS LYS L . n 
C 3 170 ASP 170 170 170 ASP ASP L . n 
C 3 171 SER 171 171 171 SER SER L . n 
C 3 172 THR 172 172 172 THR THR L . n 
C 3 173 TYR 173 173 173 TYR TYR L . n 
C 3 174 SER 174 174 174 SER SER L . n 
C 3 175 MET 175 175 175 MET MET L . n 
C 3 176 SER 176 176 176 SER SER L . n 
C 3 177 SER 177 177 177 SER SER L . n 
C 3 178 THR 178 178 178 THR THR L . n 
C 3 179 LEU 179 179 179 LEU LEU L . n 
C 3 180 THR 180 180 180 THR THR L . n 
C 3 181 LEU 181 181 181 LEU LEU L . n 
C 3 182 THR 182 182 182 THR THR L . n 
C 3 183 LYS 183 183 183 LYS LYS L . n 
C 3 184 ASP 184 184 184 ASP ASP L . n 
C 3 185 GLU 185 185 185 GLU GLU L . n 
C 3 186 TYR 186 186 186 TYR TYR L . n 
C 3 187 GLU 187 187 187 GLU GLU L . n 
C 3 188 ARG 188 188 188 ARG ARG L . n 
C 3 189 HIS 189 189 189 HIS HIS L . n 
C 3 190 ASN 190 190 190 ASN ASN L . n 
C 3 191 THR 191 191 191 THR THR L . n 
C 3 192 TYR 192 192 192 TYR TYR L . n 
C 3 193 THR 193 193 193 THR THR L . n 
C 3 194 CYS 194 194 194 CYS CYS L . n 
C 3 195 GLU 195 195 195 GLU GLU L . n 
C 3 196 ALA 196 196 196 ALA ALA L . n 
C 3 197 THR 197 197 197 THR THR L . n 
C 3 198 HIS 198 198 198 HIS HIS L . n 
C 3 199 LYS 199 199 199 LYS LYS L . n 
C 3 200 THR 200 200 200 THR THR L . n 
C 3 201 SER 201 201 201 SER SER L . n 
C 3 202 THR 202 202 202 THR THR L . n 
C 3 203 SER 203 203 203 SER SER L . n 
C 3 204 PRO 204 204 204 PRO PRO L . n 
C 3 205 ILE 205 205 205 ILE ILE L . n 
C 3 206 VAL 206 206 206 VAL VAL L . n 
C 3 207 LYS 207 207 207 LYS LYS L . n 
C 3 208 SER 208 208 208 SER SER L . n 
C 3 209 PHE 209 209 209 PHE PHE L . n 
C 3 210 ASN 210 210 210 ASN ASN L . n 
C 3 211 ARG 211 211 211 ARG ARG L . n 
C 3 212 ASN 212 212 212 ASN ASN L . n 
C 3 213 GLU 213 213 213 GLU GLU L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NA  1  301 1  NA  NA  L . 
E 5 HOH 1  301 68 HOH HOH A . 
E 5 HOH 2  302 32 HOH HOH A . 
E 5 HOH 3  303 67 HOH HOH A . 
E 5 HOH 4  304 70 HOH HOH A . 
E 5 HOH 5  305 41 HOH HOH A . 
E 5 HOH 6  306 63 HOH HOH A . 
E 5 HOH 7  307 60 HOH HOH A . 
E 5 HOH 8  308 62 HOH HOH A . 
E 5 HOH 9  309 42 HOH HOH A . 
E 5 HOH 10 310 33 HOH HOH A . 
E 5 HOH 11 311 44 HOH HOH A . 
E 5 HOH 12 312 65 HOH HOH A . 
E 5 HOH 13 313 40 HOH HOH A . 
E 5 HOH 14 314 59 HOH HOH A . 
E 5 HOH 15 315 61 HOH HOH A . 
E 5 HOH 16 316 69 HOH HOH A . 
E 5 HOH 17 317 66 HOH HOH A . 
E 5 HOH 18 318 64 HOH HOH A . 
F 5 HOH 1  301 47 HOH HOH H . 
F 5 HOH 2  302 5  HOH HOH H . 
F 5 HOH 3  303 19 HOH HOH H . 
F 5 HOH 4  304 45 HOH HOH H . 
F 5 HOH 5  305 24 HOH HOH H . 
F 5 HOH 6  306 30 HOH HOH H . 
F 5 HOH 7  307 38 HOH HOH H . 
F 5 HOH 8  308 2  HOH HOH H . 
F 5 HOH 9  309 71 HOH HOH H . 
F 5 HOH 10 310 10 HOH HOH H . 
F 5 HOH 11 311 37 HOH HOH H . 
F 5 HOH 12 312 27 HOH HOH H . 
F 5 HOH 13 313 18 HOH HOH H . 
F 5 HOH 14 314 11 HOH HOH H . 
F 5 HOH 15 315 9  HOH HOH H . 
F 5 HOH 16 316 6  HOH HOH H . 
F 5 HOH 17 317 4  HOH HOH H . 
F 5 HOH 18 318 43 HOH HOH H . 
F 5 HOH 19 319 3  HOH HOH H . 
F 5 HOH 20 320 20 HOH HOH H . 
F 5 HOH 21 321 1  HOH HOH H . 
F 5 HOH 22 322 16 HOH HOH H . 
F 5 HOH 23 323 49 HOH HOH H . 
F 5 HOH 24 324 12 HOH HOH H . 
F 5 HOH 25 325 21 HOH HOH H . 
F 5 HOH 26 326 28 HOH HOH H . 
F 5 HOH 27 327 34 HOH HOH H . 
F 5 HOH 28 328 73 HOH HOH H . 
F 5 HOH 29 329 36 HOH HOH H . 
F 5 HOH 30 330 35 HOH HOH H . 
G 5 HOH 1  401 13 HOH HOH L . 
G 5 HOH 2  402 55 HOH HOH L . 
G 5 HOH 3  403 57 HOH HOH L . 
G 5 HOH 4  404 74 HOH HOH L . 
G 5 HOH 5  405 51 HOH HOH L . 
G 5 HOH 6  406 14 HOH HOH L . 
G 5 HOH 7  407 31 HOH HOH L . 
G 5 HOH 8  408 58 HOH HOH L . 
G 5 HOH 9  409 17 HOH HOH L . 
G 5 HOH 10 410 7  HOH HOH L . 
G 5 HOH 11 411 29 HOH HOH L . 
G 5 HOH 12 412 23 HOH HOH L . 
G 5 HOH 13 413 26 HOH HOH L . 
G 5 HOH 14 414 53 HOH HOH L . 
G 5 HOH 15 415 39 HOH HOH L . 
G 5 HOH 16 416 52 HOH HOH L . 
G 5 HOH 17 417 15 HOH HOH L . 
G 5 HOH 18 418 8  HOH HOH L . 
G 5 HOH 19 419 75 HOH HOH L . 
G 5 HOH 20 420 25 HOH HOH L . 
G 5 HOH 21 421 46 HOH HOH L . 
G 5 HOH 22 422 76 HOH HOH L . 
G 5 HOH 23 423 54 HOH HOH L . 
G 5 HOH 24 424 22 HOH HOH L . 
G 5 HOH 25 425 72 HOH HOH L . 
G 5 HOH 26 426 77 HOH HOH L . 
G 5 HOH 27 427 56 HOH HOH L . 
G 5 HOH 28 428 50 HOH HOH L . 
G 5 HOH 29 429 48 HOH HOH L . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA dimeric   2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,E       
2 1 B,C,D,F,G 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0     ? 
1 MORE         0     ? 
1 'SSA (A^2)'  6550  ? 
2 'ABSA (A^2)' 3470  ? 
2 MORE         -30   ? 
2 'SSA (A^2)'  20780 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? C GLU 79  ? L GLU 79  ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OE2 ? C GLU 79  ? L GLU 79  ? 1_555 47.4  ? 
2  OE1 ? C GLU 79  ? L GLU 79  ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 O   ? B SER 191 ? H SER 191 ? 1_555 75.5  ? 
3  OE2 ? C GLU 79  ? L GLU 79  ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 O   ? B SER 191 ? H SER 191 ? 1_555 109.0 ? 
4  OE1 ? C GLU 79  ? L GLU 79  ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OG  ? B SER 195 ? H SER 195 ? 1_555 73.9  ? 
5  OE2 ? C GLU 79  ? L GLU 79  ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OG  ? B SER 195 ? H SER 195 ? 1_555 108.3 ? 
6  O   ? B SER 191 ? H SER 191 ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OG  ? B SER 195 ? H SER 195 ? 1_555 2.0   ? 
7  OE1 ? C GLU 79  ? L GLU 79  ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OE1 ? B GLU 196 ? H GLU 196 ? 1_555 79.6  ? 
8  OE2 ? C GLU 79  ? L GLU 79  ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OE1 ? B GLU 196 ? H GLU 196 ? 1_555 113.9 ? 
9  O   ? B SER 191 ? H SER 191 ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OE1 ? B GLU 196 ? H GLU 196 ? 1_555 4.9   ? 
10 OG  ? B SER 195 ? H SER 195 ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OE1 ? B GLU 196 ? H GLU 196 ? 1_555 5.9   ? 
11 OE1 ? C GLU 79  ? L GLU 79  ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OE2 ? B GLU 196 ? H GLU 196 ? 1_555 78.5  ? 
12 OE2 ? C GLU 79  ? L GLU 79  ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OE2 ? B GLU 196 ? H GLU 196 ? 1_555 112.4 ? 
13 O   ? B SER 191 ? H SER 191 ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OE2 ? B GLU 196 ? H GLU 196 ? 1_555 3.4   ? 
14 OG  ? B SER 195 ? H SER 195 ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OE2 ? B GLU 196 ? H GLU 196 ? 1_555 4.6   ? 
15 OE1 ? B GLU 196 ? H GLU 196 ? 1_555 NA ? D NA . ? L NA 301 ? 1_555 OE2 ? B GLU 196 ? H GLU 196 ? 1_555 1.4   ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-09-23 
2 'Structure model' 1 1 2015-10-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.9_1692 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP   ? ? ? .        4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   SG 
_pdbx_validate_close_contact.auth_asym_id_1   L 
_pdbx_validate_close_contact.auth_comp_id_1   CYS 
_pdbx_validate_close_contact.auth_seq_id_1    134 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   SG 
_pdbx_validate_close_contact.auth_asym_id_2   L 
_pdbx_validate_close_contact.auth_comp_id_2   CYS 
_pdbx_validate_close_contact.auth_seq_id_2    194 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.71 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CA L PRO 141 ? ? N  L PRO 141 ? ? CD  L PRO 141 ? ? 96.90  111.50 -14.60 1.40 N 
2  1 N  L LYS 147 ? ? CA L LYS 147 ? ? CB  L LYS 147 ? ? 99.80  110.60 -10.80 1.80 N 
3  1 C  L LYS 147 ? ? N  L TRP 148 ? ? CA  L TRP 148 ? ? 137.93 121.70 16.23  2.50 Y 
4  1 CA L TRP 148 ? ? C  L TRP 148 ? ? N   L LYS 149 ? ? 134.89 117.20 17.69  2.20 Y 
5  1 O  L TRP 148 ? ? C  L TRP 148 ? ? N   L LYS 149 ? ? 110.30 122.70 -12.40 1.60 Y 
6  1 CD L LYS 169 ? ? CE L LYS 169 ? ? NZ  L LYS 169 ? ? 126.16 111.70 14.46  2.30 N 
7  1 CB L TYR 173 ? ? CG L TYR 173 ? ? CD2 L TYR 173 ? ? 115.94 121.00 -5.06  0.60 N 
8  1 CA L LEU 179 ? ? CB L LEU 179 ? ? CG  L LEU 179 ? ? 150.16 115.30 34.86  2.30 N 
9  1 CB L LEU 179 ? ? CG L LEU 179 ? ? CD2 L LEU 179 ? ? 99.78  111.00 -11.22 1.70 N 
10 1 CB L ASN 190 ? ? CA L ASN 190 ? ? C   L ASN 190 ? ? 126.07 110.40 15.67  2.00 N 
11 1 N  L ASN 210 ? ? CA L ASN 210 ? ? C   L ASN 210 ? ? 133.13 111.00 22.13  2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 163 ? ? -179.25 -179.28 
2  1 ALA A 216 ? ? -147.12 -70.73  
3  1 ASN H 138 ? ? -175.47 -26.82  
4  1 SER H 139 ? ? 72.87   -24.80  
5  1 SER H 165 ? ? -141.04 18.37   
6  1 SER L 32  ? ? -81.15  49.43   
7  1 ALA L 51  ? ? 69.92   -41.06  
8  1 SER L 52  ? ? -142.86 -0.20   
9  1 ALA L 84  ? ? 178.45  173.21  
10 1 ASP L 151 ? ? 39.72   36.76   
11 1 GLU L 154 ? ? 146.84  158.40  
12 1 ARG L 155 ? ? 157.97  145.30  
13 1 GLN L 156 ? ? 66.77   -87.25  
14 1 SER L 171 ? ? 59.04   18.56   
15 1 ALA L 196 ? ? -153.81 -147.27 
16 1 THR L 197 ? ? -167.68 -71.58  
17 1 HIS L 198 ? ? 39.85   163.56  
18 1 PHE L 209 ? ? 80.77   -170.12 
19 1 ASN L 210 ? ? -111.98 -156.34 
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1 1 TRP L 148 ? ? 17.76 
2 1 ARG L 155 ? ? 15.41 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 ASN A 189 ? ? 0.072 'SIDE CHAIN' 
2 1 ARG L 45  ? ? 0.099 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 86  ? A MET 1   
2  1 Y 1 A GLY 87  ? A GLY 2   
3  1 Y 1 A SER 88  ? A SER 3   
4  1 Y 1 A SER 89  ? A SER 4   
5  1 Y 1 A HIS 90  ? A HIS 5   
6  1 Y 1 A HIS 91  ? A HIS 6   
7  1 Y 1 A HIS 92  ? A HIS 7   
8  1 Y 1 A HIS 93  ? A HIS 8   
9  1 Y 1 A HIS 94  ? A HIS 9   
10 1 Y 1 A HIS 95  ? A HIS 10  
11 1 Y 1 A SER 96  ? A SER 11  
12 1 Y 1 A SER 97  ? A SER 12  
13 1 Y 1 A GLY 98  ? A GLY 13  
14 1 Y 1 A LEU 99  ? A LEU 14  
15 1 Y 1 A VAL 100 ? A VAL 15  
16 1 Y 1 A PRO 101 ? A PRO 16  
17 1 Y 1 A ARG 102 ? A ARG 17  
18 1 Y 1 A GLY 103 ? A GLY 18  
19 1 Y 1 A SER 104 ? A SER 19  
20 1 Y 1 A HIS 105 ? A HIS 20  
21 1 Y 1 A MET 106 ? A MET 21  
22 1 Y 1 A LEU 107 ? A LEU 22  
23 1 Y 1 A GLU 108 ? A GLU 23  
24 1 Y 1 A ASP 109 ? A ASP 24  
25 1 Y 1 A PRO 110 ? A PRO 25  
26 1 Y 1 A HIS 111 ? A HIS 26  
27 1 Y 1 A MET 112 ? A MET 27  
28 1 Y 1 A VAL 113 ? A VAL 28  
29 1 Y 1 A VAL 114 ? A VAL 29  
30 1 Y 1 A GLY 115 ? A GLY 30  
31 1 Y 1 A GLY 116 ? A GLY 31  
32 1 Y 1 A TYR 218 ? A TYR 133 
33 1 Y 1 A GLN 219 ? A GLN 134 
34 1 Y 1 A ARG 220 ? A ARG 135 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'SODIUM ION' NA  
5 water        HOH 
#