data_4YZ9
# 
_entry.id   4YZ9 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4YZ9         
WWPDB D_1000208329 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4YZC unspecified 
PDB . 4YZD unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4YZ9 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
_audit_author.name           'Concha, N.O.' 
_audit_author.pdbx_ordinal   1 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Mol.Pharmacol. 
_citation.journal_id_ASTM           MOPMA3 
_citation.journal_id_CSD            0197 
_citation.journal_id_ISSN           1521-0111 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            88 
_citation.language                  ? 
_citation.page_first                1011 
_citation.page_last                 1023 
_citation.title                     
'Long-Range Inhibitor-Induced Conformational Regulation of Human IRE1 alpha Endoribonuclease Activity.' 
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1124/mol.115.100917 
_citation.pdbx_database_id_PubMed   26438213 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Concha, N.O.'   1  
primary 'Smallwood, A.'  2  
primary 'Bonnette, W.'   3  
primary 'Totoritis, R.'  4  
primary 'Zhang, G.'      5  
primary 'Federowicz, K.' 6  
primary 'Yang, J.'       7  
primary 'Qi, H.'         8  
primary 'Chen, S.'       9  
primary 'Campobasso, N.' 10 
primary 'Choudhry, A.E.' 11 
primary 'Shuster, L.E.'  12 
primary 'Evans, K.A.'    13 
primary 'Ralph, J.'      14 
primary 'Sweitzer, S.'   15 
primary 'Heerding, D.A.' 16 
primary 'Buser, C.A.'    17 
primary 'Su, D.S.'       18 
primary 'DeYoung, M.P.'  19 
# 
_cell.entry_id           4YZ9 
_cell.length_a           244.004 
_cell.length_b           77.767 
_cell.length_c           88.313 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4YZ9 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Serine/threonine-protein kinase/endoribonuclease IRE1'                                  46610.570 3  
2.7.11.1,3.1.26.- ? 'UNP residues 562-966' ? 
2 non-polymer syn '(5R)-2-(3,4-dichlorobenzyl)-N-(4-methylbenzyl)-2,7-diazaspiro[4.5]decane-7-carboxamide' 446.413   3  ? ? ? ? 
3 water       nat water                                                                                    18.015    80 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Endoplasmic reticulum-to-nucleus signaling 1,Inositol-requiring protein 1,hIRE1p,Ire1-alpha,IRE1a' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIA
IELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAVG
RHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGACSLDCLHPEKHE
DVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVP
LQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPYY
FHEPP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIA
IELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAVG
RHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGACSLDCLHPEKHE
DVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVP
LQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPYY
FHEPP
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   VAL n 
1 3   VAL n 
1 4   ILE n 
1 5   VAL n 
1 6   GLY n 
1 7   LYS n 
1 8   ILE n 
1 9   SER n 
1 10  PHE n 
1 11  CYS n 
1 12  PRO n 
1 13  LYS n 
1 14  ASP n 
1 15  VAL n 
1 16  LEU n 
1 17  GLY n 
1 18  HIS n 
1 19  GLY n 
1 20  ALA n 
1 21  GLU n 
1 22  GLY n 
1 23  THR n 
1 24  ILE n 
1 25  VAL n 
1 26  TYR n 
1 27  ARG n 
1 28  GLY n 
1 29  MET n 
1 30  PHE n 
1 31  ASP n 
1 32  ASN n 
1 33  ARG n 
1 34  ASP n 
1 35  VAL n 
1 36  ALA n 
1 37  VAL n 
1 38  LYS n 
1 39  ARG n 
1 40  ILE n 
1 41  LEU n 
1 42  PRO n 
1 43  GLU n 
1 44  CYS n 
1 45  PHE n 
1 46  SER n 
1 47  PHE n 
1 48  ALA n 
1 49  ASP n 
1 50  ARG n 
1 51  GLU n 
1 52  VAL n 
1 53  GLN n 
1 54  LEU n 
1 55  LEU n 
1 56  ARG n 
1 57  GLU n 
1 58  SER n 
1 59  ASP n 
1 60  GLU n 
1 61  HIS n 
1 62  PRO n 
1 63  ASN n 
1 64  VAL n 
1 65  ILE n 
1 66  ARG n 
1 67  TYR n 
1 68  PHE n 
1 69  CYS n 
1 70  THR n 
1 71  GLU n 
1 72  LYS n 
1 73  ASP n 
1 74  ARG n 
1 75  GLN n 
1 76  PHE n 
1 77  GLN n 
1 78  TYR n 
1 79  ILE n 
1 80  ALA n 
1 81  ILE n 
1 82  GLU n 
1 83  LEU n 
1 84  CYS n 
1 85  ALA n 
1 86  ALA n 
1 87  THR n 
1 88  LEU n 
1 89  GLN n 
1 90  GLU n 
1 91  TYR n 
1 92  VAL n 
1 93  GLU n 
1 94  GLN n 
1 95  LYS n 
1 96  ASP n 
1 97  PHE n 
1 98  ALA n 
1 99  HIS n 
1 100 LEU n 
1 101 GLY n 
1 102 LEU n 
1 103 GLU n 
1 104 PRO n 
1 105 ILE n 
1 106 THR n 
1 107 LEU n 
1 108 LEU n 
1 109 GLN n 
1 110 GLN n 
1 111 THR n 
1 112 THR n 
1 113 SER n 
1 114 GLY n 
1 115 LEU n 
1 116 ALA n 
1 117 HIS n 
1 118 LEU n 
1 119 HIS n 
1 120 SER n 
1 121 LEU n 
1 122 ASN n 
1 123 ILE n 
1 124 VAL n 
1 125 HIS n 
1 126 ARG n 
1 127 ASP n 
1 128 LEU n 
1 129 LYS n 
1 130 PRO n 
1 131 HIS n 
1 132 ASN n 
1 133 ILE n 
1 134 LEU n 
1 135 ILE n 
1 136 SER n 
1 137 MET n 
1 138 PRO n 
1 139 ASN n 
1 140 ALA n 
1 141 HIS n 
1 142 GLY n 
1 143 LYS n 
1 144 ILE n 
1 145 LYS n 
1 146 ALA n 
1 147 MET n 
1 148 ILE n 
1 149 SER n 
1 150 ASP n 
1 151 PHE n 
1 152 GLY n 
1 153 LEU n 
1 154 CYS n 
1 155 LYS n 
1 156 LYS n 
1 157 LEU n 
1 158 ALA n 
1 159 VAL n 
1 160 GLY n 
1 161 ARG n 
1 162 HIS n 
1 163 SER n 
1 164 PHE n 
1 165 SER n 
1 166 ARG n 
1 167 ARG n 
1 168 SER n 
1 169 GLY n 
1 170 VAL n 
1 171 PRO n 
1 172 GLY n 
1 173 THR n 
1 174 GLU n 
1 175 GLY n 
1 176 TRP n 
1 177 ILE n 
1 178 ALA n 
1 179 PRO n 
1 180 GLU n 
1 181 MET n 
1 182 LEU n 
1 183 SER n 
1 184 GLU n 
1 185 ASP n 
1 186 CYS n 
1 187 LYS n 
1 188 GLU n 
1 189 ASN n 
1 190 PRO n 
1 191 THR n 
1 192 TYR n 
1 193 THR n 
1 194 VAL n 
1 195 ASP n 
1 196 ILE n 
1 197 PHE n 
1 198 SER n 
1 199 ALA n 
1 200 GLY n 
1 201 CYS n 
1 202 VAL n 
1 203 PHE n 
1 204 TYR n 
1 205 TYR n 
1 206 VAL n 
1 207 ILE n 
1 208 SER n 
1 209 GLU n 
1 210 GLY n 
1 211 SER n 
1 212 HIS n 
1 213 PRO n 
1 214 PHE n 
1 215 GLY n 
1 216 LYS n 
1 217 SER n 
1 218 LEU n 
1 219 GLN n 
1 220 ARG n 
1 221 GLN n 
1 222 ALA n 
1 223 ASN n 
1 224 ILE n 
1 225 LEU n 
1 226 LEU n 
1 227 GLY n 
1 228 ALA n 
1 229 CYS n 
1 230 SER n 
1 231 LEU n 
1 232 ASP n 
1 233 CYS n 
1 234 LEU n 
1 235 HIS n 
1 236 PRO n 
1 237 GLU n 
1 238 LYS n 
1 239 HIS n 
1 240 GLU n 
1 241 ASP n 
1 242 VAL n 
1 243 ILE n 
1 244 ALA n 
1 245 ARG n 
1 246 GLU n 
1 247 LEU n 
1 248 ILE n 
1 249 GLU n 
1 250 LYS n 
1 251 MET n 
1 252 ILE n 
1 253 ALA n 
1 254 MET n 
1 255 ASP n 
1 256 PRO n 
1 257 GLN n 
1 258 LYS n 
1 259 ARG n 
1 260 PRO n 
1 261 SER n 
1 262 ALA n 
1 263 LYS n 
1 264 HIS n 
1 265 VAL n 
1 266 LEU n 
1 267 LYS n 
1 268 HIS n 
1 269 PRO n 
1 270 PHE n 
1 271 PHE n 
1 272 TRP n 
1 273 SER n 
1 274 LEU n 
1 275 GLU n 
1 276 LYS n 
1 277 GLN n 
1 278 LEU n 
1 279 GLN n 
1 280 PHE n 
1 281 PHE n 
1 282 GLN n 
1 283 ASP n 
1 284 VAL n 
1 285 SER n 
1 286 ASP n 
1 287 ARG n 
1 288 ILE n 
1 289 GLU n 
1 290 LYS n 
1 291 GLU n 
1 292 SER n 
1 293 LEU n 
1 294 ASP n 
1 295 GLY n 
1 296 PRO n 
1 297 ILE n 
1 298 VAL n 
1 299 LYS n 
1 300 GLN n 
1 301 LEU n 
1 302 GLU n 
1 303 ARG n 
1 304 GLY n 
1 305 GLY n 
1 306 ARG n 
1 307 ALA n 
1 308 VAL n 
1 309 VAL n 
1 310 LYS n 
1 311 MET n 
1 312 ASP n 
1 313 TRP n 
1 314 ARG n 
1 315 GLU n 
1 316 ASN n 
1 317 ILE n 
1 318 THR n 
1 319 VAL n 
1 320 PRO n 
1 321 LEU n 
1 322 GLN n 
1 323 THR n 
1 324 ASP n 
1 325 LEU n 
1 326 ARG n 
1 327 LYS n 
1 328 PHE n 
1 329 ARG n 
1 330 THR n 
1 331 TYR n 
1 332 LYS n 
1 333 GLY n 
1 334 GLY n 
1 335 SER n 
1 336 VAL n 
1 337 ARG n 
1 338 ASP n 
1 339 LEU n 
1 340 LEU n 
1 341 ARG n 
1 342 ALA n 
1 343 MET n 
1 344 ARG n 
1 345 ASN n 
1 346 LYS n 
1 347 LYS n 
1 348 HIS n 
1 349 HIS n 
1 350 TYR n 
1 351 ARG n 
1 352 GLU n 
1 353 LEU n 
1 354 PRO n 
1 355 ALA n 
1 356 GLU n 
1 357 VAL n 
1 358 ARG n 
1 359 GLU n 
1 360 THR n 
1 361 LEU n 
1 362 GLY n 
1 363 SER n 
1 364 LEU n 
1 365 PRO n 
1 366 ASP n 
1 367 ASP n 
1 368 PHE n 
1 369 VAL n 
1 370 CYS n 
1 371 TYR n 
1 372 PHE n 
1 373 THR n 
1 374 SER n 
1 375 ARG n 
1 376 PHE n 
1 377 PRO n 
1 378 HIS n 
1 379 LEU n 
1 380 LEU n 
1 381 ALA n 
1 382 HIS n 
1 383 THR n 
1 384 TYR n 
1 385 ARG n 
1 386 ALA n 
1 387 MET n 
1 388 GLU n 
1 389 LEU n 
1 390 CYS n 
1 391 SER n 
1 392 HIS n 
1 393 GLU n 
1 394 ARG n 
1 395 LEU n 
1 396 PHE n 
1 397 GLN n 
1 398 PRO n 
1 399 TYR n 
1 400 TYR n 
1 401 PHE n 
1 402 HIS n 
1 403 GLU n 
1 404 PRO n 
1 405 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   405 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ERN1, IRE1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               'Fall Armyworm' 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            Sf9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ERN1_HUMAN 
_struct_ref.pdbx_db_accession          O75460 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SVVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTEKDRQFQYIA
IELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPHNILISMPNAHGKIKAMISDFGLCKKLAVG
RHSFSRRSGVPGTEGWIAPEMLSEDCKENPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGACSLDCLHPEKHE
DVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGGRAVVKMDWRENITVP
LQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGSLPDDFVCYFTSRFPHLLAHTYRAMELCSHERLFQPYY
FHEPP
;
_struct_ref.pdbx_align_begin           562 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4YZ9 A 1 ? 405 ? O75460 562 ? 966 ? 562 966 
2 1 4YZ9 B 1 ? 405 ? O75460 562 ? 966 ? 562 966 
3 1 4YZ9 C 1 ? 405 ? O75460 562 ? 966 ? 562 966 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4K7 non-polymer         . '(5R)-2-(3,4-dichlorobenzyl)-N-(4-methylbenzyl)-2,7-diazaspiro[4.5]decane-7-carboxamide' ? 
'C24 H29 Cl2 N3 O' 446.413 
ALA 'L-peptide linking' y ALANINE                                                                                  ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                                 ? 
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                               ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                          ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                 ? 
'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                ? 
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                          ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                  ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                ? 
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                                    ? 'H2 O' 18.015 
ILE 'L-peptide linking' y ISOLEUCINE                                                                               ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                  ? 'C6 H13 N O2' 
131.173 
LYS 'L-peptide linking' y LYSINE                                                                                   ? 
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                               ? 
'C5 H11 N O2 S'    149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                            ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                  ? 'C5 H9 N O2' 
115.130 
SER 'L-peptide linking' y SERINE                                                                                   ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                                ? 'C4 H9 N O3' 
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                               ? 
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                 ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                   ? 'C5 H11 N O2' 
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4YZ9 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.01 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.12 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;Crystals of pIRE1alpha (547 - 977) with GSK2850163 were prepared by mixing pIRE1alpha with 0.5 mM GSK2850163 and incubating overnight on ice. The crystals were grown at 20 C by vapor diffusion in sitting drops containing 2 ul of protein (13 mg/ml in 50 mM Hepes, pH 7.5, 200 mM NaCl, 5 mM DTT, 1 mM EDTA , 0.5 mM GSK2850163, 0.25% DMSO ) and 2 ul reservoir solution containing PEG 3350 (16%-22%), 100 mM Hepes pH 7.0, 200 mM Ca2+ acetate.  The crystals were thick rods that appeared over 2-5 days and reached full size (0.05 X 0.025 X 0.3 mm) in 2 weeks. Seeding was used to improve crystal quality. The pIRE1alpha + GSK2850163 crystals were frozen in a solution of 20% ethylene glycol, 22% PEG 3350, 0.2 M calcium acetate added in a stepwise manner to the protein drop before mounting the crystal on the loop.
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   'from a single crystal' 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX SX-165mm' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-10-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-007' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.54 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            44.870 
_reflns.entry_id                         4YZ9 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.450 
_reflns.d_resolution_low                 29.182 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       59737 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       2 
_reflns.percent_possible_obs             97.200 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.300 
_reflns.pdbx_Rmerge_I_obs                0.073 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.073 
_reflns.pdbx_netI_over_av_sigmaI         22.874 
_reflns.pdbx_netI_over_sigmaI            9.000 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.009 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         377173 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.450 2.540  ? 3.1 ? ? ? 5411 ? 89.700 ? ? ? ? 0.592 ? ? ? ? ? ? ? ? 6.300 ? 0.972 ? ? ? ? 0 1  1 ? ? 
2.540 2.640  ? ?   ? ? ? 5652 ? 93.100 ? ? ? ? 0.450 ? ? ? ? ? ? ? ? 6.200 ? 0.992 ? ? ? ? 0 2  1 ? ? 
2.640 2.760  ? ?   ? ? ? 5823 ? 95.800 ? ? ? ? 0.348 ? ? ? ? ? ? ? ? 6.100 ? 1.043 ? ? ? ? 0 3  1 ? ? 
2.760 2.900  ? ?   ? ? ? 5878 ? 97.000 ? ? ? ? 0.268 ? ? ? ? ? ? ? ? 6.100 ? 1.027 ? ? ? ? 0 4  1 ? ? 
2.900 3.090  ? ?   ? ? ? 6008 ? 98.500 ? ? ? ? 0.180 ? ? ? ? ? ? ? ? 6.100 ? 1.019 ? ? ? ? 0 5  1 ? ? 
3.090 3.320  ? ?   ? ? ? 6028 ? 99.100 ? ? ? ? 0.116 ? ? ? ? ? ? ? ? 6.200 ? 1.011 ? ? ? ? 0 6  1 ? ? 
3.320 3.660  ? ?   ? ? ? 6137 ? 99.400 ? ? ? ? 0.076 ? ? ? ? ? ? ? ? 6.300 ? 1.012 ? ? ? ? 0 7  1 ? ? 
3.660 4.190  ? ?   ? ? ? 6133 ? 99.600 ? ? ? ? 0.062 ? ? ? ? ? ? ? ? 6.400 ? 1.012 ? ? ? ? 0 8  1 ? ? 
4.190 5.270  ? ?   ? ? ? 6199 ? 99.800 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? 6.800 ? 1.000 ? ? ? ? 0 9  1 ? ? 
5.270 30.000 ? ?   ? ? ? 6468 ? 99.500 ? ? ? ? 0.028 ? ? ? ? ? ? ? ? 6.600 ? 1.000 ? ? ? ? 0 10 1 ? ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4YZ9 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     59654 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.182 
_refine.ls_d_res_high                            2.463 
_refine.ls_percent_reflns_obs                    96.69 
_refine.ls_R_factor_obs                          0.2378 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2354 
_refine.ls_R_factor_R_free                       0.2829 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.06 
_refine.ls_number_reflns_R_free                  3016 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      3P23 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       MLHL 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            rqandom 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.35 
_refine.pdbx_overall_phase_error                 33.01 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8931 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         90 
_refine_hist.number_atoms_solvent             80 
_refine_hist.number_atoms_total               9101 
_refine_hist.d_res_high                       2.463 
_refine_hist.d_res_low                        29.182 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 9280  'X-RAY DIFFRACTION' ? 
f_angle_d          0.663  ? ? 12591 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 14.045 ? ? 3386  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.038  ? ? 1375  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 1624  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 2.4633 2.5018  2095 0.3189 79.00  0.3830 . . 108 . . . . 
'X-RAY DIFFRACTION' . 2.5018 2.5428  2319 0.3037 89.00  0.3417 . . 130 . . . . 
'X-RAY DIFFRACTION' . 2.5428 2.5866  2432 0.3031 92.00  0.3315 . . 131 . . . . 
'X-RAY DIFFRACTION' . 2.5866 2.6336  2416 0.2950 93.00  0.3936 . . 125 . . . . 
'X-RAY DIFFRACTION' . 2.6336 2.6843  2552 0.2932 95.00  0.3711 . . 132 . . . . 
'X-RAY DIFFRACTION' . 2.6843 2.7390  2477 0.2888 96.00  0.3235 . . 137 . . . . 
'X-RAY DIFFRACTION' . 2.7390 2.7985  2527 0.2901 96.00  0.3441 . . 135 . . . . 
'X-RAY DIFFRACTION' . 2.7985 2.8636  2567 0.3090 98.00  0.3217 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.8636 2.9351  2589 0.2853 98.00  0.3447 . . 140 . . . . 
'X-RAY DIFFRACTION' . 2.9351 3.0144  2571 0.2861 98.00  0.3074 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.0144 3.1030  2620 0.2756 99.00  0.3238 . . 129 . . . . 
'X-RAY DIFFRACTION' . 3.1030 3.2030  2609 0.2820 99.00  0.3116 . . 147 . . . . 
'X-RAY DIFFRACTION' . 3.2030 3.3174  2634 0.2746 99.00  0.2947 . . 112 . . . . 
'X-RAY DIFFRACTION' . 3.3174 3.4500  2636 0.2708 99.00  0.3614 . . 158 . . . . 
'X-RAY DIFFRACTION' . 3.4500 3.6067  2637 0.2548 99.00  0.3059 . . 139 . . . . 
'X-RAY DIFFRACTION' . 3.6067 3.7965  2648 0.2336 100.00 0.3122 . . 160 . . . . 
'X-RAY DIFFRACTION' . 3.7965 4.0338  2667 0.2115 100.00 0.2924 . . 137 . . . . 
'X-RAY DIFFRACTION' . 4.0338 4.3443  2657 0.2041 100.00 0.2125 . . 144 . . . . 
'X-RAY DIFFRACTION' . 4.3443 4.7798  2684 0.1843 100.00 0.2424 . . 135 . . . . 
'X-RAY DIFFRACTION' . 4.7798 5.4675  2719 0.1956 100.00 0.2316 . . 142 . . . . 
'X-RAY DIFFRACTION' . 5.4675 6.8736  2756 0.2179 100.00 0.2606 . . 141 . . . . 
'X-RAY DIFFRACTION' . 6.8736 29.1840 2826 0.1849 98.00  0.2173 . . 153 . . . . 
# 
_struct.entry_id                     4YZ9 
_struct.title                        
'Crystal Structure of human phosphorylated IRE1alpha in complex with a type III kinase inhibitor (GSK2850163A)' 
_struct.pdbx_descriptor              'Serine/threonine-protein kinase/endoribonuclease IRE1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4YZ9 
_struct_keywords.text            'active, inhibitor, complex, IRE1, TRANSFERASE-TRANSFERASE INHIBITOR complex' 
_struct_keywords.pdbx_keywords   'TRANSFERASE/TRANSFERASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 LEU A 41  ? GLU A 43  ? LEU A 602 GLU A 604 5 ? 3  
HELX_P HELX_P2  AA2 CYS A 44  ? GLU A 57  ? CYS A 605 GLU A 618 1 ? 14 
HELX_P HELX_P3  AA3 LEU A 88  ? LYS A 95  ? LEU A 649 LYS A 656 1 ? 8  
HELX_P HELX_P4  AA4 ASP A 96  ? GLY A 101 ? ASP A 657 GLY A 662 5 ? 6  
HELX_P HELX_P5  AA5 GLU A 103 ? LEU A 121 ? GLU A 664 LEU A 682 1 ? 19 
HELX_P HELX_P6  AA6 TYR A 192 ? SER A 208 ? TYR A 753 SER A 769 1 ? 17 
HELX_P HELX_P7  AA7 LYS A 216 ? LEU A 218 ? LYS A 777 LEU A 779 5 ? 3  
HELX_P HELX_P8  AA8 GLN A 219 ? GLY A 227 ? GLN A 780 GLY A 788 1 ? 9  
HELX_P HELX_P9  AA9 LYS A 238 ? ILE A 252 ? LYS A 799 ILE A 813 1 ? 15 
HELX_P HELX_P10 AB1 ASP A 255 ? ARG A 259 ? ASP A 816 ARG A 820 5 ? 5  
HELX_P HELX_P11 AB2 SER A 261 ? LYS A 267 ? SER A 822 LYS A 828 1 ? 7  
HELX_P HELX_P12 AB3 HIS A 268 ? TRP A 272 ? HIS A 829 TRP A 833 5 ? 5  
HELX_P HELX_P13 AB4 SER A 273 ? GLU A 289 ? SER A 834 GLU A 850 1 ? 17 
HELX_P HELX_P14 AB5 GLY A 295 ? GLY A 305 ? GLY A 856 GLY A 866 1 ? 11 
HELX_P HELX_P15 AB6 GLY A 305 ? LYS A 310 ? GLY A 866 LYS A 871 1 ? 6  
HELX_P HELX_P16 AB7 THR A 318 ? LYS A 327 ? THR A 879 LYS A 888 1 ? 10 
HELX_P HELX_P17 AB8 SER A 335 ? HIS A 349 ? SER A 896 HIS A 910 1 ? 15 
HELX_P HELX_P18 AB9 TYR A 350 ? LEU A 353 ? TYR A 911 LEU A 914 5 ? 4  
HELX_P HELX_P19 AC1 PRO A 354 ? GLY A 362 ? PRO A 915 GLY A 923 1 ? 9  
HELX_P HELX_P20 AC2 PRO A 365 ? PHE A 376 ? PRO A 926 PHE A 937 1 ? 12 
HELX_P HELX_P21 AC3 HIS A 378 ? MET A 387 ? HIS A 939 MET A 948 1 ? 10 
HELX_P HELX_P22 AC4 GLU A 388 ? SER A 391 ? GLU A 949 SER A 952 5 ? 4  
HELX_P HELX_P23 AC5 GLU A 393 ? GLN A 397 ? GLU A 954 GLN A 958 5 ? 5  
HELX_P HELX_P24 AC6 LEU B 41  ? GLU B 43  ? LEU B 602 GLU B 604 5 ? 3  
HELX_P HELX_P25 AC7 CYS B 44  ? SER B 58  ? CYS B 605 SER B 619 1 ? 15 
HELX_P HELX_P26 AC8 LEU B 88  ? LYS B 95  ? LEU B 649 LYS B 656 1 ? 8  
HELX_P HELX_P27 AC9 ASP B 96  ? HIS B 99  ? ASP B 657 HIS B 660 5 ? 4  
HELX_P HELX_P28 AD1 GLU B 103 ? LEU B 121 ? GLU B 664 LEU B 682 1 ? 19 
HELX_P HELX_P29 AD2 ALA B 178 ? LEU B 182 ? ALA B 739 LEU B 743 5 ? 5  
HELX_P HELX_P30 AD3 TYR B 192 ? SER B 208 ? TYR B 753 SER B 769 1 ? 17 
HELX_P HELX_P31 AD4 GLN B 219 ? LEU B 226 ? GLN B 780 LEU B 787 1 ? 8  
HELX_P HELX_P32 AD5 LYS B 238 ? ILE B 252 ? LYS B 799 ILE B 813 1 ? 15 
HELX_P HELX_P33 AD6 ASP B 255 ? ARG B 259 ? ASP B 816 ARG B 820 5 ? 5  
HELX_P HELX_P34 AD7 SER B 261 ? HIS B 268 ? SER B 822 HIS B 829 1 ? 8  
HELX_P HELX_P35 AD8 PRO B 269 ? TRP B 272 ? PRO B 830 TRP B 833 5 ? 4  
HELX_P HELX_P36 AD9 SER B 273 ? ILE B 288 ? SER B 834 ILE B 849 1 ? 16 
HELX_P HELX_P37 AE1 GLY B 295 ? GLY B 304 ? GLY B 856 GLY B 865 1 ? 10 
HELX_P HELX_P38 AE2 THR B 318 ? LEU B 325 ? THR B 879 LEU B 886 1 ? 8  
HELX_P HELX_P39 AE3 SER B 335 ? HIS B 349 ? SER B 896 HIS B 910 1 ? 15 
HELX_P HELX_P40 AE4 TYR B 350 ? LEU B 353 ? TYR B 911 LEU B 914 5 ? 4  
HELX_P HELX_P41 AE5 PRO B 354 ? GLY B 362 ? PRO B 915 GLY B 923 1 ? 9  
HELX_P HELX_P42 AE6 PRO B 365 ? PHE B 376 ? PRO B 926 PHE B 937 1 ? 12 
HELX_P HELX_P43 AE7 HIS B 378 ? MET B 387 ? HIS B 939 MET B 948 1 ? 10 
HELX_P HELX_P44 AE8 GLU B 388 ? SER B 391 ? GLU B 949 SER B 952 5 ? 4  
HELX_P HELX_P45 AE9 PHE B 396 ? TYR B 400 ? PHE B 957 TYR B 961 5 ? 5  
HELX_P HELX_P46 AF1 ALA C 20  ? GLY C 22  ? ALA C 581 GLY C 583 5 ? 3  
HELX_P HELX_P47 AF2 LEU C 41  ? GLU C 43  ? LEU C 602 GLU C 604 5 ? 3  
HELX_P HELX_P48 AF3 CYS C 44  ? SER C 58  ? CYS C 605 SER C 619 1 ? 15 
HELX_P HELX_P49 AF4 LEU C 88  ? GLN C 94  ? LEU C 649 GLN C 655 1 ? 7  
HELX_P HELX_P50 AF5 GLU C 103 ? LEU C 121 ? GLU C 664 LEU C 682 1 ? 19 
HELX_P HELX_P51 AF6 LYS C 129 ? HIS C 131 ? LYS C 690 HIS C 692 5 ? 3  
HELX_P HELX_P52 AF7 ALA C 178 ? SER C 183 ? ALA C 739 SER C 744 1 ? 6  
HELX_P HELX_P53 AF8 TYR C 192 ? SER C 208 ? TYR C 753 SER C 769 1 ? 17 
HELX_P HELX_P54 AF9 GLN C 219 ? GLY C 227 ? GLN C 780 GLY C 788 1 ? 9  
HELX_P HELX_P55 AG1 LYS C 238 ? ILE C 252 ? LYS C 799 ILE C 813 1 ? 15 
HELX_P HELX_P56 AG2 ASP C 255 ? ARG C 259 ? ASP C 816 ARG C 820 5 ? 5  
HELX_P HELX_P57 AG3 SER C 261 ? LYS C 267 ? SER C 822 LYS C 828 1 ? 7  
HELX_P HELX_P58 AG4 HIS C 268 ? TRP C 272 ? HIS C 829 TRP C 833 5 ? 5  
HELX_P HELX_P59 AG5 SER C 273 ? LYS C 290 ? SER C 834 LYS C 851 1 ? 18 
HELX_P HELX_P60 AG6 GLY C 295 ? ARG C 303 ? GLY C 856 ARG C 864 1 ? 9  
HELX_P HELX_P61 AG7 GLY C 304 ? VAL C 309 ? GLY C 865 VAL C 870 1 ? 6  
HELX_P HELX_P62 AG8 THR C 318 ? LYS C 327 ? THR C 879 LYS C 888 1 ? 10 
HELX_P HELX_P63 AG9 SER C 335 ? HIS C 349 ? SER C 896 HIS C 910 1 ? 15 
HELX_P HELX_P64 AH1 TYR C 350 ? LEU C 353 ? TYR C 911 LEU C 914 5 ? 4  
HELX_P HELX_P65 AH2 PRO C 354 ? LEU C 361 ? PRO C 915 LEU C 922 1 ? 8  
HELX_P HELX_P66 AH3 PRO C 365 ? PHE C 376 ? PRO C 926 PHE C 937 1 ? 12 
HELX_P HELX_P67 AH4 HIS C 378 ? MET C 387 ? HIS C 939 MET C 948 1 ? 10 
HELX_P HELX_P68 AH5 GLU C 388 ? SER C 391 ? GLU C 949 SER C 952 5 ? 4  
HELX_P HELX_P69 AH6 GLU C 393 ? TYR C 400 ? GLU C 954 TYR C 961 5 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 364 A . ? LEU 925 A PRO 365 A ? PRO 926 A 1 -14.14 
2 LEU 364 B . ? LEU 925 B PRO 365 B ? PRO 926 B 1 -21.80 
3 LEU 364 C . ? LEU 925 C PRO 365 C ? PRO 926 C 1 -8.62  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 6 ? 
AA4 ? 3 ? 
AA5 ? 3 ? 
AA6 ? 6 ? 
AA7 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
AA3 5 6 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 3   ? ILE A 4   ? VAL A 564 ILE A 565 
AA1 2 ILE A 8   ? GLY A 19  ? ILE A 569 GLY A 580 
AA1 3 THR A 23  ? PHE A 30  ? THR A 584 PHE A 591 
AA1 4 ARG A 33  ? ILE A 40  ? ARG A 594 ILE A 601 
AA1 5 GLN A 77  ? ILE A 81  ? GLN A 638 ILE A 642 
AA1 6 TYR A 67  ? LYS A 72  ? TYR A 628 LYS A 633 
AA2 1 CYS A 84  ? THR A 87  ? CYS A 645 THR A 648 
AA2 2 ILE A 133 ? SER A 136 ? ILE A 694 SER A 697 
AA2 3 ALA A 146 ? ILE A 148 ? ALA A 707 ILE A 709 
AA3 1 VAL B 3   ? ILE B 4   ? VAL B 564 ILE B 565 
AA3 2 ILE B 8   ? GLY B 19  ? ILE B 569 GLY B 580 
AA3 3 THR B 23  ? PHE B 30  ? THR B 584 PHE B 591 
AA3 4 ARG B 33  ? ILE B 40  ? ARG B 594 ILE B 601 
AA3 5 GLN B 77  ? GLU B 82  ? GLN B 638 GLU B 643 
AA3 6 TYR B 67  ? LYS B 72  ? TYR B 628 LYS B 633 
AA4 1 VAL B 3   ? ILE B 4   ? VAL B 564 ILE B 565 
AA4 2 ILE B 8   ? GLY B 19  ? ILE B 569 GLY B 580 
AA4 3 GLY B 152 ? LEU B 153 ? GLY B 713 LEU B 714 
AA5 1 CYS B 84  ? THR B 87  ? CYS B 645 THR B 648 
AA5 2 ILE B 133 ? SER B 136 ? ILE B 694 SER B 697 
AA5 3 ALA B 146 ? ILE B 148 ? ALA B 707 ILE B 709 
AA6 1 VAL C 3   ? VAL C 5   ? VAL C 564 VAL C 566 
AA6 2 ILE C 8   ? GLY C 19  ? ILE C 569 GLY C 580 
AA6 3 THR C 23  ? PHE C 30  ? THR C 584 PHE C 591 
AA6 4 ARG C 33  ? ILE C 40  ? ARG C 594 ILE C 601 
AA6 5 GLN C 77  ? GLU C 82  ? GLN C 638 GLU C 643 
AA6 6 TYR C 67  ? LYS C 72  ? TYR C 628 LYS C 633 
AA7 1 ALA C 86  ? THR C 87  ? ALA C 647 THR C 648 
AA7 2 ILE C 133 ? ILE C 135 ? ILE C 694 ILE C 696 
AA7 3 ALA C 146 ? ILE C 148 ? ALA C 707 ILE C 709 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A 3   ? N VAL A 564 O PHE A 10  ? O PHE A 571 
AA1 2 3 N LEU A 16  ? N LEU A 577 O VAL A 25  ? O VAL A 586 
AA1 3 4 N TYR A 26  ? N TYR A 587 O VAL A 37  ? O VAL A 598 
AA1 4 5 N ALA A 36  ? N ALA A 597 O ILE A 81  ? O ILE A 642 
AA1 5 6 O TYR A 78  ? O TYR A 639 N GLU A 71  ? N GLU A 632 
AA2 1 2 N ALA A 86  ? N ALA A 647 O ILE A 135 ? O ILE A 696 
AA2 2 3 N LEU A 134 ? N LEU A 695 O MET A 147 ? O MET A 708 
AA3 1 2 N VAL B 3   ? N VAL B 564 O PHE B 10  ? O PHE B 571 
AA3 2 3 N SER B 9   ? N SER B 570 O MET B 29  ? O MET B 590 
AA3 3 4 N ILE B 24  ? N ILE B 585 O ARG B 39  ? O ARG B 600 
AA3 4 5 N LYS B 38  ? N LYS B 599 O ILE B 79  ? O ILE B 640 
AA3 5 6 O TYR B 78  ? O TYR B 639 N GLU B 71  ? N GLU B 632 
AA4 1 2 N VAL B 3   ? N VAL B 564 O PHE B 10  ? O PHE B 571 
AA4 2 3 N HIS B 18  ? N HIS B 579 O GLY B 152 ? O GLY B 713 
AA5 1 2 N ALA B 86  ? N ALA B 647 O ILE B 135 ? O ILE B 696 
AA5 2 3 N LEU B 134 ? N LEU B 695 O MET B 147 ? O MET B 708 
AA6 1 2 N VAL C 5   ? N VAL C 566 O ILE C 8   ? O ILE C 569 
AA6 2 3 N SER C 9   ? N SER C 570 O MET C 29  ? O MET C 590 
AA6 3 4 N ILE C 24  ? N ILE C 585 O ARG C 39  ? O ARG C 600 
AA6 4 5 N LYS C 38  ? N LYS C 599 O ILE C 79  ? O ILE C 640 
AA6 5 6 O TYR C 78  ? O TYR C 639 N GLU C 71  ? N GLU C 632 
AA7 1 2 N ALA C 86  ? N ALA C 647 O ILE C 135 ? O ILE C 696 
AA7 2 3 N LEU C 134 ? N LEU C 695 O MET C 147 ? O MET C 708 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 4K7 1001 ? 13 'binding site for residue 4K7 A 1001' 
AC2 Software B 4K7 1001 ? 9  'binding site for residue 4K7 B 1001' 
AC3 Software C 4K7 1001 ? 11 'binding site for residue 4K7 C 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 ALA A 20  ? ALA A 581 . ? 1_555 ? 
2  AC1 13 THR A 23  ? THR A 584 . ? 1_555 ? 
3  AC1 13 LYS A 38  ? LYS A 599 . ? 1_555 ? 
4  AC1 13 CYS A 44  ? CYS A 605 . ? 1_555 ? 
5  AC1 13 ALA A 48  ? ALA A 609 . ? 1_555 ? 
6  AC1 13 GLU A 51  ? GLU A 612 . ? 1_555 ? 
7  AC1 13 VAL A 52  ? VAL A 613 . ? 1_555 ? 
8  AC1 13 ILE A 65  ? ILE A 626 . ? 1_555 ? 
9  AC1 13 LEU A 118 ? LEU A 679 . ? 1_555 ? 
10 AC1 13 ILE A 123 ? ILE A 684 . ? 1_555 ? 
11 AC1 13 VAL A 124 ? VAL A 685 . ? 1_555 ? 
12 AC1 13 HIS A 125 ? HIS A 686 . ? 1_555 ? 
13 AC1 13 ASP A 150 ? ASP A 711 . ? 1_555 ? 
14 AC2 9  ALA B 20  ? ALA B 581 . ? 1_555 ? 
15 AC2 9  THR B 23  ? THR B 584 . ? 1_555 ? 
16 AC2 9  LYS B 38  ? LYS B 599 . ? 1_555 ? 
17 AC2 9  ALA B 48  ? ALA B 609 . ? 1_555 ? 
18 AC2 9  GLU B 51  ? GLU B 612 . ? 1_555 ? 
19 AC2 9  ILE B 65  ? ILE B 626 . ? 1_555 ? 
20 AC2 9  HIS B 125 ? HIS B 686 . ? 1_555 ? 
21 AC2 9  ARG B 126 ? ARG B 687 . ? 1_555 ? 
22 AC2 9  ASP B 150 ? ASP B 711 . ? 1_555 ? 
23 AC3 11 ALA C 20  ? ALA C 581 . ? 1_555 ? 
24 AC3 11 THR C 23  ? THR C 584 . ? 1_555 ? 
25 AC3 11 LYS C 38  ? LYS C 599 . ? 1_555 ? 
26 AC3 11 ALA C 48  ? ALA C 609 . ? 1_555 ? 
27 AC3 11 GLU C 51  ? GLU C 612 . ? 1_555 ? 
28 AC3 11 VAL C 52  ? VAL C 613 . ? 1_555 ? 
29 AC3 11 ILE C 65  ? ILE C 626 . ? 1_555 ? 
30 AC3 11 ILE C 123 ? ILE C 684 . ? 1_555 ? 
31 AC3 11 VAL C 124 ? VAL C 685 . ? 1_555 ? 
32 AC3 11 HIS C 125 ? HIS C 686 . ? 1_555 ? 
33 AC3 11 ASP C 150 ? ASP C 711 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4YZ9 
_atom_sites.fract_transf_matrix[1][1]   0.004098 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012859 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011323 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . SER A 1 1   ? -90.626  8.903   -3.228  1.00 68.25  ? 562  SER A N    1 
ATOM   2     C  CA   . SER A 1 1   ? -91.041  9.778   -4.318  1.00 70.65  ? 562  SER A CA   1 
ATOM   3     C  C    . SER A 1 1   ? -90.118  9.625   -5.522  1.00 63.14  ? 562  SER A C    1 
ATOM   4     O  O    . SER A 1 1   ? -88.940  9.306   -5.374  1.00 55.97  ? 562  SER A O    1 
ATOM   5     C  CB   . SER A 1 1   ? -91.058  11.236  -3.856  1.00 57.72  ? 562  SER A CB   1 
ATOM   6     H  HA   . SER A 1 1   ? -91.939  9.538   -4.594  1.00 84.78  ? 562  SER A HA   1 
ATOM   7     N  N    . VAL A 1 2   ? -90.665  9.845   -6.717  1.00 64.39  ? 563  VAL A N    1 
ATOM   8     C  CA   . VAL A 1 2   ? -89.900  9.749   -7.956  1.00 51.70  ? 563  VAL A CA   1 
ATOM   9     C  C    . VAL A 1 2   ? -90.424  10.802  -8.923  1.00 51.06  ? 563  VAL A C    1 
ATOM   10    O  O    . VAL A 1 2   ? -91.600  11.169  -8.890  1.00 60.39  ? 563  VAL A O    1 
ATOM   11    C  CB   . VAL A 1 2   ? -89.992  8.336   -8.583  1.00 63.02  ? 563  VAL A CB   1 
ATOM   12    C  CG1  . VAL A 1 2   ? -89.044  8.215   -9.778  1.00 53.91  ? 563  VAL A CG1  1 
ATOM   13    C  CG2  . VAL A 1 2   ? -89.680  7.259   -7.547  1.00 66.12  ? 563  VAL A CG2  1 
ATOM   14    H  H    . VAL A 1 2   ? -91.490  10.055  -6.837  1.00 77.26  ? 563  VAL A H    1 
ATOM   15    H  HA   . VAL A 1 2   ? -88.967  9.941   -7.772  1.00 62.04  ? 563  VAL A HA   1 
ATOM   16    H  HB   . VAL A 1 2   ? -90.897  8.191   -8.903  1.00 75.62  ? 563  VAL A HB   1 
ATOM   17    H  HG11 . VAL A 1 2   ? -89.121  7.323   -10.152 1.00 64.70  ? 563  VAL A HG11 1 
ATOM   18    H  HG12 . VAL A 1 2   ? -89.290  8.876   -10.444 1.00 64.70  ? 563  VAL A HG12 1 
ATOM   19    H  HG13 . VAL A 1 2   ? -88.136  8.371   -9.476  1.00 64.70  ? 563  VAL A HG13 1 
ATOM   20    H  HG21 . VAL A 1 2   ? -89.746  6.388   -7.968  1.00 79.34  ? 563  VAL A HG21 1 
ATOM   21    H  HG22 . VAL A 1 2   ? -88.781  7.397   -7.210  1.00 79.34  ? 563  VAL A HG22 1 
ATOM   22    H  HG23 . VAL A 1 2   ? -90.320  7.325   -6.821  1.00 79.34  ? 563  VAL A HG23 1 
ATOM   23    N  N    . VAL A 1 3   ? -89.538  11.291  -9.787  1.00 44.39  ? 564  VAL A N    1 
ATOM   24    C  CA   . VAL A 1 3   ? -89.894  12.215  -10.857 1.00 50.64  ? 564  VAL A CA   1 
ATOM   25    C  C    . VAL A 1 3   ? -89.419  11.610  -12.169 1.00 42.33  ? 564  VAL A C    1 
ATOM   26    O  O    . VAL A 1 3   ? -88.242  11.257  -12.303 1.00 61.46  ? 564  VAL A O    1 
ATOM   27    C  CB   . VAL A 1 3   ? -89.279  13.609  -10.632 1.00 47.88  ? 564  VAL A CB   1 
ATOM   28    C  CG1  . VAL A 1 3   ? -89.466  14.490  -11.859 1.00 43.10  ? 564  VAL A CG1  1 
ATOM   29    C  CG2  . VAL A 1 3   ? -89.903  14.259  -9.414  1.00 43.65  ? 564  VAL A CG2  1 
ATOM   30    H  H    . VAL A 1 3   ? -88.700  11.095  -9.771  1.00 53.27  ? 564  VAL A H    1 
ATOM   31    H  HA   . VAL A 1 3   ? -90.858  12.308  -10.894 1.00 60.76  ? 564  VAL A HA   1 
ATOM   32    H  HB   . VAL A 1 3   ? -88.327  13.514  -10.470 1.00 57.46  ? 564  VAL A HB   1 
ATOM   33    H  HG11 . VAL A 1 3   ? -89.069  15.358  -11.687 1.00 51.72  ? 564  VAL A HG11 1 
ATOM   34    H  HG12 . VAL A 1 3   ? -89.030  14.071  -12.618 1.00 51.72  ? 564  VAL A HG12 1 
ATOM   35    H  HG13 . VAL A 1 3   ? -90.415  14.588  -12.035 1.00 51.72  ? 564  VAL A HG13 1 
ATOM   36    H  HG21 . VAL A 1 3   ? -89.507  15.135  -9.286  1.00 52.38  ? 564  VAL A HG21 1 
ATOM   37    H  HG22 . VAL A 1 3   ? -90.859  14.346  -9.557  1.00 52.38  ? 564  VAL A HG22 1 
ATOM   38    H  HG23 . VAL A 1 3   ? -89.734  13.702  -8.638  1.00 52.38  ? 564  VAL A HG23 1 
ATOM   39    N  N    . ILE A 1 4   ? -90.336  11.473  -13.122 1.00 42.49  ? 565  ILE A N    1 
ATOM   40    C  CA   . ILE A 1 4   ? -90.039  10.928  -14.443 1.00 43.77  ? 565  ILE A CA   1 
ATOM   41    C  C    . ILE A 1 4   ? -90.249  12.055  -15.447 1.00 47.86  ? 565  ILE A C    1 
ATOM   42    O  O    . ILE A 1 4   ? -91.390  12.454  -15.710 1.00 63.43  ? 565  ILE A O    1 
ATOM   43    C  CB   . ILE A 1 4   ? -90.935  9.720   -14.763 1.00 43.12  ? 565  ILE A CB   1 
ATOM   44    C  CG1  . ILE A 1 4   ? -90.847  8.677   -13.641 1.00 41.10  ? 565  ILE A CG1  1 
ATOM   45    C  CG2  . ILE A 1 4   ? -90.556  9.117   -16.102 1.00 36.06  ? 565  ILE A CG2  1 
ATOM   46    C  CD1  . ILE A 1 4   ? -91.862  7.567   -13.755 1.00 60.74  ? 565  ILE A CD1  1 
ATOM   47    H  H    . ILE A 1 4   ? -91.161  11.696  -13.024 1.00 50.99  ? 565  ILE A H    1 
ATOM   48    H  HA   . ILE A 1 4   ? -89.111  10.646  -14.480 1.00 52.52  ? 565  ILE A HA   1 
ATOM   49    H  HB   . ILE A 1 4   ? -91.852  10.029  -14.819 1.00 51.74  ? 565  ILE A HB   1 
ATOM   50    H  HG12 . ILE A 1 4   ? -89.965  8.274   -13.657 1.00 49.32  ? 565  ILE A HG12 1 
ATOM   51    H  HG13 . ILE A 1 4   ? -90.990  9.121   -12.790 1.00 49.32  ? 565  ILE A HG13 1 
ATOM   52    H  HG21 . ILE A 1 4   ? -91.134  8.358   -16.280 1.00 43.27  ? 565  ILE A HG21 1 
ATOM   53    H  HG22 . ILE A 1 4   ? -90.668  9.788   -16.793 1.00 43.27  ? 565  ILE A HG22 1 
ATOM   54    H  HG23 . ILE A 1 4   ? -89.631  8.827   -16.067 1.00 43.27  ? 565  ILE A HG23 1 
ATOM   55    H  HD11 . ILE A 1 4   ? -91.743  6.953   -13.014 1.00 72.89  ? 565  ILE A HD11 1 
ATOM   56    H  HD12 . ILE A 1 4   ? -92.753  7.950   -13.728 1.00 72.89  ? 565  ILE A HD12 1 
ATOM   57    H  HD13 . ILE A 1 4   ? -91.727  7.102   -14.595 1.00 72.89  ? 565  ILE A HD13 1 
ATOM   58    N  N    . VAL A 1 5   ? -89.148  12.595  -15.982 1.00 59.82  ? 566  VAL A N    1 
ATOM   59    C  CA   . VAL A 1 5   ? -89.204  13.616  -17.026 1.00 64.31  ? 566  VAL A CA   1 
ATOM   60    C  C    . VAL A 1 5   ? -88.963  13.052  -18.426 1.00 53.38  ? 566  VAL A C    1 
ATOM   61    O  O    . VAL A 1 5   ? -89.117  13.783  -19.413 1.00 93.48  ? 566  VAL A O    1 
ATOM   62    C  CB   . VAL A 1 5   ? -88.209  14.748  -16.694 1.00 48.17  ? 566  VAL A CB   1 
ATOM   63    C  CG1  . VAL A 1 5   ? -88.293  15.901  -17.700 1.00 55.21  ? 566  VAL A CG1  1 
ATOM   64    C  CG2  . VAL A 1 5   ? -88.500  15.273  -15.293 1.00 55.03  ? 566  VAL A CG2  1 
ATOM   65    H  H    . VAL A 1 5   ? -88.348  12.381  -15.752 1.00 71.78  ? 566  VAL A H    1 
ATOM   66    H  HA   . VAL A 1 5   ? -90.093  14.004  -17.023 1.00 77.17  ? 566  VAL A HA   1 
ATOM   67    H  HB   . VAL A 1 5   ? -87.306  14.396  -16.707 1.00 57.80  ? 566  VAL A HB   1 
ATOM   68    H  HG11 . VAL A 1 5   ? -87.652  16.585  -17.450 1.00 66.25  ? 566  VAL A HG11 1 
ATOM   69    H  HG12 . VAL A 1 5   ? -88.088  15.563  -18.585 1.00 66.25  ? 566  VAL A HG12 1 
ATOM   70    H  HG13 . VAL A 1 5   ? -89.191  16.268  -17.685 1.00 66.25  ? 566  VAL A HG13 1 
ATOM   71    H  HG21 . VAL A 1 5   ? -87.873  15.984  -15.086 1.00 66.04  ? 566  VAL A HG21 1 
ATOM   72    H  HG22 . VAL A 1 5   ? -89.408  15.613  -15.265 1.00 66.04  ? 566  VAL A HG22 1 
ATOM   73    H  HG23 . VAL A 1 5   ? -88.399  14.548  -14.657 1.00 66.04  ? 566  VAL A HG23 1 
ATOM   74    N  N    . GLY A 1 6   ? -88.656  11.769  -18.552 1.00 60.38  ? 567  GLY A N    1 
ATOM   75    C  CA   . GLY A 1 6   ? -88.202  11.264  -19.838 1.00 69.74  ? 567  GLY A CA   1 
ATOM   76    C  C    . GLY A 1 6   ? -87.557  9.910   -19.663 1.00 61.05  ? 567  GLY A C    1 
ATOM   77    O  O    . GLY A 1 6   ? -87.881  9.169   -18.727 1.00 63.98  ? 567  GLY A O    1 
ATOM   78    H  H    . GLY A 1 6   ? -88.700  11.182  -17.925 1.00 72.45  ? 567  GLY A H    1 
ATOM   79    H  HA2  . GLY A 1 6   ? -88.954  11.179  -20.444 1.00 83.69  ? 567  GLY A HA2  1 
ATOM   80    H  HA3  . GLY A 1 6   ? -87.554  11.875  -20.224 1.00 83.69  ? 567  GLY A HA3  1 
ATOM   81    N  N    . LYS A 1 7   ? -86.651  9.580   -20.587 1.00 59.09  ? 568  LYS A N    1 
ATOM   82    C  CA   . LYS A 1 7   ? -85.756  8.459   -20.327 1.00 67.52  ? 568  LYS A CA   1 
ATOM   83    C  C    . LYS A 1 7   ? -85.042  8.654   -18.998 1.00 46.77  ? 568  LYS A C    1 
ATOM   84    O  O    . LYS A 1 7   ? -84.678  7.675   -18.333 1.00 71.76  ? 568  LYS A O    1 
ATOM   85    C  CB   . LYS A 1 7   ? -84.747  8.308   -21.464 1.00 59.54  ? 568  LYS A CB   1 
ATOM   86    C  CG   . LYS A 1 7   ? -84.406  6.863   -21.816 1.00 87.05  ? 568  LYS A CG   1 
ATOM   87    H  H    . LYS A 1 7   ? -86.539  9.974   -21.344 1.00 70.91  ? 568  LYS A H    1 
ATOM   88    H  HA   . LYS A 1 7   ? -86.276  7.641   -20.274 1.00 81.03  ? 568  LYS A HA   1 
ATOM   89    H  HB2  . LYS A 1 7   ? -85.111  8.727   -22.259 1.00 71.45  ? 568  LYS A HB2  1 
ATOM   90    H  HB3  . LYS A 1 7   ? -83.924  8.752   -21.208 1.00 71.45  ? 568  LYS A HB3  1 
ATOM   91    H  HG2  . LYS A 1 7   ? -83.937  6.848   -22.665 1.00 104.46 ? 568  LYS A HG2  1 
ATOM   92    H  HG3  . LYS A 1 7   ? -85.227  6.351   -21.880 1.00 104.46 ? 568  LYS A HG3  1 
ATOM   93    N  N    . ILE A 1 8   ? -84.845  9.909   -18.595 1.00 37.71  ? 569  ILE A N    1 
ATOM   94    C  CA   . ILE A 1 8   ? -84.278  10.232  -17.293 1.00 56.05  ? 569  ILE A CA   1 
ATOM   95    C  C    . ILE A 1 8   ? -85.365  10.188  -16.230 1.00 38.37  ? 569  ILE A C    1 
ATOM   96    O  O    . ILE A 1 8   ? -86.525  10.533  -16.477 1.00 62.71  ? 569  ILE A O    1 
ATOM   97    C  CB   . ILE A 1 8   ? -83.603  11.618  -17.332 1.00 36.38  ? 569  ILE A CB   1 
ATOM   98    C  CG1  . ILE A 1 8   ? -82.398  11.605  -18.282 1.00 51.28  ? 569  ILE A CG1  1 
ATOM   99    C  CG2  . ILE A 1 8   ? -83.174  12.046  -15.925 1.00 34.04  ? 569  ILE A CG2  1 
ATOM   100   C  CD1  . ILE A 1 8   ? -81.793  12.981  -18.540 1.00 44.89  ? 569  ILE A CD1  1 
ATOM   101   H  H    . ILE A 1 8   ? -85.037  10.600  -19.069 1.00 45.25  ? 569  ILE A H    1 
ATOM   102   H  HA   . ILE A 1 8   ? -83.604  9.573   -17.066 1.00 67.26  ? 569  ILE A HA   1 
ATOM   103   H  HB   . ILE A 1 8   ? -84.248  12.262  -17.665 1.00 43.65  ? 569  ILE A HB   1 
ATOM   104   H  HG12 . ILE A 1 8   ? -81.705  11.044  -17.899 1.00 61.53  ? 569  ILE A HG12 1 
ATOM   105   H  HG13 . ILE A 1 8   ? -82.679  11.241  -19.137 1.00 61.53  ? 569  ILE A HG13 1 
ATOM   106   H  HG21 . ILE A 1 8   ? -82.753  12.918  -15.975 1.00 40.85  ? 569  ILE A HG21 1 
ATOM   107   H  HG22 . ILE A 1 8   ? -83.958  12.088  -15.355 1.00 40.85  ? 569  ILE A HG22 1 
ATOM   108   H  HG23 . ILE A 1 8   ? -82.546  11.395  -15.575 1.00 40.85  ? 569  ILE A HG23 1 
ATOM   109   H  HD11 . ILE A 1 8   ? -81.042  12.887  -19.146 1.00 53.87  ? 569  ILE A HD11 1 
ATOM   110   H  HD12 . ILE A 1 8   ? -82.469  13.553  -18.936 1.00 53.87  ? 569  ILE A HD12 1 
ATOM   111   H  HD13 . ILE A 1 8   ? -81.494  13.357  -17.697 1.00 53.87  ? 569  ILE A HD13 1 
ATOM   112   N  N    . SER A 1 9   ? -84.980  9.765   -15.027 1.00 45.48  ? 570  SER A N    1 
ATOM   113   C  CA   . SER A 1 9   ? -85.850  9.791   -13.864 1.00 40.91  ? 570  SER A CA   1 
ATOM   114   C  C    . SER A 1 9   ? -84.962  9.930   -12.642 1.00 36.40  ? 570  SER A C    1 
ATOM   115   O  O    . SER A 1 9   ? -83.801  9.518   -12.666 1.00 43.04  ? 570  SER A O    1 
ATOM   116   C  CB   . SER A 1 9   ? -86.710  8.526   -13.757 1.00 50.96  ? 570  SER A CB   1 
ATOM   117   O  OG   . SER A 1 9   ? -85.894  7.400   -13.497 1.00 49.76  ? 570  SER A OG   1 
ATOM   118   H  H    . SER A 1 9   ? -84.197  9.451   -14.861 1.00 54.58  ? 570  SER A H    1 
ATOM   119   H  HA   . SER A 1 9   ? -86.436  10.563  -13.911 1.00 49.10  ? 570  SER A HA   1 
ATOM   120   H  HB2  . SER A 1 9   ? -87.344  8.634   -13.031 1.00 61.15  ? 570  SER A HB2  1 
ATOM   121   H  HB3  . SER A 1 9   ? -87.182  8.391   -14.594 1.00 61.15  ? 570  SER A HB3  1 
ATOM   122   H  HG   . SER A 1 9   ? -86.367  6.709   -13.439 1.00 59.71  ? 570  SER A HG   1 
ATOM   123   N  N    . PHE A 1 10  ? -85.505  10.509  -11.576 1.00 37.67  ? 571  PHE A N    1 
ATOM   124   C  CA   . PHE A 1 10  ? -84.706  10.752  -10.384 1.00 47.31  ? 571  PHE A CA   1 
ATOM   125   C  C    . PHE A 1 10  ? -85.624  10.826  -9.173  1.00 39.78  ? 571  PHE A C    1 
ATOM   126   O  O    . PHE A 1 10  ? -86.850  10.780  -9.290  1.00 54.47  ? 571  PHE A O    1 
ATOM   127   C  CB   . PHE A 1 10  ? -83.871  12.028  -10.533 1.00 47.77  ? 571  PHE A CB   1 
ATOM   128   C  CG   . PHE A 1 10  ? -84.683  13.295  -10.541 1.00 45.54  ? 571  PHE A CG   1 
ATOM   129   C  CD1  . PHE A 1 10  ? -85.209  13.793  -11.724 1.00 44.97  ? 571  PHE A CD1  1 
ATOM   130   C  CD2  . PHE A 1 10  ? -84.911  13.998  -9.368  1.00 47.93  ? 571  PHE A CD2  1 
ATOM   131   C  CE1  . PHE A 1 10  ? -85.951  14.964  -11.732 1.00 44.44  ? 571  PHE A CE1  1 
ATOM   132   C  CE2  . PHE A 1 10  ? -85.655  15.168  -9.375  1.00 45.32  ? 571  PHE A CE2  1 
ATOM   133   C  CZ   . PHE A 1 10  ? -86.169  15.649  -10.558 1.00 33.51  ? 571  PHE A CZ   1 
ATOM   134   H  H    . PHE A 1 10  ? -86.323  10.767  -11.519 1.00 45.20  ? 571  PHE A H    1 
ATOM   135   H  HA   . PHE A 1 10  ? -84.097  10.008  -10.254 1.00 56.78  ? 571  PHE A HA   1 
ATOM   136   H  HB2  . PHE A 1 10  ? -83.248  12.081  -9.791  1.00 57.33  ? 571  PHE A HB2  1 
ATOM   137   H  HB3  . PHE A 1 10  ? -83.382  11.985  -11.370 1.00 57.33  ? 571  PHE A HB3  1 
ATOM   138   H  HD1  . PHE A 1 10  ? -85.062  13.336  -12.520 1.00 53.96  ? 571  PHE A HD1  1 
ATOM   139   H  HD2  . PHE A 1 10  ? -84.564  13.678  -8.567  1.00 57.52  ? 571  PHE A HD2  1 
ATOM   140   H  HE1  . PHE A 1 10  ? -86.300  15.287  -12.531 1.00 53.33  ? 571  PHE A HE1  1 
ATOM   141   H  HE2  . PHE A 1 10  ? -85.802  15.630  -8.582  1.00 54.39  ? 571  PHE A HE2  1 
ATOM   142   H  HZ   . PHE A 1 10  ? -86.669  16.433  -10.563 1.00 40.21  ? 571  PHE A HZ   1 
ATOM   143   N  N    . CYS A 1 11  ? -85.008  10.976  -8.009  1.00 45.31  ? 572  CYS A N    1 
ATOM   144   C  CA   . CYS A 1 11  ? -85.707  11.028  -6.726  1.00 55.90  ? 572  CYS A CA   1 
ATOM   145   C  C    . CYS A 1 11  ? -85.497  12.400  -6.099  1.00 53.59  ? 572  CYS A C    1 
ATOM   146   O  O    . CYS A 1 11  ? -84.350  12.744  -5.753  1.00 54.14  ? 572  CYS A O    1 
ATOM   147   C  CB   . CYS A 1 11  ? -85.191  9.934   -5.792  1.00 51.51  ? 572  CYS A CB   1 
ATOM   148   S  SG   . CYS A 1 11  ? -85.798  10.069  -4.087  1.00 66.83  ? 572  CYS A SG   1 
ATOM   149   H  H    . CYS A 1 11  ? -84.155  11.052  -7.931  1.00 54.37  ? 572  CYS A H    1 
ATOM   150   H  HA   . CYS A 1 11  ? -86.657  10.894  -6.866  1.00 67.08  ? 572  CYS A HA   1 
ATOM   151   H  HB2  . CYS A 1 11  ? -85.471  9.072   -6.138  1.00 61.81  ? 572  CYS A HB2  1 
ATOM   152   H  HB3  . CYS A 1 11  ? -84.223  9.977   -5.765  1.00 61.81  ? 572  CYS A HB3  1 
ATOM   153   H  HG   . CYS A 1 11  ? -86.996  10.001  -4.092  1.00 80.20  ? 572  CYS A HG   1 
ATOM   154   N  N    . PRO A 1 12  ? -86.542  13.216  -5.917  1.00 60.36  ? 573  PRO A N    1 
ATOM   155   C  CA   . PRO A 1 12  ? -86.319  14.554  -5.341  1.00 48.92  ? 573  PRO A CA   1 
ATOM   156   C  C    . PRO A 1 12  ? -85.878  14.517  -3.892  1.00 55.66  ? 573  PRO A C    1 
ATOM   157   O  O    . PRO A 1 12  ? -85.174  15.434  -3.450  1.00 70.96  ? 573  PRO A O    1 
ATOM   158   C  CB   . PRO A 1 12  ? -87.685  15.241  -5.487  1.00 50.83  ? 573  PRO A CB   1 
ATOM   159   C  CG   . PRO A 1 12  ? -88.465  14.391  -6.419  1.00 46.84  ? 573  PRO A CG   1 
ATOM   160   C  CD   . PRO A 1 12  ? -87.957  13.002  -6.255  1.00 62.34  ? 573  PRO A CD   1 
ATOM   161   H  HA   . PRO A 1 12  ? -85.661  15.038  -5.863  1.00 58.71  ? 573  PRO A HA   1 
ATOM   162   H  HB2  . PRO A 1 12  ? -88.120  15.286  -4.621  1.00 60.99  ? 573  PRO A HB2  1 
ATOM   163   H  HB3  . PRO A 1 12  ? -87.564  16.130  -5.856  1.00 60.99  ? 573  PRO A HB3  1 
ATOM   164   H  HG2  . PRO A 1 12  ? -89.406  14.437  -6.187  1.00 56.21  ? 573  PRO A HG2  1 
ATOM   165   H  HG3  . PRO A 1 12  ? -88.325  14.697  -7.329  1.00 56.21  ? 573  PRO A HG3  1 
ATOM   166   H  HD2  . PRO A 1 12  ? -88.417  12.555  -5.527  1.00 74.80  ? 573  PRO A HD2  1 
ATOM   167   H  HD3  . PRO A 1 12  ? -88.038  12.509  -7.087  1.00 74.80  ? 573  PRO A HD3  1 
ATOM   168   N  N    . LYS A 1 13  ? -86.270  13.490  -3.136  1.00 57.65  ? 574  LYS A N    1 
ATOM   169   C  CA   . LYS A 1 13  ? -85.904  13.421  -1.728  1.00 64.11  ? 574  LYS A CA   1 
ATOM   170   C  C    . LYS A 1 13  ? -84.437  13.070  -1.529  1.00 63.72  ? 574  LYS A C    1 
ATOM   171   O  O    . LYS A 1 13  ? -83.920  13.246  -0.420  1.00 61.71  ? 574  LYS A O    1 
ATOM   172   C  CB   . LYS A 1 13  ? -86.773  12.394  -1.000  1.00 76.67  ? 574  LYS A CB   1 
ATOM   173   C  CG   . LYS A 1 13  ? -88.274  12.612  -1.135  1.00 89.79  ? 574  LYS A CG   1 
ATOM   174   C  CD   . LYS A 1 13  ? -89.030  11.868  -0.037  1.00 102.53 ? 574  LYS A CD   1 
ATOM   175   C  CE   . LYS A 1 13  ? -90.426  11.459  -0.479  1.00 108.87 ? 574  LYS A CE   1 
ATOM   176   N  NZ   . LYS A 1 13  ? -91.304  12.626  -0.787  1.00 113.34 ? 574  LYS A NZ   1 
ATOM   177   H  H    . LYS A 1 13  ? -86.744  12.828  -3.415  1.00 69.18  ? 574  LYS A H    1 
ATOM   178   H  HA   . LYS A 1 13  ? -86.061  14.287  -1.321  1.00 76.93  ? 574  LYS A HA   1 
ATOM   179   H  HB2  . LYS A 1 13  ? -86.572  11.513  -1.354  1.00 92.00  ? 574  LYS A HB2  1 
ATOM   180   H  HB3  . LYS A 1 13  ? -86.557  12.421  -0.055  1.00 92.00  ? 574  LYS A HB3  1 
ATOM   181   H  HG2  . LYS A 1 13  ? -88.471  13.558  -1.055  1.00 107.75 ? 574  LYS A HG2  1 
ATOM   182   H  HG3  . LYS A 1 13  ? -88.573  12.275  -1.994  1.00 107.75 ? 574  LYS A HG3  1 
ATOM   183   H  HD2  . LYS A 1 13  ? -88.540  11.064  0.198   1.00 123.03 ? 574  LYS A HD2  1 
ATOM   184   H  HD3  . LYS A 1 13  ? -89.115  12.445  0.738   1.00 123.03 ? 574  LYS A HD3  1 
ATOM   185   H  HE2  . LYS A 1 13  ? -90.357  10.917  -1.281  1.00 130.65 ? 574  LYS A HE2  1 
ATOM   186   H  HE3  . LYS A 1 13  ? -90.845  10.948  0.231   1.00 130.65 ? 574  LYS A HE3  1 
ATOM   187   H  HZ1  . LYS A 1 13  ? -92.108  12.343  -1.041  1.00 136.01 ? 574  LYS A HZ1  1 
ATOM   188   H  HZ2  . LYS A 1 13  ? -91.392  13.139  -0.064  1.00 136.01 ? 574  LYS A HZ2  1 
ATOM   189   H  HZ3  . LYS A 1 13  ? -90.947  13.110  -1.443  1.00 136.01 ? 574  LYS A HZ3  1 
ATOM   190   N  N    . ASP A 1 14  ? -83.759  12.570  -2.562  1.00 60.34  ? 575  ASP A N    1 
ATOM   191   C  CA   . ASP A 1 14  ? -82.353  12.192  -2.467  1.00 68.51  ? 575  ASP A CA   1 
ATOM   192   C  C    . ASP A 1 14  ? -81.536  13.192  -3.273  1.00 63.10  ? 575  ASP A C    1 
ATOM   193   O  O    . ASP A 1 14  ? -81.542  13.158  -4.509  1.00 60.02  ? 575  ASP A O    1 
ATOM   194   C  CB   . ASP A 1 14  ? -82.141  10.768  -2.975  1.00 58.87  ? 575  ASP A CB   1 
ATOM   195   C  CG   . ASP A 1 14  ? -80.923  10.110  -2.365  1.00 48.76  ? 575  ASP A CG   1 
ATOM   196   O  OD1  . ASP A 1 14  ? -80.026  10.838  -1.889  1.00 66.76  ? 575  ASP A OD1  1 
ATOM   197   O  OD2  . ASP A 1 14  ? -80.866  8.863   -2.359  1.00 68.93  ? 575  ASP A OD2  1 
ATOM   198   H  H    . ASP A 1 14  ? -84.099  12.440  -3.341  1.00 72.41  ? 575  ASP A H    1 
ATOM   199   H  HA   . ASP A 1 14  ? -82.068  12.235  -1.541  1.00 82.21  ? 575  ASP A HA   1 
ATOM   200   H  HB2  . ASP A 1 14  ? -82.917  10.232  -2.748  1.00 70.65  ? 575  ASP A HB2  1 
ATOM   201   H  HB3  . ASP A 1 14  ? -82.021  10.789  -3.937  1.00 70.65  ? 575  ASP A HB3  1 
ATOM   202   N  N    . VAL A 1 15  ? -80.799  14.046  -2.569  1.00 52.44  ? 576  VAL A N    1 
ATOM   203   C  CA   . VAL A 1 15  ? -79.981  15.083  -3.184  1.00 65.55  ? 576  VAL A CA   1 
ATOM   204   C  C    . VAL A 1 15  ? -78.532  14.652  -3.030  1.00 50.35  ? 576  VAL A C    1 
ATOM   205   O  O    . VAL A 1 15  ? -78.056  14.430  -1.910  1.00 57.72  ? 576  VAL A O    1 
ATOM   206   C  CB   . VAL A 1 15  ? -80.238  16.468  -2.562  1.00 59.93  ? 576  VAL A CB   1 
ATOM   207   C  CG1  . VAL A 1 15  ? -80.119  16.435  -1.037  1.00 72.68  ? 576  VAL A CG1  1 
ATOM   208   C  CG2  . VAL A 1 15  ? -79.301  17.516  -3.167  1.00 61.44  ? 576  VAL A CG2  1 
ATOM   209   H  H    . VAL A 1 15  ? -80.756  14.043  -1.710  1.00 62.93  ? 576  VAL A H    1 
ATOM   210   H  HA   . VAL A 1 15  ? -80.185  15.133  -4.131  1.00 78.67  ? 576  VAL A HA   1 
ATOM   211   H  HB   . VAL A 1 15  ? -81.146  16.734  -2.775  1.00 71.91  ? 576  VAL A HB   1 
ATOM   212   H  HG11 . VAL A 1 15  ? -80.288  17.324  -0.688  1.00 87.21  ? 576  VAL A HG11 1 
ATOM   213   H  HG12 . VAL A 1 15  ? -80.772  15.811  -0.683  1.00 87.21  ? 576  VAL A HG12 1 
ATOM   214   H  HG13 . VAL A 1 15  ? -79.224  16.149  -0.796  1.00 87.21  ? 576  VAL A HG13 1 
ATOM   215   H  HG21 . VAL A 1 15  ? -79.485  18.377  -2.758  1.00 73.73  ? 576  VAL A HG21 1 
ATOM   216   H  HG22 . VAL A 1 15  ? -78.383  17.256  -2.994  1.00 73.73  ? 576  VAL A HG22 1 
ATOM   217   H  HG23 . VAL A 1 15  ? -79.457  17.564  -4.123  1.00 73.73  ? 576  VAL A HG23 1 
ATOM   218   N  N    . LEU A 1 16  ? -77.852  14.467  -4.158  1.00 48.54  ? 577  LEU A N    1 
ATOM   219   C  CA   . LEU A 1 16  ? -76.459  14.039  -4.116  1.00 60.07  ? 577  LEU A CA   1 
ATOM   220   C  C    . LEU A 1 16  ? -75.500  15.202  -3.880  1.00 57.33  ? 577  LEU A C    1 
ATOM   221   O  O    . LEU A 1 16  ? -74.492  15.033  -3.189  1.00 69.16  ? 577  LEU A O    1 
ATOM   222   C  CB   . LEU A 1 16  ? -76.113  13.270  -5.395  1.00 56.09  ? 577  LEU A CB   1 
ATOM   223   C  CG   . LEU A 1 16  ? -76.072  11.743  -5.196  1.00 51.57  ? 577  LEU A CG   1 
ATOM   224   C  CD1  . LEU A 1 16  ? -77.280  11.213  -4.417  1.00 69.31  ? 577  LEU A CD1  1 
ATOM   225   C  CD2  . LEU A 1 16  ? -75.981  11.035  -6.528  1.00 45.81  ? 577  LEU A CD2  1 
ATOM   226   H  H    . LEU A 1 16  ? -78.169  14.581  -4.950  1.00 58.25  ? 577  LEU A H    1 
ATOM   227   H  HA   . LEU A 1 16  ? -76.353  13.425  -3.373  1.00 72.08  ? 577  LEU A HA   1 
ATOM   228   H  HB2  . LEU A 1 16  ? -76.783  13.465  -6.069  1.00 67.31  ? 577  LEU A HB2  1 
ATOM   229   H  HB3  . LEU A 1 16  ? -75.239  13.554  -5.706  1.00 67.31  ? 577  LEU A HB3  1 
ATOM   230   H  HG   . LEU A 1 16  ? -75.276  11.519  -4.690  1.00 61.89  ? 577  LEU A HG   1 
ATOM   231   H  HD11 . LEU A 1 16  ? -77.198  10.251  -4.325  1.00 83.18  ? 577  LEU A HD11 1 
ATOM   232   H  HD12 . LEU A 1 16  ? -77.298  11.630  -3.542  1.00 83.18  ? 577  LEU A HD12 1 
ATOM   233   H  HD13 . LEU A 1 16  ? -78.090  11.431  -4.905  1.00 83.18  ? 577  LEU A HD13 1 
ATOM   234   H  HD21 . LEU A 1 16  ? -75.957  10.077  -6.374  1.00 54.97  ? 577  LEU A HD21 1 
ATOM   235   H  HD22 . LEU A 1 16  ? -76.757  11.265  -7.062  1.00 54.97  ? 577  LEU A HD22 1 
ATOM   236   H  HD23 . LEU A 1 16  ? -75.171  11.318  -6.981  1.00 54.97  ? 577  LEU A HD23 1 
ATOM   237   N  N    . GLY A 1 17  ? -75.771  16.376  -4.438  1.00 49.68  ? 578  GLY A N    1 
ATOM   238   C  CA   . GLY A 1 17  ? -74.827  17.468  -4.298  1.00 54.52  ? 578  GLY A CA   1 
ATOM   239   C  C    . GLY A 1 17  ? -75.375  18.773  -4.824  1.00 53.88  ? 578  GLY A C    1 
ATOM   240   O  O    . GLY A 1 17  ? -76.318  18.796  -5.623  1.00 59.75  ? 578  GLY A O    1 
ATOM   241   H  H    . GLY A 1 17  ? -76.477  16.561  -4.892  1.00 59.62  ? 578  GLY A H    1 
ATOM   242   H  HA2  . GLY A 1 17  ? -74.604  17.584  -3.361  1.00 65.42  ? 578  GLY A HA2  1 
ATOM   243   H  HA3  . GLY A 1 17  ? -74.015  17.258  -4.784  1.00 65.42  ? 578  GLY A HA3  1 
ATOM   244   N  N    . HIS A 1 18  ? -74.773  19.870  -4.350  1.00 77.25  ? 579  HIS A N    1 
ATOM   245   C  CA   . HIS A 1 18  ? -75.083  21.213  -4.833  1.00 71.96  ? 579  HIS A CA   1 
ATOM   246   C  C    . HIS A 1 18  ? -73.788  21.936  -5.192  1.00 95.13  ? 579  HIS A C    1 
ATOM   247   O  O    . HIS A 1 18  ? -73.003  22.262  -4.294  1.00 148.54 ? 579  HIS A O    1 
ATOM   248   C  CB   . HIS A 1 18  ? -75.843  21.985  -3.746  1.00 78.46  ? 579  HIS A CB   1 
ATOM   249   C  CG   . HIS A 1 18  ? -76.527  21.103  -2.750  1.00 75.15  ? 579  HIS A CG   1 
ATOM   250   N  ND1  . HIS A 1 18  ? -75.843  20.405  -1.776  1.00 67.38  ? 579  HIS A ND1  1 
ATOM   251   C  CD2  . HIS A 1 18  ? -77.834  20.797  -2.583  1.00 57.97  ? 579  HIS A CD2  1 
ATOM   252   C  CE1  . HIS A 1 18  ? -76.701  19.711  -1.049  1.00 91.26  ? 579  HIS A CE1  1 
ATOM   253   N  NE2  . HIS A 1 18  ? -77.917  19.932  -1.518  1.00 113.64 ? 579  HIS A NE2  1 
ATOM   254   H  H    . HIS A 1 18  ? -74.171  19.857  -3.736  1.00 92.70  ? 579  HIS A H    1 
ATOM   255   H  HA   . HIS A 1 18  ? -75.640  21.157  -5.625  1.00 86.35  ? 579  HIS A HA   1 
ATOM   256   H  HB2  . HIS A 1 18  ? -75.216  22.546  -3.264  1.00 94.15  ? 579  HIS A HB2  1 
ATOM   257   H  HB3  . HIS A 1 18  ? -76.520  22.535  -4.169  1.00 94.15  ? 579  HIS A HB3  1 
ATOM   258   H  HD1  . HIS A 1 18  ? -74.991  20.420  -1.659  1.00 80.86  ? 579  HIS A HD1  1 
ATOM   259   H  HD2  . HIS A 1 18  ? -78.544  21.115  -3.092  1.00 69.56  ? 579  HIS A HD2  1 
ATOM   260   H  HE1  . HIS A 1 18  ? -76.486  19.162  -0.330  1.00 109.51 ? 579  HIS A HE1  1 
ATOM   261   H  HE2  . HIS A 1 18  ? -78.642  19.590  -1.208  1.00 136.37 ? 579  HIS A HE2  1 
ATOM   262   N  N    . GLY A 1 19  ? -73.532  22.150  -6.493  1.00 63.28  ? 580  GLY A N    1 
ATOM   263   C  CA   . GLY A 1 19  ? -72.707  23.264  -6.953  1.00 92.16  ? 580  GLY A CA   1 
ATOM   264   C  C    . GLY A 1 19  ? -73.338  24.424  -7.730  1.00 64.45  ? 580  GLY A C    1 
ATOM   265   O  O    . GLY A 1 19  ? -74.474  24.305  -8.204  1.00 82.44  ? 580  GLY A O    1 
ATOM   266   H  H    . GLY A 1 19  ? -73.831  21.655  -7.130  1.00 75.93  ? 580  GLY A H    1 
ATOM   267   H  HA2  . GLY A 1 19  ? -72.275  23.651  -6.175  1.00 110.59 ? 580  GLY A HA2  1 
ATOM   268   H  HA3  . GLY A 1 19  ? -72.007  22.899  -7.516  1.00 110.59 ? 580  GLY A HA3  1 
ATOM   269   N  N    . ALA A 1 20  ? -72.592  25.534  -7.895  1.00 87.84  ? 581  ALA A N    1 
ATOM   270   C  CA   . ALA A 1 20  ? -72.438  26.211  -9.193  1.00 68.96  ? 581  ALA A CA   1 
ATOM   271   C  C    . ALA A 1 20  ? -73.698  26.651  -9.954  1.00 75.32  ? 581  ALA A C    1 
ATOM   272   O  O    . ALA A 1 20  ? -74.209  25.891  -10.782 1.00 61.98  ? 581  ALA A O    1 
ATOM   273   C  CB   . ALA A 1 20  ? -71.534  25.383  -10.113 1.00 88.68  ? 581  ALA A CB   1 
ATOM   274   H  H    . ALA A 1 20  ? -72.160  25.917  -7.257  1.00 105.41 ? 581  ALA A H    1 
ATOM   275   H  HA   . ALA A 1 20  ? -71.949  27.030  -9.015  1.00 82.75  ? 581  ALA A HA   1 
ATOM   276   H  HB1  . ALA A 1 20  ? -71.443  25.842  -10.962 1.00 106.41 ? 581  ALA A HB1  1 
ATOM   277   H  HB2  . ALA A 1 20  ? -70.664  25.284  -9.695  1.00 106.41 ? 581  ALA A HB2  1 
ATOM   278   H  HB3  . ALA A 1 20  ? -71.937  24.511  -10.249 1.00 106.41 ? 581  ALA A HB3  1 
ATOM   279   N  N    . GLU A 1 21  ? -74.248  27.837  -9.631  1.00 63.19  ? 582  GLU A N    1 
ATOM   280   C  CA   . GLU A 1 21  ? -75.391  28.428  -10.345 1.00 57.10  ? 582  GLU A CA   1 
ATOM   281   C  C    . GLU A 1 21  ? -76.719  27.767  -10.030 1.00 49.60  ? 582  GLU A C    1 
ATOM   282   O  O    . GLU A 1 21  ? -77.566  27.606  -10.915 1.00 38.07  ? 582  GLU A O    1 
ATOM   283   C  CB   . GLU A 1 21  ? -75.192  28.353  -11.877 1.00 44.24  ? 582  GLU A CB   1 
ATOM   284   C  CG   . GLU A 1 21  ? -73.919  28.982  -12.414 1.00 56.55  ? 582  GLU A CG   1 
ATOM   285   C  CD   . GLU A 1 21  ? -73.886  30.480  -12.229 1.00 68.16  ? 582  GLU A CD   1 
ATOM   286   O  OE1  . GLU A 1 21  ? -74.843  31.150  -12.670 1.00 79.34  ? 582  GLU A OE1  1 
ATOM   287   O  OE2  . GLU A 1 21  ? -72.912  30.989  -11.634 1.00 65.52  ? 582  GLU A OE2  1 
ATOM   288   H  H    . GLU A 1 21  ? -73.966  28.328  -8.984  1.00 75.83  ? 582  GLU A H    1 
ATOM   289   H  HA   . GLU A 1 21  ? -75.461  29.364  -10.101 1.00 68.52  ? 582  GLU A HA   1 
ATOM   290   H  HB2  . GLU A 1 21  ? -75.185  27.418  -12.138 1.00 53.08  ? 582  GLU A HB2  1 
ATOM   291   H  HB3  . GLU A 1 21  ? -75.938  28.800  -12.304 1.00 53.08  ? 582  GLU A HB3  1 
ATOM   292   H  HG2  . GLU A 1 21  ? -73.158  28.605  -11.947 1.00 67.85  ? 582  GLU A HG2  1 
ATOM   293   H  HG3  . GLU A 1 21  ? -73.851  28.796  -13.364 1.00 67.85  ? 582  GLU A HG3  1 
ATOM   294   N  N    . GLY A 1 22  ? -76.925  27.429  -8.760  1.00 44.25  ? 583  GLY A N    1 
ATOM   295   C  CA   . GLY A 1 22  ? -78.200  26.896  -8.339  1.00 55.20  ? 583  GLY A CA   1 
ATOM   296   C  C    . GLY A 1 22  ? -78.479  25.505  -8.840  1.00 56.90  ? 583  GLY A C    1 
ATOM   297   O  O    . GLY A 1 22  ? -79.622  25.049  -8.751  1.00 57.46  ? 583  GLY A O    1 
ATOM   298   H  H    . GLY A 1 22  ? -76.342  27.501  -8.131  1.00 53.10  ? 583  GLY A H    1 
ATOM   299   H  HA2  . GLY A 1 22  ? -78.234  26.880  -7.370  1.00 66.24  ? 583  GLY A HA2  1 
ATOM   300   H  HA3  . GLY A 1 22  ? -78.908  27.479  -8.656  1.00 66.24  ? 583  GLY A HA3  1 
ATOM   301   N  N    . THR A 1 23  ? -77.471  24.824  -9.376  1.00 58.01  ? 584  THR A N    1 
ATOM   302   C  CA   . THR A 1 23  ? -77.633  23.457  -9.839  1.00 52.13  ? 584  THR A CA   1 
ATOM   303   C  C    . THR A 1 23  ? -77.730  22.515  -8.652  1.00 53.31  ? 584  THR A C    1 
ATOM   304   O  O    . THR A 1 23  ? -76.976  22.635  -7.682  1.00 49.22  ? 584  THR A O    1 
ATOM   305   C  CB   . THR A 1 23  ? -76.461  23.048  -10.727 1.00 41.68  ? 584  THR A CB   1 
ATOM   306   O  OG1  . THR A 1 23  ? -76.408  23.897  -11.881 1.00 45.64  ? 584  THR A OG1  1 
ATOM   307   C  CG2  . THR A 1 23  ? -76.613  21.606  -11.178 1.00 62.31  ? 584  THR A CG2  1 
ATOM   308   H  H    . THR A 1 23  ? -76.677  25.137  -9.482  1.00 69.61  ? 584  THR A H    1 
ATOM   309   H  HA   . THR A 1 23  ? -78.450  23.386  -10.357 1.00 62.56  ? 584  THR A HA   1 
ATOM   310   H  HB   . THR A 1 23  ? -75.633  23.128  -10.228 1.00 50.02  ? 584  THR A HB   1 
ATOM   311   H  HG1  . THR A 1 23  ? -76.307  24.697  -11.644 1.00 54.77  ? 584  THR A HG1  1 
ATOM   312   H  HG21 . THR A 1 23  ? -75.865  21.354  -11.741 1.00 74.77  ? 584  THR A HG21 1 
ATOM   313   H  HG22 . THR A 1 23  ? -76.639  21.019  -10.407 1.00 74.77  ? 584  THR A HG22 1 
ATOM   314   H  HG23 . THR A 1 23  ? -77.436  21.502  -11.681 1.00 74.77  ? 584  THR A HG23 1 
ATOM   315   N  N    . ILE A 1 24  ? -78.664  21.571  -8.736  1.00 46.32  ? 585  ILE A N    1 
ATOM   316   C  CA   . ILE A 1 24  ? -78.858  20.562  -7.704  1.00 52.13  ? 585  ILE A CA   1 
ATOM   317   C  C    . ILE A 1 24  ? -78.855  19.190  -8.364  1.00 44.82  ? 585  ILE A C    1 
ATOM   318   O  O    . ILE A 1 24  ? -79.429  19.004  -9.444  1.00 39.46  ? 585  ILE A O    1 
ATOM   319   C  CB   . ILE A 1 24  ? -80.165  20.795  -6.920  1.00 39.45  ? 585  ILE A CB   1 
ATOM   320   C  CG1  . ILE A 1 24  ? -80.216  22.240  -6.418  1.00 50.48  ? 585  ILE A CG1  1 
ATOM   321   C  CG2  . ILE A 1 24  ? -80.263  19.802  -5.765  1.00 60.43  ? 585  ILE A CG2  1 
ATOM   322   C  CD1  . ILE A 1 24  ? -81.419  22.566  -5.547  1.00 59.02  ? 585  ILE A CD1  1 
ATOM   323   H  H    . ILE A 1 24  ? -79.209  21.495  -9.397  1.00 55.58  ? 585  ILE A H    1 
ATOM   324   H  HA   . ILE A 1 24  ? -78.118  20.599  -7.078  1.00 62.55  ? 585  ILE A HA   1 
ATOM   325   H  HB   . ILE A 1 24  ? -80.914  20.648  -7.518  1.00 47.33  ? 585  ILE A HB   1 
ATOM   326   H  HG12 . ILE A 1 24  ? -79.419  22.415  -5.895  1.00 60.58  ? 585  ILE A HG12 1 
ATOM   327   H  HG13 . ILE A 1 24  ? -80.240  22.834  -7.185  1.00 60.58  ? 585  ILE A HG13 1 
ATOM   328   H  HG21 . ILE A 1 24  ? -81.089  19.960  -5.282  1.00 72.51  ? 585  ILE A HG21 1 
ATOM   329   H  HG22 . ILE A 1 24  ? -80.257  18.900  -6.122  1.00 72.51  ? 585  ILE A HG22 1 
ATOM   330   H  HG23 . ILE A 1 24  ? -79.505  19.929  -5.174  1.00 72.51  ? 585  ILE A HG23 1 
ATOM   331   H  HD11 . ILE A 1 24  ? -81.370  23.496  -5.276  1.00 70.82  ? 585  ILE A HD11 1 
ATOM   332   H  HD12 . ILE A 1 24  ? -82.229  22.411  -6.058  1.00 70.82  ? 585  ILE A HD12 1 
ATOM   333   H  HD13 . ILE A 1 24  ? -81.407  21.992  -4.765  1.00 70.82  ? 585  ILE A HD13 1 
ATOM   334   N  N    . VAL A 1 25  ? -78.208  18.230  -7.708  1.00 46.44  ? 586  VAL A N    1 
ATOM   335   C  CA   . VAL A 1 25  ? -77.966  16.907  -8.273  1.00 51.97  ? 586  VAL A CA   1 
ATOM   336   C  C    . VAL A 1 25  ? -78.693  15.874  -7.424  1.00 48.21  ? 586  VAL A C    1 
ATOM   337   O  O    . VAL A 1 25  ? -78.532  15.846  -6.198  1.00 46.86  ? 586  VAL A O    1 
ATOM   338   C  CB   . VAL A 1 25  ? -76.461  16.596  -8.343  1.00 43.39  ? 586  VAL A CB   1 
ATOM   339   C  CG1  . VAL A 1 25  ? -76.232  15.306  -9.105  1.00 52.89  ? 586  VAL A CG1  1 
ATOM   340   C  CG2  . VAL A 1 25  ? -75.729  17.741  -9.009  1.00 48.68  ? 586  VAL A CG2  1 
ATOM   341   H  H    . VAL A 1 25  ? -77.893  18.324  -6.913  1.00 55.73  ? 586  VAL A H    1 
ATOM   342   H  HA   . VAL A 1 25  ? -78.326  16.872  -9.172  1.00 62.36  ? 586  VAL A HA   1 
ATOM   343   H  HB   . VAL A 1 25  ? -76.111  16.488  -7.445  1.00 52.07  ? 586  VAL A HB   1 
ATOM   344   H  HG11 . VAL A 1 25  ? -75.280  15.125  -9.140  1.00 63.47  ? 586  VAL A HG11 1 
ATOM   345   H  HG12 . VAL A 1 25  ? -76.690  14.584  -8.647  1.00 63.47  ? 586  VAL A HG12 1 
ATOM   346   H  HG13 . VAL A 1 25  ? -76.584  15.404  -10.004 1.00 63.47  ? 586  VAL A HG13 1 
ATOM   347   H  HG21 . VAL A 1 25  ? -74.782  17.531  -9.046  1.00 58.42  ? 586  VAL A HG21 1 
ATOM   348   H  HG22 . VAL A 1 25  ? -76.077  17.860  -9.906  1.00 58.42  ? 586  VAL A HG22 1 
ATOM   349   H  HG23 . VAL A 1 25  ? -75.868  18.549  -8.490  1.00 58.42  ? 586  VAL A HG23 1 
ATOM   350   N  N    . TYR A 1 26  ? -79.487  15.029  -8.079  1.00 41.77  ? 587  TYR A N    1 
ATOM   351   C  CA   . TYR A 1 26  ? -80.271  13.999  -7.417  1.00 50.59  ? 587  TYR A CA   1 
ATOM   352   C  C    . TYR A 1 26  ? -79.842  12.623  -7.908  1.00 56.80  ? 587  TYR A C    1 
ATOM   353   O  O    . TYR A 1 26  ? -79.305  12.466  -9.009  1.00 44.41  ? 587  TYR A O    1 
ATOM   354   C  CB   . TYR A 1 26  ? -81.772  14.188  -7.673  1.00 48.13  ? 587  TYR A CB   1 
ATOM   355   C  CG   . TYR A 1 26  ? -82.280  15.589  -7.405  1.00 48.73  ? 587  TYR A CG   1 
ATOM   356   C  CD1  . TYR A 1 26  ? -82.290  16.546  -8.412  1.00 50.29  ? 587  TYR A CD1  1 
ATOM   357   C  CD2  . TYR A 1 26  ? -82.756  15.954  -6.151  1.00 47.51  ? 587  TYR A CD2  1 
ATOM   358   C  CE1  . TYR A 1 26  ? -82.752  17.832  -8.177  1.00 59.09  ? 587  TYR A CE1  1 
ATOM   359   C  CE2  . TYR A 1 26  ? -83.223  17.239  -5.908  1.00 56.21  ? 587  TYR A CE2  1 
ATOM   360   C  CZ   . TYR A 1 26  ? -83.216  18.174  -6.926  1.00 41.83  ? 587  TYR A CZ   1 
ATOM   361   O  OH   . TYR A 1 26  ? -83.679  19.451  -6.699  1.00 51.62  ? 587  TYR A OH   1 
ATOM   362   H  H    . TYR A 1 26  ? -79.587  15.037  -8.933  1.00 50.12  ? 587  TYR A H    1 
ATOM   363   H  HA   . TYR A 1 26  ? -80.116  14.044  -6.460  1.00 60.71  ? 587  TYR A HA   1 
ATOM   364   H  HB2  . TYR A 1 26  ? -81.957  13.980  -8.602  1.00 57.76  ? 587  TYR A HB2  1 
ATOM   365   H  HB3  . TYR A 1 26  ? -82.264  13.581  -7.098  1.00 57.76  ? 587  TYR A HB3  1 
ATOM   366   H  HD1  . TYR A 1 26  ? -81.975  16.322  -9.258  1.00 60.34  ? 587  TYR A HD1  1 
ATOM   367   H  HD2  . TYR A 1 26  ? -82.759  15.328  -5.463  1.00 57.01  ? 587  TYR A HD2  1 
ATOM   368   H  HE1  . TYR A 1 26  ? -82.750  18.461  -8.862  1.00 70.91  ? 587  TYR A HE1  1 
ATOM   369   H  HE2  . TYR A 1 26  ? -83.536  17.470  -5.063  1.00 67.45  ? 587  TYR A HE2  1 
ATOM   370   H  HH   . TYR A 1 26  ? -83.620  19.907  -7.401  1.00 61.95  ? 587  TYR A HH   1 
ATOM   371   N  N    . ARG A 1 27  ? -80.079  11.623  -7.065  1.00 38.11  ? 588  ARG A N    1 
ATOM   372   C  CA   . ARG A 1 27  ? -79.925  10.240  -7.491  1.00 43.12  ? 588  ARG A CA   1 
ATOM   373   C  C    . ARG A 1 27  ? -81.065  9.855   -8.424  1.00 55.42  ? 588  ARG A C    1 
ATOM   374   O  O    . ARG A 1 27  ? -82.219  10.238  -8.212  1.00 45.56  ? 588  ARG A O    1 
ATOM   375   C  CB   . ARG A 1 27  ? -79.903  9.306   -6.283  1.00 45.79  ? 588  ARG A CB   1 
ATOM   376   C  CG   . ARG A 1 27  ? -79.515  7.878   -6.626  1.00 59.93  ? 588  ARG A CG   1 
ATOM   377   C  CD   . ARG A 1 27  ? -79.600  6.972   -5.409  1.00 54.38  ? 588  ARG A CD   1 
ATOM   378   N  NE   . ARG A 1 27  ? -78.710  7.408   -4.334  1.00 58.42  ? 588  ARG A NE   1 
ATOM   379   C  CZ   . ARG A 1 27  ? -77.430  7.064   -4.228  1.00 58.40  ? 588  ARG A CZ   1 
ATOM   380   N  NH1  . ARG A 1 27  ? -76.867  6.276   -5.134  1.00 52.56  ? 588  ARG A NH1  1 
ATOM   381   N  NH2  . ARG A 1 27  ? -76.705  7.513   -3.213  1.00 58.17  ? 588  ARG A NH2  1 
ATOM   382   H  H    . ARG A 1 27  ? -80.329  11.718  -6.247  1.00 45.73  ? 588  ARG A H    1 
ATOM   383   H  HA   . ARG A 1 27  ? -79.088  10.142  -7.971  1.00 51.75  ? 588  ARG A HA   1 
ATOM   384   H  HB2  . ARG A 1 27  ? -79.261  9.642   -5.638  1.00 54.95  ? 588  ARG A HB2  1 
ATOM   385   H  HB3  . ARG A 1 27  ? -80.788  9.286   -5.886  1.00 54.95  ? 588  ARG A HB3  1 
ATOM   386   H  HG2  . ARG A 1 27  ? -80.119  7.536   -7.303  1.00 71.92  ? 588  ARG A HG2  1 
ATOM   387   H  HG3  . ARG A 1 27  ? -78.602  7.864   -6.953  1.00 71.92  ? 588  ARG A HG3  1 
ATOM   388   H  HD2  . ARG A 1 27  ? -80.508  6.979   -5.070  1.00 65.25  ? 588  ARG A HD2  1 
ATOM   389   H  HD3  . ARG A 1 27  ? -79.345  6.072   -5.665  1.00 65.25  ? 588  ARG A HD3  1 
ATOM   390   H  HE   . ARG A 1 27  ? -79.038  7.923   -3.728  1.00 70.10  ? 588  ARG A HE   1 
ATOM   391   H  HH11 . ARG A 1 27  ? -77.331  5.981   -5.795  1.00 63.07  ? 588  ARG A HH11 1 
ATOM   392   H  HH12 . ARG A 1 27  ? -76.038  6.058   -5.059  1.00 63.07  ? 588  ARG A HH12 1 
ATOM   393   H  HH21 . ARG A 1 27  ? -77.064  8.025   -2.622  1.00 69.81  ? 588  ARG A HH21 1 
ATOM   394   H  HH22 . ARG A 1 27  ? -75.877  7.291   -3.144  1.00 69.81  ? 588  ARG A HH22 1 
ATOM   395   N  N    . GLY A 1 28  ? -80.743  9.084   -9.454  1.00 41.68  ? 589  GLY A N    1 
ATOM   396   C  CA   . GLY A 1 28  ? -81.722  8.777   -10.468 1.00 36.74  ? 589  GLY A CA   1 
ATOM   397   C  C    . GLY A 1 28  ? -81.275  7.626   -11.337 1.00 35.12  ? 589  GLY A C    1 
ATOM   398   O  O    . GLY A 1 28  ? -80.358  6.881   -10.990 1.00 34.38  ? 589  GLY A O    1 
ATOM   399   H  H    . GLY A 1 28  ? -79.969  8.732   -9.583  1.00 50.02  ? 589  GLY A H    1 
ATOM   400   H  HA2  . GLY A 1 28  ? -82.564  8.541   -10.049 1.00 44.09  ? 589  GLY A HA2  1 
ATOM   401   H  HA3  . GLY A 1 28  ? -81.863  9.554   -11.031 1.00 44.09  ? 589  GLY A HA3  1 
ATOM   402   N  N    . MET A 1 29  ? -81.968  7.467   -12.463 1.00 41.00  ? 590  MET A N    1 
ATOM   403   C  CA   . MET A 1 29  ? -81.658  6.404   -13.404 1.00 45.62  ? 590  MET A CA   1 
ATOM   404   C  C    . MET A 1 29  ? -81.869  6.886   -14.831 1.00 36.97  ? 590  MET A C    1 
ATOM   405   O  O    . MET A 1 29  ? -82.739  7.723   -15.094 1.00 44.53  ? 590  MET A O    1 
ATOM   406   C  CB   . MET A 1 29  ? -82.511  5.150   -13.135 1.00 45.42  ? 590  MET A CB   1 
ATOM   407   C  CG   . MET A 1 29  ? -82.057  4.349   -11.916 1.00 60.77  ? 590  MET A CG   1 
ATOM   408   S  SD   . MET A 1 29  ? -82.542  2.615   -11.994 1.00 64.15  ? 590  MET A SD   1 
ATOM   409   C  CE   . MET A 1 29  ? -84.295  2.764   -12.299 1.00 53.43  ? 590  MET A CE   1 
ATOM   410   H  H    . MET A 1 29  ? -82.626  7.967   -12.703 1.00 49.20  ? 590  MET A H    1 
ATOM   411   H  HA   . MET A 1 29  ? -80.727  6.155   -13.295 1.00 54.75  ? 590  MET A HA   1 
ATOM   412   H  HB2  . MET A 1 29  ? -83.430  5.422   -12.985 1.00 54.51  ? 590  MET A HB2  1 
ATOM   413   H  HB3  . MET A 1 29  ? -82.462  4.566   -13.908 1.00 54.51  ? 590  MET A HB3  1 
ATOM   414   H  HG2  . MET A 1 29  ? -81.089  4.387   -11.856 1.00 72.93  ? 590  MET A HG2  1 
ATOM   415   H  HG3  . MET A 1 29  ? -82.453  4.736   -11.119 1.00 72.93  ? 590  MET A HG3  1 
ATOM   416   H  HE1  . MET A 1 29  ? -84.681  1.876   -12.363 1.00 64.12  ? 590  MET A HE1  1 
ATOM   417   H  HE2  . MET A 1 29  ? -84.703  3.250   -11.565 1.00 64.12  ? 590  MET A HE2  1 
ATOM   418   H  HE3  . MET A 1 29  ? -84.431  3.244   -13.130 1.00 64.12  ? 590  MET A HE3  1 
ATOM   419   N  N    . PHE A 1 30  ? -81.018  6.395   -15.734 1.00 42.04  ? 591  PHE A N    1 
ATOM   420   C  CA   . PHE A 1 30  ? -81.170  6.581   -17.172 1.00 34.31  ? 591  PHE A CA   1 
ATOM   421   C  C    . PHE A 1 30  ? -80.758  5.303   -17.886 1.00 40.89  ? 591  PHE A C    1 
ATOM   422   O  O    . PHE A 1 30  ? -79.662  4.789   -17.649 1.00 49.25  ? 591  PHE A O    1 
ATOM   423   C  CB   . PHE A 1 30  ? -80.325  7.756   -17.674 1.00 37.46  ? 591  PHE A CB   1 
ATOM   424   C  CG   . PHE A 1 30  ? -80.123  7.758   -19.163 1.00 32.19  ? 591  PHE A CG   1 
ATOM   425   C  CD1  . PHE A 1 30  ? -81.123  8.200   -20.006 1.00 43.52  ? 591  PHE A CD1  1 
ATOM   426   C  CD2  . PHE A 1 30  ? -78.936  7.309   -19.719 1.00 49.39  ? 591  PHE A CD2  1 
ATOM   427   C  CE1  . PHE A 1 30  ? -80.945  8.201   -21.376 1.00 43.77  ? 591  PHE A CE1  1 
ATOM   428   C  CE2  . PHE A 1 30  ? -78.753  7.309   -21.092 1.00 43.23  ? 591  PHE A CE2  1 
ATOM   429   C  CZ   . PHE A 1 30  ? -79.759  7.755   -21.918 1.00 42.49  ? 591  PHE A CZ   1 
ATOM   430   H  H    . PHE A 1 30  ? -80.322  5.934   -15.526 1.00 50.45  ? 591  PHE A H    1 
ATOM   431   H  HA   . PHE A 1 30  ? -82.101  6.762   -17.377 1.00 41.18  ? 591  PHE A HA   1 
ATOM   432   H  HB2  . PHE A 1 30  ? -80.767  8.586   -17.433 1.00 44.95  ? 591  PHE A HB2  1 
ATOM   433   H  HB3  . PHE A 1 30  ? -79.451  7.715   -17.256 1.00 44.95  ? 591  PHE A HB3  1 
ATOM   434   H  HD1  . PHE A 1 30  ? -81.926  8.503   -19.647 1.00 52.22  ? 591  PHE A HD1  1 
ATOM   435   H  HD2  . PHE A 1 30  ? -78.253  7.007   -19.165 1.00 59.27  ? 591  PHE A HD2  1 
ATOM   436   H  HE1  . PHE A 1 30  ? -81.626  8.503   -21.932 1.00 52.52  ? 591  PHE A HE1  1 
ATOM   437   H  HE2  . PHE A 1 30  ? -77.952  7.007   -21.455 1.00 51.88  ? 591  PHE A HE2  1 
ATOM   438   H  HZ   . PHE A 1 30  ? -79.639  7.756   -22.840 1.00 50.98  ? 591  PHE A HZ   1 
ATOM   439   N  N    . ASP A 1 31  ? -81.621  4.808   -18.774 1.00 46.80  ? 592  ASP A N    1 
ATOM   440   C  CA   . ASP A 1 31  ? -81.319  3.621   -19.581 1.00 50.11  ? 592  ASP A CA   1 
ATOM   441   C  C    . ASP A 1 31  ? -80.896  2.446   -18.697 1.00 55.90  ? 592  ASP A C    1 
ATOM   442   O  O    . ASP A 1 31  ? -79.942  1.725   -18.997 1.00 49.94  ? 592  ASP A O    1 
ATOM   443   C  CB   . ASP A 1 31  ? -80.242  3.938   -20.627 1.00 57.83  ? 592  ASP A CB   1 
ATOM   444   C  CG   . ASP A 1 31  ? -80.120  2.860   -21.700 1.00 56.43  ? 592  ASP A CG   1 
ATOM   445   O  OD1  . ASP A 1 31  ? -81.143  2.239   -22.054 1.00 63.29  ? 592  ASP A OD1  1 
ATOM   446   O  OD2  . ASP A 1 31  ? -78.995  2.633   -22.191 1.00 64.11  ? 592  ASP A OD2  1 
ATOM   447   H  H    . ASP A 1 31  ? -82.396  5.145   -18.931 1.00 56.15  ? 592  ASP A H    1 
ATOM   448   H  HA   . ASP A 1 31  ? -82.122  3.357   -20.056 1.00 60.13  ? 592  ASP A HA   1 
ATOM   449   H  HB2  . ASP A 1 31  ? -80.465  4.774   -21.066 1.00 69.39  ? 592  ASP A HB2  1 
ATOM   450   H  HB3  . ASP A 1 31  ? -79.383  4.016   -20.182 1.00 69.39  ? 592  ASP A HB3  1 
ATOM   451   N  N    . ASN A 1 32  ? -81.612  2.261   -17.587 1.00 46.82  ? 593  ASN A N    1 
ATOM   452   C  CA   . ASN A 1 32  ? -81.353  1.194   -16.617 1.00 50.51  ? 593  ASN A CA   1 
ATOM   453   C  C    . ASN A 1 32  ? -79.964  1.291   -15.988 1.00 44.43  ? 593  ASN A C    1 
ATOM   454   O  O    . ASN A 1 32  ? -79.437  0.295   -15.483 1.00 56.99  ? 593  ASN A O    1 
ATOM   455   C  CB   . ASN A 1 32  ? -81.554  -0.190  -17.249 1.00 57.23  ? 593  ASN A CB   1 
ATOM   456   C  CG   . ASN A 1 32  ? -83.006  -0.491  -17.516 1.00 57.68  ? 593  ASN A CG   1 
ATOM   457   O  OD1  . ASN A 1 32  ? -83.417  -0.659  -18.664 1.00 79.02  ? 593  ASN A OD1  1 
ATOM   458   N  ND2  . ASN A 1 32  ? -83.799  -0.553  -16.453 1.00 58.14  ? 593  ASN A ND2  1 
ATOM   459   H  H    . ASN A 1 32  ? -82.277  2.759   -17.367 1.00 56.18  ? 593  ASN A H    1 
ATOM   460   H  HA   . ASN A 1 32  ? -81.998  1.278   -15.899 1.00 60.61  ? 593  ASN A HA   1 
ATOM   461   H  HB2  . ASN A 1 32  ? -81.079  -0.225  -18.094 1.00 68.68  ? 593  ASN A HB2  1 
ATOM   462   H  HB3  . ASN A 1 32  ? -81.212  -0.867  -16.645 1.00 68.68  ? 593  ASN A HB3  1 
ATOM   463   H  HD21 . ASN A 1 32  ? -83.475  -0.424  -15.667 1.00 69.77  ? 593  ASN A HD21 1 
ATOM   464   H  HD22 . ASN A 1 32  ? -84.637  -0.722  -16.550 1.00 69.77  ? 593  ASN A HD22 1 
ATOM   465   N  N    . ARG A 1 33  ? -79.378  2.484   -15.975 1.00 47.78  ? 594  ARG A N    1 
ATOM   466   C  CA   . ARG A 1 33  ? -78.164  2.767   -15.226 1.00 43.73  ? 594  ARG A CA   1 
ATOM   467   C  C    . ARG A 1 33  ? -78.517  3.592   -13.998 1.00 35.79  ? 594  ARG A C    1 
ATOM   468   O  O    . ARG A 1 33  ? -79.445  4.400   -14.028 1.00 49.48  ? 594  ARG A O    1 
ATOM   469   C  CB   . ARG A 1 33  ? -77.143  3.552   -16.057 1.00 57.78  ? 594  ARG A CB   1 
ATOM   470   C  CG   . ARG A 1 33  ? -76.402  2.774   -17.113 1.00 67.40  ? 594  ARG A CG   1 
ATOM   471   C  CD   . ARG A 1 33  ? -75.245  3.630   -17.640 1.00 71.18  ? 594  ARG A CD   1 
ATOM   472   N  NE   . ARG A 1 33  ? -74.521  3.027   -18.761 1.00 90.59  ? 594  ARG A NE   1 
ATOM   473   C  CZ   . ARG A 1 33  ? -74.742  3.292   -20.048 1.00 76.77  ? 594  ARG A CZ   1 
ATOM   474   N  NH1  . ARG A 1 33  ? -75.683  4.154   -20.413 1.00 64.55  ? 594  ARG A NH1  1 
ATOM   475   N  NH2  . ARG A 1 33  ? -74.019  2.688   -20.982 1.00 72.10  ? 594  ARG A NH2  1 
ATOM   476   H  H    . ARG A 1 33  ? -79.676  3.165   -16.408 1.00 57.34  ? 594  ARG A H    1 
ATOM   477   H  HA   . ARG A 1 33  ? -77.757  1.936   -14.936 1.00 52.48  ? 594  ARG A HA   1 
ATOM   478   H  HB2  . ARG A 1 33  ? -77.608  4.275   -16.505 1.00 69.34  ? 594  ARG A HB2  1 
ATOM   479   H  HB3  . ARG A 1 33  ? -76.479  3.921   -15.454 1.00 69.34  ? 594  ARG A HB3  1 
ATOM   480   H  HG2  . ARG A 1 33  ? -76.039  1.961   -16.729 1.00 80.88  ? 594  ARG A HG2  1 
ATOM   481   H  HG3  . ARG A 1 33  ? -77.000  2.570   -17.850 1.00 80.88  ? 594  ARG A HG3  1 
ATOM   482   H  HD2  . ARG A 1 33  ? -75.598  4.482   -17.940 1.00 85.42  ? 594  ARG A HD2  1 
ATOM   483   H  HD3  . ARG A 1 33  ? -74.610  3.774   -16.920 1.00 85.42  ? 594  ARG A HD3  1 
ATOM   484   H  HE   . ARG A 1 33  ? -73.904  2.458   -18.574 1.00 108.71 ? 594  ARG A HE   1 
ATOM   485   H  HH11 . ARG A 1 33  ? -76.157  4.552   -19.815 1.00 77.46  ? 594  ARG A HH11 1 
ATOM   486   H  HH12 . ARG A 1 33  ? -75.818  4.316   -21.247 1.00 77.46  ? 594  ARG A HH12 1 
ATOM   487   H  HH21 . ARG A 1 33  ? -73.408  2.126   -20.756 1.00 86.51  ? 594  ARG A HH21 1 
ATOM   488   H  HH22 . ARG A 1 33  ? -74.163  2.856   -21.813 1.00 86.51  ? 594  ARG A HH22 1 
ATOM   489   N  N    . ASP A 1 34  ? -77.774  3.381   -12.917 1.00 32.01  ? 595  ASP A N    1 
ATOM   490   C  CA   . ASP A 1 34  ? -77.808  4.296   -11.784 1.00 30.73  ? 595  ASP A CA   1 
ATOM   491   C  C    . ASP A 1 34  ? -76.927  5.493   -12.118 1.00 37.47  ? 595  ASP A C    1 
ATOM   492   O  O    . ASP A 1 34  ? -75.740  5.329   -12.424 1.00 39.56  ? 595  ASP A O    1 
ATOM   493   C  CB   . ASP A 1 34  ? -77.328  3.609   -10.504 1.00 41.55  ? 595  ASP A CB   1 
ATOM   494   C  CG   . ASP A 1 34  ? -78.331  2.592   -9.956  1.00 43.86  ? 595  ASP A CG   1 
ATOM   495   O  OD1  . ASP A 1 34  ? -79.530  2.672   -10.296 1.00 65.63  ? 595  ASP A OD1  1 
ATOM   496   O  OD2  . ASP A 1 34  ? -77.914  1.719   -9.166  1.00 55.07  ? 595  ASP A OD2  1 
ATOM   497   H  H    . ASP A 1 34  ? -77.240  2.714   -12.815 1.00 38.41  ? 595  ASP A H    1 
ATOM   498   H  HA   . ASP A 1 34  ? -78.716  4.609   -11.646 1.00 36.87  ? 595  ASP A HA   1 
ATOM   499   H  HB2  . ASP A 1 34  ? -76.499  3.140   -10.690 1.00 49.86  ? 595  ASP A HB2  1 
ATOM   500   H  HB3  . ASP A 1 34  ? -77.181  4.282   -9.821  1.00 49.86  ? 595  ASP A HB3  1 
ATOM   501   N  N    . VAL A 1 35  ? -77.508  6.694   -12.076 1.00 38.51  ? 596  VAL A N    1 
ATOM   502   C  CA   . VAL A 1 35  ? -76.825  7.924   -12.465 1.00 38.44  ? 596  VAL A CA   1 
ATOM   503   C  C    . VAL A 1 35  ? -77.149  9.008   -11.445 1.00 47.30  ? 596  VAL A C    1 
ATOM   504   O  O    . VAL A 1 35  ? -78.049  8.868   -10.614 1.00 41.75  ? 596  VAL A O    1 
ATOM   505   C  CB   . VAL A 1 35  ? -77.228  8.400   -13.880 1.00 37.49  ? 596  VAL A CB   1 
ATOM   506   C  CG1  . VAL A 1 35  ? -76.907  7.338   -14.919 1.00 40.48  ? 596  VAL A CG1  1 
ATOM   507   C  CG2  . VAL A 1 35  ? -78.720  8.765   -13.927 1.00 38.38  ? 596  VAL A CG2  1 
ATOM   508   H  H    . VAL A 1 35  ? -78.318  6.821   -11.818 1.00 46.21  ? 596  VAL A H    1 
ATOM   509   H  HA   . VAL A 1 35  ? -75.867  7.774   -12.456 1.00 46.12  ? 596  VAL A HA   1 
ATOM   510   H  HB   . VAL A 1 35  ? -76.719  9.196   -14.100 1.00 44.99  ? 596  VAL A HB   1 
ATOM   511   H  HG11 . VAL A 1 35  ? -77.170  7.663   -15.794 1.00 48.58  ? 596  VAL A HG11 1 
ATOM   512   H  HG12 . VAL A 1 35  ? -75.954  7.160   -14.904 1.00 48.58  ? 596  VAL A HG12 1 
ATOM   513   H  HG13 . VAL A 1 35  ? -77.398  6.529   -14.705 1.00 48.58  ? 596  VAL A HG13 1 
ATOM   514   H  HG21 . VAL A 1 35  ? -78.944  9.059   -14.823 1.00 46.06  ? 596  VAL A HG21 1 
ATOM   515   H  HG22 . VAL A 1 35  ? -79.243  7.982   -13.694 1.00 46.06  ? 596  VAL A HG22 1 
ATOM   516   H  HG23 . VAL A 1 35  ? -78.890  9.478   -13.291 1.00 46.06  ? 596  VAL A HG23 1 
ATOM   517   N  N    . ALA A 1 36  ? -76.382  10.090  -11.511 1.00 35.22  ? 597  ALA A N    1 
ATOM   518   C  CA   . ALA A 1 36  ? -76.729  11.342  -10.861 1.00 36.05  ? 597  ALA A CA   1 
ATOM   519   C  C    . ALA A 1 36  ? -77.380  12.251  -11.897 1.00 32.90  ? 597  ALA A C    1 
ATOM   520   O  O    . ALA A 1 36  ? -76.995  12.238  -13.070 1.00 40.30  ? 597  ALA A O    1 
ATOM   521   C  CB   . ALA A 1 36  ? -75.492  11.998  -10.255 1.00 41.22  ? 597  ALA A CB   1 
ATOM   522   H  H    . ALA A 1 36  ? -75.636  10.122  -11.938 1.00 42.26  ? 597  ALA A H    1 
ATOM   523   H  HA   . ALA A 1 36  ? -77.369  11.174  -10.152 1.00 43.26  ? 597  ALA A HA   1 
ATOM   524   H  HB1  . ALA A 1 36  ? -75.753  12.830  -9.829  1.00 49.46  ? 597  ALA A HB1  1 
ATOM   525   H  HB2  . ALA A 1 36  ? -75.106  11.397  -9.599  1.00 49.46  ? 597  ALA A HB2  1 
ATOM   526   H  HB3  . ALA A 1 36  ? -74.851  12.174  -10.961 1.00 49.46  ? 597  ALA A HB3  1 
ATOM   527   N  N    . VAL A 1 37  ? -78.385  13.012  -11.472 1.00 42.63  ? 598  VAL A N    1 
ATOM   528   C  CA   . VAL A 1 37  ? -79.180  13.847  -12.373 1.00 56.49  ? 598  VAL A CA   1 
ATOM   529   C  C    . VAL A 1 37  ? -79.051  15.297  -11.925 1.00 41.14  ? 598  VAL A C    1 
ATOM   530   O  O    . VAL A 1 37  ? -79.446  15.640  -10.804 1.00 40.16  ? 598  VAL A O    1 
ATOM   531   C  CB   . VAL A 1 37  ? -80.655  13.414  -12.396 1.00 49.16  ? 598  VAL A CB   1 
ATOM   532   C  CG1  . VAL A 1 37  ? -81.468  14.316  -13.319 1.00 35.53  ? 598  VAL A CG1  1 
ATOM   533   C  CG2  . VAL A 1 37  ? -80.768  11.958  -12.838 1.00 46.89  ? 598  VAL A CG2  1 
ATOM   534   H  H    . VAL A 1 37  ? -78.631  13.064  -10.650 1.00 51.15  ? 598  VAL A H    1 
ATOM   535   H  HA   . VAL A 1 37  ? -78.827  13.774  -13.273 1.00 67.79  ? 598  VAL A HA   1 
ATOM   536   H  HB   . VAL A 1 37  ? -81.023  13.487  -11.501 1.00 58.99  ? 598  VAL A HB   1 
ATOM   537   H  HG11 . VAL A 1 37  ? -82.392  14.020  -13.314 1.00 42.64  ? 598  VAL A HG11 1 
ATOM   538   H  HG12 . VAL A 1 37  ? -81.411  15.229  -12.998 1.00 42.64  ? 598  VAL A HG12 1 
ATOM   539   H  HG13 . VAL A 1 37  ? -81.106  14.256  -14.217 1.00 42.64  ? 598  VAL A HG13 1 
ATOM   540   H  HG21 . VAL A 1 37  ? -81.704  11.702  -12.847 1.00 56.27  ? 598  VAL A HG21 1 
ATOM   541   H  HG22 . VAL A 1 37  ? -80.392  11.868  -13.728 1.00 56.27  ? 598  VAL A HG22 1 
ATOM   542   H  HG23 . VAL A 1 37  ? -80.278  11.400  -12.214 1.00 56.27  ? 598  VAL A HG23 1 
ATOM   543   N  N    . LYS A 1 38  ? -78.513  16.144  -12.801 1.00 41.12  ? 599  LYS A N    1 
ATOM   544   C  CA   . LYS A 1 38  ? -78.391  17.572  -12.530 1.00 47.56  ? 599  LYS A CA   1 
ATOM   545   C  C    . LYS A 1 38  ? -79.622  18.306  -13.042 1.00 51.71  ? 599  LYS A C    1 
ATOM   546   O  O    . LYS A 1 38  ? -80.106  18.030  -14.144 1.00 48.10  ? 599  LYS A O    1 
ATOM   547   C  CB   . LYS A 1 38  ? -77.140  18.148  -13.196 1.00 32.65  ? 599  LYS A CB   1 
ATOM   548   C  CG   . LYS A 1 38  ? -75.857  17.420  -12.845 1.00 53.31  ? 599  LYS A CG   1 
ATOM   549   C  CD   . LYS A 1 38  ? -74.627  18.245  -13.191 1.00 42.17  ? 599  LYS A CD   1 
ATOM   550   C  CE   . LYS A 1 38  ? -74.454  18.373  -14.691 1.00 56.99  ? 599  LYS A CE   1 
ATOM   551   N  NZ   . LYS A 1 38  ? -73.108  18.906  -15.046 1.00 41.53  ? 599  LYS A NZ   1 
ATOM   552   H  H    . LYS A 1 38  ? -78.208  15.911  -13.571 1.00 49.35  ? 599  LYS A H    1 
ATOM   553   H  HA   . LYS A 1 38  ? -78.323  17.715  -11.573 1.00 57.07  ? 599  LYS A HA   1 
ATOM   554   H  HB2  . LYS A 1 38  ? -77.251  18.102  -14.159 1.00 39.17  ? 599  LYS A HB2  1 
ATOM   555   H  HB3  . LYS A 1 38  ? -77.039  19.073  -12.922 1.00 39.17  ? 599  LYS A HB3  1 
ATOM   556   H  HG2  . LYS A 1 38  ? -75.843  17.240  -11.892 1.00 63.98  ? 599  LYS A HG2  1 
ATOM   557   H  HG3  . LYS A 1 38  ? -75.815  16.589  -13.343 1.00 63.98  ? 599  LYS A HG3  1 
ATOM   558   H  HD2  . LYS A 1 38  ? -74.723  19.136  -12.818 1.00 50.61  ? 599  LYS A HD2  1 
ATOM   559   H  HD3  . LYS A 1 38  ? -73.838  17.812  -12.828 1.00 50.61  ? 599  LYS A HD3  1 
ATOM   560   H  HE2  . LYS A 1 38  ? -74.551  17.498  -15.099 1.00 68.38  ? 599  LYS A HE2  1 
ATOM   561   H  HE3  . LYS A 1 38  ? -75.124  18.982  -15.040 1.00 68.38  ? 599  LYS A HE3  1 
ATOM   562   H  HZ1  . LYS A 1 38  ? -73.030  18.972  -15.931 1.00 49.84  ? 599  LYS A HZ1  1 
ATOM   563   H  HZ2  . LYS A 1 38  ? -72.995  19.712  -14.686 1.00 49.84  ? 599  LYS A HZ2  1 
ATOM   564   H  HZ3  . LYS A 1 38  ? -72.474  18.362  -14.740 1.00 49.84  ? 599  LYS A HZ3  1 
ATOM   565   N  N    . ARG A 1 39  ? -80.130  19.239  -12.233 1.00 48.50  ? 600  ARG A N    1 
ATOM   566   C  CA   . ARG A 1 39  ? -81.235  20.110  -12.628 1.00 35.72  ? 600  ARG A CA   1 
ATOM   567   C  C    . ARG A 1 39  ? -80.668  21.486  -12.953 1.00 41.24  ? 600  ARG A C    1 
ATOM   568   O  O    . ARG A 1 39  ? -80.170  22.186  -12.065 1.00 38.63  ? 600  ARG A O    1 
ATOM   569   C  CB   . ARG A 1 39  ? -82.291  20.204  -11.531 1.00 40.76  ? 600  ARG A CB   1 
ATOM   570   C  CG   . ARG A 1 39  ? -83.583  20.872  -11.987 1.00 51.23  ? 600  ARG A CG   1 
ATOM   571   C  CD   . ARG A 1 39  ? -84.565  21.040  -10.834 1.00 58.16  ? 600  ARG A CD   1 
ATOM   572   N  NE   . ARG A 1 39  ? -84.031  21.898  -9.780  1.00 70.96  ? 600  ARG A NE   1 
ATOM   573   C  CZ   . ARG A 1 39  ? -84.714  22.292  -8.709  1.00 74.97  ? 600  ARG A CZ   1 
ATOM   574   N  NH1  . ARG A 1 39  ? -85.976  21.911  -8.533  1.00 62.66  ? 600  ARG A NH1  1 
ATOM   575   N  NH2  . ARG A 1 39  ? -84.128  23.076  -7.811  1.00 73.29  ? 600  ARG A NH2  1 
ATOM   576   H  H    . ARG A 1 39  ? -79.845  19.387  -11.435 1.00 58.20  ? 600  ARG A H    1 
ATOM   577   H  HA   . ARG A 1 39  ? -81.655  19.755  -13.427 1.00 42.87  ? 600  ARG A HA   1 
ATOM   578   H  HB2  . ARG A 1 39  ? -82.509  19.309  -11.228 1.00 48.91  ? 600  ARG A HB2  1 
ATOM   579   H  HB3  . ARG A 1 39  ? -81.932  20.723  -10.794 1.00 48.91  ? 600  ARG A HB3  1 
ATOM   580   H  HG2  . ARG A 1 39  ? -83.380  21.751  -12.343 1.00 61.47  ? 600  ARG A HG2  1 
ATOM   581   H  HG3  . ARG A 1 39  ? -84.004  20.323  -12.667 1.00 61.47  ? 600  ARG A HG3  1 
ATOM   582   H  HD2  . ARG A 1 39  ? -85.382  21.443  -11.168 1.00 69.79  ? 600  ARG A HD2  1 
ATOM   583   H  HD3  . ARG A 1 39  ? -84.755  20.170  -10.449 1.00 69.79  ? 600  ARG A HD3  1 
ATOM   584   H  HE   . ARG A 1 39  ? -83.218  22.168  -9.858  1.00 85.16  ? 600  ARG A HE   1 
ATOM   585   H  HH11 . ARG A 1 39  ? -86.357  21.404  -9.114  1.00 75.19  ? 600  ARG A HH11 1 
ATOM   586   H  HH12 . ARG A 1 39  ? -86.410  22.171  -7.838  1.00 75.19  ? 600  ARG A HH12 1 
ATOM   587   H  HH21 . ARG A 1 39  ? -83.312  23.324  -7.923  1.00 87.95  ? 600  ARG A HH21 1 
ATOM   588   H  HH22 . ARG A 1 39  ? -84.564  23.334  -7.116  1.00 87.95  ? 600  ARG A HH22 1 
ATOM   589   N  N    . ILE A 1 40  ? -80.745  21.866  -14.224 1.00 38.86  ? 601  ILE A N    1 
ATOM   590   C  CA   . ILE A 1 40  ? -80.229  23.146  -14.693 1.00 42.03  ? 601  ILE A CA   1 
ATOM   591   C  C    . ILE A 1 40  ? -81.343  24.183  -14.610 1.00 47.57  ? 601  ILE A C    1 
ATOM   592   O  O    . ILE A 1 40  ? -82.438  23.977  -15.146 1.00 41.54  ? 601  ILE A O    1 
ATOM   593   C  CB   . ILE A 1 40  ? -79.700  23.028  -16.132 1.00 43.77  ? 601  ILE A CB   1 
ATOM   594   C  CG1  . ILE A 1 40  ? -78.773  21.814  -16.273 1.00 41.10  ? 601  ILE A CG1  1 
ATOM   595   C  CG2  . ILE A 1 40  ? -78.979  24.310  -16.541 1.00 54.90  ? 601  ILE A CG2  1 
ATOM   596   C  CD1  . ILE A 1 40  ? -77.544  21.851  -15.369 1.00 37.86  ? 601  ILE A CD1  1 
ATOM   597   H  H    . ILE A 1 40  ? -81.100  21.390  -14.846 1.00 46.63  ? 601  ILE A H    1 
ATOM   598   H  HA   . ILE A 1 40  ? -79.500  23.431  -14.120 1.00 50.43  ? 601  ILE A HA   1 
ATOM   599   H  HB   . ILE A 1 40  ? -80.457  22.903  -16.725 1.00 52.53  ? 601  ILE A HB   1 
ATOM   600   H  HG12 . ILE A 1 40  ? -79.275  21.013  -16.055 1.00 49.32  ? 601  ILE A HG12 1 
ATOM   601   H  HG13 . ILE A 1 40  ? -78.462  21.765  -17.191 1.00 49.32  ? 601  ILE A HG13 1 
ATOM   602   H  HG21 . ILE A 1 40  ? -78.655  24.212  -17.450 1.00 65.88  ? 601  ILE A HG21 1 
ATOM   603   H  HG22 . ILE A 1 40  ? -79.602  25.052  -16.489 1.00 65.88  ? 601  ILE A HG22 1 
ATOM   604   H  HG23 . ILE A 1 40  ? -78.234  24.459  -15.938 1.00 65.88  ? 601  ILE A HG23 1 
ATOM   605   H  HD11 . ILE A 1 40  ? -77.016  21.052  -15.521 1.00 45.44  ? 601  ILE A HD11 1 
ATOM   606   H  HD12 . ILE A 1 40  ? -77.020  22.640  -15.582 1.00 45.44  ? 601  ILE A HD12 1 
ATOM   607   H  HD13 . ILE A 1 40  ? -77.834  21.886  -14.444 1.00 45.44  ? 601  ILE A HD13 1 
ATOM   608   N  N    . LEU A 1 41  ? -81.064  25.298  -13.940 1.00 58.42  ? 602  LEU A N    1 
ATOM   609   C  CA   . LEU A 1 41  ? -82.025  26.384  -13.850 1.00 54.76  ? 602  LEU A CA   1 
ATOM   610   C  C    . LEU A 1 41  ? -81.951  27.261  -15.097 1.00 50.26  ? 602  LEU A C    1 
ATOM   611   O  O    . LEU A 1 41  ? -80.955  27.240  -15.825 1.00 42.59  ? 602  LEU A O    1 
ATOM   612   C  CB   . LEU A 1 41  ? -81.765  27.218  -12.598 1.00 47.57  ? 602  LEU A CB   1 
ATOM   613   C  CG   . LEU A 1 41  ? -81.945  26.505  -11.253 1.00 50.91  ? 602  LEU A CG   1 
ATOM   614   C  CD1  . LEU A 1 41  ? -81.606  27.431  -10.103 1.00 51.04  ? 602  LEU A CD1  1 
ATOM   615   C  CD2  . LEU A 1 41  ? -83.354  25.976  -11.092 1.00 58.16  ? 602  LEU A CD2  1 
ATOM   616   H  H    . LEU A 1 41  ? -80.323  25.448  -13.529 1.00 70.10  ? 602  LEU A H    1 
ATOM   617   H  HA   . LEU A 1 41  ? -82.920  26.016  -13.790 1.00 65.71  ? 602  LEU A HA   1 
ATOM   618   H  HB2  . LEU A 1 41  ? -80.850  27.540  -12.632 1.00 57.09  ? 602  LEU A HB2  1 
ATOM   619   H  HB3  . LEU A 1 41  ? -82.372  27.975  -12.606 1.00 57.09  ? 602  LEU A HB3  1 
ATOM   620   H  HG   . LEU A 1 41  ? -81.338  25.749  -11.215 1.00 61.09  ? 602  LEU A HG   1 
ATOM   621   H  HD11 . LEU A 1 41  ? -81.729  26.954  -9.267  1.00 61.25  ? 602  LEU A HD11 1 
ATOM   622   H  HD12 . LEU A 1 41  ? -80.683  27.716  -10.188 1.00 61.25  ? 602  LEU A HD12 1 
ATOM   623   H  HD13 . LEU A 1 41  ? -82.195  28.201  -10.134 1.00 61.25  ? 602  LEU A HD13 1 
ATOM   624   H  HD21 . LEU A 1 41  ? -83.428  25.533  -10.232 1.00 69.79  ? 602  LEU A HD21 1 
ATOM   625   H  HD22 . LEU A 1 41  ? -83.977  26.718  -11.137 1.00 69.79  ? 602  LEU A HD22 1 
ATOM   626   H  HD23 . LEU A 1 41  ? -83.539  25.346  -11.806 1.00 69.79  ? 602  LEU A HD23 1 
ATOM   627   N  N    . PRO A 1 42  ? -83.003  28.040  -15.369 1.00 47.98  ? 603  PRO A N    1 
ATOM   628   C  CA   . PRO A 1 42  ? -83.007  28.861  -16.592 1.00 49.20  ? 603  PRO A CA   1 
ATOM   629   C  C    . PRO A 1 42  ? -81.819  29.800  -16.701 1.00 44.01  ? 603  PRO A C    1 
ATOM   630   O  O    . PRO A 1 42  ? -81.374  30.092  -17.819 1.00 42.94  ? 603  PRO A O    1 
ATOM   631   C  CB   . PRO A 1 42  ? -84.327  29.636  -16.484 1.00 40.55  ? 603  PRO A CB   1 
ATOM   632   C  CG   . PRO A 1 42  ? -85.175  28.823  -15.582 1.00 47.28  ? 603  PRO A CG   1 
ATOM   633   C  CD   . PRO A 1 42  ? -84.249  28.190  -14.600 1.00 53.89  ? 603  PRO A CD   1 
ATOM   634   H  HA   . PRO A 1 42  ? -83.037  28.292  -17.376 1.00 59.04  ? 603  PRO A HA   1 
ATOM   635   H  HB2  . PRO A 1 42  ? -84.162  30.512  -16.102 1.00 48.66  ? 603  PRO A HB2  1 
ATOM   636   H  HB3  . PRO A 1 42  ? -84.734  29.713  -17.361 1.00 48.66  ? 603  PRO A HB3  1 
ATOM   637   H  HG2  . PRO A 1 42  ? -85.811  29.398  -15.129 1.00 56.74  ? 603  PRO A HG2  1 
ATOM   638   H  HG3  . PRO A 1 42  ? -85.638  28.144  -16.098 1.00 56.74  ? 603  PRO A HG3  1 
ATOM   639   H  HD2  . PRO A 1 42  ? -84.110  28.776  -13.839 1.00 64.67  ? 603  PRO A HD2  1 
ATOM   640   H  HD3  . PRO A 1 42  ? -84.586  27.323  -14.326 1.00 64.67  ? 603  PRO A HD3  1 
ATOM   641   N  N    . GLU A 1 43  ? -81.286  30.277  -15.573 1.00 39.71  ? 604  GLU A N    1 
ATOM   642   C  CA   . GLU A 1 43  ? -80.127  31.164  -15.614 1.00 49.36  ? 604  GLU A CA   1 
ATOM   643   C  C    . GLU A 1 43  ? -78.907  30.463  -16.194 1.00 43.80  ? 604  GLU A C    1 
ATOM   644   O  O    . GLU A 1 43  ? -78.032  31.115  -16.775 1.00 49.01  ? 604  GLU A O    1 
ATOM   645   C  CB   . GLU A 1 43  ? -79.809  31.686  -14.211 1.00 46.19  ? 604  GLU A CB   1 
ATOM   646   C  CG   . GLU A 1 43  ? -80.892  32.565  -13.591 1.00 56.92  ? 604  GLU A CG   1 
ATOM   647   C  CD   . GLU A 1 43  ? -82.008  31.769  -12.928 1.00 69.49  ? 604  GLU A CD   1 
ATOM   648   O  OE1  . GLU A 1 43  ? -82.122  30.550  -13.192 1.00 59.79  ? 604  GLU A OE1  1 
ATOM   649   O  OE2  . GLU A 1 43  ? -82.769  32.364  -12.134 1.00 47.77  ? 604  GLU A OE2  1 
ATOM   650   H  H    . GLU A 1 43  ? -81.574  30.103  -14.781 1.00 47.65  ? 604  GLU A H    1 
ATOM   651   H  HA   . GLU A 1 43  ? -80.332  31.926  -16.179 1.00 59.23  ? 604  GLU A HA   1 
ATOM   652   H  HB2  . GLU A 1 43  ? -79.675  30.926  -13.623 1.00 55.43  ? 604  GLU A HB2  1 
ATOM   653   H  HB3  . GLU A 1 43  ? -78.994  32.211  -14.255 1.00 55.43  ? 604  GLU A HB3  1 
ATOM   654   H  HG2  . GLU A 1 43  ? -80.488  33.132  -12.915 1.00 68.31  ? 604  GLU A HG2  1 
ATOM   655   H  HG3  . GLU A 1 43  ? -81.289  33.113  -14.287 1.00 68.31  ? 604  GLU A HG3  1 
ATOM   656   N  N    . CYS A 1 44  ? -78.821  29.144  -16.025 1.00 48.21  ? 605  CYS A N    1 
ATOM   657   C  CA   . CYS A 1 44  ? -77.674  28.356  -16.451 1.00 43.10  ? 605  CYS A CA   1 
ATOM   658   C  C    . CYS A 1 44  ? -77.858  27.679  -17.808 1.00 53.55  ? 605  CYS A C    1 
ATOM   659   O  O    . CYS A 1 44  ? -76.931  27.004  -18.270 1.00 39.86  ? 605  CYS A O    1 
ATOM   660   C  CB   . CYS A 1 44  ? -77.363  27.304  -15.388 1.00 45.49  ? 605  CYS A CB   1 
ATOM   661   S  SG   . CYS A 1 44  ? -75.682  26.692  -15.440 1.00 52.89  ? 605  CYS A SG   1 
ATOM   662   H  H    . CYS A 1 44  ? -79.438  28.672  -15.655 1.00 57.85  ? 605  CYS A H    1 
ATOM   663   H  HA   . CYS A 1 44  ? -76.904  28.943  -16.519 1.00 51.72  ? 605  CYS A HA   1 
ATOM   664   H  HB2  . CYS A 1 44  ? -77.508  27.694  -14.511 1.00 54.59  ? 605  CYS A HB2  1 
ATOM   665   H  HB3  . CYS A 1 44  ? -77.957  26.548  -15.514 1.00 54.59  ? 605  CYS A HB3  1 
ATOM   666   H  HG   . CYS A 1 44  ? -75.483  26.190  -16.512 1.00 63.47  ? 605  CYS A HG   1 
ATOM   667   N  N    . PHE A 1 45  ? -79.021  27.837  -18.453 1.00 46.22  ? 606  PHE A N    1 
ATOM   668   C  CA   . PHE A 1 45  ? -79.273  27.158  -19.726 1.00 51.75  ? 606  PHE A CA   1 
ATOM   669   C  C    . PHE A 1 45  ? -78.148  27.399  -20.728 1.00 43.95  ? 606  PHE A C    1 
ATOM   670   O  O    . PHE A 1 45  ? -77.595  26.452  -21.298 1.00 49.81  ? 606  PHE A O    1 
ATOM   671   C  CB   . PHE A 1 45  ? -80.605  27.626  -20.327 1.00 36.62  ? 606  PHE A CB   1 
ATOM   672   C  CG   . PHE A 1 45  ? -81.834  27.049  -19.666 1.00 42.76  ? 606  PHE A CG   1 
ATOM   673   C  CD1  . PHE A 1 45  ? -81.739  26.156  -18.610 1.00 40.64  ? 606  PHE A CD1  1 
ATOM   674   C  CD2  . PHE A 1 45  ? -83.098  27.409  -20.117 1.00 52.11  ? 606  PHE A CD2  1 
ATOM   675   C  CE1  . PHE A 1 45  ? -82.880  25.636  -18.018 1.00 56.60  ? 606  PHE A CE1  1 
ATOM   676   C  CE2  . PHE A 1 45  ? -84.237  26.895  -19.527 1.00 45.78  ? 606  PHE A CE2  1 
ATOM   677   C  CZ   . PHE A 1 45  ? -84.128  26.006  -18.478 1.00 52.17  ? 606  PHE A CZ   1 
ATOM   678   H  H    . PHE A 1 45  ? -79.672  28.326  -18.177 1.00 55.47  ? 606  PHE A H    1 
ATOM   679   H  HA   . PHE A 1 45  ? -79.334  26.203  -19.568 1.00 62.10  ? 606  PHE A HA   1 
ATOM   680   H  HB2  . PHE A 1 45  ? -80.657  28.591  -20.250 1.00 43.95  ? 606  PHE A HB2  1 
ATOM   681   H  HB3  . PHE A 1 45  ? -80.629  27.371  -21.262 1.00 43.95  ? 606  PHE A HB3  1 
ATOM   682   H  HD1  . PHE A 1 45  ? -80.902  25.902  -18.296 1.00 48.77  ? 606  PHE A HD1  1 
ATOM   683   H  HD2  . PHE A 1 45  ? -83.178  28.008  -20.824 1.00 62.53  ? 606  PHE A HD2  1 
ATOM   684   H  HE1  . PHE A 1 45  ? -82.804  25.038  -17.310 1.00 67.91  ? 606  PHE A HE1  1 
ATOM   685   H  HE2  . PHE A 1 45  ? -85.077  27.145  -19.840 1.00 54.93  ? 606  PHE A HE2  1 
ATOM   686   H  HZ   . PHE A 1 45  ? -84.893  25.658  -18.081 1.00 62.60  ? 606  PHE A HZ   1 
ATOM   687   N  N    . SER A 1 46  ? -77.800  28.668  -20.956 1.00 55.79  ? 607  SER A N    1 
ATOM   688   C  CA   . SER A 1 46  ? -76.803  28.997  -21.970 1.00 45.10  ? 607  SER A CA   1 
ATOM   689   C  C    . SER A 1 46  ? -75.450  28.375  -21.646 1.00 39.35  ? 607  SER A C    1 
ATOM   690   O  O    . SER A 1 46  ? -74.778  27.838  -22.535 1.00 45.18  ? 607  SER A O    1 
ATOM   691   C  CB   . SER A 1 46  ? -76.675  30.513  -22.096 1.00 43.04  ? 607  SER A CB   1 
ATOM   692   O  OG   . SER A 1 46  ? -77.918  31.093  -22.445 1.00 82.99  ? 607  SER A OG   1 
ATOM   693   H  H    . SER A 1 46  ? -78.124  29.348  -20.541 1.00 66.94  ? 607  SER A H    1 
ATOM   694   H  HA   . SER A 1 46  ? -77.096  28.648  -22.826 1.00 54.12  ? 607  SER A HA   1 
ATOM   695   H  HB2  . SER A 1 46  ? -76.384  30.878  -21.245 1.00 51.65  ? 607  SER A HB2  1 
ATOM   696   H  HB3  . SER A 1 46  ? -76.025  30.719  -22.786 1.00 51.65  ? 607  SER A HB3  1 
ATOM   697   H  HG   . SER A 1 46  ? -77.837  31.927  -22.511 1.00 99.58  ? 607  SER A HG   1 
ATOM   698   N  N    . PHE A 1 47  ? -75.029  28.445  -20.383 1.00 38.45  ? 608  PHE A N    1 
ATOM   699   C  CA   . PHE A 1 47  ? -73.767  27.830  -19.987 1.00 45.06  ? 608  PHE A CA   1 
ATOM   700   C  C    . PHE A 1 47  ? -73.792  26.328  -20.245 1.00 51.96  ? 608  PHE A C    1 
ATOM   701   O  O    . PHE A 1 47  ? -72.859  25.770  -20.834 1.00 47.60  ? 608  PHE A O    1 
ATOM   702   C  CB   . PHE A 1 47  ? -73.486  28.108  -18.509 1.00 42.78  ? 608  PHE A CB   1 
ATOM   703   C  CG   . PHE A 1 47  ? -73.511  29.564  -18.142 1.00 46.85  ? 608  PHE A CG   1 
ATOM   704   C  CD1  . PHE A 1 47  ? -73.154  30.534  -19.060 1.00 46.98  ? 608  PHE A CD1  1 
ATOM   705   C  CD2  . PHE A 1 47  ? -73.891  29.959  -16.868 1.00 61.43  ? 608  PHE A CD2  1 
ATOM   706   C  CE1  . PHE A 1 47  ? -73.179  31.871  -18.718 1.00 52.23  ? 608  PHE A CE1  1 
ATOM   707   C  CE2  . PHE A 1 47  ? -73.916  31.293  -16.521 1.00 52.94  ? 608  PHE A CE2  1 
ATOM   708   C  CZ   . PHE A 1 47  ? -73.560  32.251  -17.446 1.00 50.09  ? 608  PHE A CZ   1 
ATOM   709   H  H    . PHE A 1 47  ? -75.450  28.839  -19.745 1.00 46.14  ? 608  PHE A H    1 
ATOM   710   H  HA   . PHE A 1 47  ? -73.047  28.215  -20.510 1.00 54.07  ? 608  PHE A HA   1 
ATOM   711   H  HB2  . PHE A 1 47  ? -74.157  27.657  -17.974 1.00 51.33  ? 608  PHE A HB2  1 
ATOM   712   H  HB3  . PHE A 1 47  ? -72.606  27.764  -18.290 1.00 51.33  ? 608  PHE A HB3  1 
ATOM   713   H  HD1  . PHE A 1 47  ? -72.897  30.283  -19.918 1.00 56.37  ? 608  PHE A HD1  1 
ATOM   714   H  HD2  . PHE A 1 47  ? -74.132  29.317  -16.241 1.00 73.71  ? 608  PHE A HD2  1 
ATOM   715   H  HE1  . PHE A 1 47  ? -72.937  32.516  -19.343 1.00 62.68  ? 608  PHE A HE1  1 
ATOM   716   H  HE2  . PHE A 1 47  ? -74.173  31.547  -15.665 1.00 63.53  ? 608  PHE A HE2  1 
ATOM   717   H  HZ   . PHE A 1 47  ? -73.576  33.151  -17.214 1.00 60.11  ? 608  PHE A HZ   1 
ATOM   718   N  N    . ALA A 1 48  ? -74.858  25.659  -19.802 1.00 44.71  ? 609  ALA A N    1 
ATOM   719   C  CA   . ALA A 1 48  ? -75.003  24.224  -20.022 1.00 45.54  ? 609  ALA A CA   1 
ATOM   720   C  C    . ALA A 1 48  ? -74.849  23.869  -21.498 1.00 44.54  ? 609  ALA A C    1 
ATOM   721   O  O    . ALA A 1 48  ? -73.939  23.125  -21.877 1.00 48.24  ? 609  ALA A O    1 
ATOM   722   C  CB   . ALA A 1 48  ? -76.356  23.747  -19.485 1.00 44.21  ? 609  ALA A CB   1 
ATOM   723   H  H    . ALA A 1 48  ? -75.511  26.016  -19.371 1.00 53.65  ? 609  ALA A H    1 
ATOM   724   H  HA   . ALA A 1 48  ? -74.307  23.760  -19.530 1.00 54.65  ? 609  ALA A HA   1 
ATOM   725   H  HB1  . ALA A 1 48  ? -76.437  22.792  -19.638 1.00 53.05  ? 609  ALA A HB1  1 
ATOM   726   H  HB2  . ALA A 1 48  ? -76.402  23.935  -18.534 1.00 53.05  ? 609  ALA A HB2  1 
ATOM   727   H  HB3  . ALA A 1 48  ? -77.064  24.218  -19.951 1.00 53.05  ? 609  ALA A HB3  1 
ATOM   728   N  N    . ASP A 1 49  ? -75.753  24.380  -22.342 1.00 50.21  ? 610  ASP A N    1 
ATOM   729   C  CA   . ASP A 1 49  ? -75.790  23.992  -23.753 1.00 49.19  ? 610  ASP A CA   1 
ATOM   730   C  C    . ASP A 1 49  ? -74.415  24.088  -24.402 1.00 45.93  ? 610  ASP A C    1 
ATOM   731   O  O    . ASP A 1 49  ? -73.987  23.177  -25.120 1.00 54.56  ? 610  ASP A O    1 
ATOM   732   C  CB   . ASP A 1 49  ? -76.788  24.868  -24.516 1.00 40.64  ? 610  ASP A CB   1 
ATOM   733   C  CG   . ASP A 1 49  ? -78.169  24.858  -23.902 1.00 48.27  ? 610  ASP A CG   1 
ATOM   734   O  OD1  . ASP A 1 49  ? -78.416  24.027  -23.003 1.00 66.26  ? 610  ASP A OD1  1 
ATOM   735   O  OD2  . ASP A 1 49  ? -79.009  25.680  -24.325 1.00 60.05  ? 610  ASP A OD2  1 
ATOM   736   H  H    . ASP A 1 49  ? -76.354  24.954  -22.121 1.00 60.25  ? 610  ASP A H    1 
ATOM   737   H  HA   . ASP A 1 49  ? -76.088  23.071  -23.818 1.00 59.02  ? 610  ASP A HA   1 
ATOM   738   H  HB2  . ASP A 1 49  ? -76.468  25.784  -24.518 1.00 48.77  ? 610  ASP A HB2  1 
ATOM   739   H  HB3  . ASP A 1 49  ? -76.863  24.542  -25.427 1.00 48.77  ? 610  ASP A HB3  1 
ATOM   740   N  N    . ARG A 1 50  ? -73.706  25.189  -24.156 1.00 46.57  ? 611  ARG A N    1 
ATOM   741   C  CA   . ARG A 1 50  ? -72.398  25.376  -24.773 1.00 47.02  ? 611  ARG A CA   1 
ATOM   742   C  C    . ARG A 1 50  ? -71.420  24.295  -24.333 1.00 46.93  ? 611  ARG A C    1 
ATOM   743   O  O    . ARG A 1 50  ? -70.640  23.785  -25.144 1.00 42.43  ? 611  ARG A O    1 
ATOM   744   C  CB   . ARG A 1 50  ? -71.858  26.761  -24.426 1.00 41.50  ? 611  ARG A CB   1 
ATOM   745   C  CG   . ARG A 1 50  ? -70.379  26.956  -24.723 1.00 41.75  ? 611  ARG A CG   1 
ATOM   746   C  CD   . ARG A 1 50  ? -69.912  28.345  -24.313 1.00 55.25  ? 611  ARG A CD   1 
ATOM   747   N  NE   . ARG A 1 50  ? -68.457  28.468  -24.378 1.00 51.82  ? 611  ARG A NE   1 
ATOM   748   C  CZ   . ARG A 1 50  ? -67.624  28.154  -23.389 1.00 50.03  ? 611  ARG A CZ   1 
ATOM   749   N  NH1  . ARG A 1 50  ? -68.089  27.693  -22.232 1.00 44.00  ? 611  ARG A NH1  1 
ATOM   750   N  NH2  . ARG A 1 50  ? -66.317  28.304  -23.560 1.00 63.20  ? 611  ARG A NH2  1 
ATOM   751   H  H    . ARG A 1 50  ? -73.956  25.833  -23.643 1.00 55.88  ? 611  ARG A H    1 
ATOM   752   H  HA   . ARG A 1 50  ? -72.492  25.322  -25.737 1.00 56.42  ? 611  ARG A HA   1 
ATOM   753   H  HB2  . ARG A 1 50  ? -72.350  27.423  -24.938 1.00 49.80  ? 611  ARG A HB2  1 
ATOM   754   H  HB3  . ARG A 1 50  ? -71.990  26.917  -23.478 1.00 49.80  ? 611  ARG A HB3  1 
ATOM   755   H  HG2  . ARG A 1 50  ? -69.863  26.302  -24.226 1.00 50.11  ? 611  ARG A HG2  1 
ATOM   756   H  HG3  . ARG A 1 50  ? -70.227  26.852  -25.675 1.00 50.11  ? 611  ARG A HG3  1 
ATOM   757   H  HD2  . ARG A 1 50  ? -70.300  29.002  -24.912 1.00 66.31  ? 611  ARG A HD2  1 
ATOM   758   H  HD3  . ARG A 1 50  ? -70.191  28.518  -23.400 1.00 66.31  ? 611  ARG A HD3  1 
ATOM   759   H  HE   . ARG A 1 50  ? -68.115  28.766  -25.109 1.00 62.19  ? 611  ARG A HE   1 
ATOM   760   H  HH11 . ARG A 1 50  ? -68.935  27.594  -22.117 1.00 52.80  ? 611  ARG A HH11 1 
ATOM   761   H  HH12 . ARG A 1 50  ? -67.542  27.494  -21.598 1.00 52.80  ? 611  ARG A HH12 1 
ATOM   762   H  HH21 . ARG A 1 50  ? -66.013  28.602  -24.307 1.00 75.84  ? 611  ARG A HH21 1 
ATOM   763   H  HH22 . ARG A 1 50  ? -65.775  28.104  -22.924 1.00 75.84  ? 611  ARG A HH22 1 
ATOM   764   N  N    . GLU A 1 51  ? -71.450  23.928  -23.054 1.00 39.65  ? 612  GLU A N    1 
ATOM   765   C  CA   . GLU A 1 51  ? -70.491  22.965  -22.532 1.00 45.37  ? 612  GLU A CA   1 
ATOM   766   C  C    . GLU A 1 51  ? -70.861  21.537  -22.918 1.00 48.06  ? 612  GLU A C    1 
ATOM   767   O  O    . GLU A 1 51  ? -69.980  20.750  -23.278 1.00 40.82  ? 612  GLU A O    1 
ATOM   768   C  CB   . GLU A 1 51  ? -70.387  23.117  -21.016 1.00 44.24  ? 612  GLU A CB   1 
ATOM   769   C  CG   . GLU A 1 51  ? -69.743  24.430  -20.603 1.00 44.42  ? 612  GLU A CG   1 
ATOM   770   C  CD   . GLU A 1 51  ? -69.640  24.594  -19.102 1.00 60.56  ? 612  GLU A CD   1 
ATOM   771   O  OE1  . GLU A 1 51  ? -70.221  23.763  -18.373 1.00 42.13  ? 612  GLU A OE1  1 
ATOM   772   O  OE2  . GLU A 1 51  ? -68.972  25.550  -18.651 1.00 47.44  ? 612  GLU A OE2  1 
ATOM   773   H  H    . GLU A 1 51  ? -72.012  24.221  -22.473 1.00 47.59  ? 612  GLU A H    1 
ATOM   774   H  HA   . GLU A 1 51  ? -69.619  23.157  -22.910 1.00 54.44  ? 612  GLU A HA   1 
ATOM   775   H  HB2  . GLU A 1 51  ? -71.278  23.086  -20.633 1.00 53.09  ? 612  GLU A HB2  1 
ATOM   776   H  HB3  . GLU A 1 51  ? -69.847  22.393  -20.661 1.00 53.09  ? 612  GLU A HB3  1 
ATOM   777   H  HG2  . GLU A 1 51  ? -68.846  24.470  -20.971 1.00 53.30  ? 612  GLU A HG2  1 
ATOM   778   H  HG3  . GLU A 1 51  ? -70.276  25.164  -20.948 1.00 53.30  ? 612  GLU A HG3  1 
ATOM   779   N  N    . VAL A 1 52  ? -72.149  21.185  -22.856 1.00 42.18  ? 613  VAL A N    1 
ATOM   780   C  CA   . VAL A 1 52  ? -72.585  19.869  -23.321 1.00 48.53  ? 613  VAL A CA   1 
ATOM   781   C  C    . VAL A 1 52  ? -72.143  19.648  -24.763 1.00 49.25  ? 613  VAL A C    1 
ATOM   782   O  O    . VAL A 1 52  ? -71.547  18.617  -25.099 1.00 66.23  ? 613  VAL A O    1 
ATOM   783   C  CB   . VAL A 1 52  ? -74.112  19.720  -23.177 1.00 41.29  ? 613  VAL A CB   1 
ATOM   784   C  CG1  . VAL A 1 52  ? -74.626  18.518  -23.970 1.00 48.50  ? 613  VAL A CG1  1 
ATOM   785   C  CG2  . VAL A 1 52  ? -74.499  19.582  -21.723 1.00 48.89  ? 613  VAL A CG2  1 
ATOM   786   H  H    . VAL A 1 52  ? -72.781  21.684  -22.552 1.00 50.61  ? 613  VAL A H    1 
ATOM   787   H  HA   . VAL A 1 52  ? -72.166  19.187  -22.773 1.00 58.24  ? 613  VAL A HA   1 
ATOM   788   H  HB   . VAL A 1 52  ? -74.542  20.517  -23.527 1.00 49.55  ? 613  VAL A HB   1 
ATOM   789   H  HG11 . VAL A 1 52  ? -75.587  18.454  -23.858 1.00 58.20  ? 613  VAL A HG11 1 
ATOM   790   H  HG12 . VAL A 1 52  ? -74.409  18.643  -24.907 1.00 58.20  ? 613  VAL A HG12 1 
ATOM   791   H  HG13 . VAL A 1 52  ? -74.199  17.714  -23.636 1.00 58.20  ? 613  VAL A HG13 1 
ATOM   792   H  HG21 . VAL A 1 52  ? -75.462  19.490  -21.660 1.00 58.67  ? 613  VAL A HG21 1 
ATOM   793   H  HG22 . VAL A 1 52  ? -74.066  18.795  -21.356 1.00 58.67  ? 613  VAL A HG22 1 
ATOM   794   H  HG23 . VAL A 1 52  ? -74.209  20.374  -21.243 1.00 58.67  ? 613  VAL A HG23 1 
ATOM   795   N  N    . GLN A 1 53  ? -72.429  20.614  -25.638 1.00 48.29  ? 614  GLN A N    1 
ATOM   796   C  CA   . GLN A 1 53  ? -72.074  20.466  -27.044 1.00 49.00  ? 614  GLN A CA   1 
ATOM   797   C  C    . GLN A 1 53  ? -70.567  20.344  -27.221 1.00 57.03  ? 614  GLN A C    1 
ATOM   798   O  O    . GLN A 1 53  ? -70.092  19.521  -28.011 1.00 60.80  ? 614  GLN A O    1 
ATOM   799   C  CB   . GLN A 1 53  ? -72.612  21.651  -27.844 1.00 58.15  ? 614  GLN A CB   1 
ATOM   800   C  CG   . GLN A 1 53  ? -72.379  21.544  -29.343 1.00 58.60  ? 614  GLN A CG   1 
ATOM   801   C  CD   . GLN A 1 53  ? -72.988  22.698  -30.117 1.00 93.25  ? 614  GLN A CD   1 
ATOM   802   O  OE1  . GLN A 1 53  ? -73.640  23.573  -29.546 1.00 103.68 ? 614  GLN A OE1  1 
ATOM   803   N  NE2  . GLN A 1 53  ? -72.776  22.704  -31.429 1.00 93.05  ? 614  GLN A NE2  1 
ATOM   804   H  H    . GLN A 1 53  ? -72.823  21.353  -25.443 1.00 57.95  ? 614  GLN A H    1 
ATOM   805   H  HA   . GLN A 1 53  ? -72.483  19.658  -27.391 1.00 58.81  ? 614  GLN A HA   1 
ATOM   806   H  HB2  . GLN A 1 53  ? -73.569  21.717  -27.697 1.00 69.79  ? 614  GLN A HB2  1 
ATOM   807   H  HB3  . GLN A 1 53  ? -72.177  22.461  -27.534 1.00 69.79  ? 614  GLN A HB3  1 
ATOM   808   H  HG2  . GLN A 1 53  ? -71.424  21.538  -29.514 1.00 70.32  ? 614  GLN A HG2  1 
ATOM   809   H  HG3  . GLN A 1 53  ? -72.778  20.721  -29.666 1.00 70.32  ? 614  GLN A HG3  1 
ATOM   810   H  HE21 . GLN A 1 53  ? -72.315  22.076  -31.793 1.00 111.66 ? 614  GLN A HE21 1 
ATOM   811   H  HE22 . GLN A 1 53  ? -73.099  23.336  -31.913 1.00 111.66 ? 614  GLN A HE22 1 
ATOM   812   N  N    . LEU A 1 54  ? -69.800  21.147  -26.486 1.00 50.56  ? 615  LEU A N    1 
ATOM   813   C  CA   . LEU A 1 54  ? -68.348  21.102  -26.616 1.00 49.40  ? 615  LEU A CA   1 
ATOM   814   C  C    . LEU A 1 54  ? -67.798  19.774  -26.117 1.00 56.99  ? 615  LEU A C    1 
ATOM   815   O  O    . LEU A 1 54  ? -66.874  19.209  -26.716 1.00 63.73  ? 615  LEU A O    1 
ATOM   816   C  CB   . LEU A 1 54  ? -67.731  22.273  -25.847 1.00 54.95  ? 615  LEU A CB   1 
ATOM   817   C  CG   . LEU A 1 54  ? -66.663  23.150  -26.499 1.00 50.48  ? 615  LEU A CG   1 
ATOM   818   C  CD1  . LEU A 1 54  ? -66.973  23.520  -27.940 1.00 52.69  ? 615  LEU A CD1  1 
ATOM   819   C  CD2  . LEU A 1 54  ? -66.532  24.414  -25.673 1.00 57.06  ? 615  LEU A CD2  1 
ATOM   820   H  H    . LEU A 1 54  ? -70.091  21.719  -25.914 1.00 60.67  ? 615  LEU A H    1 
ATOM   821   H  HA   . LEU A 1 54  ? -68.109  21.196  -27.551 1.00 59.28  ? 615  LEU A HA   1 
ATOM   822   H  HB2  . LEU A 1 54  ? -68.455  22.867  -25.595 1.00 65.94  ? 615  LEU A HB2  1 
ATOM   823   H  HB3  . LEU A 1 54  ? -67.332  21.911  -25.040 1.00 65.94  ? 615  LEU A HB3  1 
ATOM   824   H  HG   . LEU A 1 54  ? -65.812  22.685  -26.481 1.00 60.58  ? 615  LEU A HG   1 
ATOM   825   H  HD11 . LEU A 1 54  ? -66.255  24.074  -28.285 1.00 63.23  ? 615  LEU A HD11 1 
ATOM   826   H  HD12 . LEU A 1 54  ? -67.047  22.708  -28.465 1.00 63.23  ? 615  LEU A HD12 1 
ATOM   827   H  HD13 . LEU A 1 54  ? -67.811  24.009  -27.966 1.00 63.23  ? 615  LEU A HD13 1 
ATOM   828   H  HD21 . LEU A 1 54  ? -65.857  24.984  -26.073 1.00 68.48  ? 615  LEU A HD21 1 
ATOM   829   H  HD22 . LEU A 1 54  ? -67.387  24.872  -25.660 1.00 68.48  ? 615  LEU A HD22 1 
ATOM   830   H  HD23 . LEU A 1 54  ? -66.271  24.174  -24.770 1.00 68.48  ? 615  LEU A HD23 1 
ATOM   831   N  N    . LEU A 1 55  ? -68.360  19.257  -25.026 1.00 55.43  ? 616  LEU A N    1 
ATOM   832   C  CA   . LEU A 1 55  ? -67.941  17.958  -24.517 1.00 63.30  ? 616  LEU A CA   1 
ATOM   833   C  C    . LEU A 1 55  ? -68.371  16.841  -25.459 1.00 63.66  ? 616  LEU A C    1 
ATOM   834   O  O    . LEU A 1 55  ? -67.617  15.892  -25.695 1.00 62.42  ? 616  LEU A O    1 
ATOM   835   C  CB   . LEU A 1 55  ? -68.526  17.752  -23.116 1.00 51.87  ? 616  LEU A CB   1 
ATOM   836   C  CG   . LEU A 1 55  ? -67.616  17.314  -21.966 1.00 61.43  ? 616  LEU A CG   1 
ATOM   837   C  CD1  . LEU A 1 55  ? -66.317  18.102  -21.897 1.00 48.29  ? 616  LEU A CD1  1 
ATOM   838   C  CD2  . LEU A 1 55  ? -68.384  17.461  -20.660 1.00 55.17  ? 616  LEU A CD2  1 
ATOM   839   H  H    . LEU A 1 55  ? -68.981  19.636  -24.568 1.00 66.51  ? 616  LEU A H    1 
ATOM   840   H  HA   . LEU A 1 55  ? -66.974  17.940  -24.447 1.00 75.96  ? 616  LEU A HA   1 
ATOM   841   H  HB2  . LEU A 1 55  ? -68.930  18.590  -22.843 1.00 62.24  ? 616  LEU A HB2  1 
ATOM   842   H  HB3  . LEU A 1 55  ? -69.222  17.080  -23.188 1.00 62.24  ? 616  LEU A HB3  1 
ATOM   843   H  HG   . LEU A 1 55  ? -67.393  16.376  -22.079 1.00 73.71  ? 616  LEU A HG   1 
ATOM   844   H  HD11 . LEU A 1 55  ? -65.790  17.777  -21.150 1.00 57.94  ? 616  LEU A HD11 1 
ATOM   845   H  HD12 . LEU A 1 55  ? -65.829  17.979  -22.726 1.00 57.94  ? 616  LEU A HD12 1 
ATOM   846   H  HD13 . LEU A 1 55  ? -66.525  19.041  -21.771 1.00 57.94  ? 616  LEU A HD13 1 
ATOM   847   H  HD21 . LEU A 1 55  ? -67.814  17.185  -19.926 1.00 66.20  ? 616  LEU A HD21 1 
ATOM   848   H  HD22 . LEU A 1 55  ? -68.641  18.390  -20.549 1.00 66.20  ? 616  LEU A HD22 1 
ATOM   849   H  HD23 . LEU A 1 55  ? -69.175  16.901  -20.694 1.00 66.20  ? 616  LEU A HD23 1 
ATOM   850   N  N    . ARG A 1 56  ? -69.576  16.954  -26.020 1.00 63.56  ? 617  ARG A N    1 
ATOM   851   C  CA   . ARG A 1 56  ? -70.081  15.942  -26.941 1.00 59.29  ? 617  ARG A CA   1 
ATOM   852   C  C    . ARG A 1 56  ? -69.244  15.866  -28.212 1.00 66.90  ? 617  ARG A C    1 
ATOM   853   O  O    . ARG A 1 56  ? -69.106  14.787  -28.799 1.00 65.77  ? 617  ARG A O    1 
ATOM   854   C  CB   . ARG A 1 56  ? -71.541  16.251  -27.281 1.00 69.30  ? 617  ARG A CB   1 
ATOM   855   C  CG   . ARG A 1 56  ? -72.202  15.289  -28.259 1.00 75.03  ? 617  ARG A CG   1 
ATOM   856   C  CD   . ARG A 1 56  ? -73.407  15.932  -28.924 1.00 73.81  ? 617  ARG A CD   1 
ATOM   857   N  NE   . ARG A 1 56  ? -74.475  16.242  -27.972 1.00 70.99  ? 617  ARG A NE   1 
ATOM   858   C  CZ   . ARG A 1 56  ? -75.020  17.443  -27.789 1.00 89.27  ? 617  ARG A CZ   1 
ATOM   859   N  NH1  . ARG A 1 56  ? -74.611  18.498  -28.491 1.00 64.72  ? 617  ARG A NH1  1 
ATOM   860   N  NH2  . ARG A 1 56  ? -75.992  17.586  -26.893 1.00 83.47  ? 617  ARG A NH2  1 
ATOM   861   H  H    . ARG A 1 56  ? -70.118  17.607  -25.883 1.00 76.27  ? 617  ARG A H    1 
ATOM   862   H  HA   . ARG A 1 56  ? -70.049  15.074  -26.507 1.00 71.15  ? 617  ARG A HA   1 
ATOM   863   H  HB2  . ARG A 1 56  ? -72.058  16.233  -26.461 1.00 83.15  ? 617  ARG A HB2  1 
ATOM   864   H  HB3  . ARG A 1 56  ? -71.583  17.138  -27.672 1.00 83.15  ? 617  ARG A HB3  1 
ATOM   865   H  HG2  . ARG A 1 56  ? -71.566  15.044  -28.949 1.00 90.04  ? 617  ARG A HG2  1 
ATOM   866   H  HG3  . ARG A 1 56  ? -72.501  14.500  -27.781 1.00 90.04  ? 617  ARG A HG3  1 
ATOM   867   H  HD2  . ARG A 1 56  ? -73.131  16.761  -29.346 1.00 88.57  ? 617  ARG A HD2  1 
ATOM   868   H  HD3  . ARG A 1 56  ? -73.764  15.323  -29.589 1.00 88.57  ? 617  ARG A HD3  1 
ATOM   869   H  HE   . ARG A 1 56  ? -74.775  15.595  -27.492 1.00 85.18  ? 617  ARG A HE   1 
ATOM   870   H  HH11 . ARG A 1 56  ? -73.984  18.410  -29.073 1.00 77.67  ? 617  ARG A HH11 1 
ATOM   871   H  HH12 . ARG A 1 56  ? -74.972  19.268  -28.362 1.00 77.67  ? 617  ARG A HH12 1 
ATOM   872   H  HH21 . ARG A 1 56  ? -76.259  16.908  -26.436 1.00 100.16 ? 617  ARG A HH21 1 
ATOM   873   H  HH22 . ARG A 1 56  ? -76.349  18.358  -26.765 1.00 100.16 ? 617  ARG A HH22 1 
ATOM   874   N  N    . GLU A 1 57  ? -68.669  16.988  -28.642 1.00 70.19  ? 618  GLU A N    1 
ATOM   875   C  CA   . GLU A 1 57  ? -67.994  17.075  -29.931 1.00 59.20  ? 618  GLU A CA   1 
ATOM   876   C  C    . GLU A 1 57  ? -66.541  16.617  -29.889 1.00 55.76  ? 618  GLU A C    1 
ATOM   877   O  O    . GLU A 1 57  ? -65.873  16.645  -30.928 1.00 75.05  ? 618  GLU A O    1 
ATOM   878   C  CB   . GLU A 1 57  ? -68.060  18.514  -30.462 1.00 63.73  ? 618  GLU A CB   1 
ATOM   879   C  CG   . GLU A 1 57  ? -69.414  18.897  -31.047 1.00 63.87  ? 618  GLU A CG   1 
ATOM   880   C  CD   . GLU A 1 57  ? -69.463  20.334  -31.546 1.00 76.16  ? 618  GLU A CD   1 
ATOM   881   O  OE1  . GLU A 1 57  ? -68.466  21.069  -31.369 1.00 65.25  ? 618  GLU A OE1  1 
ATOM   882   O  OE2  . GLU A 1 57  ? -70.504  20.727  -32.118 1.00 82.44  ? 618  GLU A OE2  1 
ATOM   883   H  H    . GLU A 1 57  ? -68.657  17.723  -28.197 1.00 84.23  ? 618  GLU A H    1 
ATOM   884   H  HA   . GLU A 1 57  ? -68.461  16.507  -30.563 1.00 71.04  ? 618  GLU A HA   1 
ATOM   885   H  HB2  . GLU A 1 57  ? -67.870  19.124  -29.732 1.00 76.47  ? 618  GLU A HB2  1 
ATOM   886   H  HB3  . GLU A 1 57  ? -67.396  18.620  -31.160 1.00 76.47  ? 618  GLU A HB3  1 
ATOM   887   H  HG2  . GLU A 1 57  ? -69.610  18.314  -31.797 1.00 76.65  ? 618  GLU A HG2  1 
ATOM   888   H  HG3  . GLU A 1 57  ? -70.094  18.796  -30.362 1.00 76.65  ? 618  GLU A HG3  1 
ATOM   889   N  N    . SER A 1 58  ? -66.032  16.204  -28.731 1.00 52.66  ? 619  SER A N    1 
ATOM   890   C  CA   . SER A 1 58  ? -64.677  15.681  -28.612 1.00 59.82  ? 619  SER A CA   1 
ATOM   891   C  C    . SER A 1 58  ? -64.724  14.304  -27.963 1.00 44.77  ? 619  SER A C    1 
ATOM   892   O  O    . SER A 1 58  ? -65.788  13.803  -27.587 1.00 66.22  ? 619  SER A O    1 
ATOM   893   C  CB   . SER A 1 58  ? -63.784  16.636  -27.813 1.00 64.98  ? 619  SER A CB   1 
ATOM   894   O  OG   . SER A 1 58  ? -63.514  17.806  -28.566 1.00 92.08  ? 619  SER A OG   1 
ATOM   895   H  H    . SER A 1 58  ? -66.462  16.217  -27.986 1.00 63.19  ? 619  SER A H    1 
ATOM   896   H  HA   . SER A 1 58  ? -64.295  15.583  -29.499 1.00 71.79  ? 619  SER A HA   1 
ATOM   897   H  HB2  . SER A 1 58  ? -64.239  16.884  -26.993 1.00 77.98  ? 619  SER A HB2  1 
ATOM   898   H  HB3  . SER A 1 58  ? -62.947  16.191  -27.608 1.00 77.98  ? 619  SER A HB3  1 
ATOM   899   H  HG   . SER A 1 58  ? -63.025  18.326  -28.123 1.00 110.50 ? 619  SER A HG   1 
ATOM   900   N  N    . ASP A 1 59  ? -63.554  13.688  -27.831 1.00 51.68  ? 620  ASP A N    1 
ATOM   901   C  CA   . ASP A 1 59  ? -63.476  12.351  -27.268 1.00 59.87  ? 620  ASP A CA   1 
ATOM   902   C  C    . ASP A 1 59  ? -63.670  12.394  -25.755 1.00 42.92  ? 620  ASP A C    1 
ATOM   903   O  O    . ASP A 1 59  ? -63.448  13.414  -25.098 1.00 37.95  ? 620  ASP A O    1 
ATOM   904   C  CB   . ASP A 1 59  ? -62.133  11.703  -27.600 1.00 63.82  ? 620  ASP A CB   1 
ATOM   905   C  CG   . ASP A 1 59  ? -61.945  11.471  -29.088 1.00 71.63  ? 620  ASP A CG   1 
ATOM   906   O  OD1  . ASP A 1 59  ? -62.956  11.327  -29.807 1.00 75.08  ? 620  ASP A OD1  1 
ATOM   907   O  OD2  . ASP A 1 59  ? -60.779  11.428  -29.537 1.00 75.01  ? 620  ASP A OD2  1 
ATOM   908   H  H    . ASP A 1 59  ? -62.796  14.023  -28.060 1.00 62.02  ? 620  ASP A H    1 
ATOM   909   H  HA   . ASP A 1 59  ? -64.180  11.803  -27.649 1.00 71.85  ? 620  ASP A HA   1 
ATOM   910   H  HB2  . ASP A 1 59  ? -61.418  12.283  -27.295 1.00 76.58  ? 620  ASP A HB2  1 
ATOM   911   H  HB3  . ASP A 1 59  ? -62.077  10.844  -27.153 1.00 76.58  ? 620  ASP A HB3  1 
ATOM   912   N  N    . GLU A 1 60  ? -64.090  11.257  -25.206 1.00 44.65  ? 621  GLU A N    1 
ATOM   913   C  CA   . GLU A 1 60  ? -64.301  11.132  -23.771 1.00 32.47  ? 621  GLU A CA   1 
ATOM   914   C  C    . GLU A 1 60  ? -62.961  10.989  -23.066 1.00 40.14  ? 621  GLU A C    1 
ATOM   915   O  O    . GLU A 1 60  ? -62.159  10.113  -23.408 1.00 54.20  ? 621  GLU A O    1 
ATOM   916   C  CB   . GLU A 1 60  ? -65.196  9.936   -23.456 1.00 40.21  ? 621  GLU A CB   1 
ATOM   917   C  CG   . GLU A 1 60  ? -66.692  10.232  -23.566 1.00 51.80  ? 621  GLU A CG   1 
ATOM   918   C  CD   . GLU A 1 60  ? -67.560  9.153   -22.935 1.00 86.05  ? 621  GLU A CD   1 
ATOM   919   O  OE1  . GLU A 1 60  ? -67.036  8.355   -22.128 1.00 83.67  ? 621  GLU A OE1  1 
ATOM   920   O  OE2  . GLU A 1 60  ? -68.769  9.103   -23.248 1.00 85.00  ? 621  GLU A OE2  1 
ATOM   921   H  H    . GLU A 1 60  ? -64.261  10.539  -25.648 1.00 53.58  ? 621  GLU A H    1 
ATOM   922   H  HA   . GLU A 1 60  ? -64.736  11.933  -23.439 1.00 38.97  ? 621  GLU A HA   1 
ATOM   923   H  HB2  . GLU A 1 60  ? -64.990  9.221   -24.078 1.00 48.25  ? 621  GLU A HB2  1 
ATOM   924   H  HB3  . GLU A 1 60  ? -65.018  9.643   -22.549 1.00 48.25  ? 621  GLU A HB3  1 
ATOM   925   H  HG2  . GLU A 1 60  ? -66.881  11.069  -23.114 1.00 62.16  ? 621  GLU A HG2  1 
ATOM   926   H  HG3  . GLU A 1 60  ? -66.932  10.299  -24.503 1.00 62.16  ? 621  GLU A HG3  1 
ATOM   927   N  N    . HIS A 1 61  ? -62.723  11.847  -22.101 1.00 35.82  ? 622  HIS A N    1 
ATOM   928   C  CA   . HIS A 1 61  ? -61.546  11.772  -21.246 1.00 36.41  ? 622  HIS A CA   1 
ATOM   929   C  C    . HIS A 1 61  ? -61.875  10.947  -20.008 1.00 35.85  ? 622  HIS A C    1 
ATOM   930   O  O    . HIS A 1 61  ? -62.945  11.133  -19.419 1.00 32.76  ? 622  HIS A O    1 
ATOM   931   C  CB   . HIS A 1 61  ? -61.092  13.165  -20.836 1.00 36.13  ? 622  HIS A CB   1 
ATOM   932   C  CG   . HIS A 1 61  ? -59.686  13.217  -20.323 1.00 46.83  ? 622  HIS A CG   1 
ATOM   933   N  ND1  . HIS A 1 61  ? -59.379  13.153  -18.981 1.00 40.42  ? 622  HIS A ND1  1 
ATOM   934   C  CD2  . HIS A 1 61  ? -58.505  13.333  -20.974 1.00 46.57  ? 622  HIS A CD2  1 
ATOM   935   C  CE1  . HIS A 1 61  ? -58.069  13.226  -18.828 1.00 41.55  ? 622  HIS A CE1  1 
ATOM   936   N  NE2  . HIS A 1 61  ? -57.516  13.334  -20.022 1.00 37.69  ? 622  HIS A NE2  1 
ATOM   937   H  H    . HIS A 1 61  ? -63.241  12.506  -21.909 1.00 42.99  ? 622  HIS A H    1 
ATOM   938   H  HA   . HIS A 1 61  ? -60.823  11.338  -21.725 1.00 43.70  ? 622  HIS A HA   1 
ATOM   939   H  HB2  . HIS A 1 61  ? -61.148  13.751  -21.607 1.00 43.36  ? 622  HIS A HB2  1 
ATOM   940   H  HB3  . HIS A 1 61  ? -61.676  13.490  -20.134 1.00 43.36  ? 622  HIS A HB3  1 
ATOM   941   H  HD1  . HIS A 1 61  ? -59.951  13.078  -18.343 1.00 48.50  ? 622  HIS A HD1  1 
ATOM   942   H  HD2  . HIS A 1 61  ? -58.386  13.397  -21.894 1.00 55.88  ? 622  HIS A HD2  1 
ATOM   943   H  HE1  . HIS A 1 61  ? -57.614  13.203  -18.017 1.00 49.86  ? 622  HIS A HE1  1 
ATOM   944   H  HE2  . HIS A 1 61  ? -56.672  13.396  -20.178 1.00 45.23  ? 622  HIS A HE2  1 
ATOM   945   N  N    . PRO A 1 62  ? -61.008  10.023  -19.588 1.00 41.25  ? 623  PRO A N    1 
ATOM   946   C  CA   . PRO A 1 62  ? -61.353  9.184   -18.427 1.00 32.70  ? 623  PRO A CA   1 
ATOM   947   C  C    . PRO A 1 62  ? -61.470  9.961   -17.125 1.00 29.52  ? 623  PRO A C    1 
ATOM   948   O  O    . PRO A 1 62  ? -62.122  9.488   -16.185 1.00 41.01  ? 623  PRO A O    1 
ATOM   949   C  CB   . PRO A 1 62  ? -60.200  8.169   -18.380 1.00 27.54  ? 623  PRO A CB   1 
ATOM   950   C  CG   . PRO A 1 62  ? -59.067  8.839   -19.081 1.00 30.13  ? 623  PRO A CG   1 
ATOM   951   C  CD   . PRO A 1 62  ? -59.693  9.672   -20.154 1.00 43.75  ? 623  PRO A CD   1 
ATOM   952   H  HA   . PRO A 1 62  ? -62.185  8.713   -18.592 1.00 39.24  ? 623  PRO A HA   1 
ATOM   953   H  HB2  . PRO A 1 62  ? -59.969  7.979   -17.457 1.00 33.04  ? 623  PRO A HB2  1 
ATOM   954   H  HB3  . PRO A 1 62  ? -60.460  7.357   -18.844 1.00 33.04  ? 623  PRO A HB3  1 
ATOM   955   H  HG2  . PRO A 1 62  ? -58.581  9.398   -18.455 1.00 36.15  ? 623  PRO A HG2  1 
ATOM   956   H  HG3  . PRO A 1 62  ? -58.481  8.169   -19.467 1.00 36.15  ? 623  PRO A HG3  1 
ATOM   957   H  HD2  . PRO A 1 62  ? -59.168  10.472  -20.311 1.00 52.50  ? 623  PRO A HD2  1 
ATOM   958   H  HD3  . PRO A 1 62  ? -59.802  9.152   -20.966 1.00 52.50  ? 623  PRO A HD3  1 
ATOM   959   N  N    . ASN A 1 63  ? -60.812  11.113  -17.026 1.00 37.36  ? 624  ASN A N    1 
ATOM   960   C  CA   . ASN A 1 63  ? -60.761  11.916  -15.811 1.00 35.27  ? 624  ASN A CA   1 
ATOM   961   C  C    . ASN A 1 63  ? -61.769  13.068  -15.786 1.00 44.38  ? 624  ASN A C    1 
ATOM   962   O  O    . ASN A 1 63  ? -61.688  13.925  -14.899 1.00 35.47  ? 624  ASN A O    1 
ATOM   963   C  CB   . ASN A 1 63  ? -59.338  12.425  -15.597 1.00 30.07  ? 624  ASN A CB   1 
ATOM   964   C  CG   . ASN A 1 63  ? -58.333  11.293  -15.538 1.00 33.24  ? 624  ASN A CG   1 
ATOM   965   O  OD1  . ASN A 1 63  ? -57.315  11.311  -16.227 1.00 46.37  ? 624  ASN A OD1  1 
ATOM   966   N  ND2  . ASN A 1 63  ? -58.630  10.283  -14.729 1.00 29.71  ? 624  ASN A ND2  1 
ATOM   967   H  H    . ASN A 1 63  ? -60.371  11.462  -17.677 1.00 44.83  ? 624  ASN A H    1 
ATOM   968   H  HA   . ASN A 1 63  ? -60.972  11.338  -15.061 1.00 42.33  ? 624  ASN A HA   1 
ATOM   969   H  HB2  . ASN A 1 63  ? -59.094  13.008  -16.333 1.00 36.08  ? 624  ASN A HB2  1 
ATOM   970   H  HB3  . ASN A 1 63  ? -59.296  12.910  -14.758 1.00 36.08  ? 624  ASN A HB3  1 
ATOM   971   H  HD21 . ASN A 1 63  ? -59.360  10.297  -14.274 1.00 35.65  ? 624  ASN A HD21 1 
ATOM   972   H  HD22 . ASN A 1 63  ? -58.093  9.615   -14.659 1.00 35.65  ? 624  ASN A HD22 1 
ATOM   973   N  N    . VAL A 1 64  ? -62.660  13.160  -16.771 1.00 30.82  ? 625  VAL A N    1 
ATOM   974   C  CA   . VAL A 1 64  ? -63.796  14.077  -16.726 1.00 33.06  ? 625  VAL A CA   1 
ATOM   975   C  C    . VAL A 1 64  ? -65.064  13.250  -16.569 1.00 31.32  ? 625  VAL A C    1 
ATOM   976   O  O    . VAL A 1 64  ? -65.274  12.282  -17.309 1.00 37.18  ? 625  VAL A O    1 
ATOM   977   C  CB   . VAL A 1 64  ? -63.875  14.955  -17.986 1.00 34.11  ? 625  VAL A CB   1 
ATOM   978   C  CG1  . VAL A 1 64  ? -65.057  15.904  -17.889 1.00 34.38  ? 625  VAL A CG1  1 
ATOM   979   C  CG2  . VAL A 1 64  ? -62.587  15.740  -18.170 1.00 33.66  ? 625  VAL A CG2  1 
ATOM   980   H  H    . VAL A 1 64  ? -62.626  12.692  -17.491 1.00 36.98  ? 625  VAL A H    1 
ATOM   981   H  HA   . VAL A 1 64  ? -63.711  14.657  -15.954 1.00 39.67  ? 625  VAL A HA   1 
ATOM   982   H  HB   . VAL A 1 64  ? -64.001  14.390  -18.764 1.00 40.94  ? 625  VAL A HB   1 
ATOM   983   H  HG11 . VAL A 1 64  ? -65.091  16.449  -18.691 1.00 41.26  ? 625  VAL A HG11 1 
ATOM   984   H  HG12 . VAL A 1 64  ? -65.872  15.384  -17.808 1.00 41.26  ? 625  VAL A HG12 1 
ATOM   985   H  HG13 . VAL A 1 64  ? -64.945  16.469  -17.109 1.00 41.26  ? 625  VAL A HG13 1 
ATOM   986   H  HG21 . VAL A 1 64  ? -62.662  16.284  -18.969 1.00 40.40  ? 625  VAL A HG21 1 
ATOM   987   H  HG22 . VAL A 1 64  ? -62.449  16.306  -17.395 1.00 40.40  ? 625  VAL A HG22 1 
ATOM   988   H  HG23 . VAL A 1 64  ? -61.849  15.117  -18.261 1.00 40.40  ? 625  VAL A HG23 1 
ATOM   989   N  N    . ILE A 1 65  ? -65.919  13.648  -15.621 1.00 38.01  ? 626  ILE A N    1 
ATOM   990   C  CA   . ILE A 1 65  ? -67.127  12.887  -15.330 1.00 37.57  ? 626  ILE A CA   1 
ATOM   991   C  C    . ILE A 1 65  ? -67.937  12.727  -16.608 1.00 33.92  ? 626  ILE A C    1 
ATOM   992   O  O    . ILE A 1 65  ? -68.016  13.641  -17.438 1.00 35.56  ? 626  ILE A O    1 
ATOM   993   C  CB   . ILE A 1 65  ? -67.940  13.579  -14.220 1.00 38.81  ? 626  ILE A CB   1 
ATOM   994   C  CG1  . ILE A 1 65  ? -68.832  12.572  -13.498 1.00 47.46  ? 626  ILE A CG1  1 
ATOM   995   C  CG2  . ILE A 1 65  ? -68.762  14.736  -14.772 1.00 39.55  ? 626  ILE A CG2  1 
ATOM   996   C  CD1  . ILE A 1 65  ? -69.556  13.156  -12.296 1.00 60.48  ? 626  ILE A CD1  1 
ATOM   997   H  H    . ILE A 1 65  ? -65.819  14.352  -15.137 1.00 45.61  ? 626  ILE A H    1 
ATOM   998   H  HA   . ILE A 1 65  ? -66.879  12.003  -15.017 1.00 45.09  ? 626  ILE A HA   1 
ATOM   999   H  HB   . ILE A 1 65  ? -67.314  13.940  -13.573 1.00 46.57  ? 626  ILE A HB   1 
ATOM   1000  H  HG12 . ILE A 1 65  ? -69.502  12.246  -14.119 1.00 56.95  ? 626  ILE A HG12 1 
ATOM   1001  H  HG13 . ILE A 1 65  ? -68.285  11.835  -13.186 1.00 56.95  ? 626  ILE A HG13 1 
ATOM   1002  H  HG21 . ILE A 1 65  ? -69.258  15.145  -14.046 1.00 47.46  ? 626  ILE A HG21 1 
ATOM   1003  H  HG22 . ILE A 1 65  ? -68.163  15.386  -15.172 1.00 47.46  ? 626  ILE A HG22 1 
ATOM   1004  H  HG23 . ILE A 1 65  ? -69.375  14.396  -15.442 1.00 47.46  ? 626  ILE A HG23 1 
ATOM   1005  H  HD11 . ILE A 1 65  ? -70.101  12.465  -11.889 1.00 72.58  ? 626  ILE A HD11 1 
ATOM   1006  H  HD12 . ILE A 1 65  ? -68.900  13.479  -11.658 1.00 72.58  ? 626  ILE A HD12 1 
ATOM   1007  H  HD13 . ILE A 1 65  ? -70.118  13.890  -12.592 1.00 72.58  ? 626  ILE A HD13 1 
ATOM   1008  N  N    . ARG A 1 66  ? -68.527  11.550  -16.780 1.00 40.54  ? 627  ARG A N    1 
ATOM   1009  C  CA   . ARG A 1 66  ? -69.132  11.188  -18.052 1.00 41.03  ? 627  ARG A CA   1 
ATOM   1010  C  C    . ARG A 1 66  ? -70.529  11.772  -18.184 1.00 45.44  ? 627  ARG A C    1 
ATOM   1011  O  O    . ARG A 1 66  ? -71.299  11.823  -17.219 1.00 34.40  ? 627  ARG A O    1 
ATOM   1012  C  CB   . ARG A 1 66  ? -69.198  9.670   -18.199 1.00 51.76  ? 627  ARG A CB   1 
ATOM   1013  C  CG   . ARG A 1 66  ? -69.289  9.200   -19.638 1.00 56.05  ? 627  ARG A CG   1 
ATOM   1014  C  CD   . ARG A 1 66  ? -69.749  7.750   -19.729 1.00 56.58  ? 627  ARG A CD   1 
ATOM   1015  N  NE   . ARG A 1 66  ? -69.184  6.906   -18.678 1.00 54.73  ? 627  ARG A NE   1 
ATOM   1016  C  CZ   . ARG A 1 66  ? -69.347  5.586   -18.608 1.00 70.61  ? 627  ARG A CZ   1 
ATOM   1017  N  NH1  . ARG A 1 66  ? -70.047  4.948   -19.539 1.00 68.71  ? 627  ARG A NH1  1 
ATOM   1018  N  NH2  . ARG A 1 66  ? -68.802  4.900   -17.610 1.00 60.32  ? 627  ARG A NH2  1 
ATOM   1019  H  H    . ARG A 1 66  ? -68.591  10.944  -16.174 1.00 48.65  ? 627  ARG A H    1 
ATOM   1020  H  HA   . ARG A 1 66  ? -68.588  11.538  -18.775 1.00 49.24  ? 627  ARG A HA   1 
ATOM   1021  H  HB2  . ARG A 1 66  ? -68.397  9.283   -17.810 1.00 62.11  ? 627  ARG A HB2  1 
ATOM   1022  H  HB3  . ARG A 1 66  ? -69.982  9.344   -17.729 1.00 62.11  ? 627  ARG A HB3  1 
ATOM   1023  H  HG2  . ARG A 1 66  ? -69.930  9.751   -20.114 1.00 67.26  ? 627  ARG A HG2  1 
ATOM   1024  H  HG3  . ARG A 1 66  ? -68.415  9.267   -20.053 1.00 67.26  ? 627  ARG A HG3  1 
ATOM   1025  H  HD2  . ARG A 1 66  ? -70.716  7.720   -19.650 1.00 67.90  ? 627  ARG A HD2  1 
ATOM   1026  H  HD3  . ARG A 1 66  ? -69.476  7.386   -20.586 1.00 67.90  ? 627  ARG A HD3  1 
ATOM   1027  H  HE   . ARG A 1 66  ? -68.715  7.286   -18.066 1.00 65.67  ? 627  ARG A HE   1 
ATOM   1028  H  HH11 . ARG A 1 66  ? -70.403  5.388   -20.187 1.00 82.45  ? 627  ARG A HH11 1 
ATOM   1029  H  HH12 . ARG A 1 66  ? -70.148  4.095   -19.492 1.00 82.45  ? 627  ARG A HH12 1 
ATOM   1030  H  HH21 . ARG A 1 66  ? -68.345  5.308   -17.007 1.00 72.39  ? 627  ARG A HH21 1 
ATOM   1031  H  HH22 . ARG A 1 66  ? -68.903  4.047   -17.569 1.00 72.39  ? 627  ARG A HH22 1 
ATOM   1032  N  N    . TYR A 1 67  ? -70.851  12.200  -19.397 1.00 43.87  ? 628  TYR A N    1 
ATOM   1033  C  CA   . TYR A 1 67  ? -72.154  12.757  -19.722 1.00 56.75  ? 628  TYR A CA   1 
ATOM   1034  C  C    . TYR A 1 67  ? -72.955  11.729  -20.511 1.00 45.69  ? 628  TYR A C    1 
ATOM   1035  O  O    . TYR A 1 67  ? -72.463  11.166  -21.494 1.00 49.80  ? 628  TYR A O    1 
ATOM   1036  C  CB   . TYR A 1 67  ? -71.998  14.053  -20.512 1.00 40.43  ? 628  TYR A CB   1 
ATOM   1037  C  CG   . TYR A 1 67  ? -73.200  14.439  -21.336 1.00 38.81  ? 628  TYR A CG   1 
ATOM   1038  C  CD1  . TYR A 1 67  ? -74.320  15.003  -20.745 1.00 49.00  ? 628  TYR A CD1  1 
ATOM   1039  C  CD2  . TYR A 1 67  ? -73.201  14.264  -22.711 1.00 53.86  ? 628  TYR A CD2  1 
ATOM   1040  C  CE1  . TYR A 1 67  ? -75.418  15.369  -21.502 1.00 46.79  ? 628  TYR A CE1  1 
ATOM   1041  C  CE2  . TYR A 1 67  ? -74.287  14.627  -23.476 1.00 43.96  ? 628  TYR A CE2  1 
ATOM   1042  C  CZ   . TYR A 1 67  ? -75.393  15.181  -22.867 1.00 50.54  ? 628  TYR A CZ   1 
ATOM   1043  O  OH   . TYR A 1 67  ? -76.482  15.543  -23.626 1.00 51.24  ? 628  TYR A OH   1 
ATOM   1044  H  H    . TYR A 1 67  ? -70.314  12.177  -20.068 1.00 52.64  ? 628  TYR A H    1 
ATOM   1045  H  HA   . TYR A 1 67  ? -72.633  12.954  -18.902 1.00 68.10  ? 628  TYR A HA   1 
ATOM   1046  H  HB2  . TYR A 1 67  ? -71.825  14.776  -19.889 1.00 48.52  ? 628  TYR A HB2  1 
ATOM   1047  H  HB3  . TYR A 1 67  ? -71.246  13.958  -21.117 1.00 48.52  ? 628  TYR A HB3  1 
ATOM   1048  H  HD1  . TYR A 1 67  ? -74.335  15.132  -19.824 1.00 58.80  ? 628  TYR A HD1  1 
ATOM   1049  H  HD2  . TYR A 1 67  ? -72.456  13.893  -23.125 1.00 64.64  ? 628  TYR A HD2  1 
ATOM   1050  H  HE1  . TYR A 1 67  ? -76.165  15.743  -21.093 1.00 56.15  ? 628  TYR A HE1  1 
ATOM   1051  H  HE2  . TYR A 1 67  ? -74.274  14.500  -24.397 1.00 52.75  ? 628  TYR A HE2  1 
ATOM   1052  H  HH   . TYR A 1 67  ? -76.336  15.376  -24.436 1.00 61.49  ? 628  TYR A HH   1 
ATOM   1053  N  N    . PHE A 1 68  ? -74.184  11.487  -20.066 1.00 48.38  ? 629  PHE A N    1 
ATOM   1054  C  CA   . PHE A 1 68  ? -75.057  10.460  -20.623 1.00 49.62  ? 629  PHE A CA   1 
ATOM   1055  C  C    . PHE A 1 68  ? -76.100  11.051  -21.565 1.00 50.60  ? 629  PHE A C    1 
ATOM   1056  O  O    . PHE A 1 68  ? -76.180  10.655  -22.731 1.00 59.50  ? 629  PHE A O    1 
ATOM   1057  C  CB   . PHE A 1 68  ? -75.709  9.650   -19.499 1.00 41.79  ? 629  PHE A CB   1 
ATOM   1058  C  CG   . PHE A 1 68  ? -74.756  8.709   -18.822 1.00 39.22  ? 629  PHE A CG   1 
ATOM   1059  C  CD1  . PHE A 1 68  ? -74.131  7.707   -19.542 1.00 42.03  ? 629  PHE A CD1  1 
ATOM   1060  C  CD2  . PHE A 1 68  ? -74.469  8.836   -17.476 1.00 50.54  ? 629  PHE A CD2  1 
ATOM   1061  C  CE1  . PHE A 1 68  ? -73.250  6.848   -18.930 1.00 48.43  ? 629  PHE A CE1  1 
ATOM   1062  C  CE2  . PHE A 1 68  ? -73.589  7.975   -16.863 1.00 42.29  ? 629  PHE A CE2  1 
ATOM   1063  C  CZ   . PHE A 1 68  ? -72.979  6.982   -17.591 1.00 51.78  ? 629  PHE A CZ   1 
ATOM   1064  H  H    . PHE A 1 68  ? -74.546  11.922  -19.418 1.00 58.06  ? 629  PHE A H    1 
ATOM   1065  H  HA   . PHE A 1 68  ? -74.514  9.847   -21.143 1.00 59.54  ? 629  PHE A HA   1 
ATOM   1066  H  HB2  . PHE A 1 68  ? -76.052  10.261  -18.829 1.00 50.14  ? 629  PHE A HB2  1 
ATOM   1067  H  HB3  . PHE A 1 68  ? -76.435  9.124   -19.870 1.00 50.14  ? 629  PHE A HB3  1 
ATOM   1068  H  HD1  . PHE A 1 68  ? -74.311  7.613   -20.449 1.00 50.43  ? 629  PHE A HD1  1 
ATOM   1069  H  HD2  . PHE A 1 68  ? -74.880  9.506   -16.979 1.00 60.65  ? 629  PHE A HD2  1 
ATOM   1070  H  HE1  . PHE A 1 68  ? -72.838  6.175   -19.423 1.00 58.11  ? 629  PHE A HE1  1 
ATOM   1071  H  HE2  . PHE A 1 68  ? -73.405  8.066   -15.956 1.00 50.74  ? 629  PHE A HE2  1 
ATOM   1072  H  HZ   . PHE A 1 68  ? -72.384  6.400   -17.176 1.00 62.14  ? 629  PHE A HZ   1 
ATOM   1073  N  N    . CYS A 1 69  ? -76.921  11.974  -21.079 1.00 54.57  ? 630  CYS A N    1 
ATOM   1074  C  CA   . CYS A 1 69  ? -78.097  12.380  -21.831 1.00 56.78  ? 630  CYS A CA   1 
ATOM   1075  C  C    . CYS A 1 69  ? -78.741  13.554  -21.116 1.00 41.61  ? 630  CYS A C    1 
ATOM   1076  O  O    . CYS A 1 69  ? -78.421  13.856  -19.962 1.00 39.68  ? 630  CYS A O    1 
ATOM   1077  C  CB   . CYS A 1 69  ? -79.087  11.205  -21.964 1.00 48.52  ? 630  CYS A CB   1 
ATOM   1078  S  SG   . CYS A 1 69  ? -80.648  11.547  -22.797 1.00 61.55  ? 630  CYS A SG   1 
ATOM   1079  H  H    . CYS A 1 69  ? -76.821  12.375  -20.325 1.00 65.48  ? 630  CYS A H    1 
ATOM   1080  H  HA   . CYS A 1 69  ? -77.833  12.665  -22.719 1.00 68.14  ? 630  CYS A HA   1 
ATOM   1081  H  HB2  . CYS A 1 69  ? -78.648  10.495  -22.459 1.00 58.22  ? 630  CYS A HB2  1 
ATOM   1082  H  HB3  . CYS A 1 69  ? -79.301  10.888  -21.073 1.00 58.22  ? 630  CYS A HB3  1 
ATOM   1083  H  HG   . CYS A 1 69  ? -81.306  10.543  -22.822 1.00 73.86  ? 630  CYS A HG   1 
ATOM   1084  N  N    . THR A 1 70  ? -79.620  14.243  -21.838 1.00 52.96  ? 631  THR A N    1 
ATOM   1085  C  CA   . THR A 1 70  ? -80.322  15.394  -21.297 1.00 56.15  ? 631  THR A CA   1 
ATOM   1086  C  C    . THR A 1 70  ? -81.774  15.370  -21.751 1.00 53.86  ? 631  THR A C    1 
ATOM   1087  O  O    . THR A 1 70  ? -82.080  14.937  -22.866 1.00 60.49  ? 631  THR A O    1 
ATOM   1088  C  CB   . THR A 1 70  ? -79.653  16.716  -21.720 1.00 58.88  ? 631  THR A CB   1 
ATOM   1089  O  OG1  . THR A 1 70  ? -80.505  17.822  -21.388 1.00 57.95  ? 631  THR A OG1  1 
ATOM   1090  C  CG2  . THR A 1 70  ? -79.376  16.728  -23.206 1.00 62.89  ? 631  THR A CG2  1 
ATOM   1091  H  H    . THR A 1 70  ? -79.828  14.058  -22.652 1.00 63.55  ? 631  THR A H    1 
ATOM   1092  H  HA   . THR A 1 70  ? -80.309  15.347  -20.328 1.00 67.38  ? 631  THR A HA   1 
ATOM   1093  H  HB   . THR A 1 70  ? -78.808  16.811  -21.252 1.00 70.66  ? 631  THR A HB   1 
ATOM   1094  H  HG1  . THR A 1 70  ? -80.141  18.543  -21.618 1.00 69.53  ? 631  THR A HG1  1 
ATOM   1095  H  HG21 . THR A 1 70  ? -78.955  17.565  -23.458 1.00 75.46  ? 631  THR A HG21 1 
ATOM   1096  H  HG22 . THR A 1 70  ? -78.785  15.995  -23.439 1.00 75.46  ? 631  THR A HG22 1 
ATOM   1097  H  HG23 . THR A 1 70  ? -80.207  16.632  -23.698 1.00 75.46  ? 631  THR A HG23 1 
ATOM   1098  N  N    . GLU A 1 71  ? -82.662  15.820  -20.865 1.00 46.79  ? 632  GLU A N    1 
ATOM   1099  C  CA   . GLU A 1 71  ? -84.078  15.998  -21.151 1.00 43.80  ? 632  GLU A CA   1 
ATOM   1100  C  C    . GLU A 1 71  ? -84.490  17.394  -20.709 1.00 57.77  ? 632  GLU A C    1 
ATOM   1101  O  O    . GLU A 1 71  ? -83.961  17.932  -19.730 1.00 56.40  ? 632  GLU A O    1 
ATOM   1102  C  CB   . GLU A 1 71  ? -84.944  14.943  -20.431 1.00 41.77  ? 632  GLU A CB   1 
ATOM   1103  C  CG   . GLU A 1 71  ? -84.719  13.498  -20.889 1.00 58.40  ? 632  GLU A CG   1 
ATOM   1104  C  CD   . GLU A 1 71  ? -85.438  13.161  -22.188 1.00 64.41  ? 632  GLU A CD   1 
ATOM   1105  O  OE1  . GLU A 1 71  ? -85.769  14.095  -22.950 1.00 63.06  ? 632  GLU A OE1  1 
ATOM   1106  O  OE2  . GLU A 1 71  ? -85.673  11.959  -22.445 1.00 50.54  ? 632  GLU A OE2  1 
ATOM   1107  H  H    . GLU A 1 71  ? -82.454  16.035  -20.059 1.00 56.15  ? 632  GLU A H    1 
ATOM   1108  H  HA   . GLU A 1 71  ? -84.228  15.919  -22.106 1.00 52.56  ? 632  GLU A HA   1 
ATOM   1109  H  HB2  . GLU A 1 71  ? -84.750  14.982  -19.481 1.00 50.13  ? 632  GLU A HB2  1 
ATOM   1110  H  HB3  . GLU A 1 71  ? -85.878  15.156  -20.581 1.00 50.13  ? 632  GLU A HB3  1 
ATOM   1111  H  HG2  . GLU A 1 71  ? -83.770  13.356  -21.028 1.00 70.08  ? 632  GLU A HG2  1 
ATOM   1112  H  HG3  . GLU A 1 71  ? -85.046  12.896  -20.203 1.00 70.08  ? 632  GLU A HG3  1 
ATOM   1113  N  N    . LYS A 1 72  ? -85.441  17.978  -21.437 1.00 60.93  ? 633  LYS A N    1 
ATOM   1114  C  CA   . LYS A 1 72  ? -85.871  19.353  -21.209 1.00 60.46  ? 633  LYS A CA   1 
ATOM   1115  C  C    . LYS A 1 72  ? -87.382  19.400  -21.048 1.00 58.77  ? 633  LYS A C    1 
ATOM   1116  O  O    . LYS A 1 72  ? -88.117  18.950  -21.933 1.00 81.99  ? 633  LYS A O    1 
ATOM   1117  C  CB   . LYS A 1 72  ? -85.441  20.263  -22.363 1.00 54.62  ? 633  LYS A CB   1 
ATOM   1118  C  CG   . LYS A 1 72  ? -83.943  20.297  -22.608 1.00 54.96  ? 633  LYS A CG   1 
ATOM   1119  C  CD   . LYS A 1 72  ? -83.601  21.270  -23.724 1.00 54.48  ? 633  LYS A CD   1 
ATOM   1120  C  CE   . LYS A 1 72  ? -82.100  21.373  -23.935 1.00 76.88  ? 633  LYS A CE   1 
ATOM   1121  N  NZ   . LYS A 1 72  ? -81.752  22.405  -24.954 1.00 79.65  ? 633  LYS A NZ   1 
ATOM   1122  H  H    . LYS A 1 72  ? -85.858  17.589  -22.081 1.00 73.12  ? 633  LYS A H    1 
ATOM   1123  H  HA   . LYS A 1 72  ? -85.467  19.685  -20.392 1.00 72.55  ? 633  LYS A HA   1 
ATOM   1124  H  HB2  . LYS A 1 72  ? -85.865  19.952  -23.178 1.00 65.54  ? 633  LYS A HB2  1 
ATOM   1125  H  HB3  . LYS A 1 72  ? -85.728  21.168  -22.168 1.00 65.54  ? 633  LYS A HB3  1 
ATOM   1126  H  HG2  . LYS A 1 72  ? -83.491  20.587  -21.800 1.00 65.95  ? 633  LYS A HG2  1 
ATOM   1127  H  HG3  . LYS A 1 72  ? -83.638  19.414  -22.868 1.00 65.95  ? 633  LYS A HG3  1 
ATOM   1128  H  HD2  . LYS A 1 72  ? -84.003  20.963  -24.551 1.00 65.38  ? 633  LYS A HD2  1 
ATOM   1129  H  HD3  . LYS A 1 72  ? -83.936  22.151  -23.494 1.00 65.38  ? 633  LYS A HD3  1 
ATOM   1130  H  HE2  . LYS A 1 72  ? -81.677  21.619  -23.098 1.00 92.26  ? 633  LYS A HE2  1 
ATOM   1131  H  HE3  . LYS A 1 72  ? -81.762  20.517  -24.242 1.00 92.26  ? 633  LYS A HE3  1 
ATOM   1132  H  HZ1  . LYS A 1 72  ? -80.869  22.444  -25.058 1.00 95.58  ? 633  LYS A HZ1  1 
ATOM   1133  H  HZ2  . LYS A 1 72  ? -82.127  22.199  -25.735 1.00 95.58  ? 633  LYS A HZ2  1 
ATOM   1134  H  HZ3  . LYS A 1 72  ? -82.049  23.202  -24.693 1.00 95.58  ? 633  LYS A HZ3  1 
ATOM   1135  N  N    . ASP A 1 73  ? -87.840  19.928  -19.919 1.00 60.96  ? 634  ASP A N    1 
ATOM   1136  C  CA   . ASP A 1 73  ? -89.192  20.440  -19.791 1.00 66.60  ? 634  ASP A CA   1 
ATOM   1137  C  C    . ASP A 1 73  ? -89.148  21.948  -20.042 1.00 78.46  ? 634  ASP A C    1 
ATOM   1138  O  O    . ASP A 1 73  ? -88.124  22.500  -20.460 1.00 70.60  ? 634  ASP A O    1 
ATOM   1139  C  CB   . ASP A 1 73  ? -89.786  20.074  -18.426 1.00 51.54  ? 634  ASP A CB   1 
ATOM   1140  C  CG   . ASP A 1 73  ? -89.028  20.685  -17.265 1.00 62.34  ? 634  ASP A CG   1 
ATOM   1141  O  OD1  . ASP A 1 73  ? -87.934  21.239  -17.483 1.00 64.02  ? 634  ASP A OD1  1 
ATOM   1142  O  OD2  . ASP A 1 73  ? -89.525  20.596  -16.123 1.00 69.23  ? 634  ASP A OD2  1 
ATOM   1143  H  H    . ASP A 1 73  ? -87.374  20.000  -19.199 1.00 73.16  ? 634  ASP A H    1 
ATOM   1144  H  HA   . ASP A 1 73  ? -89.749  20.038  -20.477 1.00 79.91  ? 634  ASP A HA   1 
ATOM   1145  H  HB2  . ASP A 1 73  ? -90.702  20.392  -18.385 1.00 61.85  ? 634  ASP A HB2  1 
ATOM   1146  H  HB3  . ASP A 1 73  ? -89.766  19.110  -18.322 1.00 61.85  ? 634  ASP A HB3  1 
ATOM   1147  N  N    . ARG A 1 74  ? -90.272  22.627  -19.814 1.00 88.05  ? 635  ARG A N    1 
ATOM   1148  C  CA   . ARG A 1 74  ? -90.301  24.074  -19.996 1.00 80.68  ? 635  ARG A CA   1 
ATOM   1149  C  C    . ARG A 1 74  ? -89.395  24.774  -18.988 1.00 72.08  ? 635  ARG A C    1 
ATOM   1150  O  O    . ARG A 1 74  ? -88.586  25.635  -19.356 1.00 80.74  ? 635  ARG A O    1 
ATOM   1151  C  CB   . ARG A 1 74  ? -91.738  24.587  -19.877 1.00 74.99  ? 635  ARG A CB   1 
ATOM   1152  H  H    . ARG A 1 74  ? -91.016  22.280  -19.559 1.00 105.66 ? 635  ARG A H    1 
ATOM   1153  H  HA   . ARG A 1 74  ? -89.980  24.287  -20.886 1.00 96.82  ? 635  ARG A HA   1 
ATOM   1154  N  N    . GLN A 1 75  ? -89.516  24.413  -17.707 1.00 64.87  ? 636  GLN A N    1 
ATOM   1155  C  CA   . GLN A 1 75  ? -88.899  25.175  -16.628 1.00 70.43  ? 636  GLN A CA   1 
ATOM   1156  C  C    . GLN A 1 75  ? -87.456  24.785  -16.307 1.00 67.06  ? 636  GLN A C    1 
ATOM   1157  O  O    . GLN A 1 75  ? -86.760  25.577  -15.660 1.00 61.84  ? 636  GLN A O    1 
ATOM   1158  C  CB   . GLN A 1 75  ? -89.749  25.058  -15.351 1.00 73.94  ? 636  GLN A CB   1 
ATOM   1159  C  CG   . GLN A 1 75  ? -90.089  23.637  -14.927 1.00 71.54  ? 636  GLN A CG   1 
ATOM   1160  C  CD   . GLN A 1 75  ? -90.906  23.587  -13.646 1.00 65.93  ? 636  GLN A CD   1 
ATOM   1161  O  OE1  . GLN A 1 75  ? -91.295  24.619  -13.099 1.00 62.18  ? 636  GLN A OE1  1 
ATOM   1162  N  NE2  . GLN A 1 75  ? -91.171  22.379  -13.164 1.00 82.03  ? 636  GLN A NE2  1 
ATOM   1163  H  H    . GLN A 1 75  ? -89.955  23.724  -17.440 1.00 77.84  ? 636  GLN A H    1 
ATOM   1164  H  HA   . GLN A 1 75  ? -88.892  26.111  -16.884 1.00 84.52  ? 636  GLN A HA   1 
ATOM   1165  H  HB2  . GLN A 1 75  ? -89.264  25.472  -14.620 1.00 88.72  ? 636  GLN A HB2  1 
ATOM   1166  H  HB3  . GLN A 1 75  ? -90.585  25.527  -15.494 1.00 88.72  ? 636  GLN A HB3  1 
ATOM   1167  H  HG2  . GLN A 1 75  ? -90.605  23.212  -15.629 1.00 85.84  ? 636  GLN A HG2  1 
ATOM   1168  H  HG3  . GLN A 1 75  ? -89.265  23.146  -14.777 1.00 85.84  ? 636  GLN A HG3  1 
ATOM   1169  H  HE21 . GLN A 1 75  ? -90.883  21.680  -13.574 1.00 98.44  ? 636  GLN A HE21 1 
ATOM   1170  H  HE22 . GLN A 1 75  ? -91.630  22.296  -12.442 1.00 98.44  ? 636  GLN A HE22 1 
ATOM   1171  N  N    . PHE A 1 76  ? -86.969  23.622  -16.750 1.00 76.54  ? 637  PHE A N    1 
ATOM   1172  C  CA   . PHE A 1 76  ? -85.620  23.185  -16.389 1.00 59.12  ? 637  PHE A CA   1 
ATOM   1173  C  C    . PHE A 1 76  ? -84.995  22.389  -17.530 1.00 50.29  ? 637  PHE A C    1 
ATOM   1174  O  O    . PHE A 1 76  ? -85.611  22.149  -18.572 1.00 54.84  ? 637  PHE A O    1 
ATOM   1175  C  CB   . PHE A 1 76  ? -85.607  22.310  -15.123 1.00 62.35  ? 637  PHE A CB   1 
ATOM   1176  C  CG   . PHE A 1 76  ? -86.179  22.969  -13.894 1.00 62.68  ? 637  PHE A CG   1 
ATOM   1177  C  CD1  . PHE A 1 76  ? -85.625  24.127  -13.376 1.00 67.48  ? 637  PHE A CD1  1 
ATOM   1178  C  CD2  . PHE A 1 76  ? -87.250  22.395  -13.228 1.00 53.88  ? 637  PHE A CD2  1 
ATOM   1179  C  CE1  . PHE A 1 76  ? -86.157  24.718  -12.239 1.00 77.54  ? 637  PHE A CE1  1 
ATOM   1180  C  CE2  . PHE A 1 76  ? -87.779  22.979  -12.091 1.00 57.39  ? 637  PHE A CE2  1 
ATOM   1181  C  CZ   . PHE A 1 76  ? -87.231  24.138  -11.595 1.00 58.68  ? 637  PHE A CZ   1 
ATOM   1182  H  H    . PHE A 1 76  ? -87.396  23.073  -17.257 1.00 91.85  ? 637  PHE A H    1 
ATOM   1183  H  HA   . PHE A 1 76  ? -85.066  23.964  -16.225 1.00 70.94  ? 637  PHE A HA   1 
ATOM   1184  H  HB2  . PHE A 1 76  ? -86.126  21.509  -15.295 1.00 74.82  ? 637  PHE A HB2  1 
ATOM   1185  H  HB3  . PHE A 1 76  ? -84.689  22.067  -14.925 1.00 74.82  ? 637  PHE A HB3  1 
ATOM   1186  H  HD1  . PHE A 1 76  ? -84.903  24.524  -13.807 1.00 80.97  ? 637  PHE A HD1  1 
ATOM   1187  H  HD2  . PHE A 1 76  ? -87.628  21.612  -13.559 1.00 64.65  ? 637  PHE A HD2  1 
ATOM   1188  H  HE1  . PHE A 1 76  ? -85.783  25.501  -11.904 1.00 93.05  ? 637  PHE A HE1  1 
ATOM   1189  H  HE2  . PHE A 1 76  ? -88.504  22.586  -11.661 1.00 68.87  ? 637  PHE A HE2  1 
ATOM   1190  H  HZ   . PHE A 1 76  ? -87.586  24.532  -10.831 1.00 70.42  ? 637  PHE A HZ   1 
ATOM   1191  N  N    . GLN A 1 77  ? -83.743  21.991  -17.313 1.00 55.70  ? 638  GLN A N    1 
ATOM   1192  C  CA   . GLN A 1 77  ? -83.103  20.901  -18.029 1.00 45.39  ? 638  GLN A CA   1 
ATOM   1193  C  C    . GLN A 1 77  ? -82.706  19.844  -17.010 1.00 43.20  ? 638  GLN A C    1 
ATOM   1194  O  O    . GLN A 1 77  ? -82.500  20.146  -15.830 1.00 50.32  ? 638  GLN A O    1 
ATOM   1195  C  CB   . GLN A 1 77  ? -81.850  21.339  -18.795 1.00 48.36  ? 638  GLN A CB   1 
ATOM   1196  C  CG   . GLN A 1 77  ? -82.031  22.465  -19.795 1.00 60.24  ? 638  GLN A CG   1 
ATOM   1197  C  CD   . GLN A 1 77  ? -80.724  22.806  -20.499 1.00 64.20  ? 638  GLN A CD   1 
ATOM   1198  O  OE1  . GLN A 1 77  ? -79.679  22.226  -20.198 1.00 64.33  ? 638  GLN A OE1  1 
ATOM   1199  N  NE2  . GLN A 1 77  ? -80.777  23.744  -21.440 1.00 57.65  ? 638  GLN A NE2  1 
ATOM   1200  H  H    . GLN A 1 77  ? -83.228  22.356  -16.729 1.00 66.84  ? 638  GLN A H    1 
ATOM   1201  H  HA   . GLN A 1 77  ? -83.730  20.509  -18.657 1.00 54.47  ? 638  GLN A HA   1 
ATOM   1202  H  HB2  . GLN A 1 77  ? -81.186  21.630  -18.150 1.00 58.04  ? 638  GLN A HB2  1 
ATOM   1203  H  HB3  . GLN A 1 77  ? -81.509  20.573  -19.283 1.00 58.04  ? 638  GLN A HB3  1 
ATOM   1204  H  HG2  . GLN A 1 77  ? -82.676  22.195  -20.467 1.00 72.29  ? 638  GLN A HG2  1 
ATOM   1205  H  HG3  . GLN A 1 77  ? -82.342  23.257  -19.331 1.00 72.29  ? 638  GLN A HG3  1 
ATOM   1206  H  HE21 . GLN A 1 77  ? -81.525  24.126  -21.626 1.00 69.18  ? 638  GLN A HE21 1 
ATOM   1207  H  HE22 . GLN A 1 77  ? -80.063  23.969  -21.864 1.00 69.18  ? 638  GLN A HE22 1 
ATOM   1208  N  N    . TYR A 1 78  ? -82.595  18.604  -17.473 1.00 47.47  ? 639  TYR A N    1 
ATOM   1209  C  CA   . TYR A 1 78  ? -82.187  17.488  -16.630 1.00 42.16  ? 639  TYR A CA   1 
ATOM   1210  C  C    . TYR A 1 78  ? -81.075  16.750  -17.350 1.00 43.56  ? 639  TYR A C    1 
ATOM   1211  O  O    . TYR A 1 78  ? -81.285  16.248  -18.456 1.00 36.49  ? 639  TYR A O    1 
ATOM   1212  C  CB   . TYR A 1 78  ? -83.368  16.565  -16.339 1.00 39.70  ? 639  TYR A CB   1 
ATOM   1213  C  CG   . TYR A 1 78  ? -84.510  17.278  -15.654 1.00 46.40  ? 639  TYR A CG   1 
ATOM   1214  C  CD1  . TYR A 1 78  ? -84.577  17.355  -14.269 1.00 45.79  ? 639  TYR A CD1  1 
ATOM   1215  C  CD2  . TYR A 1 78  ? -85.514  17.891  -16.393 1.00 44.00  ? 639  TYR A CD2  1 
ATOM   1216  C  CE1  . TYR A 1 78  ? -85.618  18.016  -13.637 1.00 46.88  ? 639  TYR A CE1  1 
ATOM   1217  C  CE2  . TYR A 1 78  ? -86.558  18.551  -15.771 1.00 57.45  ? 639  TYR A CE2  1 
ATOM   1218  C  CZ   . TYR A 1 78  ? -86.605  18.612  -14.394 1.00 45.71  ? 639  TYR A CZ   1 
ATOM   1219  O  OH   . TYR A 1 78  ? -87.643  19.266  -13.772 1.00 56.68  ? 639  TYR A OH   1 
ATOM   1220  H  H    . TYR A 1 78  ? -82.753  18.380  -18.288 1.00 56.97  ? 639  TYR A H    1 
ATOM   1221  H  HA   . TYR A 1 78  ? -81.842  17.825  -15.788 1.00 50.59  ? 639  TYR A HA   1 
ATOM   1222  H  HB2  . TYR A 1 78  ? -83.699  16.202  -17.175 1.00 47.64  ? 639  TYR A HB2  1 
ATOM   1223  H  HB3  . TYR A 1 78  ? -83.073  15.846  -15.758 1.00 47.64  ? 639  TYR A HB3  1 
ATOM   1224  H  HD1  . TYR A 1 78  ? -83.912  16.954  -13.757 1.00 54.94  ? 639  TYR A HD1  1 
ATOM   1225  H  HD2  . TYR A 1 78  ? -85.486  17.852  -17.322 1.00 52.80  ? 639  TYR A HD2  1 
ATOM   1226  H  HE1  . TYR A 1 78  ? -85.652  18.056  -12.709 1.00 56.25  ? 639  TYR A HE1  1 
ATOM   1227  H  HE2  . TYR A 1 78  ? -87.225  18.954  -16.279 1.00 68.93  ? 639  TYR A HE2  1 
ATOM   1228  H  HH   . TYR A 1 78  ? -88.170  19.581  -14.345 1.00 68.01  ? 639  TYR A HH   1 
ATOM   1229  N  N    . ILE A 1 79  ? -79.894  16.710  -16.739 1.00 44.11  ? 640  ILE A N    1 
ATOM   1230  C  CA   . ILE A 1 79  ? -78.707  16.098  -17.330 1.00 41.27  ? 640  ILE A CA   1 
ATOM   1231  C  C    . ILE A 1 79  ? -78.305  14.923  -16.451 1.00 45.21  ? 640  ILE A C    1 
ATOM   1232  O  O    . ILE A 1 79  ? -78.121  15.082  -15.237 1.00 49.06  ? 640  ILE A O    1 
ATOM   1233  C  CB   . ILE A 1 79  ? -77.553  17.106  -17.471 1.00 49.54  ? 640  ILE A CB   1 
ATOM   1234  C  CG1  . ILE A 1 79  ? -77.958  18.234  -18.428 1.00 39.31  ? 640  ILE A CG1  1 
ATOM   1235  C  CG2  . ILE A 1 79  ? -76.285  16.401  -17.963 1.00 41.54  ? 640  ILE A CG2  1 
ATOM   1236  C  CD1  . ILE A 1 79  ? -76.904  19.307  -18.625 1.00 51.55  ? 640  ILE A CD1  1 
ATOM   1237  H  H    . ILE A 1 79  ? -79.752  17.040  -15.958 1.00 52.94  ? 640  ILE A H    1 
ATOM   1238  H  HA   . ILE A 1 79  ? -78.925  15.759  -18.212 1.00 49.53  ? 640  ILE A HA   1 
ATOM   1239  H  HB   . ILE A 1 79  ? -77.373  17.492  -16.599 1.00 59.45  ? 640  ILE A HB   1 
ATOM   1240  H  HG12 . ILE A 1 79  ? -78.151  17.848  -19.297 1.00 47.17  ? 640  ILE A HG12 1 
ATOM   1241  H  HG13 . ILE A 1 79  ? -78.754  18.665  -18.079 1.00 47.17  ? 640  ILE A HG13 1 
ATOM   1242  H  HG21 . ILE A 1 79  ? -75.572  17.054  -18.044 1.00 49.85  ? 640  ILE A HG21 1 
ATOM   1243  H  HG22 . ILE A 1 79  ? -76.036  15.717  -17.322 1.00 49.85  ? 640  ILE A HG22 1 
ATOM   1244  H  HG23 . ILE A 1 79  ? -76.464  15.996  -18.826 1.00 49.85  ? 640  ILE A HG23 1 
ATOM   1245  H  HD11 . ILE A 1 79  ? -77.245  19.974  -19.241 1.00 61.86  ? 640  ILE A HD11 1 
ATOM   1246  H  HD12 . ILE A 1 79  ? -76.707  19.718  -17.769 1.00 61.86  ? 640  ILE A HD12 1 
ATOM   1247  H  HD13 . ILE A 1 79  ? -76.103  18.899  -18.989 1.00 61.86  ? 640  ILE A HD13 1 
ATOM   1248  N  N    . ALA A 1 80  ? -78.185  13.747  -17.059 1.00 39.47  ? 641  ALA A N    1 
ATOM   1249  C  CA   . ALA A 1 80  ? -77.747  12.546  -16.361 1.00 43.53  ? 641  ALA A CA   1 
ATOM   1250  C  C    . ALA A 1 80  ? -76.232  12.425  -16.484 1.00 52.25  ? 641  ALA A C    1 
ATOM   1251  O  O    . ALA A 1 80  ? -75.697  12.401  -17.599 1.00 38.87  ? 641  ALA A O    1 
ATOM   1252  C  CB   . ALA A 1 80  ? -78.438  11.309  -16.933 1.00 49.49  ? 641  ALA A CB   1 
ATOM   1253  H  H    . ALA A 1 80  ? -78.354  13.618  -17.893 1.00 47.37  ? 641  ALA A H    1 
ATOM   1254  H  HA   . ALA A 1 80  ? -77.974  12.618  -15.420 1.00 52.24  ? 641  ALA A HA   1 
ATOM   1255  H  HB1  . ALA A 1 80  ? -78.130  10.525  -16.451 1.00 59.39  ? 641  ALA A HB1  1 
ATOM   1256  H  HB2  . ALA A 1 80  ? -79.397  11.407  -16.827 1.00 59.39  ? 641  ALA A HB2  1 
ATOM   1257  H  HB3  . ALA A 1 80  ? -78.214  11.229  -17.873 1.00 59.39  ? 641  ALA A HB3  1 
ATOM   1258  N  N    . ILE A 1 81  ? -75.546  12.347  -15.342 1.00 40.81  ? 642  ILE A N    1 
ATOM   1259  C  CA   . ILE A 1 81  ? -74.091  12.274  -15.291 1.00 49.77  ? 642  ILE A CA   1 
ATOM   1260  C  C    . ILE A 1 81  ? -73.682  11.038  -14.499 1.00 44.51  ? 642  ILE A C    1 
ATOM   1261  O  O    . ILE A 1 81  ? -74.470  10.449  -13.756 1.00 40.81  ? 642  ILE A O    1 
ATOM   1262  C  CB   . ILE A 1 81  ? -73.461  13.539  -14.672 1.00 39.76  ? 642  ILE A CB   1 
ATOM   1263  C  CG1  . ILE A 1 81  ? -74.138  13.884  -13.346 1.00 50.67  ? 642  ILE A CG1  1 
ATOM   1264  C  CG2  . ILE A 1 81  ? -73.578  14.700  -15.624 1.00 47.67  ? 642  ILE A CG2  1 
ATOM   1265  H  H    . ILE A 1 81  ? -75.915  12.335  -14.566 1.00 48.97  ? 642  ILE A H    1 
ATOM   1266  H  HA   . ILE A 1 81  ? -73.748  12.180  -16.193 1.00 59.73  ? 642  ILE A HA   1 
ATOM   1267  H  HB   . ILE A 1 81  ? -72.521  13.368  -14.505 1.00 47.71  ? 642  ILE A HB   1 
ATOM   1268  H  HG12 . ILE A 1 81  ? -75.054  14.151  -13.520 1.00 60.81  ? 642  ILE A HG12 1 
ATOM   1269  H  HG13 . ILE A 1 81  ? -74.123  13.104  -12.771 1.00 60.81  ? 642  ILE A HG13 1 
ATOM   1270  H  HG21 . ILE A 1 81  ? -73.177  15.484  -15.217 1.00 57.20  ? 642  ILE A HG21 1 
ATOM   1271  H  HG22 . ILE A 1 81  ? -73.114  14.481  -16.448 1.00 57.20  ? 642  ILE A HG22 1 
ATOM   1272  H  HG23 . ILE A 1 81  ? -74.516  14.866  -15.807 1.00 57.20  ? 642  ILE A HG23 1 
ATOM   1273  N  N    . GLU A 1 82  ? -72.419  10.655  -14.672 1.00 50.15  ? 643  GLU A N    1 
ATOM   1274  C  CA   . GLU A 1 82  ? -71.887  9.462   -14.030 1.00 42.11  ? 643  GLU A CA   1 
ATOM   1275  C  C    . GLU A 1 82  ? -72.001  9.566   -12.515 1.00 35.31  ? 643  GLU A C    1 
ATOM   1276  O  O    . GLU A 1 82  ? -71.767  10.624  -11.925 1.00 37.49  ? 643  GLU A O    1 
ATOM   1277  C  CB   . GLU A 1 82  ? -70.428  9.262   -14.438 1.00 48.00  ? 643  GLU A CB   1 
ATOM   1278  C  CG   . GLU A 1 82  ? -69.830  7.922   -14.042 1.00 58.27  ? 643  GLU A CG   1 
ATOM   1279  C  CD   . GLU A 1 82  ? -68.369  7.795   -14.465 1.00 56.04  ? 643  GLU A CD   1 
ATOM   1280  O  OE1  . GLU A 1 82  ? -67.906  8.640   -15.261 1.00 46.12  ? 643  GLU A OE1  1 
ATOM   1281  O  OE2  . GLU A 1 82  ? -67.683  6.860   -13.997 1.00 74.49  ? 643  GLU A OE2  1 
ATOM   1282  H  H    . GLU A 1 82  ? -71.848  11.073  -15.161 1.00 60.18  ? 643  GLU A H    1 
ATOM   1283  H  HA   . GLU A 1 82  ? -72.394  8.688   -14.321 1.00 50.53  ? 643  GLU A HA   1 
ATOM   1284  H  HB2  . GLU A 1 82  ? -70.365  9.337   -15.403 1.00 57.60  ? 643  GLU A HB2  1 
ATOM   1285  H  HB3  . GLU A 1 82  ? -69.893  9.956   -14.022 1.00 57.60  ? 643  GLU A HB3  1 
ATOM   1286  H  HG2  . GLU A 1 82  ? -69.874  7.827   -13.078 1.00 69.92  ? 643  GLU A HG2  1 
ATOM   1287  H  HG3  . GLU A 1 82  ? -70.331  7.211   -14.471 1.00 69.92  ? 643  GLU A HG3  1 
ATOM   1288  N  N    . LEU A 1 83  ? -72.379  8.455   -11.891 1.00 28.22  ? 644  LEU A N    1 
ATOM   1289  C  CA   . LEU A 1 83  ? -72.497  8.371   -10.443 1.00 27.76  ? 644  LEU A CA   1 
ATOM   1290  C  C    . LEU A 1 83  ? -71.182  7.902   -9.833  1.00 38.54  ? 644  LEU A C    1 
ATOM   1291  O  O    . LEU A 1 83  ? -70.570  6.939   -10.307 1.00 41.36  ? 644  LEU A O    1 
ATOM   1292  C  CB   . LEU A 1 83  ? -73.622  7.414   -10.054 1.00 35.87  ? 644  LEU A CB   1 
ATOM   1293  C  CG   . LEU A 1 83  ? -73.898  7.274   -8.561  1.00 47.30  ? 644  LEU A CG   1 
ATOM   1294  C  CD1  . LEU A 1 83  ? -74.372  8.589   -7.986  1.00 30.08  ? 644  LEU A CD1  1 
ATOM   1295  C  CD2  . LEU A 1 83  ? -74.920  6.177   -8.322  1.00 42.45  ? 644  LEU A CD2  1 
ATOM   1296  H  H    . LEU A 1 83  ? -72.577  7.722   -12.295 1.00 33.86  ? 644  LEU A H    1 
ATOM   1297  H  HA   . LEU A 1 83  ? -72.704  9.248   -10.085 1.00 33.31  ? 644  LEU A HA   1 
ATOM   1298  H  HB2  . LEU A 1 83  ? -74.441  7.722   -10.472 1.00 43.04  ? 644  LEU A HB2  1 
ATOM   1299  H  HB3  . LEU A 1 83  ? -73.401  6.531   -10.391 1.00 43.04  ? 644  LEU A HB3  1 
ATOM   1300  H  HG   . LEU A 1 83  ? -73.077  7.025   -8.108  1.00 56.76  ? 644  LEU A HG   1 
ATOM   1301  H  HD11 . LEU A 1 83  ? -74.540  8.476   -7.038  1.00 36.10  ? 644  LEU A HD11 1 
ATOM   1302  H  HD12 . LEU A 1 83  ? -73.683  9.259   -8.123  1.00 36.10  ? 644  LEU A HD12 1 
ATOM   1303  H  HD13 . LEU A 1 83  ? -75.187  8.855   -8.439  1.00 36.10  ? 644  LEU A HD13 1 
ATOM   1304  H  HD21 . LEU A 1 83  ? -75.084  6.101   -7.369  1.00 50.94  ? 644  LEU A HD21 1 
ATOM   1305  H  HD22 . LEU A 1 83  ? -75.742  6.406   -8.782  1.00 50.94  ? 644  LEU A HD22 1 
ATOM   1306  H  HD23 . LEU A 1 83  ? -74.570  5.340   -8.665  1.00 50.94  ? 644  LEU A HD23 1 
ATOM   1307  N  N    . CYS A 1 84  ? -70.771  8.573   -8.759  1.00 41.19  ? 645  CYS A N    1 
ATOM   1308  C  CA   . CYS A 1 84  ? -69.457  8.398   -8.161  1.00 35.02  ? 645  CYS A CA   1 
ATOM   1309  C  C    . CYS A 1 84  ? -69.567  7.955   -6.707  1.00 37.03  ? 645  CYS A C    1 
ATOM   1310  O  O    . CYS A 1 84  ? -70.591  8.144   -6.045  1.00 43.14  ? 645  CYS A O    1 
ATOM   1311  C  CB   . CYS A 1 84  ? -68.643  9.690   -8.242  1.00 45.68  ? 645  CYS A CB   1 
ATOM   1312  S  SG   . CYS A 1 84  ? -68.117  10.082  -9.911  1.00 41.64  ? 645  CYS A SG   1 
ATOM   1313  H  H    . CYS A 1 84  ? -71.255  9.154   -8.349  1.00 49.42  ? 645  CYS A H    1 
ATOM   1314  H  HA   . CYS A 1 84  ? -68.978  7.710   -8.649  1.00 42.02  ? 645  CYS A HA   1 
ATOM   1315  H  HB2  . CYS A 1 84  ? -69.186  10.426  -7.918  1.00 54.81  ? 645  CYS A HB2  1 
ATOM   1316  H  HB3  . CYS A 1 84  ? -67.849  9.598   -7.692  1.00 54.81  ? 645  CYS A HB3  1 
ATOM   1317  H  HG   . CYS A 1 84  ? -69.087  10.212  -10.606 1.00 49.97  ? 645  CYS A HG   1 
ATOM   1318  N  N    . ALA A 1 85  ? -68.478  7.352   -6.221  1.00 44.82  ? 646  ALA A N    1 
ATOM   1319  C  CA   . ALA A 1 85  ? -68.448  6.777   -4.880  1.00 31.40  ? 646  ALA A CA   1 
ATOM   1320  C  C    . ALA A 1 85  ? -68.250  7.835   -3.801  1.00 33.20  ? 646  ALA A C    1 
ATOM   1321  O  O    . ALA A 1 85  ? -68.936  7.814   -2.773  1.00 50.81  ? 646  ALA A O    1 
ATOM   1322  C  CB   . ALA A 1 85  ? -67.340  5.730   -4.791  1.00 40.50  ? 646  ALA A CB   1 
ATOM   1323  H  H    . ALA A 1 85  ? -67.741  7.265   -6.655  1.00 53.79  ? 646  ALA A H    1 
ATOM   1324  H  HA   . ALA A 1 85  ? -69.293  6.332   -4.710  1.00 37.68  ? 646  ALA A HA   1 
ATOM   1325  H  HB1  . ALA A 1 85  ? -67.330  5.356   -3.896  1.00 48.60  ? 646  ALA A HB1  1 
ATOM   1326  H  HB2  . ALA A 1 85  ? -67.514  5.030   -5.440  1.00 48.60  ? 646  ALA A HB2  1 
ATOM   1327  H  HB3  . ALA A 1 85  ? -66.489  6.154   -4.982  1.00 48.60  ? 646  ALA A HB3  1 
ATOM   1328  N  N    . ALA A 1 86  ? -67.306  8.751   -3.999  1.00 37.63  ? 647  ALA A N    1 
ATOM   1329  C  CA   . ALA A 1 86  ? -66.943  9.709   -2.961  1.00 36.92  ? 647  ALA A CA   1 
ATOM   1330  C  C    . ALA A 1 86  ? -66.250  10.903  -3.604  1.00 32.49  ? 647  ALA A C    1 
ATOM   1331  O  O    . ALA A 1 86  ? -66.058  10.955  -4.821  1.00 30.01  ? 647  ALA A O    1 
ATOM   1332  C  CB   . ALA A 1 86  ? -66.043  9.058   -1.907  1.00 37.58  ? 647  ALA A CB   1 
ATOM   1333  H  H    . ALA A 1 86  ? -66.860  8.839   -4.729  1.00 45.16  ? 647  ALA A H    1 
ATOM   1334  H  HA   . ALA A 1 86  ? -67.748  10.024  -2.520  1.00 44.30  ? 647  ALA A HA   1 
ATOM   1335  H  HB1  . ALA A 1 86  ? -65.820  9.719   -1.232  1.00 45.10  ? 647  ALA A HB1  1 
ATOM   1336  H  HB2  . ALA A 1 86  ? -66.518  8.317   -1.500  1.00 45.10  ? 647  ALA A HB2  1 
ATOM   1337  H  HB3  . ALA A 1 86  ? -65.234  8.738   -2.337  1.00 45.10  ? 647  ALA A HB3  1 
ATOM   1338  N  N    . THR A 1 87  ? -65.873  11.867  -2.767  1.00 29.70  ? 648  THR A N    1 
ATOM   1339  C  CA   . THR A 1 87  ? -65.142  13.043  -3.208  1.00 32.46  ? 648  THR A CA   1 
ATOM   1340  C  C    . THR A 1 87  ? -63.676  12.929  -2.804  1.00 37.92  ? 648  THR A C    1 
ATOM   1341  O  O    . THR A 1 87  ? -63.261  11.996  -2.112  1.00 37.61  ? 648  THR A O    1 
ATOM   1342  C  CB   . THR A 1 87  ? -65.741  14.313  -2.608  1.00 26.41  ? 648  THR A CB   1 
ATOM   1343  O  OG1  . THR A 1 87  ? -65.376  14.389  -1.225  1.00 41.28  ? 648  THR A OG1  1 
ATOM   1344  C  CG2  . THR A 1 87  ? -67.268  14.325  -2.745  1.00 39.79  ? 648  THR A CG2  1 
ATOM   1345  H  H    . THR A 1 87  ? -66.034  11.858  -1.922  1.00 35.64  ? 648  THR A H    1 
ATOM   1346  H  HA   . THR A 1 87  ? -65.190  13.109  -4.175  1.00 38.95  ? 648  THR A HA   1 
ATOM   1347  H  HB   . THR A 1 87  ? -65.388  15.085  -3.075  1.00 31.69  ? 648  THR A HB   1 
ATOM   1348  H  HG1  . THR A 1 87  ? -65.699  15.083  -0.880  1.00 49.53  ? 648  THR A HG1  1 
ATOM   1349  H  HG21 . THR A 1 87  ? -67.628  15.138  -2.358  1.00 47.75  ? 648  THR A HG21 1 
ATOM   1350  H  HG22 . THR A 1 87  ? -67.517  14.284  -3.682  1.00 47.75  ? 648  THR A HG22 1 
ATOM   1351  H  HG23 . THR A 1 87  ? -67.648  13.561  -2.284  1.00 47.75  ? 648  THR A HG23 1 
ATOM   1352  N  N    . LEU A 1 88  ? -62.887  13.926  -3.207  1.00 33.39  ? 649  LEU A N    1 
ATOM   1353  C  CA   . LEU A 1 88  ? -61.491  13.984  -2.791  1.00 29.25  ? 649  LEU A CA   1 
ATOM   1354  C  C    . LEU A 1 88  ? -61.366  14.414  -1.338  1.00 34.94  ? 649  LEU A C    1 
ATOM   1355  O  O    . LEU A 1 88  ? -60.405  14.031  -0.664  1.00 35.21  ? 649  LEU A O    1 
ATOM   1356  C  CB   . LEU A 1 88  ? -60.703  14.934  -3.696  1.00 22.71  ? 649  LEU A CB   1 
ATOM   1357  C  CG   . LEU A 1 88  ? -59.228  15.155  -3.359  1.00 30.46  ? 649  LEU A CG   1 
ATOM   1358  C  CD1  . LEU A 1 88  ? -58.461  13.839  -3.353  1.00 41.50  ? 649  LEU A CD1  1 
ATOM   1359  C  CD2  . LEU A 1 88  ? -58.602  16.133  -4.350  1.00 31.73  ? 649  LEU A CD2  1 
ATOM   1360  H  H    . LEU A 1 88  ? -63.135  14.574  -3.716  1.00 40.07  ? 649  LEU A H    1 
ATOM   1361  H  HA   . LEU A 1 88  ? -61.101  13.099  -2.875  1.00 35.11  ? 649  LEU A HA   1 
ATOM   1362  H  HB2  . LEU A 1 88  ? -60.741  14.588  -4.601  1.00 27.25  ? 649  LEU A HB2  1 
ATOM   1363  H  HB3  . LEU A 1 88  ? -61.135  15.802  -3.668  1.00 27.25  ? 649  LEU A HB3  1 
ATOM   1364  H  HG   . LEU A 1 88  ? -59.162  15.544  -2.473  1.00 36.55  ? 649  LEU A HG   1 
ATOM   1365  H  HD11 . LEU A 1 88  ? -57.532  14.017  -3.137  1.00 49.80  ? 649  LEU A HD11 1 
ATOM   1366  H  HD12 . LEU A 1 88  ? -58.849  13.251  -2.687  1.00 49.80  ? 649  LEU A HD12 1 
ATOM   1367  H  HD13 . LEU A 1 88  ? -58.524  13.433  -4.231  1.00 49.80  ? 649  LEU A HD13 1 
ATOM   1368  H  HD21 . LEU A 1 88  ? -57.668  16.259  -4.120  1.00 38.08  ? 649  LEU A HD21 1 
ATOM   1369  H  HD22 . LEU A 1 88  ? -58.677  15.766  -5.245  1.00 38.08  ? 649  LEU A HD22 1 
ATOM   1370  H  HD23 . LEU A 1 88  ? -59.074  16.979  -4.298  1.00 38.08  ? 649  LEU A HD23 1 
ATOM   1371  N  N    . GLN A 1 89  ? -62.324  15.198  -0.837  1.00 36.14  ? 650  GLN A N    1 
ATOM   1372  C  CA   . GLN A 1 89  ? -62.339  15.537  0.582   1.00 34.62  ? 650  GLN A CA   1 
ATOM   1373  C  C    . GLN A 1 89  ? -62.412  14.279  1.438   1.00 38.39  ? 650  GLN A C    1 
ATOM   1374  O  O    . GLN A 1 89  ? -61.676  14.136  2.421   1.00 37.58  ? 650  GLN A O    1 
ATOM   1375  C  CB   . GLN A 1 89  ? -63.517  16.458  0.892   1.00 32.52  ? 650  GLN A CB   1 
ATOM   1376  C  CG   . GLN A 1 89  ? -63.563  16.934  2.343   1.00 44.90  ? 650  GLN A CG   1 
ATOM   1377  C  CD   . GLN A 1 89  ? -64.872  17.611  2.700   1.00 51.79  ? 650  GLN A CD   1 
ATOM   1378  O  OE1  . GLN A 1 89  ? -65.872  17.471  1.996   1.00 57.08  ? 650  GLN A OE1  1 
ATOM   1379  N  NE2  . GLN A 1 89  ? -64.872  18.348  3.801   1.00 60.22  ? 650  GLN A NE2  1 
ATOM   1380  H  H    . GLN A 1 89  ? -62.967  15.542  -1.293  1.00 43.37  ? 650  GLN A H    1 
ATOM   1381  H  HA   . GLN A 1 89  ? -61.520  16.008  0.806   1.00 41.54  ? 650  GLN A HA   1 
ATOM   1382  H  HB2  . GLN A 1 89  ? -63.459  17.242  0.324   1.00 39.02  ? 650  GLN A HB2  1 
ATOM   1383  H  HB3  . GLN A 1 89  ? -64.342  15.981  0.710   1.00 39.02  ? 650  GLN A HB3  1 
ATOM   1384  H  HG2  . GLN A 1 89  ? -63.451  16.170  2.930   1.00 53.88  ? 650  GLN A HG2  1 
ATOM   1385  H  HG3  . GLN A 1 89  ? -62.847  17.572  2.489   1.00 53.88  ? 650  GLN A HG3  1 
ATOM   1386  H  HE21 . GLN A 1 89  ? -64.154  18.422  4.269   1.00 72.26  ? 650  GLN A HE21 1 
ATOM   1387  H  HE22 . GLN A 1 89  ? -65.589  18.753  4.047   1.00 72.26  ? 650  GLN A HE22 1 
ATOM   1388  N  N    . GLU A 1 90  ? -63.304  13.355  1.081   1.00 45.06  ? 651  GLU A N    1 
ATOM   1389  C  CA   . GLU A 1 90  ? -63.406  12.103  1.821   1.00 39.76  ? 651  GLU A CA   1 
ATOM   1390  C  C    . GLU A 1 90  ? -62.153  11.254  1.639   1.00 42.07  ? 651  GLU A C    1 
ATOM   1391  O  O    . GLU A 1 90  ? -61.666  10.644  2.595   1.00 41.73  ? 651  GLU A O    1 
ATOM   1392  C  CB   . GLU A 1 90  ? -64.649  11.334  1.374   1.00 44.48  ? 651  GLU A CB   1 
ATOM   1393  C  CG   . GLU A 1 90  ? -65.937  12.164  1.377   1.00 53.65  ? 651  GLU A CG   1 
ATOM   1394  C  CD   . GLU A 1 90  ? -67.164  11.360  0.946   1.00 50.94  ? 651  GLU A CD   1 
ATOM   1395  O  OE1  . GLU A 1 90  ? -68.212  11.971  0.641   1.00 70.24  ? 651  GLU A OE1  1 
ATOM   1396  O  OE2  . GLU A 1 90  ? -67.081  10.114  0.915   1.00 73.19  ? 651  GLU A OE2  1 
ATOM   1397  H  H    . GLU A 1 90  ? -63.853  13.429  0.423   1.00 54.08  ? 651  GLU A H    1 
ATOM   1398  H  HA   . GLU A 1 90  ? -63.499  12.302  2.766   1.00 47.71  ? 651  GLU A HA   1 
ATOM   1399  H  HB2  . GLU A 1 90  ? -64.508  11.013  0.469   1.00 53.38  ? 651  GLU A HB2  1 
ATOM   1400  H  HB3  . GLU A 1 90  ? -64.781  10.582  1.971   1.00 53.38  ? 651  GLU A HB3  1 
ATOM   1401  H  HG2  . GLU A 1 90  ? -66.097  12.495  2.275   1.00 64.38  ? 651  GLU A HG2  1 
ATOM   1402  H  HG3  . GLU A 1 90  ? -65.835  12.908  0.763   1.00 64.38  ? 651  GLU A HG3  1 
ATOM   1403  N  N    . TYR A 1 91  ? -61.613  11.209  0.422   1.00 42.53  ? 652  TYR A N    1 
ATOM   1404  C  CA   . TYR A 1 91  ? -60.403  10.433  0.172   1.00 37.20  ? 652  TYR A CA   1 
ATOM   1405  C  C    . TYR A 1 91  ? -59.253  10.887  1.066   1.00 43.51  ? 652  TYR A C    1 
ATOM   1406  O  O    . TYR A 1 91  ? -58.509  10.057  1.601   1.00 43.06  ? 652  TYR A O    1 
ATOM   1407  C  CB   . TYR A 1 91  ? -60.025  10.541  -1.305  1.00 45.01  ? 652  TYR A CB   1 
ATOM   1408  C  CG   . TYR A 1 91  ? -58.648  10.023  -1.658  1.00 39.23  ? 652  TYR A CG   1 
ATOM   1409  C  CD1  . TYR A 1 91  ? -57.516  10.788  -1.420  1.00 49.86  ? 652  TYR A CD1  1 
ATOM   1410  C  CD2  . TYR A 1 91  ? -58.487  8.788   -2.262  1.00 43.81  ? 652  TYR A CD2  1 
ATOM   1411  C  CE1  . TYR A 1 91  ? -56.259  10.329  -1.748  1.00 39.68  ? 652  TYR A CE1  1 
ATOM   1412  C  CE2  . TYR A 1 91  ? -57.232  8.316   -2.601  1.00 43.67  ? 652  TYR A CE2  1 
ATOM   1413  C  CZ   . TYR A 1 91  ? -56.119  9.089   -2.342  1.00 44.54  ? 652  TYR A CZ   1 
ATOM   1414  O  OH   . TYR A 1 91  ? -54.858  8.626   -2.678  1.00 40.74  ? 652  TYR A OH   1 
ATOM   1415  H  H    . TYR A 1 91  ? -61.925  11.616  -0.269  1.00 51.04  ? 652  TYR A H    1 
ATOM   1416  H  HA   . TYR A 1 91  ? -60.581  9.500   0.368   1.00 44.64  ? 652  TYR A HA   1 
ATOM   1417  H  HB2  . TYR A 1 91  ? -60.669  10.035  -1.825  1.00 54.01  ? 652  TYR A HB2  1 
ATOM   1418  H  HB3  . TYR A 1 91  ? -60.060  11.475  -1.565  1.00 54.01  ? 652  TYR A HB3  1 
ATOM   1419  H  HD1  . TYR A 1 91  ? -57.605  11.622  -1.019  1.00 59.84  ? 652  TYR A HD1  1 
ATOM   1420  H  HD2  . TYR A 1 91  ? -59.235  8.264   -2.437  1.00 52.57  ? 652  TYR A HD2  1 
ATOM   1421  H  HE1  . TYR A 1 91  ? -55.510  10.852  -1.576  1.00 47.62  ? 652  TYR A HE1  1 
ATOM   1422  H  HE2  . TYR A 1 91  ? -57.139  7.481   -3.000  1.00 52.41  ? 652  TYR A HE2  1 
ATOM   1423  H  HH   . TYR A 1 91  ? -54.915  7.865   -3.029  1.00 48.88  ? 652  TYR A HH   1 
ATOM   1424  N  N    . VAL A 1 92  ? -59.088  12.202  1.235   1.00 43.31  ? 653  VAL A N    1 
ATOM   1425  C  CA   . VAL A 1 92  ? -57.984  12.718  2.042   1.00 42.40  ? 653  VAL A CA   1 
ATOM   1426  C  C    . VAL A 1 92  ? -58.284  12.551  3.528   1.00 37.84  ? 653  VAL A C    1 
ATOM   1427  O  O    . VAL A 1 92  ? -57.435  12.089  4.300   1.00 57.20  ? 653  VAL A O    1 
ATOM   1428  C  CB   . VAL A 1 92  ? -57.706  14.191  1.688   1.00 32.00  ? 653  VAL A CB   1 
ATOM   1429  C  CG1  . VAL A 1 92  ? -56.638  14.764  2.601   1.00 33.53  ? 653  VAL A CG1  1 
ATOM   1430  C  CG2  . VAL A 1 92  ? -57.279  14.320  0.233   1.00 31.51  ? 653  VAL A CG2  1 
ATOM   1431  H  H    . VAL A 1 92  ? -59.596  12.808  0.896   1.00 51.97  ? 653  VAL A H    1 
ATOM   1432  H  HA   . VAL A 1 92  ? -57.184  12.208  1.842   1.00 50.88  ? 653  VAL A HA   1 
ATOM   1433  H  HB   . VAL A 1 92  ? -58.518  14.707  1.812   1.00 38.39  ? 653  VAL A HB   1 
ATOM   1434  H  HG11 . VAL A 1 92  ? -56.481  15.690  2.359   1.00 40.23  ? 653  VAL A HG11 1 
ATOM   1435  H  HG12 . VAL A 1 92  ? -56.945  14.708  3.519   1.00 40.23  ? 653  VAL A HG12 1 
ATOM   1436  H  HG13 . VAL A 1 92  ? -55.823  14.250  2.492   1.00 40.23  ? 653  VAL A HG13 1 
ATOM   1437  H  HG21 . VAL A 1 92  ? -57.111  15.255  0.036   1.00 37.82  ? 653  VAL A HG21 1 
ATOM   1438  H  HG22 . VAL A 1 92  ? -56.471  13.802  0.095   1.00 37.82  ? 653  VAL A HG22 1 
ATOM   1439  H  HG23 . VAL A 1 92  ? -57.990  13.985  -0.335  1.00 37.82  ? 653  VAL A HG23 1 
ATOM   1440  N  N    . GLU A 1 93  ? -59.499  12.909  3.949   1.00 52.19  ? 654  GLU A N    1 
ATOM   1441  C  CA   . GLU A 1 93  ? -59.817  12.907  5.374   1.00 55.50  ? 654  GLU A CA   1 
ATOM   1442  C  C    . GLU A 1 93  ? -60.048  11.497  5.902   1.00 66.98  ? 654  GLU A C    1 
ATOM   1443  O  O    . GLU A 1 93  ? -59.580  11.156  6.994   1.00 81.41  ? 654  GLU A O    1 
ATOM   1444  C  CB   . GLU A 1 93  ? -61.044  13.776  5.638   1.00 55.58  ? 654  GLU A CB   1 
ATOM   1445  C  CG   . GLU A 1 93  ? -60.780  15.265  5.462   1.00 70.29  ? 654  GLU A CG   1 
ATOM   1446  C  CD   . GLU A 1 93  ? -61.887  16.131  6.023   1.00 79.85  ? 654  GLU A CD   1 
ATOM   1447  O  OE1  . GLU A 1 93  ? -62.942  15.582  6.403   1.00 79.74  ? 654  GLU A OE1  1 
ATOM   1448  O  OE2  . GLU A 1 93  ? -61.694  17.363  6.086   1.00 74.22  ? 654  GLU A OE2  1 
ATOM   1449  H  H    . GLU A 1 93  ? -60.145  13.153  3.437   1.00 62.62  ? 654  GLU A H    1 
ATOM   1450  H  HA   . GLU A 1 93  ? -59.070  13.289  5.862   1.00 66.60  ? 654  GLU A HA   1 
ATOM   1451  H  HB2  . GLU A 1 93  ? -61.746  13.523  5.020   1.00 66.70  ? 654  GLU A HB2  1 
ATOM   1452  H  HB3  . GLU A 1 93  ? -61.340  13.632  6.551   1.00 66.70  ? 654  GLU A HB3  1 
ATOM   1453  H  HG2  . GLU A 1 93  ? -59.957  15.496  5.922   1.00 84.35  ? 654  GLU A HG2  1 
ATOM   1454  H  HG3  . GLU A 1 93  ? -60.697  15.460  4.516   1.00 84.35  ? 654  GLU A HG3  1 
ATOM   1455  N  N    . GLN A 1 94  ? -60.758  10.659  5.144   1.00 66.86  ? 655  GLN A N    1 
ATOM   1456  C  CA   . GLN A 1 94  ? -61.138  9.351   5.668   1.00 73.32  ? 655  GLN A CA   1 
ATOM   1457  C  C    . GLN A 1 94  ? -59.951  8.399   5.717   1.00 82.62  ? 655  GLN A C    1 
ATOM   1458  O  O    . GLN A 1 94  ? -59.820  7.620   6.667   1.00 105.45 ? 655  GLN A O    1 
ATOM   1459  C  CB   . GLN A 1 94  ? -62.263  8.738   4.832   1.00 93.94  ? 655  GLN A CB   1 
ATOM   1460  C  CG   . GLN A 1 94  ? -63.514  9.612   4.661   1.00 94.82  ? 655  GLN A CG   1 
ATOM   1461  C  CD   . GLN A 1 94  ? -64.308  9.798   5.938   1.00 71.79  ? 655  GLN A CD   1 
ATOM   1462  O  OE1  . GLN A 1 94  ? -63.748  9.946   7.022   1.00 77.20  ? 655  GLN A OE1  1 
ATOM   1463  N  NE2  . GLN A 1 94  ? -65.628  9.805   5.810   1.00 70.78  ? 655  GLN A NE2  1 
ATOM   1464  H  H    . GLN A 1 94  ? -61.025  10.820  4.342   1.00 80.23  ? 655  GLN A H    1 
ATOM   1465  H  HA   . GLN A 1 94  ? -61.467  9.461   6.574   1.00 87.98  ? 655  GLN A HA   1 
ATOM   1466  H  HB2  . GLN A 1 94  ? -61.918  8.548   3.946   1.00 112.73 ? 655  GLN A HB2  1 
ATOM   1467  H  HB3  . GLN A 1 94  ? -62.543  7.910   5.254   1.00 112.73 ? 655  GLN A HB3  1 
ATOM   1468  H  HG2  . GLN A 1 94  ? -63.242  10.490  4.350   1.00 113.78 ? 655  GLN A HG2  1 
ATOM   1469  H  HG3  . GLN A 1 94  ? -64.098  9.198   4.006   1.00 113.78 ? 655  GLN A HG3  1 
ATOM   1470  H  HE21 . GLN A 1 94  ? -65.986  9.708   5.034   1.00 84.94  ? 655  GLN A HE21 1 
ATOM   1471  H  HE22 . GLN A 1 94  ? -66.127  9.908   6.503   1.00 84.94  ? 655  GLN A HE22 1 
ATOM   1472  N  N    . LYS A 1 95  ? -59.086  8.431   4.704   1.00 80.91  ? 656  LYS A N    1 
ATOM   1473  C  CA   . LYS A 1 95  ? -57.946  7.523   4.565   1.00 72.61  ? 656  LYS A CA   1 
ATOM   1474  C  C    . LYS A 1 95  ? -58.391  6.143   4.095   1.00 78.43  ? 656  LYS A C    1 
ATOM   1475  O  O    . LYS A 1 95  ? -57.531  5.274   3.899   1.00 103.53 ? 656  LYS A O    1 
ATOM   1476  C  CB   . LYS A 1 95  ? -57.140  7.371   5.865   1.00 70.25  ? 656  LYS A CB   1 
ATOM   1477  H  H    . LYS A 1 95  ? -59.142  8.995   4.057   1.00 97.09  ? 656  LYS A H    1 
ATOM   1478  H  HA   . LYS A 1 95  ? -57.347  7.883   3.891   1.00 87.13  ? 656  LYS A HA   1 
ATOM   1479  N  N    . ASP A 1 96  ? -59.698  5.906   3.925   1.00 79.65  ? 657  ASP A N    1 
ATOM   1480  C  CA   . ASP A 1 96  ? -60.197  4.570   3.602   1.00 94.52  ? 657  ASP A CA   1 
ATOM   1481  C  C    . ASP A 1 96  ? -59.576  4.006   2.327   1.00 93.00  ? 657  ASP A C    1 
ATOM   1482  O  O    . ASP A 1 96  ? -59.416  2.785   2.204   1.00 98.81  ? 657  ASP A O    1 
ATOM   1483  C  CB   . ASP A 1 96  ? -61.718  4.604   3.453   1.00 77.41  ? 657  ASP A CB   1 
ATOM   1484  C  CG   . ASP A 1 96  ? -62.410  5.287   4.621   1.00 86.87  ? 657  ASP A CG   1 
ATOM   1485  O  OD1  . ASP A 1 96  ? -61.825  5.332   5.725   1.00 84.06  ? 657  ASP A OD1  1 
ATOM   1486  O  OD2  . ASP A 1 96  ? -63.542  5.779   4.428   1.00 73.68  ? 657  ASP A OD2  1 
ATOM   1487  H  H    . ASP A 1 96  ? -60.313  6.504   3.993   1.00 95.58  ? 657  ASP A H    1 
ATOM   1488  H  HA   . ASP A 1 96  ? -59.981  3.968   4.332   1.00 113.42 ? 657  ASP A HA   1 
ATOM   1489  H  HB2  . ASP A 1 96  ? -61.945  5.089   2.645   1.00 92.89  ? 657  ASP A HB2  1 
ATOM   1490  H  HB3  . ASP A 1 96  ? -62.050  3.694   3.398   1.00 92.89  ? 657  ASP A HB3  1 
ATOM   1491  N  N    . PHE A 1 97  ? -59.207  4.869   1.381   1.00 94.24  ? 658  PHE A N    1 
ATOM   1492  C  CA   . PHE A 1 97  ? -58.771  4.436   0.058   1.00 80.66  ? 658  PHE A CA   1 
ATOM   1493  C  C    . PHE A 1 97  ? -57.299  4.054   0.008   1.00 78.32  ? 658  PHE A C    1 
ATOM   1494  O  O    . PHE A 1 97  ? -56.798  3.732   -1.076  1.00 77.35  ? 658  PHE A O    1 
ATOM   1495  C  CB   . PHE A 1 97  ? -59.039  5.538   -0.965  1.00 59.39  ? 658  PHE A CB   1 
ATOM   1496  C  CG   . PHE A 1 97  ? -60.496  5.804   -1.192  1.00 58.91  ? 658  PHE A CG   1 
ATOM   1497  C  CD1  . PHE A 1 97  ? -61.247  6.488   -0.250  1.00 70.22  ? 658  PHE A CD1  1 
ATOM   1498  C  CD2  . PHE A 1 97  ? -61.116  5.368   -2.348  1.00 59.07  ? 658  PHE A CD2  1 
ATOM   1499  C  CE1  . PHE A 1 97  ? -62.591  6.731   -0.458  1.00 52.50  ? 658  PHE A CE1  1 
ATOM   1500  C  CE2  . PHE A 1 97  ? -62.459  5.608   -2.562  1.00 69.39  ? 658  PHE A CE2  1 
ATOM   1501  C  CZ   . PHE A 1 97  ? -63.198  6.292   -1.615  1.00 56.71  ? 658  PHE A CZ   1 
ATOM   1502  H  H    . PHE A 1 97  ? -59.201  5.723   1.485   1.00 113.09 ? 658  PHE A H    1 
ATOM   1503  H  HA   . PHE A 1 97  ? -59.288  3.657   -0.202  1.00 96.80  ? 658  PHE A HA   1 
ATOM   1504  H  HB2  . PHE A 1 97  ? -58.631  6.361   -0.653  1.00 71.26  ? 658  PHE A HB2  1 
ATOM   1505  H  HB3  . PHE A 1 97  ? -58.648  5.278   -1.815  1.00 71.26  ? 658  PHE A HB3  1 
ATOM   1506  H  HD1  . PHE A 1 97  ? -60.842  6.786   0.533   1.00 84.26  ? 658  PHE A HD1  1 
ATOM   1507  H  HD2  . PHE A 1 97  ? -60.623  4.907   -2.988  1.00 70.88  ? 658  PHE A HD2  1 
ATOM   1508  H  HE1  . PHE A 1 97  ? -63.086  7.191   0.181   1.00 63.00  ? 658  PHE A HE1  1 
ATOM   1509  H  HE2  . PHE A 1 97  ? -62.866  5.311   -3.344  1.00 83.26  ? 658  PHE A HE2  1 
ATOM   1510  H  HZ   . PHE A 1 97  ? -64.102  6.454   -1.758  1.00 68.05  ? 658  PHE A HZ   1 
ATOM   1511  N  N    . ALA A 1 98  ? -56.600  4.100   1.144   1.00 78.00  ? 659  ALA A N    1 
ATOM   1512  C  CA   . ALA A 1 98  ? -55.179  3.770   1.176   1.00 70.94  ? 659  ALA A CA   1 
ATOM   1513  C  C    . ALA A 1 98  ? -54.893  2.443   0.483   1.00 80.91  ? 659  ALA A C    1 
ATOM   1514  O  O    . ALA A 1 98  ? -53.905  2.318   -0.250  1.00 91.21  ? 659  ALA A O    1 
ATOM   1515  C  CB   . ALA A 1 98  ? -54.689  3.732   2.626   1.00 76.28  ? 659  ALA A CB   1 
ATOM   1516  H  H    . ALA A 1 98  ? -56.927  4.320   1.909   1.00 93.59  ? 659  ALA A H    1 
ATOM   1517  H  HA   . ALA A 1 98  ? -54.684  4.462   0.711   1.00 85.13  ? 659  ALA A HA   1 
ATOM   1518  H  HB1  . ALA A 1 98  ? -53.745  3.512   2.635   1.00 91.54  ? 659  ALA A HB1  1 
ATOM   1519  H  HB2  . ALA A 1 98  ? -54.830  4.603   3.029   1.00 91.54  ? 659  ALA A HB2  1 
ATOM   1520  H  HB3  . ALA A 1 98  ? -55.191  3.058   3.111   1.00 91.54  ? 659  ALA A HB3  1 
ATOM   1521  N  N    . HIS A 1 99  ? -55.752  1.447   0.693   1.00 77.13  ? 660  HIS A N    1 
ATOM   1522  C  CA   . HIS A 1 99  ? -55.536  0.107   0.162   1.00 77.00  ? 660  HIS A CA   1 
ATOM   1523  C  C    . HIS A 1 99  ? -56.222  -0.139  -1.176  1.00 65.18  ? 660  HIS A C    1 
ATOM   1524  O  O    . HIS A 1 99  ? -56.164  -1.267  -1.679  1.00 91.66  ? 660  HIS A O    1 
ATOM   1525  C  CB   . HIS A 1 99  ? -56.012  -0.939  1.172   1.00 78.60  ? 660  HIS A CB   1 
ATOM   1526  H  H    . HIS A 1 99  ? -56.478  1.526   1.147   1.00 92.56  ? 660  HIS A H    1 
ATOM   1527  H  HA   . HIS A 1 99  ? -54.583  -0.023  0.032   1.00 92.40  ? 660  HIS A HA   1 
ATOM   1528  N  N    . LEU A 1 100 ? -56.867  0.866   -1.764  1.00 64.35  ? 661  LEU A N    1 
ATOM   1529  C  CA   . LEU A 1 100 ? -57.598  0.684   -3.013  1.00 59.21  ? 661  LEU A CA   1 
ATOM   1530  C  C    . LEU A 1 100 ? -56.759  0.945   -4.259  1.00 59.43  ? 661  LEU A C    1 
ATOM   1531  O  O    . LEU A 1 100 ? -57.293  0.877   -5.371  1.00 70.12  ? 661  LEU A O    1 
ATOM   1532  C  CB   . LEU A 1 100 ? -58.835  1.582   -3.026  1.00 52.66  ? 661  LEU A CB   1 
ATOM   1533  C  CG   . LEU A 1 100 ? -60.115  0.839   -2.640  1.00 61.67  ? 661  LEU A CG   1 
ATOM   1534  C  CD1  . LEU A 1 100 ? -59.980  0.191   -1.265  1.00 74.78  ? 661  LEU A CD1  1 
ATOM   1535  C  CD2  . LEU A 1 100 ? -61.312  1.778   -2.681  1.00 65.97  ? 661  LEU A CD2  1 
ATOM   1536  H  H    . LEU A 1 100 ? -56.895  1.669   -1.457  1.00 77.22  ? 661  LEU A H    1 
ATOM   1537  H  HA   . LEU A 1 100 ? -57.905  -0.235  -3.057  1.00 71.05  ? 661  LEU A HA   1 
ATOM   1538  H  HB2  . LEU A 1 100 ? -58.707  2.305   -2.392  1.00 63.19  ? 661  LEU A HB2  1 
ATOM   1539  H  HB3  . LEU A 1 100 ? -58.955  1.941   -3.919  1.00 63.19  ? 661  LEU A HB3  1 
ATOM   1540  H  HG   . LEU A 1 100 ? -60.272  0.132   -3.286  1.00 74.00  ? 661  LEU A HG   1 
ATOM   1541  H  HD11 . LEU A 1 100 ? -60.806  -0.271  -1.052  1.00 89.74  ? 661  LEU A HD11 1 
ATOM   1542  H  HD12 . LEU A 1 100 ? -59.244  -0.440  -1.285  1.00 89.74  ? 661  LEU A HD12 1 
ATOM   1543  H  HD13 . LEU A 1 100 ? -59.807  0.882   -0.607  1.00 89.74  ? 661  LEU A HD13 1 
ATOM   1544  H  HD21 . LEU A 1 100 ? -62.109  1.283   -2.433  1.00 79.16  ? 661  LEU A HD21 1 
ATOM   1545  H  HD22 . LEU A 1 100 ? -61.164  2.504   -2.055  1.00 79.16  ? 661  LEU A HD22 1 
ATOM   1546  H  HD23 . LEU A 1 100 ? -61.406  2.129   -3.580  1.00 79.16  ? 661  LEU A HD23 1 
ATOM   1547  N  N    . GLY A 1 101 ? -55.471  1.250   -4.110  1.00 47.47  ? 662  GLY A N    1 
ATOM   1548  C  CA   . GLY A 1 101 ? -54.559  1.271   -5.231  1.00 45.35  ? 662  GLY A CA   1 
ATOM   1549  C  C    . GLY A 1 101 ? -54.414  2.600   -5.938  1.00 44.40  ? 662  GLY A C    1 
ATOM   1550  O  O    . GLY A 1 101 ? -53.540  2.723   -6.806  1.00 57.56  ? 662  GLY A O    1 
ATOM   1551  H  H    . GLY A 1 101 ? -55.105  1.449   -3.358  1.00 56.96  ? 662  GLY A H    1 
ATOM   1552  H  HA2  . GLY A 1 101 ? -53.679  1.003   -4.922  1.00 54.42  ? 662  GLY A HA2  1 
ATOM   1553  H  HA3  . GLY A 1 101 ? -54.855  0.619   -5.886  1.00 54.42  ? 662  GLY A HA3  1 
ATOM   1554  N  N    . LEU A 1 102 ? -55.224  3.600   -5.601  1.00 44.18  ? 663  LEU A N    1 
ATOM   1555  C  CA   . LEU A 1 102 ? -55.093  4.923   -6.202  1.00 38.33  ? 663  LEU A CA   1 
ATOM   1556  C  C    . LEU A 1 102 ? -54.215  5.769   -5.294  1.00 39.77  ? 663  LEU A C    1 
ATOM   1557  O  O    . LEU A 1 102 ? -54.619  6.125   -4.183  1.00 39.89  ? 663  LEU A O    1 
ATOM   1558  C  CB   . LEU A 1 102 ? -56.459  5.567   -6.409  1.00 40.29  ? 663  LEU A CB   1 
ATOM   1559  C  CG   . LEU A 1 102 ? -56.451  6.974   -7.022  1.00 47.14  ? 663  LEU A CG   1 
ATOM   1560  C  CD1  . LEU A 1 102 ? -55.722  7.005   -8.357  1.00 35.81  ? 663  LEU A CD1  1 
ATOM   1561  C  CD2  . LEU A 1 102 ? -57.872  7.492   -7.194  1.00 35.29  ? 663  LEU A CD2  1 
ATOM   1562  H  H    . LEU A 1 102 ? -55.860  3.537   -5.025  1.00 53.02  ? 663  LEU A H    1 
ATOM   1563  H  HA   . LEU A 1 102 ? -54.657  4.844   -7.065  1.00 45.99  ? 663  LEU A HA   1 
ATOM   1564  H  HB2  . LEU A 1 102 ? -56.979  4.998   -6.999  1.00 48.35  ? 663  LEU A HB2  1 
ATOM   1565  H  HB3  . LEU A 1 102 ? -56.901  5.629   -5.548  1.00 48.35  ? 663  LEU A HB3  1 
ATOM   1566  H  HG   . LEU A 1 102 ? -55.987  7.574   -6.417  1.00 56.57  ? 663  LEU A HG   1 
ATOM   1567  H  HD11 . LEU A 1 102 ? -55.741  7.910   -8.705  1.00 42.97  ? 663  LEU A HD11 1 
ATOM   1568  H  HD12 . LEU A 1 102 ? -54.804  6.722   -8.222  1.00 42.97  ? 663  LEU A HD12 1 
ATOM   1569  H  HD13 . LEU A 1 102 ? -56.167  6.403   -8.973  1.00 42.97  ? 663  LEU A HD13 1 
ATOM   1570  H  HD21 . LEU A 1 102 ? -57.838  8.381   -7.582  1.00 42.35  ? 663  LEU A HD21 1 
ATOM   1571  H  HD22 . LEU A 1 102 ? -58.357  6.892   -7.781  1.00 42.35  ? 663  LEU A HD22 1 
ATOM   1572  H  HD23 . LEU A 1 102 ? -58.302  7.526   -6.325  1.00 42.35  ? 663  LEU A HD23 1 
ATOM   1573  N  N    . GLU A 1 103 ? -53.007  6.095   -5.776  1.00 44.57  ? 664  GLU A N    1 
ATOM   1574  C  CA   . GLU A 1 103 ? -52.014  6.810   -4.991  1.00 47.93  ? 664  GLU A CA   1 
ATOM   1575  C  C    . GLU A 1 103 ? -52.212  8.317   -5.117  1.00 35.16  ? 664  GLU A C    1 
ATOM   1576  O  O    . GLU A 1 103 ? -52.743  8.793   -6.125  1.00 38.52  ? 664  GLU A O    1 
ATOM   1577  C  CB   . GLU A 1 103 ? -50.609  6.440   -5.455  1.00 49.56  ? 664  GLU A CB   1 
ATOM   1578  C  CG   . GLU A 1 103 ? -50.190  5.028   -5.087  1.00 62.65  ? 664  GLU A CG   1 
ATOM   1579  C  CD   . GLU A 1 103 ? -49.907  4.872   -3.599  1.00 81.70  ? 664  GLU A CD   1 
ATOM   1580  O  OE1  . GLU A 1 103 ? -48.736  5.041   -3.194  1.00 100.41 ? 664  GLU A OE1  1 
ATOM   1581  O  OE2  . GLU A 1 103 ? -50.853  4.585   -2.835  1.00 58.71  ? 664  GLU A OE2  1 
ATOM   1582  H  H    . GLU A 1 103 ? -52.743  5.906   -6.573  1.00 53.49  ? 664  GLU A H    1 
ATOM   1583  H  HA   . GLU A 1 103 ? -52.104  6.565   -4.057  1.00 57.51  ? 664  GLU A HA   1 
ATOM   1584  H  HB2  . GLU A 1 103 ? -50.568  6.519   -6.421  1.00 59.47  ? 664  GLU A HB2  1 
ATOM   1585  H  HB3  . GLU A 1 103 ? -49.975  7.052   -5.049  1.00 59.47  ? 664  GLU A HB3  1 
ATOM   1586  H  HG2  . GLU A 1 103 ? -50.903  4.415   -5.323  1.00 75.19  ? 664  GLU A HG2  1 
ATOM   1587  H  HG3  . GLU A 1 103 ? -49.381  4.801   -5.572  1.00 75.19  ? 664  GLU A HG3  1 
ATOM   1588  N  N    . PRO A 1 104 ? -51.780  9.090   -4.112  1.00 33.12  ? 665  PRO A N    1 
ATOM   1589  C  CA   . PRO A 1 104 ? -52.021  10.544  -4.166  1.00 37.83  ? 665  PRO A CA   1 
ATOM   1590  C  C    . PRO A 1 104 ? -51.451  11.216  -5.405  1.00 36.22  ? 665  PRO A C    1 
ATOM   1591  O  O    . PRO A 1 104 ? -52.147  12.020  -6.041  1.00 36.81  ? 665  PRO A O    1 
ATOM   1592  C  CB   . PRO A 1 104 ? -51.356  11.044  -2.876  1.00 37.11  ? 665  PRO A CB   1 
ATOM   1593  C  CG   . PRO A 1 104 ? -51.403  9.884   -1.960  1.00 40.81  ? 665  PRO A CG   1 
ATOM   1594  C  CD   . PRO A 1 104 ? -51.212  8.677   -2.818  1.00 40.17  ? 665  PRO A CD   1 
ATOM   1595  H  HA   . PRO A 1 104 ? -52.973  10.724  -4.119  1.00 45.40  ? 665  PRO A HA   1 
ATOM   1596  H  HB2  . PRO A 1 104 ? -50.439  11.302  -3.058  1.00 44.54  ? 665  PRO A HB2  1 
ATOM   1597  H  HB3  . PRO A 1 104 ? -51.860  11.790  -2.514  1.00 44.54  ? 665  PRO A HB3  1 
ATOM   1598  H  HG2  . PRO A 1 104 ? -50.688  9.956   -1.308  1.00 48.97  ? 665  PRO A HG2  1 
ATOM   1599  H  HG3  . PRO A 1 104 ? -52.266  9.855   -1.518  1.00 48.97  ? 665  PRO A HG3  1 
ATOM   1600  H  HD2  . PRO A 1 104 ? -50.268  8.475   -2.911  1.00 48.21  ? 665  PRO A HD2  1 
ATOM   1601  H  HD3  . PRO A 1 104 ? -51.704  7.924   -2.456  1.00 48.21  ? 665  PRO A HD3  1 
ATOM   1602  N  N    . ILE A 1 105 ? -50.215  10.893  -5.790  1.00 29.11  ? 666  ILE A N    1 
ATOM   1603  C  CA   . ILE A 1 105 ? -49.586  11.605  -6.899  1.00 37.93  ? 666  ILE A CA   1 
ATOM   1604  C  C    . ILE A 1 105 ? -50.262  11.246  -8.215  1.00 32.11  ? 666  ILE A C    1 
ATOM   1605  O  O    . ILE A 1 105 ? -50.417  12.095  -9.100  1.00 35.85  ? 666  ILE A O    1 
ATOM   1606  C  CB   . ILE A 1 105 ? -48.074  11.310  -6.935  1.00 39.91  ? 666  ILE A CB   1 
ATOM   1607  C  CG1  . ILE A 1 105 ? -47.388  11.945  -5.723  1.00 40.83  ? 666  ILE A CG1  1 
ATOM   1608  C  CG2  . ILE A 1 105 ? -47.452  11.856  -8.211  1.00 36.21  ? 666  ILE A CG2  1 
ATOM   1609  C  CD1  . ILE A 1 105 ? -45.921  11.564  -5.563  1.00 49.02  ? 666  ILE A CD1  1 
ATOM   1610  H  H    . ILE A 1 105 ? -49.730  10.279  -5.433  1.00 34.94  ? 666  ILE A H    1 
ATOM   1611  H  HA   . ILE A 1 105 ? -49.697  12.558  -6.760  1.00 45.51  ? 666  ILE A HA   1 
ATOM   1612  H  HB   . ILE A 1 105 ? -47.940  10.349  -6.905  1.00 47.90  ? 666  ILE A HB   1 
ATOM   1613  H  HG12 . ILE A 1 105 ? -47.433  12.910  -5.811  1.00 49.00  ? 666  ILE A HG12 1 
ATOM   1614  H  HG13 . ILE A 1 105 ? -47.854  11.667  -4.920  1.00 49.00  ? 666  ILE A HG13 1 
ATOM   1615  H  HG21 . ILE A 1 105 ? -46.503  11.657  -8.209  1.00 43.45  ? 666  ILE A HG21 1 
ATOM   1616  H  HG22 . ILE A 1 105 ? -47.877  11.434  -8.974  1.00 43.45  ? 666  ILE A HG22 1 
ATOM   1617  H  HG23 . ILE A 1 105 ? -47.590  12.815  -8.243  1.00 43.45  ? 666  ILE A HG23 1 
ATOM   1618  H  HD11 . ILE A 1 105 ? -45.565  12.006  -4.777  1.00 58.83  ? 666  ILE A HD11 1 
ATOM   1619  H  HD12 . ILE A 1 105 ? -45.855  10.601  -5.460  1.00 58.83  ? 666  ILE A HD12 1 
ATOM   1620  H  HD13 . ILE A 1 105 ? -45.433  11.847  -6.352  1.00 58.83  ? 666  ILE A HD13 1 
ATOM   1621  N  N    . THR A 1 106 ? -50.679  9.989   -8.370  1.00 28.13  ? 667  THR A N    1 
ATOM   1622  C  CA   . THR A 1 106 ? -51.361  9.598   -9.597  1.00 31.09  ? 667  THR A CA   1 
ATOM   1623  C  C    . THR A 1 106 ? -52.763  10.183  -9.649  1.00 34.83  ? 667  THR A C    1 
ATOM   1624  O  O    . THR A 1 106 ? -53.274  10.481  -10.737 1.00 27.04  ? 667  THR A O    1 
ATOM   1625  C  CB   . THR A 1 106 ? -51.416  8.075   -9.716  1.00 34.64  ? 667  THR A CB   1 
ATOM   1626  O  OG1  . THR A 1 106 ? -52.386  7.549   -8.805  1.00 53.07  ? 667  THR A OG1  1 
ATOM   1627  C  CG2  . THR A 1 106 ? -50.064  7.448   -9.417  1.00 39.40  ? 667  THR A CG2  1 
ATOM   1628  H  H    . THR A 1 106 ? -50.581  9.359   -7.792  1.00 33.75  ? 667  THR A H    1 
ATOM   1629  H  HA   . THR A 1 106 ? -50.864  9.941   -10.357 1.00 37.30  ? 667  THR A HA   1 
ATOM   1630  H  HB   . THR A 1 106 ? -51.666  7.835   -10.622 1.00 41.57  ? 667  THR A HB   1 
ATOM   1631  H  HG1  . THR A 1 106 ? -52.417  6.712   -8.870  1.00 63.68  ? 667  THR A HG1  1 
ATOM   1632  H  HG21 . THR A 1 106 ? -50.120  6.484   -9.498  1.00 47.28  ? 667  THR A HG21 1 
ATOM   1633  H  HG22 . THR A 1 106 ? -49.400  7.779   -10.042 1.00 47.28  ? 667  THR A HG22 1 
ATOM   1634  H  HG23 . THR A 1 106 ? -49.786  7.673   -8.515  1.00 47.28  ? 667  THR A HG23 1 
ATOM   1635  N  N    . LEU A 1 107 ? -53.395  10.354  -8.485  1.00 29.75  ? 668  LEU A N    1 
ATOM   1636  C  CA   . LEU A 1 107 ? -54.682  11.036  -8.424  1.00 33.59  ? 668  LEU A CA   1 
ATOM   1637  C  C    . LEU A 1 107 ? -54.562  12.479  -8.901  1.00 34.10  ? 668  LEU A C    1 
ATOM   1638  O  O    . LEU A 1 107 ? -55.432  12.974  -9.627  1.00 33.42  ? 668  LEU A O    1 
ATOM   1639  C  CB   . LEU A 1 107 ? -55.226  10.978  -6.995  1.00 28.71  ? 668  LEU A CB   1 
ATOM   1640  C  CG   . LEU A 1 107 ? -56.538  11.694  -6.678  1.00 43.15  ? 668  LEU A CG   1 
ATOM   1641  C  CD1  . LEU A 1 107 ? -57.274  10.942  -5.577  1.00 42.13  ? 668  LEU A CD1  1 
ATOM   1642  C  CD2  . LEU A 1 107 ? -56.305  13.145  -6.259  1.00 44.77  ? 668  LEU A CD2  1 
ATOM   1643  H  H    . LEU A 1 107 ? -53.099  10.086  -7.723  1.00 35.70  ? 668  LEU A H    1 
ATOM   1644  H  HA   . LEU A 1 107 ? -55.311  10.579  -9.004  1.00 40.31  ? 668  LEU A HA   1 
ATOM   1645  H  HB2  . LEU A 1 107 ? -55.354  10.044  -6.766  1.00 34.45  ? 668  LEU A HB2  1 
ATOM   1646  H  HB3  . LEU A 1 107 ? -54.552  11.356  -6.407  1.00 34.45  ? 668  LEU A HB3  1 
ATOM   1647  H  HG   . LEU A 1 107 ? -57.099  11.695  -7.469  1.00 51.78  ? 668  LEU A HG   1 
ATOM   1648  H  HD11 . LEU A 1 107 ? -58.105  11.403  -5.382  1.00 50.56  ? 668  LEU A HD11 1 
ATOM   1649  H  HD12 . LEU A 1 107 ? -57.458  10.040  -5.881  1.00 50.56  ? 668  LEU A HD12 1 
ATOM   1650  H  HD13 . LEU A 1 107 ? -56.715  10.917  -4.785  1.00 50.56  ? 668  LEU A HD13 1 
ATOM   1651  H  HD21 . LEU A 1 107 ? -57.161  13.559  -6.068  1.00 53.73  ? 668  LEU A HD21 1 
ATOM   1652  H  HD22 . LEU A 1 107 ? -55.746  13.158  -5.467  1.00 53.73  ? 668  LEU A HD22 1 
ATOM   1653  H  HD23 . LEU A 1 107 ? -55.864  13.615  -6.984  1.00 53.73  ? 668  LEU A HD23 1 
ATOM   1654  N  N    . LEU A 1 108 ? -53.490  13.171  -8.502  1.00 31.35  ? 669  LEU A N    1 
ATOM   1655  C  CA   . LEU A 1 108 ? -53.296  14.551  -8.937  1.00 21.07  ? 669  LEU A CA   1 
ATOM   1656  C  C    . LEU A 1 108 ? -52.973  14.626  -10.424 1.00 28.33  ? 669  LEU A C    1 
ATOM   1657  O  O    . LEU A 1 108 ? -53.389  15.575  -11.100 1.00 30.97  ? 669  LEU A O    1 
ATOM   1658  C  CB   . LEU A 1 108 ? -52.191  15.209  -8.110  1.00 33.15  ? 669  LEU A CB   1 
ATOM   1659  C  CG   . LEU A 1 108 ? -52.460  15.296  -6.603  1.00 32.83  ? 669  LEU A CG   1 
ATOM   1660  C  CD1  . LEU A 1 108 ? -51.230  15.806  -5.880  1.00 33.18  ? 669  LEU A CD1  1 
ATOM   1661  C  CD2  . LEU A 1 108 ? -53.652  16.185  -6.304  1.00 35.18  ? 669  LEU A CD2  1 
ATOM   1662  H  H    . LEU A 1 108 ? -52.872  12.868  -7.987  1.00 37.62  ? 669  LEU A H    1 
ATOM   1663  H  HA   . LEU A 1 108 ? -54.117  15.046  -8.786  1.00 25.28  ? 669  LEU A HA   1 
ATOM   1664  H  HB2  . LEU A 1 108 ? -51.374  14.701  -8.232  1.00 39.78  ? 669  LEU A HB2  1 
ATOM   1665  H  HB3  . LEU A 1 108 ? -52.062  16.114  -8.436  1.00 39.78  ? 669  LEU A HB3  1 
ATOM   1666  H  HG   . LEU A 1 108 ? -52.657  14.408  -6.267  1.00 39.40  ? 669  LEU A HG   1 
ATOM   1667  H  HD11 . LEU A 1 108 ? -51.420  15.853  -4.930  1.00 39.82  ? 669  LEU A HD11 1 
ATOM   1668  H  HD12 . LEU A 1 108 ? -50.495  15.194  -6.041  1.00 39.82  ? 669  LEU A HD12 1 
ATOM   1669  H  HD13 . LEU A 1 108 ? -51.008  16.687  -6.219  1.00 39.82  ? 669  LEU A HD13 1 
ATOM   1670  H  HD21 . LEU A 1 108 ? -53.790  16.216  -5.345  1.00 42.22  ? 669  LEU A HD21 1 
ATOM   1671  H  HD22 . LEU A 1 108 ? -53.473  17.077  -6.642  1.00 42.22  ? 669  LEU A HD22 1 
ATOM   1672  H  HD23 . LEU A 1 108 ? -54.437  15.817  -6.740  1.00 42.22  ? 669  LEU A HD23 1 
ATOM   1673  N  N    . GLN A 1 109 ? -52.246  13.635  -10.950 1.00 31.17  ? 670  GLN A N    1 
ATOM   1674  C  CA   . GLN A 1 109 ? -51.974  13.581  -12.383 1.00 29.74  ? 670  GLN A CA   1 
ATOM   1675  C  C    . GLN A 1 109 ? -53.265  13.429  -13.177 1.00 30.02  ? 670  GLN A C    1 
ATOM   1676  O  O    . GLN A 1 109 ? -53.442  14.067  -14.222 1.00 33.07  ? 670  GLN A O    1 
ATOM   1677  C  CB   . GLN A 1 109 ? -51.020  12.424  -12.680 1.00 27.12  ? 670  GLN A CB   1 
ATOM   1678  C  CG   . GLN A 1 109 ? -50.604  12.297  -14.139 1.00 29.35  ? 670  GLN A CG   1 
ATOM   1679  C  CD   . GLN A 1 109 ? -49.594  11.182  -14.354 1.00 52.31  ? 670  GLN A CD   1 
ATOM   1680  O  OE1  . GLN A 1 109 ? -48.479  11.419  -14.820 1.00 52.03  ? 670  GLN A OE1  1 
ATOM   1681  N  NE2  . GLN A 1 109 ? -49.982  9.956   -14.014 1.00 49.19  ? 670  GLN A NE2  1 
ATOM   1682  H  H    . GLN A 1 109 ? -51.903  12.988  -10.499 1.00 37.41  ? 670  GLN A H    1 
ATOM   1683  H  HA   . GLN A 1 109 ? -51.545  14.406  -12.657 1.00 35.69  ? 670  GLN A HA   1 
ATOM   1684  H  HB2  . GLN A 1 109 ? -50.213  12.546  -12.155 1.00 32.54  ? 670  GLN A HB2  1 
ATOM   1685  H  HB3  . GLN A 1 109 ? -51.452  11.594  -12.425 1.00 32.54  ? 670  GLN A HB3  1 
ATOM   1686  H  HG2  . GLN A 1 109 ? -51.388  12.102  -14.676 1.00 35.22  ? 670  GLN A HG2  1 
ATOM   1687  H  HG3  . GLN A 1 109 ? -50.200  13.130  -14.428 1.00 35.22  ? 670  GLN A HG3  1 
ATOM   1688  H  HE21 . GLN A 1 109 ? -50.769  9.828   -13.691 1.00 59.03  ? 670  GLN A HE21 1 
ATOM   1689  H  HE22 . GLN A 1 109 ? -49.446  9.291   -14.116 1.00 59.03  ? 670  GLN A HE22 1 
ATOM   1690  N  N    . GLN A 1 110 ? -54.179  12.586  -12.695 1.00 26.49  ? 671  GLN A N    1 
ATOM   1691  C  CA   . GLN A 1 110 ? -55.475  12.437  -13.349 1.00 20.88  ? 671  GLN A CA   1 
ATOM   1692  C  C    . GLN A 1 110 ? -56.276  13.729  -13.264 1.00 25.74  ? 671  GLN A C    1 
ATOM   1693  O  O    . GLN A 1 110 ? -56.831  14.195  -14.265 1.00 28.50  ? 671  GLN A O    1 
ATOM   1694  C  CB   . GLN A 1 110 ? -56.243  11.276  -12.714 1.00 28.04  ? 671  GLN A CB   1 
ATOM   1695  C  CG   . GLN A 1 110 ? -55.630  9.907   -12.998 1.00 34.58  ? 671  GLN A CG   1 
ATOM   1696  C  CD   . GLN A 1 110 ? -56.239  8.793   -12.162 1.00 38.53  ? 671  GLN A CD   1 
ATOM   1697  O  OE1  . GLN A 1 110 ? -57.125  9.029   -11.342 1.00 43.75  ? 671  GLN A OE1  1 
ATOM   1698  N  NE2  . GLN A 1 110 ? -55.757  7.570   -12.362 1.00 35.77  ? 671  GLN A NE2  1 
ATOM   1699  H  H    . GLN A 1 110 ? -54.073  12.094  -11.998 1.00 31.79  ? 671  GLN A H    1 
ATOM   1700  H  HA   . GLN A 1 110 ? -55.336  12.230  -14.286 1.00 25.06  ? 671  GLN A HA   1 
ATOM   1701  H  HB2  . GLN A 1 110 ? -56.259  11.401  -11.752 1.00 33.64  ? 671  GLN A HB2  1 
ATOM   1702  H  HB3  . GLN A 1 110 ? -57.149  11.274  -13.061 1.00 33.64  ? 671  GLN A HB3  1 
ATOM   1703  H  HG2  . GLN A 1 110 ? -55.769  9.688   -13.933 1.00 41.49  ? 671  GLN A HG2  1 
ATOM   1704  H  HG3  . GLN A 1 110 ? -54.680  9.941   -12.804 1.00 41.49  ? 671  GLN A HG3  1 
ATOM   1705  H  HE21 . GLN A 1 110 ? -55.134  7.443   -12.940 1.00 42.92  ? 671  GLN A HE21 1 
ATOM   1706  H  HE22 . GLN A 1 110 ? -56.069  6.906   -11.913 1.00 42.92  ? 671  GLN A HE22 1 
ATOM   1707  N  N    . THR A 1 111 ? -56.343  14.323  -12.069 1.00 28.79  ? 672  THR A N    1 
ATOM   1708  C  CA   . THR A 1 111 ? -57.020  15.606  -11.904 1.00 23.52  ? 672  THR A CA   1 
ATOM   1709  C  C    . THR A 1 111 ? -56.456  16.660  -12.847 1.00 31.89  ? 672  THR A C    1 
ATOM   1710  O  O    . THR A 1 111 ? -57.209  17.446  -13.435 1.00 30.70  ? 672  THR A O    1 
ATOM   1711  C  CB   . THR A 1 111 ? -56.895  16.080  -10.457 1.00 25.57  ? 672  THR A CB   1 
ATOM   1712  O  OG1  . THR A 1 111 ? -57.468  15.103  -9.583  1.00 32.80  ? 672  THR A OG1  1 
ATOM   1713  C  CG2  . THR A 1 111 ? -57.608  17.415  -10.254 1.00 24.17  ? 672  THR A CG2  1 
ATOM   1714  H  H    . THR A 1 111 ? -56.006  14.004  -11.345 1.00 34.55  ? 672  THR A H    1 
ATOM   1715  H  HA   . THR A 1 111 ? -57.963  15.496  -12.104 1.00 28.23  ? 672  THR A HA   1 
ATOM   1716  H  HB   . THR A 1 111 ? -55.957  16.197  -10.237 1.00 30.68  ? 672  THR A HB   1 
ATOM   1717  H  HG1  . THR A 1 111 ? -57.067  14.370  -9.669  1.00 39.36  ? 672  THR A HG1  1 
ATOM   1718  H  HG21 . THR A 1 111 ? -57.519  17.701  -9.332  1.00 29.01  ? 672  THR A HG21 1 
ATOM   1719  H  HG22 . THR A 1 111 ? -57.220  18.089  -10.833 1.00 29.01  ? 672  THR A HG22 1 
ATOM   1720  H  HG23 . THR A 1 111 ? -58.550  17.323  -10.466 1.00 29.01  ? 672  THR A HG23 1 
ATOM   1721  N  N    . THR A 1 112 ? -55.131  16.707  -12.993 1.00 29.64  ? 673  THR A N    1 
ATOM   1722  C  CA   . THR A 1 112 ? -54.529  17.688  -13.890 1.00 26.83  ? 673  THR A CA   1 
ATOM   1723  C  C    . THR A 1 112 ? -54.791  17.336  -15.350 1.00 32.31  ? 673  THR A C    1 
ATOM   1724  O  O    . THR A 1 112 ? -55.010  18.226  -16.179 1.00 39.39  ? 673  THR A O    1 
ATOM   1725  C  CB   . THR A 1 112 ? -53.036  17.785  -13.606 1.00 31.28  ? 673  THR A CB   1 
ATOM   1726  O  OG1  . THR A 1 112 ? -52.848  18.046  -12.211 1.00 29.52  ? 673  THR A OG1  1 
ATOM   1727  C  CG2  . THR A 1 112 ? -52.394  18.898  -14.422 1.00 36.61  ? 673  THR A CG2  1 
ATOM   1728  H  H    . THR A 1 112 ? -54.570  16.193  -12.592 1.00 35.57  ? 673  THR A H    1 
ATOM   1729  H  HA   . THR A 1 112 ? -54.924  18.557  -13.716 1.00 32.19  ? 673  THR A HA   1 
ATOM   1730  H  HB   . THR A 1 112 ? -52.607  16.947  -13.838 1.00 37.53  ? 673  THR A HB   1 
ATOM   1731  H  HG1  . THR A 1 112 ? -53.181  17.424  -11.755 1.00 35.42  ? 673  THR A HG1  1 
ATOM   1732  H  HG21 . THR A 1 112 ? -51.445  18.945  -14.228 1.00 43.93  ? 673  THR A HG21 1 
ATOM   1733  H  HG22 . THR A 1 112 ? -52.515  18.726  -15.369 1.00 43.93  ? 673  THR A HG22 1 
ATOM   1734  H  HG23 . THR A 1 112 ? -52.804  19.749  -14.201 1.00 43.93  ? 673  THR A HG23 1 
ATOM   1735  N  N    . SER A 1 113 ? -54.790  16.043  -15.682 1.00 33.16  ? 674  SER A N    1 
ATOM   1736  C  CA   . SER A 1 113 ? -55.060  15.632  -17.055 1.00 30.51  ? 674  SER A CA   1 
ATOM   1737  C  C    . SER A 1 113 ? -56.487  15.967  -17.465 1.00 29.57  ? 674  SER A C    1 
ATOM   1738  O  O    . SER A 1 113 ? -56.727  16.399  -18.599 1.00 37.17  ? 674  SER A O    1 
ATOM   1739  C  CB   . SER A 1 113 ? -54.802  14.136  -17.206 1.00 29.33  ? 674  SER A CB   1 
ATOM   1740  O  OG   . SER A 1 113 ? -55.072  13.714  -18.529 1.00 46.82  ? 674  SER A OG   1 
ATOM   1741  H  H    . SER A 1 113 ? -54.637  15.396  -15.137 1.00 39.80  ? 674  SER A H    1 
ATOM   1742  H  HA   . SER A 1 113 ? -54.457  16.103  -17.651 1.00 36.61  ? 674  SER A HA   1 
ATOM   1743  H  HB2  . SER A 1 113 ? -53.872  13.954  -17.000 1.00 35.19  ? 674  SER A HB2  1 
ATOM   1744  H  HB3  . SER A 1 113 ? -55.379  13.652  -16.596 1.00 35.19  ? 674  SER A HB3  1 
ATOM   1745  H  HG   . SER A 1 113 ? -54.927  12.890  -18.603 1.00 56.18  ? 674  SER A HG   1 
ATOM   1746  N  N    . GLY A 1 114 ? -57.450  15.762  -16.565 1.00 34.20  ? 675  GLY A N    1 
ATOM   1747  C  CA   . GLY A 1 114 ? -58.821  16.126  -16.873 1.00 36.69  ? 675  GLY A CA   1 
ATOM   1748  C  C    . GLY A 1 114 ? -59.007  17.626  -16.967 1.00 34.33  ? 675  GLY A C    1 
ATOM   1749  O  O    . GLY A 1 114 ? -59.791  18.115  -17.787 1.00 36.04  ? 675  GLY A O    1 
ATOM   1750  H  H    . GLY A 1 114 ? -57.333  15.420  -15.785 1.00 41.04  ? 675  GLY A H    1 
ATOM   1751  H  HA2  . GLY A 1 114 ? -59.079  15.730  -17.721 1.00 44.02  ? 675  GLY A HA2  1 
ATOM   1752  H  HA3  . GLY A 1 114 ? -59.410  15.785  -16.182 1.00 44.02  ? 675  GLY A HA3  1 
ATOM   1753  N  N    . LEU A 1 115 ? -58.289  18.378  -16.131 1.00 33.00  ? 676  LEU A N    1 
ATOM   1754  C  CA   . LEU A 1 115 ? -58.365  19.831  -16.206 1.00 24.69  ? 676  LEU A CA   1 
ATOM   1755  C  C    . LEU A 1 115 ? -57.763  20.343  -17.510 1.00 36.12  ? 676  LEU A C    1 
ATOM   1756  O  O    . LEU A 1 115 ? -58.273  21.299  -18.103 1.00 36.71  ? 676  LEU A O    1 
ATOM   1757  C  CB   . LEU A 1 115 ? -57.655  20.447  -15.006 1.00 29.25  ? 676  LEU A CB   1 
ATOM   1758  C  CG   . LEU A 1 115 ? -57.942  21.920  -14.731 1.00 39.85  ? 676  LEU A CG   1 
ATOM   1759  C  CD1  . LEU A 1 115 ? -59.390  22.140  -14.295 1.00 31.56  ? 676  LEU A CD1  1 
ATOM   1760  C  CD2  . LEU A 1 115 ? -56.990  22.435  -13.680 1.00 40.07  ? 676  LEU A CD2  1 
ATOM   1761  H  H    . LEU A 1 115 ? -57.761  18.075  -15.524 1.00 39.59  ? 676  LEU A H    1 
ATOM   1762  H  HA   . LEU A 1 115 ? -59.296  20.102  -16.178 1.00 29.63  ? 676  LEU A HA   1 
ATOM   1763  H  HB2  . LEU A 1 115 ? -57.913  19.952  -14.213 1.00 35.10  ? 676  LEU A HB2  1 
ATOM   1764  H  HB3  . LEU A 1 115 ? -56.698  20.361  -15.141 1.00 35.10  ? 676  LEU A HB3  1 
ATOM   1765  H  HG   . LEU A 1 115 ? -57.793  22.428  -15.544 1.00 47.82  ? 676  LEU A HG   1 
ATOM   1766  H  HD11 . LEU A 1 115 ? -59.530  23.086  -14.131 1.00 37.87  ? 676  LEU A HD11 1 
ATOM   1767  H  HD12 . LEU A 1 115 ? -59.982  21.835  -15.000 1.00 37.87  ? 676  LEU A HD12 1 
ATOM   1768  H  HD13 . LEU A 1 115 ? -59.555  21.636  -13.483 1.00 37.87  ? 676  LEU A HD13 1 
ATOM   1769  H  HD21 . LEU A 1 115 ? -57.180  23.371  -13.513 1.00 48.09  ? 676  LEU A HD21 1 
ATOM   1770  H  HD22 . LEU A 1 115 ? -57.112  21.922  -12.866 1.00 48.09  ? 676  LEU A HD22 1 
ATOM   1771  H  HD23 . LEU A 1 115 ? -56.080  22.334  -14.001 1.00 48.09  ? 676  LEU A HD23 1 
ATOM   1772  N  N    . ALA A 1 116 ? -56.679  19.716  -17.973 1.00 37.97  ? 677  ALA A N    1 
ATOM   1773  C  CA   . ALA A 1 116 ? -56.079  20.109  -19.244 1.00 35.65  ? 677  ALA A CA   1 
ATOM   1774  C  C    . ALA A 1 116 ? -57.013  19.815  -20.409 1.00 38.35  ? 677  ALA A C    1 
ATOM   1775  O  O    . ALA A 1 116 ? -57.038  20.557  -21.397 1.00 42.95  ? 677  ALA A O    1 
ATOM   1776  C  CB   . ALA A 1 116 ? -54.746  19.391  -19.437 1.00 33.45  ? 677  ALA A CB   1 
ATOM   1777  H  H    . ALA A 1 116 ? -56.279  19.067  -17.575 1.00 45.56  ? 677  ALA A H    1 
ATOM   1778  H  HA   . ALA A 1 116 ? -55.907  21.064  -19.230 1.00 42.78  ? 677  ALA A HA   1 
ATOM   1779  H  HB1  . ALA A 1 116 ? -54.361  19.663  -20.285 1.00 40.14  ? 677  ALA A HB1  1 
ATOM   1780  H  HB2  . ALA A 1 116 ? -54.150  19.630  -18.710 1.00 40.14  ? 677  ALA A HB2  1 
ATOM   1781  H  HB3  . ALA A 1 116 ? -54.901  18.433  -19.436 1.00 40.14  ? 677  ALA A HB3  1 
ATOM   1782  N  N    . HIS A 1 117 ? -57.782  18.729  -20.317 1.00 39.15  ? 678  HIS A N    1 
ATOM   1783  C  CA   . HIS A 1 117 ? -58.747  18.422  -21.367 1.00 46.78  ? 678  HIS A CA   1 
ATOM   1784  C  C    . HIS A 1 117 ? -59.836  19.482  -21.433 1.00 46.48  ? 678  HIS A C    1 
ATOM   1785  O  O    . HIS A 1 117 ? -60.255  19.883  -22.526 1.00 45.82  ? 678  HIS A O    1 
ATOM   1786  C  CB   . HIS A 1 117 ? -59.359  17.041  -21.138 1.00 34.55  ? 678  HIS A CB   1 
ATOM   1787  C  CG   . HIS A 1 117 ? -60.391  16.670  -22.155 1.00 34.90  ? 678  HIS A CG   1 
ATOM   1788  N  ND1  . HIS A 1 117 ? -61.744  16.745  -21.906 1.00 43.91  ? 678  HIS A ND1  1 
ATOM   1789  C  CD2  . HIS A 1 117 ? -60.265  16.226  -23.427 1.00 41.41  ? 678  HIS A CD2  1 
ATOM   1790  C  CE1  . HIS A 1 117 ? -62.408  16.361  -22.981 1.00 43.48  ? 678  HIS A CE1  1 
ATOM   1791  N  NE2  . HIS A 1 117 ? -61.535  16.042  -23.918 1.00 44.98  ? 678  HIS A NE2  1 
ATOM   1792  H  H    . HIS A 1 117 ? -57.764  18.165  -19.668 1.00 46.98  ? 678  HIS A H    1 
ATOM   1793  H  HA   . HIS A 1 117 ? -58.289  18.409  -22.222 1.00 56.13  ? 678  HIS A HA   1 
ATOM   1794  H  HB2  . HIS A 1 117 ? -58.655  16.375  -21.173 1.00 41.46  ? 678  HIS A HB2  1 
ATOM   1795  H  HB3  . HIS A 1 117 ? -59.783  17.026  -20.266 1.00 41.46  ? 678  HIS A HB3  1 
ATOM   1796  H  HD1  . HIS A 1 117 ? -62.100  17.001  -21.166 1.00 52.69  ? 678  HIS A HD1  1 
ATOM   1797  H  HD2  . HIS A 1 117 ? -59.469  16.075  -23.883 1.00 49.69  ? 678  HIS A HD2  1 
ATOM   1798  H  HE1  . HIS A 1 117 ? -63.334  16.323  -23.064 1.00 52.18  ? 678  HIS A HE1  1 
ATOM   1799  H  HE2  . HIS A 1 117 ? -61.729  15.762  -24.708 1.00 53.98  ? 678  HIS A HE2  1 
ATOM   1800  N  N    . LEU A 1 118 ? -60.310  19.950  -20.276 1.00 42.77  ? 679  LEU A N    1 
ATOM   1801  C  CA   . LEU A 1 118 ? -61.306  21.015  -20.274 1.00 44.85  ? 679  LEU A CA   1 
ATOM   1802  C  C    . LEU A 1 118 ? -60.726  22.293  -20.864 1.00 43.75  ? 679  LEU A C    1 
ATOM   1803  O  O    . LEU A 1 118 ? -61.342  22.929  -21.727 1.00 45.64  ? 679  LEU A O    1 
ATOM   1804  C  CB   . LEU A 1 118 ? -61.824  21.259  -18.852 1.00 38.69  ? 679  LEU A CB   1 
ATOM   1805  C  CG   . LEU A 1 118 ? -62.724  20.181  -18.231 1.00 44.40  ? 679  LEU A CG   1 
ATOM   1806  C  CD1  . LEU A 1 118 ? -63.154  20.594  -16.831 1.00 41.00  ? 679  LEU A CD1  1 
ATOM   1807  C  CD2  . LEU A 1 118 ? -63.945  19.902  -19.088 1.00 34.77  ? 679  LEU A CD2  1 
ATOM   1808  H  H    . LEU A 1 118 ? -60.076  19.672  -19.497 1.00 51.32  ? 679  LEU A H    1 
ATOM   1809  H  HA   . LEU A 1 118 ? -62.058  20.746  -20.824 1.00 53.82  ? 679  LEU A HA   1 
ATOM   1810  H  HB2  . LEU A 1 118 ? -61.056  21.359  -18.268 1.00 46.43  ? 679  LEU A HB2  1 
ATOM   1811  H  HB3  . LEU A 1 118 ? -62.331  22.085  -18.856 1.00 46.43  ? 679  LEU A HB3  1 
ATOM   1812  H  HG   . LEU A 1 118 ? -62.219  19.356  -18.155 1.00 53.28  ? 679  LEU A HG   1 
ATOM   1813  H  HD11 . LEU A 1 118 ? -63.720  19.901  -16.458 1.00 49.20  ? 679  LEU A HD11 1 
ATOM   1814  H  HD12 . LEU A 1 118 ? -62.364  20.709  -16.280 1.00 49.20  ? 679  LEU A HD12 1 
ATOM   1815  H  HD13 . LEU A 1 118 ? -63.644  21.429  -16.885 1.00 49.20  ? 679  LEU A HD13 1 
ATOM   1816  H  HD21 . LEU A 1 118 ? -64.482  19.218  -18.658 1.00 41.73  ? 679  LEU A HD21 1 
ATOM   1817  H  HD22 . LEU A 1 118 ? -64.460  20.719  -19.178 1.00 41.73  ? 679  LEU A HD22 1 
ATOM   1818  H  HD23 . LEU A 1 118 ? -63.655  19.595  -19.961 1.00 41.73  ? 679  LEU A HD23 1 
ATOM   1819  N  N    . HIS A 1 119 ? -59.525  22.673  -20.423 1.00 43.48  ? 680  HIS A N    1 
ATOM   1820  C  CA   . HIS A 1 119 ? -58.908  23.901  -20.914 1.00 38.45  ? 680  HIS A CA   1 
ATOM   1821  C  C    . HIS A 1 119 ? -58.675  23.854  -22.418 1.00 28.68  ? 680  HIS A C    1 
ATOM   1822  O  O    . HIS A 1 119 ? -58.743  24.890  -23.087 1.00 48.97  ? 680  HIS A O    1 
ATOM   1823  C  CB   . HIS A 1 119 ? -57.592  24.152  -20.180 1.00 38.15  ? 680  HIS A CB   1 
ATOM   1824  C  CG   . HIS A 1 119 ? -57.765  24.486  -18.732 1.00 39.37  ? 680  HIS A CG   1 
ATOM   1825  N  ND1  . HIS A 1 119 ? -56.721  24.449  -17.834 1.00 37.33  ? 680  HIS A ND1  1 
ATOM   1826  C  CD2  . HIS A 1 119 ? -58.857  24.863  -18.025 1.00 33.57  ? 680  HIS A CD2  1 
ATOM   1827  C  CE1  . HIS A 1 119 ? -57.162  24.789  -16.636 1.00 41.28  ? 680  HIS A CE1  1 
ATOM   1828  N  NE2  . HIS A 1 119 ? -58.455  25.044  -16.725 1.00 39.50  ? 680  HIS A NE2  1 
ATOM   1829  H  H    . HIS A 1 119 ? -59.054  22.242  -19.848 1.00 52.17  ? 680  HIS A H    1 
ATOM   1830  H  HA   . HIS A 1 119 ? -59.501  24.646  -20.728 1.00 46.14  ? 680  HIS A HA   1 
ATOM   1831  H  HB2  . HIS A 1 119 ? -57.045  23.354  -20.238 1.00 45.77  ? 680  HIS A HB2  1 
ATOM   1832  H  HB3  . HIS A 1 119 ? -57.135  24.895  -20.604 1.00 45.77  ? 680  HIS A HB3  1 
ATOM   1833  H  HD1  . HIS A 1 119 ? -55.909  24.238  -18.024 1.00 44.80  ? 680  HIS A HD1  1 
ATOM   1834  H  HD2  . HIS A 1 119 ? -59.718  24.977  -18.358 1.00 40.29  ? 680  HIS A HD2  1 
ATOM   1835  H  HE1  . HIS A 1 119 ? -56.649  24.839  -15.862 1.00 49.54  ? 680  HIS A HE1  1 
ATOM   1836  H  HE2  . HIS A 1 119 ? -58.962  25.286  -16.074 1.00 47.40  ? 680  HIS A HE2  1 
ATOM   1837  N  N    . SER A 1 120 ? -58.404  22.671  -22.969 1.00 39.10  ? 681  SER A N    1 
ATOM   1838  C  CA   . SER A 1 120 ? -58.220  22.560  -24.410 1.00 38.57  ? 681  SER A CA   1 
ATOM   1839  C  C    . SER A 1 120 ? -59.515  22.809  -25.174 1.00 40.08  ? 681  SER A C    1 
ATOM   1840  O  O    . SER A 1 120 ? -59.465  23.103  -26.372 1.00 47.78  ? 681  SER A O    1 
ATOM   1841  C  CB   . SER A 1 120 ? -57.658  21.183  -24.758 1.00 34.61  ? 681  SER A CB   1 
ATOM   1842  O  OG   . SER A 1 120 ? -58.563  20.155  -24.398 1.00 50.91  ? 681  SER A OG   1 
ATOM   1843  H  H    . SER A 1 120 ? -58.324  21.931  -22.537 1.00 46.92  ? 681  SER A H    1 
ATOM   1844  H  HA   . SER A 1 120 ? -57.575  23.225  -24.695 1.00 46.29  ? 681  SER A HA   1 
ATOM   1845  H  HB2  . SER A 1 120 ? -57.498  21.141  -25.714 1.00 41.53  ? 681  SER A HB2  1 
ATOM   1846  H  HB3  . SER A 1 120 ? -56.826  21.052  -24.278 1.00 41.53  ? 681  SER A HB3  1 
ATOM   1847  H  HG   . SER A 1 120 ? -58.711  20.178  -23.572 1.00 61.09  ? 681  SER A HG   1 
ATOM   1848  N  N    . LEU A 1 121 ? -60.664  22.694  -24.510 1.00 37.83  ? 682  LEU A N    1 
ATOM   1849  C  CA   . LEU A 1 121 ? -61.964  22.982  -25.102 1.00 41.31  ? 682  LEU A CA   1 
ATOM   1850  C  C    . LEU A 1 121 ? -62.425  24.411  -24.843 1.00 47.84  ? 682  LEU A C    1 
ATOM   1851  O  O    . LEU A 1 121 ? -63.566  24.748  -25.171 1.00 47.02  ? 682  LEU A O    1 
ATOM   1852  C  CB   . LEU A 1 121 ? -63.014  22.000  -24.575 1.00 45.79  ? 682  LEU A CB   1 
ATOM   1853  C  CG   . LEU A 1 121 ? -62.768  20.514  -24.861 1.00 48.85  ? 682  LEU A CG   1 
ATOM   1854  C  CD1  . LEU A 1 121 ? -63.840  19.660  -24.210 1.00 40.77  ? 682  LEU A CD1  1 
ATOM   1855  C  CD2  . LEU A 1 121 ? -62.714  20.249  -26.354 1.00 44.84  ? 682  LEU A CD2  1 
ATOM   1856  H  H    . LEU A 1 121 ? -60.715  22.444  -23.689 1.00 45.40  ? 682  LEU A H    1 
ATOM   1857  H  HA   . LEU A 1 121 ? -61.902  22.861  -26.062 1.00 49.57  ? 682  LEU A HA   1 
ATOM   1858  H  HB2  . LEU A 1 121 ? -63.067  22.101  -23.611 1.00 54.95  ? 682  LEU A HB2  1 
ATOM   1859  H  HB3  . LEU A 1 121 ? -63.870  22.230  -24.969 1.00 54.95  ? 682  LEU A HB3  1 
ATOM   1860  H  HG   . LEU A 1 121 ? -61.913  20.259  -24.481 1.00 58.62  ? 682  LEU A HG   1 
ATOM   1861  H  HD11 . LEU A 1 121 ? -63.662  18.727  -24.406 1.00 48.93  ? 682  LEU A HD11 1 
ATOM   1862  H  HD12 . LEU A 1 121 ? -63.822  19.807  -23.252 1.00 48.93  ? 682  LEU A HD12 1 
ATOM   1863  H  HD13 . LEU A 1 121 ? -64.705  19.914  -24.568 1.00 48.93  ? 682  LEU A HD13 1 
ATOM   1864  H  HD21 . LEU A 1 121 ? -62.558  19.303  -26.501 1.00 53.80  ? 682  LEU A HD21 1 
ATOM   1865  H  HD22 . LEU A 1 121 ? -63.559  20.510  -26.752 1.00 53.80  ? 682  LEU A HD22 1 
ATOM   1866  H  HD23 . LEU A 1 121 ? -61.991  20.768  -26.741 1.00 53.80  ? 682  LEU A HD23 1 
ATOM   1867  N  N    . ASN A 1 122 ? -61.581  25.242  -24.231 1.00 42.58  ? 683  ASN A N    1 
ATOM   1868  C  CA   . ASN A 1 122 ? -61.968  26.587  -23.801 1.00 44.92  ? 683  ASN A CA   1 
ATOM   1869  C  C    . ASN A 1 122 ? -63.091  26.534  -22.766 1.00 43.92  ? 683  ASN A C    1 
ATOM   1870  O  O    . ASN A 1 122 ? -64.020  27.344  -22.788 1.00 53.24  ? 683  ASN A O    1 
ATOM   1871  C  CB   . ASN A 1 122 ? -62.364  27.472  -24.989 1.00 56.86  ? 683  ASN A CB   1 
ATOM   1872  C  CG   . ASN A 1 122 ? -61.184  27.841  -25.866 1.00 70.79  ? 683  ASN A CG   1 
ATOM   1873  O  OD1  . ASN A 1 122 ? -60.029  27.677  -25.479 1.00 76.18  ? 683  ASN A OD1  1 
ATOM   1874  N  ND2  . ASN A 1 122 ? -61.474  28.360  -27.052 1.00 87.86  ? 683  ASN A ND2  1 
ATOM   1875  H  H    . ASN A 1 122 ? -60.763  25.046  -24.050 1.00 51.09  ? 683  ASN A H    1 
ATOM   1876  H  HA   . ASN A 1 122 ? -61.202  27.003  -23.375 1.00 53.91  ? 683  ASN A HA   1 
ATOM   1877  H  HB2  . ASN A 1 122 ? -63.007  26.995  -25.538 1.00 68.23  ? 683  ASN A HB2  1 
ATOM   1878  H  HB3  . ASN A 1 122 ? -62.758  28.293  -24.655 1.00 68.23  ? 683  ASN A HB3  1 
ATOM   1879  H  HD21 . ASN A 1 122 ? -62.294  28.470  -27.285 1.00 105.43 ? 683  ASN A HD21 1 
ATOM   1880  H  HD22 . ASN A 1 122 ? -60.841  28.587  -27.588 1.00 105.43 ? 683  ASN A HD22 1 
ATOM   1881  N  N    . ILE A 1 123 ? -63.001  25.571  -21.850 1.00 37.97  ? 684  ILE A N    1 
ATOM   1882  C  CA   . ILE A 1 123 ? -63.886  25.476  -20.694 1.00 40.89  ? 684  ILE A CA   1 
ATOM   1883  C  C    . ILE A 1 123 ? -63.053  25.739  -19.449 1.00 36.95  ? 684  ILE A C    1 
ATOM   1884  O  O    . ILE A 1 123 ? -61.991  25.133  -19.267 1.00 39.13  ? 684  ILE A O    1 
ATOM   1885  C  CB   . ILE A 1 123 ? -64.570  24.100  -20.604 1.00 31.47  ? 684  ILE A CB   1 
ATOM   1886  C  CG1  . ILE A 1 123 ? -65.425  23.841  -21.847 1.00 42.53  ? 684  ILE A CG1  1 
ATOM   1887  C  CG2  . ILE A 1 123 ? -65.426  24.013  -19.340 1.00 43.24  ? 684  ILE A CG2  1 
ATOM   1888  C  CD1  . ILE A 1 123 ? -66.066  22.449  -21.890 1.00 35.07  ? 684  ILE A CD1  1 
ATOM   1889  H  H    . ILE A 1 123 ? -62.415  24.942  -21.879 1.00 45.57  ? 684  ILE A H    1 
ATOM   1890  H  HA   . ILE A 1 123 ? -64.573  26.157  -20.755 1.00 49.07  ? 684  ILE A HA   1 
ATOM   1891  H  HB   . ILE A 1 123 ? -63.882  23.418  -20.557 1.00 37.77  ? 684  ILE A HB   1 
ATOM   1892  H  HG12 . ILE A 1 123 ? -66.140  24.496  -21.875 1.00 51.03  ? 684  ILE A HG12 1 
ATOM   1893  H  HG13 . ILE A 1 123 ? -64.866  23.933  -22.634 1.00 51.03  ? 684  ILE A HG13 1 
ATOM   1894  H  HG21 . ILE A 1 123 ? -65.847  23.140  -19.303 1.00 51.89  ? 684  ILE A HG21 1 
ATOM   1895  H  HG22 . ILE A 1 123 ? -64.857  24.139  -18.564 1.00 51.89  ? 684  ILE A HG22 1 
ATOM   1896  H  HG23 . ILE A 1 123 ? -66.104  24.707  -19.370 1.00 51.89  ? 684  ILE A HG23 1 
ATOM   1897  H  HD11 . ILE A 1 123 ? -66.587  22.367  -22.704 1.00 42.08  ? 684  ILE A HD11 1 
ATOM   1898  H  HD12 . ILE A 1 123 ? -65.365  21.779  -21.877 1.00 42.08  ? 684  ILE A HD12 1 
ATOM   1899  H  HD13 . ILE A 1 123 ? -66.641  22.343  -21.116 1.00 42.08  ? 684  ILE A HD13 1 
ATOM   1900  N  N    . VAL A 1 124 ? -63.541  26.631  -18.591 1.00 45.71  ? 685  VAL A N    1 
ATOM   1901  C  CA   . VAL A 1 124 ? -62.904  26.950  -17.319 1.00 24.06  ? 685  VAL A CA   1 
ATOM   1902  C  C    . VAL A 1 124 ? -63.846  26.523  -16.203 1.00 31.28  ? 685  VAL A C    1 
ATOM   1903  O  O    . VAL A 1 124 ? -65.033  26.870  -16.216 1.00 34.20  ? 685  VAL A O    1 
ATOM   1904  C  CB   . VAL A 1 124 ? -62.570  28.449  -17.215 1.00 37.05  ? 685  VAL A CB   1 
ATOM   1905  C  CG1  . VAL A 1 124 ? -61.893  28.754  -15.885 1.00 37.50  ? 685  VAL A CG1  1 
ATOM   1906  C  CG2  . VAL A 1 124 ? -61.678  28.867  -18.374 1.00 42.20  ? 685  VAL A CG2  1 
ATOM   1907  H  H    . VAL A 1 124 ? -64.263  27.077  -18.730 1.00 54.85  ? 685  VAL A H    1 
ATOM   1908  H  HA   . VAL A 1 124 ? -62.080  26.446  -17.235 1.00 28.88  ? 685  VAL A HA   1 
ATOM   1909  H  HB   . VAL A 1 124 ? -63.391  28.964  -17.262 1.00 44.46  ? 685  VAL A HB   1 
ATOM   1910  H  HG11 . VAL A 1 124 ? -61.693  29.703  -15.843 1.00 45.00  ? 685  VAL A HG11 1 
ATOM   1911  H  HG12 . VAL A 1 124 ? -62.493  28.510  -15.162 1.00 45.00  ? 685  VAL A HG12 1 
ATOM   1912  H  HG13 . VAL A 1 124 ? -61.073  28.240  -15.823 1.00 45.00  ? 685  VAL A HG13 1 
ATOM   1913  H  HG21 . VAL A 1 124 ? -61.478  29.813  -18.292 1.00 50.64  ? 685  VAL A HG21 1 
ATOM   1914  H  HG22 . VAL A 1 124 ? -60.858  28.351  -18.342 1.00 50.64  ? 685  VAL A HG22 1 
ATOM   1915  H  HG23 . VAL A 1 124 ? -62.144  28.698  -19.207 1.00 50.64  ? 685  VAL A HG23 1 
ATOM   1916  N  N    . HIS A 1 125 ? -63.316  25.769  -15.243 1.00 30.10  ? 686  HIS A N    1 
ATOM   1917  C  CA   . HIS A 1 125 ? -64.140  25.232  -14.168 1.00 39.88  ? 686  HIS A CA   1 
ATOM   1918  C  C    . HIS A 1 125 ? -64.689  26.351  -13.289 1.00 31.16  ? 686  HIS A C    1 
ATOM   1919  O  O    . HIS A 1 125 ? -65.904  26.479  -13.103 1.00 46.45  ? 686  HIS A O    1 
ATOM   1920  C  CB   . HIS A 1 125 ? -63.295  24.253  -13.351 1.00 36.00  ? 686  HIS A CB   1 
ATOM   1921  C  CG   . HIS A 1 125 ? -64.093  23.303  -12.517 1.00 38.33  ? 686  HIS A CG   1 
ATOM   1922  N  ND1  . HIS A 1 125 ? -64.984  23.719  -11.553 1.00 33.51  ? 686  HIS A ND1  1 
ATOM   1923  C  CD2  . HIS A 1 125 ? -64.119  21.951  -12.493 1.00 36.46  ? 686  HIS A CD2  1 
ATOM   1924  C  CE1  . HIS A 1 125 ? -65.535  22.665  -10.979 1.00 43.20  ? 686  HIS A CE1  1 
ATOM   1925  N  NE2  . HIS A 1 125 ? -65.027  21.579  -11.532 1.00 43.61  ? 686  HIS A NE2  1 
ATOM   1926  H  H    . HIS A 1 125 ? -62.484  25.555  -15.193 1.00 36.12  ? 686  HIS A H    1 
ATOM   1927  H  HA   . HIS A 1 125 ? -64.889  24.746  -14.548 1.00 47.86  ? 686  HIS A HA   1 
ATOM   1928  H  HB2  . HIS A 1 125 ? -62.752  23.727  -13.960 1.00 43.20  ? 686  HIS A HB2  1 
ATOM   1929  H  HB3  . HIS A 1 125 ? -62.721  24.759  -12.755 1.00 43.20  ? 686  HIS A HB3  1 
ATOM   1930  H  HD1  . HIS A 1 125 ? -65.160  24.538  -11.360 1.00 40.21  ? 686  HIS A HD1  1 
ATOM   1931  H  HD2  . HIS A 1 125 ? -63.621  21.380  -13.033 1.00 43.75  ? 686  HIS A HD2  1 
ATOM   1932  H  HE1  . HIS A 1 125 ? -66.170  22.684  -10.300 1.00 51.84  ? 686  HIS A HE1  1 
ATOM   1933  H  HE2  . HIS A 1 125 ? -65.229  20.770  -11.322 1.00 52.34  ? 686  HIS A HE2  1 
ATOM   1934  N  N    . ARG A 1 126 ? -63.787  27.160  -12.733 1.00 33.25  ? 687  ARG A N    1 
ATOM   1935  C  CA   . ARG A 1 126 ? -64.036  28.314  -11.870 1.00 36.35  ? 687  ARG A CA   1 
ATOM   1936  C  C    . ARG A 1 126 ? -64.442  27.930  -10.451 1.00 26.52  ? 687  ARG A C    1 
ATOM   1937  O  O    . ARG A 1 126 ? -64.320  28.749  -9.536  1.00 38.73  ? 687  ARG A O    1 
ATOM   1938  C  CB   . ARG A 1 126 ? -65.149  29.207  -12.433 1.00 36.01  ? 687  ARG A CB   1 
ATOM   1939  C  CG   . ARG A 1 126 ? -65.086  29.533  -13.920 1.00 44.38  ? 687  ARG A CG   1 
ATOM   1940  C  CD   . ARG A 1 126 ? -66.458  29.996  -14.414 1.00 50.76  ? 687  ARG A CD   1 
ATOM   1941  N  NE   . ARG A 1 126 ? -67.023  31.015  -13.528 1.00 76.43  ? 687  ARG A NE   1 
ATOM   1942  C  CZ   . ARG A 1 126 ? -67.146  32.310  -13.814 1.00 58.28  ? 687  ARG A CZ   1 
ATOM   1943  N  NH1  . ARG A 1 126 ? -66.768  32.791  -14.991 1.00 56.53  ? 687  ARG A NH1  1 
ATOM   1944  N  NH2  . ARG A 1 126 ? -67.665  33.135  -12.914 1.00 54.17  ? 687  ARG A NH2  1 
ATOM   1945  H  H    . ARG A 1 126 ? -62.944  27.043  -12.857 1.00 39.90  ? 687  ARG A H    1 
ATOM   1946  H  HA   . ARG A 1 126 ? -63.226  28.845  -11.815 1.00 43.61  ? 687  ARG A HA   1 
ATOM   1947  H  HB2  . ARG A 1 126 ? -65.998  28.768  -12.272 1.00 43.21  ? 687  ARG A HB2  1 
ATOM   1948  H  HB3  . ARG A 1 126 ? -65.130  30.051  -11.954 1.00 43.21  ? 687  ARG A HB3  1 
ATOM   1949  H  HG2  . ARG A 1 126 ? -64.447  30.248  -14.069 1.00 53.26  ? 687  ARG A HG2  1 
ATOM   1950  H  HG3  . ARG A 1 126 ? -64.830  28.740  -14.416 1.00 53.26  ? 687  ARG A HG3  1 
ATOM   1951  H  HD2  . ARG A 1 126 ? -66.367  30.379  -15.301 1.00 60.91  ? 687  ARG A HD2  1 
ATOM   1952  H  HD3  . ARG A 1 126 ? -67.064  29.239  -14.434 1.00 60.91  ? 687  ARG A HD3  1 
ATOM   1953  H  HE   . ARG A 1 126 ? -67.300  30.755  -12.756 1.00 91.72  ? 687  ARG A HE   1 
ATOM   1954  H  HH11 . ARG A 1 126 ? -66.428  32.265  -15.581 1.00 67.83  ? 687  ARG A HH11 1 
ATOM   1955  H  HH12 . ARG A 1 126 ? -66.857  33.629  -15.162 1.00 67.83  ? 687  ARG A HH12 1 
ATOM   1956  H  HH21 . ARG A 1 126 ? -67.918  32.833  -12.150 1.00 65.01  ? 687  ARG A HH21 1 
ATOM   1957  H  HH22 . ARG A 1 126 ? -67.754  33.970  -13.097 1.00 65.01  ? 687  ARG A HH22 1 
ATOM   1958  N  N    . ASP A 1 127 ? -64.925  26.704  -10.256 1.00 27.96  ? 688  ASP A N    1 
ATOM   1959  C  CA   . ASP A 1 127 ? -65.315  26.183  -8.948  1.00 50.48  ? 688  ASP A CA   1 
ATOM   1960  C  C    . ASP A 1 127 ? -64.313  25.210  -8.325  1.00 40.71  ? 688  ASP A C    1 
ATOM   1961  O  O    . ASP A 1 127 ? -64.585  24.694  -7.236  1.00 44.41  ? 688  ASP A O    1 
ATOM   1962  C  CB   . ASP A 1 127 ? -66.700  25.519  -9.042  1.00 64.44  ? 688  ASP A CB   1 
ATOM   1963  C  CG   . ASP A 1 127 ? -67.504  25.630  -7.743  1.00 65.55  ? 688  ASP A CG   1 
ATOM   1964  O  OD1  . ASP A 1 127 ? -67.024  26.266  -6.782  1.00 48.79  ? 688  ASP A OD1  1 
ATOM   1965  O  OD2  . ASP A 1 127 ? -68.632  25.086  -7.688  1.00 56.62  ? 688  ASP A OD2  1 
ATOM   1966  H  H    . ASP A 1 127 ? -65.040  26.135  -10.891 1.00 33.55  ? 688  ASP A H    1 
ATOM   1967  H  HA   . ASP A 1 127 ? -65.399  26.934  -8.339  1.00 60.57  ? 688  ASP A HA   1 
ATOM   1968  H  HB2  . ASP A 1 127 ? -67.209  25.949  -9.747  1.00 77.33  ? 688  ASP A HB2  1 
ATOM   1969  H  HB3  . ASP A 1 127 ? -66.585  24.577  -9.244  1.00 77.33  ? 688  ASP A HB3  1 
ATOM   1970  N  N    . LEU A 1 128 ? -63.201  24.903  -8.992  1.00 38.20  ? 689  LEU A N    1 
ATOM   1971  C  CA   . LEU A 1 128 ? -62.445  23.693  -8.665  1.00 25.72  ? 689  LEU A CA   1 
ATOM   1972  C  C    . LEU A 1 128 ? -62.027  23.646  -7.197  1.00 27.41  ? 689  LEU A C    1 
ATOM   1973  O  O    . LEU A 1 128 ? -61.422  24.585  -6.673  1.00 30.27  ? 689  LEU A O    1 
ATOM   1974  C  CB   . LEU A 1 128 ? -61.207  23.575  -9.552  1.00 19.51  ? 689  LEU A CB   1 
ATOM   1975  C  CG   . LEU A 1 128 ? -60.486  22.228  -9.441  1.00 37.36  ? 689  LEU A CG   1 
ATOM   1976  C  CD1  . LEU A 1 128 ? -61.268  21.132  -10.143 1.00 33.86  ? 689  LEU A CD1  1 
ATOM   1977  C  CD2  . LEU A 1 128 ? -59.100  22.321  -10.007 1.00 31.93  ? 689  LEU A CD2  1 
ATOM   1978  H  H    . LEU A 1 128 ? -62.866  25.371  -9.630  1.00 45.84  ? 689  LEU A H    1 
ATOM   1979  H  HA   . LEU A 1 128 ? -63.006  22.920  -8.837  1.00 30.87  ? 689  LEU A HA   1 
ATOM   1980  H  HB2  . LEU A 1 128 ? -61.473  23.694  -10.477 1.00 23.41  ? 689  LEU A HB2  1 
ATOM   1981  H  HB3  . LEU A 1 128 ? -60.577  24.269  -9.301  1.00 23.41  ? 689  LEU A HB3  1 
ATOM   1982  H  HG   . LEU A 1 128 ? -60.411  21.987  -8.505  1.00 44.83  ? 689  LEU A HG   1 
ATOM   1983  H  HD11 . LEU A 1 128 ? -60.787  20.295  -10.055 1.00 40.64  ? 689  LEU A HD11 1 
ATOM   1984  H  HD12 . LEU A 1 128 ? -62.143  21.056  -9.731  1.00 40.64  ? 689  LEU A HD12 1 
ATOM   1985  H  HD13 . LEU A 1 128 ? -61.363  21.363  -11.080 1.00 40.64  ? 689  LEU A HD13 1 
ATOM   1986  H  HD21 . LEU A 1 128 ? -58.667  21.457  -9.926  1.00 38.31  ? 689  LEU A HD21 1 
ATOM   1987  H  HD22 . LEU A 1 128 ? -59.157  22.576  -10.942 1.00 38.31  ? 689  LEU A HD22 1 
ATOM   1988  H  HD23 . LEU A 1 128 ? -58.602  22.990  -9.512  1.00 38.31  ? 689  LEU A HD23 1 
ATOM   1989  N  N    . LYS A 1 129 ? -62.343  22.525  -6.541  1.00 24.87  ? 690  LYS A N    1 
ATOM   1990  C  CA   . LYS A 1 129 ? -61.982  22.287  -5.151  1.00 30.19  ? 690  LYS A CA   1 
ATOM   1991  C  C    . LYS A 1 129 ? -62.067  20.796  -4.838  1.00 27.73  ? 690  LYS A C    1 
ATOM   1992  O  O    . LYS A 1 129 ? -62.562  20.024  -5.670  1.00 27.28  ? 690  LYS A O    1 
ATOM   1993  C  CB   . LYS A 1 129 ? -62.917  23.082  -4.240  1.00 35.27  ? 690  LYS A CB   1 
ATOM   1994  C  CG   . LYS A 1 129 ? -64.364  22.621  -4.298  1.00 38.93  ? 690  LYS A CG   1 
ATOM   1995  C  CD   . LYS A 1 129 ? -65.323  23.682  -3.759  1.00 51.58  ? 690  LYS A CD   1 
ATOM   1996  C  CE   . LYS A 1 129 ? -66.771  23.205  -3.821  1.00 67.98  ? 690  LYS A CE   1 
ATOM   1997  N  NZ   . LYS A 1 129 ? -67.764  24.279  -3.534  1.00 77.25  ? 690  LYS A NZ   1 
ATOM   1998  H  H    . LYS A 1 129 ? -62.777  21.873  -6.895  1.00 29.84  ? 690  LYS A H    1 
ATOM   1999  H  HA   . LYS A 1 129 ? -61.072  22.584  -4.995  1.00 36.23  ? 690  LYS A HA   1 
ATOM   2000  H  HB2  . LYS A 1 129 ? -62.613  22.990  -3.323  1.00 42.33  ? 690  LYS A HB2  1 
ATOM   2001  H  HB3  . LYS A 1 129 ? -62.891  24.015  -4.503  1.00 42.33  ? 690  LYS A HB3  1 
ATOM   2002  H  HG2  . LYS A 1 129 ? -64.603  22.438  -5.220  1.00 46.71  ? 690  LYS A HG2  1 
ATOM   2003  H  HG3  . LYS A 1 129 ? -64.466  21.820  -3.761  1.00 46.71  ? 690  LYS A HG3  1 
ATOM   2004  H  HD2  . LYS A 1 129 ? -65.104  23.871  -2.833  1.00 61.90  ? 690  LYS A HD2  1 
ATOM   2005  H  HD3  . LYS A 1 129 ? -65.244  24.487  -4.294  1.00 61.90  ? 690  LYS A HD3  1 
ATOM   2006  H  HE2  . LYS A 1 129 ? -66.951  22.864  -4.711  1.00 81.58  ? 690  LYS A HE2  1 
ATOM   2007  H  HE3  . LYS A 1 129 ? -66.897  22.501  -3.166  1.00 81.58  ? 690  LYS A HE3  1 
ATOM   2008  H  HZ1  . LYS A 1 129 ? -68.590  23.951  -3.583  1.00 92.70  ? 690  LYS A HZ1  1 
ATOM   2009  H  HZ2  . LYS A 1 129 ? -67.631  24.606  -2.717  1.00 92.70  ? 690  LYS A HZ2  1 
ATOM   2010  H  HZ3  . LYS A 1 129 ? -67.679  24.938  -4.126  1.00 92.70  ? 690  LYS A HZ3  1 
ATOM   2011  N  N    . PRO A 1 130 ? -61.673  20.355  -3.638  1.00 25.19  ? 691  PRO A N    1 
ATOM   2012  C  CA   . PRO A 1 130 ? -61.687  18.905  -3.371  1.00 37.12  ? 691  PRO A CA   1 
ATOM   2013  C  C    . PRO A 1 130 ? -63.079  18.314  -3.387  1.00 38.21  ? 691  PRO A C    1 
ATOM   2014  O  O    . PRO A 1 130 ? -63.235  17.127  -3.691  1.00 37.83  ? 691  PRO A O    1 
ATOM   2015  C  CB   . PRO A 1 130 ? -61.035  18.792  -1.984  1.00 27.02  ? 691  PRO A CB   1 
ATOM   2016  C  CG   . PRO A 1 130 ? -60.219  20.056  -1.843  1.00 32.23  ? 691  PRO A CG   1 
ATOM   2017  C  CD   . PRO A 1 130 ? -60.987  21.108  -2.570  1.00 30.28  ? 691  PRO A CD   1 
ATOM   2018  H  HA   . PRO A 1 130 ? -61.137  18.441  -4.020  1.00 44.55  ? 691  PRO A HA   1 
ATOM   2019  H  HB2  . PRO A 1 130 ? -61.722  18.747  -1.301  1.00 32.43  ? 691  PRO A HB2  1 
ATOM   2020  H  HB3  . PRO A 1 130 ? -60.464  18.008  -1.953  1.00 32.43  ? 691  PRO A HB3  1 
ATOM   2021  H  HG2  . PRO A 1 130 ? -60.131  20.285  -0.905  1.00 38.68  ? 691  PRO A HG2  1 
ATOM   2022  H  HG3  . PRO A 1 130 ? -59.347  19.928  -2.248  1.00 38.68  ? 691  PRO A HG3  1 
ATOM   2023  H  HD2  . PRO A 1 130 ? -61.635  21.523  -1.980  1.00 36.34  ? 691  PRO A HD2  1 
ATOM   2024  H  HD3  . PRO A 1 130 ? -60.384  21.763  -2.954  1.00 36.34  ? 691  PRO A HD3  1 
ATOM   2025  N  N    . HIS A 1 131 ? -64.099  19.115  -3.094  1.00 35.77  ? 692  HIS A N    1 
ATOM   2026  C  CA   . HIS A 1 131 ? -65.463  18.608  -3.115  1.00 37.26  ? 692  HIS A CA   1 
ATOM   2027  C  C    . HIS A 1 131 ? -65.923  18.301  -4.536  1.00 40.10  ? 692  HIS A C    1 
ATOM   2028  O  O    . HIS A 1 131 ? -66.786  17.441  -4.731  1.00 32.43  ? 692  HIS A O    1 
ATOM   2029  C  CB   . HIS A 1 131 ? -66.406  19.621  -2.463  1.00 35.53  ? 692  HIS A CB   1 
ATOM   2030  C  CG   . HIS A 1 131 ? -65.961  20.087  -1.108  1.00 44.84  ? 692  HIS A CG   1 
ATOM   2031  N  ND1  . HIS A 1 131 ? -64.842  20.871  -0.916  1.00 52.16  ? 692  HIS A ND1  1 
ATOM   2032  C  CD2  . HIS A 1 131 ? -66.492  19.884  0.121   1.00 50.43  ? 692  HIS A CD2  1 
ATOM   2033  C  CE1  . HIS A 1 131 ? -64.702  21.127  0.373   1.00 52.31  ? 692  HIS A CE1  1 
ATOM   2034  N  NE2  . HIS A 1 131 ? -65.690  20.540  1.024   1.00 64.89  ? 692  HIS A NE2  1 
ATOM   2035  H  H    . HIS A 1 131 ? -64.028  19.945  -2.882  1.00 42.93  ? 692  HIS A H    1 
ATOM   2036  H  HA   . HIS A 1 131 ? -65.503  17.786  -2.602  1.00 44.71  ? 692  HIS A HA   1 
ATOM   2037  H  HB2  . HIS A 1 131 ? -66.471  20.400  -3.037  1.00 42.64  ? 692  HIS A HB2  1 
ATOM   2038  H  HB3  . HIS A 1 131 ? -67.281  19.213  -2.363  1.00 42.64  ? 692  HIS A HB3  1 
ATOM   2039  H  HD1  . HIS A 1 131 ? -64.317  21.148  -1.538  1.00 62.59  ? 692  HIS A HD1  1 
ATOM   2040  H  HD2  . HIS A 1 131 ? -67.256  19.392  0.318   1.00 60.52  ? 692  HIS A HD2  1 
ATOM   2041  H  HE1  . HIS A 1 131 ? -64.023  21.634  0.756   1.00 62.77  ? 692  HIS A HE1  1 
ATOM   2042  H  HE2  . HIS A 1 131 ? -65.812  20.564  1.875   1.00 77.87  ? 692  HIS A HE2  1 
ATOM   2043  N  N    . ASN A 1 132 ? -65.363  18.992  -5.529  1.00 36.08  ? 693  ASN A N    1 
ATOM   2044  C  CA   . ASN A 1 132 ? -65.718  18.827  -6.934  1.00 40.13  ? 693  ASN A CA   1 
ATOM   2045  C  C    . ASN A 1 132 ? -64.929  17.730  -7.641  1.00 35.40  ? 693  ASN A C    1 
ATOM   2046  O  O    . ASN A 1 132 ? -65.255  17.395  -8.785  1.00 38.22  ? 693  ASN A O    1 
ATOM   2047  C  CB   . ASN A 1 132 ? -65.491  20.146  -7.690  1.00 34.75  ? 693  ASN A CB   1 
ATOM   2048  C  CG   . ASN A 1 132 ? -66.594  21.146  -7.469  1.00 58.90  ? 693  ASN A CG   1 
ATOM   2049  O  OD1  . ASN A 1 132 ? -67.757  20.781  -7.281  1.00 82.51  ? 693  ASN A OD1  1 
ATOM   2050  N  ND2  . ASN A 1 132 ? -66.241  22.423  -7.500  1.00 58.07  ? 693  ASN A ND2  1 
ATOM   2051  H  H    . ASN A 1 132 ? -64.751  19.583  -5.405  1.00 43.29  ? 693  ASN A H    1 
ATOM   2052  H  HA   . ASN A 1 132 ? -66.660  18.605  -6.996  1.00 48.16  ? 693  ASN A HA   1 
ATOM   2053  H  HB2  . ASN A 1 132 ? -64.660  20.544  -7.387  1.00 41.70  ? 693  ASN A HB2  1 
ATOM   2054  H  HB3  . ASN A 1 132 ? -65.442  19.960  -8.641  1.00 41.70  ? 693  ASN A HB3  1 
ATOM   2055  H  HD21 . ASN A 1 132 ? -65.420  22.639  -7.641  1.00 69.68  ? 693  ASN A HD21 1 
ATOM   2056  H  HD22 . ASN A 1 132 ? -66.832  23.036  -7.379  1.00 69.68  ? 693  ASN A HD22 1 
ATOM   2057  N  N    . ILE A 1 133 ? -63.893  17.192  -7.009  1.00 33.98  ? 694  ILE A N    1 
ATOM   2058  C  CA   . ILE A 1 133 ? -63.059  16.145  -7.587  1.00 28.22  ? 694  ILE A CA   1 
ATOM   2059  C  C    . ILE A 1 133 ? -63.539  14.824  -6.997  1.00 21.43  ? 694  ILE A C    1 
ATOM   2060  O  O    . ILE A 1 133 ? -63.393  14.582  -5.794  1.00 40.65  ? 694  ILE A O    1 
ATOM   2061  C  CB   . ILE A 1 133 ? -61.571  16.396  -7.299  1.00 30.68  ? 694  ILE A CB   1 
ATOM   2062  C  CG1  . ILE A 1 133 ? -61.142  17.750  -7.872  1.00 28.00  ? 694  ILE A CG1  1 
ATOM   2063  C  CG2  . ILE A 1 133 ? -60.711  15.299  -7.893  1.00 32.31  ? 694  ILE A CG2  1 
ATOM   2064  C  CD1  . ILE A 1 133 ? -59.855  18.284  -7.306  1.00 29.62  ? 694  ILE A CD1  1 
ATOM   2065  H  H    . ILE A 1 133 ? -63.646  17.425  -6.219  1.00 40.77  ? 694  ILE A H    1 
ATOM   2066  H  HA   . ILE A 1 133 ? -63.188  16.119  -8.548  1.00 33.86  ? 694  ILE A HA   1 
ATOM   2067  H  HB   . ILE A 1 133 ? -61.438  16.409  -6.338  1.00 36.82  ? 694  ILE A HB   1 
ATOM   2068  H  HG12 . ILE A 1 133 ? -61.027  17.660  -8.831  1.00 33.60  ? 694  ILE A HG12 1 
ATOM   2069  H  HG13 . ILE A 1 133 ? -61.838  18.400  -7.687  1.00 33.60  ? 694  ILE A HG13 1 
ATOM   2070  H  HG21 . ILE A 1 133 ? -59.780  15.485  -7.695  1.00 38.78  ? 694  ILE A HG21 1 
ATOM   2071  H  HG22 . ILE A 1 133 ? -60.969  14.449  -7.503  1.00 38.78  ? 694  ILE A HG22 1 
ATOM   2072  H  HG23 . ILE A 1 133 ? -60.847  15.276  -8.854  1.00 38.78  ? 694  ILE A HG23 1 
ATOM   2073  H  HD11 . ILE A 1 133 ? -59.659  19.139  -7.720  1.00 35.54  ? 694  ILE A HD11 1 
ATOM   2074  H  HD12 . ILE A 1 133 ? -59.954  18.396  -6.347  1.00 35.54  ? 694  ILE A HD12 1 
ATOM   2075  H  HD13 . ILE A 1 133 ? -59.142  17.654  -7.494  1.00 35.54  ? 694  ILE A HD13 1 
ATOM   2076  N  N    . LEU A 1 134 ? -64.106  13.966  -7.841  1.00 32.65  ? 695  LEU A N    1 
ATOM   2077  C  CA   . LEU A 1 134 ? -64.816  12.771  -7.403  1.00 38.21  ? 695  LEU A CA   1 
ATOM   2078  C  C    . LEU A 1 134 ? -64.007  11.508  -7.675  1.00 32.53  ? 695  LEU A C    1 
ATOM   2079  O  O    . LEU A 1 134 ? -63.227  11.437  -8.629  1.00 35.16  ? 695  LEU A O    1 
ATOM   2080  C  CB   . LEU A 1 134 ? -66.178  12.667  -8.095  1.00 35.37  ? 695  LEU A CB   1 
ATOM   2081  C  CG   . LEU A 1 134 ? -67.093  13.882  -7.952  1.00 37.63  ? 695  LEU A CG   1 
ATOM   2082  C  CD1  . LEU A 1 134 ? -68.432  13.613  -8.624  1.00 39.14  ? 695  LEU A CD1  1 
ATOM   2083  C  CD2  . LEU A 1 134 ? -67.289  14.247  -6.494  1.00 40.58  ? 695  LEU A CD2  1 
ATOM   2084  H  H    . LEU A 1 134 ? -64.092  14.058  -8.696  1.00 39.18  ? 695  LEU A H    1 
ATOM   2085  H  HA   . LEU A 1 134 ? -64.969  12.829  -6.446  1.00 45.86  ? 695  LEU A HA   1 
ATOM   2086  H  HB2  . LEU A 1 134 ? -66.029  12.526  -9.043  1.00 42.44  ? 695  LEU A HB2  1 
ATOM   2087  H  HB3  . LEU A 1 134 ? -66.651  11.904  -7.726  1.00 42.44  ? 695  LEU A HB3  1 
ATOM   2088  H  HG   . LEU A 1 134 ? -66.682  14.640  -8.397  1.00 45.15  ? 695  LEU A HG   1 
ATOM   2089  H  HD11 . LEU A 1 134 ? -68.998  14.395  -8.523  1.00 46.97  ? 695  LEU A HD11 1 
ATOM   2090  H  HD12 . LEU A 1 134 ? -68.282  13.432  -9.565  1.00 46.97  ? 695  LEU A HD12 1 
ATOM   2091  H  HD13 . LEU A 1 134 ? -68.849  12.846  -8.201  1.00 46.97  ? 695  LEU A HD13 1 
ATOM   2092  H  HD21 . LEU A 1 134 ? -67.872  15.019  -6.438  1.00 48.69  ? 695  LEU A HD21 1 
ATOM   2093  H  HD22 . LEU A 1 134 ? -67.691  13.494  -6.032  1.00 48.69  ? 695  LEU A HD22 1 
ATOM   2094  H  HD23 . LEU A 1 134 ? -66.426  14.454  -6.102  1.00 48.69  ? 695  LEU A HD23 1 
ATOM   2095  N  N    . ILE A 1 135 ? -64.195  10.519  -6.804  1.00 33.02  ? 696  ILE A N    1 
ATOM   2096  C  CA   . ILE A 1 135 ? -63.603  9.195   -6.948  1.00 29.02  ? 696  ILE A CA   1 
ATOM   2097  C  C    . ILE A 1 135 ? -64.634  8.289   -7.608  1.00 31.13  ? 696  ILE A C    1 
ATOM   2098  O  O    . ILE A 1 135 ? -65.758  8.151   -7.111  1.00 39.99  ? 696  ILE A O    1 
ATOM   2099  C  CB   . ILE A 1 135 ? -63.168  8.630   -5.587  1.00 43.88  ? 696  ILE A CB   1 
ATOM   2100  C  CG1  . ILE A 1 135 ? -62.367  9.673   -4.807  1.00 29.42  ? 696  ILE A CG1  1 
ATOM   2101  C  CG2  . ILE A 1 135 ? -62.365  7.356   -5.771  1.00 37.87  ? 696  ILE A CG2  1 
ATOM   2102  C  CD1  . ILE A 1 135 ? -61.190  10.245  -5.566  1.00 37.17  ? 696  ILE A CD1  1 
ATOM   2103  H  H    . ILE A 1 135 ? -64.680  10.597  -6.098  1.00 39.63  ? 696  ILE A H    1 
ATOM   2104  H  HA   . ILE A 1 135 ? -62.824  9.248   -7.523  1.00 34.82  ? 696  ILE A HA   1 
ATOM   2105  H  HB   . ILE A 1 135 ? -63.966  8.416   -5.078  1.00 52.65  ? 696  ILE A HB   1 
ATOM   2106  H  HG12 . ILE A 1 135 ? -62.955  10.409  -4.577  1.00 35.31  ? 696  ILE A HG12 1 
ATOM   2107  H  HG13 . ILE A 1 135 ? -62.025  9.261   -3.998  1.00 35.31  ? 696  ILE A HG13 1 
ATOM   2108  H  HG21 . ILE A 1 135 ? -62.103  7.020   -4.900  1.00 45.45  ? 696  ILE A HG21 1 
ATOM   2109  H  HG22 . ILE A 1 135 ? -62.914  6.700   -6.228  1.00 45.45  ? 696  ILE A HG22 1 
ATOM   2110  H  HG23 . ILE A 1 135 ? -61.577  7.554   -6.301  1.00 45.45  ? 696  ILE A HG23 1 
ATOM   2111  H  HD11 . ILE A 1 135 ? -60.739  10.894  -5.004  1.00 44.60  ? 696  ILE A HD11 1 
ATOM   2112  H  HD12 . ILE A 1 135 ? -60.582  9.525   -5.794  1.00 44.60  ? 696  ILE A HD12 1 
ATOM   2113  H  HD13 . ILE A 1 135 ? -61.514  10.674  -6.373  1.00 44.60  ? 696  ILE A HD13 1 
ATOM   2114  N  N    . SER A 1 136 ? -64.248  7.662   -8.716  1.00 31.92  ? 697  SER A N    1 
ATOM   2115  C  CA   . SER A 1 136 ? -65.181  6.883   -9.512  1.00 37.68  ? 697  SER A CA   1 
ATOM   2116  C  C    . SER A 1 136 ? -65.579  5.599   -8.792  1.00 37.85  ? 697  SER A C    1 
ATOM   2117  O  O    . SER A 1 136 ? -64.921  5.140   -7.857  1.00 38.01  ? 697  SER A O    1 
ATOM   2118  C  CB   . SER A 1 136 ? -64.572  6.536   -10.869 1.00 42.87  ? 697  SER A CB   1 
ATOM   2119  O  OG   . SER A 1 136 ? -63.593  5.520   -10.734 1.00 39.12  ? 697  SER A OG   1 
ATOM   2120  H  H    . SER A 1 136 ? -63.446  7.675   -9.027  1.00 38.30  ? 697  SER A H    1 
ATOM   2121  H  HA   . SER A 1 136 ? -65.983  7.406   -9.665  1.00 45.22  ? 697  SER A HA   1 
ATOM   2122  H  HB2  . SER A 1 136 ? -65.274  6.222   -11.460 1.00 51.44  ? 697  SER A HB2  1 
ATOM   2123  H  HB3  . SER A 1 136 ? -64.155  7.329   -11.241 1.00 51.44  ? 697  SER A HB3  1 
ATOM   2124  H  HG   . SER A 1 136 ? -62.979  5.779   -10.223 1.00 46.94  ? 697  SER A HG   1 
ATOM   2125  N  N    . MET A 1 137 ? -66.697  5.032   -9.234  1.00 40.26  ? 698  MET A N    1 
ATOM   2126  C  CA   . MET A 1 137 ? -67.075  3.699   -8.800  1.00 40.68  ? 698  MET A CA   1 
ATOM   2127  C  C    . MET A 1 137 ? -65.999  2.703   -9.224  1.00 38.46  ? 698  MET A C    1 
ATOM   2128  O  O    . MET A 1 137 ? -65.300  2.920   -10.219 1.00 37.26  ? 698  MET A O    1 
ATOM   2129  C  CB   . MET A 1 137 ? -68.418  3.290   -9.402  1.00 37.09  ? 698  MET A CB   1 
ATOM   2130  C  CG   . MET A 1 137 ? -69.612  4.025   -8.828  1.00 46.04  ? 698  MET A CG   1 
ATOM   2131  S  SD   . MET A 1 137 ? -69.816  3.719   -7.065  1.00 50.71  ? 698  MET A SD   1 
ATOM   2132  C  CE   . MET A 1 137 ? -71.423  4.462   -6.788  1.00 65.46  ? 698  MET A CE   1 
ATOM   2133  H  H    . MET A 1 137 ? -67.249  5.398   -9.782  1.00 48.31  ? 698  MET A H    1 
ATOM   2134  H  HA   . MET A 1 137 ? -67.158  3.689   -7.833  1.00 48.82  ? 698  MET A HA   1 
ATOM   2135  H  HB2  . MET A 1 137 ? -68.396  3.463   -10.356 1.00 44.50  ? 698  MET A HB2  1 
ATOM   2136  H  HB3  . MET A 1 137 ? -68.553  2.342   -9.245  1.00 44.50  ? 698  MET A HB3  1 
ATOM   2137  H  HG2  . MET A 1 137 ? -69.490  4.979   -8.956  1.00 55.24  ? 698  MET A HG2  1 
ATOM   2138  H  HG3  . MET A 1 137 ? -70.417  3.728   -9.281  1.00 55.24  ? 698  MET A HG3  1 
ATOM   2139  H  HE1  . MET A 1 137 ? -71.658  4.363   -5.852  1.00 78.55  ? 698  MET A HE1  1 
ATOM   2140  H  HE2  . MET A 1 137 ? -71.380  5.402   -7.022  1.00 78.55  ? 698  MET A HE2  1 
ATOM   2141  H  HE3  . MET A 1 137 ? -72.078  4.012   -7.344  1.00 78.55  ? 698  MET A HE3  1 
ATOM   2142  N  N    . PRO A 1 138 ? -65.850  1.599   -8.493  1.00 43.22  ? 699  PRO A N    1 
ATOM   2143  C  CA   . PRO A 1 138 ? -64.837  0.604   -8.858  1.00 43.26  ? 699  PRO A CA   1 
ATOM   2144  C  C    . PRO A 1 138 ? -65.051  0.055   -10.261 1.00 43.64  ? 699  PRO A C    1 
ATOM   2145  O  O    . PRO A 1 138 ? -66.179  -0.114  -10.727 1.00 51.32  ? 699  PRO A O    1 
ATOM   2146  C  CB   . PRO A 1 138 ? -65.017  -0.490  -7.800  1.00 42.19  ? 699  PRO A CB   1 
ATOM   2147  C  CG   . PRO A 1 138 ? -65.646  0.202   -6.649  1.00 57.19  ? 699  PRO A CG   1 
ATOM   2148  C  CD   . PRO A 1 138 ? -66.524  1.261   -7.229  1.00 50.36  ? 699  PRO A CD   1 
ATOM   2149  H  HA   . PRO A 1 138 ? -63.946  0.981   -8.788  1.00 51.92  ? 699  PRO A HA   1 
ATOM   2150  H  HB2  . PRO A 1 138 ? -65.599  -1.186  -8.143  1.00 50.62  ? 699  PRO A HB2  1 
ATOM   2151  H  HB3  . PRO A 1 138 ? -64.153  -0.853  -7.553  1.00 50.62  ? 699  PRO A HB3  1 
ATOM   2152  H  HG2  . PRO A 1 138 ? -66.172  -0.433  -6.138  1.00 68.62  ? 699  PRO A HG2  1 
ATOM   2153  H  HG3  . PRO A 1 138 ? -64.957  0.598   -6.094  1.00 68.62  ? 699  PRO A HG3  1 
ATOM   2154  H  HD2  . PRO A 1 138 ? -67.411  0.909   -7.402  1.00 60.43  ? 699  PRO A HD2  1 
ATOM   2155  H  HD3  . PRO A 1 138 ? -66.555  2.034   -6.644  1.00 60.43  ? 699  PRO A HD3  1 
ATOM   2156  N  N    . ASN A 1 139 ? -63.936  -0.223  -10.930 1.00 56.15  ? 700  ASN A N    1 
ATOM   2157  C  CA   . ASN A 1 139 ? -63.946  -0.860  -12.236 1.00 56.61  ? 700  ASN A CA   1 
ATOM   2158  C  C    . ASN A 1 139 ? -64.319  -2.339  -12.087 1.00 57.00  ? 700  ASN A C    1 
ATOM   2159  O  O    . ASN A 1 139 ? -64.594  -2.835  -10.991 1.00 62.88  ? 700  ASN A O    1 
ATOM   2160  C  CB   . ASN A 1 139 ? -62.576  -0.696  -12.892 1.00 57.69  ? 700  ASN A CB   1 
ATOM   2161  C  CG   . ASN A 1 139 ? -62.624  -0.841  -14.392 1.00 71.08  ? 700  ASN A CG   1 
ATOM   2162  O  OD1  . ASN A 1 139 ? -63.561  -1.415  -14.942 1.00 97.61  ? 700  ASN A OD1  1 
ATOM   2163  N  ND2  . ASN A 1 139 ? -61.606  -0.324  -15.067 1.00 58.17  ? 700  ASN A ND2  1 
ATOM   2164  H  H    . ASN A 1 139 ? -63.146  -0.046  -10.639 1.00 67.38  ? 700  ASN A H    1 
ATOM   2165  H  HA   . ASN A 1 139 ? -64.609  -0.432  -12.799 1.00 67.93  ? 700  ASN A HA   1 
ATOM   2166  H  HB2  . ASN A 1 139 ? -62.231  0.188   -12.687 1.00 69.23  ? 700  ASN A HB2  1 
ATOM   2167  H  HB3  . ASN A 1 139 ? -61.976  -1.374  -12.545 1.00 69.23  ? 700  ASN A HB3  1 
ATOM   2168  H  HD21 . ASN A 1 139 ? -60.966  0.067   -14.646 1.00 69.81  ? 700  ASN A HD21 1 
ATOM   2169  H  HD22 . ASN A 1 139 ? -61.587  -0.380  -15.924 1.00 69.81  ? 700  ASN A HD22 1 
ATOM   2170  N  N    . ALA A 1 140 ? -64.344  -3.057  -13.213 1.00 59.63  ? 701  ALA A N    1 
ATOM   2171  C  CA   . ALA A 1 140 ? -64.544  -4.503  -13.159 1.00 64.18  ? 701  ALA A CA   1 
ATOM   2172  C  C    . ALA A 1 140 ? -63.478  -5.167  -12.299 1.00 58.15  ? 701  ALA A C    1 
ATOM   2173  O  O    . ALA A 1 140 ? -63.752  -6.146  -11.597 1.00 53.69  ? 701  ALA A O    1 
ATOM   2174  C  CB   . ALA A 1 140 ? -64.530  -5.090  -14.570 1.00 62.13  ? 701  ALA A CB   1 
ATOM   2175  H  H    . ALA A 1 140 ? -64.249  -2.737  -14.006 1.00 71.56  ? 701  ALA A H    1 
ATOM   2176  H  HA   . ALA A 1 140 ? -65.410  -4.689  -12.763 1.00 77.01  ? 701  ALA A HA   1 
ATOM   2177  H  HB1  . ALA A 1 140 ? -64.663  -6.049  -14.514 1.00 74.56  ? 701  ALA A HB1  1 
ATOM   2178  H  HB2  . ALA A 1 140 ? -65.244  -4.685  -15.087 1.00 74.56  ? 701  ALA A HB2  1 
ATOM   2179  H  HB3  . ALA A 1 140 ? -63.673  -4.899  -14.983 1.00 74.56  ? 701  ALA A HB3  1 
ATOM   2180  N  N    . HIS A 1 141 ? -62.257  -4.647  -12.348 1.00 51.28  ? 702  HIS A N    1 
ATOM   2181  C  CA   . HIS A 1 141 ? -61.134  -5.148  -11.571 1.00 46.36  ? 702  HIS A CA   1 
ATOM   2182  C  C    . HIS A 1 141 ? -60.936  -4.400  -10.261 1.00 43.55  ? 702  HIS A C    1 
ATOM   2183  O  O    . HIS A 1 141 ? -59.930  -4.621  -9.583  1.00 60.16  ? 702  HIS A O    1 
ATOM   2184  C  CB   . HIS A 1 141 ? -59.866  -5.077  -12.411 1.00 43.80  ? 702  HIS A CB   1 
ATOM   2185  C  CG   . HIS A 1 141 ? -59.993  -5.772  -13.728 1.00 80.42  ? 702  HIS A CG   1 
ATOM   2186  N  ND1  . HIS A 1 141 ? -60.422  -5.129  -14.868 1.00 73.55  ? 702  HIS A ND1  1 
ATOM   2187  C  CD2  . HIS A 1 141 ? -59.777  -7.061  -14.080 1.00 80.67  ? 702  HIS A CD2  1 
ATOM   2188  C  CE1  . HIS A 1 141 ? -60.449  -5.988  -15.871 1.00 91.13  ? 702  HIS A CE1  1 
ATOM   2189  N  NE2  . HIS A 1 141 ? -60.062  -7.168  -15.419 1.00 80.61  ? 702  HIS A NE2  1 
ATOM   2190  H  H    . HIS A 1 141 ? -62.049  -3.977  -12.845 1.00 61.54  ? 702  HIS A H    1 
ATOM   2191  H  HA   . HIS A 1 141 ? -61.295  -6.080  -11.357 1.00 55.63  ? 702  HIS A HA   1 
ATOM   2192  H  HB2  . HIS A 1 141 ? -59.653  -4.147  -12.583 1.00 52.56  ? 702  HIS A HB2  1 
ATOM   2193  H  HB3  . HIS A 1 141 ? -59.141  -5.497  -11.921 1.00 52.56  ? 702  HIS A HB3  1 
ATOM   2194  H  HD1  . HIS A 1 141 ? -60.632  -4.296  -14.921 1.00 88.26  ? 702  HIS A HD1  1 
ATOM   2195  H  HD2  . HIS A 1 141 ? -59.482  -7.744  -13.522 1.00 96.81  ? 702  HIS A HD2  1 
ATOM   2196  H  HE1  . HIS A 1 141 ? -60.699  -5.796  -16.746 1.00 109.36 ? 702  HIS A HE1  1 
ATOM   2197  H  HE2  . HIS A 1 141 ? -59.999  -7.887  -15.888 1.00 96.74  ? 702  HIS A HE2  1 
ATOM   2198  N  N    . GLY A 1 142 ? -61.834  -3.488  -9.919  1.00 56.06  ? 703  GLY A N    1 
ATOM   2199  C  CA   . GLY A 1 142 ? -61.720  -2.739  -8.690  1.00 50.07  ? 703  GLY A CA   1 
ATOM   2200  C  C    . GLY A 1 142 ? -60.862  -1.502  -8.786  1.00 39.69  ? 703  GLY A C    1 
ATOM   2201  O  O    . GLY A 1 142 ? -60.593  -0.875  -7.755  1.00 45.69  ? 703  GLY A O    1 
ATOM   2202  H  H    . GLY A 1 142 ? -62.525  -3.286  -10.389 1.00 67.28  ? 703  GLY A H    1 
ATOM   2203  H  HA2  . GLY A 1 142 ? -62.605  -2.467  -8.402  1.00 60.09  ? 703  GLY A HA2  1 
ATOM   2204  H  HA3  . GLY A 1 142 ? -61.343  -3.312  -8.005  1.00 60.09  ? 703  GLY A HA3  1 
ATOM   2205  N  N    . LYS A 1 143 ? -60.427  -1.127  -9.984  1.00 40.04  ? 704  LYS A N    1 
ATOM   2206  C  CA   . LYS A 1 143 ? -59.622  0.073   -10.135 1.00 46.04  ? 704  LYS A CA   1 
ATOM   2207  C  C    . LYS A 1 143 ? -60.506  1.304   -9.992  1.00 49.40  ? 704  LYS A C    1 
ATOM   2208  O  O    . LYS A 1 143 ? -61.646  1.326   -10.463 1.00 38.75  ? 704  LYS A O    1 
ATOM   2209  C  CB   . LYS A 1 143 ? -58.918  0.076   -11.490 1.00 34.98  ? 704  LYS A CB   1 
ATOM   2210  C  CG   . LYS A 1 143 ? -57.903  1.198   -11.655 1.00 47.51  ? 704  LYS A CG   1 
ATOM   2211  H  H    . LYS A 1 143 ? -60.584  -1.547  -10.718 1.00 48.05  ? 704  LYS A H    1 
ATOM   2212  H  HA   . LYS A 1 143 ? -58.947  0.098   -9.438  1.00 55.25  ? 704  LYS A HA   1 
ATOM   2213  H  HB2  . LYS A 1 143 ? -58.449  -0.766  -11.600 1.00 41.98  ? 704  LYS A HB2  1 
ATOM   2214  H  HB3  . LYS A 1 143 ? -59.584  0.175   -12.188 1.00 41.98  ? 704  LYS A HB3  1 
ATOM   2215  N  N    . ILE A 1 144 ? -59.982  2.325   -9.315  1.00 51.93  ? 705  ILE A N    1 
ATOM   2216  C  CA   . ILE A 1 144 ? -60.679  3.592   -9.150  1.00 37.01  ? 705  ILE A CA   1 
ATOM   2217  C  C    . ILE A 1 144 ? -59.794  4.710   -9.681  1.00 37.71  ? 705  ILE A C    1 
ATOM   2218  O  O    . ILE A 1 144 ? -58.572  4.578   -9.802  1.00 31.03  ? 705  ILE A O    1 
ATOM   2219  C  CB   . ILE A 1 144 ? -61.074  3.868   -7.685  1.00 40.73  ? 705  ILE A CB   1 
ATOM   2220  C  CG1  . ILE A 1 144 ? -59.835  3.884   -6.791  1.00 48.60  ? 705  ILE A CG1  1 
ATOM   2221  C  CG2  . ILE A 1 144 ? -62.070  2.829   -7.203  1.00 46.58  ? 705  ILE A CG2  1 
ATOM   2222  C  CD1  . ILE A 1 144 ? -60.099  4.416   -5.400  1.00 50.06  ? 705  ILE A CD1  1 
ATOM   2223  H  H    . ILE A 1 144 ? -59.209  2.305   -8.938  1.00 62.32  ? 705  ILE A H    1 
ATOM   2224  H  HA   . ILE A 1 144 ? -61.491  3.576   -9.680  1.00 44.41  ? 705  ILE A HA   1 
ATOM   2225  H  HB   . ILE A 1 144 ? -61.496  4.741   -7.640  1.00 48.88  ? 705  ILE A HB   1 
ATOM   2226  H  HG12 . ILE A 1 144 ? -59.501  2.977   -6.703  1.00 58.32  ? 705  ILE A HG12 1 
ATOM   2227  H  HG13 . ILE A 1 144 ? -59.160  4.446   -7.201  1.00 58.32  ? 705  ILE A HG13 1 
ATOM   2228  H  HG21 . ILE A 1 144 ? -62.305  3.021   -6.282  1.00 55.89  ? 705  ILE A HG21 1 
ATOM   2229  H  HG22 . ILE A 1 144 ? -62.862  2.868   -7.762  1.00 55.89  ? 705  ILE A HG22 1 
ATOM   2230  H  HG23 . ILE A 1 144 ? -61.663  1.950   -7.266  1.00 55.89  ? 705  ILE A HG23 1 
ATOM   2231  H  HD11 . ILE A 1 144 ? -59.272  4.396   -4.893  1.00 60.07  ? 705  ILE A HD11 1 
ATOM   2232  H  HD12 . ILE A 1 144 ? -60.424  5.327   -5.467  1.00 60.07  ? 705  ILE A HD12 1 
ATOM   2233  H  HD13 . ILE A 1 144 ? -60.765  3.858   -4.969  1.00 60.07  ? 705  ILE A HD13 1 
ATOM   2234  N  N    . LYS A 1 145 ? -60.440  5.832   -9.980  1.00 33.24  ? 706  LYS A N    1 
ATOM   2235  C  CA   . LYS A 1 145 ? -59.796  6.960   -10.626 1.00 36.47  ? 706  LYS A CA   1 
ATOM   2236  C  C    . LYS A 1 145 ? -60.465  8.238   -10.145 1.00 34.79  ? 706  LYS A C    1 
ATOM   2237  O  O    . LYS A 1 145 ? -61.569  8.217   -9.595  1.00 34.50  ? 706  LYS A O    1 
ATOM   2238  C  CB   . LYS A 1 145 ? -59.880  6.849   -12.152 1.00 31.62  ? 706  LYS A CB   1 
ATOM   2239  C  CG   . LYS A 1 145 ? -61.299  6.665   -12.665 1.00 35.98  ? 706  LYS A CG   1 
ATOM   2240  C  CD   . LYS A 1 145 ? -61.377  6.813   -14.171 1.00 38.06  ? 706  LYS A CD   1 
ATOM   2241  C  CE   . LYS A 1 145 ? -62.796  6.583   -14.664 1.00 42.94  ? 706  LYS A CE   1 
ATOM   2242  N  NZ   . LYS A 1 145 ? -62.970  6.954   -16.101 1.00 39.43  ? 706  LYS A NZ   1 
ATOM   2243  H  H    . LYS A 1 145 ? -61.273  5.963   -9.813  1.00 39.89  ? 706  LYS A H    1 
ATOM   2244  H  HA   . LYS A 1 145 ? -58.860  6.988   -10.371 1.00 43.76  ? 706  LYS A HA   1 
ATOM   2245  H  HB2  . LYS A 1 145 ? -59.524  7.661   -12.547 1.00 37.95  ? 706  LYS A HB2  1 
ATOM   2246  H  HB3  . LYS A 1 145 ? -59.357  6.085   -12.441 1.00 37.95  ? 706  LYS A HB3  1 
ATOM   2247  H  HG2  . LYS A 1 145 ? -61.610  5.776   -12.431 1.00 43.18  ? 706  LYS A HG2  1 
ATOM   2248  H  HG3  . LYS A 1 145 ? -61.873  7.336   -12.264 1.00 43.18  ? 706  LYS A HG3  1 
ATOM   2249  H  HD2  . LYS A 1 145 ? -61.108  7.711   -14.421 1.00 45.67  ? 706  LYS A HD2  1 
ATOM   2250  H  HD3  . LYS A 1 145 ? -60.797  6.157   -14.590 1.00 45.67  ? 706  LYS A HD3  1 
ATOM   2251  H  HE2  . LYS A 1 145 ? -63.017  5.643   -14.567 1.00 51.53  ? 706  LYS A HE2  1 
ATOM   2252  H  HE3  . LYS A 1 145 ? -63.406  7.123   -14.138 1.00 51.53  ? 706  LYS A HE3  1 
ATOM   2253  H  HZ1  . LYS A 1 145 ? -63.811  6.806   -16.354 1.00 47.31  ? 706  LYS A HZ1  1 
ATOM   2254  H  HZ2  . LYS A 1 145 ? -62.780  7.816   -16.218 1.00 47.31  ? 706  LYS A HZ2  1 
ATOM   2255  H  HZ3  . LYS A 1 145 ? -62.426  6.467   -16.609 1.00 47.31  ? 706  LYS A HZ3  1 
ATOM   2256  N  N    . ALA A 1 146 ? -59.782  9.354   -10.373 1.00 35.40  ? 707  ALA A N    1 
ATOM   2257  C  CA   . ALA A 1 146 ? -60.268  10.675  -10.013 1.00 29.37  ? 707  ALA A CA   1 
ATOM   2258  C  C    . ALA A 1 146 ? -60.850  11.353  -11.244 1.00 31.95  ? 707  ALA A C    1 
ATOM   2259  O  O    . ALA A 1 146 ? -60.399  11.122  -12.369 1.00 37.56  ? 707  ALA A O    1 
ATOM   2260  C  CB   . ALA A 1 146 ? -59.146  11.527  -9.420  1.00 31.74  ? 707  ALA A CB   1 
ATOM   2261  H  H    . ALA A 1 146 ? -59.009  9.368   -10.748 1.00 42.48  ? 707  ALA A H    1 
ATOM   2262  H  HA   . ALA A 1 146 ? -60.971  10.590  -9.349  1.00 35.24  ? 707  ALA A HA   1 
ATOM   2263  H  HB1  . ALA A 1 146 ? -59.501  12.400  -9.191  1.00 38.08  ? 707  ALA A HB1  1 
ATOM   2264  H  HB2  . ALA A 1 146 ? -58.804  11.089  -8.626  1.00 38.08  ? 707  ALA A HB2  1 
ATOM   2265  H  HB3  . ALA A 1 146 ? -58.440  11.619  -10.079 1.00 38.08  ? 707  ALA A HB3  1 
ATOM   2266  N  N    . MET A 1 147 ? -61.888  12.160  -11.029 1.00 34.16  ? 708  MET A N    1 
ATOM   2267  C  CA   . MET A 1 147 ? -62.604  12.782  -12.130 1.00 27.68  ? 708  MET A CA   1 
ATOM   2268  C  C    . MET A 1 147 ? -63.013  14.203  -11.773 1.00 33.97  ? 708  MET A C    1 
ATOM   2269  O  O    . MET A 1 147 ? -63.460  14.468  -10.655 1.00 42.16  ? 708  MET A O    1 
ATOM   2270  C  CB   . MET A 1 147 ? -63.842  11.961  -12.502 1.00 44.46  ? 708  MET A CB   1 
ATOM   2271  C  CG   . MET A 1 147 ? -63.522  10.568  -13.033 1.00 51.06  ? 708  MET A CG   1 
ATOM   2272  S  SD   . MET A 1 147 ? -64.979  9.710   -13.659 1.00 58.06  ? 708  MET A SD   1 
ATOM   2273  C  CE   . MET A 1 147 ? -65.956  9.592   -12.169 1.00 57.15  ? 708  MET A CE   1 
ATOM   2274  H  H    . MET A 1 147 ? -62.195  12.361  -10.251 1.00 41.00  ? 708  MET A H    1 
ATOM   2275  H  HA   . MET A 1 147 ? -62.023  12.809  -12.906 1.00 33.22  ? 708  MET A HA   1 
ATOM   2276  H  HB2  . MET A 1 147 ? -64.396  11.857  -11.712 1.00 53.35  ? 708  MET A HB2  1 
ATOM   2277  H  HB3  . MET A 1 147 ? -64.336  12.434  -13.190 1.00 53.35  ? 708  MET A HB3  1 
ATOM   2278  H  HG2  . MET A 1 147 ? -62.884  10.645  -13.760 1.00 61.28  ? 708  MET A HG2  1 
ATOM   2279  H  HG3  . MET A 1 147 ? -63.145  10.035  -12.316 1.00 61.28  ? 708  MET A HG3  1 
ATOM   2280  H  HE1  . MET A 1 147 ? -66.789  9.138   -12.373 1.00 68.58  ? 708  MET A HE1  1 
ATOM   2281  H  HE2  . MET A 1 147 ? -65.459  9.089   -11.505 1.00 68.58  ? 708  MET A HE2  1 
ATOM   2282  H  HE3  . MET A 1 147 ? -66.138  10.486  -11.839 1.00 68.58  ? 708  MET A HE3  1 
ATOM   2283  N  N    . ILE A 1 148 ? -62.862  15.112  -12.740 1.00 31.49  ? 709  ILE A N    1 
ATOM   2284  C  CA   . ILE A 1 148 ? -63.350  16.478  -12.595 1.00 28.56  ? 709  ILE A CA   1 
ATOM   2285  C  C    . ILE A 1 148 ? -64.866  16.501  -12.752 1.00 37.40  ? 709  ILE A C    1 
ATOM   2286  O  O    . ILE A 1 148 ? -65.430  15.876  -13.661 1.00 37.61  ? 709  ILE A O    1 
ATOM   2287  C  CB   . ILE A 1 148 ? -62.693  17.400  -13.636 1.00 34.78  ? 709  ILE A CB   1 
ATOM   2288  C  CG1  . ILE A 1 148 ? -61.177  17.431  -13.461 1.00 38.02  ? 709  ILE A CG1  1 
ATOM   2289  C  CG2  . ILE A 1 148 ? -63.275  18.804  -13.552 1.00 37.29  ? 709  ILE A CG2  1 
ATOM   2290  C  CD1  . ILE A 1 148 ? -60.707  18.043  -12.163 1.00 45.87  ? 709  ILE A CD1  1 
ATOM   2291  H  H    . ILE A 1 148 ? -62.477  14.957  -13.494 1.00 37.78  ? 709  ILE A H    1 
ATOM   2292  H  HA   . ILE A 1 148 ? -63.129  16.807  -11.710 1.00 34.27  ? 709  ILE A HA   1 
ATOM   2293  H  HB   . ILE A 1 148 ? -62.887  17.045  -14.518 1.00 41.73  ? 709  ILE A HB   1 
ATOM   2294  H  HG12 . ILE A 1 148 ? -60.843  16.521  -13.495 1.00 45.63  ? 709  ILE A HG12 1 
ATOM   2295  H  HG13 . ILE A 1 148 ? -60.792  17.947  -14.186 1.00 45.63  ? 709  ILE A HG13 1 
ATOM   2296  H  HG21 . ILE A 1 148 ? -62.845  19.364  -14.217 1.00 44.75  ? 709  ILE A HG21 1 
ATOM   2297  H  HG22 . ILE A 1 148 ? -64.229  18.760  -13.723 1.00 44.75  ? 709  ILE A HG22 1 
ATOM   2298  H  HG23 . ILE A 1 148 ? -63.113  19.159  -12.664 1.00 44.75  ? 709  ILE A HG23 1 
ATOM   2299  H  HD11 . ILE A 1 148 ? -59.738  18.022  -12.137 1.00 55.04  ? 709  ILE A HD11 1 
ATOM   2300  H  HD12 . ILE A 1 148 ? -61.019  18.961  -12.115 1.00 55.04  ? 709  ILE A HD12 1 
ATOM   2301  H  HD13 . ILE A 1 148 ? -61.070  17.532  -11.423 1.00 55.04  ? 709  ILE A HD13 1 
ATOM   2302  N  N    . SER A 1 149 ? -65.528  17.250  -11.876 1.00 38.05  ? 710  SER A N    1 
ATOM   2303  C  CA   . SER A 1 149 ? -66.970  17.436  -11.932 1.00 42.15  ? 710  SER A CA   1 
ATOM   2304  C  C    . SER A 1 149 ? -67.303  18.848  -11.474 1.00 39.87  ? 710  SER A C    1 
ATOM   2305  O  O    . SER A 1 149 ? -66.553  19.456  -10.706 1.00 35.62  ? 710  SER A O    1 
ATOM   2306  C  CB   . SER A 1 149 ? -67.692  16.420  -11.052 1.00 36.33  ? 710  SER A CB   1 
ATOM   2307  O  OG   . SER A 1 149 ? -69.082  16.660  -11.045 1.00 49.07  ? 710  SER A OG   1 
ATOM   2308  H  H    . SER A 1 149 ? -65.154  17.670  -11.225 1.00 45.66  ? 710  SER A H    1 
ATOM   2309  H  HA   . SER A 1 149 ? -67.276  17.326  -12.846 1.00 50.58  ? 710  SER A HA   1 
ATOM   2310  H  HB2  . SER A 1 149 ? -67.528  15.529  -11.397 1.00 43.60  ? 710  SER A HB2  1 
ATOM   2311  H  HB3  . SER A 1 149 ? -67.355  16.492  -10.145 1.00 43.60  ? 710  SER A HB3  1 
ATOM   2312  H  HG   . SER A 1 149 ? -69.469  16.096  -10.557 1.00 58.88  ? 710  SER A HG   1 
ATOM   2313  N  N    . ASP A 1 150 ? -68.441  19.364  -11.942 1.00 41.09  ? 711  ASP A N    1 
ATOM   2314  C  CA   . ASP A 1 150 ? -68.863  20.689  -11.505 1.00 40.49  ? 711  ASP A CA   1 
ATOM   2315  C  C    . ASP A 1 150 ? -69.507  20.665  -10.127 1.00 32.95  ? 711  ASP A C    1 
ATOM   2316  O  O    . ASP A 1 150 ? -69.497  21.681  -9.422  1.00 64.34  ? 711  ASP A O    1 
ATOM   2317  C  CB   . ASP A 1 150 ? -69.839  21.300  -12.499 1.00 50.56  ? 711  ASP A CB   1 
ATOM   2318  C  CG   . ASP A 1 150 ? -70.483  22.560  -11.959 1.00 85.40  ? 711  ASP A CG   1 
ATOM   2319  O  OD1  . ASP A 1 150 ? -69.758  23.563  -11.771 1.00 63.81  ? 711  ASP A OD1  1 
ATOM   2320  O  OD2  . ASP A 1 150 ? -71.705  22.536  -11.692 1.00 92.66  ? 711  ASP A OD2  1 
ATOM   2321  H  H    . ASP A 1 150 ? -68.971  18.978  -12.498 1.00 49.31  ? 711  ASP A H    1 
ATOM   2322  H  HA   . ASP A 1 150 ? -68.085  21.267  -11.460 1.00 48.59  ? 711  ASP A HA   1 
ATOM   2323  H  HB2  . ASP A 1 150 ? -69.364  21.527  -13.314 1.00 60.67  ? 711  ASP A HB2  1 
ATOM   2324  H  HB3  . ASP A 1 150 ? -70.542  20.659  -12.690 1.00 60.67  ? 711  ASP A HB3  1 
ATOM   2325  N  N    . PHE A 1 151 ? -70.069  19.531  -9.729  1.00 40.21  ? 712  PHE A N    1 
ATOM   2326  C  CA   . PHE A 1 151 ? -70.758  19.401  -8.457  1.00 42.61  ? 712  PHE A CA   1 
ATOM   2327  C  C    . PHE A 1 151 ? -69.997  18.461  -7.533  1.00 45.45  ? 712  PHE A C    1 
ATOM   2328  O  O    . PHE A 1 151 ? -69.363  17.500  -7.978  1.00 45.51  ? 712  PHE A O    1 
ATOM   2329  C  CB   . PHE A 1 151 ? -72.179  18.879  -8.662  1.00 35.08  ? 712  PHE A CB   1 
ATOM   2330  C  CG   . PHE A 1 151 ? -72.249  17.411  -8.985  1.00 38.83  ? 712  PHE A CG   1 
ATOM   2331  C  CD1  . PHE A 1 151 ? -72.164  16.966  -10.296 1.00 34.66  ? 712  PHE A CD1  1 
ATOM   2332  C  CD2  . PHE A 1 151 ? -72.429  16.477  -7.979  1.00 38.78  ? 712  PHE A CD2  1 
ATOM   2333  C  CE1  . PHE A 1 151 ? -72.244  15.617  -10.590 1.00 38.86  ? 712  PHE A CE1  1 
ATOM   2334  C  CE2  . PHE A 1 151 ? -72.507  15.131  -8.271  1.00 41.95  ? 712  PHE A CE2  1 
ATOM   2335  C  CZ   . PHE A 1 151 ? -72.414  14.703  -9.578  1.00 45.65  ? 712  PHE A CZ   1 
ATOM   2336  H  H    . PHE A 1 151 ? -70.062  18.805  -10.191 1.00 48.25  ? 712  PHE A H    1 
ATOM   2337  H  HA   . PHE A 1 151 ? -70.811  20.271  -8.031  1.00 51.14  ? 712  PHE A HA   1 
ATOM   2338  H  HB2  . PHE A 1 151 ? -72.686  19.028  -7.849  1.00 42.10  ? 712  PHE A HB2  1 
ATOM   2339  H  HB3  . PHE A 1 151 ? -72.586  19.364  -9.397  1.00 42.10  ? 712  PHE A HB3  1 
ATOM   2340  H  HD1  . PHE A 1 151 ? -72.049  17.581  -10.984 1.00 41.59  ? 712  PHE A HD1  1 
ATOM   2341  H  HD2  . PHE A 1 151 ? -72.492  16.760  -7.095  1.00 46.54  ? 712  PHE A HD2  1 
ATOM   2342  H  HE1  . PHE A 1 151 ? -72.180  15.328  -11.472 1.00 46.64  ? 712  PHE A HE1  1 
ATOM   2343  H  HE2  . PHE A 1 151 ? -72.623  14.512  -7.586  1.00 50.34  ? 712  PHE A HE2  1 
ATOM   2344  H  HZ   . PHE A 1 151 ? -72.466  13.795  -9.775  1.00 54.78  ? 712  PHE A HZ   1 
ATOM   2345  N  N    . GLY A 1 152 ? -70.074  18.750  -6.234  1.00 43.91  ? 713  GLY A N    1 
ATOM   2346  C  CA   . GLY A 1 152 ? -69.556  17.868  -5.215  1.00 54.65  ? 713  GLY A CA   1 
ATOM   2347  C  C    . GLY A 1 152 ? -70.671  17.068  -4.569  1.00 55.37  ? 713  GLY A C    1 
ATOM   2348  O  O    . GLY A 1 152 ? -71.844  17.316  -4.797  1.00 61.26  ? 713  GLY A O    1 
ATOM   2349  H  H    . GLY A 1 152 ? -70.432  19.467  -5.922  1.00 52.69  ? 713  GLY A H    1 
ATOM   2350  H  HA2  . GLY A 1 152 ? -68.918  17.252  -5.609  1.00 65.58  ? 713  GLY A HA2  1 
ATOM   2351  H  HA3  . GLY A 1 152 ? -69.106  18.387  -4.530  1.00 65.58  ? 713  GLY A HA3  1 
ATOM   2352  N  N    . LEU A 1 153 ? -70.277  16.093  -3.756  1.00 55.56  ? 714  LEU A N    1 
ATOM   2353  C  CA   . LEU A 1 153 ? -71.225  15.216  -3.088  1.00 53.96  ? 714  LEU A CA   1 
ATOM   2354  C  C    . LEU A 1 153 ? -71.425  15.665  -1.642  1.00 63.67  ? 714  LEU A C    1 
ATOM   2355  O  O    . LEU A 1 153 ? -70.793  16.609  -1.160  1.00 65.74  ? 714  LEU A O    1 
ATOM   2356  C  CB   . LEU A 1 153 ? -70.749  13.763  -3.158  1.00 55.93  ? 714  LEU A CB   1 
ATOM   2357  C  CG   . LEU A 1 153 ? -70.494  13.206  -4.565  1.00 56.17  ? 714  LEU A CG   1 
ATOM   2358  C  CD1  . LEU A 1 153 ? -70.122  11.733  -4.497  1.00 49.32  ? 714  LEU A CD1  1 
ATOM   2359  C  CD2  . LEU A 1 153 ? -71.695  13.401  -5.481  1.00 60.38  ? 714  LEU A CD2  1 
ATOM   2360  H  H    . LEU A 1 153 ? -69.455  15.918  -3.574  1.00 66.67  ? 714  LEU A H    1 
ATOM   2361  H  HA   . LEU A 1 153 ? -72.081  15.273  -3.541  1.00 64.75  ? 714  LEU A HA   1 
ATOM   2362  H  HB2  . LEU A 1 153 ? -69.918  13.691  -2.663  1.00 67.11  ? 714  LEU A HB2  1 
ATOM   2363  H  HB3  . LEU A 1 153 ? -71.421  13.201  -2.742  1.00 67.11  ? 714  LEU A HB3  1 
ATOM   2364  H  HG   . LEU A 1 153 ? -69.744  13.681  -4.956  1.00 67.40  ? 714  LEU A HG   1 
ATOM   2365  H  HD11 . LEU A 1 153 ? -69.967  11.406  -5.397  1.00 59.18  ? 714  LEU A HD11 1 
ATOM   2366  H  HD12 . LEU A 1 153 ? -69.317  11.635  -3.965  1.00 59.18  ? 714  LEU A HD12 1 
ATOM   2367  H  HD13 . LEU A 1 153 ? -70.852  11.243  -4.088  1.00 59.18  ? 714  LEU A HD13 1 
ATOM   2368  H  HD21 . LEU A 1 153 ? -71.488  13.035  -6.355  1.00 72.45  ? 714  LEU A HD21 1 
ATOM   2369  H  HD22 . LEU A 1 153 ? -72.460  12.940  -5.101  1.00 72.45  ? 714  LEU A HD22 1 
ATOM   2370  H  HD23 . LEU A 1 153 ? -71.884  14.350  -5.555  1.00 72.45  ? 714  LEU A HD23 1 
ATOM   2371  N  N    . CYS A 1 154 ? -72.312  14.962  -0.941  1.00 66.88  ? 715  CYS A N    1 
ATOM   2372  C  CA   . CYS A 1 154 ? -72.654  15.290  0.440   1.00 71.67  ? 715  CYS A CA   1 
ATOM   2373  C  C    . CYS A 1 154 ? -71.879  14.409  1.416   1.00 63.77  ? 715  CYS A C    1 
ATOM   2374  O  O    . CYS A 1 154 ? -72.467  13.637  2.176   1.00 70.01  ? 715  CYS A O    1 
ATOM   2375  C  CB   . CYS A 1 154 ? -74.161  15.131  0.676   1.00 75.26  ? 715  CYS A CB   1 
ATOM   2376  S  SG   . CYS A 1 154 ? -75.214  16.223  -0.320  1.00 83.86  ? 715  CYS A SG   1 
ATOM   2377  H  H    . CYS A 1 154 ? -72.736  14.280  -1.249  1.00 80.25  ? 715  CYS A H    1 
ATOM   2378  H  HA   . CYS A 1 154 ? -72.417  16.214  0.616   1.00 86.00  ? 715  CYS A HA   1 
ATOM   2379  H  HB2  . CYS A 1 154 ? -74.410  14.217  0.469   1.00 90.31  ? 715  CYS A HB2  1 
ATOM   2380  H  HB3  . CYS A 1 154 ? -74.348  15.316  1.609   1.00 90.31  ? 715  CYS A HB3  1 
ATOM   2381  H  HG   . CYS A 1 154 ? -76.364  16.009  -0.051  1.00 100.63 ? 715  CYS A HG   1 
ATOM   2382  N  N    . GLY A 1 172 ? -65.699  22.797  4.671   1.00 57.84  ? 733  GLY A N    1 
ATOM   2383  C  CA   . GLY A 1 172 ? -64.631  23.732  4.365   1.00 66.79  ? 733  GLY A CA   1 
ATOM   2384  C  C    . GLY A 1 172 ? -64.549  24.039  2.881   1.00 76.51  ? 733  GLY A C    1 
ATOM   2385  O  O    . GLY A 1 172 ? -63.560  23.709  2.222   1.00 57.69  ? 733  GLY A O    1 
ATOM   2386  H  HA2  . GLY A 1 172 ? -64.779  24.562  4.844   1.00 80.14  ? 733  GLY A HA2  1 
ATOM   2387  H  HA3  . GLY A 1 172 ? -63.782  23.359  4.650   1.00 80.14  ? 733  GLY A HA3  1 
ATOM   2388  N  N    . THR A 1 173 ? -65.594  24.686  2.362   1.00 70.69  ? 734  THR A N    1 
ATOM   2389  C  CA   . THR A 1 173 ? -65.734  24.967  0.938   1.00 65.59  ? 734  THR A CA   1 
ATOM   2390  C  C    . THR A 1 173 ? -65.161  26.321  0.531   1.00 65.44  ? 734  THR A C    1 
ATOM   2391  O  O    . THR A 1 173 ? -65.157  26.639  -0.663  1.00 63.51  ? 734  THR A O    1 
ATOM   2392  C  CB   . THR A 1 173 ? -67.217  24.904  0.532   1.00 67.98  ? 734  THR A CB   1 
ATOM   2393  O  OG1  . THR A 1 173 ? -67.931  26.008  1.105   1.00 73.81  ? 734  THR A OG1  1 
ATOM   2394  C  CG2  . THR A 1 173 ? -67.855  23.600  0.997   1.00 69.56  ? 734  THR A CG2  1 
ATOM   2395  H  H    . THR A 1 173 ? -66.252  24.978  2.832   1.00 84.83  ? 734  THR A H    1 
ATOM   2396  H  HA   . THR A 1 173 ? -65.261  24.283  0.437   1.00 78.71  ? 734  THR A HA   1 
ATOM   2397  H  HB   . THR A 1 173 ? -67.286  24.946  -0.435  1.00 81.58  ? 734  THR A HB   1 
ATOM   2398  H  HG1  . THR A 1 173 ? -68.740  25.973  0.883   1.00 88.57  ? 734  THR A HG1  1 
ATOM   2399  H  HG21 . THR A 1 173 ? -68.788  23.576  0.734   1.00 83.47  ? 734  THR A HG21 1 
ATOM   2400  H  HG22 . THR A 1 173 ? -67.395  22.845  0.598   1.00 83.47  ? 734  THR A HG22 1 
ATOM   2401  H  HG23 . THR A 1 173 ? -67.797  23.529  1.963   1.00 83.47  ? 734  THR A HG23 1 
ATOM   2402  N  N    . GLU A 1 174 ? -64.675  27.116  1.482   1.00 55.72  ? 735  GLU A N    1 
ATOM   2403  C  CA   . GLU A 1 174 ? -64.205  28.472  1.235   1.00 58.33  ? 735  GLU A CA   1 
ATOM   2404  C  C    . GLU A 1 174 ? -62.690  28.502  1.067   1.00 63.32  ? 735  GLU A C    1 
ATOM   2405  O  O    . GLU A 1 174 ? -61.963  27.727  1.696   1.00 63.25  ? 735  GLU A O    1 
ATOM   2406  C  CB   . GLU A 1 174 ? -64.615  29.402  2.380   1.00 52.30  ? 735  GLU A CB   1 
ATOM   2407  H  H    . GLU A 1 174 ? -64.607  26.880  2.306   1.00 66.87  ? 735  GLU A H    1 
ATOM   2408  H  HA   . GLU A 1 174 ? -64.607  28.804  0.416   1.00 69.99  ? 735  GLU A HA   1 
ATOM   2409  N  N    . GLY A 1 175 ? -62.222  29.394  0.195   1.00 61.88  ? 736  GLY A N    1 
ATOM   2410  C  CA   . GLY A 1 175 ? -60.803  29.666  0.051   1.00 48.54  ? 736  GLY A CA   1 
ATOM   2411  C  C    . GLY A 1 175 ? -60.109  29.033  -1.137  1.00 34.83  ? 736  GLY A C    1 
ATOM   2412  O  O    . GLY A 1 175 ? -58.875  28.971  -1.143  1.00 51.48  ? 736  GLY A O    1 
ATOM   2413  H  H    . GLY A 1 175 ? -62.719  29.859  -0.331  1.00 74.26  ? 736  GLY A H    1 
ATOM   2414  H  HA2  . GLY A 1 175 ? -60.678  30.626  -0.014  1.00 58.25  ? 736  GLY A HA2  1 
ATOM   2415  H  HA3  . GLY A 1 175 ? -60.348  29.363  0.852   1.00 58.25  ? 736  GLY A HA3  1 
ATOM   2416  N  N    . TRP A 1 176 ? -60.854  28.521  -2.112  1.00 37.94  ? 737  TRP A N    1 
ATOM   2417  C  CA   . TRP A 1 176 ? -60.283  27.895  -3.298  1.00 36.18  ? 737  TRP A CA   1 
ATOM   2418  C  C    . TRP A 1 176 ? -60.220  28.818  -4.510  1.00 29.85  ? 737  TRP A C    1 
ATOM   2419  O  O    . TRP A 1 176 ? -59.774  28.382  -5.576  1.00 37.23  ? 737  TRP A O    1 
ATOM   2420  C  CB   . TRP A 1 176 ? -61.080  26.634  -3.624  1.00 35.32  ? 737  TRP A CB   1 
ATOM   2421  C  CG   . TRP A 1 176 ? -61.173  25.744  -2.432  1.00 30.79  ? 737  TRP A CG   1 
ATOM   2422  C  CD1  . TRP A 1 176 ? -62.176  25.712  -1.511  1.00 36.85  ? 737  TRP A CD1  1 
ATOM   2423  C  CD2  . TRP A 1 176 ? -60.210  24.771  -2.011  1.00 34.37  ? 737  TRP A CD2  1 
ATOM   2424  N  NE1  . TRP A 1 176 ? -61.906  24.769  -0.548  1.00 43.91  ? 737  TRP A NE1  1 
ATOM   2425  C  CE2  . TRP A 1 176 ? -60.703  24.179  -0.832  1.00 35.77  ? 737  TRP A CE2  1 
ATOM   2426  C  CE3  . TRP A 1 176 ? -58.984  24.339  -2.521  1.00 28.53  ? 737  TRP A CE3  1 
ATOM   2427  C  CZ2  . TRP A 1 176 ? -60.010  23.178  -0.154  1.00 39.18  ? 737  TRP A CZ2  1 
ATOM   2428  C  CZ3  . TRP A 1 176 ? -58.297  23.346  -1.847  1.00 30.88  ? 737  TRP A CZ3  1 
ATOM   2429  C  CH2  . TRP A 1 176 ? -58.810  22.778  -0.677  1.00 37.22  ? 737  TRP A CH2  1 
ATOM   2430  H  H    . TRP A 1 176 ? -61.714  28.525  -2.109  1.00 45.52  ? 737  TRP A H    1 
ATOM   2431  H  HA   . TRP A 1 176 ? -59.375  27.622  -3.093  1.00 43.41  ? 737  TRP A HA   1 
ATOM   2432  H  HB2  . TRP A 1 176 ? -61.979  26.881  -3.893  1.00 42.38  ? 737  TRP A HB2  1 
ATOM   2433  H  HB3  . TRP A 1 176 ? -60.636  26.147  -4.336  1.00 42.38  ? 737  TRP A HB3  1 
ATOM   2434  H  HD1  . TRP A 1 176 ? -62.937  26.246  -1.534  1.00 44.22  ? 737  TRP A HD1  1 
ATOM   2435  H  HE1  . TRP A 1 176 ? -62.408  24.583  0.125   1.00 52.69  ? 737  TRP A HE1  1 
ATOM   2436  H  HE3  . TRP A 1 176 ? -58.635  24.714  -3.298  1.00 34.23  ? 737  TRP A HE3  1 
ATOM   2437  H  HZ2  . TRP A 1 176 ? -60.349  22.797  0.623   1.00 47.01  ? 737  TRP A HZ2  1 
ATOM   2438  H  HZ3  . TRP A 1 176 ? -57.479  23.052  -2.178  1.00 37.06  ? 737  TRP A HZ3  1 
ATOM   2439  H  HH2  . TRP A 1 176 ? -58.327  22.110  -0.246  1.00 44.67  ? 737  TRP A HH2  1 
ATOM   2440  N  N    . ILE A 1 177 ? -60.642  30.070  -4.378  1.00 38.21  ? 738  ILE A N    1 
ATOM   2441  C  CA   . ILE A 1 177 ? -60.793  30.971  -5.518  1.00 36.44  ? 738  ILE A CA   1 
ATOM   2442  C  C    . ILE A 1 177 ? -59.537  31.810  -5.676  1.00 40.17  ? 738  ILE A C    1 
ATOM   2443  O  O    . ILE A 1 177 ? -58.950  32.280  -4.692  1.00 32.58  ? 738  ILE A O    1 
ATOM   2444  C  CB   . ILE A 1 177 ? -62.029  31.873  -5.343  1.00 45.10  ? 738  ILE A CB   1 
ATOM   2445  C  CG1  . ILE A 1 177 ? -63.290  31.023  -5.226  1.00 41.04  ? 738  ILE A CG1  1 
ATOM   2446  C  CG2  . ILE A 1 177 ? -62.154  32.844  -6.519  1.00 44.85  ? 738  ILE A CG2  1 
ATOM   2447  C  CD1  . ILE A 1 177 ? -64.535  31.817  -4.873  1.00 47.37  ? 738  ILE A CD1  1 
ATOM   2448  H  H    . ILE A 1 177 ? -60.851  30.430  -3.625  1.00 45.85  ? 738  ILE A H    1 
ATOM   2449  H  HA   . ILE A 1 177 ? -60.912  30.447  -6.325  1.00 43.72  ? 738  ILE A HA   1 
ATOM   2450  H  HB   . ILE A 1 177 ? -61.924  32.387  -4.527  1.00 54.11  ? 738  ILE A HB   1 
ATOM   2451  H  HG12 . ILE A 1 177 ? -63.449  30.583  -6.075  1.00 49.25  ? 738  ILE A HG12 1 
ATOM   2452  H  HG13 . ILE A 1 177 ? -63.155  30.359  -4.532  1.00 49.25  ? 738  ILE A HG13 1 
ATOM   2453  H  HG21 . ILE A 1 177 ? -62.937  33.401  -6.387  1.00 53.81  ? 738  ILE A HG21 1 
ATOM   2454  H  HG22 . ILE A 1 177 ? -61.358  33.397  -6.558  1.00 53.81  ? 738  ILE A HG22 1 
ATOM   2455  H  HG23 . ILE A 1 177 ? -62.243  32.335  -7.340  1.00 53.81  ? 738  ILE A HG23 1 
ATOM   2456  H  HD11 . ILE A 1 177 ? -65.290  31.210  -4.817  1.00 56.85  ? 738  ILE A HD11 1 
ATOM   2457  H  HD12 . ILE A 1 177 ? -64.398  32.255  -4.019  1.00 56.85  ? 738  ILE A HD12 1 
ATOM   2458  H  HD13 . ILE A 1 177 ? -64.693  32.479  -5.564  1.00 56.85  ? 738  ILE A HD13 1 
ATOM   2459  N  N    . ALA A 1 178 ? -59.145  32.027  -6.929  1.00 39.64  ? 739  ALA A N    1 
ATOM   2460  C  CA   . ALA A 1 178 ? -57.977  32.835  -7.220  1.00 28.46  ? 739  ALA A CA   1 
ATOM   2461  C  C    . ALA A 1 178 ? -58.213  34.284  -6.793  1.00 46.18  ? 739  ALA A C    1 
ATOM   2462  O  O    . ALA A 1 178 ? -59.347  34.769  -6.816  1.00 45.32  ? 739  ALA A O    1 
ATOM   2463  C  CB   . ALA A 1 178 ? -57.649  32.780  -8.708  1.00 40.81  ? 739  ALA A CB   1 
ATOM   2464  H  H    . ALA A 1 178 ? -59.541  31.715  -7.625  1.00 47.57  ? 739  ALA A H    1 
ATOM   2465  H  HA   . ALA A 1 178 ? -57.216  32.491  -6.726  1.00 34.15  ? 739  ALA A HA   1 
ATOM   2466  H  HB1  . ALA A 1 178 ? -56.866  33.326  -8.879  1.00 48.97  ? 739  ALA A HB1  1 
ATOM   2467  H  HB2  . ALA A 1 178 ? -57.471  31.859  -8.958  1.00 48.97  ? 739  ALA A HB2  1 
ATOM   2468  H  HB3  . ALA A 1 178 ? -58.406  33.119  -9.211  1.00 48.97  ? 739  ALA A HB3  1 
ATOM   2469  N  N    . PRO A 1 179 ? -57.154  34.996  -6.398  1.00 34.38  ? 740  PRO A N    1 
ATOM   2470  C  CA   . PRO A 1 179 ? -57.346  36.385  -5.949  1.00 48.42  ? 740  PRO A CA   1 
ATOM   2471  C  C    . PRO A 1 179 ? -57.996  37.277  -6.991  1.00 54.82  ? 740  PRO A C    1 
ATOM   2472  O  O    . PRO A 1 179 ? -58.858  38.090  -6.642  1.00 45.69  ? 740  PRO A O    1 
ATOM   2473  C  CB   . PRO A 1 179 ? -55.918  36.848  -5.615  1.00 43.52  ? 740  PRO A CB   1 
ATOM   2474  C  CG   . PRO A 1 179 ? -55.008  35.858  -6.277  1.00 47.93  ? 740  PRO A CG   1 
ATOM   2475  C  CD   . PRO A 1 179 ? -55.752  34.567  -6.293  1.00 41.29  ? 740  PRO A CD   1 
ATOM   2476  H  HA   . PRO A 1 179 ? -57.881  36.402  -5.140  1.00 58.10  ? 740  PRO A HA   1 
ATOM   2477  H  HB2  . PRO A 1 179 ? -55.772  37.737  -5.973  1.00 52.22  ? 740  PRO A HB2  1 
ATOM   2478  H  HB3  . PRO A 1 179 ? -55.790  36.840  -4.654  1.00 52.22  ? 740  PRO A HB3  1 
ATOM   2479  H  HG2  . PRO A 1 179 ? -54.812  36.150  -7.181  1.00 57.52  ? 740  PRO A HG2  1 
ATOM   2480  H  HG3  . PRO A 1 179 ? -54.190  35.773  -5.761  1.00 57.52  ? 740  PRO A HG3  1 
ATOM   2481  H  HD2  . PRO A 1 179 ? -55.499  34.039  -7.067  1.00 49.55  ? 740  PRO A HD2  1 
ATOM   2482  H  HD3  . PRO A 1 179 ? -55.607  34.081  -5.466  1.00 49.55  ? 740  PRO A HD3  1 
ATOM   2483  N  N    . GLU A 1 180 ? -57.631  37.127  -8.267  1.00 58.68  ? 741  GLU A N    1 
ATOM   2484  C  CA   . GLU A 1 180 ? -58.026  38.109  -9.274  1.00 35.16  ? 741  GLU A CA   1 
ATOM   2485  C  C    . GLU A 1 180 ? -59.538  38.237  -9.399  1.00 48.66  ? 741  GLU A C    1 
ATOM   2486  O  O    . GLU A 1 180 ? -60.033  39.313  -9.756  1.00 76.04  ? 741  GLU A O    1 
ATOM   2487  C  CB   . GLU A 1 180 ? -57.421  37.758  -10.634 1.00 46.10  ? 741  GLU A CB   1 
ATOM   2488  C  CG   . GLU A 1 180 ? -57.624  36.319  -11.069 1.00 54.40  ? 741  GLU A CG   1 
ATOM   2489  C  CD   . GLU A 1 180 ? -56.426  35.456  -10.766 1.00 42.95  ? 741  GLU A CD   1 
ATOM   2490  O  OE1  . GLU A 1 180 ? -55.845  35.613  -9.670  1.00 38.09  ? 741  GLU A OE1  1 
ATOM   2491  O  OE2  . GLU A 1 180 ? -56.063  34.630  -11.626 1.00 42.17  ? 741  GLU A OE2  1 
ATOM   2492  H  H    . GLU A 1 180 ? -57.162  36.473  -8.570  1.00 70.42  ? 741  GLU A H    1 
ATOM   2493  H  HA   . GLU A 1 180 ? -57.679  38.976  -9.013  1.00 42.19  ? 741  GLU A HA   1 
ATOM   2494  H  HB2  . GLU A 1 180 ? -57.824  38.328  -11.308 1.00 55.32  ? 741  GLU A HB2  1 
ATOM   2495  H  HB3  . GLU A 1 180 ? -56.466  37.921  -10.598 1.00 55.32  ? 741  GLU A HB3  1 
ATOM   2496  H  HG2  . GLU A 1 180 ? -58.389  35.950  -10.599 1.00 65.28  ? 741  GLU A HG2  1 
ATOM   2497  H  HG3  . GLU A 1 180 ? -57.778  36.295  -12.026 1.00 65.28  ? 741  GLU A HG3  1 
ATOM   2498  N  N    . MET A 1 181 ? -60.291  37.175  -9.112  1.00 49.59  ? 742  MET A N    1 
ATOM   2499  C  CA   . MET A 1 181 ? -61.750  37.227  -9.177  1.00 77.97  ? 742  MET A CA   1 
ATOM   2500  C  C    . MET A 1 181 ? -62.297  37.352  -7.761  1.00 79.24  ? 742  MET A C    1 
ATOM   2501  O  O    . MET A 1 181 ? -62.246  36.395  -6.982  1.00 73.51  ? 742  MET A O    1 
ATOM   2502  C  CB   . MET A 1 181 ? -62.331  36.004  -9.884  1.00 71.45  ? 742  MET A CB   1 
ATOM   2503  C  CG   . MET A 1 181 ? -61.527  34.723  -9.767  1.00 47.25  ? 742  MET A CG   1 
ATOM   2504  S  SD   . MET A 1 181 ? -62.442  33.307  -10.427 1.00 76.25  ? 742  MET A SD   1 
ATOM   2505  C  CE   . MET A 1 181 ? -62.935  33.917  -12.031 1.00 41.86  ? 742  MET A CE   1 
ATOM   2506  H  H    . MET A 1 181 ? -59.979  36.409  -8.876  1.00 59.51  ? 742  MET A H    1 
ATOM   2507  H  HA   . MET A 1 181 ? -62.011  38.012  -9.682  1.00 93.56  ? 742  MET A HA   1 
ATOM   2508  H  HB2  . MET A 1 181 ? -63.211  35.828  -9.514  1.00 85.74  ? 742  MET A HB2  1 
ATOM   2509  H  HB3  . MET A 1 181 ? -62.414  36.209  -10.828 1.00 85.74  ? 742  MET A HB3  1 
ATOM   2510  H  HG2  . MET A 1 181 ? -60.703  34.815  -10.271 1.00 56.70  ? 742  MET A HG2  1 
ATOM   2511  H  HG3  . MET A 1 181 ? -61.332  34.551  -8.833  1.00 56.70  ? 742  MET A HG3  1 
ATOM   2512  H  HE1  . MET A 1 181 ? -63.444  33.229  -12.488 1.00 50.23  ? 742  MET A HE1  1 
ATOM   2513  H  HE2  . MET A 1 181 ? -63.482  34.710  -11.913 1.00 50.23  ? 742  MET A HE2  1 
ATOM   2514  H  HE3  . MET A 1 181 ? -62.141  34.137  -12.543 1.00 50.23  ? 742  MET A HE3  1 
ATOM   2515  N  N    . LEU A 1 182 ? -62.842  38.526  -7.448  1.00 83.52  ? 743  LEU A N    1 
ATOM   2516  C  CA   . LEU A 1 182 ? -63.389  38.828  -6.130  1.00 78.12  ? 743  LEU A CA   1 
ATOM   2517  C  C    . LEU A 1 182 ? -63.781  40.299  -6.060  1.00 91.75  ? 743  LEU A C    1 
ATOM   2518  O  O    . LEU A 1 182 ? -63.388  41.095  -6.914  1.00 80.77  ? 743  LEU A O    1 
ATOM   2519  C  CB   . LEU A 1 182 ? -62.385  38.497  -5.020  1.00 73.07  ? 743  LEU A CB   1 
ATOM   2520  C  CG   . LEU A 1 182 ? -62.717  37.245  -4.202  1.00 90.05  ? 743  LEU A CG   1 
ATOM   2521  C  CD1  . LEU A 1 182 ? -61.469  36.621  -3.607  1.00 59.41  ? 743  LEU A CD1  1 
ATOM   2522  C  CD2  . LEU A 1 182 ? -63.711  37.583  -3.112  1.00 92.80  ? 743  LEU A CD2  1 
ATOM   2523  H  H    . LEU A 1 182 ? -62.907  39.182  -8.001  1.00 100.23 ? 743  LEU A H    1 
ATOM   2524  H  HA   . LEU A 1 182 ? -64.186  38.294  -5.985  1.00 93.74  ? 743  LEU A HA   1 
ATOM   2525  H  HB2  . LEU A 1 182 ? -61.513  38.360  -5.424  1.00 87.69  ? 743  LEU A HB2  1 
ATOM   2526  H  HB3  . LEU A 1 182 ? -62.345  39.247  -4.406  1.00 87.69  ? 743  LEU A HB3  1 
ATOM   2527  H  HG   . LEU A 1 182 ? -63.128  36.589  -4.786  1.00 108.06 ? 743  LEU A HG   1 
ATOM   2528  H  HD11 . LEU A 1 182 ? -61.721  35.834  -3.099  1.00 71.29  ? 743  LEU A HD11 1 
ATOM   2529  H  HD12 . LEU A 1 182 ? -60.868  36.372  -4.327  1.00 71.29  ? 743  LEU A HD12 1 
ATOM   2530  H  HD13 . LEU A 1 182 ? -61.039  37.268  -3.026  1.00 71.29  ? 743  LEU A HD13 1 
ATOM   2531  H  HD21 . LEU A 1 182 ? -63.909  36.780  -2.606  1.00 111.36 ? 743  LEU A HD21 1 
ATOM   2532  H  HD22 . LEU A 1 182 ? -63.324  38.255  -2.529  1.00 111.36 ? 743  LEU A HD22 1 
ATOM   2533  H  HD23 . LEU A 1 182 ? -64.522  37.926  -3.520  1.00 111.36 ? 743  LEU A HD23 1 
ATOM   2534  N  N    . GLU A 1 188 ? -67.753  38.569  -17.625 1.00 68.05  ? 749  GLU A N    1 
ATOM   2535  C  CA   . GLU A 1 188 ? -66.651  37.906  -16.936 1.00 91.47  ? 749  GLU A CA   1 
ATOM   2536  C  C    . GLU A 1 188 ? -66.198  36.668  -17.700 1.00 73.61  ? 749  GLU A C    1 
ATOM   2537  O  O    . GLU A 1 188 ? -66.975  35.737  -17.906 1.00 79.98  ? 749  GLU A O    1 
ATOM   2538  C  CB   . GLU A 1 188 ? -67.063  37.524  -15.515 1.00 83.60  ? 749  GLU A CB   1 
ATOM   2539  C  CG   . GLU A 1 188 ? -65.944  36.917  -14.693 1.00 77.07  ? 749  GLU A CG   1 
ATOM   2540  C  CD   . GLU A 1 188 ? -66.288  36.843  -13.222 1.00 89.53  ? 749  GLU A CD   1 
ATOM   2541  O  OE1  . GLU A 1 188 ? -67.483  36.984  -12.887 1.00 91.44  ? 749  GLU A OE1  1 
ATOM   2542  O  OE2  . GLU A 1 188 ? -65.365  36.653  -12.401 1.00 80.48  ? 749  GLU A OE2  1 
ATOM   2543  H  HA   . GLU A 1 188 ? -65.900  38.517  -16.879 1.00 109.76 ? 749  GLU A HA   1 
ATOM   2544  N  N    . ASN A 1 189 ? -64.932  36.663  -18.114 1.00 71.92  ? 750  ASN A N    1 
ATOM   2545  C  CA   . ASN A 1 189 ? -64.359  35.579  -18.911 1.00 69.74  ? 750  ASN A CA   1 
ATOM   2546  C  C    . ASN A 1 189 ? -63.001  35.215  -18.326 1.00 63.95  ? 750  ASN A C    1 
ATOM   2547  O  O    . ASN A 1 189 ? -61.956  35.581  -18.879 1.00 68.13  ? 750  ASN A O    1 
ATOM   2548  C  CB   . ASN A 1 189 ? -64.240  35.981  -20.382 1.00 77.94  ? 750  ASN A CB   1 
ATOM   2549  H  H    . ASN A 1 189 ? -64.372  37.292  -17.941 1.00 86.30  ? 750  ASN A H    1 
ATOM   2550  H  HA   . ASN A 1 189 ? -64.934  34.800  -18.854 1.00 83.69  ? 750  ASN A HA   1 
ATOM   2551  N  N    . PRO A 1 190 ? -62.978  34.500  -17.202 1.00 70.05  ? 751  PRO A N    1 
ATOM   2552  C  CA   . PRO A 1 190 ? -61.696  34.067  -16.636 1.00 48.66  ? 751  PRO A CA   1 
ATOM   2553  C  C    . PRO A 1 190 ? -60.987  33.076  -17.544 1.00 46.75  ? 751  PRO A C    1 
ATOM   2554  O  O    . PRO A 1 190 ? -61.610  32.371  -18.342 1.00 62.31  ? 751  PRO A O    1 
ATOM   2555  C  CB   . PRO A 1 190 ? -62.095  33.416  -15.308 1.00 52.18  ? 751  PRO A CB   1 
ATOM   2556  C  CG   . PRO A 1 190 ? -63.503  32.980  -15.515 1.00 60.37  ? 751  PRO A CG   1 
ATOM   2557  C  CD   . PRO A 1 190 ? -64.118  34.026  -16.397 1.00 60.35  ? 751  PRO A CD   1 
ATOM   2558  H  HA   . PRO A 1 190 ? -61.119  34.829  -16.468 1.00 58.39  ? 751  PRO A HA   1 
ATOM   2559  H  HB2  . PRO A 1 190 ? -61.521  32.655  -15.129 1.00 62.61  ? 751  PRO A HB2  1 
ATOM   2560  H  HB3  . PRO A 1 190 ? -62.038  34.068  -14.592 1.00 62.61  ? 751  PRO A HB3  1 
ATOM   2561  H  HG2  . PRO A 1 190 ? -63.515  32.114  -15.952 1.00 72.44  ? 751  PRO A HG2  1 
ATOM   2562  H  HG3  . PRO A 1 190 ? -63.961  32.940  -14.661 1.00 72.44  ? 751  PRO A HG3  1 
ATOM   2563  H  HD2  . PRO A 1 190 ? -64.795  33.632  -16.968 1.00 72.42  ? 751  PRO A HD2  1 
ATOM   2564  H  HD3  . PRO A 1 190 ? -64.479  34.750  -15.862 1.00 72.42  ? 751  PRO A HD3  1 
ATOM   2565  N  N    . THR A 1 191 ? -59.664  33.034  -17.416 1.00 46.79  ? 752  THR A N    1 
ATOM   2566  C  CA   . THR A 1 191 ? -58.839  32.126  -18.192 1.00 44.89  ? 752  THR A CA   1 
ATOM   2567  C  C    . THR A 1 191 ? -58.520  30.881  -17.372 1.00 39.42  ? 752  THR A C    1 
ATOM   2568  O  O    . THR A 1 191 ? -58.895  30.754  -16.205 1.00 46.38  ? 752  THR A O    1 
ATOM   2569  C  CB   . THR A 1 191 ? -57.548  32.814  -18.640 1.00 46.79  ? 752  THR A CB   1 
ATOM   2570  O  OG1  . THR A 1 191 ? -56.802  33.230  -17.491 1.00 62.49  ? 752  THR A OG1  1 
ATOM   2571  C  CG2  . THR A 1 191 ? -57.860  34.020  -19.503 1.00 49.04  ? 752  THR A CG2  1 
ATOM   2572  H  H    . THR A 1 191 ? -59.217  33.531  -16.875 1.00 56.15  ? 752  THR A H    1 
ATOM   2573  H  HA   . THR A 1 191 ? -59.326  31.851  -18.985 1.00 53.87  ? 752  THR A HA   1 
ATOM   2574  H  HB   . THR A 1 191 ? -57.017  32.193  -19.162 1.00 56.14  ? 752  THR A HB   1 
ATOM   2575  H  HG1  . THR A 1 191 ? -56.091  33.609  -17.731 1.00 74.98  ? 752  THR A HG1  1 
ATOM   2576  H  HG21 . THR A 1 191 ? -57.036  34.450  -19.782 1.00 58.85  ? 752  THR A HG21 1 
ATOM   2577  H  HG22 . THR A 1 191 ? -58.354  33.745  -20.291 1.00 58.85  ? 752  THR A HG22 1 
ATOM   2578  H  HG23 . THR A 1 191 ? -58.393  34.657  -19.003 1.00 58.85  ? 752  THR A HG23 1 
ATOM   2579  N  N    . TYR A 1 192 ? -57.792  29.956  -18.002 1.00 36.52  ? 753  TYR A N    1 
ATOM   2580  C  CA   . TYR A 1 192 ? -57.400  28.720  -17.335 1.00 39.02  ? 753  TYR A CA   1 
ATOM   2581  C  C    . TYR A 1 192 ? -56.632  28.990  -16.044 1.00 38.22  ? 753  TYR A C    1 
ATOM   2582  O  O    . TYR A 1 192 ? -56.665  28.167  -15.122 1.00 45.21  ? 753  TYR A O    1 
ATOM   2583  C  CB   . TYR A 1 192 ? -56.550  27.873  -18.284 1.00 45.70  ? 753  TYR A CB   1 
ATOM   2584  C  CG   . TYR A 1 192 ? -55.190  28.479  -18.558 1.00 34.39  ? 753  TYR A CG   1 
ATOM   2585  C  CD1  . TYR A 1 192 ? -55.040  29.530  -19.454 1.00 37.77  ? 753  TYR A CD1  1 
ATOM   2586  C  CD2  . TYR A 1 192 ? -54.056  28.008  -17.910 1.00 34.67  ? 753  TYR A CD2  1 
ATOM   2587  C  CE1  . TYR A 1 192 ? -53.798  30.093  -19.698 1.00 43.22  ? 753  TYR A CE1  1 
ATOM   2588  C  CE2  . TYR A 1 192 ? -52.810  28.564  -18.149 1.00 40.31  ? 753  TYR A CE2  1 
ATOM   2589  C  CZ   . TYR A 1 192 ? -52.691  29.608  -19.041 1.00 38.02  ? 753  TYR A CZ   1 
ATOM   2590  O  OH   . TYR A 1 192 ? -51.460  30.158  -19.281 1.00 49.58  ? 753  TYR A OH   1 
ATOM   2591  H  H    . TYR A 1 192 ? -57.515  30.023  -18.813 1.00 43.82  ? 753  TYR A H    1 
ATOM   2592  H  HA   . TYR A 1 192 ? -58.197  28.214  -17.111 1.00 46.82  ? 753  TYR A HA   1 
ATOM   2593  H  HB2  . TYR A 1 192 ? -56.413  26.998  -17.890 1.00 54.84  ? 753  TYR A HB2  1 
ATOM   2594  H  HB3  . TYR A 1 192 ? -57.015  27.786  -19.131 1.00 54.84  ? 753  TYR A HB3  1 
ATOM   2595  H  HD1  . TYR A 1 192 ? -55.787  29.863  -19.896 1.00 45.33  ? 753  TYR A HD1  1 
ATOM   2596  H  HD2  . TYR A 1 192 ? -54.134  27.306  -17.305 1.00 41.61  ? 753  TYR A HD2  1 
ATOM   2597  H  HE1  . TYR A 1 192 ? -53.714  30.796  -20.301 1.00 51.86  ? 753  TYR A HE1  1 
ATOM   2598  H  HE2  . TYR A 1 192 ? -52.059  28.237  -17.708 1.00 48.37  ? 753  TYR A HE2  1 
ATOM   2599  H  HH   . TYR A 1 192 ? -51.527  30.777  -19.845 1.00 59.50  ? 753  TYR A HH   1 
ATOM   2600  N  N    . THR A 1 193 ? -55.952  30.140  -15.953 1.00 40.04  ? 754  THR A N    1 
ATOM   2601  C  CA   . THR A 1 193 ? -55.064  30.409  -14.822 1.00 36.78  ? 754  THR A CA   1 
ATOM   2602  C  C    . THR A 1 193 ? -55.805  30.399  -13.490 1.00 36.62  ? 754  THR A C    1 
ATOM   2603  O  O    . THR A 1 193 ? -55.203  30.102  -12.451 1.00 40.76  ? 754  THR A O    1 
ATOM   2604  C  CB   . THR A 1 193 ? -54.357  31.755  -15.015 1.00 34.90  ? 754  THR A CB   1 
ATOM   2605  O  OG1  . THR A 1 193 ? -55.327  32.790  -15.222 1.00 49.79  ? 754  THR A OG1  1 
ATOM   2606  C  CG2  . THR A 1 193 ? -53.421  31.700  -16.208 1.00 41.25  ? 754  THR A CG2  1 
ATOM   2607  H  H    . THR A 1 193 ? -55.989  30.775  -16.531 1.00 48.04  ? 754  THR A H    1 
ATOM   2608  H  HA   . THR A 1 193 ? -54.384  29.719  -14.787 1.00 44.13  ? 754  THR A HA   1 
ATOM   2609  H  HB   . THR A 1 193 ? -53.833  31.959  -14.224 1.00 41.88  ? 754  THR A HB   1 
ATOM   2610  H  HG1  . THR A 1 193 ? -55.786  32.622  -15.905 1.00 59.74  ? 754  THR A HG1  1 
ATOM   2611  H  HG21 . THR A 1 193 ? -52.979  32.556  -16.321 1.00 49.50  ? 754  THR A HG21 1 
ATOM   2612  H  HG22 . THR A 1 193 ? -52.749  31.014  -16.071 1.00 49.50  ? 754  THR A HG22 1 
ATOM   2613  H  HG23 . THR A 1 193 ? -53.922  31.495  -17.013 1.00 49.50  ? 754  THR A HG23 1 
ATOM   2614  N  N    . VAL A 1 194 ? -57.101  30.722  -13.496 1.00 33.44  ? 755  VAL A N    1 
ATOM   2615  C  CA   . VAL A 1 194 ? -57.892  30.671  -12.268 1.00 36.44  ? 755  VAL A CA   1 
ATOM   2616  C  C    . VAL A 1 194 ? -57.923  29.253  -11.714 1.00 33.07  ? 755  VAL A C    1 
ATOM   2617  O  O    . VAL A 1 194 ? -57.754  29.035  -10.507 1.00 30.53  ? 755  VAL A O    1 
ATOM   2618  C  CB   . VAL A 1 194 ? -59.314  31.202  -12.536 1.00 43.85  ? 755  VAL A CB   1 
ATOM   2619  C  CG1  . VAL A 1 194 ? -60.300  30.695  -11.486 1.00 50.31  ? 755  VAL A CG1  1 
ATOM   2620  C  CG2  . VAL A 1 194 ? -59.304  32.718  -12.576 1.00 43.03  ? 755  VAL A CG2  1 
ATOM   2621  H  H    . VAL A 1 194 ? -57.540  30.971  -14.192 1.00 40.12  ? 755  VAL A H    1 
ATOM   2622  H  HA   . VAL A 1 194 ? -57.479  31.244  -11.603 1.00 43.73  ? 755  VAL A HA   1 
ATOM   2623  H  HB   . VAL A 1 194 ? -59.610  30.882  -13.403 1.00 52.62  ? 755  VAL A HB   1 
ATOM   2624  H  HG11 . VAL A 1 194 ? -61.182  31.048  -11.686 1.00 60.37  ? 755  VAL A HG11 1 
ATOM   2625  H  HG12 . VAL A 1 194 ? -60.318  29.726  -11.512 1.00 60.37  ? 755  VAL A HG12 1 
ATOM   2626  H  HG13 . VAL A 1 194 ? -60.013  30.998  -10.611 1.00 60.37  ? 755  VAL A HG13 1 
ATOM   2627  H  HG21 . VAL A 1 194 ? -60.205  33.035  -12.746 1.00 51.63  ? 755  VAL A HG21 1 
ATOM   2628  H  HG22 . VAL A 1 194 ? -58.990  33.054  -11.722 1.00 51.63  ? 755  VAL A HG22 1 
ATOM   2629  H  HG23 . VAL A 1 194 ? -58.711  33.011  -13.286 1.00 51.63  ? 755  VAL A HG23 1 
ATOM   2630  N  N    . ASP A 1 195 ? -58.146  28.269  -12.588 1.00 32.92  ? 756  ASP A N    1 
ATOM   2631  C  CA   . ASP A 1 195 ? -58.217  26.882  -12.148 1.00 30.08  ? 756  ASP A CA   1 
ATOM   2632  C  C    . ASP A 1 195 ? -56.866  26.381  -11.656 1.00 28.67  ? 756  ASP A C    1 
ATOM   2633  O  O    . ASP A 1 195 ? -56.814  25.540  -10.754 1.00 40.31  ? 756  ASP A O    1 
ATOM   2634  C  CB   . ASP A 1 195 ? -58.722  25.989  -13.286 1.00 31.64  ? 756  ASP A CB   1 
ATOM   2635  C  CG   . ASP A 1 195 ? -60.160  26.291  -13.689 1.00 37.06  ? 756  ASP A CG   1 
ATOM   2636  O  OD1  . ASP A 1 195 ? -60.917  26.857  -12.871 1.00 42.02  ? 756  ASP A OD1  1 
ATOM   2637  O  OD2  . ASP A 1 195 ? -60.535  25.938  -14.828 1.00 40.07  ? 756  ASP A OD2  1 
ATOM   2638  H  H    . ASP A 1 195 ? -58.259  28.380  -13.433 1.00 39.51  ? 756  ASP A H    1 
ATOM   2639  H  HA   . ASP A 1 195 ? -58.846  26.816  -11.413 1.00 36.10  ? 756  ASP A HA   1 
ATOM   2640  H  HB2  . ASP A 1 195 ? -58.159  26.122  -14.065 1.00 37.97  ? 756  ASP A HB2  1 
ATOM   2641  H  HB3  . ASP A 1 195 ? -58.679  25.062  -13.002 1.00 37.97  ? 756  ASP A HB3  1 
ATOM   2642  N  N    . ILE A 1 196 ? -55.770  26.880  -12.230 1.00 25.24  ? 757  ILE A N    1 
ATOM   2643  C  CA   . ILE A 1 196 ? -54.441  26.439  -11.806 1.00 29.96  ? 757  ILE A CA   1 
ATOM   2644  C  C    . ILE A 1 196 ? -54.186  26.841  -10.361 1.00 33.28  ? 757  ILE A C    1 
ATOM   2645  O  O    . ILE A 1 196 ? -53.554  26.101  -9.597  1.00 33.72  ? 757  ILE A O    1 
ATOM   2646  C  CB   . ILE A 1 196 ? -53.365  27.004  -12.750 1.00 31.18  ? 757  ILE A CB   1 
ATOM   2647  C  CG1  . ILE A 1 196 ? -53.615  26.520  -14.185 1.00 34.12  ? 757  ILE A CG1  1 
ATOM   2648  C  CG2  . ILE A 1 196 ? -51.963  26.614  -12.270 1.00 47.41  ? 757  ILE A CG2  1 
ATOM   2649  C  CD1  . ILE A 1 196 ? -53.568  25.008  -14.366 1.00 32.49  ? 757  ILE A CD1  1 
ATOM   2650  H  H    . ILE A 1 196 ? -55.767  27.467  -12.859 1.00 30.28  ? 757  ILE A H    1 
ATOM   2651  H  HA   . ILE A 1 196 ? -54.402  25.471  -11.856 1.00 35.96  ? 757  ILE A HA   1 
ATOM   2652  H  HB   . ILE A 1 196 ? -53.430  27.971  -12.741 1.00 37.41  ? 757  ILE A HB   1 
ATOM   2653  H  HG12 . ILE A 1 196 ? -54.494  26.822  -14.463 1.00 40.95  ? 757  ILE A HG12 1 
ATOM   2654  H  HG13 . ILE A 1 196 ? -52.940  26.907  -14.764 1.00 40.95  ? 757  ILE A HG13 1 
ATOM   2655  H  HG21 . ILE A 1 196 ? -51.306  26.982  -12.882 1.00 56.90  ? 757  ILE A HG21 1 
ATOM   2656  H  HG22 . ILE A 1 196 ? -51.823  26.973  -11.380 1.00 56.90  ? 757  ILE A HG22 1 
ATOM   2657  H  HG23 . ILE A 1 196 ? -51.893  25.647  -12.252 1.00 56.90  ? 757  ILE A HG23 1 
ATOM   2658  H  HD11 . ILE A 1 196 ? -53.736  24.797  -15.297 1.00 38.98  ? 757  ILE A HD11 1 
ATOM   2659  H  HD12 . ILE A 1 196 ? -52.690  24.687  -14.107 1.00 38.98  ? 757  ILE A HD12 1 
ATOM   2660  H  HD13 . ILE A 1 196 ? -54.247  24.602  -13.806 1.00 38.98  ? 757  ILE A HD13 1 
ATOM   2661  N  N    . PHE A 1 197 ? -54.665  28.018  -9.960  1.00 29.91  ? 758  PHE A N    1 
ATOM   2662  C  CA   . PHE A 1 197 ? -54.523  28.426  -8.568  1.00 27.87  ? 758  PHE A CA   1 
ATOM   2663  C  C    . PHE A 1 197 ? -55.289  27.477  -7.658  1.00 38.39  ? 758  PHE A C    1 
ATOM   2664  O  O    . PHE A 1 197 ? -54.768  27.019  -6.634  1.00 28.43  ? 758  PHE A O    1 
ATOM   2665  C  CB   . PHE A 1 197 ? -55.011  29.864  -8.394  1.00 33.43  ? 758  PHE A CB   1 
ATOM   2666  C  CG   . PHE A 1 197 ? -54.929  30.367  -6.980  1.00 36.19  ? 758  PHE A CG   1 
ATOM   2667  C  CD1  . PHE A 1 197 ? -55.943  30.098  -6.074  1.00 39.28  ? 758  PHE A CD1  1 
ATOM   2668  C  CD2  . PHE A 1 197 ? -53.847  31.120  -6.561  1.00 36.97  ? 758  PHE A CD2  1 
ATOM   2669  C  CE1  . PHE A 1 197 ? -55.871  30.561  -4.773  1.00 32.66  ? 758  PHE A CE1  1 
ATOM   2670  C  CE2  . PHE A 1 197 ? -53.773  31.586  -5.263  1.00 35.54  ? 758  PHE A CE2  1 
ATOM   2671  C  CZ   . PHE A 1 197 ? -54.789  31.305  -4.369  1.00 30.61  ? 758  PHE A CZ   1 
ATOM   2672  H  H    . PHE A 1 197 ? -55.067  28.587  -10.465 1.00 35.89  ? 758  PHE A H    1 
ATOM   2673  H  HA   . PHE A 1 197 ? -53.586  28.392  -8.320  1.00 33.45  ? 758  PHE A HA   1 
ATOM   2674  H  HB2  . PHE A 1 197 ? -54.469  30.447  -8.948  1.00 40.12  ? 758  PHE A HB2  1 
ATOM   2675  H  HB3  . PHE A 1 197 ? -55.939  29.915  -8.673  1.00 40.12  ? 758  PHE A HB3  1 
ATOM   2676  H  HD1  . PHE A 1 197 ? -56.677  29.594  -6.342  1.00 47.13  ? 758  PHE A HD1  1 
ATOM   2677  H  HD2  . PHE A 1 197 ? -53.160  31.311  -7.158  1.00 44.36  ? 758  PHE A HD2  1 
ATOM   2678  H  HE1  . PHE A 1 197 ? -56.556  30.372  -4.173  1.00 39.20  ? 758  PHE A HE1  1 
ATOM   2679  H  HE2  . PHE A 1 197 ? -53.040  32.089  -4.991  1.00 42.65  ? 758  PHE A HE2  1 
ATOM   2680  H  HZ   . PHE A 1 197 ? -54.740  31.618  -3.495  1.00 36.74  ? 758  PHE A HZ   1 
ATOM   2681  N  N    . SER A 1 198 ? -56.534  27.167  -8.025  1.00 23.07  ? 759  SER A N    1 
ATOM   2682  C  CA   . SER A 1 198 ? -57.322  26.210  -7.261  1.00 25.47  ? 759  SER A CA   1 
ATOM   2683  C  C    . SER A 1 198 ? -56.629  24.857  -7.221  1.00 28.09  ? 759  SER A C    1 
ATOM   2684  O  O    . SER A 1 198 ? -56.520  24.230  -6.161  1.00 32.08  ? 759  SER A O    1 
ATOM   2685  C  CB   . SER A 1 198 ? -58.719  26.075  -7.875  1.00 35.58  ? 759  SER A CB   1 
ATOM   2686  O  OG   . SER A 1 198 ? -59.373  27.331  -7.968  1.00 39.23  ? 759  SER A OG   1 
ATOM   2687  H  H    . SER A 1 198 ? -56.940  27.496  -8.708  1.00 27.68  ? 759  SER A H    1 
ATOM   2688  H  HA   . SER A 1 198 ? -57.419  26.529  -6.350  1.00 30.56  ? 759  SER A HA   1 
ATOM   2689  H  HB2  . SER A 1 198 ? -58.635  25.699  -8.765  1.00 42.70  ? 759  SER A HB2  1 
ATOM   2690  H  HB3  . SER A 1 198 ? -59.250  25.486  -7.317  1.00 42.70  ? 759  SER A HB3  1 
ATOM   2691  H  HG   . SER A 1 198 ? -59.456  27.669  -7.204  1.00 47.08  ? 759  SER A HG   1 
ATOM   2692  N  N    . ALA A 1 199 ? -56.154  24.392  -8.377  1.00 27.00  ? 760  ALA A N    1 
ATOM   2693  C  CA   . ALA A 1 199 ? -55.426  23.132  -8.428  1.00 31.89  ? 760  ALA A CA   1 
ATOM   2694  C  C    . ALA A 1 199 ? -54.223  23.156  -7.497  1.00 23.92  ? 760  ALA A C    1 
ATOM   2695  O  O    . ALA A 1 199 ? -53.930  22.162  -6.822  1.00 28.83  ? 760  ALA A O    1 
ATOM   2696  C  CB   . ALA A 1 199 ? -54.986  22.845  -9.860  1.00 30.77  ? 760  ALA A CB   1 
ATOM   2697  H  H    . ALA A 1 199 ? -56.240  24.785  -9.137  1.00 32.40  ? 760  ALA A H    1 
ATOM   2698  H  HA   . ALA A 1 199 ? -56.013  22.414  -8.143  1.00 38.27  ? 760  ALA A HA   1 
ATOM   2699  H  HB1  . ALA A 1 199 ? -54.503  22.004  -9.879  1.00 36.92  ? 760  ALA A HB1  1 
ATOM   2700  H  HB2  . ALA A 1 199 ? -55.771  22.789  -10.426 1.00 36.92  ? 760  ALA A HB2  1 
ATOM   2701  H  HB3  . ALA A 1 199 ? -54.410  23.565  -10.163 1.00 36.92  ? 760  ALA A HB3  1 
ATOM   2702  N  N    . GLY A 1 200 ? -53.514  24.284  -7.444  1.00 31.37  ? 761  GLY A N    1 
ATOM   2703  C  CA   . GLY A 1 200 ? -52.369  24.380  -6.556  1.00 32.79  ? 761  GLY A CA   1 
ATOM   2704  C  C    . GLY A 1 200 ? -52.739  24.146  -5.106  1.00 33.23  ? 761  GLY A C    1 
ATOM   2705  O  O    . GLY A 1 200 ? -52.027  23.451  -4.377  1.00 29.07  ? 761  GLY A O    1 
ATOM   2706  H  H    . GLY A 1 200 ? -53.675  24.992  -7.905  1.00 37.65  ? 761  GLY A H    1 
ATOM   2707  H  HA2  . GLY A 1 200 ? -51.704  23.721  -6.813  1.00 39.34  ? 761  GLY A HA2  1 
ATOM   2708  H  HA3  . GLY A 1 200 ? -51.973  25.262  -6.633  1.00 39.34  ? 761  GLY A HA3  1 
ATOM   2709  N  N    . CYS A 1 201 ? -53.863  24.715  -4.671  1.00 29.13  ? 762  CYS A N    1 
ATOM   2710  C  CA   . CYS A 1 201 ? -54.330  24.467  -3.313  1.00 22.38  ? 762  CYS A CA   1 
ATOM   2711  C  C    . CYS A 1 201 ? -54.714  23.009  -3.128  1.00 29.31  ? 762  CYS A C    1 
ATOM   2712  O  O    . CYS A 1 201 ? -54.504  22.438  -2.052  1.00 29.61  ? 762  CYS A O    1 
ATOM   2713  C  CB   . CYS A 1 201 ? -55.509  25.381  -2.993  1.00 31.60  ? 762  CYS A CB   1 
ATOM   2714  S  SG   . CYS A 1 201 ? -55.075  27.139  -3.004  1.00 37.65  ? 762  CYS A SG   1 
ATOM   2715  H  H    . CYS A 1 201 ? -54.364  25.238  -5.134  1.00 34.96  ? 762  CYS A H    1 
ATOM   2716  H  HA   . CYS A 1 201 ? -53.614  24.671  -2.690  1.00 26.86  ? 762  CYS A HA   1 
ATOM   2717  H  HB2  . CYS A 1 201 ? -56.204  25.241  -3.656  1.00 37.91  ? 762  CYS A HB2  1 
ATOM   2718  H  HB3  . CYS A 1 201 ? -55.846  25.162  -2.110  1.00 37.91  ? 762  CYS A HB3  1 
ATOM   2719  H  HG   . CYS A 1 201 ? -54.667  27.434  -4.093  1.00 45.18  ? 762  CYS A HG   1 
ATOM   2720  N  N    . VAL A 1 202 ? -55.269  22.387  -4.170  1.00 34.80  ? 763  VAL A N    1 
ATOM   2721  C  CA   . VAL A 1 202 ? -55.664  20.987  -4.070  1.00 25.37  ? 763  VAL A CA   1 
ATOM   2722  C  C    . VAL A 1 202 ? -54.435  20.095  -3.942  1.00 30.73  ? 763  VAL A C    1 
ATOM   2723  O  O    . VAL A 1 202 ? -54.440  19.122  -3.179  1.00 32.23  ? 763  VAL A O    1 
ATOM   2724  C  CB   . VAL A 1 202 ? -56.528  20.592  -5.283  1.00 39.75  ? 763  VAL A CB   1 
ATOM   2725  C  CG1  . VAL A 1 202 ? -56.786  19.087  -5.307  1.00 30.09  ? 763  VAL A CG1  1 
ATOM   2726  C  CG2  . VAL A 1 202 ? -57.841  21.345  -5.261  1.00 31.49  ? 763  VAL A CG2  1 
ATOM   2727  H  H    . VAL A 1 202 ? -55.425  22.750  -4.934  1.00 41.76  ? 763  VAL A H    1 
ATOM   2728  H  HA   . VAL A 1 202 ? -56.201  20.869  -3.271  1.00 30.44  ? 763  VAL A HA   1 
ATOM   2729  H  HB   . VAL A 1 202 ? -56.059  20.830  -6.097  1.00 47.70  ? 763  VAL A HB   1 
ATOM   2730  H  HG11 . VAL A 1 202 ? -57.331  18.873  -6.080  1.00 36.11  ? 763  VAL A HG11 1 
ATOM   2731  H  HG12 . VAL A 1 202 ? -55.936  18.623  -5.361  1.00 36.11  ? 763  VAL A HG12 1 
ATOM   2732  H  HG13 . VAL A 1 202 ? -57.250  18.834  -4.493  1.00 36.11  ? 763  VAL A HG13 1 
ATOM   2733  H  HG21 . VAL A 1 202 ? -58.368  21.082  -6.031  1.00 37.79  ? 763  VAL A HG21 1 
ATOM   2734  H  HG22 . VAL A 1 202 ? -58.316  21.127  -4.444  1.00 37.79  ? 763  VAL A HG22 1 
ATOM   2735  H  HG23 . VAL A 1 202 ? -57.658  22.297  -5.293  1.00 37.79  ? 763  VAL A HG23 1 
ATOM   2736  N  N    . PHE A 1 203 ? -53.367  20.408  -4.685  1.00 23.31  ? 764  PHE A N    1 
ATOM   2737  C  CA   . PHE A 1 203 ? -52.134  19.628  -4.589  1.00 22.35  ? 764  PHE A CA   1 
ATOM   2738  C  C    . PHE A 1 203 ? -51.620  19.596  -3.154  1.00 29.26  ? 764  PHE A C    1 
ATOM   2739  O  O    . PHE A 1 203 ? -51.366  18.521  -2.595  1.00 26.72  ? 764  PHE A O    1 
ATOM   2740  C  CB   . PHE A 1 203 ? -51.066  20.207  -5.517  1.00 25.64  ? 764  PHE A CB   1 
ATOM   2741  C  CG   . PHE A 1 203 ? -51.151  19.723  -6.940  1.00 26.73  ? 764  PHE A CG   1 
ATOM   2742  C  CD1  . PHE A 1 203 ? -52.361  19.682  -7.608  1.00 30.26  ? 764  PHE A CD1  1 
ATOM   2743  C  CD2  . PHE A 1 203 ? -50.004  19.338  -7.622  1.00 30.23  ? 764  PHE A CD2  1 
ATOM   2744  C  CE1  . PHE A 1 203 ? -52.429  19.247  -8.924  1.00 30.11  ? 764  PHE A CE1  1 
ATOM   2745  C  CE2  . PHE A 1 203 ? -50.068  18.907  -8.937  1.00 28.66  ? 764  PHE A CE2  1 
ATOM   2746  C  CZ   . PHE A 1 203 ? -51.278  18.867  -9.587  1.00 30.18  ? 764  PHE A CZ   1 
ATOM   2747  H  H    . PHE A 1 203 ? -53.334  21.059  -5.246  1.00 27.97  ? 764  PHE A H    1 
ATOM   2748  H  HA   . PHE A 1 203 ? -52.312  18.716  -4.866  1.00 26.82  ? 764  PHE A HA   1 
ATOM   2749  H  HB2  . PHE A 1 203 ? -51.155  21.173  -5.528  1.00 30.77  ? 764  PHE A HB2  1 
ATOM   2750  H  HB3  . PHE A 1 203 ? -50.192  19.963  -5.174  1.00 30.77  ? 764  PHE A HB3  1 
ATOM   2751  H  HD1  . PHE A 1 203 ? -53.138  19.940  -7.168  1.00 36.31  ? 764  PHE A HD1  1 
ATOM   2752  H  HD2  . PHE A 1 203 ? -49.182  19.367  -7.189  1.00 36.28  ? 764  PHE A HD2  1 
ATOM   2753  H  HE1  . PHE A 1 203 ? -53.248  19.220  -9.362  1.00 36.13  ? 764  PHE A HE1  1 
ATOM   2754  H  HE2  . PHE A 1 203 ? -49.292  18.648  -9.380  1.00 34.39  ? 764  PHE A HE2  1 
ATOM   2755  H  HZ   . PHE A 1 203 ? -51.324  18.573  -10.468 1.00 36.21  ? 764  PHE A HZ   1 
ATOM   2756  N  N    . TYR A 1 204 ? -51.464  20.770  -2.537  1.00 26.11  ? 765  TYR A N    1 
ATOM   2757  C  CA   . TYR A 1 204 ? -51.008  20.823  -1.153  1.00 22.96  ? 765  TYR A CA   1 
ATOM   2758  C  C    . TYR A 1 204 ? -51.959  20.069  -0.234  1.00 28.07  ? 765  TYR A C    1 
ATOM   2759  O  O    . TYR A 1 204 ? -51.520  19.362  0.681   1.00 36.83  ? 765  TYR A O    1 
ATOM   2760  C  CB   . TYR A 1 204 ? -50.874  22.279  -0.713  1.00 31.39  ? 765  TYR A CB   1 
ATOM   2761  C  CG   . TYR A 1 204 ? -50.236  22.477  0.645   1.00 29.86  ? 765  TYR A CG   1 
ATOM   2762  C  CD1  . TYR A 1 204 ? -48.859  22.425  0.799   1.00 33.26  ? 765  TYR A CD1  1 
ATOM   2763  C  CD2  . TYR A 1 204 ? -51.011  22.738  1.764   1.00 29.08  ? 765  TYR A CD2  1 
ATOM   2764  C  CE1  . TYR A 1 204 ? -48.270  22.615  2.038   1.00 39.56  ? 765  TYR A CE1  1 
ATOM   2765  C  CE2  . TYR A 1 204 ? -50.434  22.932  3.005   1.00 42.41  ? 765  TYR A CE2  1 
ATOM   2766  C  CZ   . TYR A 1 204 ? -49.063  22.871  3.137   1.00 48.05  ? 765  TYR A CZ   1 
ATOM   2767  O  OH   . TYR A 1 204 ? -48.485  23.062  4.373   1.00 47.73  ? 765  TYR A OH   1 
ATOM   2768  H  H    . TYR A 1 204 ? -51.615  21.537  -2.895  1.00 31.33  ? 765  TYR A H    1 
ATOM   2769  H  HA   . TYR A 1 204 ? -50.134  20.407  -1.090  1.00 27.55  ? 765  TYR A HA   1 
ATOM   2770  H  HB2  . TYR A 1 204 ? -50.330  22.750  -1.364  1.00 37.66  ? 765  TYR A HB2  1 
ATOM   2771  H  HB3  . TYR A 1 204 ? -51.759  22.675  -0.682  1.00 37.66  ? 765  TYR A HB3  1 
ATOM   2772  H  HD1  . TYR A 1 204 ? -48.322  22.254  0.060   1.00 39.92  ? 765  TYR A HD1  1 
ATOM   2773  H  HD2  . TYR A 1 204 ? -51.936  22.782  1.679   1.00 34.89  ? 765  TYR A HD2  1 
ATOM   2774  H  HE1  . TYR A 1 204 ? -47.346  22.575  2.127   1.00 47.47  ? 765  TYR A HE1  1 
ATOM   2775  H  HE2  . TYR A 1 204 ? -50.968  23.103  3.747   1.00 50.89  ? 765  TYR A HE2  1 
ATOM   2776  H  HH   . TYR A 1 204 ? -49.080  23.208  4.948   1.00 57.28  ? 765  TYR A HH   1 
ATOM   2777  N  N    . TYR A 1 205 ? -53.266  20.190  -0.483  1.00 30.11  ? 766  TYR A N    1 
ATOM   2778  C  CA   . TYR A 1 205 ? -54.267  19.549  0.366   1.00 26.57  ? 766  TYR A CA   1 
ATOM   2779  C  C    . TYR A 1 205 ? -54.092  18.035  0.377   1.00 33.27  ? 766  TYR A C    1 
ATOM   2780  O  O    . TYR A 1 205 ? -54.224  17.390  1.426   1.00 31.34  ? 766  TYR A O    1 
ATOM   2781  C  CB   . TYR A 1 205 ? -55.668  19.953  -0.119  1.00 32.11  ? 766  TYR A CB   1 
ATOM   2782  C  CG   . TYR A 1 205 ? -56.826  19.325  0.624   1.00 34.77  ? 766  TYR A CG   1 
ATOM   2783  C  CD1  . TYR A 1 205 ? -57.289  19.867  1.814   1.00 33.08  ? 766  TYR A CD1  1 
ATOM   2784  C  CD2  . TYR A 1 205 ? -57.468  18.197  0.126   1.00 35.73  ? 766  TYR A CD2  1 
ATOM   2785  C  CE1  . TYR A 1 205 ? -58.351  19.298  2.491   1.00 31.92  ? 766  TYR A CE1  1 
ATOM   2786  C  CE2  . TYR A 1 205 ? -58.528  17.622  0.799   1.00 37.40  ? 766  TYR A CE2  1 
ATOM   2787  C  CZ   . TYR A 1 205 ? -58.966  18.176  1.981   1.00 33.74  ? 766  TYR A CZ   1 
ATOM   2788  O  OH   . TYR A 1 205 ? -60.022  17.609  2.656   1.00 38.69  ? 766  TYR A OH   1 
ATOM   2789  H  H    . TYR A 1 205 ? -53.597  20.638  -1.139  1.00 36.13  ? 766  TYR A H    1 
ATOM   2790  H  HA   . TYR A 1 205 ? -54.161  19.870  1.275   1.00 31.89  ? 766  TYR A HA   1 
ATOM   2791  H  HB2  . TYR A 1 205 ? -55.756  20.915  -0.034  1.00 38.53  ? 766  TYR A HB2  1 
ATOM   2792  H  HB3  . TYR A 1 205 ? -55.752  19.703  -1.053  1.00 38.53  ? 766  TYR A HB3  1 
ATOM   2793  H  HD1  . TYR A 1 205 ? -56.876  20.623  2.163   1.00 39.70  ? 766  TYR A HD1  1 
ATOM   2794  H  HD2  . TYR A 1 205 ? -57.174  17.819  -0.671  1.00 42.88  ? 766  TYR A HD2  1 
ATOM   2795  H  HE1  . TYR A 1 205 ? -58.648  19.670  3.290   1.00 38.30  ? 766  TYR A HE1  1 
ATOM   2796  H  HE2  . TYR A 1 205 ? -58.945  16.865  0.455   1.00 44.88  ? 766  TYR A HE2  1 
ATOM   2797  H  HH   . TYR A 1 205 ? -60.184  18.046  3.355   1.00 46.43  ? 766  TYR A HH   1 
ATOM   2798  N  N    . VAL A 1 206 ? -53.773  17.452  -0.774  1.00 27.62  ? 767  VAL A N    1 
ATOM   2799  C  CA   . VAL A 1 206 ? -53.573  16.010  -0.848  1.00 29.88  ? 767  VAL A CA   1 
ATOM   2800  C  C    . VAL A 1 206 ? -52.239  15.615  -0.220  1.00 28.51  ? 767  VAL A C    1 
ATOM   2801  O  O    . VAL A 1 206 ? -52.175  14.693  0.600   1.00 34.23  ? 767  VAL A O    1 
ATOM   2802  C  CB   . VAL A 1 206 ? -53.680  15.553  -2.315  1.00 31.28  ? 767  VAL A CB   1 
ATOM   2803  C  CG1  . VAL A 1 206 ? -53.243  14.100  -2.475  1.00 27.77  ? 767  VAL A CG1  1 
ATOM   2804  C  CG2  . VAL A 1 206 ? -55.116  15.744  -2.816  1.00 28.82  ? 767  VAL A CG2  1 
ATOM   2805  H  H    . VAL A 1 206 ? -53.668  17.866  -1.521  1.00 33.15  ? 767  VAL A H    1 
ATOM   2806  H  HA   . VAL A 1 206 ? -54.279  15.570  -0.348  1.00 35.86  ? 767  VAL A HA   1 
ATOM   2807  H  HB   . VAL A 1 206 ? -53.096  16.103  -2.861  1.00 37.54  ? 767  VAL A HB   1 
ATOM   2808  H  HG11 . VAL A 1 206 ? -53.323  13.848  -3.409  1.00 33.33  ? 767  VAL A HG11 1 
ATOM   2809  H  HG12 . VAL A 1 206 ? -52.321  14.015  -2.187  1.00 33.33  ? 767  VAL A HG12 1 
ATOM   2810  H  HG13 . VAL A 1 206 ? -53.814  13.537  -1.930  1.00 33.33  ? 767  VAL A HG13 1 
ATOM   2811  H  HG21 . VAL A 1 206 ? -55.169  15.453  -3.740  1.00 34.58  ? 767  VAL A HG21 1 
ATOM   2812  H  HG22 . VAL A 1 206 ? -55.714  15.214  -2.267  1.00 34.58  ? 767  VAL A HG22 1 
ATOM   2813  H  HG23 . VAL A 1 206 ? -55.350  16.683  -2.751  1.00 34.58  ? 767  VAL A HG23 1 
ATOM   2814  N  N    . ILE A 1 207 ? -51.157  16.309  -0.582  1.00 32.58  ? 768  ILE A N    1 
ATOM   2815  C  CA   . ILE A 1 207 ? -49.831  15.947  -0.081  1.00 28.33  ? 768  ILE A CA   1 
ATOM   2816  C  C    . ILE A 1 207 ? -49.750  16.143  1.429   1.00 34.45  ? 768  ILE A C    1 
ATOM   2817  O  O    . ILE A 1 207 ? -49.170  15.318  2.146   1.00 43.26  ? 768  ILE A O    1 
ATOM   2818  C  CB   . ILE A 1 207 ? -48.751  16.770  -0.807  1.00 36.48  ? 768  ILE A CB   1 
ATOM   2819  C  CG1  . ILE A 1 207 ? -48.760  16.466  -2.304  1.00 33.10  ? 768  ILE A CG1  1 
ATOM   2820  C  CG2  . ILE A 1 207 ? -47.374  16.490  -0.222  1.00 51.41  ? 768  ILE A CG2  1 
ATOM   2821  C  CD1  . ILE A 1 207 ? -47.982  17.482  -3.123  1.00 48.48  ? 768  ILE A CD1  1 
ATOM   2822  H  H    . ILE A 1 207 ? -51.164  16.987  -1.111  1.00 39.09  ? 768  ILE A H    1 
ATOM   2823  H  HA   . ILE A 1 207 ? -49.668  15.010  -0.270  1.00 33.99  ? 768  ILE A HA   1 
ATOM   2824  H  HB   . ILE A 1 207 ? -48.950  17.712  -0.684  1.00 43.78  ? 768  ILE A HB   1 
ATOM   2825  H  HG12 . ILE A 1 207 ? -48.361  15.594  -2.450  1.00 39.72  ? 768  ILE A HG12 1 
ATOM   2826  H  HG13 . ILE A 1 207 ? -49.678  16.467  -2.619  1.00 39.72  ? 768  ILE A HG13 1 
ATOM   2827  H  HG21 . ILE A 1 207 ? -46.716  17.021  -0.698  1.00 61.70  ? 768  ILE A HG21 1 
ATOM   2828  H  HG22 . ILE A 1 207 ? -47.376  16.729  0.718   1.00 61.70  ? 768  ILE A HG22 1 
ATOM   2829  H  HG23 . ILE A 1 207 ? -47.174  15.546  -0.324  1.00 61.70  ? 768  ILE A HG23 1 
ATOM   2830  H  HD11 . ILE A 1 207 ? -48.027  17.233  -4.060  1.00 58.17  ? 768  ILE A HD11 1 
ATOM   2831  H  HD12 . ILE A 1 207 ? -48.376  18.359  -2.995  1.00 58.17  ? 768  ILE A HD12 1 
ATOM   2832  H  HD13 . ILE A 1 207 ? -47.059  17.487  -2.826  1.00 58.17  ? 768  ILE A HD13 1 
ATOM   2833  N  N    . SER A 1 208 ? -50.320  17.237  1.935   1.00 39.35  ? 769  SER A N    1 
ATOM   2834  C  CA   . SER A 1 208 ? -50.285  17.552  3.358   1.00 33.61  ? 769  SER A CA   1 
ATOM   2835  C  C    . SER A 1 208 ? -51.357  16.817  4.150   1.00 39.49  ? 769  SER A C    1 
ATOM   2836  O  O    . SER A 1 208 ? -51.373  16.916  5.381   1.00 41.94  ? 769  SER A O    1 
ATOM   2837  C  CB   . SER A 1 208 ? -50.448  19.060  3.563   1.00 37.78  ? 769  SER A CB   1 
ATOM   2838  O  OG   . SER A 1 208 ? -51.698  19.503  3.062   1.00 46.97  ? 769  SER A OG   1 
ATOM   2839  H  H    . SER A 1 208 ? -50.740  17.821  1.464   1.00 47.22  ? 769  SER A H    1 
ATOM   2840  H  HA   . SER A 1 208 ? -49.421  17.294  3.716   1.00 40.33  ? 769  SER A HA   1 
ATOM   2841  H  HB2  . SER A 1 208 ? -50.400  19.257  4.511   1.00 45.33  ? 769  SER A HB2  1 
ATOM   2842  H  HB3  . SER A 1 208 ? -49.737  19.521  3.091   1.00 45.33  ? 769  SER A HB3  1 
ATOM   2843  H  HG   . SER A 1 208 ? -51.777  20.331  3.180   1.00 56.36  ? 769  SER A HG   1 
ATOM   2844  N  N    . GLU A 1 209 ? -52.226  16.061  3.480   1.00 43.33  ? 770  GLU A N    1 
ATOM   2845  C  CA   . GLU A 1 209 ? -53.296  15.322  4.143   1.00 40.32  ? 770  GLU A CA   1 
ATOM   2846  C  C    . GLU A 1 209 ? -54.220  16.253  4.934   1.00 38.41  ? 770  GLU A C    1 
ATOM   2847  O  O    . GLU A 1 209 ? -54.472  16.052  6.124   1.00 43.88  ? 770  GLU A O    1 
ATOM   2848  C  CB   . GLU A 1 209 ? -52.710  14.226  5.037   1.00 39.29  ? 770  GLU A CB   1 
ATOM   2849  C  CG   . GLU A 1 209 ? -51.780  13.273  4.290   1.00 42.70  ? 770  GLU A CG   1 
ATOM   2850  C  CD   . GLU A 1 209 ? -51.226  12.162  5.168   1.00 60.41  ? 770  GLU A CD   1 
ATOM   2851  O  OE1  . GLU A 1 209 ? -51.577  12.112  6.366   1.00 69.49  ? 770  GLU A OE1  1 
ATOM   2852  O  OE2  . GLU A 1 209 ? -50.438  11.336  4.658   1.00 63.54  ? 770  GLU A OE2  1 
ATOM   2853  H  H    . GLU A 1 209 ? -52.215  15.960  2.626   1.00 51.99  ? 770  GLU A H    1 
ATOM   2854  H  HA   . GLU A 1 209 ? -53.835  14.887  3.464   1.00 48.39  ? 770  GLU A HA   1 
ATOM   2855  H  HB2  . GLU A 1 209 ? -52.201  14.642  5.751   1.00 47.14  ? 770  GLU A HB2  1 
ATOM   2856  H  HB3  . GLU A 1 209 ? -53.437  13.703  5.410   1.00 47.14  ? 770  GLU A HB3  1 
ATOM   2857  H  HG2  . GLU A 1 209 ? -52.271  12.861  3.562   1.00 51.24  ? 770  GLU A HG2  1 
ATOM   2858  H  HG3  . GLU A 1 209 ? -51.029  13.777  3.938   1.00 51.24  ? 770  GLU A HG3  1 
ATOM   2859  N  N    . GLY A 1 210 ? -54.749  17.267  4.243   1.00 41.51  ? 771  GLY A N    1 
ATOM   2860  C  CA   . GLY A 1 210 ? -55.825  18.102  4.754   1.00 49.94  ? 771  GLY A CA   1 
ATOM   2861  C  C    . GLY A 1 210 ? -55.481  19.540  5.087   1.00 38.73  ? 771  GLY A C    1 
ATOM   2862  O  O    . GLY A 1 210 ? -56.400  20.312  5.385   1.00 50.50  ? 771  GLY A O    1 
ATOM   2863  H  H    . GLY A 1 210 ? -54.490  17.493  3.455   1.00 49.81  ? 771  GLY A H    1 
ATOM   2864  H  HA2  . GLY A 1 210 ? -56.540  18.117  4.098   1.00 59.93  ? 771  GLY A HA2  1 
ATOM   2865  H  HA3  . GLY A 1 210 ? -56.175  17.692  5.561   1.00 59.93  ? 771  GLY A HA3  1 
ATOM   2866  N  N    . SER A 1 211 ? -54.213  19.935  5.061   1.00 43.87  ? 772  SER A N    1 
ATOM   2867  C  CA   . SER A 1 211 ? -53.870  21.339  5.233   1.00 29.28  ? 772  SER A CA   1 
ATOM   2868  C  C    . SER A 1 211 ? -54.126  22.118  3.943   1.00 36.80  ? 772  SER A C    1 
ATOM   2869  O  O    . SER A 1 211 ? -54.181  21.554  2.850   1.00 44.39  ? 772  SER A O    1 
ATOM   2870  C  CB   . SER A 1 211 ? -52.411  21.497  5.664   1.00 47.81  ? 772  SER A CB   1 
ATOM   2871  O  OG   . SER A 1 211 ? -52.192  20.910  6.934   1.00 58.12  ? 772  SER A OG   1 
ATOM   2872  H  H    . SER A 1 211 ? -53.539  19.414  4.945   1.00 52.65  ? 772  SER A H    1 
ATOM   2873  H  HA   . SER A 1 211 ? -54.431  21.718  5.928   1.00 35.13  ? 772  SER A HA   1 
ATOM   2874  H  HB2  . SER A 1 211 ? -51.841  21.061  5.012   1.00 57.38  ? 772  SER A HB2  1 
ATOM   2875  H  HB3  . SER A 1 211 ? -52.197  22.442  5.712   1.00 57.38  ? 772  SER A HB3  1 
ATOM   2876  H  HG   . SER A 1 211 ? -51.388  21.004  7.159   1.00 69.75  ? 772  SER A HG   1 
ATOM   2877  N  N    . HIS A 1 212 ? -54.293  23.436  4.087   1.00 36.24  ? 773  HIS A N    1 
ATOM   2878  C  CA   . HIS A 1 212 ? -54.470  24.363  2.976   1.00 44.58  ? 773  HIS A CA   1 
ATOM   2879  C  C    . HIS A 1 212 ? -53.335  25.382  2.998   1.00 39.63  ? 773  HIS A C    1 
ATOM   2880  O  O    . HIS A 1 212 ? -52.905  25.787  4.083   1.00 44.01  ? 773  HIS A O    1 
ATOM   2881  C  CB   . HIS A 1 212 ? -55.832  25.089  3.090   1.00 38.23  ? 773  HIS A CB   1 
ATOM   2882  C  CG   . HIS A 1 212 ? -56.303  25.743  1.824   1.00 38.86  ? 773  HIS A CG   1 
ATOM   2883  N  ND1  . HIS A 1 212 ? -55.894  27.001  1.434   1.00 36.36  ? 773  HIS A ND1  1 
ATOM   2884  C  CD2  . HIS A 1 212 ? -57.194  25.337  0.888   1.00 45.60  ? 773  HIS A CD2  1 
ATOM   2885  C  CE1  . HIS A 1 212 ? -56.481  27.325  0.296   1.00 33.63  ? 773  HIS A CE1  1 
ATOM   2886  N  NE2  . HIS A 1 212 ? -57.280  26.335  -0.054  1.00 39.11  ? 773  HIS A NE2  1 
ATOM   2887  H  H    . HIS A 1 212 ? -54.308  23.826  4.853   1.00 43.49  ? 773  HIS A H    1 
ATOM   2888  H  HA   . HIS A 1 212 ? -54.441  23.880  2.136   1.00 53.50  ? 773  HIS A HA   1 
ATOM   2889  H  HB2  . HIS A 1 212 ? -56.505  24.443  3.355   1.00 45.87  ? 773  HIS A HB2  1 
ATOM   2890  H  HB3  . HIS A 1 212 ? -55.758  25.779  3.768   1.00 45.87  ? 773  HIS A HB3  1 
ATOM   2891  H  HD1  . HIS A 1 212 ? -55.326  27.490  1.856   1.00 43.64  ? 773  HIS A HD1  1 
ATOM   2892  H  HD2  . HIS A 1 212 ? -57.650  24.527  0.876   1.00 54.72  ? 773  HIS A HD2  1 
ATOM   2893  H  HE1  . HIS A 1 212 ? -56.362  28.120  -0.171  1.00 40.36  ? 773  HIS A HE1  1 
ATOM   2894  H  HE2  . HIS A 1 212 ? -57.772  26.315  -0.759  1.00 46.93  ? 773  HIS A HE2  1 
ATOM   2895  N  N    . PRO A 1 213 ? -52.832  25.825  1.839   1.00 31.25  ? 774  PRO A N    1 
ATOM   2896  C  CA   . PRO A 1 213 ? -51.684  26.752  1.860   1.00 38.37  ? 774  PRO A CA   1 
ATOM   2897  C  C    . PRO A 1 213 ? -51.974  28.075  2.542   1.00 44.38  ? 774  PRO A C    1 
ATOM   2898  O  O    . PRO A 1 213 ? -51.075  28.652  3.165   1.00 53.88  ? 774  PRO A O    1 
ATOM   2899  C  CB   . PRO A 1 213 ? -51.368  26.955  0.369   1.00 40.49  ? 774  PRO A CB   1 
ATOM   2900  C  CG   . PRO A 1 213 ? -51.978  25.792  -0.322  1.00 36.00  ? 774  PRO A CG   1 
ATOM   2901  C  CD   . PRO A 1 213 ? -53.199  25.442  0.464   1.00 43.22  ? 774  PRO A CD   1 
ATOM   2902  H  HA   . PRO A 1 213 ? -50.924  26.331  2.291   1.00 46.04  ? 774  PRO A HA   1 
ATOM   2903  H  HB2  . PRO A 1 213 ? -51.767  27.784  0.061   1.00 48.58  ? 774  PRO A HB2  1 
ATOM   2904  H  HB3  . PRO A 1 213 ? -50.407  26.967  0.238   1.00 48.58  ? 774  PRO A HB3  1 
ATOM   2905  H  HG2  . PRO A 1 213 ? -52.216  26.041  -1.229  1.00 43.20  ? 774  PRO A HG2  1 
ATOM   2906  H  HG3  . PRO A 1 213 ? -51.351  25.051  -0.326  1.00 43.20  ? 774  PRO A HG3  1 
ATOM   2907  H  HD2  . PRO A 1 213 ? -53.959  25.961  0.159   1.00 51.86  ? 774  PRO A HD2  1 
ATOM   2908  H  HD3  . PRO A 1 213 ? -53.374  24.489  0.413   1.00 51.86  ? 774  PRO A HD3  1 
ATOM   2909  N  N    . PHE A 1 214 ? -53.193  28.583  2.416   1.00 45.17  ? 775  PHE A N    1 
ATOM   2910  C  CA   . PHE A 1 214 ? -53.599  29.871  2.958   1.00 47.78  ? 775  PHE A CA   1 
ATOM   2911  C  C    . PHE A 1 214 ? -54.249  29.773  4.338   1.00 40.09  ? 775  PHE A C    1 
ATOM   2912  O  O    . PHE A 1 214 ? -54.809  30.769  4.812   1.00 43.41  ? 775  PHE A O    1 
ATOM   2913  C  CB   . PHE A 1 214 ? -54.515  30.579  1.963   1.00 35.65  ? 775  PHE A CB   1 
ATOM   2914  C  CG   . PHE A 1 214 ? -53.820  30.934  0.678   1.00 41.98  ? 775  PHE A CG   1 
ATOM   2915  C  CD1  . PHE A 1 214 ? -53.171  32.148  0.541   1.00 53.88  ? 775  PHE A CD1  1 
ATOM   2916  C  CD2  . PHE A 1 214 ? -53.785  30.040  -0.378  1.00 37.55  ? 775  PHE A CD2  1 
ATOM   2917  C  CE1  . PHE A 1 214 ? -52.515  32.472  -0.632  1.00 46.91  ? 775  PHE A CE1  1 
ATOM   2918  C  CE2  . PHE A 1 214 ? -53.131  30.360  -1.555  1.00 42.23  ? 775  PHE A CE2  1 
ATOM   2919  C  CZ   . PHE A 1 214 ? -52.493  31.576  -1.679  1.00 37.46  ? 775  PHE A CZ   1 
ATOM   2920  H  H    . PHE A 1 214 ? -53.829  28.180  2.001   1.00 54.20  ? 775  PHE A H    1 
ATOM   2921  H  HA   . PHE A 1 214 ? -52.806  30.420  3.056   1.00 57.34  ? 775  PHE A HA   1 
ATOM   2922  H  HB2  . PHE A 1 214 ? -55.259  29.995  1.749   1.00 42.78  ? 775  PHE A HB2  1 
ATOM   2923  H  HB3  . PHE A 1 214 ? -54.842  31.399  2.363   1.00 42.78  ? 775  PHE A HB3  1 
ATOM   2924  H  HD1  . PHE A 1 214 ? -53.180  32.755  1.245   1.00 64.65  ? 775  PHE A HD1  1 
ATOM   2925  H  HD2  . PHE A 1 214 ? -54.212  29.217  -0.298  1.00 45.06  ? 775  PHE A HD2  1 
ATOM   2926  H  HE1  . PHE A 1 214 ? -52.088  33.294  -0.714  1.00 56.29  ? 775  PHE A HE1  1 
ATOM   2927  H  HE2  . PHE A 1 214 ? -53.119  29.754  -2.260  1.00 50.67  ? 775  PHE A HE2  1 
ATOM   2928  H  HZ   . PHE A 1 214 ? -52.056  31.795  -2.470  1.00 44.95  ? 775  PHE A HZ   1 
ATOM   2929  N  N    . GLY A 1 215 ? -54.232  28.600  4.967   1.00 47.80  ? 776  GLY A N    1 
ATOM   2930  C  CA   . GLY A 1 215 ? -54.624  28.462  6.359   1.00 38.69  ? 776  GLY A CA   1 
ATOM   2931  C  C    . GLY A 1 215 ? -55.990  27.821  6.540   1.00 51.67  ? 776  GLY A C    1 
ATOM   2932  O  O    . GLY A 1 215 ? -56.542  27.177  5.644   1.00 44.54  ? 776  GLY A O    1 
ATOM   2933  H  H    . GLY A 1 215 ? -53.993  27.860  4.600   1.00 57.36  ? 776  GLY A H    1 
ATOM   2934  H  HA2  . GLY A 1 215 ? -53.969  27.919  6.823   1.00 46.42  ? 776  GLY A HA2  1 
ATOM   2935  H  HA3  . GLY A 1 215 ? -54.643  29.339  6.774   1.00 46.42  ? 776  GLY A HA3  1 
ATOM   2936  N  N    . LYS A 1 216 ? -56.495  27.945  7.767   1.00 50.95  ? 777  LYS A N    1 
ATOM   2937  C  CA   . LYS A 1 216 ? -57.760  27.330  8.138   1.00 42.93  ? 777  LYS A CA   1 
ATOM   2938  C  C    . LYS A 1 216 ? -58.907  27.942  7.337   1.00 46.66  ? 777  LYS A C    1 
ATOM   2939  O  O    . LYS A 1 216 ? -58.820  29.060  6.825   1.00 50.97  ? 777  LYS A O    1 
ATOM   2940  C  CB   . LYS A 1 216 ? -58.009  27.488  9.638   1.00 35.28  ? 777  LYS A CB   1 
ATOM   2941  H  H    . LYS A 1 216 ? -56.119  28.384  8.404   1.00 61.13  ? 777  LYS A H    1 
ATOM   2942  H  HA   . LYS A 1 216 ? -57.723  26.382  7.936   1.00 51.52  ? 777  LYS A HA   1 
ATOM   2943  N  N    . SER A 1 217 ? -60.001  27.180  7.247   1.00 46.91  ? 778  SER A N    1 
ATOM   2944  C  CA   . SER A 1 217 ? -61.077  27.470  6.300   1.00 57.17  ? 778  SER A CA   1 
ATOM   2945  C  C    . SER A 1 217 ? -61.540  28.924  6.359   1.00 44.80  ? 778  SER A C    1 
ATOM   2946  O  O    . SER A 1 217 ? -61.688  29.579  5.321   1.00 45.60  ? 778  SER A O    1 
ATOM   2947  C  CB   . SER A 1 217 ? -62.252  26.529  6.564   1.00 41.56  ? 778  SER A CB   1 
ATOM   2948  O  OG   . SER A 1 217 ? -62.644  26.589  7.924   1.00 62.69  ? 778  SER A OG   1 
ATOM   2949  H  H    . SER A 1 217 ? -60.143  26.483  7.730   1.00 56.29  ? 778  SER A H    1 
ATOM   2950  H  HA   . SER A 1 217 ? -60.756  27.298  5.401   1.00 68.60  ? 778  SER A HA   1 
ATOM   2951  H  HB2  . SER A 1 217 ? -63.001  26.793  6.007   1.00 49.87  ? 778  SER A HB2  1 
ATOM   2952  H  HB3  . SER A 1 217 ? -61.985  25.621  6.352   1.00 49.87  ? 778  SER A HB3  1 
ATOM   2953  H  HG   . SER A 1 217 ? -63.290  26.069  8.060   1.00 75.23  ? 778  SER A HG   1 
ATOM   2954  N  N    . LEU A 1 218 ? -61.785  29.447  7.563   1.00 45.25  ? 779  LEU A N    1 
ATOM   2955  C  CA   . LEU A 1 218 ? -62.343  30.794  7.668   1.00 43.79  ? 779  LEU A CA   1 
ATOM   2956  C  C    . LEU A 1 218 ? -61.327  31.881  7.334   1.00 41.68  ? 779  LEU A C    1 
ATOM   2957  O  O    . LEU A 1 218 ? -61.718  32.986  6.944   1.00 49.77  ? 779  LEU A O    1 
ATOM   2958  C  CB   . LEU A 1 218 ? -62.902  31.026  9.072   1.00 53.73  ? 779  LEU A CB   1 
ATOM   2959  C  CG   . LEU A 1 218 ? -64.272  30.436  9.406   1.00 57.87  ? 779  LEU A CG   1 
ATOM   2960  C  CD1  . LEU A 1 218 ? -64.687  30.904  10.789  1.00 64.34  ? 779  LEU A CD1  1 
ATOM   2961  C  CD2  . LEU A 1 218 ? -65.338  30.815  8.378   1.00 48.30  ? 779  LEU A CD2  1 
ATOM   2962  H  H    . LEU A 1 218 ? -61.640  29.054  8.314   1.00 54.30  ? 779  LEU A H    1 
ATOM   2963  H  HA   . LEU A 1 218 ? -63.079  30.875  7.041   1.00 52.54  ? 779  LEU A HA   1 
ATOM   2964  H  HB2  . LEU A 1 218 ? -62.271  30.654  9.708   1.00 64.47  ? 779  LEU A HB2  1 
ATOM   2965  H  HB3  . LEU A 1 218 ? -62.965  31.984  9.212   1.00 64.47  ? 779  LEU A HB3  1 
ATOM   2966  H  HG   . LEU A 1 218 ? -64.204  29.468  9.424   1.00 69.44  ? 779  LEU A HG   1 
ATOM   2967  H  HD11 . LEU A 1 218 ? -65.557  30.529  11.001  1.00 77.21  ? 779  LEU A HD11 1 
ATOM   2968  H  HD12 . LEU A 1 218 ? -64.030  30.601  11.435  1.00 77.21  ? 779  LEU A HD12 1 
ATOM   2969  H  HD13 . LEU A 1 218 ? -64.734  31.873  10.793  1.00 77.21  ? 779  LEU A HD13 1 
ATOM   2970  H  HD21 . LEU A 1 218 ? -66.183  30.416  8.638   1.00 57.96  ? 779  LEU A HD21 1 
ATOM   2971  H  HD22 . LEU A 1 218 ? -65.421  31.781  8.353   1.00 57.96  ? 779  LEU A HD22 1 
ATOM   2972  H  HD23 . LEU A 1 218 ? -65.068  30.483  7.507   1.00 57.96  ? 779  LEU A HD23 1 
ATOM   2973  N  N    . GLN A 1 219 ? -60.035  31.607  7.487   1.00 50.35  ? 780  GLN A N    1 
ATOM   2974  C  CA   . GLN A 1 219 ? -59.000  32.606  7.241   1.00 50.27  ? 780  GLN A CA   1 
ATOM   2975  C  C    . GLN A 1 219 ? -58.403  32.524  5.842   1.00 37.64  ? 780  GLN A C    1 
ATOM   2976  O  O    . GLN A 1 219 ? -57.502  33.304  5.525   1.00 55.71  ? 780  GLN A O    1 
ATOM   2977  C  CB   . GLN A 1 219 ? -57.887  32.486  8.290   1.00 51.50  ? 780  GLN A CB   1 
ATOM   2978  C  CG   . GLN A 1 219 ? -57.408  31.065  8.557   1.00 63.48  ? 780  GLN A CG   1 
ATOM   2979  C  CD   . GLN A 1 219 ? -56.268  30.988  9.565   1.00 68.51  ? 780  GLN A CD   1 
ATOM   2980  O  OE1  . GLN A 1 219 ? -55.433  30.083  9.497   1.00 54.87  ? 780  GLN A OE1  1 
ATOM   2981  N  NE2  . GLN A 1 219 ? -56.236  31.923  10.512  1.00 67.03  ? 780  GLN A NE2  1 
ATOM   2982  H  H    . GLN A 1 219 ? -59.729  30.842  7.735   1.00 60.42  ? 780  GLN A H    1 
ATOM   2983  H  HA   . GLN A 1 219 ? -59.396  33.486  7.336   1.00 60.32  ? 780  GLN A HA   1 
ATOM   2984  H  HB2  . GLN A 1 219 ? -57.123  33.001  7.989   1.00 61.79  ? 780  GLN A HB2  1 
ATOM   2985  H  HB3  . GLN A 1 219 ? -58.214  32.848  9.129   1.00 61.79  ? 780  GLN A HB3  1 
ATOM   2986  H  HG2  . GLN A 1 219 ? -58.149  30.545  8.906   1.00 76.18  ? 780  GLN A HG2  1 
ATOM   2987  H  HG3  . GLN A 1 219 ? -57.096  30.678  7.725   1.00 76.18  ? 780  GLN A HG3  1 
ATOM   2988  H  HE21 . GLN A 1 219 ? -56.841  32.533  10.534  1.00 80.44  ? 780  GLN A HE21 1 
ATOM   2989  H  HE22 . GLN A 1 219 ? -55.610  31.917  11.101  1.00 80.44  ? 780  GLN A HE22 1 
ATOM   2990  N  N    . ARG A 1 220 ? -58.893  31.618  4.992   1.00 60.33  ? 781  ARG A N    1 
ATOM   2991  C  CA   . ARG A 1 220 ? -58.249  31.384  3.701   1.00 41.13  ? 781  ARG A CA   1 
ATOM   2992  C  C    . ARG A 1 220 ? -58.427  32.567  2.757   1.00 42.54  ? 781  ARG A C    1 
ATOM   2993  O  O    . ARG A 1 220 ? -57.451  33.071  2.190   1.00 39.13  ? 781  ARG A O    1 
ATOM   2994  C  CB   . ARG A 1 220 ? -58.806  30.116  3.057   1.00 42.16  ? 781  ARG A CB   1 
ATOM   2995  C  CG   . ARG A 1 220 ? -58.662  28.879  3.922   1.00 50.40  ? 781  ARG A CG   1 
ATOM   2996  C  CD   . ARG A 1 220 ? -58.427  27.628  3.100   1.00 52.16  ? 781  ARG A CD   1 
ATOM   2997  N  NE   . ARG A 1 220 ? -59.616  26.803  2.908   1.00 63.32  ? 781  ARG A NE   1 
ATOM   2998  C  CZ   . ARG A 1 220 ? -59.856  25.651  3.531   1.00 54.12  ? 781  ARG A CZ   1 
ATOM   2999  N  NH1  . ARG A 1 220 ? -58.997  25.166  4.419   1.00 52.18  ? 781  ARG A NH1  1 
ATOM   3000  N  NH2  . ARG A 1 220 ? -60.970  24.979  3.267   1.00 66.66  ? 781  ARG A NH2  1 
ATOM   3001  H  H    . ARG A 1 220 ? -59.587  31.132  5.138   1.00 72.39  ? 781  ARG A H    1 
ATOM   3002  H  HA   . ARG A 1 220 ? -57.298  31.255  3.842   1.00 49.35  ? 781  ARG A HA   1 
ATOM   3003  H  HB2  . ARG A 1 220 ? -59.751  30.245  2.878   1.00 50.59  ? 781  ARG A HB2  1 
ATOM   3004  H  HB3  . ARG A 1 220 ? -58.333  29.954  2.226   1.00 50.59  ? 781  ARG A HB3  1 
ATOM   3005  H  HG2  . ARG A 1 220 ? -57.906  28.995  4.518   1.00 60.48  ? 781  ARG A HG2  1 
ATOM   3006  H  HG3  . ARG A 1 220 ? -59.476  28.754  4.435   1.00 60.48  ? 781  ARG A HG3  1 
ATOM   3007  H  HD2  . ARG A 1 220 ? -58.104  27.888  2.223   1.00 62.59  ? 781  ARG A HD2  1 
ATOM   3008  H  HD3  . ARG A 1 220 ? -57.759  27.084  3.546   1.00 62.59  ? 781  ARG A HD3  1 
ATOM   3009  H  HE   . ARG A 1 220 ? -60.208  27.083  2.350   1.00 75.99  ? 781  ARG A HE   1 
ATOM   3010  H  HH11 . ARG A 1 220 ? -58.272  25.594  4.594   1.00 62.62  ? 781  ARG A HH11 1 
ATOM   3011  H  HH12 . ARG A 1 220 ? -59.164  24.422  4.817   1.00 62.62  ? 781  ARG A HH12 1 
ATOM   3012  H  HH21 . ARG A 1 220 ? -61.533  25.287  2.696   1.00 79.99  ? 781  ARG A HH21 1 
ATOM   3013  H  HH22 . ARG A 1 220 ? -61.131  24.237  3.673   1.00 79.99  ? 781  ARG A HH22 1 
ATOM   3014  N  N    . GLN A 1 221 ? -59.669  33.015  2.562   1.00 53.17  ? 782  GLN A N    1 
ATOM   3015  C  CA   . GLN A 1 221 ? -59.945  33.974  1.498   1.00 40.11  ? 782  GLN A CA   1 
ATOM   3016  C  C    . GLN A 1 221 ? -59.280  35.315  1.770   1.00 39.03  ? 782  GLN A C    1 
ATOM   3017  O  O    . GLN A 1 221 ? -58.840  35.992  0.834   1.00 43.93  ? 782  GLN A O    1 
ATOM   3018  C  CB   . GLN A 1 221 ? -61.453  34.150  1.326   1.00 54.62  ? 782  GLN A CB   1 
ATOM   3019  C  CG   . GLN A 1 221 ? -61.864  34.546  -0.084  1.00 65.21  ? 782  GLN A CG   1 
ATOM   3020  C  CD   . GLN A 1 221 ? -61.530  33.472  -1.108  1.00 82.04  ? 782  GLN A CD   1 
ATOM   3021  O  OE1  . GLN A 1 221 ? -62.130  32.397  -1.114  1.00 73.87  ? 782  GLN A OE1  1 
ATOM   3022  N  NE2  . GLN A 1 221 ? -60.561  33.755  -1.975  1.00 67.55  ? 782  GLN A NE2  1 
ATOM   3023  H  H    . GLN A 1 221 ? -60.356  32.782  3.024   1.00 63.81  ? 782  GLN A H    1 
ATOM   3024  H  HA   . GLN A 1 221 ? -59.588  33.629  0.665   1.00 48.13  ? 782  GLN A HA   1 
ATOM   3025  H  HB2  . GLN A 1 221 ? -61.893  33.312  1.539   1.00 65.54  ? 782  GLN A HB2  1 
ATOM   3026  H  HB3  . GLN A 1 221 ? -61.759  34.845  1.931   1.00 65.54  ? 782  GLN A HB3  1 
ATOM   3027  H  HG2  . GLN A 1 221 ? -62.822  34.695  -0.106  1.00 78.25  ? 782  GLN A HG2  1 
ATOM   3028  H  HG3  . GLN A 1 221 ? -61.395  35.357  -0.335  1.00 78.25  ? 782  GLN A HG3  1 
ATOM   3029  H  HE21 . GLN A 1 221 ? -60.158  34.514  -1.937  1.00 81.06  ? 782  GLN A HE21 1 
ATOM   3030  H  HE22 . GLN A 1 221 ? -60.336  33.179  -2.573  1.00 81.06  ? 782  GLN A HE22 1 
ATOM   3031  N  N    . ALA A 1 222 ? -59.194  35.717  3.039   1.00 44.95  ? 783  ALA A N    1 
ATOM   3032  C  CA   . ALA A 1 222 ? -58.515  36.968  3.359   1.00 45.39  ? 783  ALA A CA   1 
ATOM   3033  C  C    . ALA A 1 222 ? -57.010  36.847  3.141   1.00 40.45  ? 783  ALA A C    1 
ATOM   3034  O  O    . ALA A 1 222 ? -56.375  37.779  2.633   1.00 41.57  ? 783  ALA A O    1 
ATOM   3035  C  CB   . ALA A 1 222 ? -58.827  37.384  4.796   1.00 34.94  ? 783  ALA A CB   1 
ATOM   3036  H  H    . ALA A 1 222 ? -59.514  35.295  3.716   1.00 53.94  ? 783  ALA A H    1 
ATOM   3037  H  HA   . ALA A 1 222 ? -58.845  37.664  2.769   1.00 54.46  ? 783  ALA A HA   1 
ATOM   3038  H  HB1  . ALA A 1 222 ? -58.367  38.216  4.991   1.00 41.93  ? 783  ALA A HB1  1 
ATOM   3039  H  HB2  . ALA A 1 222 ? -59.785  37.505  4.889   1.00 41.93  ? 783  ALA A HB2  1 
ATOM   3040  H  HB3  . ALA A 1 222 ? -58.521  36.688  5.399   1.00 41.93  ? 783  ALA A HB3  1 
ATOM   3041  N  N    . ASN A 1 223 ? -56.422  35.706  3.507   1.00 43.22  ? 784  ASN A N    1 
ATOM   3042  C  CA   . ASN A 1 223 ? -54.994  35.507  3.277   1.00 49.44  ? 784  ASN A CA   1 
ATOM   3043  C  C    . ASN A 1 223 ? -54.669  35.419  1.792   1.00 38.99  ? 784  ASN A C    1 
ATOM   3044  O  O    . ASN A 1 223 ? -53.540  35.716  1.386   1.00 43.21  ? 784  ASN A O    1 
ATOM   3045  C  CB   . ASN A 1 223 ? -54.514  34.248  3.999   1.00 47.58  ? 784  ASN A CB   1 
ATOM   3046  C  CG   . ASN A 1 223 ? -54.446  34.427  5.505   1.00 47.65  ? 784  ASN A CG   1 
ATOM   3047  O  OD1  . ASN A 1 223 ? -54.186  35.522  6.003   1.00 57.22  ? 784  ASN A OD1  1 
ATOM   3048  N  ND2  . ASN A 1 223 ? -54.672  33.343  6.238   1.00 46.96  ? 784  ASN A ND2  1 
ATOM   3049  H  H    . ASN A 1 223 ? -56.821  35.043  3.883   1.00 51.86  ? 784  ASN A H    1 
ATOM   3050  H  HA   . ASN A 1 223 ? -54.509  36.264  3.643   1.00 59.32  ? 784  ASN A HA   1 
ATOM   3051  H  HB2  . ASN A 1 223 ? -55.129  33.522  3.810   1.00 57.10  ? 784  ASN A HB2  1 
ATOM   3052  H  HB3  . ASN A 1 223 ? -53.626  34.021  3.683   1.00 57.10  ? 784  ASN A HB3  1 
ATOM   3053  H  HD21 . ASN A 1 223 ? -54.845  32.593  5.854   1.00 56.36  ? 784  ASN A HD21 1 
ATOM   3054  H  HD22 . ASN A 1 223 ? -54.644  33.392  7.096   1.00 56.36  ? 784  ASN A HD22 1 
ATOM   3055  N  N    . ILE A 1 224 ? -55.640  35.024  0.967   1.00 43.27  ? 785  ILE A N    1 
ATOM   3056  C  CA   . ILE A 1 224 ? -55.395  34.911  -0.468  1.00 49.98  ? 785  ILE A CA   1 
ATOM   3057  C  C    . ILE A 1 224 ? -55.241  36.286  -1.105  1.00 40.91  ? 785  ILE A C    1 
ATOM   3058  O  O    . ILE A 1 224 ? -54.471  36.451  -2.059  1.00 44.09  ? 785  ILE A O    1 
ATOM   3059  C  CB   . ILE A 1 224 ? -56.529  34.099  -1.125  1.00 38.69  ? 785  ILE A CB   1 
ATOM   3060  C  CG1  . ILE A 1 224 ? -56.355  32.611  -0.804  1.00 57.08  ? 785  ILE A CG1  1 
ATOM   3061  C  CG2  . ILE A 1 224 ? -56.546  34.305  -2.645  1.00 38.17  ? 785  ILE A CG2  1 
ATOM   3062  C  CD1  . ILE A 1 224 ? -57.518  31.733  -1.233  1.00 34.11  ? 785  ILE A CD1  1 
ATOM   3063  H  H    . ILE A 1 224 ? -56.438  34.819  1.210   1.00 51.93  ? 785  ILE A H    1 
ATOM   3064  H  HA   . ILE A 1 224 ? -54.566  34.426  -0.606  1.00 59.98  ? 785  ILE A HA   1 
ATOM   3065  H  HB   . ILE A 1 224 ? -57.377  34.399  -0.762  1.00 46.43  ? 785  ILE A HB   1 
ATOM   3066  H  HG12 . ILE A 1 224 ? -55.560  32.288  -1.255  1.00 68.50  ? 785  ILE A HG12 1 
ATOM   3067  H  HG13 . ILE A 1 224 ? -56.250  32.512  0.155   1.00 68.50  ? 785  ILE A HG13 1 
ATOM   3068  H  HG21 . ILE A 1 224 ? -57.269  33.783  -3.026  1.00 45.80  ? 785  ILE A HG21 1 
ATOM   3069  H  HG22 . ILE A 1 224 ? -56.682  35.247  -2.834  1.00 45.80  ? 785  ILE A HG22 1 
ATOM   3070  H  HG23 . ILE A 1 224 ? -55.697  34.013  -3.012  1.00 45.80  ? 785  ILE A HG23 1 
ATOM   3071  H  HD11 . ILE A 1 224 ? -57.325  30.813  -0.992  1.00 40.93  ? 785  ILE A HD11 1 
ATOM   3072  H  HD12 . ILE A 1 224 ? -58.323  32.031  -0.781  1.00 40.93  ? 785  ILE A HD12 1 
ATOM   3073  H  HD13 . ILE A 1 224 ? -57.632  31.807  -2.194  1.00 40.93  ? 785  ILE A HD13 1 
ATOM   3074  N  N    . LEU A 1 225 ? -55.956  37.293  -0.600  1.00 41.65  ? 786  LEU A N    1 
ATOM   3075  C  CA   . LEU A 1 225 ? -55.910  38.608  -1.230  1.00 50.74  ? 786  LEU A CA   1 
ATOM   3076  C  C    . LEU A 1 225 ? -54.592  39.323  -0.951  1.00 51.53  ? 786  LEU A C    1 
ATOM   3077  O  O    . LEU A 1 225 ? -54.067  40.022  -1.825  1.00 58.08  ? 786  LEU A O    1 
ATOM   3078  C  CB   . LEU A 1 225 ? -57.092  39.456  -0.761  1.00 54.45  ? 786  LEU A CB   1 
ATOM   3079  C  CG   . LEU A 1 225 ? -58.462  39.031  -1.298  1.00 70.49  ? 786  LEU A CG   1 
ATOM   3080  C  CD1  . LEU A 1 225 ? -59.548  39.886  -0.681  1.00 71.44  ? 786  LEU A CD1  1 
ATOM   3081  C  CD2  . LEU A 1 225 ? -58.522  39.119  -2.818  1.00 71.44  ? 786  LEU A CD2  1 
ATOM   3082  H  H    . LEU A 1 225 ? -56.465  37.240  0.091   1.00 49.98  ? 786  LEU A H    1 
ATOM   3083  H  HA   . LEU A 1 225 ? -55.989  38.497  -2.191  1.00 60.89  ? 786  LEU A HA   1 
ATOM   3084  H  HB2  . LEU A 1 225 ? -57.133  39.415  0.207   1.00 65.34  ? 786  LEU A HB2  1 
ATOM   3085  H  HB3  . LEU A 1 225 ? -56.942  40.372  -1.040  1.00 65.34  ? 786  LEU A HB3  1 
ATOM   3086  H  HG   . LEU A 1 225 ? -58.627  38.109  -1.045  1.00 84.59  ? 786  LEU A HG   1 
ATOM   3087  H  HD11 . LEU A 1 225 ? -60.408  39.604  -1.031  1.00 85.72  ? 786  LEU A HD11 1 
ATOM   3088  H  HD12 . LEU A 1 225 ? -59.529  39.774  0.282   1.00 85.72  ? 786  LEU A HD12 1 
ATOM   3089  H  HD13 . LEU A 1 225 ? -59.386  40.815  -0.910  1.00 85.72  ? 786  LEU A HD13 1 
ATOM   3090  H  HD21 . LEU A 1 225 ? -59.403  38.842  -3.115  1.00 85.73  ? 786  LEU A HD21 1 
ATOM   3091  H  HD22 . LEU A 1 225 ? -58.354  40.035  -3.087  1.00 85.73  ? 786  LEU A HD22 1 
ATOM   3092  H  HD23 . LEU A 1 225 ? -57.847  38.534  -3.195  1.00 85.73  ? 786  LEU A HD23 1 
ATOM   3093  N  N    . LEU A 1 226 ? -54.049  39.176  0.257   1.00 46.29  ? 787  LEU A N    1 
ATOM   3094  C  CA   . LEU A 1 226 ? -52.748  39.747  0.594   1.00 64.75  ? 787  LEU A CA   1 
ATOM   3095  C  C    . LEU A 1 226 ? -51.603  38.756  0.423   1.00 56.92  ? 787  LEU A C    1 
ATOM   3096  O  O    . LEU A 1 226 ? -50.455  39.102  0.711   1.00 76.99  ? 787  LEU A O    1 
ATOM   3097  C  CB   . LEU A 1 226 ? -52.758  40.306  2.021   1.00 60.61  ? 787  LEU A CB   1 
ATOM   3098  C  CG   . LEU A 1 226 ? -53.391  39.491  3.144   1.00 61.40  ? 787  LEU A CG   1 
ATOM   3099  C  CD1  . LEU A 1 226 ? -52.396  38.520  3.747   1.00 60.22  ? 787  LEU A CD1  1 
ATOM   3100  C  CD2  . LEU A 1 226 ? -53.933  40.431  4.196   1.00 59.01  ? 787  LEU A CD2  1 
ATOM   3101  H  H    . LEU A 1 226 ? -54.418  38.746  0.904   1.00 55.54  ? 787  LEU A H    1 
ATOM   3102  H  HA   . LEU A 1 226 ? -52.578  40.490  -0.006  1.00 77.70  ? 787  LEU A HA   1 
ATOM   3103  H  HB2  . LEU A 1 226 ? -51.836  40.462  2.279   1.00 72.73  ? 787  LEU A HB2  1 
ATOM   3104  H  HB3  . LEU A 1 226 ? -53.224  41.156  1.999   1.00 72.73  ? 787  LEU A HB3  1 
ATOM   3105  H  HG   . LEU A 1 226 ? -54.133  38.979  2.786   1.00 73.68  ? 787  LEU A HG   1 
ATOM   3106  H  HD11 . LEU A 1 226 ? -52.832  38.021  4.455   1.00 72.27  ? 787  LEU A HD11 1 
ATOM   3107  H  HD12 . LEU A 1 226 ? -52.089  37.913  3.055   1.00 72.27  ? 787  LEU A HD12 1 
ATOM   3108  H  HD13 . LEU A 1 226 ? -51.647  39.019  4.106   1.00 72.27  ? 787  LEU A HD13 1 
ATOM   3109  H  HD21 . LEU A 1 226 ? -54.335  39.910  4.908   1.00 70.82  ? 787  LEU A HD21 1 
ATOM   3110  H  HD22 . LEU A 1 226 ? -53.204  40.965  4.548   1.00 70.82  ? 787  LEU A HD22 1 
ATOM   3111  H  HD23 . LEU A 1 226 ? -54.600  41.007  3.791   1.00 70.82  ? 787  LEU A HD23 1 
ATOM   3112  N  N    . GLY A 1 227 ? -51.884  37.542  -0.036  1.00 62.31  ? 788  GLY A N    1 
ATOM   3113  C  CA   . GLY A 1 227 ? -50.834  36.631  -0.454  1.00 48.32  ? 788  GLY A CA   1 
ATOM   3114  C  C    . GLY A 1 227 ? -50.021  36.022  0.667   1.00 61.47  ? 788  GLY A C    1 
ATOM   3115  O  O    . GLY A 1 227 ? -48.799  35.871  0.528   1.00 57.46  ? 788  GLY A O    1 
ATOM   3116  H  H    . GLY A 1 227 ? -52.679  37.223  -0.114  1.00 74.77  ? 788  GLY A H    1 
ATOM   3117  H  HA2  . GLY A 1 227 ? -51.231  35.906  -0.961  1.00 57.98  ? 788  GLY A HA2  1 
ATOM   3118  H  HA3  . GLY A 1 227 ? -50.223  37.106  -1.040  1.00 57.98  ? 788  GLY A HA3  1 
ATOM   3119  N  N    . ALA A 1 228 ? -50.669  35.642  1.766   1.00 54.05  ? 789  ALA A N    1 
ATOM   3120  C  CA   . ALA A 1 228 ? -50.000  34.975  2.877   1.00 51.63  ? 789  ALA A CA   1 
ATOM   3121  C  C    . ALA A 1 228 ? -50.288  33.483  2.774   1.00 44.92  ? 789  ALA A C    1 
ATOM   3122  O  O    . ALA A 1 228 ? -51.413  33.041  3.028   1.00 57.15  ? 789  ALA A O    1 
ATOM   3123  C  CB   . ALA A 1 228 ? -50.480  35.536  4.213   1.00 44.08  ? 789  ALA A CB   1 
ATOM   3124  H  H    . ALA A 1 228 ? -51.511  35.763  1.892   1.00 64.86  ? 789  ALA A H    1 
ATOM   3125  H  HA   . ALA A 1 228 ? -49.042  35.111  2.810   1.00 61.95  ? 789  ALA A HA   1 
ATOM   3126  H  HB1  . ALA A 1 228 ? -50.019  35.075  4.932   1.00 52.90  ? 789  ALA A HB1  1 
ATOM   3127  H  HB2  . ALA A 1 228 ? -50.280  36.484  4.247   1.00 52.90  ? 789  ALA A HB2  1 
ATOM   3128  H  HB3  . ALA A 1 228 ? -51.436  35.396  4.289   1.00 52.90  ? 789  ALA A HB3  1 
ATOM   3129  N  N    . CYS A 1 229 ? -49.267  32.708  2.422   1.00 41.27  ? 790  CYS A N    1 
ATOM   3130  C  CA   . CYS A 1 229 ? -49.387  31.267  2.268   1.00 58.27  ? 790  CYS A CA   1 
ATOM   3131  C  C    . CYS A 1 229 ? -48.258  30.593  3.031   1.00 41.51  ? 790  CYS A C    1 
ATOM   3132  O  O    . CYS A 1 229 ? -47.165  31.148  3.172   1.00 36.11  ? 790  CYS A O    1 
ATOM   3133  C  CB   . CYS A 1 229 ? -49.348  30.851  0.794   1.00 43.59  ? 790  CYS A CB   1 
ATOM   3134  S  SG   . CYS A 1 229 ? -47.791  31.219  -0.009  1.00 48.33  ? 790  CYS A SG   1 
ATOM   3135  H  H    . CYS A 1 229 ? -48.475  33.004  2.264   1.00 49.53  ? 790  CYS A H    1 
ATOM   3136  H  HA   . CYS A 1 229 ? -50.230  30.972  2.647   1.00 69.92  ? 790  CYS A HA   1 
ATOM   3137  H  HB2  . CYS A 1 229 ? -49.494  29.894  0.735   1.00 52.30  ? 790  CYS A HB2  1 
ATOM   3138  H  HB3  . CYS A 1 229 ? -50.048  31.322  0.317   1.00 52.30  ? 790  CYS A HB3  1 
ATOM   3139  H  HG   . CYS A 1 229 ? -47.848  30.862  -1.153  1.00 57.99  ? 790  CYS A HG   1 
ATOM   3140  N  N    . SER A 1 230 ? -48.546  29.397  3.543   1.00 49.71  ? 791  SER A N    1 
ATOM   3141  C  CA   . SER A 1 230 ? -47.581  28.603  4.295   1.00 52.33  ? 791  SER A CA   1 
ATOM   3142  C  C    . SER A 1 230 ? -47.604  27.180  3.761   1.00 53.90  ? 791  SER A C    1 
ATOM   3143  O  O    . SER A 1 230 ? -48.630  26.497  3.845   1.00 58.25  ? 791  SER A O    1 
ATOM   3144  C  CB   . SER A 1 230 ? -47.896  28.623  5.793   1.00 51.47  ? 791  SER A CB   1 
ATOM   3145  O  OG   . SER A 1 230 ? -46.888  27.957  6.529   1.00 63.68  ? 791  SER A OG   1 
ATOM   3146  H  H    . SER A 1 230 ? -49.313  29.017  3.466   1.00 59.65  ? 791  SER A H    1 
ATOM   3147  H  HA   . SER A 1 230 ? -46.692  28.966  4.164   1.00 62.79  ? 791  SER A HA   1 
ATOM   3148  H  HB2  . SER A 1 230 ? -47.949  29.545  6.092   1.00 61.77  ? 791  SER A HB2  1 
ATOM   3149  H  HB3  . SER A 1 230 ? -48.744  28.177  5.943   1.00 61.77  ? 791  SER A HB3  1 
ATOM   3150  H  HG   . SER A 1 230 ? -47.071  27.974  7.349   1.00 76.41  ? 791  SER A HG   1 
ATOM   3151  N  N    . LEU A 1 231 ? -46.480  26.756  3.192   1.00 63.61  ? 792  LEU A N    1 
ATOM   3152  C  CA   . LEU A 1 231 ? -46.266  25.406  2.688   1.00 47.02  ? 792  LEU A CA   1 
ATOM   3153  C  C    . LEU A 1 231 ? -45.566  24.504  3.700   1.00 43.70  ? 792  LEU A C    1 
ATOM   3154  O  O    . LEU A 1 231 ? -45.116  23.414  3.337   1.00 58.81  ? 792  LEU A O    1 
ATOM   3155  C  CB   . LEU A 1 231 ? -45.495  25.458  1.369   1.00 51.56  ? 792  LEU A CB   1 
ATOM   3156  C  CG   . LEU A 1 231 ? -46.192  26.271  0.267   1.00 42.14  ? 792  LEU A CG   1 
ATOM   3157  C  CD1  . LEU A 1 231 ? -45.440  26.143  -1.044  1.00 57.44  ? 792  LEU A CD1  1 
ATOM   3158  C  CD2  . LEU A 1 231 ? -47.661  25.862  0.075   1.00 45.44  ? 792  LEU A CD2  1 
ATOM   3159  H  H    . LEU A 1 231 ? -45.794  27.262  3.082   1.00 76.34  ? 792  LEU A H    1 
ATOM   3160  H  HA   . LEU A 1 231 ? -47.131  25.011  2.501   1.00 56.43  ? 792  LEU A HA   1 
ATOM   3161  H  HB2  . LEU A 1 231 ? -44.628  25.861  1.531   1.00 61.87  ? 792  LEU A HB2  1 
ATOM   3162  H  HB3  . LEU A 1 231 ? -45.379  24.552  1.040   1.00 61.87  ? 792  LEU A HB3  1 
ATOM   3163  H  HG   . LEU A 1 231 ? -46.181  27.207  0.521   1.00 50.57  ? 792  LEU A HG   1 
ATOM   3164  H  HD11 . LEU A 1 231 ? -45.898  26.664  -1.722  1.00 68.93  ? 792  LEU A HD11 1 
ATOM   3165  H  HD12 . LEU A 1 231 ? -44.537  26.477  -0.923  1.00 68.93  ? 792  LEU A HD12 1 
ATOM   3166  H  HD13 . LEU A 1 231 ? -45.416  25.209  -1.304  1.00 68.93  ? 792  LEU A HD13 1 
ATOM   3167  H  HD21 . LEU A 1 231 ? -48.050  26.404  -0.629  1.00 54.53  ? 792  LEU A HD21 1 
ATOM   3168  H  HD22 . LEU A 1 231 ? -47.697  24.924  -0.171  1.00 54.53  ? 792  LEU A HD22 1 
ATOM   3169  H  HD23 . LEU A 1 231 ? -48.139  26.005  0.907   1.00 54.53  ? 792  LEU A HD23 1 
ATOM   3170  N  N    . ASP A 1 232 ? -45.415  24.961  4.943   1.00 59.26  ? 793  ASP A N    1 
ATOM   3171  C  CA   . ASP A 1 232 ? -44.474  24.386  5.900   1.00 51.05  ? 793  ASP A CA   1 
ATOM   3172  C  C    . ASP A 1 232 ? -44.680  22.897  6.176   1.00 55.29  ? 793  ASP A C    1 
ATOM   3173  O  O    . ASP A 1 232 ? -43.804  22.289  6.800   1.00 57.01  ? 793  ASP A O    1 
ATOM   3174  C  CB   . ASP A 1 232 ? -44.555  25.156  7.223   1.00 72.69  ? 793  ASP A CB   1 
ATOM   3175  C  CG   . ASP A 1 232 ? -45.990  25.389  7.684   1.00 90.14  ? 793  ASP A CG   1 
ATOM   3176  O  OD1  . ASP A 1 232 ? -46.894  24.654  7.234   1.00 82.03  ? 793  ASP A OD1  1 
ATOM   3177  O  OD2  . ASP A 1 232 ? -46.212  26.313  8.495   1.00 105.74 ? 793  ASP A OD2  1 
ATOM   3178  H  H    . ASP A 1 232 ? -45.861  25.623  5.263   1.00 71.12  ? 793  ASP A H    1 
ATOM   3179  H  HA   . ASP A 1 232 ? -43.575  24.496  5.551   1.00 61.26  ? 793  ASP A HA   1 
ATOM   3180  H  HB2  . ASP A 1 232 ? -44.097  24.650  7.912   1.00 87.23  ? 793  ASP A HB2  1 
ATOM   3181  H  HB3  . ASP A 1 232 ? -44.132  26.022  7.111   1.00 87.23  ? 793  ASP A HB3  1 
ATOM   3182  N  N    . CYS A 1 233 ? -45.798  22.290  5.762   1.00 48.29  ? 794  CYS A N    1 
ATOM   3183  C  CA   . CYS A 1 233 ? -45.898  20.831  5.840   1.00 44.82  ? 794  CYS A CA   1 
ATOM   3184  C  C    . CYS A 1 233 ? -44.863  20.138  4.959   1.00 44.44  ? 794  CYS A C    1 
ATOM   3185  O  O    . CYS A 1 233 ? -44.619  18.938  5.133   1.00 50.03  ? 794  CYS A O    1 
ATOM   3186  C  CB   . CYS A 1 233 ? -47.296  20.350  5.444   1.00 51.77  ? 794  CYS A CB   1 
ATOM   3187  S  SG   . CYS A 1 233 ? -48.575  20.603  6.704   1.00 74.64  ? 794  CYS A SG   1 
ATOM   3188  H  H    . CYS A 1 233 ? -46.491  22.687  5.443   1.00 57.95  ? 794  CYS A H    1 
ATOM   3189  H  HA   . CYS A 1 233 ? -45.738  20.557  6.757   1.00 53.79  ? 794  CYS A HA   1 
ATOM   3190  H  HB2  . CYS A 1 233 ? -47.572  20.826  4.646   1.00 62.13  ? 794  CYS A HB2  1 
ATOM   3191  H  HB3  . CYS A 1 233 ? -47.253  19.399  5.257   1.00 62.13  ? 794  CYS A HB3  1 
ATOM   3192  H  HG   . CYS A 1 233 ? -49.622  20.191  6.287   1.00 89.57  ? 794  CYS A HG   1 
ATOM   3193  N  N    . LEU A 1 234 ? -44.261  20.862  4.019   1.00 41.49  ? 795  LEU A N    1 
ATOM   3194  C  CA   . LEU A 1 234 ? -43.212  20.336  3.156   1.00 42.09  ? 795  LEU A CA   1 
ATOM   3195  C  C    . LEU A 1 234 ? -41.854  20.616  3.783   1.00 46.33  ? 795  LEU A C    1 
ATOM   3196  O  O    . LEU A 1 234 ? -41.544  21.766  4.115   1.00 41.56  ? 795  LEU A O    1 
ATOM   3197  C  CB   . LEU A 1 234 ? -43.290  20.980  1.771   1.00 40.66  ? 795  LEU A CB   1 
ATOM   3198  C  CG   . LEU A 1 234 ? -44.611  20.809  1.024   1.00 34.27  ? 795  LEU A CG   1 
ATOM   3199  C  CD1  . LEU A 1 234 ? -44.624  21.666  -0.235  1.00 37.11  ? 795  LEU A CD1  1 
ATOM   3200  C  CD2  . LEU A 1 234 ? -44.854  19.340  0.683   1.00 37.56  ? 795  LEU A CD2  1 
ATOM   3201  H  H    . LEU A 1 234 ? -44.451  21.686  3.860   1.00 49.79  ? 795  LEU A H    1 
ATOM   3202  H  HA   . LEU A 1 234 ? -43.319  19.377  3.059   1.00 50.51  ? 795  LEU A HA   1 
ATOM   3203  H  HB2  . LEU A 1 234 ? -43.135  21.932  1.868   1.00 48.80  ? 795  LEU A HB2  1 
ATOM   3204  H  HB3  . LEU A 1 234 ? -42.593  20.595  1.216   1.00 48.80  ? 795  LEU A HB3  1 
ATOM   3205  H  HG   . LEU A 1 234 ? -45.336  21.106  1.596   1.00 41.12  ? 795  LEU A HG   1 
ATOM   3206  H  HD11 . LEU A 1 234 ? -45.470  21.542  -0.692  1.00 44.53  ? 795  LEU A HD11 1 
ATOM   3207  H  HD12 . LEU A 1 234 ? -44.516  22.597  0.017   1.00 44.53  ? 795  LEU A HD12 1 
ATOM   3208  H  HD13 . LEU A 1 234 ? -43.893  21.392  -0.810  1.00 44.53  ? 795  LEU A HD13 1 
ATOM   3209  H  HD21 . LEU A 1 234 ? -45.697  19.262  0.210   1.00 45.07  ? 795  LEU A HD21 1 
ATOM   3210  H  HD22 . LEU A 1 234 ? -44.129  19.023  0.122   1.00 45.07  ? 795  LEU A HD22 1 
ATOM   3211  H  HD23 . LEU A 1 234 ? -44.885  18.827  1.505   1.00 45.07  ? 795  LEU A HD23 1 
ATOM   3212  N  N    . HIS A 1 235 ? -41.046  19.568  3.936   1.00 39.60  ? 796  HIS A N    1 
ATOM   3213  C  CA   . HIS A 1 235 ? -39.739  19.717  4.568   1.00 51.99  ? 796  HIS A CA   1 
ATOM   3214  C  C    . HIS A 1 235 ? -38.766  20.404  3.612   1.00 34.82  ? 796  HIS A C    1 
ATOM   3215  O  O    . HIS A 1 235 ? -38.725  20.071  2.424   1.00 49.94  ? 796  HIS A O    1 
ATOM   3216  C  CB   . HIS A 1 235 ? -39.173  18.356  4.982   1.00 52.37  ? 796  HIS A CB   1 
ATOM   3217  C  CG   . HIS A 1 235 ? -38.146  18.436  6.070   1.00 37.87  ? 796  HIS A CG   1 
ATOM   3218  N  ND1  . HIS A 1 235 ? -36.800  18.590  5.818   1.00 47.25  ? 796  HIS A ND1  1 
ATOM   3219  C  CD2  . HIS A 1 235 ? -38.273  18.392  7.418   1.00 41.29  ? 796  HIS A CD2  1 
ATOM   3220  C  CE1  . HIS A 1 235 ? -36.141  18.633  6.962   1.00 37.27  ? 796  HIS A CE1  1 
ATOM   3221  N  NE2  . HIS A 1 235 ? -37.012  18.516  7.948   1.00 48.48  ? 796  HIS A NE2  1 
ATOM   3222  H  H    . HIS A 1 235 ? -41.230  18.766  3.684   1.00 47.52  ? 796  HIS A H    1 
ATOM   3223  H  HA   . HIS A 1 235 ? -39.827  20.267  5.362   1.00 62.39  ? 796  HIS A HA   1 
ATOM   3224  H  HB2  . HIS A 1 235 ? -39.900  17.799  5.300   1.00 62.85  ? 796  HIS A HB2  1 
ATOM   3225  H  HB3  . HIS A 1 235 ? -38.755  17.943  4.210   1.00 62.85  ? 796  HIS A HB3  1 
ATOM   3226  H  HD1  . HIS A 1 235 ? -36.444  18.647  5.037   1.00 56.70  ? 796  HIS A HD1  1 
ATOM   3227  H  HD2  . HIS A 1 235 ? -39.065  18.296  7.895   1.00 49.54  ? 796  HIS A HD2  1 
ATOM   3228  H  HE1  . HIS A 1 235 ? -35.221  18.730  7.057   1.00 44.72  ? 796  HIS A HE1  1 
ATOM   3229  H  HE2  . HIS A 1 235 ? -36.820  18.516  8.787   1.00 58.17  ? 796  HIS A HE2  1 
ATOM   3230  N  N    . PRO A 1 236 ? -37.958  21.352  4.098   1.00 48.85  ? 797  PRO A N    1 
ATOM   3231  C  CA   . PRO A 1 236 ? -37.047  22.062  3.179   1.00 52.34  ? 797  PRO A CA   1 
ATOM   3232  C  C    . PRO A 1 236 ? -35.930  21.200  2.613   1.00 48.23  ? 797  PRO A C    1 
ATOM   3233  O  O    . PRO A 1 236 ? -35.492  21.440  1.481   1.00 59.43  ? 797  PRO A O    1 
ATOM   3234  C  CB   . PRO A 1 236 ? -36.499  23.198  4.051   1.00 38.13  ? 797  PRO A CB   1 
ATOM   3235  C  CG   . PRO A 1 236 ? -36.624  22.700  5.441   1.00 49.26  ? 797  PRO A CG   1 
ATOM   3236  C  CD   . PRO A 1 236 ? -37.874  21.881  5.470   1.00 47.89  ? 797  PRO A CD   1 
ATOM   3237  H  HA   . PRO A 1 236 ? -37.551  22.445  2.444   1.00 62.81  ? 797  PRO A HA   1 
ATOM   3238  H  HB2  . PRO A 1 236 ? -35.570  23.364  3.827   1.00 45.75  ? 797  PRO A HB2  1 
ATOM   3239  H  HB3  . PRO A 1 236 ? -37.033  23.997  3.922   1.00 45.75  ? 797  PRO A HB3  1 
ATOM   3240  H  HG2  . PRO A 1 236 ? -35.853  22.153  5.661   1.00 59.11  ? 797  PRO A HG2  1 
ATOM   3241  H  HG3  . PRO A 1 236 ? -36.694  23.451  6.050   1.00 59.11  ? 797  PRO A HG3  1 
ATOM   3242  H  HD2  . PRO A 1 236 ? -37.789  21.156  6.109   1.00 57.47  ? 797  PRO A HD2  1 
ATOM   3243  H  HD3  . PRO A 1 236 ? -38.641  22.442  5.665   1.00 57.47  ? 797  PRO A HD3  1 
ATOM   3244  N  N    . GLU A 1 237 ? -35.400  20.260  3.394   1.00 47.61  ? 798  GLU A N    1 
ATOM   3245  C  CA   . GLU A 1 237 ? -34.287  19.412  2.976   1.00 47.83  ? 798  GLU A CA   1 
ATOM   3246  C  C    . GLU A 1 237 ? -34.699  18.027  2.470   1.00 54.11  ? 798  GLU A C    1 
ATOM   3247  O  O    . GLU A 1 237 ? -33.829  17.170  2.288   1.00 50.32  ? 798  GLU A O    1 
ATOM   3248  C  CB   . GLU A 1 237 ? -33.268  19.293  4.106   1.00 49.62  ? 798  GLU A CB   1 
ATOM   3249  C  CG   . GLU A 1 237 ? -32.469  20.579  4.340   1.00 62.56  ? 798  GLU A CG   1 
ATOM   3250  C  CD   . GLU A 1 237 ? -31.785  21.117  3.090   1.00 69.28  ? 798  GLU A CD   1 
ATOM   3251  O  OE1  . GLU A 1 237 ? -31.169  20.315  2.354   1.00 67.33  ? 798  GLU A OE1  1 
ATOM   3252  O  OE2  . GLU A 1 237 ? -31.863  22.341  2.847   1.00 54.92  ? 798  GLU A OE2  1 
ATOM   3253  H  H    . GLU A 1 237 ? -35.677  20.091  4.191   1.00 57.14  ? 798  GLU A H    1 
ATOM   3254  H  HA   . GLU A 1 237 ? -33.838  19.856  2.239   1.00 57.39  ? 798  GLU A HA   1 
ATOM   3255  H  HB2  . GLU A 1 237 ? -33.736  19.079  4.929   1.00 59.54  ? 798  GLU A HB2  1 
ATOM   3256  H  HB3  . GLU A 1 237 ? -32.640  18.587  3.890   1.00 59.54  ? 798  GLU A HB3  1 
ATOM   3257  H  HG2  . GLU A 1 237 ? -33.071  21.266  4.667   1.00 75.07  ? 798  GLU A HG2  1 
ATOM   3258  H  HG3  . GLU A 1 237 ? -31.782  20.403  5.001   1.00 75.07  ? 798  GLU A HG3  1 
ATOM   3259  N  N    . LYS A 1 238 ? -35.988  17.751  2.315   1.00 42.28  ? 799  LYS A N    1 
ATOM   3260  C  CA   . LYS A 1 238 ? -36.447  16.466  1.796   1.00 37.71  ? 799  LYS A CA   1 
ATOM   3261  C  C    . LYS A 1 238 ? -36.736  16.575  0.299   1.00 38.95  ? 799  LYS A C    1 
ATOM   3262  O  O    . LYS A 1 238 ? -37.571  17.384  -0.118  1.00 45.17  ? 799  LYS A O    1 
ATOM   3263  C  CB   . LYS A 1 238 ? -37.687  16.003  2.555   1.00 42.83  ? 799  LYS A CB   1 
ATOM   3264  C  CG   . LYS A 1 238 ? -38.111  14.593  2.232   1.00 42.36  ? 799  LYS A CG   1 
ATOM   3265  C  CD   . LYS A 1 238 ? -39.223  14.149  3.157   1.00 47.18  ? 799  LYS A CD   1 
ATOM   3266  C  CE   . LYS A 1 238 ? -39.815  12.817  2.727   1.00 54.31  ? 799  LYS A CE   1 
ATOM   3267  N  NZ   . LYS A 1 238 ? -41.028  12.475  3.531   1.00 68.81  ? 799  LYS A NZ   1 
ATOM   3268  H  H    . LYS A 1 238 ? -36.625  18.297  2.504   1.00 50.73  ? 799  LYS A H    1 
ATOM   3269  H  HA   . LYS A 1 238 ? -35.750  15.803  1.923   1.00 45.26  ? 799  LYS A HA   1 
ATOM   3270  H  HB2  . LYS A 1 238 ? -37.504  16.047  3.507   1.00 51.40  ? 799  LYS A HB2  1 
ATOM   3271  H  HB3  . LYS A 1 238 ? -38.425  16.593  2.336   1.00 51.40  ? 799  LYS A HB3  1 
ATOM   3272  H  HG2  . LYS A 1 238 ? -38.437  14.554  1.319   1.00 50.84  ? 799  LYS A HG2  1 
ATOM   3273  H  HG3  . LYS A 1 238 ? -37.357  13.993  2.348   1.00 50.84  ? 799  LYS A HG3  1 
ATOM   3274  H  HD2  . LYS A 1 238 ? -38.871  14.048  4.055   1.00 56.62  ? 799  LYS A HD2  1 
ATOM   3275  H  HD3  . LYS A 1 238 ? -39.931  14.812  3.147   1.00 56.62  ? 799  LYS A HD3  1 
ATOM   3276  H  HE2  . LYS A 1 238 ? -40.073  12.867  1.793   1.00 65.18  ? 799  LYS A HE2  1 
ATOM   3277  H  HE3  . LYS A 1 238 ? -39.157  12.116  2.856   1.00 65.18  ? 799  LYS A HE3  1 
ATOM   3278  H  HZ1  . LYS A 1 238 ? -41.359  11.693  3.264   1.00 82.58  ? 799  LYS A HZ1  1 
ATOM   3279  H  HZ2  . LYS A 1 238 ? -40.815  12.420  4.393   1.00 82.58  ? 799  LYS A HZ2  1 
ATOM   3280  H  HZ3  . LYS A 1 238 ? -41.649  13.103  3.426   1.00 82.58  ? 799  LYS A HZ3  1 
ATOM   3281  N  N    . HIS A 1 239 ? -36.069  15.733  -0.498  1.00 38.75  ? 800  HIS A N    1 
ATOM   3282  C  CA   . HIS A 1 239 ? -36.125  15.846  -1.957  1.00 31.20  ? 800  HIS A CA   1 
ATOM   3283  C  C    . HIS A 1 239 ? -37.558  15.857  -2.484  1.00 39.22  ? 800  HIS A C    1 
ATOM   3284  O  O    . HIS A 1 239 ? -37.928  16.729  -3.278  1.00 34.53  ? 800  HIS A O    1 
ATOM   3285  C  CB   . HIS A 1 239 ? -35.342  14.697  -2.591  1.00 31.98  ? 800  HIS A CB   1 
ATOM   3286  C  CG   . HIS A 1 239 ? -35.524  14.584  -4.075  1.00 31.53  ? 800  HIS A CG   1 
ATOM   3287  N  ND1  . HIS A 1 239 ? -36.252  13.571  -4.664  1.00 38.58  ? 800  HIS A ND1  1 
ATOM   3288  C  CD2  . HIS A 1 239 ? -35.066  15.355  -5.088  1.00 31.39  ? 800  HIS A CD2  1 
ATOM   3289  C  CE1  . HIS A 1 239 ? -36.236  13.725  -5.976  1.00 29.04  ? 800  HIS A CE1  1 
ATOM   3290  N  NE2  . HIS A 1 239 ? -35.523  14.801  -6.259  1.00 34.78  ? 800  HIS A NE2  1 
ATOM   3291  H  H    . HIS A 1 239 ? -35.577  15.086  -0.217  1.00 46.50  ? 800  HIS A H    1 
ATOM   3292  H  HA   . HIS A 1 239 ? -35.704  16.678  -2.223  1.00 37.44  ? 800  HIS A HA   1 
ATOM   3293  H  HB2  . HIS A 1 239 ? -34.397  14.830  -2.418  1.00 38.38  ? 800  HIS A HB2  1 
ATOM   3294  H  HB3  . HIS A 1 239 ? -35.635  13.862  -2.193  1.00 38.38  ? 800  HIS A HB3  1 
ATOM   3295  H  HD1  . HIS A 1 239 ? -36.654  12.938  -4.243  1.00 46.30  ? 800  HIS A HD1  1 
ATOM   3296  H  HD2  . HIS A 1 239 ? -34.541  16.119  -5.007  1.00 37.67  ? 800  HIS A HD2  1 
ATOM   3297  H  HE1  . HIS A 1 239 ? -36.655  13.171  -6.595  1.00 34.85  ? 800  HIS A HE1  1 
ATOM   3298  H  HE2  . HIS A 1 239 ? -35.370  15.106  -7.049  1.00 41.74  ? 800  HIS A HE2  1 
ATOM   3299  N  N    . GLU A 1 240 ? -38.372  14.879  -2.063  1.00 33.66  ? 801  GLU A N    1 
ATOM   3300  C  CA   A GLU A 1 240 ? -39.747  14.789  -2.549  0.65 37.48  ? 801  GLU A CA   1 
ATOM   3301  C  CA   B GLU A 1 240 ? -39.747  14.791  -2.550  0.35 37.78  ? 801  GLU A CA   1 
ATOM   3302  C  C    . GLU A 1 240 ? -40.528  16.060  -2.237  1.00 36.47  ? 801  GLU A C    1 
ATOM   3303  O  O    . GLU A 1 240 ? -41.307  16.540  -3.068  1.00 44.94  ? 801  GLU A O    1 
ATOM   3304  C  CB   A GLU A 1 240 ? -40.449  13.574  -1.936  0.65 45.68  ? 801  GLU A CB   1 
ATOM   3305  C  CB   B GLU A 1 240 ? -40.453  13.576  -1.944  0.35 47.13  ? 801  GLU A CB   1 
ATOM   3306  C  CG   A GLU A 1 240 ? -39.932  12.222  -2.425  0.65 45.73  ? 801  GLU A CG   1 
ATOM   3307  C  CG   B GLU A 1 240 ? -40.061  12.238  -2.565  0.35 46.67  ? 801  GLU A CG   1 
ATOM   3308  C  CD   A GLU A 1 240 ? -38.597  11.830  -1.816  0.65 45.71  ? 801  GLU A CD   1 
ATOM   3309  C  CD   B GLU A 1 240 ? -40.952  11.088  -2.112  0.35 58.47  ? 801  GLU A CD   1 
ATOM   3310  O  OE1  A GLU A 1 240 ? -38.090  10.739  -2.153  0.65 54.76  ? 801  GLU A OE1  1 
ATOM   3311  O  OE1  B GLU A 1 240 ? -41.956  11.342  -1.412  0.35 50.50  ? 801  GLU A OE1  1 
ATOM   3312  O  OE2  A GLU A 1 240 ? -38.054  12.608  -1.002  0.65 37.87  ? 801  GLU A OE2  1 
ATOM   3313  O  OE2  B GLU A 1 240 ? -40.647  9.926   -2.460  0.35 48.33  ? 801  GLU A OE2  1 
ATOM   3314  H  H    A GLU A 1 240 ? -38.152  14.264  -1.503  0.65 40.40  ? 801  GLU A H    1 
ATOM   3315  H  H    B GLU A 1 240 ? -38.153  14.264  -1.503  0.35 40.40  ? 801  GLU A H    1 
ATOM   3316  H  HA   A GLU A 1 240 ? -39.735  14.674  -3.512  0.65 44.98  ? 801  GLU A HA   1 
ATOM   3317  H  HA   B GLU A 1 240 ? -39.733  14.679  -3.514  0.35 45.33  ? 801  GLU A HA   1 
ATOM   3318  H  HB2  A GLU A 1 240 ? -40.331  13.601  -0.973  0.65 54.81  ? 801  GLU A HB2  1 
ATOM   3319  H  HB2  B GLU A 1 240 ? -40.241  13.535  -0.998  0.35 56.56  ? 801  GLU A HB2  1 
ATOM   3320  H  HB3  A GLU A 1 240 ? -41.393  13.621  -2.150  0.65 54.81  ? 801  GLU A HB3  1 
ATOM   3321  H  HB3  B GLU A 1 240 ? -41.410  13.684  -2.059  0.35 56.56  ? 801  GLU A HB3  1 
ATOM   3322  H  HG2  A GLU A 1 240 ? -40.578  11.536  -2.193  0.65 54.88  ? 801  GLU A HG2  1 
ATOM   3323  H  HG2  B GLU A 1 240 ? -40.128  12.307  -3.530  0.35 56.00  ? 801  GLU A HG2  1 
ATOM   3324  H  HG3  A GLU A 1 240 ? -39.821  12.258  -3.388  0.65 54.88  ? 801  GLU A HG3  1 
ATOM   3325  H  HG3  B GLU A 1 240 ? -39.149  12.028  -2.310  0.35 56.00  ? 801  GLU A HG3  1 
ATOM   3326  N  N    . ASP A 1 241 ? -40.332  16.620  -1.041  1.00 40.60  ? 802  ASP A N    1 
ATOM   3327  C  CA   . ASP A 1 241 ? -41.063  17.820  -0.649  1.00 35.81  ? 802  ASP A CA   1 
ATOM   3328  C  C    . ASP A 1 241 ? -40.557  19.061  -1.378  1.00 28.31  ? 802  ASP A C    1 
ATOM   3329  O  O    . ASP A 1 241 ? -41.341  19.980  -1.640  1.00 34.42  ? 802  ASP A O    1 
ATOM   3330  C  CB   . ASP A 1 241 ? -40.969  18.009  0.865   1.00 37.10  ? 802  ASP A CB   1 
ATOM   3331  C  CG   . ASP A 1 241 ? -41.665  16.892  1.641   1.00 39.50  ? 802  ASP A CG   1 
ATOM   3332  O  OD1  . ASP A 1 241 ? -42.122  15.917  1.009   1.00 48.16  ? 802  ASP A OD1  1 
ATOM   3333  O  OD2  . ASP A 1 241 ? -41.746  16.979  2.883   1.00 40.70  ? 802  ASP A OD2  1 
ATOM   3334  H  H    . ASP A 1 241 ? -39.786  16.325  -0.445  1.00 48.72  ? 802  ASP A H    1 
ATOM   3335  H  HA   . ASP A 1 241 ? -41.999  17.704  -0.876  1.00 42.98  ? 802  ASP A HA   1 
ATOM   3336  H  HB2  . ASP A 1 241 ? -40.034  18.018  1.125   1.00 44.52  ? 802  ASP A HB2  1 
ATOM   3337  H  HB3  . ASP A 1 241 ? -41.389  18.849  1.106   1.00 44.52  ? 802  ASP A HB3  1 
ATOM   3338  N  N    . VAL A 1 242 ? -39.267  19.101  -1.726  1.00 33.71  ? 803  VAL A N    1 
ATOM   3339  C  CA   . VAL A 1 242 ? -38.712  20.254  -2.435  1.00 33.10  ? 803  VAL A CA   1 
ATOM   3340  C  C    . VAL A 1 242 ? -39.276  20.340  -3.848  1.00 35.60  ? 803  VAL A C    1 
ATOM   3341  O  O    . VAL A 1 242 ? -39.550  21.435  -4.355  1.00 33.67  ? 803  VAL A O    1 
ATOM   3342  C  CB   . VAL A 1 242 ? -37.174  20.179  -2.456  1.00 30.90  ? 803  VAL A CB   1 
ATOM   3343  C  CG1  . VAL A 1 242 ? -36.584  21.222  -3.403  1.00 27.13  ? 803  VAL A CG1  1 
ATOM   3344  C  CG2  . VAL A 1 242 ? -36.617  20.365  -1.064  1.00 38.57  ? 803  VAL A CG2  1 
ATOM   3345  H  H    . VAL A 1 242 ? -38.697  18.478  -1.563  1.00 40.45  ? 803  VAL A H    1 
ATOM   3346  H  HA   . VAL A 1 242 ? -38.964  21.064  -1.964  1.00 39.71  ? 803  VAL A HA   1 
ATOM   3347  H  HB   . VAL A 1 242 ? -36.905  19.302  -2.772  1.00 37.08  ? 803  VAL A HB   1 
ATOM   3348  H  HG11 . VAL A 1 242 ? -35.617  21.147  -3.392  1.00 32.55  ? 803  VAL A HG11 1 
ATOM   3349  H  HG12 . VAL A 1 242 ? -36.919  21.060  -4.299  1.00 32.55  ? 803  VAL A HG12 1 
ATOM   3350  H  HG13 . VAL A 1 242 ? -36.852  22.105  -3.104  1.00 32.55  ? 803  VAL A HG13 1 
ATOM   3351  H  HG21 . VAL A 1 242 ? -35.650  20.313  -1.102  1.00 46.28  ? 803  VAL A HG21 1 
ATOM   3352  H  HG22 . VAL A 1 242 ? -36.890  21.233  -0.729  1.00 46.28  ? 803  VAL A HG22 1 
ATOM   3353  H  HG23 . VAL A 1 242 ? -36.964  19.664  -0.490  1.00 46.28  ? 803  VAL A HG23 1 
ATOM   3354  N  N    . ILE A 1 243 ? -39.415  19.196  -4.523  1.00 47.49  ? 804  ILE A N    1 
ATOM   3355  C  CA   . ILE A 1 243 ? -39.997  19.186  -5.863  1.00 35.39  ? 804  ILE A CA   1 
ATOM   3356  C  C    . ILE A 1 243 ? -41.432  19.693  -5.811  1.00 31.88  ? 804  ILE A C    1 
ATOM   3357  O  O    . ILE A 1 243 ? -41.838  20.550  -6.606  1.00 38.76  ? 804  ILE A O    1 
ATOM   3358  C  CB   . ILE A 1 243 ? -39.913  17.771  -6.470  1.00 40.66  ? 804  ILE A CB   1 
ATOM   3359  C  CG1  . ILE A 1 243 ? -38.448  17.361  -6.672  1.00 33.74  ? 804  ILE A CG1  1 
ATOM   3360  C  CG2  . ILE A 1 243 ? -40.685  17.683  -7.792  1.00 36.37  ? 804  ILE A CG2  1 
ATOM   3361  C  CD1  . ILE A 1 243 ? -37.692  18.201  -7.669  1.00 34.57  ? 804  ILE A CD1  1 
ATOM   3362  H  H    . ILE A 1 243 ? -39.182  18.422  -4.229  1.00 56.99  ? 804  ILE A H    1 
ATOM   3363  H  HA   . ILE A 1 243 ? -39.488  19.786  -6.432  1.00 42.46  ? 804  ILE A HA   1 
ATOM   3364  H  HB   . ILE A 1 243 ? -40.316  17.150  -5.843  1.00 48.80  ? 804  ILE A HB   1 
ATOM   3365  H  HG12 . ILE A 1 243 ? -37.987  17.428  -5.821  1.00 40.49  ? 804  ILE A HG12 1 
ATOM   3366  H  HG13 . ILE A 1 243 ? -38.424  16.442  -6.984  1.00 40.49  ? 804  ILE A HG13 1 
ATOM   3367  H  HG21 . ILE A 1 243 ? -40.610  16.781  -8.142  1.00 43.64  ? 804  ILE A HG21 1 
ATOM   3368  H  HG22 . ILE A 1 243 ? -41.617  17.897  -7.628  1.00 43.64  ? 804  ILE A HG22 1 
ATOM   3369  H  HG23 . ILE A 1 243 ? -40.305  18.315  -8.422  1.00 43.64  ? 804  ILE A HG23 1 
ATOM   3370  H  HD11 . ILE A 1 243 ? -36.781  17.873  -7.732  1.00 41.48  ? 804  ILE A HD11 1 
ATOM   3371  H  HD12 . ILE A 1 243 ? -38.129  18.135  -8.532  1.00 41.48  ? 804  ILE A HD12 1 
ATOM   3372  H  HD13 . ILE A 1 243 ? -37.691  19.123  -7.367  1.00 41.48  ? 804  ILE A HD13 1 
ATOM   3373  N  N    . ALA A 1 244 ? -42.216  19.182  -4.859  1.00 31.15  ? 805  ALA A N    1 
ATOM   3374  C  CA   . ALA A 1 244 ? -43.614  19.583  -4.747  1.00 31.78  ? 805  ALA A CA   1 
ATOM   3375  C  C    . ALA A 1 244 ? -43.739  21.065  -4.430  1.00 34.45  ? 805  ALA A C    1 
ATOM   3376  O  O    . ALA A 1 244 ? -44.611  21.751  -4.976  1.00 37.30  ? 805  ALA A O    1 
ATOM   3377  C  CB   . ALA A 1 244 ? -44.310  18.748  -3.673  1.00 31.56  ? 805  ALA A CB   1 
ATOM   3378  H  H    . ALA A 1 244 ? -41.962  18.607  -4.272  1.00 37.37  ? 805  ALA A H    1 
ATOM   3379  H  HA   . ALA A 1 244 ? -44.059  19.417  -5.592  1.00 38.13  ? 805  ALA A HA   1 
ATOM   3380  H  HB1  . ALA A 1 244 ? -45.238  19.026  -3.610  1.00 37.87  ? 805  ALA A HB1  1 
ATOM   3381  H  HB2  . ALA A 1 244 ? -44.261  17.812  -3.920  1.00 37.87  ? 805  ALA A HB2  1 
ATOM   3382  H  HB3  . ALA A 1 244 ? -43.864  18.891  -2.824  1.00 37.87  ? 805  ALA A HB3  1 
ATOM   3383  N  N    . ARG A 1 245 ? -42.868  21.577  -3.556  1.00 38.74  ? 806  ARG A N    1 
ATOM   3384  C  CA   . ARG A 1 245 ? -42.936  22.983  -3.170  1.00 34.98  ? 806  ARG A CA   1 
ATOM   3385  C  C    . ARG A 1 245 ? -42.669  23.897  -4.357  1.00 37.83  ? 806  ARG A C    1 
ATOM   3386  O  O    . ARG A 1 245 ? -43.304  24.948  -4.496  1.00 36.58  ? 806  ARG A O    1 
ATOM   3387  C  CB   . ARG A 1 245 ? -41.935  23.268  -2.052  1.00 40.00  ? 806  ARG A CB   1 
ATOM   3388  C  CG   . ARG A 1 245 ? -42.112  24.627  -1.396  1.00 39.13  ? 806  ARG A CG   1 
ATOM   3389  C  CD   . ARG A 1 245 ? -40.989  24.935  -0.404  1.00 31.39  ? 806  ARG A CD   1 
ATOM   3390  N  NE   . ARG A 1 245 ? -41.451  25.834  0.654   1.00 59.92  ? 806  ARG A NE   1 
ATOM   3391  C  CZ   . ARG A 1 245 ? -41.777  25.461  1.889   1.00 46.89  ? 806  ARG A CZ   1 
ATOM   3392  N  NH1  . ARG A 1 245 ? -41.676  24.194  2.267   1.00 45.55  ? 806  ARG A NH1  1 
ATOM   3393  N  NH2  . ARG A 1 245 ? -42.193  26.370  2.762   1.00 62.51  ? 806  ARG A NH2  1 
ATOM   3394  H  H    . ARG A 1 245 ? -42.236  21.134  -3.177  1.00 46.49  ? 806  ARG A H    1 
ATOM   3395  H  HA   . ARG A 1 245 ? -43.826  23.177  -2.835  1.00 41.98  ? 806  ARG A HA   1 
ATOM   3396  H  HB2  . ARG A 1 245 ? -42.036  22.591  -1.364  1.00 48.00  ? 806  ARG A HB2  1 
ATOM   3397  H  HB3  . ARG A 1 245 ? -41.038  23.231  -2.420  1.00 48.00  ? 806  ARG A HB3  1 
ATOM   3398  H  HG2  . ARG A 1 245 ? -42.108  25.314  -2.080  1.00 46.96  ? 806  ARG A HG2  1 
ATOM   3399  H  HG3  . ARG A 1 245 ? -42.954  24.641  -0.913  1.00 46.96  ? 806  ARG A HG3  1 
ATOM   3400  H  HD2  . ARG A 1 245 ? -40.688  24.110  0.007   1.00 37.67  ? 806  ARG A HD2  1 
ATOM   3401  H  HD3  . ARG A 1 245 ? -40.257  25.366  -0.871  1.00 37.67  ? 806  ARG A HD3  1 
ATOM   3402  H  HE   . ARG A 1 245 ? -41.516  26.669  0.462   1.00 71.90  ? 806  ARG A HE   1 
ATOM   3403  H  HH11 . ARG A 1 245 ? -41.409  23.598  1.707   1.00 54.67  ? 806  ARG A HH11 1 
ATOM   3404  H  HH12 . ARG A 1 245 ? -41.886  23.966  3.069   1.00 54.67  ? 806  ARG A HH12 1 
ATOM   3405  H  HH21 . ARG A 1 245 ? -42.256  27.195  2.527   1.00 75.01  ? 806  ARG A HH21 1 
ATOM   3406  H  HH22 . ARG A 1 245 ? -42.397  26.135  3.563   1.00 75.01  ? 806  ARG A HH22 1 
ATOM   3407  N  N    . GLU A 1 246 ? -41.724  23.515  -5.221  1.00 36.32  ? 807  GLU A N    1 
ATOM   3408  C  CA   . GLU A 1 246 ? -41.404  24.337  -6.384  1.00 32.76  ? 807  GLU A CA   1 
ATOM   3409  C  C    . GLU A 1 246 ? -42.595  24.441  -7.329  1.00 41.03  ? 807  GLU A C    1 
ATOM   3410  O  O    . GLU A 1 246 ? -42.870  25.513  -7.881  1.00 44.31  ? 807  GLU A O    1 
ATOM   3411  C  CB   . GLU A 1 246 ? -40.190  23.752  -7.107  1.00 39.14  ? 807  GLU A CB   1 
ATOM   3412  C  CG   . GLU A 1 246 ? -39.385  24.758  -7.930  1.00 47.77  ? 807  GLU A CG   1 
ATOM   3413  C  CD   . GLU A 1 246 ? -39.908  24.955  -9.344  1.00 46.28  ? 807  GLU A CD   1 
ATOM   3414  O  OE1  . GLU A 1 246 ? -40.297  23.962  -9.992  1.00 42.26  ? 807  GLU A OE1  1 
ATOM   3415  O  OE2  . GLU A 1 246 ? -39.921  26.114  -9.812  1.00 60.41  ? 807  GLU A OE2  1 
ATOM   3416  H  H    . GLU A 1 246 ? -41.260  22.794  -5.155  1.00 43.58  ? 807  GLU A H    1 
ATOM   3417  H  HA   . GLU A 1 246 ? -41.176  25.232  -6.087  1.00 39.31  ? 807  GLU A HA   1 
ATOM   3418  H  HB2  . GLU A 1 246 ? -39.593  23.369  -6.446  1.00 46.96  ? 807  GLU A HB2  1 
ATOM   3419  H  HB3  . GLU A 1 246 ? -40.496  23.058  -7.711  1.00 46.96  ? 807  GLU A HB3  1 
ATOM   3420  H  HG2  . GLU A 1 246 ? -39.410  25.619  -7.483  1.00 57.32  ? 807  GLU A HG2  1 
ATOM   3421  H  HG3  . GLU A 1 246 ? -38.468  24.447  -7.993  1.00 57.32  ? 807  GLU A HG3  1 
ATOM   3422  N  N    . LEU A 1 247 ? -43.320  23.338  -7.523  1.00 31.69  ? 808  LEU A N    1 
ATOM   3423  C  CA   . LEU A 1 247 ? -44.482  23.354  -8.405  1.00 35.23  ? 808  LEU A CA   1 
ATOM   3424  C  C    . LEU A 1 247 ? -45.643  24.119  -7.778  1.00 38.71  ? 808  LEU A C    1 
ATOM   3425  O  O    . LEU A 1 247 ? -46.225  25.011  -8.408  1.00 39.38  ? 808  LEU A O    1 
ATOM   3426  C  CB   . LEU A 1 247 ? -44.890  21.918  -8.733  1.00 31.50  ? 808  LEU A CB   1 
ATOM   3427  C  CG   . LEU A 1 247 ? -46.183  21.728  -9.520  1.00 31.67  ? 808  LEU A CG   1 
ATOM   3428  C  CD1  . LEU A 1 247 ? -46.114  22.424  -10.868 1.00 29.76  ? 808  LEU A CD1  1 
ATOM   3429  C  CD2  . LEU A 1 247 ? -46.474  20.246  -9.689  1.00 33.05  ? 808  LEU A CD2  1 
ATOM   3430  H  H    . LEU A 1 247 ? -43.160  22.576  -7.158  1.00 38.03  ? 808  LEU A H    1 
ATOM   3431  H  HA   . LEU A 1 247 ? -44.244  23.796  -9.235  1.00 42.28  ? 808  LEU A HA   1 
ATOM   3432  H  HB2  . LEU A 1 247 ? -44.177  21.514  -9.251  1.00 37.79  ? 808  LEU A HB2  1 
ATOM   3433  H  HB3  . LEU A 1 247 ? -44.990  21.436  -7.897  1.00 37.79  ? 808  LEU A HB3  1 
ATOM   3434  H  HG   . LEU A 1 247 ? -46.915  22.120  -9.020  1.00 38.00  ? 808  LEU A HG   1 
ATOM   3435  H  HD11 . LEU A 1 247 ? -46.950  22.282  -11.339 1.00 35.71  ? 808  LEU A HD11 1 
ATOM   3436  H  HD12 . LEU A 1 247 ? -45.971  23.373  -10.725 1.00 35.71  ? 808  LEU A HD12 1 
ATOM   3437  H  HD13 . LEU A 1 247 ? -45.379  22.051  -11.378 1.00 35.71  ? 808  LEU A HD13 1 
ATOM   3438  H  HD21 . LEU A 1 247 ? -47.298  20.141  -10.190 1.00 39.66  ? 808  LEU A HD21 1 
ATOM   3439  H  HD22 . LEU A 1 247 ? -45.740  19.832  -10.168 1.00 39.66  ? 808  LEU A HD22 1 
ATOM   3440  H  HD23 . LEU A 1 247 ? -46.567  19.841  -8.812  1.00 39.66  ? 808  LEU A HD23 1 
ATOM   3441  N  N    . ILE A 1 248 ? -45.973  23.801  -6.521  1.00 34.31  ? 809  ILE A N    1 
ATOM   3442  C  CA   . ILE A 1 248 ? -47.157  24.369  -5.874  1.00 36.94  ? 809  ILE A CA   1 
ATOM   3443  C  C    . ILE A 1 248 ? -47.057  25.889  -5.782  1.00 34.61  ? 809  ILE A C    1 
ATOM   3444  O  O    . ILE A 1 248 ? -48.030  26.602  -6.054  1.00 34.55  ? 809  ILE A O    1 
ATOM   3445  C  CB   . ILE A 1 248 ? -47.358  23.729  -4.487  1.00 32.88  ? 809  ILE A CB   1 
ATOM   3446  C  CG1  . ILE A 1 248 ? -47.766  22.266  -4.653  1.00 33.97  ? 809  ILE A CG1  1 
ATOM   3447  C  CG2  . ILE A 1 248 ? -48.414  24.481  -3.693  1.00 34.66  ? 809  ILE A CG2  1 
ATOM   3448  C  CD1  . ILE A 1 248 ? -47.846  21.475  -3.356  1.00 27.92  ? 809  ILE A CD1  1 
ATOM   3449  H  H    . ILE A 1 248 ? -45.528  23.258  -6.024  1.00 41.17  ? 809  ILE A H    1 
ATOM   3450  H  HA   . ILE A 1 248 ? -47.936  24.158  -6.412  1.00 44.33  ? 809  ILE A HA   1 
ATOM   3451  H  HB   . ILE A 1 248 ? -46.519  23.766  -4.003  1.00 39.46  ? 809  ILE A HB   1 
ATOM   3452  H  HG12 . ILE A 1 248 ? -48.641  22.234  -5.070  1.00 40.77  ? 809  ILE A HG12 1 
ATOM   3453  H  HG13 . ILE A 1 248 ? -47.117  21.826  -5.225  1.00 40.77  ? 809  ILE A HG13 1 
ATOM   3454  H  HG21 . ILE A 1 248 ? -48.519  24.057  -2.827  1.00 41.59  ? 809  ILE A HG21 1 
ATOM   3455  H  HG22 . ILE A 1 248 ? -48.127  25.400  -3.579  1.00 41.59  ? 809  ILE A HG22 1 
ATOM   3456  H  HG23 . ILE A 1 248 ? -49.253  24.454  -4.179  1.00 41.59  ? 809  ILE A HG23 1 
ATOM   3457  H  HD11 . ILE A 1 248 ? -48.110  20.564  -3.559  1.00 33.50  ? 809  ILE A HD11 1 
ATOM   3458  H  HD12 . ILE A 1 248 ? -46.975  21.480  -2.930  1.00 33.50  ? 809  ILE A HD12 1 
ATOM   3459  H  HD13 . ILE A 1 248 ? -48.503  21.889  -2.775  1.00 33.50  ? 809  ILE A HD13 1 
ATOM   3460  N  N    . GLU A 1 249 ? -45.893  26.412  -5.384  1.00 35.46  ? 810  GLU A N    1 
ATOM   3461  C  CA   . GLU A 1 249 ? -45.764  27.858  -5.220  1.00 45.01  ? 810  GLU A CA   1 
ATOM   3462  C  C    . GLU A 1 249 ? -45.906  28.587  -6.549  1.00 33.76  ? 810  GLU A C    1 
ATOM   3463  O  O    . GLU A 1 249 ? -46.310  29.755  -6.571  1.00 44.53  ? 810  GLU A O    1 
ATOM   3464  C  CB   . GLU A 1 249 ? -44.429  28.208  -4.556  1.00 33.08  ? 810  GLU A CB   1 
ATOM   3465  C  CG   . GLU A 1 249 ? -43.215  27.910  -5.390  1.00 49.83  ? 810  GLU A CG   1 
ATOM   3466  C  CD   . GLU A 1 249 ? -41.931  28.031  -4.595  1.00 66.40  ? 810  GLU A CD   1 
ATOM   3467  O  OE1  . GLU A 1 249 ? -42.006  28.190  -3.354  1.00 44.63  ? 810  GLU A OE1  1 
ATOM   3468  O  OE2  . GLU A 1 249 ? -40.849  27.969  -5.214  1.00 56.48  ? 810  GLU A OE2  1 
ATOM   3469  H  H    . GLU A 1 249 ? -45.182  25.962  -5.208  1.00 42.55  ? 810  GLU A H    1 
ATOM   3470  H  HA   . GLU A 1 249 ? -46.474  28.169  -4.637  1.00 54.01  ? 810  GLU A HA   1 
ATOM   3471  H  HB2  . GLU A 1 249 ? -44.422  29.157  -4.357  1.00 39.70  ? 810  GLU A HB2  1 
ATOM   3472  H  HB3  . GLU A 1 249 ? -44.351  27.702  -3.733  1.00 39.70  ? 810  GLU A HB3  1 
ATOM   3473  H  HG2  . GLU A 1 249 ? -43.277  27.002  -5.727  1.00 59.79  ? 810  GLU A HG2  1 
ATOM   3474  H  HG3  . GLU A 1 249 ? -43.174  28.538  -6.127  1.00 59.79  ? 810  GLU A HG3  1 
ATOM   3475  N  N    . LYS A 1 250 ? -45.599  27.922  -7.664  1.00 35.93  ? 811  LYS A N    1 
ATOM   3476  C  CA   . LYS A 1 250 ? -45.819  28.544  -8.965  1.00 43.64  ? 811  LYS A CA   1 
ATOM   3477  C  C    . LYS A 1 250 ? -47.298  28.547  -9.330  1.00 39.97  ? 811  LYS A C    1 
ATOM   3478  O  O    . LYS A 1 250 ? -47.787  29.495  -9.955  1.00 43.40  ? 811  LYS A O    1 
ATOM   3479  C  CB   . LYS A 1 250 ? -45.006  27.822  -10.037 1.00 41.35  ? 811  LYS A CB   1 
ATOM   3480  C  CG   . LYS A 1 250 ? -43.548  28.225  -10.078 1.00 37.63  ? 811  LYS A CG   1 
ATOM   3481  C  CD   . LYS A 1 250 ? -42.820  27.543  -11.222 1.00 41.60  ? 811  LYS A CD   1 
ATOM   3482  C  CE   . LYS A 1 250 ? -41.465  28.192  -11.483 1.00 56.67  ? 811  LYS A CE   1 
ATOM   3483  N  NZ   . LYS A 1 250 ? -40.687  27.483  -12.541 1.00 79.22  ? 811  LYS A NZ   1 
ATOM   3484  H  H    . LYS A 1 250 ? -45.271  27.128  -7.693  1.00 43.11  ? 811  LYS A H    1 
ATOM   3485  H  HA   . LYS A 1 250 ? -45.517  29.465  -8.930  1.00 52.37  ? 811  LYS A HA   1 
ATOM   3486  H  HB2  . LYS A 1 250 ? -45.044  26.868  -9.868  1.00 49.63  ? 811  LYS A HB2  1 
ATOM   3487  H  HB3  . LYS A 1 250 ? -45.391  28.017  -10.905 1.00 49.63  ? 811  LYS A HB3  1 
ATOM   3488  H  HG2  . LYS A 1 250 ? -43.483  29.184  -10.204 1.00 45.16  ? 811  LYS A HG2  1 
ATOM   3489  H  HG3  . LYS A 1 250 ? -43.120  27.965  -9.247  1.00 45.16  ? 811  LYS A HG3  1 
ATOM   3490  H  HD2  . LYS A 1 250 ? -42.674  26.611  -10.999 1.00 49.92  ? 811  LYS A HD2  1 
ATOM   3491  H  HD3  . LYS A 1 250 ? -43.353  27.616  -12.029 1.00 49.92  ? 811  LYS A HD3  1 
ATOM   3492  H  HE2  . LYS A 1 250 ? -41.602  29.107  -11.773 1.00 68.00  ? 811  LYS A HE2  1 
ATOM   3493  H  HE3  . LYS A 1 250 ? -40.943  28.177  -10.665 1.00 68.00  ? 811  LYS A HE3  1 
ATOM   3494  H  HZ1  . LYS A 1 250 ? -39.904  27.888  -12.666 1.00 95.06  ? 811  LYS A HZ1  1 
ATOM   3495  H  HZ2  . LYS A 1 250 ? -40.540  26.640  -12.297 1.00 95.06  ? 811  LYS A HZ2  1 
ATOM   3496  H  HZ3  . LYS A 1 250 ? -41.140  27.488  -13.307 1.00 95.06  ? 811  LYS A HZ3  1 
ATOM   3497  N  N    . MET A 1 251 ? -48.027  27.499  -8.940  1.00 29.38  ? 812  MET A N    1 
ATOM   3498  C  CA   . MET A 1 251 ? -49.429  27.376  -9.326  1.00 36.69  ? 812  MET A CA   1 
ATOM   3499  C  C    . MET A 1 251 ? -50.310  28.344  -8.543  1.00 31.37  ? 812  MET A C    1 
ATOM   3500  O  O    . MET A 1 251 ? -51.297  28.861  -9.079  1.00 35.39  ? 812  MET A O    1 
ATOM   3501  C  CB   . MET A 1 251 ? -49.905  25.933  -9.123  1.00 20.14  ? 812  MET A CB   1 
ATOM   3502  C  CG   . MET A 1 251 ? -49.277  24.922  -10.073 1.00 28.03  ? 812  MET A CG   1 
ATOM   3503  S  SD   . MET A 1 251 ? -49.924  23.245  -9.866  1.00 43.02  ? 812  MET A SD   1 
ATOM   3504  C  CE   . MET A 1 251 ? -49.449  22.904  -8.188  1.00 34.35  ? 812  MET A CE   1 
ATOM   3505  H  H    . MET A 1 251 ? -47.734  26.852  -8.454  1.00 35.26  ? 812  MET A H    1 
ATOM   3506  H  HA   . MET A 1 251 ? -49.509  27.581  -10.271 1.00 44.03  ? 812  MET A HA   1 
ATOM   3507  H  HB2  . MET A 1 251 ? -49.688  25.659  -8.218  1.00 24.16  ? 812  MET A HB2  1 
ATOM   3508  H  HB3  . MET A 1 251 ? -50.865  25.902  -9.253  1.00 24.16  ? 812  MET A HB3  1 
ATOM   3509  H  HG2  . MET A 1 251 ? -49.452  25.199  -10.986 1.00 33.64  ? 812  MET A HG2  1 
ATOM   3510  H  HG3  . MET A 1 251 ? -48.321  24.894  -9.914  1.00 33.64  ? 812  MET A HG3  1 
ATOM   3511  H  HE1  . MET A 1 251 ? -48.484  22.961  -8.116  1.00 41.21  ? 812  MET A HE1  1 
ATOM   3512  H  HE2  . MET A 1 251 ? -49.864  23.557  -7.604  1.00 41.21  ? 812  MET A HE2  1 
ATOM   3513  H  HE3  . MET A 1 251 ? -49.746  22.012  -7.952  1.00 41.21  ? 812  MET A HE3  1 
ATOM   3514  N  N    . ILE A 1 252 ? -49.978  28.591  -7.276  1.00 29.35  ? 813  ILE A N    1 
ATOM   3515  C  CA   . ILE A 1 252 ? -50.761  29.469  -6.407  1.00 47.20  ? 813  ILE A CA   1 
ATOM   3516  C  C    . ILE A 1 252 ? -50.194  30.885  -6.447  1.00 34.97  ? 813  ILE A C    1 
ATOM   3517  O  O    . ILE A 1 252 ? -50.559  31.730  -5.620  1.00 36.16  ? 813  ILE A O    1 
ATOM   3518  C  CB   . ILE A 1 252 ? -50.832  28.936  -4.962  1.00 44.74  ? 813  ILE A CB   1 
ATOM   3519  C  CG1  . ILE A 1 252 ? -49.470  29.031  -4.270  1.00 43.65  ? 813  ILE A CG1  1 
ATOM   3520  C  CG2  . ILE A 1 252 ? -51.372  27.508  -4.951  1.00 40.09  ? 813  ILE A CG2  1 
ATOM   3521  C  CD1  . ILE A 1 252 ? -49.490  28.620  -2.807  1.00 32.41  ? 813  ILE A CD1  1 
ATOM   3522  H  H    . ILE A 1 252 ? -49.289  28.254  -6.888  1.00 35.22  ? 813  ILE A H    1 
ATOM   3523  H  HA   . ILE A 1 252 ? -51.668  29.509  -6.748  1.00 56.64  ? 813  ILE A HA   1 
ATOM   3524  H  HB   . ILE A 1 252 ? -51.455  29.494  -4.470  1.00 53.68  ? 813  ILE A HB   1 
ATOM   3525  H  HG12 . ILE A 1 252 ? -48.845  28.451  -4.732  1.00 52.38  ? 813  ILE A HG12 1 
ATOM   3526  H  HG13 . ILE A 1 252 ? -49.161  29.949  -4.315  1.00 52.38  ? 813  ILE A HG13 1 
ATOM   3527  H  HG21 . ILE A 1 252 ? -51.410  27.193  -4.034  1.00 48.10  ? 813  ILE A HG21 1 
ATOM   3528  H  HG22 . ILE A 1 252 ? -52.262  27.505  -5.338  1.00 48.10  ? 813  ILE A HG22 1 
ATOM   3529  H  HG23 . ILE A 1 252 ? -50.781  26.943  -5.472  1.00 48.10  ? 813  ILE A HG23 1 
ATOM   3530  H  HD11 . ILE A 1 252 ? -48.595  28.707  -2.443  1.00 38.90  ? 813  ILE A HD11 1 
ATOM   3531  H  HD12 . ILE A 1 252 ? -50.102  29.198  -2.325  1.00 38.90  ? 813  ILE A HD12 1 
ATOM   3532  H  HD13 . ILE A 1 252 ? -49.786  27.698  -2.743  1.00 38.90  ? 813  ILE A HD13 1 
ATOM   3533  N  N    . ALA A 1 253 ? -49.247  31.134  -7.351  1.00 33.91  ? 814  ALA A N    1 
ATOM   3534  C  CA   . ALA A 1 253 ? -48.626  32.451  -7.454  1.00 36.13  ? 814  ALA A CA   1 
ATOM   3535  C  C    . ALA A 1 253 ? -49.669  33.554  -7.611  1.00 39.34  ? 814  ALA A C    1 
ATOM   3536  O  O    . ALA A 1 253 ? -50.708  33.369  -8.252  1.00 36.10  ? 814  ALA A O    1 
ATOM   3537  C  CB   . ALA A 1 253 ? -47.662  32.485  -8.638  1.00 28.27  ? 814  ALA A CB   1 
ATOM   3538  H  H    . ALA A 1 253 ? -48.948  30.558  -7.915  1.00 40.69  ? 814  ALA A H    1 
ATOM   3539  H  HA   . ALA A 1 253 ? -48.119  32.628  -6.646  1.00 43.35  ? 814  ALA A HA   1 
ATOM   3540  H  HB1  . ALA A 1 253 ? -47.259  33.366  -8.691  1.00 33.93  ? 814  ALA A HB1  1 
ATOM   3541  H  HB2  . ALA A 1 253 ? -46.975  31.814  -8.504  1.00 33.93  ? 814  ALA A HB2  1 
ATOM   3542  H  HB3  . ALA A 1 253 ? -48.156  32.297  -9.452  1.00 33.93  ? 814  ALA A HB3  1 
ATOM   3543  N  N    . MET A 1 254 ? -49.384  34.706  -6.993  1.00 42.16  ? 815  MET A N    1 
ATOM   3544  C  CA   . MET A 1 254 ? -50.297  35.843  -7.060  1.00 37.26  ? 815  MET A CA   1 
ATOM   3545  C  C    . MET A 1 254 ? -50.469  36.343  -8.489  1.00 36.48  ? 815  MET A C    1 
ATOM   3546  O  O    . MET A 1 254 ? -51.591  36.627  -8.923  1.00 44.95  ? 815  MET A O    1 
ATOM   3547  C  CB   . MET A 1 254 ? -49.787  36.972  -6.167  1.00 38.72  ? 815  MET A CB   1 
ATOM   3548  C  CG   . MET A 1 254 ? -49.904  36.700  -4.674  1.00 53.63  ? 815  MET A CG   1 
ATOM   3549  S  SD   . MET A 1 254 ? -51.611  36.597  -4.099  1.00 64.69  ? 815  MET A SD   1 
ATOM   3550  C  CE   . MET A 1 254 ? -51.850  34.819  -4.063  1.00 63.58  ? 815  MET A CE   1 
ATOM   3551  H  H    . MET A 1 254 ? -48.671  34.850  -6.533  1.00 50.59  ? 815  MET A H    1 
ATOM   3552  H  HA   . MET A 1 254 ? -51.163  35.567  -6.721  1.00 44.71  ? 815  MET A HA   1 
ATOM   3553  H  HB2  . MET A 1 254 ? -48.850  37.125  -6.365  1.00 46.46  ? 815  MET A HB2  1 
ATOM   3554  H  HB3  . MET A 1 254 ? -50.297  37.774  -6.360  1.00 46.46  ? 815  MET A HB3  1 
ATOM   3555  H  HG2  . MET A 1 254 ? -49.471  35.855  -4.474  1.00 64.36  ? 815  MET A HG2  1 
ATOM   3556  H  HG3  . MET A 1 254 ? -49.468  37.418  -4.189  1.00 64.36  ? 815  MET A HG3  1 
ATOM   3557  H  HE1  . MET A 1 254 ? -52.752  34.628  -3.762  1.00 76.30  ? 815  MET A HE1  1 
ATOM   3558  H  HE2  . MET A 1 254 ? -51.716  34.465  -4.956  1.00 76.30  ? 815  MET A HE2  1 
ATOM   3559  H  HE3  . MET A 1 254 ? -51.207  34.427  -3.451  1.00 76.30  ? 815  MET A HE3  1 
ATOM   3560  N  N    . ASP A 1 255 ? -49.380  36.471  -9.227  1.00 40.87  ? 816  ASP A N    1 
ATOM   3561  C  CA   . ASP A 1 255 ? -49.464  36.930  -10.607 1.00 44.12  ? 816  ASP A CA   1 
ATOM   3562  C  C    . ASP A 1 255 ? -50.008  35.815  -11.493 1.00 42.75  ? 816  ASP A C    1 
ATOM   3563  O  O    . ASP A 1 255 ? -49.326  34.795  -11.658 1.00 39.38  ? 816  ASP A O    1 
ATOM   3564  C  CB   . ASP A 1 255 ? -48.084  37.364  -11.090 1.00 35.33  ? 816  ASP A CB   1 
ATOM   3565  C  CG   . ASP A 1 255 ? -48.113  37.996  -12.472 1.00 34.32  ? 816  ASP A CG   1 
ATOM   3566  O  OD1  . ASP A 1 255 ? -49.208  38.382  -12.937 1.00 63.48  ? 816  ASP A OD1  1 
ATOM   3567  O  OD2  . ASP A 1 255 ? -47.038  38.118  -13.095 1.00 53.78  ? 816  ASP A OD2  1 
ATOM   3568  H  H    . ASP A 1 255 ? -48.582  36.300  -8.957  1.00 49.04  ? 816  ASP A H    1 
ATOM   3569  H  HA   . ASP A 1 255 ? -50.064  37.690  -10.661 1.00 52.94  ? 816  ASP A HA   1 
ATOM   3570  H  HB2  . ASP A 1 255 ? -47.724  38.018  -10.470 1.00 42.39  ? 816  ASP A HB2  1 
ATOM   3571  H  HB3  . ASP A 1 255 ? -47.503  36.588  -11.127 1.00 42.39  ? 816  ASP A HB3  1 
ATOM   3572  N  N    . PRO A 1 256 ? -51.197  35.959  -12.094 1.00 41.72  ? 817  PRO A N    1 
ATOM   3573  C  CA   . PRO A 1 256 ? -51.758  34.841  -12.880 1.00 37.63  ? 817  PRO A CA   1 
ATOM   3574  C  C    . PRO A 1 256 ? -50.871  34.393  -14.026 1.00 52.21  ? 817  PRO A C    1 
ATOM   3575  O  O    . PRO A 1 256 ? -50.929  33.221  -14.419 1.00 59.74  ? 817  PRO A O    1 
ATOM   3576  C  CB   . PRO A 1 256 ? -53.089  35.408  -13.393 1.00 39.77  ? 817  PRO A CB   1 
ATOM   3577  C  CG   . PRO A 1 256 ? -53.417  36.526  -12.462 1.00 47.30  ? 817  PRO A CG   1 
ATOM   3578  C  CD   . PRO A 1 256 ? -52.106  37.118  -12.065 1.00 40.50  ? 817  PRO A CD   1 
ATOM   3579  H  HA   . PRO A 1 256 ? -51.937  34.083  -12.301 1.00 45.15  ? 817  PRO A HA   1 
ATOM   3580  H  HB2  . PRO A 1 256 ? -52.978  35.736  -14.299 1.00 47.72  ? 817  PRO A HB2  1 
ATOM   3581  H  HB3  . PRO A 1 256 ? -53.773  34.720  -13.358 1.00 47.72  ? 817  PRO A HB3  1 
ATOM   3582  H  HG2  . PRO A 1 256 ? -53.963  37.182  -12.923 1.00 56.76  ? 817  PRO A HG2  1 
ATOM   3583  H  HG3  . PRO A 1 256 ? -53.883  36.177  -11.686 1.00 56.76  ? 817  PRO A HG3  1 
ATOM   3584  H  HD2  . PRO A 1 256 ? -51.825  37.785  -12.711 1.00 48.61  ? 817  PRO A HD2  1 
ATOM   3585  H  HD3  . PRO A 1 256 ? -52.157  37.486  -11.170 1.00 48.61  ? 817  PRO A HD3  1 
ATOM   3586  N  N    . GLN A 1 257 ? -50.042  35.286  -14.570 1.00 42.91  ? 818  GLN A N    1 
ATOM   3587  C  CA   . GLN A 1 257 ? -49.195  34.925  -15.700 1.00 43.84  ? 818  GLN A CA   1 
ATOM   3588  C  C    . GLN A 1 257 ? -48.020  34.051  -15.288 1.00 48.43  ? 818  GLN A C    1 
ATOM   3589  O  O    . GLN A 1 257 ? -47.445  33.366  -16.142 1.00 53.77  ? 818  GLN A O    1 
ATOM   3590  C  CB   . GLN A 1 257 ? -48.691  36.188  -16.394 1.00 62.43  ? 818  GLN A CB   1 
ATOM   3591  C  CG   . GLN A 1 257 ? -49.808  37.101  -16.886 1.00 59.23  ? 818  GLN A CG   1 
ATOM   3592  C  CD   . GLN A 1 257 ? -49.287  38.404  -17.459 1.00 101.41 ? 818  GLN A CD   1 
ATOM   3593  O  OE1  . GLN A 1 257 ? -48.422  38.408  -18.335 1.00 108.88 ? 818  GLN A OE1  1 
ATOM   3594  N  NE2  . GLN A 1 257 ? -49.805  39.521  -16.959 1.00 111.40 ? 818  GLN A NE2  1 
ATOM   3595  H  H    . GLN A 1 257 ? -49.954  36.099  -14.304 1.00 51.49  ? 818  GLN A H    1 
ATOM   3596  H  HA   . GLN A 1 257 ? -49.725  34.426  -16.341 1.00 52.61  ? 818  GLN A HA   1 
ATOM   3597  H  HB2  . GLN A 1 257 ? -48.149  36.694  -15.768 1.00 74.92  ? 818  GLN A HB2  1 
ATOM   3598  H  HB3  . GLN A 1 257 ? -48.156  35.932  -17.161 1.00 74.92  ? 818  GLN A HB3  1 
ATOM   3599  H  HG2  . GLN A 1 257 ? -50.305  36.644  -17.583 1.00 71.07  ? 818  GLN A HG2  1 
ATOM   3600  H  HG3  . GLN A 1 257 ? -50.394  37.313  -16.143 1.00 71.07  ? 818  GLN A HG3  1 
ATOM   3601  H  HE21 . GLN A 1 257 ? -50.403  39.479  -16.343 1.00 133.68 ? 818  GLN A HE21 1 
ATOM   3602  H  HE22 . GLN A 1 257 ? -49.542  40.286  -17.251 1.00 133.68 ? 818  GLN A HE22 1 
ATOM   3603  N  N    . LYS A 1 258 ? -47.650  34.054  -14.006 1.00 36.02  ? 819  LYS A N    1 
ATOM   3604  C  CA   . LYS A 1 258 ? -46.597  33.174  -13.519 1.00 40.45  ? 819  LYS A CA   1 
ATOM   3605  C  C    . LYS A 1 258 ? -47.075  31.747  -13.282 1.00 49.21  ? 819  LYS A C    1 
ATOM   3606  O  O    . LYS A 1 258 ? -46.245  30.880  -12.987 1.00 45.82  ? 819  LYS A O    1 
ATOM   3607  C  CB   . LYS A 1 258 ? -46.005  33.719  -12.218 1.00 46.35  ? 819  LYS A CB   1 
ATOM   3608  C  CG   . LYS A 1 258 ? -45.142  34.954  -12.389 1.00 52.36  ? 819  LYS A CG   1 
ATOM   3609  C  CD   . LYS A 1 258 ? -44.182  35.119  -11.217 1.00 70.68  ? 819  LYS A CD   1 
ATOM   3610  C  CE   . LYS A 1 258 ? -43.334  36.383  -11.346 1.00 69.61  ? 819  LYS A CE   1 
ATOM   3611  N  NZ   . LYS A 1 258 ? -44.135  37.627  -11.170 1.00 74.59  ? 819  LYS A NZ   1 
ATOM   3612  H  H    . LYS A 1 258 ? -47.996  34.559  -13.402 1.00 43.23  ? 819  LYS A H    1 
ATOM   3613  H  HA   . LYS A 1 258 ? -45.887  33.142  -14.178 1.00 48.55  ? 819  LYS A HA   1 
ATOM   3614  H  HB2  . LYS A 1 258 ? -46.733  33.949  -11.619 1.00 55.61  ? 819  LYS A HB2  1 
ATOM   3615  H  HB3  . LYS A 1 258 ? -45.456  33.029  -11.814 1.00 55.61  ? 819  LYS A HB3  1 
ATOM   3616  H  HG2  . LYS A 1 258 ? -44.620  34.870  -13.202 1.00 62.83  ? 819  LYS A HG2  1 
ATOM   3617  H  HG3  . LYS A 1 258 ? -45.710  35.739  -12.432 1.00 62.83  ? 819  LYS A HG3  1 
ATOM   3618  H  HD2  . LYS A 1 258 ? -44.691  35.180  -10.394 1.00 84.82  ? 819  LYS A HD2  1 
ATOM   3619  H  HD3  . LYS A 1 258 ? -43.584  34.356  -11.185 1.00 84.82  ? 819  LYS A HD3  1 
ATOM   3620  H  HE2  . LYS A 1 258 ? -42.643  36.372  -10.666 1.00 83.53  ? 819  LYS A HE2  1 
ATOM   3621  H  HE3  . LYS A 1 258 ? -42.932  36.406  -12.229 1.00 83.53  ? 819  LYS A HE3  1 
ATOM   3622  H  HZ1  . LYS A 1 258 ? -43.610  38.341  -11.252 1.00 89.50  ? 819  LYS A HZ1  1 
ATOM   3623  H  HZ2  . LYS A 1 258 ? -44.775  37.667  -11.788 1.00 89.50  ? 819  LYS A HZ2  1 
ATOM   3624  H  HZ3  . LYS A 1 258 ? -44.511  37.636  -10.364 1.00 89.50  ? 819  LYS A HZ3  1 
ATOM   3625  N  N    . ARG A 1 259 ? -48.378  31.486  -13.390 1.00 45.55  ? 820  ARG A N    1 
ATOM   3626  C  CA   . ARG A 1 259 ? -48.913  30.152  -13.143 1.00 50.15  ? 820  ARG A CA   1 
ATOM   3627  C  C    . ARG A 1 259 ? -48.793  29.305  -14.405 1.00 43.77  ? 820  ARG A C    1 
ATOM   3628  O  O    . ARG A 1 259 ? -49.200  29.751  -15.482 1.00 45.63  ? 820  ARG A O    1 
ATOM   3629  C  CB   . ARG A 1 259 ? -50.373  30.231  -12.711 1.00 38.09  ? 820  ARG A CB   1 
ATOM   3630  C  CG   . ARG A 1 259 ? -50.593  31.073  -11.470 1.00 42.81  ? 820  ARG A CG   1 
ATOM   3631  C  CD   . ARG A 1 259 ? -52.066  31.315  -11.220 1.00 38.98  ? 820  ARG A CD   1 
ATOM   3632  N  NE   . ARG A 1 259 ? -52.289  32.324  -10.189 1.00 39.41  ? 820  ARG A NE   1 
ATOM   3633  C  CZ   . ARG A 1 259 ? -53.421  33.007  -10.040 1.00 49.37  ? 820  ARG A CZ   1 
ATOM   3634  N  NH1  . ARG A 1 259 ? -54.447  32.803  -10.859 1.00 38.77  ? 820  ARG A NH1  1 
ATOM   3635  N  NH2  . ARG A 1 259 ? -53.525  33.902  -9.071  1.00 42.28  ? 820  ARG A NH2  1 
ATOM   3636  H  H    . ARG A 1 259 ? -48.973  32.068  -13.607 1.00 54.66  ? 820  ARG A H    1 
ATOM   3637  H  HA   . ARG A 1 259 ? -48.405  29.726  -12.436 1.00 60.18  ? 820  ARG A HA   1 
ATOM   3638  H  HB2  . ARG A 1 259 ? -50.892  30.622  -13.431 1.00 45.70  ? 820  ARG A HB2  1 
ATOM   3639  H  HB3  . ARG A 1 259 ? -50.693  29.335  -12.523 1.00 45.70  ? 820  ARG A HB3  1 
ATOM   3640  H  HG2  . ARG A 1 259 ? -50.226  30.611  -10.700 1.00 51.37  ? 820  ARG A HG2  1 
ATOM   3641  H  HG3  . ARG A 1 259 ? -50.159  31.933  -11.585 1.00 51.37  ? 820  ARG A HG3  1 
ATOM   3642  H  HD2  . ARG A 1 259 ? -52.481  31.624  -12.040 1.00 46.77  ? 820  ARG A HD2  1 
ATOM   3643  H  HD3  . ARG A 1 259 ? -52.479  30.488  -10.927 1.00 46.77  ? 820  ARG A HD3  1 
ATOM   3644  H  HE   . ARG A 1 259 ? -51.647  32.488  -9.642  1.00 47.29  ? 820  ARG A HE   1 
ATOM   3645  H  HH11 . ARG A 1 259 ? -54.384  32.223  -11.491 1.00 46.53  ? 820  ARG A HH11 1 
ATOM   3646  H  HH12 . ARG A 1 259 ? -55.175  33.250  -10.757 1.00 46.53  ? 820  ARG A HH12 1 
ATOM   3647  H  HH21 . ARG A 1 259 ? -52.863  34.038  -8.539  1.00 50.74  ? 820  ARG A HH21 1 
ATOM   3648  H  HH22 . ARG A 1 259 ? -54.254  34.347  -8.973  1.00 50.74  ? 820  ARG A HH22 1 
ATOM   3649  N  N    . PRO A 1 260 ? -48.262  28.088  -14.318 1.00 40.59  ? 821  PRO A N    1 
ATOM   3650  C  CA   . PRO A 1 260 ? -48.131  27.255  -15.516 1.00 39.60  ? 821  PRO A CA   1 
ATOM   3651  C  C    . PRO A 1 260 ? -49.458  26.641  -15.924 1.00 41.90  ? 821  PRO A C    1 
ATOM   3652  O  O    . PRO A 1 260 ? -50.343  26.402  -15.100 1.00 35.11  ? 821  PRO A O    1 
ATOM   3653  C  CB   . PRO A 1 260 ? -47.134  26.176  -15.081 1.00 32.99  ? 821  PRO A CB   1 
ATOM   3654  C  CG   . PRO A 1 260 ? -47.380  26.028  -13.624 1.00 36.76  ? 821  PRO A CG   1 
ATOM   3655  C  CD   . PRO A 1 260 ? -47.759  27.398  -13.115 1.00 40.48  ? 821  PRO A CD   1 
ATOM   3656  H  HA   . PRO A 1 260 ? -47.763  27.766  -16.253 1.00 47.52  ? 821  PRO A HA   1 
ATOM   3657  H  HB2  . PRO A 1 260 ? -47.319  25.347  -15.549 1.00 39.58  ? 821  PRO A HB2  1 
ATOM   3658  H  HB3  . PRO A 1 260 ? -46.227  26.476  -15.250 1.00 39.58  ? 821  PRO A HB3  1 
ATOM   3659  H  HG2  . PRO A 1 260 ? -48.106  25.401  -13.481 1.00 44.11  ? 821  PRO A HG2  1 
ATOM   3660  H  HG3  . PRO A 1 260 ? -46.571  25.717  -13.189 1.00 44.11  ? 821  PRO A HG3  1 
ATOM   3661  H  HD2  . PRO A 1 260 ? -48.459  27.328  -12.448 1.00 48.58  ? 821  PRO A HD2  1 
ATOM   3662  H  HD3  . PRO A 1 260 ? -46.978  27.855  -12.765 1.00 48.58  ? 821  PRO A HD3  1 
ATOM   3663  N  N    . SER A 1 261 ? -49.583  26.383  -17.223 1.00 37.45  ? 822  SER A N    1 
ATOM   3664  C  CA   . SER A 1 261 ? -50.756  25.693  -17.737 1.00 38.88  ? 822  SER A CA   1 
ATOM   3665  C  C    . SER A 1 261 ? -50.763  24.241  -17.264 1.00 38.84  ? 822  SER A C    1 
ATOM   3666  O  O    . SER A 1 261 ? -49.741  23.690  -16.843 1.00 30.06  ? 822  SER A O    1 
ATOM   3667  C  CB   . SER A 1 261 ? -50.794  25.751  -19.264 1.00 30.57  ? 822  SER A CB   1 
ATOM   3668  O  OG   . SER A 1 261 ? -49.863  24.849  -19.836 1.00 43.78  ? 822  SER A OG   1 
ATOM   3669  H  H    . SER A 1 261 ? -49.005  26.597  -17.823 1.00 44.93  ? 822  SER A H    1 
ATOM   3670  H  HA   . SER A 1 261 ? -51.555  26.126  -17.398 1.00 46.66  ? 822  SER A HA   1 
ATOM   3671  H  HB2  . SER A 1 261 ? -51.685  25.515  -19.565 1.00 36.68  ? 822  SER A HB2  1 
ATOM   3672  H  HB3  . SER A 1 261 ? -50.575  26.651  -19.550 1.00 36.68  ? 822  SER A HB3  1 
ATOM   3673  H  HG   . SER A 1 261 ? -49.897  24.894  -20.674 1.00 52.54  ? 822  SER A HG   1 
ATOM   3674  N  N    . ALA A 1 262 ? -51.949  23.627  -17.315 1.00 37.60  ? 823  ALA A N    1 
ATOM   3675  C  CA   . ALA A 1 262 ? -52.092  22.243  -16.872 1.00 33.23  ? 823  ALA A CA   1 
ATOM   3676  C  C    . ALA A 1 262 ? -51.126  21.317  -17.599 1.00 31.81  ? 823  ALA A C    1 
ATOM   3677  O  O    . ALA A 1 262 ? -50.600  20.369  -17.007 1.00 37.06  ? 823  ALA A O    1 
ATOM   3678  C  CB   . ALA A 1 262 ? -53.527  21.773  -17.084 1.00 34.11  ? 823  ALA A CB   1 
ATOM   3679  H  H    . ALA A 1 262 ? -52.676  23.987  -17.599 1.00 45.12  ? 823  ALA A H    1 
ATOM   3680  H  HA   . ALA A 1 262 ? -51.898  22.194  -15.923 1.00 39.87  ? 823  ALA A HA   1 
ATOM   3681  H  HB1  . ALA A 1 262 ? -53.605  20.853  -16.785 1.00 40.93  ? 823  ALA A HB1  1 
ATOM   3682  H  HB2  . ALA A 1 262 ? -54.124  22.340  -16.571 1.00 40.93  ? 823  ALA A HB2  1 
ATOM   3683  H  HB3  . ALA A 1 262 ? -53.742  21.833  -18.028 1.00 40.93  ? 823  ALA A HB3  1 
ATOM   3684  N  N    . LYS A 1 263 ? -50.883  21.571  -18.888 1.00 34.49  ? 824  LYS A N    1 
ATOM   3685  C  CA   . LYS A 1 263 ? -49.933  20.752  -19.638 1.00 32.66  ? 824  LYS A CA   1 
ATOM   3686  C  C    . LYS A 1 263 ? -48.503  20.951  -19.150 1.00 35.76  ? 824  LYS A C    1 
ATOM   3687  O  O    . LYS A 1 263 ? -47.705  20.007  -19.186 1.00 41.09  ? 824  LYS A O    1 
ATOM   3688  C  CB   . LYS A 1 263 ? -50.031  21.063  -21.131 1.00 45.38  ? 824  LYS A CB   1 
ATOM   3689  C  CG   . LYS A 1 263 ? -51.140  20.310  -21.843 1.00 45.79  ? 824  LYS A CG   1 
ATOM   3690  C  CD   . LYS A 1 263 ? -51.232  20.692  -23.311 1.00 57.11  ? 824  LYS A CD   1 
ATOM   3691  C  CE   . LYS A 1 263 ? -52.182  19.774  -24.067 1.00 62.52  ? 824  LYS A CE   1 
ATOM   3692  N  NZ   . LYS A 1 263 ? -53.326  20.518  -24.667 1.00 85.46  ? 824  LYS A NZ   1 
ATOM   3693  H  H    . LYS A 1 263 ? -51.250  22.201  -19.343 1.00 41.38  ? 824  LYS A H    1 
ATOM   3694  H  HA   . LYS A 1 263 ? -50.161  19.817  -19.515 1.00 39.19  ? 824  LYS A HA   1 
ATOM   3695  H  HB2  . LYS A 1 263 ? -50.198  22.012  -21.241 1.00 54.45  ? 824  LYS A HB2  1 
ATOM   3696  H  HB3  . LYS A 1 263 ? -49.192  20.826  -21.555 1.00 54.45  ? 824  LYS A HB3  1 
ATOM   3697  H  HG2  . LYS A 1 263 ? -50.965  19.358  -21.788 1.00 54.95  ? 824  LYS A HG2  1 
ATOM   3698  H  HG3  . LYS A 1 263 ? -51.989  20.519  -21.422 1.00 54.95  ? 824  LYS A HG3  1 
ATOM   3699  H  HD2  . LYS A 1 263 ? -51.563  21.601  -23.386 1.00 68.53  ? 824  LYS A HD2  1 
ATOM   3700  H  HD3  . LYS A 1 263 ? -50.353  20.621  -23.716 1.00 68.53  ? 824  LYS A HD3  1 
ATOM   3701  H  HE2  . LYS A 1 263 ? -51.697  19.336  -24.784 1.00 75.02  ? 824  LYS A HE2  1 
ATOM   3702  H  HE3  . LYS A 1 263 ? -52.540  19.113  -23.453 1.00 75.02  ? 824  LYS A HE3  1 
ATOM   3703  H  HZ1  . LYS A 1 263 ? -53.861  19.954  -25.100 1.00 102.55 ? 824  LYS A HZ1  1 
ATOM   3704  H  HZ2  . LYS A 1 263 ? -53.792  20.926  -24.028 1.00 102.55 ? 824  LYS A HZ2  1 
ATOM   3705  H  HZ3  . LYS A 1 263 ? -53.025  21.128  -25.240 1.00 102.55 ? 824  LYS A HZ3  1 
ATOM   3706  N  N    . HIS A 1 264 ? -48.156  22.162  -18.709 1.00 36.68  ? 825  HIS A N    1 
ATOM   3707  C  CA   . HIS A 1 264 ? -46.864  22.375  -18.067 1.00 35.94  ? 825  HIS A CA   1 
ATOM   3708  C  C    . HIS A 1 264 ? -46.782  21.621  -16.747 1.00 39.31  ? 825  HIS A C    1 
ATOM   3709  O  O    . HIS A 1 264 ? -45.746  21.024  -16.426 1.00 44.85  ? 825  HIS A O    1 
ATOM   3710  C  CB   . HIS A 1 264 ? -46.625  23.869  -17.835 1.00 47.86  ? 825  HIS A CB   1 
ATOM   3711  C  CG   . HIS A 1 264 ? -46.216  24.621  -19.061 1.00 52.87  ? 825  HIS A CG   1 
ATOM   3712  N  ND1  . HIS A 1 264 ? -47.102  25.372  -19.803 1.00 46.18  ? 825  HIS A ND1  1 
ATOM   3713  C  CD2  . HIS A 1 264 ? -45.013  24.743  -19.673 1.00 45.08  ? 825  HIS A CD2  1 
ATOM   3714  C  CE1  . HIS A 1 264 ? -46.464  25.921  -20.821 1.00 47.11  ? 825  HIS A CE1  1 
ATOM   3715  N  NE2  . HIS A 1 264 ? -45.195  25.555  -20.765 1.00 50.15  ? 825  HIS A NE2  1 
ATOM   3716  H  H    . HIS A 1 264 ? -48.646  22.867  -18.770 1.00 44.02  ? 825  HIS A H    1 
ATOM   3717  H  HA   . HIS A 1 264 ? -46.162  22.043  -18.649 1.00 43.13  ? 825  HIS A HA   1 
ATOM   3718  H  HB2  . HIS A 1 264 ? -47.444  24.268  -17.503 1.00 57.43  ? 825  HIS A HB2  1 
ATOM   3719  H  HB3  . HIS A 1 264 ? -45.920  23.972  -17.176 1.00 57.43  ? 825  HIS A HB3  1 
ATOM   3720  H  HD1  . HIS A 1 264 ? -47.939  25.467  -19.632 1.00 55.41  ? 825  HIS A HD1  1 
ATOM   3721  H  HD2  . HIS A 1 264 ? -44.215  24.349  -19.405 1.00 54.10  ? 825  HIS A HD2  1 
ATOM   3722  H  HE1  . HIS A 1 264 ? -46.843  26.472  -21.468 1.00 56.54  ? 825  HIS A HE1  1 
ATOM   3723  H  HE2  . HIS A 1 264 ? -44.583  25.788  -21.322 1.00 60.17  ? 825  HIS A HE2  1 
ATOM   3724  N  N    . VAL A 1 265 ? -47.869  21.631  -15.971 1.00 33.78  ? 826  VAL A N    1 
ATOM   3725  C  CA   . VAL A 1 265 ? -47.872  20.958  -14.674 1.00 32.72  ? 826  VAL A CA   1 
ATOM   3726  C  C    . VAL A 1 265 ? -47.604  19.470  -14.850 1.00 23.50  ? 826  VAL A C    1 
ATOM   3727  O  O    . VAL A 1 265 ? -46.884  18.856  -14.053 1.00 34.92  ? 826  VAL A O    1 
ATOM   3728  C  CB   . VAL A 1 265 ? -49.210  21.214  -13.950 1.00 36.02  ? 826  VAL A CB   1 
ATOM   3729  C  CG1  . VAL A 1 265 ? -49.319  20.385  -12.669 1.00 30.02  ? 826  VAL A CG1  1 
ATOM   3730  C  CG2  . VAL A 1 265 ? -49.365  22.695  -13.641 1.00 32.97  ? 826  VAL A CG2  1 
ATOM   3731  H  H    . VAL A 1 265 ? -48.611  22.017  -16.173 1.00 40.54  ? 826  VAL A H    1 
ATOM   3732  H  HA   . VAL A 1 265 ? -47.161  21.327  -14.127 1.00 39.27  ? 826  VAL A HA   1 
ATOM   3733  H  HB   . VAL A 1 265 ? -49.938  20.955  -14.536 1.00 43.22  ? 826  VAL A HB   1 
ATOM   3734  H  HG11 . VAL A 1 265 ? -50.170  20.572  -12.244 1.00 36.03  ? 826  VAL A HG11 1 
ATOM   3735  H  HG12 . VAL A 1 265 ? -49.263  19.444  -12.898 1.00 36.03  ? 826  VAL A HG12 1 
ATOM   3736  H  HG13 . VAL A 1 265 ? -48.591  20.625  -12.075 1.00 36.03  ? 826  VAL A HG13 1 
ATOM   3737  H  HG21 . VAL A 1 265 ? -50.211  22.836  -13.186 1.00 39.57  ? 826  VAL A HG21 1 
ATOM   3738  H  HG22 . VAL A 1 265 ? -48.632  22.977  -13.071 1.00 39.57  ? 826  VAL A HG22 1 
ATOM   3739  H  HG23 . VAL A 1 265 ? -49.349  23.195  -14.472 1.00 39.57  ? 826  VAL A HG23 1 
ATOM   3740  N  N    . LEU A 1 266 ? -48.162  18.871  -15.906 1.00 34.09  ? 827  LEU A N    1 
ATOM   3741  C  CA   . LEU A 1 266 ? -48.008  17.438  -16.128 1.00 37.65  ? 827  LEU A CA   1 
ATOM   3742  C  C    . LEU A 1 266 ? -46.571  17.045  -16.440 1.00 29.34  ? 827  LEU A C    1 
ATOM   3743  O  O    . LEU A 1 266 ? -46.221  15.871  -16.295 1.00 36.99  ? 827  LEU A O    1 
ATOM   3744  C  CB   . LEU A 1 266 ? -48.921  16.991  -17.268 1.00 35.13  ? 827  LEU A CB   1 
ATOM   3745  C  CG   . LEU A 1 266 ? -50.412  17.001  -16.937 1.00 33.94  ? 827  LEU A CG   1 
ATOM   3746  C  CD1  . LEU A 1 266 ? -51.246  16.948  -18.208 1.00 29.78  ? 827  LEU A CD1  1 
ATOM   3747  C  CD2  . LEU A 1 266 ? -50.750  15.840  -16.011 1.00 32.59  ? 827  LEU A CD2  1 
ATOM   3748  H  H    . LEU A 1 266 ? -48.632  19.273  -16.503 1.00 40.90  ? 827  LEU A H    1 
ATOM   3749  H  HA   . LEU A 1 266 ? -48.279  16.965  -15.326 1.00 45.18  ? 827  LEU A HA   1 
ATOM   3750  H  HB2  . LEU A 1 266 ? -48.784  17.583  -18.024 1.00 42.16  ? 827  LEU A HB2  1 
ATOM   3751  H  HB3  . LEU A 1 266 ? -48.682  16.084  -17.517 1.00 42.16  ? 827  LEU A HB3  1 
ATOM   3752  H  HG   . LEU A 1 266 ? -50.626  17.826  -16.473 1.00 40.73  ? 827  LEU A HG   1 
ATOM   3753  H  HD11 . LEU A 1 266 ? -52.186  16.956  -17.969 1.00 35.73  ? 827  LEU A HD11 1 
ATOM   3754  H  HD12 . LEU A 1 266 ? -51.037  17.722  -18.755 1.00 35.73  ? 827  LEU A HD12 1 
ATOM   3755  H  HD13 . LEU A 1 266 ? -51.034  16.134  -18.691 1.00 35.73  ? 827  LEU A HD13 1 
ATOM   3756  H  HD21 . LEU A 1 266 ? -51.700  15.861  -15.811 1.00 39.11  ? 827  LEU A HD21 1 
ATOM   3757  H  HD22 . LEU A 1 266 ? -50.524  15.007  -16.454 1.00 39.11  ? 827  LEU A HD22 1 
ATOM   3758  H  HD23 . LEU A 1 266 ? -50.238  15.929  -15.192 1.00 39.11  ? 827  LEU A HD23 1 
ATOM   3759  N  N    . LYS A 1 267 ? -45.743  17.994  -16.872 1.00 36.93  ? 828  LYS A N    1 
ATOM   3760  C  CA   . LYS A 1 267 ? -44.343  17.741  -17.180 1.00 32.33  ? 828  LYS A CA   1 
ATOM   3761  C  C    . LYS A 1 267 ? -43.417  17.934  -15.986 1.00 28.65  ? 828  LYS A C    1 
ATOM   3762  O  O    . LYS A 1 267 ? -42.230  17.607  -16.091 1.00 41.35  ? 828  LYS A O    1 
ATOM   3763  C  CB   . LYS A 1 267 ? -43.886  18.666  -18.313 1.00 37.85  ? 828  LYS A CB   1 
ATOM   3764  C  CG   . LYS A 1 267 ? -44.461  18.326  -19.681 1.00 37.18  ? 828  LYS A CG   1 
ATOM   3765  C  CD   . LYS A 1 267 ? -43.879  17.034  -20.220 1.00 46.77  ? 828  LYS A CD   1 
ATOM   3766  C  CE   . LYS A 1 267 ? -44.280  16.805  -21.667 1.00 57.98  ? 828  LYS A CE   1 
ATOM   3767  N  NZ   . LYS A 1 267 ? -43.652  15.574  -22.224 1.00 62.92  ? 828  LYS A NZ   1 
ATOM   3768  H  H    . LYS A 1 267 ? -45.978  18.812  -16.996 1.00 44.31  ? 828  LYS A H    1 
ATOM   3769  H  HA   . LYS A 1 267 ? -44.249  16.826  -17.486 1.00 38.80  ? 828  LYS A HA   1 
ATOM   3770  H  HB2  . LYS A 1 267 ? -44.154  19.574  -18.099 1.00 45.42  ? 828  LYS A HB2  1 
ATOM   3771  H  HB3  . LYS A 1 267 ? -42.920  18.619  -18.381 1.00 45.42  ? 828  LYS A HB3  1 
ATOM   3772  H  HG2  . LYS A 1 267 ? -45.423  18.219  -19.606 1.00 44.61  ? 828  LYS A HG2  1 
ATOM   3773  H  HG3  . LYS A 1 267 ? -44.250  19.039  -20.304 1.00 44.61  ? 828  LYS A HG3  1 
ATOM   3774  H  HD2  . LYS A 1 267 ? -42.911  17.076  -20.177 1.00 56.12  ? 828  LYS A HD2  1 
ATOM   3775  H  HD3  . LYS A 1 267 ? -44.207  16.289  -19.692 1.00 56.12  ? 828  LYS A HD3  1 
ATOM   3776  H  HE2  . LYS A 1 267 ? -45.244  16.705  -21.719 1.00 69.58  ? 828  LYS A HE2  1 
ATOM   3777  H  HE3  . LYS A 1 267 ? -43.993  17.562  -22.201 1.00 69.58  ? 828  LYS A HE3  1 
ATOM   3778  H  HZ1  . LYS A 1 267 ? -43.902  15.462  -23.071 1.00 75.51  ? 828  LYS A HZ1  1 
ATOM   3779  H  HZ2  . LYS A 1 267 ? -42.765  15.643  -22.191 1.00 75.51  ? 828  LYS A HZ2  1 
ATOM   3780  H  HZ3  . LYS A 1 267 ? -43.904  14.863  -21.751 1.00 75.51  ? 828  LYS A HZ3  1 
ATOM   3781  N  N    . HIS A 1 268 ? -43.919  18.444  -14.864 1.00 33.44  ? 829  HIS A N    1 
ATOM   3782  C  CA   . HIS A 1 268 ? -43.056  18.759  -13.738 1.00 31.04  ? 829  HIS A CA   1 
ATOM   3783  C  C    . HIS A 1 268 ? -42.469  17.482  -13.137 1.00 29.83  ? 829  HIS A C    1 
ATOM   3784  O  O    . HIS A 1 268 ? -43.131  16.441  -13.115 1.00 31.97  ? 829  HIS A O    1 
ATOM   3785  C  CB   . HIS A 1 268 ? -43.830  19.516  -12.666 1.00 32.68  ? 829  HIS A CB   1 
ATOM   3786  C  CG   . HIS A 1 268 ? -42.959  20.272  -11.718 1.00 32.93  ? 829  HIS A CG   1 
ATOM   3787  N  ND1  . HIS A 1 268 ? -42.543  19.755  -10.509 1.00 29.57  ? 829  HIS A ND1  1 
ATOM   3788  C  CD2  . HIS A 1 268 ? -42.410  21.504  -11.809 1.00 33.51  ? 829  HIS A CD2  1 
ATOM   3789  C  CE1  . HIS A 1 268 ? -41.781  20.641  -9.893  1.00 33.59  ? 829  HIS A CE1  1 
ATOM   3790  N  NE2  . HIS A 1 268 ? -41.689  21.714  -10.659 1.00 31.85  ? 829  HIS A NE2  1 
ATOM   3791  H  H    . HIS A 1 268 ? -44.752  18.616  -14.733 1.00 40.12  ? 829  HIS A H    1 
ATOM   3792  H  HA   . HIS A 1 268 ? -42.324  19.320  -14.040 1.00 37.24  ? 829  HIS A HA   1 
ATOM   3793  H  HB2  . HIS A 1 268 ? -44.422  20.152  -13.097 1.00 39.22  ? 829  HIS A HB2  1 
ATOM   3794  H  HB3  . HIS A 1 268 ? -44.351  18.881  -12.149 1.00 39.22  ? 829  HIS A HB3  1 
ATOM   3795  H  HD1  . HIS A 1 268 ? -42.749  18.978  -10.203 1.00 35.49  ? 829  HIS A HD1  1 
ATOM   3796  H  HD2  . HIS A 1 268 ? -42.510  22.102  -12.515 1.00 40.21  ? 829  HIS A HD2  1 
ATOM   3797  H  HE1  . HIS A 1 268 ? -41.382  20.531  -9.060  1.00 40.31  ? 829  HIS A HE1  1 
ATOM   3798  H  HE2  . HIS A 1 268 ? -41.243  22.425  -10.471 1.00 38.22  ? 829  HIS A HE2  1 
ATOM   3799  N  N    . PRO A 1 269 ? -41.234  17.539  -12.620 1.00 30.81  ? 830  PRO A N    1 
ATOM   3800  C  CA   . PRO A 1 269 ? -40.642  16.343  -11.999 1.00 34.82  ? 830  PRO A CA   1 
ATOM   3801  C  C    . PRO A 1 269 ? -41.457  15.765  -10.857 1.00 33.75  ? 830  PRO A C    1 
ATOM   3802  O  O    . PRO A 1 269 ? -41.208  14.619  -10.460 1.00 33.31  ? 830  PRO A O    1 
ATOM   3803  C  CB   . PRO A 1 269 ? -39.264  16.832  -11.521 1.00 30.15  ? 830  PRO A CB   1 
ATOM   3804  C  CG   . PRO A 1 269 ? -39.293  18.322  -11.653 1.00 34.95  ? 830  PRO A CG   1 
ATOM   3805  C  CD   . PRO A 1 269 ? -40.239  18.616  -12.753 1.00 35.13  ? 830  PRO A CD   1 
ATOM   3806  H  HA   . PRO A 1 269 ? -40.513  15.654  -12.669 1.00 41.78  ? 830  PRO A HA   1 
ATOM   3807  H  HB2  . PRO A 1 269 ? -39.130  16.574  -10.596 1.00 36.18  ? 830  PRO A HB2  1 
ATOM   3808  H  HB3  . PRO A 1 269 ? -38.571  16.452  -12.085 1.00 36.18  ? 830  PRO A HB3  1 
ATOM   3809  H  HG2  . PRO A 1 269 ? -39.603  18.715  -10.823 1.00 41.94  ? 830  PRO A HG2  1 
ATOM   3810  H  HG3  . PRO A 1 269 ? -38.405  18.645  -11.873 1.00 41.94  ? 830  PRO A HG3  1 
ATOM   3811  H  HD2  . PRO A 1 269 ? -40.656  19.482  -12.620 1.00 42.16  ? 830  PRO A HD2  1 
ATOM   3812  H  HD3  . PRO A 1 269 ? -39.791  18.562  -13.611 1.00 42.16  ? 830  PRO A HD3  1 
ATOM   3813  N  N    . PHE A 1 270 ? -42.419  16.513  -10.325 1.00 36.42  ? 831  PHE A N    1 
ATOM   3814  C  CA   . PHE A 1 270 ? -43.301  15.994  -9.290  1.00 34.24  ? 831  PHE A CA   1 
ATOM   3815  C  C    . PHE A 1 270 ? -43.905  14.652  -9.689  1.00 32.03  ? 831  PHE A C    1 
ATOM   3816  O  O    . PHE A 1 270 ? -44.124  13.791  -8.830  1.00 31.74  ? 831  PHE A O    1 
ATOM   3817  C  CB   . PHE A 1 270 ? -44.387  17.039  -9.015  1.00 39.36  ? 831  PHE A CB   1 
ATOM   3818  C  CG   . PHE A 1 270 ? -45.421  16.609  -8.026  1.00 32.12  ? 831  PHE A CG   1 
ATOM   3819  C  CD1  . PHE A 1 270 ? -45.116  16.498  -6.681  1.00 36.35  ? 831  PHE A CD1  1 
ATOM   3820  C  CD2  . PHE A 1 270 ? -46.710  16.337  -8.441  1.00 31.78  ? 831  PHE A CD2  1 
ATOM   3821  C  CE1  . PHE A 1 270 ? -46.075  16.113  -5.777  1.00 34.33  ? 831  PHE A CE1  1 
ATOM   3822  C  CE2  . PHE A 1 270 ? -47.669  15.955  -7.543  1.00 31.94  ? 831  PHE A CE2  1 
ATOM   3823  C  CZ   . PHE A 1 270 ? -47.354  15.840  -6.208  1.00 35.53  ? 831  PHE A CZ   1 
ATOM   3824  H  H    . PHE A 1 270 ? -42.581  17.328  -10.548 1.00 43.70  ? 831  PHE A H    1 
ATOM   3825  H  HA   . PHE A 1 270 ? -42.793  15.865  -8.474  1.00 41.09  ? 831  PHE A HA   1 
ATOM   3826  H  HB2  . PHE A 1 270 ? -43.965  17.841  -8.670  1.00 47.23  ? 831  PHE A HB2  1 
ATOM   3827  H  HB3  . PHE A 1 270 ? -44.842  17.240  -9.847  1.00 47.23  ? 831  PHE A HB3  1 
ATOM   3828  H  HD1  . PHE A 1 270 ? -44.253  16.682  -6.387  1.00 43.62  ? 831  PHE A HD1  1 
ATOM   3829  H  HD2  . PHE A 1 270 ? -46.928  16.413  -9.342  1.00 38.14  ? 831  PHE A HD2  1 
ATOM   3830  H  HE1  . PHE A 1 270 ? -45.861  16.036  -4.875  1.00 41.19  ? 831  PHE A HE1  1 
ATOM   3831  H  HE2  . PHE A 1 270 ? -48.532  15.769  -7.835  1.00 38.33  ? 831  PHE A HE2  1 
ATOM   3832  H  HZ   . PHE A 1 270 ? -48.005  15.578  -5.598  1.00 42.63  ? 831  PHE A HZ   1 
ATOM   3833  N  N    . PHE A 1 271 ? -44.172  14.453  -10.983 1.00 28.60  ? 832  PHE A N    1 
ATOM   3834  C  CA   . PHE A 1 271 ? -44.816  13.245  -11.485 1.00 34.48  ? 832  PHE A CA   1 
ATOM   3835  C  C    . PHE A 1 271 ? -43.841  12.196  -12.028 1.00 38.94  ? 832  PHE A C    1 
ATOM   3836  O  O    . PHE A 1 271 ? -44.288  11.128  -12.452 1.00 34.40  ? 832  PHE A O    1 
ATOM   3837  C  CB   . PHE A 1 271 ? -45.831  13.611  -12.577 1.00 28.56  ? 832  PHE A CB   1 
ATOM   3838  C  CG   . PHE A 1 271 ? -46.998  14.430  -12.076 1.00 31.56  ? 832  PHE A CG   1 
ATOM   3839  C  CD1  . PHE A 1 271 ? -47.936  13.875  -11.221 1.00 41.29  ? 832  PHE A CD1  1 
ATOM   3840  C  CD2  . PHE A 1 271 ? -47.163  15.748  -12.468 1.00 33.57  ? 832  PHE A CD2  1 
ATOM   3841  C  CE1  . PHE A 1 271 ? -49.010  14.625  -10.760 1.00 38.30  ? 832  PHE A CE1  1 
ATOM   3842  C  CE2  . PHE A 1 271 ? -48.236  16.498  -12.010 1.00 36.98  ? 832  PHE A CE2  1 
ATOM   3843  C  CZ   . PHE A 1 271 ? -49.154  15.937  -11.156 1.00 32.21  ? 832  PHE A CZ   1 
ATOM   3844  H  H    . PHE A 1 271 ? -43.984  15.021  -11.601 1.00 34.32  ? 832  PHE A H    1 
ATOM   3845  H  HA   . PHE A 1 271 ? -45.307  12.835  -10.756 1.00 41.37  ? 832  PHE A HA   1 
ATOM   3846  H  HB2  . PHE A 1 271 ? -45.380  14.128  -13.263 1.00 34.27  ? 832  PHE A HB2  1 
ATOM   3847  H  HB3  . PHE A 1 271 ? -46.186  12.794  -12.960 1.00 34.27  ? 832  PHE A HB3  1 
ATOM   3848  H  HD1  . PHE A 1 271 ? -47.842  12.991  -10.948 1.00 49.55  ? 832  PHE A HD1  1 
ATOM   3849  H  HD2  . PHE A 1 271 ? -46.544  16.137  -13.043 1.00 40.29  ? 832  PHE A HD2  1 
ATOM   3850  H  HE1  . PHE A 1 271 ? -49.631  14.242  -10.184 1.00 45.96  ? 832  PHE A HE1  1 
ATOM   3851  H  HE2  . PHE A 1 271 ? -48.332  17.383  -12.279 1.00 44.38  ? 832  PHE A HE2  1 
ATOM   3852  H  HZ   . PHE A 1 271 ? -49.874  16.440  -10.851 1.00 38.66  ? 832  PHE A HZ   1 
ATOM   3853  N  N    . TRP A 1 272 ? -42.535  12.453  -12.028 1.00 33.84  ? 833  TRP A N    1 
ATOM   3854  C  CA   . TRP A 1 272 ? -41.589  11.534  -12.659 1.00 40.90  ? 833  TRP A CA   1 
ATOM   3855  C  C    . TRP A 1 272 ? -41.326  10.311  -11.788 1.00 38.56  ? 833  TRP A C    1 
ATOM   3856  O  O    . TRP A 1 272 ? -41.228  10.411  -10.560 1.00 33.94  ? 833  TRP A O    1 
ATOM   3857  C  CB   . TRP A 1 272 ? -40.252  12.222  -12.941 1.00 35.31  ? 833  TRP A CB   1 
ATOM   3858  C  CG   . TRP A 1 272 ? -40.306  13.366  -13.908 1.00 35.36  ? 833  TRP A CG   1 
ATOM   3859  C  CD1  . TRP A 1 272 ? -41.390  13.803  -14.613 1.00 36.92  ? 833  TRP A CD1  1 
ATOM   3860  C  CD2  . TRP A 1 272 ? -39.219  14.228  -14.267 1.00 33.96  ? 833  TRP A CD2  1 
ATOM   3861  N  NE1  . TRP A 1 272 ? -41.045  14.889  -15.385 1.00 38.09  ? 833  TRP A NE1  1 
ATOM   3862  C  CE2  . TRP A 1 272 ? -39.717  15.166  -15.192 1.00 35.98  ? 833  TRP A CE2  1 
ATOM   3863  C  CE3  . TRP A 1 272 ? -37.875  14.303  -13.887 1.00 31.41  ? 833  TRP A CE3  1 
ATOM   3864  C  CZ2  . TRP A 1 272 ? -38.918  16.160  -15.746 1.00 41.73  ? 833  TRP A CZ2  1 
ATOM   3865  C  CZ3  . TRP A 1 272 ? -37.086  15.288  -14.438 1.00 32.77  ? 833  TRP A CZ3  1 
ATOM   3866  C  CH2  . TRP A 1 272 ? -37.608  16.204  -15.358 1.00 38.29  ? 833  TRP A CH2  1 
ATOM   3867  H  H    . TRP A 1 272 ? -42.173  13.147  -11.672 1.00 40.60  ? 833  TRP A H    1 
ATOM   3868  H  HA   . TRP A 1 272 ? -41.957  11.230  -13.503 1.00 49.08  ? 833  TRP A HA   1 
ATOM   3869  H  HB2  . TRP A 1 272 ? -39.901  12.565  -12.104 1.00 42.37  ? 833  TRP A HB2  1 
ATOM   3870  H  HB3  . TRP A 1 272 ? -39.639  11.564  -13.304 1.00 42.37  ? 833  TRP A HB3  1 
ATOM   3871  H  HD1  . TRP A 1 272 ? -42.239  13.426  -14.575 1.00 44.30  ? 833  TRP A HD1  1 
ATOM   3872  H  HE1  . TRP A 1 272 ? -41.573  15.317  -15.911 1.00 45.71  ? 833  TRP A HE1  1 
ATOM   3873  H  HE3  . TRP A 1 272 ? -37.521  13.698  -13.276 1.00 37.69  ? 833  TRP A HE3  1 
ATOM   3874  H  HZ2  . TRP A 1 272 ? -39.262  16.771  -16.358 1.00 50.08  ? 833  TRP A HZ2  1 
ATOM   3875  H  HZ3  . TRP A 1 272 ? -36.190  15.344  -14.196 1.00 39.32  ? 833  TRP A HZ3  1 
ATOM   3876  H  HH2  . TRP A 1 272 ? -37.050  16.857  -15.715 1.00 45.95  ? 833  TRP A HH2  1 
ATOM   3877  N  N    . SER A 1 273 ? -41.184  9.155   -12.437 1.00 36.33  ? 834  SER A N    1 
ATOM   3878  C  CA   . SER A 1 273 ? -40.716  7.956   -11.757 1.00 40.00  ? 834  SER A CA   1 
ATOM   3879  C  C    . SER A 1 273 ? -39.233  8.091   -11.426 1.00 34.87  ? 834  SER A C    1 
ATOM   3880  O  O    . SER A 1 273 ? -38.520  8.918   -11.999 1.00 36.61  ? 834  SER A O    1 
ATOM   3881  C  CB   . SER A 1 273 ? -40.944  6.716   -12.621 1.00 27.66  ? 834  SER A CB   1 
ATOM   3882  O  OG   . SER A 1 273 ? -40.226  6.806   -13.836 1.00 47.96  ? 834  SER A OG   1 
ATOM   3883  H  H    . SER A 1 273 ? -41.353  9.043   -13.273 1.00 43.60  ? 834  SER A H    1 
ATOM   3884  H  HA   . SER A 1 273 ? -41.206  7.844   -10.928 1.00 48.00  ? 834  SER A HA   1 
ATOM   3885  H  HB2  . SER A 1 273 ? -40.643  5.933   -12.134 1.00 33.20  ? 834  SER A HB2  1 
ATOM   3886  H  HB3  . SER A 1 273 ? -41.890  6.640   -12.819 1.00 33.20  ? 834  SER A HB3  1 
ATOM   3887  H  HG   . SER A 1 273 ? -40.360  6.119   -14.301 1.00 57.55  ? 834  SER A HG   1 
ATOM   3888  N  N    . LEU A 1 274 ? -38.775  7.282   -10.465 1.00 29.14  ? 835  LEU A N    1 
ATOM   3889  C  CA   . LEU A 1 274 ? -37.359  7.293   -10.102 1.00 38.13  ? 835  LEU A CA   1 
ATOM   3890  C  C    . LEU A 1 274 ? -36.476  7.077   -11.324 1.00 40.22  ? 835  LEU A C    1 
ATOM   3891  O  O    . LEU A 1 274 ? -35.449  7.747   -11.486 1.00 45.27  ? 835  LEU A O    1 
ATOM   3892  C  CB   . LEU A 1 274 ? -37.073  6.224   -9.041  1.00 39.07  ? 835  LEU A CB   1 
ATOM   3893  C  CG   . LEU A 1 274 ? -37.677  6.442   -7.647  1.00 41.36  ? 835  LEU A CG   1 
ATOM   3894  C  CD1  . LEU A 1 274 ? -37.371  5.257   -6.742  1.00 36.42  ? 835  LEU A CD1  1 
ATOM   3895  C  CD2  . LEU A 1 274 ? -37.172  7.725   -7.025  1.00 39.77  ? 835  LEU A CD2  1 
ATOM   3896  H  H    . LEU A 1 274 ? -39.256  6.727   -10.017 1.00 34.96  ? 835  LEU A H    1 
ATOM   3897  H  HA   . LEU A 1 274 ? -37.138  8.158   -9.722  1.00 45.75  ? 835  LEU A HA   1 
ATOM   3898  H  HB2  . LEU A 1 274 ? -37.412  5.377   -9.369  1.00 46.88  ? 835  LEU A HB2  1 
ATOM   3899  H  HB3  . LEU A 1 274 ? -36.112  6.162   -8.928  1.00 46.88  ? 835  LEU A HB3  1 
ATOM   3900  H  HG   . LEU A 1 274 ? -38.641  6.511   -7.730  1.00 49.64  ? 835  LEU A HG   1 
ATOM   3901  H  HD11 . LEU A 1 274 ? -37.762  5.418   -5.869  1.00 43.70  ? 835  LEU A HD11 1 
ATOM   3902  H  HD12 . LEU A 1 274 ? -37.751  4.455   -7.132  1.00 43.70  ? 835  LEU A HD12 1 
ATOM   3903  H  HD13 . LEU A 1 274 ? -36.409  5.163   -6.661  1.00 43.70  ? 835  LEU A HD13 1 
ATOM   3904  H  HD21 . LEU A 1 274 ? -37.573  7.829   -6.148  1.00 47.73  ? 835  LEU A HD21 1 
ATOM   3905  H  HD22 . LEU A 1 274 ? -36.206  7.677   -6.944  1.00 47.73  ? 835  LEU A HD22 1 
ATOM   3906  H  HD23 . LEU A 1 274 ? -37.420  8.470   -7.594  1.00 47.73  ? 835  LEU A HD23 1 
ATOM   3907  N  N    . GLU A 1 275 ? -36.872  6.152   -12.203 1.00 38.35  ? 836  GLU A N    1 
ATOM   3908  C  CA   . GLU A 1 275 ? -36.120  5.908   -13.431 1.00 43.83  ? 836  GLU A CA   1 
ATOM   3909  C  C    . GLU A 1 275 ? -36.049  7.161   -14.300 1.00 38.61  ? 836  GLU A C    1 
ATOM   3910  O  O    . GLU A 1 275 ? -34.997  7.468   -14.874 1.00 36.24  ? 836  GLU A O    1 
ATOM   3911  C  CB   . GLU A 1 275 ? -36.759  4.746   -14.194 1.00 37.09  ? 836  GLU A CB   1 
ATOM   3912  C  CG   . GLU A 1 275 ? -36.197  4.496   -15.586 1.00 57.55  ? 836  GLU A CG   1 
ATOM   3913  C  CD   . GLU A 1 275 ? -36.864  3.321   -16.275 1.00 74.16  ? 836  GLU A CD   1 
ATOM   3914  O  OE1  . GLU A 1 275 ? -37.492  2.497   -15.577 1.00 81.99  ? 836  GLU A OE1  1 
ATOM   3915  O  OE2  . GLU A 1 275 ? -36.766  3.225   -17.516 1.00 93.68  ? 836  GLU A OE2  1 
ATOM   3916  H  H    . GLU A 1 275 ? -37.568  5.657   -12.110 1.00 46.02  ? 836  GLU A H    1 
ATOM   3917  H  HA   . GLU A 1 275 ? -35.213  5.653   -13.200 1.00 52.60  ? 836  GLU A HA   1 
ATOM   3918  H  HB2  . GLU A 1 275 ? -36.634  3.934   -13.679 1.00 44.51  ? 836  GLU A HB2  1 
ATOM   3919  H  HB3  . GLU A 1 275 ? -37.707  4.926   -14.291 1.00 44.51  ? 836  GLU A HB3  1 
ATOM   3920  H  HG2  . GLU A 1 275 ? -36.337  5.285   -16.132 1.00 69.06  ? 836  GLU A HG2  1 
ATOM   3921  H  HG3  . GLU A 1 275 ? -35.248  4.304   -15.515 1.00 69.06  ? 836  GLU A HG3  1 
ATOM   3922  N  N    . LYS A 1 276 ? -37.156  7.903   -14.406 1.00 46.67  ? 837  LYS A N    1 
ATOM   3923  C  CA   . LYS A 1 276 ? -37.169  9.099   -15.244 1.00 39.47  ? 837  LYS A CA   1 
ATOM   3924  C  C    . LYS A 1 276 ? -36.317  10.215  -14.653 1.00 39.97  ? 837  LYS A C    1 
ATOM   3925  O  O    . LYS A 1 276 ? -35.737  11.013  -15.400 1.00 39.30  ? 837  LYS A O    1 
ATOM   3926  C  CB   . LYS A 1 276 ? -38.600  9.588   -15.443 1.00 38.75  ? 837  LYS A CB   1 
ATOM   3927  C  CG   . LYS A 1 276 ? -38.696  10.833  -16.307 1.00 46.39  ? 837  LYS A CG   1 
ATOM   3928  C  CD   . LYS A 1 276 ? -40.119  11.094  -16.772 1.00 46.68  ? 837  LYS A CD   1 
ATOM   3929  C  CE   . LYS A 1 276 ? -40.165  12.217  -17.796 1.00 47.55  ? 837  LYS A CE   1 
ATOM   3930  N  NZ   . LYS A 1 276 ? -41.520  12.388  -18.388 1.00 56.32  ? 837  LYS A NZ   1 
ATOM   3931  H  H    . LYS A 1 276 ? -37.900  7.737   -14.008 1.00 56.01  ? 837  LYS A H    1 
ATOM   3932  H  HA   . LYS A 1 276 ? -36.805  8.876   -16.115 1.00 47.36  ? 837  LYS A HA   1 
ATOM   3933  H  HB2  . LYS A 1 276 ? -39.115  8.886   -15.873 1.00 46.50  ? 837  LYS A HB2  1 
ATOM   3934  H  HB3  . LYS A 1 276 ? -38.985  9.795   -14.577 1.00 46.50  ? 837  LYS A HB3  1 
ATOM   3935  H  HG2  . LYS A 1 276 ? -38.401  11.601  -15.792 1.00 55.66  ? 837  LYS A HG2  1 
ATOM   3936  H  HG3  . LYS A 1 276 ? -38.137  10.721  -17.091 1.00 55.66  ? 837  LYS A HG3  1 
ATOM   3937  H  HD2  . LYS A 1 276 ? -40.474  10.291  -17.185 1.00 56.01  ? 837  LYS A HD2  1 
ATOM   3938  H  HD3  . LYS A 1 276 ? -40.664  11.351  -16.012 1.00 56.01  ? 837  LYS A HD3  1 
ATOM   3939  H  HE2  . LYS A 1 276 ? -39.918  13.050  -17.364 1.00 57.06  ? 837  LYS A HE2  1 
ATOM   3940  H  HE3  . LYS A 1 276 ? -39.544  12.018  -18.514 1.00 57.06  ? 837  LYS A HE3  1 
ATOM   3941  H  HZ1  . LYS A 1 276 ? -41.511  13.052  -18.981 1.00 67.58  ? 837  LYS A HZ1  1 
ATOM   3942  H  HZ2  . LYS A 1 276 ? -41.769  11.638  -18.798 1.00 67.58  ? 837  LYS A HZ2  1 
ATOM   3943  H  HZ3  . LYS A 1 276 ? -42.109  12.578  -17.749 1.00 67.58  ? 837  LYS A HZ3  1 
ATOM   3944  N  N    . GLN A 1 277 ? -36.238  10.296  -13.325 1.00 36.15  ? 838  GLN A N    1 
ATOM   3945  C  CA   . GLN A 1 277 ? -35.384  11.296  -12.694 1.00 32.27  ? 838  GLN A CA   1 
ATOM   3946  C  C    . GLN A 1 277 ? -33.918  11.030  -13.008 1.00 39.91  ? 838  GLN A C    1 
ATOM   3947  O  O    . GLN A 1 277 ? -33.170  11.951  -13.360 1.00 33.97  ? 838  GLN A O    1 
ATOM   3948  C  CB   . GLN A 1 277 ? -35.617  11.303  -11.185 1.00 36.54  ? 838  GLN A CB   1 
ATOM   3949  C  CG   . GLN A 1 277 ? -37.019  11.702  -10.775 1.00 30.39  ? 838  GLN A CG   1 
ATOM   3950  C  CD   . GLN A 1 277 ? -37.257  11.530  -9.290  1.00 39.06  ? 838  GLN A CD   1 
ATOM   3951  O  OE1  . GLN A 1 277 ? -36.334  11.646  -8.485  1.00 37.09  ? 838  GLN A OE1  1 
ATOM   3952  N  NE2  . GLN A 1 277 ? -38.498  11.242  -8.919  1.00 40.74  ? 838  GLN A NE2  1 
ATOM   3953  H  H    . GLN A 1 277 ? -36.663  9.790   -12.774 1.00 43.38  ? 838  GLN A H    1 
ATOM   3954  H  HA   . GLN A 1 277 ? -35.613  12.173  -13.040 1.00 38.73  ? 838  GLN A HA   1 
ATOM   3955  H  HB2  . GLN A 1 277 ? -35.451  10.412  -10.840 1.00 43.85  ? 838  GLN A HB2  1 
ATOM   3956  H  HB3  . GLN A 1 277 ? -35.001  11.932  -10.778 1.00 43.85  ? 838  GLN A HB3  1 
ATOM   3957  H  HG2  . GLN A 1 277 ? -37.161  12.636  -10.997 1.00 36.47  ? 838  GLN A HG2  1 
ATOM   3958  H  HG3  . GLN A 1 277 ? -37.658  11.146  -11.249 1.00 36.47  ? 838  GLN A HG3  1 
ATOM   3959  H  HE21 . GLN A 1 277 ? -39.117  11.163  -9.511  1.00 48.88  ? 838  GLN A HE21 1 
ATOM   3960  H  HE22 . GLN A 1 277 ? -38.684  11.134  -8.086  1.00 48.88  ? 838  GLN A HE22 1 
ATOM   3961  N  N    . LEU A 1 278 ? -33.488  9.771   -12.881 1.00 33.50  ? 839  LEU A N    1 
ATOM   3962  C  CA   . LEU A 1 278 ? -32.100  9.425   -13.164 1.00 35.00  ? 839  LEU A CA   1 
ATOM   3963  C  C    . LEU A 1 278 ? -31.765  9.612   -14.635 1.00 42.79  ? 839  LEU A C    1 
ATOM   3964  O  O    . LEU A 1 278 ? -30.632  9.975   -14.970 1.00 43.29  ? 839  LEU A O    1 
ATOM   3965  C  CB   . LEU A 1 278 ? -31.814  7.983   -12.749 1.00 35.99  ? 839  LEU A CB   1 
ATOM   3966  C  CG   . LEU A 1 278 ? -30.383  7.496   -12.987 1.00 38.13  ? 839  LEU A CG   1 
ATOM   3967  C  CD1  . LEU A 1 278 ? -29.379  8.348   -12.231 1.00 38.54  ? 839  LEU A CD1  1 
ATOM   3968  C  CD2  . LEU A 1 278 ? -30.248  6.039   -12.591 1.00 38.68  ? 839  LEU A CD2  1 
ATOM   3969  H  H    . LEU A 1 278 ? -33.978  9.108   -12.635 1.00 40.20  ? 839  LEU A H    1 
ATOM   3970  H  HA   . LEU A 1 278 ? -31.518  10.006  -12.648 1.00 42.00  ? 839  LEU A HA   1 
ATOM   3971  H  HB2  . LEU A 1 278 ? -31.997  7.895   -11.801 1.00 43.18  ? 839  LEU A HB2  1 
ATOM   3972  H  HB3  . LEU A 1 278 ? -32.406  7.399   -13.248 1.00 43.18  ? 839  LEU A HB3  1 
ATOM   3973  H  HG   . LEU A 1 278 ? -30.181  7.567   -13.933 1.00 45.76  ? 839  LEU A HG   1 
ATOM   3974  H  HD11 . LEU A 1 278 ? -28.486  8.011   -12.405 1.00 46.25  ? 839  LEU A HD11 1 
ATOM   3975  H  HD12 . LEU A 1 278 ? -29.452  9.266   -12.536 1.00 46.25  ? 839  LEU A HD12 1 
ATOM   3976  H  HD13 . LEU A 1 278 ? -29.573  8.297   -11.282 1.00 46.25  ? 839  LEU A HD13 1 
ATOM   3977  H  HD21 . LEU A 1 278 ? -29.335  5.752   -12.750 1.00 46.41  ? 839  LEU A HD21 1 
ATOM   3978  H  HD22 . LEU A 1 278 ? -30.466  5.946   -11.651 1.00 46.41  ? 839  LEU A HD22 1 
ATOM   3979  H  HD23 . LEU A 1 278 ? -30.860  5.509   -13.127 1.00 46.41  ? 839  LEU A HD23 1 
ATOM   3980  N  N    . GLN A 1 279 ? -32.726  9.359   -15.525 1.00 44.90  ? 840  GLN A N    1 
ATOM   3981  C  CA   . GLN A 1 279 ? -32.487  9.572   -16.947 1.00 45.78  ? 840  GLN A CA   1 
ATOM   3982  C  C    . GLN A 1 279 ? -32.385  11.054  -17.277 1.00 42.76  ? 840  GLN A C    1 
ATOM   3983  O  O    . GLN A 1 279 ? -31.697  11.426  -18.234 1.00 48.75  ? 840  GLN A O    1 
ATOM   3984  C  CB   . GLN A 1 279 ? -33.599  8.920   -17.769 1.00 49.24  ? 840  GLN A CB   1 
ATOM   3985  C  CG   . GLN A 1 279 ? -33.208  8.619   -19.209 1.00 68.37  ? 840  GLN A CG   1 
ATOM   3986  C  CD   . GLN A 1 279 ? -32.252  7.442   -19.328 1.00 81.35  ? 840  GLN A CD   1 
ATOM   3987  O  OE1  . GLN A 1 279 ? -31.745  6.932   -18.328 1.00 72.75  ? 840  GLN A OE1  1 
ATOM   3988  N  NE2  . GLN A 1 279 ? -32.008  7.000   -20.557 1.00 92.35  ? 840  GLN A NE2  1 
ATOM   3989  H  H    . GLN A 1 279 ? -33.512  9.068   -15.332 1.00 53.88  ? 840  GLN A H    1 
ATOM   3990  H  HA   . GLN A 1 279 ? -31.648  9.152   -17.192 1.00 54.93  ? 840  GLN A HA   1 
ATOM   3991  H  HB2  . GLN A 1 279 ? -33.848  8.082   -17.349 1.00 59.09  ? 840  GLN A HB2  1 
ATOM   3992  H  HB3  . GLN A 1 279 ? -34.364  9.516   -17.789 1.00 59.09  ? 840  GLN A HB3  1 
ATOM   3993  H  HG2  . GLN A 1 279 ? -34.008  8.408   -19.716 1.00 82.05  ? 840  GLN A HG2  1 
ATOM   3994  H  HG3  . GLN A 1 279 ? -32.772  9.398   -19.588 1.00 82.05  ? 840  GLN A HG3  1 
ATOM   3995  H  HE21 . GLN A 1 279 ? -32.384  7.378   -21.232 1.00 110.82 ? 840  GLN A HE21 1 
ATOM   3996  H  HE22 . GLN A 1 279 ? -31.475  6.337   -20.677 1.00 110.82 ? 840  GLN A HE22 1 
ATOM   3997  N  N    . PHE A 1 280 ? -33.058  11.911  -16.504 1.00 41.09  ? 841  PHE A N    1 
ATOM   3998  C  CA   . PHE A 1 280 ? -32.923  13.351  -16.703 1.00 42.22  ? 841  PHE A CA   1 
ATOM   3999  C  C    . PHE A 1 280 ? -31.511  13.813  -16.375 1.00 41.16  ? 841  PHE A C    1 
ATOM   4000  O  O    . PHE A 1 280 ? -30.902  14.572  -17.137 1.00 43.61  ? 841  PHE A O    1 
ATOM   4001  C  CB   . PHE A 1 280 ? -33.946  14.095  -15.847 1.00 42.48  ? 841  PHE A CB   1 
ATOM   4002  C  CG   . PHE A 1 280 ? -33.863  15.592  -15.954 1.00 42.68  ? 841  PHE A CG   1 
ATOM   4003  C  CD1  . PHE A 1 280 ? -34.242  16.242  -17.116 1.00 39.54  ? 841  PHE A CD1  1 
ATOM   4004  C  CD2  . PHE A 1 280 ? -33.429  16.350  -14.882 1.00 30.90  ? 841  PHE A CD2  1 
ATOM   4005  C  CE1  . PHE A 1 280 ? -34.176  17.621  -17.211 1.00 41.17  ? 841  PHE A CE1  1 
ATOM   4006  C  CE2  . PHE A 1 280 ? -33.361  17.727  -14.968 1.00 38.36  ? 841  PHE A CE2  1 
ATOM   4007  C  CZ   . PHE A 1 280 ? -33.735  18.364  -16.133 1.00 40.96  ? 841  PHE A CZ   1 
ATOM   4008  H  H    . PHE A 1 280 ? -33.590  11.686  -15.867 1.00 49.30  ? 841  PHE A H    1 
ATOM   4009  H  HA   . PHE A 1 280 ? -33.100  13.560  -17.634 1.00 50.66  ? 841  PHE A HA   1 
ATOM   4010  H  HB2  . PHE A 1 280 ? -34.837  13.827  -16.123 1.00 50.98  ? 841  PHE A HB2  1 
ATOM   4011  H  HB3  . PHE A 1 280 ? -33.806  13.856  -14.917 1.00 50.98  ? 841  PHE A HB3  1 
ATOM   4012  H  HD1  . PHE A 1 280 ? -34.540  15.746  -17.844 1.00 47.45  ? 841  PHE A HD1  1 
ATOM   4013  H  HD2  . PHE A 1 280 ? -33.176  15.926  -14.094 1.00 37.08  ? 841  PHE A HD2  1 
ATOM   4014  H  HE1  . PHE A 1 280 ? -34.429  18.047  -17.998 1.00 49.41  ? 841  PHE A HE1  1 
ATOM   4015  H  HE2  . PHE A 1 280 ? -33.063  18.224  -14.241 1.00 46.04  ? 841  PHE A HE2  1 
ATOM   4016  H  HZ   . PHE A 1 280 ? -33.688  19.291  -16.193 1.00 49.15  ? 841  PHE A HZ   1 
ATOM   4017  N  N    . PHE A 1 281 ? -30.974  13.366  -15.237 1.00 49.50  ? 842  PHE A N    1 
ATOM   4018  C  CA   . PHE A 1 281 ? -29.595  13.691  -14.892 1.00 43.19  ? 842  PHE A CA   1 
ATOM   4019  C  C    . PHE A 1 281 ? -28.636  13.240  -15.987 1.00 52.09  ? 842  PHE A C    1 
ATOM   4020  O  O    . PHE A 1 281 ? -27.692  13.959  -16.331 1.00 58.36  ? 842  PHE A O    1 
ATOM   4021  C  CB   . PHE A 1 281 ? -29.223  13.040  -13.560 1.00 44.54  ? 842  PHE A CB   1 
ATOM   4022  C  CG   . PHE A 1 281 ? -29.881  13.668  -12.361 1.00 33.47  ? 842  PHE A CG   1 
ATOM   4023  C  CD1  . PHE A 1 281 ? -29.932  15.044  -12.216 1.00 45.10  ? 842  PHE A CD1  1 
ATOM   4024  C  CD2  . PHE A 1 281 ? -30.437  12.875  -11.369 1.00 38.91  ? 842  PHE A CD2  1 
ATOM   4025  C  CE1  . PHE A 1 281 ? -30.525  15.615  -11.108 1.00 35.95  ? 842  PHE A CE1  1 
ATOM   4026  C  CE2  . PHE A 1 281 ? -31.032  13.440  -10.263 1.00 44.31  ? 842  PHE A CE2  1 
ATOM   4027  C  CZ   . PHE A 1 281 ? -31.077  14.810  -10.130 1.00 39.15  ? 842  PHE A CZ   1 
ATOM   4028  H  H    . PHE A 1 281 ? -31.383  12.879  -14.657 1.00 59.40  ? 842  PHE A H    1 
ATOM   4029  H  HA   . PHE A 1 281 ? -29.510  14.652  -14.793 1.00 51.82  ? 842  PHE A HA   1 
ATOM   4030  H  HB2  . PHE A 1 281 ? -29.486  12.106  -13.586 1.00 53.45  ? 842  PHE A HB2  1 
ATOM   4031  H  HB3  . PHE A 1 281 ? -28.263  13.106  -13.439 1.00 53.45  ? 842  PHE A HB3  1 
ATOM   4032  H  HD1  . PHE A 1 281 ? -29.560  15.590  -12.871 1.00 54.12  ? 842  PHE A HD1  1 
ATOM   4033  H  HD2  . PHE A 1 281 ? -30.408  11.949  -11.452 1.00 46.69  ? 842  PHE A HD2  1 
ATOM   4034  H  HE1  . PHE A 1 281 ? -30.556  16.540  -11.022 1.00 43.15  ? 842  PHE A HE1  1 
ATOM   4035  H  HE2  . PHE A 1 281 ? -31.403  12.897  -9.606  1.00 53.18  ? 842  PHE A HE2  1 
ATOM   4036  H  HZ   . PHE A 1 281 ? -31.481  15.192  -9.385  1.00 46.97  ? 842  PHE A HZ   1 
ATOM   4037  N  N    . GLN A 1 282 ? -28.867  12.053  -16.551 1.00 47.08  ? 843  GLN A N    1 
ATOM   4038  C  CA   . GLN A 1 282 ? -28.008  11.561  -17.623 1.00 49.86  ? 843  GLN A CA   1 
ATOM   4039  C  C    . GLN A 1 282 ? -28.135  12.428  -18.869 1.00 60.72  ? 843  GLN A C    1 
ATOM   4040  O  O    . GLN A 1 282 ? -27.126  12.848  -19.447 1.00 57.78  ? 843  GLN A O    1 
ATOM   4041  C  CB   . GLN A 1 282 ? -28.351  10.106  -17.945 1.00 59.78  ? 843  GLN A CB   1 
ATOM   4042  C  CG   . GLN A 1 282 ? -27.654  9.561   -19.187 1.00 54.69  ? 843  GLN A CG   1 
ATOM   4043  C  CD   . GLN A 1 282 ? -27.990  8.111   -19.448 1.00 66.44  ? 843  GLN A CD   1 
ATOM   4044  O  OE1  . GLN A 1 282 ? -27.848  7.264   -18.570 1.00 78.96  ? 843  GLN A OE1  1 
ATOM   4045  N  NE2  . GLN A 1 282 ? -28.453  7.819   -20.657 1.00 79.86  ? 843  GLN A NE2  1 
ATOM   4046  H  H    . GLN A 1 282 ? -29.507  11.522  -16.333 1.00 56.49  ? 843  GLN A H    1 
ATOM   4047  H  HA   . GLN A 1 282 ? -27.084  11.594  -17.328 1.00 59.83  ? 843  GLN A HA   1 
ATOM   4048  H  HB2  . GLN A 1 282 ? -28.091  9.551   -17.193 1.00 71.73  ? 843  GLN A HB2  1 
ATOM   4049  H  HB3  . GLN A 1 282 ? -29.308  10.036  -18.088 1.00 71.73  ? 843  GLN A HB3  1 
ATOM   4050  H  HG2  . GLN A 1 282 ? -27.932  10.078  -19.960 1.00 65.63  ? 843  GLN A HG2  1 
ATOM   4051  H  HG3  . GLN A 1 282 ? -26.693  9.630   -19.068 1.00 65.63  ? 843  GLN A HG3  1 
ATOM   4052  H  HE21 . GLN A 1 282 ? -28.547  8.441   -21.243 1.00 95.83  ? 843  GLN A HE21 1 
ATOM   4053  H  HE22 . GLN A 1 282 ? -28.659  7.008   -20.854 1.00 95.83  ? 843  GLN A HE22 1 
ATOM   4054  N  N    . ASP A 1 283 ? -29.369  12.696  -19.305 1.00 49.04  ? 844  ASP A N    1 
ATOM   4055  C  CA   . ASP A 1 283 ? -29.573  13.530  -20.487 1.00 51.93  ? 844  ASP A CA   1 
ATOM   4056  C  C    . ASP A 1 283 ? -28.978  14.917  -20.291 1.00 45.21  ? 844  ASP A C    1 
ATOM   4057  O  O    . ASP A 1 283 ? -28.466  15.521  -21.241 1.00 62.13  ? 844  ASP A O    1 
ATOM   4058  C  CB   . ASP A 1 283 ? -31.062  13.634  -20.812 1.00 68.65  ? 844  ASP A CB   1 
ATOM   4059  C  CG   . ASP A 1 283 ? -31.627  12.349  -21.378 1.00 65.06  ? 844  ASP A CG   1 
ATOM   4060  O  OD1  . ASP A 1 283 ? -30.834  11.460  -21.752 1.00 68.38  ? 844  ASP A OD1  1 
ATOM   4061  O  OD2  . ASP A 1 283 ? -32.866  12.230  -21.459 1.00 65.14  ? 844  ASP A OD2  1 
ATOM   4062  H  H    . ASP A 1 283 ? -30.093  12.411  -18.940 1.00 58.85  ? 844  ASP A H    1 
ATOM   4063  H  HA   . ASP A 1 283 ? -29.129  13.118  -21.244 1.00 62.32  ? 844  ASP A HA   1 
ATOM   4064  H  HB2  . ASP A 1 283 ? -31.549  13.844  -20.000 1.00 82.38  ? 844  ASP A HB2  1 
ATOM   4065  H  HB3  . ASP A 1 283 ? -31.194  14.335  -21.469 1.00 82.38  ? 844  ASP A HB3  1 
ATOM   4066  N  N    . VAL A 1 284 ? -29.039  15.442  -19.066 1.00 52.87  ? 845  VAL A N    1 
ATOM   4067  C  CA   . VAL A 1 284 ? -28.418  16.732  -18.779 1.00 59.15  ? 845  VAL A CA   1 
ATOM   4068  C  C    . VAL A 1 284 ? -26.901  16.616  -18.871 1.00 61.87  ? 845  VAL A C    1 
ATOM   4069  O  O    . VAL A 1 284 ? -26.235  17.454  -19.489 1.00 61.24  ? 845  VAL A O    1 
ATOM   4070  C  CB   . VAL A 1 284 ? -28.862  17.244  -17.395 1.00 43.88  ? 845  VAL A CB   1 
ATOM   4071  C  CG1  . VAL A 1 284 ? -27.976  18.400  -16.924 1.00 44.99  ? 845  VAL A CG1  1 
ATOM   4072  C  CG2  . VAL A 1 284 ? -30.321  17.676  -17.431 1.00 56.75  ? 845  VAL A CG2  1 
ATOM   4073  H  H    . VAL A 1 284 ? -29.429  15.075  -18.393 1.00 63.44  ? 845  VAL A H    1 
ATOM   4074  H  HA   . VAL A 1 284 ? -28.709  17.376  -19.443 1.00 70.98  ? 845  VAL A HA   1 
ATOM   4075  H  HB   . VAL A 1 284 ? -28.780  16.524  -16.751 1.00 52.66  ? 845  VAL A HB   1 
ATOM   4076  H  HG11 . VAL A 1 284 ? -28.282  18.697  -16.053 1.00 53.98  ? 845  VAL A HG11 1 
ATOM   4077  H  HG12 . VAL A 1 284 ? -27.059  18.090  -16.864 1.00 53.98  ? 845  VAL A HG12 1 
ATOM   4078  H  HG13 . VAL A 1 284 ? -28.040  19.127  -17.563 1.00 53.98  ? 845  VAL A HG13 1 
ATOM   4079  H  HG21 . VAL A 1 284 ? -30.578  17.995  -16.551 1.00 68.10  ? 845  VAL A HG21 1 
ATOM   4080  H  HG22 . VAL A 1 284 ? -30.424  18.387  -18.083 1.00 68.10  ? 845  VAL A HG22 1 
ATOM   4081  H  HG23 . VAL A 1 284 ? -30.869  16.916  -17.681 1.00 68.10  ? 845  VAL A HG23 1 
ATOM   4082  N  N    . SER A 1 285 ? -26.335  15.573  -18.257 1.00 54.14  ? 846  SER A N    1 
ATOM   4083  C  CA   . SER A 1 285 ? -24.884  15.415  -18.241 1.00 64.95  ? 846  SER A CA   1 
ATOM   4084  C  C    . SER A 1 285 ? -24.324  15.291  -19.653 1.00 64.20  ? 846  SER A C    1 
ATOM   4085  O  O    . SER A 1 285 ? -23.307  15.914  -19.981 1.00 59.11  ? 846  SER A O    1 
ATOM   4086  C  CB   . SER A 1 285 ? -24.501  14.195  -17.403 1.00 60.81  ? 846  SER A CB   1 
ATOM   4087  O  OG   . SER A 1 285 ? -23.097  14.114  -17.230 1.00 62.83  ? 846  SER A OG   1 
ATOM   4088  H  H    . SER A 1 285 ? -26.766  14.952  -17.847 1.00 64.96  ? 846  SER A H    1 
ATOM   4089  H  HA   . SER A 1 285 ? -24.486  16.198  -17.829 1.00 77.93  ? 846  SER A HA   1 
ATOM   4090  H  HB2  . SER A 1 285 ? -24.922  14.267  -16.532 1.00 72.97  ? 846  SER A HB2  1 
ATOM   4091  H  HB3  . SER A 1 285 ? -24.810  13.394  -17.854 1.00 72.97  ? 846  SER A HB3  1 
ATOM   4092  H  HG   . SER A 1 285 ? -22.816  14.802  -16.840 1.00 75.39  ? 846  SER A HG   1 
ATOM   4093  N  N    . ASP A 1 286 ? -24.970  14.491  -20.503 1.00 67.18  ? 847  ASP A N    1 
ATOM   4094  C  CA   . ASP A 1 286 ? -24.524  14.368  -21.886 1.00 59.88  ? 847  ASP A CA   1 
ATOM   4095  C  C    . ASP A 1 286 ? -24.686  15.681  -22.643 1.00 68.72  ? 847  ASP A C    1 
ATOM   4096  O  O    . ASP A 1 286 ? -23.961  15.932  -23.611 1.00 82.16  ? 847  ASP A O    1 
ATOM   4097  C  CB   . ASP A 1 286 ? -25.300  13.253  -22.589 1.00 53.97  ? 847  ASP A CB   1 
ATOM   4098  C  CG   . ASP A 1 286 ? -25.163  11.905  -21.893 1.00 59.53  ? 847  ASP A CG   1 
ATOM   4099  O  OD1  . ASP A 1 286 ? -24.119  11.661  -21.249 1.00 67.84  ? 847  ASP A OD1  1 
ATOM   4100  O  OD2  . ASP A 1 286 ? -26.101  11.086  -21.990 1.00 71.96  ? 847  ASP A OD2  1 
ATOM   4101  H  H    . ASP A 1 286 ? -25.659  14.016  -20.306 1.00 80.61  ? 847  ASP A H    1 
ATOM   4102  H  HA   . ASP A 1 286 ? -23.583  14.131  -21.895 1.00 71.85  ? 847  ASP A HA   1 
ATOM   4103  H  HB2  . ASP A 1 286 ? -26.241  13.486  -22.607 1.00 64.76  ? 847  ASP A HB2  1 
ATOM   4104  H  HB3  . ASP A 1 286 ? -24.965  13.158  -23.495 1.00 64.76  ? 847  ASP A HB3  1 
ATOM   4105  N  N    . ARG A 1 287 ? -25.617  16.535  -22.213 1.00 57.19  ? 848  ARG A N    1 
ATOM   4106  C  CA   . ARG A 1 287 ? -25.889  17.777  -22.930 1.00 62.80  ? 848  ARG A CA   1 
ATOM   4107  C  C    . ARG A 1 287 ? -24.856  18.854  -22.617 1.00 67.94  ? 848  ARG A C    1 
ATOM   4108  O  O    . ARG A 1 287 ? -24.418  19.577  -23.520 1.00 81.46  ? 848  ARG A O    1 
ATOM   4109  C  CB   . ARG A 1 287 ? -27.291  18.278  -22.581 1.00 65.90  ? 848  ARG A CB   1 
ATOM   4110  C  CG   . ARG A 1 287 ? -27.639  19.646  -23.152 1.00 69.09  ? 848  ARG A CG   1 
ATOM   4111  C  CD   . ARG A 1 287 ? -27.583  19.655  -24.671 1.00 83.18  ? 848  ARG A CD   1 
ATOM   4112  N  NE   . ARG A 1 287 ? -27.911  20.971  -25.215 1.00 80.95  ? 848  ARG A NE   1 
ATOM   4113  C  CZ   . ARG A 1 287 ? -27.036  21.960  -25.373 1.00 75.82  ? 848  ARG A CZ   1 
ATOM   4114  N  NH1  . ARG A 1 287 ? -25.765  21.795  -25.032 1.00 64.86  ? 848  ARG A NH1  1 
ATOM   4115  N  NH2  . ARG A 1 287 ? -27.434  23.122  -25.874 1.00 63.00  ? 848  ARG A NH2  1 
ATOM   4116  H  H    . ARG A 1 287 ? -26.101  16.417  -21.512 1.00 68.63  ? 848  ARG A H    1 
ATOM   4117  H  HA   . ARG A 1 287 ? -25.861  17.603  -23.884 1.00 75.36  ? 848  ARG A HA   1 
ATOM   4118  H  HB2  . ARG A 1 287 ? -27.940  17.643  -22.923 1.00 79.08  ? 848  ARG A HB2  1 
ATOM   4119  H  HB3  . ARG A 1 287 ? -27.368  18.334  -21.616 1.00 79.08  ? 848  ARG A HB3  1 
ATOM   4120  H  HG2  . ARG A 1 287 ? -28.539  19.885  -22.881 1.00 82.91  ? 848  ARG A HG2  1 
ATOM   4121  H  HG3  . ARG A 1 287 ? -27.005  20.301  -22.821 1.00 82.91  ? 848  ARG A HG3  1 
ATOM   4122  H  HD2  . ARG A 1 287 ? -26.686  19.423  -24.958 1.00 99.82  ? 848  ARG A HD2  1 
ATOM   4123  H  HD3  . ARG A 1 287 ? -28.223  19.015  -25.018 1.00 99.82  ? 848  ARG A HD3  1 
ATOM   4124  H  HE   . ARG A 1 287 ? -28.726  21.115  -25.450 1.00 97.14  ? 848  ARG A HE   1 
ATOM   4125  H  HH11 . ARG A 1 287 ? -25.501  21.045  -24.706 1.00 77.83  ? 848  ARG A HH11 1 
ATOM   4126  H  HH12 . ARG A 1 287 ? -25.204  22.439  -25.137 1.00 77.83  ? 848  ARG A HH12 1 
ATOM   4127  H  HH21 . ARG A 1 287 ? -28.257  23.235  -26.097 1.00 75.60  ? 848  ARG A HH21 1 
ATOM   4128  H  HH22 . ARG A 1 287 ? -26.869  23.762  -25.978 1.00 75.60  ? 848  ARG A HH22 1 
ATOM   4129  N  N    . ILE A 1 288 ? -24.465  18.986  -21.343 1.00 67.36  ? 849  ILE A N    1 
ATOM   4130  C  CA   . ILE A 1 288 ? -23.513  20.018  -20.941 1.00 61.58  ? 849  ILE A CA   1 
ATOM   4131  C  C    . ILE A 1 288 ? -22.065  19.547  -20.997 1.00 68.76  ? 849  ILE A C    1 
ATOM   4132  O  O    . ILE A 1 288 ? -21.167  20.289  -20.576 1.00 81.80  ? 849  ILE A O    1 
ATOM   4133  C  CB   . ILE A 1 288 ? -23.834  20.544  -19.525 1.00 60.22  ? 849  ILE A CB   1 
ATOM   4134  C  CG1  . ILE A 1 288 ? -23.719  19.427  -18.485 1.00 63.90  ? 849  ILE A CG1  1 
ATOM   4135  C  CG2  . ILE A 1 288 ? -25.220  21.181  -19.514 1.00 61.20  ? 849  ILE A CG2  1 
ATOM   4136  C  CD1  . ILE A 1 288 ? -24.011  19.869  -17.060 1.00 62.19  ? 849  ILE A CD1  1 
ATOM   4137  H  H    . ILE A 1 288 ? -24.738  18.489  -20.697 1.00 80.83  ? 849  ILE A H    1 
ATOM   4138  H  HA   . ILE A 1 288 ? -23.597  20.766  -21.554 1.00 73.89  ? 849  ILE A HA   1 
ATOM   4139  H  HB   . ILE A 1 288 ? -23.185  21.231  -19.303 1.00 72.26  ? 849  ILE A HB   1 
ATOM   4140  H  HG12 . ILE A 1 288 ? -24.350  18.726  -18.711 1.00 76.67  ? 849  ILE A HG12 1 
ATOM   4141  H  HG13 . ILE A 1 288 ? -22.816  19.075  -18.505 1.00 76.67  ? 849  ILE A HG13 1 
ATOM   4142  H  HG21 . ILE A 1 288 ? -25.410  21.507  -18.621 1.00 73.45  ? 849  ILE A HG21 1 
ATOM   4143  H  HG22 . ILE A 1 288 ? -25.234  21.917  -20.146 1.00 73.45  ? 849  ILE A HG22 1 
ATOM   4144  H  HG23 . ILE A 1 288 ? -25.876  20.513  -19.770 1.00 73.45  ? 849  ILE A HG23 1 
ATOM   4145  H  HD11 . ILE A 1 288 ? -23.916  19.107  -16.468 1.00 74.63  ? 849  ILE A HD11 1 
ATOM   4146  H  HD12 . ILE A 1 288 ? -23.380  20.563  -16.810 1.00 74.63  ? 849  ILE A HD12 1 
ATOM   4147  H  HD13 . ILE A 1 288 ? -24.917  20.213  -17.016 1.00 74.63  ? 849  ILE A HD13 1 
ATOM   4148  N  N    . GLU A 1 289 ? -21.809  18.333  -21.485 1.00 63.39  ? 850  GLU A N    1 
ATOM   4149  C  CA   . GLU A 1 289 ? -20.447  17.810  -21.531 1.00 72.59  ? 850  GLU A CA   1 
ATOM   4150  C  C    . GLU A 1 289 ? -19.518  18.730  -22.317 1.00 80.44  ? 850  GLU A C    1 
ATOM   4151  O  O    . GLU A 1 289 ? -18.388  18.996  -21.889 1.00 83.55  ? 850  GLU A O    1 
ATOM   4152  C  CB   . GLU A 1 289 ? -20.462  16.409  -22.143 1.00 75.92  ? 850  GLU A CB   1 
ATOM   4153  C  CG   . GLU A 1 289 ? -19.172  15.642  -21.984 1.00 77.64  ? 850  GLU A CG   1 
ATOM   4154  C  CD   . GLU A 1 289 ? -18.885  15.266  -20.540 1.00 91.73  ? 850  GLU A CD   1 
ATOM   4155  O  OE1  . GLU A 1 289 ? -19.775  15.451  -19.682 1.00 96.38  ? 850  GLU A OE1  1 
ATOM   4156  O  OE2  . GLU A 1 289 ? -17.766  14.783  -20.261 1.00 100.03 ? 850  GLU A OE2  1 
ATOM   4157  H  H    . GLU A 1 289 ? -22.405  17.795  -21.795 1.00 76.06  ? 850  GLU A H    1 
ATOM   4158  H  HA   . GLU A 1 289 ? -20.105  17.739  -20.626 1.00 87.11  ? 850  GLU A HA   1 
ATOM   4159  H  HB2  . GLU A 1 289 ? -21.165  15.893  -21.718 1.00 91.10  ? 850  GLU A HB2  1 
ATOM   4160  H  HB3  . GLU A 1 289 ? -20.643  16.488  -23.092 1.00 91.10  ? 850  GLU A HB3  1 
ATOM   4161  H  HG2  . GLU A 1 289 ? -19.225  14.823  -22.502 1.00 93.17  ? 850  GLU A HG2  1 
ATOM   4162  H  HG3  . GLU A 1 289 ? -18.437  16.189  -22.303 1.00 93.17  ? 850  GLU A HG3  1 
ATOM   4163  N  N    . LYS A 1 290 ? -19.973  19.221  -23.469 1.00 77.99  ? 851  LYS A N    1 
ATOM   4164  C  CA   . LYS A 1 290 ? -19.151  20.028  -24.363 1.00 63.40  ? 851  LYS A CA   1 
ATOM   4165  C  C    . LYS A 1 290 ? -19.329  21.529  -24.161 1.00 71.01  ? 851  LYS A C    1 
ATOM   4166  O  O    . LYS A 1 290 ? -18.719  22.309  -24.896 1.00 82.80  ? 851  LYS A O    1 
ATOM   4167  C  CB   . LYS A 1 290 ? -19.461  19.669  -25.822 1.00 58.13  ? 851  LYS A CB   1 
ATOM   4168  H  H    . LYS A 1 290 ? -20.773  19.096  -23.759 1.00 93.59  ? 851  LYS A H    1 
ATOM   4169  H  HA   . LYS A 1 290 ? -18.219  19.819  -24.199 1.00 76.08  ? 851  LYS A HA   1 
ATOM   4170  N  N    . GLU A 1 291 ? -20.141  21.954  -23.195 1.00 74.04  ? 852  GLU A N    1 
ATOM   4171  C  CA   . GLU A 1 291 ? -20.455  23.370  -23.064 1.00 69.06  ? 852  GLU A CA   1 
ATOM   4172  C  C    . GLU A 1 291 ? -19.236  24.168  -22.603 1.00 67.53  ? 852  GLU A C    1 
ATOM   4173  O  O    . GLU A 1 291 ? -18.284  23.638  -22.025 1.00 71.28  ? 852  GLU A O    1 
ATOM   4174  C  CB   . GLU A 1 291 ? -21.622  23.580  -22.096 1.00 74.90  ? 852  GLU A CB   1 
ATOM   4175  C  CG   . GLU A 1 291 ? -22.989  23.294  -22.710 1.00 68.30  ? 852  GLU A CG   1 
ATOM   4176  C  CD   . GLU A 1 291 ? -23.276  24.149  -23.929 1.00 72.55  ? 852  GLU A CD   1 
ATOM   4177  O  OE1  . GLU A 1 291 ? -23.596  25.347  -23.764 1.00 67.03  ? 852  GLU A OE1  1 
ATOM   4178  O  OE2  . GLU A 1 291 ? -23.170  23.621  -25.056 1.00 65.32  ? 852  GLU A OE2  1 
ATOM   4179  H  H    . GLU A 1 291 ? -20.518  21.448  -22.611 1.00 88.85  ? 852  GLU A H    1 
ATOM   4180  H  HA   . GLU A 1 291 ? -20.723  23.712  -23.931 1.00 82.88  ? 852  GLU A HA   1 
ATOM   4181  H  HB2  . GLU A 1 291 ? -21.509  22.988  -21.336 1.00 89.88  ? 852  GLU A HB2  1 
ATOM   4182  H  HB3  . GLU A 1 291 ? -21.619  24.502  -21.797 1.00 89.88  ? 852  GLU A HB3  1 
ATOM   4183  H  HG2  . GLU A 1 291 ? -23.025  22.363  -22.981 1.00 81.96  ? 852  GLU A HG2  1 
ATOM   4184  H  HG3  . GLU A 1 291 ? -23.676  23.474  -22.049 1.00 81.96  ? 852  GLU A HG3  1 
ATOM   4185  N  N    . SER A 1 292 ? -19.293  25.478  -22.864 1.00 80.59  ? 853  SER A N    1 
ATOM   4186  C  CA   . SER A 1 292 ? -18.138  26.357  -22.707 1.00 84.74  ? 853  SER A CA   1 
ATOM   4187  C  C    . SER A 1 292 ? -17.691  26.514  -21.258 1.00 92.48  ? 853  SER A C    1 
ATOM   4188  O  O    . SER A 1 292 ? -16.534  26.878  -21.023 1.00 105.69 ? 853  SER A O    1 
ATOM   4189  C  CB   . SER A 1 292 ? -18.460  27.735  -23.293 1.00 89.33  ? 853  SER A CB   1 
ATOM   4190  O  OG   . SER A 1 292 ? -17.466  28.687  -22.954 1.00 104.25 ? 853  SER A OG   1 
ATOM   4191  H  H    . SER A 1 292 ? -20.000  25.883  -23.137 1.00 96.71  ? 853  SER A H    1 
ATOM   4192  H  HA   . SER A 1 292 ? -17.394  25.988  -23.208 1.00 101.69 ? 853  SER A HA   1 
ATOM   4193  H  HB2  . SER A 1 292 ? -18.508  27.662  -24.259 1.00 107.19 ? 853  SER A HB2  1 
ATOM   4194  H  HB3  . SER A 1 292 ? -19.314  28.034  -22.942 1.00 107.19 ? 853  SER A HB3  1 
ATOM   4195  H  HG   . SER A 1 292 ? -16.720  28.442  -23.253 1.00 125.10 ? 853  SER A HG   1 
ATOM   4196  N  N    . LEU A 1 293 ? -18.595  26.312  -20.298 1.00 78.83  ? 854  LEU A N    1 
ATOM   4197  C  CA   . LEU A 1 293 ? -18.347  26.430  -18.860 1.00 80.89  ? 854  LEU A CA   1 
ATOM   4198  C  C    . LEU A 1 293 ? -18.254  27.891  -18.429 1.00 80.84  ? 854  LEU A C    1 
ATOM   4199  O  O    . LEU A 1 293 ? -18.417  28.200  -17.244 1.00 72.58  ? 854  LEU A O    1 
ATOM   4200  C  CB   . LEU A 1 293 ? -17.076  25.662  -18.451 1.00 78.22  ? 854  LEU A CB   1 
ATOM   4201  C  CG   . LEU A 1 293 ? -16.521  25.863  -17.036 1.00 73.68  ? 854  LEU A CG   1 
ATOM   4202  C  CD1  . LEU A 1 293 ? -17.509  25.429  -15.968 1.00 82.65  ? 854  LEU A CD1  1 
ATOM   4203  C  CD2  . LEU A 1 293 ? -15.211  25.109  -16.885 1.00 71.16  ? 854  LEU A CD2  1 
ATOM   4204  H  H    . LEU A 1 293 ? -19.408  26.092  -20.470 1.00 94.60  ? 854  LEU A H    1 
ATOM   4205  H  HA   . LEU A 1 293 ? -19.094  26.032  -18.386 1.00 97.07  ? 854  LEU A HA   1 
ATOM   4206  H  HB2  . LEU A 1 293 ? -17.259  24.714  -18.548 1.00 93.86  ? 854  LEU A HB2  1 
ATOM   4207  H  HB3  . LEU A 1 293 ? -16.369  25.911  -19.067 1.00 93.86  ? 854  LEU A HB3  1 
ATOM   4208  H  HG   . LEU A 1 293 ? -16.337  26.806  -16.904 1.00 88.42  ? 854  LEU A HG   1 
ATOM   4209  H  HD11 . LEU A 1 293 ? -17.113  25.575  -15.094 1.00 99.19  ? 854  LEU A HD11 1 
ATOM   4210  H  HD12 . LEU A 1 293 ? -18.320  25.953  -16.056 1.00 99.19  ? 854  LEU A HD12 1 
ATOM   4211  H  HD13 . LEU A 1 293 ? -17.708  24.487  -16.088 1.00 99.19  ? 854  LEU A HD13 1 
ATOM   4212  H  HD21 . LEU A 1 293 ? -14.871  25.244  -15.986 1.00 85.39  ? 854  LEU A HD21 1 
ATOM   4213  H  HD22 . LEU A 1 293 ? -15.371  24.165  -17.039 1.00 85.39  ? 854  LEU A HD22 1 
ATOM   4214  H  HD23 . LEU A 1 293 ? -14.575  25.448  -17.534 1.00 85.39  ? 854  LEU A HD23 1 
ATOM   4215  N  N    . ASP A 1 294 ? -18.025  28.801  -19.379 1.00 99.42  ? 855  ASP A N    1 
ATOM   4216  C  CA   . ASP A 1 294 ? -18.392  30.203  -19.233 1.00 82.55  ? 855  ASP A CA   1 
ATOM   4217  C  C    . ASP A 1 294 ? -19.747  30.508  -19.852 1.00 73.54  ? 855  ASP A C    1 
ATOM   4218  O  O    . ASP A 1 294 ? -20.273  31.608  -19.651 1.00 83.19  ? 855  ASP A O    1 
ATOM   4219  C  CB   . ASP A 1 294 ? -17.323  31.108  -19.868 1.00 85.16  ? 855  ASP A CB   1 
ATOM   4220  C  CG   . ASP A 1 294 ? -15.994  31.053  -19.132 1.00 94.49  ? 855  ASP A CG   1 
ATOM   4221  O  OD1  . ASP A 1 294 ? -15.998  30.888  -17.893 1.00 97.17  ? 855  ASP A OD1  1 
ATOM   4222  O  OD2  . ASP A 1 294 ? -14.942  31.179  -19.794 1.00 102.98 ? 855  ASP A OD2  1 
ATOM   4223  H  H    . ASP A 1 294 ? -17.649  28.622  -20.132 1.00 119.30 ? 855  ASP A H    1 
ATOM   4224  H  HA   . ASP A 1 294 ? -18.441  30.418  -18.288 1.00 99.06  ? 855  ASP A HA   1 
ATOM   4225  H  HB2  . ASP A 1 294 ? -17.172  30.824  -20.783 1.00 102.19 ? 855  ASP A HB2  1 
ATOM   4226  H  HB3  . ASP A 1 294 ? -17.637  32.025  -19.853 1.00 102.19 ? 855  ASP A HB3  1 
ATOM   4227  N  N    . GLY A 1 295 ? -20.324  29.558  -20.585 1.00 79.25  ? 856  GLY A N    1 
ATOM   4228  C  CA   . GLY A 1 295 ? -21.545  29.785  -21.315 1.00 86.10  ? 856  GLY A CA   1 
ATOM   4229  C  C    . GLY A 1 295 ? -22.736  29.949  -20.397 1.00 73.59  ? 856  GLY A C    1 
ATOM   4230  O  O    . GLY A 1 295 ? -22.690  29.605  -19.212 1.00 72.01  ? 856  GLY A O    1 
ATOM   4231  H  H    . GLY A 1 295 ? -20.012  28.761  -20.670 1.00 95.11  ? 856  GLY A H    1 
ATOM   4232  H  HA2  . GLY A 1 295 ? -21.457  30.588  -21.852 1.00 103.32 ? 856  GLY A HA2  1 
ATOM   4233  H  HA3  . GLY A 1 295 ? -21.713  29.035  -21.906 1.00 103.32 ? 856  GLY A HA3  1 
ATOM   4234  N  N    . PRO A 1 296 ? -23.835  30.485  -20.934 1.00 80.27  ? 857  PRO A N    1 
ATOM   4235  C  CA   . PRO A 1 296 ? -25.022  30.708  -20.092 1.00 84.82  ? 857  PRO A CA   1 
ATOM   4236  C  C    . PRO A 1 296 ? -25.598  29.430  -19.509 1.00 75.73  ? 857  PRO A C    1 
ATOM   4237  O  O    . PRO A 1 296 ? -26.131  29.460  -18.393 1.00 73.62  ? 857  PRO A O    1 
ATOM   4238  C  CB   . PRO A 1 296 ? -26.008  31.390  -21.052 1.00 71.67  ? 857  PRO A CB   1 
ATOM   4239  C  CG   . PRO A 1 296 ? -25.549  30.998  -22.419 1.00 79.22  ? 857  PRO A CG   1 
ATOM   4240  C  CD   . PRO A 1 296 ? -24.060  30.886  -22.332 1.00 69.28  ? 857  PRO A CD   1 
ATOM   4241  H  HA   . PRO A 1 296 ? -24.808  31.319  -19.370 1.00 101.78 ? 857  PRO A HA   1 
ATOM   4242  H  HB2  . PRO A 1 296 ? -26.906  31.064  -20.884 1.00 86.01  ? 857  PRO A HB2  1 
ATOM   4243  H  HB3  . PRO A 1 296 ? -25.963  32.352  -20.937 1.00 86.01  ? 857  PRO A HB3  1 
ATOM   4244  H  HG2  . PRO A 1 296 ? -25.941  30.145  -22.661 1.00 95.07  ? 857  PRO A HG2  1 
ATOM   4245  H  HG3  . PRO A 1 296 ? -25.803  31.684  -23.056 1.00 95.07  ? 857  PRO A HG3  1 
ATOM   4246  H  HD2  . PRO A 1 296 ? -23.736  30.201  -22.938 1.00 83.14  ? 857  PRO A HD2  1 
ATOM   4247  H  HD3  . PRO A 1 296 ? -23.644  31.744  -22.510 1.00 83.14  ? 857  PRO A HD3  1 
ATOM   4248  N  N    . ILE A 1 297 ? -25.521  28.313  -20.232 1.00 65.29  ? 858  ILE A N    1 
ATOM   4249  C  CA   . ILE A 1 297 ? -26.004  27.029  -19.729 1.00 57.25  ? 858  ILE A CA   1 
ATOM   4250  C  C    . ILE A 1 297 ? -25.283  26.677  -18.433 1.00 60.11  ? 858  ILE A C    1 
ATOM   4251  O  O    . ILE A 1 297 ? -25.899  26.628  -17.362 1.00 59.60  ? 858  ILE A O    1 
ATOM   4252  C  CB   . ILE A 1 297 ? -25.828  25.916  -20.780 1.00 59.94  ? 858  ILE A CB   1 
ATOM   4253  C  CG1  . ILE A 1 297 ? -26.786  26.159  -21.949 1.00 52.78  ? 858  ILE A CG1  1 
ATOM   4254  C  CG2  . ILE A 1 297 ? -26.073  24.542  -20.156 1.00 62.66  ? 858  ILE A CG2  1 
ATOM   4255  C  CD1  . ILE A 1 297 ? -26.853  25.038  -22.977 1.00 50.60  ? 858  ILE A CD1  1 
ATOM   4256  H  H    . ILE A 1 297 ? -25.189  28.273  -21.024 1.00 78.35  ? 858  ILE A H    1 
ATOM   4257  H  HA   . ILE A 1 297 ? -26.950  27.106  -19.532 1.00 68.70  ? 858  ILE A HA   1 
ATOM   4258  H  HB   . ILE A 1 297 ? -24.918  25.947  -21.114 1.00 71.93  ? 858  ILE A HB   1 
ATOM   4259  H  HG12 . ILE A 1 297 ? -27.680  26.283  -21.594 1.00 63.33  ? 858  ILE A HG12 1 
ATOM   4260  H  HG13 . ILE A 1 297 ? -26.507  26.964  -22.413 1.00 63.33  ? 858  ILE A HG13 1 
ATOM   4261  H  HG21 . ILE A 1 297 ? -25.956  23.861  -20.837 1.00 75.20  ? 858  ILE A HG21 1 
ATOM   4262  H  HG22 . ILE A 1 297 ? -25.437  24.404  -19.437 1.00 75.20  ? 858  ILE A HG22 1 
ATOM   4263  H  HG23 . ILE A 1 297 ? -26.978  24.510  -19.808 1.00 75.20  ? 858  ILE A HG23 1 
ATOM   4264  H  HD11 . ILE A 1 297 ? -27.482  25.285  -23.672 1.00 60.72  ? 858  ILE A HD11 1 
ATOM   4265  H  HD12 . ILE A 1 297 ? -25.971  24.908  -23.359 1.00 60.72  ? 858  ILE A HD12 1 
ATOM   4266  H  HD13 . ILE A 1 297 ? -27.146  24.225  -22.538 1.00 60.72  ? 858  ILE A HD13 1 
ATOM   4267  N  N    . VAL A 1 298 ? -23.977  26.417  -18.520 1.00 70.96  ? 859  VAL A N    1 
ATOM   4268  C  CA   . VAL A 1 298 ? -23.240  25.983  -17.337 1.00 52.20  ? 859  VAL A CA   1 
ATOM   4269  C  C    . VAL A 1 298 ? -23.200  27.093  -16.294 1.00 69.21  ? 859  VAL A C    1 
ATOM   4270  O  O    . VAL A 1 298 ? -23.246  26.819  -15.089 1.00 69.96  ? 859  VAL A O    1 
ATOM   4271  C  CB   . VAL A 1 298 ? -21.827  25.518  -17.729 1.00 59.46  ? 859  VAL A CB   1 
ATOM   4272  C  CG1  . VAL A 1 298 ? -21.041  25.074  -16.495 1.00 67.90  ? 859  VAL A CG1  1 
ATOM   4273  C  CG2  . VAL A 1 298 ? -21.909  24.380  -18.740 1.00 50.33  ? 859  VAL A CG2  1 
ATOM   4274  H  H    . VAL A 1 298 ? -23.505  26.482  -19.236 1.00 85.16  ? 859  VAL A H    1 
ATOM   4275  H  HA   . VAL A 1 298 ? -23.701  25.226  -16.944 1.00 62.64  ? 859  VAL A HA   1 
ATOM   4276  H  HB   . VAL A 1 298 ? -21.351  26.256  -18.142 1.00 71.35  ? 859  VAL A HB   1 
ATOM   4277  H  HG11 . VAL A 1 298 ? -20.156  24.787  -16.771 1.00 81.48  ? 859  VAL A HG11 1 
ATOM   4278  H  HG12 . VAL A 1 298 ? -20.969  25.821  -15.881 1.00 81.48  ? 859  VAL A HG12 1 
ATOM   4279  H  HG13 . VAL A 1 298 ? -21.510  24.339  -16.069 1.00 81.48  ? 859  VAL A HG13 1 
ATOM   4280  H  HG21 . VAL A 1 298 ? -21.011  24.101  -18.974 1.00 60.39  ? 859  VAL A HG21 1 
ATOM   4281  H  HG22 . VAL A 1 298 ? -22.393  23.640  -18.342 1.00 60.39  ? 859  VAL A HG22 1 
ATOM   4282  H  HG23 . VAL A 1 298 ? -22.376  24.694  -19.530 1.00 60.39  ? 859  VAL A HG23 1 
ATOM   4283  N  N    . LYS A 1 299 ? -23.123  28.354  -16.725 1.00 70.68  ? 860  LYS A N    1 
ATOM   4284  C  CA   . LYS A 1 299 ? -23.191  29.456  -15.771 1.00 60.28  ? 860  LYS A CA   1 
ATOM   4285  C  C    . LYS A 1 299 ? -24.515  29.436  -15.019 1.00 53.28  ? 860  LYS A C    1 
ATOM   4286  O  O    . LYS A 1 299 ? -24.551  29.655  -13.803 1.00 55.31  ? 860  LYS A O    1 
ATOM   4287  C  CB   . LYS A 1 299 ? -22.997  30.792  -16.490 1.00 55.20  ? 860  LYS A CB   1 
ATOM   4288  H  H    . LYS A 1 299 ? -23.033  28.593  -17.547 1.00 84.81  ? 860  LYS A H    1 
ATOM   4289  H  HA   . LYS A 1 299 ? -22.476  29.357  -15.122 1.00 72.34  ? 860  LYS A HA   1 
ATOM   4290  N  N    . GLN A 1 300 ? -25.613  29.160  -15.726 1.00 56.81  ? 861  GLN A N    1 
ATOM   4291  C  CA   . GLN A 1 300 ? -26.917  29.061  -15.076 1.00 64.48  ? 861  GLN A CA   1 
ATOM   4292  C  C    . GLN A 1 300 ? -26.957  27.880  -14.114 1.00 67.41  ? 861  GLN A C    1 
ATOM   4293  O  O    . GLN A 1 300 ? -27.432  28.006  -12.979 1.00 63.65  ? 861  GLN A O    1 
ATOM   4294  C  CB   . GLN A 1 300 ? -28.019  28.933  -16.131 1.00 64.30  ? 861  GLN A CB   1 
ATOM   4295  C  CG   . GLN A 1 300 ? -29.437  28.796  -15.580 1.00 52.37  ? 861  GLN A CG   1 
ATOM   4296  C  CD   . GLN A 1 300 ? -30.088  30.132  -15.291 1.00 75.69  ? 861  GLN A CD   1 
ATOM   4297  O  OE1  . GLN A 1 300 ? -29.464  31.041  -14.742 1.00 82.64  ? 861  GLN A OE1  1 
ATOM   4298  N  NE2  . GLN A 1 300 ? -31.354  30.259  -15.665 1.00 82.65  ? 861  GLN A NE2  1 
ATOM   4299  H  H    . GLN A 1 300 ? -25.629  29.027  -16.575 1.00 68.18  ? 861  GLN A H    1 
ATOM   4300  H  HA   . GLN A 1 300 ? -27.081  29.870  -14.566 1.00 77.38  ? 861  GLN A HA   1 
ATOM   4301  H  HB2  . GLN A 1 300 ? -27.999  29.722  -16.694 1.00 77.16  ? 861  GLN A HB2  1 
ATOM   4302  H  HB3  . GLN A 1 300 ? -27.838  28.146  -16.669 1.00 77.16  ? 861  GLN A HB3  1 
ATOM   4303  H  HG2  . GLN A 1 300 ? -29.986  28.331  -16.231 1.00 62.84  ? 861  GLN A HG2  1 
ATOM   4304  H  HG3  . GLN A 1 300 ? -29.407  28.292  -14.752 1.00 62.84  ? 861  GLN A HG3  1 
ATOM   4305  H  HE21 . GLN A 1 300 ? -31.756  29.603  -16.049 1.00 99.18  ? 861  GLN A HE21 1 
ATOM   4306  H  HE22 . GLN A 1 300 ? -31.772  30.997  -15.525 1.00 99.18  ? 861  GLN A HE22 1 
ATOM   4307  N  N    . LEU A 1 301 ? -26.467  26.718  -14.555 1.00 57.04  ? 862  LEU A N    1 
ATOM   4308  C  CA   . LEU A 1 301 ? -26.467  25.540  -13.692 1.00 59.16  ? 862  LEU A CA   1 
ATOM   4309  C  C    . LEU A 1 301 ? -25.551  25.734  -12.492 1.00 52.89  ? 862  LEU A C    1 
ATOM   4310  O  O    . LEU A 1 301 ? -25.898  25.352  -11.369 1.00 53.70  ? 862  LEU A O    1 
ATOM   4311  C  CB   . LEU A 1 301 ? -26.046  24.305  -14.487 1.00 63.90  ? 862  LEU A CB   1 
ATOM   4312  C  CG   . LEU A 1 301 ? -25.940  22.999  -13.694 1.00 65.45  ? 862  LEU A CG   1 
ATOM   4313  C  CD1  . LEU A 1 301 ? -27.283  22.630  -13.075 1.00 62.42  ? 862  LEU A CD1  1 
ATOM   4314  C  CD2  . LEU A 1 301 ? -25.435  21.876  -14.584 1.00 63.83  ? 862  LEU A CD2  1 
ATOM   4315  H  H    . LEU A 1 301 ? -26.134  26.588  -15.337 1.00 68.45  ? 862  LEU A H    1 
ATOM   4316  H  HA   . LEU A 1 301 ? -27.367  25.392  -13.361 1.00 70.99  ? 862  LEU A HA   1 
ATOM   4317  H  HB2  . LEU A 1 301 ? -26.695  24.161  -15.194 1.00 76.68  ? 862  LEU A HB2  1 
ATOM   4318  H  HB3  . LEU A 1 301 ? -25.175  24.476  -14.879 1.00 76.68  ? 862  LEU A HB3  1 
ATOM   4319  H  HG   . LEU A 1 301 ? -25.302  23.120  -12.973 1.00 78.54  ? 862  LEU A HG   1 
ATOM   4320  H  HD11 . LEU A 1 301 ? -27.185  21.801  -12.580 1.00 74.91  ? 862  LEU A HD11 1 
ATOM   4321  H  HD12 . LEU A 1 301 ? -27.562  23.341  -12.477 1.00 74.91  ? 862  LEU A HD12 1 
ATOM   4322  H  HD13 . LEU A 1 301 ? -27.937  22.517  -13.783 1.00 74.91  ? 862  LEU A HD13 1 
ATOM   4323  H  HD21 . LEU A 1 301 ? -25.377  21.061  -14.060 1.00 76.60  ? 862  LEU A HD21 1 
ATOM   4324  H  HD22 . LEU A 1 301 ? -26.056  21.753  -15.319 1.00 76.60  ? 862  LEU A HD22 1 
ATOM   4325  H  HD23 . LEU A 1 301 ? -24.559  22.114  -14.925 1.00 76.60  ? 862  LEU A HD23 1 
ATOM   4326  N  N    . GLU A 1 302 ? -24.376  26.323  -12.704 1.00 56.73  ? 863  GLU A N    1 
ATOM   4327  C  CA   . GLU A 1 302 ? -23.459  26.557  -11.599 1.00 59.17  ? 863  GLU A CA   1 
ATOM   4328  C  C    . GLU A 1 302 ? -23.872  27.736  -10.730 1.00 54.92  ? 863  GLU A C    1 
ATOM   4329  O  O    . GLU A 1 302 ? -23.263  27.947  -9.675  1.00 54.96  ? 863  GLU A O    1 
ATOM   4330  C  CB   . GLU A 1 302 ? -22.042  26.778  -12.131 1.00 54.34  ? 863  GLU A CB   1 
ATOM   4331  C  CG   . GLU A 1 302 ? -21.440  25.557  -12.822 1.00 53.65  ? 863  GLU A CG   1 
ATOM   4332  C  CD   . GLU A 1 302 ? -21.293  24.359  -11.896 1.00 62.79  ? 863  GLU A CD   1 
ATOM   4333  O  OE1  . GLU A 1 302 ? -21.411  24.532  -10.662 1.00 54.63  ? 863  GLU A OE1  1 
ATOM   4334  O  OE2  . GLU A 1 302 ? -21.059  23.240  -12.403 1.00 61.25  ? 863  GLU A OE2  1 
ATOM   4335  H  H    . GLU A 1 302 ? -24.091  26.591  -13.470 1.00 68.08  ? 863  GLU A H    1 
ATOM   4336  H  HA   . GLU A 1 302 ? -23.444  25.768  -11.035 1.00 71.00  ? 863  GLU A HA   1 
ATOM   4337  H  HB2  . GLU A 1 302 ? -22.060  27.503  -12.775 1.00 65.21  ? 863  GLU A HB2  1 
ATOM   4338  H  HB3  . GLU A 1 302 ? -21.463  27.013  -11.389 1.00 65.21  ? 863  GLU A HB3  1 
ATOM   4339  H  HG2  . GLU A 1 302 ? -22.015  25.297  -13.559 1.00 64.39  ? 863  GLU A HG2  1 
ATOM   4340  H  HG3  . GLU A 1 302 ? -20.558  25.786  -13.156 1.00 64.39  ? 863  GLU A HG3  1 
ATOM   4341  N  N    . ARG A 1 303 ? -24.891  28.497  -11.135 1.00 54.32  ? 864  ARG A N    1 
ATOM   4342  C  CA   . ARG A 1 303 ? -25.299  29.664  -10.359 1.00 42.14  ? 864  ARG A CA   1 
ATOM   4343  C  C    . ARG A 1 303 ? -25.789  29.267  -8.971  1.00 43.27  ? 864  ARG A C    1 
ATOM   4344  O  O    . ARG A 1 303 ? -25.468  29.933  -7.980  1.00 67.13  ? 864  ARG A O    1 
ATOM   4345  C  CB   . ARG A 1 303 ? -26.382  30.435  -11.112 1.00 60.73  ? 864  ARG A CB   1 
ATOM   4346  C  CG   . ARG A 1 303 ? -26.826  31.720  -10.426 1.00 49.59  ? 864  ARG A CG   1 
ATOM   4347  H  H    . ARG A 1 303 ? -25.355  28.360  -11.846 1.00 65.18  ? 864  ARG A H    1 
ATOM   4348  H  HA   . ARG A 1 303 ? -24.536  30.252  -10.250 1.00 50.57  ? 864  ARG A HA   1 
ATOM   4349  H  HB2  . ARG A 1 303 ? -26.042  30.671  -11.990 1.00 72.88  ? 864  ARG A HB2  1 
ATOM   4350  H  HB3  . ARG A 1 303 ? -27.162  29.865  -11.205 1.00 72.88  ? 864  ARG A HB3  1 
ATOM   4351  N  N    . GLY A 1 304 ? -26.573  28.192  -8.876  1.00 67.65  ? 865  GLY A N    1 
ATOM   4352  C  CA   . GLY A 1 304 ? -26.932  27.669  -7.565  1.00 76.26  ? 865  GLY A CA   1 
ATOM   4353  C  C    . GLY A 1 304 ? -25.713  27.269  -6.757  1.00 62.65  ? 865  GLY A C    1 
ATOM   4354  O  O    . GLY A 1 304 ? -25.634  27.541  -5.557  1.00 70.94  ? 865  GLY A O    1 
ATOM   4355  H  H    . GLY A 1 304 ? -26.903  27.758  -9.541  1.00 81.18  ? 865  GLY A H    1 
ATOM   4356  H  HA2  . GLY A 1 304 ? -27.422  28.343  -7.070  1.00 91.52  ? 865  GLY A HA2  1 
ATOM   4357  H  HA3  . GLY A 1 304 ? -27.500  26.890  -7.672  1.00 91.52  ? 865  GLY A HA3  1 
ATOM   4358  N  N    . GLY A 1 305 ? -24.764  26.593  -7.398  1.00 67.13  ? 866  GLY A N    1 
ATOM   4359  C  CA   . GLY A 1 305 ? -23.421  26.482  -6.852  1.00 77.50  ? 866  GLY A CA   1 
ATOM   4360  C  C    . GLY A 1 305 ? -23.355  25.655  -5.587  1.00 58.29  ? 866  GLY A C    1 
ATOM   4361  O  O    . GLY A 1 305 ? -23.910  24.554  -5.494  1.00 69.01  ? 866  GLY A O    1 
ATOM   4362  H  H    . GLY A 1 305 ? -24.874  26.191  -8.150  1.00 80.55  ? 866  GLY A H    1 
ATOM   4363  H  HA2  . GLY A 1 305 ? -22.839  26.075  -7.512  1.00 93.01  ? 866  GLY A HA2  1 
ATOM   4364  H  HA3  . GLY A 1 305 ? -23.082  27.369  -6.653  1.00 93.01  ? 866  GLY A HA3  1 
ATOM   4365  N  N    . ARG A 1 306 ? -22.665  26.213  -4.591  1.00 78.22  ? 867  ARG A N    1 
ATOM   4366  C  CA   . ARG A 1 306 ? -22.214  25.435  -3.446  1.00 73.34  ? 867  ARG A CA   1 
ATOM   4367  C  C    . ARG A 1 306 ? -23.372  24.955  -2.585  1.00 50.19  ? 867  ARG A C    1 
ATOM   4368  O  O    . ARG A 1 306 ? -23.288  23.873  -1.995  1.00 86.53  ? 867  ARG A O    1 
ATOM   4369  C  CB   . ARG A 1 306 ? -21.244  26.270  -2.608  1.00 75.94  ? 867  ARG A CB   1 
ATOM   4370  H  H    . ARG A 1 306 ? -22.447  27.044  -4.559  1.00 93.86  ? 867  ARG A H    1 
ATOM   4371  H  HA   . ARG A 1 306 ? -21.737  24.654  -3.765  1.00 88.01  ? 867  ARG A HA   1 
ATOM   4372  N  N    . ALA A 1 307 ? -24.450  25.734  -2.490  1.00 57.98  ? 868  ALA A N    1 
ATOM   4373  C  CA   . ALA A 1 307 ? -25.553  25.354  -1.612  1.00 51.59  ? 868  ALA A CA   1 
ATOM   4374  C  C    . ALA A 1 307 ? -26.173  24.031  -2.043  1.00 38.30  ? 868  ALA A C    1 
ATOM   4375  O  O    . ALA A 1 307 ? -26.481  23.180  -1.201  1.00 43.76  ? 868  ALA A O    1 
ATOM   4376  C  CB   . ALA A 1 307 ? -26.605  26.459  -1.585  1.00 47.29  ? 868  ALA A CB   1 
ATOM   4377  H  H    . ALA A 1 307 ? -24.566  26.473  -2.914  1.00 69.58  ? 868  ALA A H    1 
ATOM   4378  H  HA   . ALA A 1 307 ? -25.213  25.244  -0.710  1.00 61.91  ? 868  ALA A HA   1 
ATOM   4379  H  HB1  . ALA A 1 307 ? -27.329  26.191  -0.998  1.00 56.75  ? 868  ALA A HB1  1 
ATOM   4380  H  HB2  . ALA A 1 307 ? -26.197  27.275  -1.256  1.00 56.75  ? 868  ALA A HB2  1 
ATOM   4381  H  HB3  . ALA A 1 307 ? -26.941  26.596  -2.485  1.00 56.75  ? 868  ALA A HB3  1 
ATOM   4382  N  N    . VAL A 1 308 ? -26.361  23.838  -3.350  1.00 47.34  ? 869  VAL A N    1 
ATOM   4383  C  CA   . VAL A 1 308 ? -26.952  22.598  -3.851  1.00 39.78  ? 869  VAL A CA   1 
ATOM   4384  C  C    . VAL A 1 308 ? -26.057  21.411  -3.515  1.00 56.81  ? 869  VAL A C    1 
ATOM   4385  O  O    . VAL A 1 308 ? -26.532  20.363  -3.059  1.00 50.07  ? 869  VAL A O    1 
ATOM   4386  C  CB   . VAL A 1 308 ? -27.196  22.705  -5.369  1.00 49.37  ? 869  VAL A CB   1 
ATOM   4387  C  CG1  . VAL A 1 308 ? -27.792  21.406  -5.916  1.00 51.98  ? 869  VAL A CG1  1 
ATOM   4388  C  CG2  . VAL A 1 308 ? -28.101  23.887  -5.685  1.00 51.47  ? 869  VAL A CG2  1 
ATOM   4389  H  H    . VAL A 1 308 ? -26.156  24.405  -3.963  1.00 56.81  ? 869  VAL A H    1 
ATOM   4390  H  HA   . VAL A 1 308 ? -27.809  22.460  -3.418  1.00 47.73  ? 869  VAL A HA   1 
ATOM   4391  H  HB   . VAL A 1 308 ? -26.347  22.853  -5.814  1.00 59.25  ? 869  VAL A HB   1 
ATOM   4392  H  HG11 . VAL A 1 308 ? -27.935  21.502  -6.870  1.00 62.37  ? 869  VAL A HG11 1 
ATOM   4393  H  HG12 . VAL A 1 308 ? -27.174  20.678  -5.745  1.00 62.37  ? 869  VAL A HG12 1 
ATOM   4394  H  HG13 . VAL A 1 308 ? -28.637  21.234  -5.470  1.00 62.37  ? 869  VAL A HG13 1 
ATOM   4395  H  HG21 . VAL A 1 308 ? -28.239  23.931  -6.644  1.00 61.76  ? 869  VAL A HG21 1 
ATOM   4396  H  HG22 . VAL A 1 308 ? -28.951  23.763  -5.234  1.00 61.76  ? 869  VAL A HG22 1 
ATOM   4397  H  HG23 . VAL A 1 308 ? -27.676  24.701  -5.374  1.00 61.76  ? 869  VAL A HG23 1 
ATOM   4398  N  N    . VAL A 1 309 ? -24.745  21.559  -3.726  1.00 56.23  ? 870  VAL A N    1 
ATOM   4399  C  CA   . VAL A 1 309 ? -23.798  20.479  -3.467  1.00 52.81  ? 870  VAL A CA   1 
ATOM   4400  C  C    . VAL A 1 309 ? -23.267  20.507  -2.041  1.00 53.57  ? 870  VAL A C    1 
ATOM   4401  O  O    . VAL A 1 309 ? -22.365  19.724  -1.711  1.00 55.30  ? 870  VAL A O    1 
ATOM   4402  C  CB   . VAL A 1 309 ? -22.628  20.536  -4.472  1.00 67.28  ? 870  VAL A CB   1 
ATOM   4403  C  CG1  . VAL A 1 309 ? -23.163  20.631  -5.898  1.00 55.32  ? 870  VAL A CG1  1 
ATOM   4404  C  CG2  . VAL A 1 309 ? -21.703  21.708  -4.173  1.00 61.52  ? 870  VAL A CG2  1 
ATOM   4405  H  H    . VAL A 1 309 ? -24.380  22.281  -4.019  1.00 67.48  ? 870  VAL A H    1 
ATOM   4406  H  HA   . VAL A 1 309 ? -24.253  19.632  -3.594  1.00 63.37  ? 870  VAL A HA   1 
ATOM   4407  H  HB   . VAL A 1 309 ? -22.110  19.720  -4.400  1.00 80.74  ? 870  VAL A HB   1 
ATOM   4408  H  HG11 . VAL A 1 309 ? -22.415  20.666  -6.514  1.00 66.38  ? 870  VAL A HG11 1 
ATOM   4409  H  HG12 . VAL A 1 309 ? -23.708  19.850  -6.082  1.00 66.38  ? 870  VAL A HG12 1 
ATOM   4410  H  HG13 . VAL A 1 309 ? -23.698  21.436  -5.981  1.00 66.38  ? 870  VAL A HG13 1 
ATOM   4411  H  HG21 . VAL A 1 309 ? -20.982  21.713  -4.821  1.00 73.82  ? 870  VAL A HG21 1 
ATOM   4412  H  HG22 . VAL A 1 309 ? -22.209  22.533  -4.233  1.00 73.82  ? 870  VAL A HG22 1 
ATOM   4413  H  HG23 . VAL A 1 309 ? -21.343  21.605  -3.278  1.00 73.82  ? 870  VAL A HG23 1 
ATOM   4414  N  N    . LYS A 1 310 ? -23.778  21.403  -1.194  1.00 56.92  ? 871  LYS A N    1 
ATOM   4415  C  CA   . LYS A 1 310 ? -23.300  21.566  0.179   1.00 66.64  ? 871  LYS A CA   1 
ATOM   4416  C  C    . LYS A 1 310 ? -21.822  21.954  0.201   1.00 63.34  ? 871  LYS A C    1 
ATOM   4417  O  O    . LYS A 1 310 ? -21.087  21.630  1.137   1.00 59.56  ? 871  LYS A O    1 
ATOM   4418  C  CB   . LYS A 1 310 ? -23.572  20.306  1.005   1.00 53.44  ? 871  LYS A CB   1 
ATOM   4419  C  CG   . LYS A 1 310 ? -25.050  19.910  0.962   1.00 51.16  ? 871  LYS A CG   1 
ATOM   4420  C  CD   . LYS A 1 310 ? -25.450  18.954  2.072   1.00 49.61  ? 871  LYS A CD   1 
ATOM   4421  C  CE   . LYS A 1 310 ? -26.950  18.694  2.053   1.00 45.63  ? 871  LYS A CE   1 
ATOM   4422  N  NZ   . LYS A 1 310 ? -27.394  17.811  3.164   1.00 58.77  ? 871  LYS A NZ   1 
ATOM   4423  H  H    . LYS A 1 310 ? -24.418  21.941  -1.398  1.00 68.30  ? 871  LYS A H    1 
ATOM   4424  H  HA   . LYS A 1 310 ? -23.795  22.292  0.590   1.00 79.97  ? 871  LYS A HA   1 
ATOM   4425  H  HB2  . LYS A 1 310 ? -23.051  19.570  0.647   1.00 64.13  ? 871  LYS A HB2  1 
ATOM   4426  H  HB3  . LYS A 1 310 ? -23.329  20.470  1.929   1.00 64.13  ? 871  LYS A HB3  1 
ATOM   4427  H  HG2  . LYS A 1 310 ? -25.592  20.710  1.049   1.00 61.39  ? 871  LYS A HG2  1 
ATOM   4428  H  HG3  . LYS A 1 310 ? -25.235  19.477  0.115   1.00 61.39  ? 871  LYS A HG3  1 
ATOM   4429  H  HD2  . LYS A 1 310 ? -24.992  18.108  1.949   1.00 59.53  ? 871  LYS A HD2  1 
ATOM   4430  H  HD3  . LYS A 1 310 ? -25.218  19.341  2.931   1.00 59.53  ? 871  LYS A HD3  1 
ATOM   4431  H  HE2  . LYS A 1 310 ? -27.419  19.540  2.136   1.00 54.76  ? 871  LYS A HE2  1 
ATOM   4432  H  HE3  . LYS A 1 310 ? -27.186  18.265  1.216   1.00 54.76  ? 871  LYS A HE3  1 
ATOM   4433  H  HZ1  . LYS A 1 310 ? -28.274  17.684  3.119   1.00 70.52  ? 871  LYS A HZ1  1 
ATOM   4434  H  HZ2  . LYS A 1 310 ? -26.984  17.023  3.108   1.00 70.52  ? 871  LYS A HZ2  1 
ATOM   4435  H  HZ3  . LYS A 1 310 ? -27.196  18.186  3.947   1.00 70.52  ? 871  LYS A HZ3  1 
ATOM   4436  N  N    . MET A 1 311 ? -21.401  22.626  -0.870  1.00 59.81  ? 872  MET A N    1 
ATOM   4437  C  CA   . MET A 1 311 ? -20.125  23.317  -1.017  1.00 63.59  ? 872  MET A CA   1 
ATOM   4438  C  C    . MET A 1 311 ? -18.960  22.361  -1.252  1.00 49.29  ? 872  MET A C    1 
ATOM   4439  O  O    . MET A 1 311 ? -17.935  22.765  -1.806  1.00 57.61  ? 872  MET A O    1 
ATOM   4440  C  CB   . MET A 1 311 ? -19.861  24.179  0.222   1.00 63.68  ? 872  MET A CB   1 
ATOM   4441  C  CG   . MET A 1 311 ? -18.779  25.232  0.027   1.00 88.84  ? 872  MET A CG   1 
ATOM   4442  S  SD   . MET A 1 311 ? -18.941  26.650  1.130   1.00 94.51  ? 872  MET A SD   1 
ATOM   4443  C  CE   . MET A 1 311 ? -17.597  27.679  0.549   1.00 67.46  ? 872  MET A CE   1 
ATOM   4444  H  H    . MET A 1 311 ? -21.882  22.697  -1.579  1.00 71.77  ? 872  MET A H    1 
ATOM   4445  H  HA   . MET A 1 311 ? -20.187  23.915  -1.778  1.00 76.31  ? 872  MET A HA   1 
ATOM   4446  N  N    . ASP A 1 312 ? -19.118  21.088  -0.899  1.00 63.72  ? 873  ASP A N    1 
ATOM   4447  C  CA   . ASP A 1 312 ? -18.314  20.012  -1.462  1.00 56.91  ? 873  ASP A CA   1 
ATOM   4448  C  C    . ASP A 1 312 ? -19.228  18.806  -1.586  1.00 57.24  ? 873  ASP A C    1 
ATOM   4449  O  O    . ASP A 1 312 ? -19.806  18.379  -0.582  1.00 66.20  ? 873  ASP A O    1 
ATOM   4450  C  CB   . ASP A 1 312 ? -17.100  19.698  -0.568  1.00 58.98  ? 873  ASP A CB   1 
ATOM   4451  C  CG   . ASP A 1 312 ? -16.003  18.911  -1.287  1.00 55.17  ? 873  ASP A CG   1 
ATOM   4452  O  OD1  . ASP A 1 312 ? -16.191  18.500  -2.451  1.00 47.60  ? 873  ASP A OD1  1 
ATOM   4453  O  OD2  . ASP A 1 312 ? -14.941  18.692  -0.665  1.00 60.62  ? 873  ASP A OD2  1 
ATOM   4454  H  H    . ASP A 1 312 ? -19.697  20.819  -0.323  1.00 76.46  ? 873  ASP A H    1 
ATOM   4455  H  HA   . ASP A 1 312 ? -17.999  20.261  -2.345  1.00 68.29  ? 873  ASP A HA   1 
ATOM   4456  H  HB2  . ASP A 1 312 ? -16.714  20.533  -0.259  1.00 70.77  ? 873  ASP A HB2  1 
ATOM   4457  H  HB3  . ASP A 1 312 ? -17.397  19.171  0.191   1.00 70.77  ? 873  ASP A HB3  1 
ATOM   4458  N  N    . TRP A 1 313 ? -19.342  18.229  -2.782  1.00 49.15  ? 874  TRP A N    1 
ATOM   4459  C  CA   . TRP A 1 313 ? -20.161  17.029  -2.914  1.00 55.59  ? 874  TRP A CA   1 
ATOM   4460  C  C    . TRP A 1 313 ? -19.364  15.756  -2.677  1.00 46.67  ? 874  TRP A C    1 
ATOM   4461  O  O    . TRP A 1 313 ? -19.966  14.692  -2.505  1.00 48.50  ? 874  TRP A O    1 
ATOM   4462  C  CB   . TRP A 1 313 ? -20.861  16.971  -4.282  1.00 54.99  ? 874  TRP A CB   1 
ATOM   4463  C  CG   . TRP A 1 313 ? -19.978  16.911  -5.495  1.00 52.64  ? 874  TRP A CG   1 
ATOM   4464  C  CD1  . TRP A 1 313 ? -19.700  17.932  -6.352  1.00 64.40  ? 874  TRP A CD1  1 
ATOM   4465  C  CD2  . TRP A 1 313 ? -19.297  15.760  -6.010  1.00 50.14  ? 874  TRP A CD2  1 
ATOM   4466  N  NE1  . TRP A 1 313 ? -18.876  17.497  -7.358  1.00 60.35  ? 874  TRP A NE1  1 
ATOM   4467  C  CE2  . TRP A 1 313 ? -18.612  16.166  -7.172  1.00 52.72  ? 874  TRP A CE2  1 
ATOM   4468  C  CE3  . TRP A 1 313 ? -19.194  14.428  -5.599  1.00 52.08  ? 874  TRP A CE3  1 
ATOM   4469  C  CZ2  . TRP A 1 313 ? -17.831  15.289  -7.924  1.00 65.58  ? 874  TRP A CZ2  1 
ATOM   4470  C  CZ3  . TRP A 1 313 ? -18.415  13.559  -6.346  1.00 59.27  ? 874  TRP A CZ3  1 
ATOM   4471  C  CH2  . TRP A 1 313 ? -17.747  13.993  -7.496  1.00 68.03  ? 874  TRP A CH2  1 
ATOM   4472  H  H    . TRP A 1 313 ? -18.969  18.503  -3.507  1.00 58.98  ? 874  TRP A H    1 
ATOM   4473  H  HA   . TRP A 1 313 ? -20.855  17.062  -2.237  1.00 66.70  ? 874  TRP A HA   1 
ATOM   4474  H  HB2  . TRP A 1 313 ? -21.424  16.181  -4.300  1.00 65.99  ? 874  TRP A HB2  1 
ATOM   4475  H  HB3  . TRP A 1 313 ? -21.416  17.761  -4.372  1.00 65.99  ? 874  TRP A HB3  1 
ATOM   4476  H  HD1  . TRP A 1 313 ? -20.020  18.801  -6.264  1.00 77.29  ? 874  TRP A HD1  1 
ATOM   4477  H  HE1  . TRP A 1 313 ? -18.572  17.982  -8.000  1.00 72.42  ? 874  TRP A HE1  1 
ATOM   4478  H  HE3  . TRP A 1 313 ? -19.633  14.133  -4.834  1.00 62.49  ? 874  TRP A HE3  1 
ATOM   4479  H  HZ2  . TRP A 1 313 ? -17.385  15.575  -8.689  1.00 78.70  ? 874  TRP A HZ2  1 
ATOM   4480  H  HZ3  . TRP A 1 313 ? -18.338  12.671  -6.081  1.00 71.13  ? 874  TRP A HZ3  1 
ATOM   4481  H  HH2  . TRP A 1 313 ? -17.233  13.387  -7.979  1.00 81.64  ? 874  TRP A HH2  1 
ATOM   4482  N  N    . ARG A 1 314 ? -18.034  15.848  -2.618  1.00 56.83  ? 875  ARG A N    1 
ATOM   4483  C  CA   . ARG A 1 314 ? -17.214  14.689  -2.293  1.00 43.67  ? 875  ARG A CA   1 
ATOM   4484  C  C    . ARG A 1 314 ? -17.283  14.331  -0.814  1.00 42.96  ? 875  ARG A C    1 
ATOM   4485  O  O    . ARG A 1 314 ? -16.999  13.185  -0.458  1.00 42.67  ? 875  ARG A O    1 
ATOM   4486  C  CB   . ARG A 1 314 ? -15.762  14.947  -2.700  1.00 60.02  ? 875  ARG A CB   1 
ATOM   4487  C  CG   . ARG A 1 314 ? -15.567  15.142  -4.197  1.00 52.05  ? 875  ARG A CG   1 
ATOM   4488  C  CD   . ARG A 1 314 ? -14.171  15.651  -4.520  1.00 60.35  ? 875  ARG A CD   1 
ATOM   4489  N  NE   . ARG A 1 314 ? -13.978  17.034  -4.090  1.00 77.71  ? 875  ARG A NE   1 
ATOM   4490  C  CZ   . ARG A 1 314 ? -12.871  17.741  -4.302  1.00 66.43  ? 875  ARG A CZ   1 
ATOM   4491  N  NH1  . ARG A 1 314 ? -11.843  17.201  -4.941  1.00 63.23  ? 875  ARG A NH1  1 
ATOM   4492  N  NH2  . ARG A 1 314 ? -12.790  18.993  -3.873  1.00 64.16  ? 875  ARG A NH2  1 
ATOM   4493  H  H    . ARG A 1 314 ? -17.588  16.569  -2.761  1.00 68.20  ? 875  ARG A H    1 
ATOM   4494  H  HA   . ARG A 1 314 ? -17.535  13.927  -2.799  1.00 52.40  ? 875  ARG A HA   1 
ATOM   4495  H  HB2  . ARG A 1 314 ? -15.450  15.750  -2.254  1.00 72.03  ? 875  ARG A HB2  1 
ATOM   4496  H  HB3  . ARG A 1 314 ? -15.222  14.189  -2.427  1.00 72.03  ? 875  ARG A HB3  1 
ATOM   4497  H  HG2  . ARG A 1 314 ? -15.693  14.293  -4.649  1.00 62.46  ? 875  ARG A HG2  1 
ATOM   4498  H  HG3  . ARG A 1 314 ? -16.209  15.793  -4.521  1.00 62.46  ? 875  ARG A HG3  1 
ATOM   4499  H  HD2  . ARG A 1 314 ? -13.517  15.098  -4.063  1.00 72.42  ? 875  ARG A HD2  1 
ATOM   4500  H  HD3  . ARG A 1 314 ? -14.031  15.610  -5.479  1.00 72.42  ? 875  ARG A HD3  1 
ATOM   4501  H  HE   . ARG A 1 314 ? -14.624  17.417  -3.671  1.00 93.25  ? 875  ARG A HE   1 
ATOM   4502  H  HH11 . ARG A 1 314 ? -11.890  16.390  -5.222  1.00 75.87  ? 875  ARG A HH11 1 
ATOM   4503  H  HH12 . ARG A 1 314 ? -11.130  17.663  -5.075  1.00 75.87  ? 875  ARG A HH12 1 
ATOM   4504  H  HH21 . ARG A 1 314 ? -13.454  19.349  -3.458  1.00 76.99  ? 875  ARG A HH21 1 
ATOM   4505  H  HH22 . ARG A 1 314 ? -12.074  19.449  -4.011  1.00 76.99  ? 875  ARG A HH22 1 
ATOM   4506  N  N    . GLU A 1 315 ? -17.641  15.279  0.052   1.00 49.39  ? 876  GLU A N    1 
ATOM   4507  C  CA   . GLU A 1 315 ? -17.779  15.016  1.481   1.00 60.89  ? 876  GLU A CA   1 
ATOM   4508  C  C    . GLU A 1 315 ? -19.167  14.530  1.884   1.00 62.13  ? 876  GLU A C    1 
ATOM   4509  O  O    . GLU A 1 315 ? -19.337  14.075  3.021   1.00 62.10  ? 876  GLU A O    1 
ATOM   4510  C  CB   . GLU A 1 315 ? -17.443  16.281  2.278   1.00 66.99  ? 876  GLU A CB   1 
ATOM   4511  C  CG   . GLU A 1 315 ? -16.009  16.757  2.108   1.00 78.39  ? 876  GLU A CG   1 
ATOM   4512  C  CD   . GLU A 1 315 ? -14.990  15.701  2.506   1.00 104.75 ? 876  GLU A CD   1 
ATOM   4513  O  OE1  . GLU A 1 315 ? -15.293  14.887  3.406   1.00 97.45  ? 876  GLU A OE1  1 
ATOM   4514  O  OE2  . GLU A 1 315 ? -13.891  15.679  1.911   1.00 112.17 ? 876  GLU A OE2  1 
ATOM   4515  H  H    . GLU A 1 315 ? -17.812  16.092  -0.168  1.00 59.27  ? 876  GLU A H    1 
ATOM   4516  H  HA   . GLU A 1 315 ? -17.141  14.330  1.733   1.00 73.07  ? 876  GLU A HA   1 
ATOM   4517  H  HB2  . GLU A 1 315 ? -18.029  16.998  1.988   1.00 80.39  ? 876  GLU A HB2  1 
ATOM   4518  H  HB3  . GLU A 1 315 ? -17.585  16.103  3.221   1.00 80.39  ? 876  GLU A HB3  1 
ATOM   4519  H  HG2  . GLU A 1 315 ? -15.860  16.982  1.176   1.00 94.06  ? 876  GLU A HG2  1 
ATOM   4520  H  HG3  . GLU A 1 315 ? -15.867  17.538  2.666   1.00 94.06  ? 876  GLU A HG3  1 
ATOM   4521  N  N    . ASN A 1 316 ? -20.160  14.643  1.004   1.00 47.34  ? 877  ASN A N    1 
ATOM   4522  C  CA   . ASN A 1 316 ? -21.528  14.223  1.289   1.00 55.86  ? 877  ASN A CA   1 
ATOM   4523  C  C    . ASN A 1 316 ? -21.870  12.834  0.765   1.00 44.40  ? 877  ASN A C    1 
ATOM   4524  O  O    . ASN A 1 316 ? -23.036  12.434  0.840   1.00 58.08  ? 877  ASN A O    1 
ATOM   4525  C  CB   . ASN A 1 316 ? -22.507  15.253  0.736   1.00 51.08  ? 877  ASN A CB   1 
ATOM   4526  C  CG   . ASN A 1 316 ? -22.421  16.565  1.481   1.00 72.04  ? 877  ASN A CG   1 
ATOM   4527  O  OD1  . ASN A 1 316 ? -23.064  16.744  2.514   1.00 83.58  ? 877  ASN A OD1  1 
ATOM   4528  N  ND2  . ASN A 1 316 ? -21.597  17.478  0.982   1.00 66.68  ? 877  ASN A ND2  1 
ATOM   4529  H  H    . ASN A 1 316 ? -20.062  14.969  0.214   1.00 56.81  ? 877  ASN A H    1 
ATOM   4530  H  HA   . ASN A 1 316 ? -21.644  14.203  2.252   1.00 67.03  ? 877  ASN A HA   1 
ATOM   4531  H  HB2  . ASN A 1 316 ? -22.302  15.420  -0.197  1.00 61.29  ? 877  ASN A HB2  1 
ATOM   4532  H  HB3  . ASN A 1 316 ? -23.411  14.913  0.825   1.00 61.29  ? 877  ASN A HB3  1 
ATOM   4533  H  HD21 . ASN A 1 316 ? -21.145  17.307  0.270   1.00 80.01  ? 877  ASN A HD21 1 
ATOM   4534  H  HD22 . ASN A 1 316 ? -21.514  18.241  1.371   1.00 80.01  ? 877  ASN A HD22 1 
ATOM   4535  N  N    . ILE A 1 317 ? -20.900  12.109  0.215   1.00 47.30  ? 878  ILE A N    1 
ATOM   4536  C  CA   . ILE A 1 317 ? -21.106  10.763  -0.304  1.00 41.27  ? 878  ILE A CA   1 
ATOM   4537  C  C    . ILE A 1 317 ? -20.309  9.789   0.555   1.00 46.19  ? 878  ILE A C    1 
ATOM   4538  O  O    . ILE A 1 317 ? -19.332  10.152  1.216   1.00 54.85  ? 878  ILE A O    1 
ATOM   4539  C  CB   . ILE A 1 317 ? -20.701  10.649  -1.787  1.00 47.37  ? 878  ILE A CB   1 
ATOM   4540  C  CG1  . ILE A 1 317 ? -19.315  11.262  -2.013  1.00 54.74  ? 878  ILE A CG1  1 
ATOM   4541  C  CG2  . ILE A 1 317 ? -21.728  11.344  -2.662  1.00 39.44  ? 878  ILE A CG2  1 
ATOM   4542  C  CD1  . ILE A 1 317 ? -18.733  10.991  -3.387  1.00 47.12  ? 878  ILE A CD1  1 
ATOM   4543  H  H    . ILE A 1 317 ? -20.091  12.386  0.129   1.00 56.76  ? 878  ILE A H    1 
ATOM   4544  H  HA   . ILE A 1 317 ? -22.045  10.534  -0.230  1.00 49.52  ? 878  ILE A HA   1 
ATOM   4545  H  HB   . ILE A 1 317 ? -20.669  9.711   -2.030  1.00 56.84  ? 878  ILE A HB   1 
ATOM   4546  H  HG12 . ILE A 1 317 ? -19.378  12.224  -1.904  1.00 65.69  ? 878  ILE A HG12 1 
ATOM   4547  H  HG13 . ILE A 1 317 ? -18.702  10.897  -1.356  1.00 65.69  ? 878  ILE A HG13 1 
ATOM   4548  H  HG21 . ILE A 1 317 ? -21.459  11.262  -3.591  1.00 47.33  ? 878  ILE A HG21 1 
ATOM   4549  H  HG22 . ILE A 1 317 ? -22.592  10.922  -2.530  1.00 47.33  ? 878  ILE A HG22 1 
ATOM   4550  H  HG23 . ILE A 1 317 ? -21.775  12.279  -2.412  1.00 47.33  ? 878  ILE A HG23 1 
ATOM   4551  H  HD11 . ILE A 1 317 ? -17.861  11.410  -3.449  1.00 56.54  ? 878  ILE A HD11 1 
ATOM   4552  H  HD12 . ILE A 1 317 ? -18.650  10.032  -3.511  1.00 56.54  ? 878  ILE A HD12 1 
ATOM   4553  H  HD13 . ILE A 1 317 ? -19.327  11.361  -4.059  1.00 56.54  ? 878  ILE A HD13 1 
ATOM   4554  N  N    . THR A 1 318 ? -20.750  8.534   0.553   1.00 43.09  ? 879  THR A N    1 
ATOM   4555  C  CA   . THR A 1 318 ? -20.200  7.526   1.448   1.00 49.31  ? 879  THR A CA   1 
ATOM   4556  C  C    . THR A 1 318 ? -18.794  7.106   1.016   1.00 52.94  ? 879  THR A C    1 
ATOM   4557  O  O    . THR A 1 318 ? -18.360  7.339   -0.117  1.00 47.23  ? 879  THR A O    1 
ATOM   4558  C  CB   . THR A 1 318 ? -21.120  6.306   1.530   1.00 49.77  ? 879  THR A CB   1 
ATOM   4559  O  OG1  . THR A 1 318 ? -20.710  5.476   2.624   1.00 84.57  ? 879  THR A OG1  1 
ATOM   4560  C  CG2  . THR A 1 318 ? -21.096  5.497   0.253   1.00 35.81  ? 879  THR A CG2  1 
ATOM   4561  H  H    . THR A 1 318 ? -21.373  8.240   0.037   1.00 51.71  ? 879  THR A H    1 
ATOM   4562  H  HA   . THR A 1 318 ? -20.134  7.905   2.339   1.00 59.18  ? 879  THR A HA   1 
ATOM   4563  H  HB   . THR A 1 318 ? -22.030  6.604   1.681   1.00 59.73  ? 879  THR A HB   1 
ATOM   4564  H  HG1  . THR A 1 318 ? -21.209  4.803   2.676   1.00 101.48 ? 879  THR A HG1  1 
ATOM   4565  H  HG21 . THR A 1 318 ? -21.687  4.732   0.335   1.00 42.97  ? 879  THR A HG21 1 
ATOM   4566  H  HG22 . THR A 1 318 ? -21.391  6.045   -0.491  1.00 42.97  ? 879  THR A HG22 1 
ATOM   4567  H  HG23 . THR A 1 318 ? -20.196  5.182   0.077   1.00 42.97  ? 879  THR A HG23 1 
ATOM   4568  N  N    . VAL A 1 319 ? -18.078  6.482   1.960   1.00 52.29  ? 880  VAL A N    1 
ATOM   4569  C  CA   . VAL A 1 319 ? -16.639  6.258   1.790   1.00 56.05  ? 880  VAL A CA   1 
ATOM   4570  C  C    . VAL A 1 319 ? -16.313  5.435   0.548   1.00 48.27  ? 880  VAL A C    1 
ATOM   4571  O  O    . VAL A 1 319 ? -15.405  5.829   -0.202  1.00 51.75  ? 880  VAL A O    1 
ATOM   4572  C  CB   . VAL A 1 319 ? -16.053  5.638   3.069   1.00 58.98  ? 880  VAL A CB   1 
ATOM   4573  C  CG1  . VAL A 1 319 ? -14.593  5.248   2.864   1.00 55.95  ? 880  VAL A CG1  1 
ATOM   4574  C  CG2  . VAL A 1 319 ? -16.189  6.608   4.237   1.00 45.42  ? 880  VAL A CG2  1 
ATOM   4575  H  H    . VAL A 1 319 ? -18.399  6.183   2.699   1.00 62.75  ? 880  VAL A H    1 
ATOM   4576  H  HA   . VAL A 1 319 ? -16.214  7.122   1.675   1.00 67.26  ? 880  VAL A HA   1 
ATOM   4577  H  HB   . VAL A 1 319 ? -16.550  4.834   3.287   1.00 70.77  ? 880  VAL A HB   1 
ATOM   4578  H  HG11 . VAL A 1 319 ? -14.252  4.860   3.685   1.00 67.14  ? 880  VAL A HG11 1 
ATOM   4579  H  HG12 . VAL A 1 319 ? -14.539  4.600   2.144   1.00 67.14  ? 880  VAL A HG12 1 
ATOM   4580  H  HG13 . VAL A 1 319 ? -14.084  6.041   2.635   1.00 67.14  ? 880  VAL A HG13 1 
ATOM   4581  H  HG21 . VAL A 1 319 ? -15.814  6.198   5.032   1.00 54.51  ? 880  VAL A HG21 1 
ATOM   4582  H  HG22 . VAL A 1 319 ? -15.708  7.424   4.027   1.00 54.51  ? 880  VAL A HG22 1 
ATOM   4583  H  HG23 . VAL A 1 319 ? -17.129  6.804   4.376   1.00 54.51  ? 880  VAL A HG23 1 
ATOM   4584  N  N    . PRO A 1 320 ? -16.955  4.292   0.289   1.00 54.67  ? 881  PRO A N    1 
ATOM   4585  C  CA   . PRO A 1 320 ? -16.600  3.532   -0.924  1.00 60.33  ? 881  PRO A CA   1 
ATOM   4586  C  C    . PRO A 1 320 ? -16.686  4.346   -2.204  1.00 55.86  ? 881  PRO A C    1 
ATOM   4587  O  O    . PRO A 1 320 ? -15.819  4.207   -3.075  1.00 61.31  ? 881  PRO A O    1 
ATOM   4588  C  CB   . PRO A 1 320 ? -17.607  2.376   -0.916  1.00 53.96  ? 881  PRO A CB   1 
ATOM   4589  C  CG   . PRO A 1 320 ? -17.919  2.175   0.518   1.00 54.24  ? 881  PRO A CG   1 
ATOM   4590  C  CD   . PRO A 1 320 ? -17.901  3.545   1.139   1.00 56.67  ? 881  PRO A CD   1 
ATOM   4591  H  HA   . PRO A 1 320 ? -15.703  3.171   -0.839  1.00 72.40  ? 881  PRO A HA   1 
ATOM   4592  H  HB2  . PRO A 1 320 ? -18.402  2.628   -1.411  1.00 64.75  ? 881  PRO A HB2  1 
ATOM   4593  H  HB3  . PRO A 1 320 ? -17.200  1.582   -1.295  1.00 64.75  ? 881  PRO A HB3  1 
ATOM   4594  H  HG2  . PRO A 1 320 ? -18.798  1.773   0.606   1.00 65.09  ? 881  PRO A HG2  1 
ATOM   4595  H  HG3  . PRO A 1 320 ? -17.243  1.609   0.921   1.00 65.09  ? 881  PRO A HG3  1 
ATOM   4596  H  HD2  . PRO A 1 320 ? -18.783  3.948   1.097   1.00 68.01  ? 881  PRO A HD2  1 
ATOM   4597  H  HD3  . PRO A 1 320 ? -17.573  3.499   2.050   1.00 68.01  ? 881  PRO A HD3  1 
ATOM   4598  N  N    . LEU A 1 321 ? -17.707  5.194   -2.348  1.00 56.70  ? 882  LEU A N    1 
ATOM   4599  C  CA   . LEU A 1 321 ? -17.775  6.059   -3.520  1.00 41.69  ? 882  LEU A CA   1 
ATOM   4600  C  C    . LEU A 1 321 ? -16.657  7.094   -3.495  1.00 45.69  ? 882  LEU A C    1 
ATOM   4601  O  O    . LEU A 1 321 ? -15.998  7.326   -4.511  1.00 47.84  ? 882  LEU A O    1 
ATOM   4602  C  CB   . LEU A 1 321 ? -19.137  6.744   -3.600  1.00 35.74  ? 882  LEU A CB   1 
ATOM   4603  C  CG   . LEU A 1 321 ? -19.355  7.613   -4.846  1.00 40.36  ? 882  LEU A CG   1 
ATOM   4604  C  CD1  . LEU A 1 321 ? -19.229  6.791   -6.118  1.00 36.38  ? 882  LEU A CD1  1 
ATOM   4605  C  CD2  . LEU A 1 321 ? -20.712  8.310   -4.800  1.00 56.54  ? 882  LEU A CD2  1 
ATOM   4606  H  H    . LEU A 1 321 ? -18.358  5.285   -1.793  1.00 68.04  ? 882  LEU A H    1 
ATOM   4607  H  HA   . LEU A 1 321 ? -17.664  5.518   -4.318  1.00 50.03  ? 882  LEU A HA   1 
ATOM   4608  H  HB2  . LEU A 1 321 ? -19.826  6.061   -3.596  1.00 42.89  ? 882  LEU A HB2  1 
ATOM   4609  H  HB3  . LEU A 1 321 ? -19.241  7.315   -2.824  1.00 42.89  ? 882  LEU A HB3  1 
ATOM   4610  H  HG   . LEU A 1 321 ? -18.672  8.301   -4.869  1.00 48.43  ? 882  LEU A HG   1 
ATOM   4611  H  HD11 . LEU A 1 321 ? -19.373  7.370   -6.883  1.00 43.66  ? 882  LEU A HD11 1 
ATOM   4612  H  HD12 . LEU A 1 321 ? -18.340  6.405   -6.157  1.00 43.66  ? 882  LEU A HD12 1 
ATOM   4613  H  HD13 . LEU A 1 321 ? -19.896  6.087   -6.106  1.00 43.66  ? 882  LEU A HD13 1 
ATOM   4614  H  HD21 . LEU A 1 321 ? -20.817  8.849   -5.599  1.00 67.85  ? 882  LEU A HD21 1 
ATOM   4615  H  HD22 . LEU A 1 321 ? -21.410  7.638   -4.759  1.00 67.85  ? 882  LEU A HD22 1 
ATOM   4616  H  HD23 . LEU A 1 321 ? -20.750  8.875   -4.012  1.00 67.85  ? 882  LEU A HD23 1 
ATOM   4617  N  N    . GLN A 1 322 ? -16.432  7.727   -2.338  1.00 49.47  ? 883  GLN A N    1 
ATOM   4618  C  CA   . GLN A 1 322 ? -15.332  8.680   -2.196  1.00 44.25  ? 883  GLN A CA   1 
ATOM   4619  C  C    . GLN A 1 322 ? -14.006  8.065   -2.621  1.00 69.06  ? 883  GLN A C    1 
ATOM   4620  O  O    . GLN A 1 322 ? -13.238  8.670   -3.379  1.00 53.34  ? 883  GLN A O    1 
ATOM   4621  C  CB   . GLN A 1 322 ? -15.226  9.154   -0.747  1.00 44.17  ? 883  GLN A CB   1 
ATOM   4622  C  CG   . GLN A 1 322 ? -16.129  10.294  -0.372  1.00 71.15  ? 883  GLN A CG   1 
ATOM   4623  C  CD   . GLN A 1 322 ? -15.776  10.871  0.987   1.00 71.08  ? 883  GLN A CD   1 
ATOM   4624  O  OE1  . GLN A 1 322 ? -14.832  10.419  1.637   1.00 56.18  ? 883  GLN A OE1  1 
ATOM   4625  N  NE2  . GLN A 1 322 ? -16.535  11.871  1.426   1.00 80.46  ? 883  GLN A NE2  1 
ATOM   4626  H  H    . GLN A 1 322 ? -16.901  7.620   -1.625  1.00 59.37  ? 883  GLN A H    1 
ATOM   4627  H  HA   . GLN A 1 322 ? -15.503  9.452   -2.757  1.00 53.10  ? 883  GLN A HA   1 
ATOM   4628  H  HB2  . GLN A 1 322 ? -15.440  8.410   -0.163  1.00 53.00  ? 883  GLN A HB2  1 
ATOM   4629  H  HB3  . GLN A 1 322 ? -14.313  9.441   -0.584  1.00 53.00  ? 883  GLN A HB3  1 
ATOM   4630  H  HG2  . GLN A 1 322 ? -16.042  11.000  -1.032  1.00 85.38  ? 883  GLN A HG2  1 
ATOM   4631  H  HG3  . GLN A 1 322 ? -17.045  9.978   -0.338  1.00 85.38  ? 883  GLN A HG3  1 
ATOM   4632  H  HE21 . GLN A 1 322 ? -17.187  12.159  0.945   1.00 96.55  ? 883  GLN A HE21 1 
ATOM   4633  H  HE22 . GLN A 1 322 ? -16.373  12.230  2.190   1.00 96.55  ? 883  GLN A HE22 1 
ATOM   4634  N  N    . THR A 1 323 ? -13.712  6.867   -2.107  1.00 61.62  ? 884  THR A N    1 
ATOM   4635  C  CA   . THR A 1 323 ? -12.452  6.201   -2.415  1.00 57.68  ? 884  THR A CA   1 
ATOM   4636  C  C    . THR A 1 323 ? -12.309  5.951   -3.911  1.00 66.38  ? 884  THR A C    1 
ATOM   4637  O  O    . THR A 1 323 ? -11.213  6.081   -4.469  1.00 69.68  ? 884  THR A O    1 
ATOM   4638  C  CB   . THR A 1 323 ? -12.365  4.886   -1.639  1.00 49.67  ? 884  THR A CB   1 
ATOM   4639  O  OG1  . THR A 1 323 ? -12.483  5.151   -0.237  1.00 63.37  ? 884  THR A OG1  1 
ATOM   4640  C  CG2  . THR A 1 323 ? -11.049  4.184   -1.895  1.00 61.18  ? 884  THR A CG2  1 
ATOM   4641  H  H    . THR A 1 323 ? -14.227  6.423   -1.580  1.00 73.95  ? 884  THR A H    1 
ATOM   4642  H  HA   . THR A 1 323 ? -11.716  6.767   -2.133  1.00 69.21  ? 884  THR A HA   1 
ATOM   4643  H  HB   . THR A 1 323 ? -13.085  4.298   -1.918  1.00 59.60  ? 884  THR A HB   1 
ATOM   4644  H  HG1  . THR A 1 323 ? -13.221  5.519   -0.076  1.00 76.04  ? 884  THR A HG1  1 
ATOM   4645  H  HG21 . THR A 1 323 ? -11.014  3.353   -1.395  1.00 73.42  ? 884  THR A HG21 1 
ATOM   4646  H  HG22 . THR A 1 323 ? -10.957  3.987   -2.841  1.00 73.42  ? 884  THR A HG22 1 
ATOM   4647  H  HG23 . THR A 1 323 ? -10.312  4.750   -1.618  1.00 73.42  ? 884  THR A HG23 1 
ATOM   4648  N  N    . ASP A 1 324 ? -13.412  5.610   -4.582  1.00 46.71  ? 885  ASP A N    1 
ATOM   4649  C  CA   . ASP A 1 324 ? -13.329  5.195   -5.978  1.00 50.69  ? 885  ASP A CA   1 
ATOM   4650  C  C    . ASP A 1 324 ? -13.017  6.372   -6.896  1.00 56.54  ? 885  ASP A C    1 
ATOM   4651  O  O    . ASP A 1 324 ? -12.198  6.245   -7.813  1.00 75.49  ? 885  ASP A O    1 
ATOM   4652  C  CB   . ASP A 1 324 ? -14.631  4.516   -6.395  1.00 53.06  ? 885  ASP A CB   1 
ATOM   4653  C  CG   . ASP A 1 324 ? -14.546  3.885   -7.770  1.00 70.69  ? 885  ASP A CG   1 
ATOM   4654  O  OD1  . ASP A 1 324 ? -13.884  2.833   -7.902  1.00 63.83  ? 885  ASP A OD1  1 
ATOM   4655  O  OD2  . ASP A 1 324 ? -15.151  4.432   -8.714  1.00 74.31  ? 885  ASP A OD2  1 
ATOM   4656  H  H    . ASP A 1 324 ? -14.207  5.610   -4.255  1.00 56.06  ? 885  ASP A H    1 
ATOM   4657  H  HA   . ASP A 1 324 ? -12.612  4.548   -6.071  1.00 60.83  ? 885  ASP A HA   1 
ATOM   4658  H  HB2  . ASP A 1 324 ? -14.841  3.817   -5.756  1.00 63.67  ? 885  ASP A HB2  1 
ATOM   4659  H  HB3  . ASP A 1 324 ? -15.341  5.177   -6.411  1.00 63.67  ? 885  ASP A HB3  1 
ATOM   4660  N  N    . LEU A 1 325 ? -13.645  7.523   -6.665  1.00 62.68  ? 886  LEU A N    1 
ATOM   4661  C  CA   . LEU A 1 325 ? -13.461  8.682   -7.532  1.00 66.85  ? 886  LEU A CA   1 
ATOM   4662  C  C    . LEU A 1 325 ? -12.376  9.631   -7.039  1.00 77.35  ? 886  LEU A C    1 
ATOM   4663  O  O    . LEU A 1 325 ? -12.153  10.669  -7.670  1.00 76.04  ? 886  LEU A O    1 
ATOM   4664  C  CB   . LEU A 1 325 ? -14.783  9.444   -7.701  1.00 59.97  ? 886  LEU A CB   1 
ATOM   4665  C  CG   . LEU A 1 325 ? -15.609  9.768   -6.454  1.00 72.18  ? 886  LEU A CG   1 
ATOM   4666  C  CD1  . LEU A 1 325 ? -14.992  10.885  -5.613  1.00 83.89  ? 886  LEU A CD1  1 
ATOM   4667  C  CD2  . LEU A 1 325 ? -17.047  10.103  -6.841  1.00 63.21  ? 886  LEU A CD2  1 
ATOM   4668  H  H    . LEU A 1 325 ? -14.185  7.658   -6.010  1.00 75.22  ? 886  LEU A H    1 
ATOM   4669  H  HA   . LEU A 1 325 ? -13.193  8.368   -8.410  1.00 80.22  ? 886  LEU A HA   1 
ATOM   4670  H  HB2  . LEU A 1 325 ? -14.583  10.290  -8.132  1.00 71.97  ? 886  LEU A HB2  1 
ATOM   4671  H  HB3  . LEU A 1 325 ? -15.353  8.920   -8.286  1.00 71.97  ? 886  LEU A HB3  1 
ATOM   4672  H  HG   . LEU A 1 325 ? -15.640  8.974   -5.897  1.00 86.61  ? 886  LEU A HG   1 
ATOM   4673  H  HD11 . LEU A 1 325 ? -15.555  11.046  -4.840  1.00 100.67 ? 886  LEU A HD11 1 
ATOM   4674  H  HD12 . LEU A 1 325 ? -14.106  10.610  -5.326  1.00 100.67 ? 886  LEU A HD12 1 
ATOM   4675  H  HD13 . LEU A 1 325 ? -14.931  11.689  -6.152  1.00 100.67 ? 886  LEU A HD13 1 
ATOM   4676  H  HD21 . LEU A 1 325 ? -17.551  10.305  -6.037  1.00 75.85  ? 886  LEU A HD21 1 
ATOM   4677  H  HD22 . LEU A 1 325 ? -17.043  10.873  -7.431  1.00 75.85  ? 886  LEU A HD22 1 
ATOM   4678  H  HD23 . LEU A 1 325 ? -17.437  9.340   -7.295  1.00 75.85  ? 886  LEU A HD23 1 
ATOM   4679  N  N    . ARG A 1 326 ? -11.695  9.308   -5.937  1.00 82.85  ? 887  ARG A N    1 
ATOM   4680  C  CA   . ARG A 1 326 ? -10.547  10.111  -5.532  1.00 85.08  ? 887  ARG A CA   1 
ATOM   4681  C  C    . ARG A 1 326 ? -9.420   9.999   -6.552  1.00 96.31  ? 887  ARG A C    1 
ATOM   4682  O  O    . ARG A 1 326 ? -8.725   10.985  -6.829  1.00 90.25  ? 887  ARG A O    1 
ATOM   4683  C  CB   . ARG A 1 326 ? -10.066  9.684   -4.145  1.00 70.61  ? 887  ARG A CB   1 
ATOM   4684  H  H    . ARG A 1 326 ? -11.875  8.645   -5.420  1.00 99.42  ? 887  ARG A H    1 
ATOM   4685  H  HA   . ARG A 1 326 ? -10.815  11.042  -5.483  1.00 102.10 ? 887  ARG A HA   1 
ATOM   4686  N  N    . LYS A 1 327 ? -9.235   8.808   -7.133  1.00 99.96  ? 888  LYS A N    1 
ATOM   4687  C  CA   . LYS A 1 327 ? -8.195   8.622   -8.141  1.00 109.45 ? 888  LYS A CA   1 
ATOM   4688  C  C    . LYS A 1 327 ? -8.494   9.421   -9.405  1.00 109.87 ? 888  LYS A C    1 
ATOM   4689  O  O    . LYS A 1 327 ? -7.572   9.912   -10.068 1.00 125.55 ? 888  LYS A O    1 
ATOM   4690  C  CB   . LYS A 1 327 ? -8.050   7.138   -8.474  1.00 112.21 ? 888  LYS A CB   1 
ATOM   4691  H  H    . LYS A 1 327 ? -9.695   8.102   -6.962  1.00 119.95 ? 888  LYS A H    1 
ATOM   4692  H  HA   . LYS A 1 327 ? -7.349   8.934   -7.783  1.00 131.34 ? 888  LYS A HA   1 
ATOM   4693  N  N    . PHE A 1 328 ? -9.772   9.555   -9.760  1.00 99.96  ? 889  PHE A N    1 
ATOM   4694  C  CA   . PHE A 1 328 ? -10.145  10.277  -10.969 1.00 96.59  ? 889  PHE A CA   1 
ATOM   4695  C  C    . PHE A 1 328 ? -9.744   11.744  -10.874 1.00 97.94  ? 889  PHE A C    1 
ATOM   4696  O  O    . PHE A 1 328 ? -10.028  12.420  -9.880  1.00 102.75 ? 889  PHE A O    1 
ATOM   4697  C  CB   . PHE A 1 328 ? -11.649  10.158  -11.210 1.00 83.00  ? 889  PHE A CB   1 
ATOM   4698  H  H    . PHE A 1 328 ? -10.437  9.237   -9.317  1.00 119.95 ? 889  PHE A H    1 
ATOM   4699  H  HA   . PHE A 1 328 ? -9.685   9.887   -11.729 1.00 115.90 ? 889  PHE A HA   1 
ATOM   4700  N  N    . ARG A 1 329 ? -9.086   12.232  -11.921 1.00 115.48 ? 890  ARG A N    1 
ATOM   4701  C  CA   . ARG A 1 329 ? -8.660   13.620  -11.991 1.00 101.51 ? 890  ARG A CA   1 
ATOM   4702  C  C    . ARG A 1 329 ? -9.859   14.544  -12.181 1.00 103.38 ? 890  ARG A C    1 
ATOM   4703  O  O    . ARG A 1 329 ? -10.950  14.123  -12.575 1.00 112.58 ? 890  ARG A O    1 
ATOM   4704  C  CB   . ARG A 1 329 ? -7.662   13.817  -13.132 1.00 85.25  ? 890  ARG A CB   1 
ATOM   4705  H  H    . ARG A 1 329 ? -8.872   11.769  -12.613 1.00 138.57 ? 890  ARG A H    1 
ATOM   4706  H  HA   . ARG A 1 329 ? -8.221   13.861  -11.160 1.00 121.81 ? 890  ARG A HA   1 
ATOM   4707  N  N    . THR A 1 330 ? -9.639   15.820  -11.881 1.00 105.62 ? 891  THR A N    1 
ATOM   4708  C  CA   . THR A 1 330 ? -10.663  16.866  -12.006 1.00 108.46 ? 891  THR A CA   1 
ATOM   4709  C  C    . THR A 1 330 ? -11.786  16.511  -11.032 1.00 107.99 ? 891  THR A C    1 
ATOM   4710  O  O    . THR A 1 330 ? -11.492  16.239  -9.856  1.00 123.09 ? 891  THR A O    1 
ATOM   4711  C  CB   . THR A 1 330 ? -11.074  16.997  -13.471 1.00 103.64 ? 891  THR A CB   1 
ATOM   4712  O  OG1  . THR A 1 330 ? -9.908   16.969  -14.304 1.00 101.25 ? 891  THR A OG1  1 
ATOM   4713  C  CG2  . THR A 1 330 ? -11.837  18.301  -13.704 1.00 91.30  ? 891  THR A CG2  1 
ATOM   4714  H  H    . THR A 1 330 ? -8.885   16.118  -11.595 1.00 126.74 ? 891  THR A H    1 
ATOM   4715  H  HA   . THR A 1 330 ? -10.284  17.713  -11.727 1.00 130.15 ? 891  THR A HA   1 
ATOM   4716  H  HB   . THR A 1 330 ? -11.655  16.257  -13.708 1.00 124.37 ? 891  THR A HB   1 
ATOM   4717  H  HG1  . THR A 1 330 ? -9.496   16.245  -14.197 1.00 121.49 ? 891  THR A HG1  1 
ATOM   4718  H  HG21 . THR A 1 330 ? -12.093  18.373  -14.637 1.00 109.57 ? 891  THR A HG21 1 
ATOM   4719  H  HG22 . THR A 1 330 ? -12.637  18.319  -13.156 1.00 109.57 ? 891  THR A HG22 1 
ATOM   4720  H  HG23 . THR A 1 330 ? -11.278  19.058  -13.471 1.00 109.57 ? 891  THR A HG23 1 
ATOM   4721  N  N    . TYR A 1 331 ? -13.051  16.485  -11.458 1.00 92.62  ? 892  TYR A N    1 
ATOM   4722  C  CA   . TYR A 1 331 ? -14.178  16.265  -10.550 1.00 81.00  ? 892  TYR A CA   1 
ATOM   4723  C  C    . TYR A 1 331 ? -14.157  17.286  -9.408  1.00 73.63  ? 892  TYR A C    1 
ATOM   4724  O  O    . TYR A 1 331 ? -14.077  16.947  -8.225  1.00 77.55  ? 892  TYR A O    1 
ATOM   4725  C  CB   . TYR A 1 331 ? -14.197  14.821  -10.020 1.00 83.67  ? 892  TYR A CB   1 
ATOM   4726  C  CG   . TYR A 1 331 ? -14.866  13.798  -10.924 1.00 79.77  ? 892  TYR A CG   1 
ATOM   4727  C  CD1  . TYR A 1 331 ? -15.845  14.166  -11.842 1.00 68.33  ? 892  TYR A CD1  1 
ATOM   4728  C  CD2  . TYR A 1 331 ? -14.522  12.454  -10.846 1.00 89.90  ? 892  TYR A CD2  1 
ATOM   4729  C  CE1  . TYR A 1 331 ? -16.449  13.229  -12.656 1.00 48.10  ? 892  TYR A CE1  1 
ATOM   4730  C  CE2  . TYR A 1 331 ? -15.123  11.510  -11.654 1.00 74.18  ? 892  TYR A CE2  1 
ATOM   4731  C  CZ   . TYR A 1 331 ? -16.087  11.904  -12.557 1.00 52.84  ? 892  TYR A CZ   1 
ATOM   4732  O  OH   . TYR A 1 331 ? -16.690  10.974  -13.368 1.00 70.20  ? 892  TYR A OH   1 
ATOM   4733  H  H    . TYR A 1 331 ? -13.284  16.594  -12.278 1.00 111.15 ? 892  TYR A H    1 
ATOM   4734  H  HA   . TYR A 1 331 ? -15.001  16.402  -11.046 1.00 97.20  ? 892  TYR A HA   1 
ATOM   4735  H  HB2  . TYR A 1 331 ? -13.282  14.533  -9.882  1.00 100.41 ? 892  TYR A HB2  1 
ATOM   4736  H  HB3  . TYR A 1 331 ? -14.670  14.813  -9.172  1.00 100.41 ? 892  TYR A HB3  1 
ATOM   4737  H  HD1  . TYR A 1 331 ? -16.094  15.059  -11.912 1.00 81.99  ? 892  TYR A HD1  1 
ATOM   4738  H  HD2  . TYR A 1 331 ? -13.872  12.185  -10.237 1.00 107.88 ? 892  TYR A HD2  1 
ATOM   4739  H  HE1  . TYR A 1 331 ? -17.101  13.490  -13.266 1.00 57.72  ? 892  TYR A HE1  1 
ATOM   4740  H  HE2  . TYR A 1 331 ? -14.878  10.615  -11.591 1.00 89.02  ? 892  TYR A HE2  1 
ATOM   4741  H  HH   . TYR A 1 331 ? -16.381  10.210  -13.208 1.00 84.24  ? 892  TYR A HH   1 
ATOM   4742  N  N    . LYS A 1 332 ? -14.172  18.560  -9.799  1.00 68.58  ? 893  LYS A N    1 
ATOM   4743  C  CA   . LYS A 1 332 ? -14.253  19.653  -8.836  1.00 65.05  ? 893  LYS A CA   1 
ATOM   4744  C  C    . LYS A 1 332 ? -15.438  19.463  -7.898  1.00 73.28  ? 893  LYS A C    1 
ATOM   4745  O  O    . LYS A 1 332 ? -16.571  19.244  -8.340  1.00 74.03  ? 893  LYS A O    1 
ATOM   4746  C  CB   . LYS A 1 332 ? -14.390  20.986  -9.572  1.00 77.24  ? 893  LYS A CB   1 
ATOM   4747  C  CG   . LYS A 1 332 ? -13.256  21.299  -10.549 1.00 77.64  ? 893  LYS A CG   1 
ATOM   4748  C  CD   . LYS A 1 332 ? -13.680  22.340  -11.580 1.00 85.85  ? 893  LYS A CD   1 
ATOM   4749  C  CE   . LYS A 1 332 ? -14.656  21.757  -12.596 1.00 60.12  ? 893  LYS A CE   1 
ATOM   4750  N  NZ   . LYS A 1 332 ? -15.075  22.750  -13.615 1.00 75.91  ? 893  LYS A NZ   1 
ATOM   4751  H  H    . LYS A 1 332 ? -14.137  18.817  -10.619 1.00 82.30  ? 893  LYS A H    1 
ATOM   4752  H  HA   . LYS A 1 332 ? -13.441  19.676  -8.305  1.00 78.06  ? 893  LYS A HA   1 
ATOM   4753  H  HB2  . LYS A 1 332 ? -15.218  20.976  -10.077 1.00 92.68  ? 893  LYS A HB2  1 
ATOM   4754  H  HB3  . LYS A 1 332 ? -14.417  21.699  -8.915  1.00 92.68  ? 893  LYS A HB3  1 
ATOM   4755  H  HG2  . LYS A 1 332 ? -12.497  21.649  -10.057 1.00 93.17  ? 893  LYS A HG2  1 
ATOM   4756  H  HG3  . LYS A 1 332 ? -13.006  20.488  -11.019 1.00 93.17  ? 893  LYS A HG3  1 
ATOM   4757  H  HD2  . LYS A 1 332 ? -14.117  23.079  -11.128 1.00 103.02 ? 893  LYS A HD2  1 
ATOM   4758  H  HD3  . LYS A 1 332 ? -12.896  22.655  -12.058 1.00 103.02 ? 893  LYS A HD3  1 
ATOM   4759  H  HE2  . LYS A 1 332 ? -14.231  21.016  -13.055 1.00 72.14  ? 893  LYS A HE2  1 
ATOM   4760  H  HE3  . LYS A 1 332 ? -15.450  21.450  -12.132 1.00 72.14  ? 893  LYS A HE3  1 
ATOM   4761  H  HZ1  . LYS A 1 332 ? -15.643  22.375  -14.189 1.00 91.10  ? 893  LYS A HZ1  1 
ATOM   4762  H  HZ2  . LYS A 1 332 ? -15.476  23.440  -13.221 1.00 91.10  ? 893  LYS A HZ2  1 
ATOM   4763  H  HZ3  . LYS A 1 332 ? -14.364  23.045  -14.062 1.00 91.10  ? 893  LYS A HZ3  1 
ATOM   4764  N  N    . GLY A 1 333 ? -15.175  19.581  -6.598  1.00 71.20  ? 894  GLY A N    1 
ATOM   4765  C  CA   . GLY A 1 333 ? -16.179  19.287  -5.593  1.00 60.86  ? 894  GLY A CA   1 
ATOM   4766  C  C    . GLY A 1 333 ? -17.271  20.331  -5.461  1.00 58.51  ? 894  GLY A C    1 
ATOM   4767  O  O    . GLY A 1 333 ? -18.304  20.040  -4.846  1.00 51.25  ? 894  GLY A O    1 
ATOM   4768  H  H    . GLY A 1 333 ? -14.418  19.832  -6.276  1.00 85.44  ? 894  GLY A H    1 
ATOM   4769  H  HA2  . GLY A 1 333 ? -16.599  18.440  -5.807  1.00 73.03  ? 894  GLY A HA2  1 
ATOM   4770  H  HA3  . GLY A 1 333 ? -15.744  19.198  -4.731  1.00 73.03  ? 894  GLY A HA3  1 
ATOM   4771  N  N    . GLY A 1 334 ? -17.072  21.526  -6.009  1.00 55.56  ? 895  GLY A N    1 
ATOM   4772  C  CA   . GLY A 1 334 ? -18.052  22.589  -5.924  1.00 52.82  ? 895  GLY A CA   1 
ATOM   4773  C  C    . GLY A 1 334 ? -18.887  22.787  -7.167  1.00 50.94  ? 895  GLY A C    1 
ATOM   4774  O  O    . GLY A 1 334 ? -19.702  23.712  -7.204  1.00 53.88  ? 895  GLY A O    1 
ATOM   4775  H  H    . GLY A 1 334 ? -16.362  21.745  -6.443  1.00 66.67  ? 895  GLY A H    1 
ATOM   4776  H  HA2  . GLY A 1 334 ? -18.655  22.403  -5.187  1.00 63.39  ? 895  GLY A HA2  1 
ATOM   4777  H  HA3  . GLY A 1 334 ? -17.596  23.424  -5.735  1.00 63.39  ? 895  GLY A HA3  1 
ATOM   4778  N  N    . SER A 1 335 ? -18.713  21.947  -8.185  1.00 50.81  ? 896  SER A N    1 
ATOM   4779  C  CA   . SER A 1 335 ? -19.434  22.068  -9.445  1.00 50.88  ? 896  SER A CA   1 
ATOM   4780  C  C    . SER A 1 335 ? -20.636  21.132  -9.461  1.00 64.59  ? 896  SER A C    1 
ATOM   4781  O  O    . SER A 1 335 ? -20.500  19.933  -9.190  1.00 59.87  ? 896  SER A O    1 
ATOM   4782  C  CB   . SER A 1 335 ? -18.511  21.750  -10.619 1.00 55.11  ? 896  SER A CB   1 
ATOM   4783  O  OG   . SER A 1 335 ? -19.253  21.553  -11.809 1.00 54.35  ? 896  SER A OG   1 
ATOM   4784  H  H    . SER A 1 335 ? -18.167  21.282  -8.166  1.00 60.97  ? 896  SER A H    1 
ATOM   4785  H  HA   . SER A 1 335 ? -19.754  22.979  -9.545  1.00 61.05  ? 896  SER A HA   1 
ATOM   4786  H  HB2  . SER A 1 335 ? -17.899  22.491  -10.749 1.00 66.13  ? 896  SER A HB2  1 
ATOM   4787  H  HB3  . SER A 1 335 ? -18.014  20.941  -10.420 1.00 66.13  ? 896  SER A HB3  1 
ATOM   4788  H  HG   . SER A 1 335 ? -19.689  22.247  -11.994 1.00 65.22  ? 896  SER A HG   1 
ATOM   4789  N  N    . VAL A 1 336 ? -21.810  21.683  -9.782  1.00 47.53  ? 897  VAL A N    1 
ATOM   4790  C  CA   . VAL A 1 336 ? -22.981  20.844  -10.018 1.00 52.38  ? 897  VAL A CA   1 
ATOM   4791  C  C    . VAL A 1 336 ? -22.759  19.974  -11.249 1.00 56.94  ? 897  VAL A C    1 
ATOM   4792  O  O    . VAL A 1 336 ? -23.115  18.789  -11.265 1.00 46.24  ? 897  VAL A O    1 
ATOM   4793  C  CB   . VAL A 1 336 ? -24.242  21.719  -10.161 1.00 41.93  ? 897  VAL A CB   1 
ATOM   4794  C  CG1  . VAL A 1 336 ? -25.452  20.879  -10.549 1.00 49.95  ? 897  VAL A CG1  1 
ATOM   4795  C  CG2  . VAL A 1 336 ? -24.516  22.479  -8.866  1.00 43.69  ? 897  VAL A CG2  1 
ATOM   4796  H  H    . VAL A 1 336 ? -21.950  22.527  -9.868  1.00 57.04  ? 897  VAL A H    1 
ATOM   4797  H  HA   . VAL A 1 336 ? -23.108  20.258  -9.256  1.00 62.85  ? 897  VAL A HA   1 
ATOM   4798  H  HB   . VAL A 1 336 ? -24.093  22.371  -10.863 1.00 50.32  ? 897  VAL A HB   1 
ATOM   4799  H  HG11 . VAL A 1 336 ? -26.225  21.459  -10.630 1.00 59.94  ? 897  VAL A HG11 1 
ATOM   4800  H  HG12 . VAL A 1 336 ? -25.275  20.444  -11.397 1.00 59.94  ? 897  VAL A HG12 1 
ATOM   4801  H  HG13 . VAL A 1 336 ? -25.608  20.214  -9.861  1.00 59.94  ? 897  VAL A HG13 1 
ATOM   4802  H  HG21 . VAL A 1 336 ? -25.313  23.021  -8.982  1.00 52.43  ? 897  VAL A HG21 1 
ATOM   4803  H  HG22 . VAL A 1 336 ? -24.651  21.840  -8.149  1.00 52.43  ? 897  VAL A HG22 1 
ATOM   4804  H  HG23 . VAL A 1 336 ? -23.756  23.046  -8.666  1.00 52.43  ? 897  VAL A HG23 1 
ATOM   4805  N  N    . ARG A 1 337 ? -22.158  20.547  -12.295 1.00 58.54  ? 898  ARG A N    1 
ATOM   4806  C  CA   . ARG A 1 337 ? -21.897  19.799  -13.521 1.00 52.65  ? 898  ARG A CA   1 
ATOM   4807  C  C    . ARG A 1 337 ? -21.014  18.587  -13.257 1.00 53.81  ? 898  ARG A C    1 
ATOM   4808  O  O    . ARG A 1 337 ? -21.229  17.516  -13.838 1.00 45.33  ? 898  ARG A O    1 
ATOM   4809  C  CB   . ARG A 1 337 ? -21.254  20.725  -14.553 1.00 62.00  ? 898  ARG A CB   1 
ATOM   4810  C  CG   . ARG A 1 337 ? -20.756  20.040  -15.811 1.00 62.04  ? 898  ARG A CG   1 
ATOM   4811  C  CD   . ARG A 1 337 ? -20.254  21.067  -16.815 1.00 60.81  ? 898  ARG A CD   1 
ATOM   4812  N  NE   . ARG A 1 337 ? -19.502  20.441  -17.898 1.00 78.23  ? 898  ARG A NE   1 
ATOM   4813  C  CZ   . ARG A 1 337 ? -18.231  20.063  -17.805 1.00 74.69  ? 898  ARG A CZ   1 
ATOM   4814  N  NH1  . ARG A 1 337 ? -17.559  20.242  -16.673 1.00 72.11  ? 898  ARG A NH1  1 
ATOM   4815  N  NH2  . ARG A 1 337 ? -17.632  19.499  -18.845 1.00 70.19  ? 898  ARG A NH2  1 
ATOM   4816  H  H    . ARG A 1 337 ? -21.893  21.365  -12.317 1.00 70.25  ? 898  ARG A H    1 
ATOM   4817  H  HA   . ARG A 1 337 ? -22.740  19.483  -13.884 1.00 63.18  ? 898  ARG A HA   1 
ATOM   4818  H  HB2  . ARG A 1 337 ? -21.909  21.388  -14.822 1.00 74.40  ? 898  ARG A HB2  1 
ATOM   4819  H  HB3  . ARG A 1 337 ? -20.495  21.166  -14.140 1.00 74.40  ? 898  ARG A HB3  1 
ATOM   4820  H  HG2  . ARG A 1 337 ? -20.022  19.446  -15.587 1.00 74.44  ? 898  ARG A HG2  1 
ATOM   4821  H  HG3  . ARG A 1 337 ? -21.483  19.542  -16.218 1.00 74.44  ? 898  ARG A HG3  1 
ATOM   4822  H  HD2  . ARG A 1 337 ? -21.012  21.532  -17.202 1.00 72.97  ? 898  ARG A HD2  1 
ATOM   4823  H  HD3  . ARG A 1 337 ? -19.670  21.696  -16.364 1.00 72.97  ? 898  ARG A HD3  1 
ATOM   4824  H  HE   . ARG A 1 337 ? -19.907  20.309  -18.644 1.00 93.87  ? 898  ARG A HE   1 
ATOM   4825  H  HH11 . ARG A 1 337 ? -17.946  20.606  -15.997 1.00 86.54  ? 898  ARG A HH11 1 
ATOM   4826  H  HH12 . ARG A 1 337 ? -16.737  19.995  -16.617 1.00 86.54  ? 898  ARG A HH12 1 
ATOM   4827  H  HH21 . ARG A 1 337 ? -18.065  19.381  -19.579 1.00 84.23  ? 898  ARG A HH21 1 
ATOM   4828  H  HH22 . ARG A 1 337 ? -16.810  19.253  -18.786 1.00 84.23  ? 898  ARG A HH22 1 
ATOM   4829  N  N    . ASP A 1 338 ? -20.017  18.732  -12.380 1.00 47.51  ? 899  ASP A N    1 
ATOM   4830  C  CA   . ASP A 1 338 ? -19.138  17.610  -12.068 1.00 54.93  ? 899  ASP A CA   1 
ATOM   4831  C  C    . ASP A 1 338 ? -19.878  16.520  -11.300 1.00 50.04  ? 899  ASP A C    1 
ATOM   4832  O  O    . ASP A 1 338 ? -19.668  15.326  -11.553 1.00 41.52  ? 899  ASP A O    1 
ATOM   4833  C  CB   . ASP A 1 338 ? -17.933  18.098  -11.268 1.00 55.96  ? 899  ASP A CB   1 
ATOM   4834  C  CG   . ASP A 1 338 ? -16.886  18.778  -12.137 1.00 68.83  ? 899  ASP A CG   1 
ATOM   4835  O  OD1  . ASP A 1 338 ? -17.199  19.130  -13.295 1.00 62.81  ? 899  ASP A OD1  1 
ATOM   4836  O  OD2  . ASP A 1 338 ? -15.748  18.964  -11.659 1.00 72.75  ? 899  ASP A OD2  1 
ATOM   4837  H  H    . ASP A 1 338 ? -19.834  19.460  -11.960 1.00 57.01  ? 899  ASP A H    1 
ATOM   4838  H  HA   . ASP A 1 338 ? -18.813  17.225  -12.896 1.00 65.91  ? 899  ASP A HA   1 
ATOM   4839  H  HB2  . ASP A 1 338 ? -18.232  18.738  -10.604 1.00 67.15  ? 899  ASP A HB2  1 
ATOM   4840  H  HB3  . ASP A 1 338 ? -17.514  17.339  -10.833 1.00 67.15  ? 899  ASP A HB3  1 
ATOM   4841  N  N    . LEU A 1 339 ? -20.731  16.908  -10.348 1.00 51.90  ? 900  LEU A N    1 
ATOM   4842  C  CA   . LEU A 1 339 ? -21.544  15.925  -9.640  1.00 49.07  ? 900  LEU A CA   1 
ATOM   4843  C  C    . LEU A 1 339 ? -22.417  15.148  -10.615 1.00 40.13  ? 900  LEU A C    1 
ATOM   4844  O  O    . LEU A 1 339 ? -22.464  13.912  -10.578 1.00 33.16  ? 900  LEU A O    1 
ATOM   4845  C  CB   . LEU A 1 339 ? -22.404  16.615  -8.579  1.00 44.75  ? 900  LEU A CB   1 
ATOM   4846  C  CG   . LEU A 1 339 ? -23.372  15.718  -7.803  1.00 52.97  ? 900  LEU A CG   1 
ATOM   4847  C  CD1  . LEU A 1 339 ? -22.623  14.615  -7.071  1.00 46.65  ? 900  LEU A CD1  1 
ATOM   4848  C  CD2  . LEU A 1 339 ? -24.211  16.536  -6.826  1.00 44.33  ? 900  LEU A CD2  1 
ATOM   4849  H  H    . LEU A 1 339 ? -20.854  17.722  -10.099 1.00 62.28  ? 900  LEU A H    1 
ATOM   4850  H  HA   . LEU A 1 339 ? -20.960  15.294  -9.190  1.00 58.88  ? 900  LEU A HA   1 
ATOM   4851  H  HB2  . LEU A 1 339 ? -21.813  17.030  -7.931  1.00 53.70  ? 900  LEU A HB2  1 
ATOM   4852  H  HB3  . LEU A 1 339 ? -22.933  17.301  -9.016  1.00 53.70  ? 900  LEU A HB3  1 
ATOM   4853  H  HG   . LEU A 1 339 ? -23.979  15.296  -8.432  1.00 63.57  ? 900  LEU A HG   1 
ATOM   4854  H  HD11 . LEU A 1 339 ? -23.262  14.065  -6.590  1.00 55.98  ? 900  LEU A HD11 1 
ATOM   4855  H  HD12 . LEU A 1 339 ? -22.144  14.075  -7.719  1.00 55.98  ? 900  LEU A HD12 1 
ATOM   4856  H  HD13 . LEU A 1 339 ? -21.998  15.018  -6.448  1.00 55.98  ? 900  LEU A HD13 1 
ATOM   4857  H  HD21 . LEU A 1 339 ? -24.812  15.940  -6.351  1.00 53.20  ? 900  LEU A HD21 1 
ATOM   4858  H  HD22 . LEU A 1 339 ? -23.620  16.979  -6.198  1.00 53.20  ? 900  LEU A HD22 1 
ATOM   4859  H  HD23 . LEU A 1 339 ? -24.721  17.194  -7.322  1.00 53.20  ? 900  LEU A HD23 1 
ATOM   4860  N  N    . LEU A 1 340 ? -23.115  15.859  -11.502 1.00 41.00  ? 901  LEU A N    1 
ATOM   4861  C  CA   . LEU A 1 340 ? -23.887  15.186  -12.538 1.00 40.09  ? 901  LEU A CA   1 
ATOM   4862  C  C    . LEU A 1 340 ? -22.988  14.365  -13.446 1.00 36.68  ? 901  LEU A C    1 
ATOM   4863  O  O    . LEU A 1 340 ? -23.406  13.317  -13.954 1.00 46.51  ? 901  LEU A O    1 
ATOM   4864  C  CB   . LEU A 1 340 ? -24.673  16.208  -13.356 1.00 37.03  ? 901  LEU A CB   1 
ATOM   4865  C  CG   . LEU A 1 340 ? -25.733  17.004  -12.593 1.00 34.03  ? 901  LEU A CG   1 
ATOM   4866  C  CD1  . LEU A 1 340 ? -26.264  18.145  -13.458 1.00 30.54  ? 901  LEU A CD1  1 
ATOM   4867  C  CD2  . LEU A 1 340 ? -26.868  16.097  -12.140 1.00 39.75  ? 901  LEU A CD2  1 
ATOM   4868  H  H    . LEU A 1 340 ? -23.155  16.718  -11.525 1.00 49.20  ? 901  LEU A H    1 
ATOM   4869  H  HA   . LEU A 1 340 ? -24.521  14.583  -12.118 1.00 48.11  ? 901  LEU A HA   1 
ATOM   4870  H  HB2  . LEU A 1 340 ? -24.046  16.846  -13.730 1.00 44.44  ? 901  LEU A HB2  1 
ATOM   4871  H  HB3  . LEU A 1 340 ? -25.125  15.740  -14.075 1.00 44.44  ? 901  LEU A HB3  1 
ATOM   4872  H  HG   . LEU A 1 340 ? -25.327  17.393  -11.803 1.00 40.84  ? 901  LEU A HG   1 
ATOM   4873  H  HD11 . LEU A 1 340 ? -26.933  18.636  -12.956 1.00 36.65  ? 901  LEU A HD11 1 
ATOM   4874  H  HD12 . LEU A 1 340 ? -25.528  18.733  -13.692 1.00 36.65  ? 901  LEU A HD12 1 
ATOM   4875  H  HD13 . LEU A 1 340 ? -26.659  17.774  -14.262 1.00 36.65  ? 901  LEU A HD13 1 
ATOM   4876  H  HD21 . LEU A 1 340 ? -27.524  16.627  -11.661 1.00 47.70  ? 901  LEU A HD21 1 
ATOM   4877  H  HD22 . LEU A 1 340 ? -27.277  15.690  -12.920 1.00 47.70  ? 901  LEU A HD22 1 
ATOM   4878  H  HD23 . LEU A 1 340 ? -26.509  15.409  -11.558 1.00 47.70  ? 901  LEU A HD23 1 
ATOM   4879  N  N    . ARG A 1 341 ? -21.751  14.816  -13.656 1.00 56.43  ? 902  ARG A N    1 
ATOM   4880  C  CA   . ARG A 1 341 ? -20.821  14.057  -14.483 1.00 54.50  ? 902  ARG A CA   1 
ATOM   4881  C  C    . ARG A 1 341 ? -20.409  12.763  -13.791 1.00 49.12  ? 902  ARG A C    1 
ATOM   4882  O  O    . ARG A 1 341 ? -20.308  11.713  -14.436 1.00 51.13  ? 902  ARG A O    1 
ATOM   4883  C  CB   . ARG A 1 341 ? -19.603  14.922  -14.815 1.00 52.05  ? 902  ARG A CB   1 
ATOM   4884  C  CG   . ARG A 1 341 ? -18.840  14.495  -16.055 1.00 79.80  ? 902  ARG A CG   1 
ATOM   4885  C  CD   . ARG A 1 341 ? -18.275  15.701  -16.802 1.00 80.54  ? 902  ARG A CD   1 
ATOM   4886  N  NE   . ARG A 1 341 ? -17.377  16.500  -15.970 1.00 85.74  ? 902  ARG A NE   1 
ATOM   4887  C  CZ   . ARG A 1 341 ? -16.094  16.220  -15.763 1.00 84.73  ? 902  ARG A CZ   1 
ATOM   4888  N  NH1  . ARG A 1 341 ? -15.543  15.149  -16.321 1.00 88.22  ? 902  ARG A NH1  1 
ATOM   4889  N  NH2  . ARG A 1 341 ? -15.359  17.010  -14.990 1.00 76.67  ? 902  ARG A NH2  1 
ATOM   4890  H  H    . ARG A 1 341 ? -21.431  15.547  -13.335 1.00 67.72  ? 902  ARG A H    1 
ATOM   4891  H  HA   . ARG A 1 341 ? -21.258  13.824  -15.317 1.00 65.40  ? 902  ARG A HA   1 
ATOM   4892  H  HB2  . ARG A 1 341 ? -19.901  15.835  -14.953 1.00 62.46  ? 902  ARG A HB2  1 
ATOM   4893  H  HB3  . ARG A 1 341 ? -18.988  14.890  -14.066 1.00 62.46  ? 902  ARG A HB3  1 
ATOM   4894  H  HG2  . ARG A 1 341 ? -18.101  13.924  -15.796 1.00 95.76  ? 902  ARG A HG2  1 
ATOM   4895  H  HG3  . ARG A 1 341 ? -19.439  14.021  -16.653 1.00 95.76  ? 902  ARG A HG3  1 
ATOM   4896  H  HD2  . ARG A 1 341 ? -17.775  15.391  -17.573 1.00 96.65  ? 902  ARG A HD2  1 
ATOM   4897  H  HD3  . ARG A 1 341 ? -19.007  16.270  -17.086 1.00 96.65  ? 902  ARG A HD3  1 
ATOM   4898  H  HE   . ARG A 1 341 ? -17.701  17.199  -15.588 1.00 102.89 ? 902  ARG A HE   1 
ATOM   4899  H  HH11 . ARG A 1 341 ? -16.016  14.635  -16.822 1.00 105.87 ? 902  ARG A HH11 1 
ATOM   4900  H  HH12 . ARG A 1 341 ? -14.713  14.971  -16.184 1.00 105.87 ? 902  ARG A HH12 1 
ATOM   4901  H  HH21 . ARG A 1 341 ? -15.712  17.704  -14.625 1.00 92.01  ? 902  ARG A HH21 1 
ATOM   4902  H  HH22 . ARG A 1 341 ? -14.529  16.828  -14.854 1.00 92.01  ? 902  ARG A HH22 1 
ATOM   4903  N  N    . ALA A 1 342 ? -20.191  12.815  -12.473 1.00 40.25  ? 903  ALA A N    1 
ATOM   4904  C  CA   . ALA A 1 342 ? -19.854  11.609  -11.723 1.00 47.13  ? 903  ALA A CA   1 
ATOM   4905  C  C    . ALA A 1 342 ? -21.004  10.607  -11.738 1.00 48.24  ? 903  ALA A C    1 
ATOM   4906  O  O    . ALA A 1 342 ? -20.792  9.405   -11.945 1.00 40.85  ? 903  ALA A O    1 
ATOM   4907  C  CB   . ALA A 1 342 ? -19.484  11.976  -10.286 1.00 39.55  ? 903  ALA A CB   1 
ATOM   4908  H  H    . ALA A 1 342 ? -20.233  13.530  -11.998 1.00 48.30  ? 903  ALA A H    1 
ATOM   4909  H  HA   . ALA A 1 342 ? -19.083  11.187  -12.133 1.00 56.56  ? 903  ALA A HA   1 
ATOM   4910  H  HB1  . ALA A 1 342 ? -19.263  11.166  -9.801  1.00 47.46  ? 903  ALA A HB1  1 
ATOM   4911  H  HB2  . ALA A 1 342 ? -18.720  12.573  -10.300 1.00 47.46  ? 903  ALA A HB2  1 
ATOM   4912  H  HB3  . ALA A 1 342 ? -20.241  12.416  -9.869  1.00 47.46  ? 903  ALA A HB3  1 
ATOM   4913  N  N    . MET A 1 343 ? -22.231  11.084  -11.507 1.00 39.94  ? 904  MET A N    1 
ATOM   4914  C  CA   . MET A 1 343 ? -23.396  10.204  -11.543 1.00 34.96  ? 904  MET A CA   1 
ATOM   4915  C  C    . MET A 1 343 ? -23.540  9.549   -12.911 1.00 36.86  ? 904  MET A C    1 
ATOM   4916  O  O    . MET A 1 343 ? -23.754  8.335   -13.015 1.00 38.19  ? 904  MET A O    1 
ATOM   4917  C  CB   . MET A 1 343 ? -24.651  11.001  -11.189 1.00 36.14  ? 904  MET A CB   1 
ATOM   4918  C  CG   . MET A 1 343 ? -24.649  11.574  -9.784  1.00 38.04  ? 904  MET A CG   1 
ATOM   4919  S  SD   . MET A 1 343 ? -25.927  12.828  -9.583  1.00 36.98  ? 904  MET A SD   1 
ATOM   4920  C  CE   . MET A 1 343 ? -27.404  11.861  -9.911  1.00 40.18  ? 904  MET A CE   1 
ATOM   4921  H  H    . MET A 1 343 ? -22.411  11.906  -11.329 1.00 47.93  ? 904  MET A H    1 
ATOM   4922  H  HA   . MET A 1 343 ? -23.286  9.511   -10.874 1.00 41.95  ? 904  MET A HA   1 
ATOM   4923  H  HB2  . MET A 1 343 ? -24.734  11.742  -11.809 1.00 43.37  ? 904  MET A HB2  1 
ATOM   4924  H  HB3  . MET A 1 343 ? -25.422  10.419  -11.269 1.00 43.37  ? 904  MET A HB3  1 
ATOM   4925  H  HG2  . MET A 1 343 ? -24.819  10.862  -9.147  1.00 45.65  ? 904  MET A HG2  1 
ATOM   4926  H  HG3  . MET A 1 343 ? -23.788  11.985  -9.606  1.00 45.65  ? 904  MET A HG3  1 
ATOM   4927  H  HE1  . MET A 1 343 ? -28.181  12.436  -9.833  1.00 48.21  ? 904  MET A HE1  1 
ATOM   4928  H  HE2  . MET A 1 343 ? -27.350  11.497  -10.808 1.00 48.21  ? 904  MET A HE2  1 
ATOM   4929  H  HE3  . MET A 1 343 ? -27.458  11.140  -9.264  1.00 48.21  ? 904  MET A HE3  1 
ATOM   4930  N  N    . ARG A 1 344 ? -23.414  10.346  -13.975 1.00 42.15  ? 905  ARG A N    1 
ATOM   4931  C  CA   . ARG A 1 344 ? -23.470  9.811   -15.332 1.00 35.79  ? 905  ARG A CA   1 
ATOM   4932  C  C    . ARG A 1 344 ? -22.430  8.713   -15.536 1.00 52.01  ? 905  ARG A C    1 
ATOM   4933  O  O    . ARG A 1 344 ? -22.730  7.664   -16.119 1.00 45.16  ? 905  ARG A O    1 
ATOM   4934  C  CB   . ARG A 1 344 ? -23.271  10.956  -16.333 1.00 46.17  ? 905  ARG A CB   1 
ATOM   4935  C  CG   . ARG A 1 344 ? -22.636  10.584  -17.670 1.00 70.60  ? 905  ARG A CG   1 
ATOM   4936  C  CD   . ARG A 1 344 ? -23.548  9.717   -18.517 1.00 75.16  ? 905  ARG A CD   1 
ATOM   4937  N  NE   . ARG A 1 344 ? -22.850  9.208   -19.694 1.00 93.37  ? 905  ARG A NE   1 
ATOM   4938  C  CZ   . ARG A 1 344 ? -23.432  8.547   -20.689 1.00 91.75  ? 905  ARG A CZ   1 
ATOM   4939  N  NH1  . ARG A 1 344 ? -24.736  8.309   -20.664 1.00 76.03  ? 905  ARG A NH1  1 
ATOM   4940  N  NH2  . ARG A 1 344 ? -22.704  8.126   -21.715 1.00 96.97  ? 905  ARG A NH2  1 
ATOM   4941  H  H    . ARG A 1 344 ? -23.296  11.196  -13.935 1.00 50.58  ? 905  ARG A H    1 
ATOM   4942  H  HA   . ARG A 1 344 ? -24.347  9.426   -15.485 1.00 42.94  ? 905  ARG A HA   1 
ATOM   4943  H  HB2  . ARG A 1 344 ? -24.138  11.346  -16.525 1.00 55.40  ? 905  ARG A HB2  1 
ATOM   4944  H  HB3  . ARG A 1 344 ? -22.702  11.624  -15.920 1.00 55.40  ? 905  ARG A HB3  1 
ATOM   4945  H  HG2  . ARG A 1 344 ? -22.444  11.395  -18.167 1.00 84.72  ? 905  ARG A HG2  1 
ATOM   4946  H  HG3  . ARG A 1 344 ? -21.817  10.091  -17.507 1.00 84.72  ? 905  ARG A HG3  1 
ATOM   4947  H  HD2  . ARG A 1 344 ? -23.850  8.960   -17.991 1.00 90.19  ? 905  ARG A HD2  1 
ATOM   4948  H  HD3  . ARG A 1 344 ? -24.306  10.244  -18.815 1.00 90.19  ? 905  ARG A HD3  1 
ATOM   4949  H  HE   . ARG A 1 344 ? -22.003  9.347   -19.747 1.00 112.04 ? 905  ARG A HE   1 
ATOM   4950  H  HH11 . ARG A 1 344 ? -25.210  8.581   -20.000 1.00 91.24  ? 905  ARG A HH11 1 
ATOM   4951  H  HH12 . ARG A 1 344 ? -25.108  7.881   -21.311 1.00 91.24  ? 905  ARG A HH12 1 
ATOM   4952  H  HH21 . ARG A 1 344 ? -21.858  8.280   -21.734 1.00 116.37 ? 905  ARG A HH21 1 
ATOM   4953  H  HH22 . ARG A 1 344 ? -23.078  7.699   -22.361 1.00 116.37 ? 905  ARG A HH22 1 
ATOM   4954  N  N    . ASN A 1 345 ? -21.206  8.925   -15.041 1.00 52.82  ? 906  ASN A N    1 
ATOM   4955  C  CA   . ASN A 1 345 ? -20.135  7.960   -15.272 1.00 49.83  ? 906  ASN A CA   1 
ATOM   4956  C  C    . ASN A 1 345 ? -20.331  6.688   -14.458 1.00 47.58  ? 906  ASN A C    1 
ATOM   4957  O  O    . ASN A 1 345 ? -20.092  5.584   -14.963 1.00 51.85  ? 906  ASN A O    1 
ATOM   4958  C  CB   . ASN A 1 345 ? -18.785  8.599   -14.951 1.00 57.31  ? 906  ASN A CB   1 
ATOM   4959  C  CG   . ASN A 1 345 ? -18.352  9.583   -16.004 1.00 74.15  ? 906  ASN A CG   1 
ATOM   4960  O  OD1  . ASN A 1 345 ? -19.057  9.820   -16.985 1.00 87.15  ? 906  ASN A OD1  1 
ATOM   4961  N  ND2  . ASN A 1 345 ? -17.191  10.173  -15.799 1.00 77.31  ? 906  ASN A ND2  1 
ATOM   4962  H  H    . ASN A 1 345 ? -20.976  9.611   -14.576 1.00 63.38  ? 906  ASN A H    1 
ATOM   4963  H  HA   . ASN A 1 345 ? -20.132  7.714   -16.210 1.00 59.79  ? 906  ASN A HA   1 
ATOM   4964  H  HB2  . ASN A 1 345 ? -18.851  9.071   -14.106 1.00 68.78  ? 906  ASN A HB2  1 
ATOM   4965  H  HB3  . ASN A 1 345 ? -18.111  7.904   -14.894 1.00 68.78  ? 906  ASN A HB3  1 
ATOM   4966  H  HD21 . ASN A 1 345 ? -16.732  9.986   -15.097 1.00 92.77  ? 906  ASN A HD21 1 
ATOM   4967  H  HD22 . ASN A 1 345 ? -16.894  10.745  -16.368 1.00 92.77  ? 906  ASN A HD22 1 
ATOM   4968  N  N    . LYS A 1 346 ? -20.749  6.814   -13.195 1.00 50.75  ? 907  LYS A N    1 
ATOM   4969  C  CA   . LYS A 1 346 ? -21.008  5.624   -12.390 1.00 55.45  ? 907  LYS A CA   1 
ATOM   4970  C  C    . LYS A 1 346 ? -22.239  4.870   -12.875 1.00 51.73  ? 907  LYS A C    1 
ATOM   4971  O  O    . LYS A 1 346 ? -22.349  3.658   -12.652 1.00 51.10  ? 907  LYS A O    1 
ATOM   4972  C  CB   . LYS A 1 346 ? -21.171  5.999   -10.915 1.00 45.08  ? 907  LYS A CB   1 
ATOM   4973  C  CG   . LYS A 1 346 ? -19.946  6.645   -10.292 1.00 52.63  ? 907  LYS A CG   1 
ATOM   4974  C  CD   . LYS A 1 346 ? -18.718  5.772   -10.455 1.00 58.78  ? 907  LYS A CD   1 
ATOM   4975  C  CE   . LYS A 1 346 ? -17.483  6.415   -9.872  1.00 64.68  ? 907  LYS A CE   1 
ATOM   4976  N  NZ   . LYS A 1 346 ? -16.281  5.596   -10.188 1.00 76.44  ? 907  LYS A NZ   1 
ATOM   4977  H  H    . LYS A 1 346 ? -20.887  7.561   -12.792 1.00 60.90  ? 907  LYS A H    1 
ATOM   4978  H  HA   . LYS A 1 346 ? -20.247  5.026   -12.461 1.00 66.54  ? 907  LYS A HA   1 
ATOM   4979  H  HB2  . LYS A 1 346 ? -21.907  6.626   -10.834 1.00 54.09  ? 907  LYS A HB2  1 
ATOM   4980  H  HB3  . LYS A 1 346 ? -21.370  5.195   -10.410 1.00 54.09  ? 907  LYS A HB3  1 
ATOM   4981  H  HG2  . LYS A 1 346 ? -19.775  7.495   -10.726 1.00 63.16  ? 907  LYS A HG2  1 
ATOM   4982  H  HG3  . LYS A 1 346 ? -20.101  6.777   -9.343  1.00 63.16  ? 907  LYS A HG3  1 
ATOM   4983  H  HD2  . LYS A 1 346 ? -18.864  4.929   -9.999  1.00 70.54  ? 907  LYS A HD2  1 
ATOM   4984  H  HD3  . LYS A 1 346 ? -18.561  5.618   -11.400 1.00 70.54  ? 907  LYS A HD3  1 
ATOM   4985  H  HE2  . LYS A 1 346 ? -17.365  7.298   -10.257 1.00 77.62  ? 907  LYS A HE2  1 
ATOM   4986  H  HE3  . LYS A 1 346 ? -17.572  6.473   -8.908  1.00 77.62  ? 907  LYS A HE3  1 
ATOM   4987  H  HZ1  . LYS A 1 346 ? -15.554  5.978   -9.843  1.00 91.73  ? 907  LYS A HZ1  1 
ATOM   4988  H  HZ2  . LYS A 1 346 ? -16.370  4.780   -9.845  1.00 91.73  ? 907  LYS A HZ2  1 
ATOM   4989  H  HZ3  . LYS A 1 346 ? -16.182  5.530   -11.070 1.00 91.73  ? 907  LYS A HZ3  1 
ATOM   4990  N  N    . LYS A 1 347 ? -23.172  5.561   -13.532 1.00 50.75  ? 908  LYS A N    1 
ATOM   4991  C  CA   . LYS A 1 347 ? -24.310  4.874   -14.135 1.00 64.45  ? 908  LYS A CA   1 
ATOM   4992  C  C    . LYS A 1 347 ? -23.879  4.083   -15.362 1.00 65.15  ? 908  LYS A C    1 
ATOM   4993  O  O    . LYS A 1 347 ? -24.390  2.985   -15.612 1.00 60.33  ? 908  LYS A O    1 
ATOM   4994  C  CB   . LYS A 1 347 ? -25.395  5.888   -14.499 1.00 64.89  ? 908  LYS A CB   1 
ATOM   4995  C  CG   . LYS A 1 347 ? -26.675  5.289   -15.075 1.00 59.40  ? 908  LYS A CG   1 
ATOM   4996  C  CD   . LYS A 1 347 ? -27.646  6.396   -15.467 1.00 64.00  ? 908  LYS A CD   1 
ATOM   4997  C  CE   . LYS A 1 347 ? -28.984  5.851   -15.948 1.00 64.06  ? 908  LYS A CE   1 
ATOM   4998  N  NZ   . LYS A 1 347 ? -28.922  5.245   -17.309 1.00 74.71  ? 908  LYS A NZ   1 
ATOM   4999  H  H    . LYS A 1 347 ? -23.169  6.414   -13.640 1.00 60.90  ? 908  LYS A H    1 
ATOM   5000  H  HA   . LYS A 1 347 ? -24.683  4.252   -13.491 1.00 77.34  ? 908  LYS A HA   1 
ATOM   5001  H  HB2  . LYS A 1 347 ? -25.637  6.381   -13.700 1.00 77.86  ? 908  LYS A HB2  1 
ATOM   5002  H  HB3  . LYS A 1 347 ? -25.035  6.499   -15.161 1.00 77.86  ? 908  LYS A HB3  1 
ATOM   5003  H  HG2  . LYS A 1 347 ? -26.463  4.771   -15.867 1.00 71.28  ? 908  LYS A HG2  1 
ATOM   5004  H  HG3  . LYS A 1 347 ? -27.100  4.730   -14.406 1.00 71.28  ? 908  LYS A HG3  1 
ATOM   5005  H  HD2  . LYS A 1 347 ? -27.810  6.961   -14.697 1.00 76.80  ? 908  LYS A HD2  1 
ATOM   5006  H  HD3  . LYS A 1 347 ? -27.257  6.918   -16.187 1.00 76.80  ? 908  LYS A HD3  1 
ATOM   5007  H  HE2  . LYS A 1 347 ? -29.285  5.166   -15.331 1.00 76.87  ? 908  LYS A HE2  1 
ATOM   5008  H  HE3  . LYS A 1 347 ? -29.627  6.577   -15.975 1.00 76.87  ? 908  LYS A HE3  1 
ATOM   5009  H  HZ1  . LYS A 1 347 ? -29.725  4.942   -17.544 1.00 89.65  ? 908  LYS A HZ1  1 
ATOM   5010  H  HZ2  . LYS A 1 347 ? -28.658  5.854   -17.901 1.00 89.65  ? 908  LYS A HZ2  1 
ATOM   5011  H  HZ3  . LYS A 1 347 ? -28.345  4.567   -17.314 1.00 89.65  ? 908  LYS A HZ3  1 
ATOM   5012  N  N    . HIS A 1 348 ? -22.931  4.620   -16.135 1.00 72.47  ? 909  HIS A N    1 
ATOM   5013  C  CA   . HIS A 1 348 ? -22.494  3.954   -17.359 1.00 71.16  ? 909  HIS A CA   1 
ATOM   5014  C  C    . HIS A 1 348 ? -21.637  2.732   -17.051 1.00 65.41  ? 909  HIS A C    1 
ATOM   5015  O  O    . HIS A 1 348 ? -21.821  1.668   -17.654 1.00 61.83  ? 909  HIS A O    1 
ATOM   5016  C  CB   . HIS A 1 348 ? -21.730  4.945   -18.238 1.00 63.55  ? 909  HIS A CB   1 
ATOM   5017  C  CG   . HIS A 1 348 ? -21.342  4.397   -19.575 1.00 72.04  ? 909  HIS A CG   1 
ATOM   5018  N  ND1  . HIS A 1 348 ? -20.038  4.377   -20.020 1.00 82.50  ? 909  HIS A ND1  1 
ATOM   5019  C  CD2  . HIS A 1 348 ? -22.086  3.849   -20.564 1.00 75.88  ? 909  HIS A CD2  1 
ATOM   5020  C  CE1  . HIS A 1 348 ? -19.995  3.841   -21.227 1.00 82.34  ? 909  HIS A CE1  1 
ATOM   5021  N  NE2  . HIS A 1 348 ? -21.225  3.511   -21.580 1.00 85.73  ? 909  HIS A NE2  1 
ATOM   5022  H  H    . HIS A 1 348 ? -22.529  5.363   -15.972 1.00 86.97  ? 909  HIS A H    1 
ATOM   5023  H  HA   . HIS A 1 348 ? -23.274  3.656   -17.852 1.00 85.39  ? 909  HIS A HA   1 
ATOM   5024  H  HB2  . HIS A 1 348 ? -22.289  5.724   -18.388 1.00 76.26  ? 909  HIS A HB2  1 
ATOM   5025  H  HB3  . HIS A 1 348 ? -20.918  5.208   -17.778 1.00 76.26  ? 909  HIS A HB3  1 
ATOM   5026  H  HD1  . HIS A 1 348 ? -19.358  4.669   -19.582 1.00 99.00  ? 909  HIS A HD1  1 
ATOM   5027  H  HD2  . HIS A 1 348 ? -23.008  3.724   -20.558 1.00 91.05  ? 909  HIS A HD2  1 
ATOM   5028  H  HE1  . HIS A 1 348 ? -19.230  3.715   -21.740 1.00 98.81  ? 909  HIS A HE1  1 
ATOM   5029  H  HE2  . HIS A 1 348 ? -21.449  3.145   -22.325 1.00 102.87 ? 909  HIS A HE2  1 
ATOM   5030  N  N    . HIS A 1 349 ? -20.717  2.858   -16.099 1.00 63.62  ? 910  HIS A N    1 
ATOM   5031  C  CA   . HIS A 1 349 ? -19.805  1.790   -15.719 1.00 65.12  ? 910  HIS A CA   1 
ATOM   5032  C  C    . HIS A 1 349 ? -20.378  0.901   -14.623 1.00 56.16  ? 910  HIS A C    1 
ATOM   5033  O  O    . HIS A 1 349 ? -19.662  0.038   -14.104 1.00 59.57  ? 910  HIS A O    1 
ATOM   5034  C  CB   . HIS A 1 349 ? -18.467  2.382   -15.273 1.00 63.27  ? 910  HIS A CB   1 
ATOM   5035  C  CG   . HIS A 1 349 ? -17.793  3.200   -16.329 1.00 68.51  ? 910  HIS A CG   1 
ATOM   5036  N  ND1  . HIS A 1 349 ? -17.234  2.641   -17.458 1.00 84.84  ? 910  HIS A ND1  1 
ATOM   5037  C  CD2  . HIS A 1 349 ? -17.596  4.536   -16.435 1.00 73.73  ? 910  HIS A CD2  1 
ATOM   5038  C  CE1  . HIS A 1 349 ? -16.717  3.596   -18.211 1.00 78.04  ? 910  HIS A CE1  1 
ATOM   5039  N  NE2  . HIS A 1 349 ? -16.923  4.755   -17.612 1.00 88.87  ? 910  HIS A NE2  1 
ATOM   5040  H  H    . HIS A 1 349 ? -20.601  3.580   -15.646 1.00 76.35  ? 910  HIS A H    1 
ATOM   5041  H  HA   . HIS A 1 349 ? -19.637  1.232   -16.495 1.00 78.14  ? 910  HIS A HA   1 
ATOM   5042  H  HB2  . HIS A 1 349 ? -18.619  2.955   -14.505 1.00 75.93  ? 910  HIS A HB2  1 
ATOM   5043  H  HB3  . HIS A 1 349 ? -17.869  1.658   -15.030 1.00 75.93  ? 910  HIS A HB3  1 
ATOM   5044  H  HD1  . HIS A 1 349 ? -17.222  1.801   -17.643 1.00 101.81 ? 910  HIS A HD1  1 
ATOM   5045  H  HD2  . HIS A 1 349 ? -17.863  5.183   -15.823 1.00 88.48  ? 910  HIS A HD2  1 
ATOM   5046  H  HE1  . HIS A 1 349 ? -16.282  3.472   -19.024 1.00 93.65  ? 910  HIS A HE1  1 
ATOM   5047  H  HE2  . HIS A 1 349 ? -16.676  5.522   -17.912 1.00 106.64 ? 910  HIS A HE2  1 
ATOM   5048  N  N    . TYR A 1 350 ? -21.648  1.108   -14.263 1.00 69.79  ? 911  TYR A N    1 
ATOM   5049  C  CA   . TYR A 1 350 ? -22.242  0.463   -13.095 1.00 68.10  ? 911  TYR A CA   1 
ATOM   5050  C  C    . TYR A 1 350 ? -21.955  -1.033  -13.049 1.00 67.71  ? 911  TYR A C    1 
ATOM   5051  O  O    . TYR A 1 350 ? -21.637  -1.576  -11.986 1.00 60.64  ? 911  TYR A O    1 
ATOM   5052  C  CB   . TYR A 1 350 ? -23.752  0.713   -13.093 1.00 63.31  ? 911  TYR A CB   1 
ATOM   5053  C  CG   . TYR A 1 350 ? -24.498  -0.057  -12.029 1.00 66.25  ? 911  TYR A CG   1 
ATOM   5054  C  CD1  . TYR A 1 350 ? -24.446  0.332   -10.697 1.00 50.37  ? 911  TYR A CD1  1 
ATOM   5055  C  CD2  . TYR A 1 350 ? -25.256  -1.173  -12.358 1.00 68.24  ? 911  TYR A CD2  1 
ATOM   5056  C  CE1  . TYR A 1 350 ? -25.122  -0.372  -9.721  1.00 63.74  ? 911  TYR A CE1  1 
ATOM   5057  C  CE2  . TYR A 1 350 ? -25.937  -1.881  -11.390 1.00 60.04  ? 911  TYR A CE2  1 
ATOM   5058  C  CZ   . TYR A 1 350 ? -25.868  -1.477  -10.075 1.00 67.56  ? 911  TYR A CZ   1 
ATOM   5059  O  OH   . TYR A 1 350 ? -26.545  -2.176  -9.106  1.00 76.20  ? 911  TYR A OH   1 
ATOM   5060  H  H    . TYR A 1 350 ? -22.190  1.625   -14.686 1.00 83.74  ? 911  TYR A H    1 
ATOM   5061  H  HA   . TYR A 1 350 ? -21.872  0.863   -12.292 1.00 81.72  ? 911  TYR A HA   1 
ATOM   5062  H  HB2  . TYR A 1 350 ? -23.913  1.658   -12.943 1.00 75.97  ? 911  TYR A HB2  1 
ATOM   5063  H  HB3  . TYR A 1 350 ? -24.113  0.452   -13.955 1.00 75.97  ? 911  TYR A HB3  1 
ATOM   5064  H  HD1  . TYR A 1 350 ? -23.942  1.076   -10.457 1.00 60.44  ? 911  TYR A HD1  1 
ATOM   5065  H  HD2  . TYR A 1 350 ? -25.303  -1.448  -13.245 1.00 81.89  ? 911  TYR A HD2  1 
ATOM   5066  H  HE1  . TYR A 1 350 ? -25.079  -0.101  -8.833  1.00 76.49  ? 911  TYR A HE1  1 
ATOM   5067  H  HE2  . TYR A 1 350 ? -26.441  -2.627  -11.624 1.00 72.05  ? 911  TYR A HE2  1 
ATOM   5068  H  HH   . TYR A 1 350 ? -26.957  -2.822  -9.453  1.00 91.44  ? 911  TYR A HH   1 
ATOM   5069  N  N    . ARG A 1 351 ? -22.060  -1.719  -14.190 1.00 63.00  ? 912  ARG A N    1 
ATOM   5070  C  CA   . ARG A 1 351 ? -21.830  -3.162  -14.199 1.00 71.99  ? 912  ARG A CA   1 
ATOM   5071  C  C    . ARG A 1 351 ? -20.380  -3.498  -13.867 1.00 66.09  ? 912  ARG A C    1 
ATOM   5072  O  O    . ARG A 1 351 ? -20.110  -4.497  -13.191 1.00 69.42  ? 912  ARG A O    1 
ATOM   5073  C  CB   . ARG A 1 351 ? -22.219  -3.747  -15.557 1.00 66.38  ? 912  ARG A CB   1 
ATOM   5074  H  H    . ARG A 1 351 ? -22.258  -1.380  -14.955 1.00 75.60  ? 912  ARG A H    1 
ATOM   5075  H  HA   . ARG A 1 351 ? -22.393  -3.574  -13.525 1.00 86.39  ? 912  ARG A HA   1 
ATOM   5076  N  N    . GLU A 1 352 ? -19.438  -2.668  -14.313 1.00 79.97  ? 913  GLU A N    1 
ATOM   5077  C  CA   . GLU A 1 352 ? -18.012  -2.948  -14.193 1.00 57.91  ? 913  GLU A CA   1 
ATOM   5078  C  C    . GLU A 1 352 ? -17.372  -2.339  -12.949 1.00 61.55  ? 913  GLU A C    1 
ATOM   5079  O  O    . GLU A 1 352 ? -16.154  -2.455  -12.783 1.00 66.56  ? 913  GLU A O    1 
ATOM   5080  C  CB   . GLU A 1 352 ? -17.275  -2.445  -15.440 1.00 61.46  ? 913  GLU A CB   1 
ATOM   5081  C  CG   . GLU A 1 352 ? -17.640  -3.190  -16.725 1.00 63.68  ? 913  GLU A CG   1 
ATOM   5082  C  CD   . GLU A 1 352 ? -18.974  -2.748  -17.321 1.00 93.40  ? 913  GLU A CD   1 
ATOM   5083  O  OE1  . GLU A 1 352 ? -19.814  -3.623  -17.625 1.00 95.05  ? 913  GLU A OE1  1 
ATOM   5084  O  OE2  . GLU A 1 352 ? -19.179  -1.527  -17.495 1.00 90.69  ? 913  GLU A OE2  1 
ATOM   5085  H  H    . GLU A 1 352 ? -19.607  -1.918  -14.698 1.00 95.97  ? 913  GLU A H    1 
ATOM   5086  H  HA   . GLU A 1 352 ? -17.889  -3.909  -14.145 1.00 69.49  ? 913  GLU A HA   1 
ATOM   5087  H  HB2  . GLU A 1 352 ? -17.488  -1.508  -15.571 1.00 73.75  ? 913  GLU A HB2  1 
ATOM   5088  H  HB3  . GLU A 1 352 ? -16.320  -2.547  -15.300 1.00 73.75  ? 913  GLU A HB3  1 
ATOM   5089  H  HG2  . GLU A 1 352 ? -16.950  -3.031  -17.388 1.00 76.42  ? 913  GLU A HG2  1 
ATOM   5090  H  HG3  . GLU A 1 352 ? -17.700  -4.139  -16.532 1.00 76.42  ? 913  GLU A HG3  1 
ATOM   5091  N  N    . LEU A 1 353 ? -18.143  -1.689  -12.080 1.00 75.75  ? 914  LEU A N    1 
ATOM   5092  C  CA   . LEU A 1 353 ? -17.566  -1.071  -10.897 1.00 76.78  ? 914  LEU A CA   1 
ATOM   5093  C  C    . LEU A 1 353 ? -17.170  -2.130  -9.866  1.00 69.68  ? 914  LEU A C    1 
ATOM   5094  O  O    . LEU A 1 353 ? -17.638  -3.270  -9.919  1.00 61.38  ? 914  LEU A O    1 
ATOM   5095  C  CB   . LEU A 1 353 ? -18.553  -0.089  -10.274 1.00 60.33  ? 914  LEU A CB   1 
ATOM   5096  C  CG   . LEU A 1 353 ? -18.825  1.196   -11.059 1.00 73.78  ? 914  LEU A CG   1 
ATOM   5097  C  CD1  . LEU A 1 353 ? -19.996  1.952   -10.453 1.00 66.47  ? 914  LEU A CD1  1 
ATOM   5098  C  CD2  . LEU A 1 353 ? -17.588  2.082   -11.102 1.00 81.26  ? 914  LEU A CD2  1 
ATOM   5099  H  H    . LEU A 1 353 ? -18.994  -1.593  -12.154 1.00 90.90  ? 914  LEU A H    1 
ATOM   5100  H  HA   . LEU A 1 353 ? -16.768  -0.581  -11.150 1.00 92.13  ? 914  LEU A HA   1 
ATOM   5101  H  HB2  . LEU A 1 353 ? -19.403  -0.543  -10.163 1.00 72.39  ? 914  LEU A HB2  1 
ATOM   5102  H  HB3  . LEU A 1 353 ? -18.213  0.172   -9.404  1.00 72.39  ? 914  LEU A HB3  1 
ATOM   5103  H  HG   . LEU A 1 353 ? -19.059  0.965   -11.971 1.00 88.54  ? 914  LEU A HG   1 
ATOM   5104  H  HD11 . LEU A 1 353 ? -20.148  2.761   -10.966 1.00 79.77  ? 914  LEU A HD11 1 
ATOM   5105  H  HD12 . LEU A 1 353 ? -20.784  1.388   -10.482 1.00 79.77  ? 914  LEU A HD12 1 
ATOM   5106  H  HD13 . LEU A 1 353 ? -19.783  2.178   -9.534  1.00 79.77  ? 914  LEU A HD13 1 
ATOM   5107  H  HD21 . LEU A 1 353 ? -17.793  2.886   -11.605 1.00 97.51  ? 914  LEU A HD21 1 
ATOM   5108  H  HD22 . LEU A 1 353 ? -17.335  2.314   -10.195 1.00 97.51  ? 914  LEU A HD22 1 
ATOM   5109  H  HD23 . LEU A 1 353 ? -16.868  1.596   -11.533 1.00 97.51  ? 914  LEU A HD23 1 
ATOM   5110  N  N    . PRO A 1 354 ? -16.305  -1.772  -8.914  1.00 60.64  ? 915  PRO A N    1 
ATOM   5111  C  CA   . PRO A 1 354 ? -15.998  -2.696  -7.815  1.00 55.18  ? 915  PRO A CA   1 
ATOM   5112  C  C    . PRO A 1 354 ? -17.247  -3.056  -7.025  1.00 65.33  ? 915  PRO A C    1 
ATOM   5113  O  O    . PRO A 1 354 ? -18.239  -2.325  -7.006  1.00 74.83  ? 915  PRO A O    1 
ATOM   5114  C  CB   . PRO A 1 354 ? -15.003  -1.911  -6.952  1.00 52.64  ? 915  PRO A CB   1 
ATOM   5115  C  CG   . PRO A 1 354 ? -14.420  -0.895  -7.867  1.00 51.95  ? 915  PRO A CG   1 
ATOM   5116  C  CD   . PRO A 1 354 ? -15.502  -0.540  -8.836  1.00 60.26  ? 915  PRO A CD   1 
ATOM   5117  H  HA   . PRO A 1 354 ? -15.576  -3.502  -8.151  1.00 66.22  ? 915  PRO A HA   1 
ATOM   5118  H  HB2  . PRO A 1 354 ? -15.472  -1.484  -6.218  1.00 63.17  ? 915  PRO A HB2  1 
ATOM   5119  H  HB3  . PRO A 1 354 ? -14.315  -2.509  -6.619  1.00 63.17  ? 915  PRO A HB3  1 
ATOM   5120  H  HG2  . PRO A 1 354 ? -14.152  -0.115  -7.356  1.00 62.34  ? 915  PRO A HG2  1 
ATOM   5121  H  HG3  . PRO A 1 354 ? -13.659  -1.276  -8.331  1.00 62.34  ? 915  PRO A HG3  1 
ATOM   5122  H  HD2  . PRO A 1 354 ? -16.037  0.192   -8.492  1.00 72.31  ? 915  PRO A HD2  1 
ATOM   5123  H  HD3  . PRO A 1 354 ? -15.123  -0.327  -9.703  1.00 72.31  ? 915  PRO A HD3  1 
ATOM   5124  N  N    . ALA A 1 355 ? -17.180  -4.207  -6.353  1.00 72.06  ? 916  ALA A N    1 
ATOM   5125  C  CA   . ALA A 1 355 ? -18.342  -4.712  -5.627  1.00 71.96  ? 916  ALA A CA   1 
ATOM   5126  C  C    . ALA A 1 355 ? -18.752  -3.764  -4.507  1.00 55.31  ? 916  ALA A C    1 
ATOM   5127  O  O    . ALA A 1 355 ? -19.944  -3.493  -4.322  1.00 61.29  ? 916  ALA A O    1 
ATOM   5128  C  CB   . ALA A 1 355 ? -18.050  -6.107  -5.070  1.00 53.22  ? 916  ALA A CB   1 
ATOM   5129  H  H    . ALA A 1 355 ? -16.483  -4.708  -6.303  1.00 86.48  ? 916  ALA A H    1 
ATOM   5130  H  HA   . ALA A 1 355 ? -19.088  -4.786  -6.242  1.00 86.36  ? 916  ALA A HA   1 
ATOM   5131  H  HB1  . ALA A 1 355 ? -18.831  -6.425  -4.592  1.00 63.86  ? 916  ALA A HB1  1 
ATOM   5132  H  HB2  . ALA A 1 355 ? -17.846  -6.704  -5.807  1.00 63.86  ? 916  ALA A HB2  1 
ATOM   5133  H  HB3  . ALA A 1 355 ? -17.292  -6.053  -4.468  1.00 63.86  ? 916  ALA A HB3  1 
ATOM   5134  N  N    . GLU A 1 356 ? -17.781  -3.247  -3.748  1.00 49.08  ? 917  GLU A N    1 
ATOM   5135  C  CA   . GLU A 1 356 ? -18.104  -2.343  -2.649  1.00 56.95  ? 917  GLU A CA   1 
ATOM   5136  C  C    . GLU A 1 356 ? -18.727  -1.044  -3.143  1.00 64.52  ? 917  GLU A C    1 
ATOM   5137  O  O    . GLU A 1 356 ? -19.452  -0.390  -2.384  1.00 45.21  ? 917  GLU A O    1 
ATOM   5138  C  CB   . GLU A 1 356 ? -16.854  -2.038  -1.818  1.00 57.08  ? 917  GLU A CB   1 
ATOM   5139  C  CG   . GLU A 1 356 ? -15.834  -1.122  -2.493  1.00 74.57  ? 917  GLU A CG   1 
ATOM   5140  C  CD   . GLU A 1 356 ? -14.765  -0.633  -1.531  1.00 87.21  ? 917  GLU A CD   1 
ATOM   5141  O  OE1  . GLU A 1 356 ? -14.598  -1.252  -0.457  1.00 80.41  ? 917  GLU A OE1  1 
ATOM   5142  O  OE2  . GLU A 1 356 ? -14.097  0.378   -1.846  1.00 78.18  ? 917  GLU A OE2  1 
ATOM   5143  H  H    . GLU A 1 356 ? -16.942  -3.403  -3.849  1.00 58.89  ? 917  GLU A H    1 
ATOM   5144  H  HA   . GLU A 1 356 ? -18.748  -2.777  -2.067  1.00 68.34  ? 917  GLU A HA   1 
ATOM   5145  H  HB2  . GLU A 1 356 ? -17.129  -1.611  -0.992  1.00 68.49  ? 917  GLU A HB2  1 
ATOM   5146  H  HB3  . GLU A 1 356 ? -16.406  -2.875  -1.616  1.00 68.49  ? 917  GLU A HB3  1 
ATOM   5147  H  HG2  . GLU A 1 356 ? -15.396  -1.609  -3.208  1.00 89.49  ? 917  GLU A HG2  1 
ATOM   5148  H  HG3  . GLU A 1 356 ? -16.294  -0.347  -2.852  1.00 89.49  ? 917  GLU A HG3  1 
ATOM   5149  N  N    . VAL A 1 357 ? -18.460  -0.658  -4.391  1.00 55.05  ? 918  VAL A N    1 
ATOM   5150  C  CA   . VAL A 1 357 ? -19.074  0.538   -4.958  1.00 58.73  ? 918  VAL A CA   1 
ATOM   5151  C  C    . VAL A 1 357 ? -20.526  0.263   -5.334  1.00 58.85  ? 918  VAL A C    1 
ATOM   5152  O  O    . VAL A 1 357 ? -21.419  1.068   -5.045  1.00 65.96  ? 918  VAL A O    1 
ATOM   5153  C  CB   . VAL A 1 357 ? -18.259  1.035   -6.169  1.00 63.19  ? 918  VAL A CB   1 
ATOM   5154  C  CG1  . VAL A 1 357 ? -18.906  2.268   -6.791  1.00 54.33  ? 918  VAL A CG1  1 
ATOM   5155  C  CG2  . VAL A 1 357 ? -16.829  1.348   -5.759  1.00 58.56  ? 918  VAL A CG2  1 
ATOM   5156  H  H    . VAL A 1 357 ? -17.929  -1.071  -4.927  1.00 66.06  ? 918  VAL A H    1 
ATOM   5157  H  HA   . VAL A 1 357 ? -19.069  1.240   -4.288  1.00 70.48  ? 918  VAL A HA   1 
ATOM   5158  H  HB   . VAL A 1 357 ? -18.233  0.336   -6.842  1.00 75.82  ? 918  VAL A HB   1 
ATOM   5159  H  HG11 . VAL A 1 357 ? -18.373  2.556   -7.548  1.00 65.19  ? 918  VAL A HG11 1 
ATOM   5160  H  HG12 . VAL A 1 357 ? -19.802  2.039   -7.085  1.00 65.19  ? 918  VAL A HG12 1 
ATOM   5161  H  HG13 . VAL A 1 357 ? -18.946  2.973   -6.126  1.00 65.19  ? 918  VAL A HG13 1 
ATOM   5162  H  HG21 . VAL A 1 357 ? -16.339  1.657   -6.537  1.00 70.28  ? 918  VAL A HG21 1 
ATOM   5163  H  HG22 . VAL A 1 357 ? -16.841  2.039   -5.078  1.00 70.28  ? 918  VAL A HG22 1 
ATOM   5164  H  HG23 . VAL A 1 357 ? -16.418  0.543   -5.407  1.00 70.28  ? 918  VAL A HG23 1 
ATOM   5165  N  N    . ARG A 1 358 ? -20.785  -0.876  -5.984  1.00 66.40  ? 919  ARG A N    1 
ATOM   5166  C  CA   . ARG A 1 358 ? -22.158  -1.219  -6.342  1.00 55.90  ? 919  ARG A CA   1 
ATOM   5167  C  C    . ARG A 1 358 ? -23.029  -1.408  -5.109  1.00 57.09  ? 919  ARG A C    1 
ATOM   5168  O  O    . ARG A 1 358 ? -24.237  -1.152  -5.161  1.00 64.82  ? 919  ARG A O    1 
ATOM   5169  C  CB   . ARG A 1 358 ? -22.189  -2.482  -7.199  1.00 59.34  ? 919  ARG A CB   1 
ATOM   5170  C  CG   . ARG A 1 358 ? -21.605  -2.307  -8.587  1.00 71.48  ? 919  ARG A CG   1 
ATOM   5171  C  CD   . ARG A 1 358 ? -22.053  -3.430  -9.516  1.00 84.09  ? 919  ARG A CD   1 
ATOM   5172  N  NE   . ARG A 1 358 ? -21.814  -4.750  -8.940  1.00 72.61  ? 919  ARG A NE   1 
ATOM   5173  C  CZ   . ARG A 1 358 ? -20.657  -5.402  -9.003  1.00 74.31  ? 919  ARG A CZ   1 
ATOM   5174  N  NH1  . ARG A 1 358 ? -19.610  -4.862  -9.616  1.00 79.08  ? 919  ARG A NH1  1 
ATOM   5175  N  NH2  . ARG A 1 358 ? -20.544  -6.599  -8.445  1.00 65.87  ? 919  ARG A NH2  1 
ATOM   5176  H  H    . ARG A 1 358 ? -20.195  -1.454  -6.223  1.00 79.68  ? 919  ARG A H    1 
ATOM   5177  H  HA   . ARG A 1 358 ? -22.536  -0.494  -6.865  1.00 67.08  ? 919  ARG A HA   1 
ATOM   5178  H  HB2  . ARG A 1 358 ? -21.681  -3.175  -6.751  1.00 71.21  ? 919  ARG A HB2  1 
ATOM   5179  H  HB3  . ARG A 1 358 ? -23.111  -2.766  -7.301  1.00 71.21  ? 919  ARG A HB3  1 
ATOM   5180  H  HG2  . ARG A 1 358 ? -21.907  -1.463  -8.959  1.00 85.77  ? 919  ARG A HG2  1 
ATOM   5181  H  HG3  . ARG A 1 358 ? -20.637  -2.323  -8.533  1.00 85.77  ? 919  ARG A HG3  1 
ATOM   5182  H  HD2  . ARG A 1 358 ? -23.004  -3.342  -9.686  1.00 100.91 ? 919  ARG A HD2  1 
ATOM   5183  H  HD3  . ARG A 1 358 ? -21.559  -3.370  -10.349 1.00 100.91 ? 919  ARG A HD3  1 
ATOM   5184  H  HE   . ARG A 1 358 ? -22.467  -5.133  -8.532  1.00 87.14  ? 919  ARG A HE   1 
ATOM   5185  H  HH11 . ARG A 1 358 ? -19.678  -4.085  -9.979  1.00 94.90  ? 919  ARG A HH11 1 
ATOM   5186  H  HH12 . ARG A 1 358 ? -18.865  -5.289  -9.652  1.00 94.90  ? 919  ARG A HH12 1 
ATOM   5187  H  HH21 . ARG A 1 358 ? -21.219  -6.953  -8.046  1.00 79.05  ? 919  ARG A HH21 1 
ATOM   5188  H  HH22 . ARG A 1 358 ? -19.797  -7.022  -8.483  1.00 79.05  ? 919  ARG A HH22 1 
ATOM   5189  N  N    . GLU A 1 359 ? -22.444  -1.844  -3.991  1.00 50.67  ? 920  GLU A N    1 
ATOM   5190  C  CA   . GLU A 1 359 ? -23.230  -2.005  -2.773  1.00 54.03  ? 920  GLU A CA   1 
ATOM   5191  C  C    . GLU A 1 359 ? -23.737  -0.664  -2.259  1.00 50.45  ? 920  GLU A C    1 
ATOM   5192  O  O    . GLU A 1 359 ? -24.883  -0.564  -1.804  1.00 62.15  ? 920  GLU A O    1 
ATOM   5193  C  CB   . GLU A 1 359 ? -22.411  -2.713  -1.697  1.00 50.80  ? 920  GLU A CB   1 
ATOM   5194  C  CG   . GLU A 1 359 ? -22.222  -4.203  -1.948  1.00 69.27  ? 920  GLU A CG   1 
ATOM   5195  C  CD   . GLU A 1 359 ? -22.038  -5.012  -0.670  1.00 71.77  ? 920  GLU A CD   1 
ATOM   5196  O  OE1  . GLU A 1 359 ? -22.646  -4.658  0.363   1.00 69.98  ? 920  GLU A OE1  1 
ATOM   5197  O  OE2  . GLU A 1 359 ? -21.284  -6.008  -0.699  1.00 72.12  ? 920  GLU A OE2  1 
ATOM   5198  H  H    . GLU A 1 359 ? -21.612  -2.048  -3.914  1.00 60.81  ? 920  GLU A H    1 
ATOM   5199  H  HA   . GLU A 1 359 ? -24.002  -2.559  -2.970  1.00 64.84  ? 920  GLU A HA   1 
ATOM   5200  H  HB2  . GLU A 1 359 ? -21.531  -2.305  -1.656  1.00 60.96  ? 920  GLU A HB2  1 
ATOM   5201  H  HB3  . GLU A 1 359 ? -22.860  -2.610  -0.844  1.00 60.96  ? 920  GLU A HB3  1 
ATOM   5202  H  HG2  . GLU A 1 359 ? -23.005  -4.546  -2.407  1.00 83.12  ? 920  GLU A HG2  1 
ATOM   5203  H  HG3  . GLU A 1 359 ? -21.434  -4.332  -2.498  1.00 83.12  ? 920  GLU A HG3  1 
ATOM   5204  N  N    . THR A 1 360 ? -22.901  0.380   -2.318  1.00 55.18  ? 921  THR A N    1 
ATOM   5205  C  CA   . THR A 1 360 ? -23.341  1.699   -1.870  1.00 54.04  ? 921  THR A CA   1 
ATOM   5206  C  C    . THR A 1 360 ? -24.464  2.236   -2.747  1.00 35.64  ? 921  THR A C    1 
ATOM   5207  O  O    . THR A 1 360 ? -25.381  2.902   -2.248  1.00 51.14  ? 921  THR A O    1 
ATOM   5208  C  CB   . THR A 1 360 ? -22.173  2.689   -1.849  1.00 53.61  ? 921  THR A CB   1 
ATOM   5209  O  OG1  . THR A 1 360 ? -21.447  2.617   -3.080  1.00 66.03  ? 921  THR A OG1  1 
ATOM   5210  C  CG2  . THR A 1 360 ? -21.247  2.390   -0.703  1.00 56.64  ? 921  THR A CG2  1 
ATOM   5211  H  H    . THR A 1 360 ? -22.092  0.349   -2.608  1.00 66.21  ? 921  THR A H    1 
ATOM   5212  H  HA   . THR A 1 360 ? -23.683  1.624   -0.965  1.00 64.84  ? 921  THR A HA   1 
ATOM   5213  H  HB   . THR A 1 360 ? -22.518  3.588   -1.733  1.00 64.34  ? 921  THR A HB   1 
ATOM   5214  H  HG1  . THR A 1 360 ? -21.952  2.807   -3.723  1.00 79.23  ? 921  THR A HG1  1 
ATOM   5215  H  HG21 . THR A 1 360 ? -20.511  3.022   -0.699  1.00 67.97  ? 921  THR A HG21 1 
ATOM   5216  H  HG22 . THR A 1 360 ? -21.727  2.459   0.137   1.00 67.97  ? 921  THR A HG22 1 
ATOM   5217  H  HG23 . THR A 1 360 ? -20.892  1.492   -0.790  1.00 67.97  ? 921  THR A HG23 1 
ATOM   5218  N  N    . LEU A 1 361 ? -24.414  1.950   -4.052  1.00 48.21  ? 922  LEU A N    1 
ATOM   5219  C  CA   . LEU A 1 361 ? -25.452  2.422   -4.956  1.00 67.58  ? 922  LEU A CA   1 
ATOM   5220  C  C    . LEU A 1 361 ? -26.537  1.368   -5.173  1.00 69.25  ? 922  LEU A C    1 
ATOM   5221  O  O    . LEU A 1 361 ? -27.626  1.472   -4.596  1.00 79.24  ? 922  LEU A O    1 
ATOM   5222  C  CB   . LEU A 1 361 ? -24.813  2.817   -6.282  1.00 52.72  ? 922  LEU A CB   1 
ATOM   5223  C  CG   . LEU A 1 361 ? -23.600  3.754   -6.156  1.00 56.59  ? 922  LEU A CG   1 
ATOM   5224  C  CD1  . LEU A 1 361 ? -22.785  3.800   -7.441  1.00 51.68  ? 922  LEU A CD1  1 
ATOM   5225  C  CD2  . LEU A 1 361 ? -24.048  5.150   -5.763  1.00 51.68  ? 922  LEU A CD2  1 
ATOM   5226  H  H    . LEU A 1 361 ? -23.795  1.488   -4.431  1.00 57.85  ? 922  LEU A H    1 
ATOM   5227  H  HA   . LEU A 1 361 ? -25.870  3.211   -4.575  1.00 81.10  ? 922  LEU A HA   1 
ATOM   5228  H  HB2  . LEU A 1 361 ? -24.517  2.012   -6.734  1.00 63.27  ? 922  LEU A HB2  1 
ATOM   5229  H  HB3  . LEU A 1 361 ? -25.478  3.270   -6.823  1.00 63.27  ? 922  LEU A HB3  1 
ATOM   5230  H  HG   . LEU A 1 361 ? -23.021  3.421   -5.452  1.00 67.91  ? 922  LEU A HG   1 
ATOM   5231  H  HD11 . LEU A 1 361 ? -22.034  4.400   -7.316  1.00 62.02  ? 922  LEU A HD11 1 
ATOM   5232  H  HD12 . LEU A 1 361 ? -22.466  2.907   -7.644  1.00 62.02  ? 922  LEU A HD12 1 
ATOM   5233  H  HD13 . LEU A 1 361 ? -23.350  4.122   -8.161  1.00 62.02  ? 922  LEU A HD13 1 
ATOM   5234  H  HD21 . LEU A 1 361 ? -23.269  5.722   -5.690  1.00 62.01  ? 922  LEU A HD21 1 
ATOM   5235  H  HD22 . LEU A 1 361 ? -24.647  5.492   -6.445  1.00 62.01  ? 922  LEU A HD22 1 
ATOM   5236  H  HD23 . LEU A 1 361 ? -24.508  5.105   -4.910  1.00 62.01  ? 922  LEU A HD23 1 
ATOM   5237  N  N    . GLY A 1 362 ? -26.255  0.346   -5.981  1.00 86.83  ? 923  GLY A N    1 
ATOM   5238  C  CA   . GLY A 1 362 ? -27.102  -0.830  -6.071  1.00 52.64  ? 923  GLY A CA   1 
ATOM   5239  C  C    . GLY A 1 362 ? -28.469  -0.573  -6.677  1.00 55.13  ? 923  GLY A C    1 
ATOM   5240  O  O    . GLY A 1 362 ? -28.853  0.577   -6.896  1.00 95.01  ? 923  GLY A O    1 
ATOM   5241  H  H    . GLY A 1 362 ? -25.565  0.315   -6.494  1.00 104.20 ? 923  GLY A H    1 
ATOM   5242  H  HA2  . GLY A 1 362 ? -26.656  -1.501  -6.611  1.00 63.17  ? 923  GLY A HA2  1 
ATOM   5243  H  HA3  . GLY A 1 362 ? -27.231  -1.196  -5.182  1.00 63.17  ? 923  GLY A HA3  1 
ATOM   5244  N  N    . SER A 1 363 ? -29.205  -1.654  -6.946  1.00 76.81  ? 924  SER A N    1 
ATOM   5245  C  CA   . SER A 1 363 ? -30.640  -1.609  -7.254  1.00 79.72  ? 924  SER A CA   1 
ATOM   5246  C  C    . SER A 1 363 ? -30.970  -0.499  -8.250  1.00 83.20  ? 924  SER A C    1 
ATOM   5247  O  O    . SER A 1 363 ? -31.992  0.187   -8.144  1.00 120.66 ? 924  SER A O    1 
ATOM   5248  C  CB   . SER A 1 363 ? -31.451  -1.458  -5.968  1.00 86.49  ? 924  SER A CB   1 
ATOM   5249  O  OG   . SER A 1 363 ? -32.064  -2.671  -5.559  1.00 109.23 ? 924  SER A OG   1 
ATOM   5250  H  H    . SER A 1 363 ? -28.885  -2.452  -6.956  1.00 92.17  ? 924  SER A H    1 
ATOM   5251  H  HA   . SER A 1 363 ? -30.893  -2.452  -7.662  1.00 95.66  ? 924  SER A HA   1 
ATOM   5252  H  HB2  . SER A 1 363 ? -30.858  -1.158  -5.261  1.00 103.78 ? 924  SER A HB2  1 
ATOM   5253  H  HB3  . SER A 1 363 ? -32.144  -0.796  -6.115  1.00 103.78 ? 924  SER A HB3  1 
ATOM   5254  H  HG   . SER A 1 363 ? -32.499  -2.549  -4.851  1.00 131.07 ? 924  SER A HG   1 
ATOM   5255  N  N    . LEU A 1 364 ? -30.096  -0.325  -9.233  1.00 50.60  ? 925  LEU A N    1 
ATOM   5256  C  CA   . LEU A 1 364 ? -30.279  0.696   -10.253 1.00 48.17  ? 925  LEU A CA   1 
ATOM   5257  C  C    . LEU A 1 364 ? -31.617  0.507   -10.981 1.00 72.35  ? 925  LEU A C    1 
ATOM   5258  O  O    . LEU A 1 364 ? -32.102  -0.618  -11.107 1.00 92.33  ? 925  LEU A O    1 
ATOM   5259  C  CB   . LEU A 1 364 ? -29.112  0.641   -11.243 1.00 60.02  ? 925  LEU A CB   1 
ATOM   5260  C  CG   . LEU A 1 364 ? -28.983  1.712   -12.332 1.00 65.86  ? 925  LEU A CG   1 
ATOM   5261  C  CD1  . LEU A 1 364 ? -28.401  2.996   -11.783 1.00 63.15  ? 925  LEU A CD1  1 
ATOM   5262  C  CD2  . LEU A 1 364 ? -28.122  1.207   -13.467 1.00 57.32  ? 925  LEU A CD2  1 
ATOM   5263  H  H    . LEU A 1 364 ? -29.380  -0.792  -9.331  1.00 60.72  ? 925  LEU A H    1 
ATOM   5264  H  HA   . LEU A 1 364 ? -30.282  1.571   -9.834  1.00 57.80  ? 925  LEU A HA   1 
ATOM   5265  H  HB2  . LEU A 1 364 ? -28.291  0.673   -10.726 1.00 72.03  ? 925  LEU A HB2  1 
ATOM   5266  H  HB3  . LEU A 1 364 ? -29.158  -0.213  -11.701 1.00 72.03  ? 925  LEU A HB3  1 
ATOM   5267  H  HG   . LEU A 1 364 ? -29.863  1.910   -12.687 1.00 79.03  ? 925  LEU A HG   1 
ATOM   5268  H  HD11 . LEU A 1 364 ? -28.336  3.645   -12.500 1.00 75.78  ? 925  LEU A HD11 1 
ATOM   5269  H  HD12 . LEU A 1 364 ? -28.983  3.332   -11.083 1.00 75.78  ? 925  LEU A HD12 1 
ATOM   5270  H  HD13 . LEU A 1 364 ? -27.520  2.813   -11.421 1.00 75.78  ? 925  LEU A HD13 1 
ATOM   5271  H  HD21 . LEU A 1 364 ? -28.054  1.899   -14.143 1.00 68.78  ? 925  LEU A HD21 1 
ATOM   5272  H  HD22 . LEU A 1 364 ? -27.241  0.992   -13.123 1.00 68.78  ? 925  LEU A HD22 1 
ATOM   5273  H  HD23 . LEU A 1 364 ? -28.532  0.414   -13.845 1.00 68.78  ? 925  LEU A HD23 1 
ATOM   5274  N  N    . PRO A 1 365 ? -32.226  1.608   -11.451 1.00 61.05  ? 926  PRO A N    1 
ATOM   5275  C  CA   . PRO A 1 365 ? -31.974  3.022   -11.159 1.00 62.49  ? 926  PRO A CA   1 
ATOM   5276  C  C    . PRO A 1 365 ? -32.475  3.501   -9.788  1.00 43.98  ? 926  PRO A C    1 
ATOM   5277  O  O    . PRO A 1 365 ? -32.003  4.533   -9.312  1.00 51.95  ? 926  PRO A O    1 
ATOM   5278  C  CB   . PRO A 1 365 ? -32.710  3.733   -12.292 1.00 44.10  ? 926  PRO A CB   1 
ATOM   5279  C  CG   . PRO A 1 365 ? -33.878  2.878   -12.562 1.00 46.99  ? 926  PRO A CG   1 
ATOM   5280  C  CD   . PRO A 1 365 ? -33.500  1.450   -12.171 1.00 49.22  ? 926  PRO A CD   1 
ATOM   5281  H  HA   . PRO A 1 365 ? -31.026  3.212   -11.232 1.00 74.99  ? 926  PRO A HA   1 
ATOM   5282  H  HB2  . PRO A 1 365 ? -32.988  4.615   -12.001 1.00 52.92  ? 926  PRO A HB2  1 
ATOM   5283  H  HB3  . PRO A 1 365 ? -32.136  3.790   -13.072 1.00 52.92  ? 926  PRO A HB3  1 
ATOM   5284  H  HG2  . PRO A 1 365 ? -34.629  3.184   -12.029 1.00 56.38  ? 926  PRO A HG2  1 
ATOM   5285  H  HG3  . PRO A 1 365 ? -34.095  2.922   -13.506 1.00 56.38  ? 926  PRO A HG3  1 
ATOM   5286  H  HD2  . PRO A 1 365 ? -34.174  1.071   -11.585 1.00 59.06  ? 926  PRO A HD2  1 
ATOM   5287  H  HD3  . PRO A 1 365 ? -33.373  0.906   -12.964 1.00 59.06  ? 926  PRO A HD3  1 
ATOM   5288  N  N    . ASP A 1 366 ? -33.426  2.777   -9.189  1.00 51.27  ? 927  ASP A N    1 
ATOM   5289  C  CA   . ASP A 1 366 ? -34.176  3.310   -8.053  1.00 53.86  ? 927  ASP A CA   1 
ATOM   5290  C  C    . ASP A 1 366 ? -33.249  3.708   -6.911  1.00 40.83  ? 927  ASP A C    1 
ATOM   5291  O  O    . ASP A 1 366 ? -33.214  4.872   -6.494  1.00 37.93  ? 927  ASP A O    1 
ATOM   5292  C  CB   . ASP A 1 366 ? -35.206  2.278   -7.577  1.00 29.04  ? 927  ASP A CB   1 
ATOM   5293  C  CG   . ASP A 1 366 ? -36.239  1.941   -8.643  1.00 40.53  ? 927  ASP A CG   1 
ATOM   5294  O  OD1  . ASP A 1 366 ? -36.043  2.330   -9.813  1.00 41.52  ? 927  ASP A OD1  1 
ATOM   5295  O  OD2  . ASP A 1 366 ? -37.251  1.286   -8.304  1.00 44.86  ? 927  ASP A OD2  1 
ATOM   5296  H  H    . ASP A 1 366 ? -33.652  1.981   -9.420  1.00 61.52  ? 927  ASP A H    1 
ATOM   5297  H  HA   . ASP A 1 366 ? -34.657  4.103   -8.338  1.00 64.63  ? 927  ASP A HA   1 
ATOM   5298  H  HB2  . ASP A 1 366 ? -34.746  1.459   -7.337  1.00 34.85  ? 927  ASP A HB2  1 
ATOM   5299  H  HB3  . ASP A 1 366 ? -35.676  2.633   -6.806  1.00 34.85  ? 927  ASP A HB3  1 
ATOM   5300  N  N    . ASP A 1 367 ? -32.469  2.754   -6.403  1.00 43.65  ? 928  ASP A N    1 
ATOM   5301  C  CA   . ASP A 1 367 ? -31.628  3.040   -5.246  1.00 47.35  ? 928  ASP A CA   1 
ATOM   5302  C  C    . ASP A 1 367 ? -30.441  3.916   -5.627  1.00 53.35  ? 928  ASP A C    1 
ATOM   5303  O  O    . ASP A 1 367 ? -29.954  4.699   -4.802  1.00 35.30  ? 928  ASP A O    1 
ATOM   5304  C  CB   . ASP A 1 367 ? -31.159  1.726   -4.618  1.00 54.53  ? 928  ASP A CB   1 
ATOM   5305  C  CG   . ASP A 1 367 ? -32.271  1.009   -3.822  1.00 48.06  ? 928  ASP A CG   1 
ATOM   5306  O  OD1  . ASP A 1 367 ? -33.227  1.668   -3.365  1.00 72.02  ? 928  ASP A OD1  1 
ATOM   5307  O  OD2  . ASP A 1 367 ? -32.199  -0.218  -3.643  1.00 71.96  ? 928  ASP A OD2  1 
ATOM   5308  H  H    . ASP A 1 367 ? -32.410  1.950   -6.703  1.00 52.38  ? 928  ASP A H    1 
ATOM   5309  H  HA   . ASP A 1 367 ? -32.153  3.518   -4.585  1.00 56.82  ? 928  ASP A HA   1 
ATOM   5310  H  HB2  . ASP A 1 367 ? -30.862  1.128   -5.322  1.00 65.44  ? 928  ASP A HB2  1 
ATOM   5311  H  HB3  . ASP A 1 367 ? -30.426  1.911   -4.010  1.00 65.44  ? 928  ASP A HB3  1 
ATOM   5312  N  N    . PHE A 1 368 ? -29.980  3.815   -6.874  1.00 46.42  ? 929  PHE A N    1 
ATOM   5313  C  CA   . PHE A 1 368 ? -28.908  4.680   -7.348  1.00 39.34  ? 929  PHE A CA   1 
ATOM   5314  C  C    . PHE A 1 368 ? -29.328  6.144   -7.308  1.00 46.05  ? 929  PHE A C    1 
ATOM   5315  O  O    . PHE A 1 368 ? -28.584  6.999   -6.816  1.00 41.29  ? 929  PHE A O    1 
ATOM   5316  C  CB   . PHE A 1 368 ? -28.518  4.266   -8.764  1.00 43.52  ? 929  PHE A CB   1 
ATOM   5317  C  CG   . PHE A 1 368 ? -27.337  5.008   -9.323  1.00 42.14  ? 929  PHE A CG   1 
ATOM   5318  C  CD1  . PHE A 1 368 ? -27.471  6.305   -9.788  1.00 48.22  ? 929  PHE A CD1  1 
ATOM   5319  C  CD2  . PHE A 1 368 ? -26.101  4.396   -9.416  1.00 55.80  ? 929  PHE A CD2  1 
ATOM   5320  C  CE1  . PHE A 1 368 ? -26.391  6.983   -10.314 1.00 47.10  ? 929  PHE A CE1  1 
ATOM   5321  C  CE2  . PHE A 1 368 ? -25.019  5.068   -9.943  1.00 55.68  ? 929  PHE A CE2  1 
ATOM   5322  C  CZ   . PHE A 1 368 ? -25.164  6.366   -10.391 1.00 56.11  ? 929  PHE A CZ   1 
ATOM   5323  H  H    . PHE A 1 368 ? -30.271  3.257   -7.460  1.00 55.71  ? 929  PHE A H    1 
ATOM   5324  H  HA   . PHE A 1 368 ? -28.133  4.571   -6.776  1.00 47.21  ? 929  PHE A HA   1 
ATOM   5325  H  HB2  . PHE A 1 368 ? -28.298  3.321   -8.762  1.00 52.22  ? 929  PHE A HB2  1 
ATOM   5326  H  HB3  . PHE A 1 368 ? -29.271  4.426   -9.353  1.00 52.22  ? 929  PHE A HB3  1 
ATOM   5327  H  HD1  . PHE A 1 368 ? -28.297  6.728   -9.736  1.00 57.86  ? 929  PHE A HD1  1 
ATOM   5328  H  HD2  . PHE A 1 368 ? -25.997  3.522   -9.114  1.00 66.96  ? 929  PHE A HD2  1 
ATOM   5329  H  HE1  . PHE A 1 368 ? -26.492  7.856   -10.616 1.00 56.52  ? 929  PHE A HE1  1 
ATOM   5330  H  HE2  . PHE A 1 368 ? -24.191  4.648   -9.993  1.00 66.82  ? 929  PHE A HE2  1 
ATOM   5331  H  HZ   . PHE A 1 368 ? -24.434  6.821   -10.746 1.00 67.34  ? 929  PHE A HZ   1 
ATOM   5332  N  N    . VAL A 1 369 ? -30.516  6.458   -7.826  1.00 39.35  ? 930  VAL A N    1 
ATOM   5333  C  CA   . VAL A 1 369 ? -30.925  7.859   -7.877  1.00 42.70  ? 930  VAL A CA   1 
ATOM   5334  C  C    . VAL A 1 369 ? -31.345  8.361   -6.497  1.00 41.89  ? 930  VAL A C    1 
ATOM   5335  O  O    . VAL A 1 369 ? -31.148  9.539   -6.180  1.00 41.94  ? 930  VAL A O    1 
ATOM   5336  C  CB   . VAL A 1 369 ? -32.044  8.056   -8.913  1.00 37.38  ? 930  VAL A CB   1 
ATOM   5337  C  CG1  . VAL A 1 369 ? -33.375  7.550   -8.389  1.00 42.74  ? 930  VAL A CG1  1 
ATOM   5338  C  CG2  . VAL A 1 369 ? -32.145  9.529   -9.320  1.00 38.93  ? 930  VAL A CG2  1 
ATOM   5339  H  H    . VAL A 1 369 ? -31.087  5.898   -8.144  1.00 47.22  ? 930  VAL A H    1 
ATOM   5340  H  HA   . VAL A 1 369 ? -30.166  8.391   -8.162  1.00 51.24  ? 930  VAL A HA   1 
ATOM   5341  H  HB   . VAL A 1 369 ? -31.826  7.544   -9.708  1.00 44.86  ? 930  VAL A HB   1 
ATOM   5342  H  HG11 . VAL A 1 369 ? -34.055  7.691   -9.067  1.00 51.29  ? 930  VAL A HG11 1 
ATOM   5343  H  HG12 . VAL A 1 369 ? -33.297  6.604   -8.189  1.00 51.29  ? 930  VAL A HG12 1 
ATOM   5344  H  HG13 . VAL A 1 369 ? -33.604  8.041   -7.584  1.00 51.29  ? 930  VAL A HG13 1 
ATOM   5345  H  HG21 . VAL A 1 369 ? -32.856  9.627   -9.973  1.00 46.72  ? 930  VAL A HG21 1 
ATOM   5346  H  HG22 . VAL A 1 369 ? -32.342  10.060  -8.533  1.00 46.72  ? 930  VAL A HG22 1 
ATOM   5347  H  HG23 . VAL A 1 369 ? -31.300  9.808   -9.706  1.00 46.72  ? 930  VAL A HG23 1 
ATOM   5348  N  N    . CYS A 1 370 ? -31.924  7.496   -5.659  1.00 34.12  ? 931  CYS A N    1 
ATOM   5349  C  CA   . CYS A 1 370 ? -32.258  7.897   -4.295  1.00 36.57  ? 931  CYS A CA   1 
ATOM   5350  C  C    . CYS A 1 370 ? -31.005  8.174   -3.477  1.00 39.32  ? 931  CYS A C    1 
ATOM   5351  O  O    . CYS A 1 370 ? -31.032  9.002   -2.556  1.00 27.32  ? 931  CYS A O    1 
ATOM   5352  C  CB   . CYS A 1 370 ? -33.110  6.818   -3.626  1.00 51.16  ? 931  CYS A CB   1 
ATOM   5353  S  SG   . CYS A 1 370 ? -34.802  6.731   -4.264  1.00 50.73  ? 931  CYS A SG   1 
ATOM   5354  H  H    . CYS A 1 370 ? -32.131  6.684   -5.854  1.00 40.95  ? 931  CYS A H    1 
ATOM   5355  H  HA   . CYS A 1 370 ? -32.780  8.714   -4.326  1.00 43.89  ? 931  CYS A HA   1 
ATOM   5356  H  HB2  . CYS A 1 370 ? -32.693  5.955   -3.771  1.00 61.39  ? 931  CYS A HB2  1 
ATOM   5357  H  HB3  . CYS A 1 370 ? -33.161  7.004   -2.675  1.00 61.39  ? 931  CYS A HB3  1 
ATOM   5358  H  HG   . CYS A 1 370 ? -35.394  5.863   -3.685  1.00 60.87  ? 931  CYS A HG   1 
ATOM   5359  N  N    . TYR A 1 371 ? -29.904  7.497   -3.804  1.00 46.74  ? 932  TYR A N    1 
ATOM   5360  C  CA   . TYR A 1 371 ? -28.641  7.734   -3.118  1.00 36.88  ? 932  TYR A CA   1 
ATOM   5361  C  C    . TYR A 1 371 ? -28.244  9.206   -3.194  1.00 46.47  ? 932  TYR A C    1 
ATOM   5362  O  O    . TYR A 1 371 ? -27.875  9.820   -2.185  1.00 39.27  ? 932  TYR A O    1 
ATOM   5363  C  CB   . TYR A 1 371 ? -27.571  6.834   -3.740  1.00 48.76  ? 932  TYR A CB   1 
ATOM   5364  C  CG   . TYR A 1 371 ? -26.148  7.094   -3.307  1.00 58.92  ? 932  TYR A CG   1 
ATOM   5365  C  CD1  . TYR A 1 371 ? -25.456  8.207   -3.760  1.00 42.44  ? 932  TYR A CD1  1 
ATOM   5366  C  CD2  . TYR A 1 371 ? -25.479  6.200   -2.483  1.00 55.39  ? 932  TYR A CD2  1 
ATOM   5367  C  CE1  . TYR A 1 371 ? -24.164  8.441   -3.384  1.00 46.05  ? 932  TYR A CE1  1 
ATOM   5368  C  CE2  . TYR A 1 371 ? -24.175  6.427   -2.100  1.00 59.53  ? 932  TYR A CE2  1 
ATOM   5369  C  CZ   . TYR A 1 371 ? -23.526  7.548   -2.557  1.00 46.03  ? 932  TYR A CZ   1 
ATOM   5370  O  OH   . TYR A 1 371 ? -22.232  7.788   -2.188  1.00 60.77  ? 932  TYR A OH   1 
ATOM   5371  H  H    . TYR A 1 371 ? -29.865  6.897   -4.419  1.00 56.08  ? 932  TYR A H    1 
ATOM   5372  H  HA   . TYR A 1 371 ? -28.734  7.492   -2.183  1.00 44.25  ? 932  TYR A HA   1 
ATOM   5373  H  HB2  . TYR A 1 371 ? -27.778  5.914   -3.514  1.00 58.52  ? 932  TYR A HB2  1 
ATOM   5374  H  HB3  . TYR A 1 371 ? -27.603  6.944   -4.704  1.00 58.52  ? 932  TYR A HB3  1 
ATOM   5375  H  HD1  . TYR A 1 371 ? -25.885  8.815   -4.318  1.00 50.93  ? 932  TYR A HD1  1 
ATOM   5376  H  HD2  . TYR A 1 371 ? -25.922  5.442   -2.174  1.00 66.46  ? 932  TYR A HD2  1 
ATOM   5377  H  HE1  . TYR A 1 371 ? -23.717  9.197   -3.690  1.00 55.25  ? 932  TYR A HE1  1 
ATOM   5378  H  HE2  . TYR A 1 371 ? -23.738  5.826   -1.540  1.00 71.43  ? 932  TYR A HE2  1 
ATOM   5379  H  HH   . TYR A 1 371 ? -21.958  7.174   -1.685  1.00 72.92  ? 932  TYR A HH   1 
ATOM   5380  N  N    . PHE A 1 372 ? -28.295  9.782   -4.396  1.00 35.16  ? 933  PHE A N    1 
ATOM   5381  C  CA   . PHE A 1 372 ? -27.901  11.174  -4.584  1.00 35.08  ? 933  PHE A CA   1 
ATOM   5382  C  C    . PHE A 1 372 ? -29.010  12.152  -4.201  1.00 42.27  ? 933  PHE A C    1 
ATOM   5383  O  O    . PHE A 1 372 ? -28.730  13.188  -3.586  1.00 37.19  ? 933  PHE A O    1 
ATOM   5384  C  CB   . PHE A 1 372 ? -27.453  11.382  -6.027  1.00 36.46  ? 933  PHE A CB   1 
ATOM   5385  C  CG   . PHE A 1 372 ? -26.260  10.551  -6.396  1.00 43.07  ? 933  PHE A CG   1 
ATOM   5386  C  CD1  . PHE A 1 372 ? -24.983  10.999  -6.118  1.00 34.78  ? 933  PHE A CD1  1 
ATOM   5387  C  CD2  . PHE A 1 372 ? -26.416  9.306   -6.984  1.00 50.92  ? 933  PHE A CD2  1 
ATOM   5388  C  CE1  . PHE A 1 372 ? -23.880  10.232  -6.437  1.00 30.97  ? 933  PHE A CE1  1 
ATOM   5389  C  CE2  . PHE A 1 372 ? -25.312  8.530   -7.309  1.00 38.78  ? 933  PHE A CE2  1 
ATOM   5390  C  CZ   . PHE A 1 372 ? -24.046  8.995   -7.036  1.00 42.78  ? 933  PHE A CZ   1 
ATOM   5391  H  H    . PHE A 1 372 ? -28.553  9.388   -5.115  1.00 42.20  ? 933  PHE A H    1 
ATOM   5392  H  HA   . PHE A 1 372 ? -27.140  11.358  -4.012  1.00 42.09  ? 933  PHE A HA   1 
ATOM   5393  H  HB2  . PHE A 1 372 ? -28.181  11.140  -6.621  1.00 43.76  ? 933  PHE A HB2  1 
ATOM   5394  H  HB3  . PHE A 1 372 ? -27.218  12.314  -6.152  1.00 43.76  ? 933  PHE A HB3  1 
ATOM   5395  H  HD1  . PHE A 1 372 ? -24.865  11.829  -5.717  1.00 41.74  ? 933  PHE A HD1  1 
ATOM   5396  H  HD2  . PHE A 1 372 ? -27.270  8.989   -7.171  1.00 61.11  ? 933  PHE A HD2  1 
ATOM   5397  H  HE1  . PHE A 1 372 ? -23.025  10.547  -6.253  1.00 37.16  ? 933  PHE A HE1  1 
ATOM   5398  H  HE2  . PHE A 1 372 ? -25.428  7.700   -7.711  1.00 46.53  ? 933  PHE A HE2  1 
ATOM   5399  H  HZ   . PHE A 1 372 ? -23.304  8.479   -7.253  1.00 51.34  ? 933  PHE A HZ   1 
ATOM   5400  N  N    . THR A 1 373 ? -30.269  11.858  -4.551  1.00 36.72  ? 934  THR A N    1 
ATOM   5401  C  CA   . THR A 1 373 ? -31.346  12.794  -4.230  1.00 38.08  ? 934  THR A CA   1 
ATOM   5402  C  C    . THR A 1 373 ? -31.578  12.882  -2.729  1.00 37.06  ? 934  THR A C    1 
ATOM   5403  O  O    . THR A 1 373 ? -32.019  13.925  -2.232  1.00 30.86  ? 934  THR A O    1 
ATOM   5404  C  CB   . THR A 1 373 ? -32.651  12.403  -4.935  1.00 27.60  ? 934  THR A CB   1 
ATOM   5405  O  OG1  . THR A 1 373 ? -33.028  11.077  -4.559  1.00 48.19  ? 934  THR A OG1  1 
ATOM   5406  C  CG2  . THR A 1 373 ? -32.501  12.490  -6.451  1.00 29.72  ? 934  THR A CG2  1 
ATOM   5407  H  H    . THR A 1 373 ? -30.517  11.145  -4.963  1.00 44.07  ? 934  THR A H    1 
ATOM   5408  H  HA   . THR A 1 373 ? -31.095  13.677  -4.542  1.00 45.69  ? 934  THR A HA   1 
ATOM   5409  H  HB   . THR A 1 373 ? -33.352  13.018  -4.667  1.00 33.12  ? 934  THR A HB   1 
ATOM   5410  H  HG1  . THR A 1 373 ? -33.742  10.861  -4.945  1.00 57.83  ? 934  THR A HG1  1 
ATOM   5411  H  HG21 . THR A 1 373 ? -33.333  12.240  -6.882  1.00 35.66  ? 934  THR A HG21 1 
ATOM   5412  H  HG22 . THR A 1 373 ? -32.271  13.396  -6.710  1.00 35.66  ? 934  THR A HG22 1 
ATOM   5413  H  HG23 . THR A 1 373 ? -31.799  11.890  -6.749  1.00 35.66  ? 934  THR A HG23 1 
ATOM   5414  N  N    . SER A 1 374 ? -31.269  11.818  -1.985  1.00 30.36  ? 935  SER A N    1 
ATOM   5415  C  CA   . SER A 1 374 ? -31.437  11.884  -0.538  1.00 34.35  ? 935  SER A CA   1 
ATOM   5416  C  C    . SER A 1 374 ? -30.357  12.753  0.096   1.00 39.86  ? 935  SER A C    1 
ATOM   5417  O  O    . SER A 1 374 ? -30.631  13.491  1.048   1.00 48.47  ? 935  SER A O    1 
ATOM   5418  C  CB   . SER A 1 374 ? -31.428  10.478  0.058   1.00 37.17  ? 935  SER A CB   1 
ATOM   5419  O  OG   . SER A 1 374 ? -30.244  9.787   -0.294  1.00 45.74  ? 935  SER A OG   1 
ATOM   5420  H  H    . SER A 1 374 ? -30.969  11.070  -2.284  1.00 36.43  ? 935  SER A H    1 
ATOM   5421  H  HA   . SER A 1 374 ? -32.297  12.287  -0.340  1.00 41.22  ? 935  SER A HA   1 
ATOM   5422  H  HB2  . SER A 1 374 ? -31.479  10.544  1.025   1.00 44.60  ? 935  SER A HB2  1 
ATOM   5423  H  HB3  . SER A 1 374 ? -32.193  9.987   -0.281  1.00 44.60  ? 935  SER A HB3  1 
ATOM   5424  H  HG   . SER A 1 374 ? -30.251  9.016   0.039   1.00 54.89  ? 935  SER A HG   1 
ATOM   5425  N  N    . ARG A 1 375 ? -29.133  12.699  -0.433  1.00 37.61  ? 936  ARG A N    1 
ATOM   5426  C  CA   . ARG A 1 375 ? -28.023  13.495  0.078   1.00 39.41  ? 936  ARG A CA   1 
ATOM   5427  C  C    . ARG A 1 375 ? -27.926  14.875  -0.563  1.00 37.11  ? 936  ARG A C    1 
ATOM   5428  O  O    . ARG A 1 375 ? -27.140  15.704  -0.091  1.00 47.57  ? 936  ARG A O    1 
ATOM   5429  C  CB   . ARG A 1 375 ? -26.704  12.739  -0.129  1.00 41.26  ? 936  ARG A CB   1 
ATOM   5430  C  CG   . ARG A 1 375 ? -26.634  11.429  0.651   1.00 50.82  ? 936  ARG A CG   1 
ATOM   5431  C  CD   . ARG A 1 375 ? -25.568  10.490  0.114   1.00 47.08  ? 936  ARG A CD   1 
ATOM   5432  N  NE   . ARG A 1 375 ? -25.933  9.093   0.339   1.00 49.82  ? 936  ARG A NE   1 
ATOM   5433  C  CZ   . ARG A 1 375 ? -25.625  8.399   1.429   1.00 55.09  ? 936  ARG A CZ   1 
ATOM   5434  N  NH1  . ARG A 1 375 ? -24.932  8.956   2.416   1.00 72.85  ? 936  ARG A NH1  1 
ATOM   5435  N  NH2  . ARG A 1 375 ? -26.010  7.138   1.529   1.00 37.65  ? 936  ARG A NH2  1 
ATOM   5436  H  H    . ARG A 1 375 ? -28.920  12.199  -1.099  1.00 45.13  ? 936  ARG A H    1 
ATOM   5437  H  HA   . ARG A 1 375 ? -28.145  13.622  1.032   1.00 47.29  ? 936  ARG A HA   1 
ATOM   5438  H  HB2  . ARG A 1 375 ? -26.605  12.531  -1.071  1.00 49.51  ? 936  ARG A HB2  1 
ATOM   5439  H  HB3  . ARG A 1 375 ? -25.970  13.301  0.165   1.00 49.51  ? 936  ARG A HB3  1 
ATOM   5440  H  HG2  . ARG A 1 375 ? -26.426  11.623  1.578   1.00 60.98  ? 936  ARG A HG2  1 
ATOM   5441  H  HG3  . ARG A 1 375 ? -27.491  10.978  0.590   1.00 60.98  ? 936  ARG A HG3  1 
ATOM   5442  H  HD2  . ARG A 1 375 ? -25.468  10.629  -0.840  1.00 56.50  ? 936  ARG A HD2  1 
ATOM   5443  H  HD3  . ARG A 1 375 ? -24.729  10.663  0.570   1.00 56.50  ? 936  ARG A HD3  1 
ATOM   5444  H  HE   . ARG A 1 375 ? -26.378  8.692   -0.278  1.00 59.79  ? 936  ARG A HE   1 
ATOM   5445  H  HH11 . ARG A 1 375 ? -24.680  9.776   2.355   1.00 87.42  ? 936  ARG A HH11 1 
ATOM   5446  H  HH12 . ARG A 1 375 ? -24.737  8.497   3.116   1.00 87.42  ? 936  ARG A HH12 1 
ATOM   5447  H  HH21 . ARG A 1 375 ? -26.458  6.773   0.892   1.00 45.18  ? 936  ARG A HH21 1 
ATOM   5448  H  HH22 . ARG A 1 375 ? -25.812  6.683   2.231   1.00 45.18  ? 936  ARG A HH22 1 
ATOM   5449  N  N    . PHE A 1 376 ? -28.689  15.139  -1.621  1.00 45.36  ? 937  PHE A N    1 
ATOM   5450  C  CA   . PHE A 1 376 ? -28.693  16.439  -2.290  1.00 28.80  ? 937  PHE A CA   1 
ATOM   5451  C  C    . PHE A 1 376 ? -30.127  16.761  -2.681  1.00 39.20  ? 937  PHE A C    1 
ATOM   5452  O  O    . PHE A 1 376 ? -30.514  16.650  -3.851  1.00 41.70  ? 937  PHE A O    1 
ATOM   5453  C  CB   . PHE A 1 376 ? -27.766  16.437  -3.507  1.00 45.13  ? 937  PHE A CB   1 
ATOM   5454  C  CG   . PHE A 1 376 ? -26.363  15.984  -3.202  1.00 43.83  ? 937  PHE A CG   1 
ATOM   5455  C  CD1  . PHE A 1 376 ? -25.461  16.837  -2.591  1.00 52.92  ? 937  PHE A CD1  1 
ATOM   5456  C  CD2  . PHE A 1 376 ? -25.950  14.702  -3.526  1.00 44.66  ? 937  PHE A CD2  1 
ATOM   5457  C  CE1  . PHE A 1 376 ? -24.171  16.420  -2.309  1.00 54.09  ? 937  PHE A CE1  1 
ATOM   5458  C  CE2  . PHE A 1 376 ? -24.661  14.279  -3.248  1.00 51.99  ? 937  PHE A CE2  1 
ATOM   5459  C  CZ   . PHE A 1 376 ? -23.772  15.139  -2.639  1.00 56.38  ? 937  PHE A CZ   1 
ATOM   5460  H  H    . PHE A 1 376 ? -29.225  14.569  -1.977  1.00 54.43  ? 937  PHE A H    1 
ATOM   5461  H  HA   . PHE A 1 376 ? -28.385  17.120  -1.672  1.00 34.56  ? 937  PHE A HA   1 
ATOM   5462  H  HB2  . PHE A 1 376 ? -28.131  15.838  -4.177  1.00 54.15  ? 937  PHE A HB2  1 
ATOM   5463  H  HB3  . PHE A 1 376 ? -27.715  17.337  -3.863  1.00 54.15  ? 937  PHE A HB3  1 
ATOM   5464  H  HD1  . PHE A 1 376 ? -25.724  17.701  -2.367  1.00 63.50  ? 937  PHE A HD1  1 
ATOM   5465  H  HD2  . PHE A 1 376 ? -26.546  14.118  -3.937  1.00 53.59  ? 937  PHE A HD2  1 
ATOM   5466  H  HE1  . PHE A 1 376 ? -23.573  17.003  -1.899  1.00 64.91  ? 937  PHE A HE1  1 
ATOM   5467  H  HE2  . PHE A 1 376 ? -24.396  13.416  -3.471  1.00 62.38  ? 937  PHE A HE2  1 
ATOM   5468  H  HZ   . PHE A 1 376 ? -22.906  14.857  -2.451  1.00 67.65  ? 937  PHE A HZ   1 
ATOM   5469  N  N    . PRO A 1 377 ? -30.950  17.177  -1.715  1.00 36.01  ? 938  PRO A N    1 
ATOM   5470  C  CA   . PRO A 1 377 ? -32.393  17.314  -1.979  1.00 41.19  ? 938  PRO A CA   1 
ATOM   5471  C  C    . PRO A 1 377 ? -32.755  18.398  -2.979  1.00 46.34  ? 938  PRO A C    1 
ATOM   5472  O  O    . PRO A 1 377 ? -33.874  18.378  -3.512  1.00 35.89  ? 938  PRO A O    1 
ATOM   5473  C  CB   . PRO A 1 377 ? -32.964  17.633  -0.593  1.00 40.96  ? 938  PRO A CB   1 
ATOM   5474  C  CG   . PRO A 1 377 ? -31.793  18.186  0.177   1.00 38.37  ? 938  PRO A CG   1 
ATOM   5475  C  CD   . PRO A 1 377 ? -30.624  17.418  -0.300  1.00 34.29  ? 938  PRO A CD   1 
ATOM   5476  H  HA   . PRO A 1 377 ? -32.757  16.468  -2.284  1.00 49.43  ? 938  PRO A HA   1 
ATOM   5477  H  HB2  . PRO A 1 377 ? -33.669  18.295  -0.671  1.00 49.15  ? 938  PRO A HB2  1 
ATOM   5478  H  HB3  . PRO A 1 377 ? -33.296  16.821  -0.179  1.00 49.15  ? 938  PRO A HB3  1 
ATOM   5479  H  HG2  . PRO A 1 377 ? -31.687  19.130  -0.022  1.00 46.04  ? 938  PRO A HG2  1 
ATOM   5480  H  HG3  . PRO A 1 377 ? -31.930  18.048  1.127   1.00 46.04  ? 938  PRO A HG3  1 
ATOM   5481  H  HD2  . PRO A 1 377 ? -29.815  17.947  -0.223  1.00 41.15  ? 938  PRO A HD2  1 
ATOM   5482  H  HD3  . PRO A 1 377 ? -30.550  16.579  0.180   1.00 41.15  ? 938  PRO A HD3  1 
ATOM   5483  N  N    . HIS A 1 378 ? -31.871  19.361  -3.220  1.00 45.48  ? 939  HIS A N    1 
ATOM   5484  C  CA   . HIS A 1 378 ? -32.123  20.437  -4.168  1.00 30.22  ? 939  HIS A CA   1 
ATOM   5485  C  C    . HIS A 1 378 ? -31.517  20.186  -5.542  1.00 40.70  ? 939  HIS A C    1 
ATOM   5486  O  O    . HIS A 1 378 ? -31.660  21.035  -6.426  1.00 45.13  ? 939  HIS A O    1 
ATOM   5487  C  CB   . HIS A 1 378 ? -31.594  21.757  -3.602  1.00 26.61  ? 939  HIS A CB   1 
ATOM   5488  C  CG   . HIS A 1 378 ? -32.273  22.181  -2.338  1.00 36.52  ? 939  HIS A CG   1 
ATOM   5489  N  ND1  . HIS A 1 378 ? -33.389  22.989  -2.331  1.00 43.45  ? 939  HIS A ND1  1 
ATOM   5490  C  CD2  . HIS A 1 378 ? -32.003  21.901  -1.041  1.00 38.67  ? 939  HIS A CD2  1 
ATOM   5491  C  CE1  . HIS A 1 378 ? -33.777  23.190  -1.085  1.00 36.75  ? 939  HIS A CE1  1 
ATOM   5492  N  NE2  . HIS A 1 378 ? -32.952  22.542  -0.282  1.00 46.87  ? 939  HIS A NE2  1 
ATOM   5493  H  H    . HIS A 1 378 ? -31.102  19.413  -2.837  1.00 54.57  ? 939  HIS A H    1 
ATOM   5494  H  HA   . HIS A 1 378 ? -33.081  20.530  -4.283  1.00 36.27  ? 939  HIS A HA   1 
ATOM   5495  H  HB2  . HIS A 1 378 ? -30.647  21.660  -3.412  1.00 31.94  ? 939  HIS A HB2  1 
ATOM   5496  H  HB3  . HIS A 1 378 ? -31.728  22.457  -4.260  1.00 31.94  ? 939  HIS A HB3  1 
ATOM   5497  H  HD1  . HIS A 1 378 ? -33.775  23.311  -3.030  1.00 52.14  ? 939  HIS A HD1  1 
ATOM   5498  H  HD2  . HIS A 1 378 ? -31.306  21.374  -0.723  1.00 46.40  ? 939  HIS A HD2  1 
ATOM   5499  H  HE1  . HIS A 1 378 ? -34.505  23.704  -0.818  1.00 44.10  ? 939  HIS A HE1  1 
ATOM   5500  H  HE2  . HIS A 1 378 ? -33.001  22.525  0.577   1.00 56.24  ? 939  HIS A HE2  1 
ATOM   5501  N  N    . LEU A 1 379 ? -30.857  19.043  -5.749  1.00 38.16  ? 940  LEU A N    1 
ATOM   5502  C  CA   . LEU A 1 379 ? -30.135  18.815  -6.998  1.00 37.88  ? 940  LEU A CA   1 
ATOM   5503  C  C    . LEU A 1 379 ? -31.085  18.804  -8.191  1.00 40.27  ? 940  LEU A C    1 
ATOM   5504  O  O    . LEU A 1 379 ? -30.885  19.537  -9.168  1.00 37.80  ? 940  LEU A O    1 
ATOM   5505  C  CB   . LEU A 1 379 ? -29.348  17.502  -6.915  1.00 37.61  ? 940  LEU A CB   1 
ATOM   5506  C  CG   . LEU A 1 379 ? -28.457  17.157  -8.114  1.00 30.18  ? 940  LEU A CG   1 
ATOM   5507  C  CD1  . LEU A 1 379 ? -27.355  18.191  -8.308  1.00 41.64  ? 940  LEU A CD1  1 
ATOM   5508  C  CD2  . LEU A 1 379 ? -27.856  15.766  -7.955  1.00 33.46  ? 940  LEU A CD2  1 
ATOM   5509  H  H    . LEU A 1 379 ? -30.814  18.393  -5.188  1.00 45.79  ? 940  LEU A H    1 
ATOM   5510  H  HA   . LEU A 1 379 ? -29.500  19.536  -7.130  1.00 45.46  ? 940  LEU A HA   1 
ATOM   5511  H  HB2  . LEU A 1 379 ? -28.774  17.543  -6.134  1.00 45.13  ? 940  LEU A HB2  1 
ATOM   5512  H  HB3  . LEU A 1 379 ? -29.981  16.776  -6.810  1.00 45.13  ? 940  LEU A HB3  1 
ATOM   5513  H  HG   . LEU A 1 379 ? -29.003  17.154  -8.916  1.00 36.22  ? 940  LEU A HG   1 
ATOM   5514  H  HD11 . LEU A 1 379 ? -26.816  17.937  -9.073  1.00 49.97  ? 940  LEU A HD11 1 
ATOM   5515  H  HD12 . LEU A 1 379 ? -27.760  19.059  -8.461  1.00 49.97  ? 940  LEU A HD12 1 
ATOM   5516  H  HD13 . LEU A 1 379 ? -26.805  18.218  -7.509  1.00 49.97  ? 940  LEU A HD13 1 
ATOM   5517  H  HD21 . LEU A 1 379 ? -27.299  15.574  -8.725  1.00 40.15  ? 940  LEU A HD21 1 
ATOM   5518  H  HD22 . LEU A 1 379 ? -27.322  15.744  -7.146  1.00 40.15  ? 940  LEU A HD22 1 
ATOM   5519  H  HD23 . LEU A 1 379 ? -28.574  15.117  -7.895  1.00 40.15  ? 940  LEU A HD23 1 
ATOM   5520  N  N    . LEU A 1 380 ? -32.137  17.985  -8.124  1.00 39.03  ? 941  LEU A N    1 
ATOM   5521  C  CA   . LEU A 1 380 ? -33.057  17.869  -9.252  1.00 34.36  ? 941  LEU A CA   1 
ATOM   5522  C  C    . LEU A 1 380 ? -33.843  19.156  -9.470  1.00 36.30  ? 941  LEU A C    1 
ATOM   5523  O  O    . LEU A 1 380 ? -34.033  19.588  -10.614 1.00 35.71  ? 941  LEU A O    1 
ATOM   5524  C  CB   . LEU A 1 380 ? -34.014  16.695  -9.035  1.00 37.90  ? 941  LEU A CB   1 
ATOM   5525  C  CG   . LEU A 1 380 ? -35.110  16.538  -10.091 1.00 30.98  ? 941  LEU A CG   1 
ATOM   5526  C  CD1  . LEU A 1 380 ? -34.511  16.445  -11.493 1.00 55.86  ? 941  LEU A CD1  1 
ATOM   5527  C  CD2  . LEU A 1 380 ? -35.959  15.318  -9.793  1.00 43.23  ? 941  LEU A CD2  1 
ATOM   5528  H  H    . LEU A 1 380 ? -32.337  17.494  -7.446  1.00 46.84  ? 941  LEU A H    1 
ATOM   5529  H  HA   . LEU A 1 380 ? -32.546  17.692  -10.057 1.00 41.23  ? 941  LEU A HA   1 
ATOM   5530  H  HB2  . LEU A 1 380 ? -33.496  15.874  -9.029  1.00 45.49  ? 941  LEU A HB2  1 
ATOM   5531  H  HB3  . LEU A 1 380 ? -34.450  16.809  -8.176  1.00 45.49  ? 941  LEU A HB3  1 
ATOM   5532  H  HG   . LEU A 1 380 ? -35.688  17.317  -10.063 1.00 37.17  ? 941  LEU A HG   1 
ATOM   5533  H  HD11 . LEU A 1 380 ? -35.229  16.346  -12.137 1.00 67.03  ? 941  LEU A HD11 1 
ATOM   5534  H  HD12 . LEU A 1 380 ? -34.010  17.256  -11.676 1.00 67.03  ? 941  LEU A HD12 1 
ATOM   5535  H  HD13 . LEU A 1 380 ? -33.921  15.676  -11.534 1.00 67.03  ? 941  LEU A HD13 1 
ATOM   5536  H  HD21 . LEU A 1 380 ? -36.646  15.238  -10.473 1.00 51.88  ? 941  LEU A HD21 1 
ATOM   5537  H  HD22 . LEU A 1 380 ? -35.393  14.530  -9.800  1.00 51.88  ? 941  LEU A HD22 1 
ATOM   5538  H  HD23 . LEU A 1 380 ? -36.368  15.423  -8.919  1.00 51.88  ? 941  LEU A HD23 1 
ATOM   5539  N  N    . ALA A 1 381 ? -34.333  19.769  -8.391  1.00 39.26  ? 942  ALA A N    1 
ATOM   5540  C  CA   . ALA A 1 381 ? -35.087  21.011  -8.527  1.00 38.77  ? 942  ALA A CA   1 
ATOM   5541  C  C    . ALA A 1 381 ? -34.230  22.103  -9.153  1.00 32.82  ? 942  ALA A C    1 
ATOM   5542  O  O    . ALA A 1 381 ? -34.659  22.783  -10.091 1.00 41.01  ? 942  ALA A O    1 
ATOM   5543  C  CB   . ALA A 1 381 ? -35.617  21.458  -7.165  1.00 37.31  ? 942  ALA A CB   1 
ATOM   5544  H  H    . ALA A 1 381 ? -34.244  19.490  -7.582  1.00 47.11  ? 942  ALA A H    1 
ATOM   5545  H  HA   . ALA A 1 381 ? -35.848  20.857  -9.108  1.00 46.52  ? 942  ALA A HA   1 
ATOM   5546  H  HB1  . ALA A 1 381 ? -36.114  22.283  -7.275  1.00 44.77  ? 942  ALA A HB1  1 
ATOM   5547  H  HB2  . ALA A 1 381 ? -36.197  20.766  -6.810  1.00 44.77  ? 942  ALA A HB2  1 
ATOM   5548  H  HB3  . ALA A 1 381 ? -34.867  21.600  -6.566  1.00 44.77  ? 942  ALA A HB3  1 
ATOM   5549  N  N    . HIS A 1 382 ? -33.011  22.285  -8.642  1.00 43.48  ? 943  HIS A N    1 
ATOM   5550  C  CA   . HIS A 1 382 ? -32.105  23.287  -9.196  1.00 36.38  ? 943  HIS A CA   1 
ATOM   5551  C  C    . HIS A 1 382 ? -31.778  22.990  -10.656 1.00 43.53  ? 943  HIS A C    1 
ATOM   5552  O  O    . HIS A 1 382 ? -31.804  23.888  -11.506 1.00 42.13  ? 943  HIS A O    1 
ATOM   5553  C  CB   . HIS A 1 382 ? -30.824  23.342  -8.363  1.00 50.33  ? 943  HIS A CB   1 
ATOM   5554  C  CG   . HIS A 1 382 ? -29.711  24.080  -9.030  1.00 53.63  ? 943  HIS A CG   1 
ATOM   5555  N  ND1  . HIS A 1 382 ? -29.695  25.452  -9.149  1.00 50.49  ? 943  HIS A ND1  1 
ATOM   5556  C  CD2  . HIS A 1 382 ? -28.580  23.636  -9.626  1.00 55.85  ? 943  HIS A CD2  1 
ATOM   5557  C  CE1  . HIS A 1 382 ? -28.602  25.821  -9.791  1.00 57.68  ? 943  HIS A CE1  1 
ATOM   5558  N  NE2  . HIS A 1 382 ? -27.905  24.739  -10.085 1.00 56.87  ? 943  HIS A NE2  1 
ATOM   5559  H  H    . HIS A 1 382 ? -32.688  21.843  -7.979  1.00 52.18  ? 943  HIS A H    1 
ATOM   5560  H  HA   . HIS A 1 382 ? -32.530  24.158  -9.154  1.00 43.66  ? 943  HIS A HA   1 
ATOM   5561  H  HB2  . HIS A 1 382 ? -31.016  23.789  -7.523  1.00 60.39  ? 943  HIS A HB2  1 
ATOM   5562  H  HB3  . HIS A 1 382 ? -30.521  22.437  -8.193  1.00 60.39  ? 943  HIS A HB3  1 
ATOM   5563  H  HD1  . HIS A 1 382 ? -30.304  25.984  -8.856  1.00 60.59  ? 943  HIS A HD1  1 
ATOM   5564  H  HD2  . HIS A 1 382 ? -28.309  22.750  -9.705  1.00 67.02  ? 943  HIS A HD2  1 
ATOM   5565  H  HE1  . HIS A 1 382 ? -28.358  26.696  -9.991  1.00 69.22  ? 943  HIS A HE1  1 
ATOM   5566  H  HE2  . HIS A 1 382 ? -27.153  24.727  -10.502 1.00 68.25  ? 943  HIS A HE2  1 
ATOM   5567  N  N    . THR A 1 383 ? -31.456  21.732  -10.963 1.00 42.73  ? 944  THR A N    1 
ATOM   5568  C  CA   . THR A 1 383 ? -31.117  21.370  -12.335 1.00 33.21  ? 944  THR A CA   1 
ATOM   5569  C  C    . THR A 1 383 ? -32.301  21.582  -13.272 1.00 37.93  ? 944  THR A C    1 
ATOM   5570  O  O    . THR A 1 383 ? -32.126  21.993  -14.425 1.00 39.26  ? 944  THR A O    1 
ATOM   5571  C  CB   . THR A 1 383 ? -30.640  19.916  -12.385 1.00 38.34  ? 944  THR A CB   1 
ATOM   5572  O  OG1  . THR A 1 383 ? -29.541  19.737  -11.482 1.00 40.02  ? 944  THR A OG1  1 
ATOM   5573  C  CG2  . THR A 1 383 ? -30.197  19.535  -13.793 1.00 36.30  ? 944  THR A CG2  1 
ATOM   5574  H  H    . THR A 1 383 ? -31.427  21.080  -10.403 1.00 51.28  ? 944  THR A H    1 
ATOM   5575  H  HA   . THR A 1 383 ? -30.389  21.934  -12.640 1.00 39.85  ? 944  THR A HA   1 
ATOM   5576  H  HB   . THR A 1 383 ? -31.368  19.330  -12.125 1.00 46.01  ? 944  THR A HB   1 
ATOM   5577  H  HG1  . THR A 1 383 ? -29.780  19.921  -10.698 1.00 48.03  ? 944  THR A HG1  1 
ATOM   5578  H  HG21 . THR A 1 383 ? -29.898  18.613  -13.808 1.00 43.56  ? 944  THR A HG21 1 
ATOM   5579  H  HG22 . THR A 1 383 ? -30.937  19.637  -14.412 1.00 43.56  ? 944  THR A HG22 1 
ATOM   5580  H  HG23 . THR A 1 383 ? -29.467  20.108  -14.076 1.00 43.56  ? 944  THR A HG23 1 
ATOM   5581  N  N    . TYR A 1 384 ? -33.519  21.317  -12.792 1.00 53.83  ? 945  TYR A N    1 
ATOM   5582  C  CA   . TYR A 1 384 ? -34.693  21.439  -13.651 1.00 46.95  ? 945  TYR A CA   1 
ATOM   5583  C  C    . TYR A 1 384 ? -34.965  22.892  -14.024 1.00 41.51  ? 945  TYR A C    1 
ATOM   5584  O  O    . TYR A 1 384 ? -35.320  23.186  -15.171 1.00 41.37  ? 945  TYR A O    1 
ATOM   5585  C  CB   . TYR A 1 384 ? -35.909  20.829  -12.961 1.00 44.75  ? 945  TYR A CB   1 
ATOM   5586  C  CG   . TYR A 1 384 ? -37.131  20.759  -13.842 1.00 40.31  ? 945  TYR A CG   1 
ATOM   5587  C  CD1  . TYR A 1 384 ? -37.219  19.816  -14.855 1.00 39.83  ? 945  TYR A CD1  1 
ATOM   5588  C  CD2  . TYR A 1 384 ? -38.201  21.629  -13.659 1.00 42.71  ? 945  TYR A CD2  1 
ATOM   5589  C  CE1  . TYR A 1 384 ? -38.335  19.742  -15.664 1.00 45.60  ? 945  TYR A CE1  1 
ATOM   5590  C  CE2  . TYR A 1 384 ? -39.322  21.557  -14.463 1.00 34.91  ? 945  TYR A CE2  1 
ATOM   5591  C  CZ   . TYR A 1 384 ? -39.382  20.613  -15.460 1.00 46.35  ? 945  TYR A CZ   1 
ATOM   5592  O  OH   . TYR A 1 384 ? -40.491  20.538  -16.263 1.00 47.23  ? 945  TYR A OH   1 
ATOM   5593  H  H    . TYR A 1 384 ? -33.688  21.070  -11.986 1.00 64.60  ? 945  TYR A H    1 
ATOM   5594  H  HA   . TYR A 1 384 ? -34.536  20.945  -14.471 1.00 56.35  ? 945  TYR A HA   1 
ATOM   5595  H  HB2  . TYR A 1 384 ? -35.691  19.926  -12.683 1.00 53.70  ? 945  TYR A HB2  1 
ATOM   5596  H  HB3  . TYR A 1 384 ? -36.132  21.368  -12.186 1.00 53.70  ? 945  TYR A HB3  1 
ATOM   5597  H  HD1  . TYR A 1 384 ? -36.514  19.226  -14.993 1.00 47.80  ? 945  TYR A HD1  1 
ATOM   5598  H  HD2  . TYR A 1 384 ? -38.162  22.266  -12.983 1.00 51.25  ? 945  TYR A HD2  1 
ATOM   5599  H  HE1  . TYR A 1 384 ? -38.381  19.104  -16.339 1.00 54.72  ? 945  TYR A HE1  1 
ATOM   5600  H  HE2  . TYR A 1 384 ? -40.031  22.145  -14.331 1.00 41.89  ? 945  TYR A HE2  1 
ATOM   5601  H  HH   . TYR A 1 384 ? -40.396  19.923  -16.828 1.00 56.67  ? 945  TYR A HH   1 
ATOM   5602  N  N    . ARG A 1 385 ? -34.809  23.815  -13.070 1.00 41.98  ? 946  ARG A N    1 
ATOM   5603  C  CA   . ARG A 1 385 ? -35.011  25.228  -13.376 1.00 42.23  ? 946  ARG A CA   1 
ATOM   5604  C  C    . ARG A 1 385 ? -33.904  25.752  -14.280 1.00 47.47  ? 946  ARG A C    1 
ATOM   5605  O  O    . ARG A 1 385 ? -34.164  26.528  -15.205 1.00 49.85  ? 946  ARG A O    1 
ATOM   5606  C  CB   . ARG A 1 385 ? -35.083  26.051  -12.087 1.00 39.78  ? 946  ARG A CB   1 
ATOM   5607  C  CG   . ARG A 1 385 ? -36.043  25.487  -11.050 1.00 68.40  ? 946  ARG A CG   1 
ATOM   5608  C  CD   . ARG A 1 385 ? -36.720  26.555  -10.210 1.00 70.23  ? 946  ARG A CD   1 
ATOM   5609  N  NE   . ARG A 1 385 ? -35.861  27.086  -9.154  1.00 60.15  ? 946  ARG A NE   1 
ATOM   5610  C  CZ   . ARG A 1 385 ? -36.309  27.765  -8.101  1.00 85.74  ? 946  ARG A CZ   1 
ATOM   5611  N  NH1  . ARG A 1 385 ? -37.611  27.989  -7.951  1.00 69.61  ? 946  ARG A NH1  1 
ATOM   5612  N  NH2  . ARG A 1 385 ? -35.458  28.217  -7.189  1.00 95.50  ? 946  ARG A NH2  1 
ATOM   5613  H  H    . ARG A 1 385 ? -34.590  23.650  -12.254 1.00 50.37  ? 946  ARG A H    1 
ATOM   5614  H  HA   . ARG A 1 385 ? -35.853  25.332  -13.845 1.00 50.68  ? 946  ARG A HA   1 
ATOM   5615  H  HB2  . ARG A 1 385 ? -34.200  26.083  -11.686 1.00 47.74  ? 946  ARG A HB2  1 
ATOM   5616  H  HB3  . ARG A 1 385 ? -35.378  26.949  -12.305 1.00 47.74  ? 946  ARG A HB3  1 
ATOM   5617  H  HG2  . ARG A 1 385 ? -36.736  24.983  -11.505 1.00 82.08  ? 946  ARG A HG2  1 
ATOM   5618  H  HG3  . ARG A 1 385 ? -35.551  24.904  -10.451 1.00 82.08  ? 946  ARG A HG3  1 
ATOM   5619  H  HD2  . ARG A 1 385 ? -36.977  27.293  -10.785 1.00 84.27  ? 946  ARG A HD2  1 
ATOM   5620  H  HD3  . ARG A 1 385 ? -37.507  26.173  -9.790  1.00 84.27  ? 946  ARG A HD3  1 
ATOM   5621  H  HE   . ARG A 1 385 ? -35.024  26.893  -9.183  1.00 72.17  ? 946  ARG A HE   1 
ATOM   5622  H  HH11 . ARG A 1 385 ? -38.168  27.700  -8.539  1.00 83.53  ? 946  ARG A HH11 1 
ATOM   5623  H  HH12 . ARG A 1 385 ? -37.896  28.427  -7.268  1.00 83.53  ? 946  ARG A HH12 1 
ATOM   5624  H  HH21 . ARG A 1 385 ? -34.615  28.073  -7.278  1.00 114.60 ? 946  ARG A HH21 1 
ATOM   5625  H  HH22 . ARG A 1 385 ? -35.749  28.652  -6.507  1.00 114.60 ? 946  ARG A HH22 1 
ATOM   5626  N  N    . ALA A 1 386 ? -32.664  25.323  -14.039 1.00 48.37  ? 947  ALA A N    1 
ATOM   5627  C  CA   . ALA A 1 386 ? -31.543  25.837  -14.814 1.00 38.32  ? 947  ALA A CA   1 
ATOM   5628  C  C    . ALA A 1 386 ? -31.609  25.367  -16.262 1.00 41.88  ? 947  ALA A C    1 
ATOM   5629  O  O    . ALA A 1 386 ? -31.291  26.129  -17.181 1.00 63.23  ? 947  ALA A O    1 
ATOM   5630  C  CB   . ALA A 1 386 ? -30.226  25.413  -14.166 1.00 51.34  ? 947  ALA A CB   1 
ATOM   5631  H  H    . ALA A 1 386 ? -32.450  24.743  -13.440 1.00 58.05  ? 947  ALA A H    1 
ATOM   5632  H  HA   . ALA A 1 386 ? -31.578  26.806  -14.814 1.00 45.98  ? 947  ALA A HA   1 
ATOM   5633  H  HB1  . ALA A 1 386 ? -29.489  25.761  -14.692 1.00 61.61  ? 947  ALA A HB1  1 
ATOM   5634  H  HB2  . ALA A 1 386 ? -30.188  25.771  -13.265 1.00 61.61  ? 947  ALA A HB2  1 
ATOM   5635  H  HB3  . ALA A 1 386 ? -30.185  24.444  -14.140 1.00 61.61  ? 947  ALA A HB3  1 
ATOM   5636  N  N    . MET A 1 387 ? -32.049  24.131  -16.488 1.00 49.48  ? 948  MET A N    1 
ATOM   5637  C  CA   . MET A 1 387 ? -32.024  23.538  -17.819 1.00 42.18  ? 948  MET A CA   1 
ATOM   5638  C  C    . MET A 1 387 ? -33.241  23.905  -18.656 1.00 44.46  ? 948  MET A C    1 
ATOM   5639  O  O    . MET A 1 387 ? -33.378  23.395  -19.774 1.00 48.05  ? 948  MET A O    1 
ATOM   5640  C  CB   . MET A 1 387 ? -31.905  22.015  -17.718 1.00 37.95  ? 948  MET A CB   1 
ATOM   5641  C  CG   . MET A 1 387 ? -30.551  21.534  -17.202 1.00 59.98  ? 948  MET A CG   1 
ATOM   5642  S  SD   . MET A 1 387 ? -29.144  22.012  -18.240 1.00 50.12  ? 948  MET A SD   1 
ATOM   5643  C  CE   . MET A 1 387 ? -29.430  21.010  -19.696 1.00 53.82  ? 948  MET A CE   1 
ATOM   5644  H  H    . MET A 1 387 ? -32.369  23.612  -15.881 1.00 59.37  ? 948  MET A H    1 
ATOM   5645  H  HA   . MET A 1 387 ? -31.233  23.858  -18.279 1.00 50.62  ? 948  MET A HA   1 
ATOM   5646  H  HB2  . MET A 1 387 ? -32.587  21.688  -17.110 1.00 45.53  ? 948  MET A HB2  1 
ATOM   5647  H  HB3  . MET A 1 387 ? -32.040  21.632  -18.599 1.00 45.53  ? 948  MET A HB3  1 
ATOM   5648  H  HG2  . MET A 1 387 ? -30.405  21.906  -16.318 1.00 71.97  ? 948  MET A HG2  1 
ATOM   5649  H  HG3  . MET A 1 387 ? -30.564  20.565  -17.150 1.00 71.97  ? 948  MET A HG3  1 
ATOM   5650  H  HE1  . MET A 1 387 ? -28.726  21.182  -20.341 1.00 64.59  ? 948  MET A HE1  1 
ATOM   5651  H  HE2  . MET A 1 387 ? -29.425  20.074  -19.441 1.00 64.59  ? 948  MET A HE2  1 
ATOM   5652  H  HE3  . MET A 1 387 ? -30.291  21.245  -20.076 1.00 64.59  ? 948  MET A HE3  1 
ATOM   5653  N  N    . GLU A 1 388 ? -34.134  24.753  -18.141 1.00 59.78  ? 949  GLU A N    1 
ATOM   5654  C  CA   . GLU A 1 388 ? -35.243  25.251  -18.946 1.00 54.26  ? 949  GLU A CA   1 
ATOM   5655  C  C    . GLU A 1 388 ? -34.771  25.950  -20.216 1.00 55.38  ? 949  GLU A C    1 
ATOM   5656  O  O    . GLU A 1 388 ? -35.552  26.073  -21.166 1.00 54.63  ? 949  GLU A O    1 
ATOM   5657  C  CB   . GLU A 1 388 ? -36.104  26.214  -18.124 1.00 65.26  ? 949  GLU A CB   1 
ATOM   5658  C  CG   . GLU A 1 388 ? -37.377  25.592  -17.570 1.00 75.80  ? 949  GLU A CG   1 
ATOM   5659  C  CD   . GLU A 1 388 ? -38.430  26.628  -17.227 1.00 80.19  ? 949  GLU A CD   1 
ATOM   5660  O  OE1  . GLU A 1 388 ? -39.632  26.287  -17.256 1.00 82.37  ? 949  GLU A OE1  1 
ATOM   5661  O  OE2  . GLU A 1 388 ? -38.056  27.782  -16.931 1.00 83.14  ? 949  GLU A OE2  1 
ATOM   5662  H  H    . GLU A 1 388 ? -34.119  25.051  -17.334 1.00 71.73  ? 949  GLU A H    1 
ATOM   5663  H  HA   . GLU A 1 388 ? -35.801  24.502  -19.209 1.00 65.12  ? 949  GLU A HA   1 
ATOM   5664  H  HB2  . GLU A 1 388 ? -35.581  26.536  -17.373 1.00 78.31  ? 949  GLU A HB2  1 
ATOM   5665  H  HB3  . GLU A 1 388 ? -36.361  26.960  -18.688 1.00 78.31  ? 949  GLU A HB3  1 
ATOM   5666  H  HG2  . GLU A 1 388 ? -37.752  24.992  -18.234 1.00 90.96  ? 949  GLU A HG2  1 
ATOM   5667  H  HG3  . GLU A 1 388 ? -37.164  25.102  -16.761 1.00 90.96  ? 949  GLU A HG3  1 
ATOM   5668  N  N    . LEU A 1 389 ? -33.517  26.413  -20.260 1.00 64.48  ? 950  LEU A N    1 
ATOM   5669  C  CA   . LEU A 1 389 ? -33.012  27.061  -21.467 1.00 58.20  ? 950  LEU A CA   1 
ATOM   5670  C  C    . LEU A 1 389 ? -32.992  26.101  -22.648 1.00 59.73  ? 950  LEU A C    1 
ATOM   5671  O  O    . LEU A 1 389 ? -33.086  26.535  -23.802 1.00 78.26  ? 950  LEU A O    1 
ATOM   5672  C  CB   . LEU A 1 389 ? -31.610  27.614  -21.222 1.00 50.71  ? 950  LEU A CB   1 
ATOM   5673  C  CG   . LEU A 1 389 ? -31.438  28.490  -19.980 1.00 54.58  ? 950  LEU A CG   1 
ATOM   5674  C  CD1  . LEU A 1 389 ? -30.006  28.990  -19.888 1.00 72.07  ? 950  LEU A CD1  1 
ATOM   5675  C  CD2  . LEU A 1 389 ? -32.414  29.657  -19.985 1.00 81.15  ? 950  LEU A CD2  1 
ATOM   5676  H  H    . LEU A 1 389 ? -32.951  26.364  -19.614 1.00 77.37  ? 950  LEU A H    1 
ATOM   5677  H  HA   . LEU A 1 389 ? -33.593  27.803  -21.694 1.00 69.83  ? 950  LEU A HA   1 
ATOM   5678  H  HB2  . LEU A 1 389 ? -30.998  26.867  -21.135 1.00 60.85  ? 950  LEU A HB2  1 
ATOM   5679  H  HB3  . LEU A 1 389 ? -31.356  28.150  -21.990 1.00 60.85  ? 950  LEU A HB3  1 
ATOM   5680  H  HG   . LEU A 1 389 ? -31.618  27.955  -19.191 1.00 65.50  ? 950  LEU A HG   1 
ATOM   5681  H  HD11 . LEU A 1 389 ? -29.916  29.543  -19.095 1.00 86.48  ? 950  LEU A HD11 1 
ATOM   5682  H  HD12 . LEU A 1 389 ? -29.409  28.228  -19.830 1.00 86.48  ? 950  LEU A HD12 1 
ATOM   5683  H  HD13 . LEU A 1 389 ? -29.803  29.512  -20.680 1.00 86.48  ? 950  LEU A HD13 1 
ATOM   5684  H  HD21 . LEU A 1 389 ? -32.275  30.188  -19.185 1.00 97.38  ? 950  LEU A HD21 1 
ATOM   5685  H  HD22 . LEU A 1 389 ? -32.254  30.199  -20.773 1.00 97.38  ? 950  LEU A HD22 1 
ATOM   5686  H  HD23 . LEU A 1 389 ? -33.320  29.310  -19.999 1.00 97.38  ? 950  LEU A HD23 1 
ATOM   5687  N  N    . CYS A 1 390 ? -32.857  24.805  -22.383 1.00 52.22  ? 951  CYS A N    1 
ATOM   5688  C  CA   . CYS A 1 390 ? -32.916  23.767  -23.403 1.00 51.19  ? 951  CYS A CA   1 
ATOM   5689  C  C    . CYS A 1 390 ? -34.322  23.207  -23.596 1.00 70.78  ? 951  CYS A C    1 
ATOM   5690  O  O    . CYS A 1 390 ? -34.485  22.224  -24.329 1.00 64.67  ? 951  CYS A O    1 
ATOM   5691  C  CB   . CYS A 1 390 ? -31.951  22.632  -23.057 1.00 64.06  ? 951  CYS A CB   1 
ATOM   5692  S  SG   . CYS A 1 390 ? -30.215  23.121  -22.983 1.00 67.98  ? 951  CYS A SG   1 
ATOM   5693  H  H    . CYS A 1 390 ? -32.726  24.494  -21.592 1.00 62.66  ? 951  CYS A H    1 
ATOM   5694  H  HA   . CYS A 1 390 ? -32.632  24.148  -24.249 1.00 61.43  ? 951  CYS A HA   1 
ATOM   5695  H  HB2  . CYS A 1 390 ? -32.193  22.274  -22.188 1.00 76.87  ? 951  CYS A HB2  1 
ATOM   5696  H  HB3  . CYS A 1 390 ? -32.033  21.939  -23.730 1.00 76.87  ? 951  CYS A HB3  1 
ATOM   5697  H  HG   . CYS A 1 390 ? -29.550  22.162  -22.705 1.00 81.57  ? 951  CYS A HG   1 
ATOM   5698  N  N    . SER A 1 391 ? -35.328  23.782  -22.925 1.00 68.50  ? 952  SER A N    1 
ATOM   5699  C  CA   . SER A 1 391 ? -36.691  23.259  -23.001 1.00 58.22  ? 952  SER A CA   1 
ATOM   5700  C  C    . SER A 1 391 ? -37.151  23.062  -24.440 1.00 60.94  ? 952  SER A C    1 
ATOM   5701  O  O    . SER A 1 391 ? -37.906  22.127  -24.728 1.00 74.51  ? 952  SER A O    1 
ATOM   5702  C  CB   . SER A 1 391 ? -37.650  24.201  -22.271 1.00 51.72  ? 952  SER A CB   1 
ATOM   5703  O  OG   . SER A 1 391 ? -37.682  25.478  -22.885 1.00 71.19  ? 952  SER A OG   1 
ATOM   5704  H  H    . SER A 1 391 ? -35.245  24.474  -22.421 1.00 82.20  ? 952  SER A H    1 
ATOM   5705  H  HA   . SER A 1 391 ? -36.722  22.397  -22.557 1.00 69.87  ? 952  SER A HA   1 
ATOM   5706  H  HB2  . SER A 1 391 ? -38.542  23.820  -22.292 1.00 62.06  ? 952  SER A HB2  1 
ATOM   5707  H  HB3  . SER A 1 391 ? -37.355  24.301  -21.353 1.00 62.06  ? 952  SER A HB3  1 
ATOM   5708  H  HG   . SER A 1 391 ? -37.937  25.408  -23.683 1.00 85.43  ? 952  SER A HG   1 
ATOM   5709  N  N    . HIS A 1 392 ? -36.707  23.925  -25.355 1.00 73.12  ? 953  HIS A N    1 
ATOM   5710  C  CA   . HIS A 1 392 ? -37.089  23.801  -26.757 1.00 68.38  ? 953  HIS A CA   1 
ATOM   5711  C  C    . HIS A 1 392 ? -36.417  22.621  -27.450 1.00 62.58  ? 953  HIS A C    1 
ATOM   5712  O  O    . HIS A 1 392 ? -36.915  22.164  -28.484 1.00 75.17  ? 953  HIS A O    1 
ATOM   5713  C  CB   . HIS A 1 392 ? -36.744  25.090  -27.504 1.00 76.99  ? 953  HIS A CB   1 
ATOM   5714  C  CG   . HIS A 1 392 ? -35.284  25.420  -27.495 1.00 73.93  ? 953  HIS A CG   1 
ATOM   5715  N  ND1  . HIS A 1 392 ? -34.712  26.238  -26.545 1.00 76.26  ? 953  HIS A ND1  1 
ATOM   5716  C  CD2  . HIS A 1 392 ? -34.278  25.037  -28.317 1.00 76.30  ? 953  HIS A CD2  1 
ATOM   5717  C  CE1  . HIS A 1 392 ? -33.417  26.349  -26.784 1.00 75.78  ? 953  HIS A CE1  1 
ATOM   5718  N  NE2  . HIS A 1 392 ? -33.128  25.630  -27.854 1.00 81.38  ? 953  HIS A NE2  1 
ATOM   5719  H  H    . HIS A 1 392 ? -36.185  24.588  -25.188 1.00 87.74  ? 953  HIS A H    1 
ATOM   5720  H  HA   . HIS A 1 392 ? -38.049  23.672  -26.810 1.00 82.05  ? 953  HIS A HA   1 
ATOM   5721  H  HB2  . HIS A 1 392 ? -37.022  24.999  -28.429 1.00 92.38  ? 953  HIS A HB2  1 
ATOM   5722  H  HB3  . HIS A 1 392 ? -37.218  25.828  -27.090 1.00 92.38  ? 953  HIS A HB3  1 
ATOM   5723  H  HD1  . HIS A 1 392 ? -35.133  26.620  -25.899 1.00 91.51  ? 953  HIS A HD1  1 
ATOM   5724  H  HD2  . HIS A 1 392 ? -34.352  24.480  -29.058 1.00 91.56  ? 953  HIS A HD2  1 
ATOM   5725  H  HE1  . HIS A 1 392 ? -32.812  26.847  -26.284 1.00 90.93  ? 953  HIS A HE1  1 
ATOM   5726  H  HE2  . HIS A 1 392 ? -32.347  25.546  -28.203 1.00 97.66  ? 953  HIS A HE2  1 
ATOM   5727  N  N    . GLU A 1 393 ? -35.309  22.118  -26.913 1.00 65.70  ? 954  GLU A N    1 
ATOM   5728  C  CA   . GLU A 1 393 ? -34.515  21.120  -27.615 1.00 71.97  ? 954  GLU A CA   1 
ATOM   5729  C  C    . GLU A 1 393 ? -35.183  19.750  -27.574 1.00 65.50  ? 954  GLU A C    1 
ATOM   5730  O  O    . GLU A 1 393 ? -35.863  19.388  -26.609 1.00 70.75  ? 954  GLU A O    1 
ATOM   5731  C  CB   . GLU A 1 393 ? -33.111  21.043  -27.015 1.00 71.38  ? 954  GLU A CB   1 
ATOM   5732  C  CG   . GLU A 1 393 ? -32.337  22.350  -27.134 1.00 77.01  ? 954  GLU A CG   1 
ATOM   5733  C  CD   . GLU A 1 393 ? -30.922  22.249  -26.606 1.00 75.49  ? 954  GLU A CD   1 
ATOM   5734  O  OE1  . GLU A 1 393 ? -30.165  23.233  -26.751 1.00 70.24  ? 954  GLU A OE1  1 
ATOM   5735  O  OE2  . GLU A 1 393 ? -30.565  21.191  -26.047 1.00 85.82  ? 954  GLU A OE2  1 
ATOM   5736  H  H    . GLU A 1 393 ? -34.997  22.340  -26.143 1.00 78.85  ? 954  GLU A H    1 
ATOM   5737  H  HA   . GLU A 1 393 ? -34.429  21.384  -28.544 1.00 86.36  ? 954  GLU A HA   1 
ATOM   5738  H  HB2  . GLU A 1 393 ? -33.182  20.823  -26.074 1.00 85.66  ? 954  GLU A HB2  1 
ATOM   5739  H  HB3  . GLU A 1 393 ? -32.608  20.356  -27.479 1.00 85.66  ? 954  GLU A HB3  1 
ATOM   5740  H  HG2  . GLU A 1 393 ? -32.290  22.605  -28.069 1.00 92.41  ? 954  GLU A HG2  1 
ATOM   5741  H  HG3  . GLU A 1 393 ? -32.798  23.037  -26.627 1.00 92.41  ? 954  GLU A HG3  1 
ATOM   5742  N  N    . ARG A 1 394 ? -34.964  18.980  -28.643 1.00 57.56  ? 955  ARG A N    1 
ATOM   5743  C  CA   . ARG A 1 394 ? -35.679  17.721  -28.833 1.00 59.37  ? 955  ARG A CA   1 
ATOM   5744  C  C    . ARG A 1 394 ? -35.389  16.723  -27.722 1.00 63.89  ? 955  ARG A C    1 
ATOM   5745  O  O    . ARG A 1 394 ? -36.253  15.907  -27.384 1.00 69.37  ? 955  ARG A O    1 
ATOM   5746  C  CB   . ARG A 1 394 ? -35.305  17.120  -30.188 1.00 70.84  ? 955  ARG A CB   1 
ATOM   5747  C  CG   . ARG A 1 394 ? -35.877  15.735  -30.458 1.00 77.51  ? 955  ARG A CG   1 
ATOM   5748  C  CD   . ARG A 1 394 ? -35.360  15.188  -31.777 1.00 91.11  ? 955  ARG A CD   1 
ATOM   5749  N  NE   . ARG A 1 394 ? -36.347  15.289  -32.849 1.00 112.73 ? 955  ARG A NE   1 
ATOM   5750  C  CZ   . ARG A 1 394 ? -36.081  15.075  -34.134 1.00 115.80 ? 955  ARG A CZ   1 
ATOM   5751  N  NH1  . ARG A 1 394 ? -34.851  14.757  -34.520 1.00 109.55 ? 955  ARG A NH1  1 
ATOM   5752  N  NH2  . ARG A 1 394 ? -37.046  15.186  -35.038 1.00 106.76 ? 955  ARG A NH2  1 
ATOM   5753  H  H    . ARG A 1 394 ? -34.407  19.166  -29.271 1.00 69.07  ? 955  ARG A H    1 
ATOM   5754  H  HA   . ARG A 1 394 ? -36.633  17.897  -28.836 1.00 71.24  ? 955  ARG A HA   1 
ATOM   5755  H  HB2  . ARG A 1 394 ? -35.627  17.711  -30.887 1.00 85.01  ? 955  ARG A HB2  1 
ATOM   5756  H  HB3  . ARG A 1 394 ? -34.339  17.052  -30.239 1.00 85.01  ? 955  ARG A HB3  1 
ATOM   5757  H  HG2  . ARG A 1 394 ? -35.607  15.131  -29.749 1.00 93.01  ? 955  ARG A HG2  1 
ATOM   5758  H  HG3  . ARG A 1 394 ? -36.844  15.790  -30.506 1.00 93.01  ? 955  ARG A HG3  1 
ATOM   5759  H  HD2  . ARG A 1 394 ? -34.575  15.692  -32.043 1.00 109.34 ? 955  ARG A HD2  1 
ATOM   5760  H  HD3  . ARG A 1 394 ? -35.133  14.252  -31.665 1.00 109.34 ? 955  ARG A HD3  1 
ATOM   5761  H  HE   . ARG A 1 394 ? -37.153  15.501  -32.635 1.00 135.28 ? 955  ARG A HE   1 
ATOM   5762  H  HH11 . ARG A 1 394 ? -34.223  14.684  -33.937 1.00 131.46 ? 955  ARG A HH11 1 
ATOM   5763  H  HH12 . ARG A 1 394 ? -34.684  14.622  -35.353 1.00 131.46 ? 955  ARG A HH12 1 
ATOM   5764  H  HH21 . ARG A 1 394 ? -37.843  15.394  -34.792 1.00 128.11 ? 955  ARG A HH21 1 
ATOM   5765  H  HH22 . ARG A 1 394 ? -36.874  15.051  -35.870 1.00 128.11 ? 955  ARG A HH22 1 
ATOM   5766  N  N    . LEU A 1 395 ? -34.187  16.764  -27.148 1.00 67.77  ? 956  LEU A N    1 
ATOM   5767  C  CA   . LEU A 1 395 ? -33.817  15.758  -26.159 1.00 66.86  ? 956  LEU A CA   1 
ATOM   5768  C  C    . LEU A 1 395 ? -34.592  15.931  -24.859 1.00 53.83  ? 956  LEU A C    1 
ATOM   5769  O  O    . LEU A 1 395 ? -34.822  14.951  -24.141 1.00 50.76  ? 956  LEU A O    1 
ATOM   5770  C  CB   . LEU A 1 395 ? -32.313  15.825  -25.892 1.00 64.39  ? 956  LEU A CB   1 
ATOM   5771  C  CG   . LEU A 1 395 ? -31.670  14.606  -25.227 1.00 76.74  ? 956  LEU A CG   1 
ATOM   5772  C  CD1  . LEU A 1 395 ? -31.776  13.373  -26.119 1.00 76.62  ? 956  LEU A CD1  1 
ATOM   5773  C  CD2  . LEU A 1 395 ? -30.215  14.898  -24.896 1.00 75.87  ? 956  LEU A CD2  1 
ATOM   5774  H  H    . LEU A 1 395 ? -33.580  17.351  -27.311 1.00 81.32  ? 956  LEU A H    1 
ATOM   5775  H  HA   . LEU A 1 395 ? -34.019  14.878  -26.513 1.00 80.24  ? 956  LEU A HA   1 
ATOM   5776  H  HB2  . LEU A 1 395 ? -31.862  15.959  -26.741 1.00 77.27  ? 956  LEU A HB2  1 
ATOM   5777  H  HB3  . LEU A 1 395 ? -32.143  16.587  -25.317 1.00 77.27  ? 956  LEU A HB3  1 
ATOM   5778  H  HG   . LEU A 1 395 ? -32.134  14.416  -24.397 1.00 92.09  ? 956  LEU A HG   1 
ATOM   5779  H  HD11 . LEU A 1 395 ? -31.360  12.621  -25.669 1.00 91.94  ? 956  LEU A HD11 1 
ATOM   5780  H  HD12 . LEU A 1 395 ? -32.713  13.183  -26.284 1.00 91.94  ? 956  LEU A HD12 1 
ATOM   5781  H  HD13 . LEU A 1 395 ? -31.321  13.550  -26.957 1.00 91.94  ? 956  LEU A HD13 1 
ATOM   5782  H  HD21 . LEU A 1 395 ? -29.825  14.115  -24.476 1.00 91.05  ? 956  LEU A HD21 1 
ATOM   5783  H  HD22 . LEU A 1 395 ? -29.741  15.105  -25.716 1.00 91.05  ? 956  LEU A HD22 1 
ATOM   5784  H  HD23 . LEU A 1 395 ? -30.176  15.654  -24.289 1.00 91.05  ? 956  LEU A HD23 1 
ATOM   5785  N  N    . PHE A 1 396 ? -34.983  17.161  -24.534 1.00 57.13  ? 957  PHE A N    1 
ATOM   5786  C  CA   . PHE A 1 396 ? -35.660  17.474  -23.283 1.00 58.23  ? 957  PHE A CA   1 
ATOM   5787  C  C    . PHE A 1 396 ? -37.180  17.528  -23.406 1.00 58.66  ? 957  PHE A C    1 
ATOM   5788  O  O    . PHE A 1 396 ? -37.850  17.895  -22.436 1.00 55.90  ? 957  PHE A O    1 
ATOM   5789  C  CB   . PHE A 1 396 ? -35.115  18.793  -22.724 1.00 52.62  ? 957  PHE A CB   1 
ATOM   5790  C  CG   . PHE A 1 396 ? -33.653  18.727  -22.375 1.00 59.56  ? 957  PHE A CG   1 
ATOM   5791  C  CD1  . PHE A 1 396 ? -33.237  18.148  -21.187 1.00 60.37  ? 957  PHE A CD1  1 
ATOM   5792  C  CD2  . PHE A 1 396 ? -32.694  19.213  -23.247 1.00 73.15  ? 957  PHE A CD2  1 
ATOM   5793  C  CE1  . PHE A 1 396 ? -31.891  18.068  -20.867 1.00 72.25  ? 957  PHE A CE1  1 
ATOM   5794  C  CE2  . PHE A 1 396 ? -31.345  19.138  -22.934 1.00 76.13  ? 957  PHE A CE2  1 
ATOM   5795  C  CZ   . PHE A 1 396 ? -30.945  18.564  -21.743 1.00 72.12  ? 957  PHE A CZ   1 
ATOM   5796  H  H    . PHE A 1 396 ? -34.863  17.847  -25.038 1.00 68.56  ? 957  PHE A H    1 
ATOM   5797  H  HA   . PHE A 1 396 ? -35.448  16.779  -22.640 1.00 69.87  ? 957  PHE A HA   1 
ATOM   5798  H  HB2  . PHE A 1 396 ? -35.233  19.489  -23.388 1.00 63.14  ? 957  PHE A HB2  1 
ATOM   5799  H  HB3  . PHE A 1 396 ? -35.605  19.019  -21.917 1.00 63.14  ? 957  PHE A HB3  1 
ATOM   5800  H  HD1  . PHE A 1 396 ? -33.870  17.812  -20.594 1.00 72.44  ? 957  PHE A HD1  1 
ATOM   5801  H  HD2  . PHE A 1 396 ? -32.958  19.599  -24.051 1.00 87.78  ? 957  PHE A HD2  1 
ATOM   5802  H  HE1  . PHE A 1 396 ? -31.625  17.683  -20.064 1.00 86.71  ? 957  PHE A HE1  1 
ATOM   5803  H  HE2  . PHE A 1 396 ? -30.711  19.474  -23.525 1.00 91.36  ? 957  PHE A HE2  1 
ATOM   5804  H  HZ   . PHE A 1 396 ? -30.041  18.515  -21.529 1.00 86.55  ? 957  PHE A HZ   1 
ATOM   5805  N  N    . GLN A 1 397 ? -37.737  17.200  -24.573 1.00 57.70  ? 958  GLN A N    1 
ATOM   5806  C  CA   . GLN A 1 397 ? -39.190  17.192  -24.731 1.00 52.44  ? 958  GLN A CA   1 
ATOM   5807  C  C    . GLN A 1 397 ? -39.909  16.287  -23.737 1.00 56.70  ? 958  GLN A C    1 
ATOM   5808  O  O    . GLN A 1 397 ? -41.046  16.616  -23.359 1.00 59.30  ? 958  GLN A O    1 
ATOM   5809  C  CB   . GLN A 1 397 ? -39.554  16.798  -26.167 1.00 58.56  ? 958  GLN A CB   1 
ATOM   5810  C  CG   . GLN A 1 397 ? -39.194  17.844  -27.209 1.00 74.54  ? 958  GLN A CG   1 
ATOM   5811  C  CD   . GLN A 1 397 ? -39.799  19.209  -26.912 1.00 83.25  ? 958  GLN A CD   1 
ATOM   5812  O  OE1  . GLN A 1 397 ? -39.189  20.037  -26.232 1.00 68.58  ? 958  GLN A OE1  1 
ATOM   5813  N  NE2  . GLN A 1 397 ? -41.002  19.448  -27.422 1.00 81.60  ? 958  GLN A NE2  1 
ATOM   5814  H  H    . GLN A 1 397 ? -37.300  16.980  -25.281 1.00 69.24  ? 958  GLN A H    1 
ATOM   5815  H  HA   . GLN A 1 397 ? -39.516  18.094  -24.587 1.00 62.92  ? 958  GLN A HA   1 
ATOM   5816  H  HB2  . GLN A 1 397 ? -39.083  15.981  -26.394 1.00 70.27  ? 958  GLN A HB2  1 
ATOM   5817  H  HB3  . GLN A 1 397 ? -40.511  16.650  -26.216 1.00 70.27  ? 958  GLN A HB3  1 
ATOM   5818  H  HG2  . GLN A 1 397 ? -38.230  17.944  -27.236 1.00 89.45  ? 958  GLN A HG2  1 
ATOM   5819  H  HG3  . GLN A 1 397 ? -39.522  17.553  -28.074 1.00 89.45  ? 958  GLN A HG3  1 
ATOM   5820  H  HE21 . GLN A 1 397 ? -41.397  18.846  -27.892 1.00 97.92  ? 958  GLN A HE21 1 
ATOM   5821  H  HE22 . GLN A 1 397 ? -41.386  20.205  -27.282 1.00 97.92  ? 958  GLN A HE22 1 
ATOM   5822  N  N    . PRO A 1 398 ? -39.367  15.142  -23.326 1.00 53.81  ? 959  PRO A N    1 
ATOM   5823  C  CA   . PRO A 1 398 ? -40.033  14.380  -22.257 1.00 50.11  ? 959  PRO A CA   1 
ATOM   5824  C  C    . PRO A 1 398 ? -40.125  15.132  -20.939 1.00 51.54  ? 959  PRO A C    1 
ATOM   5825  O  O    . PRO A 1 398 ? -41.054  14.882  -20.161 1.00 55.23  ? 959  PRO A O    1 
ATOM   5826  C  CB   . PRO A 1 398 ? -39.156  13.128  -22.121 1.00 63.46  ? 959  PRO A CB   1 
ATOM   5827  C  CG   . PRO A 1 398 ? -38.438  13.014  -23.412 1.00 46.27  ? 959  PRO A CG   1 
ATOM   5828  C  CD   . PRO A 1 398 ? -38.221  14.411  -23.891 1.00 46.69  ? 959  PRO A CD   1 
ATOM   5829  H  HA   . PRO A 1 398 ? -40.923  14.117  -22.538 1.00 60.13  ? 959  PRO A HA   1 
ATOM   5830  H  HB2  . PRO A 1 398 ? -38.529  13.246  -21.390 1.00 76.15  ? 959  PRO A HB2  1 
ATOM   5831  H  HB3  . PRO A 1 398 ? -39.716  12.351  -21.971 1.00 76.15  ? 959  PRO A HB3  1 
ATOM   5832  H  HG2  . PRO A 1 398 ? -37.588  12.566  -23.272 1.00 55.52  ? 959  PRO A HG2  1 
ATOM   5833  H  HG3  . PRO A 1 398 ? -38.983  12.519  -24.043 1.00 55.52  ? 959  PRO A HG3  1 
ATOM   5834  H  HD2  . PRO A 1 398 ? -37.388  14.764  -23.540 1.00 56.03  ? 959  PRO A HD2  1 
ATOM   5835  H  HD3  . PRO A 1 398 ? -38.242  14.445  -24.860 1.00 56.03  ? 959  PRO A HD3  1 
ATOM   5836  N  N    . TYR A 1 399 ? -39.156  16.003  -20.642 1.00 56.62  ? 960  TYR A N    1 
ATOM   5837  C  CA   . TYR A 1 399 ? -39.081  16.707  -19.366 1.00 42.23  ? 960  TYR A CA   1 
ATOM   5838  C  C    . TYR A 1 399 ? -39.731  18.092  -19.368 1.00 47.16  ? 960  TYR A C    1 
ATOM   5839  O  O    . TYR A 1 399 ? -39.884  18.682  -18.291 1.00 46.50  ? 960  TYR A O    1 
ATOM   5840  C  CB   . TYR A 1 399 ? -37.611  16.826  -18.950 1.00 53.76  ? 960  TYR A CB   1 
ATOM   5841  C  CG   . TYR A 1 399 ? -36.843  15.532  -19.129 1.00 47.48  ? 960  TYR A CG   1 
ATOM   5842  C  CD1  . TYR A 1 399 ? -36.984  14.487  -18.225 1.00 44.46  ? 960  TYR A CD1  1 
ATOM   5843  C  CD2  . TYR A 1 399 ? -35.985  15.352  -20.206 1.00 59.72  ? 960  TYR A CD2  1 
ATOM   5844  C  CE1  . TYR A 1 399 ? -36.288  13.301  -18.386 1.00 52.32  ? 960  TYR A CE1  1 
ATOM   5845  C  CE2  . TYR A 1 399 ? -35.284  14.167  -20.374 1.00 55.17  ? 960  TYR A CE2  1 
ATOM   5846  C  CZ   . TYR A 1 399 ? -35.440  13.148  -19.461 1.00 43.80  ? 960  TYR A CZ   1 
ATOM   5847  O  OH   . TYR A 1 399 ? -34.752  11.970  -19.615 1.00 59.77  ? 960  TYR A OH   1 
ATOM   5848  H  H    . TYR A 1 399 ? -38.517  16.206  -21.180 1.00 67.94  ? 960  TYR A H    1 
ATOM   5849  H  HA   . TYR A 1 399 ? -39.534  16.175  -18.693 1.00 50.68  ? 960  TYR A HA   1 
ATOM   5850  H  HB2  . TYR A 1 399 ? -37.183  17.506  -19.493 1.00 64.51  ? 960  TYR A HB2  1 
ATOM   5851  H  HB3  . TYR A 1 399 ? -37.567  17.073  -18.013 1.00 64.51  ? 960  TYR A HB3  1 
ATOM   5852  H  HD1  . TYR A 1 399 ? -37.554  14.587  -17.498 1.00 53.35  ? 960  TYR A HD1  1 
ATOM   5853  H  HD2  . TYR A 1 399 ? -35.877  16.038  -20.824 1.00 71.66  ? 960  TYR A HD2  1 
ATOM   5854  H  HE1  . TYR A 1 399 ? -36.391  12.612  -17.770 1.00 62.79  ? 960  TYR A HE1  1 
ATOM   5855  H  HE2  . TYR A 1 399 ? -34.711  14.062  -21.100 1.00 66.20  ? 960  TYR A HE2  1 
ATOM   5856  H  HH   . TYR A 1 399 ? -34.273  12.005  -20.305 1.00 71.72  ? 960  TYR A HH   1 
ATOM   5857  N  N    . TYR A 1 400 ? -40.124  18.623  -20.528 1.00 44.80  ? 961  TYR A N    1 
ATOM   5858  C  CA   . TYR A 1 400 ? -40.724  19.949  -20.614 1.00 40.34  ? 961  TYR A CA   1 
ATOM   5859  C  C    . TYR A 1 400 ? -41.813  19.942  -21.678 1.00 39.14  ? 961  TYR A C    1 
ATOM   5860  O  O    . TYR A 1 400 ? -41.876  19.048  -22.524 1.00 53.65  ? 961  TYR A O    1 
ATOM   5861  C  CB   . TYR A 1 400 ? -39.695  21.039  -20.959 1.00 40.66  ? 961  TYR A CB   1 
ATOM   5862  C  CG   . TYR A 1 400 ? -38.542  21.172  -19.989 1.00 43.26  ? 961  TYR A CG   1 
ATOM   5863  C  CD1  . TYR A 1 400 ? -37.386  20.419  -20.146 1.00 56.77  ? 961  TYR A CD1  1 
ATOM   5864  C  CD2  . TYR A 1 400 ? -38.599  22.064  -18.929 1.00 47.82  ? 961  TYR A CD2  1 
ATOM   5865  C  CE1  . TYR A 1 400 ? -36.324  20.543  -19.266 1.00 51.31  ? 961  TYR A CE1  1 
ATOM   5866  C  CE2  . TYR A 1 400 ? -37.542  22.195  -18.045 1.00 46.80  ? 961  TYR A CE2  1 
ATOM   5867  C  CZ   . TYR A 1 400 ? -36.409  21.432  -18.220 1.00 47.73  ? 961  TYR A CZ   1 
ATOM   5868  O  OH   . TYR A 1 400 ? -35.354  21.553  -17.347 1.00 43.94  ? 961  TYR A OH   1 
ATOM   5869  H  H    . TYR A 1 400 ? -40.051  18.226  -21.288 1.00 53.76  ? 961  TYR A H    1 
ATOM   5870  H  HA   . TYR A 1 400 ? -41.131  20.173  -19.762 1.00 48.40  ? 961  TYR A HA   1 
ATOM   5871  H  HB2  . TYR A 1 400 ? -39.320  20.842  -21.832 1.00 48.79  ? 961  TYR A HB2  1 
ATOM   5872  H  HB3  . TYR A 1 400 ? -40.151  21.895  -20.988 1.00 48.79  ? 961  TYR A HB3  1 
ATOM   5873  H  HD1  . TYR A 1 400 ? -37.326  19.817  -20.853 1.00 68.12  ? 961  TYR A HD1  1 
ATOM   5874  H  HD2  . TYR A 1 400 ? -39.363  22.581  -18.808 1.00 57.38  ? 961  TYR A HD2  1 
ATOM   5875  H  HE1  . TYR A 1 400 ? -35.558  20.029  -19.383 1.00 61.57  ? 961  TYR A HE1  1 
ATOM   5876  H  HE2  . TYR A 1 400 ? -37.596  22.795  -17.336 1.00 56.16  ? 961  TYR A HE2  1 
ATOM   5877  H  HH   . TYR A 1 400 ? -35.533  22.125  -16.759 1.00 52.72  ? 961  TYR A HH   1 
ATOM   5878  N  N    . PHE A 1 401 ? -42.668  20.962  -21.635 1.00 42.57  ? 962  PHE A N    1 
ATOM   5879  C  CA   . PHE A 1 401 ? -43.703  21.167  -22.642 1.00 58.77  ? 962  PHE A CA   1 
ATOM   5880  C  C    . PHE A 1 401 ? -43.356  22.410  -23.448 1.00 47.28  ? 962  PHE A C    1 
ATOM   5881  O  O    . PHE A 1 401 ? -43.169  23.490  -22.877 1.00 60.97  ? 962  PHE A O    1 
ATOM   5882  C  CB   . PHE A 1 401 ? -45.086  21.312  -22.008 1.00 57.46  ? 962  PHE A CB   1 
ATOM   5883  C  CG   . PHE A 1 401 ? -46.179  21.581  -23.005 1.00 56.44  ? 962  PHE A CG   1 
ATOM   5884  C  CD1  . PHE A 1 401 ? -46.665  20.566  -23.814 1.00 58.94  ? 962  PHE A CD1  1 
ATOM   5885  C  CD2  . PHE A 1 401 ? -46.719  22.849  -23.135 1.00 55.14  ? 962  PHE A CD2  1 
ATOM   5886  C  CE1  . PHE A 1 401 ? -47.671  20.812  -24.735 1.00 59.72  ? 962  PHE A CE1  1 
ATOM   5887  C  CE2  . PHE A 1 401 ? -47.725  23.101  -24.053 1.00 47.03  ? 962  PHE A CE2  1 
ATOM   5888  C  CZ   . PHE A 1 401 ? -48.199  22.084  -24.854 1.00 60.58  ? 962  PHE A CZ   1 
ATOM   5889  H  H    . PHE A 1 401 ? -42.666  21.561  -21.018 1.00 51.09  ? 962  PHE A H    1 
ATOM   5890  H  HA   . PHE A 1 401 ? -43.720  20.407  -23.244 1.00 70.52  ? 962  PHE A HA   1 
ATOM   5891  H  HB2  . PHE A 1 401 ? -45.305  20.490  -21.542 1.00 68.95  ? 962  PHE A HB2  1 
ATOM   5892  H  HB3  . PHE A 1 401 ? -45.068  22.052  -21.380 1.00 68.95  ? 962  PHE A HB3  1 
ATOM   5893  H  HD1  . PHE A 1 401 ? -46.311  19.709  -23.738 1.00 70.73  ? 962  PHE A HD1  1 
ATOM   5894  H  HD2  . PHE A 1 401 ? -46.403  23.540  -22.599 1.00 66.17  ? 962  PHE A HD2  1 
ATOM   5895  H  HE1  . PHE A 1 401 ? -47.989  20.123  -25.274 1.00 71.67  ? 962  PHE A HE1  1 
ATOM   5896  H  HE2  . PHE A 1 401 ? -48.079  23.958  -24.130 1.00 56.44  ? 962  PHE A HE2  1 
ATOM   5897  H  HZ   . PHE A 1 401 ? -48.875  22.252  -25.470 1.00 72.70  ? 962  PHE A HZ   1 
ATOM   5898  N  N    . HIS A 1 402 ? -43.259  22.251  -24.768 1.00 63.55  ? 963  HIS A N    1 
ATOM   5899  C  CA   . HIS A 1 402 ? -42.930  23.355  -25.661 1.00 77.18  ? 963  HIS A CA   1 
ATOM   5900  C  C    . HIS A 1 402 ? -43.777  23.261  -26.920 1.00 71.00  ? 963  HIS A C    1 
ATOM   5901  O  O    . HIS A 1 402 ? -43.822  22.209  -27.563 1.00 66.20  ? 963  HIS A O    1 
ATOM   5902  C  CB   . HIS A 1 402 ? -41.439  23.345  -26.023 1.00 76.03  ? 963  HIS A CB   1 
ATOM   5903  C  CG   . HIS A 1 402 ? -40.914  24.680  -26.451 1.00 79.20  ? 963  HIS A CG   1 
ATOM   5904  N  ND1  . HIS A 1 402 ? -40.004  25.397  -25.703 1.00 89.65  ? 963  HIS A ND1  1 
ATOM   5905  C  CD2  . HIS A 1 402 ? -41.179  25.435  -27.543 1.00 83.28  ? 963  HIS A CD2  1 
ATOM   5906  C  CE1  . HIS A 1 402 ? -39.728  26.532  -26.318 1.00 96.57  ? 963  HIS A CE1  1 
ATOM   5907  N  NE2  . HIS A 1 402 ? -40.428  26.580  -27.438 1.00 101.83 ? 963  HIS A NE2  1 
ATOM   5908  H  H    . HIS A 1 402 ? -43.381  21.503  -25.173 1.00 76.26  ? 963  HIS A H    1 
ATOM   5909  H  HA   . HIS A 1 402 ? -43.131  24.195  -25.220 1.00 92.62  ? 963  HIS A HA   1 
ATOM   5910  H  HB2  . HIS A 1 402 ? -40.931  23.060  -25.247 1.00 91.24  ? 963  HIS A HB2  1 
ATOM   5911  H  HB3  . HIS A 1 402 ? -41.300  22.723  -26.754 1.00 91.24  ? 963  HIS A HB3  1 
ATOM   5912  H  HD1  . HIS A 1 402 ? -39.667  25.143  -24.953 1.00 107.58 ? 963  HIS A HD1  1 
ATOM   5913  H  HD2  . HIS A 1 402 ? -41.760  25.218  -28.236 1.00 99.93  ? 963  HIS A HD2  1 
ATOM   5914  H  HE1  . HIS A 1 402 ? -39.140  27.187  -26.016 1.00 115.88 ? 963  HIS A HE1  1 
ATOM   5915  H  HE2  . HIS A 1 402 ? -40.415  27.224  -28.008 1.00 122.20 ? 963  HIS A HE2  1 
ATOM   5916  N  N    . GLU A 1 403 ? -44.433  24.364  -27.271 1.00 87.49  ? 964  GLU A N    1 
ATOM   5917  C  CA   . GLU A 1 403 ? -45.226  24.438  -28.494 1.00 88.06  ? 964  GLU A CA   1 
ATOM   5918  C  C    . GLU A 1 403 ? -46.283  23.337  -28.540 1.00 90.07  ? 964  GLU A C    1 
ATOM   5919  O  O    . GLU A 1 403 ? -47.478  23.613  -28.640 1.00 86.26  ? 964  GLU A O    1 
ATOM   5920  C  CB   . GLU A 1 403 ? -44.319  24.345  -29.723 1.00 69.70  ? 964  GLU A CB   1 
ATOM   5921  H  H    . GLU A 1 403 ? -44.434  25.091  -26.812 1.00 104.99 ? 964  GLU A H    1 
ATOM   5922  H  HA   . GLU A 1 403 ? -45.683  25.293  -28.523 1.00 105.67 ? 964  GLU A HA   1 
ATOM   5923  N  N    . VAL B 1 2   ? -89.011  9.221   -41.488 1.00 82.03  ? 563  VAL B N    1 
ATOM   5924  C  CA   . VAL B 1 2   ? -88.195  9.451   -40.302 1.00 61.51  ? 563  VAL B CA   1 
ATOM   5925  C  C    . VAL B 1 2   ? -88.828  8.794   -39.079 1.00 67.34  ? 563  VAL B C    1 
ATOM   5926  O  O    . VAL B 1 2   ? -89.787  9.314   -38.509 1.00 75.01  ? 563  VAL B O    1 
ATOM   5927  C  CB   . VAL B 1 2   ? -88.008  10.954  -40.023 1.00 69.26  ? 563  VAL B CB   1 
ATOM   5928  C  CG1  . VAL B 1 2   ? -86.906  11.165  -38.995 1.00 59.51  ? 563  VAL B CG1  1 
ATOM   5929  C  CG2  . VAL B 1 2   ? -87.689  11.704  -41.311 1.00 75.51  ? 563  VAL B CG2  1 
ATOM   5930  H  HA   . VAL B 1 2   ? -87.320  9.057   -40.437 1.00 73.82  ? 563  VAL B HA   1 
ATOM   5931  H  HB   . VAL B 1 2   ? -88.832  11.315  -39.660 1.00 83.11  ? 563  VAL B HB   1 
ATOM   5932  H  HG11 . VAL B 1 2   ? -86.804  12.116  -38.834 1.00 71.41  ? 563  VAL B HG11 1 
ATOM   5933  H  HG12 . VAL B 1 2   ? -87.152  10.714  -38.173 1.00 71.41  ? 563  VAL B HG12 1 
ATOM   5934  H  HG13 . VAL B 1 2   ? -86.078  10.796  -39.341 1.00 71.41  ? 563  VAL B HG13 1 
ATOM   5935  H  HG21 . VAL B 1 2   ? -87.576  12.645  -41.108 1.00 90.61  ? 563  VAL B HG21 1 
ATOM   5936  H  HG22 . VAL B 1 2   ? -86.871  11.346  -41.690 1.00 90.61  ? 563  VAL B HG22 1 
ATOM   5937  H  HG23 . VAL B 1 2   ? -88.423  11.585  -41.934 1.00 90.61  ? 563  VAL B HG23 1 
ATOM   5938  N  N    . VAL B 1 3   ? -88.287  7.649   -38.681 1.00 76.71  ? 564  VAL B N    1 
ATOM   5939  C  CA   . VAL B 1 3   ? -88.798  6.918   -37.528 1.00 69.25  ? 564  VAL B CA   1 
ATOM   5940  C  C    . VAL B 1 3   ? -88.307  7.591   -36.254 1.00 74.42  ? 564  VAL B C    1 
ATOM   5941  O  O    . VAL B 1 3   ? -87.148  8.013   -36.160 1.00 79.87  ? 564  VAL B O    1 
ATOM   5942  C  CB   . VAL B 1 3   ? -88.353  5.445   -37.582 1.00 63.36  ? 564  VAL B CB   1 
ATOM   5943  C  CG1  . VAL B 1 3   ? -88.972  4.662   -36.434 1.00 63.85  ? 564  VAL B CG1  1 
ATOM   5944  C  CG2  . VAL B 1 3   ? -88.725  4.825   -38.919 1.00 68.52  ? 564  VAL B CG2  1 
ATOM   5945  H  H    . VAL B 1 3   ? -87.617  7.270   -39.066 1.00 92.05  ? 564  VAL B H    1 
ATOM   5946  H  HA   . VAL B 1 3   ? -89.767  6.944   -37.534 1.00 83.10  ? 564  VAL B HA   1 
ATOM   5947  H  HB   . VAL B 1 3   ? -87.388  5.403   -37.489 1.00 76.03  ? 564  VAL B HB   1 
ATOM   5948  H  HG11 . VAL B 1 3   ? -88.678  3.739   -36.487 1.00 76.62  ? 564  VAL B HG11 1 
ATOM   5949  H  HG12 . VAL B 1 3   ? -88.684  5.053   -35.594 1.00 76.62  ? 564  VAL B HG12 1 
ATOM   5950  H  HG13 . VAL B 1 3   ? -89.938  4.708   -36.506 1.00 76.62  ? 564  VAL B HG13 1 
ATOM   5951  H  HG21 . VAL B 1 3   ? -88.435  3.899   -38.929 1.00 82.22  ? 564  VAL B HG21 1 
ATOM   5952  H  HG22 . VAL B 1 3   ? -89.688  4.872   -39.031 1.00 82.22  ? 564  VAL B HG22 1 
ATOM   5953  H  HG23 . VAL B 1 3   ? -88.285  5.318   -39.629 1.00 82.22  ? 564  VAL B HG23 1 
ATOM   5954  N  N    . ILE B 1 4   ? -89.194  7.696   -35.266 1.00 72.71  ? 565  ILE B N    1 
ATOM   5955  C  CA   . ILE B 1 4   ? -88.851  8.202   -33.942 1.00 62.42  ? 565  ILE B CA   1 
ATOM   5956  C  C    . ILE B 1 4   ? -89.425  7.230   -32.922 1.00 78.00  ? 565  ILE B C    1 
ATOM   5957  O  O    . ILE B 1 4   ? -90.648  7.061   -32.844 1.00 74.62  ? 565  ILE B O    1 
ATOM   5958  C  CB   . ILE B 1 4   ? -89.392  9.623   -33.707 1.00 64.91  ? 565  ILE B CB   1 
ATOM   5959  C  CG1  . ILE B 1 4   ? -88.784  10.585  -34.732 1.00 70.81  ? 565  ILE B CG1  1 
ATOM   5960  C  CG2  . ILE B 1 4   ? -89.082  10.085  -32.283 1.00 64.30  ? 565  ILE B CG2  1 
ATOM   5961  C  CD1  . ILE B 1 4   ? -89.373  11.981  -34.702 1.00 67.36  ? 565  ILE B CD1  1 
ATOM   5962  H  H    . ILE B 1 4   ? -90.021  7.474   -35.343 1.00 87.25  ? 565  ILE B H    1 
ATOM   5963  H  HA   . ILE B 1 4   ? -87.887  8.219   -33.841 1.00 74.90  ? 565  ILE B HA   1 
ATOM   5964  H  HB   . ILE B 1 4   ? -90.355  9.611   -33.826 1.00 77.89  ? 565  ILE B HB   1 
ATOM   5965  H  HG12 . ILE B 1 4   ? -87.832  10.663  -34.559 1.00 84.97  ? 565  ILE B HG12 1 
ATOM   5966  H  HG13 . ILE B 1 4   ? -88.926  10.224  -35.621 1.00 84.97  ? 565  ILE B HG13 1 
ATOM   5967  H  HG21 . ILE B 1 4   ? -89.432  10.982  -32.160 1.00 77.15  ? 565  ILE B HG21 1 
ATOM   5968  H  HG22 . ILE B 1 4   ? -89.502  9.477   -31.655 1.00 77.15  ? 565  ILE B HG22 1 
ATOM   5969  H  HG23 . ILE B 1 4   ? -88.121  10.084  -32.153 1.00 77.15  ? 565  ILE B HG23 1 
ATOM   5970  H  HD11 . ILE B 1 4   ? -88.935  12.522  -35.377 1.00 80.83  ? 565  ILE B HD11 1 
ATOM   5971  H  HD12 . ILE B 1 4   ? -90.323  11.926  -34.887 1.00 80.83  ? 565  ILE B HD12 1 
ATOM   5972  H  HD13 . ILE B 1 4   ? -89.228  12.366  -33.824 1.00 80.83  ? 565  ILE B HD13 1 
ATOM   5973  N  N    . VAL B 1 5   ? -88.548  6.596   -32.145 1.00 77.70  ? 566  VAL B N    1 
ATOM   5974  C  CA   . VAL B 1 5   ? -88.974  5.624   -31.146 1.00 69.48  ? 566  VAL B CA   1 
ATOM   5975  C  C    . VAL B 1 5   ? -88.896  6.267   -29.767 1.00 77.71  ? 566  VAL B C    1 
ATOM   5976  O  O    . VAL B 1 5   ? -89.917  6.650   -29.183 1.00 101.29 ? 566  VAL B O    1 
ATOM   5977  C  CB   . VAL B 1 5   ? -88.095  4.359   -31.219 1.00 67.62  ? 566  VAL B CB   1 
ATOM   5978  C  CG1  . VAL B 1 5   ? -88.521  3.334   -30.173 1.00 81.11  ? 566  VAL B CG1  1 
ATOM   5979  C  CG2  . VAL B 1 5   ? -88.141  3.758   -32.617 1.00 70.39  ? 566  VAL B CG2  1 
ATOM   5980  H  H    . VAL B 1 5   ? -87.697  6.713   -32.180 1.00 93.24  ? 566  VAL B H    1 
ATOM   5981  H  HA   . VAL B 1 5   ? -89.894  5.368   -31.315 1.00 83.37  ? 566  VAL B HA   1 
ATOM   5982  H  HB   . VAL B 1 5   ? -87.176  4.607   -31.033 1.00 81.14  ? 566  VAL B HB   1 
ATOM   5983  H  HG11 . VAL B 1 5   ? -87.950  2.553   -30.246 1.00 97.34  ? 566  VAL B HG11 1 
ATOM   5984  H  HG12 . VAL B 1 5   ? -88.433  3.727   -29.291 1.00 97.34  ? 566  VAL B HG12 1 
ATOM   5985  H  HG13 . VAL B 1 5   ? -89.445  3.085   -30.335 1.00 97.34  ? 566  VAL B HG13 1 
ATOM   5986  H  HG21 . VAL B 1 5   ? -87.581  2.965   -32.638 1.00 84.46  ? 566  VAL B HG21 1 
ATOM   5987  H  HG22 . VAL B 1 5   ? -89.057  3.522   -32.829 1.00 84.46  ? 566  VAL B HG22 1 
ATOM   5988  H  HG23 . VAL B 1 5   ? -87.811  4.412   -33.253 1.00 84.46  ? 566  VAL B HG23 1 
ATOM   5989  N  N    . GLY B 1 6   ? -87.685  6.377   -29.247 1.00 73.67  ? 567  GLY B N    1 
ATOM   5990  C  CA   . GLY B 1 6   ? -87.330  7.102   -28.041 1.00 81.58  ? 567  GLY B CA   1 
ATOM   5991  C  C    . GLY B 1 6   ? -86.675  8.424   -28.365 1.00 83.42  ? 567  GLY B C    1 
ATOM   5992  O  O    . GLY B 1 6   ? -87.043  9.104   -29.330 1.00 75.98  ? 567  GLY B O    1 
ATOM   5993  H  H    . GLY B 1 6   ? -86.999  6.007   -29.609 1.00 88.41  ? 567  GLY B H    1 
ATOM   5994  H  HA2  . GLY B 1 6   ? -88.126  7.270   -27.514 1.00 97.90  ? 567  GLY B HA2  1 
ATOM   5995  H  HA3  . GLY B 1 6   ? -86.713  6.572   -27.511 1.00 97.90  ? 567  GLY B HA3  1 
ATOM   5996  N  N    . LYS B 1 7   ? -85.707  8.805   -27.533 1.00 62.67  ? 568  LYS B N    1 
ATOM   5997  C  CA   . LYS B 1 7   ? -84.743  9.811   -27.955 1.00 55.20  ? 568  LYS B CA   1 
ATOM   5998  C  C    . LYS B 1 7   ? -83.982  9.386   -29.205 1.00 46.50  ? 568  LYS B C    1 
ATOM   5999  O  O    . LYS B 1 7   ? -83.303  10.223  -29.811 1.00 53.21  ? 568  LYS B O    1 
ATOM   6000  C  CB   . LYS B 1 7   ? -83.740  10.093  -26.838 1.00 44.84  ? 568  LYS B CB   1 
ATOM   6001  C  CG   . LYS B 1 7   ? -84.352  10.682  -25.578 1.00 49.83  ? 568  LYS B CG   1 
ATOM   6002  C  CD   . LYS B 1 7   ? -83.331  11.502  -24.800 1.00 63.84  ? 568  LYS B CD   1 
ATOM   6003  C  CE   . LYS B 1 7   ? -83.046  12.853  -25.465 1.00 66.50  ? 568  LYS B CE   1 
ATOM   6004  N  NZ   . LYS B 1 7   ? -84.262  13.715  -25.549 1.00 58.14  ? 568  LYS B NZ   1 
ATOM   6005  H  H    . LYS B 1 7   ? -85.590  8.503   -26.736 1.00 75.20  ? 568  LYS B H    1 
ATOM   6006  H  HA   . LYS B 1 7   ? -85.212  10.636  -28.154 1.00 66.24  ? 568  LYS B HA   1 
ATOM   6007  H  HB2  . LYS B 1 7   ? -83.306  9.261   -26.593 1.00 53.80  ? 568  LYS B HB2  1 
ATOM   6008  H  HB3  . LYS B 1 7   ? -83.078  10.722  -27.167 1.00 53.80  ? 568  LYS B HB3  1 
ATOM   6009  H  HG2  . LYS B 1 7   ? -85.089  11.264  -25.822 1.00 59.80  ? 568  LYS B HG2  1 
ATOM   6010  H  HG3  . LYS B 1 7   ? -84.665  9.963   -25.007 1.00 59.80  ? 568  LYS B HG3  1 
ATOM   6011  H  HD2  . LYS B 1 7   ? -83.672  11.670  -23.908 1.00 76.61  ? 568  LYS B HD2  1 
ATOM   6012  H  HD3  . LYS B 1 7   ? -82.498  11.008  -24.751 1.00 76.61  ? 568  LYS B HD3  1 
ATOM   6013  H  HE2  . LYS B 1 7   ? -82.377  13.327  -24.947 1.00 79.79  ? 568  LYS B HE2  1 
ATOM   6014  H  HE3  . LYS B 1 7   ? -82.722  12.701  -26.367 1.00 79.79  ? 568  LYS B HE3  1 
ATOM   6015  H  HZ1  . LYS B 1 7   ? -84.892  13.306  -26.027 1.00 69.77  ? 568  LYS B HZ1  1 
ATOM   6016  H  HZ2  . LYS B 1 7   ? -84.577  13.877  -24.733 1.00 69.77  ? 568  LYS B HZ2  1 
ATOM   6017  H  HZ3  . LYS B 1 7   ? -84.059  14.489  -25.940 1.00 69.77  ? 568  LYS B HZ3  1 
ATOM   6018  N  N    . ILE B 1 8   ? -84.066  8.110   -29.591 1.00 60.85  ? 569  ILE B N    1 
ATOM   6019  C  CA   . ILE B 1 8   ? -83.443  7.617   -30.815 1.00 67.44  ? 569  ILE B CA   1 
ATOM   6020  C  C    . ILE B 1 8   ? -84.346  7.919   -32.003 1.00 66.71  ? 569  ILE B C    1 
ATOM   6021  O  O    . ILE B 1 8   ? -85.570  7.747   -31.938 1.00 70.24  ? 569  ILE B O    1 
ATOM   6022  C  CB   . ILE B 1 8   ? -83.167  6.105   -30.713 1.00 58.09  ? 569  ILE B CB   1 
ATOM   6023  C  CG1  . ILE B 1 8   ? -82.209  5.813   -29.556 1.00 50.69  ? 569  ILE B CG1  1 
ATOM   6024  C  CG2  . ILE B 1 8   ? -82.596  5.573   -32.033 1.00 57.20  ? 569  ILE B CG2  1 
ATOM   6025  C  CD1  . ILE B 1 8   ? -82.006  4.342   -29.279 1.00 47.63  ? 569  ILE B CD1  1 
ATOM   6026  H  H    . ILE B 1 8   ? -84.487  7.502   -29.150 1.00 73.02  ? 569  ILE B H    1 
ATOM   6027  H  HA   . ILE B 1 8   ? -82.597  8.073   -30.951 1.00 80.93  ? 569  ILE B HA   1 
ATOM   6028  H  HB   . ILE B 1 8   ? -84.007  5.652   -30.537 1.00 69.71  ? 569  ILE B HB   1 
ATOM   6029  H  HG12 . ILE B 1 8   ? -81.343  6.197   -29.765 1.00 60.83  ? 569  ILE B HG12 1 
ATOM   6030  H  HG13 . ILE B 1 8   ? -82.562  6.220   -28.749 1.00 60.83  ? 569  ILE B HG13 1 
ATOM   6031  H  HG21 . ILE B 1 8   ? -82.431  4.622   -31.945 1.00 68.64  ? 569  ILE B HG21 1 
ATOM   6032  H  HG22 . ILE B 1 8   ? -83.239  5.734   -32.742 1.00 68.64  ? 569  ILE B HG22 1 
ATOM   6033  H  HG23 . ILE B 1 8   ? -81.766  6.037   -32.227 1.00 68.64  ? 569  ILE B HG23 1 
ATOM   6034  H  HD11 . ILE B 1 8   ? -81.390  4.243   -28.536 1.00 57.16  ? 569  ILE B HD11 1 
ATOM   6035  H  HD12 . ILE B 1 8   ? -82.861  3.942   -29.055 1.00 57.16  ? 569  ILE B HD12 1 
ATOM   6036  H  HD13 . ILE B 1 8   ? -81.640  3.919   -30.072 1.00 57.16  ? 569  ILE B HD13 1 
ATOM   6037  N  N    . SER B 1 9   ? -83.734  8.354   -33.102 1.00 59.66  ? 570  SER B N    1 
ATOM   6038  C  CA   . SER B 1 9   ? -84.427  8.579   -34.361 1.00 61.06  ? 570  SER B CA   1 
ATOM   6039  C  C    . SER B 1 9   ? -83.502  8.168   -35.496 1.00 64.57  ? 570  SER B C    1 
ATOM   6040  O  O    . SER B 1 9   ? -82.279  8.295   -35.390 1.00 66.65  ? 570  SER B O    1 
ATOM   6041  C  CB   . SER B 1 9   ? -84.852  10.046  -34.525 1.00 62.44  ? 570  SER B CB   1 
ATOM   6042  O  OG   . SER B 1 9   ? -83.731  10.914  -34.475 1.00 70.16  ? 570  SER B OG   1 
ATOM   6043  H  H    . SER B 1 9   ? -82.893  8.530   -33.140 1.00 71.60  ? 570  SER B H    1 
ATOM   6044  H  HA   . SER B 1 9   ? -85.222  8.024   -34.396 1.00 73.27  ? 570  SER B HA   1 
ATOM   6045  H  HB2  . SER B 1 9   ? -85.294  10.152  -35.382 1.00 74.92  ? 570  SER B HB2  1 
ATOM   6046  H  HB3  . SER B 1 9   ? -85.462  10.279  -33.807 1.00 74.92  ? 570  SER B HB3  1 
ATOM   6047  H  HG   . SER B 1 9   ? -83.980  11.711  -34.566 1.00 84.19  ? 570  SER B HG   1 
ATOM   6048  N  N    . PHE B 1 10  ? -84.090  7.664   -36.579 1.00 65.60  ? 571  PHE B N    1 
ATOM   6049  C  CA   . PHE B 1 10  ? -83.299  7.221   -37.718 1.00 63.16  ? 571  PHE B CA   1 
ATOM   6050  C  C    . PHE B 1 10  ? -84.153  7.278   -38.974 1.00 68.02  ? 571  PHE B C    1 
ATOM   6051  O  O    . PHE B 1 10  ? -85.385  7.287   -38.913 1.00 70.37  ? 571  PHE B O    1 
ATOM   6052  C  CB   . PHE B 1 10  ? -82.751  5.804   -37.506 1.00 70.32  ? 571  PHE B CB   1 
ATOM   6053  C  CG   . PHE B 1 10  ? -83.794  4.731   -37.604 1.00 63.99  ? 571  PHE B CG   1 
ATOM   6054  C  CD1  . PHE B 1 10  ? -84.578  4.406   -36.511 1.00 61.58  ? 571  PHE B CD1  1 
ATOM   6055  C  CD2  . PHE B 1 10  ? -83.985  4.042   -38.788 1.00 66.28  ? 571  PHE B CD2  1 
ATOM   6056  C  CE1  . PHE B 1 10  ? -85.536  3.419   -36.600 1.00 64.93  ? 571  PHE B CE1  1 
ATOM   6057  C  CE2  . PHE B 1 10  ? -84.940  3.056   -38.882 1.00 75.42  ? 571  PHE B CE2  1 
ATOM   6058  C  CZ   . PHE B 1 10  ? -85.717  2.744   -37.784 1.00 62.80  ? 571  PHE B CZ   1 
ATOM   6059  H  H    . PHE B 1 10  ? -84.939  7.569   -36.676 1.00 78.72  ? 571  PHE B H    1 
ATOM   6060  H  HA   . PHE B 1 10  ? -82.546  7.821   -37.837 1.00 75.79  ? 571  PHE B HA   1 
ATOM   6061  H  HB2  . PHE B 1 10  ? -82.077  5.625   -38.180 1.00 84.38  ? 571  PHE B HB2  1 
ATOM   6062  H  HB3  . PHE B 1 10  ? -82.354  5.752   -36.623 1.00 84.38  ? 571  PHE B HB3  1 
ATOM   6063  H  HD1  . PHE B 1 10  ? -84.460  4.861   -35.709 1.00 73.89  ? 571  PHE B HD1  1 
ATOM   6064  H  HD2  . PHE B 1 10  ? -83.464  4.250   -39.531 1.00 79.53  ? 571  PHE B HD2  1 
ATOM   6065  H  HE1  . PHE B 1 10  ? -86.059  3.210   -35.860 1.00 77.92  ? 571  PHE B HE1  1 
ATOM   6066  H  HE2  . PHE B 1 10  ? -85.061  2.600   -39.683 1.00 90.50  ? 571  PHE B HE2  1 
ATOM   6067  H  HZ   . PHE B 1 10  ? -86.363  2.078   -37.845 1.00 75.36  ? 571  PHE B HZ   1 
ATOM   6068  N  N    . CYS B 1 11  ? -83.472  7.313   -40.119 1.00 69.37  ? 572  CYS B N    1 
ATOM   6069  C  CA   . CYS B 1 11  ? -84.122  7.306   -41.421 1.00 86.76  ? 572  CYS B CA   1 
ATOM   6070  C  C    . CYS B 1 11  ? -83.922  5.945   -42.070 1.00 96.24  ? 572  CYS B C    1 
ATOM   6071  O  O    . CYS B 1 11  ? -82.768  5.535   -42.263 1.00 88.39  ? 572  CYS B O    1 
ATOM   6072  C  CB   . CYS B 1 11  ? -83.554  8.408   -42.311 1.00 82.37  ? 572  CYS B CB   1 
ATOM   6073  S  SG   . CYS B 1 11  ? -84.452  8.616   -43.869 1.00 129.08 ? 572  CYS B SG   1 
ATOM   6074  H  H    . CYS B 1 11  ? -82.613  7.342   -40.164 1.00 83.24  ? 572  CYS B H    1 
ATOM   6075  H  HA   . CYS B 1 11  ? -85.074  7.459   -41.309 1.00 104.11 ? 572  CYS B HA   1 
ATOM   6076  H  HB2  . CYS B 1 11  ? -83.594  9.250   -41.831 1.00 98.84  ? 572  CYS B HB2  1 
ATOM   6077  H  HB3  . CYS B 1 11  ? -82.633  8.194   -42.526 1.00 98.84  ? 572  CYS B HB3  1 
ATOM   6078  H  HG   . CYS B 1 11  ? -83.939  9.498   -44.500 1.00 154.90 ? 572  CYS B HG   1 
ATOM   6079  N  N    . PRO B 1 12  ? -84.982  5.205   -42.418 1.00 101.52 ? 573  PRO B N    1 
ATOM   6080  C  CA   . PRO B 1 12  ? -84.774  3.911   -43.091 1.00 97.25  ? 573  PRO B CA   1 
ATOM   6081  C  C    . PRO B 1 12  ? -84.175  4.039   -44.481 1.00 97.25  ? 573  PRO B C    1 
ATOM   6082  O  O    . PRO B 1 12  ? -83.646  3.048   -45.001 1.00 83.44  ? 573  PRO B O    1 
ATOM   6083  C  CB   . PRO B 1 12  ? -86.186  3.309   -43.151 1.00 82.00  ? 573  PRO B CB   1 
ATOM   6084  C  CG   . PRO B 1 12  ? -86.997  4.087   -42.166 1.00 70.53  ? 573  PRO B CG   1 
ATOM   6085  C  CD   . PRO B 1 12  ? -86.406  5.456   -42.142 1.00 81.30  ? 573  PRO B CD   1 
ATOM   6086  H  HA   . PRO B 1 12  ? -84.207  3.340   -42.551 1.00 116.70 ? 573  PRO B HA   1 
ATOM   6087  H  HB2  . PRO B 1 12  ? -86.546  3.410   -44.046 1.00 98.40  ? 573  PRO B HB2  1 
ATOM   6088  H  HB3  . PRO B 1 12  ? -86.151  2.372   -42.901 1.00 98.40  ? 573  PRO B HB3  1 
ATOM   6089  H  HG2  . PRO B 1 12  ? -87.921  4.120   -42.461 1.00 84.64  ? 573  PRO B HG2  1 
ATOM   6090  H  HG3  . PRO B 1 12  ? -86.932  3.672   -41.292 1.00 84.64  ? 573  PRO B HG3  1 
ATOM   6091  H  HD2  . PRO B 1 12  ? -86.795  6.007   -42.839 1.00 97.56  ? 573  PRO B HD2  1 
ATOM   6092  H  HD3  . PRO B 1 12  ? -86.516  5.858   -41.266 1.00 97.56  ? 573  PRO B HD3  1 
ATOM   6093  N  N    . LYS B 1 13  ? -84.238  5.222   -45.099 1.00 100.79 ? 574  LYS B N    1 
ATOM   6094  C  CA   . LYS B 1 13  ? -83.720  5.385   -46.454 1.00 101.91 ? 574  LYS B CA   1 
ATOM   6095  C  C    . LYS B 1 13  ? -82.201  5.266   -46.498 1.00 110.62 ? 574  LYS B C    1 
ATOM   6096  O  O    . LYS B 1 13  ? -81.651  4.769   -47.487 1.00 109.53 ? 574  LYS B O    1 
ATOM   6097  C  CB   . LYS B 1 13  ? -84.164  6.733   -47.023 1.00 90.45  ? 574  LYS B CB   1 
ATOM   6098  H  H    . LYS B 1 13  ? -84.573  5.937   -44.757 1.00 120.95 ? 574  LYS B H    1 
ATOM   6099  H  HA   . LYS B 1 13  ? -84.090  4.687   -47.017 1.00 122.29 ? 574  LYS B HA   1 
ATOM   6100  N  N    . ASP B 1 14  ? -81.511  5.707   -45.446 1.00 110.12 ? 575  ASP B N    1 
ATOM   6101  C  CA   . ASP B 1 14  ? -80.058  5.602   -45.366 1.00 94.06  ? 575  ASP B CA   1 
ATOM   6102  C  C    . ASP B 1 14  ? -79.712  4.311   -44.634 1.00 99.71  ? 575  ASP B C    1 
ATOM   6103  O  O    . ASP B 1 14  ? -79.955  4.186   -43.429 1.00 93.63  ? 575  ASP B O    1 
ATOM   6104  C  CB   . ASP B 1 14  ? -79.467  6.813   -44.650 1.00 70.30  ? 575  ASP B CB   1 
ATOM   6105  H  H    . ASP B 1 14  ? -81.870  6.076   -44.757 1.00 132.15 ? 575  ASP B H    1 
ATOM   6106  H  HA   . ASP B 1 14  ? -79.685  5.559   -46.260 1.00 112.87 ? 575  ASP B HA   1 
ATOM   6107  N  N    . VAL B 1 15  ? -79.136  3.358   -45.360 1.00 102.38 ? 576  VAL B N    1 
ATOM   6108  C  CA   . VAL B 1 15  ? -78.737  2.072   -44.802 1.00 89.14  ? 576  VAL B CA   1 
ATOM   6109  C  C    . VAL B 1 15  ? -77.245  2.121   -44.519 1.00 101.61 ? 576  VAL B C    1 
ATOM   6110  O  O    . VAL B 1 15  ? -76.473  2.710   -45.287 1.00 102.26 ? 576  VAL B O    1 
ATOM   6111  C  CB   . VAL B 1 15  ? -79.085  0.913   -45.756 1.00 95.69  ? 576  VAL B CB   1 
ATOM   6112  C  CG1  . VAL B 1 15  ? -78.336  1.048   -47.084 1.00 89.22  ? 576  VAL B CG1  1 
ATOM   6113  C  CG2  . VAL B 1 15  ? -78.786  -0.430  -45.097 1.00 86.08  ? 576  VAL B CG2  1 
ATOM   6114  H  H    . VAL B 1 15  ? -78.962  3.436   -46.199 1.00 122.86 ? 576  VAL B H    1 
ATOM   6115  H  HA   . VAL B 1 15  ? -79.203  1.927   -43.964 1.00 106.97 ? 576  VAL B HA   1 
ATOM   6116  H  HB   . VAL B 1 15  ? -80.035  0.942   -45.949 1.00 114.83 ? 576  VAL B HB   1 
ATOM   6117  H  HG11 . VAL B 1 15  ? -78.577  0.304   -47.659 1.00 107.07 ? 576  VAL B HG11 1 
ATOM   6118  H  HG12 . VAL B 1 15  ? -78.586  1.886   -47.503 1.00 107.07 ? 576  VAL B HG12 1 
ATOM   6119  H  HG13 . VAL B 1 15  ? -77.382  1.036   -46.910 1.00 107.07 ? 576  VAL B HG13 1 
ATOM   6120  H  HG21 . VAL B 1 15  ? -79.012  -1.142  -45.716 1.00 103.30 ? 576  VAL B HG21 1 
ATOM   6121  H  HG22 . VAL B 1 15  ? -77.842  -0.470  -44.877 1.00 103.30 ? 576  VAL B HG22 1 
ATOM   6122  H  HG23 . VAL B 1 15  ? -79.318  -0.511  -44.290 1.00 103.30 ? 576  VAL B HG23 1 
ATOM   6123  N  N    . LEU B 1 16  ? -76.837  1.507   -43.409 1.00 84.23  ? 577  LEU B N    1 
ATOM   6124  C  CA   . LEU B 1 16  ? -75.442  1.484   -42.995 1.00 77.61  ? 577  LEU B CA   1 
ATOM   6125  C  C    . LEU B 1 16  ? -74.842  0.089   -43.104 1.00 85.35  ? 577  LEU B C    1 
ATOM   6126  O  O    . LEU B 1 16  ? -73.896  -0.115  -43.867 1.00 88.50  ? 577  LEU B O    1 
ATOM   6127  C  CB   . LEU B 1 16  ? -75.305  2.026   -41.565 1.00 86.28  ? 577  LEU B CB   1 
ATOM   6128  C  CG   . LEU B 1 16  ? -74.940  3.515   -41.501 1.00 74.12  ? 577  LEU B CG   1 
ATOM   6129  C  CD1  . LEU B 1 16  ? -75.108  4.065   -40.102 1.00 68.34  ? 577  LEU B CD1  1 
ATOM   6130  C  CD2  . LEU B 1 16  ? -73.512  3.742   -41.985 1.00 71.31  ? 577  LEU B CD2  1 
ATOM   6131  H  H    . LEU B 1 16  ? -77.363  1.089   -42.872 1.00 101.08 ? 577  LEU B H    1 
ATOM   6132  H  HA   . LEU B 1 16  ? -74.935  2.068   -43.581 1.00 93.14  ? 577  LEU B HA   1 
ATOM   6133  H  HB2  . LEU B 1 16  ? -76.150  1.908   -41.103 1.00 103.54 ? 577  LEU B HB2  1 
ATOM   6134  H  HB3  . LEU B 1 16  ? -74.608  1.530   -41.108 1.00 103.54 ? 577  LEU B HB3  1 
ATOM   6135  H  HG   . LEU B 1 16  ? -75.535  4.008   -42.088 1.00 88.94  ? 577  LEU B HG   1 
ATOM   6136  H  HD11 . LEU B 1 16  ? -74.869  5.005   -40.102 1.00 82.01  ? 577  LEU B HD11 1 
ATOM   6137  H  HD12 . LEU B 1 16  ? -76.033  3.959   -39.830 1.00 82.01  ? 577  LEU B HD12 1 
ATOM   6138  H  HD13 . LEU B 1 16  ? -74.527  3.576   -39.498 1.00 82.01  ? 577  LEU B HD13 1 
ATOM   6139  H  HD21 . LEU B 1 16  ? -73.309  4.689   -41.933 1.00 85.57  ? 577  LEU B HD21 1 
ATOM   6140  H  HD22 . LEU B 1 16  ? -72.904  3.242   -41.418 1.00 85.57  ? 577  LEU B HD22 1 
ATOM   6141  H  HD23 . LEU B 1 16  ? -73.438  3.436   -42.902 1.00 85.57  ? 577  LEU B HD23 1 
ATOM   6142  N  N    . GLY B 1 17  ? -75.353  -0.872  -42.347 1.00 79.89  ? 578  GLY B N    1 
ATOM   6143  C  CA   . GLY B 1 17  ? -74.777  -2.198  -42.375 1.00 87.48  ? 578  GLY B CA   1 
ATOM   6144  C  C    . GLY B 1 17  ? -75.681  -3.215  -41.715 1.00 93.19  ? 578  GLY B C    1 
ATOM   6145  O  O    . GLY B 1 17  ? -76.859  -2.958  -41.458 1.00 81.43  ? 578  GLY B O    1 
ATOM   6146  H  H    . GLY B 1 17  ? -76.024  -0.781  -41.817 1.00 95.87  ? 578  GLY B H    1 
ATOM   6147  H  HA2  . GLY B 1 17  ? -74.626  -2.469  -43.294 1.00 104.98 ? 578  GLY B HA2  1 
ATOM   6148  H  HA3  . GLY B 1 17  ? -73.926  -2.193  -41.910 1.00 104.98 ? 578  GLY B HA3  1 
ATOM   6149  N  N    . HIS B 1 18  ? -75.102  -4.390  -41.456 1.00 91.01  ? 579  HIS B N    1 
ATOM   6150  C  CA   . HIS B 1 18  ? -75.820  -5.515  -40.874 1.00 90.39  ? 579  HIS B CA   1 
ATOM   6151  C  C    . HIS B 1 18  ? -74.962  -6.173  -39.803 1.00 87.75  ? 579  HIS B C    1 
ATOM   6152  O  O    . HIS B 1 18  ? -73.755  -6.356  -39.985 1.00 59.19  ? 579  HIS B O    1 
ATOM   6153  C  CB   . HIS B 1 18  ? -76.197  -6.551  -41.946 1.00 70.29  ? 579  HIS B CB   1 
ATOM   6154  C  CG   . HIS B 1 18  ? -76.751  -5.947  -43.199 1.00 84.02  ? 579  HIS B CG   1 
ATOM   6155  N  ND1  . HIS B 1 18  ? -75.956  -5.591  -44.267 1.00 98.41  ? 579  HIS B ND1  1 
ATOM   6156  C  CD2  . HIS B 1 18  ? -78.019  -5.624  -43.549 1.00 73.37  ? 579  HIS B CD2  1 
ATOM   6157  C  CE1  . HIS B 1 18  ? -76.710  -5.081  -45.224 1.00 89.80  ? 579  HIS B CE1  1 
ATOM   6158  N  NE2  . HIS B 1 18  ? -77.966  -5.089  -44.814 1.00 93.58  ? 579  HIS B NE2  1 
ATOM   6159  H  H    . HIS B 1 18  ? -74.274  -4.559  -41.614 1.00 109.21 ? 579  HIS B H    1 
ATOM   6160  H  HA   . HIS B 1 18  ? -76.636  -5.196  -40.459 1.00 108.46 ? 579  HIS B HA   1 
ATOM   6161  H  HB2  . HIS B 1 18  ? -75.404  -7.056  -42.186 1.00 84.35  ? 579  HIS B HB2  1 
ATOM   6162  H  HB3  . HIS B 1 18  ? -76.869  -7.148  -41.582 1.00 84.35  ? 579  HIS B HB3  1 
ATOM   6163  H  HD1  . HIS B 1 18  ? -75.102  -5.689  -44.306 1.00 118.10 ? 579  HIS B HD1  1 
ATOM   6164  H  HD2  . HIS B 1 18  ? -78.782  -5.744  -43.032 1.00 88.04  ? 579  HIS B HD2  1 
ATOM   6165  H  HE1  . HIS B 1 18  ? -76.409  -4.769  -46.047 1.00 107.77 ? 579  HIS B HE1  1 
ATOM   6166  H  HE2  . HIS B 1 18  ? -78.641  -4.806  -45.265 1.00 112.29 ? 579  HIS B HE2  1 
ATOM   6167  N  N    . GLY B 1 19  ? -75.597  -6.511  -38.678 1.00 91.36  ? 580  GLY B N    1 
ATOM   6168  C  CA   . GLY B 1 19  ? -74.956  -7.248  -37.613 1.00 89.69  ? 580  GLY B CA   1 
ATOM   6169  C  C    . GLY B 1 19  ? -75.403  -8.705  -37.579 1.00 92.02  ? 580  GLY B C    1 
ATOM   6170  O  O    . GLY B 1 19  ? -76.252  -9.152  -38.345 1.00 99.46  ? 580  GLY B O    1 
ATOM   6171  H  H    . GLY B 1 19  ? -76.418  -6.315  -38.514 1.00 109.63 ? 580  GLY B H    1 
ATOM   6172  H  HA2  . GLY B 1 19  ? -73.994  -7.223  -37.734 1.00 107.63 ? 580  GLY B HA2  1 
ATOM   6173  H  HA3  . GLY B 1 19  ? -75.171  -6.840  -36.760 1.00 107.63 ? 580  GLY B HA3  1 
ATOM   6174  N  N    . ALA B 1 20  ? -74.801  -9.450  -36.657 1.00 89.61  ? 581  ALA B N    1 
ATOM   6175  C  CA   . ALA B 1 20  ? -75.126  -10.859 -36.493 1.00 104.55 ? 581  ALA B CA   1 
ATOM   6176  C  C    . ALA B 1 20  ? -76.525  -11.023 -35.901 1.00 99.57  ? 581  ALA B C    1 
ATOM   6177  O  O    . ALA B 1 20  ? -77.097  -10.097 -35.319 1.00 93.90  ? 581  ALA B O    1 
ATOM   6178  C  CB   . ALA B 1 20  ? -74.089  -11.549 -35.605 1.00 80.29  ? 581  ALA B CB   1 
ATOM   6179  H  H    . ALA B 1 20  ? -74.200  -9.161  -36.114 1.00 107.53 ? 581  ALA B H    1 
ATOM   6180  H  HA   . ALA B 1 20  ? -75.113  -11.291 -37.362 1.00 125.46 ? 581  ALA B HA   1 
ATOM   6181  H  HB1  . ALA B 1 20  ? -74.327  -12.484 -35.511 1.00 96.35  ? 581  ALA B HB1  1 
ATOM   6182  H  HB2  . ALA B 1 20  ? -73.216  -11.469 -36.019 1.00 96.35  ? 581  ALA B HB2  1 
ATOM   6183  H  HB3  . ALA B 1 20  ? -74.084  -11.120 -34.735 1.00 96.35  ? 581  ALA B HB3  1 
ATOM   6184  N  N    . GLU B 1 21  ? -77.083  -12.222 -36.076 1.00 84.39  ? 582  GLU B N    1 
ATOM   6185  C  CA   . GLU B 1 21  ? -78.417  -12.549 -35.571 1.00 92.80  ? 582  GLU B CA   1 
ATOM   6186  C  C    . GLU B 1 21  ? -79.499  -11.731 -36.278 1.00 97.01  ? 582  GLU B C    1 
ATOM   6187  O  O    . GLU B 1 21  ? -80.475  -11.304 -35.659 1.00 99.27  ? 582  GLU B O    1 
ATOM   6188  C  CB   . GLU B 1 21  ? -78.497  -12.351 -34.054 1.00 64.27  ? 582  GLU B CB   1 
ATOM   6189  H  H    . GLU B 1 21  ? -76.703  -12.872 -36.492 1.00 101.26 ? 582  GLU B H    1 
ATOM   6190  H  HA   . GLU B 1 21  ? -78.593  -13.485 -35.753 1.00 111.36 ? 582  GLU B HA   1 
ATOM   6191  N  N    . GLY B 1 22  ? -79.324  -11.511 -37.578 1.00 84.14  ? 583  GLY B N    1 
ATOM   6192  C  CA   . GLY B 1 22  ? -80.339  -10.830 -38.371 1.00 94.14  ? 583  GLY B CA   1 
ATOM   6193  C  C    . GLY B 1 22  ? -80.586  -9.399  -37.944 1.00 103.85 ? 583  GLY B C    1 
ATOM   6194  O  O    . GLY B 1 22  ? -81.737  -8.944  -37.932 1.00 93.72  ? 583  GLY B O    1 
ATOM   6195  H  H    . GLY B 1 22  ? -78.627  -11.747 -38.023 1.00 100.97 ? 583  GLY B H    1 
ATOM   6196  H  HA2  . GLY B 1 22  ? -80.066  -10.825 -39.302 1.00 112.97 ? 583  GLY B HA2  1 
ATOM   6197  H  HA3  . GLY B 1 22  ? -81.176  -11.315 -38.302 1.00 112.97 ? 583  GLY B HA3  1 
ATOM   6198  N  N    . THR B 1 23  ? -79.525  -8.677  -37.598 1.00 100.73 ? 584  THR B N    1 
ATOM   6199  C  CA   . THR B 1 23  ? -79.618  -7.308  -37.112 1.00 94.27  ? 584  THR B CA   1 
ATOM   6200  C  C    . THR B 1 23  ? -79.356  -6.335  -38.256 1.00 90.91  ? 584  THR B C    1 
ATOM   6201  O  O    . THR B 1 23  ? -78.418  -6.517  -39.038 1.00 87.45  ? 584  THR B O    1 
ATOM   6202  C  CB   . THR B 1 23  ? -78.616  -7.072  -35.977 1.00 86.83  ? 584  THR B CB   1 
ATOM   6203  O  OG1  . THR B 1 23  ? -78.741  -8.113  -35.000 1.00 98.00  ? 584  THR B OG1  1 
ATOM   6204  C  CG2  . THR B 1 23  ? -78.863  -5.744  -35.300 1.00 90.03  ? 584  THR B CG2  1 
ATOM   6205  H  H    . THR B 1 23  ? -78.717  -8.969  -37.637 1.00 120.88 ? 584  THR B H    1 
ATOM   6206  H  HA   . THR B 1 23  ? -80.512  -7.146  -36.771 1.00 113.12 ? 584  THR B HA   1 
ATOM   6207  H  HB   . THR B 1 23  ? -77.715  -7.071  -36.336 1.00 104.20 ? 584  THR B HB   1 
ATOM   6208  H  HG1  . THR B 1 23  ? -78.585  -8.859  -35.353 1.00 117.60 ? 584  THR B HG1  1 
ATOM   6209  H  HG21 . THR B 1 23  ? -78.220  -5.612  -34.585 1.00 108.03 ? 584  THR B HG21 1 
ATOM   6210  H  HG22 . THR B 1 23  ? -78.773  -5.022  -35.942 1.00 108.03 ? 584  THR B HG22 1 
ATOM   6211  H  HG23 . THR B 1 23  ? -79.758  -5.723  -34.927 1.00 108.03 ? 584  THR B HG23 1 
ATOM   6212  N  N    . ILE B 1 24  ? -80.194  -5.301  -38.346 1.00 81.54  ? 585  ILE B N    1 
ATOM   6213  C  CA   . ILE B 1 24  ? -80.086  -4.267  -39.372 1.00 86.73  ? 585  ILE B CA   1 
ATOM   6214  C  C    . ILE B 1 24  ? -79.673  -2.963  -38.702 1.00 86.79  ? 585  ILE B C    1 
ATOM   6215  O  O    . ILE B 1 24  ? -80.149  -2.641  -37.606 1.00 81.59  ? 585  ILE B O    1 
ATOM   6216  C  CB   . ILE B 1 24  ? -81.411  -4.082  -40.139 1.00 87.73  ? 585  ILE B CB   1 
ATOM   6217  C  CG1  . ILE B 1 24  ? -82.015  -5.439  -40.517 1.00 100.86 ? 585  ILE B CG1  1 
ATOM   6218  C  CG2  . ILE B 1 24  ? -81.178  -3.229  -41.380 1.00 82.78  ? 585  ILE B CG2  1 
ATOM   6219  C  CD1  . ILE B 1 24  ? -83.438  -5.353  -41.039 1.00 101.44 ? 585  ILE B CD1  1 
ATOM   6220  H  H    . ILE B 1 24  ? -80.852  -5.175  -37.807 1.00 97.85  ? 585  ILE B H    1 
ATOM   6221  H  HA   . ILE B 1 24  ? -79.397  -4.515  -40.008 1.00 104.08 ? 585  ILE B HA   1 
ATOM   6222  H  HB   . ILE B 1 24  ? -82.037  -3.619  -39.561 1.00 105.27 ? 585  ILE B HB   1 
ATOM   6223  H  HG12 . ILE B 1 24  ? -81.469  -5.841  -41.211 1.00 121.04 ? 585  ILE B HG12 1 
ATOM   6224  H  HG13 . ILE B 1 24  ? -82.021  -6.009  -39.732 1.00 121.04 ? 585  ILE B HG13 1 
ATOM   6225  H  HG21 . ILE B 1 24  ? -82.019  -3.122  -41.852 1.00 99.34  ? 585  ILE B HG21 1 
ATOM   6226  H  HG22 . ILE B 1 24  ? -80.838  -2.363  -41.108 1.00 99.34  ? 585  ILE B HG22 1 
ATOM   6227  H  HG23 . ILE B 1 24  ? -80.532  -3.674  -41.952 1.00 99.34  ? 585  ILE B HG23 1 
ATOM   6228  H  HD11 . ILE B 1 24  ? -83.749  -6.246  -41.255 1.00 121.72 ? 585  ILE B HD11 1 
ATOM   6229  H  HD12 . ILE B 1 24  ? -84.002  -4.963  -40.352 1.00 121.72 ? 585  ILE B HD12 1 
ATOM   6230  H  HD13 . ILE B 1 24  ? -83.450  -4.796  -41.833 1.00 121.72 ? 585  ILE B HD13 1 
ATOM   6231  N  N    . VAL B 1 25  ? -78.797  -2.210  -39.366 1.00 77.28  ? 586  VAL B N    1 
ATOM   6232  C  CA   . VAL B 1 25  ? -78.229  -0.981  -38.818 1.00 85.44  ? 586  VAL B CA   1 
ATOM   6233  C  C    . VAL B 1 25  ? -78.493  0.158   -39.793 1.00 74.04  ? 586  VAL B C    1 
ATOM   6234  O  O    . VAL B 1 25  ? -78.113  0.073   -40.968 1.00 76.56  ? 586  VAL B O    1 
ATOM   6235  C  CB   . VAL B 1 25  ? -76.718  -1.124  -38.550 1.00 80.08  ? 586  VAL B CB   1 
ATOM   6236  C  CG1  . VAL B 1 25  ? -76.123  0.199   -38.062 1.00 70.45  ? 586  VAL B CG1  1 
ATOM   6237  C  CG2  . VAL B 1 25  ? -76.458  -2.227  -37.534 1.00 84.93  ? 586  VAL B CG2  1 
ATOM   6238  H  H    . VAL B 1 25  ? -78.510  -2.395  -40.155 1.00 92.73  ? 586  VAL B H    1 
ATOM   6239  H  HA   . VAL B 1 25  ? -78.668  -0.772  -37.979 1.00 102.52 ? 586  VAL B HA   1 
ATOM   6240  H  HB   . VAL B 1 25  ? -76.272  -1.367  -39.377 1.00 96.09  ? 586  VAL B HB   1 
ATOM   6241  H  HG11 . VAL B 1 25  ? -75.174  0.078   -37.903 1.00 84.54  ? 586  VAL B HG11 1 
ATOM   6242  H  HG12 . VAL B 1 25  ? -76.261  0.876   -38.743 1.00 84.54  ? 586  VAL B HG12 1 
ATOM   6243  H  HG13 . VAL B 1 25  ? -76.567  0.459   -37.240 1.00 84.54  ? 586  VAL B HG13 1 
ATOM   6244  H  HG21 . VAL B 1 25  ? -75.503  -2.298  -37.382 1.00 101.91 ? 586  VAL B HG21 1 
ATOM   6245  H  HG22 . VAL B 1 25  ? -76.910  -2.004  -36.705 1.00 101.91 ? 586  VAL B HG22 1 
ATOM   6246  H  HG23 . VAL B 1 25  ? -76.801  -3.065  -37.883 1.00 101.91 ? 586  VAL B HG23 1 
ATOM   6247  N  N    . TYR B 1 26  ? -79.119  1.226   -39.301 1.00 65.87  ? 587  TYR B N    1 
ATOM   6248  C  CA   . TYR B 1 26  ? -79.403  2.419   -40.091 1.00 64.34  ? 587  TYR B CA   1 
ATOM   6249  C  C    . TYR B 1 26  ? -78.631  3.610   -39.531 1.00 60.74  ? 587  TYR B C    1 
ATOM   6250  O  O    . TYR B 1 26  ? -77.975  3.527   -38.491 1.00 63.62  ? 587  TYR B O    1 
ATOM   6251  C  CB   . TYR B 1 26  ? -80.902  2.731   -40.099 1.00 68.19  ? 587  TYR B CB   1 
ATOM   6252  C  CG   . TYR B 1 26  ? -81.791  1.528   -40.312 1.00 85.96  ? 587  TYR B CG   1 
ATOM   6253  C  CD1  . TYR B 1 26  ? -82.227  0.765   -39.236 1.00 63.76  ? 587  TYR B CD1  1 
ATOM   6254  C  CD2  . TYR B 1 26  ? -82.204  1.162   -41.586 1.00 86.54  ? 587  TYR B CD2  1 
ATOM   6255  C  CE1  . TYR B 1 26  ? -83.042  -0.333  -39.423 1.00 83.30  ? 587  TYR B CE1  1 
ATOM   6256  C  CE2  . TYR B 1 26  ? -83.020  0.064   -41.783 1.00 87.33  ? 587  TYR B CE2  1 
ATOM   6257  C  CZ   . TYR B 1 26  ? -83.436  -0.680  -40.697 1.00 91.46  ? 587  TYR B CZ   1 
ATOM   6258  O  OH   . TYR B 1 26  ? -84.249  -1.777  -40.882 1.00 102.65 ? 587  TYR B OH   1 
ATOM   6259  H  H    . TYR B 1 26  ? -79.396  1.282   -38.489 1.00 79.05  ? 587  TYR B H    1 
ATOM   6260  H  HA   . TYR B 1 26  ? -79.117  2.273   -41.006 1.00 77.20  ? 587  TYR B HA   1 
ATOM   6261  H  HB2  . TYR B 1 26  ? -81.141  3.127   -39.247 1.00 81.83  ? 587  TYR B HB2  1 
ATOM   6262  H  HB3  . TYR B 1 26  ? -81.084  3.361   -40.814 1.00 81.83  ? 587  TYR B HB3  1 
ATOM   6263  H  HD1  . TYR B 1 26  ? -81.962  0.996   -38.375 1.00 76.51  ? 587  TYR B HD1  1 
ATOM   6264  H  HD2  . TYR B 1 26  ? -81.925  1.661   -42.319 1.00 103.85 ? 587  TYR B HD2  1 
ATOM   6265  H  HE1  . TYR B 1 26  ? -83.323  -0.836  -38.693 1.00 99.96  ? 587  TYR B HE1  1 
ATOM   6266  H  HE2  . TYR B 1 26  ? -83.287  -0.172  -42.642 1.00 104.80 ? 587  TYR B HE2  1 
ATOM   6267  H  HH   . TYR B 1 26  ? -84.423  -2.133  -40.142 1.00 123.18 ? 587  TYR B HH   1 
ATOM   6268  N  N    . ARG B 1 27  ? -78.760  4.738   -40.221 1.00 65.91  ? 588  ARG B N    1 
ATOM   6269  C  CA   . ARG B 1 27  ? -78.149  6.002   -39.831 1.00 53.11  ? 588  ARG B CA   1 
ATOM   6270  C  C    . ARG B 1 27  ? -79.176  6.816   -39.051 1.00 65.55  ? 588  ARG B C    1 
ATOM   6271  O  O    . ARG B 1 27  ? -80.310  6.986   -39.509 1.00 66.17  ? 588  ARG B O    1 
ATOM   6272  C  CB   . ARG B 1 27  ? -77.684  6.763   -41.074 1.00 51.60  ? 588  ARG B CB   1 
ATOM   6273  C  CG   . ARG B 1 27  ? -77.000  8.095   -40.823 1.00 72.03  ? 588  ARG B CG   1 
ATOM   6274  C  CD   . ARG B 1 27  ? -75.533  7.928   -40.486 1.00 69.36  ? 588  ARG B CD   1 
ATOM   6275  N  NE   . ARG B 1 27  ? -74.752  9.099   -40.875 1.00 73.66  ? 588  ARG B NE   1 
ATOM   6276  C  CZ   . ARG B 1 27  ? -74.853  10.295  -40.302 1.00 84.51  ? 588  ARG B CZ   1 
ATOM   6277  N  NH1  . ARG B 1 27  ? -75.715  10.498  -39.311 1.00 76.48  ? 588  ARG B NH1  1 
ATOM   6278  N  NH2  . ARG B 1 27  ? -74.094  11.298  -40.727 1.00 75.48  ? 588  ARG B NH2  1 
ATOM   6279  H  H    . ARG B 1 27  ? -79.216  4.796   -40.948 1.00 79.10  ? 588  ARG B H    1 
ATOM   6280  H  HA   . ARG B 1 27  ? -77.383  5.836   -39.260 1.00 63.74  ? 588  ARG B HA   1 
ATOM   6281  H  HB2  . ARG B 1 27  ? -77.056  6.203   -41.557 1.00 61.92  ? 588  ARG B HB2  1 
ATOM   6282  H  HB3  . ARG B 1 27  ? -78.457  6.936   -41.633 1.00 61.92  ? 588  ARG B HB3  1 
ATOM   6283  H  HG2  . ARG B 1 27  ? -77.067  8.642   -41.621 1.00 86.44  ? 588  ARG B HG2  1 
ATOM   6284  H  HG3  . ARG B 1 27  ? -77.433  8.539   -40.077 1.00 86.44  ? 588  ARG B HG3  1 
ATOM   6285  H  HD2  . ARG B 1 27  ? -75.438  7.804   -39.529 1.00 83.23  ? 588  ARG B HD2  1 
ATOM   6286  H  HD3  . ARG B 1 27  ? -75.182  7.158   -40.961 1.00 83.23  ? 588  ARG B HD3  1 
ATOM   6287  H  HE   . ARG B 1 27  ? -74.189  9.009   -41.518 1.00 88.39  ? 588  ARG B HE   1 
ATOM   6288  H  HH11 . ARG B 1 27  ? -76.208  9.852   -39.032 1.00 91.77  ? 588  ARG B HH11 1 
ATOM   6289  H  HH12 . ARG B 1 27  ? -75.776  11.274  -38.947 1.00 91.77  ? 588  ARG B HH12 1 
ATOM   6290  H  HH21 . ARG B 1 27  ? -73.537  11.172  -41.370 1.00 90.57  ? 588  ARG B HH21 1 
ATOM   6291  H  HH22 . ARG B 1 27  ? -74.160  12.073  -40.360 1.00 90.57  ? 588  ARG B HH22 1 
ATOM   6292  N  N    . GLY B 1 28  ? -78.781  7.321   -37.887 1.00 51.38  ? 589  GLY B N    1 
ATOM   6293  C  CA   . GLY B 1 28  ? -79.732  7.953   -36.999 1.00 52.85  ? 589  GLY B CA   1 
ATOM   6294  C  C    . GLY B 1 28  ? -79.076  8.922   -36.039 1.00 52.98  ? 589  GLY B C    1 
ATOM   6295  O  O    . GLY B 1 28  ? -77.892  9.245   -36.158 1.00 48.21  ? 589  GLY B O    1 
ATOM   6296  H  H    . GLY B 1 28  ? -77.973  7.307   -37.594 1.00 61.65  ? 589  GLY B H    1 
ATOM   6297  H  HA2  . GLY B 1 28  ? -80.389  8.438   -37.523 1.00 63.42  ? 589  GLY B HA2  1 
ATOM   6298  H  HA3  . GLY B 1 28  ? -80.192  7.274   -36.483 1.00 63.42  ? 589  GLY B HA3  1 
ATOM   6299  N  N    . MET B 1 29  ? -79.879  9.406   -35.091 1.00 47.09  ? 590  MET B N    1 
ATOM   6300  C  CA   . MET B 1 29  ? -79.428  10.402  -34.131 1.00 44.95  ? 590  MET B CA   1 
ATOM   6301  C  C    . MET B 1 29  ? -79.980  10.097  -32.747 1.00 42.01  ? 590  MET B C    1 
ATOM   6302  O  O    . MET B 1 29  ? -81.096  9.588   -32.609 1.00 57.14  ? 590  MET B O    1 
ATOM   6303  C  CB   . MET B 1 29  ? -79.849  11.816  -34.558 1.00 60.92  ? 590  MET B CB   1 
ATOM   6304  C  CG   . MET B 1 29  ? -79.075  12.359  -35.752 1.00 71.84  ? 590  MET B CG   1 
ATOM   6305  S  SD   . MET B 1 29  ? -79.069  14.161  -35.806 1.00 84.27  ? 590  MET B SD   1 
ATOM   6306  C  CE   . MET B 1 29  ? -80.821  14.500  -35.964 1.00 97.32  ? 590  MET B CE   1 
ATOM   6307  H  H    . MET B 1 29  ? -80.699  9.169   -34.986 1.00 56.51  ? 590  MET B H    1 
ATOM   6308  H  HA   . MET B 1 29  ? -78.459  10.381  -34.092 1.00 53.94  ? 590  MET B HA   1 
ATOM   6309  H  HB2  . MET B 1 29  ? -80.789  11.803  -34.796 1.00 73.10  ? 590  MET B HB2  1 
ATOM   6310  H  HB3  . MET B 1 29  ? -79.707  12.421  -33.813 1.00 73.10  ? 590  MET B HB3  1 
ATOM   6311  H  HG2  . MET B 1 29  ? -78.155  12.057  -35.697 1.00 86.21  ? 590  MET B HG2  1 
ATOM   6312  H  HG3  . MET B 1 29  ? -79.484  12.035  -36.569 1.00 86.21  ? 590  MET B HG3  1 
ATOM   6313  H  HE1  . MET B 1 29  ? -80.954  15.460  -36.004 1.00 116.79 ? 590  MET B HE1  1 
ATOM   6314  H  HE2  . MET B 1 29  ? -81.151  14.086  -36.777 1.00 116.79 ? 590  MET B HE2  1 
ATOM   6315  H  HE3  . MET B 1 29  ? -81.284  14.134  -35.194 1.00 116.79 ? 590  MET B HE3  1 
ATOM   6316  N  N    . PHE B 1 30  ? -79.170  10.382  -31.728 1.00 46.85  ? 591  PHE B N    1 
ATOM   6317  C  CA   . PHE B 1 30  ? -79.579  10.289  -30.332 1.00 39.97  ? 591  PHE B CA   1 
ATOM   6318  C  C    . PHE B 1 30  ? -78.929  11.424  -29.559 1.00 48.73  ? 591  PHE B C    1 
ATOM   6319  O  O    . PHE B 1 30  ? -77.713  11.615  -29.655 1.00 47.83  ? 591  PHE B O    1 
ATOM   6320  C  CB   . PHE B 1 30  ? -79.180  8.939   -29.723 1.00 45.41  ? 591  PHE B CB   1 
ATOM   6321  C  CG   . PHE B 1 30  ? -79.073  8.962   -28.226 1.00 45.27  ? 591  PHE B CG   1 
ATOM   6322  C  CD1  . PHE B 1 30  ? -80.204  8.853   -27.436 1.00 48.75  ? 591  PHE B CD1  1 
ATOM   6323  C  CD2  . PHE B 1 30  ? -77.840  9.100   -27.608 1.00 50.59  ? 591  PHE B CD2  1 
ATOM   6324  C  CE1  . PHE B 1 30  ? -80.107  8.876   -26.057 1.00 46.60  ? 591  PHE B CE1  1 
ATOM   6325  C  CE2  . PHE B 1 30  ? -77.739  9.127   -26.229 1.00 44.52  ? 591  PHE B CE2  1 
ATOM   6326  C  CZ   . PHE B 1 30  ? -78.873  9.012   -25.454 1.00 49.75  ? 591  PHE B CZ   1 
ATOM   6327  H  H    . PHE B 1 30  ? -78.356  10.639  -31.827 1.00 56.21  ? 591  PHE B H    1 
ATOM   6328  H  HA   . PHE B 1 30  ? -80.542  10.384  -30.269 1.00 47.97  ? 591  PHE B HA   1 
ATOM   6329  H  HB2  . PHE B 1 30  ? -79.848  8.277   -29.962 1.00 54.49  ? 591  PHE B HB2  1 
ATOM   6330  H  HB3  . PHE B 1 30  ? -78.316  8.678   -30.078 1.00 54.49  ? 591  PHE B HB3  1 
ATOM   6331  H  HD1  . PHE B 1 30  ? -81.037  8.760   -27.837 1.00 58.50  ? 591  PHE B HD1  1 
ATOM   6332  H  HD2  . PHE B 1 30  ? -77.072  9.176   -28.127 1.00 60.71  ? 591  PHE B HD2  1 
ATOM   6333  H  HE1  . PHE B 1 30  ? -80.874  8.800   -25.536 1.00 55.92  ? 591  PHE B HE1  1 
ATOM   6334  H  HE2  . PHE B 1 30  ? -76.906  9.218   -25.825 1.00 53.43  ? 591  PHE B HE2  1 
ATOM   6335  H  HZ   . PHE B 1 30  ? -78.808  9.029   -24.527 1.00 59.71  ? 591  PHE B HZ   1 
ATOM   6336  N  N    . ASP B 1 31  ? -79.726  12.148  -28.772 1.00 44.38  ? 592  ASP B N    1 
ATOM   6337  C  CA   . ASP B 1 31  ? -79.220  13.242  -27.941 1.00 53.86  ? 592  ASP B CA   1 
ATOM   6338  C  C    . ASP B 1 31  ? -78.372  14.215  -28.763 1.00 57.32  ? 592  ASP B C    1 
ATOM   6339  O  O    . ASP B 1 31  ? -77.340  14.718  -28.307 1.00 52.06  ? 592  ASP B O    1 
ATOM   6340  C  CB   . ASP B 1 31  ? -78.427  12.691  -26.755 1.00 57.83  ? 592  ASP B CB   1 
ATOM   6341  C  CG   . ASP B 1 31  ? -78.144  13.741  -25.701 1.00 59.92  ? 592  ASP B CG   1 
ATOM   6342  O  OD1  . ASP B 1 31  ? -79.093  14.152  -25.002 1.00 55.79  ? 592  ASP B OD1  1 
ATOM   6343  O  OD2  . ASP B 1 31  ? -76.969  14.146  -25.567 1.00 64.73  ? 592  ASP B OD2  1 
ATOM   6344  H  H    . ASP B 1 31  ? -80.574  12.024  -28.702 1.00 53.25  ? 592  ASP B H    1 
ATOM   6345  H  HA   . ASP B 1 31  ? -79.974  13.737  -27.586 1.00 64.64  ? 592  ASP B HA   1 
ATOM   6346  H  HB2  . ASP B 1 31  ? -78.936  11.978  -26.339 1.00 69.40  ? 592  ASP B HB2  1 
ATOM   6347  H  HB3  . ASP B 1 31  ? -77.577  12.349  -27.074 1.00 69.40  ? 592  ASP B HB3  1 
ATOM   6348  N  N    . ASN B 1 32  ? -78.819  14.483  -29.992 1.00 53.78  ? 593  ASN B N    1 
ATOM   6349  C  CA   . ASN B 1 32  ? -78.139  15.406  -30.902 1.00 48.59  ? 593  ASN B CA   1 
ATOM   6350  C  C    . ASN B 1 32  ? -76.753  14.903  -31.299 1.00 62.99  ? 593  ASN B C    1 
ATOM   6351  O  O    . ASN B 1 32  ? -75.878  15.691  -31.666 1.00 53.76  ? 593  ASN B O    1 
ATOM   6352  C  CB   . ASN B 1 32  ? -78.040  16.805  -30.294 1.00 44.62  ? 593  ASN B CB   1 
ATOM   6353  C  CG   . ASN B 1 32  ? -79.352  17.274  -29.701 1.00 69.39  ? 593  ASN B CG   1 
ATOM   6354  O  OD1  . ASN B 1 32  ? -80.416  17.096  -30.295 1.00 65.17  ? 593  ASN B OD1  1 
ATOM   6355  N  ND2  . ASN B 1 32  ? -79.285  17.866  -28.516 1.00 90.26  ? 593  ASN B ND2  1 
ATOM   6356  H  H    . ASN B 1 32  ? -79.530  14.135  -30.328 1.00 64.53  ? 593  ASN B H    1 
ATOM   6357  H  HA   . ASN B 1 32  ? -78.665  15.478  -31.714 1.00 58.31  ? 593  ASN B HA   1 
ATOM   6358  H  HB2  . ASN B 1 32  ? -77.376  16.797  -29.586 1.00 53.55  ? 593  ASN B HB2  1 
ATOM   6359  H  HB3  . ASN B 1 32  ? -77.780  17.434  -30.985 1.00 53.55  ? 593  ASN B HB3  1 
ATOM   6360  H  HD21 . ASN B 1 32  ? -78.524  17.966  -28.128 1.00 108.31 ? 593  ASN B HD21 1 
ATOM   6361  H  HD22 . ASN B 1 32  ? -80.002  18.150  -28.136 1.00 108.31 ? 593  ASN B HD22 1 
ATOM   6362  N  N    . ARG B 1 33  ? -76.545  13.589  -31.239 1.00 52.22  ? 594  ARG B N    1 
ATOM   6363  C  CA   . ARG B 1 33  ? -75.342  12.951  -31.758 1.00 47.53  ? 594  ARG B CA   1 
ATOM   6364  C  C    . ARG B 1 33  ? -75.668  12.214  -33.048 1.00 52.69  ? 594  ARG B C    1 
ATOM   6365  O  O    . ARG B 1 33  ? -76.755  11.652  -33.203 1.00 53.17  ? 594  ARG B O    1 
ATOM   6366  C  CB   . ARG B 1 33  ? -74.748  11.934  -30.773 1.00 58.32  ? 594  ARG B CB   1 
ATOM   6367  C  CG   . ARG B 1 33  ? -74.234  12.478  -29.449 1.00 63.75  ? 594  ARG B CG   1 
ATOM   6368  C  CD   . ARG B 1 33  ? -73.595  11.342  -28.655 1.00 51.39  ? 594  ARG B CD   1 
ATOM   6369  N  NE   . ARG B 1 33  ? -73.329  11.679  -27.256 1.00 48.00  ? 594  ARG B NE   1 
ATOM   6370  C  CZ   . ARG B 1 33  ? -72.149  12.055  -26.770 1.00 57.60  ? 594  ARG B CZ   1 
ATOM   6371  N  NH1  . ARG B 1 33  ? -71.087  12.162  -27.563 1.00 56.21  ? 594  ARG B NH1  1 
ATOM   6372  N  NH2  . ARG B 1 33  ? -72.032  12.331  -25.477 1.00 56.75  ? 594  ARG B NH2  1 
ATOM   6373  H  H    . ARG B 1 33  ? -77.102  13.034  -30.893 1.00 62.66  ? 594  ARG B H    1 
ATOM   6374  H  HA   . ARG B 1 33  ? -74.672  13.626  -31.948 1.00 57.03  ? 594  ARG B HA   1 
ATOM   6375  H  HB2  . ARG B 1 33  ? -75.433  11.279  -30.566 1.00 69.98  ? 594  ARG B HB2  1 
ATOM   6376  H  HB3  . ARG B 1 33  ? -74.004  11.491  -31.209 1.00 69.98  ? 594  ARG B HB3  1 
ATOM   6377  H  HG2  . ARG B 1 33  ? -73.563  13.159  -29.614 1.00 76.50  ? 594  ARG B HG2  1 
ATOM   6378  H  HG3  . ARG B 1 33  ? -74.973  12.841  -28.935 1.00 76.50  ? 594  ARG B HG3  1 
ATOM   6379  H  HD2  . ARG B 1 33  ? -74.191  10.577  -28.668 1.00 61.67  ? 594  ARG B HD2  1 
ATOM   6380  H  HD3  . ARG B 1 33  ? -72.750  11.107  -29.069 1.00 61.67  ? 594  ARG B HD3  1 
ATOM   6381  H  HE   . ARG B 1 33  ? -73.987  11.631  -26.705 1.00 57.60  ? 594  ARG B HE   1 
ATOM   6382  H  HH11 . ARG B 1 33  ? -71.157  11.983  -28.402 1.00 67.45  ? 594  ARG B HH11 1 
ATOM   6383  H  HH12 . ARG B 1 33  ? -70.330  12.407  -27.238 1.00 67.45  ? 594  ARG B HH12 1 
ATOM   6384  H  HH21 . ARG B 1 33  ? -72.716  12.266  -24.960 1.00 68.10  ? 594  ARG B HH21 1 
ATOM   6385  H  HH22 . ARG B 1 33  ? -71.273  12.578  -25.157 1.00 68.10  ? 594  ARG B HH22 1 
ATOM   6386  N  N    . ASP B 1 34  ? -74.712  12.203  -33.971 1.00 53.06  ? 595  ASP B N    1 
ATOM   6387  C  CA   . ASP B 1 34  ? -74.787  11.303  -35.113 1.00 47.10  ? 595  ASP B CA   1 
ATOM   6388  C  C    . ASP B 1 34  ? -74.305  9.932   -34.661 1.00 55.67  ? 595  ASP B C    1 
ATOM   6389  O  O    . ASP B 1 34  ? -73.158  9.786   -34.225 1.00 57.43  ? 595  ASP B O    1 
ATOM   6390  C  CB   . ASP B 1 34  ? -73.942  11.815  -36.279 1.00 56.50  ? 595  ASP B CB   1 
ATOM   6391  C  CG   . ASP B 1 34  ? -74.550  13.027  -36.954 1.00 57.87  ? 595  ASP B CG   1 
ATOM   6392  O  OD1  . ASP B 1 34  ? -75.787  13.055  -37.130 1.00 77.31  ? 595  ASP B OD1  1 
ATOM   6393  O  OD2  . ASP B 1 34  ? -73.790  13.952  -37.308 1.00 75.26  ? 595  ASP B OD2  1 
ATOM   6394  H  H    . ASP B 1 34  ? -74.014  12.705  -33.959 1.00 63.68  ? 595  ASP B H    1 
ATOM   6395  H  HA   . ASP B 1 34  ? -75.707  11.226  -35.408 1.00 56.52  ? 595  ASP B HA   1 
ATOM   6396  H  HB2  . ASP B 1 34  ? -73.065  12.065  -35.948 1.00 67.80  ? 595  ASP B HB2  1 
ATOM   6397  H  HB3  . ASP B 1 34  ? -73.859  11.112  -36.942 1.00 67.80  ? 595  ASP B HB3  1 
ATOM   6398  N  N    . VAL B 1 35  ? -75.180  8.931   -34.767 1.00 49.87  ? 596  VAL B N    1 
ATOM   6399  C  CA   . VAL B 1 35  ? -74.909  7.596   -34.251 1.00 48.49  ? 596  VAL B CA   1 
ATOM   6400  C  C    . VAL B 1 35  ? -75.413  6.561   -35.247 1.00 57.42  ? 596  VAL B C    1 
ATOM   6401  O  O    . VAL B 1 35  ? -76.268  6.835   -36.090 1.00 56.94  ? 596  VAL B O    1 
ATOM   6402  C  CB   . VAL B 1 35  ? -75.570  7.360   -32.872 1.00 50.73  ? 596  VAL B CB   1 
ATOM   6403  C  CG1  . VAL B 1 35  ? -75.013  8.325   -31.841 1.00 63.38  ? 596  VAL B CG1  1 
ATOM   6404  C  CG2  . VAL B 1 35  ? -77.088  7.495   -32.972 1.00 46.13  ? 596  VAL B CG2  1 
ATOM   6405  H  H    . VAL B 1 35  ? -75.951  9.005   -35.141 1.00 59.84  ? 596  VAL B H    1 
ATOM   6406  H  HA   . VAL B 1 35  ? -73.951  7.480   -34.152 1.00 58.19  ? 596  VAL B HA   1 
ATOM   6407  H  HB   . VAL B 1 35  ? -75.369  6.458   -32.577 1.00 60.87  ? 596  VAL B HB   1 
ATOM   6408  H  HG11 . VAL B 1 35  ? -75.442  8.156   -30.987 1.00 76.06  ? 596  VAL B HG11 1 
ATOM   6409  H  HG12 . VAL B 1 35  ? -74.056  8.186   -31.763 1.00 76.06  ? 596  VAL B HG12 1 
ATOM   6410  H  HG13 . VAL B 1 35  ? -75.194  9.233   -32.129 1.00 76.06  ? 596  VAL B HG13 1 
ATOM   6411  H  HG21 . VAL B 1 35  ? -77.476  7.343   -32.096 1.00 55.35  ? 596  VAL B HG21 1 
ATOM   6412  H  HG22 . VAL B 1 35  ? -77.306  8.389   -33.279 1.00 55.35  ? 596  VAL B HG22 1 
ATOM   6413  H  HG23 . VAL B 1 35  ? -77.423  6.837   -33.601 1.00 55.35  ? 596  VAL B HG23 1 
ATOM   6414  N  N    . ALA B 1 36  ? -74.867  5.356   -35.131 1.00 57.34  ? 597  ALA B N    1 
ATOM   6415  C  CA   . ALA B 1 36  ? -75.389  4.189   -35.825 1.00 56.09  ? 597  ALA B CA   1 
ATOM   6416  C  C    . ALA B 1 36  ? -76.502  3.589   -34.974 1.00 42.95  ? 597  ALA B C    1 
ATOM   6417  O  O    . ALA B 1 36  ? -76.340  3.428   -33.759 1.00 55.70  ? 597  ALA B O    1 
ATOM   6418  C  CB   . ALA B 1 36  ? -74.279  3.163   -36.072 1.00 44.31  ? 597  ALA B CB   1 
ATOM   6419  H  H    . ALA B 1 36  ? -74.177  5.188   -34.646 1.00 68.81  ? 597  ALA B H    1 
ATOM   6420  H  HA   . ALA B 1 36  ? -75.761  4.455   -36.680 1.00 67.30  ? 597  ALA B HA   1 
ATOM   6421  H  HB1  . ALA B 1 36  ? -74.654  2.397   -36.534 1.00 53.17  ? 597  ALA B HB1  1 
ATOM   6422  H  HB2  . ALA B 1 36  ? -73.587  3.572   -36.615 1.00 53.17  ? 597  ALA B HB2  1 
ATOM   6423  H  HB3  . ALA B 1 36  ? -73.909  2.887   -35.218 1.00 53.17  ? 597  ALA B HB3  1 
ATOM   6424  N  N    . VAL B 1 37  ? -77.637  3.292   -35.604 1.00 47.78  ? 598  VAL B N    1 
ATOM   6425  C  CA   . VAL B 1 37  ? -78.803  2.736   -34.924 1.00 58.94  ? 598  VAL B CA   1 
ATOM   6426  C  C    . VAL B 1 37  ? -78.922  1.275   -35.331 1.00 67.91  ? 598  VAL B C    1 
ATOM   6427  O  O    . VAL B 1 37  ? -78.989  0.960   -36.525 1.00 67.09  ? 598  VAL B O    1 
ATOM   6428  C  CB   . VAL B 1 37  ? -80.085  3.512   -35.266 1.00 55.50  ? 598  VAL B CB   1 
ATOM   6429  C  CG1  . VAL B 1 37  ? -81.290  2.896   -34.561 1.00 60.12  ? 598  VAL B CG1  1 
ATOM   6430  C  CG2  . VAL B 1 37  ? -79.934  4.975   -34.875 1.00 57.12  ? 598  VAL B CG2  1 
ATOM   6431  H  H    . VAL B 1 37  ? -77.757  3.408   -36.448 1.00 57.34  ? 598  VAL B H    1 
ATOM   6432  H  HA   . VAL B 1 37  ? -78.667  2.777   -33.965 1.00 70.73  ? 598  VAL B HA   1 
ATOM   6433  H  HB   . VAL B 1 37  ? -80.239  3.468   -36.222 1.00 66.60  ? 598  VAL B HB   1 
ATOM   6434  H  HG11 . VAL B 1 37  ? -82.083  3.403   -34.793 1.00 72.14  ? 598  VAL B HG11 1 
ATOM   6435  H  HG12 . VAL B 1 37  ? -81.388  1.975   -34.851 1.00 72.14  ? 598  VAL B HG12 1 
ATOM   6436  H  HG13 . VAL B 1 37  ? -81.144  2.927   -33.602 1.00 72.14  ? 598  VAL B HG13 1 
ATOM   6437  H  HG21 . VAL B 1 37  ? -80.751  5.447   -35.098 1.00 68.55  ? 598  VAL B HG21 1 
ATOM   6438  H  HG22 . VAL B 1 37  ? -79.769  5.031   -33.921 1.00 68.55  ? 598  VAL B HG22 1 
ATOM   6439  H  HG23 . VAL B 1 37  ? -79.188  5.356   -35.364 1.00 68.55  ? 598  VAL B HG23 1 
ATOM   6440  N  N    . LYS B 1 38  ? -78.970  0.392   -34.336 1.00 70.29  ? 599  LYS B N    1 
ATOM   6441  C  CA   . LYS B 1 38  ? -78.923  -1.053  -34.534 1.00 71.74  ? 599  LYS B CA   1 
ATOM   6442  C  C    . LYS B 1 38  ? -80.271  -1.636  -34.126 1.00 58.86  ? 599  LYS B C    1 
ATOM   6443  O  O    . LYS B 1 38  ? -80.626  -1.619  -32.943 1.00 59.09  ? 599  LYS B O    1 
ATOM   6444  C  CB   . LYS B 1 38  ? -77.779  -1.651  -33.716 1.00 66.56  ? 599  LYS B CB   1 
ATOM   6445  C  CG   . LYS B 1 38  ? -77.592  -3.145  -33.864 1.00 75.40  ? 599  LYS B CG   1 
ATOM   6446  C  CD   . LYS B 1 38  ? -76.221  -3.596  -33.356 1.00 80.96  ? 599  LYS B CD   1 
ATOM   6447  C  CE   . LYS B 1 38  ? -75.897  -3.022  -31.979 1.00 74.70  ? 599  LYS B CE   1 
ATOM   6448  N  NZ   . LYS B 1 38  ? -74.627  -3.571  -31.416 1.00 81.97  ? 599  LYS B NZ   1 
ATOM   6449  H  H    . LYS B 1 38  ? -79.032  0.616   -33.508 1.00 84.35  ? 599  LYS B H    1 
ATOM   6450  H  HA   . LYS B 1 38  ? -78.770  -1.250  -35.471 1.00 86.09  ? 599  LYS B HA   1 
ATOM   6451  H  HB2  . LYS B 1 38  ? -76.951  -1.225  -33.989 1.00 79.87  ? 599  LYS B HB2  1 
ATOM   6452  H  HB3  . LYS B 1 38  ? -77.944  -1.469  -32.778 1.00 79.87  ? 599  LYS B HB3  1 
ATOM   6453  H  HG2  . LYS B 1 38  ? -78.272  -3.604  -33.348 1.00 90.48  ? 599  LYS B HG2  1 
ATOM   6454  H  HG3  . LYS B 1 38  ? -77.662  -3.384  -34.801 1.00 90.48  ? 599  LYS B HG3  1 
ATOM   6455  H  HD2  . LYS B 1 38  ? -76.210  -4.564  -33.290 1.00 97.15  ? 599  LYS B HD2  1 
ATOM   6456  H  HD3  . LYS B 1 38  ? -75.538  -3.296  -33.976 1.00 97.15  ? 599  LYS B HD3  1 
ATOM   6457  H  HE2  . LYS B 1 38  ? -75.802  -2.060  -32.051 1.00 89.64  ? 599  LYS B HE2  1 
ATOM   6458  H  HE3  . LYS B 1 38  ? -76.617  -3.241  -31.367 1.00 89.64  ? 599  LYS B HE3  1 
ATOM   6459  H  HZ1  . LYS B 1 38  ? -74.471  -3.215  -30.615 1.00 98.37  ? 599  LYS B HZ1  1 
ATOM   6460  H  HZ2  . LYS B 1 38  ? -74.689  -4.455  -31.332 1.00 98.37  ? 599  LYS B HZ2  1 
ATOM   6461  H  HZ3  . LYS B 1 38  ? -73.947  -3.378  -31.955 1.00 98.37  ? 599  LYS B HZ3  1 
ATOM   6462  N  N    . ARG B 1 39  ? -81.019  -2.142  -35.108 1.00 68.12  ? 600  ARG B N    1 
ATOM   6463  C  CA   . ARG B 1 39  ? -82.340  -2.723  -34.877 1.00 80.50  ? 600  ARG B CA   1 
ATOM   6464  C  C    . ARG B 1 39  ? -82.198  -4.233  -34.724 1.00 80.04  ? 600  ARG B C    1 
ATOM   6465  O  O    . ARG B 1 39  ? -81.901  -4.935  -35.697 1.00 74.91  ? 600  ARG B O    1 
ATOM   6466  C  CB   . ARG B 1 39  ? -83.286  -2.391  -36.028 1.00 75.15  ? 600  ARG B CB   1 
ATOM   6467  C  CG   . ARG B 1 39  ? -84.709  -2.901  -35.823 1.00 79.23  ? 600  ARG B CG   1 
ATOM   6468  C  CD   . ARG B 1 39  ? -85.542  -2.794  -37.090 1.00 93.11  ? 600  ARG B CD   1 
ATOM   6469  N  NE   . ARG B 1 39  ? -85.655  -4.076  -37.782 1.00 104.13 ? 600  ARG B NE   1 
ATOM   6470  C  CZ   . ARG B 1 39  ? -86.463  -4.303  -38.814 1.00 108.25 ? 600  ARG B CZ   1 
ATOM   6471  N  NH1  . ARG B 1 39  ? -87.238  -3.333  -39.284 1.00 96.48  ? 600  ARG B NH1  1 
ATOM   6472  N  NH2  . ARG B 1 39  ? -86.497  -5.504  -39.375 1.00 81.72  ? 600  ARG B NH2  1 
ATOM   6473  H  H    . ARG B 1 39  ? -80.776  -2.160  -35.933 1.00 81.74  ? 600  ARG B H    1 
ATOM   6474  H  HA   . ARG B 1 39  ? -82.714  -2.363  -34.057 1.00 96.60  ? 600  ARG B HA   1 
ATOM   6475  H  HB2  . ARG B 1 39  ? -83.328  -1.427  -36.130 1.00 90.17  ? 600  ARG B HB2  1 
ATOM   6476  H  HB3  . ARG B 1 39  ? -82.941  -2.792  -36.841 1.00 90.17  ? 600  ARG B HB3  1 
ATOM   6477  H  HG2  . ARG B 1 39  ? -84.678  -3.834  -35.559 1.00 95.08  ? 600  ARG B HG2  1 
ATOM   6478  H  HG3  . ARG B 1 39  ? -85.140  -2.373  -35.132 1.00 95.08  ? 600  ARG B HG3  1 
ATOM   6479  H  HD2  . ARG B 1 39  ? -86.435  -2.495  -36.860 1.00 111.73 ? 600  ARG B HD2  1 
ATOM   6480  H  HD3  . ARG B 1 39  ? -85.123  -2.161  -37.694 1.00 111.73 ? 600  ARG B HD3  1 
ATOM   6481  H  HE   . ARG B 1 39  ? -85.167  -4.727  -37.504 1.00 124.96 ? 600  ARG B HE   1 
ATOM   6482  H  HH11 . ARG B 1 39  ? -87.218  -2.553  -38.922 1.00 115.78 ? 600  ARG B HH11 1 
ATOM   6483  H  HH12 . ARG B 1 39  ? -87.759  -3.484  -39.952 1.00 115.78 ? 600  ARG B HH12 1 
ATOM   6484  H  HH21 . ARG B 1 39  ? -85.996  -6.134  -39.073 1.00 98.07  ? 600  ARG B HH21 1 
ATOM   6485  H  HH22 . ARG B 1 39  ? -87.019  -5.652  -40.043 1.00 98.07  ? 600  ARG B HH22 1 
ATOM   6486  N  N    . ILE B 1 40  ? -82.453  -4.734  -33.514 1.00 83.71  ? 601  ILE B N    1 
ATOM   6487  C  CA   . ILE B 1 40  ? -82.332  -6.159  -33.218 1.00 87.71  ? 601  ILE B CA   1 
ATOM   6488  C  C    . ILE B 1 40  ? -83.715  -6.796  -33.282 1.00 90.80  ? 601  ILE B C    1 
ATOM   6489  O  O    . ILE B 1 40  ? -84.706  -6.122  -33.585 1.00 83.64  ? 601  ILE B O    1 
ATOM   6490  C  CB   . ILE B 1 40  ? -81.666  -6.396  -31.846 1.00 77.30  ? 601  ILE B CB   1 
ATOM   6491  C  CG1  . ILE B 1 40  ? -82.601  -6.017  -30.688 1.00 81.20  ? 601  ILE B CG1  1 
ATOM   6492  C  CG2  . ILE B 1 40  ? -80.361  -5.603  -31.750 1.00 78.57  ? 601  ILE B CG2  1 
ATOM   6493  C  CD1  . ILE B 1 40  ? -82.084  -6.431  -29.320 1.00 77.66  ? 601  ILE B CD1  1 
ATOM   6494  H  H    . ILE B 1 40  ? -82.700  -4.261  -32.840 1.00 100.45 ? 601  ILE B H    1 
ATOM   6495  H  HA   . ILE B 1 40  ? -81.778  -6.577  -33.896 1.00 105.25 ? 601  ILE B HA   1 
ATOM   6496  H  HB   . ILE B 1 40  ? -81.454  -7.339  -31.770 1.00 92.76  ? 601  ILE B HB   1 
ATOM   6497  H  HG12 . ILE B 1 40  ? -82.716  -5.054  -30.681 1.00 97.44  ? 601  ILE B HG12 1 
ATOM   6498  H  HG13 . ILE B 1 40  ? -83.458  -6.450  -30.824 1.00 97.44  ? 601  ILE B HG13 1 
ATOM   6499  H  HG21 . ILE B 1 40  ? -79.957  -5.764  -30.883 1.00 94.28  ? 601  ILE B HG21 1 
ATOM   6500  H  HG22 . ILE B 1 40  ? -79.761  -5.896  -32.454 1.00 94.28  ? 601  ILE B HG22 1 
ATOM   6501  H  HG23 . ILE B 1 40  ? -80.557  -4.659  -31.854 1.00 94.28  ? 601  ILE B HG23 1 
ATOM   6502  H  HD11 . ILE B 1 40  ? -82.726  -6.160  -28.645 1.00 93.19  ? 601  ILE B HD11 1 
ATOM   6503  H  HD12 . ILE B 1 40  ? -81.974  -7.395  -29.303 1.00 93.19  ? 601  ILE B HD12 1 
ATOM   6504  H  HD13 . ILE B 1 40  ? -81.231  -5.997  -29.160 1.00 93.19  ? 601  ILE B HD13 1 
ATOM   6505  N  N    . LEU B 1 41  ? -83.788  -8.091  -32.992 1.00 99.56  ? 602  LEU B N    1 
ATOM   6506  C  CA   . LEU B 1 41  ? -85.004  -8.883  -33.080 1.00 92.21  ? 602  LEU B CA   1 
ATOM   6507  C  C    . LEU B 1 41  ? -85.334  -9.493  -31.722 1.00 81.97  ? 602  LEU B C    1 
ATOM   6508  O  O    . LEU B 1 41  ? -84.462  -9.596  -30.851 1.00 87.34  ? 602  LEU B O    1 
ATOM   6509  C  CB   . LEU B 1 41  ? -84.853  -10.002 -34.121 1.00 82.49  ? 602  LEU B CB   1 
ATOM   6510  C  CG   . LEU B 1 41  ? -84.270  -9.586  -35.473 1.00 80.97  ? 602  LEU B CG   1 
ATOM   6511  C  CD1  . LEU B 1 41  ? -83.941  -10.814 -36.300 1.00 84.65  ? 602  LEU B CD1  1 
ATOM   6512  C  CD2  . LEU B 1 41  ? -85.229  -8.677  -36.223 1.00 75.72  ? 602  LEU B CD2  1 
ATOM   6513  H  H    . LEU B 1 41  ? -83.110  -8.551  -32.730 1.00 119.47 ? 602  LEU B H    1 
ATOM   6514  H  HA   . LEU B 1 41  ? -85.741  -8.312  -33.347 1.00 110.65 ? 602  LEU B HA   1 
ATOM   6515  H  HB2  . LEU B 1 41  ? -84.271  -10.684 -33.753 1.00 98.98  ? 602  LEU B HB2  1 
ATOM   6516  H  HB3  . LEU B 1 41  ? -85.730  -10.382 -34.289 1.00 98.98  ? 602  LEU B HB3  1 
ATOM   6517  H  HG   . LEU B 1 41  ? -83.447  -9.095  -35.324 1.00 97.17  ? 602  LEU B HG   1 
ATOM   6518  H  HD11 . LEU B 1 41  ? -83.573  -10.531 -37.152 1.00 101.58 ? 602  LEU B HD11 1 
ATOM   6519  H  HD12 . LEU B 1 41  ? -83.291  -11.351 -35.821 1.00 101.58 ? 602  LEU B HD12 1 
ATOM   6520  H  HD13 . LEU B 1 41  ? -84.753  -11.325 -36.443 1.00 101.58 ? 602  LEU B HD13 1 
ATOM   6521  H  HD21 . LEU B 1 41  ? -84.831  -8.433  -37.073 1.00 90.86  ? 602  LEU B HD21 1 
ATOM   6522  H  HD22 . LEU B 1 41  ? -86.062  -9.151  -36.372 1.00 90.86  ? 602  LEU B HD22 1 
ATOM   6523  H  HD23 . LEU B 1 41  ? -85.390  -7.882  -35.692 1.00 90.86  ? 602  LEU B HD23 1 
ATOM   6524  N  N    . PRO B 1 42  ? -86.597  -9.913  -31.505 1.00 78.19  ? 603  PRO B N    1 
ATOM   6525  C  CA   . PRO B 1 42  ? -86.993  -10.450 -30.192 1.00 87.49  ? 603  PRO B CA   1 
ATOM   6526  C  C    . PRO B 1 42  ? -86.151  -11.637 -29.748 1.00 88.85  ? 603  PRO B C    1 
ATOM   6527  O  O    . PRO B 1 42  ? -86.044  -11.928 -28.551 1.00 87.34  ? 603  PRO B O    1 
ATOM   6528  C  CB   . PRO B 1 42  ? -88.458  -10.855 -30.408 1.00 71.89  ? 603  PRO B CB   1 
ATOM   6529  C  CG   . PRO B 1 42  ? -88.927  -9.988  -31.513 1.00 67.75  ? 603  PRO B CG   1 
ATOM   6530  C  CD   . PRO B 1 42  ? -87.747  -9.795  -32.418 1.00 73.61  ? 603  PRO B CD   1 
ATOM   6531  H  HA   . PRO B 1 42  ? -86.949  -9.755  -29.517 1.00 104.98 ? 603  PRO B HA   1 
ATOM   6532  H  HB2  . PRO B 1 42  ? -88.507  -11.790 -30.660 1.00 86.26  ? 603  PRO B HB2  1 
ATOM   6533  H  HB3  . PRO B 1 42  ? -88.967  -10.688 -29.600 1.00 86.26  ? 603  PRO B HB3  1 
ATOM   6534  H  HG2  . PRO B 1 42  ? -89.650  -10.428 -31.986 1.00 81.30  ? 603  PRO B HG2  1 
ATOM   6535  H  HG3  . PRO B 1 42  ? -89.223  -9.137  -31.154 1.00 81.30  ? 603  PRO B HG3  1 
ATOM   6536  H  HD2  . PRO B 1 42  ? -87.718  -10.493 -33.091 1.00 88.34  ? 603  PRO B HD2  1 
ATOM   6537  H  HD3  . PRO B 1 42  ? -87.770  -8.912  -32.821 1.00 88.34  ? 603  PRO B HD3  1 
ATOM   6538  N  N    . GLU B 1 43  ? -85.543  -12.329 -30.714 1.00 85.36  ? 604  GLU B N    1 
ATOM   6539  C  CA   . GLU B 1 43  ? -84.716  -13.484 -30.380 1.00 90.92  ? 604  GLU B CA   1 
ATOM   6540  C  C    . GLU B 1 43  ? -83.489  -13.062 -29.584 1.00 87.16  ? 604  GLU B C    1 
ATOM   6541  O  O    . GLU B 1 43  ? -83.059  -13.772 -28.668 1.00 84.67  ? 604  GLU B O    1 
ATOM   6542  C  CB   . GLU B 1 43  ? -84.290  -14.225 -31.653 1.00 97.27  ? 604  GLU B CB   1 
ATOM   6543  C  CG   . GLU B 1 43  ? -85.427  -14.895 -32.416 1.00 100.52 ? 604  GLU B CG   1 
ATOM   6544  C  CD   . GLU B 1 43  ? -86.307  -13.902 -33.151 1.00 112.91 ? 604  GLU B CD   1 
ATOM   6545  O  OE1  . GLU B 1 43  ? -85.800  -13.222 -34.069 1.00 110.44 ? 604  GLU B OE1  1 
ATOM   6546  O  OE2  . GLU B 1 43  ? -87.502  -13.791 -32.804 1.00 107.05 ? 604  GLU B OE2  1 
ATOM   6547  H  H    . GLU B 1 43  ? -85.594  -12.152 -31.554 1.00 102.43 ? 604  GLU B H    1 
ATOM   6548  H  HA   . GLU B 1 43  ? -85.233  -14.096 -29.834 1.00 109.10 ? 604  GLU B HA   1 
ATOM   6549  H  HB2  . GLU B 1 43  ? -83.869  -13.590 -32.253 1.00 116.72 ? 604  GLU B HB2  1 
ATOM   6550  H  HB3  . GLU B 1 43  ? -83.653  -14.915 -31.410 1.00 116.72 ? 604  GLU B HB3  1 
ATOM   6551  H  HG2  . GLU B 1 43  ? -85.051  -15.505 -33.070 1.00 120.63 ? 604  GLU B HG2  1 
ATOM   6552  H  HG3  . GLU B 1 43  ? -85.984  -15.383 -31.789 1.00 120.63 ? 604  GLU B HG3  1 
ATOM   6553  N  N    . CYS B 1 44  ? -82.911  -11.909 -29.920 1.00 92.35  ? 605  CYS B N    1 
ATOM   6554  C  CA   . CYS B 1 44  ? -81.679  -11.445 -29.300 1.00 95.94  ? 605  CYS B CA   1 
ATOM   6555  C  C    . CYS B 1 44  ? -81.898  -10.473 -28.145 1.00 76.43  ? 605  CYS B C    1 
ATOM   6556  O  O    . CYS B 1 44  ? -80.914  -9.949  -27.612 1.00 72.24  ? 605  CYS B O    1 
ATOM   6557  C  CB   . CYS B 1 44  ? -80.778  -10.793 -30.346 1.00 82.35  ? 605  CYS B CB   1 
ATOM   6558  S  SG   . CYS B 1 44  ? -79.048  -10.839 -29.867 1.00 86.08  ? 605  CYS B SG   1 
ATOM   6559  H  H    . CYS B 1 44  ? -83.222  -11.371 -30.515 1.00 110.82 ? 605  CYS B H    1 
ATOM   6560  H  HA   . CYS B 1 44  ? -81.206  -12.214 -28.946 1.00 115.13 ? 605  CYS B HA   1 
ATOM   6561  H  HB2  . CYS B 1 44  ? -80.872  -11.268 -31.187 1.00 98.81  ? 605  CYS B HB2  1 
ATOM   6562  H  HB3  . CYS B 1 44  ? -81.037  -9.865  -30.456 1.00 98.81  ? 605  CYS B HB3  1 
ATOM   6563  H  HG   . CYS B 1 44  ? -78.392  -10.316 -30.724 1.00 103.30 ? 605  CYS B HG   1 
ATOM   6564  N  N    . PHE B 1 45  ? -83.150  -10.193 -27.766 1.00 69.67  ? 606  PHE B N    1 
ATOM   6565  C  CA   . PHE B 1 45  ? -83.402  -9.306  -26.631 1.00 80.15  ? 606  PHE B CA   1 
ATOM   6566  C  C    . PHE B 1 45  ? -82.607  -9.733  -25.404 1.00 80.89  ? 606  PHE B C    1 
ATOM   6567  O  O    . PHE B 1 45  ? -82.024  -8.895  -24.707 1.00 82.77  ? 606  PHE B O    1 
ATOM   6568  C  CB   . PHE B 1 45  ? -84.896  -9.281  -26.291 1.00 77.96  ? 606  PHE B CB   1 
ATOM   6569  C  CG   . PHE B 1 45  ? -85.745  -8.503  -27.263 1.00 65.67  ? 606  PHE B CG   1 
ATOM   6570  C  CD1  . PHE B 1 45  ? -85.202  -7.939  -28.407 1.00 73.48  ? 606  PHE B CD1  1 
ATOM   6571  C  CD2  . PHE B 1 45  ? -87.100  -8.331  -27.019 1.00 78.21  ? 606  PHE B CD2  1 
ATOM   6572  C  CE1  . PHE B 1 45  ? -85.996  -7.228  -29.292 1.00 88.06  ? 606  PHE B CE1  1 
ATOM   6573  C  CE2  . PHE B 1 45  ? -87.899  -7.619  -27.896 1.00 73.37  ? 606  PHE B CE2  1 
ATOM   6574  C  CZ   . PHE B 1 45  ? -87.346  -7.065  -29.033 1.00 78.09  ? 606  PHE B CZ   1 
ATOM   6575  H  H    . PHE B 1 45  ? -83.859  -10.499 -28.145 1.00 83.60  ? 606  PHE B H    1 
ATOM   6576  H  HA   . PHE B 1 45  ? -83.131  -8.405  -26.866 1.00 96.18  ? 606  PHE B HA   1 
ATOM   6577  H  HB2  . PHE B 1 45  ? -85.226  -10.193 -26.276 1.00 93.55  ? 606  PHE B HB2  1 
ATOM   6578  H  HB3  . PHE B 1 45  ? -85.008  -8.879  -25.415 1.00 93.55  ? 606  PHE B HB3  1 
ATOM   6579  H  HD1  . PHE B 1 45  ? -84.296  -8.045  -28.586 1.00 88.18  ? 606  PHE B HD1  1 
ATOM   6580  H  HD2  . PHE B 1 45  ? -87.478  -8.702  -26.254 1.00 93.85  ? 606  PHE B HD2  1 
ATOM   6581  H  HE1  . PHE B 1 45  ? -85.621  -6.855  -30.056 1.00 105.67 ? 606  PHE B HE1  1 
ATOM   6582  H  HE2  . PHE B 1 45  ? -88.806  -7.514  -27.720 1.00 88.05  ? 606  PHE B HE2  1 
ATOM   6583  H  HZ   . PHE B 1 45  ? -87.880  -6.587  -29.626 1.00 93.70  ? 606  PHE B HZ   1 
ATOM   6584  N  N    . SER B 1 46  ? -82.564  -11.037 -25.130 1.00 74.05  ? 607  SER B N    1 
ATOM   6585  C  CA   . SER B 1 46  ? -81.904  -11.522 -23.923 1.00 81.79  ? 607  SER B CA   1 
ATOM   6586  C  C    . SER B 1 46  ? -80.393  -11.323 -24.000 1.00 81.54  ? 607  SER B C    1 
ATOM   6587  O  O    . SER B 1 46  ? -79.786  -10.748 -23.089 1.00 81.39  ? 607  SER B O    1 
ATOM   6588  C  CB   . SER B 1 46  ? -82.245  -12.996 -23.708 1.00 89.34  ? 607  SER B CB   1 
ATOM   6589  O  OG   . SER B 1 46  ? -83.638  -13.216 -23.857 1.00 95.35  ? 607  SER B OG   1 
ATOM   6590  H  H    . SER B 1 46  ? -82.906  -11.654 -25.622 1.00 88.85  ? 607  SER B H    1 
ATOM   6591  H  HA   . SER B 1 46  ? -82.234  -11.023 -23.160 1.00 98.15  ? 607  SER B HA   1 
ATOM   6592  H  HB2  . SER B 1 46  ? -81.769  -13.530 -24.364 1.00 107.20 ? 607  SER B HB2  1 
ATOM   6593  H  HB3  . SER B 1 46  ? -81.978  -13.255 -22.812 1.00 107.20 ? 607  SER B HB3  1 
ATOM   6594  H  HG   . SER B 1 46  ? -83.815  -14.028 -23.737 1.00 114.42 ? 607  SER B HG   1 
ATOM   6595  N  N    . PHE B 1 47  ? -79.768  -11.788 -25.083 1.00 68.47  ? 608  PHE B N    1 
ATOM   6596  C  CA   . PHE B 1 47  ? -78.318  -11.678 -25.198 1.00 70.87  ? 608  PHE B CA   1 
ATOM   6597  C  C    . PHE B 1 47  ? -77.875  -10.225 -25.316 1.00 64.46  ? 608  PHE B C    1 
ATOM   6598  O  O    . PHE B 1 47  ? -76.800  -9.865  -24.822 1.00 65.08  ? 608  PHE B O    1 
ATOM   6599  C  CB   . PHE B 1 47  ? -77.822  -12.488 -26.398 1.00 41.99  ? 608  PHE B CB   1 
ATOM   6600  H  H    . PHE B 1 47  ? -80.154  -12.165 -25.753 1.00 82.16  ? 608  PHE B H    1 
ATOM   6601  H  HA   . PHE B 1 47  ? -77.911  -12.049 -24.399 1.00 85.04  ? 608  PHE B HA   1 
ATOM   6602  N  N    . ALA B 1 48  ? -78.686  -9.378  -25.951 1.00 72.20  ? 609  ALA B N    1 
ATOM   6603  C  CA   . ALA B 1 48  ? -78.338  -7.965  -26.063 1.00 80.88  ? 609  ALA B CA   1 
ATOM   6604  C  C    . ALA B 1 48  ? -78.304  -7.300  -24.691 1.00 81.02  ? 609  ALA B C    1 
ATOM   6605  O  O    . ALA B 1 48  ? -77.365  -6.566  -24.367 1.00 72.08  ? 609  ALA B O    1 
ATOM   6606  C  CB   . ALA B 1 48  ? -79.329  -7.254  -26.985 1.00 67.60  ? 609  ALA B CB   1 
ATOM   6607  H  H    . ALA B 1 48  ? -79.432  -9.593  -26.320 1.00 86.63  ? 609  ALA B H    1 
ATOM   6608  H  HA   . ALA B 1 48  ? -77.454  -7.888  -26.455 1.00 97.05  ? 609  ALA B HA   1 
ATOM   6609  H  HB1  . ALA B 1 48  ? -79.084  -6.318  -27.049 1.00 81.11  ? 609  ALA B HB1  1 
ATOM   6610  H  HB2  . ALA B 1 48  ? -79.294  -7.666  -27.863 1.00 81.11  ? 609  ALA B HB2  1 
ATOM   6611  H  HB3  . ALA B 1 48  ? -80.221  -7.339  -26.614 1.00 81.11  ? 609  ALA B HB3  1 
ATOM   6612  N  N    . ASP B 1 49  ? -79.321  -7.559  -23.864 1.00 80.01  ? 610  ASP B N    1 
ATOM   6613  C  CA   . ASP B 1 49  ? -79.391  -6.929  -22.549 1.00 76.72  ? 610  ASP B CA   1 
ATOM   6614  C  C    . ASP B 1 49  ? -78.262  -7.405  -21.643 1.00 67.44  ? 610  ASP B C    1 
ATOM   6615  O  O    . ASP B 1 49  ? -77.656  -6.601  -20.925 1.00 68.99  ? 610  ASP B O    1 
ATOM   6616  C  CB   . ASP B 1 49  ? -80.747  -7.215  -21.901 1.00 88.96  ? 610  ASP B CB   1 
ATOM   6617  C  CG   . ASP B 1 49  ? -81.912  -6.661  -22.706 1.00 96.04  ? 610  ASP B CG   1 
ATOM   6618  O  OD1  . ASP B 1 49  ? -81.742  -5.620  -23.375 1.00 85.98  ? 610  ASP B OD1  1 
ATOM   6619  O  OD2  . ASP B 1 49  ? -83.003  -7.270  -22.664 1.00 92.79  ? 610  ASP B OD2  1 
ATOM   6620  H  H    . ASP B 1 49  ? -79.974  -8.090  -24.040 1.00 96.01  ? 610  ASP B H    1 
ATOM   6621  H  HA   . ASP B 1 49  ? -79.305  -5.969  -22.654 1.00 92.07  ? 610  ASP B HA   1 
ATOM   6622  H  HB2  . ASP B 1 49  ? -80.865  -8.175  -21.825 1.00 106.75 ? 610  ASP B HB2  1 
ATOM   6623  H  HB3  . ASP B 1 49  ? -80.770  -6.807  -21.022 1.00 106.75 ? 610  ASP B HB3  1 
ATOM   6624  N  N    . ARG B 1 50  ? -77.971  -8.708  -21.655 1.00 68.81  ? 611  ARG B N    1 
ATOM   6625  C  CA   . ARG B 1 50  ? -76.930  -9.242  -20.782 1.00 74.99  ? 611  ARG B CA   1 
ATOM   6626  C  C    . ARG B 1 50  ? -75.580  -8.594  -21.071 1.00 79.69  ? 611  ARG B C    1 
ATOM   6627  O  O    . ARG B 1 50  ? -74.865  -8.194  -20.145 1.00 81.89  ? 611  ARG B O    1 
ATOM   6628  C  CB   . ARG B 1 50  ? -76.843  -10.761 -20.940 1.00 56.69  ? 611  ARG B CB   1 
ATOM   6629  H  H    . ARG B 1 50  ? -78.356  -9.294  -22.153 1.00 82.57  ? 611  ARG B H    1 
ATOM   6630  H  HA   . ARG B 1 50  ? -77.163  -9.050  -19.861 1.00 89.99  ? 611  ARG B HA   1 
ATOM   6631  N  N    . GLU B 1 51  ? -75.221  -8.463  -22.351 1.00 72.60  ? 612  GLU B N    1 
ATOM   6632  C  CA   . GLU B 1 51  ? -73.914  -7.911  -22.698 1.00 78.58  ? 612  GLU B CA   1 
ATOM   6633  C  C    . GLU B 1 51  ? -73.855  -6.407  -22.464 1.00 67.73  ? 612  GLU B C    1 
ATOM   6634  O  O    . GLU B 1 51  ? -72.786  -5.874  -22.147 1.00 57.18  ? 612  GLU B O    1 
ATOM   6635  C  CB   . GLU B 1 51  ? -73.577  -8.250  -24.148 1.00 73.49  ? 612  GLU B CB   1 
ATOM   6636  C  CG   . GLU B 1 51  ? -73.154  -9.702  -24.322 1.00 79.43  ? 612  GLU B CG   1 
ATOM   6637  C  CD   . GLU B 1 51  ? -72.933  -10.093 -25.771 1.00 81.52  ? 612  GLU B CD   1 
ATOM   6638  O  OE1  . GLU B 1 51  ? -73.473  -9.415  -26.671 1.00 65.03  ? 612  GLU B OE1  1 
ATOM   6639  O  OE2  . GLU B 1 51  ? -72.212  -11.087 -26.004 1.00 93.36  ? 612  GLU B OE2  1 
ATOM   6640  H  H    . GLU B 1 51  ? -75.708  -8.682  -23.025 1.00 87.11  ? 612  GLU B H    1 
ATOM   6641  H  HA   . GLU B 1 51  ? -73.242  -8.324  -22.134 1.00 94.30  ? 612  GLU B HA   1 
ATOM   6642  H  HB2  . GLU B 1 51  ? -74.359  -8.096  -24.700 1.00 88.19  ? 612  GLU B HB2  1 
ATOM   6643  H  HB3  . GLU B 1 51  ? -72.845  -7.686  -24.443 1.00 88.19  ? 612  GLU B HB3  1 
ATOM   6644  H  HG2  . GLU B 1 51  ? -72.323  -9.847  -23.844 1.00 95.32  ? 612  GLU B HG2  1 
ATOM   6645  H  HG3  . GLU B 1 51  ? -73.848  -10.276 -23.961 1.00 95.32  ? 612  GLU B HG3  1 
ATOM   6646  N  N    . VAL B 1 52  ? -74.981  -5.706  -22.611 1.00 70.74  ? 613  VAL B N    1 
ATOM   6647  C  CA   . VAL B 1 52  ? -75.019  -4.298  -22.230 1.00 78.92  ? 613  VAL B CA   1 
ATOM   6648  C  C    . VAL B 1 52  ? -74.651  -4.146  -20.760 1.00 82.35  ? 613  VAL B C    1 
ATOM   6649  O  O    . VAL B 1 52  ? -73.885  -3.251  -20.384 1.00 72.76  ? 613  VAL B O    1 
ATOM   6650  C  CB   . VAL B 1 52  ? -76.407  -3.700  -22.534 1.00 65.62  ? 613  VAL B CB   1 
ATOM   6651  C  CG1  . VAL B 1 52  ? -76.638  -2.407  -21.754 1.00 65.09  ? 613  VAL B CG1  1 
ATOM   6652  C  CG2  . VAL B 1 52  ? -76.560  -3.446  -24.024 1.00 63.16  ? 613  VAL B CG2  1 
ATOM   6653  H  H    . VAL B 1 52  ? -75.720  -6.016  -22.921 1.00 84.88  ? 613  VAL B H    1 
ATOM   6654  H  HA   . VAL B 1 52  ? -74.363  -3.811  -22.754 1.00 94.71  ? 613  VAL B HA   1 
ATOM   6655  H  HB   . VAL B 1 52  ? -77.089  -4.337  -22.267 1.00 78.75  ? 613  VAL B HB   1 
ATOM   6656  H  HG11 . VAL B 1 52  ? -77.519  -2.062  -21.970 1.00 78.10  ? 613  VAL B HG11 1 
ATOM   6657  H  HG12 . VAL B 1 52  ? -76.580  -2.597  -20.805 1.00 78.10  ? 613  VAL B HG12 1 
ATOM   6658  H  HG13 . VAL B 1 52  ? -75.959  -1.762  -22.005 1.00 78.10  ? 613  VAL B HG13 1 
ATOM   6659  H  HG21 . VAL B 1 52  ? -77.439  -3.071  -24.191 1.00 75.79  ? 613  VAL B HG21 1 
ATOM   6660  H  HG22 . VAL B 1 52  ? -75.875  -2.822  -24.309 1.00 75.79  ? 613  VAL B HG22 1 
ATOM   6661  H  HG23 . VAL B 1 52  ? -76.463  -4.286  -24.499 1.00 75.79  ? 613  VAL B HG23 1 
ATOM   6662  N  N    . GLN B 1 53  ? -75.168  -5.035  -19.910 1.00 69.50  ? 614  GLN B N    1 
ATOM   6663  C  CA   . GLN B 1 53  ? -74.970  -4.887  -18.473 1.00 82.03  ? 614  GLN B CA   1 
ATOM   6664  C  C    . GLN B 1 53  ? -73.525  -5.173  -18.078 1.00 76.96  ? 614  GLN B C    1 
ATOM   6665  O  O    . GLN B 1 53  ? -72.932  -4.422  -17.293 1.00 77.76  ? 614  GLN B O    1 
ATOM   6666  C  CB   . GLN B 1 53  ? -75.933  -5.807  -17.719 1.00 75.52  ? 614  GLN B CB   1 
ATOM   6667  C  CG   . GLN B 1 53  ? -76.360  -5.275  -16.356 1.00 91.72  ? 614  GLN B CG   1 
ATOM   6668  C  CD   . GLN B 1 53  ? -77.159  -3.983  -16.456 1.00 86.27  ? 614  GLN B CD   1 
ATOM   6669  O  OE1  . GLN B 1 53  ? -77.919  -3.782  -17.403 1.00 79.78  ? 614  GLN B OE1  1 
ATOM   6670  N  NE2  . GLN B 1 53  ? -76.979  -3.095  -15.482 1.00 83.73  ? 614  GLN B NE2  1 
ATOM   6671  H  H    . GLN B 1 53  ? -75.630  -5.724  -20.139 1.00 83.40  ? 614  GLN B H    1 
ATOM   6672  H  HA   . GLN B 1 53  ? -75.172  -3.972  -18.221 1.00 98.43  ? 614  GLN B HA   1 
ATOM   6673  H  HB2  . GLN B 1 53  ? -76.733  -5.926  -18.254 1.00 90.62  ? 614  GLN B HB2  1 
ATOM   6674  H  HB3  . GLN B 1 53  ? -75.501  -6.664  -17.580 1.00 90.62  ? 614  GLN B HB3  1 
ATOM   6675  H  HG2  . GLN B 1 53  ? -76.915  -5.938  -15.918 1.00 110.07 ? 614  GLN B HG2  1 
ATOM   6676  H  HG3  . GLN B 1 53  ? -75.569  -5.099  -15.823 1.00 110.07 ? 614  GLN B HG3  1 
ATOM   6677  H  HE21 . GLN B 1 53  ? -76.434  -3.266  -14.839 1.00 100.48 ? 614  GLN B HE21 1 
ATOM   6678  H  HE22 . GLN B 1 53  ? -77.409  -2.350  -15.495 1.00 100.48 ? 614  GLN B HE22 1 
ATOM   6679  N  N    . LEU B 1 54  ? -72.941  -6.248  -18.614 1.00 67.28  ? 615  LEU B N    1 
ATOM   6680  C  CA   . LEU B 1 54  ? -71.559  -6.589  -18.281 1.00 88.45  ? 615  LEU B CA   1 
ATOM   6681  C  C    . LEU B 1 54  ? -70.600  -5.489  -18.715 1.00 83.10  ? 615  LEU B C    1 
ATOM   6682  O  O    . LEU B 1 54  ? -69.691  -5.113  -17.965 1.00 71.89  ? 615  LEU B O    1 
ATOM   6683  C  CB   . LEU B 1 54  ? -71.173  -7.914  -18.939 1.00 81.12  ? 615  LEU B CB   1 
ATOM   6684  C  CG   . LEU B 1 54  ? -71.520  -9.209  -18.198 1.00 90.54  ? 615  LEU B CG   1 
ATOM   6685  C  CD1  . LEU B 1 54  ? -72.938  -9.189  -17.637 1.00 90.94  ? 615  LEU B CD1  1 
ATOM   6686  C  CD2  . LEU B 1 54  ? -71.335  -10.396 -19.135 1.00 65.40  ? 615  LEU B CD2  1 
ATOM   6687  H  H    . LEU B 1 54  ? -73.319  -6.789  -19.165 1.00 80.74  ? 615  LEU B H    1 
ATOM   6688  H  HA   . LEU B 1 54  ? -71.481  -6.696  -17.320 1.00 106.14 ? 615  LEU B HA   1 
ATOM   6689  H  HB2  . LEU B 1 54  ? -71.611  -7.957  -19.804 1.00 97.35  ? 615  LEU B HB2  1 
ATOM   6690  H  HB3  . LEU B 1 54  ? -70.212  -7.913  -19.071 1.00 97.35  ? 615  LEU B HB3  1 
ATOM   6691  H  HG   . LEU B 1 54  ? -70.907  -9.318  -17.454 1.00 108.65 ? 615  LEU B HG   1 
ATOM   6692  H  HD11 . LEU B 1 54  ? -73.108  -10.028 -17.179 1.00 109.13 ? 615  LEU B HD11 1 
ATOM   6693  H  HD12 . LEU B 1 54  ? -73.021  -8.450  -17.014 1.00 109.13 ? 615  LEU B HD12 1 
ATOM   6694  H  HD13 . LEU B 1 54  ? -73.566  -9.079  -18.368 1.00 109.13 ? 615  LEU B HD13 1 
ATOM   6695  H  HD21 . LEU B 1 54  ? -71.557  -11.211 -18.659 1.00 78.49  ? 615  LEU B HD21 1 
ATOM   6696  H  HD22 . LEU B 1 54  ? -71.922  -10.288 -19.900 1.00 78.49  ? 615  LEU B HD22 1 
ATOM   6697  H  HD23 . LEU B 1 54  ? -70.411  -10.424 -19.429 1.00 78.49  ? 615  LEU B HD23 1 
ATOM   6698  N  N    . LEU B 1 55  ? -70.786  -4.965  -19.927 1.00 87.82  ? 616  LEU B N    1 
ATOM   6699  C  CA   . LEU B 1 55  ? -69.910  -3.914  -20.430 1.00 81.23  ? 616  LEU B CA   1 
ATOM   6700  C  C    . LEU B 1 55  ? -70.054  -2.625  -19.630 1.00 77.65  ? 616  LEU B C    1 
ATOM   6701  O  O    . LEU B 1 55  ? -69.086  -1.866  -19.506 1.00 68.96  ? 616  LEU B O    1 
ATOM   6702  C  CB   . LEU B 1 55  ? -70.212  -3.659  -21.908 1.00 66.19  ? 616  LEU B CB   1 
ATOM   6703  C  CG   . LEU B 1 55  ? -69.434  -2.533  -22.588 1.00 84.26  ? 616  LEU B CG   1 
ATOM   6704  C  CD1  . LEU B 1 55  ? -67.928  -2.731  -22.449 1.00 89.56  ? 616  LEU B CD1  1 
ATOM   6705  C  CD2  . LEU B 1 55  ? -69.836  -2.449  -24.053 1.00 80.21  ? 616  LEU B CD2  1 
ATOM   6706  H  H    . LEU B 1 55  ? -71.408  -5.200  -20.472 1.00 105.39 ? 616  LEU B H    1 
ATOM   6707  H  HA   . LEU B 1 55  ? -68.989  -4.209  -20.359 1.00 97.48  ? 616  LEU B HA   1 
ATOM   6708  H  HB2  . LEU B 1 55  ? -70.025  -4.474  -22.399 1.00 79.43  ? 616  LEU B HB2  1 
ATOM   6709  H  HB3  . LEU B 1 55  ? -71.155  -3.445  -21.990 1.00 79.43  ? 616  LEU B HB3  1 
ATOM   6710  H  HG   . LEU B 1 55  ? -69.664  -1.691  -22.167 1.00 101.12 ? 616  LEU B HG   1 
ATOM   6711  H  HD11 . LEU B 1 55  ? -67.471  -1.999  -22.893 1.00 107.47 ? 616  LEU B HD11 1 
ATOM   6712  H  HD12 . LEU B 1 55  ? -67.697  -2.743  -21.507 1.00 107.47 ? 616  LEU B HD12 1 
ATOM   6713  H  HD13 . LEU B 1 55  ? -67.681  -3.574  -22.862 1.00 107.47 ? 616  LEU B HD13 1 
ATOM   6714  H  HD21 . LEU B 1 55  ? -69.337  -1.733  -24.476 1.00 96.25  ? 616  LEU B HD21 1 
ATOM   6715  H  HD22 . LEU B 1 55  ? -69.633  -3.294  -24.484 1.00 96.25  ? 616  LEU B HD22 1 
ATOM   6716  H  HD23 . LEU B 1 55  ? -70.787  -2.269  -24.109 1.00 96.25  ? 616  LEU B HD23 1 
ATOM   6717  N  N    . ARG B 1 56  ? -71.243  -2.366  -19.078 1.00 89.49  ? 617  ARG B N    1 
ATOM   6718  C  CA   . ARG B 1 56  ? -71.494  -1.102  -18.390 1.00 82.45  ? 617  ARG B CA   1 
ATOM   6719  C  C    . ARG B 1 56  ? -70.661  -0.970  -17.121 1.00 88.41  ? 617  ARG B C    1 
ATOM   6720  O  O    . ARG B 1 56  ? -70.196  0.129   -16.792 1.00 91.10  ? 617  ARG B O    1 
ATOM   6721  C  CB   . ARG B 1 56  ? -72.975  -0.981  -18.041 1.00 72.43  ? 617  ARG B CB   1 
ATOM   6722  C  CG   . ARG B 1 56  ? -73.853  -0.387  -19.123 1.00 72.07  ? 617  ARG B CG   1 
ATOM   6723  C  CD   . ARG B 1 56  ? -75.275  -0.297  -18.603 1.00 79.54  ? 617  ARG B CD   1 
ATOM   6724  N  NE   . ARG B 1 56  ? -76.277  -0.197  -19.656 1.00 83.10  ? 617  ARG B NE   1 
ATOM   6725  C  CZ   . ARG B 1 56  ? -77.586  -0.300  -19.444 1.00 94.81  ? 617  ARG B CZ   1 
ATOM   6726  N  NH1  . ARG B 1 56  ? -78.046  -0.508  -18.216 1.00 93.24  ? 617  ARG B NH1  1 
ATOM   6727  N  NH2  . ARG B 1 56  ? -78.435  -0.200  -20.458 1.00 98.41  ? 617  ARG B NH2  1 
ATOM   6728  H  H    . ARG B 1 56  ? -71.914  -2.903  -19.089 1.00 107.39 ? 617  ARG B H    1 
ATOM   6729  H  HA   . ARG B 1 56  ? -71.262  -0.368  -18.980 1.00 98.94  ? 617  ARG B HA   1 
ATOM   6730  H  HB2  . ARG B 1 56  ? -73.317  -1.867  -17.843 1.00 86.91  ? 617  ARG B HB2  1 
ATOM   6731  H  HB3  . ARG B 1 56  ? -73.060  -0.418  -17.256 1.00 86.91  ? 617  ARG B HB3  1 
ATOM   6732  H  HG2  . ARG B 1 56  ? -73.544  0.505   -19.344 1.00 86.48  ? 617  ARG B HG2  1 
ATOM   6733  H  HG3  . ARG B 1 56  ? -73.842  -0.959  -19.906 1.00 86.48  ? 617  ARG B HG3  1 
ATOM   6734  H  HD2  . ARG B 1 56  ? -75.469  -1.092  -18.083 1.00 95.45  ? 617  ARG B HD2  1 
ATOM   6735  H  HD3  . ARG B 1 56  ? -75.354  0.491   -18.043 1.00 95.45  ? 617  ARG B HD3  1 
ATOM   6736  H  HE   . ARG B 1 56  ? -76.014  0.032   -20.442 1.00 99.72  ? 617  ARG B HE   1 
ATOM   6737  H  HH11 . ARG B 1 56  ? -77.498  -0.575  -17.557 1.00 111.89 ? 617  ARG B HH11 1 
ATOM   6738  H  HH12 . ARG B 1 56  ? -78.893  -0.575  -18.080 1.00 111.89 ? 617  ARG B HH12 1 
ATOM   6739  H  HH21 . ARG B 1 56  ? -78.140  -0.065  -21.255 1.00 118.10 ? 617  ARG B HH21 1 
ATOM   6740  H  HH22 . ARG B 1 56  ? -79.281  -0.267  -20.319 1.00 118.10 ? 617  ARG B HH22 1 
ATOM   6741  N  N    . GLU B 1 57  ? -70.480  -2.071  -16.387 1.00 89.43  ? 618  GLU B N    1 
ATOM   6742  C  CA   . GLU B 1 57  ? -69.811  -2.003  -15.091 1.00 93.62  ? 618  GLU B CA   1 
ATOM   6743  C  C    . GLU B 1 57  ? -68.423  -1.388  -15.220 1.00 89.72  ? 618  GLU B C    1 
ATOM   6744  O  O    . GLU B 1 57  ? -68.063  -0.474  -14.468 1.00 96.42  ? 618  GLU B O    1 
ATOM   6745  C  CB   . GLU B 1 57  ? -69.733  -3.399  -14.471 1.00 97.92  ? 618  GLU B CB   1 
ATOM   6746  C  CG   . GLU B 1 57  ? -71.098  -3.998  -14.137 1.00 99.99  ? 618  GLU B CG   1 
ATOM   6747  C  CD   . GLU B 1 57  ? -71.001  -5.326  -13.406 1.00 98.71  ? 618  GLU B CD   1 
ATOM   6748  O  OE1  . GLU B 1 57  ? -69.872  -5.746  -13.076 1.00 97.79  ? 618  GLU B OE1  1 
ATOM   6749  O  OE2  . GLU B 1 57  ? -72.057  -5.947  -13.159 1.00 93.78  ? 618  GLU B OE2  1 
ATOM   6750  H  H    . GLU B 1 57  ? -70.733  -2.860  -16.616 1.00 107.32 ? 618  GLU B H    1 
ATOM   6751  H  HA   . GLU B 1 57  ? -70.332  -1.441  -14.497 1.00 112.34 ? 618  GLU B HA   1 
ATOM   6752  H  HB2  . GLU B 1 57  ? -69.292  -3.995  -15.096 1.00 117.50 ? 618  GLU B HB2  1 
ATOM   6753  H  HB3  . GLU B 1 57  ? -69.222  -3.348  -13.648 1.00 117.50 ? 618  GLU B HB3  1 
ATOM   6754  H  HG2  . GLU B 1 57  ? -71.584  -3.379  -13.570 1.00 119.98 ? 618  GLU B HG2  1 
ATOM   6755  H  HG3  . GLU B 1 57  ? -71.587  -4.146  -14.961 1.00 119.98 ? 618  GLU B HG3  1 
ATOM   6756  N  N    . SER B 1 58  ? -67.632  -1.875  -16.170 1.00 82.56  ? 619  SER B N    1 
ATOM   6757  C  CA   . SER B 1 58  ? -66.317  -1.310  -16.422 1.00 65.44  ? 619  SER B CA   1 
ATOM   6758  C  C    . SER B 1 58  ? -66.421  -0.029  -17.245 1.00 75.97  ? 619  SER B C    1 
ATOM   6759  O  O    . SER B 1 58  ? -67.386  0.189   -17.983 1.00 69.88  ? 619  SER B O    1 
ATOM   6760  C  CB   . SER B 1 58  ? -65.435  -2.323  -17.145 1.00 64.05  ? 619  SER B CB   1 
ATOM   6761  O  OG   . SER B 1 58  ? -64.110  -1.844  -17.255 1.00 68.15  ? 619  SER B OG   1 
ATOM   6762  H  H    . SER B 1 58  ? -67.837  -2.534  -16.683 1.00 99.07  ? 619  SER B H    1 
ATOM   6763  H  HA   . SER B 1 58  ? -65.897  -1.093  -15.576 1.00 78.53  ? 619  SER B HA   1 
ATOM   6764  H  HB2  . SER B 1 58  ? -65.430  -3.153  -16.643 1.00 76.86  ? 619  SER B HB2  1 
ATOM   6765  H  HB3  . SER B 1 58  ? -65.791  -2.475  -18.034 1.00 76.86  ? 619  SER B HB3  1 
ATOM   6766  H  HG   . SER B 1 58  ? -64.100  -1.124  -17.688 1.00 81.78  ? 619  SER B HG   1 
ATOM   6767  N  N    . ASP B 1 59  ? -65.410  0.825   -17.107 1.00 81.29  ? 620  ASP B N    1 
ATOM   6768  C  CA   . ASP B 1 59  ? -65.354  2.053   -17.883 1.00 66.69  ? 620  ASP B CA   1 
ATOM   6769  C  C    . ASP B 1 59  ? -65.148  1.739   -19.365 1.00 74.81  ? 620  ASP B C    1 
ATOM   6770  O  O    . ASP B 1 59  ? -64.676  0.662   -19.745 1.00 70.91  ? 620  ASP B O    1 
ATOM   6771  C  CB   . ASP B 1 59  ? -64.233  2.959   -17.372 1.00 55.24  ? 620  ASP B CB   1 
ATOM   6772  H  H    . ASP B 1 59  ? -64.746  0.714   -16.571 1.00 97.55  ? 620  ASP B H    1 
ATOM   6773  H  HA   . ASP B 1 59  ? -66.194  2.528   -17.788 1.00 80.03  ? 620  ASP B HA   1 
ATOM   6774  N  N    . GLU B 1 60  ? -65.520  2.699   -20.207 1.00 62.36  ? 621  GLU B N    1 
ATOM   6775  C  CA   . GLU B 1 60  ? -65.438  2.509   -21.649 1.00 57.14  ? 621  GLU B CA   1 
ATOM   6776  C  C    . GLU B 1 60  ? -63.988  2.386   -22.104 1.00 66.21  ? 621  GLU B C    1 
ATOM   6777  O  O    . GLU B 1 60  ? -63.114  3.141   -21.667 1.00 51.20  ? 621  GLU B O    1 
ATOM   6778  C  CB   . GLU B 1 60  ? -66.105  3.673   -22.377 1.00 70.58  ? 621  GLU B CB   1 
ATOM   6779  C  CG   . GLU B 1 60  ? -67.520  3.978   -21.915 1.00 79.94  ? 621  GLU B CG   1 
ATOM   6780  C  CD   . GLU B 1 60  ? -68.243  4.924   -22.854 1.00 82.37  ? 621  GLU B CD   1 
ATOM   6781  O  OE1  . GLU B 1 60  ? -68.455  4.548   -24.026 1.00 74.07  ? 621  GLU B OE1  1 
ATOM   6782  O  OE2  . GLU B 1 60  ? -68.593  6.043   -22.427 1.00 92.22  ? 621  GLU B OE2  1 
ATOM   6783  H  H    . GLU B 1 60  ? -65.823  3.468   -19.969 1.00 74.84  ? 621  GLU B H    1 
ATOM   6784  H  HA   . GLU B 1 60  ? -65.902  1.692   -21.890 1.00 68.57  ? 621  GLU B HA   1 
ATOM   6785  H  HB2  . GLU B 1 60  ? -65.572  4.472   -22.239 1.00 84.70  ? 621  GLU B HB2  1 
ATOM   6786  H  HB3  . GLU B 1 60  ? -66.144  3.465   -23.324 1.00 84.70  ? 621  GLU B HB3  1 
ATOM   6787  H  HG2  . GLU B 1 60  ? -68.025  3.151   -21.872 1.00 95.92  ? 621  GLU B HG2  1 
ATOM   6788  H  HG3  . GLU B 1 60  ? -67.484  4.393   -21.038 1.00 95.92  ? 621  GLU B HG3  1 
ATOM   6789  N  N    . HIS B 1 61  ? -63.735  1.405   -23.012 1.00 54.90  ? 622  HIS B N    1 
ATOM   6790  C  CA   . HIS B 1 61  ? -62.419  1.228   -23.615 1.00 52.43  ? 622  HIS B CA   1 
ATOM   6791  C  C    . HIS B 1 61  ? -62.315  2.033   -24.911 1.00 46.25  ? 622  HIS B C    1 
ATOM   6792  O  O    . HIS B 1 61  ? -63.282  2.098   -25.675 1.00 45.31  ? 622  HIS B O    1 
ATOM   6793  C  CB   . HIS B 1 61  ? -62.157  -0.242  -23.909 1.00 44.41  ? 622  HIS B CB   1 
ATOM   6794  C  CG   . HIS B 1 61  ? -60.710  -0.568  -24.109 1.00 39.41  ? 622  HIS B CG   1 
ATOM   6795  N  ND1  . HIS B 1 61  ? -60.125  -0.640  -25.355 1.00 37.96  ? 622  HIS B ND1  1 
ATOM   6796  C  CD2  . HIS B 1 61  ? -59.728  -0.838  -23.218 1.00 43.98  ? 622  HIS B CD2  1 
ATOM   6797  C  CE1  . HIS B 1 61  ? -58.847  -0.943  -25.223 1.00 42.55  ? 622  HIS B CE1  1 
ATOM   6798  N  NE2  . HIS B 1 61  ? -58.580  -1.068  -23.936 1.00 49.31  ? 622  HIS B NE2  1 
ATOM   6799  H  H    . HIS B 1 61  ? -64.321  0.838   -23.285 1.00 65.89  ? 622  HIS B H    1 
ATOM   6800  H  HA   . HIS B 1 61  ? -61.738  1.545   -23.001 1.00 62.92  ? 622  HIS B HA   1 
ATOM   6801  H  HB2  . HIS B 1 61  ? -62.480  -0.772  -23.164 1.00 53.29  ? 622  HIS B HB2  1 
ATOM   6802  H  HB3  . HIS B 1 61  ? -62.631  -0.488  -24.718 1.00 53.29  ? 622  HIS B HB3  1 
ATOM   6803  H  HD1  . HIS B 1 61  ? -60.530  -0.509  -26.102 1.00 45.55  ? 622  HIS B HD1  1 
ATOM   6804  H  HD2  . HIS B 1 61  ? -59.815  -0.864  -22.292 1.00 52.78  ? 622  HIS B HD2  1 
ATOM   6805  H  HE1  . HIS B 1 61  ? -58.238  -1.049  -25.918 1.00 51.05  ? 622  HIS B HE1  1 
ATOM   6806  H  HE2  . HIS B 1 61  ? -57.812  -1.263  -23.601 1.00 59.18  ? 622  HIS B HE2  1 
ATOM   6807  N  N    . PRO B 1 62  ? -61.167  2.655   -25.201 1.00 38.09  ? 623  PRO B N    1 
ATOM   6808  C  CA   . PRO B 1 62  ? -61.070  3.459   -26.433 1.00 37.88  ? 623  PRO B CA   1 
ATOM   6809  C  C    . PRO B 1 62  ? -61.274  2.652   -27.700 1.00 43.99  ? 623  PRO B C    1 
ATOM   6810  O  O    . PRO B 1 62  ? -61.754  3.191   -28.705 1.00 53.04  ? 623  PRO B O    1 
ATOM   6811  C  CB   . PRO B 1 62  ? -59.646  4.030   -26.371 1.00 44.17  ? 623  PRO B CB   1 
ATOM   6812  C  CG   . PRO B 1 62  ? -59.170  3.796   -24.983 1.00 49.27  ? 623  PRO B CG   1 
ATOM   6813  C  CD   . PRO B 1 62  ? -59.884  2.602   -24.481 1.00 38.07  ? 623  PRO B CD   1 
ATOM   6814  H  HA   . PRO B 1 62  ? -61.709  4.188   -26.410 1.00 45.45  ? 623  PRO B HA   1 
ATOM   6815  H  HB2  . PRO B 1 62  ? -59.082  3.564   -27.007 1.00 53.01  ? 623  PRO B HB2  1 
ATOM   6816  H  HB3  . PRO B 1 62  ? -59.669  4.980   -26.567 1.00 53.01  ? 623  PRO B HB3  1 
ATOM   6817  H  HG2  . PRO B 1 62  ? -58.213  3.638   -24.993 1.00 59.12  ? 623  PRO B HG2  1 
ATOM   6818  H  HG3  . PRO B 1 62  ? -59.379  4.570   -24.436 1.00 59.12  ? 623  PRO B HG3  1 
ATOM   6819  H  HD2  . PRO B 1 62  ? -59.399  1.794   -24.712 1.00 45.68  ? 623  PRO B HD2  1 
ATOM   6820  H  HD3  . PRO B 1 62  ? -60.028  2.670   -23.524 1.00 45.68  ? 623  PRO B HD3  1 
ATOM   6821  N  N    . ASN B 1 63  ? -60.872  1.385   -27.687 1.00 54.03  ? 624  ASN B N    1 
ATOM   6822  C  CA   . ASN B 1 63  ? -60.891  0.499   -28.841 1.00 41.27  ? 624  ASN B CA   1 
ATOM   6823  C  C    . ASN B 1 63  ? -62.136  -0.384  -28.911 1.00 51.24  ? 624  ASN B C    1 
ATOM   6824  O  O    . ASN B 1 63  ? -62.152  -1.345  -29.689 1.00 39.82  ? 624  ASN B O    1 
ATOM   6825  C  CB   . ASN B 1 63  ? -59.616  -0.338  -28.856 1.00 37.46  ? 624  ASN B CB   1 
ATOM   6826  C  CG   . ASN B 1 63  ? -58.370  0.526   -28.936 1.00 38.80  ? 624  ASN B CG   1 
ATOM   6827  O  OD1  . ASN B 1 63  ? -58.327  1.492   -29.693 1.00 38.72  ? 624  ASN B OD1  1 
ATOM   6828  N  ND2  . ASN B 1 63  ? -57.364  0.199   -28.140 1.00 44.49  ? 624  ASN B ND2  1 
ATOM   6829  H  H    . ASN B 1 63  ? -60.569  0.999   -26.980 1.00 64.84  ? 624  ASN B H    1 
ATOM   6830  H  HA   . ASN B 1 63  ? -60.884  1.046   -29.642 1.00 49.52  ? 624  ASN B HA   1 
ATOM   6831  H  HB2  . ASN B 1 63  ? -59.569  -0.862  -28.041 1.00 44.95  ? 624  ASN B HB2  1 
ATOM   6832  H  HB3  . ASN B 1 63  ? -59.628  -0.924  -29.630 1.00 44.95  ? 624  ASN B HB3  1 
ATOM   6833  H  HD21 . ASN B 1 63  ? -57.436  -0.476  -27.612 1.00 53.38  ? 624  ASN B HD21 1 
ATOM   6834  H  HD22 . ASN B 1 63  ? -56.639  0.661   -28.152 1.00 53.38  ? 624  ASN B HD22 1 
ATOM   6835  N  N    . VAL B 1 64  ? -63.123  -0.160  -28.044 1.00 44.44  ? 625  VAL B N    1 
ATOM   6836  C  CA   . VAL B 1 64  ? -64.437  -0.786  -28.167 1.00 40.65  ? 625  VAL B CA   1 
ATOM   6837  C  C    . VAL B 1 64  ? -65.453  0.288   -28.531 1.00 35.22  ? 625  VAL B C    1 
ATOM   6838  O  O    . VAL B 1 64  ? -65.404  1.409   -28.011 1.00 53.60  ? 625  VAL B O    1 
ATOM   6839  C  CB   . VAL B 1 64  ? -64.850  -1.514  -26.873 1.00 48.99  ? 625  VAL B CB   1 
ATOM   6840  C  CG1  . VAL B 1 64  ? -66.244  -2.125  -27.020 1.00 45.08  ? 625  VAL B CG1  1 
ATOM   6841  C  CG2  . VAL B 1 64  ? -63.830  -2.590  -26.530 1.00 44.30  ? 625  VAL B CG2  1 
ATOM   6842  H  H    . VAL B 1 64  ? -63.053  0.361   -27.363 1.00 53.33  ? 625  VAL B H    1 
ATOM   6843  H  HA   . VAL B 1 64  ? -64.414  -1.437  -28.885 1.00 48.78  ? 625  VAL B HA   1 
ATOM   6844  H  HB   . VAL B 1 64  ? -64.874  -0.877  -26.142 1.00 58.79  ? 625  VAL B HB   1 
ATOM   6845  H  HG11 . VAL B 1 64  ? -66.479  -2.577  -26.194 1.00 54.10  ? 625  VAL B HG11 1 
ATOM   6846  H  HG12 . VAL B 1 64  ? -66.881  -1.417  -27.204 1.00 54.10  ? 625  VAL B HG12 1 
ATOM   6847  H  HG13 . VAL B 1 64  ? -66.234  -2.760  -27.754 1.00 54.10  ? 625  VAL B HG13 1 
ATOM   6848  H  HG21 . VAL B 1 64  ? -64.106  -3.037  -25.714 1.00 53.16  ? 625  VAL B HG21 1 
ATOM   6849  H  HG22 . VAL B 1 64  ? -63.788  -3.229  -27.259 1.00 53.16  ? 625  VAL B HG22 1 
ATOM   6850  H  HG23 . VAL B 1 64  ? -62.963  -2.174  -26.403 1.00 53.16  ? 625  VAL B HG23 1 
ATOM   6851  N  N    . ILE B 1 65  ? -66.379  -0.066  -29.425 1.00 41.75  ? 626  ILE B N    1 
ATOM   6852  C  CA   . ILE B 1 65  ? -67.384  0.881   -29.888 1.00 41.33  ? 626  ILE B CA   1 
ATOM   6853  C  C    . ILE B 1 65  ? -68.234  1.349   -28.712 1.00 55.71  ? 626  ILE B C    1 
ATOM   6854  O  O    . ILE B 1 65  ? -68.558  0.570   -27.804 1.00 34.87  ? 626  ILE B O    1 
ATOM   6855  C  CB   . ILE B 1 65  ? -68.249  0.230   -30.983 1.00 51.80  ? 626  ILE B CB   1 
ATOM   6856  C  CG1  . ILE B 1 65  ? -68.992  1.291   -31.790 1.00 50.30  ? 626  ILE B CG1  1 
ATOM   6857  C  CG2  . ILE B 1 65  ? -69.232  -0.769  -30.382 1.00 60.42  ? 626  ILE B CG2  1 
ATOM   6858  C  CD1  . ILE B 1 65  ? -69.690  0.737   -33.023 1.00 66.62  ? 626  ILE B CD1  1 
ATOM   6859  H  H    . ILE B 1 65  ? -66.443  -0.849  -29.776 1.00 50.10  ? 626  ILE B H    1 
ATOM   6860  H  HA   . ILE B 1 65  ? -66.942  1.656   -30.270 1.00 49.60  ? 626  ILE B HA   1 
ATOM   6861  H  HB   . ILE B 1 65  ? -67.660  -0.251  -31.586 1.00 62.16  ? 626  ILE B HB   1 
ATOM   6862  H  HG12 . ILE B 1 65  ? -69.666  1.699   -31.225 1.00 60.36  ? 626  ILE B HG12 1 
ATOM   6863  H  HG13 . ILE B 1 65  ? -68.358  1.963   -32.084 1.00 60.36  ? 626  ILE B HG13 1 
ATOM   6864  H  HG21 . ILE B 1 65  ? -69.760  -1.160  -31.095 1.00 72.51  ? 626  ILE B HG21 1 
ATOM   6865  H  HG22 . ILE B 1 65  ? -68.735  -1.461  -29.920 1.00 72.51  ? 626  ILE B HG22 1 
ATOM   6866  H  HG23 . ILE B 1 65  ? -69.811  -0.304  -29.758 1.00 72.51  ? 626  ILE B HG23 1 
ATOM   6867  H  HD11 . ILE B 1 65  ? -70.139  1.464   -33.484 1.00 79.94  ? 626  ILE B HD11 1 
ATOM   6868  H  HD12 . ILE B 1 65  ? -69.028  0.334   -33.606 1.00 79.94  ? 626  ILE B HD12 1 
ATOM   6869  H  HD13 . ILE B 1 65  ? -70.338  0.070   -32.746 1.00 79.94  ? 626  ILE B HD13 1 
ATOM   6870  N  N    . ARG B 1 66  ? -68.603  2.631   -28.730 1.00 44.84  ? 627  ARG B N    1 
ATOM   6871  C  CA   . ARG B 1 66  ? -69.386  3.214   -27.647 1.00 37.39  ? 627  ARG B CA   1 
ATOM   6872  C  C    . ARG B 1 66  ? -70.853  2.836   -27.776 1.00 45.09  ? 627  ARG B C    1 
ATOM   6873  O  O    . ARG B 1 66  ? -71.414  2.814   -28.875 1.00 41.59  ? 627  ARG B O    1 
ATOM   6874  C  CB   . ARG B 1 66  ? -69.263  4.738   -27.632 1.00 43.19  ? 627  ARG B CB   1 
ATOM   6875  C  CG   . ARG B 1 66  ? -67.937  5.263   -27.136 1.00 66.61  ? 627  ARG B CG   1 
ATOM   6876  C  CD   . ARG B 1 66  ? -68.039  6.728   -26.743 1.00 64.31  ? 627  ARG B CD   1 
ATOM   6877  N  NE   . ARG B 1 66  ? -68.212  7.602   -27.899 1.00 66.17  ? 627  ARG B NE   1 
ATOM   6878  C  CZ   . ARG B 1 66  ? -68.321  8.925   -27.826 1.00 75.82  ? 627  ARG B CZ   1 
ATOM   6879  N  NH1  . ARG B 1 66  ? -68.283  9.537   -26.649 1.00 72.56  ? 627  ARG B NH1  1 
ATOM   6880  N  NH2  . ARG B 1 66  ? -68.470  9.638   -28.935 1.00 78.01  ? 627  ARG B NH2  1 
ATOM   6881  H  H    . ARG B 1 66  ? -68.411  3.183   -29.361 1.00 53.81  ? 627  ARG B H    1 
ATOM   6882  H  HA   . ARG B 1 66  ? -69.059  2.875   -26.799 1.00 44.87  ? 627  ARG B HA   1 
ATOM   6883  H  HB2  . ARG B 1 66  ? -69.388  5.067   -28.537 1.00 51.83  ? 627  ARG B HB2  1 
ATOM   6884  H  HB3  . ARG B 1 66  ? -69.955  5.099   -27.056 1.00 51.83  ? 627  ARG B HB3  1 
ATOM   6885  H  HG2  . ARG B 1 66  ? -67.663  4.756   -26.356 1.00 79.93  ? 627  ARG B HG2  1 
ATOM   6886  H  HG3  . ARG B 1 66  ? -67.276  5.182   -27.841 1.00 79.93  ? 627  ARG B HG3  1 
ATOM   6887  H  HD2  . ARG B 1 66  ? -68.804  6.847   -26.158 1.00 77.17  ? 627  ARG B HD2  1 
ATOM   6888  H  HD3  . ARG B 1 66  ? -67.225  6.991   -26.285 1.00 77.17  ? 627  ARG B HD3  1 
ATOM   6889  H  HE   . ARG B 1 66  ? -68.245  7.238   -28.677 1.00 79.41  ? 627  ARG B HE   1 
ATOM   6890  H  HH11 . ARG B 1 66  ? -68.185  9.078   -25.928 1.00 87.07  ? 627  ARG B HH11 1 
ATOM   6891  H  HH12 . ARG B 1 66  ? -68.355  10.393  -26.607 1.00 87.07  ? 627  ARG B HH12 1 
ATOM   6892  H  HH21 . ARG B 1 66  ? -68.496  9.244   -29.699 1.00 93.61  ? 627  ARG B HH21 1 
ATOM   6893  H  HH22 . ARG B 1 66  ? -68.543  10.493  -28.889 1.00 93.61  ? 627  ARG B HH22 1 
ATOM   6894  N  N    . TYR B 1 67  ? -71.475  2.560   -26.634 1.00 46.18  ? 628  TYR B N    1 
ATOM   6895  C  CA   . TYR B 1 67  ? -72.898  2.265   -26.544 1.00 58.41  ? 628  TYR B CA   1 
ATOM   6896  C  C    . TYR B 1 67  ? -73.583  3.430   -25.844 1.00 53.54  ? 628  TYR B C    1 
ATOM   6897  O  O    . TYR B 1 67  ? -73.211  3.790   -24.721 1.00 49.52  ? 628  TYR B O    1 
ATOM   6898  C  CB   . TYR B 1 67  ? -73.139  0.961   -25.785 1.00 49.97  ? 628  TYR B CB   1 
ATOM   6899  C  CG   . TYR B 1 67  ? -74.530  0.855   -25.207 1.00 50.00  ? 628  TYR B CG   1 
ATOM   6900  C  CD1  . TYR B 1 67  ? -75.592  0.415   -25.980 1.00 54.32  ? 628  TYR B CD1  1 
ATOM   6901  C  CD2  . TYR B 1 67  ? -74.779  1.197   -23.883 1.00 49.19  ? 628  TYR B CD2  1 
ATOM   6902  C  CE1  . TYR B 1 67  ? -76.862  0.319   -25.454 1.00 55.91  ? 628  TYR B CE1  1 
ATOM   6903  C  CE2  . TYR B 1 67  ? -76.047  1.103   -23.350 1.00 52.99  ? 628  TYR B CE2  1 
ATOM   6904  C  CZ   . TYR B 1 67  ? -77.084  0.665   -24.141 1.00 53.72  ? 628  TYR B CZ   1 
ATOM   6905  O  OH   . TYR B 1 67  ? -78.350  0.572   -23.617 1.00 58.90  ? 628  TYR B OH   1 
ATOM   6906  H  H    . TYR B 1 67  ? -71.077  2.537   -25.872 1.00 55.42  ? 628  TYR B H    1 
ATOM   6907  H  HA   . TYR B 1 67  ? -73.270  2.178   -27.435 1.00 70.09  ? 628  TYR B HA   1 
ATOM   6908  H  HB2  . TYR B 1 67  ? -73.012  0.216   -26.393 1.00 59.97  ? 628  TYR B HB2  1 
ATOM   6909  H  HB3  . TYR B 1 67  ? -72.506  0.902   -25.053 1.00 59.97  ? 628  TYR B HB3  1 
ATOM   6910  H  HD1  . TYR B 1 67  ? -75.446  0.182   -26.869 1.00 65.18  ? 628  TYR B HD1  1 
ATOM   6911  H  HD2  . TYR B 1 67  ? -74.079  1.495   -23.348 1.00 59.03  ? 628  TYR B HD2  1 
ATOM   6912  H  HE1  . TYR B 1 67  ? -77.566  0.023   -25.985 1.00 67.09  ? 628  TYR B HE1  1 
ATOM   6913  H  HE2  . TYR B 1 67  ? -76.201  1.337   -22.463 1.00 63.59  ? 628  TYR B HE2  1 
ATOM   6914  H  HH   . TYR B 1 67  ? -78.347  0.811   -22.812 1.00 70.68  ? 628  TYR B HH   1 
ATOM   6915  N  N    . PHE B 1 68  ? -74.581  4.015   -26.506 1.00 44.80  ? 629  PHE B N    1 
ATOM   6916  C  CA   . PHE B 1 68  ? -75.263  5.200   -25.999 1.00 54.62  ? 629  PHE B CA   1 
ATOM   6917  C  C    . PHE B 1 68  ? -76.591  4.859   -25.328 1.00 50.09  ? 629  PHE B C    1 
ATOM   6918  O  O    . PHE B 1 68  ? -76.739  5.048   -24.118 1.00 53.29  ? 629  PHE B O    1 
ATOM   6919  C  CB   . PHE B 1 68  ? -75.466  6.208   -27.140 1.00 41.31  ? 629  PHE B CB   1 
ATOM   6920  C  CG   . PHE B 1 68  ? -74.186  6.811   -27.646 1.00 39.78  ? 629  PHE B CG   1 
ATOM   6921  C  CD1  . PHE B 1 68  ? -73.442  7.658   -26.842 1.00 45.88  ? 629  PHE B CD1  1 
ATOM   6922  C  CD2  . PHE B 1 68  ? -73.728  6.538   -28.926 1.00 47.69  ? 629  PHE B CD2  1 
ATOM   6923  C  CE1  . PHE B 1 68  ? -72.267  8.218   -27.302 1.00 47.95  ? 629  PHE B CE1  1 
ATOM   6924  C  CE2  . PHE B 1 68  ? -72.550  7.099   -29.389 1.00 39.49  ? 629  PHE B CE2  1 
ATOM   6925  C  CZ   . PHE B 1 68  ? -71.823  7.938   -28.577 1.00 48.13  ? 629  PHE B CZ   1 
ATOM   6926  H  H    . PHE B 1 68  ? -74.884  3.738   -27.262 1.00 53.76  ? 629  PHE B H    1 
ATOM   6927  H  HA   . PHE B 1 68  ? -74.698  5.621   -25.333 1.00 65.54  ? 629  PHE B HA   1 
ATOM   6928  H  HB2  . PHE B 1 68  ? -75.896  5.756   -27.883 1.00 49.57  ? 629  PHE B HB2  1 
ATOM   6929  H  HB3  . PHE B 1 68  ? -76.030  6.930   -26.823 1.00 49.57  ? 629  PHE B HB3  1 
ATOM   6930  H  HD1  . PHE B 1 68  ? -73.737  7.851   -25.982 1.00 55.06  ? 629  PHE B HD1  1 
ATOM   6931  H  HD2  . PHE B 1 68  ? -74.216  5.972   -29.479 1.00 57.22  ? 629  PHE B HD2  1 
ATOM   6932  H  HE1  . PHE B 1 68  ? -71.776  8.785   -26.753 1.00 57.54  ? 629  PHE B HE1  1 
ATOM   6933  H  HE2  . PHE B 1 68  ? -72.251  6.909   -30.249 1.00 47.39  ? 629  PHE B HE2  1 
ATOM   6934  H  HZ   . PHE B 1 68  ? -71.032  8.314   -28.887 1.00 57.75  ? 629  PHE B HZ   1 
ATOM   6935  N  N    . CYS B 1 69  ? -77.560  4.347   -26.086 1.00 45.83  ? 630  CYS B N    1 
ATOM   6936  C  CA   . CYS B 1 69  ? -78.906  4.178   -25.558 1.00 54.63  ? 630  CYS B CA   1 
ATOM   6937  C  C    . CYS B 1 69  ? -79.581  2.980   -26.207 1.00 52.63  ? 630  CYS B C    1 
ATOM   6938  O  O    . CYS B 1 69  ? -79.172  2.505   -27.269 1.00 48.73  ? 630  CYS B O    1 
ATOM   6939  C  CB   . CYS B 1 69  ? -79.748  5.440   -25.783 1.00 41.17  ? 630  CYS B CB   1 
ATOM   6940  S  SG   . CYS B 1 69  ? -81.306  5.447   -24.876 1.00 76.88  ? 630  CYS B SG   1 
ATOM   6941  H  H    . CYS B 1 69  ? -77.462  4.092   -26.901 1.00 54.99  ? 630  CYS B H    1 
ATOM   6942  H  HA   . CYS B 1 69  ? -78.855  4.016   -24.603 1.00 65.56  ? 630  CYS B HA   1 
ATOM   6943  H  HB2  . CYS B 1 69  ? -79.236  6.213   -25.497 1.00 49.40  ? 630  CYS B HB2  1 
ATOM   6944  H  HB3  . CYS B 1 69  ? -79.955  5.513   -26.728 1.00 49.40  ? 630  CYS B HB3  1 
ATOM   6945  H  HG   . CYS B 1 69  ? -81.074  5.372   -23.701 1.00 92.26  ? 630  CYS B HG   1 
ATOM   6946  N  N    . THR B 1 70  ? -80.631  2.499   -25.541 1.00 47.36  ? 631  THR B N    1 
ATOM   6947  C  CA   . THR B 1 70  ? -81.490  1.442   -26.057 1.00 66.48  ? 631  THR B CA   1 
ATOM   6948  C  C    . THR B 1 70  ? -82.936  1.898   -25.940 1.00 70.47  ? 631  THR B C    1 
ATOM   6949  O  O    . THR B 1 70  ? -83.343  2.406   -24.890 1.00 69.60  ? 631  THR B O    1 
ATOM   6950  C  CB   . THR B 1 70  ? -81.299  0.122   -25.296 1.00 57.78  ? 631  THR B CB   1 
ATOM   6951  O  OG1  . THR B 1 70  ? -79.955  -0.342  -25.454 1.00 63.73  ? 631  THR B OG1  1 
ATOM   6952  C  CG2  . THR B 1 70  ? -82.242  -0.945  -25.824 1.00 46.98  ? 631  THR B CG2  1 
ATOM   6953  H  H    . THR B 1 70  ? -80.870  2.781   -24.765 1.00 56.83  ? 631  THR B H    1 
ATOM   6954  H  HA   . THR B 1 70  ? -81.289  1.289   -26.994 1.00 79.78  ? 631  THR B HA   1 
ATOM   6955  H  HB   . THR B 1 70  ? -81.486  0.260   -24.354 1.00 69.33  ? 631  THR B HB   1 
ATOM   6956  H  HG1  . THR B 1 70  ? -79.417  0.229   -25.151 1.00 76.48  ? 631  THR B HG1  1 
ATOM   6957  H  HG21 . THR B 1 70  ? -82.112  -1.773  -25.336 1.00 56.38  ? 631  THR B HG21 1 
ATOM   6958  H  HG22 . THR B 1 70  ? -83.162  -0.656  -25.716 1.00 56.38  ? 631  THR B HG22 1 
ATOM   6959  H  HG23 . THR B 1 70  ? -82.069  -1.103  -26.765 1.00 56.38  ? 631  THR B HG23 1 
ATOM   6960  N  N    . GLU B 1 71  ? -83.707  1.708   -27.008 1.00 59.38  ? 632  GLU B N    1 
ATOM   6961  C  CA   . GLU B 1 71  ? -85.117  2.063   -27.020 1.00 61.46  ? 632  GLU B CA   1 
ATOM   6962  C  C    . GLU B 1 71  ? -85.935  0.892   -27.546 1.00 78.27  ? 632  GLU B C    1 
ATOM   6963  O  O    . GLU B 1 71  ? -85.407  -0.051  -28.143 1.00 67.84  ? 632  GLU B O    1 
ATOM   6964  C  CB   . GLU B 1 71  ? -85.378  3.317   -27.863 1.00 63.00  ? 632  GLU B CB   1 
ATOM   6965  C  CG   . GLU B 1 71  ? -84.824  4.599   -27.248 1.00 75.66  ? 632  GLU B CG   1 
ATOM   6966  C  CD   . GLU B 1 71  ? -85.539  5.002   -25.960 1.00 70.54  ? 632  GLU B CD   1 
ATOM   6967  O  OE1  . GLU B 1 71  ? -85.145  6.017   -25.348 1.00 79.23  ? 632  GLU B OE1  1 
ATOM   6968  O  OE2  . GLU B 1 71  ? -86.509  4.319   -25.568 1.00 90.85  ? 632  GLU B OE2  1 
ATOM   6969  H  H    . GLU B 1 71  ? -83.429  1.369   -27.748 1.00 71.26  ? 632  GLU B H    1 
ATOM   6970  H  HA   . GLU B 1 71  ? -85.405  2.247   -26.113 1.00 73.76  ? 632  GLU B HA   1 
ATOM   6971  H  HB2  . GLU B 1 71  ? -84.963  3.202   -28.732 1.00 75.60  ? 632  GLU B HB2  1 
ATOM   6972  H  HB3  . GLU B 1 71  ? -86.336  3.429   -27.969 1.00 75.60  ? 632  GLU B HB3  1 
ATOM   6973  H  HG2  . GLU B 1 71  ? -83.885  4.469   -27.040 1.00 90.79  ? 632  GLU B HG2  1 
ATOM   6974  H  HG3  . GLU B 1 71  ? -84.924  5.323   -27.885 1.00 90.79  ? 632  GLU B HG3  1 
ATOM   6975  N  N    . LYS B 1 72  ? -87.244  0.972   -27.309 1.00 75.18  ? 633  LYS B N    1 
ATOM   6976  C  CA   . LYS B 1 72  ? -88.166  -0.126  -27.555 1.00 73.74  ? 633  LYS B CA   1 
ATOM   6977  C  C    . LYS B 1 72  ? -89.416  0.380   -28.259 1.00 71.04  ? 633  LYS B C    1 
ATOM   6978  O  O    . LYS B 1 72  ? -89.900  1.480   -27.974 1.00 77.28  ? 633  LYS B O    1 
ATOM   6979  C  CB   . LYS B 1 72  ? -88.573  -0.800  -26.236 1.00 66.68  ? 633  LYS B CB   1 
ATOM   6980  C  CG   . LYS B 1 72  ? -88.256  -2.281  -26.124 1.00 74.18  ? 633  LYS B CG   1 
ATOM   6981  C  CD   . LYS B 1 72  ? -89.038  -2.901  -24.966 1.00 82.07  ? 633  LYS B CD   1 
ATOM   6982  C  CE   . LYS B 1 72  ? -88.506  -4.274  -24.569 1.00 86.70  ? 633  LYS B CE   1 
ATOM   6983  N  NZ   . LYS B 1 72  ? -88.731  -5.311  -25.615 1.00 83.02  ? 633  LYS B NZ   1 
ATOM   6984  H  H    . LYS B 1 72  ? -87.628  1.675   -26.996 1.00 90.21  ? 633  LYS B H    1 
ATOM   6985  H  HA   . LYS B 1 72  ? -87.739  -0.788  -28.122 1.00 88.49  ? 633  LYS B HA   1 
ATOM   6986  H  HB2  . LYS B 1 72  ? -88.116  -0.350  -25.509 1.00 80.02  ? 633  LYS B HB2  1 
ATOM   6987  H  HB3  . LYS B 1 72  ? -89.532  -0.700  -26.125 1.00 80.02  ? 633  LYS B HB3  1 
ATOM   6988  H  HG2  . LYS B 1 72  ? -88.512  -2.731  -26.945 1.00 89.02  ? 633  LYS B HG2  1 
ATOM   6989  H  HG3  . LYS B 1 72  ? -87.308  -2.398  -25.954 1.00 89.02  ? 633  LYS B HG3  1 
ATOM   6990  H  HD2  . LYS B 1 72  ? -88.973  -2.318  -24.194 1.00 98.48  ? 633  LYS B HD2  1 
ATOM   6991  H  HD3  . LYS B 1 72  ? -89.966  -3.002  -25.230 1.00 98.48  ? 633  LYS B HD3  1 
ATOM   6992  H  HE2  . LYS B 1 72  ? -87.551  -4.209  -24.412 1.00 104.03 ? 633  LYS B HE2  1 
ATOM   6993  H  HE3  . LYS B 1 72  ? -88.955  -4.563  -23.759 1.00 104.03 ? 633  LYS B HE3  1 
ATOM   6994  H  HZ1  . LYS B 1 72  ? -89.603  -5.399  -25.774 1.00 99.63  ? 633  LYS B HZ1  1 
ATOM   6995  H  HZ2  . LYS B 1 72  ? -88.322  -5.076  -26.370 1.00 99.63  ? 633  LYS B HZ2  1 
ATOM   6996  H  HZ3  . LYS B 1 72  ? -88.407  -6.094  -25.342 1.00 99.63  ? 633  LYS B HZ3  1 
ATOM   6997  N  N    . ASP B 1 73  ? -89.927  -0.427  -29.186 1.00 87.27  ? 634  ASP B N    1 
ATOM   6998  C  CA   . ASP B 1 73  ? -91.316  -0.364  -29.621 1.00 86.93  ? 634  ASP B CA   1 
ATOM   6999  C  C    . ASP B 1 73  ? -91.907  -1.762  -29.467 1.00 84.22  ? 634  ASP B C    1 
ATOM   7000  O  O    . ASP B 1 73  ? -91.245  -2.683  -28.976 1.00 84.24  ? 634  ASP B O    1 
ATOM   7001  C  CB   . ASP B 1 73  ? -91.454  0.166   -31.058 1.00 69.54  ? 634  ASP B CB   1 
ATOM   7002  C  CG   . ASP B 1 73  ? -90.627  -0.608  -32.062 1.00 68.35  ? 634  ASP B CG   1 
ATOM   7003  O  OD1  . ASP B 1 73  ? -90.180  -1.730  -31.752 1.00 86.76  ? 634  ASP B OD1  1 
ATOM   7004  O  OD2  . ASP B 1 73  ? -90.436  -0.088  -33.182 1.00 62.02  ? 634  ASP B OD2  1 
ATOM   7005  H  H    . ASP B 1 73  ? -89.472  -1.036  -29.588 1.00 104.73 ? 634  ASP B H    1 
ATOM   7006  H  HA   . ASP B 1 73  ? -91.805  0.234   -29.034 1.00 104.32 ? 634  ASP B HA   1 
ATOM   7007  H  HB2  . ASP B 1 73  ? -92.384  0.105   -31.327 1.00 83.45  ? 634  ASP B HB2  1 
ATOM   7008  H  HB3  . ASP B 1 73  ? -91.163  1.091   -31.081 1.00 83.45  ? 634  ASP B HB3  1 
ATOM   7009  N  N    . ARG B 1 74  ? -93.164  -1.930  -29.878 1.00 95.13  ? 635  ARG B N    1 
ATOM   7010  C  CA   . ARG B 1 74  ? -93.830  -3.206  -29.639 1.00 98.68  ? 635  ARG B CA   1 
ATOM   7011  C  C    . ARG B 1 74  ? -93.172  -4.333  -30.429 1.00 95.19  ? 635  ARG B C    1 
ATOM   7012  O  O    . ARG B 1 74  ? -93.020  -5.448  -29.917 1.00 78.61  ? 635  ARG B O    1 
ATOM   7013  C  CB   . ARG B 1 74  ? -95.319  -3.096  -29.971 1.00 87.66  ? 635  ARG B CB   1 
ATOM   7014  C  CG   . ARG B 1 74  ? -95.654  -2.907  -31.441 1.00 104.31 ? 635  ARG B CG   1 
ATOM   7015  C  CD   . ARG B 1 74  ? -97.153  -2.680  -31.609 1.00 121.82 ? 635  ARG B CD   1 
ATOM   7016  N  NE   . ARG B 1 74  ? -97.601  -2.792  -32.995 1.00 111.30 ? 635  ARG B NE   1 
ATOM   7017  C  CZ   . ARG B 1 74  ? -98.875  -2.737  -33.373 1.00 102.40 ? 635  ARG B CZ   1 
ATOM   7018  N  NH1  . ARG B 1 74  ? -99.835  -2.570  -32.472 1.00 100.85 ? 635  ARG B NH1  1 
ATOM   7019  N  NH2  . ARG B 1 74  ? -99.193  -2.850  -34.655 1.00 102.18 ? 635  ARG B NH2  1 
ATOM   7020  H  H    . ARG B 1 74  ? -93.640  -1.339  -30.284 1.00 114.16 ? 635  ARG B H    1 
ATOM   7021  H  HA   . ARG B 1 74  ? -93.753  -3.424  -28.697 1.00 118.41 ? 635  ARG B HA   1 
ATOM   7022  H  HB2  . ARG B 1 74  ? -95.759  -3.908  -29.675 1.00 105.20 ? 635  ARG B HB2  1 
ATOM   7023  H  HB3  . ARG B 1 74  ? -95.684  -2.337  -29.490 1.00 105.20 ? 635  ARG B HB3  1 
ATOM   7024  H  HG2  . ARG B 1 74  ? -95.184  -2.131  -31.785 1.00 125.17 ? 635  ARG B HG2  1 
ATOM   7025  H  HG3  . ARG B 1 74  ? -95.405  -3.703  -31.937 1.00 125.17 ? 635  ARG B HG3  1 
ATOM   7026  H  HD2  . ARG B 1 74  ? -97.632  -3.341  -31.086 1.00 146.19 ? 635  ARG B HD2  1 
ATOM   7027  H  HD3  . ARG B 1 74  ? -97.373  -1.788  -31.296 1.00 146.19 ? 635  ARG B HD3  1 
ATOM   7028  H  HE   . ARG B 1 74  ? -97.008  -2.946  -33.599 1.00 133.56 ? 635  ARG B HE   1 
ATOM   7029  H  HH11 . ARG B 1 74  ? -99.634  -2.496  -31.639 1.00 121.02 ? 635  ARG B HH11 1 
ATOM   7030  H  HH12 . ARG B 1 74  ? -100.657 -2.534  -32.721 1.00 121.02 ? 635  ARG B HH12 1 
ATOM   7031  H  HH21 . ARG B 1 74  ? -98.575  -2.958  -35.244 1.00 122.62 ? 635  ARG B HH21 1 
ATOM   7032  H  HH22 . ARG B 1 74  ? -100.017 -2.813  -34.899 1.00 122.62 ? 635  ARG B HH22 1 
ATOM   7033  N  N    . GLN B 1 75  ? -92.772  -4.065  -31.675 1.00 98.46  ? 636  GLN B N    1 
ATOM   7034  C  CA   . GLN B 1 75  ? -92.174  -5.108  -32.505 1.00 93.85  ? 636  GLN B CA   1 
ATOM   7035  C  C    . GLN B 1 75  ? -90.693  -5.333  -32.206 1.00 92.81  ? 636  GLN B C    1 
ATOM   7036  O  O    . GLN B 1 75  ? -90.251  -6.486  -32.117 1.00 91.92  ? 636  GLN B O    1 
ATOM   7037  C  CB   . GLN B 1 75  ? -92.360  -4.770  -33.985 1.00 91.98  ? 636  GLN B CB   1 
ATOM   7038  C  CG   . GLN B 1 75  ? -93.506  -5.521  -34.645 1.00 103.84 ? 636  GLN B CG   1 
ATOM   7039  C  CD   . GLN B 1 75  ? -93.272  -7.024  -34.692 1.00 112.50 ? 636  GLN B CD   1 
ATOM   7040  O  OE1  . GLN B 1 75  ? -92.142  -7.483  -34.860 1.00 102.13 ? 636  GLN B OE1  1 
ATOM   7041  N  NE2  . GLN B 1 75  ? -94.342  -7.796  -34.534 1.00 111.85 ? 636  GLN B NE2  1 
ATOM   7042  H  H    . GLN B 1 75  ? -92.835  -3.297  -32.057 1.00 118.15 ? 636  GLN B H    1 
ATOM   7043  H  HA   . GLN B 1 75  ? -92.638  -5.943  -32.334 1.00 112.62 ? 636  GLN B HA   1 
ATOM   7044  H  HB2  . GLN B 1 75  ? -92.540  -3.820  -34.068 1.00 110.38 ? 636  GLN B HB2  1 
ATOM   7045  H  HB3  . GLN B 1 75  ? -91.545  -4.993  -34.462 1.00 110.38 ? 636  GLN B HB3  1 
ATOM   7046  H  HG2  . GLN B 1 75  ? -94.320  -5.359  -34.143 1.00 124.61 ? 636  GLN B HG2  1 
ATOM   7047  H  HG3  . GLN B 1 75  ? -93.609  -5.204  -35.556 1.00 124.61 ? 636  GLN B HG3  1 
ATOM   7048  H  HE21 . GLN B 1 75  ? -95.116  -7.439  -34.414 1.00 134.22 ? 636  GLN B HE21 1 
ATOM   7049  H  HE22 . GLN B 1 75  ? -94.262  -8.652  -34.553 1.00 134.22 ? 636  GLN B HE22 1 
ATOM   7050  N  N    . PHE B 1 76  ? -89.914  -4.263  -32.038 1.00 94.26  ? 637  PHE B N    1 
ATOM   7051  C  CA   . PHE B 1 76  ? -88.458  -4.348  -32.111 1.00 92.51  ? 637  PHE B CA   1 
ATOM   7052  C  C    . PHE B 1 76  ? -87.807  -3.668  -30.911 1.00 93.77  ? 637  PHE B C    1 
ATOM   7053  O  O    . PHE B 1 76  ? -88.473  -3.174  -29.995 1.00 93.65  ? 637  PHE B O    1 
ATOM   7054  C  CB   . PHE B 1 76  ? -87.937  -3.719  -33.411 1.00 77.53  ? 637  PHE B CB   1 
ATOM   7055  C  CG   . PHE B 1 76  ? -88.310  -4.479  -34.644 1.00 86.92  ? 637  PHE B CG   1 
ATOM   7056  C  CD1  . PHE B 1 76  ? -87.725  -5.702  -34.921 1.00 89.88  ? 637  PHE B CD1  1 
ATOM   7057  C  CD2  . PHE B 1 76  ? -89.236  -3.965  -35.535 1.00 94.13  ? 637  PHE B CD2  1 
ATOM   7058  C  CE1  . PHE B 1 76  ? -88.063  -6.404  -36.058 1.00 94.41  ? 637  PHE B CE1  1 
ATOM   7059  C  CE2  . PHE B 1 76  ? -89.578  -4.662  -36.674 1.00 104.18 ? 637  PHE B CE2  1 
ATOM   7060  C  CZ   . PHE B 1 76  ? -88.990  -5.883  -36.937 1.00 110.93 ? 637  PHE B CZ   1 
ATOM   7061  H  H    . PHE B 1 76  ? -90.209  -3.471  -31.879 1.00 113.11 ? 637  PHE B H    1 
ATOM   7062  H  HA   . PHE B 1 76  ? -88.196  -5.282  -32.105 1.00 111.01 ? 637  PHE B HA   1 
ATOM   7063  H  HB2  . PHE B 1 76  ? -88.301  -2.824  -33.493 1.00 93.03  ? 637  PHE B HB2  1 
ATOM   7064  H  HB3  . PHE B 1 76  ? -86.968  -3.677  -33.371 1.00 93.03  ? 637  PHE B HB3  1 
ATOM   7065  H  HD1  . PHE B 1 76  ? -87.100  -6.056  -34.331 1.00 107.86 ? 637  PHE B HD1  1 
ATOM   7066  H  HD2  . PHE B 1 76  ? -89.634  -3.143  -35.361 1.00 112.96 ? 637  PHE B HD2  1 
ATOM   7067  H  HE1  . PHE B 1 76  ? -87.665  -7.226  -36.233 1.00 113.29 ? 637  PHE B HE1  1 
ATOM   7068  H  HE2  . PHE B 1 76  ? -90.203  -4.309  -37.265 1.00 125.02 ? 637  PHE B HE2  1 
ATOM   7069  H  HZ   . PHE B 1 76  ? -89.219  -6.355  -37.705 1.00 133.11 ? 637  PHE B HZ   1 
ATOM   7070  N  N    . GLN B 1 77  ? -86.474  -3.665  -30.935 1.00 93.05  ? 638  GLN B N    1 
ATOM   7071  C  CA   . GLN B 1 77  ? -85.633  -3.032  -29.929 1.00 82.62  ? 638  GLN B CA   1 
ATOM   7072  C  C    . GLN B 1 77  ? -84.460  -2.390  -30.658 1.00 70.52  ? 638  GLN B C    1 
ATOM   7073  O  O    . GLN B 1 77  ? -83.847  -3.029  -31.518 1.00 65.90  ? 638  GLN B O    1 
ATOM   7074  C  CB   . GLN B 1 77  ? -85.153  -4.066  -28.902 1.00 73.66  ? 638  GLN B CB   1 
ATOM   7075  C  CG   . GLN B 1 77  ? -84.678  -3.514  -27.575 1.00 81.80  ? 638  GLN B CG   1 
ATOM   7076  C  CD   . GLN B 1 77  ? -84.436  -4.618  -26.554 1.00 81.69  ? 638  GLN B CD   1 
ATOM   7077  O  OE1  . GLN B 1 77  ? -83.309  -5.086  -26.376 1.00 78.36  ? 638  GLN B OE1  1 
ATOM   7078  N  NE2  . GLN B 1 77  ? -85.500  -5.045  -25.884 1.00 66.60  ? 638  GLN B NE2  1 
ATOM   7079  H  H    . GLN B 1 77  ? -86.017  -4.044  -31.557 1.00 111.66 ? 638  GLN B H    1 
ATOM   7080  H  HA   . GLN B 1 77  ? -86.133  -2.340  -29.468 1.00 99.14  ? 638  GLN B HA   1 
ATOM   7081  H  HB2  . GLN B 1 77  ? -85.886  -4.674  -28.716 1.00 88.40  ? 638  GLN B HB2  1 
ATOM   7082  H  HB3  . GLN B 1 77  ? -84.415  -4.561  -29.290 1.00 88.40  ? 638  GLN B HB3  1 
ATOM   7083  H  HG2  . GLN B 1 77  ? -83.844  -3.037  -27.709 1.00 98.16  ? 638  GLN B HG2  1 
ATOM   7084  H  HG3  . GLN B 1 77  ? -85.352  -2.915  -27.219 1.00 98.16  ? 638  GLN B HG3  1 
ATOM   7085  H  HE21 . GLN B 1 77  ? -86.272  -4.699  -26.038 1.00 79.92  ? 638  GLN B HE21 1 
ATOM   7086  H  HE22 . GLN B 1 77  ? -85.417  -5.667  -25.295 1.00 79.92  ? 638  GLN B HE22 1 
ATOM   7087  N  N    . TYR B 1 78  ? -84.165  -1.131  -30.335 1.00 75.35  ? 639  TYR B N    1 
ATOM   7088  C  CA   . TYR B 1 78  ? -83.164  -0.343  -31.048 1.00 69.41  ? 639  TYR B CA   1 
ATOM   7089  C  C    . TYR B 1 78  ? -82.028  0.032   -30.108 1.00 57.05  ? 639  TYR B C    1 
ATOM   7090  O  O    . TYR B 1 78  ? -82.257  0.320   -28.931 1.00 66.51  ? 639  TYR B O    1 
ATOM   7091  C  CB   . TYR B 1 78  ? -83.786  0.922   -31.641 1.00 57.91  ? 639  TYR B CB   1 
ATOM   7092  C  CG   . TYR B 1 78  ? -84.951  0.645   -32.563 1.00 69.36  ? 639  TYR B CG   1 
ATOM   7093  C  CD1  . TYR B 1 78  ? -86.210  0.357   -32.053 1.00 75.52  ? 639  TYR B CD1  1 
ATOM   7094  C  CD2  . TYR B 1 78  ? -84.793  0.669   -33.942 1.00 61.73  ? 639  TYR B CD2  1 
ATOM   7095  C  CE1  . TYR B 1 78  ? -87.279  0.100   -32.888 1.00 69.76  ? 639  TYR B CE1  1 
ATOM   7096  C  CE2  . TYR B 1 78  ? -85.858  0.416   -34.788 1.00 76.26  ? 639  TYR B CE2  1 
ATOM   7097  C  CZ   . TYR B 1 78  ? -87.100  0.131   -34.254 1.00 74.99  ? 639  TYR B CZ   1 
ATOM   7098  O  OH   . TYR B 1 78  ? -88.167  -0.126  -35.089 1.00 74.92  ? 639  TYR B OH   1 
ATOM   7099  H  H    . TYR B 1 78  ? -84.540  -0.703  -29.691 1.00 90.43  ? 639  TYR B H    1 
ATOM   7100  H  HA   . TYR B 1 78  ? -82.798  -0.872  -31.773 1.00 83.29  ? 639  TYR B HA   1 
ATOM   7101  H  HB2  . TYR B 1 78  ? -84.105  1.484   -30.918 1.00 69.49  ? 639  TYR B HB2  1 
ATOM   7102  H  HB3  . TYR B 1 78  ? -83.109  1.394   -32.151 1.00 69.49  ? 639  TYR B HB3  1 
ATOM   7103  H  HD1  . TYR B 1 78  ? -86.335  0.335   -31.131 1.00 90.62  ? 639  TYR B HD1  1 
ATOM   7104  H  HD2  . TYR B 1 78  ? -83.958  0.860   -34.303 1.00 74.08  ? 639  TYR B HD2  1 
ATOM   7105  H  HE1  . TYR B 1 78  ? -88.116  -0.091  -32.530 1.00 83.71  ? 639  TYR B HE1  1 
ATOM   7106  H  HE2  . TYR B 1 78  ? -85.738  0.435   -35.710 1.00 91.51  ? 639  TYR B HE2  1 
ATOM   7107  H  HH   . TYR B 1 78  ? -88.856  -0.284  -34.634 1.00 89.91  ? 639  TYR B HH   1 
ATOM   7108  N  N    . ILE B 1 79  ? -80.806  0.036   -30.639 1.00 63.15  ? 640  ILE B N    1 
ATOM   7109  C  CA   . ILE B 1 79  ? -79.602  0.317   -29.863 1.00 58.58  ? 640  ILE B CA   1 
ATOM   7110  C  C    . ILE B 1 79  ? -78.755  1.316   -30.639 1.00 50.71  ? 640  ILE B C    1 
ATOM   7111  O  O    . ILE B 1 79  ? -78.345  1.039   -31.773 1.00 50.66  ? 640  ILE B O    1 
ATOM   7112  C  CB   . ILE B 1 79  ? -78.797  -0.960  -29.570 1.00 63.37  ? 640  ILE B CB   1 
ATOM   7113  C  CG1  . ILE B 1 79  ? -79.638  -1.915  -28.714 1.00 68.93  ? 640  ILE B CG1  1 
ATOM   7114  C  CG2  . ILE B 1 79  ? -77.479  -0.611  -28.877 1.00 65.06  ? 640  ILE B CG2  1 
ATOM   7115  C  CD1  . ILE B 1 79  ? -78.927  -3.184  -28.278 1.00 54.86  ? 640  ILE B CD1  1 
ATOM   7116  H  H    . ILE B 1 79  ? -80.647  -0.125  -31.469 1.00 75.78  ? 640  ILE B H    1 
ATOM   7117  H  HA   . ILE B 1 79  ? -79.852  0.721   -29.017 1.00 70.29  ? 640  ILE B HA   1 
ATOM   7118  H  HB   . ILE B 1 79  ? -78.595  -1.398  -30.412 1.00 76.05  ? 640  ILE B HB   1 
ATOM   7119  H  HG12 . ILE B 1 79  ? -79.917  -1.446  -27.912 1.00 82.71  ? 640  ILE B HG12 1 
ATOM   7120  H  HG13 . ILE B 1 79  ? -80.420  -2.178  -29.225 1.00 82.71  ? 640  ILE B HG13 1 
ATOM   7121  H  HG21 . ILE B 1 79  ? -76.989  -1.429  -28.702 1.00 78.07  ? 640  ILE B HG21 1 
ATOM   7122  H  HG22 . ILE B 1 79  ? -76.961  -0.032  -29.458 1.00 78.07  ? 640  ILE B HG22 1 
ATOM   7123  H  HG23 . ILE B 1 79  ? -77.673  -0.156  -28.043 1.00 78.07  ? 640  ILE B HG23 1 
ATOM   7124  H  HD11 . ILE B 1 79  ? -79.535  -3.720  -27.746 1.00 65.83  ? 640  ILE B HD11 1 
ATOM   7125  H  HD12 . ILE B 1 79  ? -78.653  -3.679  -29.066 1.00 65.83  ? 640  ILE B HD12 1 
ATOM   7126  H  HD13 . ILE B 1 79  ? -78.149  -2.945  -27.751 1.00 65.83  ? 640  ILE B HD13 1 
ATOM   7127  N  N    . ALA B 1 80  ? -78.485  2.466   -30.025 1.00 52.90  ? 641  ALA B N    1 
ATOM   7128  C  CA   . ALA B 1 80  ? -77.665  3.505   -30.632 1.00 48.34  ? 641  ALA B CA   1 
ATOM   7129  C  C    . ALA B 1 80  ? -76.216  3.317   -30.206 1.00 48.58  ? 641  ALA B C    1 
ATOM   7130  O  O    . ALA B 1 80  ? -75.936  3.121   -29.019 1.00 49.19  ? 641  ALA B O    1 
ATOM   7131  C  CB   . ALA B 1 80  ? -78.161  4.891   -30.224 1.00 51.40  ? 641  ALA B CB   1 
ATOM   7132  H  H    . ALA B 1 80  ? -78.773  2.670   -29.241 1.00 63.48  ? 641  ALA B H    1 
ATOM   7133  H  HA   . ALA B 1 80  ? -77.713  3.432   -31.598 1.00 58.00  ? 641  ALA B HA   1 
ATOM   7134  H  HB1  . ALA B 1 80  ? -77.599  5.563   -30.641 1.00 61.68  ? 641  ALA B HB1  1 
ATOM   7135  H  HB2  . ALA B 1 80  ? -79.079  4.997   -30.520 1.00 61.68  ? 641  ALA B HB2  1 
ATOM   7136  H  HB3  . ALA B 1 80  ? -78.113  4.972   -29.259 1.00 61.68  ? 641  ALA B HB3  1 
ATOM   7137  N  N    . ILE B 1 81  ? -75.299  3.375   -31.174 1.00 51.81  ? 642  ILE B N    1 
ATOM   7138  C  CA   . ILE B 1 81  ? -73.880  3.140   -30.933 1.00 60.58  ? 642  ILE B CA   1 
ATOM   7139  C  C    . ILE B 1 81  ? -73.057  4.105   -31.779 1.00 50.62  ? 642  ILE B C    1 
ATOM   7140  O  O    . ILE B 1 81  ? -73.564  4.763   -32.686 1.00 48.17  ? 642  ILE B O    1 
ATOM   7141  C  CB   . ILE B 1 81  ? -73.483  1.681   -31.232 1.00 59.59  ? 642  ILE B CB   1 
ATOM   7142  C  CG1  . ILE B 1 81  ? -73.959  1.289   -32.632 1.00 69.61  ? 642  ILE B CG1  1 
ATOM   7143  C  CG2  . ILE B 1 81  ? -74.077  0.761   -30.174 1.00 62.21  ? 642  ILE B CG2  1 
ATOM   7144  C  CD1  . ILE B 1 81  ? -73.567  -0.111  -33.051 1.00 81.62  ? 642  ILE B CD1  1 
ATOM   7145  H  H    . ILE B 1 81  ? -75.482  3.553   -31.995 1.00 62.17  ? 642  ILE B H    1 
ATOM   7146  H  HA   . ILE B 1 81  ? -73.685  3.318   -30.000 1.00 72.70  ? 642  ILE B HA   1 
ATOM   7147  H  HB   . ILE B 1 81  ? -72.517  1.609   -31.200 1.00 71.51  ? 642  ILE B HB   1 
ATOM   7148  H  HG12 . ILE B 1 81  ? -74.927  1.344   -32.659 1.00 83.53  ? 642  ILE B HG12 1 
ATOM   7149  H  HG13 . ILE B 1 81  ? -73.578  1.907   -33.275 1.00 83.53  ? 642  ILE B HG13 1 
ATOM   7150  H  HG21 . ILE B 1 81  ? -73.821  -0.153  -30.372 1.00 74.66  ? 642  ILE B HG21 1 
ATOM   7151  H  HG22 . ILE B 1 81  ? -73.736  1.020   -29.304 1.00 74.66  ? 642  ILE B HG22 1 
ATOM   7152  H  HG23 . ILE B 1 81  ? -75.043  0.846   -30.190 1.00 74.66  ? 642  ILE B HG23 1 
ATOM   7153  H  HD11 . ILE B 1 81  ? -73.905  -0.279  -33.945 1.00 97.94  ? 642  ILE B HD11 1 
ATOM   7154  H  HD12 . ILE B 1 81  ? -72.600  -0.182  -33.044 1.00 97.94  ? 642  ILE B HD12 1 
ATOM   7155  H  HD13 . ILE B 1 81  ? -73.951  -0.746  -32.427 1.00 97.94  ? 642  ILE B HD13 1 
ATOM   7156  N  N    . GLU B 1 82  ? -71.767  4.176   -31.462 1.00 41.27  ? 643  GLU B N    1 
ATOM   7157  C  CA   . GLU B 1 82  ? -70.866  5.115   -32.117 1.00 39.66  ? 643  GLU B CA   1 
ATOM   7158  C  C    . GLU B 1 82  ? -70.859  4.920   -33.628 1.00 38.78  ? 643  GLU B C    1 
ATOM   7159  O  O    . GLU B 1 82  ? -70.798  3.795   -34.131 1.00 48.44  ? 643  GLU B O    1 
ATOM   7160  C  CB   . GLU B 1 82  ? -69.452  4.944   -31.560 1.00 47.68  ? 643  GLU B CB   1 
ATOM   7161  C  CG   . GLU B 1 82  ? -68.432  5.933   -32.085 1.00 55.53  ? 643  GLU B CG   1 
ATOM   7162  C  CD   . GLU B 1 82  ? -67.065  5.742   -31.441 1.00 64.67  ? 643  GLU B CD   1 
ATOM   7163  O  OE1  . GLU B 1 82  ? -66.984  5.003   -30.437 1.00 57.33  ? 643  GLU B OE1  1 
ATOM   7164  O  OE2  . GLU B 1 82  ? -66.072  6.315   -31.940 1.00 67.09  ? 643  GLU B OE2  1 
ATOM   7165  H  H    . GLU B 1 82  ? -71.388  3.687   -30.866 1.00 49.53  ? 643  GLU B H    1 
ATOM   7166  H  HA   . GLU B 1 82  ? -71.158  6.021   -31.929 1.00 47.59  ? 643  GLU B HA   1 
ATOM   7167  H  HB2  . GLU B 1 82  ? -69.487  5.043   -30.596 1.00 57.22  ? 643  GLU B HB2  1 
ATOM   7168  H  HB3  . GLU B 1 82  ? -69.139  4.054   -31.785 1.00 57.22  ? 643  GLU B HB3  1 
ATOM   7169  H  HG2  . GLU B 1 82  ? -68.335  5.812   -33.042 1.00 66.64  ? 643  GLU B HG2  1 
ATOM   7170  H  HG3  . GLU B 1 82  ? -68.734  6.834   -31.891 1.00 66.64  ? 643  GLU B HG3  1 
ATOM   7171  N  N    . LEU B 1 83  ? -70.918  6.037   -34.350 1.00 46.61  ? 644  LEU B N    1 
ATOM   7172  C  CA   . LEU B 1 83  ? -70.869  6.049   -35.805 1.00 41.66  ? 644  LEU B CA   1 
ATOM   7173  C  C    . LEU B 1 83  ? -69.418  6.078   -36.267 1.00 36.57  ? 644  LEU B C    1 
ATOM   7174  O  O    . LEU B 1 83  ? -68.617  6.868   -35.760 1.00 51.63  ? 644  LEU B O    1 
ATOM   7175  C  CB   . LEU B 1 83  ? -71.618  7.266   -36.348 1.00 51.94  ? 644  LEU B CB   1 
ATOM   7176  C  CG   . LEU B 1 83  ? -71.752  7.372   -37.867 1.00 54.25  ? 644  LEU B CG   1 
ATOM   7177  C  CD1  . LEU B 1 83  ? -72.924  6.542   -38.363 1.00 47.76  ? 644  LEU B CD1  1 
ATOM   7178  C  CD2  . LEU B 1 83  ? -71.898  8.824   -38.283 1.00 63.90  ? 644  LEU B CD2  1 
ATOM   7179  H  H    . LEU B 1 83  ? -70.987  6.822   -34.006 1.00 55.93  ? 644  LEU B H    1 
ATOM   7180  H  HA   . LEU B 1 83  ? -71.289  5.246   -36.152 1.00 49.99  ? 644  LEU B HA   1 
ATOM   7181  H  HB2  . LEU B 1 83  ? -72.516  7.257   -35.981 1.00 62.33  ? 644  LEU B HB2  1 
ATOM   7182  H  HB3  . LEU B 1 83  ? -71.157  8.064   -36.045 1.00 62.33  ? 644  LEU B HB3  1 
ATOM   7183  H  HG   . LEU B 1 83  ? -70.946  7.024   -38.279 1.00 65.10  ? 644  LEU B HG   1 
ATOM   7184  H  HD11 . LEU B 1 83  ? -72.986  6.628   -39.328 1.00 57.31  ? 644  LEU B HD11 1 
ATOM   7185  H  HD12 . LEU B 1 83  ? -72.778  5.614   -38.122 1.00 57.31  ? 644  LEU B HD12 1 
ATOM   7186  H  HD13 . LEU B 1 83  ? -73.739  6.868   -37.949 1.00 57.31  ? 644  LEU B HD13 1 
ATOM   7187  H  HD21 . LEU B 1 83  ? -71.981  8.869   -39.248 1.00 76.68  ? 644  LEU B HD21 1 
ATOM   7188  H  HD22 . LEU B 1 83  ? -72.690  9.194   -37.864 1.00 76.68  ? 644  LEU B HD22 1 
ATOM   7189  H  HD23 . LEU B 1 83  ? -71.112  9.314   -37.995 1.00 76.68  ? 644  LEU B HD23 1 
ATOM   7190  N  N    . CYS B 1 84  ? -69.091  5.237   -37.245 1.00 45.57  ? 645  CYS B N    1 
ATOM   7191  C  CA   . CYS B 1 84  ? -67.722  5.043   -37.693 1.00 45.36  ? 645  CYS B CA   1 
ATOM   7192  C  C    . CYS B 1 84  ? -67.596  5.356   -39.178 1.00 52.93  ? 645  CYS B C    1 
ATOM   7193  O  O    . CYS B 1 84  ? -68.580  5.373   -39.921 1.00 43.68  ? 645  CYS B O    1 
ATOM   7194  C  CB   . CYS B 1 84  ? -67.251  3.611   -37.416 1.00 52.74  ? 645  CYS B CB   1 
ATOM   7195  S  SG   . CYS B 1 84  ? -67.101  3.240   -35.660 1.00 48.38  ? 645  CYS B SG   1 
ATOM   7196  H  H    . CYS B 1 84  ? -69.662  4.756   -37.672 1.00 54.68  ? 645  CYS B H    1 
ATOM   7197  H  HA   . CYS B 1 84  ? -67.141  5.649   -37.207 1.00 54.43  ? 645  CYS B HA   1 
ATOM   7198  H  HB2  . CYS B 1 84  ? -67.891  2.991   -37.798 1.00 63.29  ? 645  CYS B HB2  1 
ATOM   7199  H  HB3  . CYS B 1 84  ? -66.381  3.482   -37.824 1.00 63.29  ? 645  CYS B HB3  1 
ATOM   7200  H  HG   . CYS B 1 84  ? -66.729  2.106   -35.530 1.00 58.05  ? 645  CYS B HG   1 
ATOM   7201  N  N    . ALA B 1 85  ? -66.354  5.614   -39.595 1.00 43.29  ? 646  ALA B N    1 
ATOM   7202  C  CA   . ALA B 1 85  ? -66.081  6.034   -40.964 1.00 48.44  ? 646  ALA B CA   1 
ATOM   7203  C  C    . ALA B 1 85  ? -66.062  4.862   -41.938 1.00 46.66  ? 646  ALA B C    1 
ATOM   7204  O  O    . ALA B 1 85  ? -66.579  4.973   -43.054 1.00 58.37  ? 646  ALA B O    1 
ATOM   7205  C  CB   . ALA B 1 85  ? -64.749  6.777   -41.021 1.00 58.19  ? 646  ALA B CB   1 
ATOM   7206  H  H    . ALA B 1 85  ? -65.653  5.553   -39.100 1.00 51.95  ? 646  ALA B H    1 
ATOM   7207  H  HA   . ALA B 1 85  ? -66.777  6.647   -41.249 1.00 58.13  ? 646  ALA B HA   1 
ATOM   7208  H  HB1  . ALA B 1 85  ? -64.579  7.051   -41.936 1.00 69.83  ? 646  ALA B HB1  1 
ATOM   7209  H  HB2  . ALA B 1 85  ? -64.798  7.557   -40.446 1.00 69.83  ? 646  ALA B HB2  1 
ATOM   7210  H  HB3  . ALA B 1 85  ? -64.044  6.184   -40.716 1.00 69.83  ? 646  ALA B HB3  1 
ATOM   7211  N  N    . ALA B 1 86  ? -65.465  3.742   -41.545 1.00 55.98  ? 647  ALA B N    1 
ATOM   7212  C  CA   . ALA B 1 86  ? -65.281  2.615   -42.449 1.00 56.45  ? 647  ALA B CA   1 
ATOM   7213  C  C    . ALA B 1 86  ? -64.982  1.370   -41.623 1.00 54.89  ? 647  ALA B C    1 
ATOM   7214  O  O    . ALA B 1 86  ? -64.915  1.417   -40.391 1.00 58.64  ? 647  ALA B O    1 
ATOM   7215  C  CB   . ALA B 1 86  ? -64.160  2.904   -43.450 1.00 64.93  ? 647  ALA B CB   1 
ATOM   7216  H  H    . ALA B 1 86  ? -65.156  3.610   -40.753 1.00 67.17  ? 647  ALA B H    1 
ATOM   7217  H  HA   . ALA B 1 86  ? -66.101  2.463   -42.944 1.00 67.74  ? 647  ALA B HA   1 
ATOM   7218  H  HB1  . ALA B 1 86  ? -64.058  2.140   -44.039 1.00 77.91  ? 647  ALA B HB1  1 
ATOM   7219  H  HB2  . ALA B 1 86  ? -64.393  3.691   -43.967 1.00 77.91  ? 647  ALA B HB2  1 
ATOM   7220  H  HB3  . ALA B 1 86  ? -63.335  3.059   -42.964 1.00 77.91  ? 647  ALA B HB3  1 
ATOM   7221  N  N    . THR B 1 87  ? -64.798  0.248   -42.317 1.00 62.53  ? 648  THR B N    1 
ATOM   7222  C  CA   . THR B 1 87  ? -64.416  -1.009  -41.695 1.00 61.97  ? 648  THR B CA   1 
ATOM   7223  C  C    . THR B 1 87  ? -62.933  -1.267  -41.936 1.00 47.80  ? 648  THR B C    1 
ATOM   7224  O  O    . THR B 1 87  ? -62.252  -0.526  -42.648 1.00 63.91  ? 648  THR B O    1 
ATOM   7225  C  CB   . THR B 1 87  ? -65.255  -2.166  -42.244 1.00 61.05  ? 648  THR B CB   1 
ATOM   7226  O  OG1  . THR B 1 87  ? -64.887  -2.427  -43.606 1.00 59.99  ? 648  THR B OG1  1 
ATOM   7227  C  CG2  . THR B 1 87  ? -66.738  -1.842  -42.168 1.00 60.94  ? 648  THR B CG2  1 
ATOM   7228  H  H    . THR B 1 87  ? -64.892  0.194   -43.170 1.00 75.04  ? 648  THR B H    1 
ATOM   7229  H  HA   . THR B 1 87  ? -64.565  -0.952  -40.738 1.00 74.36  ? 648  THR B HA   1 
ATOM   7230  H  HB   . THR B 1 87  ? -65.090  -2.960  -41.712 1.00 73.26  ? 648  THR B HB   1 
ATOM   7231  H  HG1  . THR B 1 87  ? -65.345  -3.062  -43.911 1.00 71.99  ? 648  THR B HG1  1 
ATOM   7232  H  HG21 . THR B 1 87  ? -67.258  -2.582  -42.518 1.00 73.13  ? 648  THR B HG21 1 
ATOM   7233  H  HG22 . THR B 1 87  ? -66.996  -1.685  -41.246 1.00 73.13  ? 648  THR B HG22 1 
ATOM   7234  H  HG23 . THR B 1 87  ? -66.931  -1.047  -42.689 1.00 73.13  ? 648  THR B HG23 1 
ATOM   7235  N  N    . LEU B 1 88  ? -62.431  -2.357  -41.355 1.00 49.66  ? 649  LEU B N    1 
ATOM   7236  C  CA   . LEU B 1 88  ? -61.040  -2.732  -41.578 1.00 45.13  ? 649  LEU B CA   1 
ATOM   7237  C  C    . LEU B 1 88  ? -60.851  -3.317  -42.968 1.00 59.92  ? 649  LEU B C    1 
ATOM   7238  O  O    . LEU B 1 88  ? -59.764  -3.204  -43.545 1.00 44.11  ? 649  LEU B O    1 
ATOM   7239  C  CB   . LEU B 1 88  ? -60.580  -3.723  -40.505 1.00 48.69  ? 649  LEU B CB   1 
ATOM   7240  C  CG   . LEU B 1 88  ? -59.143  -4.249  -40.600 1.00 49.44  ? 649  LEU B CG   1 
ATOM   7241  C  CD1  . LEU B 1 88  ? -58.129  -3.115  -40.585 1.00 48.61  ? 649  LEU B CD1  1 
ATOM   7242  C  CD2  . LEU B 1 88  ? -58.860  -5.225  -39.468 1.00 49.12  ? 649  LEU B CD2  1 
ATOM   7243  H  H    . LEU B 1 88  ? -62.868  -2.887  -40.838 1.00 59.59  ? 649  LEU B H    1 
ATOM   7244  H  HA   . LEU B 1 88  ? -60.485  -1.939  -41.510 1.00 54.15  ? 649  LEU B HA   1 
ATOM   7245  H  HB2  . LEU B 1 88  ? -60.669  -3.293  -39.640 1.00 58.43  ? 649  LEU B HB2  1 
ATOM   7246  H  HB3  . LEU B 1 88  ? -61.168  -4.495  -40.537 1.00 58.43  ? 649  LEU B HB3  1 
ATOM   7247  H  HG   . LEU B 1 88  ? -59.040  -4.728  -41.437 1.00 59.32  ? 649  LEU B HG   1 
ATOM   7248  H  HD11 . LEU B 1 88  ? -57.236  -3.489  -40.646 1.00 58.33  ? 649  LEU B HD11 1 
ATOM   7249  H  HD12 . LEU B 1 88  ? -58.296  -2.532  -41.342 1.00 58.33  ? 649  LEU B HD12 1 
ATOM   7250  H  HD13 . LEU B 1 88  ? -58.223  -2.618  -39.757 1.00 58.33  ? 649  LEU B HD13 1 
ATOM   7251  H  HD21 . LEU B 1 88  ? -57.948  -5.544  -39.548 1.00 58.94  ? 649  LEU B HD21 1 
ATOM   7252  H  HD22 . LEU B 1 88  ? -58.978  -4.768  -38.621 1.00 58.94  ? 649  LEU B HD22 1 
ATOM   7253  H  HD23 . LEU B 1 88  ? -59.478  -5.970  -39.532 1.00 58.94  ? 649  LEU B HD23 1 
ATOM   7254  N  N    . GLN B 1 89  ? -61.899  -3.928  -43.525 1.00 53.01  ? 650  GLN B N    1 
ATOM   7255  C  CA   . GLN B 1 89  ? -61.830  -4.428  -44.892 1.00 63.05  ? 650  GLN B CA   1 
ATOM   7256  C  C    . GLN B 1 89  ? -61.521  -3.299  -45.866 1.00 68.45  ? 650  GLN B C    1 
ATOM   7257  O  O    . GLN B 1 89  ? -60.612  -3.409  -46.697 1.00 64.35  ? 650  GLN B O    1 
ATOM   7258  C  CB   . GLN B 1 89  ? -63.146  -5.107  -45.260 1.00 62.65  ? 650  GLN B CB   1 
ATOM   7259  C  CG   . GLN B 1 89  ? -63.119  -5.817  -46.601 1.00 70.54  ? 650  GLN B CG   1 
ATOM   7260  C  CD   . GLN B 1 89  ? -64.488  -6.280  -47.041 1.00 71.57  ? 650  GLN B CD   1 
ATOM   7261  O  OE1  . GLN B 1 89  ? -64.663  -7.427  -47.449 1.00 70.86  ? 650  GLN B OE1  1 
ATOM   7262  N  NE2  . GLN B 1 89  ? -65.470  -5.388  -46.967 1.00 88.92  ? 650  GLN B NE2  1 
ATOM   7263  H  H    . GLN B 1 89  ? -62.653  -4.062  -43.134 1.00 63.61  ? 650  GLN B H    1 
ATOM   7264  H  HA   . GLN B 1 89  ? -61.120  -5.086  -44.956 1.00 75.66  ? 650  GLN B HA   1 
ATOM   7265  H  HB2  . GLN B 1 89  ? -63.357  -5.767  -44.580 1.00 75.19  ? 650  GLN B HB2  1 
ATOM   7266  H  HB3  . GLN B 1 89  ? -63.845  -4.436  -45.294 1.00 75.19  ? 650  GLN B HB3  1 
ATOM   7267  H  HG2  . GLN B 1 89  ? -62.777  -5.209  -47.274 1.00 84.65  ? 650  GLN B HG2  1 
ATOM   7268  H  HG3  . GLN B 1 89  ? -62.546  -6.597  -46.535 1.00 84.65  ? 650  GLN B HG3  1 
ATOM   7269  H  HE21 . GLN B 1 89  ? -65.308  -4.593  -46.679 1.00 106.70 ? 650  GLN B HE21 1 
ATOM   7270  H  HE22 . GLN B 1 89  ? -66.267  -5.604  -47.206 1.00 106.70 ? 650  GLN B HE22 1 
ATOM   7271  N  N    . GLU B 1 90  ? -62.271  -2.199  -45.773 1.00 60.28  ? 651  GLU B N    1 
ATOM   7272  C  CA   . GLU B 1 90  ? -62.025  -1.056  -46.645 1.00 62.40  ? 651  GLU B CA   1 
ATOM   7273  C  C    . GLU B 1 90  ? -60.646  -0.459  -46.394 1.00 63.99  ? 651  GLU B C    1 
ATOM   7274  O  O    . GLU B 1 90  ? -59.977  -0.003  -47.330 1.00 75.76  ? 651  GLU B O    1 
ATOM   7275  C  CB   . GLU B 1 90  ? -63.114  -0.005  -46.435 1.00 63.17  ? 651  GLU B CB   1 
ATOM   7276  C  CG   . GLU B 1 90  ? -64.522  -0.513  -46.726 1.00 78.41  ? 651  GLU B CG   1 
ATOM   7277  C  CD   . GLU B 1 90  ? -65.582  0.553   -46.528 1.00 88.88  ? 651  GLU B CD   1 
ATOM   7278  O  OE1  . GLU B 1 90  ? -65.753  1.017   -45.383 1.00 79.11  ? 651  GLU B OE1  1 
ATOM   7279  O  OE2  . GLU B 1 90  ? -66.243  0.931   -47.520 1.00 103.93 ? 651  GLU B OE2  1 
ATOM   7280  H  H    . GLU B 1 90  ? -62.920  -2.092  -45.219 1.00 72.33  ? 651  GLU B H    1 
ATOM   7281  H  HA   . GLU B 1 90  ? -62.063  -1.349  -47.569 1.00 74.87  ? 651  GLU B HA   1 
ATOM   7282  H  HB2  . GLU B 1 90  ? -63.091  0.290   -45.511 1.00 75.80  ? 651  GLU B HB2  1 
ATOM   7283  H  HB3  . GLU B 1 90  ? -62.942  0.746   -47.025 1.00 75.80  ? 651  GLU B HB3  1 
ATOM   7284  H  HG2  . GLU B 1 90  ? -64.566  -0.812  -47.648 1.00 94.10  ? 651  GLU B HG2  1 
ATOM   7285  H  HG3  . GLU B 1 90  ? -64.722  -1.250  -46.128 1.00 94.10  ? 651  GLU B HG3  1 
ATOM   7286  N  N    . TYR B 1 91  ? -60.203  -0.455  -45.134 1.00 60.44  ? 652  TYR B N    1 
ATOM   7287  C  CA   . TYR B 1 91  ? -58.875  0.057   -44.807 1.00 54.60  ? 652  TYR B CA   1 
ATOM   7288  C  C    . TYR B 1 91  ? -57.784  -0.734  -45.521 1.00 63.04  ? 652  TYR B C    1 
ATOM   7289  O  O    . TYR B 1 91  ? -56.838  -0.151  -46.065 1.00 61.94  ? 652  TYR B O    1 
ATOM   7290  C  CB   . TYR B 1 91  ? -58.681  0.021   -43.289 1.00 55.64  ? 652  TYR B CB   1 
ATOM   7291  C  CG   . TYR B 1 91  ? -57.262  0.231   -42.804 1.00 62.12  ? 652  TYR B CG   1 
ATOM   7292  C  CD1  . TYR B 1 91  ? -56.343  -0.808  -42.817 1.00 58.05  ? 652  TYR B CD1  1 
ATOM   7293  C  CD2  . TYR B 1 91  ? -56.852  1.459   -42.299 1.00 71.09  ? 652  TYR B CD2  1 
ATOM   7294  C  CE1  . TYR B 1 91  ? -55.049  -0.627  -42.369 1.00 66.89  ? 652  TYR B CE1  1 
ATOM   7295  C  CE2  . TYR B 1 91  ? -55.556  1.650   -41.841 1.00 58.96  ? 652  TYR B CE2  1 
ATOM   7296  C  CZ   . TYR B 1 91  ? -54.661  0.603   -41.878 1.00 65.92  ? 652  TYR B CZ   1 
ATOM   7297  O  OH   . TYR B 1 91  ? -53.372  0.782   -41.425 1.00 60.44  ? 652  TYR B OH   1 
ATOM   7298  H  H    . TYR B 1 91  ? -60.650  -0.740  -44.457 1.00 72.52  ? 652  TYR B H    1 
ATOM   7299  H  HA   . TYR B 1 91  ? -58.813  0.981   -45.095 1.00 65.52  ? 652  TYR B HA   1 
ATOM   7300  H  HB2  . TYR B 1 91  ? -59.229  0.718   -42.895 1.00 66.77  ? 652  TYR B HB2  1 
ATOM   7301  H  HB3  . TYR B 1 91  ? -58.975  -0.844  -42.964 1.00 66.77  ? 652  TYR B HB3  1 
ATOM   7302  H  HD1  . TYR B 1 91  ? -56.599  -1.638  -43.148 1.00 69.66  ? 652  TYR B HD1  1 
ATOM   7303  H  HD2  . TYR B 1 91  ? -57.454  2.167   -42.275 1.00 85.30  ? 652  TYR B HD2  1 
ATOM   7304  H  HE1  . TYR B 1 91  ? -54.444  -1.333  -42.390 1.00 80.26  ? 652  TYR B HE1  1 
ATOM   7305  H  HE2  . TYR B 1 91  ? -55.294  2.480   -41.512 1.00 70.75  ? 652  TYR B HE2  1 
ATOM   7306  H  HH   . TYR B 1 91  ? -53.269  1.571   -41.156 1.00 72.53  ? 652  TYR B HH   1 
ATOM   7307  N  N    . VAL B 1 92  ? -57.902  -2.063  -45.537 1.00 66.42  ? 653  VAL B N    1 
ATOM   7308  C  CA   . VAL B 1 92  ? -56.883  -2.898  -46.168 1.00 66.78  ? 653  VAL B CA   1 
ATOM   7309  C  C    . VAL B 1 92  ? -56.997  -2.828  -47.687 1.00 77.79  ? 653  VAL B C    1 
ATOM   7310  O  O    . VAL B 1 92  ? -55.985  -2.733  -48.394 1.00 75.32  ? 653  VAL B O    1 
ATOM   7311  C  CB   . VAL B 1 92  ? -57.001  -4.348  -45.658 1.00 61.26  ? 653  VAL B CB   1 
ATOM   7312  C  CG1  . VAL B 1 92  ? -56.031  -5.261  -46.394 1.00 62.60  ? 653  VAL B CG1  1 
ATOM   7313  C  CG2  . VAL B 1 92  ? -56.751  -4.408  -44.156 1.00 57.68  ? 653  VAL B CG2  1 
ATOM   7314  H  H    . VAL B 1 92  ? -58.557  -2.501  -45.192 1.00 79.70  ? 653  VAL B H    1 
ATOM   7315  H  HA   . VAL B 1 92  ? -56.007  -2.565  -45.919 1.00 80.14  ? 653  VAL B HA   1 
ATOM   7316  H  HB   . VAL B 1 92  ? -57.901  -4.669  -45.826 1.00 73.51  ? 653  VAL B HB   1 
ATOM   7317  H  HG11 . VAL B 1 92  ? -56.128  -6.164  -46.053 1.00 75.12  ? 653  VAL B HG11 1 
ATOM   7318  H  HG12 . VAL B 1 92  ? -56.236  -5.241  -47.342 1.00 75.12  ? 653  VAL B HG12 1 
ATOM   7319  H  HG13 . VAL B 1 92  ? -55.126  -4.946  -46.244 1.00 75.12  ? 653  VAL B HG13 1 
ATOM   7320  H  HG21 . VAL B 1 92  ? -56.831  -5.328  -43.859 1.00 69.22  ? 653  VAL B HG21 1 
ATOM   7321  H  HG22 . VAL B 1 92  ? -55.859  -4.077  -43.971 1.00 69.22  ? 653  VAL B HG22 1 
ATOM   7322  H  HG23 . VAL B 1 92  ? -57.409  -3.857  -43.704 1.00 69.22  ? 653  VAL B HG23 1 
ATOM   7323  N  N    . GLU B 1 93  ? -58.223  -2.865  -48.213 1.00 72.46  ? 654  GLU B N    1 
ATOM   7324  C  CA   . GLU B 1 93  ? -58.410  -2.985  -49.657 1.00 66.21  ? 654  GLU B CA   1 
ATOM   7325  C  C    . GLU B 1 93  ? -58.050  -1.691  -50.380 1.00 84.58  ? 654  GLU B C    1 
ATOM   7326  O  O    . GLU B 1 93  ? -57.349  -1.716  -51.399 1.00 87.21  ? 654  GLU B O    1 
ATOM   7327  C  CB   . GLU B 1 93  ? -59.853  -3.389  -49.963 1.00 67.67  ? 654  GLU B CB   1 
ATOM   7328  C  CG   . GLU B 1 93  ? -60.156  -4.859  -49.700 1.00 66.56  ? 654  GLU B CG   1 
ATOM   7329  C  CD   . GLU B 1 93  ? -61.572  -5.238  -50.077 1.00 69.31  ? 654  GLU B CD   1 
ATOM   7330  O  OE1  . GLU B 1 93  ? -62.343  -4.338  -50.469 1.00 92.33  ? 654  GLU B OE1  1 
ATOM   7331  O  OE2  . GLU B 1 93  ? -61.914  -6.434  -49.983 1.00 66.47  ? 654  GLU B OE2  1 
ATOM   7332  H  H    . GLU B 1 93  ? -58.953  -2.823  -47.761 1.00 86.96  ? 654  GLU B H    1 
ATOM   7333  H  HA   . GLU B 1 93  ? -57.827  -3.685  -49.991 1.00 79.45  ? 654  GLU B HA   1 
ATOM   7334  H  HB2  . GLU B 1 93  ? -60.448  -2.860  -49.409 1.00 81.20  ? 654  GLU B HB2  1 
ATOM   7335  H  HB3  . GLU B 1 93  ? -60.033  -3.213  -50.900 1.00 81.20  ? 654  GLU B HB3  1 
ATOM   7336  H  HG2  . GLU B 1 93  ? -59.549  -5.405  -50.223 1.00 79.87  ? 654  GLU B HG2  1 
ATOM   7337  H  HG3  . GLU B 1 93  ? -60.038  -5.042  -48.755 1.00 79.87  ? 654  GLU B HG3  1 
ATOM   7338  N  N    . GLN B 1 94  ? -58.516  -0.549  -49.869 1.00 83.01  ? 655  GLN B N    1 
ATOM   7339  C  CA   . GLN B 1 94  ? -58.329  0.711   -50.583 1.00 74.78  ? 655  GLN B CA   1 
ATOM   7340  C  C    . GLN B 1 94  ? -56.856  1.071   -50.713 1.00 90.55  ? 655  GLN B C    1 
ATOM   7341  O  O    . GLN B 1 94  ? -56.434  1.616   -51.739 1.00 99.11  ? 655  GLN B O    1 
ATOM   7342  C  CB   . GLN B 1 94  ? -59.080  1.833   -49.873 1.00 89.90  ? 655  GLN B CB   1 
ATOM   7343  C  CG   . GLN B 1 94  ? -60.586  1.722   -49.968 1.00 91.80  ? 655  GLN B CG   1 
ATOM   7344  C  CD   . GLN B 1 94  ? -61.285  2.935   -49.401 1.00 102.04 ? 655  GLN B CD   1 
ATOM   7345  O  OE1  . GLN B 1 94  ? -60.664  3.972   -49.175 1.00 127.01 ? 655  GLN B OE1  1 
ATOM   7346  N  NE2  . GLN B 1 94  ? -62.586  2.812   -49.167 1.00 91.92  ? 655  GLN B NE2  1 
ATOM   7347  H  H    . GLN B 1 94  ? -58.936  -0.479  -49.122 1.00 99.62  ? 655  GLN B H    1 
ATOM   7348  H  HA   . GLN B 1 94  ? -58.695  0.624   -51.477 1.00 89.74  ? 655  GLN B HA   1 
ATOM   7349  N  N    . LYS B 1 95  ? -56.066  0.801   -49.676 1.00 91.43  ? 656  LYS B N    1 
ATOM   7350  C  CA   . LYS B 1 95  ? -54.649  1.135   -49.607 1.00 99.14  ? 656  LYS B CA   1 
ATOM   7351  C  C    . LYS B 1 95  ? -54.427  2.634   -49.456 1.00 100.55 ? 656  LYS B C    1 
ATOM   7352  O  O    . LYS B 1 95  ? -53.277  3.060   -49.292 1.00 86.65  ? 656  LYS B O    1 
ATOM   7353  C  CB   . LYS B 1 95  ? -53.864  0.635   -50.829 1.00 112.56 ? 656  LYS B CB   1 
ATOM   7354  H  H    . LYS B 1 95  ? -56.347  0.404   -48.966 1.00 109.71 ? 656  LYS B H    1 
ATOM   7355  H  HA   . LYS B 1 95  ? -54.271  0.705   -48.824 1.00 118.97 ? 656  LYS B HA   1 
ATOM   7356  N  N    . ASP B 1 96  ? -55.482  3.449   -49.501 1.00 102.96 ? 657  ASP B N    1 
ATOM   7357  C  CA   . ASP B 1 96  ? -55.358  4.890   -49.334 1.00 94.30  ? 657  ASP B CA   1 
ATOM   7358  C  C    . ASP B 1 96  ? -55.375  5.324   -47.874 1.00 89.52  ? 657  ASP B C    1 
ATOM   7359  O  O    . ASP B 1 96  ? -55.086  6.491   -47.590 1.00 87.84  ? 657  ASP B O    1 
ATOM   7360  C  CB   . ASP B 1 96  ? -56.483  5.604   -50.094 1.00 87.64  ? 657  ASP B CB   1 
ATOM   7361  H  H    . ASP B 1 96  ? -56.290  3.184   -49.629 1.00 123.56 ? 657  ASP B H    1 
ATOM   7362  H  HA   . ASP B 1 96  ? -54.514  5.176   -49.717 1.00 113.15 ? 657  ASP B HA   1 
ATOM   7363  N  N    . PHE B 1 97  ? -55.691  4.416   -46.947 1.00 76.91  ? 658  PHE B N    1 
ATOM   7364  C  CA   . PHE B 1 97  ? -55.658  4.734   -45.524 1.00 77.36  ? 658  PHE B CA   1 
ATOM   7365  C  C    . PHE B 1 97  ? -54.244  4.927   -44.999 1.00 83.41  ? 658  PHE B C    1 
ATOM   7366  O  O    . PHE B 1 97  ? -54.083  5.383   -43.860 1.00 87.69  ? 658  PHE B O    1 
ATOM   7367  C  CB   . PHE B 1 97  ? -56.351  3.632   -44.724 1.00 80.68  ? 658  PHE B CB   1 
ATOM   7368  C  CG   . PHE B 1 97  ? -57.845  3.622   -44.875 1.00 79.52  ? 658  PHE B CG   1 
ATOM   7369  C  CD1  . PHE B 1 97  ? -58.432  3.377   -46.106 1.00 72.63  ? 658  PHE B CD1  1 
ATOM   7370  C  CD2  . PHE B 1 97  ? -58.663  3.854   -43.783 1.00 83.94  ? 658  PHE B CD2  1 
ATOM   7371  C  CE1  . PHE B 1 97  ? -59.807  3.365   -46.244 1.00 66.02  ? 658  PHE B CE1  1 
ATOM   7372  C  CE2  . PHE B 1 97  ? -60.039  3.843   -43.913 1.00 71.28  ? 658  PHE B CE2  1 
ATOM   7373  C  CZ   . PHE B 1 97  ? -60.613  3.597   -45.146 1.00 66.98  ? 658  PHE B CZ   1 
ATOM   7374  H  H    . PHE B 1 97  ? -55.928  3.608   -47.120 1.00 92.30  ? 658  PHE B H    1 
ATOM   7375  H  HA   . PHE B 1 97  ? -56.146  5.559   -45.377 1.00 92.83  ? 658  PHE B HA   1 
ATOM   7376  H  HB2  . PHE B 1 97  ? -56.017  2.771   -45.022 1.00 96.81  ? 658  PHE B HB2  1 
ATOM   7377  H  HB3  . PHE B 1 97  ? -56.149  3.755   -43.783 1.00 96.81  ? 658  PHE B HB3  1 
ATOM   7378  H  HD1  . PHE B 1 97  ? -57.894  3.218   -46.848 1.00 87.16  ? 658  PHE B HD1  1 
ATOM   7379  H  HD2  . PHE B 1 97  ? -58.282  4.018   -42.951 1.00 100.73 ? 658  PHE B HD2  1 
ATOM   7380  H  HE1  . PHE B 1 97  ? -60.190  3.199   -47.076 1.00 79.22  ? 658  PHE B HE1  1 
ATOM   7381  H  HE2  . PHE B 1 97  ? -60.578  4.001   -43.172 1.00 85.53  ? 658  PHE B HE2  1 
ATOM   7382  H  HZ   . PHE B 1 97  ? -61.538  3.591   -45.236 1.00 80.37  ? 658  PHE B HZ   1 
ATOM   7383  N  N    . ALA B 1 98  ? -53.222  4.576   -45.782 1.00 75.76  ? 659  ALA B N    1 
ATOM   7384  C  CA   . ALA B 1 98  ? -51.857  4.929   -45.408 1.00 89.52  ? 659  ALA B CA   1 
ATOM   7385  C  C    . ALA B 1 98  ? -51.702  6.441   -45.294 1.00 91.83  ? 659  ALA B C    1 
ATOM   7386  O  O    . ALA B 1 98  ? -51.023  6.937   -44.387 1.00 85.63  ? 659  ALA B O    1 
ATOM   7387  C  CB   . ALA B 1 98  ? -50.872  4.357   -46.427 1.00 78.69  ? 659  ALA B CB   1 
ATOM   7388  H  H    . ALA B 1 98  ? -53.292  4.142   -46.521 1.00 90.91  ? 659  ALA B H    1 
ATOM   7389  H  HA   . ALA B 1 98  ? -51.655  4.539   -44.543 1.00 107.43 ? 659  ALA B HA   1 
ATOM   7390  H  HB1  . ALA B 1 98  ? -49.971  4.600   -46.164 1.00 94.43  ? 659  ALA B HB1  1 
ATOM   7391  H  HB2  . ALA B 1 98  ? -50.963  3.392   -46.446 1.00 94.43  ? 659  ALA B HB2  1 
ATOM   7392  H  HB3  . ALA B 1 98  ? -51.073  4.726   -47.301 1.00 94.43  ? 659  ALA B HB3  1 
ATOM   7393  N  N    . HIS B 1 99  ? -52.337  7.189   -46.201 1.00 95.81  ? 660  HIS B N    1 
ATOM   7394  C  CA   . HIS B 1 99  ? -52.358  8.644   -46.098 1.00 96.51  ? 660  HIS B CA   1 
ATOM   7395  C  C    . HIS B 1 99  ? -53.098  9.114   -44.854 1.00 90.48  ? 660  HIS B C    1 
ATOM   7396  O  O    . HIS B 1 99  ? -52.948  10.275  -44.455 1.00 71.50  ? 660  HIS B O    1 
ATOM   7397  C  CB   . HIS B 1 99  ? -53.008  9.250   -47.345 1.00 60.18  ? 660  HIS B CB   1 
ATOM   7398  H  H    . HIS B 1 99  ? -52.761  6.877   -46.882 1.00 114.98 ? 660  HIS B H    1 
ATOM   7399  H  HA   . HIS B 1 99  ? -51.446  8.970   -46.046 1.00 115.81 ? 660  HIS B HA   1 
ATOM   7400  N  N    . LEU B 1 100 ? -53.898  8.240   -44.239 1.00 81.46  ? 661  LEU B N    1 
ATOM   7401  C  CA   . LEU B 1 100 ? -54.622  8.606   -43.029 1.00 69.59  ? 661  LEU B CA   1 
ATOM   7402  C  C    . LEU B 1 100 ? -53.694  8.705   -41.822 1.00 68.91  ? 661  LEU B C    1 
ATOM   7403  O  O    . LEU B 1 100 ? -53.960  9.487   -40.901 1.00 79.60  ? 661  LEU B O    1 
ATOM   7404  C  CB   . LEU B 1 100 ? -55.731  7.584   -42.776 1.00 68.40  ? 661  LEU B CB   1 
ATOM   7405  C  CG   . LEU B 1 100 ? -57.102  8.049   -42.285 1.00 79.70  ? 661  LEU B CG   1 
ATOM   7406  C  CD1  . LEU B 1 100 ? -57.665  9.198   -43.114 1.00 73.65  ? 661  LEU B CD1  1 
ATOM   7407  C  CD2  . LEU B 1 100 ? -58.049  6.856   -42.331 1.00 74.13  ? 661  LEU B CD2  1 
ATOM   7408  H  H    . LEU B 1 100 ? -54.036  7.433   -44.504 1.00 97.75  ? 661  LEU B H    1 
ATOM   7409  H  HA   . LEU B 1 100 ? -55.037  9.473   -43.159 1.00 83.51  ? 661  LEU B HA   1 
ATOM   7410  H  HB2  . LEU B 1 100 ? -55.884  7.109   -43.607 1.00 82.08  ? 661  LEU B HB2  1 
ATOM   7411  H  HB3  . LEU B 1 100 ? -55.401  6.955   -42.115 1.00 82.08  ? 661  LEU B HB3  1 
ATOM   7412  H  HG   . LEU B 1 100 ? -57.030  8.344   -41.364 1.00 95.64  ? 661  LEU B HG   1 
ATOM   7413  H  HD11 . LEU B 1 100 ? -58.531  9.449   -42.758 1.00 88.38  ? 661  LEU B HD11 1 
ATOM   7414  H  HD12 . LEU B 1 100 ? -57.055  9.951   -43.063 1.00 88.38  ? 661  LEU B HD12 1 
ATOM   7415  H  HD13 . LEU B 1 100 ? -57.756  8.908   -44.035 1.00 88.38  ? 661  LEU B HD13 1 
ATOM   7416  H  HD21 . LEU B 1 100 ? -58.925  7.137   -42.021 1.00 88.95  ? 661  LEU B HD21 1 
ATOM   7417  H  HD22 . LEU B 1 100 ? -58.108  6.535   -43.244 1.00 88.95  ? 661  LEU B HD22 1 
ATOM   7418  H  HD23 . LEU B 1 100 ? -57.703  6.157   -41.755 1.00 88.95  ? 661  LEU B HD23 1 
ATOM   7419  N  N    . GLY B 1 101 ? -52.613  7.925   -41.802 1.00 87.52  ? 662  GLY B N    1 
ATOM   7420  C  CA   . GLY B 1 101 ? -51.599  8.029   -40.771 1.00 83.94  ? 662  GLY B CA   1 
ATOM   7421  C  C    . GLY B 1 101 ? -51.643  6.965   -39.695 1.00 82.24  ? 662  GLY B C    1 
ATOM   7422  O  O    . GLY B 1 101 ? -50.792  6.990   -38.796 1.00 63.79  ? 662  GLY B O    1 
ATOM   7423  H  H    . GLY B 1 101 ? -52.447  7.318   -42.388 1.00 105.02 ? 662  GLY B H    1 
ATOM   7424  H  HA2  . GLY B 1 101 ? -50.724  7.990   -41.190 1.00 100.73 ? 662  GLY B HA2  1 
ATOM   7425  H  HA3  . GLY B 1 101 ? -51.683  8.892   -40.337 1.00 100.73 ? 662  GLY B HA3  1 
ATOM   7426  N  N    . LEU B 1 102 ? -52.599  6.040   -39.750 1.00 86.62  ? 663  LEU B N    1 
ATOM   7427  C  CA   . LEU B 1 102 ? -52.675  4.938   -38.797 1.00 62.57  ? 663  LEU B CA   1 
ATOM   7428  C  C    . LEU B 1 102 ? -51.890  3.757   -39.353 1.00 54.95  ? 663  LEU B C    1 
ATOM   7429  O  O    . LEU B 1 102 ? -52.183  3.275   -40.452 1.00 71.78  ? 663  LEU B O    1 
ATOM   7430  C  CB   . LEU B 1 102 ? -54.128  4.549   -38.537 1.00 70.02  ? 663  LEU B CB   1 
ATOM   7431  C  CG   . LEU B 1 102 ? -54.353  3.419   -37.528 1.00 66.28  ? 663  LEU B CG   1 
ATOM   7432  C  CD1  . LEU B 1 102 ? -54.021  3.868   -36.115 1.00 56.52  ? 663  LEU B CD1  1 
ATOM   7433  C  CD2  . LEU B 1 102 ? -55.781  2.924   -37.608 1.00 63.88  ? 663  LEU B CD2  1 
ATOM   7434  H  H    . LEU B 1 102 ? -53.225  6.030   -40.340 1.00 103.94 ? 663  LEU B H    1 
ATOM   7435  H  HA   . LEU B 1 102 ? -52.273  5.208   -37.957 1.00 75.09  ? 663  LEU B HA   1 
ATOM   7436  H  HB2  . LEU B 1 102 ? -54.598  5.330   -38.204 1.00 84.02  ? 663  LEU B HB2  1 
ATOM   7437  H  HB3  . LEU B 1 102 ? -54.524  4.270   -39.377 1.00 84.02  ? 663  LEU B HB3  1 
ATOM   7438  H  HG   . LEU B 1 102 ? -53.768  2.678   -37.751 1.00 79.53  ? 663  LEU B HG   1 
ATOM   7439  H  HD11 . LEU B 1 102 ? -54.175  3.129   -35.505 1.00 67.82  ? 663  LEU B HD11 1 
ATOM   7440  H  HD12 . LEU B 1 102 ? -53.090  4.137   -36.080 1.00 67.82  ? 663  LEU B HD12 1 
ATOM   7441  H  HD13 . LEU B 1 102 ? -54.592  4.616   -35.879 1.00 67.82  ? 663  LEU B HD13 1 
ATOM   7442  H  HD21 . LEU B 1 102 ? -55.904  2.209   -36.963 1.00 76.66  ? 663  LEU B HD21 1 
ATOM   7443  H  HD22 . LEU B 1 102 ? -56.381  3.658   -37.407 1.00 76.66  ? 663  LEU B HD22 1 
ATOM   7444  H  HD23 . LEU B 1 102 ? -55.950  2.593   -38.504 1.00 76.66  ? 663  LEU B HD23 1 
ATOM   7445  N  N    . GLU B 1 103 ? -50.881  3.286   -38.584 1.00 63.13  ? 664  GLU B N    1 
ATOM   7446  C  CA   . GLU B 1 103 ? -50.018  2.226   -39.081 1.00 53.38  ? 664  GLU B CA   1 
ATOM   7447  C  C    . GLU B 1 103 ? -50.636  0.851   -38.830 1.00 53.90  ? 664  GLU B C    1 
ATOM   7448  O  O    . GLU B 1 103 ? -51.442  0.682   -37.908 1.00 51.12  ? 664  GLU B O    1 
ATOM   7449  C  CB   . GLU B 1 103 ? -48.647  2.306   -38.421 1.00 52.20  ? 664  GLU B CB   1 
ATOM   7450  C  CG   . GLU B 1 103 ? -47.893  3.575   -38.780 1.00 59.47  ? 664  GLU B CG   1 
ATOM   7451  C  CD   . GLU B 1 103 ? -46.420  3.493   -38.459 1.00 90.25  ? 664  GLU B CD   1 
ATOM   7452  O  OE1  . GLU B 1 103 ? -46.027  2.592   -37.690 1.00 99.47  ? 664  GLU B OE1  1 
ATOM   7453  O  OE2  . GLU B 1 103 ? -45.653  4.331   -38.981 1.00 100.81 ? 664  GLU B OE2  1 
ATOM   7454  H  H    . GLU B 1 103 ? -50.692  3.563   -37.792 1.00 75.75  ? 664  GLU B H    1 
ATOM   7455  H  HA   . GLU B 1 103 ? -49.900  2.334   -40.038 1.00 64.06  ? 664  GLU B HA   1 
ATOM   7456  H  HB2  . GLU B 1 103 ? -48.759  2.286   -37.458 1.00 62.65  ? 664  GLU B HB2  1 
ATOM   7457  H  HB3  . GLU B 1 103 ? -48.113  1.548   -38.708 1.00 62.65  ? 664  GLU B HB3  1 
ATOM   7458  H  HG2  . GLU B 1 103 ? -47.984  3.737   -39.732 1.00 71.37  ? 664  GLU B HG2  1 
ATOM   7459  H  HG3  . GLU B 1 103 ? -48.268  4.317   -38.280 1.00 71.37  ? 664  GLU B HG3  1 
ATOM   7460  N  N    . PRO B 1 104 ? -50.283  -0.152  -39.638 1.00 52.86  ? 665  PRO B N    1 
ATOM   7461  C  CA   . PRO B 1 104 ? -50.949  -1.459  -39.498 1.00 55.49  ? 665  PRO B CA   1 
ATOM   7462  C  C    . PRO B 1 104 ? -50.677  -2.146  -38.170 1.00 52.60  ? 665  PRO B C    1 
ATOM   7463  O  O    . PRO B 1 104 ? -51.593  -2.746  -37.594 1.00 41.68  ? 665  PRO B O    1 
ATOM   7464  C  CB   . PRO B 1 104 ? -50.390  -2.264  -40.681 1.00 63.82  ? 665  PRO B CB   1 
ATOM   7465  C  CG   . PRO B 1 104 ? -49.806  -1.255  -41.611 1.00 56.37  ? 665  PRO B CG   1 
ATOM   7466  C  CD   . PRO B 1 104 ? -49.316  -0.148  -40.746 1.00 51.18  ? 665  PRO B CD   1 
ATOM   7467  H  HA   . PRO B 1 104 ? -51.908  -1.356  -39.610 1.00 66.59  ? 665  PRO B HA   1 
ATOM   7468  H  HB2  . PRO B 1 104 ? -49.705  -2.874  -40.365 1.00 76.58  ? 665  PRO B HB2  1 
ATOM   7469  H  HB3  . PRO B 1 104 ? -51.109  -2.751  -41.113 1.00 76.58  ? 665  PRO B HB3  1 
ATOM   7470  H  HG2  . PRO B 1 104 ? -49.071  -1.654  -42.104 1.00 67.64  ? 665  PRO B HG2  1 
ATOM   7471  H  HG3  . PRO B 1 104 ? -50.492  -0.937  -42.218 1.00 67.64  ? 665  PRO B HG3  1 
ATOM   7472  H  HD2  . PRO B 1 104 ? -48.423  -0.341  -40.420 1.00 61.41  ? 665  PRO B HD2  1 
ATOM   7473  H  HD3  . PRO B 1 104 ? -49.349  0.696   -41.223 1.00 61.41  ? 665  PRO B HD3  1 
ATOM   7474  N  N    . ILE B 1 105 ? -49.441  -2.079  -37.667 1.00 44.88  ? 666  ILE B N    1 
ATOM   7475  C  CA   . ILE B 1 105 ? -49.107  -2.777  -36.428 1.00 45.28  ? 666  ILE B CA   1 
ATOM   7476  C  C    . ILE B 1 105 ? -49.803  -2.121  -35.240 1.00 53.80  ? 666  ILE B C    1 
ATOM   7477  O  O    . ILE B 1 105 ? -50.302  -2.808  -34.340 1.00 35.82  ? 666  ILE B O    1 
ATOM   7478  C  CB   . ILE B 1 105 ? -47.578  -2.831  -36.239 1.00 51.03  ? 666  ILE B CB   1 
ATOM   7479  C  CG1  . ILE B 1 105 ? -46.957  -3.736  -37.311 1.00 52.55  ? 666  ILE B CG1  1 
ATOM   7480  C  CG2  . ILE B 1 105 ? -47.221  -3.331  -34.833 1.00 50.03  ? 666  ILE B CG2  1 
ATOM   7481  C  CD1  . ILE B 1 105 ? -45.477  -3.999  -37.148 1.00 62.41  ? 666  ILE B CD1  1 
ATOM   7482  H  H    . ILE B 1 105 ? -48.789  -1.643  -38.019 1.00 53.85  ? 666  ILE B H    1 
ATOM   7483  H  HA   . ILE B 1 105 ? -49.428  -3.690  -36.489 1.00 54.34  ? 666  ILE B HA   1 
ATOM   7484  H  HB   . ILE B 1 105 ? -47.221  -1.935  -36.348 1.00 61.23  ? 666  ILE B HB   1 
ATOM   7485  H  HG12 . ILE B 1 105 ? -47.410  -4.593  -37.290 1.00 63.06  ? 666  ILE B HG12 1 
ATOM   7486  H  HG13 . ILE B 1 105 ? -47.087  -3.321  -38.178 1.00 63.06  ? 666  ILE B HG13 1 
ATOM   7487  H  HG21 . ILE B 1 105 ? -46.256  -3.355  -34.742 1.00 60.04  ? 666  ILE B HG21 1 
ATOM   7488  H  HG22 . ILE B 1 105 ? -47.601  -2.726  -34.177 1.00 60.04  ? 666  ILE B HG22 1 
ATOM   7489  H  HG23 . ILE B 1 105 ? -47.588  -4.221  -34.713 1.00 60.04  ? 666  ILE B HG23 1 
ATOM   7490  H  HD11 . ILE B 1 105 ? -45.178  -4.577  -37.868 1.00 74.89  ? 666  ILE B HD11 1 
ATOM   7491  H  HD12 . ILE B 1 105 ? -45.001  -3.154  -37.183 1.00 74.89  ? 666  ILE B HD12 1 
ATOM   7492  H  HD13 . ILE B 1 105 ? -45.325  -4.430  -36.293 1.00 74.89  ? 666  ILE B HD13 1 
ATOM   7493  N  N    . THR B 1 106 ? -49.848  -0.786  -35.210 1.00 49.95  ? 667  THR B N    1 
ATOM   7494  C  CA   . THR B 1 106 ? -50.558  -0.104  -34.133 1.00 48.73  ? 667  THR B CA   1 
ATOM   7495  C  C    . THR B 1 106 ? -52.053  -0.392  -34.201 1.00 46.49  ? 667  THR B C    1 
ATOM   7496  O  O    . THR B 1 106 ? -52.704  -0.572  -33.165 1.00 46.42  ? 667  THR B O    1 
ATOM   7497  C  CB   . THR B 1 106 ? -50.286  1.401   -34.190 1.00 52.64  ? 667  THR B CB   1 
ATOM   7498  O  OG1  . THR B 1 106 ? -50.780  1.939   -35.422 1.00 82.21  ? 667  THR B OG1  1 
ATOM   7499  C  CG2  . THR B 1 106 ? -48.789  1.681   -34.085 1.00 53.88  ? 667  THR B CG2  1 
ATOM   7500  H  H    . THR B 1 106 ? -49.483  -0.266  -35.789 1.00 59.94  ? 667  THR B H    1 
ATOM   7501  H  HA   . THR B 1 106 ? -50.229  -0.434  -33.283 1.00 58.47  ? 667  THR B HA   1 
ATOM   7502  H  HB   . THR B 1 106 ? -50.732  1.836   -33.447 1.00 63.17  ? 667  THR B HB   1 
ATOM   7503  H  HG1  . THR B 1 106 ? -51.607  1.808   -35.482 1.00 98.65  ? 667  THR B HG1  1 
ATOM   7504  H  HG21 . THR B 1 106 ? -48.628  2.636   -34.122 1.00 64.66  ? 667  THR B HG21 1 
ATOM   7505  H  HG22 . THR B 1 106 ? -48.446  1.335   -33.247 1.00 64.66  ? 667  THR B HG22 1 
ATOM   7506  H  HG23 . THR B 1 106 ? -48.320  1.253   -34.819 1.00 64.66  ? 667  THR B HG23 1 
ATOM   7507  N  N    . LEU B 1 107 ? -52.610  -0.454  -35.413 1.00 45.65  ? 668  LEU B N    1 
ATOM   7508  C  CA   . LEU B 1 107 ? -54.009  -0.835  -35.578 1.00 35.55  ? 668  LEU B CA   1 
ATOM   7509  C  C    . LEU B 1 107 ? -54.273  -2.215  -34.990 1.00 42.98  ? 668  LEU B C    1 
ATOM   7510  O  O    . LEU B 1 107 ? -55.289  -2.435  -34.316 1.00 38.03  ? 668  LEU B O    1 
ATOM   7511  C  CB   . LEU B 1 107 ? -54.380  -0.801  -37.063 1.00 40.65  ? 668  LEU B CB   1 
ATOM   7512  C  CG   . LEU B 1 107 ? -55.849  -1.010  -37.452 1.00 46.83  ? 668  LEU B CG   1 
ATOM   7513  C  CD1  . LEU B 1 107 ? -56.104  -0.448  -38.836 1.00 58.57  ? 668  LEU B CD1  1 
ATOM   7514  C  CD2  . LEU B 1 107 ? -56.264  -2.478  -37.412 1.00 49.52  ? 668  LEU B CD2  1 
ATOM   7515  H  H    . LEU B 1 107 ? -52.200  -0.281  -36.149 1.00 54.78  ? 668  LEU B H    1 
ATOM   7516  H  HA   . LEU B 1 107 ? -54.570  -0.196  -35.112 1.00 42.66  ? 668  LEU B HA   1 
ATOM   7517  H  HB2  . LEU B 1 107 ? -54.116  0.064   -37.414 1.00 48.79  ? 668  LEU B HB2  1 
ATOM   7518  H  HB3  . LEU B 1 107 ? -53.869  -1.492  -37.512 1.00 48.79  ? 668  LEU B HB3  1 
ATOM   7519  H  HG   . LEU B 1 107 ? -56.410  -0.525  -36.826 1.00 56.19  ? 668  LEU B HG   1 
ATOM   7520  H  HD11 . LEU B 1 107 ? -57.036  -0.588  -39.067 1.00 70.28  ? 668  LEU B HD11 1 
ATOM   7521  H  HD12 . LEU B 1 107 ? -55.902  0.501   -38.834 1.00 70.28  ? 668  LEU B HD12 1 
ATOM   7522  H  HD13 . LEU B 1 107 ? -55.533  -0.906  -39.473 1.00 70.28  ? 668  LEU B HD13 1 
ATOM   7523  H  HD21 . LEU B 1 107 ? -57.198  -2.548  -37.666 1.00 59.43  ? 668  LEU B HD21 1 
ATOM   7524  H  HD22 . LEU B 1 107 ? -55.713  -2.978  -38.034 1.00 59.43  ? 668  LEU B HD22 1 
ATOM   7525  H  HD23 . LEU B 1 107 ? -56.139  -2.817  -36.512 1.00 59.43  ? 668  LEU B HD23 1 
ATOM   7526  N  N    . LEU B 1 108 ? -53.382  -3.172  -35.259 1.00 45.05  ? 669  LEU B N    1 
ATOM   7527  C  CA   . LEU B 1 108 ? -53.545  -4.498  -34.676 1.00 43.43  ? 669  LEU B CA   1 
ATOM   7528  C  C    . LEU B 1 108 ? -53.371  -4.460  -33.166 1.00 41.84  ? 669  LEU B C    1 
ATOM   7529  O  O    . LEU B 1 108 ? -53.991  -5.254  -32.450 1.00 34.36  ? 669  LEU B O    1 
ATOM   7530  C  CB   . LEU B 1 108 ? -52.552  -5.478  -35.303 1.00 42.03  ? 669  LEU B CB   1 
ATOM   7531  C  CG   . LEU B 1 108 ? -52.762  -5.845  -36.775 1.00 44.77  ? 669  LEU B CG   1 
ATOM   7532  C  CD1  . LEU B 1 108 ? -51.723  -6.868  -37.196 1.00 50.01  ? 669  LEU B CD1  1 
ATOM   7533  C  CD2  . LEU B 1 108 ? -54.162  -6.374  -37.037 1.00 44.70  ? 669  LEU B CD2  1 
ATOM   7534  H  H    . LEU B 1 108 ? -52.692  -3.080  -35.764 1.00 54.06  ? 669  LEU B H    1 
ATOM   7535  H  HA   . LEU B 1 108 ? -54.441  -4.818  -34.866 1.00 52.11  ? 669  LEU B HA   1 
ATOM   7536  H  HB2  . LEU B 1 108 ? -51.664  -5.094  -35.229 1.00 50.44  ? 669  LEU B HB2  1 
ATOM   7537  H  HB3  . LEU B 1 108 ? -52.585  -6.304  -34.796 1.00 50.44  ? 669  LEU B HB3  1 
ATOM   7538  H  HG   . LEU B 1 108 ? -52.636  -5.052  -37.318 1.00 53.73  ? 669  LEU B HG   1 
ATOM   7539  H  HD11 . LEU B 1 108 ? -51.863  -7.095  -38.129 1.00 60.01  ? 669  LEU B HD11 1 
ATOM   7540  H  HD12 . LEU B 1 108 ? -50.839  -6.487  -37.077 1.00 60.01  ? 669  LEU B HD12 1 
ATOM   7541  H  HD13 . LEU B 1 108 ? -51.818  -7.660  -36.644 1.00 60.01  ? 669  LEU B HD13 1 
ATOM   7542  H  HD21 . LEU B 1 108 ? -54.245  -6.592  -37.979 1.00 53.63  ? 669  LEU B HD21 1 
ATOM   7543  H  HD22 . LEU B 1 108 ? -54.305  -7.168  -36.500 1.00 53.63  ? 669  LEU B HD22 1 
ATOM   7544  H  HD23 . LEU B 1 108 ? -54.807  -5.690  -36.797 1.00 53.63  ? 669  LEU B HD23 1 
ATOM   7545  N  N    . GLN B 1 109 ? -52.543  -3.543  -32.663 1.00 44.90  ? 670  GLN B N    1 
ATOM   7546  C  CA   . GLN B 1 109 ? -52.406  -3.380  -31.222 1.00 42.57  ? 670  GLN B CA   1 
ATOM   7547  C  C    . GLN B 1 109 ? -53.712  -2.892  -30.611 1.00 47.25  ? 670  GLN B C    1 
ATOM   7548  O  O    . GLN B 1 109 ? -54.158  -3.400  -29.576 1.00 43.13  ? 670  GLN B O    1 
ATOM   7549  C  CB   . GLN B 1 109 ? -51.271  -2.403  -30.922 1.00 36.24  ? 670  GLN B CB   1 
ATOM   7550  C  CG   . GLN B 1 109 ? -50.862  -2.335  -29.466 1.00 52.28  ? 670  GLN B CG   1 
ATOM   7551  C  CD   . GLN B 1 109 ? -49.965  -1.148  -29.181 1.00 74.11  ? 670  GLN B CD   1 
ATOM   7552  O  OE1  . GLN B 1 109 ? -48.819  -1.306  -28.759 1.00 80.89  ? 670  GLN B OE1  1 
ATOM   7553  N  NE2  . GLN B 1 109 ? -50.485  0.054   -29.414 1.00 75.13  ? 670  GLN B NE2  1 
ATOM   7554  H  H    . GLN B 1 109 ? -52.057  -3.011  -33.132 1.00 53.88  ? 670  GLN B H    1 
ATOM   7555  H  HA   . GLN B 1 109 ? -52.184  -4.236  -30.823 1.00 51.08  ? 670  GLN B HA   1 
ATOM   7556  H  HB2  . GLN B 1 109 ? -50.491  -2.669  -31.433 1.00 43.49  ? 670  GLN B HB2  1 
ATOM   7557  H  HB3  . GLN B 1 109 ? -51.549  -1.514  -31.190 1.00 43.49  ? 670  GLN B HB3  1 
ATOM   7558  H  HG2  . GLN B 1 109 ? -51.657  -2.252  -28.915 1.00 62.73  ? 670  GLN B HG2  1 
ATOM   7559  H  HG3  . GLN B 1 109 ? -50.378  -3.143  -29.233 1.00 62.73  ? 670  GLN B HG3  1 
ATOM   7560  H  HE21 . GLN B 1 109 ? -51.289  0.125   -29.711 1.00 90.15  ? 670  GLN B HE21 1 
ATOM   7561  H  HE22 . GLN B 1 109 ? -50.016  0.760   -29.269 1.00 90.15  ? 670  GLN B HE22 1 
ATOM   7562  N  N    . GLN B 1 110 ? -54.345  -1.902  -31.246 1.00 35.22  ? 671  GLN B N    1 
ATOM   7563  C  CA   . GLN B 1 110 ? -55.614  -1.387  -30.745 1.00 31.12  ? 671  GLN B CA   1 
ATOM   7564  C  C    . GLN B 1 110 ? -56.691  -2.458  -30.782 1.00 42.04  ? 671  GLN B C    1 
ATOM   7565  O  O    . GLN B 1 110 ? -57.475  -2.597  -29.835 1.00 34.40  ? 671  GLN B O    1 
ATOM   7566  C  CB   . GLN B 1 110 ? -56.040  -0.170  -31.564 1.00 34.80  ? 671  GLN B CB   1 
ATOM   7567  C  CG   . GLN B 1 110 ? -55.091  1.013   -31.446 1.00 40.84  ? 671  GLN B CG   1 
ATOM   7568  C  CD   . GLN B 1 110 ? -55.391  2.104   -32.451 1.00 38.47  ? 671  GLN B CD   1 
ATOM   7569  O  OE1  . GLN B 1 110 ? -56.257  1.952   -33.311 1.00 38.77  ? 671  GLN B OE1  1 
ATOM   7570  N  NE2  . GLN B 1 110 ? -54.672  3.212   -32.349 1.00 42.67  ? 671  GLN B NE2  1 
ATOM   7571  H  H    . GLN B 1 110 ? -54.062  -1.518  -31.962 1.00 42.27  ? 671  GLN B H    1 
ATOM   7572  H  HA   . GLN B 1 110 ? -55.500  -1.105  -29.823 1.00 37.34  ? 671  GLN B HA   1 
ATOM   7573  H  HB2  . GLN B 1 110 ? -56.084  -0.422  -32.499 1.00 41.76  ? 671  GLN B HB2  1 
ATOM   7574  H  HB3  . GLN B 1 110 ? -56.915  0.121   -31.261 1.00 41.76  ? 671  GLN B HB3  1 
ATOM   7575  H  HG2  . GLN B 1 110 ? -55.169  1.394   -30.557 1.00 49.01  ? 671  GLN B HG2  1 
ATOM   7576  H  HG3  . GLN B 1 110 ? -54.183  0.706   -31.597 1.00 49.01  ? 671  GLN B HG3  1 
ATOM   7577  H  HE21 . GLN B 1 110 ? -54.073  3.282   -31.735 1.00 51.20  ? 671  GLN B HE21 1 
ATOM   7578  H  HE22 . GLN B 1 110 ? -54.804  3.862   -32.896 1.00 51.20  ? 671  GLN B HE22 1 
ATOM   7579  N  N    . THR B 1 111 ? -56.747  -3.224  -31.871 1.00 43.28  ? 672  THR B N    1 
ATOM   7580  C  CA   . THR B 1 111 ? -57.721  -4.303  -31.978 1.00 37.60  ? 672  THR B CA   1 
ATOM   7581  C  C    . THR B 1 111 ? -57.504  -5.348  -30.892 1.00 36.87  ? 672  THR B C    1 
ATOM   7582  O  O    . THR B 1 111 ? -58.460  -5.815  -30.263 1.00 36.22  ? 672  THR B O    1 
ATOM   7583  C  CB   . THR B 1 111 ? -57.629  -4.935  -33.364 1.00 40.58  ? 672  THR B CB   1 
ATOM   7584  O  OG1  . THR B 1 111 ? -57.845  -3.923  -34.357 1.00 37.36  ? 672  THR B OG1  1 
ATOM   7585  C  CG2  . THR B 1 111 ? -58.656  -6.051  -33.525 1.00 39.54  ? 672  THR B CG2  1 
ATOM   7586  H  H    . THR B 1 111 ? -56.235  -3.138  -32.557 1.00 51.93  ? 672  THR B H    1 
ATOM   7587  H  HA   . THR B 1 111 ? -58.613  -3.938  -31.872 1.00 45.11  ? 672  THR B HA   1 
ATOM   7588  H  HB   . THR B 1 111 ? -56.745  -5.317  -33.484 1.00 48.69  ? 672  THR B HB   1 
ATOM   7589  H  HG1  . THR B 1 111 ? -57.263  -3.321  -34.285 1.00 44.83  ? 672  THR B HG1  1 
ATOM   7590  H  HG21 . THR B 1 111 ? -58.584  -6.442  -34.410 1.00 47.45  ? 672  THR B HG21 1 
ATOM   7591  H  HG22 . THR B 1 111 ? -58.501  -6.742  -32.861 1.00 47.45  ? 672  THR B HG22 1 
ATOM   7592  H  HG23 . THR B 1 111 ? -59.551  -5.697  -33.408 1.00 47.45  ? 672  THR B HG23 1 
ATOM   7593  N  N    . THR B 1 112 ? -56.247  -5.729  -30.659 1.00 43.15  ? 673  THR B N    1 
ATOM   7594  C  CA   . THR B 1 112 ? -55.952  -6.717  -29.628 1.00 43.85  ? 673  THR B CA   1 
ATOM   7595  C  C    . THR B 1 112 ? -56.226  -6.157  -28.239 1.00 49.44  ? 673  THR B C    1 
ATOM   7596  O  O    . THR B 1 112 ? -56.710  -6.877  -27.357 1.00 47.40  ? 673  THR B O    1 
ATOM   7597  C  CB   . THR B 1 112 ? -54.501  -7.173  -29.748 1.00 47.51  ? 673  THR B CB   1 
ATOM   7598  O  OG1  . THR B 1 112 ? -54.271  -7.671  -31.073 1.00 43.33  ? 673  THR B OG1  1 
ATOM   7599  C  CG2  . THR B 1 112 ? -54.182  -8.266  -28.721 1.00 45.07  ? 673  THR B CG2  1 
ATOM   7600  H  H    . THR B 1 112 ? -55.557  -5.434  -31.080 1.00 51.78  ? 673  THR B H    1 
ATOM   7601  H  HA   . THR B 1 112 ? -56.522  -7.491  -29.758 1.00 52.62  ? 673  THR B HA   1 
ATOM   7602  H  HB   . THR B 1 112 ? -53.913  -6.420  -29.583 1.00 57.02  ? 673  THR B HB   1 
ATOM   7603  H  HG1  . THR B 1 112 ? -54.421  -7.067  -31.636 1.00 51.99  ? 673  THR B HG1  1 
ATOM   7604  H  HG21 . THR B 1 112 ? -53.258  -8.545  -28.810 1.00 54.08  ? 673  THR B HG21 1 
ATOM   7605  H  HG22 . THR B 1 112 ? -54.324  -7.927  -27.823 1.00 54.08  ? 673  THR B HG22 1 
ATOM   7606  H  HG23 . THR B 1 112 ? -54.758  -9.033  -28.864 1.00 54.08  ? 673  THR B HG23 1 
ATOM   7607  N  N    . SER B 1 113 ? -55.920  -4.878  -28.021 1.00 47.79  ? 674  SER B N    1 
ATOM   7608  C  CA   . SER B 1 113 ? -56.219  -4.261  -26.736 1.00 48.16  ? 674  SER B CA   1 
ATOM   7609  C  C    . SER B 1 113 ? -57.721  -4.240  -26.481 1.00 47.71  ? 674  SER B C    1 
ATOM   7610  O  O    . SER B 1 113 ? -58.175  -4.538  -25.370 1.00 37.30  ? 674  SER B O    1 
ATOM   7611  C  CB   . SER B 1 113 ? -55.642  -2.847  -26.693 1.00 42.93  ? 674  SER B CB   1 
ATOM   7612  O  OG   . SER B 1 113 ? -55.666  -2.325  -25.376 1.00 65.89  ? 674  SER B OG   1 
ATOM   7613  H  H    . SER B 1 113 ? -55.545  -4.356  -28.593 1.00 57.35  ? 674  SER B H    1 
ATOM   7614  H  HA   . SER B 1 113 ? -55.801  -4.778  -26.030 1.00 57.79  ? 674  SER B HA   1 
ATOM   7615  H  HB2  . SER B 1 113 ? -54.723  -2.872  -27.004 1.00 51.51  ? 674  SER B HB2  1 
ATOM   7616  H  HB3  . SER B 1 113 ? -56.171  -2.273  -27.269 1.00 51.51  ? 674  SER B HB3  1 
ATOM   7617  H  HG   . SER B 1 113 ? -55.346  -1.548  -25.369 1.00 79.07  ? 674  SER B HG   1 
ATOM   7618  N  N    . GLY B 1 114 ? -58.511  -3.897  -27.501 1.00 44.24  ? 675  GLY B N    1 
ATOM   7619  C  CA   . GLY B 1 114 ? -59.953  -3.930  -27.348 1.00 38.99  ? 675  GLY B CA   1 
ATOM   7620  C  C    . GLY B 1 114 ? -60.483  -5.329  -27.118 1.00 44.10  ? 675  GLY B C    1 
ATOM   7621  O  O    . GLY B 1 114 ? -61.452  -5.517  -26.379 1.00 42.77  ? 675  GLY B O    1 
ATOM   7622  H  H    . GLY B 1 114 ? -58.236  -3.647  -28.276 1.00 53.09  ? 675  GLY B H    1 
ATOM   7623  H  HA2  . GLY B 1 114 ? -60.210  -3.377  -26.594 1.00 46.78  ? 675  GLY B HA2  1 
ATOM   7624  H  HA3  . GLY B 1 114 ? -60.370  -3.572  -28.148 1.00 46.78  ? 675  GLY B HA3  1 
ATOM   7625  N  N    . LEU B 1 115 ? -59.864  -6.327  -27.748 1.00 51.60  ? 676  LEU B N    1 
ATOM   7626  C  CA   . LEU B 1 115 ? -60.250  -7.708  -27.492 1.00 49.52  ? 676  LEU B CA   1 
ATOM   7627  C  C    . LEU B 1 115 ? -59.916  -8.107  -26.060 1.00 52.91  ? 676  LEU B C    1 
ATOM   7628  O  O    . LEU B 1 115 ? -60.725  -8.753  -25.385 1.00 44.20  ? 676  LEU B O    1 
ATOM   7629  C  CB   . LEU B 1 115 ? -59.552  -8.634  -28.488 1.00 58.44  ? 676  LEU B CB   1 
ATOM   7630  C  CG   . LEU B 1 115 ? -60.090  -10.062 -28.586 1.00 51.99  ? 676  LEU B CG   1 
ATOM   7631  C  CD1  . LEU B 1 115 ? -61.471  -10.071 -29.230 1.00 47.49  ? 676  LEU B CD1  1 
ATOM   7632  C  CD2  . LEU B 1 115 ? -59.126  -10.940 -29.364 1.00 52.32  ? 676  LEU B CD2  1 
ATOM   7633  H  H    . LEU B 1 115 ? -59.227  -6.231  -28.318 1.00 61.92  ? 676  LEU B H    1 
ATOM   7634  H  HA   . LEU B 1 115 ? -61.208  -7.799  -27.615 1.00 59.42  ? 676  LEU B HA   1 
ATOM   7635  H  HB2  . LEU B 1 115 ? -59.624  -8.239  -29.371 1.00 70.13  ? 676  LEU B HB2  1 
ATOM   7636  H  HB3  . LEU B 1 115 ? -58.616  -8.696  -28.240 1.00 70.13  ? 676  LEU B HB3  1 
ATOM   7637  H  HG   . LEU B 1 115 ? -60.174  -10.429 -27.692 1.00 62.38  ? 676  LEU B HG   1 
ATOM   7638  H  HD11 . LEU B 1 115 ? -61.789  -10.986 -29.280 1.00 56.98  ? 676  LEU B HD11 1 
ATOM   7639  H  HD12 . LEU B 1 115 ? -62.076  -9.540  -28.689 1.00 56.98  ? 676  LEU B HD12 1 
ATOM   7640  H  HD13 . LEU B 1 115 ? -61.406  -9.694  -30.121 1.00 56.98  ? 676  LEU B HD13 1 
ATOM   7641  H  HD21 . LEU B 1 115 ? -59.488  -11.839 -29.413 1.00 62.78  ? 676  LEU B HD21 1 
ATOM   7642  H  HD22 . LEU B 1 115 ? -59.019  -10.577 -30.257 1.00 62.78  ? 676  LEU B HD22 1 
ATOM   7643  H  HD23 . LEU B 1 115 ? -58.271  -10.952 -28.907 1.00 62.78  ? 676  LEU B HD23 1 
ATOM   7644  N  N    . ALA B 1 116 ? -58.731  -7.719  -25.577 1.00 51.90  ? 677  ALA B N    1 
ATOM   7645  C  CA   . ALA B 1 116 ? -58.355  -7.988  -24.191 1.00 44.11  ? 677  ALA B CA   1 
ATOM   7646  C  C    . ALA B 1 116 ? -59.345  -7.373  -23.213 1.00 58.99  ? 677  ALA B C    1 
ATOM   7647  O  O    . ALA B 1 116 ? -59.580  -7.931  -22.135 1.00 55.46  ? 677  ALA B O    1 
ATOM   7648  C  CB   . ALA B 1 116 ? -56.950  -7.451  -23.915 1.00 37.42  ? 677  ALA B CB   1 
ATOM   7649  H  H    . ALA B 1 116 ? -58.131  -7.302  -26.031 1.00 62.28  ? 677  ALA B H    1 
ATOM   7650  H  HA   . ALA B 1 116 ? -58.345  -8.947  -24.046 1.00 52.93  ? 677  ALA B HA   1 
ATOM   7651  H  HB1  . ALA B 1 116 ? -56.717  -7.637  -22.992 1.00 44.91  ? 677  ALA B HB1  1 
ATOM   7652  H  HB2  . ALA B 1 116 ? -56.322  -7.890  -24.510 1.00 44.91  ? 677  ALA B HB2  1 
ATOM   7653  H  HB3  . ALA B 1 116 ? -56.941  -6.494  -24.072 1.00 44.91  ? 677  ALA B HB3  1 
ATOM   7654  N  N    . HIS B 1 117 ? -59.930  -6.227  -23.568 1.00 51.90  ? 678  HIS B N    1 
ATOM   7655  C  CA   . HIS B 1 117 ? -60.897  -5.579  -22.690 1.00 58.13  ? 678  HIS B CA   1 
ATOM   7656  C  C    . HIS B 1 117 ? -62.173  -6.405  -22.568 1.00 54.39  ? 678  HIS B C    1 
ATOM   7657  O  O    . HIS B 1 117 ? -62.680  -6.620  -21.461 1.00 58.10  ? 678  HIS B O    1 
ATOM   7658  C  CB   . HIS B 1 117 ? -61.217  -4.176  -23.206 1.00 50.95  ? 678  HIS B CB   1 
ATOM   7659  C  CG   . HIS B 1 117 ? -62.298  -3.489  -22.436 1.00 46.91  ? 678  HIS B CG   1 
ATOM   7660  N  ND1  . HIS B 1 117 ? -62.089  -2.949  -21.186 1.00 53.02  ? 678  HIS B ND1  1 
ATOM   7661  C  CD2  . HIS B 1 117 ? -63.600  -3.266  -22.730 1.00 45.85  ? 678  HIS B CD2  1 
ATOM   7662  C  CE1  . HIS B 1 117 ? -63.214  -2.417  -20.746 1.00 48.04  ? 678  HIS B CE1  1 
ATOM   7663  N  NE2  . HIS B 1 117 ? -64.147  -2.597  -21.663 1.00 46.15  ? 678  HIS B NE2  1 
ATOM   7664  H  H    . HIS B 1 117 ? -59.784  -5.810  -24.306 1.00 62.28  ? 678  HIS B H    1 
ATOM   7665  H  HA   . HIS B 1 117 ? -60.511  -5.491  -21.804 1.00 69.76  ? 678  HIS B HA   1 
ATOM   7666  H  HB2  . HIS B 1 117 ? -60.417  -3.631  -23.148 1.00 61.14  ? 678  HIS B HB2  1 
ATOM   7667  H  HB3  . HIS B 1 117 ? -61.505  -4.240  -24.130 1.00 61.14  ? 678  HIS B HB3  1 
ATOM   7668  H  HD1  . HIS B 1 117 ? -61.341  -2.955  -20.761 1.00 63.62  ? 678  HIS B HD1  1 
ATOM   7669  H  HD2  . HIS B 1 117 ? -64.041  -3.518  -23.509 1.00 55.02  ? 678  HIS B HD2  1 
ATOM   7670  H  HE1  . HIS B 1 117 ? -63.331  -1.989  -19.929 1.00 57.64  ? 678  HIS B HE1  1 
ATOM   7671  H  HE2  . HIS B 1 117 ? -64.964  -2.336  -21.603 1.00 55.38  ? 678  HIS B HE2  1 
ATOM   7672  N  N    . LEU B 1 118 ? -62.714  -6.868  -23.698 1.00 56.77  ? 679  LEU B N    1 
ATOM   7673  C  CA   . LEU B 1 118 ? -63.932  -7.669  -23.655 1.00 60.11  ? 679  LEU B CA   1 
ATOM   7674  C  C    . LEU B 1 118 ? -63.705  -8.982  -22.917 1.00 51.93  ? 679  LEU B C    1 
ATOM   7675  O  O    . LEU B 1 118 ? -64.579  -9.445  -22.176 1.00 60.76  ? 679  LEU B O    1 
ATOM   7676  C  CB   . LEU B 1 118 ? -64.436  -7.936  -25.073 1.00 50.39  ? 679  LEU B CB   1 
ATOM   7677  C  CG   . LEU B 1 118 ? -64.944  -6.738  -25.873 1.00 43.15  ? 679  LEU B CG   1 
ATOM   7678  C  CD1  . LEU B 1 118 ? -65.541  -7.216  -27.185 1.00 54.68  ? 679  LEU B CD1  1 
ATOM   7679  C  CD2  . LEU B 1 118 ? -65.975  -5.924  -25.093 1.00 52.84  ? 679  LEU B CD2  1 
ATOM   7680  H  H    . LEU B 1 118 ? -62.400  -6.733  -24.487 1.00 68.13  ? 679  LEU B H    1 
ATOM   7681  H  HA   . LEU B 1 118 ? -64.619  -7.174  -23.181 1.00 72.13  ? 679  LEU B HA   1 
ATOM   7682  H  HB2  . LEU B 1 118 ? -63.709  -8.330  -25.581 1.00 60.47  ? 679  LEU B HB2  1 
ATOM   7683  H  HB3  . LEU B 1 118 ? -65.166  -8.572  -25.017 1.00 60.47  ? 679  LEU B HB3  1 
ATOM   7684  H  HG   . LEU B 1 118 ? -64.196  -6.155  -26.078 1.00 51.78  ? 679  LEU B HG   1 
ATOM   7685  H  HD11 . LEU B 1 118 ? -65.860  -6.449  -27.685 1.00 65.62  ? 679  LEU B HD11 1 
ATOM   7686  H  HD12 . LEU B 1 118 ? -64.856  -7.680  -27.692 1.00 65.62  ? 679  LEU B HD12 1 
ATOM   7687  H  HD13 . LEU B 1 118 ? -66.277  -7.818  -26.995 1.00 65.62  ? 679  LEU B HD13 1 
ATOM   7688  H  HD21 . LEU B 1 118 ? -66.266  -5.178  -25.639 1.00 63.41  ? 679  LEU B HD21 1 
ATOM   7689  H  HD22 . LEU B 1 118 ? -66.730  -6.493  -24.879 1.00 63.41  ? 679  LEU B HD22 1 
ATOM   7690  H  HD23 . LEU B 1 118 ? -65.566  -5.597  -24.276 1.00 63.41  ? 679  LEU B HD23 1 
ATOM   7691  N  N    . HIS B 1 119 ? -62.535  -9.591  -23.096 1.00 51.21  ? 680  HIS B N    1 
ATOM   7692  C  CA   . HIS B 1 119 ? -62.263  -10.863 -22.440 1.00 55.23  ? 680  HIS B CA   1 
ATOM   7693  C  C    . HIS B 1 119 ? -62.139  -10.695 -20.932 1.00 54.69  ? 680  HIS B C    1 
ATOM   7694  O  O    . HIS B 1 119 ? -62.529  -11.587 -20.170 1.00 76.71  ? 680  HIS B O    1 
ATOM   7695  C  CB   . HIS B 1 119 ? -60.993  -11.485 -23.018 1.00 51.41  ? 680  HIS B CB   1 
ATOM   7696  C  CG   . HIS B 1 119 ? -61.158  -12.012 -24.409 1.00 52.99  ? 680  HIS B CG   1 
ATOM   7697  N  ND1  . HIS B 1 119 ? -60.116  -12.561 -25.125 1.00 58.84  ? 680  HIS B ND1  1 
ATOM   7698  C  CD2  . HIS B 1 119 ? -62.245  -12.082 -25.214 1.00 44.60  ? 680  HIS B CD2  1 
ATOM   7699  C  CE1  . HIS B 1 119 ? -60.552  -12.941 -26.312 1.00 56.34  ? 680  HIS B CE1  1 
ATOM   7700  N  NE2  . HIS B 1 119 ? -61.840  -12.660 -26.392 1.00 55.33  ? 680  HIS B NE2  1 
ATOM   7701  H  H    . HIS B 1 119 ? -61.892  -9.293  -23.584 1.00 61.45  ? 680  HIS B H    1 
ATOM   7702  H  HA   . HIS B 1 119 ? -62.999  -11.470 -22.614 1.00 66.28  ? 680  HIS B HA   1 
ATOM   7703  H  HB2  . HIS B 1 119 ? -60.295  -10.812 -23.036 1.00 61.69  ? 680  HIS B HB2  1 
ATOM   7704  H  HB3  . HIS B 1 119 ? -60.722  -12.224 -22.451 1.00 61.69  ? 680  HIS B HB3  1 
ATOM   7705  H  HD1  . HIS B 1 119 ? -59.308  -12.641 -24.843 1.00 70.61  ? 680  HIS B HD1  1 
ATOM   7706  H  HD2  . HIS B 1 119 ? -63.103  -11.788 -25.009 1.00 53.52  ? 680  HIS B HD2  1 
ATOM   7707  H  HE1  . HIS B 1 119 ? -60.039  -13.338 -26.979 1.00 67.61  ? 680  HIS B HE1  1 
ATOM   7708  H  HE2  . HIS B 1 119 ? -62.345  -12.817 -27.071 1.00 66.39  ? 680  HIS B HE2  1 
ATOM   7709  N  N    . SER B 1 120 ? -61.599  -9.561  -20.480 1.00 57.88  ? 681  SER B N    1 
ATOM   7710  C  CA   . SER B 1 120 ? -61.475  -9.320  -19.046 1.00 52.32  ? 681  SER B CA   1 
ATOM   7711  C  C    . SER B 1 120 ? -62.840  -9.228  -18.379 1.00 53.89  ? 681  SER B C    1 
ATOM   7712  O  O    . SER B 1 120 ? -62.970  -9.515  -17.184 1.00 66.17  ? 681  SER B O    1 
ATOM   7713  C  CB   . SER B 1 120 ? -60.685  -8.040  -18.798 1.00 56.51  ? 681  SER B CB   1 
ATOM   7714  O  OG   . SER B 1 120 ? -61.444  -6.910  -19.190 1.00 57.11  ? 681  SER B OG   1 
ATOM   7715  H  H    . SER B 1 120 ? -61.301  -8.925  -20.977 1.00 69.46  ? 681  SER B H    1 
ATOM   7716  H  HA   . SER B 1 120 ? -60.991  -10.057 -18.641 1.00 62.78  ? 681  SER B HA   1 
ATOM   7717  H  HB2  . SER B 1 120 ? -60.480  -7.971  -17.853 1.00 67.81  ? 681  SER B HB2  1 
ATOM   7718  H  HB3  . SER B 1 120 ? -59.866  -8.067  -19.316 1.00 67.81  ? 681  SER B HB3  1 
ATOM   7719  H  HG   . SER B 1 120 ? -61.630  -6.959  -20.008 1.00 68.53  ? 681  SER B HG   1 
ATOM   7720  N  N    . LEU B 1 121 ? -63.860  -8.831  -19.135 1.00 59.43  ? 682  LEU B N    1 
ATOM   7721  C  CA   . LEU B 1 121 ? -65.234  -8.766  -18.663 1.00 47.42  ? 682  LEU B CA   1 
ATOM   7722  C  C    . LEU B 1 121 ? -65.994  -10.065 -18.903 1.00 56.68  ? 682  LEU B C    1 
ATOM   7723  O  O    . LEU B 1 121 ? -67.213  -10.103 -18.700 1.00 70.17  ? 682  LEU B O    1 
ATOM   7724  C  CB   . LEU B 1 121 ? -65.959  -7.599  -19.336 1.00 49.21  ? 682  LEU B CB   1 
ATOM   7725  C  CG   . LEU B 1 121 ? -65.262  -6.242  -19.183 1.00 52.64  ? 682  LEU B CG   1 
ATOM   7726  C  CD1  . LEU B 1 121 ? -66.042  -5.143  -19.890 1.00 53.27  ? 682  LEU B CD1  1 
ATOM   7727  C  CD2  . LEU B 1 121 ? -65.053  -5.888  -17.712 1.00 53.27  ? 682  LEU B CD2  1 
ATOM   7728  H  H    . LEU B 1 121 ? -63.773  -8.586  -19.954 1.00 71.32  ? 682  LEU B H    1 
ATOM   7729  H  HA   . LEU B 1 121 ? -65.228  -8.599  -17.707 1.00 56.90  ? 682  LEU B HA   1 
ATOM   7730  H  HB2  . LEU B 1 121 ? -66.034  -7.786  -20.285 1.00 59.05  ? 682  LEU B HB2  1 
ATOM   7731  H  HB3  . LEU B 1 121 ? -66.845  -7.519  -18.948 1.00 59.05  ? 682  LEU B HB3  1 
ATOM   7732  H  HG   . LEU B 1 121 ? -64.387  -6.296  -19.599 1.00 63.17  ? 682  LEU B HG   1 
ATOM   7733  H  HD11 . LEU B 1 121 ? -65.575  -4.301  -19.774 1.00 63.92  ? 682  LEU B HD11 1 
ATOM   7734  H  HD12 . LEU B 1 121 ? -66.107  -5.359  -20.833 1.00 63.92  ? 682  LEU B HD12 1 
ATOM   7735  H  HD13 . LEU B 1 121 ? -66.929  -5.086  -19.501 1.00 63.92  ? 682  LEU B HD13 1 
ATOM   7736  H  HD21 . LEU B 1 121 ? -64.611  -5.027  -17.655 1.00 63.92  ? 682  LEU B HD21 1 
ATOM   7737  H  HD22 . LEU B 1 121 ? -65.917  -5.847  -17.272 1.00 63.92  ? 682  LEU B HD22 1 
ATOM   7738  H  HD23 . LEU B 1 121 ? -64.503  -6.572  -17.298 1.00 63.92  ? 682  LEU B HD23 1 
ATOM   7739  N  N    . ASN B 1 122 ? -65.311  -11.109 -19.378 1.00 57.03  ? 683  ASN B N    1 
ATOM   7740  C  CA   . ASN B 1 122 ? -65.932  -12.403 -19.669 1.00 68.88  ? 683  ASN B CA   1 
ATOM   7741  C  C    . ASN B 1 122 ? -66.986  -12.272 -20.766 1.00 54.86  ? 683  ASN B C    1 
ATOM   7742  O  O    . ASN B 1 122 ? -68.068  -12.858 -20.691 1.00 66.90  ? 683  ASN B O    1 
ATOM   7743  C  CB   . ASN B 1 122 ? -66.524  -13.038 -18.407 1.00 63.83  ? 683  ASN B CB   1 
ATOM   7744  C  CG   . ASN B 1 122 ? -65.455  -13.439 -17.399 1.00 83.80  ? 683  ASN B CG   1 
ATOM   7745  O  OD1  . ASN B 1 122 ? -64.697  -14.382 -17.625 1.00 89.39  ? 683  ASN B OD1  1 
ATOM   7746  N  ND2  . ASN B 1 122 ? -65.399  -12.729 -16.278 1.00 80.97  ? 683  ASN B ND2  1 
ATOM   7747  H  H    . ASN B 1 122 ? -64.467  -11.091 -19.544 1.00 68.44  ? 683  ASN B H    1 
ATOM   7748  H  HA   . ASN B 1 122 ? -65.245  -13.003 -19.999 1.00 82.66  ? 683  ASN B HA   1 
ATOM   7749  H  HB2  . ASN B 1 122 ? -67.116  -12.401 -17.979 1.00 76.59  ? 683  ASN B HB2  1 
ATOM   7750  H  HB3  . ASN B 1 122 ? -67.017  -13.836 -18.655 1.00 76.59  ? 683  ASN B HB3  1 
ATOM   7751  H  HD21 . ASN B 1 122 ? -65.949  -12.080 -16.151 1.00 97.16  ? 683  ASN B HD21 1 
ATOM   7752  H  HD22 . ASN B 1 122 ? -64.811  -12.918 -15.678 1.00 97.16  ? 683  ASN B HD22 1 
ATOM   7753  N  N    . ILE B 1 123 ? -66.663  -11.490 -21.793 1.00 59.39  ? 684  ILE B N    1 
ATOM   7754  C  CA   . ILE B 1 123 ? -67.446  -11.403 -23.020 1.00 48.53  ? 684  ILE B CA   1 
ATOM   7755  C  C    . ILE B 1 123 ? -66.631  -12.040 -24.138 1.00 58.78  ? 684  ILE B C    1 
ATOM   7756  O  O    . ILE B 1 123 ? -65.405  -11.884 -24.191 1.00 55.51  ? 684  ILE B O    1 
ATOM   7757  C  CB   . ILE B 1 123 ? -67.809  -9.942  -23.361 1.00 50.10  ? 684  ILE B CB   1 
ATOM   7758  C  CG1  . ILE B 1 123 ? -68.600  -9.310  -22.210 1.00 55.59  ? 684  ILE B CG1  1 
ATOM   7759  C  CG2  . ILE B 1 123 ? -68.609  -9.880  -24.661 1.00 50.25  ? 684  ILE B CG2  1 
ATOM   7760  C  CD1  . ILE B 1 123 ? -68.884  -7.833  -22.390 1.00 76.21  ? 684  ILE B CD1  1 
ATOM   7761  H  H    . ILE B 1 123 ? -65.968  -10.982 -21.801 1.00 71.27  ? 684  ILE B H    1 
ATOM   7762  H  HA   . ILE B 1 123 ? -68.268  -11.907 -22.914 1.00 58.24  ? 684  ILE B HA   1 
ATOM   7763  H  HB   . ILE B 1 123 ? -66.987  -9.441  -23.482 1.00 60.12  ? 684  ILE B HB   1 
ATOM   7764  H  HG12 . ILE B 1 123 ? -69.451  -9.767  -22.129 1.00 66.71  ? 684  ILE B HG12 1 
ATOM   7765  H  HG13 . ILE B 1 123 ? -68.093  -9.415  -21.389 1.00 66.71  ? 684  ILE B HG13 1 
ATOM   7766  H  HG21 . ILE B 1 123 ? -68.825  -8.955  -24.854 1.00 60.30  ? 684  ILE B HG21 1 
ATOM   7767  H  HG22 . ILE B 1 123 ? -68.074  -10.253 -25.379 1.00 60.30  ? 684  ILE B HG22 1 
ATOM   7768  H  HG23 . ILE B 1 123 ? -69.424  -10.395 -24.554 1.00 60.30  ? 684  ILE B HG23 1 
ATOM   7769  H  HD11 . ILE B 1 123 ? -69.385  -7.513  -21.623 1.00 91.45  ? 684  ILE B HD11 1 
ATOM   7770  H  HD12 . ILE B 1 123 ? -68.042  -7.356  -22.459 1.00 91.45  ? 684  ILE B HD12 1 
ATOM   7771  H  HD13 . ILE B 1 123 ? -69.403  -7.708  -23.200 1.00 91.45  ? 684  ILE B HD13 1 
ATOM   7772  N  N    . VAL B 1 124 ? -67.310  -12.774 -25.017 1.00 59.37  ? 685  VAL B N    1 
ATOM   7773  C  CA   . VAL B 1 124 ? -66.687  -13.395 -26.179 1.00 44.79  ? 685  VAL B CA   1 
ATOM   7774  C  C    . VAL B 1 124 ? -67.389  -12.878 -27.425 1.00 63.41  ? 685  VAL B C    1 
ATOM   7775  O  O    . VAL B 1 124 ? -68.622  -12.806 -27.472 1.00 65.93  ? 685  VAL B O    1 
ATOM   7776  C  CB   . VAL B 1 124 ? -66.750  -14.937 -26.111 1.00 72.98  ? 685  VAL B CB   1 
ATOM   7777  C  CG1  . VAL B 1 124 ? -65.912  -15.554 -27.224 1.00 57.38  ? 685  VAL B CG1  1 
ATOM   7778  C  CG2  . VAL B 1 124 ? -66.268  -15.433 -24.754 1.00 60.98  ? 685  VAL B CG2  1 
ATOM   7779  H  H    . VAL B 1 124 ? -68.154  -12.928 -24.959 1.00 71.25  ? 685  VAL B H    1 
ATOM   7780  H  HA   . VAL B 1 124 ? -65.754  -13.131 -26.223 1.00 53.75  ? 685  VAL B HA   1 
ATOM   7781  H  HB   . VAL B 1 124 ? -67.669  -15.224 -26.230 1.00 87.58  ? 685  VAL B HB   1 
ATOM   7782  H  HG11 . VAL B 1 124 ? -65.967  -16.520 -27.161 1.00 68.85  ? 685  VAL B HG11 1 
ATOM   7783  H  HG12 . VAL B 1 124 ? -66.258  -15.257 -28.080 1.00 68.85  ? 685  VAL B HG12 1 
ATOM   7784  H  HG13 . VAL B 1 124 ? -64.991  -15.267 -27.121 1.00 68.85  ? 685  VAL B HG13 1 
ATOM   7785  H  HG21 . VAL B 1 124 ? -66.317  -16.401 -24.737 1.00 73.18  ? 685  VAL B HG21 1 
ATOM   7786  H  HG22 . VAL B 1 124 ? -65.351  -15.145 -24.621 1.00 73.18  ? 685  VAL B HG22 1 
ATOM   7787  H  HG23 . VAL B 1 124 ? -66.836  -15.060 -24.062 1.00 73.18  ? 685  VAL B HG23 1 
ATOM   7788  N  N    . HIS B 1 125 ? -66.596  -12.511 -28.433 1.00 55.88  ? 686  HIS B N    1 
ATOM   7789  C  CA   . HIS B 1 125 ? -67.153  -11.904 -29.637 1.00 51.56  ? 686  HIS B CA   1 
ATOM   7790  C  C    . HIS B 1 125 ? -67.930  -12.929 -30.457 1.00 57.65  ? 686  HIS B C    1 
ATOM   7791  O  O    . HIS B 1 125 ? -69.081  -12.687 -30.842 1.00 48.94  ? 686  HIS B O    1 
ATOM   7792  C  CB   . HIS B 1 125 ? -66.025  -11.279 -30.465 1.00 43.71  ? 686  HIS B CB   1 
ATOM   7793  C  CG   . HIS B 1 125 ? -66.450  -10.091 -31.269 1.00 40.45  ? 686  HIS B CG   1 
ATOM   7794  N  ND1  . HIS B 1 125 ? -67.449  -10.149 -32.216 1.00 55.17  ? 686  HIS B ND1  1 
ATOM   7795  C  CD2  . HIS B 1 125 ? -66.014  -8.810  -31.260 1.00 59.79  ? 686  HIS B CD2  1 
ATOM   7796  C  CE1  . HIS B 1 125 ? -67.615  -8.952  -32.752 1.00 66.31  ? 686  HIS B CE1  1 
ATOM   7797  N  NE2  . HIS B 1 125 ? -66.752  -8.123  -32.194 1.00 79.24  ? 686  HIS B NE2  1 
ATOM   7798  H  H    . HIS B 1 125 ? -65.741  -12.602 -28.442 1.00 67.06  ? 686  HIS B H    1 
ATOM   7799  H  HA   . HIS B 1 125 ? -67.766  -11.197 -29.382 1.00 61.87  ? 686  HIS B HA   1 
ATOM   7800  H  HB2  . HIS B 1 125 ? -65.319  -10.993 -29.864 1.00 52.45  ? 686  HIS B HB2  1 
ATOM   7801  H  HB3  . HIS B 1 125 ? -65.683  -11.946 -31.080 1.00 52.45  ? 686  HIS B HB3  1 
ATOM   7802  H  HD1  . HIS B 1 125 ? -67.901  -10.852 -32.420 1.00 66.21  ? 686  HIS B HD1  1 
ATOM   7803  H  HD2  . HIS B 1 125 ? -65.341  -8.459  -30.723 1.00 71.75  ? 686  HIS B HD2  1 
ATOM   7804  H  HE1  . HIS B 1 125 ? -68.226  -8.734  -33.418 1.00 79.58  ? 686  HIS B HE1  1 
ATOM   7805  H  HE2  . HIS B 1 125 ? -66.667  -7.289  -32.382 1.00 95.09  ? 686  HIS B HE2  1 
ATOM   7806  N  N    . ARG B 1 126 ? -67.299  -14.074 -30.737 1.00 53.44  ? 687  ARG B N    1 
ATOM   7807  C  CA   . ARG B 1 126 ? -67.841  -15.223 -31.466 1.00 59.63  ? 687  ARG B CA   1 
ATOM   7808  C  C    . ARG B 1 126 ? -67.908  -15.004 -32.970 1.00 48.56  ? 687  ARG B C    1 
ATOM   7809  O  O    . ARG B 1 126 ? -67.987  -15.970 -33.735 1.00 57.93  ? 687  ARG B O    1 
ATOM   7810  C  CB   . ARG B 1 126 ? -69.254  -15.582 -30.995 1.00 65.45  ? 687  ARG B CB   1 
ATOM   7811  C  CG   . ARG B 1 126 ? -69.385  -15.937 -29.545 1.00 79.59  ? 687  ARG B CG   1 
ATOM   7812  C  CD   . ARG B 1 126 ? -70.848  -16.255 -29.224 1.00 76.91  ? 687  ARG B CD   1 
ATOM   7813  N  NE   . ARG B 1 126 ? -71.188  -15.906 -27.851 1.00 73.85  ? 687  ARG B NE   1 
ATOM   7814  C  CZ   . ARG B 1 126 ? -71.255  -14.655 -27.405 1.00 77.09  ? 687  ARG B CZ   1 
ATOM   7815  N  NH1  . ARG B 1 126 ? -70.999  -13.643 -28.223 1.00 72.62  ? 687  ARG B NH1  1 
ATOM   7816  N  NH2  . ARG B 1 126 ? -71.569  -14.413 -26.141 1.00 80.64  ? 687  ARG B NH2  1 
ATOM   7817  H  H    . ARG B 1 126 ? -66.487  -14.214 -30.491 1.00 64.13  ? 687  ARG B H    1 
ATOM   7818  H  HA   . ARG B 1 126 ? -67.271  -15.990 -31.304 1.00 71.56  ? 687  ARG B HA   1 
ATOM   7819  H  HB2  . ARG B 1 126 ? -69.835  -14.823 -31.161 1.00 78.54  ? 687  ARG B HB2  1 
ATOM   7820  H  HB3  . ARG B 1 126 ? -69.564  -16.344 -31.509 1.00 78.54  ? 687  ARG B HB3  1 
ATOM   7821  H  HG2  . ARG B 1 126 ? -68.848  -16.721 -29.351 1.00 95.51  ? 687  ARG B HG2  1 
ATOM   7822  H  HG3  . ARG B 1 126 ? -69.104  -15.186 -28.998 1.00 95.51  ? 687  ARG B HG3  1 
ATOM   7823  H  HD2  . ARG B 1 126 ? -71.423  -15.747 -29.817 1.00 92.29  ? 687  ARG B HD2  1 
ATOM   7824  H  HD3  . ARG B 1 126 ? -71.001  -17.205 -29.342 1.00 92.29  ? 687  ARG B HD3  1 
ATOM   7825  H  HE   . ARG B 1 126 ? -71.469  -16.533 -27.334 1.00 88.61  ? 687  ARG B HE   1 
ATOM   7826  H  HH11 . ARG B 1 126 ? -70.793  -13.795 -29.044 1.00 87.14  ? 687  ARG B HH11 1 
ATOM   7827  H  HH12 . ARG B 1 126 ? -71.041  -12.834 -27.933 1.00 87.14  ? 687  ARG B HH12 1 
ATOM   7828  H  HH21 . ARG B 1 126 ? -71.735  -15.066 -25.607 1.00 96.76  ? 687  ARG B HH21 1 
ATOM   7829  H  HH22 . ARG B 1 126 ? -71.610  -13.602 -25.856 1.00 96.76  ? 687  ARG B HH22 1 
ATOM   7830  N  N    . ASP B 1 127 ? -67.865  -13.752 -33.408 1.00 50.88  ? 688  ASP B N    1 
ATOM   7831  C  CA   . ASP B 1 127 ? -67.673  -13.428 -34.813 1.00 59.77  ? 688  ASP B CA   1 
ATOM   7832  C  C    . ASP B 1 127 ? -66.716  -12.253 -34.854 1.00 55.92  ? 688  ASP B C    1 
ATOM   7833  O  O    . ASP B 1 127 ? -67.065  -11.164 -34.397 1.00 71.36  ? 688  ASP B O    1 
ATOM   7834  C  CB   . ASP B 1 127 ? -69.013  -13.094 -35.484 1.00 43.44  ? 688  ASP B CB   1 
ATOM   7835  C  CG   . ASP B 1 127 ? -68.899  -12.913 -36.981 1.00 71.24  ? 688  ASP B CG   1 
ATOM   7836  O  OD1  . ASP B 1 127 ? -67.948  -13.455 -37.585 1.00 85.71  ? 688  ASP B OD1  1 
ATOM   7837  O  OD2  . ASP B 1 127 ? -69.778  -12.235 -37.556 1.00 61.14  ? 688  ASP B OD2  1 
ATOM   7838  H  H    . ASP B 1 127 ? -67.947  -13.062 -32.902 1.00 61.06  ? 688  ASP B H    1 
ATOM   7839  H  HA   . ASP B 1 127 ? -67.268  -14.180 -35.274 1.00 71.72  ? 688  ASP B HA   1 
ATOM   7840  H  HB2  . ASP B 1 127 ? -69.638  -13.817 -35.317 1.00 52.13  ? 688  ASP B HB2  1 
ATOM   7841  H  HB3  . ASP B 1 127 ? -69.356  -12.267 -35.108 1.00 52.13  ? 688  ASP B HB3  1 
ATOM   7842  N  N    . LEU B 1 128 ? -65.535  -12.454 -35.421 1.00 59.22  ? 689  LEU B N    1 
ATOM   7843  C  CA   . LEU B 1 128 ? -64.531  -11.402 -35.482 1.00 55.97  ? 689  LEU B CA   1 
ATOM   7844  C  C    . LEU B 1 128 ? -63.916  -11.449 -36.866 1.00 49.20  ? 689  LEU B C    1 
ATOM   7845  O  O    . LEU B 1 128 ? -63.433  -12.501 -37.293 1.00 46.17  ? 689  LEU B O    1 
ATOM   7846  C  CB   . LEU B 1 128 ? -63.471  -11.579 -34.392 1.00 53.11  ? 689  LEU B CB   1 
ATOM   7847  C  CG   . LEU B 1 128 ? -62.459  -10.438 -34.243 1.00 49.50  ? 689  LEU B CG   1 
ATOM   7848  C  CD1  . LEU B 1 128 ? -63.121  -9.169  -33.724 1.00 53.38  ? 689  LEU B CD1  1 
ATOM   7849  C  CD2  . LEU B 1 128 ? -61.318  -10.850 -33.335 1.00 39.95  ? 689  LEU B CD2  1 
ATOM   7850  H  H    . LEU B 1 128 ? -65.288  -13.196 -35.780 1.00 71.06  ? 689  LEU B H    1 
ATOM   7851  H  HA   . LEU B 1 128 ? -64.957  -10.539 -35.362 1.00 67.16  ? 689  LEU B HA   1 
ATOM   7852  H  HB2  . LEU B 1 128 ? -63.923  -11.676 -33.540 1.00 63.73  ? 689  LEU B HB2  1 
ATOM   7853  H  HB3  . LEU B 1 128 ? -62.969  -12.387 -34.584 1.00 63.73  ? 689  LEU B HB3  1 
ATOM   7854  H  HG   . LEU B 1 128 ? -62.085  -10.240 -35.116 1.00 59.39  ? 689  LEU B HG   1 
ATOM   7855  H  HD11 . LEU B 1 128 ? -62.450  -8.473  -33.644 1.00 64.06  ? 689  LEU B HD11 1 
ATOM   7856  H  HD12 . LEU B 1 128 ? -63.810  -8.894  -34.350 1.00 64.06  ? 689  LEU B HD12 1 
ATOM   7857  H  HD13 . LEU B 1 128 ? -63.515  -9.350  -32.857 1.00 64.06  ? 689  LEU B HD13 1 
ATOM   7858  H  HD21 . LEU B 1 128 ? -60.694  -10.111 -33.259 1.00 47.94  ? 689  LEU B HD21 1 
ATOM   7859  H  HD22 . LEU B 1 128 ? -61.675  -11.074 -32.462 1.00 47.94  ? 689  LEU B HD22 1 
ATOM   7860  H  HD23 . LEU B 1 128 ? -60.872  -11.622 -33.719 1.00 47.94  ? 689  LEU B HD23 1 
ATOM   7861  N  N    . LYS B 1 129 ? -63.962  -10.326 -37.568 1.00 49.11  ? 690  LYS B N    1 
ATOM   7862  C  CA   . LYS B 1 129 ? -63.474  -10.281 -38.937 1.00 62.22  ? 690  LYS B CA   1 
ATOM   7863  C  C    . LYS B 1 129 ? -63.199  -8.835  -39.329 1.00 49.38  ? 690  LYS B C    1 
ATOM   7864  O  O    . LYS B 1 129 ? -63.481  -7.920  -38.546 1.00 52.09  ? 690  LYS B O    1 
ATOM   7865  C  CB   . LYS B 1 129 ? -64.500  -10.932 -39.869 1.00 58.64  ? 690  LYS B CB   1 
ATOM   7866  C  CG   . LYS B 1 129 ? -65.927  -10.443 -39.668 1.00 57.67  ? 690  LYS B CG   1 
ATOM   7867  C  CD   . LYS B 1 129 ? -66.937  -11.428 -40.244 1.00 65.91  ? 690  LYS B CD   1 
ATOM   7868  C  CE   . LYS B 1 129 ? -68.371  -10.934 -40.066 1.00 73.52  ? 690  LYS B CE   1 
ATOM   7869  N  NZ   . LYS B 1 129 ? -69.382  -11.995 -40.358 1.00 80.85  ? 690  LYS B NZ   1 
ATOM   7870  H  H    . LYS B 1 129 ? -64.269  -9.578  -37.276 1.00 58.93  ? 690  LYS B H    1 
ATOM   7871  H  HA   . LYS B 1 129 ? -62.644  -10.779 -39.000 1.00 74.66  ? 690  LYS B HA   1 
ATOM   7872  H  HB2  . LYS B 1 129 ? -64.250  -10.742 -40.787 1.00 70.37  ? 690  LYS B HB2  1 
ATOM   7873  H  HB3  . LYS B 1 129 ? -64.493  -11.890 -39.720 1.00 70.37  ? 690  LYS B HB3  1 
ATOM   7874  H  HG2  . LYS B 1 129 ? -66.103  -10.348 -38.719 1.00 69.20  ? 690  LYS B HG2  1 
ATOM   7875  H  HG3  . LYS B 1 129 ? -66.041  -9.592  -40.119 1.00 69.20  ? 690  LYS B HG3  1 
ATOM   7876  H  HD2  . LYS B 1 129 ? -66.770  -11.539 -41.193 1.00 79.09  ? 690  LYS B HD2  1 
ATOM   7877  H  HD3  . LYS B 1 129 ? -66.850  -12.279 -39.787 1.00 79.09  ? 690  LYS B HD3  1 
ATOM   7878  H  HE2  . LYS B 1 129 ? -68.495  -10.645 -39.149 1.00 88.22  ? 690  LYS B HE2  1 
ATOM   7879  H  HE3  . LYS B 1 129 ? -68.529  -10.194 -40.673 1.00 88.22  ? 690  LYS B HE3  1 
ATOM   7880  H  HZ1  . LYS B 1 129 ? -70.203  -11.672 -40.244 1.00 97.03  ? 690  LYS B HZ1  1 
ATOM   7881  H  HZ2  . LYS B 1 129 ? -69.295  -12.275 -41.198 1.00 97.03  ? 690  LYS B HZ2  1 
ATOM   7882  H  HZ3  . LYS B 1 129 ? -69.264  -12.686 -39.810 1.00 97.03  ? 690  LYS B HZ3  1 
ATOM   7883  N  N    . PRO B 1 130 ? -62.662  -8.583  -40.525 1.00 52.65  ? 691  PRO B N    1 
ATOM   7884  C  CA   . PRO B 1 130 ? -62.389  -7.192  -40.919 1.00 50.91  ? 691  PRO B CA   1 
ATOM   7885  C  C    . PRO B 1 130 ? -63.637  -6.342  -41.057 1.00 58.47  ? 691  PRO B C    1 
ATOM   7886  O  O    . PRO B 1 130 ? -63.546  -5.117  -40.925 1.00 53.35  ? 691  PRO B O    1 
ATOM   7887  C  CB   . PRO B 1 130 ? -61.658  -7.344  -42.258 1.00 45.74  ? 691  PRO B CB   1 
ATOM   7888  C  CG   . PRO B 1 130 ? -61.031  -8.702  -42.185 1.00 52.67  ? 691  PRO B CG   1 
ATOM   7889  C  CD   . PRO B 1 130 ? -62.014  -9.546  -41.433 1.00 54.16  ? 691  PRO B CD   1 
ATOM   7890  H  HA   . PRO B 1 130 ? -61.792  -6.775  -40.277 1.00 61.09  ? 691  PRO B HA   1 
ATOM   7891  H  HB2  . PRO B 1 130 ? -62.295  -7.297  -42.988 1.00 54.89  ? 691  PRO B HB2  1 
ATOM   7892  H  HB3  . PRO B 1 130 ? -60.981  -6.655  -42.344 1.00 54.89  ? 691  PRO B HB3  1 
ATOM   7893  H  HG2  . PRO B 1 130 ? -60.895  -9.049  -43.080 1.00 63.20  ? 691  PRO B HG2  1 
ATOM   7894  H  HG3  . PRO B 1 130 ? -60.189  -8.648  -41.706 1.00 63.20  ? 691  PRO B HG3  1 
ATOM   7895  H  HD2  . PRO B 1 130 ? -62.665  -9.929  -42.041 1.00 65.00  ? 691  PRO B HD2  1 
ATOM   7896  H  HD3  . PRO B 1 130 ? -61.553  -10.232 -40.926 1.00 65.00  ? 691  PRO B HD3  1 
ATOM   7897  N  N    . HIS B 1 131 ? -64.800  -6.945  -41.309 1.00 52.08  ? 692  HIS B N    1 
ATOM   7898  C  CA   . HIS B 1 131 ? -66.028  -6.165  -41.391 1.00 56.95  ? 692  HIS B CA   1 
ATOM   7899  C  C    . HIS B 1 131 ? -66.456  -5.659  -40.020 1.00 56.78  ? 692  HIS B C    1 
ATOM   7900  O  O    . HIS B 1 131 ? -67.012  -4.562  -39.913 1.00 65.61  ? 692  HIS B O    1 
ATOM   7901  C  CB   . HIS B 1 131 ? -67.144  -7.002  -42.015 1.00 64.73  ? 692  HIS B CB   1 
ATOM   7902  C  CG   . HIS B 1 131 ? -66.745  -7.692  -43.282 1.00 81.61  ? 692  HIS B CG   1 
ATOM   7903  N  ND1  . HIS B 1 131 ? -65.923  -8.799  -43.301 1.00 80.51  ? 692  HIS B ND1  1 
ATOM   7904  C  CD2  . HIS B 1 131 ? -67.057  -7.434  -44.574 1.00 82.85  ? 692  HIS B CD2  1 
ATOM   7905  C  CE1  . HIS B 1 131 ? -65.745  -9.192  -44.550 1.00 74.33  ? 692  HIS B CE1  1 
ATOM   7906  N  NE2  . HIS B 1 131 ? -66.423  -8.381  -45.342 1.00 83.79  ? 692  HIS B NE2  1 
ATOM   7907  H  H    . HIS B 1 131 ? -64.901  -7.790  -41.434 1.00 62.49  ? 692  HIS B H    1 
ATOM   7908  H  HA   . HIS B 1 131 ? -65.876  -5.395  -41.960 1.00 68.34  ? 692  HIS B HA   1 
ATOM   7909  H  HB2  . HIS B 1 131 ? -67.417  -7.682  -41.380 1.00 77.67  ? 692  HIS B HB2  1 
ATOM   7910  H  HB3  . HIS B 1 131 ? -67.894  -6.421  -42.217 1.00 77.67  ? 692  HIS B HB3  1 
ATOM   7911  H  HD1  . HIS B 1 131 ? -65.579  -9.174  -42.608 1.00 96.61  ? 692  HIS B HD1  1 
ATOM   7912  H  HD2  . HIS B 1 131 ? -67.600  -6.745  -44.884 1.00 99.42  ? 692  HIS B HD2  1 
ATOM   7913  H  HE1  . HIS B 1 131 ? -65.230  -9.917  -44.824 1.00 89.20  ? 692  HIS B HE1  1 
ATOM   7914  H  HE2  . HIS B 1 131 ? -66.461  -8.437  -46.200 1.00 100.55 ? 692  HIS B HE2  1 
ATOM   7915  N  N    . ASN B 1 132 ? -66.207  -6.441  -38.968 1.00 56.21  ? 693  ASN B N    1 
ATOM   7916  C  CA   . ASN B 1 132 ? -66.607  -6.072  -37.615 1.00 63.54  ? 693  ASN B CA   1 
ATOM   7917  C  C    . ASN B 1 132 ? -65.612  -5.154  -36.913 1.00 48.67  ? 693  ASN B C    1 
ATOM   7918  O  O    . ASN B 1 132 ? -65.952  -4.589  -35.867 1.00 48.92  ? 693  ASN B O    1 
ATOM   7919  C  CB   . ASN B 1 132 ? -66.802  -7.333  -36.773 1.00 48.90  ? 693  ASN B CB   1 
ATOM   7920  C  CG   . ASN B 1 132 ? -68.077  -8.069  -37.110 1.00 67.57  ? 693  ASN B CG   1 
ATOM   7921  O  OD1  . ASN B 1 132 ? -68.961  -7.533  -37.782 1.00 89.00  ? 693  ASN B OD1  1 
ATOM   7922  N  ND2  . ASN B 1 132 ? -68.189  -9.300  -36.632 1.00 72.59  ? 693  ASN B ND2  1 
ATOM   7923  H  H    . ASN B 1 132 ? -65.802  -7.199  -39.015 1.00 67.45  ? 693  ASN B H    1 
ATOM   7924  H  HA   . ASN B 1 132 ? -67.458  -5.609  -37.658 1.00 76.25  ? 693  ASN B HA   1 
ATOM   7925  H  HB2  . ASN B 1 132 ? -66.058  -7.936  -36.928 1.00 58.68  ? 693  ASN B HB2  1 
ATOM   7926  H  HB3  . ASN B 1 132 ? -66.838  -7.085  -35.836 1.00 58.68  ? 693  ASN B HB3  1 
ATOM   7927  H  HD21 . ASN B 1 132 ? -67.554  -9.637  -36.160 1.00 87.11  ? 693  ASN B HD21 1 
ATOM   7928  H  HD22 . ASN B 1 132 ? -68.895  -9.762  -36.796 1.00 87.11  ? 693  ASN B HD22 1 
ATOM   7929  N  N    . ILE B 1 133 ? -64.399  -5.011  -37.437 1.00 38.70  ? 694  ILE B N    1 
ATOM   7930  C  CA   . ILE B 1 133 ? -63.398  -4.110  -36.871 1.00 52.88  ? 694  ILE B CA   1 
ATOM   7931  C  C    . ILE B 1 133 ? -63.494  -2.789  -37.629 1.00 47.51  ? 694  ILE B C    1 
ATOM   7932  O  O    . ILE B 1 133 ? -63.151  -2.717  -38.811 1.00 47.78  ? 694  ILE B O    1 
ATOM   7933  C  CB   . ILE B 1 133 ? -61.992  -4.714  -36.967 1.00 47.89  ? 694  ILE B CB   1 
ATOM   7934  C  CG1  . ILE B 1 133 ? -61.911  -5.978  -36.106 1.00 48.19  ? 694  ILE B CG1  1 
ATOM   7935  C  CG2  . ILE B 1 133 ? -60.939  -3.713  -36.517 1.00 44.33  ? 694  ILE B CG2  1 
ATOM   7936  C  CD1  . ILE B 1 133 ? -60.753  -6.876  -36.437 1.00 42.59  ? 694  ILE B CD1  1 
ATOM   7937  H  H    . ILE B 1 133 ? -64.127  -5.432  -38.136 1.00 46.44  ? 694  ILE B H    1 
ATOM   7938  H  HA   . ILE B 1 133 ? -63.601  -3.946  -35.937 1.00 63.45  ? 694  ILE B HA   1 
ATOM   7939  H  HB   . ILE B 1 133 ? -61.818  -4.955  -37.890 1.00 57.47  ? 694  ILE B HB   1 
ATOM   7940  H  HG12 . ILE B 1 133 ? -61.826  -5.716  -35.176 1.00 57.83  ? 694  ILE B HG12 1 
ATOM   7941  H  HG13 . ILE B 1 133 ? -62.726  -6.490  -36.229 1.00 57.83  ? 694  ILE B HG13 1 
ATOM   7942  H  HG21 . ILE B 1 133 ? -60.063  -4.123  -36.589 1.00 53.20  ? 694  ILE B HG21 1 
ATOM   7943  H  HG22 . ILE B 1 133 ? -60.986  -2.929  -37.087 1.00 53.20  ? 694  ILE B HG22 1 
ATOM   7944  H  HG23 . ILE B 1 133 ? -61.114  -3.464  -35.596 1.00 53.20  ? 694  ILE B HG23 1 
ATOM   7945  H  HD11 . ILE B 1 133 ? -60.775  -7.648  -35.850 1.00 51.10  ? 694  ILE B HD11 1 
ATOM   7946  H  HD12 . ILE B 1 133 ? -60.828  -7.160  -37.361 1.00 51.10  ? 694  ILE B HD12 1 
ATOM   7947  H  HD13 . ILE B 1 133 ? -59.927  -6.385  -36.307 1.00 51.10  ? 694  ILE B HD13 1 
ATOM   7948  N  N    . LEU B 1 134 ? -63.931  -1.736  -36.941 1.00 52.10  ? 695  LEU B N    1 
ATOM   7949  C  CA   . LEU B 1 134 ? -64.304  -0.480  -37.578 1.00 44.97  ? 695  LEU B CA   1 
ATOM   7950  C  C    . LEU B 1 134 ? -63.233  0.582   -37.364 1.00 47.89  ? 695  LEU B C    1 
ATOM   7951  O  O    . LEU B 1 134 ? -62.554  0.608   -36.332 1.00 41.96  ? 695  LEU B O    1 
ATOM   7952  C  CB   . LEU B 1 134 ? -65.644  0.029   -37.039 1.00 49.70  ? 695  LEU B CB   1 
ATOM   7953  C  CG   . LEU B 1 134 ? -66.809  -0.962  -37.083 1.00 47.78  ? 695  LEU B CG   1 
ATOM   7954  C  CD1  . LEU B 1 134 ? -68.103  -0.248  -36.744 1.00 54.26  ? 695  LEU B CD1  1 
ATOM   7955  C  CD2  . LEU B 1 134 ? -66.917  -1.640  -38.435 1.00 50.62  ? 695  LEU B CD2  1 
ATOM   7956  H  H    . LEU B 1 134 ? -64.020  -1.726  -36.086 1.00 62.53  ? 695  LEU B H    1 
ATOM   7957  H  HA   . LEU B 1 134 ? -64.399  -0.625  -38.532 1.00 53.96  ? 695  LEU B HA   1 
ATOM   7958  H  HB2  . LEU B 1 134 ? -65.521  0.288   -36.112 1.00 59.64  ? 695  LEU B HB2  1 
ATOM   7959  H  HB3  . LEU B 1 134 ? -65.906  0.806   -37.558 1.00 59.64  ? 695  LEU B HB3  1 
ATOM   7960  H  HG   . LEU B 1 134 ? -66.663  -1.649  -36.415 1.00 57.33  ? 695  LEU B HG   1 
ATOM   7961  H  HD11 . LEU B 1 134 ? -68.833  -0.886  -36.776 1.00 65.12  ? 695  LEU B HD11 1 
ATOM   7962  H  HD12 . LEU B 1 134 ? -68.031  0.129   -35.853 1.00 65.12  ? 695  LEU B HD12 1 
ATOM   7963  H  HD13 . LEU B 1 134 ? -68.253  0.459   -37.391 1.00 65.12  ? 695  LEU B HD13 1 
ATOM   7964  H  HD21 . LEU B 1 134 ? -67.665  -2.257  -38.419 1.00 60.74  ? 695  LEU B HD21 1 
ATOM   7965  H  HD22 . LEU B 1 134 ? -67.059  -0.965  -39.116 1.00 60.74  ? 695  LEU B HD22 1 
ATOM   7966  H  HD23 . LEU B 1 134 ? -66.094  -2.122  -38.612 1.00 60.74  ? 695  LEU B HD23 1 
ATOM   7967  N  N    . ILE B 1 135 ? -63.083  1.443   -38.370 1.00 55.81  ? 696  ILE B N    1 
ATOM   7968  C  CA   . ILE B 1 135 ? -62.182  2.591   -38.309 1.00 53.97  ? 696  ILE B CA   1 
ATOM   7969  C  C    . ILE B 1 135 ? -62.982  3.798   -37.833 1.00 38.94  ? 696  ILE B C    1 
ATOM   7970  O  O    . ILE B 1 135 ? -63.988  4.168   -38.447 1.00 45.56  ? 696  ILE B O    1 
ATOM   7971  C  CB   . ILE B 1 135 ? -61.539  2.864   -39.677 1.00 54.52  ? 696  ILE B CB   1 
ATOM   7972  C  CG1  . ILE B 1 135 ? -60.742  1.643   -40.151 1.00 44.15  ? 696  ILE B CG1  1 
ATOM   7973  C  CG2  . ILE B 1 135 ? -60.646  4.105   -39.616 1.00 57.04  ? 696  ILE B CG2  1 
ATOM   7974  C  CD1  . ILE B 1 135 ? -59.554  1.279   -39.272 1.00 50.41  ? 696  ILE B CD1  1 
ATOM   7975  H  H    . ILE B 1 135 ? -63.504  1.381   -39.117 1.00 66.97  ? 696  ILE B H    1 
ATOM   7976  H  HA   . ILE B 1 135 ? -61.477  2.416   -37.666 1.00 64.77  ? 696  ILE B HA   1 
ATOM   7977  H  HB   . ILE B 1 135 ? -62.247  3.032   -40.318 1.00 65.42  ? 696  ILE B HB   1 
ATOM   7978  H  HG12 . ILE B 1 135 ? -61.336  0.876   -40.175 1.00 52.98  ? 696  ILE B HG12 1 
ATOM   7979  H  HG13 . ILE B 1 135 ? -60.404  1.821   -41.043 1.00 52.98  ? 696  ILE B HG13 1 
ATOM   7980  H  HG21 . ILE B 1 135 ? -60.253  4.254   -40.490 1.00 68.45  ? 696  ILE B HG21 1 
ATOM   7981  H  HG22 . ILE B 1 135 ? -61.186  4.870   -39.360 1.00 68.45  ? 696  ILE B HG22 1 
ATOM   7982  H  HG23 . ILE B 1 135 ? -59.947  3.959   -38.959 1.00 68.45  ? 696  ILE B HG23 1 
ATOM   7983  H  HD11 . ILE B 1 135 ? -59.112  0.501   -39.645 1.00 60.49  ? 696  ILE B HD11 1 
ATOM   7984  H  HD12 . ILE B 1 135 ? -58.939  2.029   -39.247 1.00 60.49  ? 696  ILE B HD12 1 
ATOM   7985  H  HD13 . ILE B 1 135 ? -59.872  1.082   -38.377 1.00 60.49  ? 696  ILE B HD13 1 
ATOM   7986  N  N    . SER B 1 136 ? -62.521  4.425   -36.755 1.00 42.15  ? 697  SER B N    1 
ATOM   7987  C  CA   . SER B 1 136 ? -63.291  5.473   -36.107 1.00 41.58  ? 697  SER B CA   1 
ATOM   7988  C  C    . SER B 1 136 ? -63.291  6.757   -36.931 1.00 59.52  ? 697  SER B C    1 
ATOM   7989  O  O    . SER B 1 136 ? -62.424  6.993   -37.779 1.00 50.43  ? 697  SER B O    1 
ATOM   7990  C  CB   . SER B 1 136 ? -62.727  5.771   -34.722 1.00 50.70  ? 697  SER B CB   1 
ATOM   7991  O  OG   . SER B 1 136 ? -61.533  6.523   -34.830 1.00 43.50  ? 697  SER B OG   1 
ATOM   7992  H  H    . SER B 1 136 ? -61.765  4.260   -36.381 1.00 50.58  ? 697  SER B H    1 
ATOM   7993  H  HA   . SER B 1 136 ? -64.210  5.178   -36.004 1.00 49.90  ? 697  SER B HA   1 
ATOM   7994  H  HB2  . SER B 1 136 ? -63.379  6.281   -34.217 1.00 60.84  ? 697  SER B HB2  1 
ATOM   7995  H  HB3  . SER B 1 136 ? -62.536  4.934   -34.271 1.00 60.84  ? 697  SER B HB3  1 
ATOM   7996  H  HG   . SER B 1 136 ? -61.225  6.685   -34.066 1.00 52.20  ? 697  SER B HG   1 
ATOM   7997  N  N    . MET B 1 137 ? -64.292  7.591   -36.667 1.00 66.32  ? 698  MET B N    1 
ATOM   7998  C  CA   . MET B 1 137 ? -64.301  8.942   -37.203 1.00 43.71  ? 698  MET B CA   1 
ATOM   7999  C  C    . MET B 1 137 ? -63.075  9.699   -36.692 1.00 49.50  ? 698  MET B C    1 
ATOM   8000  O  O    . MET B 1 137 ? -62.698  9.545   -35.523 1.00 66.38  ? 698  MET B O    1 
ATOM   8001  C  CB   . MET B 1 137 ? -65.573  9.674   -36.775 1.00 54.18  ? 698  MET B CB   1 
ATOM   8002  C  CG   . MET B 1 137 ? -66.319  10.370  -37.898 1.00 68.68  ? 698  MET B CG   1 
ATOM   8003  S  SD   . MET B 1 137 ? -67.313  9.230   -38.876 1.00 70.81  ? 698  MET B SD   1 
ATOM   8004  C  CE   . MET B 1 137 ? -68.332  10.373  -39.800 1.00 77.35  ? 698  MET B CE   1 
ATOM   8005  H  H    . MET B 1 137 ? -64.975  7.398   -36.181 1.00 79.59  ? 698  MET B H    1 
ATOM   8006  H  HA   . MET B 1 137 ? -64.278  8.906   -38.172 1.00 52.45  ? 698  MET B HA   1 
ATOM   8007  H  HB2  . MET B 1 137 ? -66.179  9.031   -36.375 1.00 65.02  ? 698  MET B HB2  1 
ATOM   8008  H  HB3  . MET B 1 137 ? -65.336  10.348  -36.119 1.00 65.02  ? 698  MET B HB3  1 
ATOM   8009  H  HG2  . MET B 1 137 ? -66.912  11.037  -37.519 1.00 82.42  ? 698  MET B HG2  1 
ATOM   8010  H  HG3  . MET B 1 137 ? -65.677  10.793  -38.490 1.00 82.42  ? 698  MET B HG3  1 
ATOM   8011  H  HE1  . MET B 1 137 ? -68.926  9.869   -40.379 1.00 92.82  ? 698  MET B HE1  1 
ATOM   8012  H  HE2  . MET B 1 137 ? -68.850  10.908  -39.179 1.00 92.82  ? 698  MET B HE2  1 
ATOM   8013  H  HE3  . MET B 1 137 ? -67.759  10.947  -40.333 1.00 92.82  ? 698  MET B HE3  1 
ATOM   8014  N  N    . PRO B 1 138 ? -62.424  10.511  -37.525 1.00 51.63  ? 699  PRO B N    1 
ATOM   8015  C  CA   . PRO B 1 138 ? -61.294  11.311  -37.031 1.00 60.23  ? 699  PRO B CA   1 
ATOM   8016  C  C    . PRO B 1 138 ? -61.727  12.240  -35.906 1.00 51.04  ? 699  PRO B C    1 
ATOM   8017  O  O    . PRO B 1 138 ? -62.725  12.953  -36.020 1.00 67.92  ? 699  PRO B O    1 
ATOM   8018  C  CB   . PRO B 1 138 ? -60.841  12.099  -38.266 1.00 54.82  ? 699  PRO B CB   1 
ATOM   8019  C  CG   . PRO B 1 138 ? -61.378  11.360  -39.430 1.00 70.18  ? 699  PRO B CG   1 
ATOM   8020  C  CD   . PRO B 1 138 ? -62.634  10.682  -38.971 1.00 56.36  ? 699  PRO B CD   1 
ATOM   8021  H  HA   . PRO B 1 138 ? -60.574  10.737  -36.725 1.00 72.27  ? 699  PRO B HA   1 
ATOM   8022  H  HB2  . PRO B 1 138 ? -61.207  12.996  -38.232 1.00 65.78  ? 699  PRO B HB2  1 
ATOM   8023  H  HB3  . PRO B 1 138 ? -59.871  12.126  -38.297 1.00 65.78  ? 699  PRO B HB3  1 
ATOM   8024  H  HG2  . PRO B 1 138 ? -61.573  11.985  -40.145 1.00 84.21  ? 699  PRO B HG2  1 
ATOM   8025  H  HG3  . PRO B 1 138 ? -60.727  10.703  -39.722 1.00 84.21  ? 699  PRO B HG3  1 
ATOM   8026  H  HD2  . PRO B 1 138 ? -63.404  11.249  -39.135 1.00 67.63  ? 699  PRO B HD2  1 
ATOM   8027  H  HD3  . PRO B 1 138 ? -62.730  9.819   -39.403 1.00 67.63  ? 699  PRO B HD3  1 
ATOM   8028  N  N    . ASN B 1 139 ? -60.965  12.232  -34.816 1.00 50.85  ? 700  ASN B N    1 
ATOM   8029  C  CA   . ASN B 1 139 ? -61.250  13.133  -33.712 1.00 57.38  ? 700  ASN B CA   1 
ATOM   8030  C  C    . ASN B 1 139 ? -60.849  14.555  -34.100 1.00 61.49  ? 700  ASN B C    1 
ATOM   8031  O  O    . ASN B 1 139 ? -60.347  14.809  -35.197 1.00 61.29  ? 700  ASN B O    1 
ATOM   8032  C  CB   . ASN B 1 139 ? -60.538  12.666  -32.443 1.00 65.99  ? 700  ASN B CB   1 
ATOM   8033  C  CG   . ASN B 1 139 ? -59.025  12.645  -32.583 1.00 63.00  ? 700  ASN B CG   1 
ATOM   8034  O  OD1  . ASN B 1 139 ? -58.436  13.448  -33.304 1.00 78.44  ? 700  ASN B OD1  1 
ATOM   8035  N  ND2  . ASN B 1 139 ? -58.387  11.719  -31.881 1.00 58.48  ? 700  ASN B ND2  1 
ATOM   8036  H  H    . ASN B 1 139 ? -60.285  11.720  -34.694 1.00 61.03  ? 700  ASN B H    1 
ATOM   8037  H  HA   . ASN B 1 139 ? -62.205  13.128  -33.539 1.00 68.86  ? 700  ASN B HA   1 
ATOM   8038  H  HB2  . ASN B 1 139 ? -60.763  13.269  -31.716 1.00 79.19  ? 700  ASN B HB2  1 
ATOM   8039  H  HB3  . ASN B 1 139 ? -60.832  11.767  -32.230 1.00 79.19  ? 700  ASN B HB3  1 
ATOM   8040  H  HD21 . ASN B 1 139 ? -58.831  11.175  -31.384 1.00 70.18  ? 700  ASN B HD21 1 
ATOM   8041  H  HD22 . ASN B 1 139 ? -57.530  11.661  -31.923 1.00 70.18  ? 700  ASN B HD22 1 
ATOM   8042  N  N    . ALA B 1 140 ? -61.060  15.496  -33.178 1.00 74.76  ? 701  ALA B N    1 
ATOM   8043  C  CA   . ALA B 1 140 ? -60.774  16.898  -33.463 1.00 73.85  ? 701  ALA B CA   1 
ATOM   8044  C  C    . ALA B 1 140 ? -59.333  17.117  -33.904 1.00 66.19  ? 701  ALA B C    1 
ATOM   8045  O  O    . ALA B 1 140 ? -59.054  18.098  -34.603 1.00 65.71  ? 701  ALA B O    1 
ATOM   8046  C  CB   . ALA B 1 140 ? -61.076  17.757  -32.233 1.00 62.30  ? 701  ALA B CB   1 
ATOM   8047  H  H    . ALA B 1 140 ? -61.366  15.348  -32.388 1.00 89.71  ? 701  ALA B H    1 
ATOM   8048  H  HA   . ALA B 1 140 ? -61.352  17.195  -34.182 1.00 88.62  ? 701  ALA B HA   1 
ATOM   8049  H  HB1  . ALA B 1 140 ? -60.880  18.684  -32.440 1.00 74.76  ? 701  ALA B HB1  1 
ATOM   8050  H  HB2  . ALA B 1 140 ? -62.014  17.660  -32.003 1.00 74.76  ? 701  ALA B HB2  1 
ATOM   8051  H  HB3  . ALA B 1 140 ? -60.522  17.458  -31.495 1.00 74.76  ? 701  ALA B HB3  1 
ATOM   8052  N  N    . HIS B 1 141 ? -58.420  16.227  -33.524 1.00 64.67  ? 702  HIS B N    1 
ATOM   8053  C  CA   . HIS B 1 141 ? -57.018  16.328  -33.907 1.00 61.65  ? 702  HIS B CA   1 
ATOM   8054  C  C    . HIS B 1 141 ? -56.687  15.537  -35.166 1.00 57.84  ? 702  HIS B C    1 
ATOM   8055  O  O    . HIS B 1 141 ? -55.516  15.482  -35.554 1.00 73.43  ? 702  HIS B O    1 
ATOM   8056  C  CB   . HIS B 1 141 ? -56.127  15.856  -32.757 1.00 68.23  ? 702  HIS B CB   1 
ATOM   8057  C  CG   . HIS B 1 141 ? -56.201  16.729  -31.544 1.00 79.57  ? 702  HIS B CG   1 
ATOM   8058  N  ND1  . HIS B 1 141 ? -57.066  16.481  -30.500 1.00 83.66  ? 702  HIS B ND1  1 
ATOM   8059  C  CD2  . HIS B 1 141 ? -55.524  17.854  -31.213 1.00 86.14  ? 702  HIS B CD2  1 
ATOM   8060  C  CE1  . HIS B 1 141 ? -56.914  17.412  -29.575 1.00 97.47  ? 702  HIS B CE1  1 
ATOM   8061  N  NE2  . HIS B 1 141 ? -55.985  18.258  -29.984 1.00 103.69 ? 702  HIS B NE2  1 
ATOM   8062  H  H    . HIS B 1 141 ? -58.593  15.542  -33.034 1.00 77.60  ? 702  HIS B H    1 
ATOM   8063  H  HA   . HIS B 1 141 ? -56.809  17.259  -34.080 1.00 73.98  ? 702  HIS B HA   1 
ATOM   8064  H  HB2  . HIS B 1 141 ? -56.400  14.962  -32.496 1.00 81.88  ? 702  HIS B HB2  1 
ATOM   8065  H  HB3  . HIS B 1 141 ? -55.206  15.845  -33.059 1.00 81.88  ? 702  HIS B HB3  1 
ATOM   8066  H  HD1  . HIS B 1 141 ? -57.616  15.821  -30.456 1.00 100.39 ? 702  HIS B HD1  1 
ATOM   8067  H  HD2  . HIS B 1 141 ? -54.868  18.273  -31.722 1.00 103.37 ? 702  HIS B HD2  1 
ATOM   8068  H  HE1  . HIS B 1 141 ? -57.383  17.464  -28.774 1.00 116.96 ? 702  HIS B HE1  1 
ATOM   8069  H  HE2  . HIS B 1 141 ? -55.713  18.949  -29.550 1.00 124.43 ? 702  HIS B HE2  1 
ATOM   8070  N  N    . GLY B 1 142 ? -57.678  14.918  -35.805 1.00 59.71  ? 703  GLY B N    1 
ATOM   8071  C  CA   . GLY B 1 142 ? -57.445  14.131  -36.995 1.00 64.64  ? 703  GLY B CA   1 
ATOM   8072  C  C    . GLY B 1 142 ? -56.941  12.725  -36.748 1.00 59.44  ? 703  GLY B C    1 
ATOM   8073  O  O    . GLY B 1 142 ? -56.659  12.011  -37.719 1.00 48.78  ? 703  GLY B O    1 
ATOM   8074  H  H    . GLY B 1 142 ? -58.502  14.944  -35.559 1.00 71.66  ? 703  GLY B H    1 
ATOM   8075  H  HA2  . GLY B 1 142 ? -58.273  14.066  -37.496 1.00 77.57  ? 703  GLY B HA2  1 
ATOM   8076  H  HA3  . GLY B 1 142 ? -56.794  14.587  -37.551 1.00 77.57  ? 703  GLY B HA3  1 
ATOM   8077  N  N    . LYS B 1 143 ? -56.818  12.305  -35.489 1.00 59.73  ? 704  LYS B N    1 
ATOM   8078  C  CA   . LYS B 1 143 ? -56.349  10.966  -35.163 1.00 48.86  ? 704  LYS B CA   1 
ATOM   8079  C  C    . LYS B 1 143 ? -57.470  9.949   -35.345 1.00 49.61  ? 704  LYS B C    1 
ATOM   8080  O  O    . LYS B 1 143 ? -58.649  10.241  -35.130 1.00 57.53  ? 704  LYS B O    1 
ATOM   8081  C  CB   . LYS B 1 143 ? -55.822  10.917  -33.727 1.00 46.64  ? 704  LYS B CB   1 
ATOM   8082  C  CG   . LYS B 1 143 ? -54.337  10.603  -33.621 1.00 46.81  ? 704  LYS B CG   1 
ATOM   8083  H  H    . LYS B 1 143 ? -57.004  12.785  -34.800 1.00 71.68  ? 704  LYS B H    1 
ATOM   8084  H  HA   . LYS B 1 143 ? -55.623  10.728  -35.760 1.00 58.64  ? 704  LYS B HA   1 
ATOM   8085  H  HB2  . LYS B 1 143 ? -55.972  11.780  -33.310 1.00 55.96  ? 704  LYS B HB2  1 
ATOM   8086  H  HB3  . LYS B 1 143 ? -56.305  10.231  -33.241 1.00 55.96  ? 704  LYS B HB3  1 
ATOM   8087  N  N    . ILE B 1 144 ? -57.083  8.741   -35.746 1.00 48.10  ? 705  ILE B N    1 
ATOM   8088  C  CA   . ILE B 1 144 ? -58.014  7.657   -36.028 1.00 42.93  ? 705  ILE B CA   1 
ATOM   8089  C  C    . ILE B 1 144 ? -57.547  6.403   -35.304 1.00 48.12  ? 705  ILE B C    1 
ATOM   8090  O  O    . ILE B 1 144 ? -56.348  6.189   -35.094 1.00 45.90  ? 705  ILE B O    1 
ATOM   8091  C  CB   . ILE B 1 144 ? -58.150  7.418   -37.554 1.00 45.01  ? 705  ILE B CB   1 
ATOM   8092  C  CG1  . ILE B 1 144 ? -59.263  8.324   -38.101 1.00 65.93  ? 705  ILE B CG1  1 
ATOM   8093  C  CG2  . ILE B 1 144 ? -58.408  5.944   -37.877 1.00 55.71  ? 705  ILE B CG2  1 
ATOM   8094  C  CD1  . ILE B 1 144 ? -59.777  7.956   -39.470 1.00 65.16  ? 705  ILE B CD1  1 
ATOM   8095  H  H    . ILE B 1 144 ? -56.260  8.521   -35.865 1.00 57.72  ? 705  ILE B H    1 
ATOM   8096  H  HA   . ILE B 1 144 ? -58.889  7.894   -35.683 1.00 51.51  ? 705  ILE B HA   1 
ATOM   8097  H  HB   . ILE B 1 144 ? -57.315  7.677   -37.976 1.00 54.01  ? 705  ILE B HB   1 
ATOM   8098  H  HG12 . ILE B 1 144 ? -60.014  8.291   -37.489 1.00 79.12  ? 705  ILE B HG12 1 
ATOM   8099  H  HG13 . ILE B 1 144 ? -58.924  9.231   -38.151 1.00 79.12  ? 705  ILE B HG13 1 
ATOM   8100  H  HG21 . ILE B 1 144 ? -58.486  5.841   -38.838 1.00 66.85  ? 705  ILE B HG21 1 
ATOM   8101  H  HG22 . ILE B 1 144 ? -57.666  5.414   -37.546 1.00 66.85  ? 705  ILE B HG22 1 
ATOM   8102  H  HG23 . ILE B 1 144 ? -59.232  5.667   -37.446 1.00 66.85  ? 705  ILE B HG23 1 
ATOM   8103  H  HD11 . ILE B 1 144 ? -60.472  8.582   -39.724 1.00 78.19  ? 705  ILE B HD11 1 
ATOM   8104  H  HD12 . ILE B 1 144 ? -59.044  7.998   -40.104 1.00 78.19  ? 705  ILE B HD12 1 
ATOM   8105  H  HD13 . ILE B 1 144 ? -60.137  7.056   -39.440 1.00 78.19  ? 705  ILE B HD13 1 
ATOM   8106  N  N    . LYS B 1 145 ? -58.513  5.568   -34.925 1.00 50.58  ? 706  LYS B N    1 
ATOM   8107  C  CA   . LYS B 1 145 ? -58.253  4.382   -34.123 1.00 44.47  ? 706  LYS B CA   1 
ATOM   8108  C  C    . LYS B 1 145 ? -59.148  3.244   -34.594 1.00 51.16  ? 706  LYS B C    1 
ATOM   8109  O  O    . LYS B 1 145 ? -60.205  3.460   -35.192 1.00 42.92  ? 706  LYS B O    1 
ATOM   8110  C  CB   . LYS B 1 145 ? -58.494  4.661   -32.636 1.00 47.16  ? 706  LYS B CB   1 
ATOM   8111  C  CG   . LYS B 1 145 ? -59.830  5.331   -32.360 1.00 48.11  ? 706  LYS B CG   1 
ATOM   8112  C  CD   . LYS B 1 145 ? -60.186  5.326   -30.883 1.00 56.83  ? 706  LYS B CD   1 
ATOM   8113  C  CE   . LYS B 1 145 ? -61.608  5.824   -30.668 1.00 52.30  ? 706  LYS B CE   1 
ATOM   8114  N  NZ   . LYS B 1 145 ? -62.025  5.753   -29.239 1.00 48.89  ? 706  LYS B NZ   1 
ATOM   8115  H  H    . LYS B 1 145 ? -59.342  5.672   -35.125 1.00 60.69  ? 706  LYS B H    1 
ATOM   8116  H  HA   . LYS B 1 145 ? -57.329  4.112   -34.238 1.00 53.36  ? 706  LYS B HA   1 
ATOM   8117  H  HB2  . LYS B 1 145 ? -58.477  3.820   -32.152 1.00 56.60  ? 706  LYS B HB2  1 
ATOM   8118  H  HB3  . LYS B 1 145 ? -57.793  5.245   -32.308 1.00 56.60  ? 706  LYS B HB3  1 
ATOM   8119  H  HG2  . LYS B 1 145 ? -59.788  6.254   -32.656 1.00 57.74  ? 706  LYS B HG2  1 
ATOM   8120  H  HG3  . LYS B 1 145 ? -60.527  4.858   -32.839 1.00 57.74  ? 706  LYS B HG3  1 
ATOM   8121  H  HD2  . LYS B 1 145 ? -60.123  4.421   -30.540 1.00 68.20  ? 706  LYS B HD2  1 
ATOM   8122  H  HD3  . LYS B 1 145 ? -59.581  5.912   -30.404 1.00 68.20  ? 706  LYS B HD3  1 
ATOM   8123  H  HE2  . LYS B 1 145 ? -61.667  6.749   -30.953 1.00 62.76  ? 706  LYS B HE2  1 
ATOM   8124  H  HE3  . LYS B 1 145 ? -62.218  5.276   -31.187 1.00 62.76  ? 706  LYS B HE3  1 
ATOM   8125  H  HZ1  . LYS B 1 145 ? -62.859  6.051   -29.150 1.00 58.67  ? 706  LYS B HZ1  1 
ATOM   8126  H  HZ2  . LYS B 1 145 ? -61.986  4.911   -28.952 1.00 58.67  ? 706  LYS B HZ2  1 
ATOM   8127  H  HZ3  . LYS B 1 145 ? -61.484  6.254   -28.739 1.00 58.67  ? 706  LYS B HZ3  1 
ATOM   8128  N  N    . ALA B 1 146 ? -58.700  2.019   -34.322 1.00 35.67  ? 707  ALA B N    1 
ATOM   8129  C  CA   . ALA B 1 146 ? -59.485  0.825   -34.601 1.00 30.58  ? 707  ALA B CA   1 
ATOM   8130  C  C    . ALA B 1 146 ? -60.386  0.496   -33.421 1.00 39.78  ? 707  ALA B C    1 
ATOM   8131  O  O    . ALA B 1 146 ? -59.994  0.651   -32.261 1.00 44.32  ? 707  ALA B O    1 
ATOM   8132  C  CB   . ALA B 1 146 ? -58.577  -0.366  -34.896 1.00 39.11  ? 707  ALA B CB   1 
ATOM   8133  H  H    . ALA B 1 146 ? -57.933  1.854   -33.970 1.00 42.81  ? 707  ALA B H    1 
ATOM   8134  H  HA   . ALA B 1 146 ? -60.045  0.982   -35.378 1.00 36.69  ? 707  ALA B HA   1 
ATOM   8135  H  HB1  . ALA B 1 146 ? -59.127  -1.145  -35.078 1.00 46.93  ? 707  ALA B HB1  1 
ATOM   8136  H  HB2  . ALA B 1 146 ? -58.029  -0.161  -35.669 1.00 46.93  ? 707  ALA B HB2  1 
ATOM   8137  H  HB3  . ALA B 1 146 ? -58.013  -0.532  -34.124 1.00 46.93  ? 707  ALA B HB3  1 
ATOM   8138  N  N    . MET B 1 147 ? -61.595  0.034   -33.725 1.00 47.57  ? 708  MET B N    1 
ATOM   8139  C  CA   . MET B 1 147 ? -62.555  -0.342  -32.694 1.00 43.22  ? 708  MET B CA   1 
ATOM   8140  C  C    . MET B 1 147 ? -63.225  -1.646  -33.084 1.00 45.08  ? 708  MET B C    1 
ATOM   8141  O  O    . MET B 1 147 ? -63.790  -1.751  -34.177 1.00 50.06  ? 708  MET B O    1 
ATOM   8142  C  CB   . MET B 1 147 ? -63.607  0.747   -32.492 1.00 63.44  ? 708  MET B CB   1 
ATOM   8143  C  CG   . MET B 1 147 ? -63.043  2.105   -32.087 1.00 53.64  ? 708  MET B CG   1 
ATOM   8144  S  SD   . MET B 1 147 ? -64.346  3.239   -31.564 1.00 70.41  ? 708  MET B SD   1 
ATOM   8145  C  CE   . MET B 1 147 ? -65.428  3.156   -32.985 1.00 64.52  ? 708  MET B CE   1 
ATOM   8146  H  H    . MET B 1 147 ? -61.886  -0.071  -34.527 1.00 57.09  ? 708  MET B H    1 
ATOM   8147  H  HA   . MET B 1 147 ? -62.085  -0.466  -31.854 1.00 51.87  ? 708  MET B HA   1 
ATOM   8148  H  HB2  . MET B 1 147 ? -64.094  0.866   -33.322 1.00 76.13  ? 708  MET B HB2  1 
ATOM   8149  H  HB3  . MET B 1 147 ? -64.217  0.462   -31.793 1.00 76.13  ? 708  MET B HB3  1 
ATOM   8150  H  HG2  . MET B 1 147 ? -62.427  1.988   -31.347 1.00 64.37  ? 708  MET B HG2  1 
ATOM   8151  H  HG3  . MET B 1 147 ? -62.584  2.499   -32.846 1.00 64.37  ? 708  MET B HG3  1 
ATOM   8152  H  HE1  . MET B 1 147 ? -66.192  3.735   -32.834 1.00 77.42  ? 708  MET B HE1  1 
ATOM   8153  H  HE2  . MET B 1 147 ? -64.941  3.450   -33.770 1.00 77.42  ? 708  MET B HE2  1 
ATOM   8154  H  HE3  . MET B 1 147 ? -65.725  2.240   -33.102 1.00 77.42  ? 708  MET B HE3  1 
ATOM   8155  N  N    . ILE B 1 148 ? -63.162  -2.636  -32.194 1.00 49.87  ? 709  ILE B N    1 
ATOM   8156  C  CA   . ILE B 1 148 ? -63.931  -3.857  -32.385 1.00 52.39  ? 709  ILE B CA   1 
ATOM   8157  C  C    . ILE B 1 148 ? -65.408  -3.547  -32.187 1.00 54.76  ? 709  ILE B C    1 
ATOM   8158  O  O    . ILE B 1 148 ? -65.785  -2.728  -31.338 1.00 58.69  ? 709  ILE B O    1 
ATOM   8159  C  CB   . ILE B 1 148 ? -63.452  -4.961  -31.426 1.00 51.66  ? 709  ILE B CB   1 
ATOM   8160  C  CG1  . ILE B 1 148 ? -63.659  -4.539  -29.969 1.00 55.82  ? 709  ILE B CG1  1 
ATOM   8161  C  CG2  . ILE B 1 148 ? -61.982  -5.293  -31.695 1.00 43.43  ? 709  ILE B CG2  1 
ATOM   8162  C  CD1  . ILE B 1 148 ? -63.283  -5.601  -28.965 1.00 72.95  ? 709  ILE B CD1  1 
ATOM   8163  H  H    . ILE B 1 148 ? -62.686  -2.623  -31.478 1.00 59.85  ? 709  ILE B H    1 
ATOM   8164  H  HA   . ILE B 1 148 ? -63.807  -4.172  -33.294 1.00 62.87  ? 709  ILE B HA   1 
ATOM   8165  H  HB   . ILE B 1 148 ? -63.979  -5.758  -31.590 1.00 61.99  ? 709  ILE B HB   1 
ATOM   8166  H  HG12 . ILE B 1 148 ? -63.114  -3.757  -29.790 1.00 66.98  ? 709  ILE B HG12 1 
ATOM   8167  H  HG13 . ILE B 1 148 ? -64.596  -4.325  -29.837 1.00 66.98  ? 709  ILE B HG13 1 
ATOM   8168  H  HG21 . ILE B 1 148 ? -61.698  -5.989  -31.082 1.00 52.12  ? 709  ILE B HG21 1 
ATOM   8169  H  HG22 . ILE B 1 148 ? -61.891  -5.600  -32.611 1.00 52.12  ? 709  ILE B HG22 1 
ATOM   8170  H  HG23 . ILE B 1 148 ? -61.448  -4.494  -31.559 1.00 52.12  ? 709  ILE B HG23 1 
ATOM   8171  H  HD11 . ILE B 1 148 ? -63.442  -5.260  -28.071 1.00 87.54  ? 709  ILE B HD11 1 
ATOM   8172  H  HD12 . ILE B 1 148 ? -63.828  -6.389  -29.120 1.00 87.54  ? 709  ILE B HD12 1 
ATOM   8173  H  HD13 . ILE B 1 148 ? -62.345  -5.820  -29.074 1.00 87.54  ? 709  ILE B HD13 1 
ATOM   8174  N  N    . SER B 1 149 ? -66.253  -4.192  -32.984 1.00 50.24  ? 710  SER B N    1 
ATOM   8175  C  CA   . SER B 1 149 ? -67.672  -3.881  -33.006 1.00 45.71  ? 710  SER B CA   1 
ATOM   8176  C  C    . SER B 1 149 ? -68.452  -5.131  -33.373 1.00 56.90  ? 710  SER B C    1 
ATOM   8177  O  O    . SER B 1 149 ? -67.896  -6.116  -33.863 1.00 53.67  ? 710  SER B O    1 
ATOM   8178  C  CB   . SER B 1 149 ? -67.989  -2.761  -33.998 1.00 47.91  ? 710  SER B CB   1 
ATOM   8179  O  OG   . SER B 1 149 ? -69.387  -2.621  -34.158 1.00 52.93  ? 710  SER B OG   1 
ATOM   8180  H  H    . SER B 1 149 ? -66.024  -4.820  -33.526 1.00 60.29  ? 710  SER B H    1 
ATOM   8181  H  HA   . SER B 1 149 ? -67.952  -3.595  -32.123 1.00 54.86  ? 710  SER B HA   1 
ATOM   8182  H  HB2  . SER B 1 149 ? -67.624  -1.928  -33.662 1.00 57.49  ? 710  SER B HB2  1 
ATOM   8183  H  HB3  . SER B 1 149 ? -67.592  -2.976  -34.856 1.00 57.49  ? 710  SER B HB3  1 
ATOM   8184  H  HG   . SER B 1 149 ? -69.554  -2.005  -34.704 1.00 63.51  ? 710  SER B HG   1 
ATOM   8185  N  N    . ASP B 1 150 ? -69.756  -5.081  -33.119 1.00 65.49  ? 711  ASP B N    1 
ATOM   8186  C  CA   . ASP B 1 150 ? -70.616  -6.206  -33.465 1.00 55.69  ? 711  ASP B CA   1 
ATOM   8187  C  C    . ASP B 1 150 ? -70.876  -6.281  -34.966 1.00 69.65  ? 711  ASP B C    1 
ATOM   8188  O  O    . ASP B 1 150 ? -70.887  -7.373  -35.545 1.00 87.55  ? 711  ASP B O    1 
ATOM   8189  C  CB   . ASP B 1 150 ? -71.943  -6.097  -32.729 1.00 82.77  ? 711  ASP B CB   1 
ATOM   8190  C  CG   . ASP B 1 150 ? -73.020  -6.905  -33.398 1.00 103.08 ? 711  ASP B CG   1 
ATOM   8191  O  OD1  . ASP B 1 150 ? -72.777  -8.104  -33.649 1.00 106.97 ? 711  ASP B OD1  1 
ATOM   8192  O  OD2  . ASP B 1 150 ? -74.083  -6.335  -33.720 1.00 97.89  ? 711  ASP B OD2  1 
ATOM   8193  H  H    . ASP B 1 150 ? -70.162  -4.418  -32.752 1.00 78.59  ? 711  ASP B H    1 
ATOM   8194  H  HA   . ASP B 1 150 ? -70.185  -7.031  -33.191 0.57 66.82  ? 711  ASP B HA   1 
ATOM   8195  H  HB2  . ASP B 1 150 ? -71.834  -6.427  -31.824 1.00 99.32  ? 711  ASP B HB2  1 
ATOM   8196  H  HB3  . ASP B 1 150 ? -72.225  -5.168  -32.716 1.00 99.32  ? 711  ASP B HB3  1 
ATOM   8197  N  N    . PHE B 1 151 ? -71.095  -5.136  -35.609 1.00 76.84  ? 712  PHE B N    1 
ATOM   8198  C  CA   . PHE B 1 151 ? -71.619  -5.073  -36.966 1.00 78.46  ? 712  PHE B CA   1 
ATOM   8199  C  C    . PHE B 1 151 ? -70.595  -4.466  -37.918 1.00 86.00  ? 712  PHE B C    1 
ATOM   8200  O  O    . PHE B 1 151 ? -69.725  -3.688  -37.512 1.00 83.45  ? 712  PHE B O    1 
ATOM   8201  C  CB   . PHE B 1 151 ? -72.899  -4.232  -37.010 1.00 75.28  ? 712  PHE B CB   1 
ATOM   8202  C  CG   . PHE B 1 151 ? -72.638  -2.753  -36.958 1.00 80.18  ? 712  PHE B CG   1 
ATOM   8203  C  CD1  . PHE B 1 151 ? -72.222  -2.150  -35.783 1.00 82.15  ? 712  PHE B CD1  1 
ATOM   8204  C  CD2  . PHE B 1 151 ? -72.784  -1.969  -38.090 1.00 90.37  ? 712  PHE B CD2  1 
ATOM   8205  C  CE1  . PHE B 1 151 ? -71.964  -0.790  -35.738 1.00 85.62  ? 712  PHE B CE1  1 
ATOM   8206  C  CE2  . PHE B 1 151 ? -72.529  -0.607  -38.048 1.00 90.33  ? 712  PHE B CE2  1 
ATOM   8207  C  CZ   . PHE B 1 151 ? -72.121  -0.019  -36.871 1.00 76.81  ? 712  PHE B CZ   1 
ATOM   8208  H  H    . PHE B 1 151 ? -70.941  -4.361  -35.268 1.00 92.21  ? 712  PHE B H    1 
ATOM   8209  H  HA   . PHE B 1 151 ? -71.830  -5.968  -37.272 1.00 94.16  ? 712  PHE B HA   1 
ATOM   8210  H  HB2  . PHE B 1 151 ? -73.372  -4.422  -37.835 1.00 90.34  ? 712  PHE B HB2  1 
ATOM   8211  H  HB3  . PHE B 1 151 ? -73.454  -4.464  -36.250 1.00 90.34  ? 712  PHE B HB3  1 
ATOM   8212  H  HD1  . PHE B 1 151 ? -72.113  -2.665  -35.016 1.00 98.58  ? 712  PHE B HD1  1 
ATOM   8213  H  HD2  . PHE B 1 151 ? -73.058  -2.361  -38.887 1.00 108.44 ? 712  PHE B HD2  1 
ATOM   8214  H  HE1  . PHE B 1 151 ? -71.690  -0.395  -34.941 1.00 102.75 ? 712  PHE B HE1  1 
ATOM   8215  H  HE2  . PHE B 1 151 ? -72.636  -0.091  -38.814 1.00 108.39 ? 712  PHE B HE2  1 
ATOM   8216  H  HZ   . PHE B 1 151 ? -71.952  0.895   -36.841 1.00 92.18  ? 712  PHE B HZ   1 
ATOM   8217  N  N    . GLY B 1 152 ? -70.712  -4.832  -39.200 1.00 88.55  ? 713  GLY B N    1 
ATOM   8218  C  CA   . GLY B 1 152 ? -69.952  -4.207  -40.260 1.00 77.67  ? 713  GLY B CA   1 
ATOM   8219  C  C    . GLY B 1 152 ? -70.798  -3.219  -41.054 1.00 85.09  ? 713  GLY B C    1 
ATOM   8220  O  O    . GLY B 1 152 ? -72.012  -3.138  -40.898 1.00 83.45  ? 713  GLY B O    1 
ATOM   8221  H  H    . GLY B 1 152 ? -71.240  -5.453  -39.475 1.00 106.26 ? 713  GLY B H    1 
ATOM   8222  H  HA2  . GLY B 1 152 ? -69.195  -3.733  -39.882 1.00 93.20  ? 713  GLY B HA2  1 
ATOM   8223  H  HA3  . GLY B 1 152 ? -69.619  -4.888  -40.866 1.00 93.20  ? 713  GLY B HA3  1 
ATOM   8224  N  N    . LEU B 1 153 ? -70.120  -2.461  -41.916 1.00 86.74  ? 714  LEU B N    1 
ATOM   8225  C  CA   . LEU B 1 153 ? -70.750  -1.425  -42.720 1.00 85.04  ? 714  LEU B CA   1 
ATOM   8226  C  C    . LEU B 1 153 ? -70.953  -1.915  -44.155 1.00 85.74  ? 714  LEU B C    1 
ATOM   8227  O  O    . LEU B 1 153 ? -70.588  -3.037  -44.518 1.00 75.63  ? 714  LEU B O    1 
ATOM   8228  C  CB   . LEU B 1 153 ? -69.909  -0.146  -42.693 1.00 78.13  ? 714  LEU B CB   1 
ATOM   8229  C  CG   . LEU B 1 153 ? -69.666  0.499   -41.325 1.00 76.39  ? 714  LEU B CG   1 
ATOM   8230  C  CD1  . LEU B 1 153 ? -68.751  1.705   -41.464 1.00 60.40  ? 714  LEU B CD1  1 
ATOM   8231  C  CD2  . LEU B 1 153 ? -70.978  0.900   -40.667 1.00 67.34  ? 714  LEU B CD2  1 
ATOM   8232  H  H    . LEU B 1 153 ? -69.274  -2.534  -42.053 1.00 104.09 ? 714  LEU B H    1 
ATOM   8233  H  HA   . LEU B 1 153 ? -71.622  -1.220  -42.347 1.00 102.05 ? 714  LEU B HA   1 
ATOM   8234  H  HB2  . LEU B 1 153 ? -69.039  -0.349  -43.071 1.00 93.76  ? 714  LEU B HB2  1 
ATOM   8235  H  HB3  . LEU B 1 153 ? -70.351  0.517   -43.247 1.00 93.76  ? 714  LEU B HB3  1 
ATOM   8236  H  HG   . LEU B 1 153 ? -69.226  -0.145  -40.747 1.00 91.66  ? 714  LEU B HG   1 
ATOM   8237  H  HD11 . LEU B 1 153 ? -68.611  2.097   -40.589 1.00 72.49  ? 714  LEU B HD11 1 
ATOM   8238  H  HD12 . LEU B 1 153 ? -67.904  1.416   -41.838 1.00 72.49  ? 714  LEU B HD12 1 
ATOM   8239  H  HD13 . LEU B 1 153 ? -69.170  2.351   -42.054 1.00 72.49  ? 714  LEU B HD13 1 
ATOM   8240  H  HD21 . LEU B 1 153 ? -70.789  1.303   -39.805 1.00 80.80  ? 714  LEU B HD21 1 
ATOM   8241  H  HD22 . LEU B 1 153 ? -71.436  1.537   -41.238 1.00 80.80  ? 714  LEU B HD22 1 
ATOM   8242  H  HD23 . LEU B 1 153 ? -71.526  0.108   -40.548 1.00 80.80  ? 714  LEU B HD23 1 
ATOM   8243  N  N    . CYS B 1 154 ? -71.546  -1.053  -44.977 1.00 98.44  ? 715  CYS B N    1 
ATOM   8244  C  CA   . CYS B 1 154 ? -71.778  -1.345  -46.391 1.00 96.35  ? 715  CYS B CA   1 
ATOM   8245  C  C    . CYS B 1 154 ? -70.791  -0.564  -47.260 1.00 92.47  ? 715  CYS B C    1 
ATOM   8246  O  O    . CYS B 1 154 ? -71.140  -0.055  -48.327 1.00 86.09  ? 715  CYS B O    1 
ATOM   8247  C  CB   . CYS B 1 154 ? -73.223  -1.008  -46.780 1.00 105.43 ? 715  CYS B CB   1 
ATOM   8248  S  SG   . CYS B 1 154 ? -74.481  -2.119  -46.087 1.00 106.02 ? 715  CYS B SG   1 
ATOM   8249  H  H    . CYS B 1 154 ? -71.828  -0.277  -44.736 1.00 118.13 ? 715  CYS B H    1 
ATOM   8250  H  HA   . CYS B 1 154 ? -71.636  -2.292  -46.547 1.00 115.61 ? 715  CYS B HA   1 
ATOM   8251  H  HB2  . CYS B 1 154 ? -73.424  -0.110  -46.474 1.00 126.51 ? 715  CYS B HB2  1 
ATOM   8252  H  HB3  . CYS B 1 154 ? -73.299  -1.047  -47.747 1.00 126.51 ? 715  CYS B HB3  1 
ATOM   8253  H  HG   . CYS B 1 154 ? -75.565  -1.762  -46.456 1.00 127.22 ? 715  CYS B HG   1 
ATOM   8254  N  N    . GLU B 1 174 ? -68.609  -16.964 -43.654 1.00 72.48  ? 735  GLU B N    1 
ATOM   8255  C  CA   . GLU B 1 174 ? -67.712  -17.641 -42.723 1.00 71.03  ? 735  GLU B CA   1 
ATOM   8256  C  C    . GLU B 1 174 ? -66.258  -17.506 -43.171 1.00 72.43  ? 735  GLU B C    1 
ATOM   8257  O  O    . GLU B 1 174 ? -65.917  -16.617 -43.955 1.00 69.45  ? 735  GLU B O    1 
ATOM   8258  C  CB   . GLU B 1 174 ? -68.092  -19.119 -42.597 1.00 53.73  ? 735  GLU B CB   1 
ATOM   8259  H  HA   . GLU B 1 174 ? -67.797  -17.232 -41.848 1.00 85.23  ? 735  GLU B HA   1 
ATOM   8260  N  N    . GLY B 1 175 ? -65.408  -18.404 -42.672 1.00 61.88  ? 736  GLY B N    1 
ATOM   8261  C  CA   . GLY B 1 175 ? -63.996  -18.415 -42.980 1.00 57.45  ? 736  GLY B CA   1 
ATOM   8262  C  C    . GLY B 1 175 ? -63.105  -17.869 -41.884 1.00 53.24  ? 736  GLY B C    1 
ATOM   8263  O  O    . GLY B 1 175 ? -61.900  -18.141 -41.894 1.00 65.46  ? 736  GLY B O    1 
ATOM   8264  H  H    . GLY B 1 175 ? -65.643  -19.034 -42.136 1.00 74.26  ? 736  GLY B H    1 
ATOM   8265  H  HA2  . GLY B 1 175 ? -63.720  -19.327 -43.163 1.00 68.94  ? 736  GLY B HA2  1 
ATOM   8266  H  HA3  . GLY B 1 175 ? -63.843  -17.888 -43.780 1.00 68.94  ? 736  GLY B HA3  1 
ATOM   8267  N  N    . TRP B 1 176 ? -63.652  -17.072 -40.973 1.00 58.69  ? 737  TRP B N    1 
ATOM   8268  C  CA   . TRP B 1 176 ? -62.931  -16.604 -39.799 1.00 53.23  ? 737  TRP B CA   1 
ATOM   8269  C  C    . TRP B 1 176 ? -63.244  -17.405 -38.540 1.00 52.37  ? 737  TRP B C    1 
ATOM   8270  O  O    . TRP B 1 176 ? -62.724  -17.075 -37.468 1.00 55.59  ? 737  TRP B O    1 
ATOM   8271  C  CB   . TRP B 1 176 ? -63.235  -15.126 -39.585 1.00 53.26  ? 737  TRP B CB   1 
ATOM   8272  C  CG   . TRP B 1 176 ? -63.115  -14.344 -40.857 1.00 39.48  ? 737  TRP B CG   1 
ATOM   8273  C  CD1  . TRP B 1 176 ? -64.081  -14.169 -41.805 1.00 52.44  ? 737  TRP B CD1  1 
ATOM   8274  C  CD2  . TRP B 1 176 ? -61.960  -13.642 -41.328 1.00 32.71  ? 737  TRP B CD2  1 
ATOM   8275  N  NE1  . TRP B 1 176 ? -63.601  -13.397 -42.833 1.00 42.92  ? 737  TRP B NE1  1 
ATOM   8276  C  CE2  . TRP B 1 176 ? -62.303  -13.056 -42.562 1.00 47.90  ? 737  TRP B CE2  1 
ATOM   8277  C  CE3  . TRP B 1 176 ? -60.674  -13.439 -40.819 1.00 46.15  ? 737  TRP B CE3  1 
ATOM   8278  C  CZ2  . TRP B 1 176 ? -61.406  -12.286 -43.298 1.00 35.89  ? 737  TRP B CZ2  1 
ATOM   8279  C  CZ3  . TRP B 1 176 ? -59.785  -12.668 -41.552 1.00 47.63  ? 737  TRP B CZ3  1 
ATOM   8280  C  CH2  . TRP B 1 176 ? -60.155  -12.104 -42.778 1.00 43.57  ? 737  TRP B CH2  1 
ATOM   8281  H  H    . TRP B 1 176 ? -64.461  -16.783 -41.015 1.00 70.42  ? 737  TRP B H    1 
ATOM   8282  H  HA   . TRP B 1 176 ? -61.980  -16.686 -39.969 1.00 63.88  ? 737  TRP B HA   1 
ATOM   8283  H  HB2  . TRP B 1 176 ? -64.143  -15.031 -39.255 1.00 63.91  ? 737  TRP B HB2  1 
ATOM   8284  H  HB3  . TRP B 1 176 ? -62.606  -14.760 -38.944 1.00 63.91  ? 737  TRP B HB3  1 
ATOM   8285  H  HD1  . TRP B 1 176 ? -64.939  -14.525 -41.763 1.00 62.93  ? 737  TRP B HD1  1 
ATOM   8286  H  HE1  . TRP B 1 176 ? -64.045  -13.163 -43.531 1.00 51.51  ? 737  TRP B HE1  1 
ATOM   8287  H  HE3  . TRP B 1 176 ? -60.423  -13.808 -40.003 1.00 55.38  ? 737  TRP B HE3  1 
ATOM   8288  H  HZ2  . TRP B 1 176 ? -61.649  -11.909 -44.113 1.00 43.07  ? 737  TRP B HZ2  1 
ATOM   8289  H  HZ3  . TRP B 1 176 ? -58.925  -12.529 -41.226 1.00 57.15  ? 737  TRP B HZ3  1 
ATOM   8290  H  HH2  . TRP B 1 176 ? -59.535  -11.597 -43.250 1.00 52.29  ? 737  TRP B HH2  1 
ATOM   8291  N  N    . ILE B 1 177 ? -64.077  -18.439 -38.640 1.00 59.20  ? 738  ILE B N    1 
ATOM   8292  C  CA   . ILE B 1 177 ? -64.548  -19.169 -37.468 1.00 60.63  ? 738  ILE B CA   1 
ATOM   8293  C  C    . ILE B 1 177 ? -63.538  -20.240 -37.085 1.00 47.02  ? 738  ILE B C    1 
ATOM   8294  O  O    . ILE B 1 177 ? -63.012  -20.957 -37.943 1.00 55.23  ? 738  ILE B O    1 
ATOM   8295  C  CB   . ILE B 1 177 ? -65.924  -19.797 -37.748 1.00 59.97  ? 738  ILE B CB   1 
ATOM   8296  C  CG1  . ILE B 1 177 ? -66.894  -18.760 -38.321 1.00 66.66  ? 738  ILE B CG1  1 
ATOM   8297  C  CG2  . ILE B 1 177 ? -66.495  -20.406 -36.476 1.00 55.15  ? 738  ILE B CG2  1 
ATOM   8298  C  CD1  . ILE B 1 177 ? -68.114  -19.369 -38.972 1.00 66.24  ? 738  ILE B CD1  1 
ATOM   8299  H  H    . ILE B 1 177 ? -64.387  -18.739 -39.384 1.00 71.05  ? 738  ILE B H    1 
ATOM   8300  H  HA   . ILE B 1 177 ? -64.639  -18.554 -36.722 1.00 72.75  ? 738  ILE B HA   1 
ATOM   8301  H  HB   . ILE B 1 177 ? -65.810  -20.504 -38.402 1.00 71.97  ? 738  ILE B HB   1 
ATOM   8302  H  HG12 . ILE B 1 177 ? -67.198  -18.184 -37.602 1.00 79.99  ? 738  ILE B HG12 1 
ATOM   8303  H  HG13 . ILE B 1 177 ? -66.431  -18.234 -38.991 1.00 79.99  ? 738  ILE B HG13 1 
ATOM   8304  H  HG21 . ILE B 1 177 ? -67.361  -20.796 -36.674 1.00 66.18  ? 738  ILE B HG21 1 
ATOM   8305  H  HG22 . ILE B 1 177 ? -65.888  -21.092 -36.155 1.00 66.18  ? 738  ILE B HG22 1 
ATOM   8306  H  HG23 . ILE B 1 177 ? -66.590  -19.710 -35.807 1.00 66.18  ? 738  ILE B HG23 1 
ATOM   8307  H  HD11 . ILE B 1 177 ? -68.680  -18.657 -39.310 1.00 79.48  ? 738  ILE B HD11 1 
ATOM   8308  H  HD12 . ILE B 1 177 ? -67.829  -19.941 -39.702 1.00 79.48  ? 738  ILE B HD12 1 
ATOM   8309  H  HD13 . ILE B 1 177 ? -68.597  -19.890 -38.312 1.00 79.48  ? 738  ILE B HD13 1 
ATOM   8310  N  N    . ALA B 1 178 ? -63.279  -20.365 -35.786 1.00 60.69  ? 739  ALA B N    1 
ATOM   8311  C  CA   . ALA B 1 178 ? -62.359  -21.380 -35.305 1.00 62.56  ? 739  ALA B CA   1 
ATOM   8312  C  C    . ALA B 1 178 ? -62.922  -22.775 -35.574 1.00 66.84  ? 739  ALA B C    1 
ATOM   8313  O  O    . ALA B 1 178 ? -64.141  -22.960 -35.630 1.00 68.57  ? 739  ALA B O    1 
ATOM   8314  C  CB   . ALA B 1 178 ? -62.096  -21.203 -33.811 1.00 53.54  ? 739  ALA B CB   1 
ATOM   8315  H  H    . ALA B 1 178 ? -63.624  -19.876 -35.168 1.00 72.83  ? 739  ALA B H    1 
ATOM   8316  H  HA   . ALA B 1 178 ? -61.514  -21.296 -35.775 1.00 75.07  ? 739  ALA B HA   1 
ATOM   8317  H  HB1  . ALA B 1 178 ? -61.479  -21.891 -33.516 1.00 64.24  ? 739  ALA B HB1  1 
ATOM   8318  H  HB2  . ALA B 1 178 ? -61.710  -20.326 -33.661 1.00 64.24  ? 739  ALA B HB2  1 
ATOM   8319  H  HB3  . ALA B 1 178 ? -62.935  -21.282 -33.332 1.00 64.24  ? 739  ALA B HB3  1 
ATOM   8320  N  N    . PRO B 1 179 ? -62.053  -23.774 -35.757 1.00 66.52  ? 740  PRO B N    1 
ATOM   8321  C  CA   . PRO B 1 179 ? -62.561  -25.130 -36.013 1.00 73.84  ? 740  PRO B CA   1 
ATOM   8322  C  C    . PRO B 1 179 ? -63.288  -25.730 -34.825 1.00 69.66  ? 740  PRO B C    1 
ATOM   8323  O  O    . PRO B 1 179 ? -64.234  -26.503 -35.018 1.00 64.52  ? 740  PRO B O    1 
ATOM   8324  C  CB   . PRO B 1 179 ? -61.292  -25.920 -36.359 1.00 54.67  ? 740  PRO B CB   1 
ATOM   8325  C  CG   . PRO B 1 179 ? -60.193  -25.184 -35.673 1.00 63.65  ? 740  PRO B CG   1 
ATOM   8326  C  CD   . PRO B 1 179 ? -60.581  -23.734 -35.703 1.00 63.86  ? 740  PRO B CD   1 
ATOM   8327  H  HA   . PRO B 1 179 ? -63.153  -25.126 -36.781 1.00 88.61  ? 740  PRO B HA   1 
ATOM   8328  H  HB2  . PRO B 1 179 ? -61.366  -26.825 -36.018 1.00 65.61  ? 740  PRO B HB2  1 
ATOM   8329  H  HB3  . PRO B 1 179 ? -61.158  -25.923 -37.319 1.00 65.61  ? 740  PRO B HB3  1 
ATOM   8330  H  HG2  . PRO B 1 179 ? -60.115  -25.497 -34.758 1.00 76.38  ? 740  PRO B HG2  1 
ATOM   8331  H  HG3  . PRO B 1 179 ? -59.362  -25.324 -36.153 1.00 76.38  ? 740  PRO B HG3  1 
ATOM   8332  H  HD2  . PRO B 1 179 ? -60.285  -23.288 -34.894 1.00 76.63  ? 740  PRO B HD2  1 
ATOM   8333  H  HD3  . PRO B 1 179 ? -60.225  -23.305 -36.496 1.00 76.63  ? 740  PRO B HD3  1 
ATOM   8334  N  N    . GLU B 1 180 ? -62.880  -25.391 -33.601 1.00 72.58  ? 741  GLU B N    1 
ATOM   8335  C  CA   . GLU B 1 180 ? -63.494  -25.973 -32.414 1.00 64.63  ? 741  GLU B CA   1 
ATOM   8336  C  C    . GLU B 1 180 ? -64.966  -25.612 -32.282 1.00 68.53  ? 741  GLU B C    1 
ATOM   8337  O  O    . GLU B 1 180 ? -65.695  -26.298 -31.558 1.00 76.73  ? 741  GLU B O    1 
ATOM   8338  C  CB   . GLU B 1 180 ? -62.740  -25.519 -31.165 1.00 65.31  ? 741  GLU B CB   1 
ATOM   8339  C  CG   . GLU B 1 180 ? -62.978  -24.058 -30.794 1.00 77.33  ? 741  GLU B CG   1 
ATOM   8340  C  CD   . GLU B 1 180 ? -61.693  -23.309 -30.521 1.00 74.90  ? 741  GLU B CD   1 
ATOM   8341  O  OE1  . GLU B 1 180 ? -60.755  -23.428 -31.337 1.00 65.40  ? 741  GLU B OE1  1 
ATOM   8342  O  OE2  . GLU B 1 180 ? -61.621  -22.604 -29.491 1.00 73.37  ? 741  GLU B OE2  1 
ATOM   8343  H  H    . GLU B 1 180 ? -62.252  -24.827 -33.434 1.00 87.09  ? 741  GLU B H    1 
ATOM   8344  H  HA   . GLU B 1 180 ? -63.427  -26.940 -32.468 1.00 77.55  ? 741  GLU B HA   1 
ATOM   8345  H  HB2  . GLU B 1 180 ? -63.022  -26.064 -30.414 1.00 78.38  ? 741  GLU B HB2  1 
ATOM   8346  H  HB3  . GLU B 1 180 ? -61.789  -25.634 -31.315 1.00 78.38  ? 741  GLU B HB3  1 
ATOM   8347  H  HG2  . GLU B 1 180 ? -63.433  -23.616 -31.528 1.00 92.80  ? 741  GLU B HG2  1 
ATOM   8348  H  HG3  . GLU B 1 180 ? -63.524  -24.020 -29.993 1.00 92.80  ? 741  GLU B HG3  1 
ATOM   8349  N  N    . MET B 1 181 ? -65.421  -24.563 -32.966 1.00 76.00  ? 742  MET B N    1 
ATOM   8350  C  CA   . MET B 1 181 ? -66.798  -24.105 -32.832 1.00 69.63  ? 742  MET B CA   1 
ATOM   8351  C  C    . MET B 1 181 ? -67.775  -24.876 -33.709 1.00 78.47  ? 742  MET B C    1 
ATOM   8352  O  O    . MET B 1 181 ? -68.977  -24.586 -33.664 1.00 97.38  ? 742  MET B O    1 
ATOM   8353  C  CB   . MET B 1 181 ? -66.889  -22.613 -33.153 1.00 66.99  ? 742  MET B CB   1 
ATOM   8354  C  CG   . MET B 1 181 ? -66.501  -21.710 -31.995 1.00 64.25  ? 742  MET B CG   1 
ATOM   8355  S  SD   . MET B 1 181 ? -67.384  -20.142 -32.037 1.00 70.99  ? 742  MET B SD   1 
ATOM   8356  C  CE   . MET B 1 181 ? -69.046  -20.658 -31.618 1.00 94.08  ? 742  MET B CE   1 
ATOM   8357  H  H    . MET B 1 181 ? -64.949  -24.099 -33.515 1.00 91.20  ? 742  MET B H    1 
ATOM   8358  H  HA   . MET B 1 181 ? -67.067  -24.218 -31.907 1.00 83.55  ? 742  MET B HA   1 
ATOM   8359  H  HB2  . MET B 1 181 ? -66.294  -22.416 -33.894 1.00 80.39  ? 742  MET B HB2  1 
ATOM   8360  H  HB3  . MET B 1 181 ? -67.802  -22.401 -33.400 1.00 80.39  ? 742  MET B HB3  1 
ATOM   8361  H  HG2  . MET B 1 181 ? -66.713  -22.155 -31.160 1.00 77.10  ? 742  MET B HG2  1 
ATOM   8362  H  HG3  . MET B 1 181 ? -65.550  -21.523 -32.042 1.00 77.10  ? 742  MET B HG3  1 
ATOM   8363  H  HE1  . MET B 1 181 ? -69.625  -19.880 -31.609 1.00 112.90 ? 742  MET B HE1  1 
ATOM   8364  H  HE2  . MET B 1 181 ? -69.355  -21.295 -32.281 1.00 112.90 ? 742  MET B HE2  1 
ATOM   8365  H  HE3  . MET B 1 181 ? -69.035  -21.072 -30.741 1.00 112.90 ? 742  MET B HE3  1 
ATOM   8366  N  N    . LEU B 1 182 ? -67.301  -25.835 -34.503 1.00 78.14  ? 743  LEU B N    1 
ATOM   8367  C  CA   . LEU B 1 182 ? -68.195  -26.714 -35.251 1.00 86.92  ? 743  LEU B CA   1 
ATOM   8368  C  C    . LEU B 1 182 ? -68.445  -28.010 -34.481 1.00 93.25  ? 743  LEU B C    1 
ATOM   8369  O  O    . LEU B 1 182 ? -69.580  -28.295 -34.085 1.00 89.54  ? 743  LEU B O    1 
ATOM   8370  C  CB   . LEU B 1 182 ? -67.621  -26.986 -36.645 1.00 91.08  ? 743  LEU B CB   1 
ATOM   8371  C  CG   . LEU B 1 182 ? -67.971  -25.906 -37.679 1.00 90.18  ? 743  LEU B CG   1 
ATOM   8372  C  CD1  . LEU B 1 182 ? -67.294  -24.581 -37.348 1.00 69.06  ? 743  LEU B CD1  1 
ATOM   8373  C  CD2  . LEU B 1 182 ? -67.614  -26.350 -39.087 1.00 84.97  ? 743  LEU B CD2  1 
ATOM   8374  H  H    . LEU B 1 182 ? -66.466  -25.996 -34.626 1.00 93.77  ? 743  LEU B H    1 
ATOM   8375  H  HA   . LEU B 1 182 ? -69.049  -26.268 -35.364 1.00 104.31 ? 743  LEU B HA   1 
ATOM   8376  H  HB2  . LEU B 1 182 ? -66.654  -27.034 -36.582 1.00 109.29 ? 743  LEU B HB2  1 
ATOM   8377  H  HB3  . LEU B 1 182 ? -67.972  -27.831 -36.969 1.00 109.29 ? 743  LEU B HB3  1 
ATOM   8378  H  HG   . LEU B 1 182 ? -68.929  -25.757 -37.655 1.00 108.22 ? 743  LEU B HG   1 
ATOM   8379  H  HD11 . LEU B 1 182 ? -67.538  -23.926 -38.021 1.00 82.87  ? 743  LEU B HD11 1 
ATOM   8380  H  HD12 . LEU B 1 182 ? -67.592  -24.284 -36.474 1.00 82.87  ? 743  LEU B HD12 1 
ATOM   8381  H  HD13 . LEU B 1 182 ? -66.333  -24.710 -37.345 1.00 82.87  ? 743  LEU B HD13 1 
ATOM   8382  H  HD21 . LEU B 1 182 ? -67.849  -25.644 -39.710 1.00 101.97 ? 743  LEU B HD21 1 
ATOM   8383  H  HD22 . LEU B 1 182 ? -66.661  -26.526 -39.130 1.00 101.97 ? 743  LEU B HD22 1 
ATOM   8384  H  HD23 . LEU B 1 182 ? -68.109  -27.157 -39.299 1.00 101.97 ? 743  LEU B HD23 1 
ATOM   8385  N  N    . SER B 1 183 ? -67.394  -28.801 -34.269 1.00 97.61  ? 744  SER B N    1 
ATOM   8386  C  CA   . SER B 1 183 ? -67.482  -29.994 -33.427 1.00 105.53 ? 744  SER B CA   1 
ATOM   8387  C  C    . SER B 1 183 ? -67.201  -29.643 -31.969 1.00 102.86 ? 744  SER B C    1 
ATOM   8388  O  O    . SER B 1 183 ? -67.695  -28.642 -31.448 1.00 101.23 ? 744  SER B O    1 
ATOM   8389  C  CB   . SER B 1 183 ? -66.505  -31.072 -33.900 1.00 95.44  ? 744  SER B CB   1 
ATOM   8390  O  OG   . SER B 1 183 ? -65.162  -30.626 -33.809 1.00 83.56  ? 744  SER B OG   1 
ATOM   8391  H  H    . SER B 1 183 ? -66.613  -28.667 -34.603 1.00 117.14 ? 744  SER B H    1 
ATOM   8392  H  HA   . SER B 1 183 ? -68.381  -30.355 -33.483 1.00 126.63 ? 744  SER B HA   1 
ATOM   8393  H  HB2  . SER B 1 183 ? -66.613  -31.860 -33.345 1.00 114.53 ? 744  SER B HB2  1 
ATOM   8394  H  HB3  . SER B 1 183 ? -66.702  -31.291 -34.825 1.00 114.53 ? 744  SER B HB3  1 
ATOM   8395  H  HG   . SER B 1 183 ? -64.640  -31.230 -34.073 1.00 100.27 ? 744  SER B HG   1 
ATOM   8396  N  N    . ASN B 1 189 ? -71.730  -22.420 -26.642 1.00 96.66  ? 750  ASN B N    1 
ATOM   8397  C  CA   . ASN B 1 189 ? -71.054  -21.933 -25.445 1.00 105.73 ? 750  ASN B CA   1 
ATOM   8398  C  C    . ASN B 1 189 ? -69.551  -21.748 -25.693 1.00 98.26  ? 750  ASN B C    1 
ATOM   8399  O  O    . ASN B 1 189 ? -68.724  -22.520 -25.203 1.00 96.58  ? 750  ASN B O    1 
ATOM   8400  C  CB   . ASN B 1 189 ? -71.309  -22.895 -24.279 1.00 106.40 ? 750  ASN B CB   1 
ATOM   8401  C  CG   . ASN B 1 189 ? -71.988  -22.221 -23.104 1.00 106.52 ? 750  ASN B CG   1 
ATOM   8402  O  OD1  . ASN B 1 189 ? -72.807  -21.319 -23.273 1.00 105.29 ? 750  ASN B OD1  1 
ATOM   8403  N  ND2  . ASN B 1 189 ? -71.646  -22.658 -21.899 1.00 115.23 ? 750  ASN B ND2  1 
ATOM   8404  H  HA   . ASN B 1 189 ? -71.424  -21.069 -25.204 1.00 126.87 ? 750  ASN B HA   1 
ATOM   8405  H  HB2  . ASN B 1 189 ? -71.882  -23.616 -24.584 1.00 127.68 ? 750  ASN B HB2  1 
ATOM   8406  H  HB3  . ASN B 1 189 ? -70.461  -23.252 -23.972 1.00 127.68 ? 750  ASN B HB3  1 
ATOM   8407  H  HD21 . ASN B 1 189 ? -71.068  -23.290 -21.819 1.00 138.28 ? 750  ASN B HD21 1 
ATOM   8408  H  HD22 . ASN B 1 189 ? -72.002  -22.310 -21.198 1.00 138.28 ? 750  ASN B HD22 1 
ATOM   8409  N  N    . PRO B 1 190 ? -69.203  -20.716 -26.456 1.00 86.83  ? 751  PRO B N    1 
ATOM   8410  C  CA   . PRO B 1 190 ? -67.814  -20.545 -26.890 1.00 77.17  ? 751  PRO B CA   1 
ATOM   8411  C  C    . PRO B 1 190 ? -66.902  -20.010 -25.798 1.00 76.45  ? 751  PRO B C    1 
ATOM   8412  O  O    . PRO B 1 190 ? -67.321  -19.289 -24.890 1.00 81.18  ? 751  PRO B O    1 
ATOM   8413  C  CB   . PRO B 1 190 ? -67.931  -19.538 -28.038 1.00 75.01  ? 751  PRO B CB   1 
ATOM   8414  C  CG   . PRO B 1 190 ? -69.156  -18.770 -27.738 1.00 82.57  ? 751  PRO B CG   1 
ATOM   8415  C  CD   . PRO B 1 190 ? -70.089  -19.676 -27.006 1.00 87.17  ? 751  PRO B CD   1 
ATOM   8416  H  HA   . PRO B 1 190 ? -67.459  -21.382 -27.228 1.00 92.61  ? 751  PRO B HA   1 
ATOM   8417  H  HB2  . PRO B 1 190 ? -67.154  -18.958 -28.047 1.00 90.01  ? 751  PRO B HB2  1 
ATOM   8418  H  HB3  . PRO B 1 190 ? -68.018  -20.010 -28.881 1.00 90.01  ? 751  PRO B HB3  1 
ATOM   8419  H  HG2  . PRO B 1 190 ? -68.927  -18.006 -27.186 1.00 99.08  ? 751  PRO B HG2  1 
ATOM   8420  H  HG3  . PRO B 1 190 ? -69.559  -18.474 -28.569 1.00 99.08  ? 751  PRO B HG3  1 
ATOM   8421  H  HD2  . PRO B 1 190 ? -70.532  -19.196 -26.288 1.00 104.61 ? 751  PRO B HD2  1 
ATOM   8422  H  HD3  . PRO B 1 190 ? -70.730  -20.068 -27.619 1.00 104.61 ? 751  PRO B HD3  1 
ATOM   8423  N  N    . THR B 1 191 ? -65.626  -20.365 -25.925 1.00 79.15  ? 752  THR B N    1 
ATOM   8424  C  CA   . THR B 1 191 ? -64.580  -19.889 -25.037 1.00 71.28  ? 752  THR B CA   1 
ATOM   8425  C  C    . THR B 1 191 ? -63.898  -18.670 -25.660 1.00 71.63  ? 752  THR B C    1 
ATOM   8426  O  O    . THR B 1 191 ? -64.216  -18.249 -26.774 1.00 71.97  ? 752  THR B O    1 
ATOM   8427  C  CB   . THR B 1 191 ? -63.575  -21.006 -24.741 1.00 65.79  ? 752  THR B CB   1 
ATOM   8428  O  OG1  . THR B 1 191 ? -62.441  -20.462 -24.053 1.00 64.36  ? 752  THR B OG1  1 
ATOM   8429  C  CG2  . THR B 1 191 ? -63.099  -21.695 -26.029 1.00 66.46  ? 752  THR B CG2  1 
ATOM   8430  H  H    . THR B 1 191 ? -65.338  -20.897 -26.536 1.00 94.98  ? 752  THR B H    1 
ATOM   8431  H  HA   . THR B 1 191 ? -64.978  -19.613 -24.197 1.00 85.53  ? 752  THR B HA   1 
ATOM   8432  H  HB   . THR B 1 191 ? -63.997  -21.674 -24.179 1.00 78.95  ? 752  THR B HB   1 
ATOM   8433  H  HG1  . THR B 1 191 ? -61.886  -21.070 -23.888 1.00 77.23  ? 752  THR B HG1  1 
ATOM   8434  H  HG21 . THR B 1 191 ? -62.465  -22.397 -25.815 1.00 79.75  ? 752  THR B HG21 1 
ATOM   8435  H  HG22 . THR B 1 191 ? -63.856  -22.085 -26.495 1.00 79.75  ? 752  THR B HG22 1 
ATOM   8436  H  HG23 . THR B 1 191 ? -62.670  -21.049 -26.611 1.00 79.75  ? 752  THR B HG23 1 
ATOM   8437  N  N    . TYR B 1 192 ? -62.937  -18.093 -24.937 1.00 65.46  ? 753  TYR B N    1 
ATOM   8438  C  CA   . TYR B 1 192 ? -62.264  -16.891 -25.417 1.00 64.95  ? 753  TYR B CA   1 
ATOM   8439  C  C    . TYR B 1 192 ? -61.213  -17.189 -26.478 1.00 64.14  ? 753  TYR B C    1 
ATOM   8440  O  O    . TYR B 1 192 ? -60.877  -16.297 -27.262 1.00 56.11  ? 753  TYR B O    1 
ATOM   8441  C  CB   . TYR B 1 192 ? -61.610  -16.145 -24.253 1.00 54.10  ? 753  TYR B CB   1 
ATOM   8442  C  CG   . TYR B 1 192 ? -60.295  -16.742 -23.805 1.00 58.44  ? 753  TYR B CG   1 
ATOM   8443  C  CD1  . TYR B 1 192 ? -60.257  -17.755 -22.858 1.00 79.87  ? 753  TYR B CD1  1 
ATOM   8444  C  CD2  . TYR B 1 192 ? -59.090  -16.290 -24.327 1.00 60.93  ? 753  TYR B CD2  1 
ATOM   8445  C  CE1  . TYR B 1 192 ? -59.056  -18.306 -22.446 1.00 73.37  ? 753  TYR B CE1  1 
ATOM   8446  C  CE2  . TYR B 1 192 ? -57.885  -16.834 -23.922 1.00 70.01  ? 753  TYR B CE2  1 
ATOM   8447  C  CZ   . TYR B 1 192 ? -57.874  -17.843 -22.981 1.00 77.36  ? 753  TYR B CZ   1 
ATOM   8448  O  OH   . TYR B 1 192 ? -56.679  -18.391 -22.572 1.00 69.04  ? 753  TYR B OH   1 
ATOM   8449  H  H    . TYR B 1 192 ? -62.660  -18.376 -24.173 1.00 78.55  ? 753  TYR B H    1 
ATOM   8450  H  HA   . TYR B 1 192 ? -62.925  -16.301 -25.813 1.00 77.94  ? 753  TYR B HA   1 
ATOM   8451  H  HB2  . TYR B 1 192 ? -61.442  -15.229 -24.524 1.00 64.91  ? 753  TYR B HB2  1 
ATOM   8452  H  HB3  . TYR B 1 192 ? -62.214  -16.157 -23.495 1.00 64.91  ? 753  TYR B HB3  1 
ATOM   8453  H  HD1  . TYR B 1 192 ? -61.053  -18.072 -22.495 1.00 95.84  ? 753  TYR B HD1  1 
ATOM   8454  H  HD2  . TYR B 1 192 ? -59.094  -15.612 -24.963 1.00 73.11  ? 753  TYR B HD2  1 
ATOM   8455  H  HE1  . TYR B 1 192 ? -59.046  -18.986 -21.811 1.00 88.04  ? 753  TYR B HE1  1 
ATOM   8456  H  HE2  . TYR B 1 192 ? -57.086  -16.522 -24.283 1.00 84.01  ? 753  TYR B HE2  1 
ATOM   8457  H  HH   . TYR B 1 192 ? -56.818  -18.990 -21.999 1.00 82.84  ? 753  TYR B HH   1 
ATOM   8458  N  N    . THR B 1 193 ? -60.683  -18.415 -26.517 1.00 59.14  ? 754  THR B N    1 
ATOM   8459  C  CA   . THR B 1 193 ? -59.676  -18.765 -27.513 1.00 62.97  ? 754  THR B CA   1 
ATOM   8460  C  C    . THR B 1 193 ? -60.237  -18.774 -28.929 1.00 53.09  ? 754  THR B C    1 
ATOM   8461  O  O    . THR B 1 193 ? -59.457  -18.729 -29.886 1.00 51.93  ? 754  THR B O    1 
ATOM   8462  C  CB   . THR B 1 193 ? -59.070  -20.131 -27.194 1.00 63.66  ? 754  THR B CB   1 
ATOM   8463  O  OG1  . THR B 1 193 ? -60.118  -21.072 -26.927 1.00 65.78  ? 754  THR B OG1  1 
ATOM   8464  C  CG2  . THR B 1 193 ? -58.150  -20.030 -25.987 1.00 63.38  ? 754  THR B CG2  1 
ATOM   8465  H  H    . THR B 1 193 ? -60.889  -19.054 -25.980 1.00 70.97  ? 754  THR B H    1 
ATOM   8466  H  HA   . THR B 1 193 ? -58.963  -18.109 -27.480 1.00 75.57  ? 754  THR B HA   1 
ATOM   8467  H  HB   . THR B 1 193 ? -58.548  -20.436 -27.953 1.00 76.39  ? 754  THR B HB   1 
ATOM   8468  H  HG1  . THR B 1 193 ? -59.790  -21.825 -26.751 1.00 78.93  ? 754  THR B HG1  1 
ATOM   8469  H  HG21 . THR B 1 193 ? -57.767  -20.900 -25.789 1.00 76.05  ? 754  THR B HG21 1 
ATOM   8470  H  HG22 . THR B 1 193 ? -57.432  -19.404 -26.169 1.00 76.05  ? 754  THR B HG22 1 
ATOM   8471  H  HG23 . THR B 1 193 ? -58.649  -19.722 -25.214 1.00 76.05  ? 754  THR B HG23 1 
ATOM   8472  N  N    . VAL B 1 194 ? -61.562  -18.843 -29.082 1.00 51.07  ? 755  VAL B N    1 
ATOM   8473  C  CA   . VAL B 1 194 ? -62.171  -18.717 -30.405 1.00 47.61  ? 755  VAL B CA   1 
ATOM   8474  C  C    . VAL B 1 194 ? -61.754  -17.404 -31.054 1.00 53.73  ? 755  VAL B C    1 
ATOM   8475  O  O    . VAL B 1 194 ? -61.432  -17.358 -32.249 1.00 46.70  ? 755  VAL B O    1 
ATOM   8476  C  CB   . VAL B 1 194 ? -63.705  -18.825 -30.296 1.00 56.08  ? 755  VAL B CB   1 
ATOM   8477  C  CG1  . VAL B 1 194 ? -64.386  -18.336 -31.577 1.00 62.51  ? 755  VAL B CG1  1 
ATOM   8478  C  CG2  . VAL B 1 194 ? -64.113  -20.256 -29.978 1.00 58.26  ? 755  VAL B CG2  1 
ATOM   8479  H  H    . VAL B 1 194 ? -62.124  -18.961 -28.442 1.00 61.28  ? 755  VAL B H    1 
ATOM   8480  H  HA   . VAL B 1 194 ? -61.858  -19.442 -30.967 1.00 57.13  ? 755  VAL B HA   1 
ATOM   8481  H  HB   . VAL B 1 194 ? -64.006  -18.262 -29.566 1.00 67.29  ? 755  VAL B HB   1 
ATOM   8482  H  HG11 . VAL B 1 194 ? -65.347  -18.417 -31.474 1.00 75.01  ? 755  VAL B HG11 1 
ATOM   8483  H  HG12 . VAL B 1 194 ? -64.147  -17.408 -31.726 1.00 75.01  ? 755  VAL B HG12 1 
ATOM   8484  H  HG13 . VAL B 1 194 ? -64.085  -18.879 -32.322 1.00 75.01  ? 755  VAL B HG13 1 
ATOM   8485  H  HG21 . VAL B 1 194 ? -65.080  -20.301 -29.914 1.00 69.92  ? 755  VAL B HG21 1 
ATOM   8486  H  HG22 . VAL B 1 194 ? -63.801  -20.838 -30.688 1.00 69.92  ? 755  VAL B HG22 1 
ATOM   8487  H  HG23 . VAL B 1 194 ? -63.713  -20.518 -29.134 1.00 69.92  ? 755  VAL B HG23 1 
ATOM   8488  N  N    . ASP B 1 195 ? -61.755  -16.317 -30.278 1.00 51.98  ? 756  ASP B N    1 
ATOM   8489  C  CA   . ASP B 1 195 ? -61.452  -15.003 -30.833 1.00 46.24  ? 756  ASP B CA   1 
ATOM   8490  C  C    . ASP B 1 195 ? -59.974  -14.853 -31.175 1.00 42.82  ? 756  ASP B C    1 
ATOM   8491  O  O    . ASP B 1 195 ? -59.631  -14.101 -32.093 1.00 52.86  ? 756  ASP B O    1 
ATOM   8492  C  CB   . ASP B 1 195 ? -61.873  -13.910 -29.853 1.00 47.29  ? 756  ASP B CB   1 
ATOM   8493  C  CG   . ASP B 1 195 ? -63.378  -13.816 -29.689 1.00 51.28  ? 756  ASP B CG   1 
ATOM   8494  O  OD1  . ASP B 1 195 ? -64.111  -14.124 -30.652 1.00 53.20  ? 756  ASP B OD1  1 
ATOM   8495  O  OD2  . ASP B 1 195 ? -63.825  -13.422 -28.592 1.00 58.85  ? 756  ASP B OD2  1 
ATOM   8496  H  H    . ASP B 1 195 ? -61.927  -16.316 -29.435 1.00 62.37  ? 756  ASP B H    1 
ATOM   8497  H  HA   . ASP B 1 195 ? -61.960  -14.883 -31.651 1.00 55.49  ? 756  ASP B HA   1 
ATOM   8498  H  HB2  . ASP B 1 195 ? -61.488  -14.101 -28.983 1.00 56.74  ? 756  ASP B HB2  1 
ATOM   8499  H  HB3  . ASP B 1 195 ? -61.553  -13.054 -30.177 1.00 56.74  ? 756  ASP B HB3  1 
ATOM   8500  N  N    . ILE B 1 196 ? -59.088  -15.541 -30.450 1.00 45.22  ? 757  ILE B N    1 
ATOM   8501  C  CA   . ILE B 1 196 ? -57.664  -15.490 -30.777 1.00 50.03  ? 757  ILE B CA   1 
ATOM   8502  C  C    . ILE B 1 196 ? -57.413  -16.086 -32.156 1.00 46.82  ? 757  ILE B C    1 
ATOM   8503  O  O    . ILE B 1 196 ? -56.529  -15.627 -32.889 1.00 45.97  ? 757  ILE B O    1 
ATOM   8504  C  CB   . ILE B 1 196 ? -56.835  -16.216 -29.695 1.00 48.32  ? 757  ILE B CB   1 
ATOM   8505  C  CG1  . ILE B 1 196 ? -57.137  -15.648 -28.302 1.00 51.25  ? 757  ILE B CG1  1 
ATOM   8506  C  CG2  . ILE B 1 196 ? -55.346  -16.118 -30.008 1.00 48.20  ? 757  ILE B CG2  1 
ATOM   8507  C  CD1  . ILE B 1 196 ? -56.830  -14.167 -28.137 1.00 52.01  ? 757  ILE B CD1  1 
ATOM   8508  H  H    . ILE B 1 196 ? -59.283  -16.036 -29.774 1.00 54.26  ? 757  ILE B H    1 
ATOM   8509  H  HA   . ILE B 1 196 ? -57.380  -14.563 -30.797 1.00 60.04  ? 757  ILE B HA   1 
ATOM   8510  H  HB   . ILE B 1 196 ? -57.085  -17.153 -29.701 1.00 57.98  ? 757  ILE B HB   1 
ATOM   8511  H  HG12 . ILE B 1 196 ? -58.080  -15.775 -28.114 1.00 61.50  ? 757  ILE B HG12 1 
ATOM   8512  H  HG13 . ILE B 1 196 ? -56.607  -16.132 -27.649 1.00 61.50  ? 757  ILE B HG13 1 
ATOM   8513  H  HG21 . ILE B 1 196 ? -54.847  -16.580 -29.315 1.00 57.84  ? 757  ILE B HG21 1 
ATOM   8514  H  HG22 . ILE B 1 196 ? -55.176  -16.530 -30.869 1.00 57.84  ? 757  ILE B HG22 1 
ATOM   8515  H  HG23 . ILE B 1 196 ? -55.089  -15.182 -30.032 1.00 57.84  ? 757  ILE B HG23 1 
ATOM   8516  H  HD11 . ILE B 1 196 ? -57.050  -13.898 -27.231 1.00 62.41  ? 757  ILE B HD11 1 
ATOM   8517  H  HD12 . ILE B 1 196 ? -55.886  -14.020 -28.306 1.00 62.41  ? 757  ILE B HD12 1 
ATOM   8518  H  HD13 . ILE B 1 196 ? -57.363  -13.662 -28.771 1.00 62.41  ? 757  ILE B HD13 1 
ATOM   8519  N  N    . PHE B 1 197 ? -58.180  -17.111 -32.532 1.00 54.41  ? 758  PHE B N    1 
ATOM   8520  C  CA   . PHE B 1 197 ? -58.040  -17.696 -33.862 1.00 60.97  ? 758  PHE B CA   1 
ATOM   8521  C  C    . PHE B 1 197 ? -58.470  -16.709 -34.938 1.00 49.50  ? 758  PHE B C    1 
ATOM   8522  O  O    . PHE B 1 197 ? -57.753  -16.497 -35.923 1.00 59.59  ? 758  PHE B O    1 
ATOM   8523  C  CB   . PHE B 1 197 ? -58.859  -18.984 -33.958 1.00 53.18  ? 758  PHE B CB   1 
ATOM   8524  C  CG   . PHE B 1 197 ? -58.769  -19.657 -35.295 1.00 46.71  ? 758  PHE B CG   1 
ATOM   8525  C  CD1  . PHE B 1 197 ? -57.749  -20.552 -35.565 1.00 48.35  ? 758  PHE B CD1  1 
ATOM   8526  C  CD2  . PHE B 1 197 ? -59.699  -19.390 -36.284 1.00 51.18  ? 758  PHE B CD2  1 
ATOM   8527  C  CE1  . PHE B 1 197 ? -57.664  -21.169 -36.793 1.00 59.24  ? 758  PHE B CE1  1 
ATOM   8528  C  CE2  . PHE B 1 197 ? -59.616  -20.007 -37.514 1.00 51.80  ? 758  PHE B CE2  1 
ATOM   8529  C  CZ   . PHE B 1 197 ? -58.601  -20.895 -37.769 1.00 53.19  ? 758  PHE B CZ   1 
ATOM   8530  H  H    . PHE B 1 197 ? -58.782  -17.481 -32.041 1.00 65.29  ? 758  PHE B H    1 
ATOM   8531  H  HA   . PHE B 1 197 ? -57.108  -17.920 -34.013 1.00 73.16  ? 758  PHE B HA   1 
ATOM   8532  H  HB2  . PHE B 1 197 ? -58.540  -19.609 -33.289 1.00 63.82  ? 758  PHE B HB2  1 
ATOM   8533  H  HB3  . PHE B 1 197 ? -59.792  -18.774 -33.794 1.00 63.82  ? 758  PHE B HB3  1 
ATOM   8534  H  HD1  . PHE B 1 197 ? -57.116  -20.740 -34.910 1.00 58.02  ? 758  PHE B HD1  1 
ATOM   8535  H  HD2  . PHE B 1 197 ? -60.389  -18.790 -36.116 1.00 61.42  ? 758  PHE B HD2  1 
ATOM   8536  H  HE1  . PHE B 1 197 ? -56.975  -21.771 -36.965 1.00 71.09  ? 758  PHE B HE1  1 
ATOM   8537  H  HE2  . PHE B 1 197 ? -60.248  -19.821 -38.170 1.00 62.17  ? 758  PHE B HE2  1 
ATOM   8538  H  HZ   . PHE B 1 197 ? -58.544  -21.311 -38.599 1.00 63.83  ? 758  PHE B HZ   1 
ATOM   8539  N  N    . SER B 1 198 ? -59.648  -16.104 -34.770 1.00 46.68  ? 759  SER B N    1 
ATOM   8540  C  CA   . SER B 1 198 ? -60.098  -15.077 -35.703 1.00 50.11  ? 759  SER B CA   1 
ATOM   8541  C  C    . SER B 1 198 ? -59.113  -13.915 -35.757 1.00 42.04  ? 759  SER B C    1 
ATOM   8542  O  O    . SER B 1 198 ? -58.857  -13.357 -36.830 1.00 38.96  ? 759  SER B O    1 
ATOM   8543  C  CB   . SER B 1 198 ? -61.482  -14.580 -35.293 1.00 38.25  ? 759  SER B CB   1 
ATOM   8544  O  OG   . SER B 1 198 ? -62.368  -15.658 -35.070 1.00 56.40  ? 759  SER B OG   1 
ATOM   8545  H  H    . SER B 1 198 ? -60.198  -16.270 -34.131 1.00 56.01  ? 759  SER B H    1 
ATOM   8546  H  HA   . SER B 1 198 ? -60.165  -15.460 -36.591 1.00 60.14  ? 759  SER B HA   1 
ATOM   8547  H  HB2  . SER B 1 198 ? -61.402  -14.064 -34.475 1.00 45.90  ? 759  SER B HB2  1 
ATOM   8548  H  HB3  . SER B 1 198 ? -61.839  -14.022 -36.002 1.00 45.90  ? 759  SER B HB3  1 
ATOM   8549  H  HG   . SER B 1 198 ? -63.123  -15.367 -34.846 1.00 67.69  ? 759  SER B HG   1 
ATOM   8550  N  N    . ALA B 1 199 ? -58.548  -13.542 -34.607 1.00 46.29  ? 760  ALA B N    1 
ATOM   8551  C  CA   . ALA B 1 199 ? -57.601  -12.435 -34.568 1.00 37.27  ? 760  ALA B CA   1 
ATOM   8552  C  C    . ALA B 1 199 ? -56.343  -12.759 -35.360 1.00 53.45  ? 760  ALA B C    1 
ATOM   8553  O  O    . ALA B 1 199 ? -55.827  -11.908 -36.093 1.00 44.88  ? 760  ALA B O    1 
ATOM   8554  C  CB   . ALA B 1 199 ? -57.248  -12.100 -33.120 1.00 46.59  ? 760  ALA B CB   1 
ATOM   8555  H  H    . ALA B 1 199 ? -58.696  -13.912 -33.845 1.00 55.55  ? 760  ALA B H    1 
ATOM   8556  H  HA   . ALA B 1 199 ? -58.013  -11.652 -34.966 1.00 44.72  ? 760  ALA B HA   1 
ATOM   8557  H  HB1  . ALA B 1 199 ? -56.618  -11.362 -33.111 1.00 55.90  ? 760  ALA B HB1  1 
ATOM   8558  H  HB2  . ALA B 1 199 ? -58.058  -11.850 -32.648 1.00 55.90  ? 760  ALA B HB2  1 
ATOM   8559  H  HB3  . ALA B 1 199 ? -56.850  -12.881 -32.704 1.00 55.90  ? 760  ALA B HB3  1 
ATOM   8560  N  N    . GLY B 1 200 ? -55.832  -13.985 -35.223 1.00 49.27  ? 761  GLY B N    1 
ATOM   8561  C  CA   . GLY B 1 200 ? -54.666  -14.374 -35.999 1.00 45.49  ? 761  GLY B CA   1 
ATOM   8562  C  C    . GLY B 1 200 ? -54.899  -14.262 -37.494 1.00 47.44  ? 761  GLY B C    1 
ATOM   8563  O  O    . GLY B 1 200 ? -54.014  -13.833 -38.240 1.00 34.41  ? 761  GLY B O    1 
ATOM   8564  H  H    . GLY B 1 200 ? -56.138  -14.594 -34.699 1.00 59.13  ? 761  GLY B H    1 
ATOM   8565  H  HA2  . GLY B 1 200 ? -53.916  -13.805 -35.762 1.00 54.59  ? 761  GLY B HA2  1 
ATOM   8566  H  HA3  . GLY B 1 200 ? -54.433  -15.292 -35.792 1.00 54.59  ? 761  GLY B HA3  1 
ATOM   8567  N  N    . CYS B 1 201 ? -56.097  -14.629 -37.951 1.00 35.69  ? 762  CYS B N    1 
ATOM   8568  C  CA   . CYS B 1 201 ? -56.438  -14.442 -39.356 1.00 41.90  ? 762  CYS B CA   1 
ATOM   8569  C  C    . CYS B 1 201 ? -56.424  -12.965 -39.730 1.00 39.68  ? 762  CYS B C    1 
ATOM   8570  O  O    . CYS B 1 201 ? -55.920  -12.587 -40.794 1.00 44.52  ? 762  CYS B O    1 
ATOM   8571  C  CB   . CYS B 1 201 ? -57.805  -15.053 -39.648 1.00 49.86  ? 762  CYS B CB   1 
ATOM   8572  S  SG   . CYS B 1 201 ? -57.842  -16.857 -39.527 1.00 47.93  ? 762  CYS B SG   1 
ATOM   8573  H  H    . CYS B 1 201 ? -56.719  -14.983 -37.474 1.00 42.82  ? 762  CYS B H    1 
ATOM   8574  H  HA   . CYS B 1 201 ? -55.781  -14.898 -39.905 1.00 50.28  ? 762  CYS B HA   1 
ATOM   8575  H  HB2  . CYS B 1 201 ? -58.447  -14.701 -39.011 1.00 59.83  ? 762  CYS B HB2  1 
ATOM   8576  H  HB3  . CYS B 1 201 ? -58.070  -14.811 -40.549 1.00 59.83  ? 762  CYS B HB3  1 
ATOM   8577  H  HG   . CYS B 1 201 ? -57.533  -17.180 -38.414 1.00 57.51  ? 762  CYS B HG   1 
ATOM   8578  N  N    . VAL B 1 202 ? -56.978  -12.112 -38.865 1.00 42.77  ? 763  VAL B N    1 
ATOM   8579  C  CA   . VAL B 1 202 ? -56.986  -10.675 -39.134 1.00 43.82  ? 763  VAL B CA   1 
ATOM   8580  C  C    . VAL B 1 202 ? -55.564  -10.129 -39.153 1.00 42.28  ? 763  VAL B C    1 
ATOM   8581  O  O    . VAL B 1 202 ? -55.236  -9.249  -39.957 1.00 41.68  ? 763  VAL B O    1 
ATOM   8582  C  CB   . VAL B 1 202 ? -57.858  -9.945  -38.093 1.00 24.95  ? 763  VAL B CB   1 
ATOM   8583  C  CG1  . VAL B 1 202 ? -57.675  -8.433  -38.186 1.00 46.91  ? 763  VAL B CG1  1 
ATOM   8584  C  CG2  . VAL B 1 202 ? -59.315  -10.316 -38.275 1.00 33.30  ? 763  VAL B CG2  1 
ATOM   8585  H  H    . VAL B 1 202 ? -57.352  -12.338 -38.125 1.00 51.32  ? 763  VAL B H    1 
ATOM   8586  H  HA   . VAL B 1 202 ? -57.376  -10.521 -40.008 1.00 52.58  ? 763  VAL B HA   1 
ATOM   8587  H  HB   . VAL B 1 202 ? -57.588  -10.224 -37.204 1.00 29.94  ? 763  VAL B HB   1 
ATOM   8588  H  HG11 . VAL B 1 202 ? -58.236  -8.005  -37.520 1.00 56.29  ? 763  VAL B HG11 1 
ATOM   8589  H  HG12 . VAL B 1 202 ? -56.743  -8.218  -38.023 1.00 56.29  ? 763  VAL B HG12 1 
ATOM   8590  H  HG13 . VAL B 1 202 ? -57.932  -8.138  -39.074 1.00 56.29  ? 763  VAL B HG13 1 
ATOM   8591  H  HG21 . VAL B 1 202 ? -59.845  -9.847  -37.611 1.00 39.96  ? 763  VAL B HG21 1 
ATOM   8592  H  HG22 . VAL B 1 202 ? -59.597  -10.059 -39.166 1.00 39.96  ? 763  VAL B HG22 1 
ATOM   8593  H  HG23 . VAL B 1 202 ? -59.413  -11.274 -38.160 1.00 39.96  ? 763  VAL B HG23 1 
ATOM   8594  N  N    . PHE B 1 203 ? -54.705  -10.627 -38.258 1.00 37.11  ? 764  PHE B N    1 
ATOM   8595  C  CA   . PHE B 1 203 ? -53.311  -10.191 -38.238 1.00 34.38  ? 764  PHE B CA   1 
ATOM   8596  C  C    . PHE B 1 203 ? -52.652  -10.421 -39.591 1.00 46.46  ? 764  PHE B C    1 
ATOM   8597  O  O    . PHE B 1 203 ? -51.994  -9.527  -40.136 1.00 47.29  ? 764  PHE B O    1 
ATOM   8598  C  CB   . PHE B 1 203 ? -52.544  -10.931 -37.140 1.00 42.80  ? 764  PHE B CB   1 
ATOM   8599  C  CG   . PHE B 1 203 ? -52.545  -10.230 -35.812 1.00 41.41  ? 764  PHE B CG   1 
ATOM   8600  C  CD1  . PHE B 1 203 ? -53.732  -9.886  -35.192 1.00 45.55  ? 764  PHE B CD1  1 
ATOM   8601  C  CD2  . PHE B 1 203 ? -51.355  -9.936  -35.172 1.00 43.82  ? 764  PHE B CD2  1 
ATOM   8602  C  CE1  . PHE B 1 203 ? -53.730  -9.249  -33.968 1.00 37.05  ? 764  PHE B CE1  1 
ATOM   8603  C  CE2  . PHE B 1 203 ? -51.349  -9.304  -33.946 1.00 39.36  ? 764  PHE B CE2  1 
ATOM   8604  C  CZ   . PHE B 1 203 ? -52.536  -8.960  -33.346 1.00 41.84  ? 764  PHE B CZ   1 
ATOM   8605  H  H    . PHE B 1 203 ? -54.904  -11.211 -37.659 1.00 44.53  ? 764  PHE B H    1 
ATOM   8606  H  HA   . PHE B 1 203 ? -53.277  -9.242  -38.043 1.00 41.26  ? 764  PHE B HA   1 
ATOM   8607  H  HB2  . PHE B 1 203 ? -52.946  -11.804 -37.014 1.00 51.36  ? 764  PHE B HB2  1 
ATOM   8608  H  HB3  . PHE B 1 203 ? -51.621  -11.032 -37.420 1.00 51.36  ? 764  PHE B HB3  1 
ATOM   8609  H  HD1  . PHE B 1 203 ? -54.541  -10.079 -35.609 1.00 54.66  ? 764  PHE B HD1  1 
ATOM   8610  H  HD2  . PHE B 1 203 ? -50.548  -10.166 -35.573 1.00 52.59  ? 764  PHE B HD2  1 
ATOM   8611  H  HE1  . PHE B 1 203 ? -54.535  -9.019  -33.562 1.00 44.46  ? 764  PHE B HE1  1 
ATOM   8612  H  HE2  . PHE B 1 203 ? -50.542  -9.107  -33.528 1.00 47.23  ? 764  PHE B HE2  1 
ATOM   8613  H  HZ   . PHE B 1 203 ? -52.533  -8.531  -32.521 1.00 50.21  ? 764  PHE B HZ   1 
ATOM   8614  N  N    . TYR B 1 204 ? -52.830  -11.619 -40.155 1.00 46.48  ? 765  TYR B N    1 
ATOM   8615  C  CA   . TYR B 1 204 ? -52.250  -11.920 -41.458 1.00 51.61  ? 765  TYR B CA   1 
ATOM   8616  C  C    . TYR B 1 204 ? -52.951  -11.149 -42.565 1.00 38.84  ? 765  TYR B C    1 
ATOM   8617  O  O    . TYR B 1 204 ? -52.308  -10.743 -43.539 1.00 52.00  ? 765  TYR B O    1 
ATOM   8618  C  CB   . TYR B 1 204 ? -52.320  -13.425 -41.727 1.00 64.23  ? 765  TYR B CB   1 
ATOM   8619  C  CG   . TYR B 1 204 ? -51.641  -13.865 -43.008 1.00 49.84  ? 765  TYR B CG   1 
ATOM   8620  C  CD1  . TYR B 1 204 ? -50.265  -14.043 -43.063 1.00 47.39  ? 765  TYR B CD1  1 
ATOM   8621  C  CD2  . TYR B 1 204 ? -52.379  -14.110 -44.160 1.00 48.09  ? 765  TYR B CD2  1 
ATOM   8622  C  CE1  . TYR B 1 204 ? -49.642  -14.450 -44.228 1.00 61.63  ? 765  TYR B CE1  1 
ATOM   8623  C  CE2  . TYR B 1 204 ? -51.766  -14.515 -45.329 1.00 54.82  ? 765  TYR B CE2  1 
ATOM   8624  C  CZ   . TYR B 1 204 ? -50.395  -14.685 -45.358 1.00 67.94  ? 765  TYR B CZ   1 
ATOM   8625  O  OH   . TYR B 1 204 ? -49.772  -15.091 -46.517 1.00 50.16  ? 765  TYR B OH   1 
ATOM   8626  H  H    . TYR B 1 204 ? -53.278  -12.265 -39.805 1.00 55.78  ? 765  TYR B H    1 
ATOM   8627  H  HA   . TYR B 1 204 ? -51.316  -11.659 -41.456 1.00 61.93  ? 765  TYR B HA   1 
ATOM   8628  H  HB2  . TYR B 1 204 ? -51.892  -13.891 -40.992 1.00 77.07  ? 765  TYR B HB2  1 
ATOM   8629  H  HB3  . TYR B 1 204 ? -53.252  -13.687 -41.783 1.00 77.07  ? 765  TYR B HB3  1 
ATOM   8630  H  HD1  . TYR B 1 204 ? -49.754  -13.886 -42.302 1.00 56.87  ? 765  TYR B HD1  1 
ATOM   8631  H  HD2  . TYR B 1 204 ? -53.302  -13.997 -44.143 1.00 57.71  ? 765  TYR B HD2  1 
ATOM   8632  H  HE1  . TYR B 1 204 ? -48.719  -14.564 -44.249 1.00 73.96  ? 765  TYR B HE1  1 
ATOM   8633  H  HE2  . TYR B 1 204 ? -52.273  -14.675 -46.092 1.00 65.79  ? 765  TYR B HE2  1 
ATOM   8634  H  HH   . TYR B 1 204 ? -50.340  -15.198 -47.127 1.00 60.20  ? 765  TYR B HH   1 
ATOM   8635  N  N    . TYR B 1 205 ? -54.258  -10.927 -42.427 1.00 44.75  ? 766  TYR B N    1 
ATOM   8636  C  CA   . TYR B 1 205 ? -54.996  -10.175 -43.436 1.00 54.11  ? 766  TYR B CA   1 
ATOM   8637  C  C    . TYR B 1 205 ? -54.446  -8.762  -43.594 1.00 49.85  ? 766  TYR B C    1 
ATOM   8638  O  O    . TYR B 1 205 ? -54.340  -8.253  -44.715 1.00 61.61  ? 766  TYR B O    1 
ATOM   8639  C  CB   . TYR B 1 205 ? -56.476  -10.138 -43.066 1.00 40.22  ? 766  TYR B CB   1 
ATOM   8640  C  CG   . TYR B 1 205 ? -57.350  -9.349  -44.012 1.00 49.50  ? 766  TYR B CG   1 
ATOM   8641  C  CD1  . TYR B 1 205 ? -57.755  -9.887  -45.223 1.00 56.05  ? 766  TYR B CD1  1 
ATOM   8642  C  CD2  . TYR B 1 205 ? -57.795  -8.076  -43.679 1.00 56.39  ? 766  TYR B CD2  1 
ATOM   8643  C  CE1  . TYR B 1 205 ? -58.564  -9.176  -46.086 1.00 53.07  ? 766  TYR B CE1  1 
ATOM   8644  C  CE2  . TYR B 1 205 ? -58.606  -7.357  -44.534 1.00 53.50  ? 766  TYR B CE2  1 
ATOM   8645  C  CZ   . TYR B 1 205 ? -58.988  -7.911  -45.736 1.00 53.57  ? 766  TYR B CZ   1 
ATOM   8646  O  OH   . TYR B 1 205 ? -59.798  -7.200  -46.591 1.00 47.71  ? 766  TYR B OH   1 
ATOM   8647  H  H    . TYR B 1 205 ? -54.735  -11.199 -41.765 1.00 53.69  ? 766  TYR B H    1 
ATOM   8648  H  HA   . TYR B 1 205 ? -54.912  -10.627 -44.291 1.00 64.93  ? 766  TYR B HA   1 
ATOM   8649  H  HB2  . TYR B 1 205 ? -56.812  -11.048 -43.048 1.00 48.26  ? 766  TYR B HB2  1 
ATOM   8650  H  HB3  . TYR B 1 205 ? -56.564  -9.741  -42.186 1.00 48.26  ? 766  TYR B HB3  1 
ATOM   8651  H  HD1  . TYR B 1 205 ? -57.471  -10.740 -45.461 1.00 67.26  ? 766  TYR B HD1  1 
ATOM   8652  H  HD2  . TYR B 1 205 ? -57.538  -7.700  -42.868 1.00 67.67  ? 766  TYR B HD2  1 
ATOM   8653  H  HE1  . TYR B 1 205 ? -58.824  -9.549  -46.897 1.00 63.69  ? 766  TYR B HE1  1 
ATOM   8654  H  HE2  . TYR B 1 205 ? -58.893  -6.503  -44.300 1.00 64.20  ? 766  TYR B HE2  1 
ATOM   8655  H  HH   . TYR B 1 205 ? -59.954  -7.652  -47.281 1.00 57.25  ? 766  TYR B HH   1 
ATOM   8656  N  N    . VAL B 1 206 ? -54.089  -8.114  -42.486 1.00 48.32  ? 767  VAL B N    1 
ATOM   8657  C  CA   . VAL B 1 206 ? -53.602  -6.739  -42.554 1.00 55.05  ? 767  VAL B CA   1 
ATOM   8658  C  C    . VAL B 1 206 ? -52.166  -6.697  -43.065 1.00 43.97  ? 767  VAL B C    1 
ATOM   8659  O  O    . VAL B 1 206 ? -51.839  -5.920  -43.968 1.00 51.05  ? 767  VAL B O    1 
ATOM   8660  C  CB   . VAL B 1 206 ? -53.736  -6.065  -41.175 1.00 54.03  ? 767  VAL B CB   1 
ATOM   8661  C  CG1  . VAL B 1 206 ? -53.044  -4.701  -41.155 1.00 43.80  ? 767  VAL B CG1  1 
ATOM   8662  C  CG2  . VAL B 1 206 ? -55.203  -5.918  -40.808 1.00 50.38  ? 767  VAL B CG2  1 
ATOM   8663  H  H    . VAL B 1 206 ? -54.118  -8.444  -41.692 1.00 57.99  ? 767  VAL B H    1 
ATOM   8664  H  HA   . VAL B 1 206 ? -54.153  -6.243  -43.179 1.00 66.06  ? 767  VAL B HA   1 
ATOM   8665  H  HB   . VAL B 1 206 ? -53.314  -6.626  -40.505 1.00 64.83  ? 767  VAL B HB   1 
ATOM   8666  H  HG11 . VAL B 1 206 ? -53.148  -4.307  -40.275 1.00 52.56  ? 767  VAL B HG11 1 
ATOM   8667  H  HG12 . VAL B 1 206 ? -52.102  -4.823  -41.355 1.00 52.56  ? 767  VAL B HG12 1 
ATOM   8668  H  HG13 . VAL B 1 206 ? -53.453  -4.130  -41.824 1.00 52.56  ? 767  VAL B HG13 1 
ATOM   8669  H  HG21 . VAL B 1 206 ? -55.270  -5.492  -39.939 1.00 60.45  ? 767  VAL B HG21 1 
ATOM   8670  H  HG22 . VAL B 1 206 ? -55.642  -5.372  -41.479 1.00 60.45  ? 767  VAL B HG22 1 
ATOM   8671  H  HG23 . VAL B 1 206 ? -55.611  -6.798  -40.779 1.00 60.45  ? 767  VAL B HG23 1 
ATOM   8672  N  N    . ILE B 1 207 ? -51.290  -7.536  -42.509 1.00 45.45  ? 768  ILE B N    1 
ATOM   8673  C  CA   . ILE B 1 207 ? -49.886  -7.514  -42.913 1.00 39.77  ? 768  ILE B CA   1 
ATOM   8674  C  C    . ILE B 1 207 ? -49.743  -7.897  -44.381 1.00 56.69  ? 768  ILE B C    1 
ATOM   8675  O  O    . ILE B 1 207 ? -48.934  -7.315  -45.113 1.00 59.73  ? 768  ILE B O    1 
ATOM   8676  C  CB   . ILE B 1 207 ? -49.055  -8.446  -42.014 1.00 42.79  ? 768  ILE B CB   1 
ATOM   8677  C  CG1  . ILE B 1 207 ? -49.118  -7.981  -40.561 1.00 41.04  ? 768  ILE B CG1  1 
ATOM   8678  C  CG2  . ILE B 1 207 ? -47.603  -8.501  -42.494 1.00 59.31  ? 768  ILE B CG2  1 
ATOM   8679  C  CD1  . ILE B 1 207 ? -48.483  -8.956  -39.578 1.00 64.69  ? 768  ILE B CD1  1 
ATOM   8680  H  H    . ILE B 1 207 ? -51.481  -8.119  -41.906 1.00 54.55  ? 768  ILE B H    1 
ATOM   8681  H  HA   . ILE B 1 207 ? -49.543  -6.613  -42.805 1.00 47.72  ? 768  ILE B HA   1 
ATOM   8682  H  HB   . ILE B 1 207 ? -49.430  -9.339  -42.067 1.00 51.35  ? 768  ILE B HB   1 
ATOM   8683  H  HG12 . ILE B 1 207 ? -48.652  -7.134  -40.483 1.00 49.25  ? 768  ILE B HG12 1 
ATOM   8684  H  HG13 . ILE B 1 207 ? -50.048  -7.868  -40.309 1.00 49.25  ? 768  ILE B HG13 1 
ATOM   8685  H  HG21 . ILE B 1 207 ? -47.101  -9.093  -41.914 1.00 71.18  ? 768  ILE B HG21 1 
ATOM   8686  H  HG22 . ILE B 1 207 ? -47.585  -8.835  -43.405 1.00 71.18  ? 768  ILE B HG22 1 
ATOM   8687  H  HG23 . ILE B 1 207 ? -47.227  -7.607  -42.462 1.00 71.18  ? 768  ILE B HG23 1 
ATOM   8688  H  HD11 . ILE B 1 207 ? -48.561  -8.595  -38.681 1.00 77.62  ? 768  ILE B HD11 1 
ATOM   8689  H  HD12 . ILE B 1 207 ? -48.946  -9.806  -39.635 1.00 77.62  ? 768  ILE B HD12 1 
ATOM   8690  H  HD13 . ILE B 1 207 ? -47.548  -9.072  -39.809 1.00 77.62  ? 768  ILE B HD13 1 
ATOM   8691  N  N    . SER B 1 208 ? -50.512  -8.888  -44.828 1.00 50.77  ? 769  SER B N    1 
ATOM   8692  C  CA   . SER B 1 208 ? -50.423  -9.381  -46.197 1.00 51.06  ? 769  SER B CA   1 
ATOM   8693  C  C    . SER B 1 208 ? -51.237  -8.553  -47.181 1.00 56.30  ? 769  SER B C    1 
ATOM   8694  O  O    . SER B 1 208 ? -51.154  -8.803  -48.388 1.00 54.50  ? 769  SER B O    1 
ATOM   8695  C  CB   . SER B 1 208 ? -50.877  -10.844 -46.261 1.00 63.23  ? 769  SER B CB   1 
ATOM   8696  O  OG   . SER B 1 208 ? -52.253  -10.980 -45.951 1.00 48.06  ? 769  SER B OG   1 
ATOM   8697  H  H    . SER B 1 208 ? -51.100  -9.295  -44.350 1.00 60.93  ? 769  SER B H    1 
ATOM   8698  H  HA   . SER B 1 208 ? -49.496  -9.347  -46.479 1.00 61.28  ? 769  SER B HA   1 
ATOM   8699  H  HB2  . SER B 1 208 ? -50.723  -11.180 -47.158 1.00 75.87  ? 769  SER B HB2  1 
ATOM   8700  H  HB3  . SER B 1 208 ? -50.359  -11.360 -45.623 1.00 75.87  ? 769  SER B HB3  1 
ATOM   8701  H  HG   . SER B 1 208 ? -52.715  -10.540 -46.497 1.00 57.67  ? 769  SER B HG   1 
ATOM   8702  N  N    . GLU B 1 209 ? -51.994  -7.566  -46.703 1.00 44.44  ? 770  GLU B N    1 
ATOM   8703  C  CA   . GLU B 1 209 ? -52.747  -6.655  -47.563 1.00 57.86  ? 770  GLU B CA   1 
ATOM   8704  C  C    . GLU B 1 209 ? -53.749  -7.400  -48.453 1.00 50.29  ? 770  GLU B C    1 
ATOM   8705  O  O    . GLU B 1 209 ? -53.754  -7.267  -49.679 1.00 59.18  ? 770  GLU B O    1 
ATOM   8706  C  CB   . GLU B 1 209 ? -51.784  -5.805  -48.397 1.00 49.77  ? 770  GLU B CB   1 
ATOM   8707  C  CG   . GLU B 1 209 ? -50.704  -5.136  -47.558 1.00 59.66  ? 770  GLU B CG   1 
ATOM   8708  C  CD   . GLU B 1 209 ? -49.813  -4.212  -48.361 1.00 67.80  ? 770  GLU B CD   1 
ATOM   8709  O  OE1  . GLU B 1 209 ? -48.848  -3.670  -47.781 1.00 64.40  ? 770  GLU B OE1  1 
ATOM   8710  O  OE2  . GLU B 1 209 ? -50.074  -4.026  -49.568 1.00 80.39  ? 770  GLU B OE2  1 
ATOM   8711  H  H    . GLU B 1 209 ? -52.089  -7.400  -45.865 1.00 53.32  ? 770  GLU B H    1 
ATOM   8712  H  HA   . GLU B 1 209 ? -53.255  -6.051  -46.999 1.00 69.43  ? 770  GLU B HA   1 
ATOM   8713  H  HB2  . GLU B 1 209 ? -51.347  -6.374  -49.050 1.00 59.73  ? 770  GLU B HB2  1 
ATOM   8714  H  HB3  . GLU B 1 209 ? -52.287  -5.109  -48.848 1.00 59.73  ? 770  GLU B HB3  1 
ATOM   8715  H  HG2  . GLU B 1 209 ? -51.128  -4.611  -46.861 1.00 71.59  ? 770  GLU B HG2  1 
ATOM   8716  H  HG3  . GLU B 1 209 ? -50.144  -5.822  -47.162 1.00 71.59  ? 770  GLU B HG3  1 
ATOM   8717  N  N    . GLY B 1 210 ? -54.621  -8.175  -47.801 1.00 64.25  ? 771  GLY B N    1 
ATOM   8718  C  CA   . GLY B 1 210 ? -55.742  -8.833  -48.452 1.00 54.83  ? 771  GLY B CA   1 
ATOM   8719  C  C    . GLY B 1 210 ? -55.656  -10.341 -48.556 1.00 48.52  ? 771  GLY B C    1 
ATOM   8720  O  O    . GLY B 1 210 ? -56.644  -10.967 -48.962 1.00 52.22  ? 771  GLY B O    1 
ATOM   8721  H  H    . GLY B 1 210 ? -54.576  -8.336  -46.958 1.00 77.10  ? 771  GLY B H    1 
ATOM   8722  H  HA2  . GLY B 1 210 ? -56.554  -8.617  -47.967 1.00 65.79  ? 771  GLY B HA2  1 
ATOM   8723  H  HA3  . GLY B 1 210 ? -55.831  -8.480  -49.351 1.00 65.79  ? 771  GLY B HA3  1 
ATOM   8724  N  N    . SER B 1 211 ? -54.531  -10.949 -48.196 1.00 56.96  ? 772  SER B N    1 
ATOM   8725  C  CA   . SER B 1 211 ? -54.392  -12.399 -48.231 1.00 60.18  ? 772  SER B CA   1 
ATOM   8726  C  C    . SER B 1 211 ? -54.755  -13.003 -46.881 1.00 58.08  ? 772  SER B C    1 
ATOM   8727  O  O    . SER B 1 211 ? -54.469  -12.427 -45.829 1.00 61.60  ? 772  SER B O    1 
ATOM   8728  C  CB   . SER B 1 211 ? -52.967  -12.801 -48.608 1.00 54.04  ? 772  SER B CB   1 
ATOM   8729  O  OG   . SER B 1 211 ? -52.753  -12.664 -50.001 1.00 86.00  ? 772  SER B OG   1 
ATOM   8730  H  H    . SER B 1 211 ? -53.826  -10.539 -47.924 1.00 68.36  ? 772  SER B H    1 
ATOM   8731  H  HA   . SER B 1 211 ? -54.996  -12.762 -48.897 1.00 72.22  ? 772  SER B HA   1 
ATOM   8732  H  HB2  . SER B 1 211 ? -52.343  -12.229 -48.136 1.00 64.85  ? 772  SER B HB2  1 
ATOM   8733  H  HB3  . SER B 1 211 ? -52.824  -13.727 -48.357 1.00 64.85  ? 772  SER B HB3  1 
ATOM   8734  H  HG   . SER B 1 211 ? -51.966  -12.888 -50.194 1.00 103.20 ? 772  SER B HG   1 
ATOM   8735  N  N    . HIS B 1 212 ? -55.363  -14.177 -46.923 1.00 53.21  ? 773  HIS B N    1 
ATOM   8736  C  CA   . HIS B 1 212 ? -55.861  -14.872 -45.750 1.00 57.15  ? 773  HIS B CA   1 
ATOM   8737  C  C    . HIS B 1 212 ? -55.067  -16.162 -45.556 1.00 56.72  ? 773  HIS B C    1 
ATOM   8738  O  O    . HIS B 1 212 ? -54.655  -16.783 -46.540 1.00 71.93  ? 773  HIS B O    1 
ATOM   8739  C  CB   . HIS B 1 212 ? -57.350  -15.190 -45.952 1.00 46.68  ? 773  HIS B CB   1 
ATOM   8740  C  CG   . HIS B 1 212 ? -58.052  -15.700 -44.733 1.00 55.26  ? 773  HIS B CG   1 
ATOM   8741  N  ND1  . HIS B 1 212 ? -57.981  -17.014 -44.327 1.00 57.82  ? 773  HIS B ND1  1 
ATOM   8742  C  CD2  . HIS B 1 212 ? -58.876  -15.081 -43.856 1.00 56.99  ? 773  HIS B CD2  1 
ATOM   8743  C  CE1  . HIS B 1 212 ? -58.712  -17.178 -43.239 1.00 62.58  ? 773  HIS B CE1  1 
ATOM   8744  N  NE2  . HIS B 1 212 ? -59.266  -16.019 -42.932 1.00 56.26  ? 773  HIS B NE2  1 
ATOM   8745  H  H    . HIS B 1 212 ? -55.504  -14.608 -47.653 1.00 63.86  ? 773  HIS B H    1 
ATOM   8746  H  HA   . HIS B 1 212 ? -55.760  -14.315 -44.963 1.00 68.57  ? 773  HIS B HA   1 
ATOM   8747  H  HB2  . HIS B 1 212 ? -57.804  -14.381 -46.235 1.00 56.01  ? 773  HIS B HB2  1 
ATOM   8748  H  HB3  . HIS B 1 212 ? -57.431  -15.867 -46.642 1.00 56.01  ? 773  HIS B HB3  1 
ATOM   8749  H  HD1  . HIS B 1 212 ? -57.523  -17.630 -44.715 1.00 69.38  ? 773  HIS B HD1  1 
ATOM   8750  H  HD2  . HIS B 1 212 ? -59.122  -14.184 -43.869 1.00 68.39  ? 773  HIS B HD2  1 
ATOM   8751  H  HE1  . HIS B 1 212 ? -58.818  -17.974 -42.770 1.00 75.10  ? 773  HIS B HE1  1 
ATOM   8752  H  HE2  . HIS B 1 212 ? -59.786  -15.876 -42.263 1.00 67.51  ? 773  HIS B HE2  1 
ATOM   8753  N  N    . PRO B 1 213 ? -54.823  -16.597 -44.313 1.00 53.97  ? 774  PRO B N    1 
ATOM   8754  C  CA   . PRO B 1 213 ? -53.925  -17.752 -44.134 1.00 45.25  ? 774  PRO B CA   1 
ATOM   8755  C  C    . PRO B 1 213 ? -54.485  -19.038 -44.713 1.00 62.36  ? 774  PRO B C    1 
ATOM   8756  O  O    . PRO B 1 213 ? -53.728  -19.851 -45.258 1.00 68.37  ? 774  PRO B O    1 
ATOM   8757  C  CB   . PRO B 1 213 ? -53.759  -17.838 -42.609 1.00 39.72  ? 774  PRO B CB   1 
ATOM   8758  C  CG   . PRO B 1 213 ? -54.168  -16.517 -42.093 1.00 45.67  ? 774  PRO B CG   1 
ATOM   8759  C  CD   . PRO B 1 213 ? -55.226  -16.021 -43.018 1.00 52.51  ? 774  PRO B CD   1 
ATOM   8760  H  HA   . PRO B 1 213 ? -53.063  -17.570 -44.539 1.00 54.30  ? 774  PRO B HA   1 
ATOM   8761  H  HB2  . PRO B 1 213 ? -54.334  -18.535 -42.258 1.00 47.67  ? 774  PRO B HB2  1 
ATOM   8762  H  HB3  . PRO B 1 213 ? -52.831  -18.017 -42.392 1.00 47.67  ? 774  PRO B HB3  1 
ATOM   8763  H  HG2  . PRO B 1 213 ? -54.521  -16.615 -41.195 1.00 54.80  ? 774  PRO B HG2  1 
ATOM   8764  H  HG3  . PRO B 1 213 ? -53.406  -15.917 -42.096 1.00 54.80  ? 774  PRO B HG3  1 
ATOM   8765  H  HD2  . PRO B 1 213 ? -56.096  -16.358 -42.752 1.00 63.01  ? 774  PRO B HD2  1 
ATOM   8766  H  HD3  . PRO B 1 213 ? -55.215  -15.052 -43.059 1.00 63.01  ? 774  PRO B HD3  1 
ATOM   8767  N  N    . PHE B 1 214 ? -55.792  -19.244 -44.599 1.00 63.48  ? 775  PHE B N    1 
ATOM   8768  C  CA   . PHE B 1 214 ? -56.481  -20.403 -45.146 1.00 60.16  ? 775  PHE B CA   1 
ATOM   8769  C  C    . PHE B 1 214 ? -56.991  -20.177 -46.568 1.00 70.08  ? 775  PHE B C    1 
ATOM   8770  O  O    . PHE B 1 214 ? -57.722  -21.024 -47.092 1.00 70.73  ? 775  PHE B O    1 
ATOM   8771  C  CB   . PHE B 1 214 ? -57.625  -20.804 -44.216 1.00 56.92  ? 775  PHE B CB   1 
ATOM   8772  C  CG   . PHE B 1 214 ? -57.163  -21.162 -42.833 1.00 61.17  ? 775  PHE B CG   1 
ATOM   8773  C  CD1  . PHE B 1 214 ? -57.002  -20.184 -41.866 1.00 58.26  ? 775  PHE B CD1  1 
ATOM   8774  C  CD2  . PHE B 1 214 ? -56.864  -22.474 -42.506 1.00 61.90  ? 775  PHE B CD2  1 
ATOM   8775  C  CE1  . PHE B 1 214 ? -56.564  -20.511 -40.596 1.00 69.72  ? 775  PHE B CE1  1 
ATOM   8776  C  CE2  . PHE B 1 214 ? -56.426  -22.807 -41.239 1.00 63.56  ? 775  PHE B CE2  1 
ATOM   8777  C  CZ   . PHE B 1 214 ? -56.276  -21.824 -40.282 1.00 74.30  ? 775  PHE B CZ   1 
ATOM   8778  H  H    . PHE B 1 214 ? -56.321  -18.701 -44.192 1.00 76.18  ? 775  PHE B H    1 
ATOM   8779  H  HA   . PHE B 1 214 ? -55.857  -21.145 -45.177 1.00 72.19  ? 775  PHE B HA   1 
ATOM   8780  H  HB2  . PHE B 1 214 ? -58.245  -20.062 -44.141 1.00 68.31  ? 775  PHE B HB2  1 
ATOM   8781  H  HB3  . PHE B 1 214 ? -58.078  -21.576 -44.589 1.00 68.31  ? 775  PHE B HB3  1 
ATOM   8782  H  HD1  . PHE B 1 214 ? -57.195  -19.298 -42.073 1.00 69.91  ? 775  PHE B HD1  1 
ATOM   8783  H  HD2  . PHE B 1 214 ? -56.964  -23.141 -43.147 1.00 74.29  ? 775  PHE B HD2  1 
ATOM   8784  H  HE1  . PHE B 1 214 ? -56.464  -19.846 -39.953 1.00 83.67  ? 775  PHE B HE1  1 
ATOM   8785  H  HE2  . PHE B 1 214 ? -56.234  -23.692 -41.030 1.00 76.27  ? 775  PHE B HE2  1 
ATOM   8786  H  HZ   . PHE B 1 214 ? -55.983  -22.045 -39.428 1.00 89.16  ? 775  PHE B HZ   1 
ATOM   8787  N  N    . GLY B 1 215 ? -56.655  -19.049 -47.182 1.00 56.17  ? 776  GLY B N    1 
ATOM   8788  C  CA   . GLY B 1 215 ? -56.896  -18.837 -48.597 1.00 51.72  ? 776  GLY B CA   1 
ATOM   8789  C  C    . GLY B 1 215 ? -58.190  -18.111 -48.904 1.00 58.35  ? 776  GLY B C    1 
ATOM   8790  O  O    . GLY B 1 215 ? -58.731  -17.345 -48.103 1.00 64.16  ? 776  GLY B O    1 
ATOM   8791  H  H    . GLY B 1 215 ? -56.279  -18.381 -46.791 1.00 67.41  ? 776  GLY B H    1 
ATOM   8792  H  HA2  . GLY B 1 215 ? -56.165  -18.320 -48.970 1.00 62.06  ? 776  GLY B HA2  1 
ATOM   8793  H  HA3  . GLY B 1 215 ? -56.919  -19.696 -49.047 1.00 62.06  ? 776  GLY B HA3  1 
ATOM   8794  N  N    . LYS B 1 216 ? -58.682  -18.360 -50.115 1.00 58.10  ? 777  LYS B N    1 
ATOM   8795  C  CA   . LYS B 1 216 ? -59.773  -17.585 -50.686 1.00 54.71  ? 777  LYS B CA   1 
ATOM   8796  C  C    . LYS B 1 216 ? -61.068  -17.781 -49.895 1.00 68.83  ? 777  LYS B C    1 
ATOM   8797  O  O    . LYS B 1 216 ? -61.257  -18.774 -49.187 1.00 66.60  ? 777  LYS B O    1 
ATOM   8798  C  CB   . LYS B 1 216 ? -59.967  -17.964 -52.154 1.00 62.04  ? 777  LYS B CB   1 
ATOM   8799  C  CG   . LYS B 1 216 ? -58.711  -17.737 -52.999 1.00 65.60  ? 777  LYS B CG   1 
ATOM   8800  C  CD   . LYS B 1 216 ? -58.845  -18.295 -54.410 1.00 70.96  ? 777  LYS B CD   1 
ATOM   8801  C  CE   . LYS B 1 216 ? -57.529  -18.194 -55.174 1.00 65.20  ? 777  LYS B CE   1 
ATOM   8802  N  NZ   . LYS B 1 216 ? -57.642  -18.724 -56.562 1.00 74.52  ? 777  LYS B NZ   1 
ATOM   8803  H  H    . LYS B 1 216 ? -58.394  -18.984 -50.632 1.00 69.72  ? 777  LYS B H    1 
ATOM   8804  H  HA   . LYS B 1 216 ? -59.541  -16.643 -50.649 1.00 65.65  ? 777  LYS B HA   1 
ATOM   8805  H  HB2  . LYS B 1 216 ? -60.199  -18.904 -52.210 1.00 74.44  ? 777  LYS B HB2  1 
ATOM   8806  H  HB3  . LYS B 1 216 ? -60.681  -17.423 -52.528 1.00 74.44  ? 777  LYS B HB3  1 
ATOM   8807  H  HG2  . LYS B 1 216 ? -58.544  -16.784 -53.068 1.00 78.72  ? 777  LYS B HG2  1 
ATOM   8808  H  HG3  . LYS B 1 216 ? -57.959  -18.176 -52.572 1.00 78.72  ? 777  LYS B HG3  1 
ATOM   8809  H  HD2  . LYS B 1 216 ? -59.098  -19.230 -54.361 1.00 85.15  ? 777  LYS B HD2  1 
ATOM   8810  H  HD3  . LYS B 1 216 ? -59.517  -17.788 -54.892 1.00 85.15  ? 777  LYS B HD3  1 
ATOM   8811  H  HE2  . LYS B 1 216 ? -57.263  -17.263 -55.227 1.00 78.24  ? 777  LYS B HE2  1 
ATOM   8812  H  HE3  . LYS B 1 216 ? -56.851  -18.709 -54.709 1.00 78.24  ? 777  LYS B HE3  1 
ATOM   8813  H  HZ1  . LYS B 1 216 ? -56.860  -18.651 -56.980 1.00 89.42  ? 777  LYS B HZ1  1 
ATOM   8814  H  HZ2  . LYS B 1 216 ? -57.880  -19.581 -56.541 1.00 89.42  ? 777  LYS B HZ2  1 
ATOM   8815  H  HZ3  . LYS B 1 216 ? -58.255  -18.264 -57.014 1.00 89.42  ? 777  LYS B HZ3  1 
ATOM   8816  N  N    . SER B 1 217 ? -61.968  -16.801 -50.032 1.00 65.17  ? 778  SER B N    1 
ATOM   8817  C  CA   . SER B 1 217 ? -63.102  -16.672 -49.118 1.00 52.28  ? 778  SER B CA   1 
ATOM   8818  C  C    . SER B 1 217 ? -63.981  -17.917 -49.113 1.00 59.08  ? 778  SER B C    1 
ATOM   8819  O  O    . SER B 1 217 ? -64.441  -18.353 -48.052 1.00 59.77  ? 778  SER B O    1 
ATOM   8820  C  CB   . SER B 1 217 ? -63.926  -15.441 -49.493 1.00 65.73  ? 778  SER B CB   1 
ATOM   8821  O  OG   . SER B 1 217 ? -64.468  -15.574 -50.794 1.00 74.40  ? 778  SER B OG   1 
ATOM   8822  H  H    . SER B 1 217 ? -61.943  -16.199 -50.646 1.00 78.20  ? 778  SER B H    1 
ATOM   8823  H  HA   . SER B 1 217 ? -62.765  -16.542 -48.218 1.00 62.73  ? 778  SER B HA   1 
ATOM   8824  H  HB2  . SER B 1 217 ? -64.652  -15.341 -48.857 1.00 78.88  ? 778  SER B HB2  1 
ATOM   8825  H  HB3  . SER B 1 217 ? -63.354  -14.658 -49.468 1.00 78.88  ? 778  SER B HB3  1 
ATOM   8826  H  HG   . SER B 1 217 ? -64.919  -14.892 -50.989 1.00 89.28  ? 778  SER B HG   1 
ATOM   8827  N  N    . LEU B 1 218 ? -64.238  -18.501 -50.283 1.00 64.70  ? 779  LEU B N    1 
ATOM   8828  C  CA   . LEU B 1 218 ? -65.146  -19.642 -50.333 1.00 67.97  ? 779  LEU B CA   1 
ATOM   8829  C  C    . LEU B 1 218 ? -64.498  -20.914 -49.799 1.00 67.23  ? 779  LEU B C    1 
ATOM   8830  O  O    . LEU B 1 218 ? -65.198  -21.781 -49.264 1.00 66.28  ? 779  LEU B O    1 
ATOM   8831  C  CB   . LEU B 1 218 ? -65.644  -19.859 -51.763 1.00 69.25  ? 779  LEU B CB   1 
ATOM   8832  C  CG   . LEU B 1 218 ? -66.694  -18.861 -52.265 1.00 74.63  ? 779  LEU B CG   1 
ATOM   8833  C  CD1  . LEU B 1 218 ? -66.923  -19.036 -53.757 1.00 81.43  ? 779  LEU B CD1  1 
ATOM   8834  C  CD2  . LEU B 1 218 ? -68.007  -19.015 -51.505 1.00 72.66  ? 779  LEU B CD2  1 
ATOM   8835  H  H    . LEU B 1 218 ? -63.909  -18.263 -51.041 1.00 77.64  ? 779  LEU B H    1 
ATOM   8836  H  HA   . LEU B 1 218 ? -65.918  -19.449 -49.778 1.00 81.56  ? 779  LEU B HA   1 
ATOM   8837  H  HB2  . LEU B 1 218 ? -64.884  -19.806 -52.363 1.00 83.10  ? 779  LEU B HB2  1 
ATOM   8838  H  HB3  . LEU B 1 218 ? -66.037  -20.744 -51.818 1.00 83.10  ? 779  LEU B HB3  1 
ATOM   8839  H  HG   . LEU B 1 218 ? -66.367  -17.960 -52.117 1.00 89.56  ? 779  LEU B HG   1 
ATOM   8840  H  HD11 . LEU B 1 218 ? -67.589  -18.395 -54.051 1.00 97.72  ? 779  LEU B HD11 1 
ATOM   8841  H  HD12 . LEU B 1 218 ? -66.087  -18.882 -54.224 1.00 97.72  ? 779  LEU B HD12 1 
ATOM   8842  H  HD13 . LEU B 1 218 ? -67.235  -19.939 -53.924 1.00 97.72  ? 779  LEU B HD13 1 
ATOM   8843  H  HD21 . LEU B 1 218 ? -68.647  -18.371 -51.847 1.00 87.19  ? 779  LEU B HD21 1 
ATOM   8844  H  HD22 . LEU B 1 218 ? -68.343  -19.916 -51.635 1.00 87.19  ? 779  LEU B HD22 1 
ATOM   8845  H  HD23 . LEU B 1 218 ? -67.847  -18.854 -50.562 1.00 87.19  ? 779  LEU B HD23 1 
ATOM   8846  N  N    . GLN B 1 219 ? -63.181  -21.055 -49.940 1.00 60.43  ? 780  GLN B N    1 
ATOM   8847  C  CA   . GLN B 1 219 ? -62.484  -22.274 -49.548 1.00 56.06  ? 780  GLN B CA   1 
ATOM   8848  C  C    . GLN B 1 219 ? -61.859  -22.214 -48.161 1.00 61.20  ? 780  GLN B C    1 
ATOM   8849  O  O    . GLN B 1 219 ? -61.330  -23.230 -47.699 1.00 56.80  ? 780  GLN B O    1 
ATOM   8850  C  CB   . GLN B 1 219 ? -61.387  -22.592 -50.567 1.00 58.66  ? 780  GLN B CB   1 
ATOM   8851  C  CG   . GLN B 1 219 ? -60.105  -21.774 -50.392 1.00 65.79  ? 780  GLN B CG   1 
ATOM   8852  C  CD   . GLN B 1 219 ? -59.046  -22.060 -51.449 1.00 75.16  ? 780  GLN B CD   1 
ATOM   8853  O  OE1  . GLN B 1 219 ? -58.094  -21.293 -51.598 1.00 75.35  ? 780  GLN B OE1  1 
ATOM   8854  N  NE2  . GLN B 1 219 ? -59.194  -23.166 -52.173 1.00 64.89  ? 780  GLN B NE2  1 
ATOM   8855  H  H    . GLN B 1 219 ? -62.664  -20.450 -50.266 1.00 72.51  ? 780  GLN B H    1 
ATOM   8856  H  HA   . GLN B 1 219 ? -63.117  -23.009 -49.555 1.00 67.27  ? 780  GLN B HA   1 
ATOM   8857  H  HB2  . GLN B 1 219 ? -61.152  -23.530 -50.487 1.00 70.39  ? 780  GLN B HB2  1 
ATOM   8858  H  HB3  . GLN B 1 219 ? -61.730  -22.416 -51.457 1.00 70.39  ? 780  GLN B HB3  1 
ATOM   8859  H  HG2  . GLN B 1 219 ? -60.327  -20.831 -50.442 1.00 78.95  ? 780  GLN B HG2  1 
ATOM   8860  H  HG3  . GLN B 1 219 ? -59.721  -21.976 -49.525 1.00 78.95  ? 780  GLN B HG3  1 
ATOM   8861  H  HE21 . GLN B 1 219 ? -59.866  -23.684 -52.035 1.00 77.87  ? 780  GLN B HE21 1 
ATOM   8862  H  HE22 . GLN B 1 219 ? -58.617  -23.363 -52.780 1.00 77.87  ? 780  GLN B HE22 1 
ATOM   8863  N  N    . ARG B 1 220 ? -61.910  -21.068 -47.476 1.00 67.84  ? 781  ARG B N    1 
ATOM   8864  C  CA   . ARG B 1 220 ? -61.080  -20.913 -46.285 1.00 62.42  ? 781  ARG B CA   1 
ATOM   8865  C  C    . ARG B 1 220 ? -61.664  -21.630 -45.074 1.00 55.33  ? 781  ARG B C    1 
ATOM   8866  O  O    . ARG B 1 220 ? -60.901  -22.100 -44.223 1.00 64.69  ? 781  ARG B O    1 
ATOM   8867  C  CB   . ARG B 1 220 ? -60.844  -19.431 -45.966 1.00 51.56  ? 781  ARG B CB   1 
ATOM   8868  C  CG   . ARG B 1 220 ? -62.071  -18.552 -45.980 1.00 74.03  ? 781  ARG B CG   1 
ATOM   8869  C  CD   . ARG B 1 220 ? -61.762  -17.157 -45.446 1.00 79.78  ? 781  ARG B CD   1 
ATOM   8870  N  NE   . ARG B 1 220 ? -60.804  -16.428 -46.283 1.00 73.72  ? 781  ARG B NE   1 
ATOM   8871  C  CZ   . ARG B 1 220 ? -60.992  -15.207 -46.786 1.00 63.68  ? 781  ARG B CZ   1 
ATOM   8872  N  NH1  . ARG B 1 220 ? -62.112  -14.534 -46.559 1.00 57.36  ? 781  ARG B NH1  1 
ATOM   8873  N  NH2  . ARG B 1 220 ? -60.048  -14.649 -47.530 1.00 68.11  ? 781  ARG B NH2  1 
ATOM   8874  H  H    . ARG B 1 220 ? -62.399  -20.389 -47.673 1.00 81.40  ? 781  ARG B H    1 
ATOM   8875  H  HA   . ARG B 1 220 ? -60.213  -21.311 -46.464 1.00 74.90  ? 781  ARG B HA   1 
ATOM   8876  H  HB2  . ARG B 1 220 ? -60.453  -19.367 -45.080 1.00 61.87  ? 781  ARG B HB2  1 
ATOM   8877  H  HB3  . ARG B 1 220 ? -60.224  -19.073 -46.619 1.00 61.87  ? 781  ARG B HB3  1 
ATOM   8878  H  HG2  . ARG B 1 220 ? -62.391  -18.464 -46.891 1.00 88.83  ? 781  ARG B HG2  1 
ATOM   8879  H  HG3  . ARG B 1 220 ? -62.756  -18.948 -45.419 1.00 88.83  ? 781  ARG B HG3  1 
ATOM   8880  H  HD2  . ARG B 1 220 ? -62.584  -16.643 -45.412 1.00 95.73  ? 781  ARG B HD2  1 
ATOM   8881  H  HD3  . ARG B 1 220 ? -61.384  -17.236 -44.556 1.00 95.73  ? 781  ARG B HD3  1 
ATOM   8882  H  HE   . ARG B 1 220 ? -60.061  -16.820 -46.464 1.00 88.46  ? 781  ARG B HE   1 
ATOM   8883  H  HH11 . ARG B 1 220 ? -62.733  -14.884 -46.078 1.00 68.83  ? 781  ARG B HH11 1 
ATOM   8884  H  HH12 . ARG B 1 220 ? -62.216  -13.748 -46.892 1.00 68.83  ? 781  ARG B HH12 1 
ATOM   8885  H  HH21 . ARG B 1 220 ? -59.316  -15.074 -47.686 1.00 81.73  ? 781  ARG B HH21 1 
ATOM   8886  H  HH22 . ARG B 1 220 ? -60.167  -13.863 -47.857 1.00 81.73  ? 781  ARG B HH22 1 
ATOM   8887  N  N    . GLN B 1 221 ? -62.991  -21.742 -44.975 1.00 62.87  ? 782  GLN B N    1 
ATOM   8888  C  CA   . GLN B 1 221 ? -63.572  -22.452 -43.840 1.00 52.96  ? 782  GLN B CA   1 
ATOM   8889  C  C    . GLN B 1 221 ? -63.366  -23.955 -43.970 1.00 59.10  ? 782  GLN B C    1 
ATOM   8890  O  O    . GLN B 1 221 ? -63.137  -24.643 -42.969 1.00 56.26  ? 782  GLN B O    1 
ATOM   8891  C  CB   . GLN B 1 221 ? -65.059  -22.126 -43.706 1.00 53.64  ? 782  GLN B CB   1 
ATOM   8892  C  CG   . GLN B 1 221 ? -65.658  -22.553 -42.364 1.00 66.01  ? 782  GLN B CG   1 
ATOM   8893  C  CD   . GLN B 1 221 ? -65.024  -21.834 -41.179 1.00 64.87  ? 782  GLN B CD   1 
ATOM   8894  O  OE1  . GLN B 1 221 ? -65.095  -20.610 -41.070 1.00 66.16  ? 782  GLN B OE1  1 
ATOM   8895  N  NE2  . GLN B 1 221 ? -64.394  -22.595 -40.290 1.00 63.50  ? 782  GLN B NE2  1 
ATOM   8896  H  H    . GLN B 1 221 ? -63.560  -21.425 -45.537 1.00 75.45  ? 782  GLN B H    1 
ATOM   8897  H  HA   . GLN B 1 221 ? -63.129  -22.160 -43.027 1.00 63.55  ? 782  GLN B HA   1 
ATOM   8898  H  HB2  . GLN B 1 221 ? -65.178  -21.167 -43.794 1.00 64.37  ? 782  GLN B HB2  1 
ATOM   8899  H  HB3  . GLN B 1 221 ? -65.545  -22.584 -44.409 1.00 64.37  ? 782  GLN B HB3  1 
ATOM   8900  H  HG2  . GLN B 1 221 ? -66.607  -22.352 -42.364 1.00 79.21  ? 782  GLN B HG2  1 
ATOM   8901  H  HG3  . GLN B 1 221 ? -65.520  -23.506 -42.246 1.00 79.21  ? 782  GLN B HG3  1 
ATOM   8902  H  HE21 . GLN B 1 221 ? -64.360  -23.447 -40.401 1.00 76.20  ? 782  GLN B HE21 1 
ATOM   8903  H  HE22 . GLN B 1 221 ? -64.020  -22.235 -39.604 1.00 76.20  ? 782  GLN B HE22 1 
ATOM   8904  N  N    . ALA B 1 222 ? -63.445  -24.485 -45.193 1.00 66.79  ? 783  ALA B N    1 
ATOM   8905  C  CA   . ALA B 1 222 ? -63.120  -25.890 -45.407 1.00 56.13  ? 783  ALA B CA   1 
ATOM   8906  C  C    . ALA B 1 222 ? -61.653  -26.159 -45.099 1.00 56.51  ? 783  ALA B C    1 
ATOM   8907  O  O    . ALA B 1 222 ? -61.319  -27.164 -44.460 1.00 55.41  ? 783  ALA B O    1 
ATOM   8908  C  CB   . ALA B 1 222 ? -63.453  -26.295 -46.843 1.00 52.62  ? 783  ALA B CB   1 
ATOM   8909  H  H    . ALA B 1 222 ? -63.680  -24.058 -45.901 1.00 80.15  ? 783  ALA B H    1 
ATOM   8910  H  HA   . ALA B 1 222 ? -63.657  -26.434 -44.810 1.00 67.36  ? 783  ALA B HA   1 
ATOM   8911  H  HB1  . ALA B 1 222 ? -63.230  -27.231 -46.966 1.00 63.14  ? 783  ALA B HB1  1 
ATOM   8912  H  HB2  . ALA B 1 222 ? -64.400  -26.157 -46.997 1.00 63.14  ? 783  ALA B HB2  1 
ATOM   8913  H  HB3  . ALA B 1 222 ? -62.934  -25.748 -47.453 1.00 63.14  ? 783  ALA B HB3  1 
ATOM   8914  N  N    . ASN B 1 223 ? -60.761  -25.265 -45.536 1.00 46.05  ? 784  ASN B N    1 
ATOM   8915  C  CA   . ASN B 1 223 ? -59.347  -25.409 -45.205 1.00 59.71  ? 784  ASN B CA   1 
ATOM   8916  C  C    . ASN B 1 223 ? -59.109  -25.314 -43.704 1.00 58.13  ? 784  ASN B C    1 
ATOM   8917  O  O    . ASN B 1 223 ? -58.134  -25.879 -43.194 1.00 47.09  ? 784  ASN B O    1 
ATOM   8918  C  CB   . ASN B 1 223 ? -58.521  -24.342 -45.931 1.00 65.17  ? 784  ASN B CB   1 
ATOM   8919  C  CG   . ASN B 1 223 ? -58.095  -24.770 -47.326 1.00 66.51  ? 784  ASN B CG   1 
ATOM   8920  O  OD1  . ASN B 1 223 ? -57.965  -25.958 -47.612 1.00 65.57  ? 784  ASN B OD1  1 
ATOM   8921  N  ND2  . ASN B 1 223 ? -57.862  -23.794 -48.199 1.00 59.74  ? 784  ASN B ND2  1 
ATOM   8922  H  H    . ASN B 1 223 ? -60.948  -24.578 -46.018 1.00 55.26  ? 784  ASN B H    1 
ATOM   8923  H  HA   . ASN B 1 223 ? -59.040  -26.279 -45.502 1.00 71.65  ? 784  ASN B HA   1 
ATOM   8924  H  HB2  . ASN B 1 223 ? -59.052  -23.535 -46.015 1.00 78.20  ? 784  ASN B HB2  1 
ATOM   8925  H  HB3  . ASN B 1 223 ? -57.720  -24.159 -45.416 1.00 78.20  ? 784  ASN B HB3  1 
ATOM   8926  H  HD21 . ASN B 1 223 ? -57.955  -22.973 -47.961 1.00 71.69  ? 784  ASN B HD21 1 
ATOM   8927  H  HD22 . ASN B 1 223 ? -57.618  -23.984 -49.001 1.00 71.69  ? 784  ASN B HD22 1 
ATOM   8928  N  N    . ILE B 1 224 ? -59.981  -24.605 -42.983 1.00 59.78  ? 785  ILE B N    1 
ATOM   8929  C  CA   . ILE B 1 224 ? -59.816  -24.476 -41.539 1.00 63.98  ? 785  ILE B CA   1 
ATOM   8930  C  C    . ILE B 1 224 ? -60.080  -25.812 -40.856 1.00 56.89  ? 785  ILE B C    1 
ATOM   8931  O  O    . ILE B 1 224 ? -59.408  -26.166 -39.880 1.00 54.58  ? 785  ILE B O    1 
ATOM   8932  C  CB   . ILE B 1 224 ? -60.728  -23.356 -40.997 1.00 59.77  ? 785  ILE B CB   1 
ATOM   8933  C  CG1  . ILE B 1 224 ? -60.042  -22.002 -41.185 1.00 47.14  ? 785  ILE B CG1  1 
ATOM   8934  C  CG2  . ILE B 1 224 ? -61.046  -23.557 -39.510 1.00 50.58  ? 785  ILE B CG2  1 
ATOM   8935  C  CD1  . ILE B 1 224 ? -60.944  -20.825 -40.963 1.00 55.75  ? 785  ILE B CD1  1 
ATOM   8936  H  H    . ILE B 1 224 ? -60.666  -24.195 -43.304 1.00 71.74  ? 785  ILE B H    1 
ATOM   8937  H  HA   . ILE B 1 224 ? -58.898  -24.225 -41.351 1.00 76.78  ? 785  ILE B HA   1 
ATOM   8938  H  HB   . ILE B 1 224 ? -61.559  -23.359 -41.499 1.00 71.73  ? 785  ILE B HB   1 
ATOM   8939  H  HG12 . ILE B 1 224 ? -59.308  -21.935 -40.555 1.00 56.56  ? 785  ILE B HG12 1 
ATOM   8940  H  HG13 . ILE B 1 224 ? -59.702  -21.948 -42.092 1.00 56.56  ? 785  ILE B HG13 1 
ATOM   8941  H  HG21 . ILE B 1 224 ? -61.620  -22.835 -39.209 1.00 60.69  ? 785  ILE B HG21 1 
ATOM   8942  H  HG22 . ILE B 1 224 ? -61.498  -24.408 -39.396 1.00 60.69  ? 785  ILE B HG22 1 
ATOM   8943  H  HG23 . ILE B 1 224 ? -60.217  -23.553 -39.006 1.00 60.69  ? 785  ILE B HG23 1 
ATOM   8944  H  HD11 . ILE B 1 224 ? -60.436  -20.009 -41.100 1.00 66.90  ? 785  ILE B HD11 1 
ATOM   8945  H  HD12 . ILE B 1 224 ? -61.679  -20.868 -41.594 1.00 66.90  ? 785  ILE B HD12 1 
ATOM   8946  H  HD13 . ILE B 1 224 ? -61.284  -20.855 -40.055 1.00 66.90  ? 785  ILE B HD13 1 
ATOM   8947  N  N    . LEU B 1 225 ? -61.051  -26.577 -41.358 1.00 52.37  ? 786  LEU B N    1 
ATOM   8948  C  CA   . LEU B 1 225 ? -61.308  -27.899 -40.799 1.00 63.68  ? 786  LEU B CA   1 
ATOM   8949  C  C    . LEU B 1 225 ? -60.152  -28.853 -41.062 1.00 69.82  ? 786  LEU B C    1 
ATOM   8950  O  O    . LEU B 1 225 ? -59.851  -29.709 -40.222 1.00 66.22  ? 786  LEU B O    1 
ATOM   8951  C  CB   . LEU B 1 225 ? -62.600  -28.473 -41.380 1.00 61.32  ? 786  LEU B CB   1 
ATOM   8952  C  CG   . LEU B 1 225 ? -63.919  -27.882 -40.876 1.00 70.48  ? 786  LEU B CG   1 
ATOM   8953  C  CD1  . LEU B 1 225 ? -65.091  -28.496 -41.629 1.00 68.04  ? 786  LEU B CD1  1 
ATOM   8954  C  CD2  . LEU B 1 225 ? -64.071  -28.102 -39.377 1.00 73.95  ? 786  LEU B CD2  1 
ATOM   8955  H  H    . LEU B 1 225 ? -61.566  -26.356 -42.010 1.00 62.84  ? 786  LEU B H    1 
ATOM   8956  H  HA   . LEU B 1 225 ? -61.420  -27.820 -39.839 1.00 76.42  ? 786  LEU B HA   1 
ATOM   8957  H  HB2  . LEU B 1 225 ? -62.580  -28.346 -42.341 1.00 73.58  ? 786  LEU B HB2  1 
ATOM   8958  H  HB3  . LEU B 1 225 ? -62.622  -29.423 -41.184 1.00 73.58  ? 786  LEU B HB3  1 
ATOM   8959  H  HG   . LEU B 1 225 ? -63.922  -26.926 -41.042 1.00 84.58  ? 786  LEU B HG   1 
ATOM   8960  H  HD11 . LEU B 1 225 ? -65.916  -28.110 -41.297 1.00 81.64  ? 786  LEU B HD11 1 
ATOM   8961  H  HD12 . LEU B 1 225 ? -64.993  -28.305 -42.575 1.00 81.64  ? 786  LEU B HD12 1 
ATOM   8962  H  HD13 . LEU B 1 225 ? -65.092  -29.455 -41.483 1.00 81.64  ? 786  LEU B HD13 1 
ATOM   8963  H  HD21 . LEU B 1 225 ? -64.913  -27.718 -39.086 1.00 88.75  ? 786  LEU B HD21 1 
ATOM   8964  H  HD22 . LEU B 1 225 ? -64.061  -29.055 -39.196 1.00 88.75  ? 786  LEU B HD22 1 
ATOM   8965  H  HD23 . LEU B 1 225 ? -63.334  -27.670 -38.918 1.00 88.75  ? 786  LEU B HD23 1 
ATOM   8966  N  N    . LEU B 1 226 ? -59.491  -28.714 -42.207 1.00 59.74  ? 787  LEU B N    1 
ATOM   8967  C  CA   . LEU B 1 226 ? -58.433  -29.623 -42.622 1.00 53.49  ? 787  LEU B CA   1 
ATOM   8968  C  C    . LEU B 1 226 ? -57.048  -29.154 -42.200 1.00 61.55  ? 787  LEU B C    1 
ATOM   8969  O  O    . LEU B 1 226 ? -56.061  -29.825 -42.517 1.00 66.11  ? 787  LEU B O    1 
ATOM   8970  C  CB   . LEU B 1 226 ? -58.486  -29.803 -44.142 1.00 50.99  ? 787  LEU B CB   1 
ATOM   8971  C  CG   . LEU B 1 226 ? -59.818  -30.370 -44.642 1.00 60.03  ? 787  LEU B CG   1 
ATOM   8972  C  CD1  . LEU B 1 226 ? -60.000  -30.120 -46.125 1.00 64.40  ? 787  LEU B CD1  1 
ATOM   8973  C  CD2  . LEU B 1 226 ? -59.907  -31.857 -44.336 1.00 60.40  ? 787  LEU B CD2  1 
ATOM   8974  H  H    . LEU B 1 226 ? -59.642  -28.084 -42.772 1.00 71.69  ? 787  LEU B H    1 
ATOM   8975  H  HA   . LEU B 1 226 ? -58.589  -30.490 -42.215 1.00 64.19  ? 787  LEU B HA   1 
ATOM   8976  H  HB2  . LEU B 1 226 ? -58.351  -28.941 -44.565 1.00 61.18  ? 787  LEU B HB2  1 
ATOM   8977  H  HB3  . LEU B 1 226 ? -57.782  -30.415 -44.410 1.00 61.18  ? 787  LEU B HB3  1 
ATOM   8978  H  HG   . LEU B 1 226 ? -60.542  -29.926 -44.175 1.00 72.03  ? 787  LEU B HG   1 
ATOM   8979  H  HD11 . LEU B 1 226 ? -60.851  -30.491 -46.405 1.00 77.28  ? 787  LEU B HD11 1 
ATOM   8980  H  HD12 . LEU B 1 226 ? -59.986  -29.163 -46.287 1.00 77.28  ? 787  LEU B HD12 1 
ATOM   8981  H  HD13 . LEU B 1 226 ? -59.277  -30.548 -46.608 1.00 77.28  ? 787  LEU B HD13 1 
ATOM   8982  H  HD21 . LEU B 1 226 ? -60.756  -32.195 -44.661 1.00 72.48  ? 787  LEU B HD21 1 
ATOM   8983  H  HD22 . LEU B 1 226 ? -59.176  -32.315 -44.781 1.00 72.48  ? 787  LEU B HD22 1 
ATOM   8984  H  HD23 . LEU B 1 226 ? -59.844  -31.985 -43.377 1.00 72.48  ? 787  LEU B HD23 1 
ATOM   8985  N  N    . GLY B 1 227 ? -56.952  -28.032 -41.493 1.00 63.30  ? 788  GLY B N    1 
ATOM   8986  C  CA   . GLY B 1 227 ? -55.664  -27.533 -41.053 1.00 45.28  ? 788  GLY B CA   1 
ATOM   8987  C  C    . GLY B 1 227 ? -54.743  -27.114 -42.175 1.00 60.76  ? 788  GLY B C    1 
ATOM   8988  O  O    . GLY B 1 227 ? -53.520  -27.164 -42.012 1.00 60.57  ? 788  GLY B O    1 
ATOM   8989  H  H    . GLY B 1 227 ? -57.620  -27.544 -41.258 1.00 75.96  ? 788  GLY B H    1 
ATOM   8990  H  HA2  . GLY B 1 227 ? -55.803  -26.766 -40.475 1.00 54.34  ? 788  GLY B HA2  1 
ATOM   8991  H  HA3  . GLY B 1 227 ? -55.217  -28.223 -40.538 1.00 54.34  ? 788  GLY B HA3  1 
ATOM   8992  N  N    . ALA B 1 228 ? -55.297  -26.682 -43.306 1.00 54.59  ? 789  ALA B N    1 
ATOM   8993  C  CA   . ALA B 1 228 ? -54.501  -26.280 -44.461 1.00 56.68  ? 789  ALA B CA   1 
ATOM   8994  C  C    . ALA B 1 228 ? -54.246  -24.780 -44.364 1.00 56.91  ? 789  ALA B C    1 
ATOM   8995  O  O    . ALA B 1 228 ? -55.169  -23.974 -44.515 1.00 65.68  ? 789  ALA B O    1 
ATOM   8996  C  CB   . ALA B 1 228 ? -55.223  -26.635 -45.757 1.00 55.87  ? 789  ALA B CB   1 
ATOM   8997  H  H    . ALA B 1 228 ? -56.146  -26.613 -43.430 1.00 65.51  ? 789  ALA B H    1 
ATOM   8998  H  HA   . ALA B 1 228 ? -53.648  -26.741 -44.445 1.00 68.01  ? 789  ALA B HA   1 
ATOM   8999  H  HB1  . ALA B 1 228 ? -54.675  -26.359 -46.509 1.00 67.04  ? 789  ALA B HB1  1 
ATOM   9000  H  HB2  . ALA B 1 228 ? -55.365  -27.594 -45.786 1.00 67.04  ? 789  ALA B HB2  1 
ATOM   9001  H  HB3  . ALA B 1 228 ? -56.075  -26.173 -45.780 1.00 67.04  ? 789  ALA B HB3  1 
ATOM   9002  N  N    . CYS B 1 229 ? -52.988  -24.408 -44.141 1.00 54.16  ? 790  CYS B N    1 
ATOM   9003  C  CA   . CYS B 1 229 ? -52.620  -23.045 -43.790 1.00 60.85  ? 790  CYS B CA   1 
ATOM   9004  C  C    . CYS B 1 229 ? -51.370  -22.653 -44.563 1.00 54.75  ? 790  CYS B C    1 
ATOM   9005  O  O    . CYS B 1 229 ? -50.407  -23.424 -44.607 1.00 66.10  ? 790  CYS B O    1 
ATOM   9006  C  CB   . CYS B 1 229 ? -52.386  -22.935 -42.278 1.00 52.66  ? 790  CYS B CB   1 
ATOM   9007  S  SG   . CYS B 1 229 ? -51.816  -21.328 -41.731 1.00 93.26  ? 790  CYS B SG   1 
ATOM   9008  H  H    . CYS B 1 229 ? -52.316  -24.943 -44.190 1.00 64.99  ? 790  CYS B H    1 
ATOM   9009  H  HA   . CYS B 1 229 ? -53.338  -22.441 -44.036 1.00 73.02  ? 790  CYS B HA   1 
ATOM   9010  H  HB2  . CYS B 1 229 ? -53.220  -23.123 -41.821 1.00 63.19  ? 790  CYS B HB2  1 
ATOM   9011  H  HB3  . CYS B 1 229 ? -51.717  -23.588 -42.020 1.00 63.19  ? 790  CYS B HB3  1 
ATOM   9012  H  HG   . CYS B 1 229 ? -51.666  -21.352 -40.540 1.00 111.92 ? 790  CYS B HG   1 
ATOM   9013  N  N    . SER B 1 230 ? -51.393  -21.475 -45.190 1.00 62.62  ? 791  SER B N    1 
ATOM   9014  C  CA   . SER B 1 230 ? -50.250  -20.961 -45.941 1.00 64.73  ? 791  SER B CA   1 
ATOM   9015  C  C    . SER B 1 230 ? -49.995  -19.511 -45.551 1.00 68.68  ? 791  SER B C    1 
ATOM   9016  O  O    . SER B 1 230 ? -50.836  -18.639 -45.795 1.00 61.46  ? 791  SER B O    1 
ATOM   9017  C  CB   . SER B 1 230 ? -50.486  -21.078 -47.448 1.00 82.14  ? 791  SER B CB   1 
ATOM   9018  O  OG   . SER B 1 230 ? -49.323  -20.714 -48.173 1.00 89.15  ? 791  SER B OG   1 
ATOM   9019  H  H    . SER B 1 230 ? -52.072  -20.947 -45.193 1.00 75.14  ? 791  SER B H    1 
ATOM   9020  H  HA   . SER B 1 230 ? -49.461  -21.479 -45.716 1.00 77.68  ? 791  SER B HA   1 
ATOM   9021  H  HB2  . SER B 1 230 ? -50.715  -21.996 -47.661 1.00 98.57  ? 791  SER B HB2  1 
ATOM   9022  H  HB3  . SER B 1 230 ? -51.213  -20.488 -47.701 1.00 98.57  ? 791  SER B HB3  1 
ATOM   9023  H  HG   . SER B 1 230 ? -49.466  -20.782 -48.998 1.00 106.98 ? 791  SER B HG   1 
ATOM   9024  N  N    . LEU B 1 231 ? -48.837  -19.266 -44.940 1.00 59.40  ? 792  LEU B N    1 
ATOM   9025  C  CA   . LEU B 1 231 ? -48.371  -17.947 -44.530 1.00 69.02  ? 792  LEU B CA   1 
ATOM   9026  C  C    . LEU B 1 231 ? -47.430  -17.296 -45.544 1.00 69.98  ? 792  LEU B C    1 
ATOM   9027  O  O    . LEU B 1 231 ? -46.814  -16.274 -45.229 1.00 70.17  ? 792  LEU B O    1 
ATOM   9028  C  CB   . LEU B 1 231 ? -47.709  -18.029 -43.153 1.00 69.36  ? 792  LEU B CB   1 
ATOM   9029  C  CG   . LEU B 1 231 ? -48.646  -18.418 -41.999 1.00 49.95  ? 792  LEU B CG   1 
ATOM   9030  C  CD1  . LEU B 1 231 ? -47.915  -18.334 -40.670 1.00 47.82  ? 792  LEU B CD1  1 
ATOM   9031  C  CD2  . LEU B 1 231 ? -49.908  -17.557 -41.958 1.00 58.24  ? 792  LEU B CD2  1 
ATOM   9032  H  H    . LEU B 1 231 ? -48.275  -19.888 -44.744 1.00 71.28  ? 792  LEU B H    1 
ATOM   9033  H  HA   . LEU B 1 231 ? -49.143  -17.367 -44.444 1.00 82.82  ? 792  LEU B HA   1 
ATOM   9034  H  HB2  . LEU B 1 231 ? -47.002  -18.691 -43.190 1.00 83.23  ? 792  LEU B HB2  1 
ATOM   9035  H  HB3  . LEU B 1 231 ? -47.330  -17.161 -42.941 1.00 83.23  ? 792  LEU B HB3  1 
ATOM   9036  H  HG   . LEU B 1 231 ? -48.924  -19.339 -42.123 1.00 59.94  ? 792  LEU B HG   1 
ATOM   9037  H  HD11 . LEU B 1 231 ? -48.526  -18.583 -39.958 1.00 57.38  ? 792  LEU B HD11 1 
ATOM   9038  H  HD12 . LEU B 1 231 ? -47.160  -18.942 -40.686 1.00 57.38  ? 792  LEU B HD12 1 
ATOM   9039  H  HD13 . LEU B 1 231 ? -47.606  -17.424 -40.537 1.00 57.38  ? 792  LEU B HD13 1 
ATOM   9040  H  HD21 . LEU B 1 231 ? -50.461  -17.843 -41.214 1.00 69.89  ? 792  LEU B HD21 1 
ATOM   9041  H  HD22 . LEU B 1 231 ? -49.652  -16.628 -41.842 1.00 69.89  ? 792  LEU B HD22 1 
ATOM   9042  H  HD23 . LEU B 1 231 ? -50.391  -17.666 -42.792 1.00 69.89  ? 792  LEU B HD23 1 
ATOM   9043  N  N    . ASP B 1 232 ? -47.283  -17.880 -46.736 1.00 75.62  ? 793  ASP B N    1 
ATOM   9044  C  CA   . ASP B 1 232 ? -46.118  -17.647 -47.588 1.00 77.46  ? 793  ASP B CA   1 
ATOM   9045  C  C    . ASP B 1 232 ? -45.817  -16.174 -47.856 1.00 67.34  ? 793  ASP B C    1 
ATOM   9046  O  O    . ASP B 1 232 ? -44.699  -15.858 -48.278 1.00 81.26  ? 793  ASP B O    1 
ATOM   9047  C  CB   . ASP B 1 232 ? -46.314  -18.359 -48.933 1.00 89.05  ? 793  ASP B CB   1 
ATOM   9048  C  CG   . ASP B 1 232 ? -46.085  -19.864 -48.846 1.00 107.68 ? 793  ASP B CG   1 
ATOM   9049  O  OD1  . ASP B 1 232 ? -45.108  -20.290 -48.194 1.00 96.02  ? 793  ASP B OD1  1 
ATOM   9050  O  OD2  . ASP B 1 232 ? -46.885  -20.620 -49.438 1.00 109.35 ? 793  ASP B OD2  1 
ATOM   9051  H  H    . ASP B 1 232 ? -47.856  -18.423 -47.077 1.00 90.75  ? 793  ASP B H    1 
ATOM   9052  H  HA   . ASP B 1 232 ? -45.339  -18.034 -47.160 1.00 92.95  ? 793  ASP B HA   1 
ATOM   9053  H  HB2  . ASP B 1 232 ? -47.223  -18.212 -49.238 1.00 106.86 ? 793  ASP B HB2  1 
ATOM   9054  H  HB3  . ASP B 1 232 ? -45.686  -17.997 -49.576 1.00 106.86 ? 793  ASP B HB3  1 
ATOM   9055  N  N    . CYS B 1 233 ? -46.769  -15.261 -47.645 1.00 51.64  ? 794  CYS B N    1 
ATOM   9056  C  CA   . CYS B 1 233 ? -46.449  -13.840 -47.784 1.00 51.65  ? 794  CYS B CA   1 
ATOM   9057  C  C    . CYS B 1 233 ? -45.378  -13.385 -46.799 1.00 52.54  ? 794  CYS B C    1 
ATOM   9058  O  O    . CYS B 1 233 ? -44.810  -12.301 -46.977 1.00 62.16  ? 794  CYS B O    1 
ATOM   9059  C  CB   . CYS B 1 233 ? -47.698  -12.978 -47.596 1.00 48.29  ? 794  CYS B CB   1 
ATOM   9060  S  SG   . CYS B 1 233 ? -48.913  -13.128 -48.925 1.00 67.56  ? 794  CYS B SG   1 
ATOM   9061  H  H    . CYS B 1 233 ? -47.583  -15.432 -47.427 1.00 61.97  ? 794  CYS B H    1 
ATOM   9062  H  HA   . CYS B 1 233 ? -46.113  -13.683 -48.680 1.00 61.98  ? 794  CYS B HA   1 
ATOM   9063  H  HB2  . CYS B 1 233 ? -48.133  -13.237 -46.768 1.00 57.94  ? 794  CYS B HB2  1 
ATOM   9064  H  HB3  . CYS B 1 233 ? -47.429  -12.048 -47.547 1.00 57.94  ? 794  CYS B HB3  1 
ATOM   9065  H  HG   . CYS B 1 233 ? -49.848  -12.416 -48.682 1.00 81.08  ? 794  CYS B HG   1 
ATOM   9066  N  N    . LEU B 1 234 ? -45.093  -14.177 -45.766 1.00 57.64  ? 795  LEU B N    1 
ATOM   9067  C  CA   . LEU B 1 234 ? -44.051  -13.860 -44.796 1.00 59.53  ? 795  LEU B CA   1 
ATOM   9068  C  C    . LEU B 1 234 ? -42.749  -14.529 -45.223 1.00 59.13  ? 795  LEU B C    1 
ATOM   9069  O  O    . LEU B 1 234 ? -42.691  -15.756 -45.352 1.00 55.87  ? 795  LEU B O    1 
ATOM   9070  C  CB   . LEU B 1 234 ? -44.454  -14.325 -43.397 1.00 63.08  ? 795  LEU B CB   1 
ATOM   9071  C  CG   . LEU B 1 234 ? -45.736  -13.733 -42.808 1.00 59.97  ? 795  LEU B CG   1 
ATOM   9072  C  CD1  . LEU B 1 234 ? -46.056  -14.393 -41.474 1.00 68.92  ? 795  LEU B CD1  1 
ATOM   9073  C  CD2  . LEU B 1 234 ? -45.623  -12.227 -42.642 1.00 53.76  ? 795  LEU B CD2  1 
ATOM   9074  H  H    . LEU B 1 234 ? -45.499  -14.918 -45.605 1.00 69.17  ? 795  LEU B H    1 
ATOM   9075  H  HA   . LEU B 1 234 ? -43.911  -12.900 -44.773 1.00 71.44  ? 795  LEU B HA   1 
ATOM   9076  H  HB2  . LEU B 1 234 ? -44.569  -15.288 -43.421 1.00 75.70  ? 795  LEU B HB2  1 
ATOM   9077  H  HB3  . LEU B 1 234 ? -43.732  -14.105 -42.787 1.00 75.70  ? 795  LEU B HB3  1 
ATOM   9078  H  HG   . LEU B 1 234 ? -46.472  -13.913 -43.413 1.00 71.96  ? 795  LEU B HG   1 
ATOM   9079  H  HD11 . LEU B 1 234 ? -46.871  -14.005 -41.117 1.00 82.70  ? 795  LEU B HD11 1 
ATOM   9080  H  HD12 . LEU B 1 234 ? -46.177  -15.346 -41.614 1.00 82.70  ? 795  LEU B HD12 1 
ATOM   9081  H  HD13 . LEU B 1 234 ? -45.320  -14.239 -40.861 1.00 82.70  ? 795  LEU B HD13 1 
ATOM   9082  H  HD21 . LEU B 1 234 ? -46.451  -11.888 -42.268 1.00 64.52  ? 795  LEU B HD21 1 
ATOM   9083  H  HD22 . LEU B 1 234 ? -44.884  -12.030 -42.046 1.00 64.52  ? 795  LEU B HD22 1 
ATOM   9084  H  HD23 . LEU B 1 234 ? -45.464  -11.826 -43.511 1.00 64.52  ? 795  LEU B HD23 1 
ATOM   9085  N  N    . HIS B 1 235 ? -41.710  -13.728 -45.430 1.00 59.02  ? 796  HIS B N    1 
ATOM   9086  C  CA   . HIS B 1 235 ? -40.424  -14.262 -45.871 1.00 76.95  ? 796  HIS B CA   1 
ATOM   9087  C  C    . HIS B 1 235 ? -39.675  -14.855 -44.679 1.00 75.12  ? 796  HIS B C    1 
ATOM   9088  O  O    . HIS B 1 235 ? -39.578  -14.205 -43.634 1.00 74.06  ? 796  HIS B O    1 
ATOM   9089  C  CB   . HIS B 1 235 ? -39.586  -13.165 -46.527 1.00 78.46  ? 796  HIS B CB   1 
ATOM   9090  C  CG   . HIS B 1 235 ? -38.464  -13.685 -47.374 1.00 88.52  ? 796  HIS B CG   1 
ATOM   9091  N  ND1  . HIS B 1 235 ? -37.138  -13.551 -47.021 1.00 82.73  ? 796  HIS B ND1  1 
ATOM   9092  C  CD2  . HIS B 1 235 ? -38.473  -14.342 -48.558 1.00 94.69  ? 796  HIS B CD2  1 
ATOM   9093  C  CE1  . HIS B 1 235 ? -36.379  -14.101 -47.952 1.00 74.10  ? 796  HIS B CE1  1 
ATOM   9094  N  NE2  . HIS B 1 235 ? -37.164  -14.589 -48.895 1.00 82.31  ? 796  HIS B NE2  1 
ATOM   9095  H  H    . HIS B 1 235 ? -41.721  -12.875 -45.324 1.00 70.82  ? 796  HIS B H    1 
ATOM   9096  H  HA   . HIS B 1 235 ? -40.573  -14.966 -46.522 1.00 92.34  ? 796  HIS B HA   1 
ATOM   9097  H  HB2  . HIS B 1 235 ? -40.162  -12.629 -47.094 1.00 94.15  ? 796  HIS B HB2  1 
ATOM   9098  H  HB3  . HIS B 1 235 ? -39.200  -12.610 -45.832 1.00 94.15  ? 796  HIS B HB3  1 
ATOM   9099  H  HD1  . HIS B 1 235 ? -36.850  -13.168 -46.307 1.00 99.27  ? 796  HIS B HD1  1 
ATOM   9100  H  HD2  . HIS B 1 235 ? -39.224  -14.581 -49.051 1.00 113.63 ? 796  HIS B HD2  1 
ATOM   9101  H  HE1  . HIS B 1 235 ? -35.450  -14.139 -47.944 1.00 88.92  ? 796  HIS B HE1  1 
ATOM   9102  H  HE2  . HIS B 1 235 ? -36.899  -14.994 -49.605 1.00 98.77  ? 796  HIS B HE2  1 
ATOM   9103  N  N    . PRO B 1 236 ? -39.148  -16.082 -44.787 1.00 72.01  ? 797  PRO B N    1 
ATOM   9104  C  CA   . PRO B 1 236 ? -38.454  -16.686 -43.632 1.00 78.12  ? 797  PRO B CA   1 
ATOM   9105  C  C    . PRO B 1 236 ? -37.118  -16.043 -43.287 1.00 80.51  ? 797  PRO B C    1 
ATOM   9106  O  O    . PRO B 1 236 ? -36.650  -16.219 -42.155 1.00 74.35  ? 797  PRO B O    1 
ATOM   9107  C  CB   . PRO B 1 236 ? -38.268  -18.149 -44.058 1.00 68.11  ? 797  PRO B CB   1 
ATOM   9108  C  CG   . PRO B 1 236 ? -38.287  -18.118 -45.541 1.00 73.82  ? 797  PRO B CG   1 
ATOM   9109  C  CD   . PRO B 1 236 ? -39.225  -17.010 -45.928 1.00 70.19  ? 797  PRO B CD   1 
ATOM   9110  H  HA   . PRO B 1 236 ? -39.028  -16.658 -42.851 1.00 93.75  ? 797  PRO B HA   1 
ATOM   9111  H  HB2  . PRO B 1 236 ? -37.416  -18.479 -43.732 1.00 81.73  ? 797  PRO B HB2  1 
ATOM   9112  H  HB3  . PRO B 1 236 ? -39.000  -18.686 -43.716 1.00 81.73  ? 797  PRO B HB3  1 
ATOM   9113  H  HG2  . PRO B 1 236 ? -37.393  -17.937 -45.872 1.00 88.58  ? 797  PRO B HG2  1 
ATOM   9114  H  HG3  . PRO B 1 236 ? -38.608  -18.968 -45.878 1.00 88.58  ? 797  PRO B HG3  1 
ATOM   9115  H  HD2  . PRO B 1 236 ? -38.919  -16.575 -46.739 1.00 84.23  ? 797  PRO B HD2  1 
ATOM   9116  H  HD3  . PRO B 1 236 ? -40.128  -17.351 -46.027 1.00 84.23  ? 797  PRO B HD3  1 
ATOM   9117  N  N    . GLU B 1 237 ? -36.464  -15.360 -44.227 1.00 78.07  ? 798  GLU B N    1 
ATOM   9118  C  CA   . GLU B 1 237 ? -35.191  -14.691 -43.973 1.00 86.88  ? 798  GLU B CA   1 
ATOM   9119  C  C    . GLU B 1 237 ? -35.330  -13.200 -43.671 1.00 72.99  ? 798  GLU B C    1 
ATOM   9120  O  O    . GLU B 1 237 ? -34.311  -12.517 -43.528 1.00 64.72  ? 798  GLU B O    1 
ATOM   9121  C  CB   . GLU B 1 237 ? -34.245  -14.896 -45.160 1.00 81.22  ? 798  GLU B CB   1 
ATOM   9122  C  CG   . GLU B 1 237 ? -33.891  -16.357 -45.413 1.00 88.49  ? 798  GLU B CG   1 
ATOM   9123  C  CD   . GLU B 1 237 ? -33.280  -17.041 -44.198 1.00 84.39  ? 798  GLU B CD   1 
ATOM   9124  O  OE1  . GLU B 1 237 ? -32.550  -16.371 -43.434 1.00 93.03  ? 798  GLU B OE1  1 
ATOM   9125  O  OE2  . GLU B 1 237 ? -33.534  -18.250 -44.002 1.00 87.67  ? 798  GLU B OE2  1 
ATOM   9126  H  H    . GLU B 1 237 ? -36.744  -15.269 -45.035 1.00 93.69  ? 798  GLU B H    1 
ATOM   9127  H  HA   . GLU B 1 237 ? -34.779  -15.105 -43.199 1.00 104.25 ? 798  GLU B HA   1 
ATOM   9128  H  HB2  . GLU B 1 237 ? -34.667  -14.549 -45.961 1.00 97.47  ? 798  GLU B HB2  1 
ATOM   9129  H  HB3  . GLU B 1 237 ? -33.419  -14.415 -44.989 1.00 97.47  ? 798  GLU B HB3  1 
ATOM   9130  H  HG2  . GLU B 1 237 ? -34.697  -16.840 -45.653 1.00 106.19 ? 798  GLU B HG2  1 
ATOM   9131  H  HG3  . GLU B 1 237 ? -33.248  -16.405 -46.138 1.00 106.19 ? 798  GLU B HG3  1 
ATOM   9132  N  N    . LYS B 1 238 ? -36.550  -12.674 -43.594 1.00 70.64  ? 799  LYS B N    1 
ATOM   9133  C  CA   . LYS B 1 238 ? -36.784  -11.268 -43.286 1.00 75.16  ? 799  LYS B CA   1 
ATOM   9134  C  C    . LYS B 1 238 ? -37.240  -11.145 -41.835 1.00 71.57  ? 799  LYS B C    1 
ATOM   9135  O  O    . LYS B 1 238 ? -38.253  -11.737 -41.448 1.00 62.90  ? 799  LYS B O    1 
ATOM   9136  C  CB   . LYS B 1 238 ? -37.823  -10.677 -44.237 1.00 72.88  ? 799  LYS B CB   1 
ATOM   9137  C  CG   . LYS B 1 238 ? -37.894  -9.163  -44.217 1.00 74.62  ? 799  LYS B CG   1 
ATOM   9138  C  CD   . LYS B 1 238 ? -39.094  -8.664  -45.001 1.00 86.42  ? 799  LYS B CD   1 
ATOM   9139  C  CE   . LYS B 1 238 ? -39.290  -7.169  -44.830 1.00 89.21  ? 799  LYS B CE   1 
ATOM   9140  N  NZ   . LYS B 1 238 ? -40.659  -6.745  -45.234 1.00 84.81  ? 799  LYS B NZ   1 
ATOM   9141  H  H    . LYS B 1 238 ? -37.273  -13.123 -43.719 1.00 84.76  ? 799  LYS B H    1 
ATOM   9142  H  HA   . LYS B 1 238 ? -35.957  -10.772 -43.391 1.00 90.19  ? 799  LYS B HA   1 
ATOM   9143  H  HB2  . LYS B 1 238 ? -37.608  -10.950 -45.143 1.00 87.45  ? 799  LYS B HB2  1 
ATOM   9144  H  HB3  . LYS B 1 238 ? -38.698  -11.016 -43.992 1.00 87.45  ? 799  LYS B HB3  1 
ATOM   9145  H  HG2  . LYS B 1 238 ? -37.979  -8.857  -43.300 1.00 89.54  ? 799  LYS B HG2  1 
ATOM   9146  H  HG3  . LYS B 1 238 ? -37.091  -8.798  -44.621 1.00 89.54  ? 799  LYS B HG3  1 
ATOM   9147  H  HD2  . LYS B 1 238 ? -38.958  -8.847  -45.944 1.00 103.70 ? 799  LYS B HD2  1 
ATOM   9148  H  HD3  . LYS B 1 238 ? -39.893  -9.114  -44.684 1.00 103.70 ? 799  LYS B HD3  1 
ATOM   9149  H  HE2  . LYS B 1 238 ? -39.162  -6.935  -43.898 1.00 107.05 ? 799  LYS B HE2  1 
ATOM   9150  H  HE3  . LYS B 1 238 ? -38.650  -6.697  -45.386 1.00 107.05 ? 799  LYS B HE3  1 
ATOM   9151  H  HZ1  . LYS B 1 238 ? -40.750  -5.867  -45.125 1.00 101.78 ? 799  LYS B HZ1  1 
ATOM   9152  H  HZ2  . LYS B 1 238 ? -40.800  -6.947  -46.089 1.00 101.78 ? 799  LYS B HZ2  1 
ATOM   9153  H  HZ3  . LYS B 1 238 ? -41.266  -7.163  -44.734 1.00 101.78 ? 799  LYS B HZ3  1 
ATOM   9154  N  N    . HIS B 1 239 ? -36.502  -10.357 -41.046 1.00 71.08  ? 800  HIS B N    1 
ATOM   9155  C  CA   . HIS B 1 239 ? -36.708  -10.320 -39.600 1.00 62.49  ? 800  HIS B CA   1 
ATOM   9156  C  C    . HIS B 1 239 ? -38.146  -9.960  -39.242 1.00 72.74  ? 800  HIS B C    1 
ATOM   9157  O  O    . HIS B 1 239 ? -38.763  -10.606 -38.386 1.00 60.16  ? 800  HIS B O    1 
ATOM   9158  C  CB   . HIS B 1 239 ? -35.737  -9.325  -38.966 1.00 62.69  ? 800  HIS B CB   1 
ATOM   9159  C  CG   . HIS B 1 239 ? -36.030  -9.024  -37.528 1.00 71.05  ? 800  HIS B CG   1 
ATOM   9160  N  ND1  . HIS B 1 239 ? -36.817  -7.962  -37.135 1.00 68.76  ? 800  HIS B ND1  1 
ATOM   9161  C  CD2  . HIS B 1 239 ? -35.635  -9.639  -36.389 1.00 71.20  ? 800  HIS B CD2  1 
ATOM   9162  C  CE1  . HIS B 1 239 ? -36.897  -7.939  -35.816 1.00 59.86  ? 800  HIS B CE1  1 
ATOM   9163  N  NE2  . HIS B 1 239 ? -36.189  -8.946  -35.339 1.00 57.72  ? 800  HIS B NE2  1 
ATOM   9164  H  H    . HIS B 1 239 ? -35.878  -9.836  -41.326 1.00 85.30  ? 800  HIS B H    1 
ATOM   9165  H  HA   . HIS B 1 239 ? -36.519  -11.198 -39.232 1.00 74.98  ? 800  HIS B HA   1 
ATOM   9166  H  HB2  . HIS B 1 239 ? -34.839  -9.690  -39.015 1.00 75.23  ? 800  HIS B HB2  1 
ATOM   9167  H  HB3  . HIS B 1 239 ? -35.779  -8.490  -39.458 1.00 75.23  ? 800  HIS B HB3  1 
ATOM   9168  H  HD1  . HIS B 1 239 ? -37.197  -7.402  -37.666 1.00 82.51  ? 800  HIS B HD1  1 
ATOM   9169  H  HD2  . HIS B 1 239 ? -35.092  -10.392 -36.328 1.00 85.44  ? 800  HIS B HD2  1 
ATOM   9170  H  HE1  . HIS B 1 239 ? -37.371  -7.319  -35.311 1.00 71.84  ? 800  HIS B HE1  1 
ATOM   9171  H  HE2  . HIS B 1 239 ? -36.090  -9.138  -34.507 1.00 69.26  ? 800  HIS B HE2  1 
ATOM   9172  N  N    . GLU B 1 240 ? -38.696  -8.927  -39.885 1.00 56.33  ? 801  GLU B N    1 
ATOM   9173  C  CA   A GLU B 1 240 ? -40.055  -8.497  -39.572 0.56 57.43  ? 801  GLU B CA   1 
ATOM   9174  C  CA   B GLU B 1 240 ? -40.056  -8.499  -39.570 0.44 57.52  ? 801  GLU B CA   1 
ATOM   9175  C  C    . GLU B 1 240 ? -41.051  -9.628  -39.800 1.00 57.97  ? 801  GLU B C    1 
ATOM   9176  O  O    . GLU B 1 240 ? -41.922  -9.886  -38.960 1.00 56.92  ? 801  GLU B O    1 
ATOM   9177  C  CB   A GLU B 1 240 ? -40.428  -7.273  -40.412 0.56 59.23  ? 801  GLU B CB   1 
ATOM   9178  C  CB   B GLU B 1 240 ? -40.435  -7.275  -40.408 0.44 59.29  ? 801  GLU B CB   1 
ATOM   9179  C  CG   A GLU B 1 240 ? -39.675  -5.999  -40.042 0.56 59.83  ? 801  GLU B CG   1 
ATOM   9180  C  CG   B GLU B 1 240 ? -40.579  -5.983  -39.614 0.44 59.73  ? 801  GLU B CG   1 
ATOM   9181  C  CD   A GLU B 1 240 ? -38.229  -6.008  -40.502 0.56 54.87  ? 801  GLU B CD   1 
ATOM   9182  C  CD   B GLU B 1 240 ? -41.778  -5.163  -40.053 0.44 54.76  ? 801  GLU B CD   1 
ATOM   9183  O  OE1  A GLU B 1 240 ? -37.352  -5.603  -39.712 0.56 60.92  ? 801  GLU B OE1  1 
ATOM   9184  O  OE1  B GLU B 1 240 ? -42.897  -5.448  -39.575 0.44 52.10  ? 801  GLU B OE1  1 
ATOM   9185  O  OE2  A GLU B 1 240 ? -37.969  -6.415  -41.653 0.56 55.55  ? 801  GLU B OE2  1 
ATOM   9186  O  OE2  B GLU B 1 240 ? -41.604  -4.237  -40.873 0.44 40.77  ? 801  GLU B OE2  1 
ATOM   9187  H  H    A GLU B 1 240 ? -38.307  -8.465  -40.498 0.56 67.60  ? 801  GLU B H    1 
ATOM   9188  H  H    B GLU B 1 240 ? -38.307  -8.464  -40.498 0.44 67.60  ? 801  GLU B H    1 
ATOM   9189  H  HA   A GLU B 1 240 ? -40.099  -8.243  -38.637 0.56 68.92  ? 801  GLU B HA   1 
ATOM   9190  H  HA   B GLU B 1 240 ? -40.099  -8.247  -38.634 0.44 69.03  ? 801  GLU B HA   1 
ATOM   9191  H  HB2  A GLU B 1 240 ? -40.239  -7.467  -41.344 0.56 71.07  ? 801  GLU B HB2  1 
ATOM   9192  H  HB2  B GLU B 1 240 ? -39.748  -7.134  -41.079 0.44 71.14  ? 801  GLU B HB2  1 
ATOM   9193  H  HB3  A GLU B 1 240 ? -41.376  -7.098  -40.301 0.56 71.07  ? 801  GLU B HB3  1 
ATOM   9194  H  HB3  B GLU B 1 240 ? -41.285  -7.449  -40.843 0.44 71.14  ? 801  GLU B HB3  1 
ATOM   9195  H  HG2  A GLU B 1 240 ? -40.116  -5.240  -40.456 0.56 71.80  ? 801  GLU B HG2  1 
ATOM   9196  H  HG2  B GLU B 1 240 ? -40.689  -6.198  -38.675 0.44 71.67  ? 801  GLU B HG2  1 
ATOM   9197  H  HG3  A GLU B 1 240 ? -39.681  -5.898  -39.077 0.56 71.80  ? 801  GLU B HG3  1 
ATOM   9198  H  HG3  B GLU B 1 240 ? -39.783  -5.443  -39.741 0.44 71.67  ? 801  GLU B HG3  1 
ATOM   9199  N  N    . ASP B 1 241 ? -40.930  -10.324 -40.931 1.00 63.01  ? 802  ASP B N    1 
ATOM   9200  C  CA   . ASP B 1 241 ? -41.888  -11.370 -41.268 1.00 55.25  ? 802  ASP B CA   1 
ATOM   9201  C  C    . ASP B 1 241 ? -41.712  -12.608 -40.396 1.00 56.22  ? 802  ASP B C    1 
ATOM   9202  O  O    . ASP B 1 241 ? -42.679  -13.345 -40.171 1.00 47.91  ? 802  ASP B O    1 
ATOM   9203  C  CB   . ASP B 1 241 ? -41.754  -11.728 -42.747 1.00 64.34  ? 802  ASP B CB   1 
ATOM   9204  C  CG   . ASP B 1 241 ? -42.090  -10.566 -43.663 1.00 66.18  ? 802  ASP B CG   1 
ATOM   9205  O  OD1  . ASP B 1 241 ? -41.958  -9.400  -43.231 1.00 60.65  ? 802  ASP B OD1  1 
ATOM   9206  O  OD2  . ASP B 1 241 ? -42.487  -10.819 -44.819 1.00 84.39  ? 802  ASP B OD2  1 
ATOM   9207  H  H    . ASP B 1 241 ? -40.307  -10.209 -41.513 1.00 75.61  ? 802  ASP B H    1 
ATOM   9208  H  HA   . ASP B 1 241 ? -42.785  -11.030 -41.124 1.00 66.30  ? 802  ASP B HA   1 
ATOM   9209  H  HB2  . ASP B 1 241 ? -40.839  -11.997 -42.926 1.00 77.21  ? 802  ASP B HB2  1 
ATOM   9210  H  HB3  . ASP B 1 241 ? -42.360  -12.457 -42.951 1.00 77.21  ? 802  ASP B HB3  1 
ATOM   9211  N  N    . VAL B 1 242 ? -40.501  -12.855 -39.891 1.00 51.56  ? 803  VAL B N    1 
ATOM   9212  C  CA   . VAL B 1 242 ? -40.284  -14.002 -39.012 1.00 56.47  ? 803  VAL B CA   1 
ATOM   9213  C  C    . VAL B 1 242 ? -41.002  -13.792 -37.684 1.00 54.90  ? 803  VAL B C    1 
ATOM   9214  O  O    . VAL B 1 242 ? -41.733  -14.670 -37.211 1.00 55.54  ? 803  VAL B O    1 
ATOM   9215  C  CB   . VAL B 1 242 ? -38.777  -14.246 -38.803 1.00 59.38  ? 803  VAL B CB   1 
ATOM   9216  C  CG1  . VAL B 1 242 ? -38.538  -15.296 -37.721 1.00 47.87  ? 803  VAL B CG1  1 
ATOM   9217  C  CG2  . VAL B 1 242 ? -38.132  -14.687 -40.097 1.00 61.61  ? 803  VAL B CG2  1 
ATOM   9218  H  H    . VAL B 1 242 ? -39.799  -12.380 -40.040 1.00 61.87  ? 803  VAL B H    1 
ATOM   9219  H  HA   . VAL B 1 242 ? -40.658  -14.793 -39.431 1.00 67.76  ? 803  VAL B HA   1 
ATOM   9220  H  HB   . VAL B 1 242 ? -38.356  -13.418 -38.522 1.00 71.26  ? 803  VAL B HB   1 
ATOM   9221  H  HG11 . VAL B 1 242 ? -37.583  -15.426 -37.613 1.00 57.45  ? 803  VAL B HG11 1 
ATOM   9222  H  HG12 . VAL B 1 242 ? -38.925  -14.984 -36.888 1.00 57.45  ? 803  VAL B HG12 1 
ATOM   9223  H  HG13 . VAL B 1 242 ? -38.958  -16.128 -37.990 1.00 57.45  ? 803  VAL B HG13 1 
ATOM   9224  H  HG21 . VAL B 1 242 ? -37.186  -14.835 -39.943 1.00 73.93  ? 803  VAL B HG21 1 
ATOM   9225  H  HG22 . VAL B 1 242 ? -38.552  -15.510 -40.394 1.00 73.93  ? 803  VAL B HG22 1 
ATOM   9226  H  HG23 . VAL B 1 242 ? -38.256  -13.994 -40.764 1.00 73.93  ? 803  VAL B HG23 1 
ATOM   9227  N  N    . ILE B 1 243 ? -40.791  -12.631 -37.058 1.00 61.93  ? 804  ILE B N    1 
ATOM   9228  C  CA   . ILE B 1 243 ? -41.448  -12.333 -35.787 1.00 48.51  ? 804  ILE B CA   1 
ATOM   9229  C  C    . ILE B 1 243 ? -42.960  -12.390 -35.949 1.00 44.58  ? 804  ILE B C    1 
ATOM   9230  O  O    . ILE B 1 243 ? -43.671  -12.950 -35.105 1.00 46.95  ? 804  ILE B O    1 
ATOM   9231  C  CB   . ILE B 1 243 ? -40.985  -10.960 -35.260 1.00 49.01  ? 804  ILE B CB   1 
ATOM   9232  C  CG1  . ILE B 1 243 ? -39.485  -10.980 -34.945 1.00 48.50  ? 804  ILE B CG1  1 
ATOM   9233  C  CG2  . ILE B 1 243 ? -41.790  -10.545 -34.028 1.00 58.31  ? 804  ILE B CG2  1 
ATOM   9234  C  CD1  . ILE B 1 243 ? -39.091  -11.871 -33.775 1.00 50.28  ? 804  ILE B CD1  1 
ATOM   9235  H  H    . ILE B 1 243 ? -40.276  -12.005 -37.347 1.00 74.31  ? 804  ILE B H    1 
ATOM   9236  H  HA   . ILE B 1 243 ? -41.192  -13.004 -35.135 1.00 58.21  ? 804  ILE B HA   1 
ATOM   9237  H  HB   . ILE B 1 243 ? -41.139  -10.302 -35.957 1.00 58.81  ? 804  ILE B HB   1 
ATOM   9238  H  HG12 . ILE B 1 243 ? -39.008  -11.296 -35.728 1.00 58.20  ? 804  ILE B HG12 1 
ATOM   9239  H  HG13 . ILE B 1 243 ? -39.201  -10.077 -34.734 1.00 58.20  ? 804  ILE B HG13 1 
ATOM   9240  H  HG21 . ILE B 1 243 ? -41.476  -9.680  -33.723 1.00 69.97  ? 804  ILE B HG21 1 
ATOM   9241  H  HG22 . ILE B 1 243 ? -42.729  -10.491 -34.269 1.00 69.97  ? 804  ILE B HG22 1 
ATOM   9242  H  HG23 . ILE B 1 243 ? -41.665  -11.209 -33.332 1.00 69.97  ? 804  ILE B HG23 1 
ATOM   9243  H  HD11 . ILE B 1 243 ? -38.131  -11.821 -33.650 1.00 60.34  ? 804  ILE B HD11 1 
ATOM   9244  H  HD12 . ILE B 1 243 ? -39.546  -11.562 -32.976 1.00 60.34  ? 804  ILE B HD12 1 
ATOM   9245  H  HD13 . ILE B 1 243 ? -39.353  -12.784 -33.973 1.00 60.34  ? 804  ILE B HD13 1 
ATOM   9246  N  N    . ALA B 1 244 ? -43.476  -11.816 -37.037 1.00 45.96  ? 805  ALA B N    1 
ATOM   9247  C  CA   . ALA B 1 244 ? -44.908  -11.886 -37.295 1.00 49.29  ? 805  ALA B CA   1 
ATOM   9248  C  C    . ALA B 1 244 ? -45.369  -13.330 -37.441 1.00 54.11  ? 805  ALA B C    1 
ATOM   9249  O  O    . ALA B 1 244 ? -46.466  -13.687 -36.995 1.00 37.45  ? 805  ALA B O    1 
ATOM   9250  C  CB   . ALA B 1 244 ? -45.252  -11.084 -38.548 1.00 40.07  ? 805  ALA B CB   1 
ATOM   9251  H  H    . ALA B 1 244 ? -43.024  -11.389 -37.631 1.00 55.16  ? 805  ALA B H    1 
ATOM   9252  H  HA   . ALA B 1 244 ? -45.384  -11.492 -36.547 1.00 59.15  ? 805  ALA B HA   1 
ATOM   9253  H  HB1  . ALA B 1 244 ? -46.207  -11.140 -38.707 1.00 48.09  ? 805  ALA B HB1  1 
ATOM   9254  H  HB2  . ALA B 1 244 ? -44.992  -10.159 -38.412 1.00 48.09  ? 805  ALA B HB2  1 
ATOM   9255  H  HB3  . ALA B 1 244 ? -44.769  -11.456 -39.303 1.00 48.09  ? 805  ALA B HB3  1 
ATOM   9256  N  N    . ARG B 1 245 ? -44.539  -14.179 -38.048 1.00 59.50  ? 806  ARG B N    1 
ATOM   9257  C  CA   . ARG B 1 245 ? -44.928  -15.567 -38.264 1.00 46.40  ? 806  ARG B CA   1 
ATOM   9258  C  C    . ARG B 1 245 ? -45.049  -16.318 -36.943 1.00 53.12  ? 806  ARG B C    1 
ATOM   9259  O  O    . ARG B 1 245 ? -46.007  -17.071 -36.735 1.00 47.52  ? 806  ARG B O    1 
ATOM   9260  C  CB   . ARG B 1 245 ? -43.918  -16.259 -39.178 1.00 64.77  ? 806  ARG B CB   1 
ATOM   9261  C  CG   . ARG B 1 245 ? -44.404  -17.593 -39.714 1.00 61.10  ? 806  ARG B CG   1 
ATOM   9262  C  CD   . ARG B 1 245 ? -43.338  -18.297 -40.536 1.00 59.14  ? 806  ARG B CD   1 
ATOM   9263  N  NE   . ARG B 1 245 ? -43.930  -19.091 -41.612 1.00 67.41  ? 806  ARG B NE   1 
ATOM   9264  C  CZ   . ARG B 1 245 ? -43.973  -18.734 -42.894 1.00 71.95  ? 806  ARG B CZ   1 
ATOM   9265  N  NH1  . ARG B 1 245 ? -43.439  -17.587 -43.300 1.00 63.18  ? 806  ARG B NH1  1 
ATOM   9266  N  NH2  . ARG B 1 245 ? -44.545  -19.535 -43.783 1.00 73.05  ? 806  ARG B NH2  1 
ATOM   9267  H  H    . ARG B 1 245 ? -43.756  -13.977 -38.340 1.00 71.40  ? 806  ARG B H    1 
ATOM   9268  H  HA   . ARG B 1 245 ? -45.793  -15.589 -38.702 1.00 55.68  ? 806  ARG B HA   1 
ATOM   9269  H  HB2  . ARG B 1 245 ? -43.735  -15.682 -39.936 1.00 77.73  ? 806  ARG B HB2  1 
ATOM   9270  H  HB3  . ARG B 1 245 ? -43.101  -16.418 -38.680 1.00 77.73  ? 806  ARG B HB3  1 
ATOM   9271  H  HG2  . ARG B 1 245 ? -44.642  -18.168 -38.970 1.00 73.32  ? 806  ARG B HG2  1 
ATOM   9272  H  HG3  . ARG B 1 245 ? -45.176  -17.446 -40.283 1.00 73.32  ? 806  ARG B HG3  1 
ATOM   9273  H  HD2  . ARG B 1 245 ? -42.751  -17.635 -40.934 1.00 70.97  ? 806  ARG B HD2  1 
ATOM   9274  H  HD3  . ARG B 1 245 ? -42.833  -18.893 -39.961 1.00 70.97  ? 806  ARG B HD3  1 
ATOM   9275  H  HE   . ARG B 1 245 ? -44.278  -19.849 -41.400 1.00 80.89  ? 806  ARG B HE   1 
ATOM   9276  H  HH11 . ARG B 1 245 ? -43.067  -17.061 -42.731 1.00 75.81  ? 806  ARG B HH11 1 
ATOM   9277  H  HH12 . ARG B 1 245 ? -43.471  -17.369 -44.132 1.00 75.81  ? 806  ARG B HH12 1 
ATOM   9278  H  HH21 . ARG B 1 245 ? -44.890  -20.281 -43.530 1.00 87.66  ? 806  ARG B HH21 1 
ATOM   9279  H  HH22 . ARG B 1 245 ? -44.569  -19.310 -44.613 1.00 87.66  ? 806  ARG B HH22 1 
ATOM   9280  N  N    . GLU B 1 246 ? -44.077  -16.132 -36.043 1.00 47.58  ? 807  GLU B N    1 
ATOM   9281  C  CA   . GLU B 1 246 ? -44.097  -16.808 -34.746 1.00 49.12  ? 807  GLU B CA   1 
ATOM   9282  C  C    . GLU B 1 246 ? -45.412  -16.572 -34.013 1.00 53.59  ? 807  GLU B C    1 
ATOM   9283  O  O    . GLU B 1 246 ? -46.023  -17.510 -33.488 1.00 45.77  ? 807  GLU B O    1 
ATOM   9284  C  CB   . GLU B 1 246 ? -42.919  -16.329 -33.891 1.00 63.56  ? 807  GLU B CB   1 
ATOM   9285  C  CG   . GLU B 1 246 ? -43.021  -16.638 -32.384 1.00 69.06  ? 807  GLU B CG   1 
ATOM   9286  C  CD   . GLU B 1 246 ? -42.922  -18.118 -32.064 1.00 92.31  ? 807  GLU B CD   1 
ATOM   9287  O  OE1  . GLU B 1 246 ? -43.687  -18.919 -32.644 1.00 102.26 ? 807  GLU B OE1  1 
ATOM   9288  O  OE2  . GLU B 1 246 ? -42.073  -18.482 -31.225 1.00 90.41  ? 807  GLU B OE2  1 
ATOM   9289  H  H    . GLU B 1 246 ? -43.397  -15.620 -36.161 1.00 57.10  ? 807  GLU B H    1 
ATOM   9290  H  HA   . GLU B 1 246 ? -43.999  -17.763 -34.885 1.00 58.94  ? 807  GLU B HA   1 
ATOM   9291  H  HB2  . GLU B 1 246 ? -42.110  -16.751 -34.220 1.00 76.27  ? 807  GLU B HB2  1 
ATOM   9292  H  HB3  . GLU B 1 246 ? -42.843  -15.367 -33.985 1.00 76.27  ? 807  GLU B HB3  1 
ATOM   9293  H  HG2  . GLU B 1 246 ? -42.299  -16.184 -31.922 1.00 82.87  ? 807  GLU B HG2  1 
ATOM   9294  H  HG3  . GLU B 1 246 ? -43.875  -16.318 -32.056 1.00 82.87  ? 807  GLU B HG3  1 
ATOM   9295  N  N    . LEU B 1 247 ? -45.850  -15.312 -33.951 1.00 60.42  ? 808  LEU B N    1 
ATOM   9296  C  CA   . LEU B 1 247 ? -47.080  -14.983 -33.239 1.00 51.94  ? 808  LEU B CA   1 
ATOM   9297  C  C    . LEU B 1 247 ? -48.298  -15.528 -33.972 1.00 40.55  ? 808  LEU B C    1 
ATOM   9298  O  O    . LEU B 1 247 ? -49.167  -16.161 -33.363 1.00 45.87  ? 808  LEU B O    1 
ATOM   9299  C  CB   . LEU B 1 247 ? -47.193  -13.467 -33.063 1.00 40.70  ? 808  LEU B CB   1 
ATOM   9300  C  CG   . LEU B 1 247 ? -48.445  -12.914 -32.373 1.00 35.72  ? 808  LEU B CG   1 
ATOM   9301  C  CD1  . LEU B 1 247 ? -48.580  -13.439 -30.956 1.00 41.00  ? 808  LEU B CD1  1 
ATOM   9302  C  CD2  . LEU B 1 247 ? -48.400  -11.396 -32.384 1.00 51.39  ? 808  LEU B CD2  1 
ATOM   9303  H  H    . LEU B 1 247 ? -45.455  -14.638 -34.311 1.00 72.50  ? 808  LEU B H    1 
ATOM   9304  H  HA   . LEU B 1 247 ? -47.054  -15.387 -32.358 1.00 62.33  ? 808  LEU B HA   1 
ATOM   9305  H  HB2  . LEU B 1 247 ? -46.430  -13.170 -32.542 1.00 48.84  ? 808  LEU B HB2  1 
ATOM   9306  H  HB3  . LEU B 1 247 ? -47.152  -13.060 -33.942 1.00 48.84  ? 808  LEU B HB3  1 
ATOM   9307  H  HG   . LEU B 1 247 ? -49.229  -13.194 -32.872 1.00 42.86  ? 808  LEU B HG   1 
ATOM   9308  H  HD11 . LEU B 1 247 ? -49.382  -13.067 -30.557 1.00 49.20  ? 808  LEU B HD11 1 
ATOM   9309  H  HD12 . LEU B 1 247 ? -48.642  -14.407 -30.983 1.00 49.20  ? 808  LEU B HD12 1 
ATOM   9310  H  HD13 . LEU B 1 247 ? -47.800  -13.171 -30.445 1.00 49.20  ? 808  LEU B HD13 1 
ATOM   9311  H  HD21 . LEU B 1 247 ? -49.195  -11.054 -31.946 1.00 61.67  ? 808  LEU B HD21 1 
ATOM   9312  H  HD22 . LEU B 1 247 ? -47.607  -11.101 -31.909 1.00 61.67  ? 808  LEU B HD22 1 
ATOM   9313  H  HD23 . LEU B 1 247 ? -48.369  -11.088 -33.303 1.00 61.67  ? 808  LEU B HD23 1 
ATOM   9314  N  N    . ILE B 1 248 ? -48.365  -15.308 -35.288 1.00 39.70  ? 809  ILE B N    1 
ATOM   9315  C  CA   . ILE B 1 248 ? -49.567  -15.650 -36.049 1.00 49.43  ? 809  ILE B CA   1 
ATOM   9316  C  C    . ILE B 1 248 ? -49.861  -17.141 -35.950 1.00 48.81  ? 809  ILE B C    1 
ATOM   9317  O  O    . ILE B 1 248 ? -50.976  -17.546 -35.600 1.00 63.04  ? 809  ILE B O    1 
ATOM   9318  C  CB   . ILE B 1 248 ? -49.423  -15.195 -37.513 1.00 43.13  ? 809  ILE B CB   1 
ATOM   9319  C  CG1  . ILE B 1 248 ? -49.586  -13.677 -37.591 1.00 41.65  ? 809  ILE B CG1  1 
ATOM   9320  C  CG2  . ILE B 1 248 ? -50.471  -15.872 -38.399 1.00 42.21  ? 809  ILE B CG2  1 
ATOM   9321  C  CD1  . ILE B 1 248 ? -49.343  -13.079 -38.964 1.00 46.77  ? 809  ILE B CD1  1 
ATOM   9322  H  H    . ILE B 1 248 ? -47.733  -14.965 -35.760 1.00 47.64  ? 809  ILE B H    1 
ATOM   9323  H  HA   . ILE B 1 248 ? -50.322  -15.175 -35.667 1.00 59.31  ? 809  ILE B HA   1 
ATOM   9324  H  HB   . ILE B 1 248 ? -48.538  -15.434 -37.831 1.00 51.76  ? 809  ILE B HB   1 
ATOM   9325  H  HG12 . ILE B 1 248 ? -50.492  -13.450 -37.329 1.00 49.97  ? 809  ILE B HG12 1 
ATOM   9326  H  HG13 . ILE B 1 248 ? -48.957  -13.266 -36.977 1.00 49.97  ? 809  ILE B HG13 1 
ATOM   9327  H  HG21 . ILE B 1 248 ? -50.355  -15.567 -39.312 1.00 50.65  ? 809  ILE B HG21 1 
ATOM   9328  H  HG22 . ILE B 1 248 ? -50.350  -16.833 -38.352 1.00 50.65  ? 809  ILE B HG22 1 
ATOM   9329  H  HG23 . ILE B 1 248 ? -51.355  -15.634 -38.079 1.00 50.65  ? 809  ILE B HG23 1 
ATOM   9330  H  HD11 . ILE B 1 248 ? -49.468  -12.118 -38.917 1.00 56.13  ? 809  ILE B HD11 1 
ATOM   9331  H  HD12 . ILE B 1 248 ? -48.435  -13.281 -39.240 1.00 56.13  ? 809  ILE B HD12 1 
ATOM   9332  H  HD13 . ILE B 1 248 ? -49.973  -13.465 -39.592 1.00 56.13  ? 809  ILE B HD13 1 
ATOM   9333  N  N    . GLU B 1 249 ? -48.871  -17.982 -36.260 1.00 56.90  ? 810  GLU B N    1 
ATOM   9334  C  CA   . GLU B 1 249 ? -49.114  -19.420 -36.289 1.00 55.99  ? 810  GLU B CA   1 
ATOM   9335  C  C    . GLU B 1 249 ? -49.403  -19.984 -34.904 1.00 50.27  ? 810  GLU B C    1 
ATOM   9336  O  O    . GLU B 1 249 ? -49.979  -21.072 -34.804 1.00 57.07  ? 810  GLU B O    1 
ATOM   9337  C  CB   . GLU B 1 249 ? -47.931  -20.150 -36.937 1.00 58.19  ? 810  GLU B CB   1 
ATOM   9338  C  CG   . GLU B 1 249 ? -46.632  -20.138 -36.149 1.00 62.12  ? 810  GLU B CG   1 
ATOM   9339  C  CD   . GLU B 1 249 ? -45.448  -20.634 -36.974 1.00 70.32  ? 810  GLU B CD   1 
ATOM   9340  O  OE1  . GLU B 1 249 ? -45.646  -21.004 -38.153 1.00 51.33  ? 810  GLU B OE1  1 
ATOM   9341  O  OE2  . GLU B 1 249 ? -44.317  -20.650 -36.444 1.00 69.87  ? 810  GLU B OE2  1 
ATOM   9342  H  H    . GLU B 1 249 ? -48.066  -17.748 -36.453 1.00 68.28  ? 810  GLU B H    1 
ATOM   9343  H  HA   . GLU B 1 249 ? -49.895  -19.587 -36.839 1.00 67.19  ? 810  GLU B HA   1 
ATOM   9344  H  HB2  . GLU B 1 249 ? -48.181  -21.078 -37.070 1.00 69.82  ? 810  GLU B HB2  1 
ATOM   9345  H  HB3  . GLU B 1 249 ? -47.752  -19.738 -37.796 1.00 69.82  ? 810  GLU B HB3  1 
ATOM   9346  H  HG2  . GLU B 1 249 ? -46.442  -19.231 -35.864 1.00 74.54  ? 810  GLU B HG2  1 
ATOM   9347  H  HG3  . GLU B 1 249 ? -46.724  -20.717 -35.376 1.00 74.54  ? 810  GLU B HG3  1 
ATOM   9348  N  N    . LYS B 1 250 ? -49.036  -19.270 -33.838 1.00 52.55  ? 811  LYS B N    1 
ATOM   9349  C  CA   . LYS B 1 250 ? -49.486  -19.660 -32.506 1.00 45.51  ? 811  LYS B CA   1 
ATOM   9350  C  C    . LYS B 1 250 ? -50.928  -19.243 -32.251 1.00 49.20  ? 811  LYS B C    1 
ATOM   9351  O  O    . LYS B 1 250 ? -51.634  -19.913 -31.490 1.00 61.40  ? 811  LYS B O    1 
ATOM   9352  C  CB   . LYS B 1 250 ? -48.574  -19.061 -31.433 1.00 51.01  ? 811  LYS B CB   1 
ATOM   9353  C  CG   . LYS B 1 250 ? -47.264  -19.816 -31.246 1.00 74.12  ? 811  LYS B CG   1 
ATOM   9354  C  CD   . LYS B 1 250 ? -46.548  -19.418 -29.962 1.00 50.19  ? 811  LYS B CD   1 
ATOM   9355  C  CE   . LYS B 1 250 ? -45.386  -20.356 -29.672 1.00 77.68  ? 811  LYS B CE   1 
ATOM   9356  N  NZ   . LYS B 1 250 ? -44.784  -20.114 -28.333 1.00 91.47  ? 811  LYS B NZ   1 
ATOM   9357  H  H    . LYS B 1 250 ? -48.538  -18.570 -33.859 1.00 63.06  ? 811  LYS B H    1 
ATOM   9358  H  HA   . LYS B 1 250 ? -49.438  -20.626 -32.430 1.00 54.61  ? 811  LYS B HA   1 
ATOM   9359  H  HB2  . LYS B 1 250 ? -48.358  -18.149 -31.682 1.00 61.21  ? 811  LYS B HB2  1 
ATOM   9360  H  HB3  . LYS B 1 250 ? -49.044  -19.068 -30.585 1.00 61.21  ? 811  LYS B HB3  1 
ATOM   9361  H  HG2  . LYS B 1 250 ? -47.448  -20.768 -31.206 1.00 88.94  ? 811  LYS B HG2  1 
ATOM   9362  H  HG3  . LYS B 1 250 ? -46.675  -19.622 -31.992 1.00 88.94  ? 811  LYS B HG3  1 
ATOM   9363  H  HD2  . LYS B 1 250 ? -46.199  -18.518 -30.054 1.00 60.23  ? 811  LYS B HD2  1 
ATOM   9364  H  HD3  . LYS B 1 250 ? -47.171  -19.464 -29.219 1.00 60.23  ? 811  LYS B HD3  1 
ATOM   9365  H  HE2  . LYS B 1 250 ? -45.704  -21.272 -29.698 1.00 93.22  ? 811  LYS B HE2  1 
ATOM   9366  H  HE3  . LYS B 1 250 ? -44.697  -20.223 -30.341 1.00 93.22  ? 811  LYS B HE3  1 
ATOM   9367  H  HZ1  . LYS B 1 250 ? -44.478  -19.280 -28.284 1.00 109.77 ? 811  LYS B HZ1  1 
ATOM   9368  H  HZ2  . LYS B 1 250 ? -45.395  -20.236 -27.698 1.00 109.77 ? 811  LYS B HZ2  1 
ATOM   9369  H  HZ3  . LYS B 1 250 ? -44.109  -20.678 -28.198 1.00 109.77 ? 811  LYS B HZ3  1 
ATOM   9370  N  N    . MET B 1 251 ? -51.385  -18.156 -32.880 1.00 53.77  ? 812  MET B N    1 
ATOM   9371  C  CA   . MET B 1 251 ? -52.749  -17.678 -32.672 1.00 52.53  ? 812  MET B CA   1 
ATOM   9372  C  C    . MET B 1 251 ? -53.769  -18.512 -33.442 1.00 49.73  ? 812  MET B C    1 
ATOM   9373  O  O    . MET B 1 251 ? -54.873  -18.757 -32.944 1.00 54.76  ? 812  MET B O    1 
ATOM   9374  C  CB   . MET B 1 251 ? -52.858  -16.210 -33.086 1.00 44.72  ? 812  MET B CB   1 
ATOM   9375  C  CG   . MET B 1 251 ? -52.167  -15.241 -32.140 1.00 60.03  ? 812  MET B CG   1 
ATOM   9376  S  SD   . MET B 1 251 ? -52.421  -13.512 -32.591 1.00 48.05  ? 812  MET B SD   1 
ATOM   9377  C  CE   . MET B 1 251 ? -51.664  -13.458 -34.203 1.00 58.22  ? 812  MET B CE   1 
ATOM   9378  H  H    . MET B 1 251 ? -50.925  -17.681 -33.430 1.00 64.52  ? 812  MET B H    1 
ATOM   9379  H  HA   . MET B 1 251 ? -52.956  -17.732 -31.726 1.00 63.04  ? 812  MET B HA   1 
ATOM   9380  H  HB2  . MET B 1 251 ? -52.455  -16.104 -33.962 1.00 53.67  ? 812  MET B HB2  1 
ATOM   9381  H  HB3  . MET B 1 251 ? -53.796  -15.966 -33.125 1.00 53.67  ? 812  MET B HB3  1 
ATOM   9382  H  HG2  . MET B 1 251 ? -52.517  -15.372 -31.245 1.00 72.03  ? 812  MET B HG2  1 
ATOM   9383  H  HG3  . MET B 1 251 ? -51.213  -15.416 -32.151 1.00 72.03  ? 812  MET B HG3  1 
ATOM   9384  H  HE1  . MET B 1 251 ? -51.740  -12.557 -34.556 1.00 69.86  ? 812  MET B HE1  1 
ATOM   9385  H  HE2  . MET B 1 251 ? -50.730  -13.704 -34.120 1.00 69.86  ? 812  MET B HE2  1 
ATOM   9386  H  HE3  . MET B 1 251 ? -52.121  -14.082 -34.787 1.00 69.86  ? 812  MET B HE3  1 
ATOM   9387  N  N    . ILE B 1 252 ? -53.423  -18.945 -34.654 1.00 60.41  ? 813  ILE B N    1 
ATOM   9388  C  CA   . ILE B 1 252 ? -54.323  -19.732 -35.496 1.00 60.56  ? 813  ILE B CA   1 
ATOM   9389  C  C    . ILE B 1 252 ? -54.071  -21.219 -35.272 1.00 56.08  ? 813  ILE B C    1 
ATOM   9390  O  O    . ILE B 1 252 ? -54.619  -22.063 -35.990 1.00 49.50  ? 813  ILE B O    1 
ATOM   9391  C  CB   . ILE B 1 252 ? -54.176  -19.368 -36.987 1.00 58.37  ? 813  ILE B CB   1 
ATOM   9392  C  CG1  . ILE B 1 252 ? -52.741  -19.631 -37.465 1.00 60.05  ? 813  ILE B CG1  1 
ATOM   9393  C  CG2  . ILE B 1 252 ? -54.610  -17.923 -37.218 1.00 57.87  ? 813  ILE B CG2  1 
ATOM   9394  C  CD1  . ILE B 1 252 ? -52.449  -19.174 -38.881 1.00 56.60  ? 813  ILE B CD1  1 
ATOM   9395  H  H    . ILE B 1 252 ? -52.659  -18.792 -35.018 1.00 72.50  ? 813  ILE B H    1 
ATOM   9396  H  HA   . ILE B 1 252 ? -55.238  -19.545 -35.235 1.00 72.67  ? 813  ILE B HA   1 
ATOM   9397  H  HB   . ILE B 1 252 ? -54.769  -19.943 -37.495 1.00 70.04  ? 813  ILE B HB   1 
ATOM   9398  H  HG12 . ILE B 1 252 ? -52.128  -19.166 -36.874 1.00 72.06  ? 813  ILE B HG12 1 
ATOM   9399  H  HG13 . ILE B 1 252 ? -52.572  -20.586 -37.424 1.00 72.06  ? 813  ILE B HG13 1 
ATOM   9400  H  HG21 . ILE B 1 252 ? -54.511  -17.711 -38.160 1.00 69.45  ? 813  ILE B HG21 1 
ATOM   9401  H  HG22 . ILE B 1 252 ? -55.537  -17.825 -36.953 1.00 69.45  ? 813  ILE B HG22 1 
ATOM   9402  H  HG23 . ILE B 1 252 ? -54.049  -17.336 -36.686 1.00 69.45  ? 813  ILE B HG23 1 
ATOM   9403  H  HD11 . ILE B 1 252 ? -51.526  -19.380 -39.094 1.00 67.92  ? 813  ILE B HD11 1 
ATOM   9404  H  HD12 . ILE B 1 252 ? -53.042  -19.640 -39.491 1.00 67.92  ? 813  ILE B HD12 1 
ATOM   9405  H  HD13 . ILE B 1 252 ? -52.598  -18.218 -38.940 1.00 67.92  ? 813  ILE B HD13 1 
ATOM   9406  N  N    . ALA B 1 253 ? -53.219  -21.546 -34.300 1.00 57.87  ? 814  ALA B N    1 
ATOM   9407  C  CA   . ALA B 1 253 ? -52.873  -22.935 -34.030 1.00 52.29  ? 814  ALA B CA   1 
ATOM   9408  C  C    . ALA B 1 253 ? -54.126  -23.781 -33.842 1.00 49.93  ? 814  ALA B C    1 
ATOM   9409  O  O    . ALA B 1 253 ? -55.104  -23.352 -33.224 1.00 58.02  ? 814  ALA B O    1 
ATOM   9410  C  CB   . ALA B 1 253 ? -51.985  -23.026 -32.786 1.00 49.91  ? 814  ALA B CB   1 
ATOM   9411  H  H    . ALA B 1 253 ? -52.829  -20.980 -33.784 1.00 69.44  ? 814  ALA B H    1 
ATOM   9412  H  HA   . ALA B 1 253 ? -52.377  -23.292 -34.783 1.00 62.75  ? 814  ALA B HA   1 
ATOM   9413  H  HB1  . ALA B 1 253 ? -51.766  -23.956 -32.623 1.00 59.90  ? 814  ALA B HB1  1 
ATOM   9414  H  HB2  . ALA B 1 253 ? -51.174  -22.516 -32.940 1.00 59.90  ? 814  ALA B HB2  1 
ATOM   9415  H  HB3  . ALA B 1 253 ? -52.466  -22.660 -32.028 1.00 59.90  ? 814  ALA B HB3  1 
ATOM   9416  N  N    . MET B 1 254 ? -54.091  -24.989 -34.409 1.00 64.18  ? 815  MET B N    1 
ATOM   9417  C  CA   . MET B 1 254 ? -55.250  -25.874 -34.381 1.00 58.91  ? 815  MET B CA   1 
ATOM   9418  C  C    . MET B 1 254 ? -55.641  -26.253 -32.959 1.00 62.54  ? 815  MET B C    1 
ATOM   9419  O  O    . MET B 1 254 ? -56.823  -26.491 -32.682 1.00 49.94  ? 815  MET B O    1 
ATOM   9420  C  CB   . MET B 1 254 ? -54.948  -27.133 -35.192 1.00 69.15  ? 815  MET B CB   1 
ATOM   9421  C  CG   . MET B 1 254 ? -56.168  -27.808 -35.781 1.00 84.40  ? 815  MET B CG   1 
ATOM   9422  S  SD   . MET B 1 254 ? -56.833  -26.931 -37.208 1.00 81.17  ? 815  MET B SD   1 
ATOM   9423  C  CE   . MET B 1 254 ? -57.844  -28.223 -37.919 1.00 77.30  ? 815  MET B CE   1 
ATOM   9424  H  H    . MET B 1 254 ? -53.407  -25.316 -34.815 1.00 77.01  ? 815  MET B H    1 
ATOM   9425  H  HA   . MET B 1 254 ? -55.998  -25.423 -34.802 1.00 70.70  ? 815  MET B HA   1 
ATOM   9426  H  HB2  . MET B 1 254 ? -54.360  -26.895 -35.926 1.00 82.98  ? 815  MET B HB2  1 
ATOM   9427  H  HB3  . MET B 1 254 ? -54.506  -27.775 -34.615 1.00 82.98  ? 815  MET B HB3  1 
ATOM   9428  H  HG2  . MET B 1 254 ? -55.928  -28.704 -36.065 1.00 101.28 ? 815  MET B HG2  1 
ATOM   9429  H  HG3  . MET B 1 254 ? -56.863  -27.850 -35.104 1.00 101.28 ? 815  MET B HG3  1 
ATOM   9430  H  HE1  . MET B 1 254 ? -57.278  -28.978 -38.145 1.00 92.76  ? 815  MET B HE1  1 
ATOM   9431  H  HE2  . MET B 1 254 ? -58.514  -28.492 -37.271 1.00 92.76  ? 815  MET B HE2  1 
ATOM   9432  H  HE3  . MET B 1 254 ? -58.275  -27.882 -38.718 1.00 92.76  ? 815  MET B HE3  1 
ATOM   9433  N  N    . ASP B 1 255 ? -54.669  -26.309 -32.046 1.00 59.19  ? 816  ASP B N    1 
ATOM   9434  C  CA   . ASP B 1 255 ? -54.923  -26.715 -30.669 1.00 62.88  ? 816  ASP B CA   1 
ATOM   9435  C  C    . ASP B 1 255 ? -55.333  -25.485 -29.867 1.00 60.19  ? 816  ASP B C    1 
ATOM   9436  O  O    . ASP B 1 255 ? -54.492  -24.599 -29.645 1.00 71.43  ? 816  ASP B O    1 
ATOM   9437  C  CB   . ASP B 1 255 ? -53.676  -27.357 -30.065 1.00 74.44  ? 816  ASP B CB   1 
ATOM   9438  C  CG   . ASP B 1 255 ? -53.920  -27.949 -28.683 1.00 78.61  ? 816  ASP B CG   1 
ATOM   9439  O  OD1  . ASP B 1 255 ? -55.095  -28.169 -28.314 1.00 70.61  ? 816  ASP B OD1  1 
ATOM   9440  O  OD2  . ASP B 1 255 ? -52.930  -28.208 -27.965 1.00 68.54  ? 816  ASP B OD2  1 
ATOM   9441  H  H    . ASP B 1 255 ? -53.847  -26.114 -32.205 1.00 71.03  ? 816  ASP B H    1 
ATOM   9442  H  HA   . ASP B 1 255 ? -55.648  -27.358 -30.645 1.00 75.45  ? 816  ASP B HA   1 
ATOM   9443  H  HB2  . ASP B 1 255 ? -53.377  -28.073 -30.648 1.00 89.32  ? 816  ASP B HB2  1 
ATOM   9444  H  HB3  . ASP B 1 255 ? -52.983  -26.684 -29.984 1.00 89.32  ? 816  ASP B HB3  1 
ATOM   9445  N  N    . PRO B 1 256 ? -56.585  -25.380 -29.409 1.00 55.61  ? 817  PRO B N    1 
ATOM   9446  C  CA   . PRO B 1 256 ? -57.006  -24.151 -28.711 1.00 46.59  ? 817  PRO B CA   1 
ATOM   9447  C  C    . PRO B 1 256 ? -56.214  -23.864 -27.452 1.00 59.65  ? 817  PRO B C    1 
ATOM   9448  O  O    . PRO B 1 256 ? -56.180  -22.710 -27.010 1.00 62.08  ? 817  PRO B O    1 
ATOM   9449  C  CB   . PRO B 1 256 ? -58.484  -24.415 -28.388 1.00 51.03  ? 817  PRO B CB   1 
ATOM   9450  C  CG   . PRO B 1 256 ? -58.896  -25.515 -29.300 1.00 57.10  ? 817  PRO B CG   1 
ATOM   9451  C  CD   . PRO B 1 256 ? -57.683  -26.356 -29.501 1.00 56.69  ? 817  PRO B CD   1 
ATOM   9452  H  HA   . PRO B 1 256 ? -56.942  -23.389 -29.308 1.00 55.90  ? 817  PRO B HA   1 
ATOM   9453  H  HB2  . PRO B 1 256 ? -58.572  -24.687 -27.461 1.00 61.24  ? 817  PRO B HB2  1 
ATOM   9454  H  HB3  . PRO B 1 256 ? -59.004  -23.614 -28.561 1.00 61.24  ? 817  PRO B HB3  1 
ATOM   9455  H  HG2  . PRO B 1 256 ? -59.604  -26.032 -28.884 1.00 68.51  ? 817  PRO B HG2  1 
ATOM   9456  H  HG3  . PRO B 1 256 ? -59.196  -25.143 -30.143 1.00 68.51  ? 817  PRO B HG3  1 
ATOM   9457  H  HD2  . PRO B 1 256 ? -57.608  -27.018 -28.796 1.00 68.03  ? 817  PRO B HD2  1 
ATOM   9458  H  HD3  . PRO B 1 256 ? -57.698  -26.769 -30.378 1.00 68.03  ? 817  PRO B HD3  1 
ATOM   9459  N  N    . GLN B 1 257 ? -55.570  -24.871 -26.865 1.00 60.65  ? 818  GLN B N    1 
ATOM   9460  C  CA   . GLN B 1 257 ? -54.806  -24.671 -25.642 1.00 57.27  ? 818  GLN B CA   1 
ATOM   9461  C  C    . GLN B 1 257 ? -53.460  -24.006 -25.892 1.00 62.61  ? 818  GLN B C    1 
ATOM   9462  O  O    . GLN B 1 257 ? -52.864  -23.475 -24.949 1.00 70.26  ? 818  GLN B O    1 
ATOM   9463  C  CB   . GLN B 1 257 ? -54.589  -26.012 -24.940 1.00 69.63  ? 818  GLN B CB   1 
ATOM   9464  C  CG   . GLN B 1 257 ? -55.866  -26.807 -24.708 1.00 83.06  ? 818  GLN B CG   1 
ATOM   9465  C  CD   . GLN B 1 257 ? -55.593  -28.210 -24.197 1.00 100.71 ? 818  GLN B CD   1 
ATOM   9466  O  OE1  . GLN B 1 257 ? -55.168  -28.396 -23.056 1.00 92.04  ? 818  GLN B OE1  1 
ATOM   9467  N  NE2  . GLN B 1 257 ? -55.830  -29.205 -25.045 1.00 91.77  ? 818  GLN B NE2  1 
ATOM   9468  H  H    . GLN B 1 257 ? -55.562  -25.680 -27.157 1.00 72.78  ? 818  GLN B H    1 
ATOM   9469  H  HA   . GLN B 1 257 ? -55.314  -24.100 -25.044 1.00 68.72  ? 818  GLN B HA   1 
ATOM   9470  H  HB2  . GLN B 1 257 ? -53.998  -26.556 -25.483 1.00 83.56  ? 818  GLN B HB2  1 
ATOM   9471  H  HB3  . GLN B 1 257 ? -54.182  -25.848 -24.075 1.00 83.56  ? 818  GLN B HB3  1 
ATOM   9472  H  HG2  . GLN B 1 257 ? -56.410  -26.347 -24.050 1.00 99.67  ? 818  GLN B HG2  1 
ATOM   9473  H  HG3  . GLN B 1 257 ? -56.350  -26.881 -25.546 1.00 99.67  ? 818  GLN B HG3  1 
ATOM   9474  H  HE21 . GLN B 1 257 ? -56.122  -29.036 -25.836 1.00 110.12 ? 818  GLN B HE21 1 
ATOM   9475  H  HE22 . GLN B 1 257 ? -55.691  -30.019 -24.803 1.00 110.12 ? 818  GLN B HE22 1 
ATOM   9476  N  N    . LYS B 1 258 ? -52.970  -24.024 -27.131 1.00 63.63  ? 819  LYS B N    1 
ATOM   9477  C  CA   . LYS B 1 258 ? -51.695  -23.410 -27.477 1.00 71.65  ? 819  LYS B CA   1 
ATOM   9478  C  C    . LYS B 1 258 ? -51.836  -21.975 -27.971 1.00 72.29  ? 819  LYS B C    1 
ATOM   9479  O  O    . LYS B 1 258 ? -50.820  -21.337 -28.263 1.00 61.50  ? 819  LYS B O    1 
ATOM   9480  C  CB   . LYS B 1 258 ? -50.984  -24.245 -28.546 1.00 67.01  ? 819  LYS B CB   1 
ATOM   9481  C  CG   . LYS B 1 258 ? -50.162  -25.397 -27.991 1.00 79.50  ? 819  LYS B CG   1 
ATOM   9482  C  CD   . LYS B 1 258 ? -48.677  -25.192 -28.259 1.00 77.90  ? 819  LYS B CD   1 
ATOM   9483  C  CE   . LYS B 1 258 ? -47.830  -26.265 -27.590 1.00 86.86  ? 819  LYS B CE   1 
ATOM   9484  N  NZ   . LYS B 1 258 ? -48.210  -27.637 -28.025 1.00 88.53  ? 819  LYS B NZ   1 
ATOM   9485  H  H    . LYS B 1 258 ? -53.367  -24.393 -27.798 1.00 76.35  ? 819  LYS B H    1 
ATOM   9486  H  HA   . LYS B 1 258 ? -51.131  -23.397 -26.688 1.00 85.98  ? 819  LYS B HA   1 
ATOM   9487  H  HB2  . LYS B 1 258 ? -51.651  -24.620 -29.143 1.00 80.41  ? 819  LYS B HB2  1 
ATOM   9488  H  HB3  . LYS B 1 258 ? -50.385  -23.669 -29.045 1.00 80.41  ? 819  LYS B HB3  1 
ATOM   9489  H  HG2  . LYS B 1 258 ? -50.294  -25.453 -27.032 1.00 95.39  ? 819  LYS B HG2  1 
ATOM   9490  H  HG3  . LYS B 1 258 ? -50.438  -26.223 -28.418 1.00 95.39  ? 819  LYS B HG3  1 
ATOM   9491  H  HD2  . LYS B 1 258 ? -48.517  -25.231 -29.215 1.00 93.48  ? 819  LYS B HD2  1 
ATOM   9492  H  HD3  . LYS B 1 258 ? -48.406  -24.329 -27.909 1.00 93.48  ? 819  LYS B HD3  1 
ATOM   9493  H  HE2  . LYS B 1 258 ? -46.898  -26.122 -27.820 1.00 104.23 ? 819  LYS B HE2  1 
ATOM   9494  H  HE3  . LYS B 1 258 ? -47.948  -26.209 -26.629 1.00 104.23 ? 819  LYS B HE3  1 
ATOM   9495  H  HZ1  . LYS B 1 258 ? -47.696  -28.239 -27.616 1.00 106.24 ? 819  LYS B HZ1  1 
ATOM   9496  H  HZ2  . LYS B 1 258 ? -49.061  -27.797 -27.819 1.00 106.24 ? 819  LYS B HZ2  1 
ATOM   9497  H  HZ3  . LYS B 1 258 ? -48.104  -27.718 -28.905 1.00 106.24 ? 819  LYS B HZ3  1 
ATOM   9498  N  N    . ARG B 1 259 ? -53.058  -21.453 -28.069 1.00 75.94  ? 820  ARG B N    1 
ATOM   9499  C  CA   . ARG B 1 259 ? -53.261  -20.082 -28.523 1.00 61.59  ? 820  ARG B CA   1 
ATOM   9500  C  C    . ARG B 1 259 ? -53.081  -19.118 -27.354 1.00 60.57  ? 820  ARG B C    1 
ATOM   9501  O  O    . ARG B 1 259 ? -53.690  -19.318 -26.298 1.00 55.42  ? 820  ARG B O    1 
ATOM   9502  C  CB   . ARG B 1 259 ? -54.654  -19.916 -29.123 1.00 50.60  ? 820  ARG B CB   1 
ATOM   9503  C  CG   . ARG B 1 259 ? -54.929  -20.824 -30.307 1.00 57.23  ? 820  ARG B CG   1 
ATOM   9504  C  CD   . ARG B 1 259 ? -56.388  -20.759 -30.726 1.00 46.01  ? 820  ARG B CD   1 
ATOM   9505  N  NE   . ARG B 1 259 ? -56.753  -21.875 -31.592 1.00 54.95  ? 820  ARG B NE   1 
ATOM   9506  C  CZ   . ARG B 1 259 ? -58.001  -22.193 -31.916 1.00 61.12  ? 820  ARG B CZ   1 
ATOM   9507  N  NH1  . ARG B 1 259 ? -59.017  -21.479 -31.447 1.00 48.41  ? 820  ARG B NH1  1 
ATOM   9508  N  NH2  . ARG B 1 259 ? -58.235  -23.228 -32.710 1.00 56.51  ? 820  ARG B NH2  1 
ATOM   9509  H  H    . ARG B 1 259 ? -53.784  -21.873 -27.878 1.00 91.13  ? 820  ARG B H    1 
ATOM   9510  H  HA   . ARG B 1 259 ? -52.605  -19.866 -29.204 1.00 73.91  ? 820  ARG B HA   1 
ATOM   9511  H  HB2  . ARG B 1 259 ? -55.314  -20.113 -28.440 1.00 60.72  ? 820  ARG B HB2  1 
ATOM   9512  H  HB3  . ARG B 1 259 ? -54.757  -18.999 -29.424 1.00 60.72  ? 820  ARG B HB3  1 
ATOM   9513  H  HG2  . ARG B 1 259 ? -54.383  -20.545 -31.058 1.00 68.68  ? 820  ARG B HG2  1 
ATOM   9514  H  HG3  . ARG B 1 259 ? -54.722  -21.740 -30.063 1.00 68.68  ? 820  ARG B HG3  1 
ATOM   9515  H  HD2  . ARG B 1 259 ? -56.949  -20.793 -29.935 1.00 55.21  ? 820  ARG B HD2  1 
ATOM   9516  H  HD3  . ARG B 1 259 ? -56.544  -19.934 -31.212 1.00 55.21  ? 820  ARG B HD3  1 
ATOM   9517  H  HE   . ARG B 1 259 ? -56.119  -22.359 -31.913 1.00 65.94  ? 820  ARG B HE   1 
ATOM   9518  H  HH11 . ARG B 1 259 ? -58.868  -20.807 -30.931 1.00 58.09  ? 820  ARG B HH11 1 
ATOM   9519  H  HH12 . ARG B 1 259 ? -59.824  -21.688 -31.659 1.00 58.09  ? 820  ARG B HH12 1 
ATOM   9520  H  HH21 . ARG B 1 259 ? -57.579  -23.692 -33.016 1.00 67.82  ? 820  ARG B HH21 1 
ATOM   9521  H  HH22 . ARG B 1 259 ? -59.043  -23.434 -32.921 1.00 67.82  ? 820  ARG B HH22 1 
ATOM   9522  N  N    . PRO B 1 260 ? -52.272  -18.070 -27.498 1.00 63.30  ? 821  PRO B N    1 
ATOM   9523  C  CA   . PRO B 1 260 ? -52.073  -17.140 -26.384 1.00 66.05  ? 821  PRO B CA   1 
ATOM   9524  C  C    . PRO B 1 260 ? -53.258  -16.205 -26.208 1.00 54.50  ? 821  PRO B C    1 
ATOM   9525  O  O    . PRO B 1 260 ? -53.980  -15.886 -27.155 1.00 51.33  ? 821  PRO B O    1 
ATOM   9526  C  CB   . PRO B 1 260 ? -50.814  -16.370 -26.796 1.00 50.63  ? 821  PRO B CB   1 
ATOM   9527  C  CG   . PRO B 1 260 ? -50.869  -16.361 -28.276 1.00 60.97  ? 821  PRO B CG   1 
ATOM   9528  C  CD   . PRO B 1 260 ? -51.509  -17.662 -28.691 1.00 60.34  ? 821  PRO B CD   1 
ATOM   9529  H  HA   . PRO B 1 260 ? -51.908  -17.622 -25.559 1.00 79.27  ? 821  PRO B HA   1 
ATOM   9530  H  HB2  . PRO B 1 260 ? -50.849  -15.467 -26.443 1.00 60.75  ? 821  PRO B HB2  1 
ATOM   9531  H  HB3  . PRO B 1 260 ? -50.024  -16.836 -26.481 1.00 60.75  ? 821  PRO B HB3  1 
ATOM   9532  H  HG2  . PRO B 1 260 ? -51.404  -15.610 -28.575 1.00 73.17  ? 821  PRO B HG2  1 
ATOM   9533  H  HG3  . PRO B 1 260 ? -49.968  -16.299 -28.632 1.00 73.17  ? 821  PRO B HG3  1 
ATOM   9534  H  HD2  . PRO B 1 260 ? -52.107  -17.520 -29.441 1.00 72.41  ? 821  PRO B HD2  1 
ATOM   9535  H  HD3  . PRO B 1 260 ? -50.829  -18.322 -28.898 1.00 72.41  ? 821  PRO B HD3  1 
ATOM   9536  N  N    . SER B 1 261 ? -53.449  -15.769 -24.967 1.00 59.54  ? 822  SER B N    1 
ATOM   9537  C  CA   . SER B 1 261 ? -54.516  -14.830 -24.665 1.00 65.38  ? 822  SER B CA   1 
ATOM   9538  C  C    . SER B 1 261 ? -54.163  -13.445 -25.197 1.00 45.10  ? 822  SER B C    1 
ATOM   9539  O  O    . SER B 1 261 ? -53.003  -13.134 -25.484 1.00 45.82  ? 822  SER B O    1 
ATOM   9540  C  CB   . SER B 1 261 ? -54.773  -14.762 -23.162 1.00 47.65  ? 822  SER B CB   1 
ATOM   9541  O  OG   . SER B 1 261 ? -53.641  -14.246 -22.491 1.00 52.48  ? 822  SER B OG   1 
ATOM   9542  H  H    . SER B 1 261 ? -52.977  -16.002 -24.287 1.00 71.44  ? 822  SER B H    1 
ATOM   9543  H  HA   . SER B 1 261 ? -55.332  -15.122 -25.099 1.00 78.46  ? 822  SER B HA   1 
ATOM   9544  H  HB2  . SER B 1 261 ? -55.532  -14.182 -22.996 1.00 57.18  ? 822  SER B HB2  1 
ATOM   9545  H  HB3  . SER B 1 261 ? -54.958  -15.655 -22.832 1.00 57.18  ? 822  SER B HB3  1 
ATOM   9546  H  HG   . SER B 1 261 ? -52.976  -14.740 -22.628 1.00 62.98  ? 822  SER B HG   1 
ATOM   9547  N  N    . ALA B 1 262 ? -55.197  -12.615 -25.342 1.00 48.76  ? 823  ALA B N    1 
ATOM   9548  C  CA   . ALA B 1 262 ? -55.024  -11.281 -25.904 1.00 37.18  ? 823  ALA B CA   1 
ATOM   9549  C  C    . ALA B 1 262 ? -53.908  -10.513 -25.207 1.00 46.42  ? 823  ALA B C    1 
ATOM   9550  O  O    . ALA B 1 262 ? -53.118  -9.821  -25.861 1.00 47.14  ? 823  ALA B O    1 
ATOM   9551  C  CB   . ALA B 1 262 ? -56.341  -10.513 -25.811 1.00 43.81  ? 823  ALA B CB   1 
ATOM   9552  H  H    . ALA B 1 262 ? -56.007  -12.803 -25.122 1.00 58.52  ? 823  ALA B H    1 
ATOM   9553  H  HA   . ALA B 1 262 ? -54.791  -11.362 -26.842 1.00 44.61  ? 823  ALA B HA   1 
ATOM   9554  H  HB1  . ALA B 1 262 ? -56.217  -9.627  -26.188 1.00 52.57  ? 823  ALA B HB1  1 
ATOM   9555  H  HB2  . ALA B 1 262 ? -57.021  -10.992 -26.310 1.00 52.57  ? 823  ALA B HB2  1 
ATOM   9556  H  HB3  . ALA B 1 262 ? -56.601  -10.443 -24.879 1.00 52.57  ? 823  ALA B HB3  1 
ATOM   9557  N  N    . LYS B 1 263 ? -53.816  -10.632 -23.881 1.00 50.43  ? 824  LYS B N    1 
ATOM   9558  C  CA   . LYS B 1 263 ? -52.774  -9.915  -23.155 1.00 44.11  ? 824  LYS B CA   1 
ATOM   9559  C  C    . LYS B 1 263 ? -51.395  -10.513 -23.410 1.00 49.98  ? 824  LYS B C    1 
ATOM   9560  O  O    . LYS B 1 263 ? -50.393  -9.794  -23.339 1.00 52.32  ? 824  LYS B O    1 
ATOM   9561  C  CB   . LYS B 1 263 ? -53.093  -9.898  -21.662 1.00 43.79  ? 824  LYS B CB   1 
ATOM   9562  C  CG   . LYS B 1 263 ? -54.266  -8.994  -21.328 1.00 52.97  ? 824  LYS B CG   1 
ATOM   9563  C  CD   . LYS B 1 263 ? -54.516  -8.898  -19.834 1.00 76.89  ? 824  LYS B CD   1 
ATOM   9564  C  CE   . LYS B 1 263 ? -55.664  -7.939  -19.535 1.00 79.03  ? 824  LYS B CE   1 
ATOM   9565  N  NZ   . LYS B 1 263 ? -56.039  -7.917  -18.091 1.00 84.95  ? 824  LYS B NZ   1 
ATOM   9566  H  H    . LYS B 1 263 ? -54.335  -11.110 -23.390 1.00 60.52  ? 824  LYS B H    1 
ATOM   9567  H  HA   . LYS B 1 263 ? -52.757  -8.996  -23.463 1.00 52.93  ? 824  LYS B HA   1 
ATOM   9568  H  HB2  . LYS B 1 263 ? -53.316  -10.797 -21.375 1.00 52.54  ? 824  LYS B HB2  1 
ATOM   9569  H  HB3  . LYS B 1 263 ? -52.318  -9.576  -21.176 1.00 52.54  ? 824  LYS B HB3  1 
ATOM   9570  H  HG2  . LYS B 1 263 ? -54.083  -8.101  -21.660 1.00 63.57  ? 824  LYS B HG2  1 
ATOM   9571  H  HG3  . LYS B 1 263 ? -55.067  -9.347  -21.745 1.00 63.57  ? 824  LYS B HG3  1 
ATOM   9572  H  HD2  . LYS B 1 263 ? -54.752  -9.774  -19.490 1.00 92.27  ? 824  LYS B HD2  1 
ATOM   9573  H  HD3  . LYS B 1 263 ? -53.718  -8.566  -19.394 1.00 92.27  ? 824  LYS B HD3  1 
ATOM   9574  H  HE2  . LYS B 1 263 ? -55.400  -7.042  -19.790 1.00 94.83  ? 824  LYS B HE2  1 
ATOM   9575  H  HE3  . LYS B 1 263 ? -56.444  -8.213  -20.043 1.00 94.83  ? 824  LYS B HE3  1 
ATOM   9576  H  HZ1  . LYS B 1 263 ? -56.710  -7.348  -17.960 1.00 101.94 ? 824  LYS B HZ1  1 
ATOM   9577  H  HZ2  . LYS B 1 263 ? -56.294  -8.729  -17.831 1.00 101.94 ? 824  LYS B HZ2  1 
ATOM   9578  H  HZ3  . LYS B 1 263 ? -55.342  -7.662  -17.600 1.00 101.94 ? 824  LYS B HZ3  1 
ATOM   9579  N  N    . HIS B 1 264 ? -51.317  -11.814 -23.707 1.00 55.25  ? 825  HIS B N    1 
ATOM   9580  C  CA   . HIS B 1 264 ? -50.046  -12.397 -24.130 1.00 55.11  ? 825  HIS B CA   1 
ATOM   9581  C  C    . HIS B 1 264 ? -49.643  -11.887 -25.508 1.00 57.63  ? 825  HIS B C    1 
ATOM   9582  O  O    . HIS B 1 264 ? -48.461  -11.623 -25.757 1.00 54.80  ? 825  HIS B O    1 
ATOM   9583  C  CB   . HIS B 1 264 ? -50.136  -13.924 -24.140 1.00 75.01  ? 825  HIS B CB   1 
ATOM   9584  C  CG   . HIS B 1 264 ? -50.063  -14.549 -22.782 1.00 85.03  ? 825  HIS B CG   1 
ATOM   9585  N  ND1  . HIS B 1 264 ? -50.952  -14.246 -21.773 1.00 89.01  ? 825  HIS B ND1  1 
ATOM   9586  C  CD2  . HIS B 1 264 ? -49.209  -15.466 -22.270 1.00 73.46  ? 825  HIS B CD2  1 
ATOM   9587  C  CE1  . HIS B 1 264 ? -50.648  -14.951 -20.698 1.00 87.04  ? 825  HIS B CE1  1 
ATOM   9588  N  NE2  . HIS B 1 264 ? -49.593  -15.696 -20.971 1.00 93.12  ? 825  HIS B NE2  1 
ATOM   9589  H  H    . HIS B 1 264 ? -51.974  -12.368 -23.672 1.00 66.30  ? 825  HIS B H    1 
ATOM   9590  H  HA   . HIS B 1 264 ? -49.355  -12.141 -23.500 1.00 66.13  ? 825  HIS B HA   1 
ATOM   9591  H  HB2  . HIS B 1 264 ? -50.981  -14.183 -24.540 1.00 90.01  ? 825  HIS B HB2  1 
ATOM   9592  H  HB3  . HIS B 1 264 ? -49.402  -14.276 -24.667 1.00 90.01  ? 825  HIS B HB3  1 
ATOM   9593  H  HD1  . HIS B 1 264 ? -51.603  -13.689 -21.835 1.00 106.81 ? 825  HIS B HD1  1 
ATOM   9594  H  HD2  . HIS B 1 264 ? -48.495  -15.864 -22.713 1.00 88.15  ? 825  HIS B HD2  1 
ATOM   9595  H  HE1  . HIS B 1 264 ? -51.098  -14.923 -19.884 1.00 104.45 ? 825  HIS B HE1  1 
ATOM   9596  H  HE2  . HIS B 1 264 ? -49.210  -16.240 -20.426 1.00 111.74 ? 825  HIS B HE2  1 
ATOM   9597  N  N    . VAL B 1 265 ? -50.614  -11.746 -26.415 1.00 50.86  ? 826  VAL B N    1 
ATOM   9598  C  CA   . VAL B 1 265 ? -50.329  -11.241 -27.756 1.00 39.28  ? 826  VAL B CA   1 
ATOM   9599  C  C    . VAL B 1 265 ? -49.706  -9.852  -27.681 1.00 43.79  ? 826  VAL B C    1 
ATOM   9600  O  O    . VAL B 1 265 ? -48.810  -9.513  -28.465 1.00 48.57  ? 826  VAL B O    1 
ATOM   9601  C  CB   . VAL B 1 265 ? -51.616  -11.237 -28.605 1.00 37.34  ? 826  VAL B CB   1 
ATOM   9602  C  CG1  . VAL B 1 265 ? -51.365  -10.617 -29.975 1.00 41.75  ? 826  VAL B CG1  1 
ATOM   9603  C  CG2  . VAL B 1 265 ? -52.157  -12.646 -28.762 1.00 42.81  ? 826  VAL B CG2  1 
ATOM   9604  H  H    . VAL B 1 265 ? -51.442  -11.935 -26.277 1.00 61.03  ? 826  VAL B H    1 
ATOM   9605  H  HA   . VAL B 1 265 ? -49.690  -11.831 -28.185 1.00 47.14  ? 826  VAL B HA   1 
ATOM   9606  H  HB   . VAL B 1 265 ? -52.290  -10.706 -28.154 1.00 44.81  ? 826  VAL B HB   1 
ATOM   9607  H  HG11 . VAL B 1 265 ? -52.191  -10.630 -30.483 1.00 50.10  ? 826  VAL B HG11 1 
ATOM   9608  H  HG12 . VAL B 1 265 ? -51.063  -9.703  -29.856 1.00 50.10  ? 826  VAL B HG12 1 
ATOM   9609  H  HG13 . VAL B 1 265 ? -50.685  -11.134 -30.435 1.00 50.10  ? 826  VAL B HG13 1 
ATOM   9610  H  HG21 . VAL B 1 265 ? -52.964  -12.617 -29.298 1.00 51.37  ? 826  VAL B HG21 1 
ATOM   9611  H  HG22 . VAL B 1 265 ? -51.488  -13.194 -29.200 1.00 51.37  ? 826  VAL B HG22 1 
ATOM   9612  H  HG23 . VAL B 1 265 ? -52.356  -13.007 -27.883 1.00 51.37  ? 826  VAL B HG23 1 
ATOM   9613  N  N    . LEU B 1 266 ? -50.166  -9.028  -26.733 1.00 43.80  ? 827  LEU B N    1 
ATOM   9614  C  CA   . LEU B 1 266 ? -49.693  -7.650  -26.645 1.00 46.21  ? 827  LEU B CA   1 
ATOM   9615  C  C    . LEU B 1 266 ? -48.235  -7.572  -26.212 1.00 39.79  ? 827  LEU B C    1 
ATOM   9616  O  O    . LEU B 1 266 ? -47.535  -6.615  -26.564 1.00 50.55  ? 827  LEU B O    1 
ATOM   9617  C  CB   . LEU B 1 266 ? -50.577  -6.862  -25.679 1.00 46.56  ? 827  LEU B CB   1 
ATOM   9618  C  CG   . LEU B 1 266 ? -51.945  -6.457  -26.233 1.00 37.25  ? 827  LEU B CG   1 
ATOM   9619  C  CD1  . LEU B 1 266 ? -52.893  -6.096  -25.108 1.00 45.31  ? 827  LEU B CD1  1 
ATOM   9620  C  CD2  . LEU B 1 266 ? -51.804  -5.296  -27.208 1.00 35.46  ? 827  LEU B CD2  1 
ATOM   9621  H  H    . LEU B 1 266 ? -50.746  -9.244  -26.137 1.00 52.56  ? 827  LEU B H    1 
ATOM   9622  H  HA   . LEU B 1 266 ? -49.766  -7.236  -27.520 1.00 55.46  ? 827  LEU B HA   1 
ATOM   9623  H  HB2  . LEU B 1 266 ? -50.730  -7.405  -24.890 1.00 55.87  ? 827  LEU B HB2  1 
ATOM   9624  H  HB3  . LEU B 1 266 ? -50.111  -6.049  -25.428 1.00 55.87  ? 827  LEU B HB3  1 
ATOM   9625  H  HG   . LEU B 1 266 ? -52.325  -7.208  -26.715 1.00 44.70  ? 827  LEU B HG   1 
ATOM   9626  H  HD11 . LEU B 1 266 ? -53.750  -5.845  -25.486 1.00 54.38  ? 827  LEU B HD11 1 
ATOM   9627  H  HD12 . LEU B 1 266 ? -53.001  -6.866  -24.527 1.00 54.38  ? 827  LEU B HD12 1 
ATOM   9628  H  HD13 . LEU B 1 266 ? -52.521  -5.353  -24.608 1.00 54.38  ? 827  LEU B HD13 1 
ATOM   9629  H  HD21 . LEU B 1 266 ? -52.682  -5.058  -27.544 1.00 42.56  ? 827  LEU B HD21 1 
ATOM   9630  H  HD22 . LEU B 1 266 ? -51.411  -4.540  -26.743 1.00 42.56  ? 827  LEU B HD22 1 
ATOM   9631  H  HD23 . LEU B 1 266 ? -51.230  -5.568  -27.941 1.00 42.56  ? 827  LEU B HD23 1 
ATOM   9632  N  N    . LYS B 1 267 ? -47.759  -8.558  -25.453 1.00 44.76  ? 828  LYS B N    1 
ATOM   9633  C  CA   . LYS B 1 267 ? -46.367  -8.580  -25.028 1.00 59.15  ? 828  LYS B CA   1 
ATOM   9634  C  C    . LYS B 1 267 ? -45.423  -9.095  -26.106 1.00 43.81  ? 828  LYS B C    1 
ATOM   9635  O  O    . LYS B 1 267 ? -44.206  -8.977  -25.937 1.00 48.71  ? 828  LYS B O    1 
ATOM   9636  C  CB   . LYS B 1 267 ? -46.223  -9.438  -23.764 1.00 63.05  ? 828  LYS B CB   1 
ATOM   9637  C  CG   . LYS B 1 267 ? -46.786  -8.792  -22.505 1.00 62.61  ? 828  LYS B CG   1 
ATOM   9638  C  CD   . LYS B 1 267 ? -45.920  -7.626  -22.042 1.00 63.28  ? 828  LYS B CD   1 
ATOM   9639  C  CE   . LYS B 1 267 ? -46.573  -6.861  -20.908 1.00 82.46  ? 828  LYS B CE   1 
ATOM   9640  N  NZ   . LYS B 1 267 ? -45.741  -5.708  -20.462 1.00 99.42  ? 828  LYS B NZ   1 
ATOM   9641  H  H    . LYS B 1 267 ? -48.224  -9.225  -25.173 1.00 53.71  ? 828  LYS B H    1 
ATOM   9642  H  HA   . LYS B 1 267 ? -46.096  -7.676  -24.805 1.00 70.97  ? 828  LYS B HA   1 
ATOM   9643  H  HB2  . LYS B 1 267 ? -46.693  -10.276 -23.901 1.00 75.66  ? 828  LYS B HB2  1 
ATOM   9644  H  HB3  . LYS B 1 267 ? -45.281  -9.612  -23.611 1.00 75.66  ? 828  LYS B HB3  1 
ATOM   9645  H  HG2  . LYS B 1 267 ? -47.677  -8.456  -22.688 1.00 75.13  ? 828  LYS B HG2  1 
ATOM   9646  H  HG3  . LYS B 1 267 ? -46.815  -9.450  -21.793 1.00 75.13  ? 828  LYS B HG3  1 
ATOM   9647  H  HD2  . LYS B 1 267 ? -45.067  -7.965  -21.727 1.00 75.93  ? 828  LYS B HD2  1 
ATOM   9648  H  HD3  . LYS B 1 267 ? -45.785  -7.014  -22.782 1.00 75.93  ? 828  LYS B HD3  1 
ATOM   9649  H  HE2  . LYS B 1 267 ? -47.430  -6.518  -21.207 1.00 98.96  ? 828  LYS B HE2  1 
ATOM   9650  H  HE3  . LYS B 1 267 ? -46.696  -7.456  -20.151 1.00 98.96  ? 828  LYS B HE3  1 
ATOM   9651  H  HZ1  . LYS B 1 267 ? -44.949  -5.997  -20.178 1.00 119.30 ? 828  LYS B HZ1  1 
ATOM   9652  H  HZ2  . LYS B 1 267 ? -45.617  -5.143  -21.139 1.00 119.30 ? 828  LYS B HZ2  1 
ATOM   9653  H  HZ3  . LYS B 1 267 ? -46.148  -5.278  -19.797 1.00 119.30 ? 828  LYS B HZ3  1 
ATOM   9654  N  N    . HIS B 1 268 ? -45.946  -9.638  -27.205 1.00 47.33  ? 829  HIS B N    1 
ATOM   9655  C  CA   . HIS B 1 268 ? -45.103  -10.301 -28.190 1.00 52.96  ? 829  HIS B CA   1 
ATOM   9656  C  C    . HIS B 1 268 ? -44.153  -9.299  -28.849 1.00 51.50  ? 829  HIS B C    1 
ATOM   9657  O  O    . HIS B 1 268 ? -44.461  -8.105  -28.937 1.00 50.60  ? 829  HIS B O    1 
ATOM   9658  C  CB   . HIS B 1 268 ? -45.960  -10.980 -29.258 1.00 46.07  ? 829  HIS B CB   1 
ATOM   9659  C  CG   . HIS B 1 268 ? -45.243  -12.061 -30.004 1.00 51.86  ? 829  HIS B CG   1 
ATOM   9660  N  ND1  . HIS B 1 268 ? -44.588  -11.835 -31.196 1.00 41.31  ? 829  HIS B ND1  1 
ATOM   9661  C  CD2  . HIS B 1 268 ? -45.061  -13.371 -29.718 1.00 59.03  ? 829  HIS B CD2  1 
ATOM   9662  C  CE1  . HIS B 1 268 ? -44.040  -12.962 -31.615 1.00 55.23  ? 829  HIS B CE1  1 
ATOM   9663  N  NE2  . HIS B 1 268 ? -44.315  -13.910 -30.737 1.00 52.04  ? 829  HIS B NE2  1 
ATOM   9664  H  H    . HIS B 1 268 ? -46.783  -9.634  -27.401 1.00 56.79  ? 829  HIS B H    1 
ATOM   9665  H  HA   . HIS B 1 268 ? -44.570  -10.981 -27.749 1.00 63.56  ? 829  HIS B HA   1 
ATOM   9666  H  HB2  . HIS B 1 268 ? -46.735  -11.378 -28.831 1.00 55.29  ? 829  HIS B HB2  1 
ATOM   9667  H  HB3  . HIS B 1 268 ? -46.245  -10.313 -29.901 1.00 55.29  ? 829  HIS B HB3  1 
ATOM   9668  H  HD1  . HIS B 1 268 ? -44.544  -11.079 -31.604 1.00 49.58  ? 829  HIS B HD1  1 
ATOM   9669  H  HD2  . HIS B 1 268 ? -45.386  -13.824 -28.973 1.00 70.83  ? 829  HIS B HD2  1 
ATOM   9670  H  HE1  . HIS B 1 268 ? -43.549  -13.070 -32.397 1.00 66.28  ? 829  HIS B HE1  1 
ATOM   9671  H  HE2  . HIS B 1 268 ? -44.065  -14.730 -30.794 1.00 62.45  ? 829  HIS B HE2  1 
ATOM   9672  N  N    . PRO B 1 269 ? -42.985  -9.756  -29.319 1.00 49.71  ? 830  PRO B N    1 
ATOM   9673  C  CA   . PRO B 1 269 ? -42.065  -8.837  -30.010 1.00 51.24  ? 830  PRO B CA   1 
ATOM   9674  C  C    . PRO B 1 269 ? -42.653  -8.180  -31.242 1.00 44.55  ? 830  PRO B C    1 
ATOM   9675  O  O    . PRO B 1 269 ? -42.085  -7.196  -31.732 1.00 37.91  ? 830  PRO B O    1 
ATOM   9676  C  CB   . PRO B 1 269 ? -40.876  -9.738  -30.368 1.00 51.72  ? 830  PRO B CB   1 
ATOM   9677  C  CG   . PRO B 1 269 ? -40.893  -10.795 -29.332 1.00 48.62  ? 830  PRO B CG   1 
ATOM   9678  C  CD   . PRO B 1 269 ? -42.333  -11.043 -29.013 1.00 48.47  ? 830  PRO B CD   1 
ATOM   9679  H  HA   . PRO B 1 269 ? -41.765  -8.146  -29.398 1.00 61.49  ? 830  PRO B HA   1 
ATOM   9680  H  HB2  . PRO B 1 269 ? -41.005  -10.117 -31.251 1.00 62.06  ? 830  PRO B HB2  1 
ATOM   9681  H  HB3  . PRO B 1 269 ? -40.052  -9.227  -30.328 1.00 62.06  ? 830  PRO B HB3  1 
ATOM   9682  H  HG2  . PRO B 1 269 ? -40.479  -11.599 -29.683 1.00 58.35  ? 830  PRO B HG2  1 
ATOM   9683  H  HG3  . PRO B 1 269 ? -40.419  -10.484 -28.544 1.00 58.35  ? 830  PRO B HG3  1 
ATOM   9684  H  HD2  . PRO B 1 269 ? -42.688  -11.745 -29.580 1.00 58.16  ? 830  PRO B HD2  1 
ATOM   9685  H  HD3  . PRO B 1 269 ? -42.438  -11.260 -28.073 1.00 58.16  ? 830  PRO B HD3  1 
ATOM   9686  N  N    . PHE B 1 270 ? -43.764  -8.700  -31.763 1.00 45.96  ? 831  PHE B N    1 
ATOM   9687  C  CA   . PHE B 1 270 ? -44.382  -8.128  -32.952 1.00 42.45  ? 831  PHE B CA   1 
ATOM   9688  C  C    . PHE B 1 270 ? -44.725  -6.656  -32.760 1.00 48.13  ? 831  PHE B C    1 
ATOM   9689  O  O    . PHE B 1 270 ? -44.654  -5.876  -33.716 1.00 48.85  ? 831  PHE B O    1 
ATOM   9690  C  CB   . PHE B 1 270 ? -45.631  -8.937  -33.307 1.00 43.35  ? 831  PHE B CB   1 
ATOM   9691  C  CG   . PHE B 1 270 ? -46.455  -8.334  -34.399 1.00 39.19  ? 831  PHE B CG   1 
ATOM   9692  C  CD1  . PHE B 1 270 ? -45.998  -8.322  -35.703 1.00 45.23  ? 831  PHE B CD1  1 
ATOM   9693  C  CD2  . PHE B 1 270 ? -47.695  -7.786  -34.123 1.00 47.57  ? 831  PHE B CD2  1 
ATOM   9694  C  CE1  . PHE B 1 270 ? -46.758  -7.766  -36.713 1.00 57.14  ? 831  PHE B CE1  1 
ATOM   9695  C  CE2  . PHE B 1 270 ? -48.460  -7.228  -35.128 1.00 57.77  ? 831  PHE B CE2  1 
ATOM   9696  C  CZ   . PHE B 1 270 ? -47.991  -7.219  -36.425 1.00 51.23  ? 831  PHE B CZ   1 
ATOM   9697  H  H    . PHE B 1 270 ? -44.177  -9.384  -31.445 1.00 55.16  ? 831  PHE B H    1 
ATOM   9698  H  HA   . PHE B 1 270 ? -43.760  -8.196  -33.694 1.00 50.93  ? 831  PHE B HA   1 
ATOM   9699  H  HB2  . PHE B 1 270 ? -45.359  -9.822  -33.596 1.00 52.02  ? 831  PHE B HB2  1 
ATOM   9700  H  HB3  . PHE B 1 270 ? -46.192  -9.008  -32.518 1.00 52.02  ? 831  PHE B HB3  1 
ATOM   9701  H  HD1  . PHE B 1 270 ? -45.166  -8.689  -35.902 1.00 54.28  ? 831  PHE B HD1  1 
ATOM   9702  H  HD2  . PHE B 1 270 ? -48.014  -7.788  -33.250 1.00 57.08  ? 831  PHE B HD2  1 
ATOM   9703  H  HE1  . PHE B 1 270 ? -46.439  -7.762  -37.587 1.00 68.57  ? 831  PHE B HE1  1 
ATOM   9704  H  HE2  . PHE B 1 270 ? -49.291  -6.860  -34.931 1.00 69.33  ? 831  PHE B HE2  1 
ATOM   9705  H  HZ   . PHE B 1 270 ? -48.505  -6.845  -37.103 1.00 61.48  ? 831  PHE B HZ   1 
ATOM   9706  N  N    . PHE B 1 271 ? -45.088  -6.257  -31.541 1.00 48.36  ? 832  PHE B N    1 
ATOM   9707  C  CA   . PHE B 1 271 ? -45.472  -4.882  -31.251 1.00 50.08  ? 832  PHE B CA   1 
ATOM   9708  C  C    . PHE B 1 271 ? -44.327  -4.038  -30.704 1.00 59.02  ? 832  PHE B C    1 
ATOM   9709  O  O    . PHE B 1 271 ? -44.525  -2.843  -30.460 1.00 55.71  ? 832  PHE B O    1 
ATOM   9710  C  CB   . PHE B 1 271 ? -46.635  -4.859  -30.254 1.00 38.22  ? 832  PHE B CB   1 
ATOM   9711  C  CG   . PHE B 1 271 ? -47.892  -5.520  -30.759 1.00 49.89  ? 832  PHE B CG   1 
ATOM   9712  C  CD1  . PHE B 1 271 ? -48.698  -4.889  -31.692 1.00 40.52  ? 832  PHE B CD1  1 
ATOM   9713  C  CD2  . PHE B 1 271 ? -48.276  -6.764  -30.287 1.00 50.95  ? 832  PHE B CD2  1 
ATOM   9714  C  CE1  . PHE B 1 271 ? -49.861  -5.495  -32.153 1.00 32.38  ? 832  PHE B CE1  1 
ATOM   9715  C  CE2  . PHE B 1 271 ? -49.436  -7.368  -30.741 1.00 34.90  ? 832  PHE B CE2  1 
ATOM   9716  C  CZ   . PHE B 1 271 ? -50.226  -6.733  -31.675 1.00 32.86  ? 832  PHE B CZ   1 
ATOM   9717  H  H    . PHE B 1 271 ? -45.119  -6.775  -30.856 1.00 58.04  ? 832  PHE B H    1 
ATOM   9718  H  HA   . PHE B 1 271 ? -45.779  -4.466  -32.072 1.00 60.09  ? 832  PHE B HA   1 
ATOM   9719  H  HB2  . PHE B 1 271 ? -46.362  -5.321  -29.446 1.00 45.86  ? 832  PHE B HB2  1 
ATOM   9720  H  HB3  . PHE B 1 271 ? -46.849  -3.936  -30.046 1.00 45.86  ? 832  PHE B HB3  1 
ATOM   9721  H  HD1  . PHE B 1 271 ? -48.456  -4.053  -32.018 1.00 48.63  ? 832  PHE B HD1  1 
ATOM   9722  H  HD2  . PHE B 1 271 ? -47.748  -7.199  -29.656 1.00 61.14  ? 832  PHE B HD2  1 
ATOM   9723  H  HE1  . PHE B 1 271 ? -50.393  -5.063  -32.782 1.00 38.86  ? 832  PHE B HE1  1 
ATOM   9724  H  HE2  . PHE B 1 271 ? -49.680  -8.205  -30.418 1.00 41.88  ? 832  PHE B HE2  1 
ATOM   9725  H  HZ   . PHE B 1 271 ? -51.004  -7.140  -31.982 1.00 39.43  ? 832  PHE B HZ   1 
ATOM   9726  N  N    . TRP B 1 272 ? -43.144  -4.611  -30.502 1.00 40.65  ? 833  TRP B N    1 
ATOM   9727  C  CA   . TRP B 1 272 ? -42.044  -3.834  -29.956 1.00 41.64  ? 833  TRP B CA   1 
ATOM   9728  C  C    . TRP B 1 272 ? -41.524  -2.838  -30.986 1.00 60.80  ? 833  TRP B C    1 
ATOM   9729  O  O    . TRP B 1 272 ? -41.551  -3.087  -32.195 1.00 46.26  ? 833  TRP B O    1 
ATOM   9730  C  CB   . TRP B 1 272 ? -40.897  -4.738  -29.516 1.00 49.05  ? 833  TRP B CB   1 
ATOM   9731  C  CG   . TRP B 1 272 ? -41.236  -5.705  -28.432 1.00 51.21  ? 833  TRP B CG   1 
ATOM   9732  C  CD1  . TRP B 1 272 ? -42.435  -5.851  -27.799 1.00 51.06  ? 833  TRP B CD1  1 
ATOM   9733  C  CD2  . TRP B 1 272 ? -40.356  -6.676  -27.856 1.00 55.43  ? 833  TRP B CD2  1 
ATOM   9734  N  NE1  . TRP B 1 272 ? -42.357  -6.859  -26.866 1.00 48.46  ? 833  TRP B NE1  1 
ATOM   9735  C  CE2  . TRP B 1 272 ? -41.091  -7.380  -26.881 1.00 50.89  ? 833  TRP B CE2  1 
ATOM   9736  C  CE3  . TRP B 1 272 ? -39.020  -7.026  -28.079 1.00 57.13  ? 833  TRP B CE3  1 
ATOM   9737  C  CZ2  . TRP B 1 272 ? -40.533  -8.405  -26.125 1.00 57.02  ? 833  TRP B CZ2  1 
ATOM   9738  C  CZ3  . TRP B 1 272 ? -38.469  -8.046  -27.326 1.00 62.53  ? 833  TRP B CZ3  1 
ATOM   9739  C  CH2  . TRP B 1 272 ? -39.225  -8.725  -26.362 1.00 59.52  ? 833  TRP B CH2  1 
ATOM   9740  H  H    . TRP B 1 272 ? -42.957  -5.434  -30.670 1.00 48.78  ? 833  TRP B H    1 
ATOM   9741  H  HA   . TRP B 1 272 ? -42.355  -3.338  -29.182 1.00 49.97  ? 833  TRP B HA   1 
ATOM   9742  H  HB2  . TRP B 1 272 ? -40.598  -5.251  -30.283 1.00 58.85  ? 833  TRP B HB2  1 
ATOM   9743  H  HB3  . TRP B 1 272 ? -40.171  -4.181  -29.194 1.00 58.85  ? 833  TRP B HB3  1 
ATOM   9744  H  HD1  . TRP B 1 272 ? -43.196  -5.345  -27.975 1.00 61.28  ? 833  TRP B HD1  1 
ATOM   9745  H  HE1  . TRP B 1 272 ? -42.997  -7.115  -26.352 1.00 58.15  ? 833  TRP B HE1  1 
ATOM   9746  H  HE3  . TRP B 1 272 ? -38.513  -6.581  -28.719 1.00 68.55  ? 833  TRP B HE3  1 
ATOM   9747  H  HZ2  . TRP B 1 272 ? -41.032  -8.858  -25.484 1.00 68.42  ? 833  TRP B HZ2  1 
ATOM   9748  H  HZ3  . TRP B 1 272 ? -37.581  -8.286  -27.462 1.00 75.03  ? 833  TRP B HZ3  1 
ATOM   9749  H  HH2  . TRP B 1 272 ? -38.826  -9.405  -25.868 1.00 71.43  ? 833  TRP B HH2  1 
ATOM   9750  N  N    . SER B 1 273 ? -41.037  -1.701  -30.490 1.00 48.75  ? 834  SER B N    1 
ATOM   9751  C  CA   . SER B 1 273 ? -40.361  -0.734  -31.338 1.00 49.57  ? 834  SER B CA   1 
ATOM   9752  C  C    . SER B 1 273 ? -38.919  -1.179  -31.566 1.00 59.39  ? 834  SER B C    1 
ATOM   9753  O  O    . SER B 1 273 ? -38.458  -2.186  -31.023 1.00 54.63  ? 834  SER B O    1 
ATOM   9754  C  CB   . SER B 1 273 ? -40.409  0.655   -30.708 1.00 49.22  ? 834  SER B CB   1 
ATOM   9755  O  OG   . SER B 1 273 ? -39.725  0.670   -29.468 1.00 49.61  ? 834  SER B OG   1 
ATOM   9756  H  H    . SER B 1 273 ? -41.089  -1.469  -29.664 1.00 58.50  ? 834  SER B H    1 
ATOM   9757  H  HA   . SER B 1 273 ? -40.807  -0.694  -32.198 1.00 59.48  ? 834  SER B HA   1 
ATOM   9758  H  HB2  . SER B 1 273 ? -39.988  1.289   -31.309 1.00 59.06  ? 834  SER B HB2  1 
ATOM   9759  H  HB3  . SER B 1 273 ? -41.336  0.902   -30.560 1.00 59.06  ? 834  SER B HB3  1 
ATOM   9760  H  HG   . SER B 1 273 ? -39.758  1.439   -29.131 1.00 59.54  ? 834  SER B HG   1 
ATOM   9761  N  N    . LEU B 1 274 ? -38.183  -0.408  -32.364 1.00 60.54  ? 835  LEU B N    1 
ATOM   9762  C  CA   . LEU B 1 274 ? -36.823  -0.812  -32.704 1.00 59.72  ? 835  LEU B CA   1 
ATOM   9763  C  C    . LEU B 1 274 ? -35.901  -0.714  -31.496 1.00 70.56  ? 835  LEU B C    1 
ATOM   9764  O  O    . LEU B 1 274 ? -35.111  -1.629  -31.238 1.00 73.42  ? 835  LEU B O    1 
ATOM   9765  C  CB   . LEU B 1 274 ? -36.298  0.032   -33.866 1.00 66.31  ? 835  LEU B CB   1 
ATOM   9766  C  CG   . LEU B 1 274 ? -36.906  -0.311  -35.231 1.00 64.17  ? 835  LEU B CG   1 
ATOM   9767  C  CD1  . LEU B 1 274 ? -36.528  0.733   -36.261 1.00 69.28  ? 835  LEU B CD1  1 
ATOM   9768  C  CD2  . LEU B 1 274 ? -36.471  -1.697  -35.698 1.00 61.88  ? 835  LEU B CD2  1 
ATOM   9769  H  H    . LEU B 1 274 ? -38.439  0.334   -32.713 1.00 72.65  ? 835  LEU B H    1 
ATOM   9770  H  HA   . LEU B 1 274 ? -36.836  -1.738  -32.992 1.00 71.66  ? 835  LEU B HA   1 
ATOM   9771  H  HB2  . LEU B 1 274 ? -36.492  0.965   -33.684 1.00 79.57  ? 835  LEU B HB2  1 
ATOM   9772  H  HB3  . LEU B 1 274 ? -35.339  -0.095  -33.932 1.00 79.57  ? 835  LEU B HB3  1 
ATOM   9773  H  HG   . LEU B 1 274 ? -37.873  -0.313  -35.151 1.00 77.00  ? 835  LEU B HG   1 
ATOM   9774  H  HD11 . LEU B 1 274 ? -36.925  0.493   -37.113 1.00 83.13  ? 835  LEU B HD11 1 
ATOM   9775  H  HD12 . LEU B 1 274 ? -36.862  1.597   -35.972 1.00 83.13  ? 835  LEU B HD12 1 
ATOM   9776  H  HD13 . LEU B 1 274 ? -35.562  0.762   -36.341 1.00 83.13  ? 835  LEU B HD13 1 
ATOM   9777  H  HD21 . LEU B 1 274 ? -36.874  -1.880  -36.561 1.00 74.26  ? 835  LEU B HD21 1 
ATOM   9778  H  HD22 . LEU B 1 274 ? -35.505  -1.716  -35.772 1.00 74.26  ? 835  LEU B HD22 1 
ATOM   9779  H  HD23 . LEU B 1 274 ? -36.767  -2.355  -35.049 1.00 74.26  ? 835  LEU B HD23 1 
ATOM   9780  N  N    . GLU B 1 275 ? -35.996  0.377   -30.731 1.00 72.43  ? 836  GLU B N    1 
ATOM   9781  C  CA   . GLU B 1 275 ? -35.140  0.528   -29.560 1.00 62.70  ? 836  GLU B CA   1 
ATOM   9782  C  C    . GLU B 1 275 ? -35.537  -0.416  -28.433 1.00 51.36  ? 836  GLU B C    1 
ATOM   9783  O  O    . GLU B 1 275 ? -34.688  -0.752  -27.601 1.00 67.85  ? 836  GLU B O    1 
ATOM   9784  C  CB   . GLU B 1 275 ? -35.158  1.976   -29.065 1.00 66.45  ? 836  GLU B CB   1 
ATOM   9785  C  CG   . GLU B 1 275 ? -36.476  2.444   -28.471 1.00 72.97  ? 836  GLU B CG   1 
ATOM   9786  C  CD   . GLU B 1 275 ? -36.382  3.847   -27.899 1.00 89.90  ? 836  GLU B CD   1 
ATOM   9787  O  OE1  . GLU B 1 275 ? -37.435  4.503   -27.756 1.00 86.76  ? 836  GLU B OE1  1 
ATOM   9788  O  OE2  . GLU B 1 275 ? -35.255  4.293   -27.591 1.00 77.95  ? 836  GLU B OE2  1 
ATOM   9789  H  H    . GLU B 1 275 ? -36.538  1.031   -30.867 1.00 86.91  ? 836  GLU B H    1 
ATOM   9790  H  HA   . GLU B 1 275 ? -34.229  0.315   -29.814 1.00 75.24  ? 836  GLU B HA   1 
ATOM   9791  H  HB2  . GLU B 1 275 ? -34.478  2.075   -28.380 1.00 79.74  ? 836  GLU B HB2  1 
ATOM   9792  H  HB3  . GLU B 1 275 ? -34.952  2.559   -29.812 1.00 79.74  ? 836  GLU B HB3  1 
ATOM   9793  H  HG2  . GLU B 1 275 ? -37.154  2.446   -29.164 1.00 87.56  ? 836  GLU B HG2  1 
ATOM   9794  H  HG3  . GLU B 1 275 ? -36.732  1.843   -27.754 1.00 87.56  ? 836  GLU B HG3  1 
ATOM   9795  N  N    . LYS B 1 276 ? -36.797  -0.854  -28.387 1.00 59.70  ? 837  LYS B N    1 
ATOM   9796  C  CA   . LYS B 1 276 ? -37.189  -1.846  -27.391 1.00 53.11  ? 837  LYS B CA   1 
ATOM   9797  C  C    . LYS B 1 276 ? -36.584  -3.206  -27.713 1.00 52.55  ? 837  LYS B C    1 
ATOM   9798  O  O    . LYS B 1 276 ? -36.209  -3.956  -26.804 1.00 61.39  ? 837  LYS B O    1 
ATOM   9799  C  CB   . LYS B 1 276 ? -38.711  -1.941  -27.305 1.00 60.65  ? 837  LYS B CB   1 
ATOM   9800  C  CG   . LYS B 1 276 ? -39.201  -2.912  -26.237 1.00 53.11  ? 837  LYS B CG   1 
ATOM   9801  C  CD   . LYS B 1 276 ? -40.713  -2.871  -26.079 1.00 53.13  ? 837  LYS B CD   1 
ATOM   9802  C  CE   . LYS B 1 276 ? -41.190  -3.922  -25.086 1.00 62.52  ? 837  LYS B CE   1 
ATOM   9803  N  NZ   . LYS B 1 276 ? -42.674  -3.933  -24.929 1.00 75.07  ? 837  LYS B NZ   1 
ATOM   9804  H  H    . LYS B 1 276 ? -37.430  -0.598  -28.910 1.00 71.64  ? 837  LYS B H    1 
ATOM   9805  H  HA   . LYS B 1 276 ? -36.856  -1.569  -26.523 1.00 63.74  ? 837  LYS B HA   1 
ATOM   9806  H  HB2  . LYS B 1 276 ? -39.069  -1.064  -27.096 1.00 72.78  ? 837  LYS B HB2  1 
ATOM   9807  H  HB3  . LYS B 1 276 ? -39.056  -2.243  -28.160 1.00 72.78  ? 837  LYS B HB3  1 
ATOM   9808  H  HG2  . LYS B 1 276 ? -38.947  -3.814  -26.486 1.00 63.73  ? 837  LYS B HG2  1 
ATOM   9809  H  HG3  . LYS B 1 276 ? -38.802  -2.675  -25.385 1.00 63.73  ? 837  LYS B HG3  1 
ATOM   9810  H  HD2  . LYS B 1 276 ? -40.978  -1.998  -25.751 1.00 63.76  ? 837  LYS B HD2  1 
ATOM   9811  H  HD3  . LYS B 1 276 ? -41.130  -3.050  -26.937 1.00 63.76  ? 837  LYS B HD3  1 
ATOM   9812  H  HE2  . LYS B 1 276 ? -40.915  -4.799  -25.397 1.00 75.03  ? 837  LYS B HE2  1 
ATOM   9813  H  HE3  . LYS B 1 276 ? -40.798  -3.738  -24.219 1.00 75.03  ? 837  LYS B HE3  1 
ATOM   9814  H  HZ1  . LYS B 1 276 ? -42.913  -4.558  -24.343 1.00 90.08  ? 837  LYS B HZ1  1 
ATOM   9815  H  HZ2  . LYS B 1 276 ? -42.955  -3.140  -24.637 1.00 90.08  ? 837  LYS B HZ2  1 
ATOM   9816  H  HZ3  . LYS B 1 276 ? -43.062  -4.107  -25.711 1.00 90.08  ? 837  LYS B HZ3  1 
ATOM   9817  N  N    . GLN B 1 277 ? -36.483  -3.543  -29.001 1.00 57.05  ? 838  GLN B N    1 
ATOM   9818  C  CA   . GLN B 1 277 ? -35.794  -4.769  -29.391 1.00 59.26  ? 838  GLN B CA   1 
ATOM   9819  C  C    . GLN B 1 277 ? -34.321  -4.707  -29.011 1.00 59.82  ? 838  GLN B C    1 
ATOM   9820  O  O    . GLN B 1 277 ? -33.761  -5.684  -28.499 1.00 52.42  ? 838  GLN B O    1 
ATOM   9821  C  CB   . GLN B 1 277 ? -35.949  -5.003  -30.893 1.00 57.22  ? 838  GLN B CB   1 
ATOM   9822  C  CG   . GLN B 1 277 ? -37.371  -5.297  -31.338 1.00 57.50  ? 838  GLN B CG   1 
ATOM   9823  C  CD   . GLN B 1 277 ? -37.509  -5.321  -32.848 1.00 63.05  ? 838  GLN B CD   1 
ATOM   9824  O  OE1  . GLN B 1 277 ? -36.603  -5.759  -33.557 1.00 65.48  ? 838  GLN B OE1  1 
ATOM   9825  N  NE2  . GLN B 1 277 ? -38.640  -4.841  -33.350 1.00 58.88  ? 838  GLN B NE2  1 
ATOM   9826  H  H    . GLN B 1 277 ? -36.800  -3.086  -29.657 1.00 68.46  ? 838  GLN B H    1 
ATOM   9827  H  HA   . GLN B 1 277 ? -36.195  -5.520  -28.926 1.00 71.11  ? 838  GLN B HA   1 
ATOM   9828  H  HB2  . GLN B 1 277 ? -35.651  -4.208  -31.363 1.00 68.66  ? 838  GLN B HB2  1 
ATOM   9829  H  HB3  . GLN B 1 277 ? -35.398  -5.759  -31.148 1.00 68.66  ? 838  GLN B HB3  1 
ATOM   9830  H  HG2  . GLN B 1 277 ? -37.638  -6.165  -30.997 1.00 69.00  ? 838  GLN B HG2  1 
ATOM   9831  H  HG3  . GLN B 1 277 ? -37.960  -4.608  -30.993 1.00 69.00  ? 838  GLN B HG3  1 
ATOM   9832  H  HE21 . GLN B 1 277 ? -39.249  -4.538  -32.824 1.00 70.65  ? 838  GLN B HE21 1 
ATOM   9833  H  HE22 . GLN B 1 277 ? -38.765  -4.834  -34.201 1.00 70.65  ? 838  GLN B HE22 1 
ATOM   9834  N  N    . LEU B 1 278 ? -33.676  -3.563  -29.254 1.00 53.30  ? 839  LEU B N    1 
ATOM   9835  C  CA   . LEU B 1 278 ? -32.284  -3.392  -28.852 1.00 51.32  ? 839  LEU B CA   1 
ATOM   9836  C  C    . LEU B 1 278 ? -32.137  -3.476  -27.340 1.00 56.71  ? 839  LEU B C    1 
ATOM   9837  O  O    . LEU B 1 278 ? -31.148  -4.018  -26.834 1.00 52.49  ? 839  LEU B O    1 
ATOM   9838  C  CB   . LEU B 1 278 ? -31.755  -2.049  -29.364 1.00 43.72  ? 839  LEU B CB   1 
ATOM   9839  C  CG   . LEU B 1 278 ? -30.286  -1.739  -29.068 1.00 57.99  ? 839  LEU B CG   1 
ATOM   9840  C  CD1  . LEU B 1 278 ? -29.377  -2.711  -29.786 1.00 60.40  ? 839  LEU B CD1  1 
ATOM   9841  C  CD2  . LEU B 1 278 ? -29.949  -0.305  -29.457 1.00 52.79  ? 839  LEU B CD2  1 
ATOM   9842  H  H    . LEU B 1 278 ? -34.021  -2.880  -29.646 1.00 63.96  ? 839  LEU B H    1 
ATOM   9843  H  HA   . LEU B 1 278 ? -31.750  -4.098  -29.248 1.00 61.58  ? 839  LEU B HA   1 
ATOM   9844  H  HB2  . LEU B 1 278 ? -31.865  -2.027  -30.327 1.00 52.47  ? 839  LEU B HB2  1 
ATOM   9845  H  HB3  . LEU B 1 278 ? -32.284  -1.342  -28.964 1.00 52.47  ? 839  LEU B HB3  1 
ATOM   9846  H  HG   . LEU B 1 278 ? -30.131  -1.834  -28.115 1.00 69.59  ? 839  LEU B HG   1 
ATOM   9847  H  HD11 . LEU B 1 278 ? -28.455  -2.491  -29.580 1.00 72.48  ? 839  LEU B HD11 1 
ATOM   9848  H  HD12 . LEU B 1 278 ? -29.578  -3.611  -29.485 1.00 72.48  ? 839  LEU B HD12 1 
ATOM   9849  H  HD13 . LEU B 1 278 ? -29.530  -2.638  -30.741 1.00 72.48  ? 839  LEU B HD13 1 
ATOM   9850  H  HD21 . LEU B 1 278 ? -29.014  -0.136  -29.259 1.00 63.35  ? 839  LEU B HD21 1 
ATOM   9851  H  HD22 . LEU B 1 278 ? -30.112  -0.189  -30.406 1.00 63.35  ? 839  LEU B HD22 1 
ATOM   9852  H  HD23 . LEU B 1 278 ? -30.510  0.300   -28.948 1.00 63.35  ? 839  LEU B HD23 1 
ATOM   9853  N  N    . GLN B 1 279 ? -33.108  -2.933  -26.600 1.00 63.19  ? 840  GLN B N    1 
ATOM   9854  C  CA   . GLN B 1 279 ? -33.046  -2.988  -25.144 1.00 61.33  ? 840  GLN B CA   1 
ATOM   9855  C  C    . GLN B 1 279 ? -33.230  -4.415  -24.642 1.00 57.08  ? 840  GLN B C    1 
ATOM   9856  O  O    . GLN B 1 279 ? -32.610  -4.812  -23.649 1.00 63.76  ? 840  GLN B O    1 
ATOM   9857  C  CB   . GLN B 1 279 ? -34.102  -2.063  -24.536 1.00 69.88  ? 840  GLN B CB   1 
ATOM   9858  C  CG   . GLN B 1 279 ? -33.976  -1.879  -23.028 1.00 68.70  ? 840  GLN B CG   1 
ATOM   9859  C  CD   . GLN B 1 279 ? -32.706  -1.146  -22.633 1.00 70.22  ? 840  GLN B CD   1 
ATOM   9860  O  OE1  . GLN B 1 279 ? -32.550  0.042   -22.913 1.00 84.08  ? 840  GLN B OE1  1 
ATOM   9861  N  NE2  . GLN B 1 279 ? -31.787  -1.855  -21.985 1.00 77.86  ? 840  GLN B NE2  1 
ATOM   9862  H  H    . GLN B 1 279 ? -33.802  -2.533  -26.915 1.00 75.83  ? 840  GLN B H    1 
ATOM   9863  H  HA   . GLN B 1 279 ? -32.174  -2.678  -24.854 1.00 73.60  ? 840  GLN B HA   1 
ATOM   9864  H  HB2  . GLN B 1 279 ? -34.024  -1.188  -24.948 1.00 83.86  ? 840  GLN B HB2  1 
ATOM   9865  H  HB3  . GLN B 1 279 ? -34.981  -2.432  -24.716 1.00 83.86  ? 840  GLN B HB3  1 
ATOM   9866  H  HG2  . GLN B 1 279 ? -34.732  -1.364  -22.707 1.00 82.44  ? 840  GLN B HG2  1 
ATOM   9867  H  HG3  . GLN B 1 279 ? -33.963  -2.751  -22.603 1.00 82.44  ? 840  GLN B HG3  1 
ATOM   9868  H  HE21 . GLN B 1 279 ? -31.929  -2.685  -21.810 1.00 93.43  ? 840  GLN B HE21 1 
ATOM   9869  H  HE22 . GLN B 1 279 ? -31.051  -1.484  -21.740 1.00 93.43  ? 840  GLN B HE22 1 
ATOM   9870  N  N    . PHE B 1 280 ? -34.078  -5.199  -25.312 1.00 65.78  ? 841  PHE B N    1 
ATOM   9871  C  CA   . PHE B 1 280 ? -34.216  -6.609  -24.961 1.00 63.54  ? 841  PHE B CA   1 
ATOM   9872  C  C    . PHE B 1 280 ? -32.894  -7.344  -25.144 1.00 61.27  ? 841  PHE B C    1 
ATOM   9873  O  O    . PHE B 1 280 ? -32.458  -8.089  -24.259 1.00 59.79  ? 841  PHE B O    1 
ATOM   9874  C  CB   . PHE B 1 280 ? -35.315  -7.258  -25.804 1.00 54.45  ? 841  PHE B CB   1 
ATOM   9875  C  CG   . PHE B 1 280 ? -35.406  -8.749  -25.636 1.00 43.20  ? 841  PHE B CG   1 
ATOM   9876  C  CD1  . PHE B 1 280 ? -36.063  -9.300  -24.549 1.00 37.25  ? 841  PHE B CD1  1 
ATOM   9877  C  CD2  . PHE B 1 280 ? -34.835  -9.600  -26.569 1.00 60.72  ? 841  PHE B CD2  1 
ATOM   9878  C  CE1  . PHE B 1 280 ? -36.147  -10.669 -24.394 1.00 56.59  ? 841  PHE B CE1  1 
ATOM   9879  C  CE2  . PHE B 1 280 ? -34.916  -10.973 -26.420 1.00 49.20  ? 841  PHE B CE2  1 
ATOM   9880  C  CZ   . PHE B 1 280 ? -35.573  -11.507 -25.331 1.00 65.45  ? 841  PHE B CZ   1 
ATOM   9881  H  H    . PHE B 1 280 ? -34.576  -4.942  -25.965 1.00 78.94  ? 841  PHE B H    1 
ATOM   9882  H  HA   . PHE B 1 280 ? -34.472  -6.679  -24.028 1.00 76.25  ? 841  PHE B HA   1 
ATOM   9883  H  HB2  . PHE B 1 280 ? -36.170  -6.878  -25.549 1.00 65.34  ? 841  PHE B HB2  1 
ATOM   9884  H  HB3  . PHE B 1 280 ? -35.139  -7.075  -26.740 1.00 65.34  ? 841  PHE B HB3  1 
ATOM   9885  H  HD1  . PHE B 1 280 ? -36.451  -8.741  -23.915 1.00 44.70  ? 841  PHE B HD1  1 
ATOM   9886  H  HD2  . PHE B 1 280 ? -34.391  -9.243  -27.304 1.00 72.87  ? 841  PHE B HD2  1 
ATOM   9887  H  HE1  . PHE B 1 280 ? -36.591  -11.027 -23.660 1.00 67.91  ? 841  PHE B HE1  1 
ATOM   9888  H  HE2  . PHE B 1 280 ? -34.528  -11.534 -27.052 1.00 59.04  ? 841  PHE B HE2  1 
ATOM   9889  H  HZ   . PHE B 1 280 ? -35.630  -12.430 -25.228 1.00 78.54  ? 841  PHE B HZ   1 
ATOM   9890  N  N    . PHE B 1 281 ? -32.237  -7.139  -26.288 1.00 59.74  ? 842  PHE B N    1 
ATOM   9891  C  CA   . PHE B 1 281 ? -30.941  -7.768  -26.519 1.00 60.98  ? 842  PHE B CA   1 
ATOM   9892  C  C    . PHE B 1 281 ? -29.936  -7.373  -25.444 1.00 63.68  ? 842  PHE B C    1 
ATOM   9893  O  O    . PHE B 1 281 ? -29.191  -8.220  -24.938 1.00 69.15  ? 842  PHE B O    1 
ATOM   9894  C  CB   . PHE B 1 281 ? -30.416  -7.391  -27.907 1.00 57.59  ? 842  PHE B CB   1 
ATOM   9895  C  CG   . PHE B 1 281 ? -31.101  -8.110  -29.042 1.00 62.01  ? 842  PHE B CG   1 
ATOM   9896  C  CD1  . PHE B 1 281 ? -31.392  -9.463  -28.958 1.00 62.69  ? 842  PHE B CD1  1 
ATOM   9897  C  CD2  . PHE B 1 281 ? -31.448  -7.428  -30.198 1.00 60.32  ? 842  PHE B CD2  1 
ATOM   9898  C  CE1  . PHE B 1 281 ? -32.018  -10.121 -30.002 1.00 61.26  ? 842  PHE B CE1  1 
ATOM   9899  C  CE2  . PHE B 1 281 ? -32.074  -8.080  -31.246 1.00 70.74  ? 842  PHE B CE2  1 
ATOM   9900  C  CZ   . PHE B 1 281 ? -32.359  -9.430  -31.147 1.00 65.06  ? 842  PHE B CZ   1 
ATOM   9901  H  H    . PHE B 1 281 ? -32.516  -6.646  -26.935 1.00 71.69  ? 842  PHE B H    1 
ATOM   9902  H  HA   . PHE B 1 281 ? -31.048  -8.732  -26.490 1.00 73.18  ? 842  PHE B HA   1 
ATOM   9903  H  HB2  . PHE B 1 281 ? -30.545  -6.439  -28.040 1.00 69.11  ? 842  PHE B HB2  1 
ATOM   9904  H  HB3  . PHE B 1 281 ? -29.471  -7.603  -27.950 1.00 69.11  ? 842  PHE B HB3  1 
ATOM   9905  H  HD1  . PHE B 1 281 ? -31.164  -9.934  -28.189 1.00 75.22  ? 842  PHE B HD1  1 
ATOM   9906  H  HD2  . PHE B 1 281 ? -31.259  -6.521  -30.270 1.00 72.39  ? 842  PHE B HD2  1 
ATOM   9907  H  HE1  . PHE B 1 281 ? -32.209  -11.029 -29.933 1.00 73.52  ? 842  PHE B HE1  1 
ATOM   9908  H  HE2  . PHE B 1 281 ? -32.302  -7.611  -32.016 1.00 84.89  ? 842  PHE B HE2  1 
ATOM   9909  H  HZ   . PHE B 1 281 ? -32.780  -9.870  -31.849 1.00 78.07  ? 842  PHE B HZ   1 
ATOM   9910  N  N    . GLN B 1 282 ? -29.908  -6.092  -25.074 1.00 70.54  ? 843  GLN B N    1 
ATOM   9911  C  CA   . GLN B 1 282 ? -28.999  -5.649  -24.025 1.00 73.34  ? 843  GLN B CA   1 
ATOM   9912  C  C    . GLN B 1 282 ? -29.346  -6.290  -22.686 1.00 65.48  ? 843  GLN B C    1 
ATOM   9913  O  O    . GLN B 1 282 ? -28.457  -6.750  -21.962 1.00 64.48  ? 843  GLN B O    1 
ATOM   9914  C  CB   . GLN B 1 282 ? -29.031  -4.125  -23.914 1.00 60.92  ? 843  GLN B CB   1 
ATOM   9915  C  CG   . GLN B 1 282 ? -28.171  -3.566  -22.791 1.00 76.92  ? 843  GLN B CG   1 
ATOM   9916  C  CD   . GLN B 1 282 ? -28.283  -2.063  -22.663 1.00 83.44  ? 843  GLN B CD   1 
ATOM   9917  O  OE1  . GLN B 1 282 ? -28.126  -1.330  -23.639 1.00 91.92  ? 843  GLN B OE1  1 
ATOM   9918  N  NE2  . GLN B 1 282 ? -28.560  -1.595  -21.453 1.00 81.75  ? 843  GLN B NE2  1 
ATOM   9919  H  H    . GLN B 1 282 ? -30.398  -5.471  -25.411 1.00 84.64  ? 843  GLN B H    1 
ATOM   9920  H  HA   . GLN B 1 282 ? -28.095  -5.913  -24.258 1.00 88.00  ? 843  GLN B HA   1 
ATOM   9921  H  HB2  . GLN B 1 282 ? -28.713  -3.744  -24.747 1.00 73.10  ? 843  GLN B HB2  1 
ATOM   9922  H  HB3  . GLN B 1 282 ? -29.946  -3.843  -23.753 1.00 73.10  ? 843  GLN B HB3  1 
ATOM   9923  H  HG2  . GLN B 1 282 ? -28.453  -3.961  -21.951 1.00 92.30  ? 843  GLN B HG2  1 
ATOM   9924  H  HG3  . GLN B 1 282 ? -27.243  -3.785  -22.965 1.00 92.30  ? 843  GLN B HG3  1 
ATOM   9925  H  HE21 . GLN B 1 282 ? -28.666  -2.138  -20.795 1.00 98.10  ? 843  GLN B HE21 1 
ATOM   9926  H  HE22 . GLN B 1 282 ? -28.635  -0.747  -21.326 1.00 98.10  ? 843  GLN B HE22 1 
ATOM   9927  N  N    . ASP B 1 283 ? -30.636  -6.331  -22.341 1.00 60.85  ? 844  ASP B N    1 
ATOM   9928  C  CA   . ASP B 1 283 ? -31.041  -6.901  -21.059 1.00 75.47  ? 844  ASP B CA   1 
ATOM   9929  C  C    . ASP B 1 283 ? -30.692  -8.381  -20.967 1.00 66.20  ? 844  ASP B C    1 
ATOM   9930  O  O    . ASP B 1 283 ? -30.325  -8.873  -19.893 1.00 77.64  ? 844  ASP B O    1 
ATOM   9931  C  CB   . ASP B 1 283 ? -32.542  -6.697  -20.840 1.00 79.81  ? 844  ASP B CB   1 
ATOM   9932  C  CG   . ASP B 1 283 ? -32.898  -5.262  -20.511 1.00 52.80  ? 844  ASP B CG   1 
ATOM   9933  O  OD1  . ASP B 1 283 ? -32.033  -4.534  -19.986 1.00 56.49  ? 844  ASP B OD1  1 
ATOM   9934  O  OD2  . ASP B 1 283 ? -34.050  -4.861  -20.771 1.00 62.41  ? 844  ASP B OD2  1 
ATOM   9935  H  H    . ASP B 1 283 ? -31.284  -6.041  -22.825 1.00 73.02  ? 844  ASP B H    1 
ATOM   9936  H  HA   . ASP B 1 283 ? -30.570  -6.439  -20.347 1.00 90.56  ? 844  ASP B HA   1 
ATOM   9937  H  HB2  . ASP B 1 283 ? -33.015  -6.946  -21.649 1.00 95.77  ? 844  ASP B HB2  1 
ATOM   9938  H  HB3  . ASP B 1 283 ? -32.831  -7.255  -20.101 1.00 95.77  ? 844  ASP B HB3  1 
ATOM   9939  N  N    . VAL B 1 284 ? -30.809  -9.112  -22.077 1.00 62.88  ? 845  VAL B N    1 
ATOM   9940  C  CA   . VAL B 1 284 ? -30.479  -10.536 -22.066 1.00 60.13  ? 845  VAL B CA   1 
ATOM   9941  C  C    . VAL B 1 284 ? -28.982  -10.736 -21.862 1.00 74.13  ? 845  VAL B C    1 
ATOM   9942  O  O    . VAL B 1 284 ? -28.555  -11.660 -21.158 1.00 69.91  ? 845  VAL B O    1 
ATOM   9943  C  CB   . VAL B 1 284 ? -30.967  -11.203 -23.367 1.00 57.70  ? 845  VAL B CB   1 
ATOM   9944  C  CG1  . VAL B 1 284 ? -30.420  -12.623 -23.495 1.00 72.71  ? 845  VAL B CG1  1 
ATOM   9945  C  CG2  . VAL B 1 284 ? -32.490  -11.218 -23.413 1.00 63.71  ? 845  VAL B CG2  1 
ATOM   9946  H  H    . VAL B 1 284 ? -31.074  -8.812  -22.838 1.00 75.46  ? 845  VAL B H    1 
ATOM   9947  H  HA   . VAL B 1 284 ? -30.939  -10.958 -21.324 1.00 72.15  ? 845  VAL B HA   1 
ATOM   9948  H  HB   . VAL B 1 284 ? -30.649  -10.689 -24.125 1.00 69.24  ? 845  VAL B HB   1 
ATOM   9949  H  HG11 . VAL B 1 284 ? -30.745  -13.013 -24.322 1.00 87.26  ? 845  VAL B HG11 1 
ATOM   9950  H  HG12 . VAL B 1 284 ? -29.450  -12.587 -23.505 1.00 87.26  ? 845  VAL B HG12 1 
ATOM   9951  H  HG13 . VAL B 1 284 ? -30.724  -13.148 -22.739 1.00 87.26  ? 845  VAL B HG13 1 
ATOM   9952  H  HG21 . VAL B 1 284 ? -32.776  -11.642 -24.238 1.00 76.45  ? 845  VAL B HG21 1 
ATOM   9953  H  HG22 . VAL B 1 284 ? -32.824  -11.717 -22.651 1.00 76.45  ? 845  VAL B HG22 1 
ATOM   9954  H  HG23 . VAL B 1 284 ? -32.816  -10.305 -23.380 1.00 76.45  ? 845  VAL B HG23 1 
ATOM   9955  N  N    . SER B 1 285 ? -28.160  -9.876  -22.470 1.00 75.02  ? 846  SER B N    1 
ATOM   9956  C  CA   . SER B 1 285 ? -26.713  -10.037 -22.377 1.00 71.19  ? 846  SER B CA   1 
ATOM   9957  C  C    . SER B 1 285 ? -26.211  -9.767  -20.962 1.00 74.62  ? 846  SER B C    1 
ATOM   9958  O  O    . SER B 1 285 ? -25.300  -10.453 -20.482 1.00 71.44  ? 846  SER B O    1 
ATOM   9959  C  CB   . SER B 1 285 ? -26.021  -9.113  -23.381 1.00 75.21  ? 846  SER B CB   1 
ATOM   9960  O  OG   . SER B 1 285 ? -24.626  -9.349  -23.405 1.00 82.07  ? 846  SER B OG   1 
ATOM   9961  H  H    . SER B 1 285 ? -28.415  -9.200  -22.937 1.00 90.02  ? 846  SER B H    1 
ATOM   9962  H  HA   . SER B 1 285 ? -26.483  -10.951 -22.606 1.00 85.43  ? 846  SER B HA   1 
ATOM   9963  H  HB2  . SER B 1 285 ? -26.385  -9.279  -24.265 1.00 90.25  ? 846  SER B HB2  1 
ATOM   9964  H  HB3  . SER B 1 285 ? -26.181  -8.192  -23.123 1.00 90.25  ? 846  SER B HB3  1 
ATOM   9965  H  HG   . SER B 1 285 ? -24.472  -10.144 -23.627 1.00 98.48  ? 846  SER B HG   1 
ATOM   9966  N  N    . ASP B 1 286 ? -26.786  -8.769  -20.282 1.00 82.35  ? 847  ASP B N    1 
ATOM   9967  C  CA   . ASP B 1 286 ? -26.389  -8.480  -18.906 1.00 76.28  ? 847  ASP B CA   1 
ATOM   9968  C  C    . ASP B 1 286 ? -26.713  -9.650  -17.985 1.00 85.00  ? 847  ASP B C    1 
ATOM   9969  O  O    . ASP B 1 286 ? -25.934  -9.974  -17.081 1.00 103.92 ? 847  ASP B O    1 
ATOM   9970  C  CB   . ASP B 1 286 ? -27.084  -7.207  -18.409 1.00 79.03  ? 847  ASP B CB   1 
ATOM   9971  C  CG   . ASP B 1 286 ? -26.675  -5.961  -19.185 1.00 76.06  ? 847  ASP B CG   1 
ATOM   9972  O  OD1  . ASP B 1 286 ? -25.594  -5.965  -19.804 1.00 80.78  ? 847  ASP B OD1  1 
ATOM   9973  O  OD2  . ASP B 1 286 ? -27.434  -4.968  -19.166 1.00 72.89  ? 847  ASP B OD2  1 
ATOM   9974  H  H    . ASP B 1 286 ? -27.400  -8.253  -20.592 1.00 98.83  ? 847  ASP B H    1 
ATOM   9975  H  HA   . ASP B 1 286 ? -25.431  -8.330  -18.878 1.00 91.53  ? 847  ASP B HA   1 
ATOM   9976  H  HB2  . ASP B 1 286 ? -28.044  -7.315  -18.502 1.00 94.84  ? 847  ASP B HB2  1 
ATOM   9977  H  HB3  . ASP B 1 286 ? -26.856  -7.067  -17.477 1.00 94.84  ? 847  ASP B HB3  1 
ATOM   9978  N  N    . ARG B 1 287 ? -27.856  -10.301 -18.207 1.00 90.78  ? 848  ARG B N    1 
ATOM   9979  C  CA   . ARG B 1 287 ? -28.304  -11.390 -17.348 1.00 75.04  ? 848  ARG B CA   1 
ATOM   9980  C  C    . ARG B 1 287 ? -27.501  -12.670 -17.561 1.00 75.05  ? 848  ARG B C    1 
ATOM   9981  O  O    . ARG B 1 287 ? -27.444  -13.507 -16.655 1.00 85.65  ? 848  ARG B O    1 
ATOM   9982  C  CB   . ARG B 1 287 ? -29.794  -11.635 -17.605 1.00 79.41  ? 848  ARG B CB   1 
ATOM   9983  C  CG   . ARG B 1 287 ? -30.413  -12.826 -16.895 1.00 87.74  ? 848  ARG B CG   1 
ATOM   9984  C  CD   . ARG B 1 287 ? -30.445  -12.647 -15.391 1.00 84.97  ? 848  ARG B CD   1 
ATOM   9985  N  NE   . ARG B 1 287 ? -31.357  -13.607 -14.777 1.00 87.89  ? 848  ARG B NE   1 
ATOM   9986  C  CZ   . ARG B 1 287 ? -31.075  -14.893 -14.586 1.00 84.42  ? 848  ARG B CZ   1 
ATOM   9987  N  NH1  . ARG B 1 287 ? -29.901  -15.388 -14.954 1.00 93.04  ? 848  ARG B NH1  1 
ATOM   9988  N  NH2  . ARG B 1 287 ? -31.969  -15.692 -14.024 1.00 94.33  ? 848  ARG B NH2  1 
ATOM   9989  H  H    . ARG B 1 287 ? -28.392  -10.127 -18.856 1.00 108.94 ? 848  ARG B H    1 
ATOM   9990  H  HA   . ARG B 1 287 ? -28.199  -11.124 -16.421 1.00 90.05  ? 848  ARG B HA   1 
ATOM   9991  H  HB2  . ARG B 1 287 ? -30.284  -10.847 -17.325 1.00 95.29  ? 848  ARG B HB2  1 
ATOM   9992  H  HB3  . ARG B 1 287 ? -29.920  -11.771 -18.557 1.00 95.29  ? 848  ARG B HB3  1 
ATOM   9993  H  HG2  . ARG B 1 287 ? -31.325  -12.941 -17.204 1.00 105.29 ? 848  ARG B HG2  1 
ATOM   9994  H  HG3  . ARG B 1 287 ? -29.892  -13.620 -17.093 1.00 105.29 ? 848  ARG B HG3  1 
ATOM   9995  H  HD2  . ARG B 1 287 ? -29.557  -12.793 -15.030 1.00 101.97 ? 848  ARG B HD2  1 
ATOM   9996  H  HD3  . ARG B 1 287 ? -30.754  -11.752 -15.179 1.00 101.97 ? 848  ARG B HD3  1 
ATOM   9997  H  HE   . ARG B 1 287 ? -32.127  -13.323 -14.522 1.00 105.47 ? 848  ARG B HE   1 
ATOM   9998  H  HH11 . ARG B 1 287 ? -29.315  -14.877 -15.321 1.00 111.65 ? 848  ARG B HH11 1 
ATOM   9999  H  HH12 . ARG B 1 287 ? -29.726  -16.221 -14.826 1.00 111.65 ? 848  ARG B HH12 1 
ATOM   10000 H  HH21 . ARG B 1 287 ? -32.732  -15.380 -13.781 1.00 113.20 ? 848  ARG B HH21 1 
ATOM   10001 H  HH22 . ARG B 1 287 ? -31.785  -16.523 -13.899 1.00 113.20 ? 848  ARG B HH22 1 
ATOM   10002 N  N    . ILE B 1 288 ? -26.876  -12.834 -18.727 1.00 81.09  ? 849  ILE B N    1 
ATOM   10003 C  CA   . ILE B 1 288 ? -26.239  -14.092 -19.107 1.00 79.60  ? 849  ILE B CA   1 
ATOM   10004 C  C    . ILE B 1 288 ? -24.750  -14.099 -18.777 1.00 88.41  ? 849  ILE B C    1 
ATOM   10005 O  O    . ILE B 1 288 ? -24.046  -15.052 -19.129 1.00 96.63  ? 849  ILE B O    1 
ATOM   10006 C  CB   . ILE B 1 288 ? -26.457  -14.373 -20.607 1.00 60.82  ? 849  ILE B CB   1 
ATOM   10007 H  H    . ILE B 1 288 ? -26.807  -12.220 -19.324 1.00 97.31  ? 849  ILE B H    1 
ATOM   10008 H  HA   . ILE B 1 288 ? -26.655  -14.814 -18.608 1.00 95.52  ? 849  ILE B HA   1 
ATOM   10009 N  N    . GLU B 1 289 ? -24.254  -13.051 -18.112 1.00 92.81  ? 850  GLU B N    1 
ATOM   10010 C  CA   . GLU B 1 289 ? -22.811  -12.798 -18.093 1.00 94.29  ? 850  GLU B CA   1 
ATOM   10011 C  C    . GLU B 1 289 ? -22.022  -13.976 -17.512 1.00 98.95  ? 850  GLU B C    1 
ATOM   10012 O  O    . GLU B 1 289 ? -21.122  -14.502 -18.173 1.00 110.17 ? 850  GLU B O    1 
ATOM   10013 C  CB   . GLU B 1 289 ? -22.505  -11.498 -17.343 1.00 90.96  ? 850  GLU B CB   1 
ATOM   10014 C  CG   . GLU B 1 289 ? -21.119  -10.923 -17.666 1.00 91.17  ? 850  GLU B CG   1 
ATOM   10015 C  CD   . GLU B 1 289 ? -20.966  -10.496 -19.128 1.00 97.61  ? 850  GLU B CD   1 
ATOM   10016 O  OE1  . GLU B 1 289 ? -21.965  -10.527 -19.879 1.00 94.30  ? 850  GLU B OE1  1 
ATOM   10017 O  OE2  . GLU B 1 289 ? -19.840  -10.123 -19.527 1.00 83.35  ? 850  GLU B OE2  1 
ATOM   10018 H  H    . GLU B 1 289 ? -24.723  -12.480 -17.671 1.00 111.37 ? 850  GLU B H    1 
ATOM   10019 H  HA   . GLU B 1 289 ? -22.514  -12.678 -19.008 1.00 113.14 ? 850  GLU B HA   1 
ATOM   10020 H  HB2  . GLU B 1 289 ? -23.168  -10.833 -17.584 1.00 109.15 ? 850  GLU B HB2  1 
ATOM   10021 H  HB3  . GLU B 1 289 ? -22.540  -11.670 -16.389 1.00 109.15 ? 850  GLU B HB3  1 
ATOM   10022 H  HG2  . GLU B 1 289 ? -20.966  -10.143 -17.111 1.00 109.41 ? 850  GLU B HG2  1 
ATOM   10023 H  HG3  . GLU B 1 289 ? -20.448  -11.598 -17.481 1.00 109.41 ? 850  GLU B HG3  1 
ATOM   10024 N  N    . LYS B 1 290 ? -22.305  -14.401 -16.278 1.00 102.42 ? 851  LYS B N    1 
ATOM   10025 C  CA   . LYS B 1 290 ? -21.829  -15.716 -15.825 1.00 96.95  ? 851  LYS B CA   1 
ATOM   10026 C  C    . LYS B 1 290 ? -23.034  -16.607 -15.546 1.00 94.14  ? 851  LYS B C    1 
ATOM   10027 O  O    . LYS B 1 290 ? -23.686  -16.472 -14.506 1.00 94.22  ? 851  LYS B O    1 
ATOM   10028 C  CB   . LYS B 1 290 ? -20.952  -15.573 -14.582 1.00 80.20  ? 851  LYS B CB   1 
ATOM   10029 H  H    . LYS B 1 290 ? -22.760  -13.961 -15.696 1.00 122.90 ? 851  LYS B H    1 
ATOM   10030 H  HA   . LYS B 1 290 ? -21.300  -16.127 -16.527 1.00 116.35 ? 851  LYS B HA   1 
ATOM   10031 N  N    . GLU B 1 291 ? -23.344  -17.508 -16.481 1.00 99.88  ? 852  GLU B N    1 
ATOM   10032 C  CA   . GLU B 1 291 ? -24.237  -18.633 -16.237 1.00 98.02  ? 852  GLU B CA   1 
ATOM   10033 C  C    . GLU B 1 291 ? -23.567  -20.006 -16.162 1.00 115.88 ? 852  GLU B C    1 
ATOM   10034 O  O    . GLU B 1 291 ? -24.270  -20.997 -15.935 1.00 119.14 ? 852  GLU B O    1 
ATOM   10035 C  CB   . GLU B 1 291 ? -25.348  -18.616 -17.285 1.00 112.76 ? 852  GLU B CB   1 
ATOM   10036 C  CG   . GLU B 1 291 ? -26.485  -17.667 -16.921 1.00 106.79 ? 852  GLU B CG   1 
ATOM   10037 C  CD   . GLU B 1 291 ? -27.180  -18.044 -15.621 1.00 105.37 ? 852  GLU B CD   1 
ATOM   10038 O  OE1  . GLU B 1 291 ? -27.073  -19.219 -15.206 1.00 106.73 ? 852  GLU B OE1  1 
ATOM   10039 O  OE2  . GLU B 1 291 ? -27.824  -17.166 -15.009 1.00 102.65 ? 852  GLU B OE2  1 
ATOM   10040 H  H    . GLU B 1 291 ? -23.039  -17.483 -17.285 1.00 119.85 ? 852  GLU B H    1 
ATOM   10041 H  HA   . GLU B 1 291 ? -24.663  -18.487 -15.378 1.00 117.62 ? 852  GLU B HA   1 
ATOM   10042 H  HB2  . GLU B 1 291 ? -24.977  -18.329 -18.134 1.00 135.31 ? 852  GLU B HB2  1 
ATOM   10043 H  HB3  . GLU B 1 291 ? -25.717  -19.509 -17.368 1.00 135.31 ? 852  GLU B HB3  1 
ATOM   10044 H  HG2  . GLU B 1 291 ? -26.128  -16.771 -16.821 1.00 128.15 ? 852  GLU B HG2  1 
ATOM   10045 H  HG3  . GLU B 1 291 ? -27.147  -17.682 -17.630 1.00 128.15 ? 852  GLU B HG3  1 
ATOM   10046 N  N    . SER B 1 292 ? -22.253  -20.106 -16.379 1.00 106.43 ? 853  SER B N    1 
ATOM   10047 C  CA   . SER B 1 292 ? -21.453  -21.333 -16.358 1.00 114.24 ? 853  SER B CA   1 
ATOM   10048 C  C    . SER B 1 292 ? -21.468  -22.126 -17.679 1.00 118.58 ? 853  SER B C    1 
ATOM   10049 O  O    . SER B 1 292 ? -20.671  -23.057 -17.819 1.00 120.35 ? 853  SER B O    1 
ATOM   10050 C  CB   . SER B 1 292 ? -21.873  -22.301 -15.234 1.00 102.95 ? 853  SER B CB   1 
ATOM   10051 O  OG   . SER B 1 292 ? -20.867  -23.264 -14.992 1.00 123.14 ? 853  SER B OG   1 
ATOM   10052 H  H    . SER B 1 292 ? -21.769  -19.417 -16.554 1.00 127.72 ? 853  SER B H    1 
ATOM   10053 H  HA   . SER B 1 292 ? -20.531  -21.084 -16.187 1.00 137.09 ? 853  SER B HA   1 
ATOM   10054 H  HB2  . SER B 1 292 ? -22.026  -21.794 -14.422 1.00 123.54 ? 853  SER B HB2  1 
ATOM   10055 H  HB3  . SER B 1 292 ? -22.688  -22.757 -15.499 1.00 123.54 ? 853  SER B HB3  1 
ATOM   10056 H  HG   . SER B 1 292 ? -20.724  -23.711 -15.688 1.00 147.76 ? 853  SER B HG   1 
ATOM   10057 N  N    . LEU B 1 293 ? -22.355  -21.819 -18.627 1.00 103.88 ? 854  LEU B N    1 
ATOM   10058 C  CA   . LEU B 1 293 ? -22.426  -22.457 -19.944 1.00 101.24 ? 854  LEU B CA   1 
ATOM   10059 C  C    . LEU B 1 293 ? -23.003  -23.869 -19.899 1.00 104.36 ? 854  LEU B C    1 
ATOM   10060 O  O    . LEU B 1 293 ? -23.428  -24.396 -20.934 1.00 98.75  ? 854  LEU B O    1 
ATOM   10061 C  CB   . LEU B 1 293 ? -21.050  -22.537 -20.616 1.00 89.35  ? 854  LEU B CB   1 
ATOM   10062 C  CG   . LEU B 1 293 ? -20.099  -21.341 -20.567 1.00 101.72 ? 854  LEU B CG   1 
ATOM   10063 C  CD1  . LEU B 1 293 ? -18.887  -21.634 -21.441 1.00 94.13  ? 854  LEU B CD1  1 
ATOM   10064 C  CD2  . LEU B 1 293 ? -20.791  -20.068 -21.008 1.00 104.99 ? 854  LEU B CD2  1 
ATOM   10065 H  H    . LEU B 1 293 ? -22.956  -21.213 -18.522 1.00 124.66 ? 854  LEU B H    1 
ATOM   10066 H  HA   . LEU B 1 293 ? -23.001  -21.923 -20.515 1.00 121.48 ? 854  LEU B HA   1 
ATOM   10067 H  HB2  . LEU B 1 293 ? -20.574  -23.281 -20.215 1.00 107.23 ? 854  LEU B HB2  1 
ATOM   10068 H  HB3  . LEU B 1 293 ? -21.196  -22.732 -21.555 1.00 107.23 ? 854  LEU B HB3  1 
ATOM   10069 H  HG   . LEU B 1 293 ? -19.791  -21.217 -19.656 1.00 122.06 ? 854  LEU B HG   1 
ATOM   10070 H  HD11 . LEU B 1 293 ? -18.284  -20.875 -21.410 1.00 112.96 ? 854  LEU B HD11 1 
ATOM   10071 H  HD12 . LEU B 1 293 ? -18.440  -22.426 -21.105 1.00 112.96 ? 854  LEU B HD12 1 
ATOM   10072 H  HD13 . LEU B 1 293 ? -19.184  -21.783 -22.353 1.00 112.96 ? 854  LEU B HD13 1 
ATOM   10073 H  HD21 . LEU B 1 293 ? -20.158  -19.334 -20.964 1.00 125.99 ? 854  LEU B HD21 1 
ATOM   10074 H  HD22 . LEU B 1 293 ? -21.106  -20.180 -21.919 1.00 125.99 ? 854  LEU B HD22 1 
ATOM   10075 H  HD23 . LEU B 1 293 ? -21.540  -19.896 -20.417 1.00 125.99 ? 854  LEU B HD23 1 
ATOM   10076 N  N    . ASP B 1 294 ? -23.028  -24.489 -18.721 1.00 104.33 ? 855  ASP B N    1 
ATOM   10077 C  CA   . ASP B 1 294 ? -23.726  -25.749 -18.510 1.00 110.70 ? 855  ASP B CA   1 
ATOM   10078 C  C    . ASP B 1 294 ? -25.100  -25.549 -17.892 1.00 104.89 ? 855  ASP B C    1 
ATOM   10079 O  O    . ASP B 1 294 ? -25.825  -26.528 -17.692 1.00 93.97  ? 855  ASP B O    1 
ATOM   10080 C  CB   . ASP B 1 294 ? -22.885  -26.680 -17.628 1.00 108.67 ? 855  ASP B CB   1 
ATOM   10081 C  CG   . ASP B 1 294 ? -21.643  -27.200 -18.337 1.00 107.34 ? 855  ASP B CG   1 
ATOM   10082 O  OD1  . ASP B 1 294 ? -21.690  -27.390 -19.571 1.00 106.32 ? 855  ASP B OD1  1 
ATOM   10083 O  OD2  . ASP B 1 294 ? -20.618  -27.423 -17.658 1.00 109.92 ? 855  ASP B OD2  1 
ATOM   10084 H  H    . ASP B 1 294 ? -22.639  -24.190 -18.015 1.00 125.19 ? 855  ASP B H    1 
ATOM   10085 H  HA   . ASP B 1 294 ? -23.848  -26.185 -19.368 1.00 132.84 ? 855  ASP B HA   1 
ATOM   10086 H  HB2  . ASP B 1 294 ? -22.599  -26.195 -16.838 1.00 130.41 ? 855  ASP B HB2  1 
ATOM   10087 H  HB3  . ASP B 1 294 ? -23.425  -27.444 -17.370 1.00 130.41 ? 855  ASP B HB3  1 
ATOM   10088 N  N    . GLY B 1 295 ? -25.471  -24.310 -17.590 1.00 105.89 ? 856  GLY B N    1 
ATOM   10089 C  CA   . GLY B 1 295 ? -26.735  -24.026 -16.958 1.00 108.50 ? 856  GLY B CA   1 
ATOM   10090 C  C    . GLY B 1 295 ? -27.863  -23.952 -17.959 1.00 102.68 ? 856  GLY B C    1 
ATOM   10091 O  O    . GLY B 1 295 ? -27.663  -23.911 -19.183 1.00 95.13  ? 856  GLY B O    1 
ATOM   10092 H  H    . GLY B 1 295 ? -24.994  -23.611 -17.746 1.00 127.07 ? 856  GLY B H    1 
ATOM   10093 H  HA2  . GLY B 1 295 ? -26.939  -24.721 -16.313 1.00 130.20 ? 856  GLY B HA2  1 
ATOM   10094 H  HA3  . GLY B 1 295 ? -26.681  -23.177 -16.490 1.00 130.20 ? 856  GLY B HA3  1 
ATOM   10095 N  N    . PRO B 1 296 ? -29.093  -23.932 -17.437 1.00 113.94 ? 857  PRO B N    1 
ATOM   10096 C  CA   . PRO B 1 296 ? -30.261  -23.940 -18.334 1.00 119.83 ? 857  PRO B CA   1 
ATOM   10097 C  C    . PRO B 1 296 ? -30.325  -22.742 -19.266 1.00 118.81 ? 857  PRO B C    1 
ATOM   10098 O  O    . PRO B 1 296 ? -30.601  -22.911 -20.460 1.00 113.77 ? 857  PRO B O    1 
ATOM   10099 C  CB   . PRO B 1 296 ? -31.446  -23.966 -17.357 1.00 103.93 ? 857  PRO B CB   1 
ATOM   10100 C  CG   . PRO B 1 296 ? -30.911  -23.385 -16.091 1.00 95.71  ? 857  PRO B CG   1 
ATOM   10101 C  CD   . PRO B 1 296 ? -29.479  -23.822 -16.020 1.00 102.29 ? 857  PRO B CD   1 
ATOM   10102 H  HA   . PRO B 1 296 ? -30.269  -24.753 -18.863 1.00 143.79 ? 857  PRO B HA   1 
ATOM   10103 H  HB2  . PRO B 1 296 ? -32.170  -23.422 -17.706 1.00 124.71 ? 857  PRO B HB2  1 
ATOM   10104 H  HB3  . PRO B 1 296 ? -31.737  -24.881 -17.220 1.00 124.71 ? 857  PRO B HB3  1 
ATOM   10105 H  HG2  . PRO B 1 296 ? -30.972  -22.418 -16.126 1.00 114.85 ? 857  PRO B HG2  1 
ATOM   10106 H  HG3  . PRO B 1 296 ? -31.412  -23.733 -15.337 1.00 114.85 ? 857  PRO B HG3  1 
ATOM   10107 H  HD2  . PRO B 1 296 ? -28.942  -23.149 -15.574 1.00 122.75 ? 857  PRO B HD2  1 
ATOM   10108 H  HD3  . PRO B 1 296 ? -29.409  -24.684 -15.582 1.00 122.75 ? 857  PRO B HD3  1 
ATOM   10109 N  N    . ILE B 1 297 ? -30.075  -21.535 -18.755 1.00 121.06 ? 858  ILE B N    1 
ATOM   10110 C  CA   . ILE B 1 297 ? -30.196  -20.324 -19.571 1.00 111.36 ? 858  ILE B CA   1 
ATOM   10111 C  C    . ILE B 1 297 ? -29.314  -20.423 -20.812 1.00 103.61 ? 858  ILE B C    1 
ATOM   10112 O  O    . ILE B 1 297 ? -29.806  -20.404 -21.946 1.00 99.08  ? 858  ILE B O    1 
ATOM   10113 C  CB   . ILE B 1 297 ? -29.868  -19.075 -18.733 1.00 103.39 ? 858  ILE B CB   1 
ATOM   10114 C  CG1  . ILE B 1 297 ? -30.931  -18.905 -17.644 1.00 99.48  ? 858  ILE B CG1  1 
ATOM   10115 C  CG2  . ILE B 1 297 ? -29.817  -17.828 -19.618 1.00 83.46  ? 858  ILE B CG2  1 
ATOM   10116 C  CD1  . ILE B 1 297 ? -30.658  -17.790 -16.665 1.00 100.54 ? 858  ILE B CD1  1 
ATOM   10117 H  H    . ILE B 1 297 ? -29.834  -21.390 -17.942 1.00 145.28 ? 858  ILE B H    1 
ATOM   10118 H  HA   . ILE B 1 297 ? -31.116  -20.244 -19.870 1.00 133.63 ? 858  ILE B HA   1 
ATOM   10119 H  HB   . ILE B 1 297 ? -29.003  -19.198 -18.312 1.00 124.07 ? 858  ILE B HB   1 
ATOM   10120 H  HG12 . ILE B 1 297 ? -31.783  -18.721 -18.069 1.00 119.38 ? 858  ILE B HG12 1 
ATOM   10121 H  HG13 . ILE B 1 297 ? -30.991  -19.731 -17.139 1.00 119.38 ? 858  ILE B HG13 1 
ATOM   10122 H  HG21 . ILE B 1 297 ? -29.609  -17.058 -19.067 1.00 100.15 ? 858  ILE B HG21 1 
ATOM   10123 H  HG22 . ILE B 1 297 ? -29.130  -17.948 -20.293 1.00 100.15 ? 858  ILE B HG22 1 
ATOM   10124 H  HG23 . ILE B 1 297 ? -30.681  -17.708 -20.043 1.00 100.15 ? 858  ILE B HG23 1 
ATOM   10125 H  HD11 . ILE B 1 297 ? -31.379  -17.757 -16.016 1.00 120.65 ? 858  ILE B HD11 1 
ATOM   10126 H  HD12 . ILE B 1 297 ? -29.816  -17.963 -16.217 1.00 120.65 ? 858  ILE B HD12 1 
ATOM   10127 H  HD13 . ILE B 1 297 ? -30.610  -16.951 -17.149 1.00 120.65 ? 858  ILE B HD13 1 
ATOM   10128 N  N    . VAL B 1 298 ? -27.996  -20.507 -20.617 1.00 94.00  ? 859  VAL B N    1 
ATOM   10129 C  CA   . VAL B 1 298 ? -27.085  -20.571 -21.759 1.00 92.09  ? 859  VAL B CA   1 
ATOM   10130 C  C    . VAL B 1 298 ? -27.381  -21.805 -22.601 1.00 97.80  ? 859  VAL B C    1 
ATOM   10131 O  O    . VAL B 1 298 ? -27.429  -21.736 -23.835 1.00 93.87  ? 859  VAL B O    1 
ATOM   10132 C  CB   . VAL B 1 298 ? -25.615  -20.555 -21.294 1.00 87.27  ? 859  VAL B CB   1 
ATOM   10133 C  CG1  . VAL B 1 298 ? -24.685  -20.357 -22.480 1.00 77.48  ? 859  VAL B CG1  1 
ATOM   10134 C  CG2  . VAL B 1 298 ? -25.389  -19.466 -20.298 1.00 87.68  ? 859  VAL B CG2  1 
ATOM   10135 H  H    . VAL B 1 298 ? -27.611  -20.528 -19.848 1.00 112.81 ? 859  VAL B H    1 
ATOM   10136 H  HA   . VAL B 1 298 ? -27.228  -19.790 -22.317 1.00 110.50 ? 859  VAL B HA   1 
ATOM   10137 H  HB   . VAL B 1 298 ? -25.401  -21.403 -20.875 1.00 104.73 ? 859  VAL B HB   1 
ATOM   10138 H  HG11 . VAL B 1 298 ? -23.768  -20.350 -22.164 1.00 92.97  ? 859  VAL B HG11 1 
ATOM   10139 H  HG12 . VAL B 1 298 ? -24.815  -21.085 -23.108 1.00 92.97  ? 859  VAL B HG12 1 
ATOM   10140 H  HG13 . VAL B 1 298 ? -24.895  -19.511 -22.906 1.00 92.97  ? 859  VAL B HG13 1 
ATOM   10141 H  HG21 . VAL B 1 298 ? -24.459  -19.479 -20.023 1.00 105.21 ? 859  VAL B HG21 1 
ATOM   10142 H  HG22 . VAL B 1 298 ? -25.601  -18.613 -20.710 1.00 105.21 ? 859  VAL B HG22 1 
ATOM   10143 H  HG23 . VAL B 1 298 ? -25.963  -19.615 -19.531 1.00 105.21 ? 859  VAL B HG23 1 
ATOM   10144 N  N    . LYS B 1 299 ? -27.594  -22.951 -21.951 1.00 98.78  ? 860  LYS B N    1 
ATOM   10145 C  CA   . LYS B 1 299 ? -27.835  -24.185 -22.693 1.00 102.48 ? 860  LYS B CA   1 
ATOM   10146 C  C    . LYS B 1 299 ? -29.130  -24.106 -23.496 1.00 102.31 ? 860  LYS B C    1 
ATOM   10147 O  O    . LYS B 1 299 ? -29.213  -24.648 -24.605 1.00 100.87 ? 860  LYS B O    1 
ATOM   10148 C  CB   . LYS B 1 299 ? -27.870  -25.375 -21.735 1.00 94.39  ? 860  LYS B CB   1 
ATOM   10149 H  H    . LYS B 1 299 ? -27.604  -23.039 -21.095 1.00 118.54 ? 860  LYS B H    1 
ATOM   10150 H  HA   . LYS B 1 299 ? -27.105  -24.324 -23.317 1.00 122.98 ? 860  LYS B HA   1 
ATOM   10151 N  N    . GLN B 1 300 ? -30.152  -23.435 -22.955 1.00 95.61  ? 861  GLN B N    1 
ATOM   10152 C  CA   . GLN B 1 300 ? -31.430  -23.334 -23.657 1.00 82.47  ? 861  GLN B CA   1 
ATOM   10153 C  C    . GLN B 1 300 ? -31.289  -22.526 -24.942 1.00 83.74  ? 861  GLN B C    1 
ATOM   10154 O  O    . GLN B 1 300 ? -31.690  -22.979 -26.021 1.00 92.69  ? 861  GLN B O    1 
ATOM   10155 C  CB   . GLN B 1 300 ? -32.486  -22.708 -22.742 1.00 89.12  ? 861  GLN B CB   1 
ATOM   10156 C  CG   . GLN B 1 300 ? -33.895  -22.701 -23.314 1.00 78.85  ? 861  GLN B CG   1 
ATOM   10157 C  CD   . GLN B 1 300 ? -34.495  -24.091 -23.411 1.00 91.05  ? 861  GLN B CD   1 
ATOM   10158 O  OE1  . GLN B 1 300 ? -33.953  -25.055 -22.871 1.00 96.84  ? 861  GLN B OE1  1 
ATOM   10159 N  NE2  . GLN B 1 300 ? -35.621  -24.199 -24.104 1.00 84.29  ? 861  GLN B NE2  1 
ATOM   10160 H  H    . GLN B 1 300 ? -30.130  -23.036 -22.194 1.00 114.73 ? 861  GLN B H    1 
ATOM   10161 H  HA   . GLN B 1 300 ? -31.730  -24.225 -23.895 1.00 98.97  ? 861  GLN B HA   1 
ATOM   10162 H  HB2  . GLN B 1 300 ? -32.509  -23.206 -21.910 1.00 106.94 ? 861  GLN B HB2  1 
ATOM   10163 H  HB3  . GLN B 1 300 ? -32.236  -21.788 -22.565 1.00 106.94 ? 861  GLN B HB3  1 
ATOM   10164 H  HG2  . GLN B 1 300 ? -34.466  -22.167 -22.740 1.00 94.62  ? 861  GLN B HG2  1 
ATOM   10165 H  HG3  . GLN B 1 300 ? -33.872  -22.321 -24.206 1.00 94.62  ? 861  GLN B HG3  1 
ATOM   10166 H  HE21 . GLN B 1 300 ? -35.971  -23.503 -24.467 1.00 101.15 ? 861  GLN B HE21 1 
ATOM   10167 H  HE22 . GLN B 1 300 ? -36.002  -24.966 -24.189 1.00 101.15 ? 861  GLN B HE22 1 
ATOM   10168 N  N    . LEU B 1 301 ? -30.728  -21.317 -24.846 1.00 92.15  ? 862  LEU B N    1 
ATOM   10169 C  CA   . LEU B 1 301 ? -30.551  -20.488 -26.034 1.00 91.79  ? 862  LEU B CA   1 
ATOM   10170 C  C    . LEU B 1 301 ? -29.485  -21.051 -26.964 1.00 89.51  ? 862  LEU B C    1 
ATOM   10171 O  O    . LEU B 1 301 ? -29.558  -20.846 -28.180 1.00 94.06  ? 862  LEU B O    1 
ATOM   10172 C  CB   . LEU B 1 301 ? -30.200  -19.053 -25.632 1.00 88.22  ? 862  LEU B CB   1 
ATOM   10173 C  CG   . LEU B 1 301 ? -28.957  -18.834 -24.763 1.00 89.71  ? 862  LEU B CG   1 
ATOM   10174 C  CD1  . LEU B 1 301 ? -27.698  -18.703 -25.608 1.00 86.24  ? 862  LEU B CD1  1 
ATOM   10175 C  CD2  . LEU B 1 301 ? -29.137  -17.605 -23.886 1.00 77.54  ? 862  LEU B CD2  1 
ATOM   10176 H  H    . LEU B 1 301 ? -30.447  -20.961 -24.115 1.00 110.59 ? 862  LEU B H    1 
ATOM   10177 H  HA   . LEU B 1 301 ? -31.388  -20.463 -26.524 1.00 110.15 ? 862  LEU B HA   1 
ATOM   10178 H  HB2  . LEU B 1 301 ? -30.071  -18.539 -26.444 1.00 105.87 ? 862  LEU B HB2  1 
ATOM   10179 H  HB3  . LEU B 1 301 ? -30.954  -18.688 -25.143 1.00 105.87 ? 862  LEU B HB3  1 
ATOM   10180 H  HG   . LEU B 1 301 ? -28.845  -19.601 -24.179 1.00 107.65 ? 862  LEU B HG   1 
ATOM   10181 H  HD11 . LEU B 1 301 ? -26.938  -18.566 -25.022 1.00 103.48 ? 862  LEU B HD11 1 
ATOM   10182 H  HD12 . LEU B 1 301 ? -27.578  -19.517 -26.122 1.00 103.48 ? 862  LEU B HD12 1 
ATOM   10183 H  HD13 . LEU B 1 301 ? -27.797  -17.945 -26.206 1.00 103.48 ? 862  LEU B HD13 1 
ATOM   10184 H  HD21 . LEU B 1 301 ? -28.341  -17.484 -23.345 1.00 93.04  ? 862  LEU B HD21 1 
ATOM   10185 H  HD22 . LEU B 1 301 ? -29.273  -16.830 -24.453 1.00 93.04  ? 862  LEU B HD22 1 
ATOM   10186 H  HD23 . LEU B 1 301 ? -29.909  -17.736 -23.314 1.00 93.04  ? 862  LEU B HD23 1 
ATOM   10187 N  N    . GLU B 1 302 ? -28.486  -21.752 -26.427 1.00 83.98  ? 863  GLU B N    1 
ATOM   10188 C  CA   . GLU B 1 302 ? -27.450  -22.320 -27.280 1.00 83.44  ? 863  GLU B CA   1 
ATOM   10189 C  C    . GLU B 1 302 ? -27.906  -23.579 -28.005 1.00 83.41  ? 863  GLU B C    1 
ATOM   10190 O  O    . GLU B 1 302 ? -27.239  -24.003 -28.954 1.00 82.61  ? 863  GLU B O    1 
ATOM   10191 C  CB   . GLU B 1 302 ? -26.195  -22.633 -26.462 1.00 87.85  ? 863  GLU B CB   1 
ATOM   10192 C  CG   . GLU B 1 302 ? -25.387  -21.409 -26.032 1.00 86.52  ? 863  GLU B CG   1 
ATOM   10193 C  CD   . GLU B 1 302 ? -24.805  -20.627 -27.202 1.00 82.15  ? 863  GLU B CD   1 
ATOM   10194 O  OE1  . GLU B 1 302 ? -24.903  -21.090 -28.358 1.00 75.88  ? 863  GLU B OE1  1 
ATOM   10195 O  OE2  . GLU B 1 302 ? -24.240  -19.539 -26.958 1.00 76.73  ? 863  GLU B OE2  1 
ATOM   10196 H  H    . GLU B 1 302 ? -28.389  -21.910 -25.587 1.00 100.77 ? 863  GLU B H    1 
ATOM   10197 H  HA   . GLU B 1 302 ? -27.208  -21.664 -27.952 1.00 100.12 ? 863  GLU B HA   1 
ATOM   10198 H  HB2  . GLU B 1 302 ? -26.460  -23.106 -25.658 1.00 105.42 ? 863  GLU B HB2  1 
ATOM   10199 H  HB3  . GLU B 1 302 ? -25.612  -23.197 -26.995 1.00 105.42 ? 863  GLU B HB3  1 
ATOM   10200 H  HG2  . GLU B 1 302 ? -25.964  -20.812 -25.532 1.00 103.82 ? 863  GLU B HG2  1 
ATOM   10201 H  HG3  . GLU B 1 302 ? -24.650  -21.701 -25.473 1.00 103.82 ? 863  GLU B HG3  1 
ATOM   10202 N  N    . ARG B 1 303 ? -29.020  -24.185 -27.582 1.00 94.12  ? 864  ARG B N    1 
ATOM   10203 C  CA   . ARG B 1 303 ? -29.501  -25.400 -28.235 1.00 80.30  ? 864  ARG B CA   1 
ATOM   10204 C  C    . ARG B 1 303 ? -29.766  -25.165 -29.716 1.00 81.23  ? 864  ARG B C    1 
ATOM   10205 O  O    . ARG B 1 303 ? -29.394  -25.988 -30.561 1.00 104.95 ? 864  ARG B O    1 
ATOM   10206 C  CB   . ARG B 1 303 ? -30.766  -25.900 -27.539 1.00 72.08  ? 864  ARG B CB   1 
ATOM   10207 H  H    . ARG B 1 303 ? -29.508  -23.914 -26.928 1.00 112.95 ? 864  ARG B H    1 
ATOM   10208 H  HA   . ARG B 1 303 ? -28.824  -26.090 -28.157 1.00 96.36  ? 864  ARG B HA   1 
ATOM   10209 N  N    . GLY B 1 304 ? -30.409  -24.051 -30.051 1.00 81.32  ? 865  GLY B N    1 
ATOM   10210 C  CA   . GLY B 1 304 ? -30.596  -23.664 -31.430 1.00 80.43  ? 865  GLY B CA   1 
ATOM   10211 C  C    . GLY B 1 304 ? -29.412  -22.957 -32.044 1.00 89.41  ? 865  GLY B C    1 
ATOM   10212 O  O    . GLY B 1 304 ? -29.521  -22.448 -33.162 1.00 106.81 ? 865  GLY B O    1 
ATOM   10213 H  H    . GLY B 1 304 ? -30.747  -23.499 -29.485 1.00 97.58  ? 865  GLY B H    1 
ATOM   10214 H  HA2  . GLY B 1 304 ? -30.780  -24.457 -31.959 1.00 96.51  ? 865  GLY B HA2  1 
ATOM   10215 H  HA3  . GLY B 1 304 ? -31.364  -23.075 -31.493 1.00 96.51  ? 865  GLY B HA3  1 
ATOM   10216 N  N    . GLY B 1 305 ? -28.272  -22.923 -31.355 1.00 79.65  ? 866  GLY B N    1 
ATOM   10217 C  CA   . GLY B 1 305 ? -27.160  -22.119 -31.821 1.00 74.16  ? 866  GLY B CA   1 
ATOM   10218 C  C    . GLY B 1 305 ? -26.586  -22.638 -33.126 1.00 98.86  ? 866  GLY B C    1 
ATOM   10219 O  O    . GLY B 1 305 ? -26.692  -23.821 -33.460 1.00 97.93  ? 866  GLY B O    1 
ATOM   10220 H  H    . GLY B 1 305 ? -28.124  -23.353 -30.625 1.00 95.59  ? 866  GLY B H    1 
ATOM   10221 H  HA2  . GLY B 1 305 ? -27.455  -21.205 -31.957 1.00 88.99  ? 866  GLY B HA2  1 
ATOM   10222 H  HA3  . GLY B 1 305 ? -26.457  -22.121 -31.153 1.00 88.99  ? 866  GLY B HA3  1 
ATOM   10223 N  N    . ARG B 1 306 ? -26.010  -21.710 -33.890 1.00 105.09 ? 867  ARG B N    1 
ATOM   10224 C  CA   . ARG B 1 306 ? -25.288  -21.958 -35.135 1.00 106.82 ? 867  ARG B CA   1 
ATOM   10225 C  C    . ARG B 1 306 ? -26.239  -22.255 -36.288 1.00 99.45  ? 867  ARG B C    1 
ATOM   10226 O  O    . ARG B 1 306 ? -25.846  -22.149 -37.454 1.00 115.42 ? 867  ARG B O    1 
ATOM   10227 C  CB   . ARG B 1 306 ? -24.288  -23.105 -34.958 1.00 119.83 ? 867  ARG B CB   1 
ATOM   10228 H  H    . ARG B 1 306 ? -26.029  -20.874 -33.689 1.00 126.11 ? 867  ARG B H    1 
ATOM   10229 H  HA   . ARG B 1 306 ? -24.785  -21.161 -35.366 1.00 128.18 ? 867  ARG B HA   1 
ATOM   10230 N  N    . ALA B 1 307 ? -27.487  -22.617 -35.987 1.00 89.69  ? 868  ALA B N    1 
ATOM   10231 C  CA   . ALA B 1 307 ? -28.555  -22.496 -36.975 1.00 95.20  ? 868  ALA B CA   1 
ATOM   10232 C  C    . ALA B 1 307 ? -29.115  -21.079 -36.990 1.00 104.93 ? 868  ALA B C    1 
ATOM   10233 O  O    . ALA B 1 307 ? -29.330  -20.498 -38.059 1.00 101.99 ? 868  ALA B O    1 
ATOM   10234 C  CB   . ALA B 1 307 ? -29.655  -23.520 -36.689 1.00 72.41  ? 868  ALA B CB   1 
ATOM   10235 H  H    . ALA B 1 307 ? -27.738  -22.931 -35.227 1.00 107.63 ? 868  ALA B H    1 
ATOM   10236 H  HA   . ALA B 1 307 ? -28.193  -22.684 -37.855 1.00 114.24 ? 868  ALA B HA   1 
ATOM   10237 H  HB1  . ALA B 1 307 ? -30.354  -23.426 -37.354 1.00 86.89  ? 868  ALA B HB1  1 
ATOM   10238 H  HB2  . ALA B 1 307 ? -29.275  -24.412 -36.732 1.00 86.89  ? 868  ALA B HB2  1 
ATOM   10239 H  HB3  . ALA B 1 307 ? -30.015  -23.357 -35.803 1.00 86.89  ? 868  ALA B HB3  1 
ATOM   10240 N  N    . VAL B 1 308 ? -29.334  -20.510 -35.804 1.00 104.61 ? 869  VAL B N    1 
ATOM   10241 C  CA   . VAL B 1 308 ? -29.738  -19.115 -35.667 1.00 85.11  ? 869  VAL B CA   1 
ATOM   10242 C  C    . VAL B 1 308 ? -28.546  -18.199 -35.904 1.00 72.72  ? 869  VAL B C    1 
ATOM   10243 O  O    . VAL B 1 308 ? -28.668  -17.150 -36.548 1.00 71.36  ? 869  VAL B O    1 
ATOM   10244 C  CB   . VAL B 1 308 ? -30.357  -18.904 -34.270 1.00 83.13  ? 869  VAL B CB   1 
ATOM   10245 C  CG1  . VAL B 1 308 ? -30.675  -17.436 -34.016 1.00 69.97  ? 869  VAL B CG1  1 
ATOM   10246 C  CG2  . VAL B 1 308 ? -31.607  -19.768 -34.105 1.00 91.48  ? 869  VAL B CG2  1 
ATOM   10247 H  H    . VAL B 1 308 ? -29.254  -20.921 -35.052 1.00 125.53 ? 869  VAL B H    1 
ATOM   10248 H  HA   . VAL B 1 308 ? -30.414  -18.912 -36.333 1.00 102.13 ? 869  VAL B HA   1 
ATOM   10249 H  HB   . VAL B 1 308 ? -29.715  -19.186 -33.601 1.00 99.75  ? 869  VAL B HB   1 
ATOM   10250 H  HG11 . VAL B 1 308 ? -31.061  -17.346 -33.131 1.00 83.97  ? 869  VAL B HG11 1 
ATOM   10251 H  HG12 . VAL B 1 308 ? -29.855  -16.922 -34.074 1.00 83.97  ? 869  VAL B HG12 1 
ATOM   10252 H  HG13 . VAL B 1 308 ? -31.306  -17.130 -34.686 1.00 83.97  ? 869  VAL B HG13 1 
ATOM   10253 H  HG21 . VAL B 1 308 ? -31.978  -19.619 -33.221 1.00 109.78 ? 869  VAL B HG21 1 
ATOM   10254 H  HG22 . VAL B 1 308 ? -32.254  -19.519 -34.783 1.00 109.78 ? 869  VAL B HG22 1 
ATOM   10255 H  HG23 . VAL B 1 308 ? -31.361  -20.701 -34.209 1.00 109.78 ? 869  VAL B HG23 1 
ATOM   10256 N  N    . VAL B 1 309 ? -27.375  -18.596 -35.400 1.00 93.52  ? 870  VAL B N    1 
ATOM   10257 C  CA   . VAL B 1 309 ? -26.148  -17.834 -35.588 1.00 96.81  ? 870  VAL B CA   1 
ATOM   10258 C  C    . VAL B 1 309 ? -25.630  -17.927 -37.017 1.00 95.06  ? 870  VAL B C    1 
ATOM   10259 O  O    . VAL B 1 309 ? -24.716  -17.180 -37.387 1.00 69.02  ? 870  VAL B O    1 
ATOM   10260 C  CB   . VAL B 1 309 ? -25.093  -18.337 -34.576 1.00 96.32  ? 870  VAL B CB   1 
ATOM   10261 C  CG1  . VAL B 1 309 ? -23.835  -17.510 -34.620 1.00 100.01 ? 870  VAL B CG1  1 
ATOM   10262 C  CG2  . VAL B 1 309 ? -25.654  -18.320 -33.161 1.00 101.05 ? 870  VAL B CG2  1 
ATOM   10263 H  H    . VAL B 1 309 ? -27.269  -19.314 -34.938 1.00 112.23 ? 870  VAL B H    1 
ATOM   10264 H  HA   . VAL B 1 309 ? -26.325  -16.900 -35.396 1.00 116.18 ? 870  VAL B HA   1 
ATOM   10265 H  HB   . VAL B 1 309 ? -24.857  -19.253 -34.794 1.00 115.59 ? 870  VAL B HB   1 
ATOM   10266 H  HG11 . VAL B 1 309 ? -23.204  -17.860 -33.972 1.00 120.01 ? 870  VAL B HG11 1 
ATOM   10267 H  HG12 . VAL B 1 309 ? -23.456  -17.561 -35.512 1.00 120.01 ? 870  VAL B HG12 1 
ATOM   10268 H  HG13 . VAL B 1 309 ? -24.055  -16.590 -34.406 1.00 120.01 ? 870  VAL B HG13 1 
ATOM   10269 H  HG21 . VAL B 1 309 ? -24.974  -18.639 -32.548 1.00 121.26 ? 870  VAL B HG21 1 
ATOM   10270 H  HG22 . VAL B 1 309 ? -25.906  -17.411 -32.933 1.00 121.26 ? 870  VAL B HG22 1 
ATOM   10271 H  HG23 . VAL B 1 309 ? -26.432  -18.898 -33.124 1.00 121.26 ? 870  VAL B HG23 1 
ATOM   10272 N  N    . LYS B 1 310 ? -26.216  -18.796 -37.844 1.00 102.53 ? 871  LYS B N    1 
ATOM   10273 C  CA   . LYS B 1 310 ? -25.736  -19.034 -39.206 1.00 98.37  ? 871  LYS B CA   1 
ATOM   10274 C  C    . LYS B 1 310 ? -24.275  -19.488 -39.196 1.00 99.74  ? 871  LYS B C    1 
ATOM   10275 O  O    . LYS B 1 310 ? -23.407  -18.906 -39.850 1.00 96.84  ? 871  LYS B O    1 
ATOM   10276 C  CB   . LYS B 1 310 ? -25.921  -17.789 -40.082 1.00 77.11  ? 871  LYS B CB   1 
ATOM   10277 C  CG   . LYS B 1 310 ? -27.339  -17.558 -40.541 1.00 78.30  ? 871  LYS B CG   1 
ATOM   10278 C  CD   . LYS B 1 310 ? -27.383  -16.427 -41.549 1.00 80.01  ? 871  LYS B CD   1 
ATOM   10279 C  CE   . LYS B 1 310 ? -28.751  -16.295 -42.184 1.00 82.05  ? 871  LYS B CE   1 
ATOM   10280 N  NZ   . LYS B 1 310 ? -28.802  -15.119 -43.090 1.00 93.06  ? 871  LYS B NZ   1 
ATOM   10281 H  H    . LYS B 1 310 ? -26.903  -19.268 -37.635 1.00 123.04 ? 871  LYS B H    1 
ATOM   10282 H  HA   . LYS B 1 310 ? -26.262  -19.748 -39.598 1.00 118.05 ? 871  LYS B HA   1 
ATOM   10283 H  HB2  . LYS B 1 310 ? -25.644  -17.009 -39.576 1.00 92.53  ? 871  LYS B HB2  1 
ATOM   10284 H  HB3  . LYS B 1 310 ? -25.366  -17.880 -40.872 1.00 92.53  ? 871  LYS B HB3  1 
ATOM   10285 H  HG2  . LYS B 1 310 ? -27.678  -18.362 -40.964 1.00 93.97  ? 871  LYS B HG2  1 
ATOM   10286 H  HG3  . LYS B 1 310 ? -27.890  -17.315 -39.781 1.00 93.97  ? 871  LYS B HG3  1 
ATOM   10287 H  HD2  . LYS B 1 310 ? -27.174  -15.592 -41.102 1.00 96.01  ? 871  LYS B HD2  1 
ATOM   10288 H  HD3  . LYS B 1 310 ? -26.738  -16.601 -42.252 1.00 96.01  ? 871  LYS B HD3  1 
ATOM   10289 H  HE2  . LYS B 1 310 ? -28.944  -17.090 -42.704 1.00 98.46  ? 871  LYS B HE2  1 
ATOM   10290 H  HE3  . LYS B 1 310 ? -29.418  -16.175 -41.490 1.00 98.46  ? 871  LYS B HE3  1 
ATOM   10291 H  HZ1  . LYS B 1 310 ? -29.610  -15.052 -43.456 1.00 111.67 ? 871  LYS B HZ1  1 
ATOM   10292 H  HZ2  . LYS B 1 310 ? -28.629  -14.375 -42.633 1.00 111.67 ? 871  LYS B HZ2  1 
ATOM   10293 H  HZ3  . LYS B 1 310 ? -28.198  -15.208 -43.737 1.00 111.67 ? 871  LYS B HZ3  1 
ATOM   10294 N  N    . MET B 1 311 ? -24.017  -20.555 -38.438 1.00 104.90 ? 872  MET B N    1 
ATOM   10295 C  CA   . MET B 1 311 ? -22.670  -21.112 -38.292 1.00 102.05 ? 872  MET B CA   1 
ATOM   10296 C  C    . MET B 1 311 ? -21.801  -20.036 -37.650 1.00 95.11  ? 872  MET B C    1 
ATOM   10297 O  O    . MET B 1 311 ? -22.119  -19.607 -36.527 1.00 98.93  ? 872  MET B O    1 
ATOM   10298 C  CB   . MET B 1 311 ? -22.209  -21.627 -39.657 1.00 97.57  ? 872  MET B CB   1 
ATOM   10299 C  CG   . MET B 1 311 ? -21.248  -22.803 -39.588 1.00 100.83 ? 872  MET B CG   1 
ATOM   10300 S  SD   . MET B 1 311 ? -22.007  -24.299 -38.917 1.00 124.89 ? 872  MET B SD   1 
ATOM   10301 C  CE   . MET B 1 311 ? -23.336  -24.581 -40.082 1.00 93.56  ? 872  MET B CE   1 
ATOM   10302 H  H    . MET B 1 311 ? -24.615  -20.981 -37.991 1.00 125.88 ? 872  MET B H    1 
ATOM   10303 H  HA   . MET B 1 311 ? -22.712  -21.873 -37.692 1.00 122.47 ? 872  MET B HA   1 
ATOM   10304 H  HB2  . MET B 1 311 ? -22.988  -21.912 -40.161 1.00 117.09 ? 872  MET B HB2  1 
ATOM   10305 H  HB3  . MET B 1 311 ? -21.761  -20.907 -40.127 1.00 117.09 ? 872  MET B HB3  1 
ATOM   10306 H  HG2  . MET B 1 311 ? -20.930  -23.004 -40.482 1.00 120.99 ? 872  MET B HG2  1 
ATOM   10307 H  HG3  . MET B 1 311 ? -20.500  -22.565 -39.017 1.00 120.99 ? 872  MET B HG3  1 
ATOM   10308 H  HE1  . MET B 1 311 ? -23.824  -25.376 -39.818 1.00 112.27 ? 872  MET B HE1  1 
ATOM   10309 H  HE2  . MET B 1 311 ? -23.928  -23.812 -40.078 1.00 112.27 ? 872  MET B HE2  1 
ATOM   10310 H  HE3  . MET B 1 311 ? -22.959  -24.703 -40.967 1.00 112.27 ? 872  MET B HE3  1 
ATOM   10311 N  N    . ASP B 1 312 ? -20.718  -19.588 -38.279 1.00 90.30  ? 873  ASP B N    1 
ATOM   10312 C  CA   . ASP B 1 312 ? -19.876  -18.554 -37.694 1.00 98.32  ? 873  ASP B CA   1 
ATOM   10313 C  C    . ASP B 1 312 ? -20.460  -17.181 -38.015 1.00 100.13 ? 873  ASP B C    1 
ATOM   10314 O  O    . ASP B 1 312 ? -20.553  -16.806 -39.188 1.00 92.88  ? 873  ASP B O    1 
ATOM   10315 C  CB   . ASP B 1 312 ? -18.454  -18.680 -38.235 1.00 86.62  ? 873  ASP B CB   1 
ATOM   10316 C  CG   . ASP B 1 312 ? -17.430  -18.013 -37.348 1.00 104.47 ? 873  ASP B CG   1 
ATOM   10317 O  OD1  . ASP B 1 312 ? -17.757  -16.985 -36.719 1.00 107.75 ? 873  ASP B OD1  1 
ATOM   10318 O  OD2  . ASP B 1 312 ? -16.291  -18.523 -37.279 1.00 102.91 ? 873  ASP B OD2  1 
ATOM   10319 H  H    . ASP B 1 312 ? -20.451  -19.867 -39.047 1.00 108.37 ? 873  ASP B H    1 
ATOM   10320 H  HA   . ASP B 1 312 ? -19.850  -18.662 -36.730 1.00 117.98 ? 873  ASP B HA   1 
ATOM   10321 H  HB2  . ASP B 1 312 ? -18.225  -19.620 -38.304 1.00 103.95 ? 873  ASP B HB2  1 
ATOM   10322 H  HB3  . ASP B 1 312 ? -18.411  -18.263 -39.110 1.00 103.95 ? 873  ASP B HB3  1 
ATOM   10323 N  N    . TRP B 1 313 ? -20.840  -16.421 -36.980 1.00 95.66  ? 874  TRP B N    1 
ATOM   10324 C  CA   . TRP B 1 313 ? -21.435  -15.106 -37.202 1.00 92.07  ? 874  TRP B CA   1 
ATOM   10325 C  C    . TRP B 1 313 ? -20.397  -14.036 -37.500 1.00 91.37  ? 874  TRP B C    1 
ATOM   10326 O  O    . TRP B 1 313 ? -20.769  -12.943 -37.944 1.00 75.42  ? 874  TRP B O    1 
ATOM   10327 C  CB   . TRP B 1 313 ? -22.295  -14.669 -35.999 1.00 82.23  ? 874  TRP B CB   1 
ATOM   10328 C  CG   . TRP B 1 313 ? -21.589  -14.519 -34.660 1.00 84.85  ? 874  TRP B CG   1 
ATOM   10329 C  CD1  . TRP B 1 313 ? -21.640  -15.382 -33.600 1.00 82.60  ? 874  TRP B CD1  1 
ATOM   10330 C  CD2  . TRP B 1 313 ? -20.763  -13.424 -34.235 1.00 73.24  ? 874  TRP B CD2  1 
ATOM   10331 N  NE1  . TRP B 1 313 ? -20.891  -14.905 -32.557 1.00 70.65  ? 874  TRP B NE1  1 
ATOM   10332 C  CE2  . TRP B 1 313 ? -20.341  -13.705 -32.919 1.00 64.52  ? 874  TRP B CE2  1 
ATOM   10333 C  CE3  . TRP B 1 313 ? -20.336  -12.239 -34.840 1.00 63.41  ? 874  TRP B CE3  1 
ATOM   10334 C  CZ2  . TRP B 1 313 ? -19.511  -12.849 -32.203 1.00 80.28  ? 874  TRP B CZ2  1 
ATOM   10335 C  CZ3  . TRP B 1 313 ? -19.512  -11.391 -34.127 1.00 65.10  ? 874  TRP B CZ3  1 
ATOM   10336 C  CH2  . TRP B 1 313 ? -19.109  -11.699 -32.821 1.00 76.32  ? 874  TRP B CH2  1 
ATOM   10337 H  H    . TRP B 1 313 ? -20.765  -16.644 -36.153 1.00 114.80 ? 874  TRP B H    1 
ATOM   10338 H  HA   . TRP B 1 313 ? -22.022  -15.163 -37.972 1.00 110.48 ? 874  TRP B HA   1 
ATOM   10339 H  HB2  . TRP B 1 313 ? -22.693  -13.810 -36.210 1.00 98.68  ? 874  TRP B HB2  1 
ATOM   10340 H  HB3  . TRP B 1 313 ? -22.999  -15.325 -35.878 1.00 98.68  ? 874  TRP B HB3  1 
ATOM   10341 H  HD1  . TRP B 1 313 ? -22.112  -16.184 -33.592 1.00 99.12  ? 874  TRP B HD1  1 
ATOM   10342 H  HE1  . TRP B 1 313 ? -20.782  -15.296 -31.798 1.00 84.77  ? 874  TRP B HE1  1 
ATOM   10343 H  HE3  . TRP B 1 313 ? -20.596  -12.029 -35.708 1.00 76.09  ? 874  TRP B HE3  1 
ATOM   10344 H  HZ2  . TRP B 1 313 ? -19.244  -13.049 -31.335 1.00 96.33  ? 874  TRP B HZ2  1 
ATOM   10345 H  HZ3  . TRP B 1 313 ? -19.220  -10.601 -34.520 1.00 78.12  ? 874  TRP B HZ3  1 
ATOM   10346 H  HH2  . TRP B 1 313 ? -18.555  -11.108 -32.366 1.00 91.59  ? 874  TRP B HH2  1 
ATOM   10347 N  N    . ARG B 1 314 ? -19.113  -14.325 -37.284 1.00 98.20  ? 875  ARG B N    1 
ATOM   10348 C  CA   . ARG B 1 314 ? -18.065  -13.358 -37.579 1.00 101.96 ? 875  ARG B CA   1 
ATOM   10349 C  C    . ARG B 1 314 ? -17.927  -13.099 -39.074 1.00 95.46  ? 875  ARG B C    1 
ATOM   10350 O  O    . ARG B 1 314 ? -17.418  -12.042 -39.463 1.00 83.96  ? 875  ARG B O    1 
ATOM   10351 C  CB   . ARG B 1 314 ? -16.736  -13.846 -36.996 1.00 101.79 ? 875  ARG B CB   1 
ATOM   10352 C  CG   . ARG B 1 314 ? -16.733  -13.942 -35.473 1.00 98.04  ? 875  ARG B CG   1 
ATOM   10353 C  CD   . ARG B 1 314 ? -15.542  -14.729 -34.946 1.00 102.09 ? 875  ARG B CD   1 
ATOM   10354 N  NE   . ARG B 1 314 ? -15.657  -16.155 -35.244 1.00 123.65 ? 875  ARG B NE   1 
ATOM   10355 C  CZ   . ARG B 1 314 ? -14.903  -17.103 -34.695 1.00 112.69 ? 875  ARG B CZ   1 
ATOM   10356 N  NH1  . ARG B 1 314 ? -13.972  -16.788 -33.805 1.00 100.68 ? 875  ARG B NH1  1 
ATOM   10357 N  NH2  . ARG B 1 314 ? -15.085  -18.377 -35.023 1.00 92.08  ? 875  ARG B NH2  1 
ATOM   10358 H  H    . ARG B 1 314 ? -18.826  -15.072 -36.968 1.00 117.84 ? 875  ARG B H    1 
ATOM   10359 H  HA   . ARG B 1 314 ? -18.287  -12.516 -37.151 1.00 122.35 ? 875  ARG B HA   1 
ATOM   10360 H  HB2  . ARG B 1 314 ? -16.545  -14.729 -37.349 1.00 122.15 ? 875  ARG B HB2  1 
ATOM   10361 H  HB3  . ARG B 1 314 ? -16.034  -13.229 -37.256 1.00 122.15 ? 875  ARG B HB3  1 
ATOM   10362 H  HG2  . ARG B 1 314 ? -16.693  -13.047 -35.099 1.00 117.65 ? 875  ARG B HG2  1 
ATOM   10363 H  HG3  . ARG B 1 314 ? -17.543  -14.389 -35.181 1.00 117.65 ? 875  ARG B HG3  1 
ATOM   10364 H  HD2  . ARG B 1 314 ? -14.731  -14.397 -35.362 1.00 122.51 ? 875  ARG B HD2  1 
ATOM   10365 H  HD3  . ARG B 1 314 ? -15.491  -14.624 -33.983 1.00 122.51 ? 875  ARG B HD3  1 
ATOM   10366 H  HE   . ARG B 1 314 ? -16.254  -16.397 -35.814 1.00 148.38 ? 875  ARG B HE   1 
ATOM   10367 H  HH11 . ARG B 1 314 ? -13.849  -15.966 -33.584 1.00 120.81 ? 875  ARG B HH11 1 
ATOM   10368 H  HH12 . ARG B 1 314 ? -13.488  -17.405 -33.452 1.00 120.81 ? 875  ARG B HH12 1 
ATOM   10369 H  HH21 . ARG B 1 314 ? -15.687  -18.591 -35.599 1.00 110.50 ? 875  ARG B HH21 1 
ATOM   10370 H  HH22 . ARG B 1 314 ? -14.596  -18.988 -34.666 1.00 110.50 ? 875  ARG B HH22 1 
ATOM   10371 N  N    . GLU B 1 315 ? -18.367  -14.036 -39.917 1.00 100.00 ? 876  GLU B N    1 
ATOM   10372 C  CA   . GLU B 1 315 ? -18.227  -13.880 -41.362 1.00 109.66 ? 876  GLU B CA   1 
ATOM   10373 C  C    . GLU B 1 315 ? -19.305  -12.986 -41.971 1.00 112.92 ? 876  GLU B C    1 
ATOM   10374 O  O    . GLU B 1 315 ? -19.066  -12.364 -43.013 1.00 110.18 ? 876  GLU B O    1 
ATOM   10375 C  CB   . GLU B 1 315 ? -18.254  -15.252 -42.034 1.00 105.08 ? 876  GLU B CB   1 
ATOM   10376 C  CG   . GLU B 1 315 ? -17.297  -16.269 -41.418 1.00 113.78 ? 876  GLU B CG   1 
ATOM   10377 C  CD   . GLU B 1 315 ? -15.842  -15.834 -41.483 1.00 109.95 ? 876  GLU B CD   1 
ATOM   10378 O  OE1  . GLU B 1 315 ? -15.490  -15.046 -42.387 1.00 102.02 ? 876  GLU B OE1  1 
ATOM   10379 O  OE2  . GLU B 1 315 ? -15.048  -16.282 -40.627 1.00 97.31  ? 876  GLU B OE2  1 
ATOM   10380 H  H    . GLU B 1 315 ? -18.749  -14.769 -39.677 1.00 120.00 ? 876  GLU B H    1 
ATOM   10381 H  HA   . GLU B 1 315 ? -17.366  -13.475 -41.549 1.00 131.60 ? 876  GLU B HA   1 
ATOM   10382 H  HB2  . GLU B 1 315 ? -19.152  -15.614 -41.968 1.00 126.10 ? 876  GLU B HB2  1 
ATOM   10383 H  HB3  . GLU B 1 315 ? -18.011  -15.146 -42.967 1.00 126.10 ? 876  GLU B HB3  1 
ATOM   10384 H  HG2  . GLU B 1 315 ? -17.530  -16.395 -40.484 1.00 136.54 ? 876  GLU B HG2  1 
ATOM   10385 H  HG3  . GLU B 1 315 ? -17.380  -17.109 -41.895 1.00 136.54 ? 876  GLU B HG3  1 
ATOM   10386 N  N    . ASN B 1 316 ? -20.487  -12.909 -41.353 1.00 107.21 ? 877  ASN B N    1 
ATOM   10387 C  CA   . ASN B 1 316 ? -21.612  -12.215 -41.972 1.00 96.88  ? 877  ASN B CA   1 
ATOM   10388 C  C    . ASN B 1 316 ? -21.513  -10.700 -41.850 1.00 105.24 ? 877  ASN B C    1 
ATOM   10389 O  O    . ASN B 1 316 ? -22.032  -9.979  -42.709 1.00 109.17 ? 877  ASN B O    1 
ATOM   10390 C  CB   . ASN B 1 316 ? -22.922  -12.688 -41.347 1.00 91.53  ? 877  ASN B CB   1 
ATOM   10391 C  CG   . ASN B 1 316 ? -23.174  -14.165 -41.572 1.00 109.33 ? 877  ASN B CG   1 
ATOM   10392 O  OD1  . ASN B 1 316 ? -22.300  -15.000 -41.335 1.00 98.95  ? 877  ASN B OD1  1 
ATOM   10393 N  ND2  . ASN B 1 316 ? -24.370  -14.495 -42.044 1.00 109.02 ? 877  ASN B ND2  1 
ATOM   10394 H  H    . ASN B 1 316 ? -20.659  -13.247 -40.581 1.00 128.65 ? 877  ASN B H    1 
ATOM   10395 H  HA   . ASN B 1 316 ? -21.636  -12.437 -42.917 1.00 116.26 ? 877  ASN B HA   1 
ATOM   10396 H  HB2  . ASN B 1 316 ? -22.891  -12.530 -40.391 1.00 109.84 ? 877  ASN B HB2  1 
ATOM   10397 H  HB3  . ASN B 1 316 ? -23.657  -12.194 -41.742 1.00 109.84 ? 877  ASN B HB3  1 
ATOM   10398 H  HD21 . ASN B 1 316 ? -24.952  -13.883 -42.206 1.00 130.82 ? 877  ASN B HD21 1 
ATOM   10399 H  HD22 . ASN B 1 316 ? -24.563  -15.321 -42.189 1.00 130.82 ? 877  ASN B HD22 1 
ATOM   10400 N  N    . ILE B 1 317 ? -20.873  -10.206 -40.790 1.00 111.05 ? 878  ILE B N    1 
ATOM   10401 C  CA   . ILE B 1 317 ? -20.778  -8.764  -40.546 1.00 105.34 ? 878  ILE B CA   1 
ATOM   10402 C  C    . ILE B 1 317 ? -19.879  -8.098  -41.586 1.00 92.28  ? 878  ILE B C    1 
ATOM   10403 O  O    . ILE B 1 317 ? -19.106  -8.744  -42.300 1.00 96.55  ? 878  ILE B O    1 
ATOM   10404 C  CB   . ILE B 1 317 ? -20.285  -8.470  -39.119 1.00 103.23 ? 878  ILE B CB   1 
ATOM   10405 C  CG1  . ILE B 1 317 ? -19.058  -9.328  -38.772 1.00 105.30 ? 878  ILE B CG1  1 
ATOM   10406 C  CG2  . ILE B 1 317 ? -21.420  -8.679  -38.129 1.00 100.77 ? 878  ILE B CG2  1 
ATOM   10407 C  CD1  . ILE B 1 317 ? -18.508  -9.100  -37.385 1.00 100.25 ? 878  ILE B CD1  1 
ATOM   10408 H  H    . ILE B 1 317 ? -20.483  -10.687 -40.193 1.00 133.26 ? 878  ILE B H    1 
ATOM   10409 H  HA   . ILE B 1 317 ? -21.663  -8.378  -40.635 1.00 126.41 ? 878  ILE B HA   1 
ATOM   10410 H  HB   . ILE B 1 317 ? -20.020  -7.537  -39.079 1.00 123.88 ? 878  ILE B HB   1 
ATOM   10411 H  HG12 . ILE B 1 317 ? -19.304  -10.264 -38.841 1.00 126.36 ? 878  ILE B HG12 1 
ATOM   10412 H  HG13 . ILE B 1 317 ? -18.351  -9.129  -39.405 1.00 126.36 ? 878  ILE B HG13 1 
ATOM   10413 H  HG21 . ILE B 1 317 ? -21.097  -8.490  -37.234 1.00 120.92 ? 878  ILE B HG21 1 
ATOM   10414 H  HG22 . ILE B 1 317 ? -22.148  -8.077  -38.352 1.00 120.92 ? 878  ILE B HG22 1 
ATOM   10415 H  HG23 . ILE B 1 317 ? -21.721  -9.599  -38.185 1.00 120.92 ? 878  ILE B HG23 1 
ATOM   10416 H  HD11 . ILE B 1 317 ? -17.741  -9.678  -37.251 1.00 120.30 ? 878  ILE B HD11 1 
ATOM   10417 H  HD12 . ILE B 1 317 ? -18.242  -8.171  -37.300 1.00 120.30 ? 878  ILE B HD12 1 
ATOM   10418 H  HD13 . ILE B 1 317 ? -19.197  -9.308  -36.735 1.00 120.30 ? 878  ILE B HD13 1 
ATOM   10419 N  N    . THR B 1 318 ? -19.999  -6.774  -41.669 1.00 96.33  ? 879  THR B N    1 
ATOM   10420 C  CA   . THR B 1 318 ? -19.309  -5.989  -42.680 1.00 115.87 ? 879  THR B CA   1 
ATOM   10421 C  C    . THR B 1 318 ? -17.808  -5.971  -42.398 1.00 120.86 ? 879  THR B C    1 
ATOM   10422 O  O    . THR B 1 318 ? -17.324  -6.529  -41.410 1.00 103.89 ? 879  THR B O    1 
ATOM   10423 C  CB   . THR B 1 318 ? -19.866  -4.565  -42.700 1.00 107.32 ? 879  THR B CB   1 
ATOM   10424 O  OG1  . THR B 1 318 ? -19.438  -3.883  -43.885 1.00 103.66 ? 879  THR B OG1  1 
ATOM   10425 C  CG2  . THR B 1 318 ? -19.409  -3.784  -41.467 1.00 104.79 ? 879  THR B CG2  1 
ATOM   10426 H  H    . THR B 1 318 ? -20.484  -6.302  -41.139 1.00 115.59 ? 879  THR B H    1 
ATOM   10427 H  HA   . THR B 1 318 ? -19.453  -6.388  -43.553 1.00 139.05 ? 879  THR B HA   1 
ATOM   10428 H  HB   . THR B 1 318 ? -20.835  -4.604  -42.689 1.00 128.79 ? 879  THR B HB   1 
ATOM   10429 H  HG1  . THR B 1 318 ? -19.745  -3.101  -43.893 1.00 124.40 ? 879  THR B HG1  1 
ATOM   10430 H  HG21 . THR B 1 318 ? -19.769  -2.884  -41.493 1.00 125.75 ? 879  THR B HG21 1 
ATOM   10431 H  HG22 . THR B 1 318 ? -19.720  -4.225  -40.661 1.00 125.75 ? 879  THR B HG22 1 
ATOM   10432 H  HG23 . THR B 1 318 ? -18.440  -3.735  -41.445 1.00 125.75 ? 879  THR B HG23 1 
ATOM   10433 N  N    . VAL B 1 319 ? -17.062  -5.305  -43.276 1.00 125.32 ? 880  VAL B N    1 
ATOM   10434 C  CA   . VAL B 1 319 ? -15.602  -5.280  -43.196 1.00 113.09 ? 880  VAL B CA   1 
ATOM   10435 C  C    . VAL B 1 319 ? -15.144  -4.473  -41.984 1.00 111.81 ? 880  VAL B C    1 
ATOM   10436 O  O    . VAL B 1 319 ? -14.345  -4.983  -41.187 1.00 108.22 ? 880  VAL B O    1 
ATOM   10437 C  CB   . VAL B 1 319 ? -14.989  -4.743  -44.502 1.00 108.60 ? 880  VAL B CB   1 
ATOM   10438 C  CG1  . VAL B 1 319 ? -13.527  -4.322  -44.300 1.00 90.32  ? 880  VAL B CG1  1 
ATOM   10439 C  CG2  . VAL B 1 319 ? -15.091  -5.796  -45.595 1.00 100.45 ? 880  VAL B CG2  1 
ATOM   10440 H  H    . VAL B 1 319 ? -17.381  -4.854  -43.935 1.00 150.38 ? 880  VAL B H    1 
ATOM   10441 H  HA   . VAL B 1 319 ? -15.285  -6.189  -43.078 1.00 135.71 ? 880  VAL B HA   1 
ATOM   10442 H  HB   . VAL B 1 319 ? -15.489  -3.963  -44.789 1.00 130.32 ? 880  VAL B HB   1 
ATOM   10443 H  HG11 . VAL B 1 319 ? -13.176  -3.990  -45.141 1.00 108.38 ? 880  VAL B HG11 1 
ATOM   10444 H  HG12 . VAL B 1 319 ? -13.490  -3.625  -43.627 1.00 108.38 ? 880  VAL B HG12 1 
ATOM   10445 H  HG13 . VAL B 1 319 ? -13.015  -5.092  -44.008 1.00 108.38 ? 880  VAL B HG13 1 
ATOM   10446 H  HG21 . VAL B 1 319 ? -14.702  -5.443  -46.410 1.00 120.54 ? 880  VAL B HG21 1 
ATOM   10447 H  HG22 . VAL B 1 319 ? -14.610  -6.590  -45.314 1.00 120.54 ? 880  VAL B HG22 1 
ATOM   10448 H  HG23 . VAL B 1 319 ? -16.026  -6.009  -45.740 1.00 120.54 ? 880  VAL B HG23 1 
ATOM   10449 N  N    . PRO B 1 320 ? -15.596  -3.223  -41.802 1.00 115.01 ? 881  PRO B N    1 
ATOM   10450 C  CA   . PRO B 1 320 ? -15.130  -2.445  -40.637 1.00 111.24 ? 881  PRO B CA   1 
ATOM   10451 C  C    . PRO B 1 320 ? -15.274  -3.156  -39.298 1.00 106.12 ? 881  PRO B C    1 
ATOM   10452 O  O    . PRO B 1 320 ? -14.370  -3.061  -38.458 1.00 98.25  ? 881  PRO B O    1 
ATOM   10453 C  CB   . PRO B 1 320 ? -16.003  -1.185  -40.702 1.00 102.24 ? 881  PRO B CB   1 
ATOM   10454 C  CG   . PRO B 1 320 ? -16.262  -0.995  -42.144 1.00 93.66  ? 881  PRO B CG   1 
ATOM   10455 C  CD   . PRO B 1 320 ? -16.321  -2.368  -42.764 1.00 107.14 ? 881  PRO B CD   1 
ATOM   10456 H  HA   . PRO B 1 320 ? -14.202  -2.191  -40.759 1.00 133.49 ? 881  PRO B HA   1 
ATOM   10457 H  HB2  . PRO B 1 320 ? -16.831  -1.333  -40.218 1.00 122.68 ? 881  PRO B HB2  1 
ATOM   10458 H  HB3  . PRO B 1 320 ? -15.518  -0.430  -40.335 1.00 122.68 ? 881  PRO B HB3  1 
ATOM   10459 H  HG2  . PRO B 1 320 ? -17.108  -0.535  -42.260 1.00 112.39 ? 881  PRO B HG2  1 
ATOM   10460 H  HG3  . PRO B 1 320 ? -15.540  -0.478  -42.535 1.00 112.39 ? 881  PRO B HG3  1 
ATOM   10461 H  HD2  . PRO B 1 320 ? -17.242  -2.661  -42.848 1.00 128.56 ? 881  PRO B HD2  1 
ATOM   10462 H  HD3  . PRO B 1 320 ? -15.870  -2.370  -43.623 1.00 128.56 ? 881  PRO B HD3  1 
ATOM   10463 N  N    . LEU B 1 321 ? -16.379  -3.867  -39.073 1.00 107.68 ? 882  LEU B N    1 
ATOM   10464 C  CA   . LEU B 1 321 ? -16.606  -4.487  -37.772 1.00 110.36 ? 882  LEU B CA   1 
ATOM   10465 C  C    . LEU B 1 321 ? -15.756  -5.735  -37.563 1.00 105.72 ? 882  LEU B C    1 
ATOM   10466 O  O    . LEU B 1 321 ? -15.432  -6.068  -36.418 1.00 87.86  ? 882  LEU B O    1 
ATOM   10467 C  CB   . LEU B 1 321 ? -18.086  -4.835  -37.605 1.00 111.36 ? 882  LEU B CB   1 
ATOM   10468 C  CG   . LEU B 1 321 ? -18.487  -5.438  -36.254 1.00 100.96 ? 882  LEU B CG   1 
ATOM   10469 C  CD1  . LEU B 1 321 ? -18.157  -4.492  -35.105 1.00 92.49  ? 882  LEU B CD1  1 
ATOM   10470 C  CD2  . LEU B 1 321 ? -19.964  -5.788  -36.247 1.00 85.18  ? 882  LEU B CD2  1 
ATOM   10471 H  H    . LEU B 1 321 ? -17.003  -4.004  -39.649 1.00 129.22 ? 882  LEU B H    1 
ATOM   10472 H  HA   . LEU B 1 321 ? -16.371  -3.850  -37.078 1.00 132.43 ? 882  LEU B HA   1 
ATOM   10473 H  HB2  . LEU B 1 321 ? -18.605  -4.025  -37.725 1.00 133.63 ? 882  LEU B HB2  1 
ATOM   10474 H  HB3  . LEU B 1 321 ? -18.328  -5.477  -38.291 1.00 133.63 ? 882  LEU B HB3  1 
ATOM   10475 H  HG   . LEU B 1 321 ? -17.987  -6.258  -36.116 1.00 121.15 ? 882  LEU B HG   1 
ATOM   10476 H  HD11 . LEU B 1 321 ? -18.424  -4.905  -34.269 1.00 110.99 ? 882  LEU B HD11 1 
ATOM   10477 H  HD12 . LEU B 1 321 ? -17.202  -4.322  -35.101 1.00 110.99 ? 882  LEU B HD12 1 
ATOM   10478 H  HD13 . LEU B 1 321 ? -18.641  -3.661  -35.233 1.00 110.99 ? 882  LEU B HD13 1 
ATOM   10479 H  HD21 . LEU B 1 321 ? -20.194  -6.167  -35.384 1.00 102.22 ? 882  LEU B HD21 1 
ATOM   10480 H  HD22 . LEU B 1 321 ? -20.479  -4.981  -36.402 1.00 102.22 ? 882  LEU B HD22 1 
ATOM   10481 H  HD23 . LEU B 1 321 ? -20.138  -6.433  -36.949 1.00 102.22 ? 882  LEU B HD23 1 
ATOM   10482 N  N    . GLN B 1 322 ? -15.394  -6.440  -38.640 1.00 108.28 ? 883  GLN B N    1 
ATOM   10483 C  CA   . GLN B 1 322 ? -14.601  -7.658  -38.488 1.00 99.74  ? 883  GLN B CA   1 
ATOM   10484 C  C    . GLN B 1 322 ? -13.218  -7.350  -37.929 1.00 103.08 ? 883  GLN B C    1 
ATOM   10485 O  O    . GLN B 1 322 ? -12.725  -8.063  -37.047 1.00 97.31  ? 883  GLN B O    1 
ATOM   10486 C  CB   . GLN B 1 322 ? -14.490  -8.393  -39.825 1.00 102.10 ? 883  GLN B CB   1 
ATOM   10487 C  CG   . GLN B 1 322 ? -15.747  -9.179  -40.197 1.00 112.94 ? 883  GLN B CG   1 
ATOM   10488 C  CD   . GLN B 1 322 ? -15.483  -10.325 -41.158 1.00 113.60 ? 883  GLN B CD   1 
ATOM   10489 O  OE1  . GLN B 1 322 ? -14.337  -10.702 -41.401 1.00 111.56 ? 883  GLN B OE1  1 
ATOM   10490 N  NE2  . GLN B 1 322 ? -16.553  -10.889 -41.706 1.00 103.51 ? 883  GLN B NE2  1 
ATOM   10491 H  H    . GLN B 1 322 ? -15.592  -6.238  -39.452 1.00 129.93 ? 883  GLN